data_1WZ0
# 
_entry.id   1WZ0 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1WZ0         
RCSB  RCSB024171   
WWPDB D_1000024171 
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          hss001000424.2 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1WZ0 
_pdbx_database_status.recvd_initial_deposition_date   2005-02-21 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Zhao, C.'                                               1 
'Saito, K.'                                              2 
'Koshiba, S.'                                            3 
'Inoue, M.'                                              4 
'Kigawa, T.'                                             5 
'Yokoyama, S.'                                           6 
'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 7 
# 
_citation.id                        primary 
_citation.title                     'Solution Structure of Human SUMO-2 (SMT3B), a Ubiquitin-like Protein' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Zhao, C.'     1 
primary 'Saito, K.'    2 
primary 'Koshiba, S.'  3 
primary 'Inoue, M.'    4 
primary 'Kigawa, T.'   5 
primary 'Yokoyama, S.' 6 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Ubiquitin-like protein SMT3B' 
_entity.formula_weight             11501.726 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'ubiquitin-like molecule' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Sentrin 2, HSMT3' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSSGSSGMADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTP
AQLEMEDEDTIDVFQQQTSGPSSG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSSGSSGMADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTP
AQLEMEDEDTIDVFQQQTSGPSSG
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         hss001000424.2 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   SER n 
1 4   GLY n 
1 5   SER n 
1 6   SER n 
1 7   GLY n 
1 8   MET n 
1 9   ALA n 
1 10  ASP n 
1 11  GLU n 
1 12  LYS n 
1 13  PRO n 
1 14  LYS n 
1 15  GLU n 
1 16  GLY n 
1 17  VAL n 
1 18  LYS n 
1 19  THR n 
1 20  GLU n 
1 21  ASN n 
1 22  ASN n 
1 23  ASP n 
1 24  HIS n 
1 25  ILE n 
1 26  ASN n 
1 27  LEU n 
1 28  LYS n 
1 29  VAL n 
1 30  ALA n 
1 31  GLY n 
1 32  GLN n 
1 33  ASP n 
1 34  GLY n 
1 35  SER n 
1 36  VAL n 
1 37  VAL n 
1 38  GLN n 
1 39  PHE n 
1 40  LYS n 
1 41  ILE n 
1 42  LYS n 
1 43  ARG n 
1 44  HIS n 
1 45  THR n 
1 46  PRO n 
1 47  LEU n 
1 48  SER n 
1 49  LYS n 
1 50  LEU n 
1 51  MET n 
1 52  LYS n 
1 53  ALA n 
1 54  TYR n 
1 55  CYS n 
1 56  GLU n 
1 57  ARG n 
1 58  GLN n 
1 59  GLY n 
1 60  LEU n 
1 61  SER n 
1 62  MET n 
1 63  ARG n 
1 64  GLN n 
1 65  ILE n 
1 66  ARG n 
1 67  PHE n 
1 68  ARG n 
1 69  PHE n 
1 70  ASP n 
1 71  GLY n 
1 72  GLN n 
1 73  PRO n 
1 74  ILE n 
1 75  ASN n 
1 76  GLU n 
1 77  THR n 
1 78  ASP n 
1 79  THR n 
1 80  PRO n 
1 81  ALA n 
1 82  GLN n 
1 83  LEU n 
1 84  GLU n 
1 85  MET n 
1 86  GLU n 
1 87  ASP n 
1 88  GLU n 
1 89  ASP n 
1 90  THR n 
1 91  ILE n 
1 92  ASP n 
1 93  VAL n 
1 94  PHE n 
1 95  GLN n 
1 96  GLN n 
1 97  GLN n 
1 98  THR n 
1 99  SER n 
1 100 GLY n 
1 101 PRO n 
1 102 SER n 
1 103 SER n 
1 104 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 SMT3B 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       P040510-09 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'Cell-free synthesis' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    SUMO2_HUMAN 
_struct_ref.pdbx_db_accession          P61956 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMED
EDTIDVFQQQT
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1WZ0 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 8 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 98 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P61956 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  91 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       8 
_struct_ref_seq.pdbx_auth_seq_align_end       98 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1WZ0 GLY A 1   ? UNP P61956 ? ? 'CLONING ARTIFACT' 1   1  
1 1WZ0 SER A 2   ? UNP P61956 ? ? 'CLONING ARTIFACT' 2   2  
1 1WZ0 SER A 3   ? UNP P61956 ? ? 'CLONING ARTIFACT' 3   3  
1 1WZ0 GLY A 4   ? UNP P61956 ? ? 'CLONING ARTIFACT' 4   4  
1 1WZ0 SER A 5   ? UNP P61956 ? ? 'CLONING ARTIFACT' 5   5  
1 1WZ0 SER A 6   ? UNP P61956 ? ? 'CLONING ARTIFACT' 6   6  
1 1WZ0 GLY A 7   ? UNP P61956 ? ? 'CLONING ARTIFACT' 7   7  
1 1WZ0 SER A 99  ? UNP P61956 ? ? 'CLONING ARTIFACT' 99  8  
1 1WZ0 GLY A 100 ? UNP P61956 ? ? 'CLONING ARTIFACT' 100 9  
1 1WZ0 PRO A 101 ? UNP P61956 ? ? 'CLONING ARTIFACT' 101 10 
1 1WZ0 SER A 102 ? UNP P61956 ? ? 'CLONING ARTIFACT' 102 11 
1 1WZ0 SER A 103 ? UNP P61956 ? ? 'CLONING ARTIFACT' 103 12 
1 1WZ0 GLY A 104 ? UNP P61956 ? ? 'CLONING ARTIFACT' 104 13 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 3D_15N-separated_NOESY 1 
2 1 3D_13C-separated_NOESY 1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298.0 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      100mM 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         
'1.21mM protein U-15N, 13C; 20mM d-Tris-HCl (pH7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 10% D2O' 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.model             Avance 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.field_strength    800 
_pdbx_nmr_spectrometer.type              ? 
# 
_pdbx_nmr_refine.entry_id           1WZ0 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      1WZ0 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'target function, structures with the least restraint violations' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             1WZ0 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
collection           XWINNMR 2.6      Bruker           1 
processing           NMRPipe 20020425 'Delaglio, F.'   2 
'data analysis'      NMRview 5.0.4    'Johnson, B. A.' 3 
'data analysis'      Kujira  0.921    'Kobayashi, N.'  4 
'structure solution' CYANA   1.0.8    'Guentert, P.'   5 
refinement           CYANA   1.0.8    'Guentert, P.'   6 
# 
_exptl.entry_id          1WZ0 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  1WZ0 
_struct.title                     'Solution Structure of Human SUMO-2 (SMT3B), a Ubiquitin-like Protein' 
_struct.pdbx_descriptor           'Ubiquitin-like protein SMT3B' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1WZ0 
_struct_keywords.pdbx_keywords   'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' 
_struct_keywords.text            
;SUMO-2, ubiquitin-like molecule, Structural genomics, Sentrin2, NPPFSA, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
;
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       1 
_struct_conf.beg_label_comp_id       LEU 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        47 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       GLN 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        58 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        LEU 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         47 
_struct_conf.end_auth_comp_id        GLN 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         58 
_struct_conf.pdbx_PDB_helix_class    1 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   5 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 36 ? ILE A 41 ? VAL A 36 ILE A 41 
A 2 ILE A 25 ? ALA A 30 ? ILE A 25 ALA A 30 
A 3 ASP A 89 ? VAL A 93 ? ASP A 89 VAL A 93 
A 4 PHE A 67 ? PHE A 69 ? PHE A 67 PHE A 69 
A 5 GLN A 72 ? PRO A 73 ? GLN A 72 PRO A 73 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O VAL A 37 ? O VAL A 37 N VAL A 29 ? N VAL A 29 
A 2 3 N LYS A 28 ? N LYS A 28 O ASP A 89 ? O ASP A 89 
A 3 4 O ASP A 92 ? O ASP A 92 N ARG A 68 ? N ARG A 68 
# 
_database_PDB_matrix.entry_id          1WZ0 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1WZ0 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . GLY A 1 1   ? -29.517 -3.823  -28.903 1.00 0.00 ? 1   GLY A N    1  
ATOM 2     C CA   . GLY A 1 1   ? -28.775 -3.822  -30.150 1.00 0.00 ? 1   GLY A CA   1  
ATOM 3     C C    . GLY A 1 1   ? -27.317 -4.190  -29.958 1.00 0.00 ? 1   GLY A C    1  
ATOM 4     O O    . GLY A 1 1   ? -26.428 -3.527  -30.491 1.00 0.00 ? 1   GLY A O    1  
ATOM 5     H H1   . GLY A 1 1   ? -29.036 -3.823  -28.049 1.00 0.00 ? 1   GLY A H1   1  
ATOM 6     H HA2  . GLY A 1 1   ? -29.229 -4.531  -30.827 1.00 0.00 ? 1   GLY A HA2  1  
ATOM 7     H HA3  . GLY A 1 1   ? -28.831 -2.836  -30.588 1.00 0.00 ? 1   GLY A HA3  1  
ATOM 8     N N    . SER A 1 2   ? -27.072 -5.248  -29.193 1.00 0.00 ? 2   SER A N    1  
ATOM 9     C CA   . SER A 1 2   ? -25.711 -5.700  -28.927 1.00 0.00 ? 2   SER A CA   1  
ATOM 10    C C    . SER A 1 2   ? -24.780 -4.514  -28.698 1.00 0.00 ? 2   SER A C    1  
ATOM 11    O O    . SER A 1 2   ? -23.650 -4.495  -29.186 1.00 0.00 ? 2   SER A O    1  
ATOM 12    C CB   . SER A 1 2   ? -25.197 -6.550  -30.091 1.00 0.00 ? 2   SER A CB   1  
ATOM 13    O OG   . SER A 1 2   ? -24.916 -5.746  -31.224 1.00 0.00 ? 2   SER A OG   1  
ATOM 14    H H    . SER A 1 2   ? -27.824 -5.736  -28.796 1.00 0.00 ? 2   SER A H    1  
ATOM 15    H HA   . SER A 1 2   ? -25.731 -6.305  -28.033 1.00 0.00 ? 2   SER A HA   1  
ATOM 16    H HB2  . SER A 1 2   ? -24.292 -7.057  -29.791 1.00 0.00 ? 2   SER A HB2  1  
ATOM 17    H HB3  . SER A 1 2   ? -25.947 -7.280  -30.359 1.00 0.00 ? 2   SER A HB3  1  
ATOM 18    H HG   . SER A 1 2   ? -24.301 -5.051  -30.979 1.00 0.00 ? 2   SER A HG   1  
ATOM 19    N N    . SER A 1 3   ? -25.263 -3.525  -27.953 1.00 0.00 ? 3   SER A N    1  
ATOM 20    C CA   . SER A 1 3   ? -24.477 -2.332  -27.662 1.00 0.00 ? 3   SER A CA   1  
ATOM 21    C C    . SER A 1 3   ? -23.651 -2.523  -26.393 1.00 0.00 ? 3   SER A C    1  
ATOM 22    O O    . SER A 1 3   ? -23.803 -3.515  -25.683 1.00 0.00 ? 3   SER A O    1  
ATOM 23    C CB   . SER A 1 3   ? -25.393 -1.116  -27.509 1.00 0.00 ? 3   SER A CB   1  
ATOM 24    O OG   . SER A 1 3   ? -25.767 -0.598  -28.774 1.00 0.00 ? 3   SER A OG   1  
ATOM 25    H H    . SER A 1 3   ? -26.172 -3.599  -27.593 1.00 0.00 ? 3   SER A H    1  
ATOM 26    H HA   . SER A 1 3   ? -23.807 -2.166  -28.492 1.00 0.00 ? 3   SER A HA   1  
ATOM 27    H HB2  . SER A 1 3   ? -26.284 -1.405  -26.974 1.00 0.00 ? 3   SER A HB2  1  
ATOM 28    H HB3  . SER A 1 3   ? -24.875 -0.346  -26.956 1.00 0.00 ? 3   SER A HB3  1  
ATOM 29    H HG   . SER A 1 3   ? -24.992 -0.241  -29.216 1.00 0.00 ? 3   SER A HG   1  
ATOM 30    N N    . GLY A 1 4   ? -22.773 -1.563  -26.116 1.00 0.00 ? 4   GLY A N    1  
ATOM 31    C CA   . GLY A 1 4   ? -21.935 -1.643  -24.934 1.00 0.00 ? 4   GLY A CA   1  
ATOM 32    C C    . GLY A 1 4   ? -20.831 -0.604  -24.936 1.00 0.00 ? 4   GLY A C    1  
ATOM 33    O O    . GLY A 1 4   ? -20.472 -0.071  -25.985 1.00 0.00 ? 4   GLY A O    1  
ATOM 34    H H    . GLY A 1 4   ? -22.694 -0.794  -26.719 1.00 0.00 ? 4   GLY A H    1  
ATOM 35    H HA2  . GLY A 1 4   ? -22.550 -1.498  -24.059 1.00 0.00 ? 4   GLY A HA2  1  
ATOM 36    H HA3  . GLY A 1 4   ? -21.489 -2.625  -24.889 1.00 0.00 ? 4   GLY A HA3  1  
ATOM 37    N N    . SER A 1 5   ? -20.290 -0.316  -23.756 1.00 0.00 ? 5   SER A N    1  
ATOM 38    C CA   . SER A 1 5   ? -19.224 0.670   -23.624 1.00 0.00 ? 5   SER A CA   1  
ATOM 39    C C    . SER A 1 5   ? -18.624 0.637   -22.222 1.00 0.00 ? 5   SER A C    1  
ATOM 40    O O    . SER A 1 5   ? -19.128 -0.052  -21.335 1.00 0.00 ? 5   SER A O    1  
ATOM 41    C CB   . SER A 1 5   ? -19.755 2.072   -23.931 1.00 0.00 ? 5   SER A CB   1  
ATOM 42    O OG   . SER A 1 5   ? -20.789 2.433   -23.031 1.00 0.00 ? 5   SER A OG   1  
ATOM 43    H H    . SER A 1 5   ? -20.619 -0.775  -22.955 1.00 0.00 ? 5   SER A H    1  
ATOM 44    H HA   . SER A 1 5   ? -18.453 0.422   -24.339 1.00 0.00 ? 5   SER A HA   1  
ATOM 45    H HB2  . SER A 1 5   ? -18.951 2.786   -23.842 1.00 0.00 ? 5   SER A HB2  1  
ATOM 46    H HB3  . SER A 1 5   ? -20.147 2.093   -24.937 1.00 0.00 ? 5   SER A HB3  1  
ATOM 47    H HG   . SER A 1 5   ? -21.271 3.185   -23.382 1.00 0.00 ? 5   SER A HG   1  
ATOM 48    N N    . SER A 1 6   ? -17.544 1.387   -22.029 1.00 0.00 ? 6   SER A N    1  
ATOM 49    C CA   . SER A 1 6   ? -16.871 1.442   -20.736 1.00 0.00 ? 6   SER A CA   1  
ATOM 50    C C    . SER A 1 6   ? -15.990 2.683   -20.634 1.00 0.00 ? 6   SER A C    1  
ATOM 51    O O    . SER A 1 6   ? -15.463 3.167   -21.635 1.00 0.00 ? 6   SER A O    1  
ATOM 52    C CB   . SER A 1 6   ? -16.027 0.184   -20.523 1.00 0.00 ? 6   SER A CB   1  
ATOM 53    O OG   . SER A 1 6   ? -15.824 -0.066  -19.143 1.00 0.00 ? 6   SER A OG   1  
ATOM 54    H H    . SER A 1 6   ? -17.189 1.915   -22.776 1.00 0.00 ? 6   SER A H    1  
ATOM 55    H HA   . SER A 1 6   ? -17.630 1.490   -19.970 1.00 0.00 ? 6   SER A HA   1  
ATOM 56    H HB2  . SER A 1 6   ? -16.533 -0.664  -20.960 1.00 0.00 ? 6   SER A HB2  1  
ATOM 57    H HB3  . SER A 1 6   ? -15.066 0.314   -20.999 1.00 0.00 ? 6   SER A HB3  1  
ATOM 58    H HG   . SER A 1 6   ? -14.886 -0.019  -18.944 1.00 0.00 ? 6   SER A HG   1  
ATOM 59    N N    . GLY A 1 7   ? -15.835 3.193   -19.416 1.00 0.00 ? 7   GLY A N    1  
ATOM 60    C CA   . GLY A 1 7   ? -15.017 4.373   -19.205 1.00 0.00 ? 7   GLY A CA   1  
ATOM 61    C C    . GLY A 1 7   ? -14.042 4.204   -18.057 1.00 0.00 ? 7   GLY A C    1  
ATOM 62    O O    . GLY A 1 7   ? -12.879 3.859   -18.267 1.00 0.00 ? 7   GLY A O    1  
ATOM 63    H H    . GLY A 1 7   ? -16.279 2.764   -18.655 1.00 0.00 ? 7   GLY A H    1  
ATOM 64    H HA2  . GLY A 1 7   ? -14.462 4.580   -20.107 1.00 0.00 ? 7   GLY A HA2  1  
ATOM 65    H HA3  . GLY A 1 7   ? -15.664 5.211   -18.991 1.00 0.00 ? 7   GLY A HA3  1  
ATOM 66    N N    . MET A 1 8   ? -14.515 4.449   -16.839 1.00 0.00 ? 8   MET A N    1  
ATOM 67    C CA   . MET A 1 8   ? -13.675 4.322   -15.653 1.00 0.00 ? 8   MET A CA   1  
ATOM 68    C C    . MET A 1 8   ? -12.505 5.299   -15.709 1.00 0.00 ? 8   MET A C    1  
ATOM 69    O O    . MET A 1 8   ? -11.391 4.971   -15.301 1.00 0.00 ? 8   MET A O    1  
ATOM 70    C CB   . MET A 1 8   ? -13.154 2.890   -15.522 1.00 0.00 ? 8   MET A CB   1  
ATOM 71    C CG   . MET A 1 8   ? -12.873 2.474   -14.087 1.00 0.00 ? 8   MET A CG   1  
ATOM 72    S SD   . MET A 1 8   ? -14.344 2.537   -13.046 1.00 0.00 ? 8   MET A SD   1  
ATOM 73    C CE   . MET A 1 8   ? -14.951 0.861   -13.215 1.00 0.00 ? 8   MET A CE   1  
ATOM 74    H H    . MET A 1 8   ? -15.451 4.721   -16.735 1.00 0.00 ? 8   MET A H    1  
ATOM 75    H HA   . MET A 1 8   ? -14.282 4.555   -14.792 1.00 0.00 ? 8   MET A HA   1  
ATOM 76    H HB2  . MET A 1 8   ? -13.888 2.213   -15.933 1.00 0.00 ? 8   MET A HB2  1  
ATOM 77    H HB3  . MET A 1 8   ? -12.237 2.800   -16.086 1.00 0.00 ? 8   MET A HB3  1  
ATOM 78    H HG2  . MET A 1 8   ? -12.493 1.464   -14.087 1.00 0.00 ? 8   MET A HG2  1  
ATOM 79    H HG3  . MET A 1 8   ? -12.128 3.138   -13.675 1.00 0.00 ? 8   MET A HG3  1  
ATOM 80    H HE1  . MET A 1 8   ? -15.616 0.634   -12.395 1.00 0.00 ? 8   MET A HE1  1  
ATOM 81    H HE2  . MET A 1 8   ? -15.484 0.764   -14.149 1.00 0.00 ? 8   MET A HE2  1  
ATOM 82    H HE3  . MET A 1 8   ? -14.117 0.174   -13.203 1.00 0.00 ? 8   MET A HE3  1  
ATOM 83    N N    . ALA A 1 9   ? -12.765 6.499   -16.218 1.00 0.00 ? 9   ALA A N    1  
ATOM 84    C CA   . ALA A 1 9   ? -11.733 7.523   -16.326 1.00 0.00 ? 9   ALA A CA   1  
ATOM 85    C C    . ALA A 1 9   ? -11.372 8.084   -14.955 1.00 0.00 ? 9   ALA A C    1  
ATOM 86    O O    . ALA A 1 9   ? -11.786 9.187   -14.596 1.00 0.00 ? 9   ALA A O    1  
ATOM 87    C CB   . ALA A 1 9   ? -12.192 8.640   -17.251 1.00 0.00 ? 9   ALA A CB   1  
ATOM 88    H H    . ALA A 1 9   ? -13.672 6.700   -16.527 1.00 0.00 ? 9   ALA A H    1  
ATOM 89    H HA   . ALA A 1 9   ? -10.854 7.067   -16.760 1.00 0.00 ? 9   ALA A HA   1  
ATOM 90    H HB1  . ALA A 1 9   ? -12.965 9.216   -16.763 1.00 0.00 ? 9   ALA A HB1  1  
ATOM 91    H HB2  . ALA A 1 9   ? -11.356 9.282   -17.483 1.00 0.00 ? 9   ALA A HB2  1  
ATOM 92    H HB3  . ALA A 1 9   ? -12.583 8.213   -18.163 1.00 0.00 ? 9   ALA A HB3  1  
ATOM 93    N N    . ASP A 1 10  ? -10.598 7.319   -14.192 1.00 0.00 ? 10  ASP A N    1  
ATOM 94    C CA   . ASP A 1 10  ? -10.181 7.741   -12.860 1.00 0.00 ? 10  ASP A CA   1  
ATOM 95    C C    . ASP A 1 10  ? -8.937  6.979   -12.414 1.00 0.00 ? 10  ASP A C    1  
ATOM 96    O O    . ASP A 1 10  ? -9.000  5.786   -12.120 1.00 0.00 ? 10  ASP A O    1  
ATOM 97    C CB   . ASP A 1 10  ? -11.314 7.525   -11.855 1.00 0.00 ? 10  ASP A CB   1  
ATOM 98    C CG   . ASP A 1 10  ? -12.018 6.197   -12.054 1.00 0.00 ? 10  ASP A CG   1  
ATOM 99    O OD1  . ASP A 1 10  ? -12.588 5.985   -13.144 1.00 0.00 ? 10  ASP A OD1  1  
ATOM 100   O OD2  . ASP A 1 10  ? -12.000 5.370   -11.118 1.00 0.00 ? 10  ASP A OD2  1  
ATOM 101   H H    . ASP A 1 10  ? -10.300 6.450   -14.534 1.00 0.00 ? 10  ASP A H    1  
ATOM 102   H HA   . ASP A 1 10  ? -9.947  8.794   -12.904 1.00 0.00 ? 10  ASP A HA   1  
ATOM 103   H HB2  . ASP A 1 10  ? -10.908 7.550   -10.854 1.00 0.00 ? 10  ASP A HB2  1  
ATOM 104   H HB3  . ASP A 1 10  ? -12.040 8.317   -11.965 1.00 0.00 ? 10  ASP A HB3  1  
ATOM 105   N N    . GLU A 1 11  ? -7.807  7.678   -12.367 1.00 0.00 ? 11  GLU A N    1  
ATOM 106   C CA   . GLU A 1 11  ? -6.548  7.066   -11.958 1.00 0.00 ? 11  GLU A CA   1  
ATOM 107   C C    . GLU A 1 11  ? -6.203  7.440   -10.520 1.00 0.00 ? 11  GLU A C    1  
ATOM 108   O O    . GLU A 1 11  ? -5.033  7.609   -10.173 1.00 0.00 ? 11  GLU A O    1  
ATOM 109   C CB   . GLU A 1 11  ? -5.417  7.499   -12.895 1.00 0.00 ? 11  GLU A CB   1  
ATOM 110   C CG   . GLU A 1 11  ? -5.613  7.051   -14.333 1.00 0.00 ? 11  GLU A CG   1  
ATOM 111   C CD   . GLU A 1 11  ? -5.837  5.556   -14.452 1.00 0.00 ? 11  GLU A CD   1  
ATOM 112   O OE1  . GLU A 1 11  ? -4.856  4.795   -14.315 1.00 0.00 ? 11  GLU A OE1  1  
ATOM 113   O OE2  . GLU A 1 11  ? -6.995  5.147   -14.683 1.00 0.00 ? 11  GLU A OE2  1  
ATOM 114   H H    . GLU A 1 11  ? -7.820  8.626   -12.613 1.00 0.00 ? 11  GLU A H    1  
ATOM 115   H HA   . GLU A 1 11  ? -6.664  5.995   -12.021 1.00 0.00 ? 11  GLU A HA   1  
ATOM 116   H HB2  . GLU A 1 11  ? -5.348  8.577   -12.881 1.00 0.00 ? 11  GLU A HB2  1  
ATOM 117   H HB3  . GLU A 1 11  ? -4.488  7.083   -12.533 1.00 0.00 ? 11  GLU A HB3  1  
ATOM 118   H HG2  . GLU A 1 11  ? -6.471  7.561   -14.743 1.00 0.00 ? 11  GLU A HG2  1  
ATOM 119   H HG3  . GLU A 1 11  ? -4.733  7.314   -14.902 1.00 0.00 ? 11  GLU A HG3  1  
ATOM 120   N N    . LYS A 1 12  ? -7.229  7.569   -9.686  1.00 0.00 ? 12  LYS A N    1  
ATOM 121   C CA   . LYS A 1 12  ? -7.037  7.922   -8.284  1.00 0.00 ? 12  LYS A CA   1  
ATOM 122   C C    . LYS A 1 12  ? -6.371  9.287   -8.153  1.00 0.00 ? 12  LYS A C    1  
ATOM 123   O O    . LYS A 1 12  ? -5.339  9.441   -7.499  1.00 0.00 ? 12  LYS A O    1  
ATOM 124   C CB   . LYS A 1 12  ? -6.189  6.859   -7.581  1.00 0.00 ? 12  LYS A CB   1  
ATOM 125   C CG   . LYS A 1 12  ? -6.989  5.658   -7.107  1.00 0.00 ? 12  LYS A CG   1  
ATOM 126   C CD   . LYS A 1 12  ? -7.858  6.004   -5.910  1.00 0.00 ? 12  LYS A CD   1  
ATOM 127   C CE   . LYS A 1 12  ? -7.093  5.854   -4.604  1.00 0.00 ? 12  LYS A CE   1  
ATOM 128   N NZ   . LYS A 1 12  ? -6.934  4.425   -4.215  1.00 0.00 ? 12  LYS A NZ   1  
ATOM 129   H H    . LYS A 1 12  ? -8.139  7.421   -10.021 1.00 0.00 ? 12  LYS A H    1  
ATOM 130   H HA   . LYS A 1 12  ? -8.009  7.962   -7.816  1.00 0.00 ? 12  LYS A HA   1  
ATOM 131   H HB2  . LYS A 1 12  ? -5.429  6.512   -8.264  1.00 0.00 ? 12  LYS A HB2  1  
ATOM 132   H HB3  . LYS A 1 12  ? -5.711  7.308   -6.722  1.00 0.00 ? 12  LYS A HB3  1  
ATOM 133   H HG2  . LYS A 1 12  ? -7.624  5.319   -7.913  1.00 0.00 ? 12  LYS A HG2  1  
ATOM 134   H HG3  . LYS A 1 12  ? -6.306  4.869   -6.828  1.00 0.00 ? 12  LYS A HG3  1  
ATOM 135   H HD2  . LYS A 1 12  ? -8.193  7.026   -6.002  1.00 0.00 ? 12  LYS A HD2  1  
ATOM 136   H HD3  . LYS A 1 12  ? -8.714  5.343   -5.894  1.00 0.00 ? 12  LYS A HD3  1  
ATOM 137   H HE2  . LYS A 1 12  ? -6.116  6.297   -4.721  1.00 0.00 ? 12  LYS A HE2  1  
ATOM 138   H HE3  . LYS A 1 12  ? -7.632  6.373   -3.825  1.00 0.00 ? 12  LYS A HE3  1  
ATOM 139   H HZ1  . LYS A 1 12  ? -7.840  4.046   -3.872  1.00 0.00 ? 12  LYS A HZ1  1  
ATOM 140   H HZ2  . LYS A 1 12  ? -6.226  4.338   -3.459  1.00 0.00 ? 12  LYS A HZ2  1  
ATOM 141   H HZ3  . LYS A 1 12  ? -6.622  3.865   -5.034  1.00 0.00 ? 12  LYS A HZ3  1  
ATOM 142   N N    . PRO A 1 13  ? -6.973  10.304  -8.788  1.00 0.00 ? 13  PRO A N    1  
ATOM 143   C CA   . PRO A 1 13  ? -6.456  11.675  -8.756  1.00 0.00 ? 13  PRO A CA   1  
ATOM 144   C C    . PRO A 1 13  ? -6.603  12.318  -7.381  1.00 0.00 ? 13  PRO A C    1  
ATOM 145   O O    . PRO A 1 13  ? -7.621  12.941  -7.081  1.00 0.00 ? 13  PRO A O    1  
ATOM 146   C CB   . PRO A 1 13  ? -7.323  12.406  -9.784  1.00 0.00 ? 13  PRO A CB   1  
ATOM 147   C CG   . PRO A 1 13  ? -8.591  11.625  -9.832  1.00 0.00 ? 13  PRO A CG   1  
ATOM 148   C CD   . PRO A 1 13  ? -8.205  10.193  -9.586  1.00 0.00 ? 13  PRO A CD   1  
ATOM 149   H HA   . PRO A 1 13  ? -5.420  11.716  -9.062  1.00 0.00 ? 13  PRO A HA   1  
ATOM 150   H HB2  . PRO A 1 13  ? -7.496  13.421  -9.456  1.00 0.00 ? 13  PRO A HB2  1  
ATOM 151   H HB3  . PRO A 1 13  ? -6.826  12.411  -10.742 1.00 0.00 ? 13  PRO A HB3  1  
ATOM 152   H HG2  . PRO A 1 13  ? -9.264  11.970  -9.062  1.00 0.00 ? 13  PRO A HG2  1  
ATOM 153   H HG3  . PRO A 1 13  ? -9.048  11.728  -10.806 1.00 0.00 ? 13  PRO A HG3  1  
ATOM 154   H HD2  . PRO A 1 13  ? -8.979  9.684   -9.032  1.00 0.00 ? 13  PRO A HD2  1  
ATOM 155   H HD3  . PRO A 1 13  ? -8.014  9.688   -10.522 1.00 0.00 ? 13  PRO A HD3  1  
ATOM 156   N N    . LYS A 1 14  ? -5.580  12.163  -6.548  1.00 0.00 ? 14  LYS A N    1  
ATOM 157   C CA   . LYS A 1 14  ? -5.594  12.729  -5.204  1.00 0.00 ? 14  LYS A CA   1  
ATOM 158   C C    . LYS A 1 14  ? -4.176  12.867  -4.657  1.00 0.00 ? 14  LYS A C    1  
ATOM 159   O O    . LYS A 1 14  ? -3.237  12.277  -5.189  1.00 0.00 ? 14  LYS A O    1  
ATOM 160   C CB   . LYS A 1 14  ? -6.430  11.854  -4.268  1.00 0.00 ? 14  LYS A CB   1  
ATOM 161   C CG   . LYS A 1 14  ? -7.928  12.056  -4.423  1.00 0.00 ? 14  LYS A CG   1  
ATOM 162   C CD   . LYS A 1 14  ? -8.703  11.343  -3.328  1.00 0.00 ? 14  LYS A CD   1  
ATOM 163   C CE   . LYS A 1 14  ? -10.074 11.968  -3.118  1.00 0.00 ? 14  LYS A CE   1  
ATOM 164   N NZ   . LYS A 1 14  ? -10.016 13.136  -2.196  1.00 0.00 ? 14  LYS A NZ   1  
ATOM 165   H H    . LYS A 1 14  ? -4.795  11.655  -6.844  1.00 0.00 ? 14  LYS A H    1  
ATOM 166   H HA   . LYS A 1 14  ? -6.041  13.710  -5.262  1.00 0.00 ? 14  LYS A HA   1  
ATOM 167   H HB2  . LYS A 1 14  ? -6.205  10.817  -4.468  1.00 0.00 ? 14  LYS A HB2  1  
ATOM 168   H HB3  . LYS A 1 14  ? -6.161  12.082  -3.247  1.00 0.00 ? 14  LYS A HB3  1  
ATOM 169   H HG2  . LYS A 1 14  ? -8.146  13.112  -4.375  1.00 0.00 ? 14  LYS A HG2  1  
ATOM 170   H HG3  . LYS A 1 14  ? -8.237  11.666  -5.383  1.00 0.00 ? 14  LYS A HG3  1  
ATOM 171   H HD2  . LYS A 1 14  ? -8.830  10.307  -3.604  1.00 0.00 ? 14  LYS A HD2  1  
ATOM 172   H HD3  . LYS A 1 14  ? -8.144  11.405  -2.405  1.00 0.00 ? 14  LYS A HD3  1  
ATOM 173   H HE2  . LYS A 1 14  ? -10.456 12.293  -4.074  1.00 0.00 ? 14  LYS A HE2  1  
ATOM 174   H HE3  . LYS A 1 14  ? -10.734 11.222  -2.701  1.00 0.00 ? 14  LYS A HE3  1  
ATOM 175   H HZ1  . LYS A 1 14  ? -9.204  13.043  -1.553  1.00 0.00 ? 14  LYS A HZ1  1  
ATOM 176   H HZ2  . LYS A 1 14  ? -10.887 13.187  -1.630  1.00 0.00 ? 14  LYS A HZ2  1  
ATOM 177   H HZ3  . LYS A 1 14  ? -9.917  14.016  -2.740  1.00 0.00 ? 14  LYS A HZ3  1  
ATOM 178   N N    . GLU A 1 15  ? -4.031  13.649  -3.592  1.00 0.00 ? 15  GLU A N    1  
ATOM 179   C CA   . GLU A 1 15  ? -2.728  13.863  -2.974  1.00 0.00 ? 15  GLU A CA   1  
ATOM 180   C C    . GLU A 1 15  ? -2.819  13.734  -1.456  1.00 0.00 ? 15  GLU A C    1  
ATOM 181   O O    . GLU A 1 15  ? -3.901  13.551  -0.901  1.00 0.00 ? 15  GLU A O    1  
ATOM 182   C CB   . GLU A 1 15  ? -2.181  15.242  -3.348  1.00 0.00 ? 15  GLU A CB   1  
ATOM 183   C CG   . GLU A 1 15  ? -1.514  15.282  -4.712  1.00 0.00 ? 15  GLU A CG   1  
ATOM 184   C CD   . GLU A 1 15  ? -2.481  14.994  -5.844  1.00 0.00 ? 15  GLU A CD   1  
ATOM 185   O OE1  . GLU A 1 15  ? -3.638  15.460  -5.770  1.00 0.00 ? 15  GLU A OE1  1  
ATOM 186   O OE2  . GLU A 1 15  ? -2.082  14.303  -6.804  1.00 0.00 ? 15  GLU A OE2  1  
ATOM 187   H H    . GLU A 1 15  ? -4.819  14.093  -3.214  1.00 0.00 ? 15  GLU A H    1  
ATOM 188   H HA   . GLU A 1 15  ? -2.056  13.106  -3.347  1.00 0.00 ? 15  GLU A HA   1  
ATOM 189   H HB2  . GLU A 1 15  ? -2.996  15.951  -3.347  1.00 0.00 ? 15  GLU A HB2  1  
ATOM 190   H HB3  . GLU A 1 15  ? -1.455  15.540  -2.606  1.00 0.00 ? 15  GLU A HB3  1  
ATOM 191   H HG2  . GLU A 1 15  ? -1.090  16.264  -4.863  1.00 0.00 ? 15  GLU A HG2  1  
ATOM 192   H HG3  . GLU A 1 15  ? -0.726  14.544  -4.735  1.00 0.00 ? 15  GLU A HG3  1  
ATOM 193   N N    . GLY A 1 16  ? -1.672  13.831  -0.790  1.00 0.00 ? 16  GLY A N    1  
ATOM 194   C CA   . GLY A 1 16  ? -1.642  13.722  0.657   1.00 0.00 ? 16  GLY A CA   1  
ATOM 195   C C    . GLY A 1 16  ? -0.692  14.717  1.294   1.00 0.00 ? 16  GLY A C    1  
ATOM 196   O O    . GLY A 1 16  ? 0.058   15.402  0.599   1.00 0.00 ? 16  GLY A O    1  
ATOM 197   H H    . GLY A 1 16  ? -0.839  13.977  -1.285  1.00 0.00 ? 16  GLY A H    1  
ATOM 198   H HA2  . GLY A 1 16  ? -2.637  13.894  1.040   1.00 0.00 ? 16  GLY A HA2  1  
ATOM 199   H HA3  . GLY A 1 16  ? -1.331  12.723  0.925   1.00 0.00 ? 16  GLY A HA3  1  
ATOM 200   N N    . VAL A 1 17  ? -0.726  14.799  2.620   1.00 0.00 ? 17  VAL A N    1  
ATOM 201   C CA   . VAL A 1 17  ? 0.139   15.718  3.351   1.00 0.00 ? 17  VAL A CA   1  
ATOM 202   C C    . VAL A 1 17  ? 0.676   15.072  4.623   1.00 0.00 ? 17  VAL A C    1  
ATOM 203   O O    . VAL A 1 17  ? -0.028  14.320  5.297   1.00 0.00 ? 17  VAL A O    1  
ATOM 204   C CB   . VAL A 1 17  ? -0.607  17.014  3.722   1.00 0.00 ? 17  VAL A CB   1  
ATOM 205   C CG1  . VAL A 1 17  ? -1.798  16.708  4.616   1.00 0.00 ? 17  VAL A CG1  1  
ATOM 206   C CG2  . VAL A 1 17  ? 0.338   17.997  4.396   1.00 0.00 ? 17  VAL A CG2  1  
ATOM 207   H H    . VAL A 1 17  ? -1.345  14.227  3.119   1.00 0.00 ? 17  VAL A H    1  
ATOM 208   H HA   . VAL A 1 17  ? 0.970   15.976  2.711   1.00 0.00 ? 17  VAL A HA   1  
ATOM 209   H HB   . VAL A 1 17  ? -0.974  17.467  2.812   1.00 0.00 ? 17  VAL A HB   1  
ATOM 210   H HG11 . VAL A 1 17  ? -1.960  15.641  4.647   1.00 0.00 ? 17  VAL A HG11 1  
ATOM 211   H HG12 . VAL A 1 17  ? -1.603  17.073  5.614   1.00 0.00 ? 17  VAL A HG12 1  
ATOM 212   H HG13 . VAL A 1 17  ? -2.679  17.193  4.221   1.00 0.00 ? 17  VAL A HG13 1  
ATOM 213   H HG21 . VAL A 1 17  ? -0.217  18.865  4.718   1.00 0.00 ? 17  VAL A HG21 1  
ATOM 214   H HG22 . VAL A 1 17  ? 0.798   17.526  5.253   1.00 0.00 ? 17  VAL A HG22 1  
ATOM 215   H HG23 . VAL A 1 17  ? 1.104   18.298  3.697   1.00 0.00 ? 17  VAL A HG23 1  
ATOM 216   N N    . LYS A 1 18  ? 1.929   15.372  4.948   1.00 0.00 ? 18  LYS A N    1  
ATOM 217   C CA   . LYS A 1 18  ? 2.563   14.823  6.141   1.00 0.00 ? 18  LYS A CA   1  
ATOM 218   C C    . LYS A 1 18  ? 3.317   15.908  6.905   1.00 0.00 ? 18  LYS A C    1  
ATOM 219   O O    . LYS A 1 18  ? 3.433   17.042  6.440   1.00 0.00 ? 18  LYS A O    1  
ATOM 220   C CB   . LYS A 1 18  ? 3.522   13.693  5.760   1.00 0.00 ? 18  LYS A CB   1  
ATOM 221   C CG   . LYS A 1 18  ? 2.823   12.466  5.200   1.00 0.00 ? 18  LYS A CG   1  
ATOM 222   C CD   . LYS A 1 18  ? 3.786   11.580  4.428   1.00 0.00 ? 18  LYS A CD   1  
ATOM 223   C CE   . LYS A 1 18  ? 4.185   12.211  3.103   1.00 0.00 ? 18  LYS A CE   1  
ATOM 224   N NZ   . LYS A 1 18  ? 4.698   11.199  2.139   1.00 0.00 ? 18  LYS A NZ   1  
ATOM 225   H H    . LYS A 1 18  ? 2.440   15.979  4.372   1.00 0.00 ? 18  LYS A H    1  
ATOM 226   H HA   . LYS A 1 18  ? 1.786   14.426  6.777   1.00 0.00 ? 18  LYS A HA   1  
ATOM 227   H HB2  . LYS A 1 18  ? 4.213   14.059  5.016   1.00 0.00 ? 18  LYS A HB2  1  
ATOM 228   H HB3  . LYS A 1 18  ? 4.076   13.396  6.639   1.00 0.00 ? 18  LYS A HB3  1  
ATOM 229   H HG2  . LYS A 1 18  ? 2.403   11.898  6.017   1.00 0.00 ? 18  LYS A HG2  1  
ATOM 230   H HG3  . LYS A 1 18  ? 2.031   12.785  4.537   1.00 0.00 ? 18  LYS A HG3  1  
ATOM 231   H HD2  . LYS A 1 18  ? 4.674   11.425  5.022   1.00 0.00 ? 18  LYS A HD2  1  
ATOM 232   H HD3  . LYS A 1 18  ? 3.310   10.629  4.235   1.00 0.00 ? 18  LYS A HD3  1  
ATOM 233   H HE2  . LYS A 1 18  ? 3.320   12.696  2.676   1.00 0.00 ? 18  LYS A HE2  1  
ATOM 234   H HE3  . LYS A 1 18  ? 4.955   12.945  3.287   1.00 0.00 ? 18  LYS A HE3  1  
ATOM 235   H HZ1  . LYS A 1 18  ? 5.108   10.393  2.652   1.00 0.00 ? 18  LYS A HZ1  1  
ATOM 236   H HZ2  . LYS A 1 18  ? 5.434   11.621  1.537   1.00 0.00 ? 18  LYS A HZ2  1  
ATOM 237   H HZ3  . LYS A 1 18  ? 3.925   10.856  1.535   1.00 0.00 ? 18  LYS A HZ3  1  
ATOM 238   N N    . THR A 1 19  ? 3.830   15.551  8.078   1.00 0.00 ? 19  THR A N    1  
ATOM 239   C CA   . THR A 1 19  ? 4.573   16.493  8.906   1.00 0.00 ? 19  THR A CA   1  
ATOM 240   C C    . THR A 1 19  ? 6.043   16.104  8.997   1.00 0.00 ? 19  THR A C    1  
ATOM 241   O O    . THR A 1 19  ? 6.390   14.928  8.892   1.00 0.00 ? 19  THR A O    1  
ATOM 242   C CB   . THR A 1 19  ? 3.986   16.577  10.327  1.00 0.00 ? 19  THR A CB   1  
ATOM 243   O OG1  . THR A 1 19  ? 2.581   16.849  10.263  1.00 0.00 ? 19  THR A OG1  1  
ATOM 244   C CG2  . THR A 1 19  ? 4.681   17.661  11.137  1.00 0.00 ? 19  THR A CG2  1  
ATOM 245   H H    . THR A 1 19  ? 3.703   14.632  8.394   1.00 0.00 ? 19  THR A H    1  
ATOM 246   H HA   . THR A 1 19  ? 4.497   17.470  8.449   1.00 0.00 ? 19  THR A HA   1  
ATOM 247   H HB   . THR A 1 19  ? 4.138   15.627  10.820  1.00 0.00 ? 19  THR A HB   1  
ATOM 248   H HG1  . THR A 1 19  ? 2.225   16.500  9.442   1.00 0.00 ? 19  THR A HG1  1  
ATOM 249   H HG21 . THR A 1 19  ? 5.491   17.225  11.702  1.00 0.00 ? 19  THR A HG21 1  
ATOM 250   H HG22 . THR A 1 19  ? 3.973   18.114  11.814  1.00 0.00 ? 19  THR A HG22 1  
ATOM 251   H HG23 . THR A 1 19  ? 5.073   18.413  10.469  1.00 0.00 ? 19  THR A HG23 1  
ATOM 252   N N    . GLU A 1 20  ? 6.903   17.098  9.195   1.00 0.00 ? 20  GLU A N    1  
ATOM 253   C CA   . GLU A 1 20  ? 8.338   16.857  9.301   1.00 0.00 ? 20  GLU A CA   1  
ATOM 254   C C    . GLU A 1 20  ? 8.710   16.398  10.707  1.00 0.00 ? 20  GLU A C    1  
ATOM 255   O O    . GLU A 1 20  ? 8.843   17.210  11.622  1.00 0.00 ? 20  GLU A O    1  
ATOM 256   C CB   . GLU A 1 20  ? 9.118   18.123  8.942   1.00 0.00 ? 20  GLU A CB   1  
ATOM 257   C CG   . GLU A 1 20  ? 8.815   18.651  7.550   1.00 0.00 ? 20  GLU A CG   1  
ATOM 258   C CD   . GLU A 1 20  ? 9.728   18.063  6.492   1.00 0.00 ? 20  GLU A CD   1  
ATOM 259   O OE1  . GLU A 1 20  ? 9.554   16.874  6.154   1.00 0.00 ? 20  GLU A OE1  1  
ATOM 260   O OE2  . GLU A 1 20  ? 10.615  18.792  6.002   1.00 0.00 ? 20  GLU A OE2  1  
ATOM 261   H H    . GLU A 1 20  ? 6.565   18.015  9.271   1.00 0.00 ? 20  GLU A H    1  
ATOM 262   H HA   . GLU A 1 20  ? 8.595   16.077  8.601   1.00 0.00 ? 20  GLU A HA   1  
ATOM 263   H HB2  . GLU A 1 20  ? 8.877   18.895  9.658   1.00 0.00 ? 20  GLU A HB2  1  
ATOM 264   H HB3  . GLU A 1 20  ? 10.175  17.909  9.000   1.00 0.00 ? 20  GLU A HB3  1  
ATOM 265   H HG2  . GLU A 1 20  ? 7.794   18.405  7.300   1.00 0.00 ? 20  GLU A HG2  1  
ATOM 266   H HG3  . GLU A 1 20  ? 8.935   19.725  7.552   1.00 0.00 ? 20  GLU A HG3  1  
ATOM 267   N N    . ASN A 1 21  ? 8.876   15.090  10.872  1.00 0.00 ? 21  ASN A N    1  
ATOM 268   C CA   . ASN A 1 21  ? 9.231   14.521  12.167  1.00 0.00 ? 21  ASN A CA   1  
ATOM 269   C C    . ASN A 1 21  ? 9.678   13.070  12.021  1.00 0.00 ? 21  ASN A C    1  
ATOM 270   O O    . ASN A 1 21  ? 9.100   12.307  11.248  1.00 0.00 ? 21  ASN A O    1  
ATOM 271   C CB   . ASN A 1 21  ? 8.044   14.607  13.129  1.00 0.00 ? 21  ASN A CB   1  
ATOM 272   C CG   . ASN A 1 21  ? 7.925   15.970  13.781  1.00 0.00 ? 21  ASN A CG   1  
ATOM 273   O OD1  . ASN A 1 21  ? 7.081   16.781  13.401  1.00 0.00 ? 21  ASN A OD1  1  
ATOM 274   N ND2  . ASN A 1 21  ? 8.774   16.229  14.770  1.00 0.00 ? 21  ASN A ND2  1  
ATOM 275   H H    . ASN A 1 21  ? 8.756   14.492  10.105  1.00 0.00 ? 21  ASN A H    1  
ATOM 276   H HA   . ASN A 1 21  ? 10.050  15.099  12.569  1.00 0.00 ? 21  ASN A HA   1  
ATOM 277   H HB2  . ASN A 1 21  ? 7.133   14.410  12.583  1.00 0.00 ? 21  ASN A HB2  1  
ATOM 278   H HB3  . ASN A 1 21  ? 8.162   13.865  13.904  1.00 0.00 ? 21  ASN A HB3  1  
ATOM 279   H HD21 . ASN A 1 21  ? 9.420   15.535  15.019  1.00 0.00 ? 21  ASN A HD21 1  
ATOM 280   H HD22 . ASN A 1 21  ? 8.719   17.103  15.210  1.00 0.00 ? 21  ASN A HD22 1  
ATOM 281   N N    . ASN A 1 22  ? 10.711  12.696  12.769  1.00 0.00 ? 22  ASN A N    1  
ATOM 282   C CA   . ASN A 1 22  ? 11.236  11.336  12.722  1.00 0.00 ? 22  ASN A CA   1  
ATOM 283   C C    . ASN A 1 22  ? 10.434  10.412  13.634  1.00 0.00 ? 22  ASN A C    1  
ATOM 284   O O    . ASN A 1 22  ? 11.000  9.588   14.353  1.00 0.00 ? 22  ASN A O    1  
ATOM 285   C CB   . ASN A 1 22  ? 12.710  11.321  13.131  1.00 0.00 ? 22  ASN A CB   1  
ATOM 286   C CG   . ASN A 1 22  ? 13.581  12.123  12.184  1.00 0.00 ? 22  ASN A CG   1  
ATOM 287   O OD1  . ASN A 1 22  ? 13.432  13.340  12.065  1.00 0.00 ? 22  ASN A OD1  1  
ATOM 288   N ND2  . ASN A 1 22  ? 14.496  11.443  11.503  1.00 0.00 ? 22  ASN A ND2  1  
ATOM 289   H H    . ASN A 1 22  ? 11.131  13.350  13.366  1.00 0.00 ? 22  ASN A H    1  
ATOM 290   H HA   . ASN A 1 22  ? 11.150  10.982  11.706  1.00 0.00 ? 22  ASN A HA   1  
ATOM 291   H HB2  . ASN A 1 22  ? 12.806  11.743  14.122  1.00 0.00 ? 22  ASN A HB2  1  
ATOM 292   H HB3  . ASN A 1 22  ? 13.065  10.302  13.142  1.00 0.00 ? 22  ASN A HB3  1  
ATOM 293   H HD21 . ASN A 1 22  ? 14.557  10.476  11.648  1.00 0.00 ? 22  ASN A HD21 1  
ATOM 294   H HD22 . ASN A 1 22  ? 15.073  11.937  10.884  1.00 0.00 ? 22  ASN A HD22 1  
ATOM 295   N N    . ASP A 1 23  ? 9.114   10.555  13.599  1.00 0.00 ? 23  ASP A N    1  
ATOM 296   C CA   . ASP A 1 23  ? 8.233   9.733   14.421  1.00 0.00 ? 23  ASP A CA   1  
ATOM 297   C C    . ASP A 1 23  ? 7.386   8.808   13.552  1.00 0.00 ? 23  ASP A C    1  
ATOM 298   O O    . ASP A 1 23  ? 6.235   8.515   13.879  1.00 0.00 ? 23  ASP A O    1  
ATOM 299   C CB   . ASP A 1 23  ? 7.329   10.617  15.280  1.00 0.00 ? 23  ASP A CB   1  
ATOM 300   C CG   . ASP A 1 23  ? 7.961   10.973  16.611  1.00 0.00 ? 23  ASP A CG   1  
ATOM 301   O OD1  . ASP A 1 23  ? 8.833   10.209  17.077  1.00 0.00 ? 23  ASP A OD1  1  
ATOM 302   O OD2  . ASP A 1 23  ? 7.585   12.015  17.187  1.00 0.00 ? 23  ASP A OD2  1  
ATOM 303   H H    . ASP A 1 23  ? 8.722   11.230  13.006  1.00 0.00 ? 23  ASP A H    1  
ATOM 304   H HA   . ASP A 1 23  ? 8.852   9.130   15.069  1.00 0.00 ? 23  ASP A HA   1  
ATOM 305   H HB2  . ASP A 1 23  ? 7.120   11.533  14.746  1.00 0.00 ? 23  ASP A HB2  1  
ATOM 306   H HB3  . ASP A 1 23  ? 6.402   10.096  15.469  1.00 0.00 ? 23  ASP A HB3  1  
ATOM 307   N N    . HIS A 1 24  ? 7.962   8.354   12.444  1.00 0.00 ? 24  HIS A N    1  
ATOM 308   C CA   . HIS A 1 24  ? 7.259   7.463   11.527  1.00 0.00 ? 24  HIS A CA   1  
ATOM 309   C C    . HIS A 1 24  ? 8.169   6.328   11.068  1.00 0.00 ? 24  HIS A C    1  
ATOM 310   O O    . HIS A 1 24  ? 9.391   6.413   11.188  1.00 0.00 ? 24  HIS A O    1  
ATOM 311   C CB   . HIS A 1 24  ? 6.747   8.243   10.316  1.00 0.00 ? 24  HIS A CB   1  
ATOM 312   C CG   . HIS A 1 24  ? 5.772   9.325   10.669  1.00 0.00 ? 24  HIS A CG   1  
ATOM 313   N ND1  . HIS A 1 24  ? 4.488   9.373   10.169  1.00 0.00 ? 24  HIS A ND1  1  
ATOM 314   C CD2  . HIS A 1 24  ? 5.900   10.401  11.479  1.00 0.00 ? 24  HIS A CD2  1  
ATOM 315   C CE1  . HIS A 1 24  ? 3.869   10.434  10.655  1.00 0.00 ? 24  HIS A CE1  1  
ATOM 316   N NE2  . HIS A 1 24  ? 4.703   11.075  11.453  1.00 0.00 ? 24  HIS A NE2  1  
ATOM 317   H H    . HIS A 1 24  ? 8.881   8.623   12.238  1.00 0.00 ? 24  HIS A H    1  
ATOM 318   H HA   . HIS A 1 24  ? 6.417   7.041   12.055  1.00 0.00 ? 24  HIS A HA   1  
ATOM 319   H HB2  . HIS A 1 24  ? 7.584   8.703   9.813   1.00 0.00 ? 24  HIS A HB2  1  
ATOM 320   H HB3  . HIS A 1 24  ? 6.255   7.561   9.638   1.00 0.00 ? 24  HIS A HB3  1  
ATOM 321   H HD1  . HIS A 1 24  ? 4.091   8.727   9.549   1.00 0.00 ? 24  HIS A HD1  1  
ATOM 322   H HD2  . HIS A 1 24  ? 6.780   10.681  12.042  1.00 0.00 ? 24  HIS A HD2  1  
ATOM 323   H HE1  . HIS A 1 24  ? 2.853   10.727  10.438  1.00 0.00 ? 24  HIS A HE1  1  
ATOM 324   H HE2  . HIS A 1 24  ? 4.527   11.941  11.876  1.00 0.00 ? 24  HIS A HE2  1  
ATOM 325   N N    . ILE A 1 25  ? 7.565   5.267   10.544  1.00 0.00 ? 25  ILE A N    1  
ATOM 326   C CA   . ILE A 1 25  ? 8.321   4.116   10.067  1.00 0.00 ? 25  ILE A CA   1  
ATOM 327   C C    . ILE A 1 25  ? 8.134   3.919   8.566   1.00 0.00 ? 25  ILE A C    1  
ATOM 328   O O    . ILE A 1 25  ? 7.061   4.180   8.025   1.00 0.00 ? 25  ILE A O    1  
ATOM 329   C CB   . ILE A 1 25  ? 7.904   2.826   10.798  1.00 0.00 ? 25  ILE A CB   1  
ATOM 330   C CG1  . ILE A 1 25  ? 6.434   2.508   10.519  1.00 0.00 ? 25  ILE A CG1  1  
ATOM 331   C CG2  . ILE A 1 25  ? 8.148   2.963   12.294  1.00 0.00 ? 25  ILE A CG2  1  
ATOM 332   C CD1  . ILE A 1 25  ? 5.951   1.241   11.190  1.00 0.00 ? 25  ILE A CD1  1  
ATOM 333   H H    . ILE A 1 25  ? 6.587   5.258   10.475  1.00 0.00 ? 25  ILE A H    1  
ATOM 334   H HA   . ILE A 1 25  ? 9.367   4.298   10.268  1.00 0.00 ? 25  ILE A HA   1  
ATOM 335   H HB   . ILE A 1 25  ? 8.516   2.016   10.431  1.00 0.00 ? 25  ILE A HB   1  
ATOM 336   H HG12 . ILE A 1 25  ? 5.822   3.323   10.873  1.00 0.00 ? 25  ILE A HG12 1  
ATOM 337   H HG13 . ILE A 1 25  ? 6.294   2.394   9.454   1.00 0.00 ? 25  ILE A HG13 1  
ATOM 338   H HG21 . ILE A 1 25  ? 8.821   2.184   12.621  1.00 0.00 ? 25  ILE A HG21 1  
ATOM 339   H HG22 . ILE A 1 25  ? 8.587   3.927   12.500  1.00 0.00 ? 25  ILE A HG22 1  
ATOM 340   H HG23 . ILE A 1 25  ? 7.210   2.873   12.821  1.00 0.00 ? 25  ILE A HG23 1  
ATOM 341   H HD11 . ILE A 1 25  ? 5.276   0.718   10.530  1.00 0.00 ? 25  ILE A HD11 1  
ATOM 342   H HD12 . ILE A 1 25  ? 6.797   0.609   11.417  1.00 0.00 ? 25  ILE A HD12 1  
ATOM 343   H HD13 . ILE A 1 25  ? 5.435   1.493   12.105  1.00 0.00 ? 25  ILE A HD13 1  
ATOM 344   N N    . ASN A 1 26  ? 9.187   3.454   7.901   1.00 0.00 ? 26  ASN A N    1  
ATOM 345   C CA   . ASN A 1 26  ? 9.139   3.221   6.462   1.00 0.00 ? 26  ASN A CA   1  
ATOM 346   C C    . ASN A 1 26  ? 9.237   1.731   6.149   1.00 0.00 ? 26  ASN A C    1  
ATOM 347   O O    . ASN A 1 26  ? 10.101  1.029   6.678   1.00 0.00 ? 26  ASN A O    1  
ATOM 348   C CB   . ASN A 1 26  ? 10.272  3.975   5.764   1.00 0.00 ? 26  ASN A CB   1  
ATOM 349   C CG   . ASN A 1 26  ? 10.449  5.381   6.304   1.00 0.00 ? 26  ASN A CG   1  
ATOM 350   O OD1  . ASN A 1 26  ? 9.524   5.961   6.872   1.00 0.00 ? 26  ASN A OD1  1  
ATOM 351   N ND2  . ASN A 1 26  ? 11.643  5.937   6.127   1.00 0.00 ? 26  ASN A ND2  1  
ATOM 352   H H    . ASN A 1 26  ? 10.016  3.265   8.388   1.00 0.00 ? 26  ASN A H    1  
ATOM 353   H HA   . ASN A 1 26  ? 8.193   3.592   6.097   1.00 0.00 ? 26  ASN A HA   1  
ATOM 354   H HB2  . ASN A 1 26  ? 11.197  3.436   5.907   1.00 0.00 ? 26  ASN A HB2  1  
ATOM 355   H HB3  . ASN A 1 26  ? 10.058  4.039   4.708   1.00 0.00 ? 26  ASN A HB3  1  
ATOM 356   H HD21 . ASN A 1 26  ? 12.332  5.416   5.665   1.00 0.00 ? 26  ASN A HD21 1  
ATOM 357   H HD22 . ASN A 1 26  ? 11.785  6.845   6.467   1.00 0.00 ? 26  ASN A HD22 1  
ATOM 358   N N    . LEU A 1 27  ? 8.347   1.253   5.286   1.00 0.00 ? 27  LEU A N    1  
ATOM 359   C CA   . LEU A 1 27  ? 8.333   -0.154  4.901   1.00 0.00 ? 27  LEU A CA   1  
ATOM 360   C C    . LEU A 1 27  ? 8.554   -0.310  3.400   1.00 0.00 ? 27  LEU A C    1  
ATOM 361   O O    . LEU A 1 27  ? 7.923   0.374   2.594   1.00 0.00 ? 27  LEU A O    1  
ATOM 362   C CB   . LEU A 1 27  ? 7.006   -0.800  5.303   1.00 0.00 ? 27  LEU A CB   1  
ATOM 363   C CG   . LEU A 1 27  ? 6.320   -0.212  6.537   1.00 0.00 ? 27  LEU A CG   1  
ATOM 364   C CD1  . LEU A 1 27  ? 4.980   -0.889  6.776   1.00 0.00 ? 27  LEU A CD1  1  
ATOM 365   C CD2  . LEU A 1 27  ? 7.215   -0.349  7.761   1.00 0.00 ? 27  LEU A CD2  1  
ATOM 366   H H    . LEU A 1 27  ? 7.684   1.860   4.898   1.00 0.00 ? 27  LEU A H    1  
ATOM 367   H HA   . LEU A 1 27  ? 9.138   -0.648  5.425   1.00 0.00 ? 27  LEU A HA   1  
ATOM 368   H HB2  . LEU A 1 27  ? 6.326   -0.704  4.471   1.00 0.00 ? 27  LEU A HB2  1  
ATOM 369   H HB3  . LEU A 1 27  ? 7.193   -1.847  5.495   1.00 0.00 ? 27  LEU A HB3  1  
ATOM 370   H HG   . LEU A 1 27  ? 6.137   0.841   6.372   1.00 0.00 ? 27  LEU A HG   1  
ATOM 371   H HD11 . LEU A 1 27  ? 4.260   -0.156  7.107   1.00 0.00 ? 27  LEU A HD11 1  
ATOM 372   H HD12 . LEU A 1 27  ? 5.091   -1.651  7.533   1.00 0.00 ? 27  LEU A HD12 1  
ATOM 373   H HD13 . LEU A 1 27  ? 4.637   -1.343  5.858   1.00 0.00 ? 27  LEU A HD13 1  
ATOM 374   H HD21 . LEU A 1 27  ? 7.721   0.588   7.942   1.00 0.00 ? 27  LEU A HD21 1  
ATOM 375   H HD22 . LEU A 1 27  ? 7.945   -1.125  7.587   1.00 0.00 ? 27  LEU A HD22 1  
ATOM 376   H HD23 . LEU A 1 27  ? 6.613   -0.605  8.620   1.00 0.00 ? 27  LEU A HD23 1  
ATOM 377   N N    . LYS A 1 28  ? 9.453   -1.217  3.031   1.00 0.00 ? 28  LYS A N    1  
ATOM 378   C CA   . LYS A 1 28  ? 9.755   -1.467  1.627   1.00 0.00 ? 28  LYS A CA   1  
ATOM 379   C C    . LYS A 1 28  ? 8.865   -2.572  1.067   1.00 0.00 ? 28  LYS A C    1  
ATOM 380   O O    . LYS A 1 28  ? 8.976   -3.733  1.463   1.00 0.00 ? 28  LYS A O    1  
ATOM 381   C CB   . LYS A 1 28  ? 11.227  -1.850  1.461   1.00 0.00 ? 28  LYS A CB   1  
ATOM 382   C CG   . LYS A 1 28  ? 12.184  -0.685  1.649   1.00 0.00 ? 28  LYS A CG   1  
ATOM 383   C CD   . LYS A 1 28  ? 13.554  -1.157  2.107   1.00 0.00 ? 28  LYS A CD   1  
ATOM 384   C CE   . LYS A 1 28  ? 13.637  -1.238  3.624   1.00 0.00 ? 28  LYS A CE   1  
ATOM 385   N NZ   . LYS A 1 28  ? 15.040  -1.125  4.109   1.00 0.00 ? 28  LYS A NZ   1  
ATOM 386   H H    . LYS A 1 28  ? 9.924   -1.731  3.720   1.00 0.00 ? 28  LYS A H    1  
ATOM 387   H HA   . LYS A 1 28  ? 9.565   -0.556  1.079   1.00 0.00 ? 28  LYS A HA   1  
ATOM 388   H HB2  . LYS A 1 28  ? 11.473  -2.611  2.187   1.00 0.00 ? 28  LYS A HB2  1  
ATOM 389   H HB3  . LYS A 1 28  ? 11.373  -2.251  0.469   1.00 0.00 ? 28  LYS A HB3  1  
ATOM 390   H HG2  . LYS A 1 28  ? 12.290  -0.163  0.710   1.00 0.00 ? 28  LYS A HG2  1  
ATOM 391   H HG3  . LYS A 1 28  ? 11.777  -0.014  2.392   1.00 0.00 ? 28  LYS A HG3  1  
ATOM 392   H HD2  . LYS A 1 28  ? 13.744  -2.137  1.695   1.00 0.00 ? 28  LYS A HD2  1  
ATOM 393   H HD3  . LYS A 1 28  ? 14.302  -0.463  1.751   1.00 0.00 ? 28  LYS A HD3  1  
ATOM 394   H HE2  . LYS A 1 28  ? 13.053  -0.435  4.047   1.00 0.00 ? 28  LYS A HE2  1  
ATOM 395   H HE3  . LYS A 1 28  ? 13.230  -2.186  3.943   1.00 0.00 ? 28  LYS A HE3  1  
ATOM 396   H HZ1  . LYS A 1 28  ? 15.074  -0.544  4.971   1.00 0.00 ? 28  LYS A HZ1  1  
ATOM 397   H HZ2  . LYS A 1 28  ? 15.635  -0.681  3.381   1.00 0.00 ? 28  LYS A HZ2  1  
ATOM 398   H HZ3  . LYS A 1 28  ? 15.421  -2.069  4.325   1.00 0.00 ? 28  LYS A HZ3  1  
ATOM 399   N N    . VAL A 1 29  ? 7.983   -2.205  0.143   1.00 0.00 ? 29  VAL A N    1  
ATOM 400   C CA   . VAL A 1 29  ? 7.076   -3.166  -0.474  1.00 0.00 ? 29  VAL A CA   1  
ATOM 401   C C    . VAL A 1 29  ? 7.685   -3.763  -1.737  1.00 0.00 ? 29  VAL A C    1  
ATOM 402   O O    . VAL A 1 29  ? 8.142   -3.039  -2.621  1.00 0.00 ? 29  VAL A O    1  
ATOM 403   C CB   . VAL A 1 29  ? 5.725   -2.516  -0.825  1.00 0.00 ? 29  VAL A CB   1  
ATOM 404   C CG1  . VAL A 1 29  ? 4.776   -3.545  -1.420  1.00 0.00 ? 29  VAL A CG1  1  
ATOM 405   C CG2  . VAL A 1 29  ? 5.112   -1.862  0.404   1.00 0.00 ? 29  VAL A CG2  1  
ATOM 406   H H    . VAL A 1 29  ? 7.942   -1.265  -0.132  1.00 0.00 ? 29  VAL A H    1  
ATOM 407   H HA   . VAL A 1 29  ? 6.896   -3.959  0.238   1.00 0.00 ? 29  VAL A HA   1  
ATOM 408   H HB   . VAL A 1 29  ? 5.899   -1.749  -1.566  1.00 0.00 ? 29  VAL A HB   1  
ATOM 409   H HG11 . VAL A 1 29  ? 4.998   -3.674  -2.470  1.00 0.00 ? 29  VAL A HG11 1  
ATOM 410   H HG12 . VAL A 1 29  ? 4.898   -4.488  -0.907  1.00 0.00 ? 29  VAL A HG12 1  
ATOM 411   H HG13 . VAL A 1 29  ? 3.758   -3.203  -1.308  1.00 0.00 ? 29  VAL A HG13 1  
ATOM 412   H HG21 . VAL A 1 29  ? 4.162   -2.327  0.622   1.00 0.00 ? 29  VAL A HG21 1  
ATOM 413   H HG22 . VAL A 1 29  ? 5.776   -1.987  1.248   1.00 0.00 ? 29  VAL A HG22 1  
ATOM 414   H HG23 . VAL A 1 29  ? 4.964   -0.809  0.217   1.00 0.00 ? 29  VAL A HG23 1  
ATOM 415   N N    . ALA A 1 30  ? 7.686   -5.090  -1.816  1.00 0.00 ? 30  ALA A N    1  
ATOM 416   C CA   . ALA A 1 30  ? 8.236   -5.786  -2.973  1.00 0.00 ? 30  ALA A CA   1  
ATOM 417   C C    . ALA A 1 30  ? 7.126   -6.372  -3.840  1.00 0.00 ? 30  ALA A C    1  
ATOM 418   O O    . ALA A 1 30  ? 6.177   -6.967  -3.331  1.00 0.00 ? 30  ALA A O    1  
ATOM 419   C CB   . ALA A 1 30  ? 9.192   -6.881  -2.525  1.00 0.00 ? 30  ALA A CB   1  
ATOM 420   H H    . ALA A 1 30  ? 7.307   -5.613  -1.079  1.00 0.00 ? 30  ALA A H    1  
ATOM 421   H HA   . ALA A 1 30  ? 8.796   -5.070  -3.558  1.00 0.00 ? 30  ALA A HA   1  
ATOM 422   H HB1  . ALA A 1 30  ? 10.208  -6.576  -2.728  1.00 0.00 ? 30  ALA A HB1  1  
ATOM 423   H HB2  . ALA A 1 30  ? 9.072   -7.052  -1.465  1.00 0.00 ? 30  ALA A HB2  1  
ATOM 424   H HB3  . ALA A 1 30  ? 8.975   -7.791  -3.064  1.00 0.00 ? 30  ALA A HB3  1  
ATOM 425   N N    . GLY A 1 31  ? 7.252   -6.198  -5.152  1.00 0.00 ? 31  GLY A N    1  
ATOM 426   C CA   . GLY A 1 31  ? 6.252   -6.715  -6.068  1.00 0.00 ? 31  GLY A CA   1  
ATOM 427   C C    . GLY A 1 31  ? 6.758   -6.792  -7.495  1.00 0.00 ? 31  GLY A C    1  
ATOM 428   O O    . GLY A 1 31  ? 6.667   -7.838  -8.136  1.00 0.00 ? 31  GLY A O    1  
ATOM 429   H H    . GLY A 1 31  ? 8.031   -5.716  -5.501  1.00 0.00 ? 31  GLY A H    1  
ATOM 430   H HA2  . GLY A 1 31  ? 5.962   -7.704  -5.746  1.00 0.00 ? 31  GLY A HA2  1  
ATOM 431   H HA3  . GLY A 1 31  ? 5.387   -6.070  -6.039  1.00 0.00 ? 31  GLY A HA3  1  
ATOM 432   N N    . GLN A 1 32  ? 7.290   -5.680  -7.993  1.00 0.00 ? 32  GLN A N    1  
ATOM 433   C CA   . GLN A 1 32  ? 7.809   -5.626  -9.354  1.00 0.00 ? 32  GLN A CA   1  
ATOM 434   C C    . GLN A 1 32  ? 9.027   -6.530  -9.509  1.00 0.00 ? 32  GLN A C    1  
ATOM 435   O O    . GLN A 1 32  ? 9.557   -7.048  -8.526  1.00 0.00 ? 32  GLN A O    1  
ATOM 436   C CB   . GLN A 1 32  ? 8.175   -4.188  -9.726  1.00 0.00 ? 32  GLN A CB   1  
ATOM 437   C CG   . GLN A 1 32  ? 8.030   -3.887  -11.209 1.00 0.00 ? 32  GLN A CG   1  
ATOM 438   C CD   . GLN A 1 32  ? 8.125   -2.405  -11.516 1.00 0.00 ? 32  GLN A CD   1  
ATOM 439   O OE1  . GLN A 1 32  ? 7.264   -1.620  -11.118 1.00 0.00 ? 32  GLN A OE1  1  
ATOM 440   N NE2  . GLN A 1 32  ? 9.176   -2.014  -12.227 1.00 0.00 ? 32  GLN A NE2  1  
ATOM 441   H H    . GLN A 1 32  ? 7.334   -4.878  -7.432  1.00 0.00 ? 32  GLN A H    1  
ATOM 442   H HA   . GLN A 1 32  ? 7.032   -5.973  -10.019 1.00 0.00 ? 32  GLN A HA   1  
ATOM 443   H HB2  . GLN A 1 32  ? 7.534   -3.513  -9.179  1.00 0.00 ? 32  GLN A HB2  1  
ATOM 444   H HB3  . GLN A 1 32  ? 9.201   -4.006  -9.443  1.00 0.00 ? 32  GLN A HB3  1  
ATOM 445   H HG2  . GLN A 1 32  ? 8.813   -4.401  -11.746 1.00 0.00 ? 32  GLN A HG2  1  
ATOM 446   H HG3  . GLN A 1 32  ? 7.069   -4.248  -11.544 1.00 0.00 ? 32  GLN A HG3  1  
ATOM 447   H HE21 . GLN A 1 32  ? 9.821   -2.696  -12.512 1.00 0.00 ? 32  GLN A HE21 1  
ATOM 448   H HE22 . GLN A 1 32  ? 9.262   -1.063  -12.441 1.00 0.00 ? 32  GLN A HE22 1  
ATOM 449   N N    . ASP A 1 33  ? 9.467   -6.715  -10.749 1.00 0.00 ? 33  ASP A N    1  
ATOM 450   C CA   . ASP A 1 33  ? 10.624  -7.556  -11.032 1.00 0.00 ? 33  ASP A CA   1  
ATOM 451   C C    . ASP A 1 33  ? 11.921  -6.772  -10.860 1.00 0.00 ? 33  ASP A C    1  
ATOM 452   O O    . ASP A 1 33  ? 12.928  -7.070  -11.500 1.00 0.00 ? 33  ASP A O    1  
ATOM 453   C CB   . ASP A 1 33  ? 10.537  -8.118  -12.452 1.00 0.00 ? 33  ASP A CB   1  
ATOM 454   C CG   . ASP A 1 33  ? 9.778   -9.429  -12.511 1.00 0.00 ? 33  ASP A CG   1  
ATOM 455   O OD1  . ASP A 1 33  ? 9.716   -10.125 -11.476 1.00 0.00 ? 33  ASP A OD1  1  
ATOM 456   O OD2  . ASP A 1 33  ? 9.247   -9.760  -13.592 1.00 0.00 ? 33  ASP A OD2  1  
ATOM 457   H H    . ASP A 1 33  ? 9.002   -6.275  -11.491 1.00 0.00 ? 33  ASP A H    1  
ATOM 458   H HA   . ASP A 1 33  ? 10.618  -8.376  -10.330 1.00 0.00 ? 33  ASP A HA   1  
ATOM 459   H HB2  . ASP A 1 33  ? 10.032  -7.403  -13.085 1.00 0.00 ? 33  ASP A HB2  1  
ATOM 460   H HB3  . ASP A 1 33  ? 11.536  -8.283  -12.828 1.00 0.00 ? 33  ASP A HB3  1  
ATOM 461   N N    . GLY A 1 34  ? 11.888  -5.765  -9.992  1.00 0.00 ? 34  GLY A N    1  
ATOM 462   C CA   . GLY A 1 34  ? 13.066  -4.953  -9.752  1.00 0.00 ? 34  GLY A CA   1  
ATOM 463   C C    . GLY A 1 34  ? 12.719  -3.538  -9.335  1.00 0.00 ? 34  GLY A C    1  
ATOM 464   O O    . GLY A 1 34  ? 13.438  -2.593  -9.662  1.00 0.00 ? 34  GLY A O    1  
ATOM 465   H H    . GLY A 1 34  ? 11.056  -5.573  -9.510  1.00 0.00 ? 34  GLY A H    1  
ATOM 466   H HA2  . GLY A 1 34  ? 13.655  -5.413  -8.973  1.00 0.00 ? 34  GLY A HA2  1  
ATOM 467   H HA3  . GLY A 1 34  ? 13.653  -4.915  -10.658 1.00 0.00 ? 34  GLY A HA3  1  
ATOM 468   N N    . SER A 1 35  ? 11.614  -3.390  -8.611  1.00 0.00 ? 35  SER A N    1  
ATOM 469   C CA   . SER A 1 35  ? 11.170  -2.078  -8.153  1.00 0.00 ? 35  SER A CA   1  
ATOM 470   C C    . SER A 1 35  ? 10.570  -2.167  -6.753  1.00 0.00 ? 35  SER A C    1  
ATOM 471   O O    . SER A 1 35  ? 9.667   -2.965  -6.501  1.00 0.00 ? 35  SER A O    1  
ATOM 472   C CB   . SER A 1 35  ? 10.143  -1.496  -9.125  1.00 0.00 ? 35  SER A CB   1  
ATOM 473   O OG   . SER A 1 35  ? 10.165  -0.079  -9.103  1.00 0.00 ? 35  SER A OG   1  
ATOM 474   H H    . SER A 1 35  ? 11.083  -4.181  -8.383  1.00 0.00 ? 35  SER A H    1  
ATOM 475   H HA   . SER A 1 35  ? 12.032  -1.429  -8.122  1.00 0.00 ? 35  SER A HA   1  
ATOM 476   H HB2  . SER A 1 35  ? 10.367  -1.832  -10.126 1.00 0.00 ? 35  SER A HB2  1  
ATOM 477   H HB3  . SER A 1 35  ? 9.155   -1.833  -8.845  1.00 0.00 ? 35  SER A HB3  1  
ATOM 478   H HG   . SER A 1 35  ? 9.265   0.255   -9.098  1.00 0.00 ? 35  SER A HG   1  
ATOM 479   N N    . VAL A 1 36  ? 11.079  -1.340  -5.845  1.00 0.00 ? 36  VAL A N    1  
ATOM 480   C CA   . VAL A 1 36  ? 10.594  -1.323  -4.470  1.00 0.00 ? 36  VAL A CA   1  
ATOM 481   C C    . VAL A 1 36  ? 9.915   0.003   -4.144  1.00 0.00 ? 36  VAL A C    1  
ATOM 482   O O    . VAL A 1 36  ? 10.457  1.074   -4.416  1.00 0.00 ? 36  VAL A O    1  
ATOM 483   C CB   . VAL A 1 36  ? 11.739  -1.561  -3.468  1.00 0.00 ? 36  VAL A CB   1  
ATOM 484   C CG1  . VAL A 1 36  ? 11.220  -1.495  -2.039  1.00 0.00 ? 36  VAL A CG1  1  
ATOM 485   C CG2  . VAL A 1 36  ? 12.413  -2.898  -3.738  1.00 0.00 ? 36  VAL A CG2  1  
ATOM 486   H H    . VAL A 1 36  ? 11.797  -0.727  -6.106  1.00 0.00 ? 36  VAL A H    1  
ATOM 487   H HA   . VAL A 1 36  ? 9.874   -2.121  -4.360  1.00 0.00 ? 36  VAL A HA   1  
ATOM 488   H HB   . VAL A 1 36  ? 12.472  -0.779  -3.597  1.00 0.00 ? 36  VAL A HB   1  
ATOM 489   H HG11 . VAL A 1 36  ? 11.138  -2.495  -1.640  1.00 0.00 ? 36  VAL A HG11 1  
ATOM 490   H HG12 . VAL A 1 36  ? 11.905  -0.920  -1.434  1.00 0.00 ? 36  VAL A HG12 1  
ATOM 491   H HG13 . VAL A 1 36  ? 10.248  -1.024  -2.031  1.00 0.00 ? 36  VAL A HG13 1  
ATOM 492   H HG21 . VAL A 1 36  ? 13.483  -2.784  -3.651  1.00 0.00 ? 36  VAL A HG21 1  
ATOM 493   H HG22 . VAL A 1 36  ? 12.069  -3.627  -3.018  1.00 0.00 ? 36  VAL A HG22 1  
ATOM 494   H HG23 . VAL A 1 36  ? 12.165  -3.232  -4.734  1.00 0.00 ? 36  VAL A HG23 1  
ATOM 495   N N    . VAL A 1 37  ? 8.724   -0.077  -3.558  1.00 0.00 ? 37  VAL A N    1  
ATOM 496   C CA   . VAL A 1 37  ? 7.971   1.117   -3.193  1.00 0.00 ? 37  VAL A CA   1  
ATOM 497   C C    . VAL A 1 37  ? 7.960   1.318   -1.681  1.00 0.00 ? 37  VAL A C    1  
ATOM 498   O O    . VAL A 1 37  ? 7.522   0.445   -0.933  1.00 0.00 ? 37  VAL A O    1  
ATOM 499   C CB   . VAL A 1 37  ? 6.519   1.041   -3.700  1.00 0.00 ? 37  VAL A CB   1  
ATOM 500   C CG1  . VAL A 1 37  ? 5.881   2.422   -3.704  1.00 0.00 ? 37  VAL A CG1  1  
ATOM 501   C CG2  . VAL A 1 37  ? 6.471   0.419   -5.088  1.00 0.00 ? 37  VAL A CG2  1  
ATOM 502   H H    . VAL A 1 37  ? 8.344   -0.959  -3.367  1.00 0.00 ? 37  VAL A H    1  
ATOM 503   H HA   . VAL A 1 37  ? 8.448   1.968   -3.656  1.00 0.00 ? 37  VAL A HA   1  
ATOM 504   H HB   . VAL A 1 37  ? 5.956   0.411   -3.027  1.00 0.00 ? 37  VAL A HB   1  
ATOM 505   H HG11 . VAL A 1 37  ? 6.312   3.015   -4.498  1.00 0.00 ? 37  VAL A HG11 1  
ATOM 506   H HG12 . VAL A 1 37  ? 4.817   2.328   -3.861  1.00 0.00 ? 37  VAL A HG12 1  
ATOM 507   H HG13 . VAL A 1 37  ? 6.064   2.906   -2.755  1.00 0.00 ? 37  VAL A HG13 1  
ATOM 508   H HG21 . VAL A 1 37  ? 7.201   0.900   -5.722  1.00 0.00 ? 37  VAL A HG21 1  
ATOM 509   H HG22 . VAL A 1 37  ? 6.694   -0.636  -5.018  1.00 0.00 ? 37  VAL A HG22 1  
ATOM 510   H HG23 . VAL A 1 37  ? 5.486   0.551   -5.508  1.00 0.00 ? 37  VAL A HG23 1  
ATOM 511   N N    . GLN A 1 38  ? 8.443   2.475   -1.240  1.00 0.00 ? 38  GLN A N    1  
ATOM 512   C CA   . GLN A 1 38  ? 8.488   2.791   0.182   1.00 0.00 ? 38  GLN A CA   1  
ATOM 513   C C    . GLN A 1 38  ? 7.211   3.498   0.624   1.00 0.00 ? 38  GLN A C    1  
ATOM 514   O O    . GLN A 1 38  ? 6.468   4.031   -0.200  1.00 0.00 ? 38  GLN A O    1  
ATOM 515   C CB   . GLN A 1 38  ? 9.704   3.666   0.493   1.00 0.00 ? 38  GLN A CB   1  
ATOM 516   C CG   . GLN A 1 38  ? 11.009  2.890   0.566   1.00 0.00 ? 38  GLN A CG   1  
ATOM 517   C CD   . GLN A 1 38  ? 12.216  3.746   0.233   1.00 0.00 ? 38  GLN A CD   1  
ATOM 518   O OE1  . GLN A 1 38  ? 12.317  4.297   -0.863  1.00 0.00 ? 38  GLN A OE1  1  
ATOM 519   N NE2  . GLN A 1 38  ? 13.139  3.862   1.181   1.00 0.00 ? 38  GLN A NE2  1  
ATOM 520   H H    . GLN A 1 38  ? 8.777   3.131   -1.887  1.00 0.00 ? 38  GLN A H    1  
ATOM 521   H HA   . GLN A 1 38  ? 8.577   1.862   0.725   1.00 0.00 ? 38  GLN A HA   1  
ATOM 522   H HB2  . GLN A 1 38  ? 9.798   4.417   -0.276  1.00 0.00 ? 38  GLN A HB2  1  
ATOM 523   H HB3  . GLN A 1 38  ? 9.547   4.154   1.444   1.00 0.00 ? 38  GLN A HB3  1  
ATOM 524   H HG2  . GLN A 1 38  ? 11.128  2.503   1.567   1.00 0.00 ? 38  GLN A HG2  1  
ATOM 525   H HG3  . GLN A 1 38  ? 10.964  2.069   -0.134  1.00 0.00 ? 38  GLN A HG3  1  
ATOM 526   H HE21 . GLN A 1 38  ? 12.992  3.394   2.029   1.00 0.00 ? 38  GLN A HE21 1  
ATOM 527   H HE22 . GLN A 1 38  ? 13.929  4.409   0.992   1.00 0.00 ? 38  GLN A HE22 1  
ATOM 528   N N    . PHE A 1 39  ? 6.962   3.498   1.930   1.00 0.00 ? 39  PHE A N    1  
ATOM 529   C CA   . PHE A 1 39  ? 5.774   4.139   2.481   1.00 0.00 ? 39  PHE A CA   1  
ATOM 530   C C    . PHE A 1 39  ? 6.027   4.619   3.907   1.00 0.00 ? 39  PHE A C    1  
ATOM 531   O O    . PHE A 1 39  ? 6.436   3.844   4.772   1.00 0.00 ? 39  PHE A O    1  
ATOM 532   C CB   . PHE A 1 39  ? 4.590   3.170   2.460   1.00 0.00 ? 39  PHE A CB   1  
ATOM 533   C CG   . PHE A 1 39  ? 4.117   2.832   1.075   1.00 0.00 ? 39  PHE A CG   1  
ATOM 534   C CD1  . PHE A 1 39  ? 4.653   1.754   0.389   1.00 0.00 ? 39  PHE A CD1  1  
ATOM 535   C CD2  . PHE A 1 39  ? 3.135   3.592   0.459   1.00 0.00 ? 39  PHE A CD2  1  
ATOM 536   C CE1  . PHE A 1 39  ? 4.220   1.442   -0.886  1.00 0.00 ? 39  PHE A CE1  1  
ATOM 537   C CE2  . PHE A 1 39  ? 2.697   3.284   -0.815  1.00 0.00 ? 39  PHE A CE2  1  
ATOM 538   C CZ   . PHE A 1 39  ? 3.240   2.207   -1.488  1.00 0.00 ? 39  PHE A CZ   1  
ATOM 539   H H    . PHE A 1 39  ? 7.593   3.056   2.536   1.00 0.00 ? 39  PHE A H    1  
ATOM 540   H HA   . PHE A 1 39  ? 5.541   4.992   1.863   1.00 0.00 ? 39  PHE A HA   1  
ATOM 541   H HB2  . PHE A 1 39  ? 4.879   2.249   2.945   1.00 0.00 ? 39  PHE A HB2  1  
ATOM 542   H HB3  . PHE A 1 39  ? 3.764   3.611   2.996   1.00 0.00 ? 39  PHE A HB3  1  
ATOM 543   H HD1  . PHE A 1 39  ? 5.419   1.154   0.859   1.00 0.00 ? 39  PHE A HD1  1  
ATOM 544   H HD2  . PHE A 1 39  ? 2.710   4.435   0.986   1.00 0.00 ? 39  PHE A HD2  1  
ATOM 545   H HE1  . PHE A 1 39  ? 4.645   0.599   -1.410  1.00 0.00 ? 39  PHE A HE1  1  
ATOM 546   H HE2  . PHE A 1 39  ? 1.931   3.884   -1.283  1.00 0.00 ? 39  PHE A HE2  1  
ATOM 547   H HZ   . PHE A 1 39  ? 2.900   1.965   -2.484  1.00 0.00 ? 39  PHE A HZ   1  
ATOM 548   N N    . LYS A 1 40  ? 5.783   5.903   4.145   1.00 0.00 ? 40  LYS A N    1  
ATOM 549   C CA   . LYS A 1 40  ? 5.983   6.489   5.465   1.00 0.00 ? 40  LYS A CA   1  
ATOM 550   C C    . LYS A 1 40  ? 4.647   6.726   6.163   1.00 0.00 ? 40  LYS A C    1  
ATOM 551   O O    . LYS A 1 40  ? 3.861   7.576   5.746   1.00 0.00 ? 40  LYS A O    1  
ATOM 552   C CB   . LYS A 1 40  ? 6.751   7.807   5.349   1.00 0.00 ? 40  LYS A CB   1  
ATOM 553   C CG   . LYS A 1 40  ? 6.965   8.505   6.681   1.00 0.00 ? 40  LYS A CG   1  
ATOM 554   C CD   . LYS A 1 40  ? 7.103   10.008  6.507   1.00 0.00 ? 40  LYS A CD   1  
ATOM 555   C CE   . LYS A 1 40  ? 8.432   10.376  5.866   1.00 0.00 ? 40  LYS A CE   1  
ATOM 556   N NZ   . LYS A 1 40  ? 9.587   9.994   6.725   1.00 0.00 ? 40  LYS A NZ   1  
ATOM 557   H H    . LYS A 1 40  ? 5.459   6.471   3.414   1.00 0.00 ? 40  LYS A H    1  
ATOM 558   H HA   . LYS A 1 40  ? 6.564   5.794   6.052   1.00 0.00 ? 40  LYS A HA   1  
ATOM 559   H HB2  . LYS A 1 40  ? 7.718   7.610   4.910   1.00 0.00 ? 40  LYS A HB2  1  
ATOM 560   H HB3  . LYS A 1 40  ? 6.201   8.475   4.702   1.00 0.00 ? 40  LYS A HB3  1  
ATOM 561   H HG2  . LYS A 1 40  ? 6.120   8.304   7.323   1.00 0.00 ? 40  LYS A HG2  1  
ATOM 562   H HG3  . LYS A 1 40  ? 7.866   8.121   7.138   1.00 0.00 ? 40  LYS A HG3  1  
ATOM 563   H HD2  . LYS A 1 40  ? 6.302   10.364  5.877   1.00 0.00 ? 40  LYS A HD2  1  
ATOM 564   H HD3  . LYS A 1 40  ? 7.038   10.482  7.477   1.00 0.00 ? 40  LYS A HD3  1  
ATOM 565   H HE2  . LYS A 1 40  ? 8.514   9.864   4.920   1.00 0.00 ? 40  LYS A HE2  1  
ATOM 566   H HE3  . LYS A 1 40  ? 8.454   11.443  5.701   1.00 0.00 ? 40  LYS A HE3  1  
ATOM 567   H HZ1  . LYS A 1 40  ? 9.839   8.998   6.563   1.00 0.00 ? 40  LYS A HZ1  1  
ATOM 568   H HZ2  . LYS A 1 40  ? 9.343   10.119  7.728   1.00 0.00 ? 40  LYS A HZ2  1  
ATOM 569   H HZ3  . LYS A 1 40  ? 10.410  10.589  6.503   1.00 0.00 ? 40  LYS A HZ3  1  
ATOM 570   N N    . ILE A 1 41  ? 4.399   5.970   7.227   1.00 0.00 ? 41  ILE A N    1  
ATOM 571   C CA   . ILE A 1 41  ? 3.160   6.101   7.984   1.00 0.00 ? 41  ILE A CA   1  
ATOM 572   C C    . ILE A 1 41  ? 3.434   6.144   9.484   1.00 0.00 ? 41  ILE A C    1  
ATOM 573   O O    . ILE A 1 41  ? 4.582   6.064   9.919   1.00 0.00 ? 41  ILE A O    1  
ATOM 574   C CB   . ILE A 1 41  ? 2.192   4.941   7.684   1.00 0.00 ? 41  ILE A CB   1  
ATOM 575   C CG1  . ILE A 1 41  ? 2.692   3.649   8.334   1.00 0.00 ? 41  ILE A CG1  1  
ATOM 576   C CG2  . ILE A 1 41  ? 2.035   4.758   6.182   1.00 0.00 ? 41  ILE A CG2  1  
ATOM 577   C CD1  . ILE A 1 41  ? 1.758   2.475   8.141   1.00 0.00 ? 41  ILE A CD1  1  
ATOM 578   H H    . ILE A 1 41  ? 5.065   5.310   7.511   1.00 0.00 ? 41  ILE A H    1  
ATOM 579   H HA   . ILE A 1 41  ? 2.685   7.025   7.688   1.00 0.00 ? 41  ILE A HA   1  
ATOM 580   H HB   . ILE A 1 41  ? 1.226   5.192   8.095   1.00 0.00 ? 41  ILE A HB   1  
ATOM 581   H HG12 . ILE A 1 41  ? 3.648   3.386   7.908   1.00 0.00 ? 41  ILE A HG12 1  
ATOM 582   H HG13 . ILE A 1 41  ? 2.808   3.811   9.396   1.00 0.00 ? 41  ILE A HG13 1  
ATOM 583   H HG21 . ILE A 1 41  ? 1.385   5.528   5.792   1.00 0.00 ? 41  ILE A HG21 1  
ATOM 584   H HG22 . ILE A 1 41  ? 3.002   4.830   5.707   1.00 0.00 ? 41  ILE A HG22 1  
ATOM 585   H HG23 . ILE A 1 41  ? 1.605   3.789   5.980   1.00 0.00 ? 41  ILE A HG23 1  
ATOM 586   H HD11 . ILE A 1 41  ? 0.749   2.773   8.384   1.00 0.00 ? 41  ILE A HD11 1  
ATOM 587   H HD12 . ILE A 1 41  ? 1.800   2.146   7.114   1.00 0.00 ? 41  ILE A HD12 1  
ATOM 588   H HD13 . ILE A 1 41  ? 2.059   1.666   8.791   1.00 0.00 ? 41  ILE A HD13 1  
ATOM 589   N N    . LYS A 1 42  ? 2.370   6.271   10.270  1.00 0.00 ? 42  LYS A N    1  
ATOM 590   C CA   . LYS A 1 42  ? 2.493   6.322   11.722  1.00 0.00 ? 42  LYS A CA   1  
ATOM 591   C C    . LYS A 1 42  ? 2.302   4.938   12.333  1.00 0.00 ? 42  LYS A C    1  
ATOM 592   O O    . LYS A 1 42  ? 1.704   4.055   11.718  1.00 0.00 ? 42  LYS A O    1  
ATOM 593   C CB   . LYS A 1 42  ? 1.468   7.296   12.307  1.00 0.00 ? 42  LYS A CB   1  
ATOM 594   C CG   . LYS A 1 42  ? 1.421   8.634   11.589  1.00 0.00 ? 42  LYS A CG   1  
ATOM 595   C CD   . LYS A 1 42  ? 0.128   9.377   11.880  1.00 0.00 ? 42  LYS A CD   1  
ATOM 596   C CE   . LYS A 1 42  ? -0.134  10.463  10.848  1.00 0.00 ? 42  LYS A CE   1  
ATOM 597   N NZ   . LYS A 1 42  ? -0.484  9.892   9.518   1.00 0.00 ? 42  LYS A NZ   1  
ATOM 598   H H    . LYS A 1 42  ? 1.480   6.330   9.863   1.00 0.00 ? 42  LYS A H    1  
ATOM 599   H HA   . LYS A 1 42  ? 3.487   6.673   11.958  1.00 0.00 ? 42  LYS A HA   1  
ATOM 600   H HB2  . LYS A 1 42  ? 0.488   6.846   12.251  1.00 0.00 ? 42  LYS A HB2  1  
ATOM 601   H HB3  . LYS A 1 42  ? 1.713   7.477   13.344  1.00 0.00 ? 42  LYS A HB3  1  
ATOM 602   H HG2  . LYS A 1 42  ? 2.253   9.238   11.917  1.00 0.00 ? 42  LYS A HG2  1  
ATOM 603   H HG3  . LYS A 1 42  ? 1.496   8.463   10.524  1.00 0.00 ? 42  LYS A HG3  1  
ATOM 604   H HD2  . LYS A 1 42  ? -0.692  8.675   11.863  1.00 0.00 ? 42  LYS A HD2  1  
ATOM 605   H HD3  . LYS A 1 42  ? 0.197   9.831   12.858  1.00 0.00 ? 42  LYS A HD3  1  
ATOM 606   H HE2  . LYS A 1 42  ? -0.952  11.078  11.191  1.00 0.00 ? 42  LYS A HE2  1  
ATOM 607   H HE3  . LYS A 1 42  ? 0.755   11.069  10.748  1.00 0.00 ? 42  LYS A HE3  1  
ATOM 608   H HZ1  . LYS A 1 42  ? -1.281  9.231   9.611   1.00 0.00 ? 42  LYS A HZ1  1  
ATOM 609   H HZ2  . LYS A 1 42  ? 0.331   9.380   9.123   1.00 0.00 ? 42  LYS A HZ2  1  
ATOM 610   H HZ3  . LYS A 1 42  ? -0.752  10.652  8.861   1.00 0.00 ? 42  LYS A HZ3  1  
ATOM 611   N N    . ARG A 1 43  ? 2.812   4.756   13.547  1.00 0.00 ? 43  ARG A N    1  
ATOM 612   C CA   . ARG A 1 43  ? 2.696   3.479   14.241  1.00 0.00 ? 43  ARG A CA   1  
ATOM 613   C C    . ARG A 1 43  ? 1.266   3.249   14.721  1.00 0.00 ? 43  ARG A C    1  
ATOM 614   O O    . ARG A 1 43  ? 0.876   2.121   15.025  1.00 0.00 ? 43  ARG A O    1  
ATOM 615   C CB   . ARG A 1 43  ? 3.658   3.432   15.430  1.00 0.00 ? 43  ARG A CB   1  
ATOM 616   C CG   . ARG A 1 43  ? 3.379   4.492   16.482  1.00 0.00 ? 43  ARG A CG   1  
ATOM 617   C CD   . ARG A 1 43  ? 4.638   4.858   17.252  1.00 0.00 ? 43  ARG A CD   1  
ATOM 618   N NE   . ARG A 1 43  ? 5.366   5.955   16.622  1.00 0.00 ? 43  ARG A NE   1  
ATOM 619   C CZ   . ARG A 1 43  ? 6.401   6.570   17.184  1.00 0.00 ? 43  ARG A CZ   1  
ATOM 620   N NH1  . ARG A 1 43  ? 6.827   6.197   18.382  1.00 0.00 ? 43  ARG A NH1  1  
ATOM 621   N NH2  . ARG A 1 43  ? 7.011   7.561   16.547  1.00 0.00 ? 43  ARG A NH2  1  
ATOM 622   H H    . ARG A 1 43  ? 3.278   5.498   13.986  1.00 0.00 ? 43  ARG A H    1  
ATOM 623   H HA   . ARG A 1 43  ? 2.959   2.698   13.545  1.00 0.00 ? 43  ARG A HA   1  
ATOM 624   H HB2  . ARG A 1 43  ? 3.585   2.462   15.899  1.00 0.00 ? 43  ARG A HB2  1  
ATOM 625   H HB3  . ARG A 1 43  ? 4.665   3.572   15.067  1.00 0.00 ? 43  ARG A HB3  1  
ATOM 626   H HG2  . ARG A 1 43  ? 2.998   5.378   15.996  1.00 0.00 ? 43  ARG A HG2  1  
ATOM 627   H HG3  . ARG A 1 43  ? 2.641   4.113   17.174  1.00 0.00 ? 43  ARG A HG3  1  
ATOM 628   H HD2  . ARG A 1 43  ? 4.359   5.152   18.253  1.00 0.00 ? 43  ARG A HD2  1  
ATOM 629   H HD3  . ARG A 1 43  ? 5.280   3.991   17.298  1.00 0.00 ? 43  ARG A HD3  1  
ATOM 630   H HE   . ARG A 1 43  ? 5.068   6.248   15.735  1.00 0.00 ? 43  ARG A HE   1  
ATOM 631   H HH11 . ARG A 1 43  ? 6.369   5.450   18.864  1.00 0.00 ? 43  ARG A HH11 1  
ATOM 632   H HH12 . ARG A 1 43  ? 7.607   6.661   18.803  1.00 0.00 ? 43  ARG A HH12 1  
ATOM 633   H HH21 . ARG A 1 43  ? 6.693   7.845   15.643  1.00 0.00 ? 43  ARG A HH21 1  
ATOM 634   H HH22 . ARG A 1 43  ? 7.790   8.023   16.971  1.00 0.00 ? 43  ARG A HH22 1  
ATOM 635   N N    . HIS A 1 44  ? 0.489   4.326   14.788  1.00 0.00 ? 44  HIS A N    1  
ATOM 636   C CA   . HIS A 1 44  ? -0.898  4.241   15.231  1.00 0.00 ? 44  HIS A CA   1  
ATOM 637   C C    . HIS A 1 44  ? -1.855  4.541   14.081  1.00 0.00 ? 44  HIS A C    1  
ATOM 638   O O    . HIS A 1 44  ? -2.910  5.145   14.278  1.00 0.00 ? 44  HIS A O    1  
ATOM 639   C CB   . HIS A 1 44  ? -1.148  5.214   16.384  1.00 0.00 ? 44  HIS A CB   1  
ATOM 640   C CG   . HIS A 1 44  ? -0.568  6.576   16.154  1.00 0.00 ? 44  HIS A CG   1  
ATOM 641   N ND1  . HIS A 1 44  ? -0.162  7.404   17.180  1.00 0.00 ? 44  HIS A ND1  1  
ATOM 642   C CD2  . HIS A 1 44  ? -0.324  7.253   15.008  1.00 0.00 ? 44  HIS A CD2  1  
ATOM 643   C CE1  . HIS A 1 44  ? 0.303   8.532   16.674  1.00 0.00 ? 44  HIS A CE1  1  
ATOM 644   N NE2  . HIS A 1 44  ? 0.217   8.465   15.358  1.00 0.00 ? 44  HIS A NE2  1  
ATOM 645   H H    . HIS A 1 44  ? 0.857   5.197   14.532  1.00 0.00 ? 44  HIS A H    1  
ATOM 646   H HA   . HIS A 1 44  ? -1.075  3.234   15.576  1.00 0.00 ? 44  HIS A HA   1  
ATOM 647   H HB2  . HIS A 1 44  ? -2.212  5.327   16.527  1.00 0.00 ? 44  HIS A HB2  1  
ATOM 648   H HB3  . HIS A 1 44  ? -0.708  4.813   17.286  1.00 0.00 ? 44  HIS A HB3  1  
ATOM 649   H HD1  . HIS A 1 44  ? -0.211  7.196   18.136  1.00 0.00 ? 44  HIS A HD1  1  
ATOM 650   H HD2  . HIS A 1 44  ? -0.520  6.905   14.003  1.00 0.00 ? 44  HIS A HD2  1  
ATOM 651   H HE1  . HIS A 1 44  ? 0.690   9.366   17.240  1.00 0.00 ? 44  HIS A HE1  1  
ATOM 652   H HE2  . HIS A 1 44  ? 0.414   9.201   14.742  1.00 0.00 ? 44  HIS A HE2  1  
ATOM 653   N N    . THR A 1 45  ? -1.480  4.115   12.878  1.00 0.00 ? 45  THR A N    1  
ATOM 654   C CA   . THR A 1 45  ? -2.303  4.340   11.697  1.00 0.00 ? 45  THR A CA   1  
ATOM 655   C C    . THR A 1 45  ? -2.543  3.039   10.939  1.00 0.00 ? 45  THR A C    1  
ATOM 656   O O    . THR A 1 45  ? -1.639  2.225   10.753  1.00 0.00 ? 45  THR A O    1  
ATOM 657   C CB   . THR A 1 45  ? -1.653  5.362   10.745  1.00 0.00 ? 45  THR A CB   1  
ATOM 658   O OG1  . THR A 1 45  ? -1.576  6.643   11.381  1.00 0.00 ? 45  THR A OG1  1  
ATOM 659   C CG2  . THR A 1 45  ? -2.447  5.478   9.453   1.00 0.00 ? 45  THR A CG2  1  
ATOM 660   H H    . THR A 1 45  ? -0.628  3.640   12.785  1.00 0.00 ? 45  THR A H    1  
ATOM 661   H HA   . THR A 1 45  ? -3.253  4.736   12.023  1.00 0.00 ? 45  THR A HA   1  
ATOM 662   H HB   . THR A 1 45  ? -0.654  5.025   10.508  1.00 0.00 ? 45  THR A HB   1  
ATOM 663   H HG1  . THR A 1 45  ? -2.297  6.732   12.009  1.00 0.00 ? 45  THR A HG1  1  
ATOM 664   H HG21 . THR A 1 45  ? -2.728  4.493   9.113   1.00 0.00 ? 45  THR A HG21 1  
ATOM 665   H HG22 . THR A 1 45  ? -1.840  5.960   8.700   1.00 0.00 ? 45  THR A HG22 1  
ATOM 666   H HG23 . THR A 1 45  ? -3.336  6.065   9.629   1.00 0.00 ? 45  THR A HG23 1  
ATOM 667   N N    . PRO A 1 46  ? -3.791  2.836   10.491  1.00 0.00 ? 46  PRO A N    1  
ATOM 668   C CA   . PRO A 1 46  ? -4.179  1.635   9.745   1.00 0.00 ? 46  PRO A CA   1  
ATOM 669   C C    . PRO A 1 46  ? -3.566  1.597   8.349   1.00 0.00 ? 46  PRO A C    1  
ATOM 670   O O    . PRO A 1 46  ? -3.670  2.559   7.588   1.00 0.00 ? 46  PRO A O    1  
ATOM 671   C CB   . PRO A 1 46  ? -5.703  1.749   9.657   1.00 0.00 ? 46  PRO A CB   1  
ATOM 672   C CG   . PRO A 1 46  ? -5.981  3.209   9.769   1.00 0.00 ? 46  PRO A CG   1  
ATOM 673   C CD   . PRO A 1 46  ? -4.919  3.764   10.677  1.00 0.00 ? 46  PRO A CD   1  
ATOM 674   H HA   . PRO A 1 46  ? -3.914  0.734   10.278  1.00 0.00 ? 46  PRO A HA   1  
ATOM 675   H HB2  . PRO A 1 46  ? -6.042  1.353   8.711   1.00 0.00 ? 46  PRO A HB2  1  
ATOM 676   H HB3  . PRO A 1 46  ? -6.156  1.198   10.468  1.00 0.00 ? 46  PRO A HB3  1  
ATOM 677   H HG2  . PRO A 1 46  ? -5.920  3.670   8.795   1.00 0.00 ? 46  PRO A HG2  1  
ATOM 678   H HG3  . PRO A 1 46  ? -6.960  3.364   10.198  1.00 0.00 ? 46  PRO A HG3  1  
ATOM 679   H HD2  . PRO A 1 46  ? -4.649  4.765   10.375  1.00 0.00 ? 46  PRO A HD2  1  
ATOM 680   H HD3  . PRO A 1 46  ? -5.258  3.756   11.703  1.00 0.00 ? 46  PRO A HD3  1  
ATOM 681   N N    . LEU A 1 47  ? -2.929  0.479   8.019   1.00 0.00 ? 47  LEU A N    1  
ATOM 682   C CA   . LEU A 1 47  ? -2.299  0.315   6.713   1.00 0.00 ? 47  LEU A CA   1  
ATOM 683   C C    . LEU A 1 47  ? -3.252  0.723   5.594   1.00 0.00 ? 47  LEU A C    1  
ATOM 684   O O    . LEU A 1 47  ? -2.826  1.001   4.473   1.00 0.00 ? 47  LEU A O    1  
ATOM 685   C CB   . LEU A 1 47  ? -1.856  -1.136  6.518   1.00 0.00 ? 47  LEU A CB   1  
ATOM 686   C CG   . LEU A 1 47  ? -0.920  -1.702  7.586   1.00 0.00 ? 47  LEU A CG   1  
ATOM 687   C CD1  . LEU A 1 47  ? -0.702  -3.191  7.371   1.00 0.00 ? 47  LEU A CD1  1  
ATOM 688   C CD2  . LEU A 1 47  ? 0.408   -0.960  7.579   1.00 0.00 ? 47  LEU A CD2  1  
ATOM 689   H H    . LEU A 1 47  ? -2.879  -0.253  8.668   1.00 0.00 ? 47  LEU A H    1  
ATOM 690   H HA   . LEU A 1 47  ? -1.431  0.956   6.681   1.00 0.00 ? 47  LEU A HA   1  
ATOM 691   H HB2  . LEU A 1 47  ? -2.742  -1.752  6.495   1.00 0.00 ? 47  LEU A HB2  1  
ATOM 692   H HB3  . LEU A 1 47  ? -1.350  -1.201  5.565   1.00 0.00 ? 47  LEU A HB3  1  
ATOM 693   H HG   . LEU A 1 47  ? -1.373  -1.569  8.559   1.00 0.00 ? 47  LEU A HG   1  
ATOM 694   H HD11 . LEU A 1 47  ? -0.004  -3.563  8.106   1.00 0.00 ? 47  LEU A HD11 1  
ATOM 695   H HD12 . LEU A 1 47  ? -0.304  -3.357  6.380   1.00 0.00 ? 47  LEU A HD12 1  
ATOM 696   H HD13 . LEU A 1 47  ? -1.643  -3.711  7.471   1.00 0.00 ? 47  LEU A HD13 1  
ATOM 697   H HD21 . LEU A 1 47  ? 1.193   -1.630  7.261   1.00 0.00 ? 47  LEU A HD21 1  
ATOM 698   H HD22 . LEU A 1 47  ? 0.625   -0.599  8.574   1.00 0.00 ? 47  LEU A HD22 1  
ATOM 699   H HD23 . LEU A 1 47  ? 0.350   -0.124  6.897   1.00 0.00 ? 47  LEU A HD23 1  
ATOM 700   N N    . SER A 1 48  ? -4.544  0.758   5.907   1.00 0.00 ? 48  SER A N    1  
ATOM 701   C CA   . SER A 1 48  ? -5.557  1.131   4.928   1.00 0.00 ? 48  SER A CA   1  
ATOM 702   C C    . SER A 1 48  ? -5.026  2.196   3.973   1.00 0.00 ? 48  SER A C    1  
ATOM 703   O O    . SER A 1 48  ? -4.991  1.996   2.759   1.00 0.00 ? 48  SER A O    1  
ATOM 704   C CB   . SER A 1 48  ? -6.814  1.644   5.633   1.00 0.00 ? 48  SER A CB   1  
ATOM 705   O OG   . SER A 1 48  ? -6.533  2.805   6.395   1.00 0.00 ? 48  SER A OG   1  
ATOM 706   H H    . SER A 1 48  ? -4.821  0.526   6.818   1.00 0.00 ? 48  SER A H    1  
ATOM 707   H HA   . SER A 1 48  ? -5.809  0.248   4.359   1.00 0.00 ? 48  SER A HA   1  
ATOM 708   H HB2  . SER A 1 48  ? -7.565  1.885   4.896   1.00 0.00 ? 48  SER A HB2  1  
ATOM 709   H HB3  . SER A 1 48  ? -7.192  0.877   6.294   1.00 0.00 ? 48  SER A HB3  1  
ATOM 710   H HG   . SER A 1 48  ? -7.355  3.196   6.699   1.00 0.00 ? 48  SER A HG   1  
ATOM 711   N N    . LYS A 1 49  ? -4.612  3.328   4.532   1.00 0.00 ? 49  LYS A N    1  
ATOM 712   C CA   . LYS A 1 49  ? -4.080  4.426   3.733   1.00 0.00 ? 49  LYS A CA   1  
ATOM 713   C C    . LYS A 1 49  ? -2.868  3.973   2.925   1.00 0.00 ? 49  LYS A C    1  
ATOM 714   O O    . LYS A 1 49  ? -2.780  4.228   1.723   1.00 0.00 ? 49  LYS A O    1  
ATOM 715   C CB   . LYS A 1 49  ? -3.694  5.600   4.636   1.00 0.00 ? 49  LYS A CB   1  
ATOM 716   C CG   . LYS A 1 49  ? -4.844  6.551   4.920   1.00 0.00 ? 49  LYS A CG   1  
ATOM 717   C CD   . LYS A 1 49  ? -5.616  6.138   6.161   1.00 0.00 ? 49  LYS A CD   1  
ATOM 718   C CE   . LYS A 1 49  ? -4.881  6.536   7.433   1.00 0.00 ? 49  LYS A CE   1  
ATOM 719   N NZ   . LYS A 1 49  ? -5.111  7.965   7.782   1.00 0.00 ? 49  LYS A NZ   1  
ATOM 720   H H    . LYS A 1 49  ? -4.664  3.427   5.506   1.00 0.00 ? 49  LYS A H    1  
ATOM 721   H HA   . LYS A 1 49  ? -4.853  4.745   3.051   1.00 0.00 ? 49  LYS A HA   1  
ATOM 722   H HB2  . LYS A 1 49  ? -3.334  5.212   5.577   1.00 0.00 ? 49  LYS A HB2  1  
ATOM 723   H HB3  . LYS A 1 49  ? -2.902  6.159   4.160   1.00 0.00 ? 49  LYS A HB3  1  
ATOM 724   H HG2  . LYS A 1 49  ? -4.448  7.545   5.069   1.00 0.00 ? 49  LYS A HG2  1  
ATOM 725   H HG3  . LYS A 1 49  ? -5.516  6.553   4.073   1.00 0.00 ? 49  LYS A HG3  1  
ATOM 726   H HD2  . LYS A 1 49  ? -6.582  6.621   6.152   1.00 0.00 ? 49  LYS A HD2  1  
ATOM 727   H HD3  . LYS A 1 49  ? -5.747  5.065   6.153   1.00 0.00 ? 49  LYS A HD3  1  
ATOM 728   H HE2  . LYS A 1 49  ? -5.231  5.916   8.244   1.00 0.00 ? 49  LYS A HE2  1  
ATOM 729   H HE3  . LYS A 1 49  ? -3.823  6.375   7.286   1.00 0.00 ? 49  LYS A HE3  1  
ATOM 730   H HZ1  . LYS A 1 49  ? -4.337  8.315   8.382   1.00 0.00 ? 49  LYS A HZ1  1  
ATOM 731   H HZ2  . LYS A 1 49  ? -6.008  8.067   8.298   1.00 0.00 ? 49  LYS A HZ2  1  
ATOM 732   H HZ3  . LYS A 1 49  ? -5.153  8.542   6.917   1.00 0.00 ? 49  LYS A HZ3  1  
ATOM 733   N N    . LEU A 1 50  ? -1.936  3.300   3.591   1.00 0.00 ? 50  LEU A N    1  
ATOM 734   C CA   . LEU A 1 50  ? -0.730  2.810   2.933   1.00 0.00 ? 50  LEU A CA   1  
ATOM 735   C C    . LEU A 1 50  ? -1.079  1.976   1.705   1.00 0.00 ? 50  LEU A C    1  
ATOM 736   O O    . LEU A 1 50  ? -0.671  2.297   0.589   1.00 0.00 ? 50  LEU A O    1  
ATOM 737   C CB   . LEU A 1 50  ? 0.104   1.976   3.909   1.00 0.00 ? 50  LEU A CB   1  
ATOM 738   C CG   . LEU A 1 50  ? 0.953   0.867   3.288   1.00 0.00 ? 50  LEU A CG   1  
ATOM 739   C CD1  . LEU A 1 50  ? 1.824   1.423   2.172   1.00 0.00 ? 50  LEU A CD1  1  
ATOM 740   C CD2  . LEU A 1 50  ? 1.811   0.194   4.350   1.00 0.00 ? 50  LEU A CD2  1  
ATOM 741   H H    . LEU A 1 50  ? -2.062  3.127   4.547   1.00 0.00 ? 50  LEU A H    1  
ATOM 742   H HA   . LEU A 1 50  ? -0.152  3.667   2.620   1.00 0.00 ? 50  LEU A HA   1  
ATOM 743   H HB2  . LEU A 1 50  ? 0.767   2.647   4.433   1.00 0.00 ? 50  LEU A HB2  1  
ATOM 744   H HB3  . LEU A 1 50  ? -0.575  1.519   4.615   1.00 0.00 ? 50  LEU A HB3  1  
ATOM 745   H HG   . LEU A 1 50  ? 0.301   0.119   2.860   1.00 0.00 ? 50  LEU A HG   1  
ATOM 746   H HD11 . LEU A 1 50  ? 2.787   0.937   2.190   1.00 0.00 ? 50  LEU A HD11 1  
ATOM 747   H HD12 . LEU A 1 50  ? 1.954   2.486   2.312   1.00 0.00 ? 50  LEU A HD12 1  
ATOM 748   H HD13 . LEU A 1 50  ? 1.346   1.243   1.219   1.00 0.00 ? 50  LEU A HD13 1  
ATOM 749   H HD21 . LEU A 1 50  ? 1.604   -0.866  4.360   1.00 0.00 ? 50  LEU A HD21 1  
ATOM 750   H HD22 . LEU A 1 50  ? 1.580   0.615   5.318   1.00 0.00 ? 50  LEU A HD22 1  
ATOM 751   H HD23 . LEU A 1 50  ? 2.854   0.356   4.125   1.00 0.00 ? 50  LEU A HD23 1  
ATOM 752   N N    . MET A 1 51  ? -1.838  0.906   1.918   1.00 0.00 ? 51  MET A N    1  
ATOM 753   C CA   . MET A 1 51  ? -2.245  0.029   0.827   1.00 0.00 ? 51  MET A CA   1  
ATOM 754   C C    . MET A 1 51  ? -2.881  0.829   -0.306  1.00 0.00 ? 51  MET A C    1  
ATOM 755   O O    . MET A 1 51  ? -2.399  0.812   -1.439  1.00 0.00 ? 51  MET A O    1  
ATOM 756   C CB   . MET A 1 51  ? -3.227  -1.029  1.334   1.00 0.00 ? 51  MET A CB   1  
ATOM 757   C CG   . MET A 1 51  ? -2.680  -1.867  2.477   1.00 0.00 ? 51  MET A CG   1  
ATOM 758   S SD   . MET A 1 51  ? -3.975  -2.472  3.577   1.00 0.00 ? 51  MET A SD   1  
ATOM 759   C CE   . MET A 1 51  ? -3.255  -4.016  4.131   1.00 0.00 ? 51  MET A CE   1  
ATOM 760   H H    . MET A 1 51  ? -2.132  0.702   2.830   1.00 0.00 ? 51  MET A H    1  
ATOM 761   H HA   . MET A 1 51  ? -1.361  -0.464  0.451   1.00 0.00 ? 51  MET A HA   1  
ATOM 762   H HB2  . MET A 1 51  ? -4.125  -0.536  1.675   1.00 0.00 ? 51  MET A HB2  1  
ATOM 763   H HB3  . MET A 1 51  ? -3.477  -1.692  0.518   1.00 0.00 ? 51  MET A HB3  1  
ATOM 764   H HG2  . MET A 1 51  ? -2.153  -2.715  2.065   1.00 0.00 ? 51  MET A HG2  1  
ATOM 765   H HG3  . MET A 1 51  ? -1.992  -1.263  3.051   1.00 0.00 ? 51  MET A HG3  1  
ATOM 766   H HE1  . MET A 1 51  ? -4.003  -4.594  4.653   1.00 0.00 ? 51  MET A HE1  1  
ATOM 767   H HE2  . MET A 1 51  ? -2.899  -4.573  3.278   1.00 0.00 ? 51  MET A HE2  1  
ATOM 768   H HE3  . MET A 1 51  ? -2.430  -3.809  4.797   1.00 0.00 ? 51  MET A HE3  1  
ATOM 769   N N    . LYS A 1 52  ? -3.967  1.529   0.007   1.00 0.00 ? 52  LYS A N    1  
ATOM 770   C CA   . LYS A 1 52  ? -4.669  2.336   -0.983  1.00 0.00 ? 52  LYS A CA   1  
ATOM 771   C C    . LYS A 1 52  ? -3.682  3.080   -1.877  1.00 0.00 ? 52  LYS A C    1  
ATOM 772   O O    . LYS A 1 52  ? -3.785  3.034   -3.103  1.00 0.00 ? 52  LYS A O    1  
ATOM 773   C CB   . LYS A 1 52  ? -5.599  3.335   -0.290  1.00 0.00 ? 52  LYS A CB   1  
ATOM 774   C CG   . LYS A 1 52  ? -6.843  2.697   0.304   1.00 0.00 ? 52  LYS A CG   1  
ATOM 775   C CD   . LYS A 1 52  ? -7.997  3.683   0.372   1.00 0.00 ? 52  LYS A CD   1  
ATOM 776   C CE   . LYS A 1 52  ? -8.825  3.660   -0.903  1.00 0.00 ? 52  LYS A CE   1  
ATOM 777   N NZ   . LYS A 1 52  ? -10.239 4.054   -0.653  1.00 0.00 ? 52  LYS A NZ   1  
ATOM 778   H H    . LYS A 1 52  ? -4.303  1.502   0.928   1.00 0.00 ? 52  LYS A H    1  
ATOM 779   H HA   . LYS A 1 52  ? -5.260  1.671   -1.594  1.00 0.00 ? 52  LYS A HA   1  
ATOM 780   H HB2  . LYS A 1 52  ? -5.055  3.823   0.505   1.00 0.00 ? 52  LYS A HB2  1  
ATOM 781   H HB3  . LYS A 1 52  ? -5.910  4.078   -1.010  1.00 0.00 ? 52  LYS A HB3  1  
ATOM 782   H HG2  . LYS A 1 52  ? -7.135  1.859   -0.311  1.00 0.00 ? 52  LYS A HG2  1  
ATOM 783   H HG3  . LYS A 1 52  ? -6.617  2.352   1.303   1.00 0.00 ? 52  LYS A HG3  1  
ATOM 784   H HD2  . LYS A 1 52  ? -8.632  3.424   1.205   1.00 0.00 ? 52  LYS A HD2  1  
ATOM 785   H HD3  . LYS A 1 52  ? -7.600  4.679   0.515   1.00 0.00 ? 52  LYS A HD3  1  
ATOM 786   H HE2  . LYS A 1 52  ? -8.389  4.346   -1.613  1.00 0.00 ? 52  LYS A HE2  1  
ATOM 787   H HE3  . LYS A 1 52  ? -8.806  2.660   -1.311  1.00 0.00 ? 52  LYS A HE3  1  
ATOM 788   H HZ1  . LYS A 1 52  ? -10.281 4.777   0.094   1.00 0.00 ? 52  LYS A HZ1  1  
ATOM 789   H HZ2  . LYS A 1 52  ? -10.793 3.228   -0.351  1.00 0.00 ? 52  LYS A HZ2  1  
ATOM 790   H HZ3  . LYS A 1 52  ? -10.661 4.443   -1.521  1.00 0.00 ? 52  LYS A HZ3  1  
ATOM 791   N N    . ALA A 1 53  ? -2.726  3.762   -1.257  1.00 0.00 ? 53  ALA A N    1  
ATOM 792   C CA   . ALA A 1 53  ? -1.719  4.513   -1.997  1.00 0.00 ? 53  ALA A CA   1  
ATOM 793   C C    . ALA A 1 53  ? -0.900  3.592   -2.895  1.00 0.00 ? 53  ALA A C    1  
ATOM 794   O O    . ALA A 1 53  ? -0.517  3.970   -4.003  1.00 0.00 ? 53  ALA A O    1  
ATOM 795   C CB   . ALA A 1 53  ? -0.809  5.264   -1.037  1.00 0.00 ? 53  ALA A CB   1  
ATOM 796   H H    . ALA A 1 53  ? -2.697  3.761   -0.277  1.00 0.00 ? 53  ALA A H    1  
ATOM 797   H HA   . ALA A 1 53  ? -2.230  5.239   -2.613  1.00 0.00 ? 53  ALA A HA   1  
ATOM 798   H HB1  . ALA A 1 53  ? -1.228  5.226   -0.042  1.00 0.00 ? 53  ALA A HB1  1  
ATOM 799   H HB2  . ALA A 1 53  ? 0.168   4.805   -1.034  1.00 0.00 ? 53  ALA A HB2  1  
ATOM 800   H HB3  . ALA A 1 53  ? -0.724  6.293   -1.353  1.00 0.00 ? 53  ALA A HB3  1  
ATOM 801   N N    . TYR A 1 54  ? -0.633  2.385   -2.411  1.00 0.00 ? 54  TYR A N    1  
ATOM 802   C CA   . TYR A 1 54  ? 0.144   1.412   -3.169  1.00 0.00 ? 54  TYR A CA   1  
ATOM 803   C C    . TYR A 1 54  ? -0.559  1.051   -4.474  1.00 0.00 ? 54  TYR A C    1  
ATOM 804   O O    . TYR A 1 54  ? 0.087   0.714   -5.468  1.00 0.00 ? 54  TYR A O    1  
ATOM 805   C CB   . TYR A 1 54  ? 0.375   0.150   -2.335  1.00 0.00 ? 54  TYR A CB   1  
ATOM 806   C CG   . TYR A 1 54  ? 1.178   -0.911  -3.052  1.00 0.00 ? 54  TYR A CG   1  
ATOM 807   C CD1  . TYR A 1 54  ? 2.565   -0.849  -3.096  1.00 0.00 ? 54  TYR A CD1  1  
ATOM 808   C CD2  . TYR A 1 54  ? 0.549   -1.977  -3.685  1.00 0.00 ? 54  TYR A CD2  1  
ATOM 809   C CE1  . TYR A 1 54  ? 3.303   -1.817  -3.751  1.00 0.00 ? 54  TYR A CE1  1  
ATOM 810   C CE2  . TYR A 1 54  ? 1.279   -2.950  -4.341  1.00 0.00 ? 54  TYR A CE2  1  
ATOM 811   C CZ   . TYR A 1 54  ? 2.656   -2.865  -4.371  1.00 0.00 ? 54  TYR A CZ   1  
ATOM 812   O OH   . TYR A 1 54  ? 3.387   -3.831  -5.023  1.00 0.00 ? 54  TYR A OH   1  
ATOM 813   H H    . TYR A 1 54  ? -0.965  2.142   -1.522  1.00 0.00 ? 54  TYR A H    1  
ATOM 814   H HA   . TYR A 1 54  ? 1.100   1.858   -3.400  1.00 0.00 ? 54  TYR A HA   1  
ATOM 815   H HB2  . TYR A 1 54  ? 0.906   0.415   -1.434  1.00 0.00 ? 54  TYR A HB2  1  
ATOM 816   H HB3  . TYR A 1 54  ? -0.581  -0.278  -2.072  1.00 0.00 ? 54  TYR A HB3  1  
ATOM 817   H HD1  . TYR A 1 54  ? 3.069   -0.027  -2.609  1.00 0.00 ? 54  TYR A HD1  1  
ATOM 818   H HD2  . TYR A 1 54  ? -0.529  -2.041  -3.659  1.00 0.00 ? 54  TYR A HD2  1  
ATOM 819   H HE1  . TYR A 1 54  ? 4.381   -1.751  -3.774  1.00 0.00 ? 54  TYR A HE1  1  
ATOM 820   H HE2  . TYR A 1 54  ? 0.773   -3.770  -4.827  1.00 0.00 ? 54  TYR A HE2  1  
ATOM 821   H HH   . TYR A 1 54  ? 3.114   -4.699  -4.717  1.00 0.00 ? 54  TYR A HH   1  
ATOM 822   N N    . CYS A 1 55  ? -1.885  1.125   -4.464  1.00 0.00 ? 55  CYS A N    1  
ATOM 823   C CA   . CYS A 1 55  ? -2.678  0.806   -5.646  1.00 0.00 ? 55  CYS A CA   1  
ATOM 824   C C    . CYS A 1 55  ? -2.644  1.954   -6.649  1.00 0.00 ? 55  CYS A C    1  
ATOM 825   O O    . CYS A 1 55  ? -2.204  1.785   -7.786  1.00 0.00 ? 55  CYS A O    1  
ATOM 826   C CB   . CYS A 1 55  ? -4.123  0.501   -5.250  1.00 0.00 ? 55  CYS A CB   1  
ATOM 827   S SG   . CYS A 1 55  ? -4.297  -0.887  -4.104  1.00 0.00 ? 55  CYS A SG   1  
ATOM 828   H H    . CYS A 1 55  ? -2.343  1.399   -3.642  1.00 0.00 ? 55  CYS A H    1  
ATOM 829   H HA   . CYS A 1 55  ? -2.247  -0.070  -6.107  1.00 0.00 ? 55  CYS A HA   1  
ATOM 830   H HB2  . CYS A 1 55  ? -4.550  1.372   -4.775  1.00 0.00 ? 55  CYS A HB2  1  
ATOM 831   H HB3  . CYS A 1 55  ? -4.691  0.269   -6.138  1.00 0.00 ? 55  CYS A HB3  1  
ATOM 832   H HG   . CYS A 1 55  ? -3.883  -0.487  -2.912  1.00 0.00 ? 55  CYS A HG   1  
ATOM 833   N N    . GLU A 1 56  ? -3.114  3.122   -6.220  1.00 0.00 ? 56  GLU A N    1  
ATOM 834   C CA   . GLU A 1 56  ? -3.140  4.297   -7.082  1.00 0.00 ? 56  GLU A CA   1  
ATOM 835   C C    . GLU A 1 56  ? -1.800  4.484   -7.788  1.00 0.00 ? 56  GLU A C    1  
ATOM 836   O O    . GLU A 1 56  ? -1.751  4.816   -8.972  1.00 0.00 ? 56  GLU A O    1  
ATOM 837   C CB   . GLU A 1 56  ? -3.478  5.548   -6.267  1.00 0.00 ? 56  GLU A CB   1  
ATOM 838   C CG   . GLU A 1 56  ? -2.281  6.149   -5.550  1.00 0.00 ? 56  GLU A CG   1  
ATOM 839   C CD   . GLU A 1 56  ? -2.583  7.509   -4.951  1.00 0.00 ? 56  GLU A CD   1  
ATOM 840   O OE1  . GLU A 1 56  ? -2.826  8.457   -5.727  1.00 0.00 ? 56  GLU A OE1  1  
ATOM 841   O OE2  . GLU A 1 56  ? -2.575  7.625   -3.708  1.00 0.00 ? 56  GLU A OE2  1  
ATOM 842   H H    . GLU A 1 56  ? -3.451  3.194   -5.303  1.00 0.00 ? 56  GLU A H    1  
ATOM 843   H HA   . GLU A 1 56  ? -3.907  4.146   -7.827  1.00 0.00 ? 56  GLU A HA   1  
ATOM 844   H HB2  . GLU A 1 56  ? -3.887  6.295   -6.931  1.00 0.00 ? 56  GLU A HB2  1  
ATOM 845   H HB3  . GLU A 1 56  ? -4.222  5.290   -5.528  1.00 0.00 ? 56  GLU A HB3  1  
ATOM 846   H HG2  . GLU A 1 56  ? -1.981  5.482   -4.756  1.00 0.00 ? 56  GLU A HG2  1  
ATOM 847   H HG3  . GLU A 1 56  ? -1.470  6.254   -6.255  1.00 0.00 ? 56  GLU A HG3  1  
ATOM 848   N N    . ARG A 1 57  ? -0.715  4.269   -7.051  1.00 0.00 ? 57  ARG A N    1  
ATOM 849   C CA   . ARG A 1 57  ? 0.626   4.415   -7.605  1.00 0.00 ? 57  ARG A CA   1  
ATOM 850   C C    . ARG A 1 57  ? 0.784   3.584   -8.875  1.00 0.00 ? 57  ARG A C    1  
ATOM 851   O O    . ARG A 1 57  ? 1.237   4.086   -9.903  1.00 0.00 ? 57  ARG A O    1  
ATOM 852   C CB   . ARG A 1 57  ? 1.675   3.995   -6.574  1.00 0.00 ? 57  ARG A CB   1  
ATOM 853   C CG   . ARG A 1 57  ? 3.106   4.211   -7.038  1.00 0.00 ? 57  ARG A CG   1  
ATOM 854   C CD   . ARG A 1 57  ? 4.097   3.468   -6.155  1.00 0.00 ? 57  ARG A CD   1  
ATOM 855   N NE   . ARG A 1 57  ? 5.480   3.797   -6.488  1.00 0.00 ? 57  ARG A NE   1  
ATOM 856   C CZ   . ARG A 1 57  ? 6.080   4.920   -6.108  1.00 0.00 ? 57  ARG A CZ   1  
ATOM 857   N NH1  . ARG A 1 57  ? 5.421   5.817   -5.388  1.00 0.00 ? 57  ARG A NH1  1  
ATOM 858   N NH2  . ARG A 1 57  ? 7.342   5.148   -6.450  1.00 0.00 ? 57  ARG A NH2  1  
ATOM 859   H H    . ARG A 1 57  ? -0.818  4.007   -6.112  1.00 0.00 ? 57  ARG A H    1  
ATOM 860   H HA   . ARG A 1 57  ? 0.772   5.457   -7.850  1.00 0.00 ? 57  ARG A HA   1  
ATOM 861   H HB2  . ARG A 1 57  ? 1.524   4.566   -5.669  1.00 0.00 ? 57  ARG A HB2  1  
ATOM 862   H HB3  . ARG A 1 57  ? 1.546   2.946   -6.354  1.00 0.00 ? 57  ARG A HB3  1  
ATOM 863   H HG2  . ARG A 1 57  ? 3.205   3.852   -8.052  1.00 0.00 ? 57  ARG A HG2  1  
ATOM 864   H HG3  . ARG A 1 57  ? 3.329   5.267   -7.005  1.00 0.00 ? 57  ARG A HG3  1  
ATOM 865   H HD2  . ARG A 1 57  ? 3.911   3.734   -5.125  1.00 0.00 ? 57  ARG A HD2  1  
ATOM 866   H HD3  . ARG A 1 57  ? 3.948   2.407   -6.285  1.00 0.00 ? 57  ARG A HD3  1  
ATOM 867   H HE   . ARG A 1 57  ? 5.986   3.149   -7.020  1.00 0.00 ? 57  ARG A HE   1  
ATOM 868   H HH11 . ARG A 1 57  ? 4.470   5.648   -5.128  1.00 0.00 ? 57  ARG A HH11 1  
ATOM 869   H HH12 . ARG A 1 57  ? 5.875   6.661   -5.102  1.00 0.00 ? 57  ARG A HH12 1  
ATOM 870   H HH21 . ARG A 1 57  ? 7.842   4.475   -6.993  1.00 0.00 ? 57  ARG A HH21 1  
ATOM 871   H HH22 . ARG A 1 57  ? 7.792   5.994   -6.165  1.00 0.00 ? 57  ARG A HH22 1  
ATOM 872   N N    . GLN A 1 58  ? 0.407   2.312   -8.794  1.00 0.00 ? 58  GLN A N    1  
ATOM 873   C CA   . GLN A 1 58  ? 0.508   1.412   -9.936  1.00 0.00 ? 58  GLN A CA   1  
ATOM 874   C C    . GLN A 1 58  ? -0.818  1.332   -10.685 1.00 0.00 ? 58  GLN A C    1  
ATOM 875   O O    . GLN A 1 58  ? -0.936  0.628   -11.687 1.00 0.00 ? 58  GLN A O    1  
ATOM 876   C CB   . GLN A 1 58  ? 0.932   0.016   -9.476  1.00 0.00 ? 58  GLN A CB   1  
ATOM 877   C CG   . GLN A 1 58  ? 2.259   -0.003  -8.734  1.00 0.00 ? 58  GLN A CG   1  
ATOM 878   C CD   . GLN A 1 58  ? 3.394   0.580   -9.553  1.00 0.00 ? 58  GLN A CD   1  
ATOM 879   O OE1  . GLN A 1 58  ? 3.394   0.498   -10.781 1.00 0.00 ? 58  GLN A OE1  1  
ATOM 880   N NE2  . GLN A 1 58  ? 4.369   1.173   -8.875  1.00 0.00 ? 58  GLN A NE2  1  
ATOM 881   H H    . GLN A 1 58  ? 0.054   1.971   -7.946  1.00 0.00 ? 58  GLN A H    1  
ATOM 882   H HA   . GLN A 1 58  ? 1.260   1.806   -10.603 1.00 0.00 ? 58  GLN A HA   1  
ATOM 883   H HB2  . GLN A 1 58  ? 0.171   -0.381  -8.821  1.00 0.00 ? 58  GLN A HB2  1  
ATOM 884   H HB3  . GLN A 1 58  ? 1.020   -0.624  -10.342 1.00 0.00 ? 58  GLN A HB3  1  
ATOM 885   H HG2  . GLN A 1 58  ? 2.157   0.574   -7.827  1.00 0.00 ? 58  GLN A HG2  1  
ATOM 886   H HG3  . GLN A 1 58  ? 2.502   -1.025  -8.485  1.00 0.00 ? 58  GLN A HG3  1  
ATOM 887   H HE21 . GLN A 1 58  ? 4.302   1.200   -7.897  1.00 0.00 ? 58  GLN A HE21 1  
ATOM 888   H HE22 . GLN A 1 58  ? 5.115   1.558   -9.378  1.00 0.00 ? 58  GLN A HE22 1  
ATOM 889   N N    . GLY A 1 59  ? -1.816  2.060   -10.192 1.00 0.00 ? 59  GLY A N    1  
ATOM 890   C CA   . GLY A 1 59  ? -3.121  2.057   -10.826 1.00 0.00 ? 59  GLY A CA   1  
ATOM 891   C C    . GLY A 1 59  ? -3.782  0.693   -10.787 1.00 0.00 ? 59  GLY A C    1  
ATOM 892   O O    . GLY A 1 59  ? -4.535  0.334   -11.693 1.00 0.00 ? 59  GLY A O    1  
ATOM 893   H H    . GLY A 1 59  ? -1.665  2.603   -9.390  1.00 0.00 ? 59  GLY A H    1  
ATOM 894   H HA2  . GLY A 1 59  ? -3.757  2.768   -10.321 1.00 0.00 ? 59  GLY A HA2  1  
ATOM 895   H HA3  . GLY A 1 59  ? -3.008  2.359   -11.857 1.00 0.00 ? 59  GLY A HA3  1  
ATOM 896   N N    . LEU A 1 60  ? -3.499  -0.069  -9.737  1.00 0.00 ? 60  LEU A N    1  
ATOM 897   C CA   . LEU A 1 60  ? -4.070  -1.403  -9.584  1.00 0.00 ? 60  LEU A CA   1  
ATOM 898   C C    . LEU A 1 60  ? -5.240  -1.385  -8.606  1.00 0.00 ? 60  LEU A C    1  
ATOM 899   O O    . LEU A 1 60  ? -5.638  -0.328  -8.117  1.00 0.00 ? 60  LEU A O    1  
ATOM 900   C CB   . LEU A 1 60  ? -3.001  -2.385  -9.100  1.00 0.00 ? 60  LEU A CB   1  
ATOM 901   C CG   . LEU A 1 60  ? -1.674  -2.360  -9.860  1.00 0.00 ? 60  LEU A CG   1  
ATOM 902   C CD1  . LEU A 1 60  ? -0.624  -3.180  -9.126  1.00 0.00 ? 60  LEU A CD1  1  
ATOM 903   C CD2  . LEU A 1 60  ? -1.862  -2.877  -11.278 1.00 0.00 ? 60  LEU A CD2  1  
ATOM 904   H H    . LEU A 1 60  ? -2.892  0.271   -9.048  1.00 0.00 ? 60  LEU A H    1  
ATOM 905   H HA   . LEU A 1 60  ? -4.429  -1.723  -10.551 1.00 0.00 ? 60  LEU A HA   1  
ATOM 906   H HB2  . LEU A 1 60  ? -2.793  -2.163  -8.065  1.00 0.00 ? 60  LEU A HB2  1  
ATOM 907   H HB3  . LEU A 1 60  ? -3.409  -3.382  -9.178  1.00 0.00 ? 60  LEU A HB3  1  
ATOM 908   H HG   . LEU A 1 60  ? -1.319  -1.340  -9.918  1.00 0.00 ? 60  LEU A HG   1  
ATOM 909   H HD11 . LEU A 1 60  ? -0.845  -3.186  -8.070  1.00 0.00 ? 60  LEU A HD11 1  
ATOM 910   H HD12 . LEU A 1 60  ? 0.351   -2.743  -9.288  1.00 0.00 ? 60  LEU A HD12 1  
ATOM 911   H HD13 . LEU A 1 60  ? -0.631  -4.192  -9.502  1.00 0.00 ? 60  LEU A HD13 1  
ATOM 912   H HD21 . LEU A 1 60  ? -0.949  -3.347  -11.613 1.00 0.00 ? 60  LEU A HD21 1  
ATOM 913   H HD22 . LEU A 1 60  ? -2.102  -2.051  -11.933 1.00 0.00 ? 60  LEU A HD22 1  
ATOM 914   H HD23 . LEU A 1 60  ? -2.666  -3.597  -11.296 1.00 0.00 ? 60  LEU A HD23 1  
ATOM 915   N N    . SER A 1 61  ? -5.786  -2.564  -8.322  1.00 0.00 ? 61  SER A N    1  
ATOM 916   C CA   . SER A 1 61  ? -6.912  -2.684  -7.403  1.00 0.00 ? 61  SER A CA   1  
ATOM 917   C C    . SER A 1 61  ? -6.517  -3.478  -6.162  1.00 0.00 ? 61  SER A C    1  
ATOM 918   O O    . SER A 1 61  ? -5.816  -4.485  -6.253  1.00 0.00 ? 61  SER A O    1  
ATOM 919   C CB   . SER A 1 61  ? -8.096  -3.358  -8.099  1.00 0.00 ? 61  SER A CB   1  
ATOM 920   O OG   . SER A 1 61  ? -9.259  -3.305  -7.292  1.00 0.00 ? 61  SER A OG   1  
ATOM 921   H H    . SER A 1 61  ? -5.424  -3.371  -8.744  1.00 0.00 ? 61  SER A H    1  
ATOM 922   H HA   . SER A 1 61  ? -7.201  -1.688  -7.102  1.00 0.00 ? 61  SER A HA   1  
ATOM 923   H HB2  . SER A 1 61  ? -8.297  -2.854  -9.032  1.00 0.00 ? 61  SER A HB2  1  
ATOM 924   H HB3  . SER A 1 61  ? -7.853  -4.393  -8.294  1.00 0.00 ? 61  SER A HB3  1  
ATOM 925   H HG   . SER A 1 61  ? -9.005  -3.226  -6.369  1.00 0.00 ? 61  SER A HG   1  
ATOM 926   N N    . MET A 1 62  ? -6.974  -3.016  -5.002  1.00 0.00 ? 62  MET A N    1  
ATOM 927   C CA   . MET A 1 62  ? -6.670  -3.683  -3.742  1.00 0.00 ? 62  MET A CA   1  
ATOM 928   C C    . MET A 1 62  ? -6.934  -5.182  -3.842  1.00 0.00 ? 62  MET A C    1  
ATOM 929   O O    . MET A 1 62  ? -6.146  -5.995  -3.358  1.00 0.00 ? 62  MET A O    1  
ATOM 930   C CB   . MET A 1 62  ? -7.503  -3.082  -2.608  1.00 0.00 ? 62  MET A CB   1  
ATOM 931   C CG   . MET A 1 62  ? -6.939  -3.364  -1.224  1.00 0.00 ? 62  MET A CG   1  
ATOM 932   S SD   . MET A 1 62  ? -7.911  -2.601  0.090   1.00 0.00 ? 62  MET A SD   1  
ATOM 933   C CE   . MET A 1 62  ? -6.763  -1.360  0.682   1.00 0.00 ? 62  MET A CE   1  
ATOM 934   H H    . MET A 1 62  ? -7.529  -2.208  -4.993  1.00 0.00 ? 62  MET A H    1  
ATOM 935   H HA   . MET A 1 62  ? -5.623  -3.528  -3.529  1.00 0.00 ? 62  MET A HA   1  
ATOM 936   H HB2  . MET A 1 62  ? -7.552  -2.012  -2.742  1.00 0.00 ? 62  MET A HB2  1  
ATOM 937   H HB3  . MET A 1 62  ? -8.502  -3.489  -2.655  1.00 0.00 ? 62  MET A HB3  1  
ATOM 938   H HG2  . MET A 1 62  ? -6.924  -4.432  -1.067  1.00 0.00 ? 62  MET A HG2  1  
ATOM 939   H HG3  . MET A 1 62  ? -5.931  -2.980  -1.177  1.00 0.00 ? 62  MET A HG3  1  
ATOM 940   H HE1  . MET A 1 62  ? -7.043  -1.058  1.680   1.00 0.00 ? 62  MET A HE1  1  
ATOM 941   H HE2  . MET A 1 62  ? -5.765  -1.771  0.697   1.00 0.00 ? 62  MET A HE2  1  
ATOM 942   H HE3  . MET A 1 62  ? -6.790  -0.503  0.025   1.00 0.00 ? 62  MET A HE3  1  
ATOM 943   N N    . ARG A 1 63  ? -8.047  -5.541  -4.474  1.00 0.00 ? 63  ARG A N    1  
ATOM 944   C CA   . ARG A 1 63  ? -8.416  -6.942  -4.636  1.00 0.00 ? 63  ARG A CA   1  
ATOM 945   C C    . ARG A 1 63  ? -7.398  -7.675  -5.506  1.00 0.00 ? 63  ARG A C    1  
ATOM 946   O O    . ARG A 1 63  ? -6.836  -8.690  -5.097  1.00 0.00 ? 63  ARG A O    1  
ATOM 947   C CB   . ARG A 1 63  ? -9.809  -7.057  -5.257  1.00 0.00 ? 63  ARG A CB   1  
ATOM 948   C CG   . ARG A 1 63  ? -10.789 -6.011  -4.751  1.00 0.00 ? 63  ARG A CG   1  
ATOM 949   C CD   . ARG A 1 63  ? -12.229 -6.473  -4.911  1.00 0.00 ? 63  ARG A CD   1  
ATOM 950   N NE   . ARG A 1 63  ? -12.787 -6.087  -6.204  1.00 0.00 ? 63  ARG A NE   1  
ATOM 951   C CZ   . ARG A 1 63  ? -12.604 -6.783  -7.321  1.00 0.00 ? 63  ARG A CZ   1  
ATOM 952   N NH1  . ARG A 1 63  ? -11.882 -7.895  -7.302  1.00 0.00 ? 63  ARG A NH1  1  
ATOM 953   N NH2  . ARG A 1 63  ? -13.145 -6.368  -8.459  1.00 0.00 ? 63  ARG A NH2  1  
ATOM 954   H H    . ARG A 1 63  ? -8.636  -4.847  -4.838  1.00 0.00 ? 63  ARG A H    1  
ATOM 955   H HA   . ARG A 1 63  ? -8.429  -7.398  -3.657  1.00 0.00 ? 63  ARG A HA   1  
ATOM 956   H HB2  . ARG A 1 63  ? -9.723  -6.950  -6.328  1.00 0.00 ? 63  ARG A HB2  1  
ATOM 957   H HB3  . ARG A 1 63  ? -10.211 -8.033  -5.032  1.00 0.00 ? 63  ARG A HB3  1  
ATOM 958   H HG2  . ARG A 1 63  ? -10.596 -5.826  -3.705  1.00 0.00 ? 63  ARG A HG2  1  
ATOM 959   H HG3  . ARG A 1 63  ? -10.648 -5.099  -5.312  1.00 0.00 ? 63  ARG A HG3  1  
ATOM 960   H HD2  . ARG A 1 63  ? -12.259 -7.549  -4.823  1.00 0.00 ? 63  ARG A HD2  1  
ATOM 961   H HD3  . ARG A 1 63  ? -12.824 -6.031  -4.126  1.00 0.00 ? 63  ARG A HD3  1  
ATOM 962   H HE   . ARG A 1 63  ? -13.325 -5.269  -6.241  1.00 0.00 ? 63  ARG A HE   1  
ATOM 963   H HH11 . ARG A 1 63  ? -11.474 -8.211  -6.446  1.00 0.00 ? 63  ARG A HH11 1  
ATOM 964   H HH12 . ARG A 1 63  ? -11.746 -8.418  -8.144  1.00 0.00 ? 63  ARG A HH12 1  
ATOM 965   H HH21 . ARG A 1 63  ? -13.691 -5.531  -8.477  1.00 0.00 ? 63  ARG A HH21 1  
ATOM 966   H HH22 . ARG A 1 63  ? -13.007 -6.892  -9.299  1.00 0.00 ? 63  ARG A HH22 1  
ATOM 967   N N    . GLN A 1 64  ? -7.167  -7.152  -6.706  1.00 0.00 ? 64  GLN A N    1  
ATOM 968   C CA   . GLN A 1 64  ? -6.218  -7.757  -7.633  1.00 0.00 ? 64  GLN A CA   1  
ATOM 969   C C    . GLN A 1 64  ? -4.915  -8.111  -6.924  1.00 0.00 ? 64  GLN A C    1  
ATOM 970   O O    . GLN A 1 64  ? -4.360  -9.191  -7.130  1.00 0.00 ? 64  GLN A O    1  
ATOM 971   C CB   . GLN A 1 64  ? -5.937  -6.808  -8.799  1.00 0.00 ? 64  GLN A CB   1  
ATOM 972   C CG   . GLN A 1 64  ? -5.339  -7.498  -10.015 1.00 0.00 ? 64  GLN A CG   1  
ATOM 973   C CD   . GLN A 1 64  ? -3.997  -8.138  -9.721  1.00 0.00 ? 64  GLN A CD   1  
ATOM 974   O OE1  . GLN A 1 64  ? -3.893  -9.358  -9.587  1.00 0.00 ? 64  GLN A OE1  1  
ATOM 975   N NE2  . GLN A 1 64  ? -2.958  -7.316  -9.619  1.00 0.00 ? 64  GLN A NE2  1  
ATOM 976   H H    . GLN A 1 64  ? -7.647  -6.341  -6.974  1.00 0.00 ? 64  GLN A H    1  
ATOM 977   H HA   . GLN A 1 64  ? -6.662  -8.662  -8.017  1.00 0.00 ? 64  GLN A HA   1  
ATOM 978   H HB2  . GLN A 1 64  ? -6.862  -6.338  -9.097  1.00 0.00 ? 64  GLN A HB2  1  
ATOM 979   H HB3  . GLN A 1 64  ? -5.245  -6.046  -8.469  1.00 0.00 ? 64  GLN A HB3  1  
ATOM 980   H HG2  . GLN A 1 64  ? -6.021  -8.266  -10.348 1.00 0.00 ? 64  GLN A HG2  1  
ATOM 981   H HG3  . GLN A 1 64  ? -5.210  -6.768  -10.800 1.00 0.00 ? 64  GLN A HG3  1  
ATOM 982   H HE21 . GLN A 1 64  ? -3.116  -6.356  -9.737  1.00 0.00 ? 64  GLN A HE21 1  
ATOM 983   H HE22 . GLN A 1 64  ? -2.079  -7.703  -9.429  1.00 0.00 ? 64  GLN A HE22 1  
ATOM 984   N N    . ILE A 1 65  ? -4.434  -7.196  -6.090  1.00 0.00 ? 65  ILE A N    1  
ATOM 985   C CA   . ILE A 1 65  ? -3.197  -7.413  -5.350  1.00 0.00 ? 65  ILE A CA   1  
ATOM 986   C C    . ILE A 1 65  ? -3.482  -7.859  -3.920  1.00 0.00 ? 65  ILE A C    1  
ATOM 987   O O    . ILE A 1 65  ? -4.631  -7.866  -3.479  1.00 0.00 ? 65  ILE A O    1  
ATOM 988   C CB   . ILE A 1 65  ? -2.330  -6.140  -5.317  1.00 0.00 ? 65  ILE A CB   1  
ATOM 989   C CG1  . ILE A 1 65  ? -3.118  -4.977  -4.712  1.00 0.00 ? 65  ILE A CG1  1  
ATOM 990   C CG2  . ILE A 1 65  ? -1.848  -5.791  -6.716  1.00 0.00 ? 65  ILE A CG2  1  
ATOM 991   C CD1  . ILE A 1 65  ? -2.243  -3.919  -4.077  1.00 0.00 ? 65  ILE A CD1  1  
ATOM 992   H H    . ILE A 1 65  ? -4.922  -6.356  -5.968  1.00 0.00 ? 65  ILE A H    1  
ATOM 993   H HA   . ILE A 1 65  ? -2.640  -8.190  -5.854  1.00 0.00 ? 65  ILE A HA   1  
ATOM 994   H HB   . ILE A 1 65  ? -1.465  -6.337  -4.702  1.00 0.00 ? 65  ILE A HB   1  
ATOM 995   H HG12 . ILE A 1 65  ? -3.700  -4.503  -5.487  1.00 0.00 ? 65  ILE A HG12 1  
ATOM 996   H HG13 . ILE A 1 65  ? -3.784  -5.359  -3.952  1.00 0.00 ? 65  ILE A HG13 1  
ATOM 997   H HG21 . ILE A 1 65  ? -1.969  -6.647  -7.363  1.00 0.00 ? 65  ILE A HG21 1  
ATOM 998   H HG22 . ILE A 1 65  ? -2.429  -4.966  -7.101  1.00 0.00 ? 65  ILE A HG22 1  
ATOM 999   H HG23 . ILE A 1 65  ? -0.806  -5.512  -6.679  1.00 0.00 ? 65  ILE A HG23 1  
ATOM 1000  H HD11 . ILE A 1 65  ? -1.221  -4.267  -4.047  1.00 0.00 ? 65  ILE A HD11 1  
ATOM 1001  H HD12 . ILE A 1 65  ? -2.298  -3.010  -4.656  1.00 0.00 ? 65  ILE A HD12 1  
ATOM 1002  H HD13 . ILE A 1 65  ? -2.586  -3.726  -3.070  1.00 0.00 ? 65  ILE A HD13 1  
ATOM 1003  N N    . ARG A 1 66  ? -2.428  -8.228  -3.200  1.00 0.00 ? 66  ARG A N    1  
ATOM 1004  C CA   . ARG A 1 66  ? -2.565  -8.674  -1.818  1.00 0.00 ? 66  ARG A CA   1  
ATOM 1005  C C    . ARG A 1 66  ? -1.360  -8.244  -0.986  1.00 0.00 ? 66  ARG A C    1  
ATOM 1006  O O    . ARG A 1 66  ? -0.237  -8.179  -1.488  1.00 0.00 ? 66  ARG A O    1  
ATOM 1007  C CB   . ARG A 1 66  ? -2.718  -10.195 -1.764  1.00 0.00 ? 66  ARG A CB   1  
ATOM 1008  C CG   . ARG A 1 66  ? -4.152  -10.669 -1.937  1.00 0.00 ? 66  ARG A CG   1  
ATOM 1009  C CD   . ARG A 1 66  ? -5.010  -10.298 -0.737  1.00 0.00 ? 66  ARG A CD   1  
ATOM 1010  N NE   . ARG A 1 66  ? -4.994  -11.338 0.289   1.00 0.00 ? 66  ARG A NE   1  
ATOM 1011  C CZ   . ARG A 1 66  ? -4.105  -11.384 1.275   1.00 0.00 ? 66  ARG A CZ   1  
ATOM 1012  N NH1  . ARG A 1 66  ? -3.165  -10.454 1.368   1.00 0.00 ? 66  ARG A NH1  1  
ATOM 1013  N NH2  . ARG A 1 66  ? -4.156  -12.362 2.170   1.00 0.00 ? 66  ARG A NH2  1  
ATOM 1014  H H    . ARG A 1 66  ? -1.537  -8.200  -3.607  1.00 0.00 ? 66  ARG A H    1  
ATOM 1015  H HA   . ARG A 1 66  ? -3.452  -8.216  -1.408  1.00 0.00 ? 66  ARG A HA   1  
ATOM 1016  H HB2  . ARG A 1 66  ? -2.121  -10.634 -2.550  1.00 0.00 ? 66  ARG A HB2  1  
ATOM 1017  H HB3  . ARG A 1 66  ? -2.358  -10.547 -0.810  1.00 0.00 ? 66  ARG A HB3  1  
ATOM 1018  H HG2  . ARG A 1 66  ? -4.570  -10.208 -2.820  1.00 0.00 ? 66  ARG A HG2  1  
ATOM 1019  H HG3  . ARG A 1 66  ? -4.155  -11.742 -2.053  1.00 0.00 ? 66  ARG A HG3  1  
ATOM 1020  H HD2  . ARG A 1 66  ? -4.632  -9.380  -0.311  1.00 0.00 ? 66  ARG A HD2  1  
ATOM 1021  H HD3  . ARG A 1 66  ? -6.026  -10.149 -1.070  1.00 0.00 ? 66  ARG A HD3  1  
ATOM 1022  H HE   . ARG A 1 66  ? -5.680  -12.035 0.239   1.00 0.00 ? 66  ARG A HE   1  
ATOM 1023  H HH11 . ARG A 1 66  ? -3.125  -9.715  0.695   1.00 0.00 ? 66  ARG A HH11 1  
ATOM 1024  H HH12 . ARG A 1 66  ? -2.497  -10.490 2.112   1.00 0.00 ? 66  ARG A HH12 1  
ATOM 1025  H HH21 . ARG A 1 66  ? -4.863  -13.065 2.103   1.00 0.00 ? 66  ARG A HH21 1  
ATOM 1026  H HH22 . ARG A 1 66  ? -3.486  -12.396 2.912   1.00 0.00 ? 66  ARG A HH22 1  
ATOM 1027  N N    . PHE A 1 67  ? -1.601  -7.951  0.287   1.00 0.00 ? 67  PHE A N    1  
ATOM 1028  C CA   . PHE A 1 67  ? -0.537  -7.526  1.189   1.00 0.00 ? 67  PHE A CA   1  
ATOM 1029  C C    . PHE A 1 67  ? -0.220  -8.616  2.209   1.00 0.00 ? 67  PHE A C    1  
ATOM 1030  O O    . PHE A 1 67  ? -1.044  -9.492  2.472   1.00 0.00 ? 67  PHE A O    1  
ATOM 1031  C CB   . PHE A 1 67  ? -0.936  -6.237  1.910   1.00 0.00 ? 67  PHE A CB   1  
ATOM 1032  C CG   . PHE A 1 67  ? -1.079  -5.056  0.993   1.00 0.00 ? 67  PHE A CG   1  
ATOM 1033  C CD1  . PHE A 1 67  ? -2.288  -4.790  0.369   1.00 0.00 ? 67  PHE A CD1  1  
ATOM 1034  C CD2  . PHE A 1 67  ? -0.006  -4.213  0.754   1.00 0.00 ? 67  PHE A CD2  1  
ATOM 1035  C CE1  . PHE A 1 67  ? -2.422  -3.705  -0.476  1.00 0.00 ? 67  PHE A CE1  1  
ATOM 1036  C CE2  . PHE A 1 67  ? -0.135  -3.126  -0.090  1.00 0.00 ? 67  PHE A CE2  1  
ATOM 1037  C CZ   . PHE A 1 67  ? -1.345  -2.871  -0.705  1.00 0.00 ? 67  PHE A CZ   1  
ATOM 1038  H H    . PHE A 1 67  ? -2.518  -8.022  0.629   1.00 0.00 ? 67  PHE A H    1  
ATOM 1039  H HA   . PHE A 1 67  ? 0.344   -7.338  0.595   1.00 0.00 ? 67  PHE A HA   1  
ATOM 1040  H HB2  . PHE A 1 67  ? -1.883  -6.388  2.406   1.00 0.00 ? 67  PHE A HB2  1  
ATOM 1041  H HB3  . PHE A 1 67  ? -0.183  -5.997  2.646   1.00 0.00 ? 67  PHE A HB3  1  
ATOM 1042  H HD1  . PHE A 1 67  ? -3.132  -5.440  0.548   1.00 0.00 ? 67  PHE A HD1  1  
ATOM 1043  H HD2  . PHE A 1 67  ? 0.941   -4.412  1.235   1.00 0.00 ? 67  PHE A HD2  1  
ATOM 1044  H HE1  . PHE A 1 67  ? -3.370  -3.507  -0.955  1.00 0.00 ? 67  PHE A HE1  1  
ATOM 1045  H HE2  . PHE A 1 67  ? 0.709   -2.477  -0.267  1.00 0.00 ? 67  PHE A HE2  1  
ATOM 1046  H HZ   . PHE A 1 67  ? -1.448  -2.023  -1.365  1.00 0.00 ? 67  PHE A HZ   1  
ATOM 1047  N N    . ARG A 1 68  ? 0.978   -8.554  2.779   1.00 0.00 ? 68  ARG A N    1  
ATOM 1048  C CA   . ARG A 1 68  ? 1.405   -9.536  3.769   1.00 0.00 ? 68  ARG A CA   1  
ATOM 1049  C C    . ARG A 1 68  ? 2.569   -9.001  4.598   1.00 0.00 ? 68  ARG A C    1  
ATOM 1050  O O    . ARG A 1 68  ? 3.316   -8.130  4.150   1.00 0.00 ? 68  ARG A O    1  
ATOM 1051  C CB   . ARG A 1 68  ? 1.812   -10.840 3.081   1.00 0.00 ? 68  ARG A CB   1  
ATOM 1052  C CG   . ARG A 1 68  ? 0.632   -11.704 2.668   1.00 0.00 ? 68  ARG A CG   1  
ATOM 1053  C CD   . ARG A 1 68  ? 1.072   -13.117 2.315   1.00 0.00 ? 68  ARG A CD   1  
ATOM 1054  N NE   . ARG A 1 68  ? 0.081   -13.810 1.496   1.00 0.00 ? 68  ARG A NE   1  
ATOM 1055  C CZ   . ARG A 1 68  ? 0.314   -14.963 0.880   1.00 0.00 ? 68  ARG A CZ   1  
ATOM 1056  N NH1  . ARG A 1 68  ? 1.499   -15.549 0.988   1.00 0.00 ? 68  ARG A NH1  1  
ATOM 1057  N NH2  . ARG A 1 68  ? -0.638  -15.533 0.152   1.00 0.00 ? 68  ARG A NH2  1  
ATOM 1058  H H    . ARG A 1 68  ? 1.591   -7.831  2.528   1.00 0.00 ? 68  ARG A H    1  
ATOM 1059  H HA   . ARG A 1 68  ? 0.571   -9.730  4.425   1.00 0.00 ? 68  ARG A HA   1  
ATOM 1060  H HB2  . ARG A 1 68  ? 2.384   -10.604 2.196   1.00 0.00 ? 68  ARG A HB2  1  
ATOM 1061  H HB3  . ARG A 1 68  ? 2.429   -11.412 3.758   1.00 0.00 ? 68  ARG A HB3  1  
ATOM 1062  H HG2  . ARG A 1 68  ? -0.072  -11.752 3.486   1.00 0.00 ? 68  ARG A HG2  1  
ATOM 1063  H HG3  . ARG A 1 68  ? 0.156   -11.259 1.807   1.00 0.00 ? 68  ARG A HG3  1  
ATOM 1064  H HD2  . ARG A 1 68  ? 2.002   -13.064 1.769   1.00 0.00 ? 68  ARG A HD2  1  
ATOM 1065  H HD3  . ARG A 1 68  ? 1.222   -13.671 3.229   1.00 0.00 ? 68  ARG A HD3  1  
ATOM 1066  H HE   . ARG A 1 68  ? -0.801  -13.395 1.403   1.00 0.00 ? 68  ARG A HE   1  
ATOM 1067  H HH11 . ARG A 1 68  ? 2.218   -15.123 1.536   1.00 0.00 ? 68  ARG A HH11 1  
ATOM 1068  H HH12 . ARG A 1 68  ? 1.672   -16.418 0.524   1.00 0.00 ? 68  ARG A HH12 1  
ATOM 1069  H HH21 . ARG A 1 68  ? -1.532  -15.094 0.068   1.00 0.00 ? 68  ARG A HH21 1  
ATOM 1070  H HH22 . ARG A 1 68  ? -0.461  -16.400 -0.311  1.00 0.00 ? 68  ARG A HH22 1  
ATOM 1071  N N    . PHE A 1 69  ? 2.718   -9.528  5.809   1.00 0.00 ? 69  PHE A N    1  
ATOM 1072  C CA   . PHE A 1 69  ? 3.789   -9.103  6.702   1.00 0.00 ? 69  PHE A CA   1  
ATOM 1073  C C    . PHE A 1 69  ? 4.371   -10.293 7.458   1.00 0.00 ? 69  PHE A C    1  
ATOM 1074  O O    . PHE A 1 69  ? 3.711   -10.880 8.316   1.00 0.00 ? 69  PHE A O    1  
ATOM 1075  C CB   . PHE A 1 69  ? 3.272   -8.057  7.692   1.00 0.00 ? 69  PHE A CB   1  
ATOM 1076  C CG   . PHE A 1 69  ? 4.316   -7.583  8.663   1.00 0.00 ? 69  PHE A CG   1  
ATOM 1077  C CD1  . PHE A 1 69  ? 5.230   -6.608  8.296   1.00 0.00 ? 69  PHE A CD1  1  
ATOM 1078  C CD2  . PHE A 1 69  ? 4.384   -8.113  9.941   1.00 0.00 ? 69  PHE A CD2  1  
ATOM 1079  C CE1  . PHE A 1 69  ? 6.191   -6.169  9.187   1.00 0.00 ? 69  PHE A CE1  1  
ATOM 1080  C CE2  . PHE A 1 69  ? 5.343   -7.678  10.836  1.00 0.00 ? 69  PHE A CE2  1  
ATOM 1081  C CZ   . PHE A 1 69  ? 6.249   -6.706  10.458  1.00 0.00 ? 69  PHE A CZ   1  
ATOM 1082  H H    . PHE A 1 69  ? 2.090   -10.219 6.110   1.00 0.00 ? 69  PHE A H    1  
ATOM 1083  H HA   . PHE A 1 69  ? 4.567   -8.661  6.098   1.00 0.00 ? 69  PHE A HA   1  
ATOM 1084  H HB2  . PHE A 1 69  ? 2.915   -7.198  7.144   1.00 0.00 ? 69  PHE A HB2  1  
ATOM 1085  H HB3  . PHE A 1 69  ? 2.458   -8.482  8.259   1.00 0.00 ? 69  PHE A HB3  1  
ATOM 1086  H HD1  . PHE A 1 69  ? 5.186   -6.188  7.301   1.00 0.00 ? 69  PHE A HD1  1  
ATOM 1087  H HD2  . PHE A 1 69  ? 3.677   -8.874  10.238  1.00 0.00 ? 69  PHE A HD2  1  
ATOM 1088  H HE1  . PHE A 1 69  ? 6.898   -5.409  8.888   1.00 0.00 ? 69  PHE A HE1  1  
ATOM 1089  H HE2  . PHE A 1 69  ? 5.386   -8.099  11.829  1.00 0.00 ? 69  PHE A HE2  1  
ATOM 1090  H HZ   . PHE A 1 69  ? 6.998   -6.364  11.156  1.00 0.00 ? 69  PHE A HZ   1  
ATOM 1091  N N    . ASP A 1 70  ? 5.610   -10.644 7.134   1.00 0.00 ? 70  ASP A N    1  
ATOM 1092  C CA   . ASP A 1 70  ? 6.282   -11.764 7.783   1.00 0.00 ? 70  ASP A CA   1  
ATOM 1093  C C    . ASP A 1 70  ? 5.640   -13.089 7.383   1.00 0.00 ? 70  ASP A C    1  
ATOM 1094  O O    . ASP A 1 70  ? 5.710   -14.072 8.120   1.00 0.00 ? 70  ASP A O    1  
ATOM 1095  C CB   . ASP A 1 70  ? 6.240   -11.601 9.303   1.00 0.00 ? 70  ASP A CB   1  
ATOM 1096  C CG   . ASP A 1 70  ? 7.310   -12.416 10.003  1.00 0.00 ? 70  ASP A CG   1  
ATOM 1097  O OD1  . ASP A 1 70  ? 8.474   -12.380 9.551   1.00 0.00 ? 70  ASP A OD1  1  
ATOM 1098  O OD2  . ASP A 1 70  ? 6.984   -13.088 11.003  1.00 0.00 ? 70  ASP A OD2  1  
ATOM 1099  H H    . ASP A 1 70  ? 6.085   -10.138 6.442   1.00 0.00 ? 70  ASP A H    1  
ATOM 1100  H HA   . ASP A 1 70  ? 7.312   -11.766 7.459   1.00 0.00 ? 70  ASP A HA   1  
ATOM 1101  H HB2  . ASP A 1 70  ? 6.387   -10.559 9.551   1.00 0.00 ? 70  ASP A HB2  1  
ATOM 1102  H HB3  . ASP A 1 70  ? 5.274   -11.920 9.666   1.00 0.00 ? 70  ASP A HB3  1  
ATOM 1103  N N    . GLY A 1 71  ? 5.013   -13.107 6.211   1.00 0.00 ? 71  GLY A N    1  
ATOM 1104  C CA   . GLY A 1 71  ? 4.366   -14.315 5.734   1.00 0.00 ? 71  GLY A CA   1  
ATOM 1105  C C    . GLY A 1 71  ? 2.996   -14.521 6.350   1.00 0.00 ? 71  GLY A C    1  
ATOM 1106  O O    . GLY A 1 71  ? 2.587   -15.653 6.604   1.00 0.00 ? 71  GLY A O    1  
ATOM 1107  H H    . GLY A 1 71  ? 4.989   -12.293 5.665   1.00 0.00 ? 71  GLY A H    1  
ATOM 1108  H HA2  . GLY A 1 71  ? 4.262   -14.256 4.661   1.00 0.00 ? 71  GLY A HA2  1  
ATOM 1109  H HA3  . GLY A 1 71  ? 4.988   -15.163 5.979   1.00 0.00 ? 71  GLY A HA3  1  
ATOM 1110  N N    . GLN A 1 72  ? 2.286   -13.423 6.591   1.00 0.00 ? 72  GLN A N    1  
ATOM 1111  C CA   . GLN A 1 72  ? 0.956   -13.489 7.183   1.00 0.00 ? 72  GLN A CA   1  
ATOM 1112  C C    . GLN A 1 72  ? 0.023   -12.467 6.541   1.00 0.00 ? 72  GLN A C    1  
ATOM 1113  O O    . GLN A 1 72  ? 0.432   -11.369 6.162   1.00 0.00 ? 72  GLN A O    1  
ATOM 1114  C CB   . GLN A 1 72  ? 1.033   -13.249 8.692   1.00 0.00 ? 72  GLN A CB   1  
ATOM 1115  C CG   . GLN A 1 72  ? 1.722   -14.372 9.451   1.00 0.00 ? 72  GLN A CG   1  
ATOM 1116  C CD   . GLN A 1 72  ? 1.865   -14.073 10.931  1.00 0.00 ? 72  GLN A CD   1  
ATOM 1117  O OE1  . GLN A 1 72  ? 2.307   -12.991 11.318  1.00 0.00 ? 72  GLN A OE1  1  
ATOM 1118  N NE2  . GLN A 1 72  ? 1.490   -15.033 11.768  1.00 0.00 ? 72  GLN A NE2  1  
ATOM 1119  H H    . GLN A 1 72  ? 2.667   -12.549 6.366   1.00 0.00 ? 72  GLN A H    1  
ATOM 1120  H HA   . GLN A 1 72  ? 0.562   -14.478 7.005   1.00 0.00 ? 72  GLN A HA   1  
ATOM 1121  H HB2  . GLN A 1 72  ? 1.578   -12.335 8.871   1.00 0.00 ? 72  GLN A HB2  1  
ATOM 1122  H HB3  . GLN A 1 72  ? 0.031   -13.144 9.079   1.00 0.00 ? 72  GLN A HB3  1  
ATOM 1123  H HG2  . GLN A 1 72  ? 1.142   -15.276 9.337   1.00 0.00 ? 72  GLN A HG2  1  
ATOM 1124  H HG3  . GLN A 1 72  ? 2.706   -14.521 9.032   1.00 0.00 ? 72  GLN A HG3  1  
ATOM 1125  H HE21 . GLN A 1 72  ? 1.148   -15.870 11.388  1.00 0.00 ? 72  GLN A HE21 1  
ATOM 1126  H HE22 . GLN A 1 72  ? 1.572   -14.868 12.729  1.00 0.00 ? 72  GLN A HE22 1  
ATOM 1127  N N    . PRO A 1 73  ? -1.261  -12.834 6.415   1.00 0.00 ? 73  PRO A N    1  
ATOM 1128  C CA   . PRO A 1 73  ? -2.278  -11.963 5.819   1.00 0.00 ? 73  PRO A CA   1  
ATOM 1129  C C    . PRO A 1 73  ? -2.606  -10.765 6.703   1.00 0.00 ? 73  PRO A C    1  
ATOM 1130  O O    . PRO A 1 73  ? -3.069  -10.924 7.833   1.00 0.00 ? 73  PRO A O    1  
ATOM 1131  C CB   . PRO A 1 73  ? -3.497  -12.880 5.687   1.00 0.00 ? 73  PRO A CB   1  
ATOM 1132  C CG   . PRO A 1 73  ? -3.304  -13.920 6.736   1.00 0.00 ? 73  PRO A CG   1  
ATOM 1133  C CD   . PRO A 1 73  ? -1.818  -14.128 6.844   1.00 0.00 ? 73  PRO A CD   1  
ATOM 1134  H HA   . PRO A 1 73  ? -1.980  -11.616 4.841   1.00 0.00 ? 73  PRO A HA   1  
ATOM 1135  H HB2  . PRO A 1 73  ? -4.400  -12.310 5.857   1.00 0.00 ? 73  PRO A HB2  1  
ATOM 1136  H HB3  . PRO A 1 73  ? -3.520  -13.315 4.699   1.00 0.00 ? 73  PRO A HB3  1  
ATOM 1137  H HG2  . PRO A 1 73  ? -3.703  -13.573 7.676   1.00 0.00 ? 73  PRO A HG2  1  
ATOM 1138  H HG3  . PRO A 1 73  ? -3.789  -14.838 6.436   1.00 0.00 ? 73  PRO A HG3  1  
ATOM 1139  H HD2  . PRO A 1 73  ? -1.541  -14.347 7.865   1.00 0.00 ? 73  PRO A HD2  1  
ATOM 1140  H HD3  . PRO A 1 73  ? -1.499  -14.922 6.186   1.00 0.00 ? 73  PRO A HD3  1  
ATOM 1141  N N    . ILE A 1 74  ? -2.363  -9.567  6.183   1.00 0.00 ? 74  ILE A N    1  
ATOM 1142  C CA   . ILE A 1 74  ? -2.635  -8.343  6.925   1.00 0.00 ? 74  ILE A CA   1  
ATOM 1143  C C    . ILE A 1 74  ? -3.891  -7.652  6.407   1.00 0.00 ? 74  ILE A C    1  
ATOM 1144  O O    . ILE A 1 74  ? -4.185  -7.691  5.213   1.00 0.00 ? 74  ILE A O    1  
ATOM 1145  C CB   . ILE A 1 74  ? -1.451  -7.360  6.843   1.00 0.00 ? 74  ILE A CB   1  
ATOM 1146  C CG1  . ILE A 1 74  ? -0.912  -7.296  5.412   1.00 0.00 ? 74  ILE A CG1  1  
ATOM 1147  C CG2  . ILE A 1 74  ? -0.352  -7.773  7.811   1.00 0.00 ? 74  ILE A CG2  1  
ATOM 1148  C CD1  . ILE A 1 74  ? -0.264  -5.973  5.070   1.00 0.00 ? 74  ILE A CD1  1  
ATOM 1149  H H    . ILE A 1 74  ? -1.994  -9.505  5.277   1.00 0.00 ? 74  ILE A H    1  
ATOM 1150  H HA   . ILE A 1 74  ? -2.785  -8.608  7.962   1.00 0.00 ? 74  ILE A HA   1  
ATOM 1151  H HB   . ILE A 1 74  ? -1.804  -6.382  7.132   1.00 0.00 ? 74  ILE A HB   1  
ATOM 1152  H HG12 . ILE A 1 74  ? -0.175  -8.071  5.277   1.00 0.00 ? 74  ILE A HG12 1  
ATOM 1153  H HG13 . ILE A 1 74  ? -1.728  -7.456  4.721   1.00 0.00 ? 74  ILE A HG13 1  
ATOM 1154  H HG21 . ILE A 1 74  ? -0.777  -7.931  8.791   1.00 0.00 ? 74  ILE A HG21 1  
ATOM 1155  H HG22 . ILE A 1 74  ? 0.105   -8.688  7.466   1.00 0.00 ? 74  ILE A HG22 1  
ATOM 1156  H HG23 . ILE A 1 74  ? 0.394   -6.994  7.862   1.00 0.00 ? 74  ILE A HG23 1  
ATOM 1157  H HD11 . ILE A 1 74  ? 0.625   -6.148  4.482   1.00 0.00 ? 74  ILE A HD11 1  
ATOM 1158  H HD12 . ILE A 1 74  ? -0.957  -5.367  4.506   1.00 0.00 ? 74  ILE A HD12 1  
ATOM 1159  H HD13 . ILE A 1 74  ? 0.005   -5.458  5.981   1.00 0.00 ? 74  ILE A HD13 1  
ATOM 1160  N N    . ASN A 1 75  ? -4.628  -7.018  7.313   1.00 0.00 ? 75  ASN A N    1  
ATOM 1161  C CA   . ASN A 1 75  ? -5.854  -6.317  6.947   1.00 0.00 ? 75  ASN A CA   1  
ATOM 1162  C C    . ASN A 1 75  ? -5.697  -4.811  7.140   1.00 0.00 ? 75  ASN A C    1  
ATOM 1163  O O    . ASN A 1 75  ? -5.199  -4.357  8.169   1.00 0.00 ? 75  ASN A O    1  
ATOM 1164  C CB   . ASN A 1 75  ? -7.029  -6.830  7.781   1.00 0.00 ? 75  ASN A CB   1  
ATOM 1165  C CG   . ASN A 1 75  ? -6.968  -8.329  8.004   1.00 0.00 ? 75  ASN A CG   1  
ATOM 1166  O OD1  . ASN A 1 75  ? -6.981  -8.800  9.141   1.00 0.00 ? 75  ASN A OD1  1  
ATOM 1167  N ND2  . ASN A 1 75  ? -6.902  -9.087  6.915   1.00 0.00 ? 75  ASN A ND2  1  
ATOM 1168  H H    . ASN A 1 75  ? -4.342  -7.022  8.250   1.00 0.00 ? 75  ASN A H    1  
ATOM 1169  H HA   . ASN A 1 75  ? -6.050  -6.515  5.904   1.00 0.00 ? 75  ASN A HA   1  
ATOM 1170  H HB2  . ASN A 1 75  ? -7.018  -6.342  8.745   1.00 0.00 ? 75  ASN A HB2  1  
ATOM 1171  H HB3  . ASN A 1 75  ? -7.952  -6.597  7.273   1.00 0.00 ? 75  ASN A HB3  1  
ATOM 1172  H HD21 . ASN A 1 75  ? -6.895  -8.643  6.041   1.00 0.00 ? 75  ASN A HD21 1  
ATOM 1173  H HD22 . ASN A 1 75  ? -6.862  -10.059 7.030   1.00 0.00 ? 75  ASN A HD22 1  
ATOM 1174  N N    . GLU A 1 76  ? -6.127  -4.044  6.143   1.00 0.00 ? 76  GLU A N    1  
ATOM 1175  C CA   . GLU A 1 76  ? -6.034  -2.590  6.204   1.00 0.00 ? 76  GLU A CA   1  
ATOM 1176  C C    . GLU A 1 76  ? -6.405  -2.079  7.594   1.00 0.00 ? 76  GLU A C    1  
ATOM 1177  O O    . GLU A 1 76  ? -5.835  -1.103  8.082   1.00 0.00 ? 76  GLU A O    1  
ATOM 1178  C CB   . GLU A 1 76  ? -6.948  -1.954  5.155   1.00 0.00 ? 76  GLU A CB   1  
ATOM 1179  C CG   . GLU A 1 76  ? -8.298  -2.641  5.026   1.00 0.00 ? 76  GLU A CG   1  
ATOM 1180  C CD   . GLU A 1 76  ? -9.204  -1.962  4.017   1.00 0.00 ? 76  GLU A CD   1  
ATOM 1181  O OE1  . GLU A 1 76  ? -9.025  -0.749  3.782   1.00 0.00 ? 76  GLU A OE1  1  
ATOM 1182  O OE2  . GLU A 1 76  ? -10.091 -2.644  3.463   1.00 0.00 ? 76  GLU A OE2  1  
ATOM 1183  H H    . GLU A 1 76  ? -6.515  -4.466  5.348   1.00 0.00 ? 76  GLU A H    1  
ATOM 1184  H HA   . GLU A 1 76  ? -5.013  -2.314  5.993   1.00 0.00 ? 76  GLU A HA   1  
ATOM 1185  H HB2  . GLU A 1 76  ? -7.117  -0.921  5.420   1.00 0.00 ? 76  GLU A HB2  1  
ATOM 1186  H HB3  . GLU A 1 76  ? -6.455  -1.994  4.195   1.00 0.00 ? 76  GLU A HB3  1  
ATOM 1187  H HG2  . GLU A 1 76  ? -8.139  -3.662  4.715   1.00 0.00 ? 76  GLU A HG2  1  
ATOM 1188  H HG3  . GLU A 1 76  ? -8.786  -2.631  5.990   1.00 0.00 ? 76  GLU A HG3  1  
ATOM 1189  N N    . THR A 1 77  ? -7.365  -2.747  8.227   1.00 0.00 ? 77  THR A N    1  
ATOM 1190  C CA   . THR A 1 77  ? -7.813  -2.360  9.559   1.00 0.00 ? 77  THR A CA   1  
ATOM 1191  C C    . THR A 1 77  ? -6.671  -2.431  10.565  1.00 0.00 ? 77  THR A C    1  
ATOM 1192  O O    . THR A 1 77  ? -6.495  -1.528  11.383  1.00 0.00 ? 77  THR A O    1  
ATOM 1193  C CB   . THR A 1 77  ? -8.967  -3.258  10.045  1.00 0.00 ? 77  THR A CB   1  
ATOM 1194  O OG1  . THR A 1 77  ? -8.543  -4.625  10.081  1.00 0.00 ? 77  THR A OG1  1  
ATOM 1195  C CG2  . THR A 1 77  ? -10.179 -3.121  9.135   1.00 0.00 ? 77  THR A CG2  1  
ATOM 1196  H H    . THR A 1 77  ? -7.781  -3.516  7.786   1.00 0.00 ? 77  THR A H    1  
ATOM 1197  H HA   . THR A 1 77  ? -8.173  -1.343  9.507   1.00 0.00 ? 77  THR A HA   1  
ATOM 1198  H HB   . THR A 1 77  ? -9.247  -2.949  11.042  1.00 0.00 ? 77  THR A HB   1  
ATOM 1199  H HG1  . THR A 1 77  ? -7.774  -4.707  10.649  1.00 0.00 ? 77  THR A HG1  1  
ATOM 1200  H HG21 . THR A 1 77  ? -10.973 -2.616  9.666   1.00 0.00 ? 77  THR A HG21 1  
ATOM 1201  H HG22 . THR A 1 77  ? -10.515 -4.102  8.834   1.00 0.00 ? 77  THR A HG22 1  
ATOM 1202  H HG23 . THR A 1 77  ? -9.910  -2.548  8.261   1.00 0.00 ? 77  THR A HG23 1  
ATOM 1203  N N    . ASP A 1 78  ? -5.897  -3.509  10.500  1.00 0.00 ? 78  ASP A N    1  
ATOM 1204  C CA   . ASP A 1 78  ? -4.769  -3.696  11.406  1.00 0.00 ? 78  ASP A CA   1  
ATOM 1205  C C    . ASP A 1 78  ? -3.791  -2.530  11.303  1.00 0.00 ? 78  ASP A C    1  
ATOM 1206  O O    . ASP A 1 78  ? -3.748  -1.827  10.293  1.00 0.00 ? 78  ASP A O    1  
ATOM 1207  C CB   . ASP A 1 78  ? -4.051  -5.010  11.095  1.00 0.00 ? 78  ASP A CB   1  
ATOM 1208  C CG   . ASP A 1 78  ? -4.663  -6.191  11.823  1.00 0.00 ? 78  ASP A CG   1  
ATOM 1209  O OD1  . ASP A 1 78  ? -5.739  -6.659  11.395  1.00 0.00 ? 78  ASP A OD1  1  
ATOM 1210  O OD2  . ASP A 1 78  ? -4.066  -6.646  12.821  1.00 0.00 ? 78  ASP A OD2  1  
ATOM 1211  H H    . ASP A 1 78  ? -6.088  -4.194  9.826   1.00 0.00 ? 78  ASP A H    1  
ATOM 1212  H HA   . ASP A 1 78  ? -5.156  -3.737  12.413  1.00 0.00 ? 78  ASP A HA   1  
ATOM 1213  H HB2  . ASP A 1 78  ? -4.104  -5.200  10.033  1.00 0.00 ? 78  ASP A HB2  1  
ATOM 1214  H HB3  . ASP A 1 78  ? -3.016  -4.925  11.390  1.00 0.00 ? 78  ASP A HB3  1  
ATOM 1215  N N    . THR A 1 79  ? -3.005  -2.329  12.357  1.00 0.00 ? 79  THR A N    1  
ATOM 1216  C CA   . THR A 1 79  ? -2.028  -1.248  12.387  1.00 0.00 ? 79  THR A CA   1  
ATOM 1217  C C    . THR A 1 79  ? -0.605  -1.793  12.409  1.00 0.00 ? 79  THR A C    1  
ATOM 1218  O O    . THR A 1 79  ? -0.362  -2.947  12.762  1.00 0.00 ? 79  THR A O    1  
ATOM 1219  C CB   . THR A 1 79  ? -2.236  -0.337  13.611  1.00 0.00 ? 79  THR A CB   1  
ATOM 1220  O OG1  . THR A 1 79  ? -2.749  -1.101  14.709  1.00 0.00 ? 79  THR A OG1  1  
ATOM 1221  C CG2  . THR A 1 79  ? -3.195  0.798   13.285  1.00 0.00 ? 79  THR A CG2  1  
ATOM 1222  H H    . THR A 1 79  ? -3.086  -2.923  13.132  1.00 0.00 ? 79  THR A H    1  
ATOM 1223  H HA   . THR A 1 79  ? -2.162  -0.653  11.495  1.00 0.00 ? 79  THR A HA   1  
ATOM 1224  H HB   . THR A 1 79  ? -1.282  0.087   13.892  1.00 0.00 ? 79  THR A HB   1  
ATOM 1225  H HG1  . THR A 1 79  ? -3.518  -1.598  14.421  1.00 0.00 ? 79  THR A HG1  1  
ATOM 1226  H HG21 . THR A 1 79  ? -3.391  0.809   12.223  1.00 0.00 ? 79  THR A HG21 1  
ATOM 1227  H HG22 . THR A 1 79  ? -2.753  1.738   13.579  1.00 0.00 ? 79  THR A HG22 1  
ATOM 1228  H HG23 . THR A 1 79  ? -4.121  0.651   13.820  1.00 0.00 ? 79  THR A HG23 1  
ATOM 1229  N N    . PRO A 1 80  ? 0.360   -0.945  12.023  1.00 0.00 ? 80  PRO A N    1  
ATOM 1230  C CA   . PRO A 1 80  ? 1.777   -1.320  11.992  1.00 0.00 ? 80  PRO A CA   1  
ATOM 1231  C C    . PRO A 1 80  ? 2.360   -1.503  13.389  1.00 0.00 ? 80  PRO A C    1  
ATOM 1232  O O    . PRO A 1 80  ? 3.445   -2.061  13.551  1.00 0.00 ? 80  PRO A O    1  
ATOM 1233  C CB   . PRO A 1 80  ? 2.442   -0.136  11.286  1.00 0.00 ? 80  PRO A CB   1  
ATOM 1234  C CG   . PRO A 1 80  ? 1.533   1.016   11.542  1.00 0.00 ? 80  PRO A CG   1  
ATOM 1235  C CD   . PRO A 1 80  ? 0.143   0.445   11.590  1.00 0.00 ? 80  PRO A CD   1  
ATOM 1236  H HA   . PRO A 1 80  ? 1.937   -2.220  11.416  1.00 0.00 ? 80  PRO A HA   1  
ATOM 1237  H HB2  . PRO A 1 80  ? 3.423   0.032   11.707  1.00 0.00 ? 80  PRO A HB2  1  
ATOM 1238  H HB3  . PRO A 1 80  ? 2.528   -0.344  10.230  1.00 0.00 ? 80  PRO A HB3  1  
ATOM 1239  H HG2  . PRO A 1 80  ? 1.782   1.477   12.486  1.00 0.00 ? 80  PRO A HG2  1  
ATOM 1240  H HG3  . PRO A 1 80  ? 1.616   1.734   10.739  1.00 0.00 ? 80  PRO A HG3  1  
ATOM 1241  H HD2  . PRO A 1 80  ? -0.461  0.982   12.305  1.00 0.00 ? 80  PRO A HD2  1  
ATOM 1242  H HD3  . PRO A 1 80  ? -0.311  0.476   10.610  1.00 0.00 ? 80  PRO A HD3  1  
ATOM 1243  N N    . ALA A 1 81  ? 1.632   -1.030  14.395  1.00 0.00 ? 81  ALA A N    1  
ATOM 1244  C CA   . ALA A 1 81  ? 2.076   -1.143  15.779  1.00 0.00 ? 81  ALA A CA   1  
ATOM 1245  C C    . ALA A 1 81  ? 1.661   -2.482  16.380  1.00 0.00 ? 81  ALA A C    1  
ATOM 1246  O O    . ALA A 1 81  ? 2.316   -2.994  17.288  1.00 0.00 ? 81  ALA A O    1  
ATOM 1247  C CB   . ALA A 1 81  ? 1.520   0.005   16.608  1.00 0.00 ? 81  ALA A CB   1  
ATOM 1248  H H    . ALA A 1 81  ? 0.776   -0.595  14.202  1.00 0.00 ? 81  ALA A H    1  
ATOM 1249  H HA   . ALA A 1 81  ? 3.154   -1.074  15.790  1.00 0.00 ? 81  ALA A HA   1  
ATOM 1250  H HB1  . ALA A 1 81  ? 1.589   -0.243  17.657  1.00 0.00 ? 81  ALA A HB1  1  
ATOM 1251  H HB2  . ALA A 1 81  ? 2.090   0.900   16.410  1.00 0.00 ? 81  ALA A HB2  1  
ATOM 1252  H HB3  . ALA A 1 81  ? 0.486   0.171   16.345  1.00 0.00 ? 81  ALA A HB3  1  
ATOM 1253  N N    . GLN A 1 82  ? 0.570   -3.042  15.869  1.00 0.00 ? 82  GLN A N    1  
ATOM 1254  C CA   . GLN A 1 82  ? 0.067   -4.321  16.358  1.00 0.00 ? 82  GLN A CA   1  
ATOM 1255  C C    . GLN A 1 82  ? 0.974   -5.466  15.918  1.00 0.00 ? 82  GLN A C    1  
ATOM 1256  O O    . GLN A 1 82  ? 1.191   -6.421  16.664  1.00 0.00 ? 82  GLN A O    1  
ATOM 1257  C CB   . GLN A 1 82  ? -1.357  -4.560  15.854  1.00 0.00 ? 82  GLN A CB   1  
ATOM 1258  C CG   . GLN A 1 82  ? -2.094  -5.654  16.608  1.00 0.00 ? 82  GLN A CG   1  
ATOM 1259  C CD   . GLN A 1 82  ? -2.488  -5.232  18.010  1.00 0.00 ? 82  GLN A CD   1  
ATOM 1260  O OE1  . GLN A 1 82  ? -1.710  -5.369  18.954  1.00 0.00 ? 82  GLN A OE1  1  
ATOM 1261  N NE2  . GLN A 1 82  ? -3.703  -4.716  18.153  1.00 0.00 ? 82  GLN A NE2  1  
ATOM 1262  H H    . GLN A 1 82  ? 0.091   -2.585  15.147  1.00 0.00 ? 82  GLN A H    1  
ATOM 1263  H HA   . GLN A 1 82  ? 0.056   -4.282  17.436  1.00 0.00 ? 82  GLN A HA   1  
ATOM 1264  H HB2  . GLN A 1 82  ? -1.919  -3.643  15.951  1.00 0.00 ? 82  GLN A HB2  1  
ATOM 1265  H HB3  . GLN A 1 82  ? -1.315  -4.838  14.811  1.00 0.00 ? 82  GLN A HB3  1  
ATOM 1266  H HG2  . GLN A 1 82  ? -2.989  -5.911  16.062  1.00 0.00 ? 82  GLN A HG2  1  
ATOM 1267  H HG3  . GLN A 1 82  ? -1.453  -6.521  16.676  1.00 0.00 ? 82  GLN A HG3  1  
ATOM 1268  H HE21 . GLN A 1 82  ? -4.270  -4.638  17.357  1.00 0.00 ? 82  GLN A HE21 1  
ATOM 1269  H HE22 . GLN A 1 82  ? -3.985  -4.435  19.048  1.00 0.00 ? 82  GLN A HE22 1  
ATOM 1270  N N    . LEU A 1 83  ? 1.500   -5.364  14.702  1.00 0.00 ? 83  LEU A N    1  
ATOM 1271  C CA   . LEU A 1 83  ? 2.383   -6.391  14.162  1.00 0.00 ? 83  LEU A CA   1  
ATOM 1272  C C    . LEU A 1 83  ? 3.833   -6.122  14.552  1.00 0.00 ? 83  LEU A C    1  
ATOM 1273  O O    . LEU A 1 83  ? 4.741   -6.840  14.133  1.00 0.00 ? 83  LEU A O    1  
ATOM 1274  C CB   . LEU A 1 83  ? 2.255   -6.453  12.639  1.00 0.00 ? 83  LEU A CB   1  
ATOM 1275  C CG   . LEU A 1 83  ? 0.834   -6.570  12.089  1.00 0.00 ? 83  LEU A CG   1  
ATOM 1276  C CD1  . LEU A 1 83  ? 0.815   -6.292  10.594  1.00 0.00 ? 83  LEU A CD1  1  
ATOM 1277  C CD2  . LEU A 1 83  ? 0.260   -7.949  12.384  1.00 0.00 ? 83  LEU A CD2  1  
ATOM 1278  H H    . LEU A 1 83  ? 1.290   -4.579  14.154  1.00 0.00 ? 83  LEU A H    1  
ATOM 1279  H HA   . LEU A 1 83  ? 2.081   -7.340  14.579  1.00 0.00 ? 83  LEU A HA   1  
ATOM 1280  H HB2  . LEU A 1 83  ? 2.693   -5.553  12.234  1.00 0.00 ? 83  LEU A HB2  1  
ATOM 1281  H HB3  . LEU A 1 83  ? 2.816   -7.310  12.295  1.00 0.00 ? 83  LEU A HB3  1  
ATOM 1282  H HG   . LEU A 1 83  ? 0.205   -5.835  12.573  1.00 0.00 ? 83  LEU A HG   1  
ATOM 1283  H HD11 . LEU A 1 83  ? 1.712   -5.762  10.316  1.00 0.00 ? 83  LEU A HD11 1  
ATOM 1284  H HD12 . LEU A 1 83  ? -0.049  -5.691  10.351  1.00 0.00 ? 83  LEU A HD12 1  
ATOM 1285  H HD13 . LEU A 1 83  ? 0.766   -7.227  10.055  1.00 0.00 ? 83  LEU A HD13 1  
ATOM 1286  H HD21 . LEU A 1 83  ? 0.267   -8.542  11.482  1.00 0.00 ? 83  LEU A HD21 1  
ATOM 1287  H HD22 . LEU A 1 83  ? -0.755  -7.847  12.741  1.00 0.00 ? 83  LEU A HD22 1  
ATOM 1288  H HD23 . LEU A 1 83  ? 0.860   -8.434  13.139  1.00 0.00 ? 83  LEU A HD23 1  
ATOM 1289  N N    . GLU A 1 84  ? 4.042   -5.086  15.357  1.00 0.00 ? 84  GLU A N    1  
ATOM 1290  C CA   . GLU A 1 84  ? 5.382   -4.724  15.804  1.00 0.00 ? 84  GLU A CA   1  
ATOM 1291  C C    . GLU A 1 84  ? 6.264   -4.336  14.621  1.00 0.00 ? 84  GLU A C    1  
ATOM 1292  O O    . GLU A 1 84  ? 7.446   -4.675  14.577  1.00 0.00 ? 84  GLU A O    1  
ATOM 1293  C CB   . GLU A 1 84  ? 6.019   -5.885  16.571  1.00 0.00 ? 84  GLU A CB   1  
ATOM 1294  C CG   . GLU A 1 84  ? 5.614   -5.943  18.034  1.00 0.00 ? 84  GLU A CG   1  
ATOM 1295  C CD   . GLU A 1 84  ? 6.254   -7.104  18.770  1.00 0.00 ? 84  GLU A CD   1  
ATOM 1296  O OE1  . GLU A 1 84  ? 5.863   -8.261  18.507  1.00 0.00 ? 84  GLU A OE1  1  
ATOM 1297  O OE2  . GLU A 1 84  ? 7.145   -6.857  19.610  1.00 0.00 ? 84  GLU A OE2  1  
ATOM 1298  H H    . GLU A 1 84  ? 3.277   -4.552  15.658  1.00 0.00 ? 84  GLU A H    1  
ATOM 1299  H HA   . GLU A 1 84  ? 5.293   -3.874  16.464  1.00 0.00 ? 84  GLU A HA   1  
ATOM 1300  H HB2  . GLU A 1 84  ? 5.729   -6.813  16.100  1.00 0.00 ? 84  GLU A HB2  1  
ATOM 1301  H HB3  . GLU A 1 84  ? 7.093   -5.787  16.520  1.00 0.00 ? 84  GLU A HB3  1  
ATOM 1302  H HG2  . GLU A 1 84  ? 5.914   -5.024  18.514  1.00 0.00 ? 84  GLU A HG2  1  
ATOM 1303  H HG3  . GLU A 1 84  ? 4.541   -6.045  18.093  1.00 0.00 ? 84  GLU A HG3  1  
ATOM 1304  N N    . MET A 1 85  ? 5.679   -3.625  13.662  1.00 0.00 ? 85  MET A N    1  
ATOM 1305  C CA   . MET A 1 85  ? 6.412   -3.191  12.479  1.00 0.00 ? 85  MET A CA   1  
ATOM 1306  C C    . MET A 1 85  ? 7.558   -2.259  12.860  1.00 0.00 ? 85  MET A C    1  
ATOM 1307  O O    . MET A 1 85  ? 7.336   -1.107  13.230  1.00 0.00 ? 85  MET A O    1  
ATOM 1308  C CB   . MET A 1 85  ? 5.471   -2.486  11.500  1.00 0.00 ? 85  MET A CB   1  
ATOM 1309  C CG   . MET A 1 85  ? 4.408   -3.400  10.914  1.00 0.00 ? 85  MET A CG   1  
ATOM 1310  S SD   . MET A 1 85  ? 3.597   -2.687  9.470   1.00 0.00 ? 85  MET A SD   1  
ATOM 1311  C CE   . MET A 1 85  ? 3.902   -3.959  8.247   1.00 0.00 ? 85  MET A CE   1  
ATOM 1312  H H    . MET A 1 85  ? 4.734   -3.385  13.753  1.00 0.00 ? 85  MET A H    1  
ATOM 1313  H HA   . MET A 1 85  ? 6.820   -4.069  12.001  1.00 0.00 ? 85  MET A HA   1  
ATOM 1314  H HB2  . MET A 1 85  ? 4.974   -1.677  12.016  1.00 0.00 ? 85  MET A HB2  1  
ATOM 1315  H HB3  . MET A 1 85  ? 6.053   -2.080  10.687  1.00 0.00 ? 85  MET A HB3  1  
ATOM 1316  H HG2  . MET A 1 85  ? 4.872   -4.331  10.624  1.00 0.00 ? 85  MET A HG2  1  
ATOM 1317  H HG3  . MET A 1 85  ? 3.662   -3.593  11.670  1.00 0.00 ? 85  MET A HG3  1  
ATOM 1318  H HE1  . MET A 1 85  ? 4.932   -4.277  8.307   1.00 0.00 ? 85  MET A HE1  1  
ATOM 1319  H HE2  . MET A 1 85  ? 3.254   -4.802  8.435   1.00 0.00 ? 85  MET A HE2  1  
ATOM 1320  H HE3  . MET A 1 85  ? 3.704   -3.564  7.260   1.00 0.00 ? 85  MET A HE3  1  
ATOM 1321  N N    . GLU A 1 86  ? 8.783   -2.767  12.767  1.00 0.00 ? 86  GLU A N    1  
ATOM 1322  C CA   . GLU A 1 86  ? 9.964   -1.980  13.104  1.00 0.00 ? 86  GLU A CA   1  
ATOM 1323  C C    . GLU A 1 86  ? 10.308  -1.007  11.979  1.00 0.00 ? 86  GLU A C    1  
ATOM 1324  O O    . GLU A 1 86  ? 9.631   -0.965  10.952  1.00 0.00 ? 86  GLU A O    1  
ATOM 1325  C CB   . GLU A 1 86  ? 11.155  -2.899  13.380  1.00 0.00 ? 86  GLU A CB   1  
ATOM 1326  C CG   . GLU A 1 86  ? 10.939  -3.839  14.554  1.00 0.00 ? 86  GLU A CG   1  
ATOM 1327  C CD   . GLU A 1 86  ? 10.296  -5.149  14.140  1.00 0.00 ? 86  GLU A CD   1  
ATOM 1328  O OE1  . GLU A 1 86  ? 9.809   -5.236  12.994  1.00 0.00 ? 86  GLU A OE1  1  
ATOM 1329  O OE2  . GLU A 1 86  ? 10.280  -6.087  14.965  1.00 0.00 ? 86  GLU A OE2  1  
ATOM 1330  H H    . GLU A 1 86  ? 8.896   -3.693  12.466  1.00 0.00 ? 86  GLU A H    1  
ATOM 1331  H HA   . GLU A 1 86  ? 9.742   -1.415  13.996  1.00 0.00 ? 86  GLU A HA   1  
ATOM 1332  H HB2  . GLU A 1 86  ? 11.349  -3.493  12.499  1.00 0.00 ? 86  GLU A HB2  1  
ATOM 1333  H HB3  . GLU A 1 86  ? 12.022  -2.290  13.590  1.00 0.00 ? 86  GLU A HB3  1  
ATOM 1334  H HG2  . GLU A 1 86  ? 11.895  -4.053  15.008  1.00 0.00 ? 86  GLU A HG2  1  
ATOM 1335  H HG3  . GLU A 1 86  ? 10.300  -3.353  15.275  1.00 0.00 ? 86  GLU A HG3  1  
ATOM 1336  N N    . ASP A 1 87  ? 11.363  -0.227  12.182  1.00 0.00 ? 87  ASP A N    1  
ATOM 1337  C CA   . ASP A 1 87  ? 11.798  0.746   11.186  1.00 0.00 ? 87  ASP A CA   1  
ATOM 1338  C C    . ASP A 1 87  ? 12.593  0.067   10.075  1.00 0.00 ? 87  ASP A C    1  
ATOM 1339  O O    . ASP A 1 87  ? 13.326  -0.890  10.320  1.00 0.00 ? 87  ASP A O    1  
ATOM 1340  C CB   . ASP A 1 87  ? 12.646  1.836   11.844  1.00 0.00 ? 87  ASP A CB   1  
ATOM 1341  C CG   . ASP A 1 87  ? 11.808  2.832   12.620  1.00 0.00 ? 87  ASP A CG   1  
ATOM 1342  O OD1  . ASP A 1 87  ? 11.512  2.564   13.804  1.00 0.00 ? 87  ASP A OD1  1  
ATOM 1343  O OD2  . ASP A 1 87  ? 11.449  3.880   12.045  1.00 0.00 ? 87  ASP A OD2  1  
ATOM 1344  H H    . ASP A 1 87  ? 11.863  -0.307  13.022  1.00 0.00 ? 87  ASP A H    1  
ATOM 1345  H HA   . ASP A 1 87  ? 10.917  1.198   10.757  1.00 0.00 ? 87  ASP A HA   1  
ATOM 1346  H HB2  . ASP A 1 87  ? 13.348  1.376   12.525  1.00 0.00 ? 87  ASP A HB2  1  
ATOM 1347  H HB3  . ASP A 1 87  ? 13.191  2.369   11.078  1.00 0.00 ? 87  ASP A HB3  1  
ATOM 1348  N N    . GLU A 1 88  ? 12.440  0.569   8.854   1.00 0.00 ? 88  GLU A N    1  
ATOM 1349  C CA   . GLU A 1 88  ? 13.142  0.009   7.705   1.00 0.00 ? 88  GLU A CA   1  
ATOM 1350  C C    . GLU A 1 88  ? 12.722  -1.438  7.463   1.00 0.00 ? 88  GLU A C    1  
ATOM 1351  O O    . GLU A 1 88  ? 13.551  -2.291  7.145   1.00 0.00 ? 88  GLU A O    1  
ATOM 1352  C CB   . GLU A 1 88  ? 14.655  0.084   7.918   1.00 0.00 ? 88  GLU A CB   1  
ATOM 1353  C CG   . GLU A 1 88  ? 15.194  1.504   7.963   1.00 0.00 ? 88  GLU A CG   1  
ATOM 1354  C CD   . GLU A 1 88  ? 14.876  2.207   9.269   1.00 0.00 ? 88  GLU A CD   1  
ATOM 1355  O OE1  . GLU A 1 88  ? 15.307  1.710   10.330  1.00 0.00 ? 88  GLU A OE1  1  
ATOM 1356  O OE2  . GLU A 1 88  ? 14.197  3.254   9.228   1.00 0.00 ? 88  GLU A OE2  1  
ATOM 1357  H H    . GLU A 1 88  ? 11.841  1.333   8.722   1.00 0.00 ? 88  GLU A H    1  
ATOM 1358  H HA   . GLU A 1 88  ? 12.880  0.596   6.838   1.00 0.00 ? 88  GLU A HA   1  
ATOM 1359  H HB2  . GLU A 1 88  ? 14.900  -0.403  8.850   1.00 0.00 ? 88  GLU A HB2  1  
ATOM 1360  H HB3  . GLU A 1 88  ? 15.146  -0.439  7.110   1.00 0.00 ? 88  GLU A HB3  1  
ATOM 1361  H HG2  . GLU A 1 88  ? 16.266  1.473   7.841   1.00 0.00 ? 88  GLU A HG2  1  
ATOM 1362  H HG3  . GLU A 1 88  ? 14.756  2.067   7.152   1.00 0.00 ? 88  GLU A HG3  1  
ATOM 1363  N N    . ASP A 1 89  ? 11.431  -1.707  7.618   1.00 0.00 ? 89  ASP A N    1  
ATOM 1364  C CA   . ASP A 1 89  ? 10.900  -3.050  7.416   1.00 0.00 ? 89  ASP A CA   1  
ATOM 1365  C C    . ASP A 1 89  ? 10.576  -3.292  5.945   1.00 0.00 ? 89  ASP A C    1  
ATOM 1366  O O    . ASP A 1 89  ? 10.842  -2.445  5.092   1.00 0.00 ? 89  ASP A O    1  
ATOM 1367  C CB   . ASP A 1 89  ? 9.647   -3.260  8.268   1.00 0.00 ? 89  ASP A CB   1  
ATOM 1368  C CG   . ASP A 1 89  ? 9.450   -4.710  8.663   1.00 0.00 ? 89  ASP A CG   1  
ATOM 1369  O OD1  . ASP A 1 89  ? 8.860   -5.467  7.864   1.00 0.00 ? 89  ASP A OD1  1  
ATOM 1370  O OD2  . ASP A 1 89  ? 9.886   -5.089  9.770   1.00 0.00 ? 89  ASP A OD2  1  
ATOM 1371  H H    . ASP A 1 89  ? 10.819  -0.984  7.873   1.00 0.00 ? 89  ASP A H    1  
ATOM 1372  H HA   . ASP A 1 89  ? 11.656  -3.756  7.726   1.00 0.00 ? 89  ASP A HA   1  
ATOM 1373  H HB2  . ASP A 1 89  ? 9.729   -2.669  9.169   1.00 0.00 ? 89  ASP A HB2  1  
ATOM 1374  H HB3  . ASP A 1 89  ? 8.781   -2.936  7.709   1.00 0.00 ? 89  ASP A HB3  1  
ATOM 1375  N N    . THR A 1 90  ? 10.000  -4.454  5.654   1.00 0.00 ? 90  THR A N    1  
ATOM 1376  C CA   . THR A 1 90  ? 9.642   -4.808  4.287   1.00 0.00 ? 90  THR A CA   1  
ATOM 1377  C C    . THR A 1 90  ? 8.275   -5.481  4.233   1.00 0.00 ? 90  THR A C    1  
ATOM 1378  O O    . THR A 1 90  ? 7.984   -6.380  5.023   1.00 0.00 ? 90  THR A O    1  
ATOM 1379  C CB   . THR A 1 90  ? 10.689  -5.747  3.657   1.00 0.00 ? 90  THR A CB   1  
ATOM 1380  O OG1  . THR A 1 90  ? 12.000  -5.193  3.813   1.00 0.00 ? 90  THR A OG1  1  
ATOM 1381  C CG2  . THR A 1 90  ? 10.398  -5.968  2.180   1.00 0.00 ? 90  THR A CG2  1  
ATOM 1382  H H    . THR A 1 90  ? 9.813   -5.088  6.378   1.00 0.00 ? 90  THR A H    1  
ATOM 1383  H HA   . THR A 1 90  ? 9.608   -3.899  3.705   1.00 0.00 ? 90  THR A HA   1  
ATOM 1384  H HB   . THR A 1 90  ? 10.646  -6.701  4.164   1.00 0.00 ? 90  THR A HB   1  
ATOM 1385  H HG1  . THR A 1 90  ? 12.577  -5.538  3.128   1.00 0.00 ? 90  THR A HG1  1  
ATOM 1386  H HG21 . THR A 1 90  ? 10.696  -5.094  1.620   1.00 0.00 ? 90  THR A HG21 1  
ATOM 1387  H HG22 . THR A 1 90  ? 9.341   -6.141  2.043   1.00 0.00 ? 90  THR A HG22 1  
ATOM 1388  H HG23 . THR A 1 90  ? 10.952  -6.826  1.830   1.00 0.00 ? 90  THR A HG23 1  
ATOM 1389  N N    . ILE A 1 91  ? 7.441   -5.041  3.297   1.00 0.00 ? 91  ILE A N    1  
ATOM 1390  C CA   . ILE A 1 91  ? 6.105   -5.603  3.140   1.00 0.00 ? 91  ILE A CA   1  
ATOM 1391  C C    . ILE A 1 91  ? 6.073   -6.642  2.025   1.00 0.00 ? 91  ILE A C    1  
ATOM 1392  O O    . ILE A 1 91  ? 6.926   -6.641  1.137   1.00 0.00 ? 91  ILE A O    1  
ATOM 1393  C CB   . ILE A 1 91  ? 5.066   -4.508  2.836   1.00 0.00 ? 91  ILE A CB   1  
ATOM 1394  C CG1  . ILE A 1 91  ? 5.198   -3.357  3.835   1.00 0.00 ? 91  ILE A CG1  1  
ATOM 1395  C CG2  . ILE A 1 91  ? 3.660   -5.087  2.870   1.00 0.00 ? 91  ILE A CG2  1  
ATOM 1396  C CD1  . ILE A 1 91  ? 4.131   -2.295  3.679   1.00 0.00 ? 91  ILE A CD1  1  
ATOM 1397  H H    . ILE A 1 91  ? 7.730   -4.322  2.698   1.00 0.00 ? 91  ILE A H    1  
ATOM 1398  H HA   . ILE A 1 91  ? 5.833   -6.080  4.071   1.00 0.00 ? 91  ILE A HA   1  
ATOM 1399  H HB   . ILE A 1 91  ? 5.251   -4.134  1.840   1.00 0.00 ? 91  ILE A HB   1  
ATOM 1400  H HG12 . ILE A 1 91  ? 5.130   -3.749  4.838   1.00 0.00 ? 91  ILE A HG12 1  
ATOM 1401  H HG13 . ILE A 1 91  ? 6.160   -2.883  3.703   1.00 0.00 ? 91  ILE A HG13 1  
ATOM 1402  H HG21 . ILE A 1 91  ? 3.416   -5.497  1.900   1.00 0.00 ? 91  ILE A HG21 1  
ATOM 1403  H HG22 . ILE A 1 91  ? 3.611   -5.870  3.612   1.00 0.00 ? 91  ILE A HG22 1  
ATOM 1404  H HG23 . ILE A 1 91  ? 2.955   -4.309  3.119   1.00 0.00 ? 91  ILE A HG23 1  
ATOM 1405  H HD11 . ILE A 1 91  ? 4.590   -1.318  3.695   1.00 0.00 ? 91  ILE A HD11 1  
ATOM 1406  H HD12 . ILE A 1 91  ? 3.617   -2.437  2.740   1.00 0.00 ? 91  ILE A HD12 1  
ATOM 1407  H HD13 . ILE A 1 91  ? 3.424   -2.373  4.492   1.00 0.00 ? 91  ILE A HD13 1  
ATOM 1408  N N    . ASP A 1 92  ? 5.084   -7.527  2.077   1.00 0.00 ? 92  ASP A N    1  
ATOM 1409  C CA   . ASP A 1 92  ? 4.938   -8.571  1.069   1.00 0.00 ? 92  ASP A CA   1  
ATOM 1410  C C    . ASP A 1 92  ? 3.716   -8.315  0.193   1.00 0.00 ? 92  ASP A C    1  
ATOM 1411  O O    . ASP A 1 92  ? 2.590   -8.241  0.686   1.00 0.00 ? 92  ASP A O    1  
ATOM 1412  C CB   . ASP A 1 92  ? 4.824   -9.942  1.737   1.00 0.00 ? 92  ASP A CB   1  
ATOM 1413  C CG   . ASP A 1 92  ? 6.170   -10.490 2.169   1.00 0.00 ? 92  ASP A CG   1  
ATOM 1414  O OD1  . ASP A 1 92  ? 6.776   -9.912  3.096   1.00 0.00 ? 92  ASP A OD1  1  
ATOM 1415  O OD2  . ASP A 1 92  ? 6.617   -11.496 1.581   1.00 0.00 ? 92  ASP A OD2  1  
ATOM 1416  H H    . ASP A 1 92  ? 4.435   -7.476  2.810   1.00 0.00 ? 92  ASP A H    1  
ATOM 1417  H HA   . ASP A 1 92  ? 5.820   -8.557  0.447   1.00 0.00 ? 92  ASP A HA   1  
ATOM 1418  H HB2  . ASP A 1 92  ? 4.194   -9.858  2.610   1.00 0.00 ? 92  ASP A HB2  1  
ATOM 1419  H HB3  . ASP A 1 92  ? 4.378   -10.638 1.042   1.00 0.00 ? 92  ASP A HB3  1  
ATOM 1420  N N    . VAL A 1 93  ? 3.945   -8.179  -1.109  1.00 0.00 ? 93  VAL A N    1  
ATOM 1421  C CA   . VAL A 1 93  ? 2.863   -7.931  -2.054  1.00 0.00 ? 93  VAL A CA   1  
ATOM 1422  C C    . VAL A 1 93  ? 3.135   -8.609  -3.392  1.00 0.00 ? 93  VAL A C    1  
ATOM 1423  O O    . VAL A 1 93  ? 4.287   -8.841  -3.759  1.00 0.00 ? 93  VAL A O    1  
ATOM 1424  C CB   . VAL A 1 93  ? 2.657   -6.422  -2.288  1.00 0.00 ? 93  VAL A CB   1  
ATOM 1425  C CG1  . VAL A 1 93  ? 1.505   -6.184  -3.253  1.00 0.00 ? 93  VAL A CG1  1  
ATOM 1426  C CG2  . VAL A 1 93  ? 2.414   -5.707  -0.968  1.00 0.00 ? 93  VAL A CG2  1  
ATOM 1427  H H    . VAL A 1 93  ? 4.864   -8.248  -1.443  1.00 0.00 ? 93  VAL A H    1  
ATOM 1428  H HA   . VAL A 1 93  ? 1.953   -8.336  -1.634  1.00 0.00 ? 93  VAL A HA   1  
ATOM 1429  H HB   . VAL A 1 93  ? 3.556   -6.021  -2.730  1.00 0.00 ? 93  VAL A HB   1  
ATOM 1430  H HG11 . VAL A 1 93  ? 0.761   -6.955  -3.122  1.00 0.00 ? 93  VAL A HG11 1  
ATOM 1431  H HG12 . VAL A 1 93  ? 1.063   -5.218  -3.055  1.00 0.00 ? 93  VAL A HG12 1  
ATOM 1432  H HG13 . VAL A 1 93  ? 1.874   -6.210  -4.267  1.00 0.00 ? 93  VAL A HG13 1  
ATOM 1433  H HG21 . VAL A 1 93  ? 1.587   -6.174  -0.453  1.00 0.00 ? 93  VAL A HG21 1  
ATOM 1434  H HG22 . VAL A 1 93  ? 3.301   -5.771  -0.355  1.00 0.00 ? 93  VAL A HG22 1  
ATOM 1435  H HG23 . VAL A 1 93  ? 2.181   -4.670  -1.157  1.00 0.00 ? 93  VAL A HG23 1  
ATOM 1436  N N    . PHE A 1 94  ? 2.067   -8.924  -4.118  1.00 0.00 ? 94  PHE A N    1  
ATOM 1437  C CA   . PHE A 1 94  ? 2.190   -9.576  -5.416  1.00 0.00 ? 94  PHE A CA   1  
ATOM 1438  C C    . PHE A 1 94  ? 1.613   -8.698  -6.523  1.00 0.00 ? 94  PHE A C    1  
ATOM 1439  O O    . PHE A 1 94  ? 0.401   -8.503  -6.604  1.00 0.00 ? 94  PHE A O    1  
ATOM 1440  C CB   . PHE A 1 94  ? 1.478   -10.930 -5.400  1.00 0.00 ? 94  PHE A CB   1  
ATOM 1441  C CG   . PHE A 1 94  ? 1.870   -11.799 -4.239  1.00 0.00 ? 94  PHE A CG   1  
ATOM 1442  C CD1  . PHE A 1 94  ? 1.468   -11.481 -2.952  1.00 0.00 ? 94  PHE A CD1  1  
ATOM 1443  C CD2  . PHE A 1 94  ? 2.639   -12.935 -4.435  1.00 0.00 ? 94  PHE A CD2  1  
ATOM 1444  C CE1  . PHE A 1 94  ? 1.828   -12.279 -1.882  1.00 0.00 ? 94  PHE A CE1  1  
ATOM 1445  C CE2  . PHE A 1 94  ? 3.002   -13.737 -3.369  1.00 0.00 ? 94  PHE A CE2  1  
ATOM 1446  C CZ   . PHE A 1 94  ? 2.594   -13.408 -2.091  1.00 0.00 ? 94  PHE A CZ   1  
ATOM 1447  H H    . PHE A 1 94  ? 1.175   -8.713  -3.771  1.00 0.00 ? 94  PHE A H    1  
ATOM 1448  H HA   . PHE A 1 94  ? 3.240   -9.733  -5.609  1.00 0.00 ? 94  PHE A HA   1  
ATOM 1449  H HB2  . PHE A 1 94  ? 0.412   -10.768 -5.347  1.00 0.00 ? 94  PHE A HB2  1  
ATOM 1450  H HB3  . PHE A 1 94  ? 1.713   -11.463 -6.309  1.00 0.00 ? 94  PHE A HB3  1  
ATOM 1451  H HD1  . PHE A 1 94  ? 0.868   -10.598 -2.787  1.00 0.00 ? 94  PHE A HD1  1  
ATOM 1452  H HD2  . PHE A 1 94  ? 2.958   -13.193 -5.435  1.00 0.00 ? 94  PHE A HD2  1  
ATOM 1453  H HE1  . PHE A 1 94  ? 1.508   -12.020 -0.884  1.00 0.00 ? 94  PHE A HE1  1  
ATOM 1454  H HE2  . PHE A 1 94  ? 3.601   -14.619 -3.536  1.00 0.00 ? 94  PHE A HE2  1  
ATOM 1455  H HZ   . PHE A 1 94  ? 2.877   -14.033 -1.257  1.00 0.00 ? 94  PHE A HZ   1  
ATOM 1456  N N    . GLN A 1 95  ? 2.490   -8.172  -7.371  1.00 0.00 ? 95  GLN A N    1  
ATOM 1457  C CA   . GLN A 1 95  ? 2.068   -7.314  -8.472  1.00 0.00 ? 95  GLN A CA   1  
ATOM 1458  C C    . GLN A 1 95  ? 1.870   -8.125  -9.749  1.00 0.00 ? 95  GLN A C    1  
ATOM 1459  O O    . GLN A 1 95  ? 2.838   -8.518  -10.400 1.00 0.00 ? 95  GLN A O    1  
ATOM 1460  C CB   . GLN A 1 95  ? 3.098   -6.209  -8.710  1.00 0.00 ? 95  GLN A CB   1  
ATOM 1461  C CG   . GLN A 1 95  ? 2.842   -4.953  -7.893  1.00 0.00 ? 95  GLN A CG   1  
ATOM 1462  C CD   . GLN A 1 95  ? 3.463   -3.717  -8.513  1.00 0.00 ? 95  GLN A CD   1  
ATOM 1463  O OE1  . GLN A 1 95  ? 3.678   -3.657  -9.724  1.00 0.00 ? 95  GLN A OE1  1  
ATOM 1464  N NE2  . GLN A 1 95  ? 3.754   -2.721  -7.685  1.00 0.00 ? 95  GLN A NE2  1  
ATOM 1465  H H    . GLN A 1 95  ? 3.443   -8.365  -7.254  1.00 0.00 ? 95  GLN A H    1  
ATOM 1466  H HA   . GLN A 1 95  ? 1.126   -6.863  -8.198  1.00 0.00 ? 95  GLN A HA   1  
ATOM 1467  H HB2  . GLN A 1 95  ? 4.078   -6.586  -8.455  1.00 0.00 ? 95  GLN A HB2  1  
ATOM 1468  H HB3  . GLN A 1 95  ? 3.086   -5.941  -9.756  1.00 0.00 ? 95  GLN A HB3  1  
ATOM 1469  H HG2  . GLN A 1 95  ? 1.776   -4.801  -7.815  1.00 0.00 ? 95  GLN A HG2  1  
ATOM 1470  H HG3  . GLN A 1 95  ? 3.258   -5.090  -6.906  1.00 0.00 ? 95  GLN A HG3  1  
ATOM 1471  H HE21 . GLN A 1 95  ? 3.556   -2.839  -6.731  1.00 0.00 ? 95  GLN A HE21 1  
ATOM 1472  H HE22 . GLN A 1 95  ? 4.157   -1.911  -8.058  1.00 0.00 ? 95  GLN A HE22 1  
ATOM 1473  N N    . GLN A 1 96  ? 0.612   -8.371  -10.099 1.00 0.00 ? 96  GLN A N    1  
ATOM 1474  C CA   . GLN A 1 96  ? 0.289   -9.136  -11.298 1.00 0.00 ? 96  GLN A CA   1  
ATOM 1475  C C    . GLN A 1 96  ? 0.212   -8.226  -12.520 1.00 0.00 ? 96  GLN A C    1  
ATOM 1476  O O    . GLN A 1 96  ? -0.217  -7.076  -12.422 1.00 0.00 ? 96  GLN A O    1  
ATOM 1477  C CB   . GLN A 1 96  ? -1.037  -9.876  -11.114 1.00 0.00 ? 96  GLN A CB   1  
ATOM 1478  C CG   . GLN A 1 96  ? -0.880  -11.264 -10.514 1.00 0.00 ? 96  GLN A CG   1  
ATOM 1479  C CD   . GLN A 1 96  ? -2.185  -12.035 -10.478 1.00 0.00 ? 96  GLN A CD   1  
ATOM 1480  O OE1  . GLN A 1 96  ? -3.055  -11.846 -11.329 1.00 0.00 ? 96  GLN A OE1  1  
ATOM 1481  N NE2  . GLN A 1 96  ? -2.328  -12.911 -9.490  1.00 0.00 ? 96  GLN A NE2  1  
ATOM 1482  H H    . GLN A 1 96  ? -0.115  -8.030  -9.539  1.00 0.00 ? 96  GLN A H    1  
ATOM 1483  H HA   . GLN A 1 96  ? 1.076   -9.858  -11.452 1.00 0.00 ? 96  GLN A HA   1  
ATOM 1484  H HB2  . GLN A 1 96  ? -1.672  -9.295  -10.463 1.00 0.00 ? 96  GLN A HB2  1  
ATOM 1485  H HB3  . GLN A 1 96  ? -1.516  -9.976  -12.077 1.00 0.00 ? 96  GLN A HB3  1  
ATOM 1486  H HG2  . GLN A 1 96  ? -0.168  -11.820 -11.106 1.00 0.00 ? 96  GLN A HG2  1  
ATOM 1487  H HG3  . GLN A 1 96  ? -0.508  -11.166 -9.505  1.00 0.00 ? 96  GLN A HG3  1  
ATOM 1488  H HE21 . GLN A 1 96  ? -1.593  -13.008 -8.848  1.00 0.00 ? 96  GLN A HE21 1  
ATOM 1489  H HE22 . GLN A 1 96  ? -3.161  -13.422 -9.442  1.00 0.00 ? 96  GLN A HE22 1  
ATOM 1490  N N    . GLN A 1 97  ? 0.629   -8.749  -13.668 1.00 0.00 ? 97  GLN A N    1  
ATOM 1491  C CA   . GLN A 1 97  ? 0.607   -7.983  -14.908 1.00 0.00 ? 97  GLN A CA   1  
ATOM 1492  C C    . GLN A 1 97  ? -0.754  -8.084  -15.587 1.00 0.00 ? 97  GLN A C    1  
ATOM 1493  O O    . GLN A 1 97  ? -1.051  -9.069  -16.265 1.00 0.00 ? 97  GLN A O    1  
ATOM 1494  C CB   . GLN A 1 97  ? 1.702   -8.476  -15.857 1.00 0.00 ? 97  GLN A CB   1  
ATOM 1495  C CG   . GLN A 1 97  ? 3.110   -8.264  -15.324 1.00 0.00 ? 97  GLN A CG   1  
ATOM 1496  C CD   . GLN A 1 97  ? 4.161   -8.975  -16.153 1.00 0.00 ? 97  GLN A CD   1  
ATOM 1497  O OE1  . GLN A 1 97  ? 4.834   -9.887  -15.674 1.00 0.00 ? 97  GLN A OE1  1  
ATOM 1498  N NE2  . GLN A 1 97  ? 4.307   -8.560  -17.406 1.00 0.00 ? 97  GLN A NE2  1  
ATOM 1499  H H    . GLN A 1 97  ? 0.959   -9.671  -13.681 1.00 0.00 ? 97  GLN A H    1  
ATOM 1500  H HA   . GLN A 1 97  ? 0.797   -6.949  -14.662 1.00 0.00 ? 97  GLN A HA   1  
ATOM 1501  H HB2  . GLN A 1 97  ? 1.561   -9.532  -16.031 1.00 0.00 ? 97  GLN A HB2  1  
ATOM 1502  H HB3  . GLN A 1 97  ? 1.612   -7.950  -16.795 1.00 0.00 ? 97  GLN A HB3  1  
ATOM 1503  H HG2  . GLN A 1 97  ? 3.326   -7.206  -15.328 1.00 0.00 ? 97  GLN A HG2  1  
ATOM 1504  H HG3  . GLN A 1 97  ? 3.157   -8.637  -14.312 1.00 0.00 ? 97  GLN A HG3  1  
ATOM 1505  H HE21 . GLN A 1 97  ? 3.736   -7.827  -17.720 1.00 0.00 ? 97  GLN A HE21 1  
ATOM 1506  H HE22 . GLN A 1 97  ? 4.979   -9.001  -17.965 1.00 0.00 ? 97  GLN A HE22 1  
ATOM 1507  N N    . THR A 1 98  ? -1.581  -7.059  -15.402 1.00 0.00 ? 98  THR A N    1  
ATOM 1508  C CA   . THR A 1 98  ? -2.912  -7.034  -15.995 1.00 0.00 ? 98  THR A CA   1  
ATOM 1509  C C    . THR A 1 98  ? -3.183  -5.700  -16.680 1.00 0.00 ? 98  THR A C    1  
ATOM 1510  O O    . THR A 1 98  ? -3.698  -4.767  -16.064 1.00 0.00 ? 98  THR A O    1  
ATOM 1511  C CB   . THR A 1 98  ? -4.003  -7.286  -14.937 1.00 0.00 ? 98  THR A CB   1  
ATOM 1512  O OG1  . THR A 1 98  ? -3.807  -6.418  -13.815 1.00 0.00 ? 98  THR A OG1  1  
ATOM 1513  C CG2  . THR A 1 98  ? -3.984  -8.735  -14.474 1.00 0.00 ? 98  THR A CG2  1  
ATOM 1514  H H    . THR A 1 98  ? -1.287  -6.304  -14.852 1.00 0.00 ? 98  THR A H    1  
ATOM 1515  H HA   . THR A 1 98  ? -2.964  -7.823  -16.731 1.00 0.00 ? 98  THR A HA   1  
ATOM 1516  H HB   . THR A 1 98  ? -4.967  -7.077  -15.380 1.00 0.00 ? 98  THR A HB   1  
ATOM 1517  H HG1  . THR A 1 98  ? -3.253  -6.857  -13.164 1.00 0.00 ? 98  THR A HG1  1  
ATOM 1518  H HG21 . THR A 1 98  ? -4.422  -8.804  -13.489 1.00 0.00 ? 98  THR A HG21 1  
ATOM 1519  H HG22 . THR A 1 98  ? -2.964  -9.088  -14.441 1.00 0.00 ? 98  THR A HG22 1  
ATOM 1520  H HG23 . THR A 1 98  ? -4.553  -9.340  -15.164 1.00 0.00 ? 98  THR A HG23 1  
ATOM 1521  N N    . SER A 1 99  ? -2.833  -5.615  -17.960 1.00 0.00 ? 99  SER A N    1  
ATOM 1522  C CA   . SER A 1 99  ? -3.036  -4.393  -18.729 1.00 0.00 ? 99  SER A CA   1  
ATOM 1523  C C    . SER A 1 99  ? -4.515  -4.024  -18.782 1.00 0.00 ? 99  SER A C    1  
ATOM 1524  O O    . SER A 1 99  ? -5.386  -4.885  -18.660 1.00 0.00 ? 99  SER A O    1  
ATOM 1525  C CB   . SER A 1 99  ? -2.489  -4.561  -20.148 1.00 0.00 ? 99  SER A CB   1  
ATOM 1526  O OG   . SER A 1 99  ? -3.371  -5.330  -20.947 1.00 0.00 ? 99  SER A OG   1  
ATOM 1527  H H    . SER A 1 99  ? -2.426  -6.393  -18.396 1.00 0.00 ? 99  SER A H    1  
ATOM 1528  H HA   . SER A 1 99  ? -2.496  -3.598  -18.236 1.00 0.00 ? 99  SER A HA   1  
ATOM 1529  H HB2  . SER A 1 99  ? -2.366  -3.589  -20.601 1.00 0.00 ? 99  SER A HB2  1  
ATOM 1530  H HB3  . SER A 1 99  ? -1.532  -5.061  -20.105 1.00 0.00 ? 99  SER A HB3  1  
ATOM 1531  H HG   . SER A 1 99  ? -3.056  -5.339  -21.854 1.00 0.00 ? 99  SER A HG   1  
ATOM 1532  N N    . GLY A 1 100 ? -4.792  -2.737  -18.967 1.00 0.00 ? 100 GLY A N    1  
ATOM 1533  C CA   . GLY A 1 100 ? -6.166  -2.275  -19.033 1.00 0.00 ? 100 GLY A CA   1  
ATOM 1534  C C    . GLY A 1 100 ? -6.519  -1.700  -20.391 1.00 0.00 ? 100 GLY A C    1  
ATOM 1535  O O    . GLY A 1 100 ? -5.689  -1.093  -21.067 1.00 0.00 ? 100 GLY A O    1  
ATOM 1536  H H    . GLY A 1 100 ? -4.056  -2.095  -19.058 1.00 0.00 ? 100 GLY A H    1  
ATOM 1537  H HA2  . GLY A 1 100 ? -6.824  -3.105  -18.823 1.00 0.00 ? 100 GLY A HA2  1  
ATOM 1538  H HA3  . GLY A 1 100 ? -6.314  -1.512  -18.283 1.00 0.00 ? 100 GLY A HA3  1  
ATOM 1539  N N    . PRO A 1 101 ? -7.779  -1.892  -20.809 1.00 0.00 ? 101 PRO A N    1  
ATOM 1540  C CA   . PRO A 1 101 ? -8.269  -1.396  -22.099 1.00 0.00 ? 101 PRO A CA   1  
ATOM 1541  C C    . PRO A 1 101 ? -8.386  0.124   -22.129 1.00 0.00 ? 101 PRO A C    1  
ATOM 1542  O O    . PRO A 1 101 ? -8.036  0.764   -23.121 1.00 0.00 ? 101 PRO A O    1  
ATOM 1543  C CB   . PRO A 1 101 ? -9.651  -2.041  -22.225 1.00 0.00 ? 101 PRO A CB   1  
ATOM 1544  C CG   . PRO A 1 101 ? -10.079 -2.298  -20.821 1.00 0.00 ? 101 PRO A CG   1  
ATOM 1545  C CD   . PRO A 1 101 ? -8.823  -2.606  -20.055 1.00 0.00 ? 101 PRO A CD   1  
ATOM 1546  H HA   . PRO A 1 101 ? -7.641  -1.724  -22.914 1.00 0.00 ? 101 PRO A HA   1  
ATOM 1547  H HB2  . PRO A 1 101 ? -10.325 -1.361  -22.726 1.00 0.00 ? 101 PRO A HB2  1  
ATOM 1548  H HB3  . PRO A 1 101 ? -9.574  -2.960  -22.788 1.00 0.00 ? 101 PRO A HB3  1  
ATOM 1549  H HG2  . PRO A 1 101 ? -10.559 -1.419  -20.417 1.00 0.00 ? 101 PRO A HG2  1  
ATOM 1550  H HG3  . PRO A 1 101 ? -10.753 -3.142  -20.791 1.00 0.00 ? 101 PRO A HG3  1  
ATOM 1551  H HD2  . PRO A 1 101 ? -8.895  -2.231  -19.045 1.00 0.00 ? 101 PRO A HD2  1  
ATOM 1552  H HD3  . PRO A 1 101 ? -8.635  -3.670  -20.051 1.00 0.00 ? 101 PRO A HD3  1  
ATOM 1553  N N    . SER A 1 102 ? -8.880  0.697   -21.036 1.00 0.00 ? 102 SER A N    1  
ATOM 1554  C CA   . SER A 1 102 ? -9.047  2.142   -20.939 1.00 0.00 ? 102 SER A CA   1  
ATOM 1555  C C    . SER A 1 102 ? -7.784  2.799   -20.389 1.00 0.00 ? 102 SER A C    1  
ATOM 1556  O O    . SER A 1 102 ? -7.007  2.170   -19.671 1.00 0.00 ? 102 SER A O    1  
ATOM 1557  C CB   . SER A 1 102 ? -10.242 2.480   -20.045 1.00 0.00 ? 102 SER A CB   1  
ATOM 1558  O OG   . SER A 1 102 ? -10.313 3.874   -19.795 1.00 0.00 ? 102 SER A OG   1  
ATOM 1559  H H    . SER A 1 102 ? -9.141  0.133   -20.277 1.00 0.00 ? 102 SER A H    1  
ATOM 1560  H HA   . SER A 1 102 ? -9.232  2.522   -21.932 1.00 0.00 ? 102 SER A HA   1  
ATOM 1561  H HB2  . SER A 1 102 ? -11.152 2.167   -20.532 1.00 0.00 ? 102 SER A HB2  1  
ATOM 1562  H HB3  . SER A 1 102 ? -10.141 1.962   -19.103 1.00 0.00 ? 102 SER A HB3  1  
ATOM 1563  H HG   . SER A 1 102 ? -10.386 4.345   -20.628 1.00 0.00 ? 102 SER A HG   1  
ATOM 1564  N N    . SER A 1 103 ? -7.587  4.068   -20.732 1.00 0.00 ? 103 SER A N    1  
ATOM 1565  C CA   . SER A 1 103 ? -6.417  4.810   -20.276 1.00 0.00 ? 103 SER A CA   1  
ATOM 1566  C C    . SER A 1 103 ? -6.830  6.003   -19.420 1.00 0.00 ? 103 SER A C    1  
ATOM 1567  O O    . SER A 1 103 ? -7.937  6.523   -19.552 1.00 0.00 ? 103 SER A O    1  
ATOM 1568  C CB   . SER A 1 103 ? -5.592  5.287   -21.473 1.00 0.00 ? 103 SER A CB   1  
ATOM 1569  O OG   . SER A 1 103 ? -6.271  6.307   -22.185 1.00 0.00 ? 103 SER A OG   1  
ATOM 1570  H H    . SER A 1 103 ? -8.243  4.514   -21.307 1.00 0.00 ? 103 SER A H    1  
ATOM 1571  H HA   . SER A 1 103 ? -5.814  4.143   -19.677 1.00 0.00 ? 103 SER A HA   1  
ATOM 1572  H HB2  . SER A 1 103 ? -4.648  5.676   -21.124 1.00 0.00 ? 103 SER A HB2  1  
ATOM 1573  H HB3  . SER A 1 103 ? -5.415  4.456   -22.139 1.00 0.00 ? 103 SER A HB3  1  
ATOM 1574  H HG   . SER A 1 103 ? -5.713  6.625   -22.899 1.00 0.00 ? 103 SER A HG   1  
ATOM 1575  N N    . GLY A 1 104 ? -5.930  6.432   -18.540 1.00 0.00 ? 104 GLY A N    1  
ATOM 1576  C CA   . GLY A 1 104 ? -6.219  7.560   -17.674 1.00 0.00 ? 104 GLY A CA   1  
ATOM 1577  C C    . GLY A 1 104 ? -6.052  8.891   -18.381 1.00 0.00 ? 104 GLY A C    1  
ATOM 1578  O O    . GLY A 1 104 ? -6.798  9.836   -18.124 1.00 0.00 ? 104 GLY A O    1  
ATOM 1579  H H    . GLY A 1 104 ? -5.064  5.979   -18.478 1.00 0.00 ? 104 GLY A H    1  
ATOM 1580  H HA2  . GLY A 1 104 ? -7.235  7.478   -17.320 1.00 0.00 ? 104 GLY A HA2  1  
ATOM 1581  H HA3  . GLY A 1 104 ? -5.549  7.530   -16.827 1.00 0.00 ? 104 GLY A HA3  1  
ATOM 1582  N N    . GLY A 1 1   ? -0.796  56.690  0.825   1.00 0.00 ? 1   GLY A N    2  
ATOM 1583  C CA   . GLY A 1 1   ? -0.598  55.745  -0.259  1.00 0.00 ? 1   GLY A CA   2  
ATOM 1584  C C    . GLY A 1 1   ? 0.437   54.689  0.075   1.00 0.00 ? 1   GLY A C    2  
ATOM 1585  O O    . GLY A 1 1   ? 1.085   54.753  1.120   1.00 0.00 ? 1   GLY A O    2  
ATOM 1586  H H1   . GLY A 1 1   ? -0.389  56.521  1.700   1.00 0.00 ? 1   GLY A H1   2  
ATOM 1587  H HA2  . GLY A 1 1   ? -1.538  55.258  -0.473  1.00 0.00 ? 1   GLY A HA2  2  
ATOM 1588  H HA3  . GLY A 1 1   ? -0.276  56.284  -1.137  1.00 0.00 ? 1   GLY A HA3  2  
ATOM 1589  N N    . SER A 1 2   ? 0.594   53.714  -0.815  1.00 0.00 ? 2   SER A N    2  
ATOM 1590  C CA   . SER A 1 2   ? 1.554   52.637  -0.607  1.00 0.00 ? 2   SER A CA   2  
ATOM 1591  C C    . SER A 1 2   ? 1.620   51.725  -1.829  1.00 0.00 ? 2   SER A C    2  
ATOM 1592  O O    . SER A 1 2   ? 0.706   51.706  -2.653  1.00 0.00 ? 2   SER A O    2  
ATOM 1593  C CB   . SER A 1 2   ? 1.179   51.822  0.632   1.00 0.00 ? 2   SER A CB   2  
ATOM 1594  O OG   . SER A 1 2   ? 0.063   50.988  0.375   1.00 0.00 ? 2   SER A OG   2  
ATOM 1595  H H    . SER A 1 2   ? 0.048   53.718  -1.629  1.00 0.00 ? 2   SER A H    2  
ATOM 1596  H HA   . SER A 1 2   ? 2.525   53.084  -0.454  1.00 0.00 ? 2   SER A HA   2  
ATOM 1597  H HB2  . SER A 1 2   ? 2.016   51.205  0.921   1.00 0.00 ? 2   SER A HB2  2  
ATOM 1598  H HB3  . SER A 1 2   ? 0.932   52.495  1.440   1.00 0.00 ? 2   SER A HB3  2  
ATOM 1599  H HG   . SER A 1 2   ? -0.519  50.988  1.138   1.00 0.00 ? 2   SER A HG   2  
ATOM 1600  N N    . SER A 1 3   ? 2.708   50.969  -1.937  1.00 0.00 ? 3   SER A N    2  
ATOM 1601  C CA   . SER A 1 3   ? 2.897   50.057  -3.059  1.00 0.00 ? 3   SER A CA   2  
ATOM 1602  C C    . SER A 1 3   ? 3.841   48.920  -2.682  1.00 0.00 ? 3   SER A C    2  
ATOM 1603  O O    . SER A 1 3   ? 4.532   48.983  -1.666  1.00 0.00 ? 3   SER A O    2  
ATOM 1604  C CB   . SER A 1 3   ? 3.447   50.812  -4.271  1.00 0.00 ? 3   SER A CB   2  
ATOM 1605  O OG   . SER A 1 3   ? 2.466   51.672  -4.824  1.00 0.00 ? 3   SER A OG   2  
ATOM 1606  H H    . SER A 1 3   ? 3.402   51.029  -1.248  1.00 0.00 ? 3   SER A H    2  
ATOM 1607  H HA   . SER A 1 3   ? 1.933   49.640  -3.313  1.00 0.00 ? 3   SER A HA   2  
ATOM 1608  H HB2  . SER A 1 3   ? 4.297   51.403  -3.968  1.00 0.00 ? 3   SER A HB2  2  
ATOM 1609  H HB3  . SER A 1 3   ? 3.753   50.101  -5.025  1.00 0.00 ? 3   SER A HB3  2  
ATOM 1610  H HG   . SER A 1 3   ? 1.591   51.342  -4.607  1.00 0.00 ? 3   SER A HG   2  
ATOM 1611  N N    . GLY A 1 4   ? 3.865   47.879  -3.510  1.00 0.00 ? 4   GLY A N    2  
ATOM 1612  C CA   . GLY A 1 4   ? 4.727   46.742  -3.247  1.00 0.00 ? 4   GLY A CA   2  
ATOM 1613  C C    . GLY A 1 4   ? 5.175   46.048  -4.518  1.00 0.00 ? 4   GLY A C    2  
ATOM 1614  O O    . GLY A 1 4   ? 4.956   46.553  -5.619  1.00 0.00 ? 4   GLY A O    2  
ATOM 1615  H H    . GLY A 1 4   ? 3.292   47.884  -4.305  1.00 0.00 ? 4   GLY A H    2  
ATOM 1616  H HA2  . GLY A 1 4   ? 5.600   47.082  -2.709  1.00 0.00 ? 4   GLY A HA2  2  
ATOM 1617  H HA3  . GLY A 1 4   ? 4.192   46.033  -2.633  1.00 0.00 ? 4   GLY A HA3  2  
ATOM 1618  N N    . SER A 1 5   ? 5.805   44.887  -4.366  1.00 0.00 ? 5   SER A N    2  
ATOM 1619  C CA   . SER A 1 5   ? 6.289   44.125  -5.511  1.00 0.00 ? 5   SER A CA   2  
ATOM 1620  C C    . SER A 1 5   ? 6.028   42.634  -5.321  1.00 0.00 ? 5   SER A C    2  
ATOM 1621  O O    . SER A 1 5   ? 5.726   42.181  -4.216  1.00 0.00 ? 5   SER A O    2  
ATOM 1622  C CB   . SER A 1 5   ? 7.785   44.370  -5.718  1.00 0.00 ? 5   SER A CB   2  
ATOM 1623  O OG   . SER A 1 5   ? 8.214   43.877  -6.975  1.00 0.00 ? 5   SER A OG   2  
ATOM 1624  H H    . SER A 1 5   ? 5.949   44.537  -3.462  1.00 0.00 ? 5   SER A H    2  
ATOM 1625  H HA   . SER A 1 5   ? 5.753   44.464  -6.385  1.00 0.00 ? 5   SER A HA   2  
ATOM 1626  H HB2  . SER A 1 5   ? 7.983   45.430  -5.674  1.00 0.00 ? 5   SER A HB2  2  
ATOM 1627  H HB3  . SER A 1 5   ? 8.340   43.868  -4.939  1.00 0.00 ? 5   SER A HB3  2  
ATOM 1628  H HG   . SER A 1 5   ? 8.576   42.994  -6.866  1.00 0.00 ? 5   SER A HG   2  
ATOM 1629  N N    . SER A 1 6   ? 6.147   41.876  -6.406  1.00 0.00 ? 6   SER A N    2  
ATOM 1630  C CA   . SER A 1 6   ? 5.920   40.436  -6.361  1.00 0.00 ? 6   SER A CA   2  
ATOM 1631  C C    . SER A 1 6   ? 7.033   39.688  -7.088  1.00 0.00 ? 6   SER A C    2  
ATOM 1632  O O    . SER A 1 6   ? 7.807   40.280  -7.838  1.00 0.00 ? 6   SER A O    2  
ATOM 1633  C CB   . SER A 1 6   ? 4.566   40.091  -6.985  1.00 0.00 ? 6   SER A CB   2  
ATOM 1634  O OG   . SER A 1 6   ? 3.499   40.519  -6.157  1.00 0.00 ? 6   SER A OG   2  
ATOM 1635  H H    . SER A 1 6   ? 6.390   42.295  -7.258  1.00 0.00 ? 6   SER A H    2  
ATOM 1636  H HA   . SER A 1 6   ? 5.916   40.133  -5.324  1.00 0.00 ? 6   SER A HA   2  
ATOM 1637  H HB2  . SER A 1 6   ? 4.480   40.580  -7.944  1.00 0.00 ? 6   SER A HB2  2  
ATOM 1638  H HB3  . SER A 1 6   ? 4.497   39.021  -7.119  1.00 0.00 ? 6   SER A HB3  2  
ATOM 1639  H HG   . SER A 1 6   ? 3.689   41.397  -5.818  1.00 0.00 ? 6   SER A HG   2  
ATOM 1640  N N    . GLY A 1 7   ? 7.107   38.380  -6.858  1.00 0.00 ? 7   GLY A N    2  
ATOM 1641  C CA   . GLY A 1 7   ? 8.128   37.571  -7.497  1.00 0.00 ? 7   GLY A CA   2  
ATOM 1642  C C    . GLY A 1 7   ? 7.857   36.085  -7.366  1.00 0.00 ? 7   GLY A C    2  
ATOM 1643  O O    . GLY A 1 7   ? 7.419   35.618  -6.315  1.00 0.00 ? 7   GLY A O    2  
ATOM 1644  H H    . GLY A 1 7   ? 6.463   37.961  -6.250  1.00 0.00 ? 7   GLY A H    2  
ATOM 1645  H HA2  . GLY A 1 7   ? 8.171   37.827  -8.545  1.00 0.00 ? 7   GLY A HA2  2  
ATOM 1646  H HA3  . GLY A 1 7   ? 9.083   37.792  -7.044  1.00 0.00 ? 7   GLY A HA3  2  
ATOM 1647  N N    . MET A 1 8   ? 8.117   35.341  -8.436  1.00 0.00 ? 8   MET A N    2  
ATOM 1648  C CA   . MET A 1 8   ? 7.898   33.899  -8.435  1.00 0.00 ? 8   MET A CA   2  
ATOM 1649  C C    . MET A 1 8   ? 9.053   33.174  -9.118  1.00 0.00 ? 8   MET A C    2  
ATOM 1650  O O    . MET A 1 8   ? 9.537   33.604  -10.164 1.00 0.00 ? 8   MET A O    2  
ATOM 1651  C CB   . MET A 1 8   ? 6.582   33.562  -9.138  1.00 0.00 ? 8   MET A CB   2  
ATOM 1652  C CG   . MET A 1 8   ? 5.373   33.602  -8.216  1.00 0.00 ? 8   MET A CG   2  
ATOM 1653  S SD   . MET A 1 8   ? 5.229   32.124  -7.194  1.00 0.00 ? 8   MET A SD   2  
ATOM 1654  C CE   . MET A 1 8   ? 3.619   32.382  -6.452  1.00 0.00 ? 8   MET A CE   2  
ATOM 1655  H H    . MET A 1 8   ? 8.465   35.771  -9.245  1.00 0.00 ? 8   MET A H    2  
ATOM 1656  H HA   . MET A 1 8   ? 7.841   33.574  -7.407  1.00 0.00 ? 8   MET A HA   2  
ATOM 1657  H HB2  . MET A 1 8   ? 6.422   34.270  -9.937  1.00 0.00 ? 8   MET A HB2  2  
ATOM 1658  H HB3  . MET A 1 8   ? 6.655   32.569  -9.556  1.00 0.00 ? 8   MET A HB3  2  
ATOM 1659  H HG2  . MET A 1 8   ? 5.459   34.463  -7.569  1.00 0.00 ? 8   MET A HG2  2  
ATOM 1660  H HG3  . MET A 1 8   ? 4.482   33.696  -8.819  1.00 0.00 ? 8   MET A HG3  2  
ATOM 1661  H HE1  . MET A 1 8   ? 3.182   33.288  -6.845  1.00 0.00 ? 8   MET A HE1  2  
ATOM 1662  H HE2  . MET A 1 8   ? 2.978   31.543  -6.683  1.00 0.00 ? 8   MET A HE2  2  
ATOM 1663  H HE3  . MET A 1 8   ? 3.727   32.469  -5.381  1.00 0.00 ? 8   MET A HE3  2  
ATOM 1664  N N    . ALA A 1 9   ? 9.490   32.071  -8.518  1.00 0.00 ? 9   ALA A N    2  
ATOM 1665  C CA   . ALA A 1 9   ? 10.587  31.285  -9.070  1.00 0.00 ? 9   ALA A CA   2  
ATOM 1666  C C    . ALA A 1 9   ? 10.225  29.805  -9.130  1.00 0.00 ? 9   ALA A C    2  
ATOM 1667  O O    . ALA A 1 9   ? 9.408   29.323  -8.345  1.00 0.00 ? 9   ALA A O    2  
ATOM 1668  C CB   . ALA A 1 9   ? 11.849  31.489  -8.245  1.00 0.00 ? 9   ALA A CB   2  
ATOM 1669  H H    . ALA A 1 9   ? 9.063   31.778  -7.686  1.00 0.00 ? 9   ALA A H    2  
ATOM 1670  H HA   . ALA A 1 9   ? 10.780  31.639  -10.072 1.00 0.00 ? 9   ALA A HA   2  
ATOM 1671  H HB1  . ALA A 1 9   ? 11.651  31.228  -7.215  1.00 0.00 ? 9   ALA A HB1  2  
ATOM 1672  H HB2  . ALA A 1 9   ? 12.637  30.859  -8.631  1.00 0.00 ? 9   ALA A HB2  2  
ATOM 1673  H HB3  . ALA A 1 9   ? 12.153  32.523  -8.303  1.00 0.00 ? 9   ALA A HB3  2  
ATOM 1674  N N    . ASP A 1 10  ? 10.838  29.089  -10.067 1.00 0.00 ? 10  ASP A N    2  
ATOM 1675  C CA   . ASP A 1 10  ? 10.581  27.662  -10.229 1.00 0.00 ? 10  ASP A CA   2  
ATOM 1676  C C    . ASP A 1 10  ? 11.790  26.839  -9.796  1.00 0.00 ? 10  ASP A C    2  
ATOM 1677  O O    . ASP A 1 10  ? 12.765  26.715  -10.536 1.00 0.00 ? 10  ASP A O    2  
ATOM 1678  C CB   . ASP A 1 10  ? 10.229  27.348  -11.684 1.00 0.00 ? 10  ASP A CB   2  
ATOM 1679  C CG   . ASP A 1 10  ? 9.554   26.000  -11.838 1.00 0.00 ? 10  ASP A CG   2  
ATOM 1680  O OD1  . ASP A 1 10  ? 8.318   25.931  -11.666 1.00 0.00 ? 10  ASP A OD1  2  
ATOM 1681  O OD2  . ASP A 1 10  ? 10.260  25.013  -12.132 1.00 0.00 ? 10  ASP A OD2  2  
ATOM 1682  H H    . ASP A 1 10  ? 11.479  29.530  -10.663 1.00 0.00 ? 10  ASP A H    2  
ATOM 1683  H HA   . ASP A 1 10  ? 9.741   27.403  -9.601  1.00 0.00 ? 10  ASP A HA   2  
ATOM 1684  H HB2  . ASP A 1 10  ? 9.560   28.110  -12.058 1.00 0.00 ? 10  ASP A HB2  2  
ATOM 1685  H HB3  . ASP A 1 10  ? 11.134  27.348  -12.274 1.00 0.00 ? 10  ASP A HB3  2  
ATOM 1686  N N    . GLU A 1 11  ? 11.719  26.281  -8.592  1.00 0.00 ? 11  GLU A N    2  
ATOM 1687  C CA   . GLU A 1 11  ? 12.809  25.471  -8.060  1.00 0.00 ? 11  GLU A CA   2  
ATOM 1688  C C    . GLU A 1 11  ? 12.284  24.156  -7.493  1.00 0.00 ? 11  GLU A C    2  
ATOM 1689  O O    . GLU A 1 11  ? 12.660  23.745  -6.395  1.00 0.00 ? 11  GLU A O    2  
ATOM 1690  C CB   . GLU A 1 11  ? 13.564  26.242  -6.975  1.00 0.00 ? 11  GLU A CB   2  
ATOM 1691  C CG   . GLU A 1 11  ? 14.673  27.128  -7.517  1.00 0.00 ? 11  GLU A CG   2  
ATOM 1692  C CD   . GLU A 1 11  ? 15.480  27.791  -6.418  1.00 0.00 ? 11  GLU A CD   2  
ATOM 1693  O OE1  . GLU A 1 11  ? 14.877  28.206  -5.406  1.00 0.00 ? 11  GLU A OE1  2  
ATOM 1694  O OE2  . GLU A 1 11  ? 16.715  27.896  -6.570  1.00 0.00 ? 11  GLU A OE2  2  
ATOM 1695  H H    . GLU A 1 11  ? 10.915  26.416  -8.048  1.00 0.00 ? 11  GLU A H    2  
ATOM 1696  H HA   . GLU A 1 11  ? 13.487  25.254  -8.872  1.00 0.00 ? 11  GLU A HA   2  
ATOM 1697  H HB2  . GLU A 1 11  ? 12.863  26.865  -6.439  1.00 0.00 ? 11  GLU A HB2  2  
ATOM 1698  H HB3  . GLU A 1 11  ? 14.001  25.534  -6.287  1.00 0.00 ? 11  GLU A HB3  2  
ATOM 1699  H HG2  . GLU A 1 11  ? 15.339  26.523  -8.116  1.00 0.00 ? 11  GLU A HG2  2  
ATOM 1700  H HG3  . GLU A 1 11  ? 14.233  27.896  -8.135  1.00 0.00 ? 11  GLU A HG3  2  
ATOM 1701  N N    . LYS A 1 12  ? 11.411  23.499  -8.249  1.00 0.00 ? 12  LYS A N    2  
ATOM 1702  C CA   . LYS A 1 12  ? 10.833  22.229  -7.825  1.00 0.00 ? 12  LYS A CA   2  
ATOM 1703  C C    . LYS A 1 12  ? 10.172  22.363  -6.457  1.00 0.00 ? 12  LYS A C    2  
ATOM 1704  O O    . LYS A 1 12  ? 10.439  21.593  -5.534  1.00 0.00 ? 12  LYS A O    2  
ATOM 1705  C CB   . LYS A 1 12  ? 11.912  21.145  -7.778  1.00 0.00 ? 12  LYS A CB   2  
ATOM 1706  C CG   . LYS A 1 12  ? 11.359  19.746  -7.564  1.00 0.00 ? 12  LYS A CG   2  
ATOM 1707  C CD   . LYS A 1 12  ? 10.655  19.229  -8.808  1.00 0.00 ? 12  LYS A CD   2  
ATOM 1708  C CE   . LYS A 1 12  ? 11.650  18.852  -9.895  1.00 0.00 ? 12  LYS A CE   2  
ATOM 1709  N NZ   . LYS A 1 12  ? 10.967  18.438  -11.152 1.00 0.00 ? 12  LYS A NZ   2  
ATOM 1710  H H    . LYS A 1 12  ? 11.150  23.877  -9.116  1.00 0.00 ? 12  LYS A H    2  
ATOM 1711  H HA   . LYS A 1 12  ? 10.083  21.948  -8.548  1.00 0.00 ? 12  LYS A HA   2  
ATOM 1712  H HB2  . LYS A 1 12  ? 12.456  21.155  -8.711  1.00 0.00 ? 12  LYS A HB2  2  
ATOM 1713  H HB3  . LYS A 1 12  ? 12.594  21.367  -6.970  1.00 0.00 ? 12  LYS A HB3  2  
ATOM 1714  H HG2  . LYS A 1 12  ? 12.173  19.080  -7.321  1.00 0.00 ? 12  LYS A HG2  2  
ATOM 1715  H HG3  . LYS A 1 12  ? 10.653  19.769  -6.746  1.00 0.00 ? 12  LYS A HG3  2  
ATOM 1716  H HD2  . LYS A 1 12  ? 10.077  18.355  -8.546  1.00 0.00 ? 12  LYS A HD2  2  
ATOM 1717  H HD3  . LYS A 1 12  ? 9.997   19.999  -9.185  1.00 0.00 ? 12  LYS A HD3  2  
ATOM 1718  H HE2  . LYS A 1 12  ? 12.278  19.705  -10.101 1.00 0.00 ? 12  LYS A HE2  2  
ATOM 1719  H HE3  . LYS A 1 12  ? 12.259  18.034  -9.539  1.00 0.00 ? 12  LYS A HE3  2  
ATOM 1720  H HZ1  . LYS A 1 12  ? 10.282  17.680  -10.953 1.00 0.00 ? 12  LYS A HZ1  2  
ATOM 1721  H HZ2  . LYS A 1 12  ? 11.665  18.087  -11.839 1.00 0.00 ? 12  LYS A HZ2  2  
ATOM 1722  H HZ3  . LYS A 1 12  ? 10.462  19.246  -11.568 1.00 0.00 ? 12  LYS A HZ3  2  
ATOM 1723  N N    . PRO A 1 13  ? 9.287   23.362  -6.321  1.00 0.00 ? 13  PRO A N    2  
ATOM 1724  C CA   . PRO A 1 13  ? 8.569   23.618  -5.069  1.00 0.00 ? 13  PRO A CA   2  
ATOM 1725  C C    . PRO A 1 13  ? 7.541   22.535  -4.758  1.00 0.00 ? 13  PRO A C    2  
ATOM 1726  O O    . PRO A 1 13  ? 6.849   22.595  -3.742  1.00 0.00 ? 13  PRO A O    2  
ATOM 1727  C CB   . PRO A 1 13  ? 7.873   24.957  -5.327  1.00 0.00 ? 13  PRO A CB   2  
ATOM 1728  C CG   . PRO A 1 13  ? 7.723   25.027  -6.808  1.00 0.00 ? 13  PRO A CG   2  
ATOM 1729  C CD   . PRO A 1 13  ? 8.920   24.318  -7.379  1.00 0.00 ? 13  PRO A CD   2  
ATOM 1730  H HA   . PRO A 1 13  ? 9.248   23.719  -4.235  1.00 0.00 ? 13  PRO A HA   2  
ATOM 1731  H HB2  . PRO A 1 13  ? 6.912   24.968  -4.831  1.00 0.00 ? 13  PRO A HB2  2  
ATOM 1732  H HB3  . PRO A 1 13  ? 8.486   25.763  -4.954  1.00 0.00 ? 13  PRO A HB3  2  
ATOM 1733  H HG2  . PRO A 1 13  ? 6.814   24.529  -7.109  1.00 0.00 ? 13  PRO A HG2  2  
ATOM 1734  H HG3  . PRO A 1 13  ? 7.711   26.058  -7.127  1.00 0.00 ? 13  PRO A HG3  2  
ATOM 1735  H HD2  . PRO A 1 13  ? 8.654   23.802  -8.290  1.00 0.00 ? 13  PRO A HD2  2  
ATOM 1736  H HD3  . PRO A 1 13  ? 9.722   25.018  -7.560  1.00 0.00 ? 13  PRO A HD3  2  
ATOM 1737  N N    . LYS A 1 14  ? 7.448   21.545  -5.639  1.00 0.00 ? 14  LYS A N    2  
ATOM 1738  C CA   . LYS A 1 14  ? 6.506   20.446  -5.459  1.00 0.00 ? 14  LYS A CA   2  
ATOM 1739  C C    . LYS A 1 14  ? 6.974   19.505  -4.353  1.00 0.00 ? 14  LYS A C    2  
ATOM 1740  O O    . LYS A 1 14  ? 6.199   19.135  -3.472  1.00 0.00 ? 14  LYS A O    2  
ATOM 1741  C CB   . LYS A 1 14  ? 6.339   19.670  -6.767  1.00 0.00 ? 14  LYS A CB   2  
ATOM 1742  C CG   . LYS A 1 14  ? 5.370   20.319  -7.740  1.00 0.00 ? 14  LYS A CG   2  
ATOM 1743  C CD   . LYS A 1 14  ? 3.951   19.817  -7.532  1.00 0.00 ? 14  LYS A CD   2  
ATOM 1744  C CE   . LYS A 1 14  ? 3.651   18.614  -8.414  1.00 0.00 ? 14  LYS A CE   2  
ATOM 1745  N NZ   . LYS A 1 14  ? 3.972   17.331  -7.729  1.00 0.00 ? 14  LYS A NZ   2  
ATOM 1746  H H    . LYS A 1 14  ? 8.027   21.553  -6.431  1.00 0.00 ? 14  LYS A H    2  
ATOM 1747  H HA   . LYS A 1 14  ? 5.554   20.869  -5.177  1.00 0.00 ? 14  LYS A HA   2  
ATOM 1748  H HB2  . LYS A 1 14  ? 7.302   19.591  -7.250  1.00 0.00 ? 14  LYS A HB2  2  
ATOM 1749  H HB3  . LYS A 1 14  ? 5.978   18.678  -6.540  1.00 0.00 ? 14  LYS A HB3  2  
ATOM 1750  H HG2  . LYS A 1 14  ? 5.387   21.389  -7.592  1.00 0.00 ? 14  LYS A HG2  2  
ATOM 1751  H HG3  . LYS A 1 14  ? 5.679   20.089  -8.750  1.00 0.00 ? 14  LYS A HG3  2  
ATOM 1752  H HD2  . LYS A 1 14  ? 3.828   19.530  -6.498  1.00 0.00 ? 14  LYS A HD2  2  
ATOM 1753  H HD3  . LYS A 1 14  ? 3.258   20.611  -7.773  1.00 0.00 ? 14  LYS A HD3  2  
ATOM 1754  H HE2  . LYS A 1 14  ? 2.602   18.624  -8.668  1.00 0.00 ? 14  LYS A HE2  2  
ATOM 1755  H HE3  . LYS A 1 14  ? 4.241   18.689  -9.315  1.00 0.00 ? 14  LYS A HE3  2  
ATOM 1756  H HZ1  . LYS A 1 14  ? 4.959   17.338  -7.402  1.00 0.00 ? 14  LYS A HZ1  2  
ATOM 1757  H HZ2  . LYS A 1 14  ? 3.841   16.534  -8.385  1.00 0.00 ? 14  LYS A HZ2  2  
ATOM 1758  H HZ3  . LYS A 1 14  ? 3.347   17.197  -6.909  1.00 0.00 ? 14  LYS A HZ3  2  
ATOM 1759  N N    . GLU A 1 15  ? 8.246   19.123  -4.407  1.00 0.00 ? 15  GLU A N    2  
ATOM 1760  C CA   . GLU A 1 15  ? 8.815   18.225  -3.408  1.00 0.00 ? 15  GLU A CA   2  
ATOM 1761  C C    . GLU A 1 15  ? 8.591   18.766  -1.999  1.00 0.00 ? 15  GLU A C    2  
ATOM 1762  O O    . GLU A 1 15  ? 7.810   18.211  -1.227  1.00 0.00 ? 15  GLU A O    2  
ATOM 1763  C CB   . GLU A 1 15  ? 10.312  18.031  -3.660  1.00 0.00 ? 15  GLU A CB   2  
ATOM 1764  C CG   . GLU A 1 15  ? 10.899  16.827  -2.942  1.00 0.00 ? 15  GLU A CG   2  
ATOM 1765  C CD   . GLU A 1 15  ? 12.379  16.648  -3.217  1.00 0.00 ? 15  GLU A CD   2  
ATOM 1766  O OE1  . GLU A 1 15  ? 12.786  16.793  -4.388  1.00 0.00 ? 15  GLU A OE1  2  
ATOM 1767  O OE2  . GLU A 1 15  ? 13.130  16.363  -2.261  1.00 0.00 ? 15  GLU A OE2  2  
ATOM 1768  H H    . GLU A 1 15  ? 8.814   19.451  -5.134  1.00 0.00 ? 15  GLU A H    2  
ATOM 1769  H HA   . GLU A 1 15  ? 8.318   17.271  -3.498  1.00 0.00 ? 15  GLU A HA   2  
ATOM 1770  H HB2  . GLU A 1 15  ? 10.474  17.906  -4.720  1.00 0.00 ? 15  GLU A HB2  2  
ATOM 1771  H HB3  . GLU A 1 15  ? 10.838  18.913  -3.326  1.00 0.00 ? 15  GLU A HB3  2  
ATOM 1772  H HG2  . GLU A 1 15  ? 10.758  16.954  -1.879  1.00 0.00 ? 15  GLU A HG2  2  
ATOM 1773  H HG3  . GLU A 1 15  ? 10.377  15.939  -3.269  1.00 0.00 ? 15  GLU A HG3  2  
ATOM 1774  N N    . GLY A 1 16  ? 9.282   19.853  -1.672  1.00 0.00 ? 16  GLY A N    2  
ATOM 1775  C CA   . GLY A 1 16  ? 9.145   20.451  -0.356  1.00 0.00 ? 16  GLY A CA   2  
ATOM 1776  C C    . GLY A 1 16  ? 9.286   19.435  0.759   1.00 0.00 ? 16  GLY A C    2  
ATOM 1777  O O    . GLY A 1 16  ? 9.508   18.251  0.507   1.00 0.00 ? 16  GLY A O    2  
ATOM 1778  H H    . GLY A 1 16  ? 9.890   20.253  -2.329  1.00 0.00 ? 16  GLY A H    2  
ATOM 1779  H HA2  . GLY A 1 16  ? 9.905   21.209  -0.237  1.00 0.00 ? 16  GLY A HA2  2  
ATOM 1780  H HA3  . GLY A 1 16  ? 8.173   20.915  -0.284  1.00 0.00 ? 16  GLY A HA3  2  
ATOM 1781  N N    . VAL A 1 17  ? 9.158   19.898  1.999   1.00 0.00 ? 17  VAL A N    2  
ATOM 1782  C CA   . VAL A 1 17  ? 9.273   19.021  3.158   1.00 0.00 ? 17  VAL A CA   2  
ATOM 1783  C C    . VAL A 1 17  ? 8.043   19.129  4.053   1.00 0.00 ? 17  VAL A C    2  
ATOM 1784  O O    . VAL A 1 17  ? 7.478   20.209  4.223   1.00 0.00 ? 17  VAL A O    2  
ATOM 1785  C CB   . VAL A 1 17  ? 10.528  19.350  3.988   1.00 0.00 ? 17  VAL A CB   2  
ATOM 1786  C CG1  . VAL A 1 17  ? 10.627  18.428  5.194   1.00 0.00 ? 17  VAL A CG1  2  
ATOM 1787  C CG2  . VAL A 1 17  ? 11.777  19.250  3.126   1.00 0.00 ? 17  VAL A CG2  2  
ATOM 1788  H H    . VAL A 1 17  ? 8.981   20.852  2.137   1.00 0.00 ? 17  VAL A H    2  
ATOM 1789  H HA   . VAL A 1 17  ? 9.359   18.005  2.801   1.00 0.00 ? 17  VAL A HA   2  
ATOM 1790  H HB   . VAL A 1 17  ? 10.443  20.366  4.346   1.00 0.00 ? 17  VAL A HB   2  
ATOM 1791  H HG11 . VAL A 1 17  ? 10.199  17.467  4.949   1.00 0.00 ? 17  VAL A HG11 2  
ATOM 1792  H HG12 . VAL A 1 17  ? 11.664  18.303  5.468   1.00 0.00 ? 17  VAL A HG12 2  
ATOM 1793  H HG13 . VAL A 1 17  ? 10.086  18.861  6.023   1.00 0.00 ? 17  VAL A HG13 2  
ATOM 1794  H HG21 . VAL A 1 17  ? 11.507  18.901  2.141   1.00 0.00 ? 17  VAL A HG21 2  
ATOM 1795  H HG22 . VAL A 1 17  ? 12.241  20.223  3.049   1.00 0.00 ? 17  VAL A HG22 2  
ATOM 1796  H HG23 . VAL A 1 17  ? 12.472  18.556  3.577   1.00 0.00 ? 17  VAL A HG23 2  
ATOM 1797  N N    . LYS A 1 18  ? 7.632   18.001  4.622   1.00 0.00 ? 18  LYS A N    2  
ATOM 1798  C CA   . LYS A 1 18  ? 6.469   17.967  5.502   1.00 0.00 ? 18  LYS A CA   2  
ATOM 1799  C C    . LYS A 1 18  ? 6.880   17.636  6.933   1.00 0.00 ? 18  LYS A C    2  
ATOM 1800  O O    . LYS A 1 18  ? 6.440   16.636  7.502   1.00 0.00 ? 18  LYS A O    2  
ATOM 1801  C CB   . LYS A 1 18  ? 5.455   16.937  5.000   1.00 0.00 ? 18  LYS A CB   2  
ATOM 1802  C CG   . LYS A 1 18  ? 4.012   17.313  5.289   1.00 0.00 ? 18  LYS A CG   2  
ATOM 1803  C CD   . LYS A 1 18  ? 3.553   16.771  6.632   1.00 0.00 ? 18  LYS A CD   2  
ATOM 1804  C CE   . LYS A 1 18  ? 2.205   17.350  7.035   1.00 0.00 ? 18  LYS A CE   2  
ATOM 1805  N NZ   . LYS A 1 18  ? 2.343   18.700  7.649   1.00 0.00 ? 18  LYS A NZ   2  
ATOM 1806  H H    . LYS A 1 18  ? 8.124   17.171  4.448   1.00 0.00 ? 18  LYS A H    2  
ATOM 1807  H HA   . LYS A 1 18  ? 6.014   18.945  5.487   1.00 0.00 ? 18  LYS A HA   2  
ATOM 1808  H HB2  . LYS A 1 18  ? 5.570   16.827  3.932   1.00 0.00 ? 18  LYS A HB2  2  
ATOM 1809  H HB3  . LYS A 1 18  ? 5.659   15.987  5.474   1.00 0.00 ? 18  LYS A HB3  2  
ATOM 1810  H HG2  . LYS A 1 18  ? 3.925   18.389  5.298   1.00 0.00 ? 18  LYS A HG2  2  
ATOM 1811  H HG3  . LYS A 1 18  ? 3.381   16.906  4.512   1.00 0.00 ? 18  LYS A HG3  2  
ATOM 1812  H HD2  . LYS A 1 18  ? 3.465   15.697  6.567   1.00 0.00 ? 18  LYS A HD2  2  
ATOM 1813  H HD3  . LYS A 1 18  ? 4.285   17.029  7.384   1.00 0.00 ? 18  LYS A HD3  2  
ATOM 1814  H HE2  . LYS A 1 18  ? 1.583   17.426  6.157   1.00 0.00 ? 18  LYS A HE2  2  
ATOM 1815  H HE3  . LYS A 1 18  ? 1.741   16.685  7.748   1.00 0.00 ? 18  LYS A HE3  2  
ATOM 1816  H HZ1  . LYS A 1 18  ? 1.556   19.311  7.349   1.00 0.00 ? 18  LYS A HZ1  2  
ATOM 1817  H HZ2  . LYS A 1 18  ? 3.239   19.137  7.354   1.00 0.00 ? 18  LYS A HZ2  2  
ATOM 1818  H HZ3  . LYS A 1 18  ? 2.332   18.624  8.686   1.00 0.00 ? 18  LYS A HZ3  2  
ATOM 1819  N N    . THR A 1 19  ? 7.725   18.483  7.513   1.00 0.00 ? 19  THR A N    2  
ATOM 1820  C CA   . THR A 1 19  ? 8.194   18.281  8.878   1.00 0.00 ? 19  THR A CA   2  
ATOM 1821  C C    . THR A 1 19  ? 8.351   16.798  9.191   1.00 0.00 ? 19  THR A C    2  
ATOM 1822  O O    . THR A 1 19  ? 7.913   16.326  10.239  1.00 0.00 ? 19  THR A O    2  
ATOM 1823  C CB   . THR A 1 19  ? 7.230   18.911  9.902   1.00 0.00 ? 19  THR A CB   2  
ATOM 1824  O OG1  . THR A 1 19  ? 6.827   20.212  9.459   1.00 0.00 ? 19  THR A OG1  2  
ATOM 1825  C CG2  . THR A 1 19  ? 7.888   19.017  11.269  1.00 0.00 ? 19  THR A CG2  2  
ATOM 1826  H H    . THR A 1 19  ? 8.040   19.262  7.008   1.00 0.00 ? 19  THR A H    2  
ATOM 1827  H HA   . THR A 1 19  ? 9.155   18.764  8.975   1.00 0.00 ? 19  THR A HA   2  
ATOM 1828  H HB   . THR A 1 19  ? 6.357   18.281  9.986   1.00 0.00 ? 19  THR A HB   2  
ATOM 1829  H HG1  . THR A 1 19  ? 5.937   20.394  9.771   1.00 0.00 ? 19  THR A HG1  2  
ATOM 1830  H HG21 . THR A 1 19  ? 7.429   19.818  11.829  1.00 0.00 ? 19  THR A HG21 2  
ATOM 1831  H HG22 . THR A 1 19  ? 8.941   19.220  11.147  1.00 0.00 ? 19  THR A HG22 2  
ATOM 1832  H HG23 . THR A 1 19  ? 7.760   18.087  11.802  1.00 0.00 ? 19  THR A HG23 2  
ATOM 1833  N N    . GLU A 1 20  ? 8.981   16.068  8.276   1.00 0.00 ? 20  GLU A N    2  
ATOM 1834  C CA   . GLU A 1 20  ? 9.196   14.637  8.456   1.00 0.00 ? 20  GLU A CA   2  
ATOM 1835  C C    . GLU A 1 20  ? 9.697   14.336  9.865   1.00 0.00 ? 20  GLU A C    2  
ATOM 1836  O O    . GLU A 1 20  ? 10.589  15.011  10.376  1.00 0.00 ? 20  GLU A O    2  
ATOM 1837  C CB   . GLU A 1 20  ? 10.197  14.115  7.424   1.00 0.00 ? 20  GLU A CB   2  
ATOM 1838  C CG   . GLU A 1 20  ? 9.593   13.891  6.048   1.00 0.00 ? 20  GLU A CG   2  
ATOM 1839  C CD   . GLU A 1 20  ? 10.644  13.771  4.962   1.00 0.00 ? 20  GLU A CD   2  
ATOM 1840  O OE1  . GLU A 1 20  ? 11.080  14.817  4.438   1.00 0.00 ? 20  GLU A OE1  2  
ATOM 1841  O OE2  . GLU A 1 20  ? 11.031  12.629  4.635   1.00 0.00 ? 20  GLU A OE2  2  
ATOM 1842  H H    . GLU A 1 20  ? 9.308   16.502  7.460   1.00 0.00 ? 20  GLU A H    2  
ATOM 1843  H HA   . GLU A 1 20  ? 8.249   14.138  8.309   1.00 0.00 ? 20  GLU A HA   2  
ATOM 1844  H HB2  . GLU A 1 20  ? 11.003  14.828  7.329   1.00 0.00 ? 20  GLU A HB2  2  
ATOM 1845  H HB3  . GLU A 1 20  ? 10.600  13.176  7.774   1.00 0.00 ? 20  GLU A HB3  2  
ATOM 1846  H HG2  . GLU A 1 20  ? 9.012   12.982  6.067   1.00 0.00 ? 20  GLU A HG2  2  
ATOM 1847  H HG3  . GLU A 1 20  ? 8.947   14.724  5.813   1.00 0.00 ? 20  GLU A HG3  2  
ATOM 1848  N N    . ASN A 1 21  ? 9.115   13.316  10.489  1.00 0.00 ? 21  ASN A N    2  
ATOM 1849  C CA   . ASN A 1 21  ? 9.502   12.925  11.839  1.00 0.00 ? 21  ASN A CA   2  
ATOM 1850  C C    . ASN A 1 21  ? 10.094  11.519  11.851  1.00 0.00 ? 21  ASN A C    2  
ATOM 1851  O O    . ASN A 1 21  ? 10.021  10.796  10.858  1.00 0.00 ? 21  ASN A O    2  
ATOM 1852  C CB   . ASN A 1 21  ? 8.294   12.989  12.776  1.00 0.00 ? 21  ASN A CB   2  
ATOM 1853  C CG   . ASN A 1 21  ? 7.805   14.408  12.993  1.00 0.00 ? 21  ASN A CG   2  
ATOM 1854  O OD1  . ASN A 1 21  ? 8.567   15.284  13.404  1.00 0.00 ? 21  ASN A OD1  2  
ATOM 1855  N ND2  . ASN A 1 21  ? 6.527   14.642  12.716  1.00 0.00 ? 21  ASN A ND2  2  
ATOM 1856  H H    . ASN A 1 21  ? 8.409   12.815  10.030  1.00 0.00 ? 21  ASN A H    2  
ATOM 1857  H HA   . ASN A 1 21  ? 10.251  13.621  12.184  1.00 0.00 ? 21  ASN A HA   2  
ATOM 1858  H HB2  . ASN A 1 21  ? 7.486   12.411  12.352  1.00 0.00 ? 21  ASN A HB2  2  
ATOM 1859  H HB3  . ASN A 1 21  ? 8.566   12.572  13.734  1.00 0.00 ? 21  ASN A HB3  2  
ATOM 1860  H HD21 . ASN A 1 21  ? 5.979   13.897  12.393  1.00 0.00 ? 21  ASN A HD21 2  
ATOM 1861  H HD22 . ASN A 1 21  ? 6.185   15.551  12.846  1.00 0.00 ? 21  ASN A HD22 2  
ATOM 1862  N N    . ASN A 1 22  ? 10.679  11.138  12.981  1.00 0.00 ? 22  ASN A N    2  
ATOM 1863  C CA   . ASN A 1 22  ? 11.283  9.818   13.122  1.00 0.00 ? 22  ASN A CA   2  
ATOM 1864  C C    . ASN A 1 22  ? 10.259  8.800   13.612  1.00 0.00 ? 22  ASN A C    2  
ATOM 1865  O O    . ASN A 1 22  ? 10.213  7.668   13.130  1.00 0.00 ? 22  ASN A O    2  
ATOM 1866  C CB   . ASN A 1 22  ? 12.465  9.877   14.092  1.00 0.00 ? 22  ASN A CB   2  
ATOM 1867  C CG   . ASN A 1 22  ? 13.470  10.948  13.716  1.00 0.00 ? 22  ASN A CG   2  
ATOM 1868  O OD1  . ASN A 1 22  ? 13.479  11.437  12.586  1.00 0.00 ? 22  ASN A OD1  2  
ATOM 1869  N ND2  . ASN A 1 22  ? 14.323  11.318  14.664  1.00 0.00 ? 22  ASN A ND2  2  
ATOM 1870  H H    . ASN A 1 22  ? 10.705  11.759  13.739  1.00 0.00 ? 22  ASN A H    2  
ATOM 1871  H HA   . ASN A 1 22  ? 11.642  9.512   12.151  1.00 0.00 ? 22  ASN A HA   2  
ATOM 1872  H HB2  . ASN A 1 22  ? 12.097  10.089  15.086  1.00 0.00 ? 22  ASN A HB2  2  
ATOM 1873  H HB3  . ASN A 1 22  ? 12.969  8.922   14.096  1.00 0.00 ? 22  ASN A HB3  2  
ATOM 1874  H HD21 . ASN A 1 22  ? 14.258  10.885  15.541  1.00 0.00 ? 22  ASN A HD21 2  
ATOM 1875  H HD22 . ASN A 1 22  ? 14.983  12.010  14.448  1.00 0.00 ? 22  ASN A HD22 2  
ATOM 1876  N N    . ASP A 1 23  ? 9.437   9.210   14.572  1.00 0.00 ? 23  ASP A N    2  
ATOM 1877  C CA   . ASP A 1 23  ? 8.411   8.335   15.127  1.00 0.00 ? 23  ASP A CA   2  
ATOM 1878  C C    . ASP A 1 23  ? 7.844   7.413   14.052  1.00 0.00 ? 23  ASP A C    2  
ATOM 1879  O O    . ASP A 1 23  ? 7.766   6.198   14.239  1.00 0.00 ? 23  ASP A O    2  
ATOM 1880  C CB   . ASP A 1 23  ? 7.287   9.163   15.751  1.00 0.00 ? 23  ASP A CB   2  
ATOM 1881  C CG   . ASP A 1 23  ? 6.121   8.307   16.206  1.00 0.00 ? 23  ASP A CG   2  
ATOM 1882  O OD1  . ASP A 1 23  ? 6.280   7.569   17.201  1.00 0.00 ? 23  ASP A OD1  2  
ATOM 1883  O OD2  . ASP A 1 23  ? 5.051   8.374   15.566  1.00 0.00 ? 23  ASP A OD2  2  
ATOM 1884  H H    . ASP A 1 23  ? 9.523   10.124  14.916  1.00 0.00 ? 23  ASP A H    2  
ATOM 1885  H HA   . ASP A 1 23  ? 8.871   7.731   15.895  1.00 0.00 ? 23  ASP A HA   2  
ATOM 1886  H HB2  . ASP A 1 23  ? 7.674   9.695   16.608  1.00 0.00 ? 23  ASP A HB2  2  
ATOM 1887  H HB3  . ASP A 1 23  ? 6.926   9.875   15.024  1.00 0.00 ? 23  ASP A HB3  2  
ATOM 1888  N N    . HIS A 1 24  ? 7.448   7.999   12.926  1.00 0.00 ? 24  HIS A N    2  
ATOM 1889  C CA   . HIS A 1 24  ? 6.888   7.230   11.821  1.00 0.00 ? 24  HIS A CA   2  
ATOM 1890  C C    . HIS A 1 24  ? 7.824   6.095   11.418  1.00 0.00 ? 24  HIS A C    2  
ATOM 1891  O O    . HIS A 1 24  ? 8.988   6.067   11.818  1.00 0.00 ? 24  HIS A O    2  
ATOM 1892  C CB   . HIS A 1 24  ? 6.625   8.140   10.621  1.00 0.00 ? 24  HIS A CB   2  
ATOM 1893  C CG   . HIS A 1 24  ? 5.930   9.418   10.978  1.00 0.00 ? 24  HIS A CG   2  
ATOM 1894  N ND1  . HIS A 1 24  ? 4.596   9.478   11.324  1.00 0.00 ? 24  HIS A ND1  2  
ATOM 1895  C CD2  . HIS A 1 24  ? 6.392   10.688  11.044  1.00 0.00 ? 24  HIS A CD2  2  
ATOM 1896  C CE1  . HIS A 1 24  ? 4.268   10.730  11.585  1.00 0.00 ? 24  HIS A CE1  2  
ATOM 1897  N NE2  . HIS A 1 24  ? 5.340   11.485  11.424  1.00 0.00 ? 24  HIS A NE2  2  
ATOM 1898  H H    . HIS A 1 24  ? 7.536   8.971   12.837  1.00 0.00 ? 24  HIS A H    2  
ATOM 1899  H HA   . HIS A 1 24  ? 5.951   6.807   12.152  1.00 0.00 ? 24  HIS A HA   2  
ATOM 1900  H HB2  . HIS A 1 24  ? 7.567   8.394   10.157  1.00 0.00 ? 24  HIS A HB2  2  
ATOM 1901  H HB3  . HIS A 1 24  ? 6.007   7.614   9.906   1.00 0.00 ? 24  HIS A HB3  2  
ATOM 1902  H HD1  . HIS A 1 24  ? 3.982   8.716   11.369  1.00 0.00 ? 24  HIS A HD1  2  
ATOM 1903  H HD2  . HIS A 1 24  ? 7.401   11.016  10.837  1.00 0.00 ? 24  HIS A HD2  2  
ATOM 1904  H HE1  . HIS A 1 24  ? 3.290   11.079  11.882  1.00 0.00 ? 24  HIS A HE1  2  
ATOM 1905  H HE2  . HIS A 1 24  ? 5.353   12.463  11.470  1.00 0.00 ? 24  HIS A HE2  2  
ATOM 1906  N N    . ILE A 1 25  ? 7.308   5.161   10.626  1.00 0.00 ? 25  ILE A N    2  
ATOM 1907  C CA   . ILE A 1 25  ? 8.098   4.025   10.170  1.00 0.00 ? 25  ILE A CA   2  
ATOM 1908  C C    . ILE A 1 25  ? 7.982   3.845   8.660   1.00 0.00 ? 25  ILE A C    2  
ATOM 1909  O O    . ILE A 1 25  ? 6.926   4.084   8.076   1.00 0.00 ? 25  ILE A O    2  
ATOM 1910  C CB   . ILE A 1 25  ? 7.664   2.721   10.866  1.00 0.00 ? 25  ILE A CB   2  
ATOM 1911  C CG1  . ILE A 1 25  ? 6.208   2.396   10.525  1.00 0.00 ? 25  ILE A CG1  2  
ATOM 1912  C CG2  . ILE A 1 25  ? 7.847   2.838   12.372  1.00 0.00 ? 25  ILE A CG2  2  
ATOM 1913  C CD1  . ILE A 1 25  ? 5.756   1.045   11.033  1.00 0.00 ? 25  ILE A CD1  2  
ATOM 1914  H H    . ILE A 1 25  ? 6.374   5.239   10.342  1.00 0.00 ? 25  ILE A H    2  
ATOM 1915  H HA   . ILE A 1 25  ? 9.132   4.216   10.421  1.00 0.00 ? 25  ILE A HA   2  
ATOM 1916  H HB   . ILE A 1 25  ? 8.297   1.922   10.512  1.00 0.00 ? 25  ILE A HB   2  
ATOM 1917  H HG12 . ILE A 1 25  ? 5.567   3.145   10.960  1.00 0.00 ? 25  ILE A HG12 2  
ATOM 1918  H HG13 . ILE A 1 25  ? 6.088   2.404   9.451   1.00 0.00 ? 25  ILE A HG13 2  
ATOM 1919  H HG21 . ILE A 1 25  ? 6.888   2.747   12.859  1.00 0.00 ? 25  ILE A HG21 2  
ATOM 1920  H HG22 . ILE A 1 25  ? 8.502   2.052   12.717  1.00 0.00 ? 25  ILE A HG22 2  
ATOM 1921  H HG23 . ILE A 1 25  ? 8.281   3.798   12.609  1.00 0.00 ? 25  ILE A HG23 2  
ATOM 1922  H HD11 . ILE A 1 25  ? 6.618   0.459   11.317  1.00 0.00 ? 25  ILE A HD11 2  
ATOM 1923  H HD12 . ILE A 1 25  ? 5.113   1.179   11.890  1.00 0.00 ? 25  ILE A HD12 2  
ATOM 1924  H HD13 . ILE A 1 25  ? 5.214   0.530   10.253  1.00 0.00 ? 25  ILE A HD13 2  
ATOM 1925  N N    . ASN A 1 26  ? 9.075   3.420   8.035   1.00 0.00 ? 26  ASN A N    2  
ATOM 1926  C CA   . ASN A 1 26  ? 9.096   3.206   6.592   1.00 0.00 ? 26  ASN A CA   2  
ATOM 1927  C C    . ASN A 1 26  ? 9.203   1.720   6.264   1.00 0.00 ? 26  ASN A C    2  
ATOM 1928  O O    . ASN A 1 26  ? 10.084  1.023   6.770   1.00 0.00 ? 26  ASN A O    2  
ATOM 1929  C CB   . ASN A 1 26  ? 10.264  3.965   5.960   1.00 0.00 ? 26  ASN A CB   2  
ATOM 1930  C CG   . ASN A 1 26  ? 10.206  5.454   6.242   1.00 0.00 ? 26  ASN A CG   2  
ATOM 1931  O OD1  . ASN A 1 26  ? 9.870   6.251   5.365   1.00 0.00 ? 26  ASN A OD1  2  
ATOM 1932  N ND2  . ASN A 1 26  ? 10.534  5.837   7.470   1.00 0.00 ? 26  ASN A ND2  2  
ATOM 1933  H H    . ASN A 1 26  ? 9.887   3.246   8.555   1.00 0.00 ? 26  ASN A H    2  
ATOM 1934  H HA   . ASN A 1 26  ? 8.170   3.586   6.188   1.00 0.00 ? 26  ASN A HA   2  
ATOM 1935  H HB2  . ASN A 1 26  ? 11.192  3.580   6.356   1.00 0.00 ? 26  ASN A HB2  2  
ATOM 1936  H HB3  . ASN A 1 26  ? 10.244  3.819   4.890   1.00 0.00 ? 26  ASN A HB3  2  
ATOM 1937  H HD21 . ASN A 1 26  ? 10.791  5.147   8.117   1.00 0.00 ? 26  ASN A HD21 2  
ATOM 1938  H HD22 . ASN A 1 26  ? 10.504  6.794   7.680   1.00 0.00 ? 26  ASN A HD22 2  
ATOM 1939  N N    . LEU A 1 27  ? 8.302   1.241   5.414   1.00 0.00 ? 27  LEU A N    2  
ATOM 1940  C CA   . LEU A 1 27  ? 8.295   -0.163  5.016   1.00 0.00 ? 27  LEU A CA   2  
ATOM 1941  C C    . LEU A 1 27  ? 8.576   -0.308  3.524   1.00 0.00 ? 27  LEU A C    2  
ATOM 1942  O O    . LEU A 1 27  ? 7.989   0.394   2.700   1.00 0.00 ? 27  LEU A O    2  
ATOM 1943  C CB   . LEU A 1 27  ? 6.949   -0.803  5.358   1.00 0.00 ? 27  LEU A CB   2  
ATOM 1944  C CG   . LEU A 1 27  ? 6.281   -0.316  6.644   1.00 0.00 ? 27  LEU A CG   2  
ATOM 1945  C CD1  . LEU A 1 27  ? 4.920   -0.971  6.820   1.00 0.00 ? 27  LEU A CD1  2  
ATOM 1946  C CD2  . LEU A 1 27  ? 7.170   -0.597  7.847   1.00 0.00 ? 27  LEU A CD2  2  
ATOM 1947  H H    . LEU A 1 27  ? 7.625   1.844   5.043   1.00 0.00 ? 27  LEU A H    2  
ATOM 1948  H HA   . LEU A 1 27  ? 9.075   -0.667  5.568   1.00 0.00 ? 27  LEU A HA   2  
ATOM 1949  H HB2  . LEU A 1 27  ? 6.273   -0.609  4.540   1.00 0.00 ? 27  LEU A HB2  2  
ATOM 1950  H HB3  . LEU A 1 27  ? 7.104   -1.869  5.448   1.00 0.00 ? 27  LEU A HB3  2  
ATOM 1951  H HG   . LEU A 1 27  ? 6.130   0.753   6.581   1.00 0.00 ? 27  LEU A HG   2  
ATOM 1952  H HD11 . LEU A 1 27  ? 4.831   -1.805  6.141   1.00 0.00 ? 27  LEU A HD11 2  
ATOM 1953  H HD12 . LEU A 1 27  ? 4.144   -0.250  6.608   1.00 0.00 ? 27  LEU A HD12 2  
ATOM 1954  H HD13 . LEU A 1 27  ? 4.817   -1.321  7.837   1.00 0.00 ? 27  LEU A HD13 2  
ATOM 1955  H HD21 . LEU A 1 27  ? 7.141   -1.652  8.076   1.00 0.00 ? 27  LEU A HD21 2  
ATOM 1956  H HD22 . LEU A 1 27  ? 6.812   -0.035  8.697   1.00 0.00 ? 27  LEU A HD22 2  
ATOM 1957  H HD23 . LEU A 1 27  ? 8.184   -0.304  7.621   1.00 0.00 ? 27  LEU A HD23 2  
ATOM 1958  N N    . LYS A 1 28  ? 9.476   -1.224  3.183   1.00 0.00 ? 28  LYS A N    2  
ATOM 1959  C CA   . LYS A 1 28  ? 9.833   -1.465  1.790   1.00 0.00 ? 28  LYS A CA   2  
ATOM 1960  C C    . LYS A 1 28  ? 8.950   -2.549  1.181   1.00 0.00 ? 28  LYS A C    2  
ATOM 1961  O O    . LYS A 1 28  ? 9.025   -3.715  1.570   1.00 0.00 ? 28  LYS A O    2  
ATOM 1962  C CB   . LYS A 1 28  ? 11.305  -1.870  1.682   1.00 0.00 ? 28  LYS A CB   2  
ATOM 1963  C CG   . LYS A 1 28  ? 12.272  -0.738  1.985   1.00 0.00 ? 28  LYS A CG   2  
ATOM 1964  C CD   . LYS A 1 28  ? 13.702  -1.240  2.092   1.00 0.00 ? 28  LYS A CD   2  
ATOM 1965  C CE   . LYS A 1 28  ? 14.051  -1.628  3.521   1.00 0.00 ? 28  LYS A CE   2  
ATOM 1966  N NZ   . LYS A 1 28  ? 13.768  -3.065  3.790   1.00 0.00 ? 28  LYS A NZ   2  
ATOM 1967  H H    . LYS A 1 28  ? 9.910   -1.752  3.886   1.00 0.00 ? 28  LYS A H    2  
ATOM 1968  H HA   . LYS A 1 28  ? 9.681   -0.546  1.245   1.00 0.00 ? 28  LYS A HA   2  
ATOM 1969  H HB2  . LYS A 1 28  ? 11.496  -2.675  2.377   1.00 0.00 ? 28  LYS A HB2  2  
ATOM 1970  H HB3  . LYS A 1 28  ? 11.497  -2.220  0.678   1.00 0.00 ? 28  LYS A HB3  2  
ATOM 1971  H HG2  . LYS A 1 28  ? 12.216  -0.008  1.192   1.00 0.00 ? 28  LYS A HG2  2  
ATOM 1972  H HG3  . LYS A 1 28  ? 11.990  -0.278  2.921   1.00 0.00 ? 28  LYS A HG3  2  
ATOM 1973  H HD2  . LYS A 1 28  ? 13.819  -2.106  1.457   1.00 0.00 ? 28  LYS A HD2  2  
ATOM 1974  H HD3  . LYS A 1 28  ? 14.374  -0.459  1.766   1.00 0.00 ? 28  LYS A HD3  2  
ATOM 1975  H HE2  . LYS A 1 28  ? 15.101  -1.440  3.685   1.00 0.00 ? 28  LYS A HE2  2  
ATOM 1976  H HE3  . LYS A 1 28  ? 13.466  -1.022  4.197   1.00 0.00 ? 28  LYS A HE3  2  
ATOM 1977  H HZ1  . LYS A 1 28  ? 13.075  -3.427  3.104   1.00 0.00 ? 28  LYS A HZ1  2  
ATOM 1978  H HZ2  . LYS A 1 28  ? 13.382  -3.180  4.749   1.00 0.00 ? 28  LYS A HZ2  2  
ATOM 1979  H HZ3  . LYS A 1 28  ? 14.643  -3.623  3.711   1.00 0.00 ? 28  LYS A HZ3  2  
ATOM 1980  N N    . VAL A 1 29  ? 8.115   -2.159  0.224   1.00 0.00 ? 29  VAL A N    2  
ATOM 1981  C CA   . VAL A 1 29  ? 7.220   -3.098  -0.440  1.00 0.00 ? 29  VAL A CA   2  
ATOM 1982  C C    . VAL A 1 29  ? 7.882   -3.715  -1.667  1.00 0.00 ? 29  VAL A C    2  
ATOM 1983  O O    . VAL A 1 29  ? 8.216   -3.014  -2.623  1.00 0.00 ? 29  VAL A O    2  
ATOM 1984  C CB   . VAL A 1 29  ? 5.907   -2.416  -0.867  1.00 0.00 ? 29  VAL A CB   2  
ATOM 1985  C CG1  . VAL A 1 29  ? 4.894   -3.451  -1.334  1.00 0.00 ? 29  VAL A CG1  2  
ATOM 1986  C CG2  . VAL A 1 29  ? 5.343   -1.584  0.275   1.00 0.00 ? 29  VAL A CG2  2  
ATOM 1987  H H    . VAL A 1 29  ? 8.102   -1.216  -0.043  1.00 0.00 ? 29  VAL A H    2  
ATOM 1988  H HA   . VAL A 1 29  ? 6.981   -3.884  0.261   1.00 0.00 ? 29  VAL A HA   2  
ATOM 1989  H HB   . VAL A 1 29  ? 6.120   -1.755  -1.694  1.00 0.00 ? 29  VAL A HB   2  
ATOM 1990  H HG11 . VAL A 1 29  ? 5.222   -4.435  -1.035  1.00 0.00 ? 29  VAL A HG11 2  
ATOM 1991  H HG12 . VAL A 1 29  ? 3.932   -3.240  -0.890  1.00 0.00 ? 29  VAL A HG12 2  
ATOM 1992  H HG13 . VAL A 1 29  ? 4.811   -3.412  -2.410  1.00 0.00 ? 29  VAL A HG13 2  
ATOM 1993  H HG21 . VAL A 1 29  ? 5.147   -2.224  1.122   1.00 0.00 ? 29  VAL A HG21 2  
ATOM 1994  H HG22 . VAL A 1 29  ? 6.059   -0.825  0.555   1.00 0.00 ? 29  VAL A HG22 2  
ATOM 1995  H HG23 . VAL A 1 29  ? 4.425   -1.113  -0.041  1.00 0.00 ? 29  VAL A HG23 2  
ATOM 1996  N N    . ALA A 1 30  ? 8.068   -5.030  -1.634  1.00 0.00 ? 30  ALA A N    2  
ATOM 1997  C CA   . ALA A 1 30  ? 8.688   -5.742  -2.745  1.00 0.00 ? 30  ALA A CA   2  
ATOM 1998  C C    . ALA A 1 30  ? 7.639   -6.438  -3.605  1.00 0.00 ? 30  ALA A C    2  
ATOM 1999  O O    . ALA A 1 30  ? 6.858   -7.251  -3.111  1.00 0.00 ? 30  ALA A O    2  
ATOM 2000  C CB   . ALA A 1 30  ? 9.702   -6.751  -2.225  1.00 0.00 ? 30  ALA A CB   2  
ATOM 2001  H H    . ALA A 1 30  ? 7.781   -5.534  -0.845  1.00 0.00 ? 30  ALA A H    2  
ATOM 2002  H HA   . ALA A 1 30  ? 9.215   -5.019  -3.352  1.00 0.00 ? 30  ALA A HA   2  
ATOM 2003  H HB1  . ALA A 1 30  ? 10.273  -6.305  -1.423  1.00 0.00 ? 30  ALA A HB1  2  
ATOM 2004  H HB2  . ALA A 1 30  ? 9.185   -7.624  -1.858  1.00 0.00 ? 30  ALA A HB2  2  
ATOM 2005  H HB3  . ALA A 1 30  ? 10.368  -7.036  -3.026  1.00 0.00 ? 30  ALA A HB3  2  
ATOM 2006  N N    . GLY A 1 31  ? 7.626   -6.114  -4.894  1.00 0.00 ? 31  GLY A N    2  
ATOM 2007  C CA   . GLY A 1 31  ? 6.668   -6.717  -5.801  1.00 0.00 ? 31  GLY A CA   2  
ATOM 2008  C C    . GLY A 1 31  ? 7.297   -7.765  -6.697  1.00 0.00 ? 31  GLY A C    2  
ATOM 2009  O O    . GLY A 1 31  ? 8.452   -7.633  -7.100  1.00 0.00 ? 31  GLY A O    2  
ATOM 2010  H H    . GLY A 1 31  ? 8.273   -5.459  -5.232  1.00 0.00 ? 31  GLY A H    2  
ATOM 2011  H HA2  . GLY A 1 31  ? 5.881   -7.178  -5.222  1.00 0.00 ? 31  GLY A HA2  2  
ATOM 2012  H HA3  . GLY A 1 31  ? 6.239   -5.942  -6.420  1.00 0.00 ? 31  GLY A HA3  2  
ATOM 2013  N N    . GLN A 1 32  ? 6.537   -8.810  -7.007  1.00 0.00 ? 32  GLN A N    2  
ATOM 2014  C CA   . GLN A 1 32  ? 7.029   -9.887  -7.858  1.00 0.00 ? 32  GLN A CA   2  
ATOM 2015  C C    . GLN A 1 32  ? 7.736   -9.328  -9.088  1.00 0.00 ? 32  GLN A C    2  
ATOM 2016  O O    . GLN A 1 32  ? 8.692   -9.920  -9.590  1.00 0.00 ? 32  GLN A O    2  
ATOM 2017  C CB   . GLN A 1 32  ? 5.875   -10.795 -8.287  1.00 0.00 ? 32  GLN A CB   2  
ATOM 2018  C CG   . GLN A 1 32  ? 4.889   -10.121 -9.228  1.00 0.00 ? 32  GLN A CG   2  
ATOM 2019  C CD   . GLN A 1 32  ? 5.311   -10.215 -10.681 1.00 0.00 ? 32  GLN A CD   2  
ATOM 2020  O OE1  . GLN A 1 32  ? 6.451   -10.567 -10.987 1.00 0.00 ? 32  GLN A OE1  2  
ATOM 2021  N NE2  . GLN A 1 32  ? 4.393   -9.899  -11.586 1.00 0.00 ? 32  GLN A NE2  2  
ATOM 2022  H H    . GLN A 1 32  ? 5.624   -8.859  -6.655  1.00 0.00 ? 32  GLN A H    2  
ATOM 2023  H HA   . GLN A 1 32  ? 7.736   -10.466 -7.284  1.00 0.00 ? 32  GLN A HA   2  
ATOM 2024  H HB2  . GLN A 1 32  ? 6.281   -11.662 -8.786  1.00 0.00 ? 32  GLN A HB2  2  
ATOM 2025  H HB3  . GLN A 1 32  ? 5.338   -11.114 -7.407  1.00 0.00 ? 32  GLN A HB3  2  
ATOM 2026  H HG2  . GLN A 1 32  ? 3.925   -10.596 -9.119  1.00 0.00 ? 32  GLN A HG2  2  
ATOM 2027  H HG3  . GLN A 1 32  ? 4.808   -9.079  -8.958  1.00 0.00 ? 32  GLN A HG3  2  
ATOM 2028  H HE21 . GLN A 1 32  ? 3.506   -9.625  -11.269 1.00 0.00 ? 32  GLN A HE21 2  
ATOM 2029  H HE22 . GLN A 1 32  ? 4.639   -9.950  -12.533 1.00 0.00 ? 32  GLN A HE22 2  
ATOM 2030  N N    . ASP A 1 33  ? 7.261   -8.185  -9.569  1.00 0.00 ? 33  ASP A N    2  
ATOM 2031  C CA   . ASP A 1 33  ? 7.848   -7.545  -10.741 1.00 0.00 ? 33  ASP A CA   2  
ATOM 2032  C C    . ASP A 1 33  ? 9.012   -6.643  -10.341 1.00 0.00 ? 33  ASP A C    2  
ATOM 2033  O O    . ASP A 1 33  ? 9.086   -5.488  -10.758 1.00 0.00 ? 33  ASP A O    2  
ATOM 2034  C CB   . ASP A 1 33  ? 6.790   -6.732  -11.489 1.00 0.00 ? 33  ASP A CB   2  
ATOM 2035  C CG   . ASP A 1 33  ? 5.934   -7.593  -12.398 1.00 0.00 ? 33  ASP A CG   2  
ATOM 2036  O OD1  . ASP A 1 33  ? 6.378   -8.706  -12.750 1.00 0.00 ? 33  ASP A OD1  2  
ATOM 2037  O OD2  . ASP A 1 33  ? 4.822   -7.154  -12.757 1.00 0.00 ? 33  ASP A OD2  2  
ATOM 2038  H H    . ASP A 1 33  ? 6.496   -7.760  -9.126  1.00 0.00 ? 33  ASP A H    2  
ATOM 2039  H HA   . ASP A 1 33  ? 8.219   -8.322  -11.392 1.00 0.00 ? 33  ASP A HA   2  
ATOM 2040  H HB2  . ASP A 1 33  ? 6.144   -6.247  -10.772 1.00 0.00 ? 33  ASP A HB2  2  
ATOM 2041  H HB3  . ASP A 1 33  ? 7.281   -5.982  -12.091 1.00 0.00 ? 33  ASP A HB3  2  
ATOM 2042  N N    . GLY A 1 34  ? 9.918   -7.179  -9.530  1.00 0.00 ? 34  GLY A N    2  
ATOM 2043  C CA   . GLY A 1 34  ? 11.065  -6.408  -9.086  1.00 0.00 ? 34  GLY A CA   2  
ATOM 2044  C C    . GLY A 1 34  ? 10.736  -4.943  -8.885  1.00 0.00 ? 34  GLY A C    2  
ATOM 2045  O O    . GLY A 1 34  ? 11.419  -4.067  -9.416  1.00 0.00 ? 34  GLY A O    2  
ATOM 2046  H H    . GLY A 1 34  ? 9.807   -8.105  -9.230  1.00 0.00 ? 34  GLY A H    2  
ATOM 2047  H HA2  . GLY A 1 34  ? 11.422  -6.818  -8.153  1.00 0.00 ? 34  GLY A HA2  2  
ATOM 2048  H HA3  . GLY A 1 34  ? 11.848  -6.491  -9.827  1.00 0.00 ? 34  GLY A HA3  2  
ATOM 2049  N N    . SER A 1 35  ? 9.685   -4.674  -8.116  1.00 0.00 ? 35  SER A N    2  
ATOM 2050  C CA   . SER A 1 35  ? 9.263   -3.304  -7.850  1.00 0.00 ? 35  SER A CA   2  
ATOM 2051  C C    . SER A 1 35  ? 9.328   -2.995  -6.357  1.00 0.00 ? 35  SER A C    2  
ATOM 2052  O O    . SER A 1 35  ? 8.672   -3.650  -5.547  1.00 0.00 ? 35  SER A O    2  
ATOM 2053  C CB   . SER A 1 35  ? 7.841   -3.076  -8.367  1.00 0.00 ? 35  SER A CB   2  
ATOM 2054  O OG   . SER A 1 35  ? 7.599   -1.700  -8.606  1.00 0.00 ? 35  SER A OG   2  
ATOM 2055  H H    . SER A 1 35  ? 9.180   -5.416  -7.721  1.00 0.00 ? 35  SER A H    2  
ATOM 2056  H HA   . SER A 1 35  ? 9.937   -2.642  -8.372  1.00 0.00 ? 35  SER A HA   2  
ATOM 2057  H HB2  . SER A 1 35  ? 7.706   -3.618  -9.291  1.00 0.00 ? 35  SER A HB2  2  
ATOM 2058  H HB3  . SER A 1 35  ? 7.133   -3.432  -7.634  1.00 0.00 ? 35  SER A HB3  2  
ATOM 2059  H HG   . SER A 1 35  ? 7.711   -1.209  -7.789  1.00 0.00 ? 35  SER A HG   2  
ATOM 2060  N N    . VAL A 1 36  ? 10.125  -1.993  -6.001  1.00 0.00 ? 36  VAL A N    2  
ATOM 2061  C CA   . VAL A 1 36  ? 10.277  -1.596  -4.606  1.00 0.00 ? 36  VAL A CA   2  
ATOM 2062  C C    . VAL A 1 36  ? 9.578   -0.268  -4.334  1.00 0.00 ? 36  VAL A C    2  
ATOM 2063  O O    . VAL A 1 36  ? 9.911   0.755   -4.932  1.00 0.00 ? 36  VAL A O    2  
ATOM 2064  C CB   . VAL A 1 36  ? 11.762  -1.470  -4.217  1.00 0.00 ? 36  VAL A CB   2  
ATOM 2065  C CG1  . VAL A 1 36  ? 11.899  -0.999  -2.777  1.00 0.00 ? 36  VAL A CG1  2  
ATOM 2066  C CG2  . VAL A 1 36  ? 12.480  -2.796  -4.423  1.00 0.00 ? 36  VAL A CG2  2  
ATOM 2067  H H    . VAL A 1 36  ? 10.623  -1.509  -6.693  1.00 0.00 ? 36  VAL A H    2  
ATOM 2068  H HA   . VAL A 1 36  ? 9.828   -2.361  -3.990  1.00 0.00 ? 36  VAL A HA   2  
ATOM 2069  H HB   . VAL A 1 36  ? 12.221  -0.733  -4.859  1.00 0.00 ? 36  VAL A HB   2  
ATOM 2070  H HG11 . VAL A 1 36  ? 11.788  -1.842  -2.111  1.00 0.00 ? 36  VAL A HG11 2  
ATOM 2071  H HG12 . VAL A 1 36  ? 12.871  -0.551  -2.635  1.00 0.00 ? 36  VAL A HG12 2  
ATOM 2072  H HG13 . VAL A 1 36  ? 11.132  -0.269  -2.563  1.00 0.00 ? 36  VAL A HG13 2  
ATOM 2073  H HG21 . VAL A 1 36  ? 11.790  -3.608  -4.249  1.00 0.00 ? 36  VAL A HG21 2  
ATOM 2074  H HG22 . VAL A 1 36  ? 12.853  -2.850  -5.435  1.00 0.00 ? 36  VAL A HG22 2  
ATOM 2075  H HG23 . VAL A 1 36  ? 13.306  -2.870  -3.731  1.00 0.00 ? 36  VAL A HG23 2  
ATOM 2076  N N    . VAL A 1 37  ? 8.607   -0.293  -3.427  1.00 0.00 ? 37  VAL A N    2  
ATOM 2077  C CA   . VAL A 1 37  ? 7.861   0.909   -3.073  1.00 0.00 ? 37  VAL A CA   2  
ATOM 2078  C C    . VAL A 1 37  ? 7.847   1.123   -1.564  1.00 0.00 ? 37  VAL A C    2  
ATOM 2079  O O    . VAL A 1 37  ? 7.407   0.257   -0.809  1.00 0.00 ? 37  VAL A O    2  
ATOM 2080  C CB   . VAL A 1 37  ? 6.409   0.839   -3.584  1.00 0.00 ? 37  VAL A CB   2  
ATOM 2081  C CG1  . VAL A 1 37  ? 5.730   2.193   -3.450  1.00 0.00 ? 37  VAL A CG1  2  
ATOM 2082  C CG2  . VAL A 1 37  ? 6.374   0.356   -5.026  1.00 0.00 ? 37  VAL A CG2  2  
ATOM 2083  H H    . VAL A 1 37  ? 8.387   -1.139  -2.984  1.00 0.00 ? 37  VAL A H    2  
ATOM 2084  H HA   . VAL A 1 37  ? 8.345   1.753   -3.543  1.00 0.00 ? 37  VAL A HA   2  
ATOM 2085  H HB   . VAL A 1 37  ? 5.869   0.128   -2.975  1.00 0.00 ? 37  VAL A HB   2  
ATOM 2086  H HG11 . VAL A 1 37  ? 4.690   2.103   -3.726  1.00 0.00 ? 37  VAL A HG11 2  
ATOM 2087  H HG12 . VAL A 1 37  ? 5.804   2.534   -2.427  1.00 0.00 ? 37  VAL A HG12 2  
ATOM 2088  H HG13 . VAL A 1 37  ? 6.214   2.905   -4.102  1.00 0.00 ? 37  VAL A HG13 2  
ATOM 2089  H HG21 . VAL A 1 37  ? 6.375   1.208   -5.690  1.00 0.00 ? 37  VAL A HG21 2  
ATOM 2090  H HG22 . VAL A 1 37  ? 7.244   -0.254  -5.223  1.00 0.00 ? 37  VAL A HG22 2  
ATOM 2091  H HG23 . VAL A 1 37  ? 5.481   -0.228  -5.189  1.00 0.00 ? 37  VAL A HG23 2  
ATOM 2092  N N    . GLN A 1 38  ? 8.333   2.283   -1.132  1.00 0.00 ? 38  GLN A N    2  
ATOM 2093  C CA   . GLN A 1 38  ? 8.377   2.611   0.288   1.00 0.00 ? 38  GLN A CA   2  
ATOM 2094  C C    . GLN A 1 38  ? 7.120   3.364   0.712   1.00 0.00 ? 38  GLN A C    2  
ATOM 2095  O O    . GLN A 1 38  ? 6.385   3.886   -0.126  1.00 0.00 ? 38  GLN A O    2  
ATOM 2096  C CB   . GLN A 1 38  ? 9.618   3.448   0.601   1.00 0.00 ? 38  GLN A CB   2  
ATOM 2097  C CG   . GLN A 1 38  ? 10.905  2.639   0.636   1.00 0.00 ? 38  GLN A CG   2  
ATOM 2098  C CD   . GLN A 1 38  ? 12.119  3.457   0.242   1.00 0.00 ? 38  GLN A CD   2  
ATOM 2099  O OE1  . GLN A 1 38  ? 12.248  4.621   0.623   1.00 0.00 ? 38  GLN A OE1  2  
ATOM 2100  N NE2  . GLN A 1 38  ? 13.017  2.851   -0.526  1.00 0.00 ? 38  GLN A NE2  2  
ATOM 2101  H H    . GLN A 1 38  ? 8.669   2.932   -1.783  1.00 0.00 ? 38  GLN A H    2  
ATOM 2102  H HA   . GLN A 1 38  ? 8.430   1.685   0.840   1.00 0.00 ? 38  GLN A HA   2  
ATOM 2103  H HB2  . GLN A 1 38  ? 9.720   4.215   -0.152  1.00 0.00 ? 38  GLN A HB2  2  
ATOM 2104  H HB3  . GLN A 1 38  ? 9.487   3.917   1.566   1.00 0.00 ? 38  GLN A HB3  2  
ATOM 2105  H HG2  . GLN A 1 38  ? 11.053  2.265   1.638   1.00 0.00 ? 38  GLN A HG2  2  
ATOM 2106  H HG3  . GLN A 1 38  ? 10.810  1.808   -0.048  1.00 0.00 ? 38  GLN A HG3  2  
ATOM 2107  H HE21 . GLN A 1 38  ? 12.847  1.923   -0.792  1.00 0.00 ? 38  GLN A HE21 2  
ATOM 2108  H HE22 . GLN A 1 38  ? 13.811  3.357   -0.796  1.00 0.00 ? 38  GLN A HE22 2  
ATOM 2109  N N    . PHE A 1 39  ? 6.880   3.416   2.018   1.00 0.00 ? 39  PHE A N    2  
ATOM 2110  C CA   . PHE A 1 39  ? 5.711   4.104   2.553   1.00 0.00 ? 39  PHE A CA   2  
ATOM 2111  C C    . PHE A 1 39  ? 5.968   4.583   3.979   1.00 0.00 ? 39  PHE A C    2  
ATOM 2112  O O    . PHE A 1 39  ? 6.302   3.792   4.861   1.00 0.00 ? 39  PHE A O    2  
ATOM 2113  C CB   . PHE A 1 39  ? 4.491   3.181   2.525   1.00 0.00 ? 39  PHE A CB   2  
ATOM 2114  C CG   . PHE A 1 39  ? 4.045   2.820   1.137   1.00 0.00 ? 39  PHE A CG   2  
ATOM 2115  C CD1  . PHE A 1 39  ? 4.646   1.777   0.451   1.00 0.00 ? 39  PHE A CD1  2  
ATOM 2116  C CD2  . PHE A 1 39  ? 3.023   3.523   0.519   1.00 0.00 ? 39  PHE A CD2  2  
ATOM 2117  C CE1  . PHE A 1 39  ? 4.237   1.443   -0.826  1.00 0.00 ? 39  PHE A CE1  2  
ATOM 2118  C CE2  . PHE A 1 39  ? 2.610   3.193   -0.758  1.00 0.00 ? 39  PHE A CE2  2  
ATOM 2119  C CZ   . PHE A 1 39  ? 3.217   2.152   -1.431  1.00 0.00 ? 39  PHE A CZ   2  
ATOM 2120  H H    . PHE A 1 39  ? 7.503   2.980   2.636   1.00 0.00 ? 39  PHE A H    2  
ATOM 2121  H HA   . PHE A 1 39  ? 5.517   4.962   1.928   1.00 0.00 ? 39  PHE A HA   2  
ATOM 2122  H HB2  . PHE A 1 39  ? 4.730   2.265   3.045   1.00 0.00 ? 39  PHE A HB2  2  
ATOM 2123  H HB3  . PHE A 1 39  ? 3.668   3.669   3.024   1.00 0.00 ? 39  PHE A HB3  2  
ATOM 2124  H HD1  . PHE A 1 39  ? 5.443   1.221   0.923   1.00 0.00 ? 39  PHE A HD1  2  
ATOM 2125  H HD2  . PHE A 1 39  ? 2.547   4.338   1.045   1.00 0.00 ? 39  PHE A HD2  2  
ATOM 2126  H HE1  . PHE A 1 39  ? 4.713   0.628   -1.351  1.00 0.00 ? 39  PHE A HE1  2  
ATOM 2127  H HE2  . PHE A 1 39  ? 1.812   3.749   -1.228  1.00 0.00 ? 39  PHE A HE2  2  
ATOM 2128  H HZ   . PHE A 1 39  ? 2.896   1.893   -2.429  1.00 0.00 ? 39  PHE A HZ   2  
ATOM 2129  N N    . LYS A 1 40  ? 5.809   5.884   4.197   1.00 0.00 ? 40  LYS A N    2  
ATOM 2130  C CA   . LYS A 1 40  ? 6.023   6.471   5.515   1.00 0.00 ? 40  LYS A CA   2  
ATOM 2131  C C    . LYS A 1 40  ? 4.692   6.776   6.196   1.00 0.00 ? 40  LYS A C    2  
ATOM 2132  O O    . LYS A 1 40  ? 3.973   7.690   5.792   1.00 0.00 ? 40  LYS A O    2  
ATOM 2133  C CB   . LYS A 1 40  ? 6.853   7.751   5.397   1.00 0.00 ? 40  LYS A CB   2  
ATOM 2134  C CG   . LYS A 1 40  ? 7.474   8.196   6.710   1.00 0.00 ? 40  LYS A CG   2  
ATOM 2135  C CD   . LYS A 1 40  ? 7.836   9.671   6.684   1.00 0.00 ? 40  LYS A CD   2  
ATOM 2136  C CE   . LYS A 1 40  ? 6.671   10.539  7.136   1.00 0.00 ? 40  LYS A CE   2  
ATOM 2137  N NZ   . LYS A 1 40  ? 5.794   10.927  5.997   1.00 0.00 ? 40  LYS A NZ   2  
ATOM 2138  H H    . LYS A 1 40  ? 5.541   6.464   3.453   1.00 0.00 ? 40  LYS A H    2  
ATOM 2139  H HA   . LYS A 1 40  ? 6.564   5.755   6.113   1.00 0.00 ? 40  LYS A HA   2  
ATOM 2140  H HB2  . LYS A 1 40  ? 7.647   7.587   4.684   1.00 0.00 ? 40  LYS A HB2  2  
ATOM 2141  H HB3  . LYS A 1 40  ? 6.217   8.547   5.037   1.00 0.00 ? 40  LYS A HB3  2  
ATOM 2142  H HG2  . LYS A 1 40  ? 6.769   8.023   7.509   1.00 0.00 ? 40  LYS A HG2  2  
ATOM 2143  H HG3  . LYS A 1 40  ? 8.370   7.618   6.887   1.00 0.00 ? 40  LYS A HG3  2  
ATOM 2144  H HD2  . LYS A 1 40  ? 8.673   9.840   7.346   1.00 0.00 ? 40  LYS A HD2  2  
ATOM 2145  H HD3  . LYS A 1 40  ? 8.110   9.949   5.676   1.00 0.00 ? 40  LYS A HD3  2  
ATOM 2146  H HE2  . LYS A 1 40  ? 6.087   9.987   7.857   1.00 0.00 ? 40  LYS A HE2  2  
ATOM 2147  H HE3  . LYS A 1 40  ? 7.063   11.432  7.599   1.00 0.00 ? 40  LYS A HE3  2  
ATOM 2148  H HZ1  . LYS A 1 40  ? 4.840   10.535  6.132   1.00 0.00 ? 40  LYS A HZ1  2  
ATOM 2149  H HZ2  . LYS A 1 40  ? 6.184   10.562  5.105   1.00 0.00 ? 40  LYS A HZ2  2  
ATOM 2150  H HZ3  . LYS A 1 40  ? 5.726   11.963  5.935   1.00 0.00 ? 40  LYS A HZ3  2  
ATOM 2151  N N    . ILE A 1 41  ? 4.373   6.007   7.232   1.00 0.00 ? 41  ILE A N    2  
ATOM 2152  C CA   . ILE A 1 41  ? 3.131   6.198   7.970   1.00 0.00 ? 41  ILE A CA   2  
ATOM 2153  C C    . ILE A 1 41  ? 3.378   6.186   9.475   1.00 0.00 ? 41  ILE A C    2  
ATOM 2154  O O    . ILE A 1 41  ? 4.508   6.000   9.928   1.00 0.00 ? 41  ILE A O    2  
ATOM 2155  C CB   . ILE A 1 41  ? 2.097   5.110   7.622   1.00 0.00 ? 41  ILE A CB   2  
ATOM 2156  C CG1  . ILE A 1 41  ? 2.443   3.801   8.334   1.00 0.00 ? 41  ILE A CG1  2  
ATOM 2157  C CG2  . ILE A 1 41  ? 2.034   4.901   6.117   1.00 0.00 ? 41  ILE A CG2  2  
ATOM 2158  C CD1  . ILE A 1 41  ? 1.400   2.721   8.152   1.00 0.00 ? 41  ILE A CD1  2  
ATOM 2159  H H    . ILE A 1 41  ? 4.988   5.295   7.506   1.00 0.00 ? 41  ILE A H    2  
ATOM 2160  H HA   . ILE A 1 41  ? 2.722   7.158   7.691   1.00 0.00 ? 41  ILE A HA   2  
ATOM 2161  H HB   . ILE A 1 41  ? 1.127   5.448   7.956   1.00 0.00 ? 41  ILE A HB   2  
ATOM 2162  H HG12 . ILE A 1 41  ? 3.378   3.426   7.949   1.00 0.00 ? 41  ILE A HG12 2  
ATOM 2163  H HG13 . ILE A 1 41  ? 2.544   3.991   9.392   1.00 0.00 ? 41  ILE A HG13 2  
ATOM 2164  H HG21 . ILE A 1 41  ? 1.163   5.402   5.720   1.00 0.00 ? 41  ILE A HG21 2  
ATOM 2165  H HG22 . ILE A 1 41  ? 2.923   5.310   5.660   1.00 0.00 ? 41  ILE A HG22 2  
ATOM 2166  H HG23 . ILE A 1 41  ? 1.971   3.845   5.902   1.00 0.00 ? 41  ILE A HG23 2  
ATOM 2167  H HD11 . ILE A 1 41  ? 0.829   2.918   7.257   1.00 0.00 ? 41  ILE A HD11 2  
ATOM 2168  H HD12 . ILE A 1 41  ? 1.886   1.761   8.066   1.00 0.00 ? 41  ILE A HD12 2  
ATOM 2169  H HD13 . ILE A 1 41  ? 0.737   2.713   9.006   1.00 0.00 ? 41  ILE A HD13 2  
ATOM 2170  N N    . LYS A 1 42  ? 2.314   6.383   10.245  1.00 0.00 ? 42  LYS A N    2  
ATOM 2171  C CA   . LYS A 1 42  ? 2.413   6.393   11.700  1.00 0.00 ? 42  LYS A CA   2  
ATOM 2172  C C    . LYS A 1 42  ? 2.190   4.995   12.269  1.00 0.00 ? 42  LYS A C    2  
ATOM 2173  O O    . LYS A 1 42  ? 1.758   4.087   11.559  1.00 0.00 ? 42  LYS A O    2  
ATOM 2174  C CB   . LYS A 1 42  ? 1.394   7.366   12.295  1.00 0.00 ? 42  LYS A CB   2  
ATOM 2175  C CG   . LYS A 1 42  ? 1.415   8.740   11.648  1.00 0.00 ? 42  LYS A CG   2  
ATOM 2176  C CD   . LYS A 1 42  ? 0.099   9.473   11.852  1.00 0.00 ? 42  LYS A CD   2  
ATOM 2177  C CE   . LYS A 1 42  ? -0.086  10.582  10.828  1.00 0.00 ? 42  LYS A CE   2  
ATOM 2178  N NZ   . LYS A 1 42  ? -0.544  10.053  9.513   1.00 0.00 ? 42  LYS A NZ   2  
ATOM 2179  H H    . LYS A 1 42  ? 1.440   6.526   9.825   1.00 0.00 ? 42  LYS A H    2  
ATOM 2180  H HA   . LYS A 1 42  ? 3.408   6.721   11.963  1.00 0.00 ? 42  LYS A HA   2  
ATOM 2181  H HB2  . LYS A 1 42  ? 0.404   6.950   12.176  1.00 0.00 ? 42  LYS A HB2  2  
ATOM 2182  H HB3  . LYS A 1 42  ? 1.600   7.485   13.349  1.00 0.00 ? 42  LYS A HB3  2  
ATOM 2183  H HG2  . LYS A 1 42  ? 2.211   9.323   12.086  1.00 0.00 ? 42  LYS A HG2  2  
ATOM 2184  H HG3  . LYS A 1 42  ? 1.592   8.626   10.588  1.00 0.00 ? 42  LYS A HG3  2  
ATOM 2185  H HD2  . LYS A 1 42  ? -0.714  8.769   11.754  1.00 0.00 ? 42  LYS A HD2  2  
ATOM 2186  H HD3  . LYS A 1 42  ? 0.088   9.904   12.843  1.00 0.00 ? 42  LYS A HD3  2  
ATOM 2187  H HE2  . LYS A 1 42  ? -0.819  11.280  11.201  1.00 0.00 ? 42  LYS A HE2  2  
ATOM 2188  H HE3  . LYS A 1 42  ? 0.858   11.090  10.692  1.00 0.00 ? 42  LYS A HE3  2  
ATOM 2189  H HZ1  . LYS A 1 42  ? -1.544  9.773   9.571   1.00 0.00 ? 42  LYS A HZ1  2  
ATOM 2190  H HZ2  . LYS A 1 42  ? 0.021   9.222   9.246   1.00 0.00 ? 42  LYS A HZ2  2  
ATOM 2191  H HZ3  . LYS A 1 42  ? -0.440  10.781  8.779   1.00 0.00 ? 42  LYS A HZ3  2  
ATOM 2192  N N    . ARG A 1 43  ? 2.485   4.831   13.554  1.00 0.00 ? 43  ARG A N    2  
ATOM 2193  C CA   . ARG A 1 43  ? 2.316   3.544   14.219  1.00 0.00 ? 43  ARG A CA   2  
ATOM 2194  C C    . ARG A 1 43  ? 0.848   3.291   14.548  1.00 0.00 ? 43  ARG A C    2  
ATOM 2195  O O    . ARG A 1 43  ? 0.379   2.153   14.508  1.00 0.00 ? 43  ARG A O    2  
ATOM 2196  C CB   . ARG A 1 43  ? 3.153   3.492   15.498  1.00 0.00 ? 43  ARG A CB   2  
ATOM 2197  C CG   . ARG A 1 43  ? 4.626   3.210   15.251  1.00 0.00 ? 43  ARG A CG   2  
ATOM 2198  C CD   . ARG A 1 43  ? 4.891   1.719   15.108  1.00 0.00 ? 43  ARG A CD   2  
ATOM 2199  N NE   . ARG A 1 43  ? 6.301   1.436   14.857  1.00 0.00 ? 43  ARG A NE   2  
ATOM 2200  C CZ   . ARG A 1 43  ? 7.238   1.473   15.798  1.00 0.00 ? 43  ARG A CZ   2  
ATOM 2201  N NH1  . ARG A 1 43  ? 6.915   1.780   17.047  1.00 0.00 ? 43  ARG A NH1  2  
ATOM 2202  N NH2  . ARG A 1 43  ? 8.500   1.202   15.492  1.00 0.00 ? 43  ARG A NH2  2  
ATOM 2203  H H    . ARG A 1 43  ? 2.826   5.593   14.068  1.00 0.00 ? 43  ARG A H    2  
ATOM 2204  H HA   . ARG A 1 43  ? 2.660   2.774   13.543  1.00 0.00 ? 43  ARG A HA   2  
ATOM 2205  H HB2  . ARG A 1 43  ? 3.072   4.442   16.006  1.00 0.00 ? 43  ARG A HB2  2  
ATOM 2206  H HB3  . ARG A 1 43  ? 2.762   2.716   16.138  1.00 0.00 ? 43  ARG A HB3  2  
ATOM 2207  H HG2  . ARG A 1 43  ? 4.932   3.707   14.343  1.00 0.00 ? 43  ARG A HG2  2  
ATOM 2208  H HG3  . ARG A 1 43  ? 5.200   3.590   16.083  1.00 0.00 ? 43  ARG A HG3  2  
ATOM 2209  H HD2  . ARG A 1 43  ? 4.591   1.224   16.019  1.00 0.00 ? 43  ARG A HD2  2  
ATOM 2210  H HD3  . ARG A 1 43  ? 4.305   1.341   14.284  1.00 0.00 ? 43  ARG A HD3  2  
ATOM 2211  H HE   . ARG A 1 43  ? 6.562   1.206   13.941  1.00 0.00 ? 43  ARG A HE   2  
ATOM 2212  H HH11 . ARG A 1 43  ? 5.964   1.983   17.281  1.00 0.00 ? 43  ARG A HH11 2  
ATOM 2213  H HH12 . ARG A 1 43  ? 7.621   1.806   17.754  1.00 0.00 ? 43  ARG A HH12 2  
ATOM 2214  H HH21 . ARG A 1 43  ? 8.747   0.970   14.551  1.00 0.00 ? 43  ARG A HH21 2  
ATOM 2215  H HH22 . ARG A 1 43  ? 9.204   1.231   16.201  1.00 0.00 ? 43  ARG A HH22 2  
ATOM 2216  N N    . HIS A 1 44  ? 0.127   4.359   14.874  1.00 0.00 ? 44  HIS A N    2  
ATOM 2217  C CA   . HIS A 1 44  ? -1.288  4.253   15.210  1.00 0.00 ? 44  HIS A CA   2  
ATOM 2218  C C    . HIS A 1 44  ? -2.160  4.604   14.008  1.00 0.00 ? 44  HIS A C    2  
ATOM 2219  O O    . HIS A 1 44  ? -3.207  5.236   14.151  1.00 0.00 ? 44  HIS A O    2  
ATOM 2220  C CB   . HIS A 1 44  ? -1.625  5.171   16.385  1.00 0.00 ? 44  HIS A CB   2  
ATOM 2221  C CG   . HIS A 1 44  ? -1.055  6.549   16.251  1.00 0.00 ? 44  HIS A CG   2  
ATOM 2222  N ND1  . HIS A 1 44  ? -0.315  7.157   17.243  1.00 0.00 ? 44  HIS A ND1  2  
ATOM 2223  C CD2  . HIS A 1 44  ? -1.118  7.438   15.232  1.00 0.00 ? 44  HIS A CD2  2  
ATOM 2224  C CE1  . HIS A 1 44  ? 0.051   8.361   16.841  1.00 0.00 ? 44  HIS A CE1  2  
ATOM 2225  N NE2  . HIS A 1 44  ? -0.423  8.556   15.624  1.00 0.00 ? 44  HIS A NE2  2  
ATOM 2226  H H    . HIS A 1 44  ? 0.557   5.239   14.888  1.00 0.00 ? 44  HIS A H    2  
ATOM 2227  H HA   . HIS A 1 44  ? -1.485  3.230   15.495  1.00 0.00 ? 44  HIS A HA   2  
ATOM 2228  H HB2  . HIS A 1 44  ? -2.698  5.263   16.465  1.00 0.00 ? 44  HIS A HB2  2  
ATOM 2229  H HB3  . HIS A 1 44  ? -1.237  4.737   17.296  1.00 0.00 ? 44  HIS A HB3  2  
ATOM 2230  H HD1  . HIS A 1 44  ? -0.092  6.765   18.113  1.00 0.00 ? 44  HIS A HD1  2  
ATOM 2231  H HD2  . HIS A 1 44  ? -1.622  7.296   14.286  1.00 0.00 ? 44  HIS A HD2  2  
ATOM 2232  H HE1  . HIS A 1 44  ? 0.639   9.067   17.410  1.00 0.00 ? 44  HIS A HE1  2  
ATOM 2233  H HE2  . HIS A 1 44  ? -0.370  9.398   15.126  1.00 0.00 ? 44  HIS A HE2  2  
ATOM 2234  N N    . THR A 1 45  ? -1.721  4.191   12.823  1.00 0.00 ? 45  THR A N    2  
ATOM 2235  C CA   . THR A 1 45  ? -2.459  4.463   11.597  1.00 0.00 ? 45  THR A CA   2  
ATOM 2236  C C    . THR A 1 45  ? -2.723  3.180   10.818  1.00 0.00 ? 45  THR A C    2  
ATOM 2237  O O    . THR A 1 45  ? -1.840  2.341   10.639  1.00 0.00 ? 45  THR A O    2  
ATOM 2238  C CB   . THR A 1 45  ? -1.701  5.453   10.693  1.00 0.00 ? 45  THR A CB   2  
ATOM 2239  O OG1  . THR A 1 45  ? -1.662  6.746   11.307  1.00 0.00 ? 45  THR A OG1  2  
ATOM 2240  C CG2  . THR A 1 45  ? -2.363  5.554   9.327   1.00 0.00 ? 45  THR A CG2  2  
ATOM 2241  H H    . THR A 1 45  ? -0.879  3.691   12.775  1.00 0.00 ? 45  THR A H    2  
ATOM 2242  H HA   . THR A 1 45  ? -3.405  4.909   11.869  1.00 0.00 ? 45  THR A HA   2  
ATOM 2243  H HB   . THR A 1 45  ? -0.690  5.095   10.561  1.00 0.00 ? 45  THR A HB   2  
ATOM 2244  H HG1  . THR A 1 45  ? -1.742  6.651   12.259  1.00 0.00 ? 45  THR A HG1  2  
ATOM 2245  H HG21 . THR A 1 45  ? -3.305  6.074   9.421   1.00 0.00 ? 45  THR A HG21 2  
ATOM 2246  H HG22 . THR A 1 45  ? -2.536  4.563   8.936   1.00 0.00 ? 45  THR A HG22 2  
ATOM 2247  H HG23 . THR A 1 45  ? -1.718  6.099   8.654   1.00 0.00 ? 45  THR A HG23 2  
ATOM 2248  N N    . PRO A 1 46  ? -3.967  3.022   10.340  1.00 0.00 ? 46  PRO A N    2  
ATOM 2249  C CA   . PRO A 1 46  ? -4.375  1.843   9.570   1.00 0.00 ? 46  PRO A CA   2  
ATOM 2250  C C    . PRO A 1 46  ? -3.734  1.803   8.187   1.00 0.00 ? 46  PRO A C    2  
ATOM 2251  O O    . PRO A 1 46  ? -3.775  2.784   7.444   1.00 0.00 ? 46  PRO A O    2  
ATOM 2252  C CB   . PRO A 1 46  ? -5.892  2.005   9.451   1.00 0.00 ? 46  PRO A CB   2  
ATOM 2253  C CG   . PRO A 1 46  ? -6.128  3.471   9.576   1.00 0.00 ? 46  PRO A CG   2  
ATOM 2254  C CD   . PRO A 1 46  ? -5.069  3.982   10.514  1.00 0.00 ? 46  PRO A CD   2  
ATOM 2255  H HA   . PRO A 1 46  ? -4.149  0.928   10.097  1.00 0.00 ? 46  PRO A HA   2  
ATOM 2256  H HB2  . PRO A 1 46  ? -6.223  1.632   8.492   1.00 0.00 ? 46  PRO A HB2  2  
ATOM 2257  H HB3  . PRO A 1 46  ? -6.380  1.459   10.244  1.00 0.00 ? 46  PRO A HB3  2  
ATOM 2258  H HG2  . PRO A 1 46  ? -6.031  3.942   8.610   1.00 0.00 ? 46  PRO A HG2  2  
ATOM 2259  H HG3  . PRO A 1 46  ? -7.110  3.651   9.986   1.00 0.00 ? 46  PRO A HG3  2  
ATOM 2260  H HD2  . PRO A 1 46  ? -4.762  4.978   10.231  1.00 0.00 ? 46  PRO A HD2  2  
ATOM 2261  H HD3  . PRO A 1 46  ? -5.431  3.972   11.532  1.00 0.00 ? 46  PRO A HD3  2  
ATOM 2262  N N    . LEU A 1 47  ? -3.141  0.664   7.848   1.00 0.00 ? 47  LEU A N    2  
ATOM 2263  C CA   . LEU A 1 47  ? -2.491  0.496   6.553   1.00 0.00 ? 47  LEU A CA   2  
ATOM 2264  C C    . LEU A 1 47  ? -3.432  0.882   5.417   1.00 0.00 ? 47  LEU A C    2  
ATOM 2265  O O    . LEU A 1 47  ? -2.998  1.104   4.286   1.00 0.00 ? 47  LEU A O    2  
ATOM 2266  C CB   . LEU A 1 47  ? -2.027  -0.951  6.377   1.00 0.00 ? 47  LEU A CB   2  
ATOM 2267  C CG   . LEU A 1 47  ? -1.154  -1.518  7.497   1.00 0.00 ? 47  LEU A CG   2  
ATOM 2268  C CD1  . LEU A 1 47  ? -0.869  -2.992  7.258   1.00 0.00 ? 47  LEU A CD1  2  
ATOM 2269  C CD2  . LEU A 1 47  ? 0.144   -0.733  7.610   1.00 0.00 ? 47  LEU A CD2  2  
ATOM 2270  H H    . LEU A 1 47  ? -3.140  -0.083  8.482   1.00 0.00 ? 47  LEU A H    2  
ATOM 2271  H HA   . LEU A 1 47  ? -1.629  1.147   6.528   1.00 0.00 ? 47  LEU A HA   2  
ATOM 2272  H HB2  . LEU A 1 47  ? -2.906  -1.572  6.297   1.00 0.00 ? 47  LEU A HB2  2  
ATOM 2273  H HB3  . LEU A 1 47  ? -1.464  -1.008  5.456   1.00 0.00 ? 47  LEU A HB3  2  
ATOM 2274  H HG   . LEU A 1 47  ? -1.683  -1.429  8.436   1.00 0.00 ? 47  LEU A HG   2  
ATOM 2275  H HD11 . LEU A 1 47  ? -1.787  -3.554  7.337   1.00 0.00 ? 47  LEU A HD11 2  
ATOM 2276  H HD12 . LEU A 1 47  ? -0.165  -3.347  7.996   1.00 0.00 ? 47  LEU A HD12 2  
ATOM 2277  H HD13 . LEU A 1 47  ? -0.451  -3.122  6.270   1.00 0.00 ? 47  LEU A HD13 2  
ATOM 2278  H HD21 . LEU A 1 47  ? 0.973   -1.366  7.328   1.00 0.00 ? 47  LEU A HD21 2  
ATOM 2279  H HD22 . LEU A 1 47  ? 0.276   -0.400  8.629   1.00 0.00 ? 47  LEU A HD22 2  
ATOM 2280  H HD23 . LEU A 1 47  ? 0.106   0.123   6.953   1.00 0.00 ? 47  LEU A HD23 2  
ATOM 2281  N N    . SER A 1 48  ? -4.722  0.964   5.726   1.00 0.00 ? 48  SER A N    2  
ATOM 2282  C CA   . SER A 1 48  ? -5.725  1.322   4.730   1.00 0.00 ? 48  SER A CA   2  
ATOM 2283  C C    . SER A 1 48  ? -5.178  2.363   3.758   1.00 0.00 ? 48  SER A C    2  
ATOM 2284  O O    . SER A 1 48  ? -5.421  2.293   2.553   1.00 0.00 ? 48  SER A O    2  
ATOM 2285  C CB   . SER A 1 48  ? -6.984  1.859   5.414   1.00 0.00 ? 48  SER A CB   2  
ATOM 2286  O OG   . SER A 1 48  ? -6.653  2.692   6.511   1.00 0.00 ? 48  SER A OG   2  
ATOM 2287  H H    . SER A 1 48  ? -5.006  0.776   6.645   1.00 0.00 ? 48  SER A H    2  
ATOM 2288  H HA   . SER A 1 48  ? -5.979  0.429   4.178   1.00 0.00 ? 48  SER A HA   2  
ATOM 2289  H HB2  . SER A 1 48  ? -7.560  2.432   4.704   1.00 0.00 ? 48  SER A HB2  2  
ATOM 2290  H HB3  . SER A 1 48  ? -7.577  1.029   5.772   1.00 0.00 ? 48  SER A HB3  2  
ATOM 2291  H HG   . SER A 1 48  ? -6.625  3.606   6.222   1.00 0.00 ? 48  SER A HG   2  
ATOM 2292  N N    . LYS A 1 49  ? -4.438  3.330   4.291   1.00 0.00 ? 49  LYS A N    2  
ATOM 2293  C CA   . LYS A 1 49  ? -3.854  4.386   3.473   1.00 0.00 ? 49  LYS A CA   2  
ATOM 2294  C C    . LYS A 1 49  ? -2.625  3.879   2.725   1.00 0.00 ? 49  LYS A C    2  
ATOM 2295  O O    . LYS A 1 49  ? -2.430  4.188   1.549   1.00 0.00 ? 49  LYS A O    2  
ATOM 2296  C CB   . LYS A 1 49  ? -3.475  5.584   4.346   1.00 0.00 ? 49  LYS A CB   2  
ATOM 2297  C CG   . LYS A 1 49  ? -4.586  6.610   4.486   1.00 0.00 ? 49  LYS A CG   2  
ATOM 2298  C CD   . LYS A 1 49  ? -5.470  6.314   5.685   1.00 0.00 ? 49  LYS A CD   2  
ATOM 2299  C CE   . LYS A 1 49  ? -4.895  6.905   6.963   1.00 0.00 ? 49  LYS A CE   2  
ATOM 2300  N NZ   . LYS A 1 49  ? -5.926  7.030   8.030   1.00 0.00 ? 49  LYS A NZ   2  
ATOM 2301  H H    . LYS A 1 49  ? -4.280  3.332   5.258   1.00 0.00 ? 49  LYS A H    2  
ATOM 2302  H HA   . LYS A 1 49  ? -4.596  4.696   2.753   1.00 0.00 ? 49  LYS A HA   2  
ATOM 2303  H HB2  . LYS A 1 49  ? -3.215  5.228   5.331   1.00 0.00 ? 49  LYS A HB2  2  
ATOM 2304  H HB3  . LYS A 1 49  ? -2.615  6.073   3.910   1.00 0.00 ? 49  LYS A HB3  2  
ATOM 2305  H HG2  . LYS A 1 49  ? -4.146  7.589   4.611   1.00 0.00 ? 49  LYS A HG2  2  
ATOM 2306  H HG3  . LYS A 1 49  ? -5.191  6.597   3.591   1.00 0.00 ? 49  LYS A HG3  2  
ATOM 2307  H HD2  . LYS A 1 49  ? -6.449  6.738   5.514   1.00 0.00 ? 49  LYS A HD2  2  
ATOM 2308  H HD3  . LYS A 1 49  ? -5.556  5.242   5.802   1.00 0.00 ? 49  LYS A HD3  2  
ATOM 2309  H HE2  . LYS A 1 49  ? -4.100  6.266   7.314   1.00 0.00 ? 49  LYS A HE2  2  
ATOM 2310  H HE3  . LYS A 1 49  ? -4.497  7.885   6.742   1.00 0.00 ? 49  LYS A HE3  2  
ATOM 2311  H HZ1  . LYS A 1 49  ? -5.557  6.655   8.928   1.00 0.00 ? 49  LYS A HZ1  2  
ATOM 2312  H HZ2  . LYS A 1 49  ? -6.778  6.494   7.768   1.00 0.00 ? 49  LYS A HZ2  2  
ATOM 2313  H HZ3  . LYS A 1 49  ? -6.184  8.028   8.163   1.00 0.00 ? 49  LYS A HZ3  2  
ATOM 2314  N N    . LEU A 1 50  ? -1.801  3.097   3.413   1.00 0.00 ? 50  LEU A N    2  
ATOM 2315  C CA   . LEU A 1 50  ? -0.591  2.545   2.814   1.00 0.00 ? 50  LEU A CA   2  
ATOM 2316  C C    . LEU A 1 50  ? -0.928  1.694   1.593   1.00 0.00 ? 50  LEU A C    2  
ATOM 2317  O O    . LEU A 1 50  ? -0.391  1.909   0.507   1.00 0.00 ? 50  LEU A O    2  
ATOM 2318  C CB   . LEU A 1 50  ? 0.174   1.706   3.839   1.00 0.00 ? 50  LEU A CB   2  
ATOM 2319  C CG   . LEU A 1 50  ? 1.031   0.573   3.275   1.00 0.00 ? 50  LEU A CG   2  
ATOM 2320  C CD1  . LEU A 1 50  ? 1.926   1.086   2.158   1.00 0.00 ? 50  LEU A CD1  2  
ATOM 2321  C CD2  . LEU A 1 50  ? 1.863   -0.066  4.377   1.00 0.00 ? 50  LEU A CD2  2  
ATOM 2322  H H    . LEU A 1 50  ? -2.009  2.885   4.347   1.00 0.00 ? 50  LEU A H    2  
ATOM 2323  H HA   . LEU A 1 50  ? 0.030   3.371   2.501   1.00 0.00 ? 50  LEU A HA   2  
ATOM 2324  H HB2  . LEU A 1 50  ? 0.823   2.369   4.390   1.00 0.00 ? 50  LEU A HB2  2  
ATOM 2325  H HB3  . LEU A 1 50  ? -0.550  1.271   4.515   1.00 0.00 ? 50  LEU A HB3  2  
ATOM 2326  H HG   . LEU A 1 50  ? 0.383   -0.187  2.860   1.00 0.00 ? 50  LEU A HG   2  
ATOM 2327  H HD11 . LEU A 1 50  ? 1.959   2.164   2.190   1.00 0.00 ? 50  LEU A HD11 2  
ATOM 2328  H HD12 . LEU A 1 50  ? 1.532   0.766   1.205   1.00 0.00 ? 50  LEU A HD12 2  
ATOM 2329  H HD13 . LEU A 1 50  ? 2.923   0.690   2.286   1.00 0.00 ? 50  LEU A HD13 2  
ATOM 2330  H HD21 . LEU A 1 50  ? 1.711   -1.136  4.367   1.00 0.00 ? 50  LEU A HD21 2  
ATOM 2331  H HD22 . LEU A 1 50  ? 1.558   0.331   5.335   1.00 0.00 ? 50  LEU A HD22 2  
ATOM 2332  H HD23 . LEU A 1 50  ? 2.907   0.151   4.212   1.00 0.00 ? 50  LEU A HD23 2  
ATOM 2333  N N    . MET A 1 51  ? -1.821  0.728   1.780   1.00 0.00 ? 51  MET A N    2  
ATOM 2334  C CA   . MET A 1 51  ? -2.232  -0.153  0.694   1.00 0.00 ? 51  MET A CA   2  
ATOM 2335  C C    . MET A 1 51  ? -2.833  0.647   -0.458  1.00 0.00 ? 51  MET A C    2  
ATOM 2336  O O    . MET A 1 51  ? -2.394  0.533   -1.602  1.00 0.00 ? 51  MET A O    2  
ATOM 2337  C CB   . MET A 1 51  ? -3.246  -1.182  1.198   1.00 0.00 ? 51  MET A CB   2  
ATOM 2338  C CG   . MET A 1 51  ? -2.797  -1.912  2.454   1.00 0.00 ? 51  MET A CG   2  
ATOM 2339  S SD   . MET A 1 51  ? -4.179  -2.407  3.501   1.00 0.00 ? 51  MET A SD   2  
ATOM 2340  C CE   . MET A 1 51  ? -3.538  -3.919  4.215   1.00 0.00 ? 51  MET A CE   2  
ATOM 2341  H H    . MET A 1 51  ? -2.215  0.605   2.670   1.00 0.00 ? 51  MET A H    2  
ATOM 2342  H HA   . MET A 1 51  ? -1.354  -0.671  0.337   1.00 0.00 ? 51  MET A HA   2  
ATOM 2343  H HB2  . MET A 1 51  ? -4.176  -0.678  1.414   1.00 0.00 ? 51  MET A HB2  2  
ATOM 2344  H HB3  . MET A 1 51  ? -3.414  -1.915  0.423   1.00 0.00 ? 51  MET A HB3  2  
ATOM 2345  H HG2  . MET A 1 51  ? -2.249  -2.796  2.164   1.00 0.00 ? 51  MET A HG2  2  
ATOM 2346  H HG3  . MET A 1 51  ? -2.149  -1.259  3.020   1.00 0.00 ? 51  MET A HG3  2  
ATOM 2347  H HE1  . MET A 1 51  ? -4.315  -4.406  4.786   1.00 0.00 ? 51  MET A HE1  2  
ATOM 2348  H HE2  . MET A 1 51  ? -3.205  -4.577  3.426   1.00 0.00 ? 51  MET A HE2  2  
ATOM 2349  H HE3  . MET A 1 51  ? -2.707  -3.685  4.865   1.00 0.00 ? 51  MET A HE3  2  
ATOM 2350  N N    . LYS A 1 52  ? -3.840  1.457   -0.148  1.00 0.00 ? 52  LYS A N    2  
ATOM 2351  C CA   . LYS A 1 52  ? -4.500  2.277   -1.156  1.00 0.00 ? 52  LYS A CA   2  
ATOM 2352  C C    . LYS A 1 52  ? -3.480  3.072   -1.965  1.00 0.00 ? 52  LYS A C    2  
ATOM 2353  O O    . LYS A 1 52  ? -3.563  3.138   -3.191  1.00 0.00 ? 52  LYS A O    2  
ATOM 2354  C CB   . LYS A 1 52  ? -5.496  3.232   -0.493  1.00 0.00 ? 52  LYS A CB   2  
ATOM 2355  C CG   . LYS A 1 52  ? -6.842  2.595   -0.193  1.00 0.00 ? 52  LYS A CG   2  
ATOM 2356  C CD   . LYS A 1 52  ? -7.960  3.624   -0.197  1.00 0.00 ? 52  LYS A CD   2  
ATOM 2357  C CE   . LYS A 1 52  ? -9.319  2.970   -0.389  1.00 0.00 ? 52  LYS A CE   2  
ATOM 2358  N NZ   . LYS A 1 52  ? -10.432 3.946   -0.227  1.00 0.00 ? 52  LYS A NZ   2  
ATOM 2359  H H    . LYS A 1 52  ? -4.145  1.504   0.783   1.00 0.00 ? 52  LYS A H    2  
ATOM 2360  H HA   . LYS A 1 52  ? -5.036  1.618   -1.822  1.00 0.00 ? 52  LYS A HA   2  
ATOM 2361  H HB2  . LYS A 1 52  ? -5.074  3.586   0.435   1.00 0.00 ? 52  LYS A HB2  2  
ATOM 2362  H HB3  . LYS A 1 52  ? -5.659  4.075   -1.149  1.00 0.00 ? 52  LYS A HB3  2  
ATOM 2363  H HG2  . LYS A 1 52  ? -7.052  1.848   -0.944  1.00 0.00 ? 52  LYS A HG2  2  
ATOM 2364  H HG3  . LYS A 1 52  ? -6.799  2.127   0.780   1.00 0.00 ? 52  LYS A HG3  2  
ATOM 2365  H HD2  . LYS A 1 52  ? -7.956  4.151   0.745   1.00 0.00 ? 52  LYS A HD2  2  
ATOM 2366  H HD3  . LYS A 1 52  ? -7.790  4.324   -1.003  1.00 0.00 ? 52  LYS A HD3  2  
ATOM 2367  H HE2  . LYS A 1 52  ? -9.364  2.548   -1.382  1.00 0.00 ? 52  LYS A HE2  2  
ATOM 2368  H HE3  . LYS A 1 52  ? -9.432  2.183   0.342   1.00 0.00 ? 52  LYS A HE3  2  
ATOM 2369  H HZ1  . LYS A 1 52  ? -10.242 4.801   -0.786  1.00 0.00 ? 52  LYS A HZ1  2  
ATOM 2370  H HZ2  . LYS A 1 52  ? -10.529 4.214   0.773   1.00 0.00 ? 52  LYS A HZ2  2  
ATOM 2371  H HZ3  . LYS A 1 52  ? -11.327 3.525   -0.550  1.00 0.00 ? 52  LYS A HZ3  2  
ATOM 2372  N N    . ALA A 1 53  ? -2.518  3.671   -1.271  1.00 0.00 ? 53  ALA A N    2  
ATOM 2373  C CA   . ALA A 1 53  ? -1.480  4.457   -1.926  1.00 0.00 ? 53  ALA A CA   2  
ATOM 2374  C C    . ALA A 1 53  ? -0.606  3.580   -2.816  1.00 0.00 ? 53  ALA A C    2  
ATOM 2375  O O    . ALA A 1 53  ? 0.029   4.066   -3.752  1.00 0.00 ? 53  ALA A O    2  
ATOM 2376  C CB   . ALA A 1 53  ? -0.628  5.175   -0.890  1.00 0.00 ? 53  ALA A CB   2  
ATOM 2377  H H    . ALA A 1 53  ? -2.506  3.581   -0.296  1.00 0.00 ? 53  ALA A H    2  
ATOM 2378  H HA   . ALA A 1 53  ? -1.964  5.205   -2.539  1.00 0.00 ? 53  ALA A HA   2  
ATOM 2379  H HB1  . ALA A 1 53  ? -0.129  6.013   -1.353  1.00 0.00 ? 53  ALA A HB1  2  
ATOM 2380  H HB2  . ALA A 1 53  ? -1.260  5.529   -0.088  1.00 0.00 ? 53  ALA A HB2  2  
ATOM 2381  H HB3  . ALA A 1 53  ? 0.108   4.491   -0.494  1.00 0.00 ? 53  ALA A HB3  2  
ATOM 2382  N N    . TYR A 1 54  ? -0.578  2.286   -2.519  1.00 0.00 ? 54  TYR A N    2  
ATOM 2383  C CA   . TYR A 1 54  ? 0.221   1.341   -3.290  1.00 0.00 ? 54  TYR A CA   2  
ATOM 2384  C C    . TYR A 1 54  ? -0.493  0.951   -4.581  1.00 0.00 ? 54  TYR A C    2  
ATOM 2385  O O    . TYR A 1 54  ? 0.109   0.935   -5.656  1.00 0.00 ? 54  TYR A O    2  
ATOM 2386  C CB   . TYR A 1 54  ? 0.514   0.091   -2.459  1.00 0.00 ? 54  TYR A CB   2  
ATOM 2387  C CG   . TYR A 1 54  ? 1.374   -0.925  -3.176  1.00 0.00 ? 54  TYR A CG   2  
ATOM 2388  C CD1  . TYR A 1 54  ? 2.760   -0.865  -3.104  1.00 0.00 ? 54  TYR A CD1  2  
ATOM 2389  C CD2  . TYR A 1 54  ? 0.800   -1.945  -3.925  1.00 0.00 ? 54  TYR A CD2  2  
ATOM 2390  C CE1  . TYR A 1 54  ? 3.550   -1.791  -3.759  1.00 0.00 ? 54  TYR A CE1  2  
ATOM 2391  C CE2  . TYR A 1 54  ? 1.582   -2.876  -4.581  1.00 0.00 ? 54  TYR A CE2  2  
ATOM 2392  C CZ   . TYR A 1 54  ? 2.956   -2.794  -4.496  1.00 0.00 ? 54  TYR A CZ   2  
ATOM 2393  O OH   . TYR A 1 54  ? 3.739   -3.719  -5.148  1.00 0.00 ? 54  TYR A OH   2  
ATOM 2394  H H    . TYR A 1 54  ? -1.106  1.958   -1.761  1.00 0.00 ? 54  TYR A H    2  
ATOM 2395  H HA   . TYR A 1 54  ? 1.155   1.823   -3.540  1.00 0.00 ? 54  TYR A HA   2  
ATOM 2396  H HB2  . TYR A 1 54  ? 1.027   0.380   -1.555  1.00 0.00 ? 54  TYR A HB2  2  
ATOM 2397  H HB3  . TYR A 1 54  ? -0.419  -0.388  -2.200  1.00 0.00 ? 54  TYR A HB3  2  
ATOM 2398  H HD1  . TYR A 1 54  ? 3.222   -0.078  -2.526  1.00 0.00 ? 54  TYR A HD1  2  
ATOM 2399  H HD2  . TYR A 1 54  ? -0.277  -2.007  -3.990  1.00 0.00 ? 54  TYR A HD2  2  
ATOM 2400  H HE1  . TYR A 1 54  ? 4.626   -1.727  -3.691  1.00 0.00 ? 54  TYR A HE1  2  
ATOM 2401  H HE2  . TYR A 1 54  ? 1.118   -3.662  -5.159  1.00 0.00 ? 54  TYR A HE2  2  
ATOM 2402  H HH   . TYR A 1 54  ? 4.655   -3.608  -4.880  1.00 0.00 ? 54  TYR A HH   2  
ATOM 2403  N N    . CYS A 1 55  ? -1.779  0.639   -4.467  1.00 0.00 ? 55  CYS A N    2  
ATOM 2404  C CA   . CYS A 1 55  ? -2.576  0.249   -5.625  1.00 0.00 ? 55  CYS A CA   2  
ATOM 2405  C C    . CYS A 1 55  ? -2.781  1.430   -6.567  1.00 0.00 ? 55  CYS A C    2  
ATOM 2406  O O    . CYS A 1 55  ? -2.778  1.271   -7.787  1.00 0.00 ? 55  CYS A O    2  
ATOM 2407  C CB   . CYS A 1 55  ? -3.930  -0.302  -5.175  1.00 0.00 ? 55  CYS A CB   2  
ATOM 2408  S SG   . CYS A 1 55  ? -5.084  0.962   -4.590  1.00 0.00 ? 55  CYS A SG   2  
ATOM 2409  H H    . CYS A 1 55  ? -2.203  0.670   -3.584  1.00 0.00 ? 55  CYS A H    2  
ATOM 2410  H HA   . CYS A 1 55  ? -2.039  -0.526  -6.151  1.00 0.00 ? 55  CYS A HA   2  
ATOM 2411  H HB2  . CYS A 1 55  ? -4.397  -0.812  -6.005  1.00 0.00 ? 55  CYS A HB2  2  
ATOM 2412  H HB3  . CYS A 1 55  ? -3.775  -1.005  -4.371  1.00 0.00 ? 55  CYS A HB3  2  
ATOM 2413  H HG   . CYS A 1 55  ? -4.954  2.025   -5.369  1.00 0.00 ? 55  CYS A HG   2  
ATOM 2414  N N    . GLU A 1 56  ? -2.962  2.615   -5.991  1.00 0.00 ? 56  GLU A N    2  
ATOM 2415  C CA   . GLU A 1 56  ? -3.171  3.823   -6.781  1.00 0.00 ? 56  GLU A CA   2  
ATOM 2416  C C    . GLU A 1 56  ? -1.896  4.218   -7.520  1.00 0.00 ? 56  GLU A C    2  
ATOM 2417  O O    . GLU A 1 56  ? -1.930  4.543   -8.707  1.00 0.00 ? 56  GLU A O    2  
ATOM 2418  C CB   . GLU A 1 56  ? -3.630  4.973   -5.882  1.00 0.00 ? 56  GLU A CB   2  
ATOM 2419  C CG   . GLU A 1 56  ? -2.485  5.799   -5.319  1.00 0.00 ? 56  GLU A CG   2  
ATOM 2420  C CD   . GLU A 1 56  ? -2.966  6.985   -4.506  1.00 0.00 ? 56  GLU A CD   2  
ATOM 2421  O OE1  . GLU A 1 56  ? -3.843  7.725   -4.998  1.00 0.00 ? 56  GLU A OE1  2  
ATOM 2422  O OE2  . GLU A 1 56  ? -2.466  7.173   -3.377  1.00 0.00 ? 56  GLU A OE2  2  
ATOM 2423  H H    . GLU A 1 56  ? -2.954  2.678   -5.013  1.00 0.00 ? 56  GLU A H    2  
ATOM 2424  H HA   . GLU A 1 56  ? -3.944  3.616   -7.505  1.00 0.00 ? 56  GLU A HA   2  
ATOM 2425  H HB2  . GLU A 1 56  ? -4.272  5.627   -6.453  1.00 0.00 ? 56  GLU A HB2  2  
ATOM 2426  H HB3  . GLU A 1 56  ? -4.191  4.565   -5.054  1.00 0.00 ? 56  GLU A HB3  2  
ATOM 2427  H HG2  . GLU A 1 56  ? -1.880  5.169   -4.685  1.00 0.00 ? 56  GLU A HG2  2  
ATOM 2428  H HG3  . GLU A 1 56  ? -1.884  6.164   -6.139  1.00 0.00 ? 56  GLU A HG3  2  
ATOM 2429  N N    . ARG A 1 57  ? -0.774  4.187   -6.809  1.00 0.00 ? 57  ARG A N    2  
ATOM 2430  C CA   . ARG A 1 57  ? 0.512   4.543   -7.397  1.00 0.00 ? 57  ARG A CA   2  
ATOM 2431  C C    . ARG A 1 57  ? 0.658   3.943   -8.792  1.00 0.00 ? 57  ARG A C    2  
ATOM 2432  O O    . ARG A 1 57  ? 0.996   4.643   -9.746  1.00 0.00 ? 57  ARG A O    2  
ATOM 2433  C CB   . ARG A 1 57  ? 1.656   4.063   -6.502  1.00 0.00 ? 57  ARG A CB   2  
ATOM 2434  C CG   . ARG A 1 57  ? 2.991   4.719   -6.816  1.00 0.00 ? 57  ARG A CG   2  
ATOM 2435  C CD   . ARG A 1 57  ? 3.874   4.804   -5.581  1.00 0.00 ? 57  ARG A CD   2  
ATOM 2436  N NE   . ARG A 1 57  ? 4.936   5.795   -5.734  1.00 0.00 ? 57  ARG A NE   2  
ATOM 2437  C CZ   . ARG A 1 57  ? 6.055   5.573   -6.415  1.00 0.00 ? 57  ARG A CZ   2  
ATOM 2438  N NH1  . ARG A 1 57  ? 6.257   4.401   -7.002  1.00 0.00 ? 57  ARG A NH1  2  
ATOM 2439  N NH2  . ARG A 1 57  ? 6.975   6.524   -6.510  1.00 0.00 ? 57  ARG A NH2  2  
ATOM 2440  H H    . ARG A 1 57  ? -0.811  3.920   -5.867  1.00 0.00 ? 57  ARG A H    2  
ATOM 2441  H HA   . ARG A 1 57  ? 0.555   5.620   -7.474  1.00 0.00 ? 57  ARG A HA   2  
ATOM 2442  H HB2  . ARG A 1 57  ? 1.408   4.279   -5.473  1.00 0.00 ? 57  ARG A HB2  2  
ATOM 2443  H HB3  . ARG A 1 57  ? 1.767   2.996   -6.621  1.00 0.00 ? 57  ARG A HB3  2  
ATOM 2444  H HG2  . ARG A 1 57  ? 3.500   4.135   -7.569  1.00 0.00 ? 57  ARG A HG2  2  
ATOM 2445  H HG3  . ARG A 1 57  ? 2.813   5.715   -7.190  1.00 0.00 ? 57  ARG A HG3  2  
ATOM 2446  H HD2  . ARG A 1 57  ? 3.261   5.076   -4.734  1.00 0.00 ? 57  ARG A HD2  2  
ATOM 2447  H HD3  . ARG A 1 57  ? 4.320   3.836   -5.406  1.00 0.00 ? 57  ARG A HD3  2  
ATOM 2448  H HE   . ARG A 1 57  ? 4.808   6.667   -5.309  1.00 0.00 ? 57  ARG A HE   2  
ATOM 2449  H HH11 . ARG A 1 57  ? 5.565   3.682   -6.933  1.00 0.00 ? 57  ARG A HH11 2  
ATOM 2450  H HH12 . ARG A 1 57  ? 7.100   4.237   -7.515  1.00 0.00 ? 57  ARG A HH12 2  
ATOM 2451  H HH21 . ARG A 1 57  ? 6.827   7.409   -6.069  1.00 0.00 ? 57  ARG A HH21 2  
ATOM 2452  H HH22 . ARG A 1 57  ? 7.817   6.356   -7.022  1.00 0.00 ? 57  ARG A HH22 2  
ATOM 2453  N N    . GLN A 1 58  ? 0.400   2.644   -8.901  1.00 0.00 ? 58  GLN A N    2  
ATOM 2454  C CA   . GLN A 1 58  ? 0.503   1.950   -10.180 1.00 0.00 ? 58  GLN A CA   2  
ATOM 2455  C C    . GLN A 1 58  ? -0.809  2.033   -10.952 1.00 0.00 ? 58  GLN A C    2  
ATOM 2456  O O    . GLN A 1 58  ? -0.819  2.307   -12.151 1.00 0.00 ? 58  GLN A O    2  
ATOM 2457  C CB   . GLN A 1 58  ? 0.888   0.486   -9.960  1.00 0.00 ? 58  GLN A CB   2  
ATOM 2458  C CG   . GLN A 1 58  ? 2.127   0.306   -9.098  1.00 0.00 ? 58  GLN A CG   2  
ATOM 2459  C CD   . GLN A 1 58  ? 3.291   1.159   -9.563  1.00 0.00 ? 58  GLN A CD   2  
ATOM 2460  O OE1  . GLN A 1 58  ? 3.321   1.619   -10.704 1.00 0.00 ? 58  GLN A OE1  2  
ATOM 2461  N NE2  . GLN A 1 58  ? 4.258   1.375   -8.678  1.00 0.00 ? 58  GLN A NE2  2  
ATOM 2462  H H    . GLN A 1 58  ? 0.135   2.140   -8.104  1.00 0.00 ? 58  GLN A H    2  
ATOM 2463  H HA   . GLN A 1 58  ? 1.277   2.433   -10.757 1.00 0.00 ? 58  GLN A HA   2  
ATOM 2464  H HB2  . GLN A 1 58  ? 0.065   -0.022  -9.480  1.00 0.00 ? 58  GLN A HB2  2  
ATOM 2465  H HB3  . GLN A 1 58  ? 1.074   0.027   -10.919 1.00 0.00 ? 58  GLN A HB3  2  
ATOM 2466  H HG2  . GLN A 1 58  ? 1.886   0.578   -8.081  1.00 0.00 ? 58  GLN A HG2  2  
ATOM 2467  H HG3  . GLN A 1 58  ? 2.425   -0.732  -9.130  1.00 0.00 ? 58  GLN A HG3  2  
ATOM 2468  H HE21 . GLN A 1 58  ? 4.167   0.975   -7.787  1.00 0.00 ? 58  GLN A HE21 2  
ATOM 2469  H HE22 . GLN A 1 58  ? 5.022   1.922   -8.953  1.00 0.00 ? 58  GLN A HE22 2  
ATOM 2470  N N    . GLY A 1 59  ? -1.916  1.792   -10.255 1.00 0.00 ? 59  GLY A N    2  
ATOM 2471  C CA   . GLY A 1 59  ? -3.219  1.844   -10.892 1.00 0.00 ? 59  GLY A CA   2  
ATOM 2472  C C    . GLY A 1 59  ? -3.847  0.472   -11.040 1.00 0.00 ? 59  GLY A C    2  
ATOM 2473  O O    . GLY A 1 59  ? -4.566  0.211   -12.006 1.00 0.00 ? 59  GLY A O    2  
ATOM 2474  H H    . GLY A 1 59  ? -1.847  1.578   -9.301  1.00 0.00 ? 59  GLY A H    2  
ATOM 2475  H HA2  . GLY A 1 59  ? -3.873  2.465   -10.299 1.00 0.00 ? 59  GLY A HA2  2  
ATOM 2476  H HA3  . GLY A 1 59  ? -3.111  2.285   -11.872 1.00 0.00 ? 59  GLY A HA3  2  
ATOM 2477  N N    . LEU A 1 60  ? -3.573  -0.408  -10.084 1.00 0.00 ? 60  LEU A N    2  
ATOM 2478  C CA   . LEU A 1 60  ? -4.115  -1.762  -10.113 1.00 0.00 ? 60  LEU A CA   2  
ATOM 2479  C C    . LEU A 1 60  ? -5.320  -1.887  -9.185  1.00 0.00 ? 60  LEU A C    2  
ATOM 2480  O O    . LEU A 1 60  ? -5.646  -0.958  -8.446  1.00 0.00 ? 60  LEU A O    2  
ATOM 2481  C CB   . LEU A 1 60  ? -3.040  -2.772  -9.708  1.00 0.00 ? 60  LEU A CB   2  
ATOM 2482  C CG   . LEU A 1 60  ? -1.651  -2.551  -10.311 1.00 0.00 ? 60  LEU A CG   2  
ATOM 2483  C CD1  . LEU A 1 60  ? -0.575  -3.095  -9.384  1.00 0.00 ? 60  LEU A CD1  2  
ATOM 2484  C CD2  . LEU A 1 60  ? -1.556  -3.201  -11.683 1.00 0.00 ? 60  LEU A CD2  2  
ATOM 2485  H H    . LEU A 1 60  ? -2.994  -0.142  -9.340  1.00 0.00 ? 60  LEU A H    2  
ATOM 2486  H HA   . LEU A 1 60  ? -4.432  -1.971  -11.124 1.00 0.00 ? 60  LEU A HA   2  
ATOM 2487  H HB2  . LEU A 1 60  ? -2.943  -2.739  -8.634  1.00 0.00 ? 60  LEU A HB2  2  
ATOM 2488  H HB3  . LEU A 1 60  ? -3.379  -3.753  -10.008 1.00 0.00 ? 60  LEU A HB3  2  
ATOM 2489  H HG   . LEU A 1 60  ? -1.483  -1.489  -10.430 1.00 0.00 ? 60  LEU A HG   2  
ATOM 2490  H HD11 . LEU A 1 60  ? 0.033   -3.809  -9.919  1.00 0.00 ? 60  LEU A HD11 2  
ATOM 2491  H HD12 . LEU A 1 60  ? -1.040  -3.580  -8.538  1.00 0.00 ? 60  LEU A HD12 2  
ATOM 2492  H HD13 . LEU A 1 60  ? 0.045   -2.282  -9.037  1.00 0.00 ? 60  LEU A HD13 2  
ATOM 2493  H HD21 . LEU A 1 60  ? -2.011  -2.555  -12.419 1.00 0.00 ? 60  LEU A HD21 2  
ATOM 2494  H HD22 . LEU A 1 60  ? -2.072  -4.150  -11.668 1.00 0.00 ? 60  LEU A HD22 2  
ATOM 2495  H HD23 . LEU A 1 60  ? -0.518  -3.359  -11.935 1.00 0.00 ? 60  LEU A HD23 2  
ATOM 2496  N N    . SER A 1 61  ? -5.976  -3.042  -9.228  1.00 0.00 ? 61  SER A N    2  
ATOM 2497  C CA   . SER A 1 61  ? -7.146  -3.288  -8.393  1.00 0.00 ? 61  SER A CA   2  
ATOM 2498  C C    . SER A 1 61  ? -6.736  -3.864  -7.041  1.00 0.00 ? 61  SER A C    2  
ATOM 2499  O O    . SER A 1 61  ? -5.868  -4.732  -6.961  1.00 0.00 ? 61  SER A O    2  
ATOM 2500  C CB   . SER A 1 61  ? -8.110  -4.245  -9.097  1.00 0.00 ? 61  SER A CB   2  
ATOM 2501  O OG   . SER A 1 61  ? -8.592  -3.684  -10.306 1.00 0.00 ? 61  SER A OG   2  
ATOM 2502  H H    . SER A 1 61  ? -5.668  -3.744  -9.838  1.00 0.00 ? 61  SER A H    2  
ATOM 2503  H HA   . SER A 1 61  ? -7.643  -2.343  -8.232  1.00 0.00 ? 61  SER A HA   2  
ATOM 2504  H HB2  . SER A 1 61  ? -7.597  -5.167  -9.321  1.00 0.00 ? 61  SER A HB2  2  
ATOM 2505  H HB3  . SER A 1 61  ? -8.949  -4.448  -8.448  1.00 0.00 ? 61  SER A HB3  2  
ATOM 2506  H HG   . SER A 1 61  ? -9.082  -2.881  -10.114 1.00 0.00 ? 61  SER A HG   2  
ATOM 2507  N N    . MET A 1 62  ? -7.369  -3.374  -5.979  1.00 0.00 ? 62  MET A N    2  
ATOM 2508  C CA   . MET A 1 62  ? -7.072  -3.841  -4.630  1.00 0.00 ? 62  MET A CA   2  
ATOM 2509  C C    . MET A 1 62  ? -7.357  -5.333  -4.496  1.00 0.00 ? 62  MET A C    2  
ATOM 2510  O O    . MET A 1 62  ? -6.781  -6.011  -3.645  1.00 0.00 ? 62  MET A O    2  
ATOM 2511  C CB   . MET A 1 62  ? -7.893  -3.058  -3.604  1.00 0.00 ? 62  MET A CB   2  
ATOM 2512  C CG   . MET A 1 62  ? -7.220  -2.944  -2.246  1.00 0.00 ? 62  MET A CG   2  
ATOM 2513  S SD   . MET A 1 62  ? -5.605  -2.148  -2.337  1.00 0.00 ? 62  MET A SD   2  
ATOM 2514  C CE   . MET A 1 62  ? -5.622  -1.175  -0.833  1.00 0.00 ? 62  MET A CE   2  
ATOM 2515  H H    . MET A 1 62  ? -8.052  -2.683  -6.106  1.00 0.00 ? 62  MET A H    2  
ATOM 2516  H HA   . MET A 1 62  ? -6.022  -3.669  -4.444  1.00 0.00 ? 62  MET A HA   2  
ATOM 2517  H HB2  . MET A 1 62  ? -8.064  -2.061  -3.982  1.00 0.00 ? 62  MET A HB2  2  
ATOM 2518  H HB3  . MET A 1 62  ? -8.844  -3.552  -3.470  1.00 0.00 ? 62  MET A HB3  2  
ATOM 2519  H HG2  . MET A 1 62  ? -7.854  -2.364  -1.592  1.00 0.00 ? 62  MET A HG2  2  
ATOM 2520  H HG3  . MET A 1 62  ? -7.096  -3.935  -1.837  1.00 0.00 ? 62  MET A HG3  2  
ATOM 2521  H HE1  . MET A 1 62  ? -4.898  -0.377  -0.912  1.00 0.00 ? 62  MET A HE1  2  
ATOM 2522  H HE2  . MET A 1 62  ? -6.606  -0.756  -0.687  1.00 0.00 ? 62  MET A HE2  2  
ATOM 2523  H HE3  . MET A 1 62  ? -5.371  -1.806  0.007   1.00 0.00 ? 62  MET A HE3  2  
ATOM 2524  N N    . ARG A 1 63  ? -8.250  -5.839  -5.341  1.00 0.00 ? 63  ARG A N    2  
ATOM 2525  C CA   . ARG A 1 63  ? -8.613  -7.250  -5.315  1.00 0.00 ? 63  ARG A CA   2  
ATOM 2526  C C    . ARG A 1 63  ? -7.591  -8.088  -6.077  1.00 0.00 ? 63  ARG A C    2  
ATOM 2527  O O    . ARG A 1 63  ? -7.435  -9.281  -5.817  1.00 0.00 ? 63  ARG A O    2  
ATOM 2528  C CB   . ARG A 1 63  ? -10.005 -7.452  -5.916  1.00 0.00 ? 63  ARG A CB   2  
ATOM 2529  C CG   . ARG A 1 63  ? -10.098 -7.060  -7.382  1.00 0.00 ? 63  ARG A CG   2  
ATOM 2530  C CD   . ARG A 1 63  ? -11.192 -7.835  -8.098  1.00 0.00 ? 63  ARG A CD   2  
ATOM 2531  N NE   . ARG A 1 63  ? -11.643 -7.154  -9.309  1.00 0.00 ? 63  ARG A NE   2  
ATOM 2532  C CZ   . ARG A 1 63  ? -12.476 -6.119  -9.303  1.00 0.00 ? 63  ARG A CZ   2  
ATOM 2533  N NH1  . ARG A 1 63  ? -12.946 -5.649  -8.156  1.00 0.00 ? 63  ARG A NH1  2  
ATOM 2534  N NH2  . ARG A 1 63  ? -12.840 -5.553  -10.446 1.00 0.00 ? 63  ARG A NH2  2  
ATOM 2535  H H    . ARG A 1 63  ? -8.676  -5.248  -5.997  1.00 0.00 ? 63  ARG A H    2  
ATOM 2536  H HA   . ARG A 1 63  ? -8.626  -7.571  -4.284  1.00 0.00 ? 63  ARG A HA   2  
ATOM 2537  H HB2  . ARG A 1 63  ? -10.275 -8.495  -5.828  1.00 0.00 ? 63  ARG A HB2  2  
ATOM 2538  H HB3  . ARG A 1 63  ? -10.714 -6.857  -5.361  1.00 0.00 ? 63  ARG A HB3  2  
ATOM 2539  H HG2  . ARG A 1 63  ? -10.317 -6.004  -7.449  1.00 0.00 ? 63  ARG A HG2  2  
ATOM 2540  H HG3  . ARG A 1 63  ? -9.151  -7.264  -7.860  1.00 0.00 ? 63  ARG A HG3  2  
ATOM 2541  H HD2  . ARG A 1 63  ? -10.809 -8.809  -8.366  1.00 0.00 ? 63  ARG A HD2  2  
ATOM 2542  H HD3  . ARG A 1 63  ? -12.030 -7.951  -7.428  1.00 0.00 ? 63  ARG A HD3  2  
ATOM 2543  H HE   . ARG A 1 63  ? -11.308 -7.485  -10.168 1.00 0.00 ? 63  ARG A HE   2  
ATOM 2544  H HH11 . ARG A 1 63  ? -12.673 -6.073  -7.293  1.00 0.00 ? 63  ARG A HH11 2  
ATOM 2545  H HH12 . ARG A 1 63  ? -13.572 -4.869  -8.154  1.00 0.00 ? 63  ARG A HH12 2  
ATOM 2546  H HH21 . ARG A 1 63  ? -12.487 -5.904  -11.313 1.00 0.00 ? 63  ARG A HH21 2  
ATOM 2547  H HH22 . ARG A 1 63  ? -13.467 -4.774  -10.441 1.00 0.00 ? 63  ARG A HH22 2  
ATOM 2548  N N    . GLN A 1 64  ? -6.898  -7.456  -7.018  1.00 0.00 ? 64  GLN A N    2  
ATOM 2549  C CA   . GLN A 1 64  ? -5.893  -8.144  -7.819  1.00 0.00 ? 64  GLN A CA   2  
ATOM 2550  C C    . GLN A 1 64  ? -4.611  -8.353  -7.020  1.00 0.00 ? 64  GLN A C    2  
ATOM 2551  O O    . GLN A 1 64  ? -3.993  -9.416  -7.086  1.00 0.00 ? 64  GLN A O    2  
ATOM 2552  C CB   . GLN A 1 64  ? -5.591  -7.349  -9.090  1.00 0.00 ? 64  GLN A CB   2  
ATOM 2553  C CG   . GLN A 1 64  ? -5.108  -8.210  -10.246 1.00 0.00 ? 64  GLN A CG   2  
ATOM 2554  C CD   . GLN A 1 64  ? -4.871  -7.409  -11.512 1.00 0.00 ? 64  GLN A CD   2  
ATOM 2555  O OE1  . GLN A 1 64  ? -4.578  -6.214  -11.458 1.00 0.00 ? 64  GLN A OE1  2  
ATOM 2556  N NE2  . GLN A 1 64  ? -4.998  -8.064  -12.660 1.00 0.00 ? 64  GLN A NE2  2  
ATOM 2557  H H    . GLN A 1 64  ? -7.068  -6.504  -7.179  1.00 0.00 ? 64  GLN A H    2  
ATOM 2558  H HA   . GLN A 1 64  ? -6.292  -9.108  -8.095  1.00 0.00 ? 64  GLN A HA   2  
ATOM 2559  H HB2  . GLN A 1 64  ? -6.489  -6.836  -9.402  1.00 0.00 ? 64  GLN A HB2  2  
ATOM 2560  H HB3  . GLN A 1 64  ? -4.826  -6.618  -8.871  1.00 0.00 ? 64  GLN A HB3  2  
ATOM 2561  H HG2  . GLN A 1 64  ? -4.181  -8.686  -9.962  1.00 0.00 ? 64  GLN A HG2  2  
ATOM 2562  H HG3  . GLN A 1 64  ? -5.852  -8.966  -10.450 1.00 0.00 ? 64  GLN A HG3  2  
ATOM 2563  H HE21 . GLN A 1 64  ? -5.235  -9.015  -12.626 1.00 0.00 ? 64  GLN A HE21 2  
ATOM 2564  H HE22 . GLN A 1 64  ? -4.851  -7.571  -13.493 1.00 0.00 ? 64  GLN A HE22 2  
ATOM 2565  N N    . ILE A 1 65  ? -4.216  -7.333  -6.266  1.00 0.00 ? 65  ILE A N    2  
ATOM 2566  C CA   . ILE A 1 65  ? -3.008  -7.406  -5.454  1.00 0.00 ? 65  ILE A CA   2  
ATOM 2567  C C    . ILE A 1 65  ? -3.347  -7.606  -3.980  1.00 0.00 ? 65  ILE A C    2  
ATOM 2568  O O    . ILE A 1 65  ? -4.468  -7.336  -3.549  1.00 0.00 ? 65  ILE A O    2  
ATOM 2569  C CB   . ILE A 1 65  ? -2.151  -6.135  -5.603  1.00 0.00 ? 65  ILE A CB   2  
ATOM 2570  C CG1  . ILE A 1 65  ? -2.912  -4.916  -5.079  1.00 0.00 ? 65  ILE A CG1  2  
ATOM 2571  C CG2  . ILE A 1 65  ? -1.753  -5.933  -7.058  1.00 0.00 ? 65  ILE A CG2  2  
ATOM 2572  C CD1  . ILE A 1 65  ? -2.667  -4.635  -3.613  1.00 0.00 ? 65  ILE A CD1  2  
ATOM 2573  H H    . ILE A 1 65  ? -4.750  -6.512  -6.255  1.00 0.00 ? 65  ILE A H    2  
ATOM 2574  H HA   . ILE A 1 65  ? -2.427  -8.250  -5.796  1.00 0.00 ? 65  ILE A HA   2  
ATOM 2575  H HB   . ILE A 1 65  ? -1.250  -6.265  -5.024  1.00 0.00 ? 65  ILE A HB   2  
ATOM 2576  H HG12 . ILE A 1 65  ? -2.611  -4.044  -5.638  1.00 0.00 ? 65  ILE A HG12 2  
ATOM 2577  H HG13 . ILE A 1 65  ? -3.972  -5.077  -5.215  1.00 0.00 ? 65  ILE A HG13 2  
ATOM 2578  H HG21 . ILE A 1 65  ? -1.500  -6.887  -7.498  1.00 0.00 ? 65  ILE A HG21 2  
ATOM 2579  H HG22 . ILE A 1 65  ? -2.579  -5.496  -7.599  1.00 0.00 ? 65  ILE A HG22 2  
ATOM 2580  H HG23 . ILE A 1 65  ? -0.899  -5.275  -7.110  1.00 0.00 ? 65  ILE A HG23 2  
ATOM 2581  H HD11 . ILE A 1 65  ? -3.153  -3.710  -3.337  1.00 0.00 ? 65  ILE A HD11 2  
ATOM 2582  H HD12 . ILE A 1 65  ? -3.067  -5.444  -3.020  1.00 0.00 ? 65  ILE A HD12 2  
ATOM 2583  H HD13 . ILE A 1 65  ? -1.605  -4.549  -3.436  1.00 0.00 ? 65  ILE A HD13 2  
ATOM 2584  N N    . ARG A 1 66  ? -2.371  -8.079  -3.213  1.00 0.00 ? 66  ARG A N    2  
ATOM 2585  C CA   . ARG A 1 66  ? -2.566  -8.315  -1.787  1.00 0.00 ? 66  ARG A CA   2  
ATOM 2586  C C    . ARG A 1 66  ? -1.329  -7.903  -0.994  1.00 0.00 ? 66  ARG A C    2  
ATOM 2587  O O    . ARG A 1 66  ? -0.268  -7.650  -1.566  1.00 0.00 ? 66  ARG A O    2  
ATOM 2588  C CB   . ARG A 1 66  ? -2.881  -9.790  -1.531  1.00 0.00 ? 66  ARG A CB   2  
ATOM 2589  C CG   . ARG A 1 66  ? -4.362  -10.120 -1.619  1.00 0.00 ? 66  ARG A CG   2  
ATOM 2590  C CD   . ARG A 1 66  ? -5.095  -9.739  -0.342  1.00 0.00 ? 66  ARG A CD   2  
ATOM 2591  N NE   . ARG A 1 66  ? -6.498  -10.142 -0.376  1.00 0.00 ? 66  ARG A NE   2  
ATOM 2592  C CZ   . ARG A 1 66  ? -7.440  -9.474  -1.032  1.00 0.00 ? 66  ARG A CZ   2  
ATOM 2593  N NH1  . ARG A 1 66  ? -7.129  -8.375  -1.707  1.00 0.00 ? 66  ARG A NH1  2  
ATOM 2594  N NH2  . ARG A 1 66  ? -8.695  -9.904  -1.015  1.00 0.00 ? 66  ARG A NH2  2  
ATOM 2595  H H    . ARG A 1 66  ? -1.499  -8.276  -3.615  1.00 0.00 ? 66  ARG A H    2  
ATOM 2596  H HA   . ARG A 1 66  ? -3.403  -7.715  -1.463  1.00 0.00 ? 66  ARG A HA   2  
ATOM 2597  H HB2  . ARG A 1 66  ? -2.357  -10.390 -2.260  1.00 0.00 ? 66  ARG A HB2  2  
ATOM 2598  H HB3  . ARG A 1 66  ? -2.534  -10.053 -0.543  1.00 0.00 ? 66  ARG A HB3  2  
ATOM 2599  H HG2  . ARG A 1 66  ? -4.795  -9.575  -2.445  1.00 0.00 ? 66  ARG A HG2  2  
ATOM 2600  H HG3  . ARG A 1 66  ? -4.475  -11.181 -1.787  1.00 0.00 ? 66  ARG A HG3  2  
ATOM 2601  H HD2  . ARG A 1 66  ? -4.611  -10.223 0.493   1.00 0.00 ? 66  ARG A HD2  2  
ATOM 2602  H HD3  . ARG A 1 66  ? -5.041  -8.668  -0.218  1.00 0.00 ? 66  ARG A HD3  2  
ATOM 2603  H HE   . ARG A 1 66  ? -6.750  -10.951 0.116   1.00 0.00 ? 66  ARG A HE   2  
ATOM 2604  H HH11 . ARG A 1 66  ? -6.184  -8.049  -1.722  1.00 0.00 ? 66  ARG A HH11 2  
ATOM 2605  H HH12 . ARG A 1 66  ? -7.840  -7.874  -2.201  1.00 0.00 ? 66  ARG A HH12 2  
ATOM 2606  H HH21 . ARG A 1 66  ? -8.933  -10.732 -0.508  1.00 0.00 ? 66  ARG A HH21 2  
ATOM 2607  H HH22 . ARG A 1 66  ? -9.403  -9.400  -1.509  1.00 0.00 ? 66  ARG A HH22 2  
ATOM 2608  N N    . PHE A 1 67  ? -1.473  -7.836  0.325   1.00 0.00 ? 67  PHE A N    2  
ATOM 2609  C CA   . PHE A 1 67  ? -0.369  -7.454  1.197   1.00 0.00 ? 67  PHE A CA   2  
ATOM 2610  C C    . PHE A 1 67  ? -0.096  -8.536  2.237   1.00 0.00 ? 67  PHE A C    2  
ATOM 2611  O O    . PHE A 1 67  ? -0.985  -9.312  2.588   1.00 0.00 ? 67  PHE A O    2  
ATOM 2612  C CB   . PHE A 1 67  ? -0.678  -6.127  1.894   1.00 0.00 ? 67  PHE A CB   2  
ATOM 2613  C CG   . PHE A 1 67  ? -0.872  -4.981  0.943   1.00 0.00 ? 67  PHE A CG   2  
ATOM 2614  C CD1  . PHE A 1 67  ? -2.004  -4.909  0.146   1.00 0.00 ? 67  PHE A CD1  2  
ATOM 2615  C CD2  . PHE A 1 67  ? 0.076   -3.975  0.847   1.00 0.00 ? 67  PHE A CD2  2  
ATOM 2616  C CE1  . PHE A 1 67  ? -2.184  -3.856  -0.730  1.00 0.00 ? 67  PHE A CE1  2  
ATOM 2617  C CE2  . PHE A 1 67  ? -0.100  -2.919  -0.028  1.00 0.00 ? 67  PHE A CE2  2  
ATOM 2618  C CZ   . PHE A 1 67  ? -1.232  -2.859  -0.816  1.00 0.00 ? 67  PHE A CZ   2  
ATOM 2619  H H    . PHE A 1 67  ? -2.344  -8.050  0.722   1.00 0.00 ? 67  PHE A H    2  
ATOM 2620  H HA   . PHE A 1 67  ? 0.510   -7.331  0.583   1.00 0.00 ? 67  PHE A HA   2  
ATOM 2621  H HB2  . PHE A 1 67  ? -1.583  -6.235  2.472   1.00 0.00 ? 67  PHE A HB2  2  
ATOM 2622  H HB3  . PHE A 1 67  ? 0.139   -5.877  2.555   1.00 0.00 ? 67  PHE A HB3  2  
ATOM 2623  H HD1  . PHE A 1 67  ? -2.750  -5.687  0.213   1.00 0.00 ? 67  PHE A HD1  2  
ATOM 2624  H HD2  . PHE A 1 67  ? 0.962   -4.021  1.464   1.00 0.00 ? 67  PHE A HD2  2  
ATOM 2625  H HE1  . PHE A 1 67  ? -3.071  -3.811  -1.346  1.00 0.00 ? 67  PHE A HE1  2  
ATOM 2626  H HE2  . PHE A 1 67  ? 0.647   -2.142  -0.092  1.00 0.00 ? 67  PHE A HE2  2  
ATOM 2627  H HZ   . PHE A 1 67  ? -1.371  -2.035  -1.501  1.00 0.00 ? 67  PHE A HZ   2  
ATOM 2628  N N    . ARG A 1 68  ? 1.139   -8.583  2.724   1.00 0.00 ? 68  ARG A N    2  
ATOM 2629  C CA   . ARG A 1 68  ? 1.530   -9.571  3.722   1.00 0.00 ? 68  ARG A CA   2  
ATOM 2630  C C    . ARG A 1 68  ? 2.657   -9.038  4.602   1.00 0.00 ? 68  ARG A C    2  
ATOM 2631  O O    . ARG A 1 68  ? 3.389   -8.129  4.210   1.00 0.00 ? 68  ARG A O    2  
ATOM 2632  C CB   . ARG A 1 68  ? 1.971   -10.868 3.041   1.00 0.00 ? 68  ARG A CB   2  
ATOM 2633  C CG   . ARG A 1 68  ? 0.814   -11.776 2.656   1.00 0.00 ? 68  ARG A CG   2  
ATOM 2634  C CD   . ARG A 1 68  ? 1.239   -13.236 2.625   1.00 0.00 ? 68  ARG A CD   2  
ATOM 2635  N NE   . ARG A 1 68  ? 0.272   -14.073 1.920   1.00 0.00 ? 68  ARG A NE   2  
ATOM 2636  C CZ   . ARG A 1 68  ? 0.438   -15.375 1.716   1.00 0.00 ? 68  ARG A CZ   2  
ATOM 2637  N NH1  . ARG A 1 68  ? 1.527   -15.986 2.162   1.00 0.00 ? 68  ARG A NH1  2  
ATOM 2638  N NH2  . ARG A 1 68  ? -0.487  -16.069 1.065   1.00 0.00 ? 68  ARG A NH2  2  
ATOM 2639  H H    . ARG A 1 68  ? 1.804   -7.937  2.405   1.00 0.00 ? 68  ARG A H    2  
ATOM 2640  H HA   . ARG A 1 68  ? 0.670   -9.774  4.343   1.00 0.00 ? 68  ARG A HA   2  
ATOM 2641  H HB2  . ARG A 1 68  ? 2.520   -10.622 2.144   1.00 0.00 ? 68  ARG A HB2  2  
ATOM 2642  H HB3  . ARG A 1 68  ? 2.618   -11.411 3.713   1.00 0.00 ? 68  ARG A HB3  2  
ATOM 2643  H HG2  . ARG A 1 68  ? 0.020   -11.659 3.379   1.00 0.00 ? 68  ARG A HG2  2  
ATOM 2644  H HG3  . ARG A 1 68  ? 0.458   -11.493 1.677   1.00 0.00 ? 68  ARG A HG3  2  
ATOM 2645  H HD2  . ARG A 1 68  ? 2.195   -13.309 2.127   1.00 0.00 ? 68  ARG A HD2  2  
ATOM 2646  H HD3  . ARG A 1 68  ? 1.335   -13.590 3.641   1.00 0.00 ? 68  ARG A HD3  2  
ATOM 2647  H HE   . ARG A 1 68  ? -0.540  -13.642 1.582   1.00 0.00 ? 68  ARG A HE   2  
ATOM 2648  H HH11 . ARG A 1 68  ? 2.225   -15.466 2.653   1.00 0.00 ? 68  ARG A HH11 2  
ATOM 2649  H HH12 . ARG A 1 68  ? 1.649   -16.967 2.008   1.00 0.00 ? 68  ARG A HH12 2  
ATOM 2650  H HH21 . ARG A 1 68  ? -1.310  -15.612 0.728   1.00 0.00 ? 68  ARG A HH21 2  
ATOM 2651  H HH22 . ARG A 1 68  ? -0.362  -17.048 0.912   1.00 0.00 ? 68  ARG A HH22 2  
ATOM 2652  N N    . PHE A 1 69  ? 2.790   -9.609  5.795   1.00 0.00 ? 69  PHE A N    2  
ATOM 2653  C CA   . PHE A 1 69  ? 3.827   -9.191  6.731   1.00 0.00 ? 69  PHE A CA   2  
ATOM 2654  C C    . PHE A 1 69  ? 4.342   -10.379 7.538   1.00 0.00 ? 69  PHE A C    2  
ATOM 2655  O O    . PHE A 1 69  ? 3.578   -11.051 8.231   1.00 0.00 ? 69  PHE A O    2  
ATOM 2656  C CB   . PHE A 1 69  ? 3.287   -8.115  7.675   1.00 0.00 ? 69  PHE A CB   2  
ATOM 2657  C CG   . PHE A 1 69  ? 4.344   -7.491  8.540   1.00 0.00 ? 69  PHE A CG   2  
ATOM 2658  C CD1  . PHE A 1 69  ? 5.401   -6.797  7.973   1.00 0.00 ? 69  PHE A CD1  2  
ATOM 2659  C CD2  . PHE A 1 69  ? 4.281   -7.598  9.920   1.00 0.00 ? 69  PHE A CD2  2  
ATOM 2660  C CE1  . PHE A 1 69  ? 6.376   -6.221  8.767   1.00 0.00 ? 69  PHE A CE1  2  
ATOM 2661  C CE2  . PHE A 1 69  ? 5.252   -7.024  10.719  1.00 0.00 ? 69  PHE A CE2  2  
ATOM 2662  C CZ   . PHE A 1 69  ? 6.302   -6.336  10.141  1.00 0.00 ? 69  PHE A CZ   2  
ATOM 2663  H H    . PHE A 1 69  ? 2.176   -10.329 6.051   1.00 0.00 ? 69  PHE A H    2  
ATOM 2664  H HA   . PHE A 1 69  ? 4.643   -8.779  6.159   1.00 0.00 ? 69  PHE A HA   2  
ATOM 2665  H HB2  . PHE A 1 69  ? 2.830   -7.330  7.092   1.00 0.00 ? 69  PHE A HB2  2  
ATOM 2666  H HB3  . PHE A 1 69  ? 2.543   -8.555  8.323   1.00 0.00 ? 69  PHE A HB3  2  
ATOM 2667  H HD1  . PHE A 1 69  ? 5.460   -6.707  6.898   1.00 0.00 ? 69  PHE A HD1  2  
ATOM 2668  H HD2  . PHE A 1 69  ? 3.462   -8.137  10.374  1.00 0.00 ? 69  PHE A HD2  2  
ATOM 2669  H HE1  . PHE A 1 69  ? 7.194   -5.684  8.311   1.00 0.00 ? 69  PHE A HE1  2  
ATOM 2670  H HE2  . PHE A 1 69  ? 5.193   -7.115  11.793  1.00 0.00 ? 69  PHE A HE2  2  
ATOM 2671  H HZ   . PHE A 1 69  ? 7.061   -5.886  10.762  1.00 0.00 ? 69  PHE A HZ   2  
ATOM 2672  N N    . ASP A 1 70  ? 5.643   -10.632 7.442   1.00 0.00 ? 70  ASP A N    2  
ATOM 2673  C CA   . ASP A 1 70  ? 6.262   -11.738 8.163   1.00 0.00 ? 70  ASP A CA   2  
ATOM 2674  C C    . ASP A 1 70  ? 5.618   -13.067 7.776   1.00 0.00 ? 70  ASP A C    2  
ATOM 2675  O O    . ASP A 1 70  ? 5.558   -13.996 8.580   1.00 0.00 ? 70  ASP A O    2  
ATOM 2676  C CB   . ASP A 1 70  ? 6.145   -11.521 9.672   1.00 0.00 ? 70  ASP A CB   2  
ATOM 2677  C CG   . ASP A 1 70  ? 7.056   -12.440 10.462  1.00 0.00 ? 70  ASP A CG   2  
ATOM 2678  O OD1  . ASP A 1 70  ? 8.140   -12.788 9.947   1.00 0.00 ? 70  ASP A OD1  2  
ATOM 2679  O OD2  . ASP A 1 70  ? 6.686   -12.811 11.596  1.00 0.00 ? 70  ASP A OD2  2  
ATOM 2680  H H    . ASP A 1 70  ? 6.200   -10.060 6.874   1.00 0.00 ? 70  ASP A H    2  
ATOM 2681  H HA   . ASP A 1 70  ? 7.307   -11.767 7.893   1.00 0.00 ? 70  ASP A HA   2  
ATOM 2682  H HB2  . ASP A 1 70  ? 6.407   -10.499 9.904   1.00 0.00 ? 70  ASP A HB2  2  
ATOM 2683  H HB3  . ASP A 1 70  ? 5.125   -11.705 9.978   1.00 0.00 ? 70  ASP A HB3  2  
ATOM 2684  N N    . GLY A 1 71  ? 5.138   -13.148 6.539   1.00 0.00 ? 71  GLY A N    2  
ATOM 2685  C CA   . GLY A 1 71  ? 4.504   -14.366 6.068   1.00 0.00 ? 71  GLY A CA   2  
ATOM 2686  C C    . GLY A 1 71  ? 3.087   -14.518 6.584   1.00 0.00 ? 71  GLY A C    2  
ATOM 2687  O O    . GLY A 1 71  ? 2.627   -15.633 6.829   1.00 0.00 ? 71  GLY A O    2  
ATOM 2688  H H    . GLY A 1 71  ? 5.214   -12.375 5.942   1.00 0.00 ? 71  GLY A H    2  
ATOM 2689  H HA2  . GLY A 1 71  ? 4.484   -14.354 4.989   1.00 0.00 ? 71  GLY A HA2  2  
ATOM 2690  H HA3  . GLY A 1 71  ? 5.088   -15.212 6.398   1.00 0.00 ? 71  GLY A HA3  2  
ATOM 2691  N N    . GLN A 1 72  ? 2.395   -13.396 6.750   1.00 0.00 ? 72  GLN A N    2  
ATOM 2692  C CA   . GLN A 1 72  ? 1.023   -13.411 7.242   1.00 0.00 ? 72  GLN A CA   2  
ATOM 2693  C C    . GLN A 1 72  ? 0.180   -12.351 6.539   1.00 0.00 ? 72  GLN A C    2  
ATOM 2694  O O    . GLN A 1 72  ? 0.642   -11.247 6.249   1.00 0.00 ? 72  GLN A O    2  
ATOM 2695  C CB   . GLN A 1 72  ? 0.998   -13.177 8.754   1.00 0.00 ? 72  GLN A CB   2  
ATOM 2696  C CG   . GLN A 1 72  ? 1.630   -14.305 9.554   1.00 0.00 ? 72  GLN A CG   2  
ATOM 2697  C CD   . GLN A 1 72  ? 1.546   -14.078 11.050  1.00 0.00 ? 72  GLN A CD   2  
ATOM 2698  O OE1  . GLN A 1 72  ? 0.477   -14.202 11.649  1.00 0.00 ? 72  GLN A OE1  2  
ATOM 2699  N NE2  . GLN A 1 72  ? 2.675   -13.744 11.663  1.00 0.00 ? 72  GLN A NE2  2  
ATOM 2700  H H    . GLN A 1 72  ? 2.817   -12.538 6.537   1.00 0.00 ? 72  GLN A H    2  
ATOM 2701  H HA   . GLN A 1 72  ? 0.605   -14.383 7.031   1.00 0.00 ? 72  GLN A HA   2  
ATOM 2702  H HB2  . GLN A 1 72  ? 1.533   -12.265 8.974   1.00 0.00 ? 72  GLN A HB2  2  
ATOM 2703  H HB3  . GLN A 1 72  ? -0.028  -13.070 9.073   1.00 0.00 ? 72  GLN A HB3  2  
ATOM 2704  H HG2  . GLN A 1 72  ? 1.120   -15.227 9.316   1.00 0.00 ? 72  GLN A HG2  2  
ATOM 2705  H HG3  . GLN A 1 72  ? 2.670   -14.388 9.275   1.00 0.00 ? 72  GLN A HG3  2  
ATOM 2706  H HE21 . GLN A 1 72  ? 3.489   -13.662 11.121  1.00 0.00 ? 72  GLN A HE21 2  
ATOM 2707  H HE22 . GLN A 1 72  ? 2.649   -13.590 12.630  1.00 0.00 ? 72  GLN A HE22 2  
ATOM 2708  N N    . PRO A 1 73  ? -1.085  -12.693 6.256   1.00 0.00 ? 73  PRO A N    2  
ATOM 2709  C CA   . PRO A 1 73  ? -2.019  -11.785 5.583   1.00 0.00 ? 73  PRO A CA   2  
ATOM 2710  C C    . PRO A 1 73  ? -2.430  -10.614 6.470   1.00 0.00 ? 73  PRO A C    2  
ATOM 2711  O O    . PRO A 1 73  ? -3.032  -10.806 7.527   1.00 0.00 ? 73  PRO A O    2  
ATOM 2712  C CB   . PRO A 1 73  ? -3.226  -12.677 5.282   1.00 0.00 ? 73  PRO A CB   2  
ATOM 2713  C CG   . PRO A 1 73  ? -3.164  -13.757 6.306   1.00 0.00 ? 73  PRO A CG   2  
ATOM 2714  C CD   . PRO A 1 73  ? -1.703  -13.992 6.572   1.00 0.00 ? 73  PRO A CD   2  
ATOM 2715  H HA   . PRO A 1 73  ? -1.608  -11.408 4.658   1.00 0.00 ? 73  PRO A HA   2  
ATOM 2716  H HB2  . PRO A 1 73  ? -4.135  -12.099 5.370   1.00 0.00 ? 73  PRO A HB2  2  
ATOM 2717  H HB3  . PRO A 1 73  ? -3.143  -13.076 4.282   1.00 0.00 ? 73  PRO A HB3  2  
ATOM 2718  H HG2  . PRO A 1 73  ? -3.663  -13.437 7.208   1.00 0.00 ? 73  PRO A HG2  2  
ATOM 2719  H HG3  . PRO A 1 73  ? -3.624  -14.655 5.920   1.00 0.00 ? 73  PRO A HG3  2  
ATOM 2720  H HD2  . PRO A 1 73  ? -1.545  -14.252 7.608   1.00 0.00 ? 73  PRO A HD2  2  
ATOM 2721  H HD3  . PRO A 1 73  ? -1.321  -14.767 5.924   1.00 0.00 ? 73  PRO A HD3  2  
ATOM 2722  N N    . ILE A 1 74  ? -2.101  -9.404  6.033   1.00 0.00 ? 74  ILE A N    2  
ATOM 2723  C CA   . ILE A 1 74  ? -2.438  -8.202  6.787   1.00 0.00 ? 74  ILE A CA   2  
ATOM 2724  C C    . ILE A 1 74  ? -3.676  -7.523  6.213   1.00 0.00 ? 74  ILE A C    2  
ATOM 2725  O O    . ILE A 1 74  ? -3.916  -7.562  5.007   1.00 0.00 ? 74  ILE A O    2  
ATOM 2726  C CB   . ILE A 1 74  ? -1.271  -7.197  6.794   1.00 0.00 ? 74  ILE A CB   2  
ATOM 2727  C CG1  . ILE A 1 74  ? -0.536  -7.226  5.452   1.00 0.00 ? 74  ILE A CG1  2  
ATOM 2728  C CG2  . ILE A 1 74  ? -0.314  -7.504  7.935   1.00 0.00 ? 74  ILE A CG2  2  
ATOM 2729  C CD1  . ILE A 1 74  ? 0.564   -6.193  5.344   1.00 0.00 ? 74  ILE A CD1  2  
ATOM 2730  H H    . ILE A 1 74  ? -1.621  -9.316  5.183   1.00 0.00 ? 74  ILE A H    2  
ATOM 2731  H HA   . ILE A 1 74  ? -2.640  -8.495  7.807   1.00 0.00 ? 74  ILE A HA   2  
ATOM 2732  H HB   . ILE A 1 74  ? -1.677  -6.210  6.952   1.00 0.00 ? 74  ILE A HB   2  
ATOM 2733  H HG12 . ILE A 1 74  ? -0.091  -8.199  5.313   1.00 0.00 ? 74  ILE A HG12 2  
ATOM 2734  H HG13 . ILE A 1 74  ? -1.245  -7.041  4.658   1.00 0.00 ? 74  ILE A HG13 2  
ATOM 2735  H HG21 . ILE A 1 74  ? 0.379   -6.684  8.055   1.00 0.00 ? 74  ILE A HG21 2  
ATOM 2736  H HG22 . ILE A 1 74  ? -0.874  -7.637  8.849   1.00 0.00 ? 74  ILE A HG22 2  
ATOM 2737  H HG23 . ILE A 1 74  ? 0.233   -8.408  7.714   1.00 0.00 ? 74  ILE A HG23 2  
ATOM 2738  H HD11 . ILE A 1 74  ? 1.347   -6.424  6.052   1.00 0.00 ? 74  ILE A HD11 2  
ATOM 2739  H HD12 . ILE A 1 74  ? 0.969   -6.201  4.343   1.00 0.00 ? 74  ILE A HD12 2  
ATOM 2740  H HD13 . ILE A 1 74  ? 0.162   -5.214  5.561   1.00 0.00 ? 74  ILE A HD13 2  
ATOM 2741  N N    . ASN A 1 75  ? -4.459  -6.898  7.087   1.00 0.00 ? 75  ASN A N    2  
ATOM 2742  C CA   . ASN A 1 75  ? -5.674  -6.207  6.667   1.00 0.00 ? 75  ASN A CA   2  
ATOM 2743  C C    . ASN A 1 75  ? -5.519  -4.697  6.816   1.00 0.00 ? 75  ASN A C    2  
ATOM 2744  O O    . ASN A 1 75  ? -4.726  -4.221  7.627   1.00 0.00 ? 75  ASN A O    2  
ATOM 2745  C CB   . ASN A 1 75  ? -6.870  -6.692  7.489   1.00 0.00 ? 75  ASN A CB   2  
ATOM 2746  C CG   . ASN A 1 75  ? -7.151  -8.168  7.285   1.00 0.00 ? 75  ASN A CG   2  
ATOM 2747  O OD1  . ASN A 1 75  ? -8.078  -8.542  6.566   1.00 0.00 ? 75  ASN A OD1  2  
ATOM 2748  N ND2  . ASN A 1 75  ? -6.350  -9.016  7.919   1.00 0.00 ? 75  ASN A ND2  2  
ATOM 2749  H H    . ASN A 1 75  ? -4.215  -6.901  8.036   1.00 0.00 ? 75  ASN A H    2  
ATOM 2750  H HA   . ASN A 1 75  ? -5.844  -6.440  5.627   1.00 0.00 ? 75  ASN A HA   2  
ATOM 2751  H HB2  . ASN A 1 75  ? -6.671  -6.525  8.537   1.00 0.00 ? 75  ASN A HB2  2  
ATOM 2752  H HB3  . ASN A 1 75  ? -7.748  -6.134  7.200   1.00 0.00 ? 75  ASN A HB3  2  
ATOM 2753  H HD21 . ASN A 1 75  ? -5.632  -8.647  8.475   1.00 0.00 ? 75  ASN A HD21 2  
ATOM 2754  H HD22 . ASN A 1 75  ? -6.508  -9.976  7.805   1.00 0.00 ? 75  ASN A HD22 2  
ATOM 2755  N N    . GLU A 1 76  ? -6.284  -3.949  6.027   1.00 0.00 ? 76  GLU A N    2  
ATOM 2756  C CA   . GLU A 1 76  ? -6.232  -2.492  6.070   1.00 0.00 ? 76  GLU A CA   2  
ATOM 2757  C C    . GLU A 1 76  ? -6.647  -1.974  7.444   1.00 0.00 ? 76  GLU A C    2  
ATOM 2758  O O    . GLU A 1 76  ? -6.064  -1.022  7.964   1.00 0.00 ? 76  GLU A O    2  
ATOM 2759  C CB   . GLU A 1 76  ? -7.139  -1.895  4.992   1.00 0.00 ? 76  GLU A CB   2  
ATOM 2760  C CG   . GLU A 1 76  ? -8.549  -2.461  5.001   1.00 0.00 ? 76  GLU A CG   2  
ATOM 2761  C CD   . GLU A 1 76  ? -9.458  -1.777  3.998   1.00 0.00 ? 76  GLU A CD   2  
ATOM 2762  O OE1  . GLU A 1 76  ? -9.973  -0.683  4.314   1.00 0.00 ? 76  GLU A OE1  2  
ATOM 2763  O OE2  . GLU A 1 76  ? -9.655  -2.334  2.898   1.00 0.00 ? 76  GLU A OE2  2  
ATOM 2764  H H    . GLU A 1 76  ? -6.898  -4.387  5.400   1.00 0.00 ? 76  GLU A H    2  
ATOM 2765  H HA   . GLU A 1 76  ? -5.213  -2.191  5.878   1.00 0.00 ? 76  GLU A HA   2  
ATOM 2766  H HB2  . GLU A 1 76  ? -7.200  -0.827  5.142   1.00 0.00 ? 76  GLU A HB2  2  
ATOM 2767  H HB3  . GLU A 1 76  ? -6.702  -2.088  4.024   1.00 0.00 ? 76  GLU A HB3  2  
ATOM 2768  H HG2  . GLU A 1 76  ? -8.502  -3.512  4.762   1.00 0.00 ? 76  GLU A HG2  2  
ATOM 2769  H HG3  . GLU A 1 76  ? -8.968  -2.335  5.988   1.00 0.00 ? 76  GLU A HG3  2  
ATOM 2770  N N    . THR A 1 77  ? -7.660  -2.607  8.028   1.00 0.00 ? 77  THR A N    2  
ATOM 2771  C CA   . THR A 1 77  ? -8.156  -2.210  9.340   1.00 0.00 ? 77  THR A CA   2  
ATOM 2772  C C    . THR A 1 77  ? -7.065  -2.327  10.398  1.00 0.00 ? 77  THR A C    2  
ATOM 2773  O O    . THR A 1 77  ? -7.058  -1.586  11.381  1.00 0.00 ? 77  THR A O    2  
ATOM 2774  C CB   . THR A 1 77  ? -9.363  -3.066  9.767   1.00 0.00 ? 77  THR A CB   2  
ATOM 2775  O OG1  . THR A 1 77  ? -8.984  -4.445  9.840   1.00 0.00 ? 77  THR A OG1  2  
ATOM 2776  C CG2  . THR A 1 77  ? -10.516 -2.902  8.788   1.00 0.00 ? 77  THR A CG2  2  
ATOM 2777  H H    . THR A 1 77  ? -8.084  -3.358  7.563   1.00 0.00 ? 77  THR A H    2  
ATOM 2778  H HA   . THR A 1 77  ? -8.475  -1.180  9.278   1.00 0.00 ? 77  THR A HA   2  
ATOM 2779  H HB   . THR A 1 77  ? -9.690  -2.738  10.744  1.00 0.00 ? 77  THR A HB   2  
ATOM 2780  H HG1  . THR A 1 77  ? -8.690  -4.742  8.975   1.00 0.00 ? 77  THR A HG1  2  
ATOM 2781  H HG21 . THR A 1 77  ? -10.544 -3.750  8.119   1.00 0.00 ? 77  THR A HG21 2  
ATOM 2782  H HG22 . THR A 1 77  ? -10.377 -1.997  8.217   1.00 0.00 ? 77  THR A HG22 2  
ATOM 2783  H HG23 . THR A 1 77  ? -11.445 -2.845  9.334   1.00 0.00 ? 77  THR A HG23 2  
ATOM 2784  N N    . ASP A 1 78  ? -6.143  -3.260  10.189  1.00 0.00 ? 78  ASP A N    2  
ATOM 2785  C CA   . ASP A 1 78  ? -5.044  -3.473  11.125  1.00 0.00 ? 78  ASP A CA   2  
ATOM 2786  C C    . ASP A 1 78  ? -4.041  -2.326  11.054  1.00 0.00 ? 78  ASP A C    2  
ATOM 2787  O O    . ASP A 1 78  ? -3.973  -1.606  10.058  1.00 0.00 ? 78  ASP A O    2  
ATOM 2788  C CB   . ASP A 1 78  ? -4.344  -4.800  10.830  1.00 0.00 ? 78  ASP A CB   2  
ATOM 2789  C CG   . ASP A 1 78  ? -4.959  -5.961  11.586  1.00 0.00 ? 78  ASP A CG   2  
ATOM 2790  O OD1  . ASP A 1 78  ? -5.948  -6.537  11.085  1.00 0.00 ? 78  ASP A OD1  2  
ATOM 2791  O OD2  . ASP A 1 78  ? -4.452  -6.293  12.677  1.00 0.00 ? 78  ASP A OD2  2  
ATOM 2792  H H    . ASP A 1 78  ? -6.201  -3.820  9.386   1.00 0.00 ? 78  ASP A H    2  
ATOM 2793  H HA   . ASP A 1 78  ? -5.460  -3.510  12.121  1.00 0.00 ? 78  ASP A HA   2  
ATOM 2794  H HB2  . ASP A 1 78  ? -4.411  -5.007  9.771   1.00 0.00 ? 78  ASP A HB2  2  
ATOM 2795  H HB3  . ASP A 1 78  ? -3.304  -4.721  11.111  1.00 0.00 ? 78  ASP A HB3  2  
ATOM 2796  N N    . THR A 1 79  ? -3.262  -2.161  12.119  1.00 0.00 ? 79  THR A N    2  
ATOM 2797  C CA   . THR A 1 79  ? -2.263  -1.101  12.179  1.00 0.00 ? 79  THR A CA   2  
ATOM 2798  C C    . THR A 1 79  ? -0.853  -1.677  12.230  1.00 0.00 ? 79  THR A C    2  
ATOM 2799  O O    . THR A 1 79  ? -0.642  -2.838  12.581  1.00 0.00 ? 79  THR A O    2  
ATOM 2800  C CB   . THR A 1 79  ? -2.479  -0.194  13.405  1.00 0.00 ? 79  THR A CB   2  
ATOM 2801  O OG1  . THR A 1 79  ? -3.030  -0.955  14.486  1.00 0.00 ? 79  THR A OG1  2  
ATOM 2802  C CG2  . THR A 1 79  ? -3.409  0.961   13.066  1.00 0.00 ? 79  THR A CG2  2  
ATOM 2803  H H    . THR A 1 79  ? -3.363  -2.767  12.882  1.00 0.00 ? 79  THR A H    2  
ATOM 2804  H HA   . THR A 1 79  ? -2.364  -0.498  11.289  1.00 0.00 ? 79  THR A HA   2  
ATOM 2805  H HB   . THR A 1 79  ? -1.524  0.208   13.709  1.00 0.00 ? 79  THR A HB   2  
ATOM 2806  H HG1  . THR A 1 79  ? -2.510  -1.752  14.615  1.00 0.00 ? 79  THR A HG1  2  
ATOM 2807  H HG21 . THR A 1 79  ? -3.011  1.876   13.480  1.00 0.00 ? 79  THR A HG21 2  
ATOM 2808  H HG22 . THR A 1 79  ? -4.386  0.772   13.485  1.00 0.00 ? 79  THR A HG22 2  
ATOM 2809  H HG23 . THR A 1 79  ? -3.488  1.056   11.994  1.00 0.00 ? 79  THR A HG23 2  
ATOM 2810  N N    . PRO A 1 80  ? 0.139   -0.848  11.871  1.00 0.00 ? 80  PRO A N    2  
ATOM 2811  C CA   . PRO A 1 80  ? 1.548   -1.253  11.869  1.00 0.00 ? 80  PRO A CA   2  
ATOM 2812  C C    . PRO A 1 80  ? 2.095   -1.457  13.278  1.00 0.00 ? 80  PRO A C    2  
ATOM 2813  O O    . PRO A 1 80  ? 3.132   -2.092  13.465  1.00 0.00 ? 80  PRO A O    2  
ATOM 2814  C CB   . PRO A 1 80  ? 2.253   -0.079  11.186  1.00 0.00 ? 80  PRO A CB   2  
ATOM 2815  C CG   . PRO A 1 80  ? 1.364   1.091   11.429  1.00 0.00 ? 80  PRO A CG   2  
ATOM 2816  C CD   . PRO A 1 80  ? -0.039  0.549   11.442  1.00 0.00 ? 80  PRO A CD   2  
ATOM 2817  H HA   . PRO A 1 80  ? 1.701   -2.153  11.291  1.00 0.00 ? 80  PRO A HA   2  
ATOM 2818  H HB2  . PRO A 1 80  ? 3.228   0.066   11.629  1.00 0.00 ? 80  PRO A HB2  2  
ATOM 2819  H HB3  . PRO A 1 80  ? 2.358   -0.282  10.131  1.00 0.00 ? 80  PRO A HB3  2  
ATOM 2820  H HG2  . PRO A 1 80  ? 1.601   1.541   12.381  1.00 0.00 ? 80  PRO A HG2  2  
ATOM 2821  H HG3  . PRO A 1 80  ? 1.480   1.812   10.633  1.00 0.00 ? 80  PRO A HG3  2  
ATOM 2822  H HD2  . PRO A 1 80  ? -0.648  1.095   12.147  1.00 0.00 ? 80  PRO A HD2  2  
ATOM 2823  H HD3  . PRO A 1 80  ? -0.470  0.596   10.453  1.00 0.00 ? 80  PRO A HD3  2  
ATOM 2824  N N    . ALA A 1 81  ? 1.390   -0.914  14.265  1.00 0.00 ? 81  ALA A N    2  
ATOM 2825  C CA   . ALA A 1 81  ? 1.805   -1.038  15.657  1.00 0.00 ? 81  ALA A CA   2  
ATOM 2826  C C    . ALA A 1 81  ? 1.346   -2.367  16.250  1.00 0.00 ? 81  ALA A C    2  
ATOM 2827  O O    . ALA A 1 81  ? 1.954   -2.880  17.188  1.00 0.00 ? 81  ALA A O    2  
ATOM 2828  C CB   . ALA A 1 81  ? 1.260   0.123   16.476  1.00 0.00 ? 81  ALA A CB   2  
ATOM 2829  H H    . ALA A 1 81  ? 0.572   -0.419  14.052  1.00 0.00 ? 81  ALA A H    2  
ATOM 2830  H HA   . ALA A 1 81  ? 2.884   -0.995  15.689  1.00 0.00 ? 81  ALA A HA   2  
ATOM 2831  H HB1  . ALA A 1 81  ? 2.014   0.893   16.551  1.00 0.00 ? 81  ALA A HB1  2  
ATOM 2832  H HB2  . ALA A 1 81  ? 0.382   0.524   15.992  1.00 0.00 ? 81  ALA A HB2  2  
ATOM 2833  H HB3  . ALA A 1 81  ? 1.000   -0.225  17.464  1.00 0.00 ? 81  ALA A HB3  2  
ATOM 2834  N N    . GLN A 1 82  ? 0.270   -2.916  15.696  1.00 0.00 ? 82  GLN A N    2  
ATOM 2835  C CA   . GLN A 1 82  ? -0.270  -4.184  16.171  1.00 0.00 ? 82  GLN A CA   2  
ATOM 2836  C C    . GLN A 1 82  ? 0.625   -5.347  15.756  1.00 0.00 ? 82  GLN A C    2  
ATOM 2837  O O    . GLN A 1 82  ? 0.725   -6.351  16.463  1.00 0.00 ? 82  GLN A O    2  
ATOM 2838  C CB   . GLN A 1 82  ? -1.685  -4.395  15.630  1.00 0.00 ? 82  GLN A CB   2  
ATOM 2839  C CG   . GLN A 1 82  ? -2.477  -5.447  16.390  1.00 0.00 ? 82  GLN A CG   2  
ATOM 2840  C CD   . GLN A 1 82  ? -3.975  -5.265  16.250  1.00 0.00 ? 82  GLN A CD   2  
ATOM 2841  O OE1  . GLN A 1 82  ? -4.587  -4.483  16.978  1.00 0.00 ? 82  GLN A OE1  2  
ATOM 2842  N NE2  . GLN A 1 82  ? -4.575  -5.987  15.310  1.00 0.00 ? 82  GLN A NE2  2  
ATOM 2843  H H    . GLN A 1 82  ? -0.171  -2.458  14.951  1.00 0.00 ? 82  GLN A H    2  
ATOM 2844  H HA   . GLN A 1 82  ? -0.310  -4.144  17.249  1.00 0.00 ? 82  GLN A HA   2  
ATOM 2845  H HB2  . GLN A 1 82  ? -2.223  -3.460  15.687  1.00 0.00 ? 82  GLN A HB2  2  
ATOM 2846  H HB3  . GLN A 1 82  ? -1.620  -4.702  14.596  1.00 0.00 ? 82  GLN A HB3  2  
ATOM 2847  H HG2  . GLN A 1 82  ? -2.212  -6.423  16.010  1.00 0.00 ? 82  GLN A HG2  2  
ATOM 2848  H HG3  . GLN A 1 82  ? -2.218  -5.388  17.437  1.00 0.00 ? 82  GLN A HG3  2  
ATOM 2849  H HE21 . GLN A 1 82  ? -4.023  -6.590  14.769  1.00 0.00 ? 82  GLN A HE21 2  
ATOM 2850  H HE22 . GLN A 1 82  ? -5.542  -5.889  15.199  1.00 0.00 ? 82  GLN A HE22 2  
ATOM 2851  N N    . LEU A 1 83  ? 1.273   -5.206  14.605  1.00 0.00 ? 83  LEU A N    2  
ATOM 2852  C CA   . LEU A 1 83  ? 2.160   -6.246  14.095  1.00 0.00 ? 83  LEU A CA   2  
ATOM 2853  C C    . LEU A 1 83  ? 3.617   -5.922  14.411  1.00 0.00 ? 83  LEU A C    2  
ATOM 2854  O O    . LEU A 1 83  ? 4.531   -6.454  13.782  1.00 0.00 ? 83  LEU A O    2  
ATOM 2855  C CB   . LEU A 1 83  ? 1.977   -6.404  12.584  1.00 0.00 ? 83  LEU A CB   2  
ATOM 2856  C CG   . LEU A 1 83  ? 0.535   -6.540  12.094  1.00 0.00 ? 83  LEU A CG   2  
ATOM 2857  C CD1  . LEU A 1 83  ? 0.438   -6.189  10.617  1.00 0.00 ? 83  LEU A CD1  2  
ATOM 2858  C CD2  . LEU A 1 83  ? 0.018   -7.950  12.343  1.00 0.00 ? 83  LEU A CD2  2  
ATOM 2859  H H    . LEU A 1 83  ? 1.153   -4.384  14.086  1.00 0.00 ? 83  LEU A H    2  
ATOM 2860  H HA   . LEU A 1 83  ? 1.897   -7.174  14.580  1.00 0.00 ? 83  LEU A HA   2  
ATOM 2861  H HB2  . LEU A 1 83  ? 2.407   -5.537  12.107  1.00 0.00 ? 83  LEU A HB2  2  
ATOM 2862  H HB3  . LEU A 1 83  ? 2.517   -7.288  12.277  1.00 0.00 ? 83  LEU A HB3  2  
ATOM 2863  H HG   . LEU A 1 83  ? -0.092  -5.851  12.642  1.00 0.00 ? 83  LEU A HG   2  
ATOM 2864  H HD11 . LEU A 1 83  ? 0.793   -5.181  10.463  1.00 0.00 ? 83  LEU A HD11 2  
ATOM 2865  H HD12 . LEU A 1 83  ? -0.591  -6.261  10.297  1.00 0.00 ? 83  LEU A HD12 2  
ATOM 2866  H HD13 . LEU A 1 83  ? 1.042   -6.876  10.043  1.00 0.00 ? 83  LEU A HD13 2  
ATOM 2867  H HD21 . LEU A 1 83  ? -0.048  -8.125  13.407  1.00 0.00 ? 83  LEU A HD21 2  
ATOM 2868  H HD22 . LEU A 1 83  ? 0.697   -8.665  11.902  1.00 0.00 ? 83  LEU A HD22 2  
ATOM 2869  H HD23 . LEU A 1 83  ? -0.960  -8.059  11.899  1.00 0.00 ? 83  LEU A HD23 2  
ATOM 2870  N N    . GLU A 1 84  ? 3.824   -5.048  15.391  1.00 0.00 ? 84  GLU A N    2  
ATOM 2871  C CA   . GLU A 1 84  ? 5.170   -4.655  15.790  1.00 0.00 ? 84  GLU A CA   2  
ATOM 2872  C C    . GLU A 1 84  ? 6.022   -4.313  14.571  1.00 0.00 ? 84  GLU A C    2  
ATOM 2873  O O    . GLU A 1 84  ? 7.199   -4.666  14.505  1.00 0.00 ? 84  GLU A O    2  
ATOM 2874  C CB   . GLU A 1 84  ? 5.836   -5.776  16.592  1.00 0.00 ? 84  GLU A CB   2  
ATOM 2875  C CG   . GLU A 1 84  ? 5.136   -6.082  17.906  1.00 0.00 ? 84  GLU A CG   2  
ATOM 2876  C CD   . GLU A 1 84  ? 5.348   -7.514  18.360  1.00 0.00 ? 84  GLU A CD   2  
ATOM 2877  O OE1  . GLU A 1 84  ? 6.343   -7.771  19.070  1.00 0.00 ? 84  GLU A OE1  2  
ATOM 2878  O OE2  . GLU A 1 84  ? 4.518   -8.377  18.005  1.00 0.00 ? 84  GLU A OE2  2  
ATOM 2879  H H    . GLU A 1 84  ? 3.054   -4.658  15.855  1.00 0.00 ? 84  GLU A H    2  
ATOM 2880  H HA   . GLU A 1 84  ? 5.088   -3.779  16.415  1.00 0.00 ? 84  GLU A HA   2  
ATOM 2881  H HB2  . GLU A 1 84  ? 5.843   -6.675  15.994  1.00 0.00 ? 84  GLU A HB2  2  
ATOM 2882  H HB3  . GLU A 1 84  ? 6.854   -5.491  16.809  1.00 0.00 ? 84  GLU A HB3  2  
ATOM 2883  H HG2  . GLU A 1 84  ? 5.520   -5.420  18.667  1.00 0.00 ? 84  GLU A HG2  2  
ATOM 2884  H HG3  . GLU A 1 84  ? 4.077   -5.912  17.783  1.00 0.00 ? 84  GLU A HG3  2  
ATOM 2885  N N    . MET A 1 85  ? 5.417   -3.623  13.610  1.00 0.00 ? 85  MET A N    2  
ATOM 2886  C CA   . MET A 1 85  ? 6.120   -3.232  12.393  1.00 0.00 ? 85  MET A CA   2  
ATOM 2887  C C    . MET A 1 85  ? 7.297   -2.317  12.715  1.00 0.00 ? 85  MET A C    2  
ATOM 2888  O O    . MET A 1 85  ? 7.121   -1.118  12.928  1.00 0.00 ? 85  MET A O    2  
ATOM 2889  C CB   . MET A 1 85  ? 5.162   -2.531  11.428  1.00 0.00 ? 85  MET A CB   2  
ATOM 2890  C CG   . MET A 1 85  ? 4.079   -3.444  10.876  1.00 0.00 ? 85  MET A CG   2  
ATOM 2891  S SD   . MET A 1 85  ? 3.326   -2.797  9.371   1.00 0.00 ? 85  MET A SD   2  
ATOM 2892  C CE   . MET A 1 85  ? 3.487   -4.207  8.278   1.00 0.00 ? 85  MET A CE   2  
ATOM 2893  H H    . MET A 1 85  ? 4.477   -3.371  13.720  1.00 0.00 ? 85  MET A H    2  
ATOM 2894  H HA   . MET A 1 85  ? 6.495   -4.130  11.924  1.00 0.00 ? 85  MET A HA   2  
ATOM 2895  H HB2  . MET A 1 85  ? 4.683   -1.713  11.946  1.00 0.00 ? 85  MET A HB2  2  
ATOM 2896  H HB3  . MET A 1 85  ? 5.729   -2.138  10.598  1.00 0.00 ? 85  MET A HB3  2  
ATOM 2897  H HG2  . MET A 1 85  ? 4.515   -4.407  10.657  1.00 0.00 ? 85  MET A HG2  2  
ATOM 2898  H HG3  . MET A 1 85  ? 3.310   -3.561  11.625  1.00 0.00 ? 85  MET A HG3  2  
ATOM 2899  H HE1  . MET A 1 85  ? 4.213   -4.896  8.684   1.00 0.00 ? 85  MET A HE1  2  
ATOM 2900  H HE2  . MET A 1 85  ? 2.532   -4.702  8.188   1.00 0.00 ? 85  MET A HE2  2  
ATOM 2901  H HE3  . MET A 1 85  ? 3.814   -3.872  7.305   1.00 0.00 ? 85  MET A HE3  2  
ATOM 2902  N N    . GLU A 1 86  ? 8.495   -2.891  12.749  1.00 0.00 ? 86  GLU A N    2  
ATOM 2903  C CA   . GLU A 1 86  ? 9.700   -2.125  13.047  1.00 0.00 ? 86  GLU A CA   2  
ATOM 2904  C C    . GLU A 1 86  ? 10.107  -1.266  11.853  1.00 0.00 ? 86  GLU A C    2  
ATOM 2905  O O    . GLU A 1 86  ? 9.608   -1.451  10.743  1.00 0.00 ? 86  GLU A O    2  
ATOM 2906  C CB   . GLU A 1 86  ? 10.846  -3.063  13.429  1.00 0.00 ? 86  GLU A CB   2  
ATOM 2907  C CG   . GLU A 1 86  ? 10.642  -3.762  14.763  1.00 0.00 ? 86  GLU A CG   2  
ATOM 2908  C CD   . GLU A 1 86  ? 11.829  -4.618  15.160  1.00 0.00 ? 86  GLU A CD   2  
ATOM 2909  O OE1  . GLU A 1 86  ? 12.141  -5.579  14.426  1.00 0.00 ? 86  GLU A OE1  2  
ATOM 2910  O OE2  . GLU A 1 86  ? 12.447  -4.326  16.206  1.00 0.00 ? 86  GLU A OE2  2  
ATOM 2911  H H    . GLU A 1 86  ? 8.571   -3.851  12.571  1.00 0.00 ? 86  GLU A H    2  
ATOM 2912  H HA   . GLU A 1 86  ? 9.483   -1.477  13.883  1.00 0.00 ? 86  GLU A HA   2  
ATOM 2913  H HB2  . GLU A 1 86  ? 10.949  -3.817  12.662  1.00 0.00 ? 86  GLU A HB2  2  
ATOM 2914  H HB3  . GLU A 1 86  ? 11.761  -2.491  13.483  1.00 0.00 ? 86  GLU A HB3  2  
ATOM 2915  H HG2  . GLU A 1 86  ? 10.486  -3.015  15.526  1.00 0.00 ? 86  GLU A HG2  2  
ATOM 2916  H HG3  . GLU A 1 86  ? 9.769   -4.393  14.694  1.00 0.00 ? 86  GLU A HG3  2  
ATOM 2917  N N    . ASP A 1 87  ? 11.016  -0.326  12.091  1.00 0.00 ? 87  ASP A N    2  
ATOM 2918  C CA   . ASP A 1 87  ? 11.491  0.562   11.036  1.00 0.00 ? 87  ASP A CA   2  
ATOM 2919  C C    . ASP A 1 87  ? 12.296  -0.212  9.996   1.00 0.00 ? 87  ASP A C    2  
ATOM 2920  O O    . ASP A 1 87  ? 12.696  -1.351  10.230  1.00 0.00 ? 87  ASP A O    2  
ATOM 2921  C CB   . ASP A 1 87  ? 12.346  1.683   11.630  1.00 0.00 ? 87  ASP A CB   2  
ATOM 2922  C CG   . ASP A 1 87  ? 13.457  1.155   12.517  1.00 0.00 ? 87  ASP A CG   2  
ATOM 2923  O OD1  . ASP A 1 87  ? 14.480  0.690   11.973  1.00 0.00 ? 87  ASP A OD1  2  
ATOM 2924  O OD2  . ASP A 1 87  ? 13.303  1.209   13.755  1.00 0.00 ? 87  ASP A OD2  2  
ATOM 2925  H H    . ASP A 1 87  ? 11.376  -0.228  12.997  1.00 0.00 ? 87  ASP A H    2  
ATOM 2926  H HA   . ASP A 1 87  ? 10.628  0.996   10.555  1.00 0.00 ? 87  ASP A HA   2  
ATOM 2927  H HB2  . ASP A 1 87  ? 12.791  2.251   10.827  1.00 0.00 ? 87  ASP A HB2  2  
ATOM 2928  H HB3  . ASP A 1 87  ? 11.716  2.332   12.220  1.00 0.00 ? 87  ASP A HB3  2  
ATOM 2929  N N    . GLU A 1 88  ? 12.527  0.416   8.848   1.00 0.00 ? 88  GLU A N    2  
ATOM 2930  C CA   . GLU A 1 88  ? 13.283  -0.215  7.772   1.00 0.00 ? 88  GLU A CA   2  
ATOM 2931  C C    . GLU A 1 88  ? 12.740  -1.609  7.471   1.00 0.00 ? 88  GLU A C    2  
ATOM 2932  O O    . GLU A 1 88  ? 13.474  -2.490  7.024   1.00 0.00 ? 88  GLU A O    2  
ATOM 2933  C CB   . GLU A 1 88  ? 14.765  -0.302  8.142   1.00 0.00 ? 88  GLU A CB   2  
ATOM 2934  C CG   . GLU A 1 88  ? 15.408  1.050   8.401   1.00 0.00 ? 88  GLU A CG   2  
ATOM 2935  C CD   . GLU A 1 88  ? 16.747  0.934   9.104   1.00 0.00 ? 88  GLU A CD   2  
ATOM 2936  O OE1  . GLU A 1 88  ? 16.765  0.505   10.277  1.00 0.00 ? 88  GLU A OE1  2  
ATOM 2937  O OE2  . GLU A 1 88  ? 17.775  1.273   8.482   1.00 0.00 ? 88  GLU A OE2  2  
ATOM 2938  H H    . GLU A 1 88  ? 12.182  1.324   8.721   1.00 0.00 ? 88  GLU A H    2  
ATOM 2939  H HA   . GLU A 1 88  ? 13.177  0.397   6.889   1.00 0.00 ? 88  GLU A HA   2  
ATOM 2940  H HB2  . GLU A 1 88  ? 14.866  -0.903  9.034   1.00 0.00 ? 88  GLU A HB2  2  
ATOM 2941  H HB3  . GLU A 1 88  ? 15.297  -0.782  7.334   1.00 0.00 ? 88  GLU A HB3  2  
ATOM 2942  H HG2  . GLU A 1 88  ? 15.558  1.550   7.455   1.00 0.00 ? 88  GLU A HG2  2  
ATOM 2943  H HG3  . GLU A 1 88  ? 14.744  1.638   9.016   1.00 0.00 ? 88  GLU A HG3  2  
ATOM 2944  N N    . ASP A 1 89  ? 11.449  -1.801  7.719   1.00 0.00 ? 89  ASP A N    2  
ATOM 2945  C CA   . ASP A 1 89  ? 10.806  -3.087  7.475   1.00 0.00 ? 89  ASP A CA   2  
ATOM 2946  C C    . ASP A 1 89  ? 10.575  -3.304  5.983   1.00 0.00 ? 89  ASP A C    2  
ATOM 2947  O O    . ASP A 1 89  ? 10.986  -2.490  5.154   1.00 0.00 ? 89  ASP A O    2  
ATOM 2948  C CB   . ASP A 1 89  ? 9.476   -3.167  8.227   1.00 0.00 ? 89  ASP A CB   2  
ATOM 2949  C CG   . ASP A 1 89  ? 9.634   -3.740  9.621   1.00 0.00 ? 89  ASP A CG   2  
ATOM 2950  O OD1  . ASP A 1 89  ? 10.748  -3.650  10.178  1.00 0.00 ? 89  ASP A OD1  2  
ATOM 2951  O OD2  . ASP A 1 89  ? 8.642   -4.278  10.157  1.00 0.00 ? 89  ASP A OD2  2  
ATOM 2952  H H    . ASP A 1 89  ? 10.915  -1.059  8.075   1.00 0.00 ? 89  ASP A H    2  
ATOM 2953  H HA   . ASP A 1 89  ? 11.463  -3.861  7.841   1.00 0.00 ? 89  ASP A HA   2  
ATOM 2954  H HB2  . ASP A 1 89  ? 9.057   -2.175  8.311   1.00 0.00 ? 89  ASP A HB2  2  
ATOM 2955  H HB3  . ASP A 1 89  ? 8.795   -3.796  7.673   1.00 0.00 ? 89  ASP A HB3  2  
ATOM 2956  N N    . THR A 1 90  ? 9.914   -4.407  5.646   1.00 0.00 ? 90  THR A N    2  
ATOM 2957  C CA   . THR A 1 90  ? 9.630   -4.733  4.254   1.00 0.00 ? 90  THR A CA   2  
ATOM 2958  C C    . THR A 1 90  ? 8.302   -5.468  4.121   1.00 0.00 ? 90  THR A C    2  
ATOM 2959  O O    . THR A 1 90  ? 8.071   -6.478  4.787   1.00 0.00 ? 90  THR A O    2  
ATOM 2960  C CB   . THR A 1 90  ? 10.747  -5.599  3.640   1.00 0.00 ? 90  THR A CB   2  
ATOM 2961  O OG1  . THR A 1 90  ? 11.991  -4.892  3.678   1.00 0.00 ? 90  THR A OG1  2  
ATOM 2962  C CG2  . THR A 1 90  ? 10.413  -5.974  2.204   1.00 0.00 ? 90  THR A CG2  2  
ATOM 2963  H H    . THR A 1 90  ? 9.612   -5.016  6.351   1.00 0.00 ? 90  THR A H    2  
ATOM 2964  H HA   . THR A 1 90  ? 9.575   -3.807  3.699   1.00 0.00 ? 90  THR A HA   2  
ATOM 2965  H HB   . THR A 1 90  ? 10.839  -6.505  4.221   1.00 0.00 ? 90  THR A HB   2  
ATOM 2966  H HG1  . THR A 1 90  ? 12.666  -5.452  4.068   1.00 0.00 ? 90  THR A HG1  2  
ATOM 2967  H HG21 . THR A 1 90  ? 10.779  -6.969  1.998   1.00 0.00 ? 90  THR A HG21 2  
ATOM 2968  H HG22 . THR A 1 90  ? 10.881  -5.271  1.531   1.00 0.00 ? 90  THR A HG22 2  
ATOM 2969  H HG23 . THR A 1 90  ? 9.343   -5.948  2.065   1.00 0.00 ? 90  THR A HG23 2  
ATOM 2970  N N    . ILE A 1 91  ? 7.431   -4.957  3.258   1.00 0.00 ? 91  ILE A N    2  
ATOM 2971  C CA   . ILE A 1 91  ? 6.126   -5.567  3.037   1.00 0.00 ? 91  ILE A CA   2  
ATOM 2972  C C    . ILE A 1 91  ? 6.135   -6.450  1.794   1.00 0.00 ? 91  ILE A C    2  
ATOM 2973  O O    . ILE A 1 91  ? 6.924   -6.236  0.874   1.00 0.00 ? 91  ILE A O    2  
ATOM 2974  C CB   . ILE A 1 91  ? 5.024   -4.501  2.888   1.00 0.00 ? 91  ILE A CB   2  
ATOM 2975  C CG1  . ILE A 1 91  ? 5.199   -3.404  3.940   1.00 0.00 ? 91  ILE A CG1  2  
ATOM 2976  C CG2  . ILE A 1 91  ? 3.649   -5.141  3.005   1.00 0.00 ? 91  ILE A CG2  2  
ATOM 2977  C CD1  . ILE A 1 91  ? 4.087   -2.378  3.934   1.00 0.00 ? 91  ILE A CD1  2  
ATOM 2978  H H    . ILE A 1 91  ? 7.672   -4.150  2.757   1.00 0.00 ? 91  ILE A H    2  
ATOM 2979  H HA   . ILE A 1 91  ? 5.894   -6.177  3.898   1.00 0.00 ? 91  ILE A HA   2  
ATOM 2980  H HB   . ILE A 1 91  ? 5.108   -4.064  1.905   1.00 0.00 ? 91  ILE A HB   2  
ATOM 2981  H HG12 . ILE A 1 91  ? 5.228   -3.855  4.919   1.00 0.00 ? 91  ILE A HG12 2  
ATOM 2982  H HG13 . ILE A 1 91  ? 6.130   -2.887  3.758   1.00 0.00 ? 91  ILE A HG13 2  
ATOM 2983  H HG21 . ILE A 1 91  ? 3.707   -6.001  3.655   1.00 0.00 ? 91  ILE A HG21 2  
ATOM 2984  H HG22 . ILE A 1 91  ? 2.953   -4.425  3.418   1.00 0.00 ? 91  ILE A HG22 2  
ATOM 2985  H HG23 . ILE A 1 91  ? 3.311   -5.450  2.028   1.00 0.00 ? 91  ILE A HG23 2  
ATOM 2986  H HD11 . ILE A 1 91  ? 3.425   -2.559  4.768   1.00 0.00 ? 91  ILE A HD11 2  
ATOM 2987  H HD12 . ILE A 1 91  ? 4.510   -1.388  4.017   1.00 0.00 ? 91  ILE A HD12 2  
ATOM 2988  H HD13 . ILE A 1 91  ? 3.531   -2.456  3.010   1.00 0.00 ? 91  ILE A HD13 2  
ATOM 2989  N N    . ASP A 1 92  ? 5.252   -7.442  1.774   1.00 0.00 ? 92  ASP A N    2  
ATOM 2990  C CA   . ASP A 1 92  ? 5.155   -8.357  0.643   1.00 0.00 ? 92  ASP A CA   2  
ATOM 2991  C C    . ASP A 1 92  ? 3.835   -8.169  -0.098  1.00 0.00 ? 92  ASP A C    2  
ATOM 2992  O O    . ASP A 1 92  ? 2.759   -8.322  0.481   1.00 0.00 ? 92  ASP A O    2  
ATOM 2993  C CB   . ASP A 1 92  ? 5.286   -9.805  1.118   1.00 0.00 ? 92  ASP A CB   2  
ATOM 2994  C CG   . ASP A 1 92  ? 5.903   -10.706 0.067   1.00 0.00 ? 92  ASP A CG   2  
ATOM 2995  O OD1  . ASP A 1 92  ? 5.400   -10.715 -1.076  1.00 0.00 ? 92  ASP A OD1  2  
ATOM 2996  O OD2  . ASP A 1 92  ? 6.889   -11.403 0.387   1.00 0.00 ? 92  ASP A OD2  2  
ATOM 2997  H H    . ASP A 1 92  ? 4.649   -7.561  2.538   1.00 0.00 ? 92  ASP A H    2  
ATOM 2998  H HA   . ASP A 1 92  ? 5.967   -8.136  -0.033  1.00 0.00 ? 92  ASP A HA   2  
ATOM 2999  H HB2  . ASP A 1 92  ? 5.909   -9.833  2.000   1.00 0.00 ? 92  ASP A HB2  2  
ATOM 3000  H HB3  . ASP A 1 92  ? 4.305   -10.187 1.362   1.00 0.00 ? 92  ASP A HB3  2  
ATOM 3001  N N    . VAL A 1 93  ? 3.925   -7.834  -1.381  1.00 0.00 ? 93  VAL A N    2  
ATOM 3002  C CA   . VAL A 1 93  ? 2.737   -7.624  -2.201  1.00 0.00 ? 93  VAL A CA   2  
ATOM 3003  C C    . VAL A 1 93  ? 2.879   -8.305  -3.558  1.00 0.00 ? 93  VAL A C    2  
ATOM 3004  O O    . VAL A 1 93  ? 3.988   -8.473  -4.067  1.00 0.00 ? 93  VAL A O    2  
ATOM 3005  C CB   . VAL A 1 93  ? 2.463   -6.124  -2.418  1.00 0.00 ? 93  VAL A CB   2  
ATOM 3006  C CG1  . VAL A 1 93  ? 1.373   -5.926  -3.461  1.00 0.00 ? 93  VAL A CG1  2  
ATOM 3007  C CG2  . VAL A 1 93  ? 2.083   -5.457  -1.105  1.00 0.00 ? 93  VAL A CG2  2  
ATOM 3008  H H    . VAL A 1 93  ? 4.810   -7.726  -1.786  1.00 0.00 ? 93  VAL A H    2  
ATOM 3009  H HA   . VAL A 1 93  ? 1.893   -8.052  -1.681  1.00 0.00 ? 93  VAL A HA   2  
ATOM 3010  H HB   . VAL A 1 93  ? 3.368   -5.662  -2.784  1.00 0.00 ? 93  VAL A HB   2  
ATOM 3011  H HG11 . VAL A 1 93  ? 0.612   -6.681  -3.333  1.00 0.00 ? 93  VAL A HG11 2  
ATOM 3012  H HG12 . VAL A 1 93  ? 0.934   -4.946  -3.341  1.00 0.00 ? 93  VAL A HG12 2  
ATOM 3013  H HG13 . VAL A 1 93  ? 1.801   -6.010  -4.449  1.00 0.00 ? 93  VAL A HG13 2  
ATOM 3014  H HG21 . VAL A 1 93  ? 1.190   -5.920  -0.712  1.00 0.00 ? 93  VAL A HG21 2  
ATOM 3015  H HG22 . VAL A 1 93  ? 2.890   -5.572  -0.395  1.00 0.00 ? 93  VAL A HG22 2  
ATOM 3016  H HG23 . VAL A 1 93  ? 1.900   -4.406  -1.274  1.00 0.00 ? 93  VAL A HG23 2  
ATOM 3017  N N    . PHE A 1 94  ? 1.750   -8.695  -4.139  1.00 0.00 ? 94  PHE A N    2  
ATOM 3018  C CA   . PHE A 1 94  ? 1.748   -9.358  -5.438  1.00 0.00 ? 94  PHE A CA   2  
ATOM 3019  C C    . PHE A 1 94  ? 1.066   -8.490  -6.491  1.00 0.00 ? 94  PHE A C    2  
ATOM 3020  O O    . PHE A 1 94  ? -0.151  -8.306  -6.465  1.00 0.00 ? 94  PHE A O    2  
ATOM 3021  C CB   . PHE A 1 94  ? 1.041   -10.712 -5.341  1.00 0.00 ? 94  PHE A CB   2  
ATOM 3022  C CG   . PHE A 1 94  ? 1.479   -11.534 -4.163  1.00 0.00 ? 94  PHE A CG   2  
ATOM 3023  C CD1  . PHE A 1 94  ? 1.081   -11.197 -2.879  1.00 0.00 ? 94  PHE A CD1  2  
ATOM 3024  C CD2  . PHE A 1 94  ? 2.288   -12.645 -4.339  1.00 0.00 ? 94  PHE A CD2  2  
ATOM 3025  C CE1  . PHE A 1 94  ? 1.483   -11.951 -1.794  1.00 0.00 ? 94  PHE A CE1  2  
ATOM 3026  C CE2  . PHE A 1 94  ? 2.693   -13.404 -3.257  1.00 0.00 ? 94  PHE A CE2  2  
ATOM 3027  C CZ   . PHE A 1 94  ? 2.289   -13.057 -1.983  1.00 0.00 ? 94  PHE A CZ   2  
ATOM 3028  H H    . PHE A 1 94  ? 0.897   -8.533  -3.683  1.00 0.00 ? 94  PHE A H    2  
ATOM 3029  H HA   . PHE A 1 94  ? 2.774   -9.518  -5.729  1.00 0.00 ? 94  PHE A HA   2  
ATOM 3030  H HB2  . PHE A 1 94  ? -0.023  -10.549 -5.254  1.00 0.00 ? 94  PHE A HB2  2  
ATOM 3031  H HB3  . PHE A 1 94  ? 1.242   -11.279 -6.237  1.00 0.00 ? 94  PHE A HB3  2  
ATOM 3032  H HD1  . PHE A 1 94  ? 0.449   -10.333 -2.730  1.00 0.00 ? 94  PHE A HD1  2  
ATOM 3033  H HD2  . PHE A 1 94  ? 2.604   -12.918 -5.336  1.00 0.00 ? 94  PHE A HD2  2  
ATOM 3034  H HE1  . PHE A 1 94  ? 1.166   -11.678 -0.798  1.00 0.00 ? 94  PHE A HE1  2  
ATOM 3035  H HE2  . PHE A 1 94  ? 3.323   -14.268 -3.409  1.00 0.00 ? 94  PHE A HE2  2  
ATOM 3036  H HZ   . PHE A 1 94  ? 2.605   -13.648 -1.136  1.00 0.00 ? 94  PHE A HZ   2  
ATOM 3037  N N    . GLN A 1 95  ? 1.860   -7.958  -7.415  1.00 0.00 ? 95  GLN A N    2  
ATOM 3038  C CA   . GLN A 1 95  ? 1.333   -7.108  -8.476  1.00 0.00 ? 95  GLN A CA   2  
ATOM 3039  C C    . GLN A 1 95  ? 1.107   -7.910  -9.754  1.00 0.00 ? 95  GLN A C    2  
ATOM 3040  O O    . GLN A 1 95  ? 2.056   -8.250  -10.459 1.00 0.00 ? 95  GLN A O    2  
ATOM 3041  C CB   . GLN A 1 95  ? 2.291   -5.947  -8.751  1.00 0.00 ? 95  GLN A CB   2  
ATOM 3042  C CG   . GLN A 1 95  ? 2.036   -4.729  -7.879  1.00 0.00 ? 95  GLN A CG   2  
ATOM 3043  C CD   . GLN A 1 95  ? 2.559   -3.448  -8.498  1.00 0.00 ? 95  GLN A CD   2  
ATOM 3044  O OE1  . GLN A 1 95  ? 2.360   -3.192  -9.686  1.00 0.00 ? 95  GLN A OE1  2  
ATOM 3045  N NE2  . GLN A 1 95  ? 3.233   -2.634  -7.694  1.00 0.00 ? 95  GLN A NE2  2  
ATOM 3046  H H    . GLN A 1 95  ? 2.821   -8.142  -7.382  1.00 0.00 ? 95  GLN A H    2  
ATOM 3047  H HA   . GLN A 1 95  ? 0.387   -6.711  -8.143  1.00 0.00 ? 95  GLN A HA   2  
ATOM 3048  H HB2  . GLN A 1 95  ? 3.303   -6.282  -8.578  1.00 0.00 ? 95  GLN A HB2  2  
ATOM 3049  H HB3  . GLN A 1 95  ? 2.190   -5.650  -9.784  1.00 0.00 ? 95  GLN A HB3  2  
ATOM 3050  H HG2  . GLN A 1 95  ? 0.971   -4.627  -7.726  1.00 0.00 ? 95  GLN A HG2  2  
ATOM 3051  H HG3  . GLN A 1 95  ? 2.522   -4.876  -6.926  1.00 0.00 ? 95  GLN A HG3  2  
ATOM 3052  H HE21 . GLN A 1 95  ? 3.354   -2.903  -6.759  1.00 0.00 ? 95  GLN A HE21 2  
ATOM 3053  H HE22 . GLN A 1 95  ? 3.583   -1.799  -8.068  1.00 0.00 ? 95  GLN A HE22 2  
ATOM 3054  N N    . GLN A 1 96  ? -0.155  -8.207  -10.044 1.00 0.00 ? 96  GLN A N    2  
ATOM 3055  C CA   . GLN A 1 96  ? -0.505  -8.970  -11.237 1.00 0.00 ? 96  GLN A CA   2  
ATOM 3056  C C    . GLN A 1 96  ? -0.361  -8.114  -12.492 1.00 0.00 ? 96  GLN A C    2  
ATOM 3057  O O    . GLN A 1 96  ? -0.804  -6.967  -12.525 1.00 0.00 ? 96  GLN A O    2  
ATOM 3058  C CB   . GLN A 1 96  ? -1.935  -9.500  -11.128 1.00 0.00 ? 96  GLN A CB   2  
ATOM 3059  C CG   . GLN A 1 96  ? -2.251  -10.607 -12.120 1.00 0.00 ? 96  GLN A CG   2  
ATOM 3060  C CD   . GLN A 1 96  ? -1.555  -11.911 -11.781 1.00 0.00 ? 96  GLN A CD   2  
ATOM 3061  O OE1  . GLN A 1 96  ? -1.308  -12.210 -10.613 1.00 0.00 ? 96  GLN A OE1  2  
ATOM 3062  N NE2  . GLN A 1 96  ? -1.234  -12.694 -12.804 1.00 0.00 ? 96  GLN A NE2  2  
ATOM 3063  H H    . GLN A 1 96  ? -0.867  -7.907  -9.443  1.00 0.00 ? 96  GLN A H    2  
ATOM 3064  H HA   . GLN A 1 96  ? 0.175   -9.805  -11.307 1.00 0.00 ? 96  GLN A HA   2  
ATOM 3065  H HB2  . GLN A 1 96  ? -2.089  -9.884  -10.131 1.00 0.00 ? 96  GLN A HB2  2  
ATOM 3066  H HB3  . GLN A 1 96  ? -2.623  -8.685  -11.301 1.00 0.00 ? 96  GLN A HB3  2  
ATOM 3067  H HG2  . GLN A 1 96  ? -3.317  -10.778 -12.123 1.00 0.00 ? 96  GLN A HG2  2  
ATOM 3068  H HG3  . GLN A 1 96  ? -1.935  -10.292 -13.104 1.00 0.00 ? 96  GLN A HG3  2  
ATOM 3069  H HE21 . GLN A 1 96  ? -1.461  -12.390 -13.708 1.00 0.00 ? 96  GLN A HE21 2  
ATOM 3070  H HE22 . GLN A 1 96  ? -0.782  -13.542 -12.614 1.00 0.00 ? 96  GLN A HE22 2  
ATOM 3071  N N    . GLN A 1 97  ? 0.260   -8.681  -13.520 1.00 0.00 ? 97  GLN A N    2  
ATOM 3072  C CA   . GLN A 1 97  ? 0.463   -7.969  -14.777 1.00 0.00 ? 97  GLN A CA   2  
ATOM 3073  C C    . GLN A 1 97  ? -0.871  -7.553  -15.388 1.00 0.00 ? 97  GLN A C    2  
ATOM 3074  O O    . GLN A 1 97  ? -1.642  -8.393  -15.854 1.00 0.00 ? 97  GLN A O    2  
ATOM 3075  C CB   . GLN A 1 97  ? 1.238   -8.844  -15.764 1.00 0.00 ? 97  GLN A CB   2  
ATOM 3076  C CG   . GLN A 1 97  ? 2.706   -9.010  -15.406 1.00 0.00 ? 97  GLN A CG   2  
ATOM 3077  C CD   . GLN A 1 97  ? 3.494   -9.723  -16.487 1.00 0.00 ? 97  GLN A CD   2  
ATOM 3078  O OE1  . GLN A 1 97  ? 3.238   -10.889 -16.790 1.00 0.00 ? 97  GLN A OE1  2  
ATOM 3079  N NE2  . GLN A 1 97  ? 4.458   -9.025  -17.076 1.00 0.00 ? 97  GLN A NE2  2  
ATOM 3080  H H    . GLN A 1 97  ? 0.591   -9.599  -13.433 1.00 0.00 ? 97  GLN A H    2  
ATOM 3081  H HA   . GLN A 1 97  ? 1.040   -7.082  -14.565 1.00 0.00 ? 97  GLN A HA   2  
ATOM 3082  H HB2  . GLN A 1 97  ? 0.784   -9.823  -15.793 1.00 0.00 ? 97  GLN A HB2  2  
ATOM 3083  H HB3  . GLN A 1 97  ? 1.178   -8.398  -16.745 1.00 0.00 ? 97  GLN A HB3  2  
ATOM 3084  H HG2  . GLN A 1 97  ? 3.139   -8.032  -15.253 1.00 0.00 ? 97  GLN A HG2  2  
ATOM 3085  H HG3  . GLN A 1 97  ? 2.778   -9.581  -14.492 1.00 0.00 ? 97  GLN A HG3  2  
ATOM 3086  H HE21 . GLN A 1 97  ? 4.606   -8.101  -16.782 1.00 0.00 ? 97  GLN A HE21 2  
ATOM 3087  H HE22 . GLN A 1 97  ? 4.983   -9.462  -17.777 1.00 0.00 ? 97  GLN A HE22 2  
ATOM 3088  N N    . THR A 1 98  ? -1.139  -6.251  -15.382 1.00 0.00 ? 98  THR A N    2  
ATOM 3089  C CA   . THR A 1 98  ? -2.380  -5.723  -15.933 1.00 0.00 ? 98  THR A CA   2  
ATOM 3090  C C    . THR A 1 98  ? -2.472  -5.988  -17.432 1.00 0.00 ? 98  THR A C    2  
ATOM 3091  O O    . THR A 1 98  ? -1.462  -6.226  -18.093 1.00 0.00 ? 98  THR A O    2  
ATOM 3092  C CB   . THR A 1 98  ? -2.507  -4.209  -15.682 1.00 0.00 ? 98  THR A CB   2  
ATOM 3093  O OG1  . THR A 1 98  ? -3.821  -3.762  -16.037 1.00 0.00 ? 98  THR A OG1  2  
ATOM 3094  C CG2  . THR A 1 98  ? -1.470  -3.438  -16.485 1.00 0.00 ? 98  THR A CG2  2  
ATOM 3095  H H    . THR A 1 98  ? -0.485  -5.632  -14.996 1.00 0.00 ? 98  THR A H    2  
ATOM 3096  H HA   . THR A 1 98  ? -3.203  -6.219  -15.439 1.00 0.00 ? 98  THR A HA   2  
ATOM 3097  H HB   . THR A 1 98  ? -2.342  -4.018  -14.631 1.00 0.00 ? 98  THR A HB   2  
ATOM 3098  H HG1  . THR A 1 98  ? -3.777  -2.854  -16.347 1.00 0.00 ? 98  THR A HG1  2  
ATOM 3099  H HG21 . THR A 1 98  ? -0.540  -3.409  -15.938 1.00 0.00 ? 98  THR A HG21 2  
ATOM 3100  H HG22 . THR A 1 98  ? -1.821  -2.430  -16.653 1.00 0.00 ? 98  THR A HG22 2  
ATOM 3101  H HG23 . THR A 1 98  ? -1.314  -3.928  -17.434 1.00 0.00 ? 98  THR A HG23 2  
ATOM 3102  N N    . SER A 1 99  ? -3.690  -5.944  -17.962 1.00 0.00 ? 99  SER A N    2  
ATOM 3103  C CA   . SER A 1 99  ? -3.914  -6.182  -19.383 1.00 0.00 ? 99  SER A CA   2  
ATOM 3104  C C    . SER A 1 99  ? -4.440  -4.925  -20.069 1.00 0.00 ? 99  SER A C    2  
ATOM 3105  O O    . SER A 1 99  ? -5.264  -4.200  -19.513 1.00 0.00 ? 99  SER A O    2  
ATOM 3106  C CB   . SER A 1 99  ? -4.902  -7.334  -19.579 1.00 0.00 ? 99  SER A CB   2  
ATOM 3107  O OG   . SER A 1 99  ? -6.215  -6.948  -19.213 1.00 0.00 ? 99  SER A OG   2  
ATOM 3108  H H    . SER A 1 99  ? -4.457  -5.749  -17.383 1.00 0.00 ? 99  SER A H    2  
ATOM 3109  H HA   . SER A 1 99  ? -2.968  -6.452  -19.827 1.00 0.00 ? 99  SER A HA   2  
ATOM 3110  H HB2  . SER A 1 99  ? -4.904  -7.631  -20.617 1.00 0.00 ? 99  SER A HB2  2  
ATOM 3111  H HB3  . SER A 1 99  ? -4.601  -8.171  -18.966 1.00 0.00 ? 99  SER A HB3  2  
ATOM 3112  H HG   . SER A 1 99  ? -6.655  -7.682  -18.777 1.00 0.00 ? 99  SER A HG   2  
ATOM 3113  N N    . GLY A 1 100 ? -3.955  -4.673  -21.281 1.00 0.00 ? 100 GLY A N    2  
ATOM 3114  C CA   . GLY A 1 100 ? -4.386  -3.503  -22.023 1.00 0.00 ? 100 GLY A CA   2  
ATOM 3115  C C    . GLY A 1 100 ? -3.246  -2.544  -22.308 1.00 0.00 ? 100 GLY A C    2  
ATOM 3116  O O    . GLY A 1 100 ? -2.144  -2.683  -21.779 1.00 0.00 ? 100 GLY A O    2  
ATOM 3117  H H    . GLY A 1 100 ? -3.299  -5.286  -21.674 1.00 0.00 ? 100 GLY A H    2  
ATOM 3118  H HA2  . GLY A 1 100 ? -4.816  -3.823  -22.961 1.00 0.00 ? 100 GLY A HA2  2  
ATOM 3119  H HA3  . GLY A 1 100 ? -5.141  -2.985  -21.450 1.00 0.00 ? 100 GLY A HA3  2  
ATOM 3120  N N    . PRO A 1 101 ? -3.508  -1.546  -23.165 1.00 0.00 ? 101 PRO A N    2  
ATOM 3121  C CA   . PRO A 1 101 ? -2.507  -0.543  -23.540 1.00 0.00 ? 101 PRO A CA   2  
ATOM 3122  C C    . PRO A 1 101 ? -2.174  0.401   -22.390 1.00 0.00 ? 101 PRO A C    2  
ATOM 3123  O O    . PRO A 1 101 ? -3.063  0.858   -21.671 1.00 0.00 ? 101 PRO A O    2  
ATOM 3124  C CB   . PRO A 1 101 ? -3.182  0.223   -24.681 1.00 0.00 ? 101 PRO A CB   2  
ATOM 3125  C CG   . PRO A 1 101 ? -4.643  0.045   -24.444 1.00 0.00 ? 101 PRO A CG   2  
ATOM 3126  C CD   . PRO A 1 101 ? -4.800  -1.320  -23.834 1.00 0.00 ? 101 PRO A CD   2  
ATOM 3127  H HA   . PRO A 1 101 ? -1.599  -1.003  -23.901 1.00 0.00 ? 101 PRO A HA   2  
ATOM 3128  H HB2  . PRO A 1 101 ? -2.898  1.265   -24.637 1.00 0.00 ? 101 PRO A HB2  2  
ATOM 3129  H HB3  . PRO A 1 101 ? -2.883  -0.198  -25.629 1.00 0.00 ? 101 PRO A HB3  2  
ATOM 3130  H HG2  . PRO A 1 101 ? -4.999  0.803   -23.764 1.00 0.00 ? 101 PRO A HG2  2  
ATOM 3131  H HG3  . PRO A 1 101 ? -5.175  0.100   -25.382 1.00 0.00 ? 101 PRO A HG3  2  
ATOM 3132  H HD2  . PRO A 1 101 ? -5.610  -1.323  -23.120 1.00 0.00 ? 101 PRO A HD2  2  
ATOM 3133  H HD3  . PRO A 1 101 ? -4.970  -2.060  -24.603 1.00 0.00 ? 101 PRO A HD3  2  
ATOM 3134  N N    . SER A 1 102 ? -0.887  0.690   -22.222 1.00 0.00 ? 102 SER A N    2  
ATOM 3135  C CA   . SER A 1 102 ? -0.436  1.578   -21.156 1.00 0.00 ? 102 SER A CA   2  
ATOM 3136  C C    . SER A 1 102 ? 1.041   1.919   -21.323 1.00 0.00 ? 102 SER A C    2  
ATOM 3137  O O    . SER A 1 102 ? 1.708   1.418   -22.228 1.00 0.00 ? 102 SER A O    2  
ATOM 3138  C CB   . SER A 1 102 ? -0.670  0.929   -19.790 1.00 0.00 ? 102 SER A CB   2  
ATOM 3139  O OG   . SER A 1 102 ? 0.043   -0.290  -19.676 1.00 0.00 ? 102 SER A OG   2  
ATOM 3140  H H    . SER A 1 102 ? -0.225  0.295   -22.827 1.00 0.00 ? 102 SER A H    2  
ATOM 3141  H HA   . SER A 1 102 ? -1.013  2.488   -21.216 1.00 0.00 ? 102 SER A HA   2  
ATOM 3142  H HB2  . SER A 1 102 ? -0.337  1.601   -19.014 1.00 0.00 ? 102 SER A HB2  2  
ATOM 3143  H HB3  . SER A 1 102 ? -1.725  0.729   -19.666 1.00 0.00 ? 102 SER A HB3  2  
ATOM 3144  H HG   . SER A 1 102 ? 0.255   -0.620  -20.552 1.00 0.00 ? 102 SER A HG   2  
ATOM 3145  N N    . SER A 1 103 ? 1.547   2.777   -20.442 1.00 0.00 ? 103 SER A N    2  
ATOM 3146  C CA   . SER A 1 103 ? 2.944   3.190   -20.493 1.00 0.00 ? 103 SER A CA   2  
ATOM 3147  C C    . SER A 1 103 ? 3.675   2.792   -19.214 1.00 0.00 ? 103 SER A C    2  
ATOM 3148  O O    . SER A 1 103 ? 4.627   2.013   -19.246 1.00 0.00 ? 103 SER A O    2  
ATOM 3149  C CB   . SER A 1 103 ? 3.044   4.703   -20.701 1.00 0.00 ? 103 SER A CB   2  
ATOM 3150  O OG   . SER A 1 103 ? 2.811   5.047   -22.056 1.00 0.00 ? 103 SER A OG   2  
ATOM 3151  H H    . SER A 1 103 ? 0.965   3.143   -19.743 1.00 0.00 ? 103 SER A H    2  
ATOM 3152  H HA   . SER A 1 103 ? 3.408   2.689   -21.329 1.00 0.00 ? 103 SER A HA   2  
ATOM 3153  H HB2  . SER A 1 103 ? 2.309   5.197   -20.085 1.00 0.00 ? 103 SER A HB2  2  
ATOM 3154  H HB3  . SER A 1 103 ? 4.033   5.037   -20.422 1.00 0.00 ? 103 SER A HB3  2  
ATOM 3155  H HG   . SER A 1 103 ? 2.252   5.827   -22.096 1.00 0.00 ? 103 SER A HG   2  
ATOM 3156  N N    . GLY A 1 104 ? 3.222   3.335   -18.088 1.00 0.00 ? 104 GLY A N    2  
ATOM 3157  C CA   . GLY A 1 104 ? 3.844   3.026   -16.813 1.00 0.00 ? 104 GLY A CA   2  
ATOM 3158  C C    . GLY A 1 104 ? 4.111   4.265   -15.983 1.00 0.00 ? 104 GLY A C    2  
ATOM 3159  O O    . GLY A 1 104 ? 4.347   5.345   -16.525 1.00 0.00 ? 104 GLY A O    2  
ATOM 3160  H H    . GLY A 1 104 ? 2.460   3.950   -18.123 1.00 0.00 ? 104 GLY A H    2  
ATOM 3161  H HA2  . GLY A 1 104 ? 3.193   2.366   -16.258 1.00 0.00 ? 104 GLY A HA2  2  
ATOM 3162  H HA3  . GLY A 1 104 ? 4.781   2.521   -16.996 1.00 0.00 ? 104 GLY A HA3  2  
ATOM 3163  N N    . GLY A 1 1   ? 42.763  -5.977  -11.698 1.00 0.00 ? 1   GLY A N    3  
ATOM 3164  C CA   . GLY A 1 1   ? 42.214  -6.768  -12.784 1.00 0.00 ? 1   GLY A CA   3  
ATOM 3165  C C    . GLY A 1 1   ? 41.026  -6.099  -13.446 1.00 0.00 ? 1   GLY A C    3  
ATOM 3166  O O    . GLY A 1 1   ? 39.884  -6.295  -13.032 1.00 0.00 ? 1   GLY A O    3  
ATOM 3167  H H1   . GLY A 1 1   ? 42.383  -6.053  -10.798 1.00 0.00 ? 1   GLY A H1   3  
ATOM 3168  H HA2  . GLY A 1 1   ? 42.984  -6.927  -13.524 1.00 0.00 ? 1   GLY A HA2  3  
ATOM 3169  H HA3  . GLY A 1 1   ? 41.901  -7.726  -12.393 1.00 0.00 ? 1   GLY A HA3  3  
ATOM 3170  N N    . SER A 1 2   ? 41.296  -5.305  -14.477 1.00 0.00 ? 2   SER A N    3  
ATOM 3171  C CA   . SER A 1 2   ? 40.240  -4.600  -15.195 1.00 0.00 ? 2   SER A CA   3  
ATOM 3172  C C    . SER A 1 2   ? 39.173  -5.573  -15.686 1.00 0.00 ? 2   SER A C    3  
ATOM 3173  O O    . SER A 1 2   ? 37.977  -5.340  -15.513 1.00 0.00 ? 2   SER A O    3  
ATOM 3174  C CB   . SER A 1 2   ? 40.827  -3.829  -16.379 1.00 0.00 ? 2   SER A CB   3  
ATOM 3175  O OG   . SER A 1 2   ? 39.816  -3.128  -17.083 1.00 0.00 ? 2   SER A OG   3  
ATOM 3176  H H    . SER A 1 2   ? 42.227  -5.189  -14.760 1.00 0.00 ? 2   SER A H    3  
ATOM 3177  H HA   . SER A 1 2   ? 39.785  -3.900  -14.511 1.00 0.00 ? 2   SER A HA   3  
ATOM 3178  H HB2  . SER A 1 2   ? 41.555  -3.118  -16.018 1.00 0.00 ? 2   SER A HB2  3  
ATOM 3179  H HB3  . SER A 1 2   ? 41.306  -4.522  -17.055 1.00 0.00 ? 2   SER A HB3  3  
ATOM 3180  H HG   . SER A 1 2   ? 38.970  -3.561  -16.944 1.00 0.00 ? 2   SER A HG   3  
ATOM 3181  N N    . SER A 1 3   ? 39.616  -6.666  -16.301 1.00 0.00 ? 3   SER A N    3  
ATOM 3182  C CA   . SER A 1 3   ? 38.700  -7.674  -16.822 1.00 0.00 ? 3   SER A CA   3  
ATOM 3183  C C    . SER A 1 3   ? 37.757  -8.167  -15.729 1.00 0.00 ? 3   SER A C    3  
ATOM 3184  O O    . SER A 1 3   ? 38.180  -8.452  -14.609 1.00 0.00 ? 3   SER A O    3  
ATOM 3185  C CB   . SER A 1 3   ? 39.483  -8.852  -17.405 1.00 0.00 ? 3   SER A CB   3  
ATOM 3186  O OG   . SER A 1 3   ? 40.095  -9.615  -16.380 1.00 0.00 ? 3   SER A OG   3  
ATOM 3187  H H    . SER A 1 3   ? 40.581  -6.795  -16.409 1.00 0.00 ? 3   SER A H    3  
ATOM 3188  H HA   . SER A 1 3   ? 38.115  -7.217  -17.606 1.00 0.00 ? 3   SER A HA   3  
ATOM 3189  H HB2  . SER A 1 3   ? 38.810  -9.489  -17.959 1.00 0.00 ? 3   SER A HB2  3  
ATOM 3190  H HB3  . SER A 1 3   ? 40.251  -8.477  -18.067 1.00 0.00 ? 3   SER A HB3  3  
ATOM 3191  H HG   . SER A 1 3   ? 41.021  -9.373  -16.310 1.00 0.00 ? 3   SER A HG   3  
ATOM 3192  N N    . GLY A 1 4   ? 36.473  -8.265  -16.063 1.00 0.00 ? 4   GLY A N    3  
ATOM 3193  C CA   . GLY A 1 4   ? 35.489  -8.724  -15.100 1.00 0.00 ? 4   GLY A CA   3  
ATOM 3194  C C    . GLY A 1 4   ? 34.067  -8.518  -15.582 1.00 0.00 ? 4   GLY A C    3  
ATOM 3195  O O    . GLY A 1 4   ? 33.816  -7.700  -16.467 1.00 0.00 ? 4   GLY A O    3  
ATOM 3196  H H    . GLY A 1 4   ? 36.193  -8.024  -16.971 1.00 0.00 ? 4   GLY A H    3  
ATOM 3197  H HA2  . GLY A 1 4   ? 35.646  -9.776  -14.914 1.00 0.00 ? 4   GLY A HA2  3  
ATOM 3198  H HA3  . GLY A 1 4   ? 35.626  -8.180  -14.176 1.00 0.00 ? 4   GLY A HA3  3  
ATOM 3199  N N    . SER A 1 5   ? 33.132  -9.263  -15.000 1.00 0.00 ? 5   SER A N    3  
ATOM 3200  C CA   . SER A 1 5   ? 31.728  -9.162  -15.379 1.00 0.00 ? 5   SER A CA   3  
ATOM 3201  C C    . SER A 1 5   ? 30.822  -9.582  -14.226 1.00 0.00 ? 5   SER A C    3  
ATOM 3202  O O    . SER A 1 5   ? 30.706  -10.767 -13.913 1.00 0.00 ? 5   SER A O    3  
ATOM 3203  C CB   . SER A 1 5   ? 31.446  -10.030 -16.607 1.00 0.00 ? 5   SER A CB   3  
ATOM 3204  O OG   . SER A 1 5   ? 30.202  -9.693  -17.195 1.00 0.00 ? 5   SER A OG   3  
ATOM 3205  H H    . SER A 1 5   ? 33.395  -9.897  -14.300 1.00 0.00 ? 5   SER A H    3  
ATOM 3206  H HA   . SER A 1 5   ? 31.524  -8.130  -15.624 1.00 0.00 ? 5   SER A HA   3  
ATOM 3207  H HB2  . SER A 1 5   ? 32.227  -9.882  -17.337 1.00 0.00 ? 5   SER A HB2  3  
ATOM 3208  H HB3  . SER A 1 5   ? 31.422  -11.069 -16.312 1.00 0.00 ? 5   SER A HB3  3  
ATOM 3209  H HG   . SER A 1 5   ? 29.709  -10.495 -17.385 1.00 0.00 ? 5   SER A HG   3  
ATOM 3210  N N    . SER A 1 6   ? 30.182  -8.602  -13.597 1.00 0.00 ? 6   SER A N    3  
ATOM 3211  C CA   . SER A 1 6   ? 29.289  -8.868  -12.476 1.00 0.00 ? 6   SER A CA   3  
ATOM 3212  C C    . SER A 1 6   ? 27.925  -8.223  -12.703 1.00 0.00 ? 6   SER A C    3  
ATOM 3213  O O    . SER A 1 6   ? 27.762  -7.384  -13.587 1.00 0.00 ? 6   SER A O    3  
ATOM 3214  C CB   . SER A 1 6   ? 29.901  -8.347  -11.174 1.00 0.00 ? 6   SER A CB   3  
ATOM 3215  O OG   . SER A 1 6   ? 29.121  -8.729  -10.055 1.00 0.00 ? 6   SER A OG   3  
ATOM 3216  H H    . SER A 1 6   ? 30.316  -7.677  -13.894 1.00 0.00 ? 6   SER A H    3  
ATOM 3217  H HA   . SER A 1 6   ? 29.161  -9.937  -12.401 1.00 0.00 ? 6   SER A HA   3  
ATOM 3218  H HB2  . SER A 1 6   ? 30.895  -8.753  -11.059 1.00 0.00 ? 6   SER A HB2  3  
ATOM 3219  H HB3  . SER A 1 6   ? 29.954  -7.269  -11.211 1.00 0.00 ? 6   SER A HB3  3  
ATOM 3220  H HG   . SER A 1 6   ? 29.691  -9.103  -9.379  1.00 0.00 ? 6   SER A HG   3  
ATOM 3221  N N    . GLY A 1 7   ? 26.946  -8.624  -11.896 1.00 0.00 ? 7   GLY A N    3  
ATOM 3222  C CA   . GLY A 1 7   ? 25.609  -8.076  -12.024 1.00 0.00 ? 7   GLY A CA   3  
ATOM 3223  C C    . GLY A 1 7   ? 25.598  -6.560  -12.006 1.00 0.00 ? 7   GLY A C    3  
ATOM 3224  O O    . GLY A 1 7   ? 26.178  -5.940  -11.116 1.00 0.00 ? 7   GLY A O    3  
ATOM 3225  H H    . GLY A 1 7   ? 27.134  -9.297  -11.209 1.00 0.00 ? 7   GLY A H    3  
ATOM 3226  H HA2  . GLY A 1 7   ? 25.179  -8.418  -12.954 1.00 0.00 ? 7   GLY A HA2  3  
ATOM 3227  H HA3  . GLY A 1 7   ? 25.004  -8.438  -11.205 1.00 0.00 ? 7   GLY A HA3  3  
ATOM 3228  N N    . MET A 1 8   ? 24.939  -5.963  -12.994 1.00 0.00 ? 8   MET A N    3  
ATOM 3229  C CA   . MET A 1 8   ? 24.857  -4.510  -13.087 1.00 0.00 ? 8   MET A CA   3  
ATOM 3230  C C    . MET A 1 8   ? 23.405  -4.053  -13.190 1.00 0.00 ? 8   MET A C    3  
ATOM 3231  O O    . MET A 1 8   ? 22.604  -4.656  -13.904 1.00 0.00 ? 8   MET A O    3  
ATOM 3232  C CB   . MET A 1 8   ? 25.647  -4.010  -14.298 1.00 0.00 ? 8   MET A CB   3  
ATOM 3233  C CG   . MET A 1 8   ? 25.220  -4.650  -15.609 1.00 0.00 ? 8   MET A CG   3  
ATOM 3234  S SD   . MET A 1 8   ? 25.988  -6.259  -15.880 1.00 0.00 ? 8   MET A SD   3  
ATOM 3235  C CE   . MET A 1 8   ? 26.742  -6.008  -17.486 1.00 0.00 ? 8   MET A CE   3  
ATOM 3236  H H    . MET A 1 8   ? 24.496  -6.512  -13.675 1.00 0.00 ? 8   MET A H    3  
ATOM 3237  H HA   . MET A 1 8   ? 25.290  -4.095  -12.190 1.00 0.00 ? 8   MET A HA   3  
ATOM 3238  H HB2  . MET A 1 8   ? 25.515  -2.942  -14.384 1.00 0.00 ? 8   MET A HB2  3  
ATOM 3239  H HB3  . MET A 1 8   ? 26.694  -4.224  -14.143 1.00 0.00 ? 8   MET A HB3  3  
ATOM 3240  H HG2  . MET A 1 8   ? 24.148  -4.777  -15.600 1.00 0.00 ? 8   MET A HG2  3  
ATOM 3241  H HG3  . MET A 1 8   ? 25.496  -3.993  -16.421 1.00 0.00 ? 8   MET A HG3  3  
ATOM 3242  H HE1  . MET A 1 8   ? 26.073  -6.362  -18.256 1.00 0.00 ? 8   MET A HE1  3  
ATOM 3243  H HE2  . MET A 1 8   ? 26.934  -4.955  -17.632 1.00 0.00 ? 8   MET A HE2  3  
ATOM 3244  H HE3  . MET A 1 8   ? 27.672  -6.555  -17.536 1.00 0.00 ? 8   MET A HE3  3  
ATOM 3245  N N    . ALA A 1 9   ? 23.073  -2.986  -12.471 1.00 0.00 ? 9   ALA A N    3  
ATOM 3246  C CA   . ALA A 1 9   ? 21.718  -2.448  -12.483 1.00 0.00 ? 9   ALA A CA   3  
ATOM 3247  C C    . ALA A 1 9   ? 21.652  -1.110  -11.754 1.00 0.00 ? 9   ALA A C    3  
ATOM 3248  O O    . ALA A 1 9   ? 22.018  -1.012  -10.583 1.00 0.00 ? 9   ALA A O    3  
ATOM 3249  C CB   . ALA A 1 9   ? 20.751  -3.441  -11.857 1.00 0.00 ? 9   ALA A CB   3  
ATOM 3250  H H    . ALA A 1 9   ? 23.756  -2.549  -11.921 1.00 0.00 ? 9   ALA A H    3  
ATOM 3251  H HA   . ALA A 1 9   ? 21.427  -2.300  -13.513 1.00 0.00 ? 9   ALA A HA   3  
ATOM 3252  H HB1  . ALA A 1 9   ? 20.353  -3.027  -10.941 1.00 0.00 ? 9   ALA A HB1  3  
ATOM 3253  H HB2  . ALA A 1 9   ? 19.942  -3.638  -12.544 1.00 0.00 ? 9   ALA A HB2  3  
ATOM 3254  H HB3  . ALA A 1 9   ? 21.271  -4.362  -11.639 1.00 0.00 ? 9   ALA A HB3  3  
ATOM 3255  N N    . ASP A 1 10  ? 21.185  -0.083  -12.454 1.00 0.00 ? 10  ASP A N    3  
ATOM 3256  C CA   . ASP A 1 10  ? 21.071  1.250   -11.873 1.00 0.00 ? 10  ASP A CA   3  
ATOM 3257  C C    . ASP A 1 10  ? 19.628  1.742   -11.922 1.00 0.00 ? 10  ASP A C    3  
ATOM 3258  O O    . ASP A 1 10  ? 19.234  2.448   -12.850 1.00 0.00 ? 10  ASP A O    3  
ATOM 3259  C CB   . ASP A 1 10  ? 21.983  2.231   -12.611 1.00 0.00 ? 10  ASP A CB   3  
ATOM 3260  C CG   . ASP A 1 10  ? 23.407  2.200   -12.092 1.00 0.00 ? 10  ASP A CG   3  
ATOM 3261  O OD1  . ASP A 1 10  ? 23.666  2.812   -11.035 1.00 0.00 ? 10  ASP A OD1  3  
ATOM 3262  O OD2  . ASP A 1 10  ? 24.262  1.565   -12.743 1.00 0.00 ? 10  ASP A OD2  3  
ATOM 3263  H H    . ASP A 1 10  ? 20.909  -0.224  -13.384 1.00 0.00 ? 10  ASP A H    3  
ATOM 3264  H HA   . ASP A 1 10  ? 21.382  1.190   -10.841 1.00 0.00 ? 10  ASP A HA   3  
ATOM 3265  H HB2  . ASP A 1 10  ? 21.997  1.979   -13.662 1.00 0.00 ? 10  ASP A HB2  3  
ATOM 3266  H HB3  . ASP A 1 10  ? 21.596  3.232   -12.490 1.00 0.00 ? 10  ASP A HB3  3  
ATOM 3267  N N    . GLU A 1 11  ? 18.844  1.364   -10.917 1.00 0.00 ? 11  GLU A N    3  
ATOM 3268  C CA   . GLU A 1 11  ? 17.444  1.766   -10.847 1.00 0.00 ? 11  GLU A CA   3  
ATOM 3269  C C    . GLU A 1 11  ? 17.252  2.894   -9.838  1.00 0.00 ? 11  GLU A C    3  
ATOM 3270  O O    . GLU A 1 11  ? 16.372  2.832   -8.979  1.00 0.00 ? 11  GLU A O    3  
ATOM 3271  C CB   . GLU A 1 11  ? 16.566  0.572   -10.468 1.00 0.00 ? 11  GLU A CB   3  
ATOM 3272  C CG   . GLU A 1 11  ? 16.366  -0.421  -11.600 1.00 0.00 ? 11  GLU A CG   3  
ATOM 3273  C CD   . GLU A 1 11  ? 17.645  -0.695  -12.368 1.00 0.00 ? 11  GLU A CD   3  
ATOM 3274  O OE1  . GLU A 1 11  ? 18.524  -1.396  -11.825 1.00 0.00 ? 11  GLU A OE1  3  
ATOM 3275  O OE2  . GLU A 1 11  ? 17.766  -0.208  -13.512 1.00 0.00 ? 11  GLU A OE2  3  
ATOM 3276  H H    . GLU A 1 11  ? 19.216  0.801   -10.206 1.00 0.00 ? 11  GLU A H    3  
ATOM 3277  H HA   . GLU A 1 11  ? 17.152  2.120   -11.824 1.00 0.00 ? 11  GLU A HA   3  
ATOM 3278  H HB2  . GLU A 1 11  ? 17.023  0.054   -9.637  1.00 0.00 ? 11  GLU A HB2  3  
ATOM 3279  H HB3  . GLU A 1 11  ? 15.596  0.937   -10.162 1.00 0.00 ? 11  GLU A HB3  3  
ATOM 3280  H HG2  . GLU A 1 11  ? 16.007  -1.351  -11.187 1.00 0.00 ? 11  GLU A HG2  3  
ATOM 3281  H HG3  . GLU A 1 11  ? 15.630  -0.024  -12.284 1.00 0.00 ? 11  GLU A HG3  3  
ATOM 3282  N N    . LYS A 1 12  ? 18.082  3.926   -9.947  1.00 0.00 ? 12  LYS A N    3  
ATOM 3283  C CA   . LYS A 1 12  ? 18.005  5.070   -9.046  1.00 0.00 ? 12  LYS A CA   3  
ATOM 3284  C C    . LYS A 1 12  ? 17.588  4.632   -7.646  1.00 0.00 ? 12  LYS A C    3  
ATOM 3285  O O    . LYS A 1 12  ? 16.627  5.142   -7.070  1.00 0.00 ? 12  LYS A O    3  
ATOM 3286  C CB   . LYS A 1 12  ? 17.013  6.104   -9.585  1.00 0.00 ? 12  LYS A CB   3  
ATOM 3287  C CG   . LYS A 1 12  ? 15.604  5.563   -9.756  1.00 0.00 ? 12  LYS A CG   3  
ATOM 3288  C CD   . LYS A 1 12  ? 14.565  6.664   -9.624  1.00 0.00 ? 12  LYS A CD   3  
ATOM 3289  C CE   . LYS A 1 12  ? 14.509  7.530   -10.873 1.00 0.00 ? 12  LYS A CE   3  
ATOM 3290  N NZ   . LYS A 1 12  ? 13.462  8.585   -10.771 1.00 0.00 ? 12  LYS A NZ   3  
ATOM 3291  H H    . LYS A 1 12  ? 18.763  3.918   -10.653 1.00 0.00 ? 12  LYS A H    3  
ATOM 3292  H HA   . LYS A 1 12  ? 18.985  5.518   -8.994  1.00 0.00 ? 12  LYS A HA   3  
ATOM 3293  H HB2  . LYS A 1 12  ? 16.976  6.939   -8.901  1.00 0.00 ? 12  LYS A HB2  3  
ATOM 3294  H HB3  . LYS A 1 12  ? 17.362  6.452   -10.547 1.00 0.00 ? 12  LYS A HB3  3  
ATOM 3295  H HG2  . LYS A 1 12  ? 15.516  5.115   -10.734 1.00 0.00 ? 12  LYS A HG2  3  
ATOM 3296  H HG3  . LYS A 1 12  ? 15.421  4.815   -8.997  1.00 0.00 ? 12  LYS A HG3  3  
ATOM 3297  H HD2  . LYS A 1 12  ? 13.595  6.215   -9.467  1.00 0.00 ? 12  LYS A HD2  3  
ATOM 3298  H HD3  . LYS A 1 12  ? 14.817  7.286   -8.776  1.00 0.00 ? 12  LYS A HD3  3  
ATOM 3299  H HE2  . LYS A 1 12  ? 15.470  8.001   -11.012 1.00 0.00 ? 12  LYS A HE2  3  
ATOM 3300  H HE3  . LYS A 1 12  ? 14.291  6.900   -11.723 1.00 0.00 ? 12  LYS A HE3  3  
ATOM 3301  H HZ1  . LYS A 1 12  ? 13.890  9.525   -10.892 1.00 0.00 ? 12  LYS A HZ1  3  
ATOM 3302  H HZ2  . LYS A 1 12  ? 13.003  8.543   -9.839  1.00 0.00 ? 12  LYS A HZ2  3  
ATOM 3303  H HZ3  . LYS A 1 12  ? 12.742  8.446   -11.507 1.00 0.00 ? 12  LYS A HZ3  3  
ATOM 3304  N N    . PRO A 1 13  ? 18.328  3.665   -7.082  1.00 0.00 ? 13  PRO A N    3  
ATOM 3305  C CA   . PRO A 1 13  ? 18.055  3.139   -5.742  1.00 0.00 ? 13  PRO A CA   3  
ATOM 3306  C C    . PRO A 1 13  ? 18.369  4.153   -4.646  1.00 0.00 ? 13  PRO A C    3  
ATOM 3307  O O    . PRO A 1 13  ? 18.203  3.871   -3.459  1.00 0.00 ? 13  PRO A O    3  
ATOM 3308  C CB   . PRO A 1 13  ? 18.990  1.932   -5.637  1.00 0.00 ? 13  PRO A CB   3  
ATOM 3309  C CG   . PRO A 1 13  ? 20.103  2.232   -6.582  1.00 0.00 ? 13  PRO A CG   3  
ATOM 3310  C CD   . PRO A 1 13  ? 19.488  3.011   -7.711  1.00 0.00 ? 13  PRO A CD   3  
ATOM 3311  H HA   . PRO A 1 13  ? 17.030  2.812   -5.645  1.00 0.00 ? 13  PRO A HA   3  
ATOM 3312  H HB2  . PRO A 1 13  ? 19.348  1.838   -4.621  1.00 0.00 ? 13  PRO A HB2  3  
ATOM 3313  H HB3  . PRO A 1 13  ? 18.461  1.036   -5.923  1.00 0.00 ? 13  PRO A HB3  3  
ATOM 3314  H HG2  . PRO A 1 13  ? 20.857  2.822   -6.085  1.00 0.00 ? 13  PRO A HG2  3  
ATOM 3315  H HG3  . PRO A 1 13  ? 20.528  1.310   -6.951  1.00 0.00 ? 13  PRO A HG3  3  
ATOM 3316  H HD2  . PRO A 1 13  ? 20.186  3.744   -8.088  1.00 0.00 ? 13  PRO A HD2  3  
ATOM 3317  H HD3  . PRO A 1 13  ? 19.173  2.346   -8.502  1.00 0.00 ? 13  PRO A HD3  3  
ATOM 3318  N N    . LYS A 1 14  ? 18.823  5.334   -5.052  1.00 0.00 ? 14  LYS A N    3  
ATOM 3319  C CA   . LYS A 1 14  ? 19.158  6.391   -4.106  1.00 0.00 ? 14  LYS A CA   3  
ATOM 3320  C C    . LYS A 1 14  ? 17.898  6.999   -3.499  1.00 0.00 ? 14  LYS A C    3  
ATOM 3321  O O    . LYS A 1 14  ? 17.300  7.910   -4.072  1.00 0.00 ? 14  LYS A O    3  
ATOM 3322  C CB   . LYS A 1 14  ? 19.981  7.481   -4.798  1.00 0.00 ? 14  LYS A CB   3  
ATOM 3323  C CG   . LYS A 1 14  ? 21.428  7.088   -5.041  1.00 0.00 ? 14  LYS A CG   3  
ATOM 3324  C CD   . LYS A 1 14  ? 22.312  8.309   -5.232  1.00 0.00 ? 14  LYS A CD   3  
ATOM 3325  C CE   . LYS A 1 14  ? 23.770  7.993   -4.938  1.00 0.00 ? 14  LYS A CE   3  
ATOM 3326  N NZ   . LYS A 1 14  ? 24.027  7.869   -3.476  1.00 0.00 ? 14  LYS A NZ   3  
ATOM 3327  H H    . LYS A 1 14  ? 18.934  5.499   -6.012  1.00 0.00 ? 14  LYS A H    3  
ATOM 3328  H HA   . LYS A 1 14  ? 19.749  5.954   -3.315  1.00 0.00 ? 14  LYS A HA   3  
ATOM 3329  H HB2  . LYS A 1 14  ? 19.526  7.708   -5.751  1.00 0.00 ? 14  LYS A HB2  3  
ATOM 3330  H HB3  . LYS A 1 14  ? 19.969  8.369   -4.182  1.00 0.00 ? 14  LYS A HB3  3  
ATOM 3331  H HG2  . LYS A 1 14  ? 21.787  6.526   -4.192  1.00 0.00 ? 14  LYS A HG2  3  
ATOM 3332  H HG3  . LYS A 1 14  ? 21.480  6.475   -5.930  1.00 0.00 ? 14  LYS A HG3  3  
ATOM 3333  H HD2  . LYS A 1 14  ? 22.228  8.648   -6.254  1.00 0.00 ? 14  LYS A HD2  3  
ATOM 3334  H HD3  . LYS A 1 14  ? 21.980  9.091   -4.564  1.00 0.00 ? 14  LYS A HD3  3  
ATOM 3335  H HE2  . LYS A 1 14  ? 24.027  7.062   -5.420  1.00 0.00 ? 14  LYS A HE2  3  
ATOM 3336  H HE3  . LYS A 1 14  ? 24.385  8.786   -5.337  1.00 0.00 ? 14  LYS A HE3  3  
ATOM 3337  H HZ1  . LYS A 1 14  ? 23.442  8.551   -2.952  1.00 0.00 ? 14  LYS A HZ1  3  
ATOM 3338  H HZ2  . LYS A 1 14  ? 25.028  8.059   -3.272  1.00 0.00 ? 14  LYS A HZ2  3  
ATOM 3339  H HZ3  . LYS A 1 14  ? 23.794  6.908   -3.152  1.00 0.00 ? 14  LYS A HZ3  3  
ATOM 3340  N N    . GLU A 1 15  ? 17.500  6.490   -2.338  1.00 0.00 ? 15  GLU A N    3  
ATOM 3341  C CA   . GLU A 1 15  ? 16.311  6.984   -1.654  1.00 0.00 ? 15  GLU A CA   3  
ATOM 3342  C C    . GLU A 1 15  ? 16.408  6.744   -0.150  1.00 0.00 ? 15  GLU A C    3  
ATOM 3343  O O    . GLU A 1 15  ? 17.139  5.865   0.303   1.00 0.00 ? 15  GLU A O    3  
ATOM 3344  C CB   . GLU A 1 15  ? 15.057  6.306   -2.210  1.00 0.00 ? 15  GLU A CB   3  
ATOM 3345  C CG   . GLU A 1 15  ? 14.777  6.643   -3.665  1.00 0.00 ? 15  GLU A CG   3  
ATOM 3346  C CD   . GLU A 1 15  ? 13.388  6.222   -4.104  1.00 0.00 ? 15  GLU A CD   3  
ATOM 3347  O OE1  . GLU A 1 15  ? 12.404  6.711   -3.513  1.00 0.00 ? 15  GLU A OE1  3  
ATOM 3348  O OE2  . GLU A 1 15  ? 13.286  5.402   -5.041  1.00 0.00 ? 15  GLU A OE2  3  
ATOM 3349  H H    . GLU A 1 15  ? 18.019  5.765   -1.931  1.00 0.00 ? 15  GLU A H    3  
ATOM 3350  H HA   . GLU A 1 15  ? 16.243  8.047   -1.833  1.00 0.00 ? 15  GLU A HA   3  
ATOM 3351  H HB2  . GLU A 1 15  ? 15.174  5.235   -2.126  1.00 0.00 ? 15  GLU A HB2  3  
ATOM 3352  H HB3  . GLU A 1 15  ? 14.206  6.613   -1.621  1.00 0.00 ? 15  GLU A HB3  3  
ATOM 3353  H HG2  . GLU A 1 15  ? 14.871  7.710   -3.798  1.00 0.00 ? 15  GLU A HG2  3  
ATOM 3354  H HG3  . GLU A 1 15  ? 15.503  6.138   -4.285  1.00 0.00 ? 15  GLU A HG3  3  
ATOM 3355  N N    . GLY A 1 16  ? 15.664  7.534   0.618   1.00 0.00 ? 16  GLY A N    3  
ATOM 3356  C CA   . GLY A 1 16  ? 15.681  7.393   2.063   1.00 0.00 ? 16  GLY A CA   3  
ATOM 3357  C C    . GLY A 1 16  ? 16.287  8.597   2.756   1.00 0.00 ? 16  GLY A C    3  
ATOM 3358  O O    . GLY A 1 16  ? 17.389  9.029   2.417   1.00 0.00 ? 16  GLY A O    3  
ATOM 3359  H H    . GLY A 1 16  ? 15.100  8.219   0.201   1.00 0.00 ? 16  GLY A H    3  
ATOM 3360  H HA2  . GLY A 1 16  ? 14.668  7.262   2.412   1.00 0.00 ? 16  GLY A HA2  3  
ATOM 3361  H HA3  . GLY A 1 16  ? 16.257  6.517   2.320   1.00 0.00 ? 16  GLY A HA3  3  
ATOM 3362  N N    . VAL A 1 17  ? 15.565  9.144   3.729   1.00 0.00 ? 17  VAL A N    3  
ATOM 3363  C CA   . VAL A 1 17  ? 16.038  10.306  4.472   1.00 0.00 ? 17  VAL A CA   3  
ATOM 3364  C C    . VAL A 1 17  ? 16.936  9.889   5.631   1.00 0.00 ? 17  VAL A C    3  
ATOM 3365  O O    . VAL A 1 17  ? 16.679  8.890   6.303   1.00 0.00 ? 17  VAL A O    3  
ATOM 3366  C CB   . VAL A 1 17  ? 14.863  11.137  5.020   1.00 0.00 ? 17  VAL A CB   3  
ATOM 3367  C CG1  . VAL A 1 17  ? 14.189  10.412  6.175   1.00 0.00 ? 17  VAL A CG1  3  
ATOM 3368  C CG2  . VAL A 1 17  ? 15.341  12.515  5.451   1.00 0.00 ? 17  VAL A CG2  3  
ATOM 3369  H H    . VAL A 1 17  ? 14.694  8.755   3.954   1.00 0.00 ? 17  VAL A H    3  
ATOM 3370  H HA   . VAL A 1 17  ? 16.605  10.927  3.794   1.00 0.00 ? 17  VAL A HA   3  
ATOM 3371  H HB   . VAL A 1 17  ? 14.137  11.262  4.230   1.00 0.00 ? 17  VAL A HB   3  
ATOM 3372  H HG11 . VAL A 1 17  ? 14.894  10.292  6.985   1.00 0.00 ? 17  VAL A HG11 3  
ATOM 3373  H HG12 . VAL A 1 17  ? 13.341  10.988  6.517   1.00 0.00 ? 17  VAL A HG12 3  
ATOM 3374  H HG13 . VAL A 1 17  ? 13.854  9.440   5.844   1.00 0.00 ? 17  VAL A HG13 3  
ATOM 3375  H HG21 . VAL A 1 17  ? 14.662  12.917  6.189   1.00 0.00 ? 17  VAL A HG21 3  
ATOM 3376  H HG22 . VAL A 1 17  ? 16.330  12.436  5.879   1.00 0.00 ? 17  VAL A HG22 3  
ATOM 3377  H HG23 . VAL A 1 17  ? 15.372  13.171  4.594   1.00 0.00 ? 17  VAL A HG23 3  
ATOM 3378  N N    . LYS A 1 18  ? 17.992  10.663  5.861   1.00 0.00 ? 18  LYS A N    3  
ATOM 3379  C CA   . LYS A 1 18  ? 18.929  10.376  6.941   1.00 0.00 ? 18  LYS A CA   3  
ATOM 3380  C C    . LYS A 1 18  ? 18.397  10.891  8.274   1.00 0.00 ? 18  LYS A C    3  
ATOM 3381  O O    . LYS A 1 18  ? 18.434  10.186  9.283   1.00 0.00 ? 18  LYS A O    3  
ATOM 3382  C CB   . LYS A 1 18  ? 20.290  11.011  6.643   1.00 0.00 ? 18  LYS A CB   3  
ATOM 3383  C CG   . LYS A 1 18  ? 21.222  10.108  5.853   1.00 0.00 ? 18  LYS A CG   3  
ATOM 3384  C CD   . LYS A 1 18  ? 21.980  9.156   6.762   1.00 0.00 ? 18  LYS A CD   3  
ATOM 3385  C CE   . LYS A 1 18  ? 23.141  9.853   7.455   1.00 0.00 ? 18  LYS A CE   3  
ATOM 3386  N NZ   . LYS A 1 18  ? 24.231  8.900   7.805   1.00 0.00 ? 18  LYS A NZ   3  
ATOM 3387  H H    . LYS A 1 18  ? 18.144  11.446  5.291   1.00 0.00 ? 18  LYS A H    3  
ATOM 3388  H HA   . LYS A 1 18  ? 19.047  9.305   7.003   1.00 0.00 ? 18  LYS A HA   3  
ATOM 3389  H HB2  . LYS A 1 18  ? 20.135  11.918  6.078   1.00 0.00 ? 18  LYS A HB2  3  
ATOM 3390  H HB3  . LYS A 1 18  ? 20.771  11.258  7.579   1.00 0.00 ? 18  LYS A HB3  3  
ATOM 3391  H HG2  . LYS A 1 18  ? 20.639  9.531   5.150   1.00 0.00 ? 18  LYS A HG2  3  
ATOM 3392  H HG3  . LYS A 1 18  ? 21.932  10.722  5.316   1.00 0.00 ? 18  LYS A HG3  3  
ATOM 3393  H HD2  . LYS A 1 18  ? 21.304  8.774   7.513   1.00 0.00 ? 18  LYS A HD2  3  
ATOM 3394  H HD3  . LYS A 1 18  ? 22.364  8.337   6.171   1.00 0.00 ? 18  LYS A HD3  3  
ATOM 3395  H HE2  . LYS A 1 18  ? 23.535  10.610  6.796   1.00 0.00 ? 18  LYS A HE2  3  
ATOM 3396  H HE3  . LYS A 1 18  ? 22.776  10.317  8.360   1.00 0.00 ? 18  LYS A HE3  3  
ATOM 3397  H HZ1  . LYS A 1 18  ? 24.738  8.607   6.946   1.00 0.00 ? 18  LYS A HZ1  3  
ATOM 3398  H HZ2  . LYS A 1 18  ? 23.833  8.055   8.264   1.00 0.00 ? 18  LYS A HZ2  3  
ATOM 3399  H HZ3  . LYS A 1 18  ? 24.904  9.350   8.456   1.00 0.00 ? 18  LYS A HZ3  3  
ATOM 3400  N N    . THR A 1 19  ? 17.901  12.125  8.272   1.00 0.00 ? 19  THR A N    3  
ATOM 3401  C CA   . THR A 1 19  ? 17.361  12.734  9.481   1.00 0.00 ? 19  THR A CA   3  
ATOM 3402  C C    . THR A 1 19  ? 15.842  12.616  9.524   1.00 0.00 ? 19  THR A C    3  
ATOM 3403  O O    . THR A 1 19  ? 15.158  12.934  8.552   1.00 0.00 ? 19  THR A O    3  
ATOM 3404  C CB   . THR A 1 19  ? 17.753  14.220  9.585   1.00 0.00 ? 19  THR A CB   3  
ATOM 3405  O OG1  . THR A 1 19  ? 17.255  14.938  8.451   1.00 0.00 ? 19  THR A OG1  3  
ATOM 3406  C CG2  . THR A 1 19  ? 19.264  14.376  9.668   1.00 0.00 ? 19  THR A CG2  3  
ATOM 3407  H H    . THR A 1 19  ? 17.900  12.637  7.436   1.00 0.00 ? 19  THR A H    3  
ATOM 3408  H HA   . THR A 1 19  ? 17.777  12.213  10.331  1.00 0.00 ? 19  THR A HA   3  
ATOM 3409  H HB   . THR A 1 19  ? 17.313  14.630  10.483  1.00 0.00 ? 19  THR A HB   3  
ATOM 3410  H HG1  . THR A 1 19  ? 17.564  15.847  8.487   1.00 0.00 ? 19  THR A HG1  3  
ATOM 3411  H HG21 . THR A 1 19  ? 19.678  13.566  10.250  1.00 0.00 ? 19  THR A HG21 3  
ATOM 3412  H HG22 . THR A 1 19  ? 19.503  15.318  10.140  1.00 0.00 ? 19  THR A HG22 3  
ATOM 3413  H HG23 . THR A 1 19  ? 19.683  14.355  8.673   1.00 0.00 ? 19  THR A HG23 3  
ATOM 3414  N N    . GLU A 1 20  ? 15.320  12.158  10.658  1.00 0.00 ? 20  GLU A N    3  
ATOM 3415  C CA   . GLU A 1 20  ? 13.881  11.999  10.826  1.00 0.00 ? 20  GLU A CA   3  
ATOM 3416  C C    . GLU A 1 20  ? 13.363  12.890  11.952  1.00 0.00 ? 20  GLU A C    3  
ATOM 3417  O O    . GLU A 1 20  ? 13.367  12.499  13.119  1.00 0.00 ? 20  GLU A O    3  
ATOM 3418  C CB   . GLU A 1 20  ? 13.537  10.537  11.119  1.00 0.00 ? 20  GLU A CB   3  
ATOM 3419  C CG   . GLU A 1 20  ? 13.521  9.657   9.881   1.00 0.00 ? 20  GLU A CG   3  
ATOM 3420  C CD   . GLU A 1 20  ? 12.897  8.299   10.139  1.00 0.00 ? 20  GLU A CD   3  
ATOM 3421  O OE1  . GLU A 1 20  ? 11.660  8.182   10.015  1.00 0.00 ? 20  GLU A OE1  3  
ATOM 3422  O OE2  . GLU A 1 20  ? 13.645  7.353   10.464  1.00 0.00 ? 20  GLU A OE2  3  
ATOM 3423  H H    . GLU A 1 20  ? 15.917  11.921  11.398  1.00 0.00 ? 20  GLU A H    3  
ATOM 3424  H HA   . GLU A 1 20  ? 13.404  12.294  9.903   1.00 0.00 ? 20  GLU A HA   3  
ATOM 3425  H HB2  . GLU A 1 20  ? 14.266  10.140  11.810  1.00 0.00 ? 20  GLU A HB2  3  
ATOM 3426  H HB3  . GLU A 1 20  ? 12.560  10.495  11.577  1.00 0.00 ? 20  GLU A HB3  3  
ATOM 3427  H HG2  . GLU A 1 20  ? 12.956  10.154  9.107   1.00 0.00 ? 20  GLU A HG2  3  
ATOM 3428  H HG3  . GLU A 1 20  ? 14.538  9.511   9.545   1.00 0.00 ? 20  GLU A HG3  3  
ATOM 3429  N N    . ASN A 1 21  ? 12.918  14.090  11.593  1.00 0.00 ? 21  ASN A N    3  
ATOM 3430  C CA   . ASN A 1 21  ? 12.398  15.037  12.573  1.00 0.00 ? 21  ASN A CA   3  
ATOM 3431  C C    . ASN A 1 21  ? 11.207  14.447  13.321  1.00 0.00 ? 21  ASN A C    3  
ATOM 3432  O O    . ASN A 1 21  ? 11.145  14.497  14.549  1.00 0.00 ? 21  ASN A O    3  
ATOM 3433  C CB   . ASN A 1 21  ? 11.988  16.340  11.885  1.00 0.00 ? 21  ASN A CB   3  
ATOM 3434  C CG   . ASN A 1 21  ? 11.358  16.103  10.526  1.00 0.00 ? 21  ASN A CG   3  
ATOM 3435  O OD1  . ASN A 1 21  ? 10.846  15.019  10.248  1.00 0.00 ? 21  ASN A OD1  3  
ATOM 3436  N ND2  . ASN A 1 21  ? 11.393  17.120  9.672   1.00 0.00 ? 21  ASN A ND2  3  
ATOM 3437  H H    . ASN A 1 21  ? 12.941  14.345  10.647  1.00 0.00 ? 21  ASN A H    3  
ATOM 3438  H HA   . ASN A 1 21  ? 13.186  15.247  13.281  1.00 0.00 ? 21  ASN A HA   3  
ATOM 3439  H HB2  . ASN A 1 21  ? 11.272  16.859  12.506  1.00 0.00 ? 21  ASN A HB2  3  
ATOM 3440  H HB3  . ASN A 1 21  ? 12.861  16.962  11.753  1.00 0.00 ? 21  ASN A HB3  3  
ATOM 3441  H HD21 . ASN A 1 21  ? 11.818  17.954  9.962   1.00 0.00 ? 21  ASN A HD21 3  
ATOM 3442  H HD22 . ASN A 1 21  ? 10.992  16.994  8.787   1.00 0.00 ? 21  ASN A HD22 3  
ATOM 3443  N N    . ASN A 1 22  ? 10.263  13.887  12.572  1.00 0.00 ? 22  ASN A N    3  
ATOM 3444  C CA   . ASN A 1 22  ? 9.073   13.287  13.164  1.00 0.00 ? 22  ASN A CA   3  
ATOM 3445  C C    . ASN A 1 22  ? 9.283   11.797  13.416  1.00 0.00 ? 22  ASN A C    3  
ATOM 3446  O O    . ASN A 1 22  ? 10.277  11.217  12.979  1.00 0.00 ? 22  ASN A O    3  
ATOM 3447  C CB   . ASN A 1 22  ? 7.863   13.495  12.250  1.00 0.00 ? 22  ASN A CB   3  
ATOM 3448  C CG   . ASN A 1 22  ? 7.161   14.813  12.511  1.00 0.00 ? 22  ASN A CG   3  
ATOM 3449  O OD1  . ASN A 1 22  ? 7.522   15.844  11.942  1.00 0.00 ? 22  ASN A OD1  3  
ATOM 3450  N ND2  . ASN A 1 22  ? 6.154   14.786  13.375  1.00 0.00 ? 22  ASN A ND2  3  
ATOM 3451  H H    . ASN A 1 22  ? 10.368  13.877  11.597  1.00 0.00 ? 22  ASN A H    3  
ATOM 3452  H HA   . ASN A 1 22  ? 8.889   13.778  14.107  1.00 0.00 ? 22  ASN A HA   3  
ATOM 3453  H HB2  . ASN A 1 22  ? 8.191   13.481  11.221  1.00 0.00 ? 22  ASN A HB2  3  
ATOM 3454  H HB3  . ASN A 1 22  ? 7.157   12.694  12.410  1.00 0.00 ? 22  ASN A HB3  3  
ATOM 3455  H HD21 . ASN A 1 22  ? 5.922   13.929  13.790  1.00 0.00 ? 22  ASN A HD21 3  
ATOM 3456  H HD22 . ASN A 1 22  ? 5.682   15.625  13.562  1.00 0.00 ? 22  ASN A HD22 3  
ATOM 3457  N N    . ASP A 1 23  ? 8.341   11.184  14.124  1.00 0.00 ? 23  ASP A N    3  
ATOM 3458  C CA   . ASP A 1 23  ? 8.422   9.761   14.434  1.00 0.00 ? 23  ASP A CA   3  
ATOM 3459  C C    . ASP A 1 23  ? 7.542   8.948   13.489  1.00 0.00 ? 23  ASP A C    3  
ATOM 3460  O O    . ASP A 1 23  ? 6.317   9.071   13.505  1.00 0.00 ? 23  ASP A O    3  
ATOM 3461  C CB   . ASP A 1 23  ? 8.004   9.509   15.884  1.00 0.00 ? 23  ASP A CB   3  
ATOM 3462  C CG   . ASP A 1 23  ? 8.979   10.106  16.879  1.00 0.00 ? 23  ASP A CG   3  
ATOM 3463  O OD1  . ASP A 1 23  ? 9.726   11.030  16.497  1.00 0.00 ? 23  ASP A OD1  3  
ATOM 3464  O OD2  . ASP A 1 23  ? 8.995   9.648   18.042  1.00 0.00 ? 23  ASP A OD2  3  
ATOM 3465  H H    . ASP A 1 23  ? 7.572   11.700  14.445  1.00 0.00 ? 23  ASP A H    3  
ATOM 3466  H HA   . ASP A 1 23  ? 9.448   9.451   14.306  1.00 0.00 ? 23  ASP A HA   3  
ATOM 3467  H HB2  . ASP A 1 23  ? 7.031   9.948   16.053  1.00 0.00 ? 23  ASP A HB2  3  
ATOM 3468  H HB3  . ASP A 1 23  ? 7.949   8.444   16.055  1.00 0.00 ? 23  ASP A HB3  3  
ATOM 3469  N N    . HIS A 1 24  ? 8.175   8.119   12.666  1.00 0.00 ? 24  HIS A N    3  
ATOM 3470  C CA   . HIS A 1 24  ? 7.450   7.286   11.713  1.00 0.00 ? 24  HIS A CA   3  
ATOM 3471  C C    . HIS A 1 24  ? 8.306   6.107   11.260  1.00 0.00 ? 24  HIS A C    3  
ATOM 3472  O O    . HIS A 1 24  ? 9.499   6.043   11.560  1.00 0.00 ? 24  HIS A O    3  
ATOM 3473  C CB   . HIS A 1 24  ? 7.022   8.115   10.502  1.00 0.00 ? 24  HIS A CB   3  
ATOM 3474  C CG   . HIS A 1 24  ? 6.208   9.321   10.859  1.00 0.00 ? 24  HIS A CG   3  
ATOM 3475  N ND1  . HIS A 1 24  ? 4.845   9.394   10.661  1.00 0.00 ? 24  HIS A ND1  3  
ATOM 3476  C CD2  . HIS A 1 24  ? 6.571   10.504  11.405  1.00 0.00 ? 24  HIS A CD2  3  
ATOM 3477  C CE1  . HIS A 1 24  ? 4.406   10.571  11.069  1.00 0.00 ? 24  HIS A CE1  3  
ATOM 3478  N NE2  . HIS A 1 24  ? 5.434   11.264  11.526  1.00 0.00 ? 24  HIS A NE2  3  
ATOM 3479  H H    . HIS A 1 24  ? 9.153   8.066   12.700  1.00 0.00 ? 24  HIS A H    3  
ATOM 3480  H HA   . HIS A 1 24  ? 6.569   6.906   12.208  1.00 0.00 ? 24  HIS A HA   3  
ATOM 3481  H HB2  . HIS A 1 24  ? 7.902   8.454   9.976   1.00 0.00 ? 24  HIS A HB2  3  
ATOM 3482  H HB3  . HIS A 1 24  ? 6.429   7.497   9.842   1.00 0.00 ? 24  HIS A HB3  3  
ATOM 3483  H HD1  . HIS A 1 24  ? 4.284   8.689   10.277  1.00 0.00 ? 24  HIS A HD1  3  
ATOM 3484  H HD2  . HIS A 1 24  ? 7.571   10.798  11.693  1.00 0.00 ? 24  HIS A HD2  3  
ATOM 3485  H HE1  . HIS A 1 24  ? 3.381   10.910  11.036  1.00 0.00 ? 24  HIS A HE1  3  
ATOM 3486  H HE2  . HIS A 1 24  ? 5.401   12.201  11.809  1.00 0.00 ? 24  HIS A HE2  3  
ATOM 3487  N N    . ILE A 1 25  ? 7.690   5.178   10.538  1.00 0.00 ? 25  ILE A N    3  
ATOM 3488  C CA   . ILE A 1 25  ? 8.396   4.002   10.045  1.00 0.00 ? 25  ILE A CA   3  
ATOM 3489  C C    . ILE A 1 25  ? 8.193   3.829   8.543   1.00 0.00 ? 25  ILE A C    3  
ATOM 3490  O O    . ILE A 1 25  ? 7.149   4.191   8.002   1.00 0.00 ? 25  ILE A O    3  
ATOM 3491  C CB   . ILE A 1 25  ? 7.931   2.722   10.765  1.00 0.00 ? 25  ILE A CB   3  
ATOM 3492  C CG1  . ILE A 1 25  ? 6.486   2.393   10.385  1.00 0.00 ? 25  ILE A CG1  3  
ATOM 3493  C CG2  . ILE A 1 25  ? 8.065   2.885   12.272  1.00 0.00 ? 25  ILE A CG2  3  
ATOM 3494  C CD1  . ILE A 1 25  ? 6.006   1.066   10.929  1.00 0.00 ? 25  ILE A CD1  3  
ATOM 3495  H H    . ILE A 1 25  ? 6.738   5.285   10.332  1.00 0.00 ? 25  ILE A H    3  
ATOM 3496  H HA   . ILE A 1 25  ? 9.450   4.139   10.241  1.00 0.00 ? 25  ILE A HA   3  
ATOM 3497  H HB   . ILE A 1 25  ? 8.571   1.910   10.457  1.00 0.00 ? 25  ILE A HB   3  
ATOM 3498  H HG12 . ILE A 1 25  ? 5.836   3.163   10.768  1.00 0.00 ? 25  ILE A HG12 3  
ATOM 3499  H HG13 . ILE A 1 25  ? 6.404   2.361   9.308   1.00 0.00 ? 25  ILE A HG13 3  
ATOM 3500  H HG21 . ILE A 1 25  ? 8.618   3.787   12.489  1.00 0.00 ? 25  ILE A HG21 3  
ATOM 3501  H HG22 . ILE A 1 25  ? 7.082   2.951   12.715  1.00 0.00 ? 25  ILE A HG22 3  
ATOM 3502  H HG23 . ILE A 1 25  ? 8.588   2.034   12.681  1.00 0.00 ? 25  ILE A HG23 3  
ATOM 3503  H HD11 . ILE A 1 25  ? 5.076   0.795   10.450  1.00 0.00 ? 25  ILE A HD11 3  
ATOM 3504  H HD12 . ILE A 1 25  ? 6.747   0.307   10.735  1.00 0.00 ? 25  ILE A HD12 3  
ATOM 3505  H HD13 . ILE A 1 25  ? 5.848   1.151   11.995  1.00 0.00 ? 25  ILE A HD13 3  
ATOM 3506  N N    . ASN A 1 26  ? 9.198   3.271   7.876   1.00 0.00 ? 26  ASN A N    3  
ATOM 3507  C CA   . ASN A 1 26  ? 9.130   3.048   6.436   1.00 0.00 ? 26  ASN A CA   3  
ATOM 3508  C C    . ASN A 1 26  ? 9.183   1.558   6.114   1.00 0.00 ? 26  ASN A C    3  
ATOM 3509  O O    . ASN A 1 26  ? 10.047  0.834   6.610   1.00 0.00 ? 26  ASN A O    3  
ATOM 3510  C CB   . ASN A 1 26  ? 10.277  3.775   5.732   1.00 0.00 ? 26  ASN A CB   3  
ATOM 3511  C CG   . ASN A 1 26  ? 9.989   5.251   5.531   1.00 0.00 ? 26  ASN A CG   3  
ATOM 3512  O OD1  . ASN A 1 26  ? 9.464   5.657   4.494   1.00 0.00 ? 26  ASN A OD1  3  
ATOM 3513  N ND2  . ASN A 1 26  ? 10.334  6.061   6.525   1.00 0.00 ? 26  ASN A ND2  3  
ATOM 3514  H H    . ASN A 1 26  ? 10.006  3.003   8.363   1.00 0.00 ? 26  ASN A H    3  
ATOM 3515  H HA   . ASN A 1 26  ? 8.191   3.448   6.084   1.00 0.00 ? 26  ASN A HA   3  
ATOM 3516  H HB2  . ASN A 1 26  ? 11.174  3.681   6.326   1.00 0.00 ? 26  ASN A HB2  3  
ATOM 3517  H HB3  . ASN A 1 26  ? 10.441  3.324   4.765   1.00 0.00 ? 26  ASN A HB3  3  
ATOM 3518  H HD21 . ASN A 1 26  ? 10.748  5.667   7.321   1.00 0.00 ? 26  ASN A HD21 3  
ATOM 3519  H HD22 . ASN A 1 26  ? 10.159  7.020   6.422   1.00 0.00 ? 26  ASN A HD22 3  
ATOM 3520  N N    . LEU A 1 27  ? 8.254   1.106   5.278   1.00 0.00 ? 27  LEU A N    3  
ATOM 3521  C CA   . LEU A 1 27  ? 8.195   -0.298  4.887   1.00 0.00 ? 27  LEU A CA   3  
ATOM 3522  C C    . LEU A 1 27  ? 8.435   -0.457  3.389   1.00 0.00 ? 27  LEU A C    3  
ATOM 3523  O O    . LEU A 1 27  ? 7.827   0.238   2.575   1.00 0.00 ? 27  LEU A O    3  
ATOM 3524  C CB   . LEU A 1 27  ? 6.838   -0.896  5.265   1.00 0.00 ? 27  LEU A CB   3  
ATOM 3525  C CG   . LEU A 1 27  ? 6.185   -0.334  6.527   1.00 0.00 ? 27  LEU A CG   3  
ATOM 3526  C CD1  . LEU A 1 27  ? 4.737   -0.789  6.628   1.00 0.00 ? 27  LEU A CD1  3  
ATOM 3527  C CD2  . LEU A 1 27  ? 6.965   -0.754  7.764   1.00 0.00 ? 27  LEU A CD2  3  
ATOM 3528  H H    . LEU A 1 27  ? 7.593   1.730   4.915   1.00 0.00 ? 27  LEU A H    3  
ATOM 3529  H HA   . LEU A 1 27  ? 8.972   -0.824  5.422   1.00 0.00 ? 27  LEU A HA   3  
ATOM 3530  H HB2  . LEU A 1 27  ? 6.163   -0.729  4.440   1.00 0.00 ? 27  LEU A HB2  3  
ATOM 3531  H HB3  . LEU A 1 27  ? 6.974   -1.959  5.406   1.00 0.00 ? 27  LEU A HB3  3  
ATOM 3532  H HG   . LEU A 1 27  ? 6.192   0.747   6.478   1.00 0.00 ? 27  LEU A HG   3  
ATOM 3533  H HD11 . LEU A 1 27  ? 4.683   -1.854  6.464   1.00 0.00 ? 27  LEU A HD11 3  
ATOM 3534  H HD12 . LEU A 1 27  ? 4.147   -0.279  5.880   1.00 0.00 ? 27  LEU A HD12 3  
ATOM 3535  H HD13 . LEU A 1 27  ? 4.354   -0.555  7.610   1.00 0.00 ? 27  LEU A HD13 3  
ATOM 3536  H HD21 . LEU A 1 27  ? 8.007   -0.503  7.635   1.00 0.00 ? 27  LEU A HD21 3  
ATOM 3537  H HD22 . LEU A 1 27  ? 6.867   -1.821  7.906   1.00 0.00 ? 27  LEU A HD22 3  
ATOM 3538  H HD23 . LEU A 1 27  ? 6.575   -0.238  8.629   1.00 0.00 ? 27  LEU A HD23 3  
ATOM 3539  N N    . LYS A 1 28  ? 9.322   -1.379  3.032   1.00 0.00 ? 28  LYS A N    3  
ATOM 3540  C CA   . LYS A 1 28  ? 9.641   -1.633  1.632   1.00 0.00 ? 28  LYS A CA   3  
ATOM 3541  C C    . LYS A 1 28  ? 8.739   -2.721  1.058   1.00 0.00 ? 28  LYS A C    3  
ATOM 3542  O O    . LYS A 1 28  ? 8.841   -3.889  1.435   1.00 0.00 ? 28  LYS A O    3  
ATOM 3543  C CB   . LYS A 1 28  ? 11.108  -2.043  1.488   1.00 0.00 ? 28  LYS A CB   3  
ATOM 3544  C CG   . LYS A 1 28  ? 12.082  -0.891  1.665   1.00 0.00 ? 28  LYS A CG   3  
ATOM 3545  C CD   . LYS A 1 28  ? 13.433  -1.375  2.163   1.00 0.00 ? 28  LYS A CD   3  
ATOM 3546  C CE   . LYS A 1 28  ? 13.495  -1.390  3.683   1.00 0.00 ? 28  LYS A CE   3  
ATOM 3547  N NZ   . LYS A 1 28  ? 14.809  -1.883  4.180   1.00 0.00 ? 28  LYS A NZ   3  
ATOM 3548  H H    . LYS A 1 28  ? 9.774   -1.902  3.728   1.00 0.00 ? 28  LYS A H    3  
ATOM 3549  H HA   . LYS A 1 28  ? 9.476   -0.719  1.083   1.00 0.00 ? 28  LYS A HA   3  
ATOM 3550  H HB2  . LYS A 1 28  ? 11.334  -2.795  2.229   1.00 0.00 ? 28  LYS A HB2  3  
ATOM 3551  H HB3  . LYS A 1 28  ? 11.257  -2.464  0.504   1.00 0.00 ? 28  LYS A HB3  3  
ATOM 3552  H HG2  . LYS A 1 28  ? 12.217  -0.396  0.715   1.00 0.00 ? 28  LYS A HG2  3  
ATOM 3553  H HG3  . LYS A 1 28  ? 11.673  -0.193  2.382   1.00 0.00 ? 28  LYS A HG3  3  
ATOM 3554  H HD2  . LYS A 1 28  ? 13.605  -2.376  1.797   1.00 0.00 ? 28  LYS A HD2  3  
ATOM 3555  H HD3  . LYS A 1 28  ? 14.203  -0.716  1.787   1.00 0.00 ? 28  LYS A HD3  3  
ATOM 3556  H HE2  . LYS A 1 28  ? 13.336  -0.386  4.046   1.00 0.00 ? 28  LYS A HE2  3  
ATOM 3557  H HE3  . LYS A 1 28  ? 12.713  -2.036  4.055   1.00 0.00 ? 28  LYS A HE3  3  
ATOM 3558  H HZ1  . LYS A 1 28  ? 15.577  -1.283  3.815   1.00 0.00 ? 28  LYS A HZ1  3  
ATOM 3559  H HZ2  . LYS A 1 28  ? 14.968  -2.860  3.862   1.00 0.00 ? 28  LYS A HZ2  3  
ATOM 3560  H HZ3  . LYS A 1 28  ? 14.830  -1.860  5.219   1.00 0.00 ? 28  LYS A HZ3  3  
ATOM 3561  N N    . VAL A 1 29  ? 7.858   -2.332  0.142   1.00 0.00 ? 29  VAL A N    3  
ATOM 3562  C CA   . VAL A 1 29  ? 6.940   -3.274  -0.486  1.00 0.00 ? 29  VAL A CA   3  
ATOM 3563  C C    . VAL A 1 29  ? 7.548   -3.875  -1.748  1.00 0.00 ? 29  VAL A C    3  
ATOM 3564  O O    . VAL A 1 29  ? 7.965   -3.153  -2.653  1.00 0.00 ? 29  VAL A O    3  
ATOM 3565  C CB   . VAL A 1 29  ? 5.602   -2.601  -0.844  1.00 0.00 ? 29  VAL A CB   3  
ATOM 3566  C CG1  . VAL A 1 29  ? 4.553   -3.647  -1.189  1.00 0.00 ? 29  VAL A CG1  3  
ATOM 3567  C CG2  . VAL A 1 29  ? 5.128   -1.716  0.299   1.00 0.00 ? 29  VAL A CG2  3  
ATOM 3568  H H    . VAL A 1 29  ? 7.825   -1.387  -0.117  1.00 0.00 ? 29  VAL A H    3  
ATOM 3569  H HA   . VAL A 1 29  ? 6.742   -4.068  0.220   1.00 0.00 ? 29  VAL A HA   3  
ATOM 3570  H HB   . VAL A 1 29  ? 5.757   -1.979  -1.713  1.00 0.00 ? 29  VAL A HB   3  
ATOM 3571  H HG11 . VAL A 1 29  ? 5.021   -4.619  -1.248  1.00 0.00 ? 29  VAL A HG11 3  
ATOM 3572  H HG12 . VAL A 1 29  ? 3.790   -3.659  -0.424  1.00 0.00 ? 29  VAL A HG12 3  
ATOM 3573  H HG13 . VAL A 1 29  ? 4.105   -3.407  -2.142  1.00 0.00 ? 29  VAL A HG13 3  
ATOM 3574  H HG21 . VAL A 1 29  ? 4.786   -2.336  1.115   1.00 0.00 ? 29  VAL A HG21 3  
ATOM 3575  H HG22 . VAL A 1 29  ? 5.946   -1.096  0.637   1.00 0.00 ? 29  VAL A HG22 3  
ATOM 3576  H HG23 . VAL A 1 29  ? 4.318   -1.089  -0.042  1.00 0.00 ? 29  VAL A HG23 3  
ATOM 3577  N N    . ALA A 1 30  ? 7.595   -5.202  -1.802  1.00 0.00 ? 30  ALA A N    3  
ATOM 3578  C CA   . ALA A 1 30  ? 8.150   -5.901  -2.955  1.00 0.00 ? 30  ALA A CA   3  
ATOM 3579  C C    . ALA A 1 30  ? 7.045   -6.496  -3.820  1.00 0.00 ? 30  ALA A C    3  
ATOM 3580  O O    . ALA A 1 30  ? 6.024   -6.957  -3.311  1.00 0.00 ? 30  ALA A O    3  
ATOM 3581  C CB   . ALA A 1 30  ? 9.111   -6.989  -2.500  1.00 0.00 ? 30  ALA A CB   3  
ATOM 3582  H H    . ALA A 1 30  ? 7.247   -5.724  -1.049  1.00 0.00 ? 30  ALA A H    3  
ATOM 3583  H HA   . ALA A 1 30  ? 8.707   -5.185  -3.542  1.00 0.00 ? 30  ALA A HA   3  
ATOM 3584  H HB1  . ALA A 1 30  ? 8.593   -7.937  -2.472  1.00 0.00 ? 30  ALA A HB1  3  
ATOM 3585  H HB2  . ALA A 1 30  ? 9.938   -7.051  -3.191  1.00 0.00 ? 30  ALA A HB2  3  
ATOM 3586  H HB3  . ALA A 1 30  ? 9.481   -6.753  -1.514  1.00 0.00 ? 30  ALA A HB3  3  
ATOM 3587  N N    . GLY A 1 31  ? 7.255   -6.483  -5.133  1.00 0.00 ? 31  GLY A N    3  
ATOM 3588  C CA   . GLY A 1 31  ? 6.267   -7.023  -6.048  1.00 0.00 ? 31  GLY A CA   3  
ATOM 3589  C C    . GLY A 1 31  ? 6.755   -7.043  -7.483  1.00 0.00 ? 31  GLY A C    3  
ATOM 3590  O O    . GLY A 1 31  ? 6.539   -8.016  -8.205  1.00 0.00 ? 31  GLY A O    3  
ATOM 3591  H H    . GLY A 1 31  ? 8.088   -6.102  -5.483  1.00 0.00 ? 31  GLY A H    3  
ATOM 3592  H HA2  . GLY A 1 31  ? 6.026   -8.032  -5.746  1.00 0.00 ? 31  GLY A HA2  3  
ATOM 3593  H HA3  . GLY A 1 31  ? 5.373   -6.419  -5.993  1.00 0.00 ? 31  GLY A HA3  3  
ATOM 3594  N N    . GLN A 1 32  ? 7.414   -5.966  -7.897  1.00 0.00 ? 32  GLN A N    3  
ATOM 3595  C CA   . GLN A 1 32  ? 7.932   -5.864  -9.256  1.00 0.00 ? 32  GLN A CA   3  
ATOM 3596  C C    . GLN A 1 32  ? 9.203   -6.692  -9.419  1.00 0.00 ? 32  GLN A C    3  
ATOM 3597  O O    . GLN A 1 32  ? 9.817   -7.104  -8.434  1.00 0.00 ? 32  GLN A O    3  
ATOM 3598  C CB   . GLN A 1 32  ? 8.213   -4.402  -9.609  1.00 0.00 ? 32  GLN A CB   3  
ATOM 3599  C CG   . GLN A 1 32  ? 8.039   -4.089  -11.087 1.00 0.00 ? 32  GLN A CG   3  
ATOM 3600  C CD   . GLN A 1 32  ? 6.616   -4.296  -11.564 1.00 0.00 ? 32  GLN A CD   3  
ATOM 3601  O OE1  . GLN A 1 32  ? 5.703   -3.571  -11.166 1.00 0.00 ? 32  GLN A OE1  3  
ATOM 3602  N NE2  . GLN A 1 32  ? 6.417   -5.290  -12.422 1.00 0.00 ? 32  GLN A NE2  3  
ATOM 3603  H H    . GLN A 1 32  ? 7.555   -5.223  -7.275  1.00 0.00 ? 32  GLN A H    3  
ATOM 3604  H HA   . GLN A 1 32  ? 7.179   -6.248  -9.928  1.00 0.00 ? 32  GLN A HA   3  
ATOM 3605  H HB2  . GLN A 1 32  ? 7.539   -3.773  -9.048  1.00 0.00 ? 32  GLN A HB2  3  
ATOM 3606  H HB3  . GLN A 1 32  ? 9.229   -4.166  -9.330  1.00 0.00 ? 32  GLN A HB3  3  
ATOM 3607  H HG2  . GLN A 1 32  ? 8.313   -3.058  -11.257 1.00 0.00 ? 32  GLN A HG2  3  
ATOM 3608  H HG3  . GLN A 1 32  ? 8.693   -4.733  -11.657 1.00 0.00 ? 32  GLN A HG3  3  
ATOM 3609  H HE21 . GLN A 1 32  ? 7.191   -5.827  -12.694 1.00 0.00 ? 32  GLN A HE21 3  
ATOM 3610  H HE22 . GLN A 1 32  ? 5.507   -5.447  -12.746 1.00 0.00 ? 32  GLN A HE22 3  
ATOM 3611  N N    . ASP A 1 33  ? 9.592   -6.931  -10.666 1.00 0.00 ? 33  ASP A N    3  
ATOM 3612  C CA   . ASP A 1 33  ? 10.790  -7.709  -10.957 1.00 0.00 ? 33  ASP A CA   3  
ATOM 3613  C C    . ASP A 1 33  ? 12.036  -6.831  -10.898 1.00 0.00 ? 33  ASP A C    3  
ATOM 3614  O O    . ASP A 1 33  ? 13.007  -7.064  -11.616 1.00 0.00 ? 33  ASP A O    3  
ATOM 3615  C CB   . ASP A 1 33  ? 10.677  -8.363  -12.335 1.00 0.00 ? 33  ASP A CB   3  
ATOM 3616  C CG   . ASP A 1 33  ? 11.437  -9.672  -12.419 1.00 0.00 ? 33  ASP A CG   3  
ATOM 3617  O OD1  . ASP A 1 33  ? 12.667  -9.659  -12.208 1.00 0.00 ? 33  ASP A OD1  3  
ATOM 3618  O OD2  . ASP A 1 33  ? 10.800  -10.711 -12.696 1.00 0.00 ? 33  ASP A OD2  3  
ATOM 3619  H H    . ASP A 1 33  ? 9.061   -6.575  -11.409 1.00 0.00 ? 33  ASP A H    3  
ATOM 3620  H HA   . ASP A 1 33  ? 10.874  -8.482  -10.208 1.00 0.00 ? 33  ASP A HA   3  
ATOM 3621  H HB2  . ASP A 1 33  ? 9.637   -8.557  -12.550 1.00 0.00 ? 33  ASP A HB2  3  
ATOM 3622  H HB3  . ASP A 1 33  ? 11.075  -7.689  -13.080 1.00 0.00 ? 33  ASP A HB3  3  
ATOM 3623  N N    . GLY A 1 34  ? 12.000  -5.819  -10.036 1.00 0.00 ? 34  GLY A N    3  
ATOM 3624  C CA   . GLY A 1 34  ? 13.132  -4.920  -9.900  1.00 0.00 ? 34  GLY A CA   3  
ATOM 3625  C C    . GLY A 1 34  ? 12.716  -3.525  -9.476  1.00 0.00 ? 34  GLY A C    3  
ATOM 3626  O O    . GLY A 1 34  ? 13.351  -2.540  -9.852  1.00 0.00 ? 34  GLY A O    3  
ATOM 3627  H H    . GLY A 1 34  ? 11.199  -5.681  -9.489  1.00 0.00 ? 34  GLY A H    3  
ATOM 3628  H HA2  . GLY A 1 34  ? 13.810  -5.322  -9.162  1.00 0.00 ? 34  GLY A HA2  3  
ATOM 3629  H HA3  . GLY A 1 34  ? 13.643  -4.857  -10.849 1.00 0.00 ? 34  GLY A HA3  3  
ATOM 3630  N N    . SER A 1 35  ? 11.646  -3.441  -8.692  1.00 0.00 ? 35  SER A N    3  
ATOM 3631  C CA   . SER A 1 35  ? 11.143  -2.156  -8.220  1.00 0.00 ? 35  SER A CA   3  
ATOM 3632  C C    . SER A 1 35  ? 10.551  -2.284  -6.820  1.00 0.00 ? 35  SER A C    3  
ATOM 3633  O O    . SER A 1 35  ? 9.787   -3.208  -6.539  1.00 0.00 ? 35  SER A O    3  
ATOM 3634  C CB   . SER A 1 35  ? 10.087  -1.613  -9.185  1.00 0.00 ? 35  SER A CB   3  
ATOM 3635  O OG   . SER A 1 35  ? 10.013  -0.199  -9.117  1.00 0.00 ? 35  SER A OG   3  
ATOM 3636  H H    . SER A 1 35  ? 11.183  -4.263  -8.426  1.00 0.00 ? 35  SER A H    3  
ATOM 3637  H HA   . SER A 1 35  ? 11.974  -1.467  -8.185  1.00 0.00 ? 35  SER A HA   3  
ATOM 3638  H HB2  . SER A 1 35  ? 10.343  -1.899  -10.194 1.00 0.00 ? 35  SER A HB2  3  
ATOM 3639  H HB3  . SER A 1 35  ? 9.122   -2.025  -8.927  1.00 0.00 ? 35  SER A HB3  3  
ATOM 3640  H HG   . SER A 1 35  ? 10.236  0.091   -8.230  1.00 0.00 ? 35  SER A HG   3  
ATOM 3641  N N    . VAL A 1 36  ? 10.910  -1.350  -5.945  1.00 0.00 ? 36  VAL A N    3  
ATOM 3642  C CA   . VAL A 1 36  ? 10.414  -1.357  -4.574  1.00 0.00 ? 36  VAL A CA   3  
ATOM 3643  C C    . VAL A 1 36  ? 9.757   -0.028  -4.220  1.00 0.00 ? 36  VAL A C    3  
ATOM 3644  O O    . VAL A 1 36  ? 10.314  1.040   -4.478  1.00 0.00 ? 36  VAL A O    3  
ATOM 3645  C CB   . VAL A 1 36  ? 11.546  -1.642  -3.569  1.00 0.00 ? 36  VAL A CB   3  
ATOM 3646  C CG1  . VAL A 1 36  ? 11.008  -1.649  -2.146  1.00 0.00 ? 36  VAL A CG1  3  
ATOM 3647  C CG2  . VAL A 1 36  ? 12.229  -2.961  -3.896  1.00 0.00 ? 36  VAL A CG2  3  
ATOM 3648  H H    . VAL A 1 36  ? 11.521  -0.639  -6.228  1.00 0.00 ? 36  VAL A H    3  
ATOM 3649  H HA   . VAL A 1 36  ? 9.679   -2.144  -4.488  1.00 0.00 ? 36  VAL A HA   3  
ATOM 3650  H HB   . VAL A 1 36  ? 12.278  -0.852  -3.649  1.00 0.00 ? 36  VAL A HB   3  
ATOM 3651  H HG11 . VAL A 1 36  ? 10.017  -1.219  -2.134  1.00 0.00 ? 36  VAL A HG11 3  
ATOM 3652  H HG12 . VAL A 1 36  ? 10.966  -2.665  -1.782  1.00 0.00 ? 36  VAL A HG12 3  
ATOM 3653  H HG13 . VAL A 1 36  ? 11.660  -1.066  -1.512  1.00 0.00 ? 36  VAL A HG13 3  
ATOM 3654  H HG21 . VAL A 1 36  ? 12.991  -2.795  -4.643  1.00 0.00 ? 36  VAL A HG21 3  
ATOM 3655  H HG22 . VAL A 1 36  ? 12.684  -3.363  -3.002  1.00 0.00 ? 36  VAL A HG22 3  
ATOM 3656  H HG23 . VAL A 1 36  ? 11.499  -3.661  -4.274  1.00 0.00 ? 36  VAL A HG23 3  
ATOM 3657  N N    . VAL A 1 37  ? 8.570   -0.099  -3.627  1.00 0.00 ? 37  VAL A N    3  
ATOM 3658  C CA   . VAL A 1 37  ? 7.837   1.099   -3.236  1.00 0.00 ? 37  VAL A CA   3  
ATOM 3659  C C    . VAL A 1 37  ? 7.844   1.277   -1.722  1.00 0.00 ? 37  VAL A C    3  
ATOM 3660  O O    . VAL A 1 37  ? 7.401   0.399   -0.982  1.00 0.00 ? 37  VAL A O    3  
ATOM 3661  C CB   . VAL A 1 37  ? 6.379   1.052   -3.730  1.00 0.00 ? 37  VAL A CB   3  
ATOM 3662  C CG1  . VAL A 1 37  ? 5.683   2.378   -3.467  1.00 0.00 ? 37  VAL A CG1  3  
ATOM 3663  C CG2  . VAL A 1 37  ? 6.329   0.697   -5.208  1.00 0.00 ? 37  VAL A CG2  3  
ATOM 3664  H H    . VAL A 1 37  ? 8.178   -0.979  -3.448  1.00 0.00 ? 37  VAL A H    3  
ATOM 3665  H HA   . VAL A 1 37  ? 8.322   1.951   -3.691  1.00 0.00 ? 37  VAL A HA   3  
ATOM 3666  H HB   . VAL A 1 37  ? 5.859   0.282   -3.179  1.00 0.00 ? 37  VAL A HB   3  
ATOM 3667  H HG11 . VAL A 1 37  ? 5.834   2.666   -2.437  1.00 0.00 ? 37  VAL A HG11 3  
ATOM 3668  H HG12 . VAL A 1 37  ? 6.093   3.136   -4.118  1.00 0.00 ? 37  VAL A HG12 3  
ATOM 3669  H HG13 . VAL A 1 37  ? 4.625   2.273   -3.658  1.00 0.00 ? 37  VAL A HG13 3  
ATOM 3670  H HG21 . VAL A 1 37  ? 7.323   0.758   -5.626  1.00 0.00 ? 37  VAL A HG21 3  
ATOM 3671  H HG22 . VAL A 1 37  ? 5.950   -0.308  -5.325  1.00 0.00 ? 37  VAL A HG22 3  
ATOM 3672  H HG23 . VAL A 1 37  ? 5.678   1.389   -5.723  1.00 0.00 ? 37  VAL A HG23 3  
ATOM 3673  N N    . GLN A 1 38  ? 8.349   2.420   -1.268  1.00 0.00 ? 38  GLN A N    3  
ATOM 3674  C CA   . GLN A 1 38  ? 8.414   2.714   0.159   1.00 0.00 ? 38  GLN A CA   3  
ATOM 3675  C C    . GLN A 1 38  ? 7.161   3.451   0.620   1.00 0.00 ? 38  GLN A C    3  
ATOM 3676  O O    . GLN A 1 38  ? 6.421   4.008   -0.192  1.00 0.00 ? 38  GLN A O    3  
ATOM 3677  C CB   . GLN A 1 38  ? 9.656   3.548   0.473   1.00 0.00 ? 38  GLN A CB   3  
ATOM 3678  C CG   . GLN A 1 38  ? 10.925  2.722   0.611   1.00 0.00 ? 38  GLN A CG   3  
ATOM 3679  C CD   . GLN A 1 38  ? 12.183  3.552   0.442   1.00 0.00 ? 38  GLN A CD   3  
ATOM 3680  O OE1  . GLN A 1 38  ? 13.026  3.255   -0.405  1.00 0.00 ? 38  GLN A OE1  3  
ATOM 3681  N NE2  . GLN A 1 38  ? 12.315  4.598   1.249   1.00 0.00 ? 38  GLN A NE2  3  
ATOM 3682  H H    . GLN A 1 38  ? 8.686   3.081   -1.908  1.00 0.00 ? 38  GLN A H    3  
ATOM 3683  H HA   . GLN A 1 38  ? 8.478   1.775   0.687   1.00 0.00 ? 38  GLN A HA   3  
ATOM 3684  H HB2  . GLN A 1 38  ? 9.803   4.266   -0.319  1.00 0.00 ? 38  GLN A HB2  3  
ATOM 3685  H HB3  . GLN A 1 38  ? 9.495   4.076   1.402   1.00 0.00 ? 38  GLN A HB3  3  
ATOM 3686  H HG2  . GLN A 1 38  ? 10.940  2.269   1.591   1.00 0.00 ? 38  GLN A HG2  3  
ATOM 3687  H HG3  . GLN A 1 38  ? 10.918  1.948   -0.142  1.00 0.00 ? 38  GLN A HG3  3  
ATOM 3688  H HE21 . GLN A 1 38  ? 11.603  4.772   1.900   1.00 0.00 ? 38  GLN A HE21 3  
ATOM 3689  H HE22 . GLN A 1 38  ? 13.118  5.151   1.162   1.00 0.00 ? 38  GLN A HE22 3  
ATOM 3690  N N    . PHE A 1 39  ? 6.928   3.451   1.928   1.00 0.00 ? 39  PHE A N    3  
ATOM 3691  C CA   . PHE A 1 39  ? 5.764   4.119   2.497   1.00 0.00 ? 39  PHE A CA   3  
ATOM 3692  C C    . PHE A 1 39  ? 6.037   4.560   3.933   1.00 0.00 ? 39  PHE A C    3  
ATOM 3693  O O    . PHE A 1 39  ? 6.372   3.744   4.792   1.00 0.00 ? 39  PHE A O    3  
ATOM 3694  C CB   . PHE A 1 39  ? 4.548   3.192   2.460   1.00 0.00 ? 39  PHE A CB   3  
ATOM 3695  C CG   . PHE A 1 39  ? 4.057   2.903   1.070   1.00 0.00 ? 39  PHE A CG   3  
ATOM 3696  C CD1  . PHE A 1 39  ? 4.612   1.876   0.324   1.00 0.00 ? 39  PHE A CD1  3  
ATOM 3697  C CD2  . PHE A 1 39  ? 3.040   3.660   0.509   1.00 0.00 ? 39  PHE A CD2  3  
ATOM 3698  C CE1  . PHE A 1 39  ? 4.162   1.609   -0.955  1.00 0.00 ? 39  PHE A CE1  3  
ATOM 3699  C CE2  . PHE A 1 39  ? 2.586   3.397   -0.769  1.00 0.00 ? 39  PHE A CE2  3  
ATOM 3700  C CZ   . PHE A 1 39  ? 3.147   2.370   -1.502  1.00 0.00 ? 39  PHE A CZ   3  
ATOM 3701  H H    . PHE A 1 39  ? 7.555   2.990   2.525   1.00 0.00 ? 39  PHE A H    3  
ATOM 3702  H HA   . PHE A 1 39  ? 5.558   4.993   1.898   1.00 0.00 ? 39  PHE A HA   3  
ATOM 3703  H HB2  . PHE A 1 39  ? 4.807   2.251   2.921   1.00 0.00 ? 39  PHE A HB2  3  
ATOM 3704  H HB3  . PHE A 1 39  ? 3.739   3.648   3.011   1.00 0.00 ? 39  PHE A HB3  3  
ATOM 3705  H HD1  . PHE A 1 39  ? 5.404   1.279   0.751   1.00 0.00 ? 39  PHE A HD1  3  
ATOM 3706  H HD2  . PHE A 1 39  ? 2.600   4.464   1.083   1.00 0.00 ? 39  PHE A HD2  3  
ATOM 3707  H HE1  . PHE A 1 39  ? 4.602   0.805   -1.526  1.00 0.00 ? 39  PHE A HE1  3  
ATOM 3708  H HE2  . PHE A 1 39  ? 1.792   3.994   -1.194  1.00 0.00 ? 39  PHE A HE2  3  
ATOM 3709  H HZ   . PHE A 1 39  ? 2.794   2.164   -2.502  1.00 0.00 ? 39  PHE A HZ   3  
ATOM 3710  N N    . LYS A 1 40  ? 5.893   5.856   4.185   1.00 0.00 ? 40  LYS A N    3  
ATOM 3711  C CA   . LYS A 1 40  ? 6.123   6.408   5.515   1.00 0.00 ? 40  LYS A CA   3  
ATOM 3712  C C    . LYS A 1 40  ? 4.803   6.745   6.200   1.00 0.00 ? 40  LYS A C    3  
ATOM 3713  O O    . LYS A 1 40  ? 4.111   7.685   5.806   1.00 0.00 ? 40  LYS A O    3  
ATOM 3714  C CB   . LYS A 1 40  ? 6.998   7.660   5.426   1.00 0.00 ? 40  LYS A CB   3  
ATOM 3715  C CG   . LYS A 1 40  ? 7.099   8.426   6.733   1.00 0.00 ? 40  LYS A CG   3  
ATOM 3716  C CD   . LYS A 1 40  ? 8.096   9.569   6.635   1.00 0.00 ? 40  LYS A CD   3  
ATOM 3717  C CE   . LYS A 1 40  ? 7.732   10.708  7.575   1.00 0.00 ? 40  LYS A CE   3  
ATOM 3718  N NZ   . LYS A 1 40  ? 6.525   11.446  7.110   1.00 0.00 ? 40  LYS A NZ   3  
ATOM 3719  H H    . LYS A 1 40  ? 5.624   6.458   3.458   1.00 0.00 ? 40  LYS A H    3  
ATOM 3720  H HA   . LYS A 1 40  ? 6.638   5.660   6.100   1.00 0.00 ? 40  LYS A HA   3  
ATOM 3721  H HB2  . LYS A 1 40  ? 7.994   7.368   5.126   1.00 0.00 ? 40  LYS A HB2  3  
ATOM 3722  H HB3  . LYS A 1 40  ? 6.586   8.321   4.677   1.00 0.00 ? 40  LYS A HB3  3  
ATOM 3723  H HG2  . LYS A 1 40  ? 6.128   8.831   6.979   1.00 0.00 ? 40  LYS A HG2  3  
ATOM 3724  H HG3  . LYS A 1 40  ? 7.416   7.749   7.513   1.00 0.00 ? 40  LYS A HG3  3  
ATOM 3725  H HD2  . LYS A 1 40  ? 9.077   9.202   6.896   1.00 0.00 ? 40  LYS A HD2  3  
ATOM 3726  H HD3  . LYS A 1 40  ? 8.106   9.940   5.620   1.00 0.00 ? 40  LYS A HD3  3  
ATOM 3727  H HE2  . LYS A 1 40  ? 7.539   10.301  8.555   1.00 0.00 ? 40  LYS A HE2  3  
ATOM 3728  H HE3  . LYS A 1 40  ? 8.565   11.394  7.627   1.00 0.00 ? 40  LYS A HE3  3  
ATOM 3729  H HZ1  . LYS A 1 40  ? 5.876   10.797  6.620   1.00 0.00 ? 40  LYS A HZ1  3  
ATOM 3730  H HZ2  . LYS A 1 40  ? 6.801   12.204  6.453   1.00 0.00 ? 40  LYS A HZ2  3  
ATOM 3731  H HZ3  . LYS A 1 40  ? 6.030   11.868  7.921   1.00 0.00 ? 40  LYS A HZ3  3  
ATOM 3732  N N    . ILE A 1 41  ? 4.461   5.975   7.227   1.00 0.00 ? 41  ILE A N    3  
ATOM 3733  C CA   . ILE A 1 41  ? 3.224   6.195   7.968   1.00 0.00 ? 41  ILE A CA   3  
ATOM 3734  C C    . ILE A 1 41  ? 3.475   6.181   9.472   1.00 0.00 ? 41  ILE A C    3  
ATOM 3735  O O    . ILE A 1 41  ? 4.596   5.949   9.924   1.00 0.00 ? 41  ILE A O    3  
ATOM 3736  C CB   . ILE A 1 41  ? 2.166   5.129   7.625   1.00 0.00 ? 41  ILE A CB   3  
ATOM 3737  C CG1  . ILE A 1 41  ? 2.486   3.814   8.339   1.00 0.00 ? 41  ILE A CG1  3  
ATOM 3738  C CG2  . ILE A 1 41  ? 2.095   4.918   6.120   1.00 0.00 ? 41  ILE A CG2  3  
ATOM 3739  C CD1  . ILE A 1 41  ? 1.485   2.715   8.057   1.00 0.00 ? 41  ILE A CD1  3  
ATOM 3740  H H    . ILE A 1 41  ? 5.054   5.242   7.493   1.00 0.00 ? 41  ILE A H    3  
ATOM 3741  H HA   . ILE A 1 41  ? 2.836   7.163   7.687   1.00 0.00 ? 41  ILE A HA   3  
ATOM 3742  H HB   . ILE A 1 41  ? 1.205   5.488   7.960   1.00 0.00 ? 41  ILE A HB   3  
ATOM 3743  H HG12 . ILE A 1 41  ? 3.457   3.467   8.023   1.00 0.00 ? 41  ILE A HG12 3  
ATOM 3744  H HG13 . ILE A 1 41  ? 2.499   3.986   9.406   1.00 0.00 ? 41  ILE A HG13 3  
ATOM 3745  H HG21 . ILE A 1 41  ? 2.997   5.295   5.661   1.00 0.00 ? 41  ILE A HG21 3  
ATOM 3746  H HG22 . ILE A 1 41  ? 1.998   3.864   5.910   1.00 0.00 ? 41  ILE A HG22 3  
ATOM 3747  H HG23 . ILE A 1 41  ? 1.241   5.445   5.723   1.00 0.00 ? 41  ILE A HG23 3  
ATOM 3748  H HD11 . ILE A 1 41  ? 0.932   2.492   8.958   1.00 0.00 ? 41  ILE A HD11 3  
ATOM 3749  H HD12 . ILE A 1 41  ? 0.803   3.038   7.285   1.00 0.00 ? 41  ILE A HD12 3  
ATOM 3750  H HD13 . ILE A 1 41  ? 2.008   1.829   7.728   1.00 0.00 ? 41  ILE A HD13 3  
ATOM 3751  N N    . LYS A 1 42  ? 2.423   6.431   10.243  1.00 0.00 ? 42  LYS A N    3  
ATOM 3752  C CA   . LYS A 1 42  ? 2.526   6.445   11.698  1.00 0.00 ? 42  LYS A CA   3  
ATOM 3753  C C    . LYS A 1 42  ? 2.281   5.054   12.274  1.00 0.00 ? 42  LYS A C    3  
ATOM 3754  O O    . LYS A 1 42  ? 1.647   4.212   11.639  1.00 0.00 ? 42  LYS A O    3  
ATOM 3755  C CB   . LYS A 1 42  ? 1.524   7.438   12.291  1.00 0.00 ? 42  LYS A CB   3  
ATOM 3756  C CG   . LYS A 1 42  ? 1.595   8.820   11.665  1.00 0.00 ? 42  LYS A CG   3  
ATOM 3757  C CD   . LYS A 1 42  ? 0.337   9.625   11.948  1.00 0.00 ? 42  LYS A CD   3  
ATOM 3758  C CE   . LYS A 1 42  ? 0.214   10.815  11.008  1.00 0.00 ? 42  LYS A CE   3  
ATOM 3759  N NZ   . LYS A 1 42  ? 0.087   10.388  9.587   1.00 0.00 ? 42  LYS A NZ   3  
ATOM 3760  H H    . LYS A 1 42  ? 1.554   6.609   9.824   1.00 0.00 ? 42  LYS A H    3  
ATOM 3761  H HA   . LYS A 1 42  ? 3.526   6.758   11.956  1.00 0.00 ? 42  LYS A HA   3  
ATOM 3762  H HB2  . LYS A 1 42  ? 0.526   7.052   12.150  1.00 0.00 ? 42  LYS A HB2  3  
ATOM 3763  H HB3  . LYS A 1 42  ? 1.716   7.535   13.350  1.00 0.00 ? 42  LYS A HB3  3  
ATOM 3764  H HG2  . LYS A 1 42  ? 2.445   9.347   12.072  1.00 0.00 ? 42  LYS A HG2  3  
ATOM 3765  H HG3  . LYS A 1 42  ? 1.712   8.716   10.596  1.00 0.00 ? 42  LYS A HG3  3  
ATOM 3766  H HD2  . LYS A 1 42  ? -0.525  8.987   11.818  1.00 0.00 ? 42  LYS A HD2  3  
ATOM 3767  H HD3  . LYS A 1 42  ? 0.371   9.984   12.967  1.00 0.00 ? 42  LYS A HD3  3  
ATOM 3768  H HE2  . LYS A 1 42  ? -0.660  11.385  11.283  1.00 0.00 ? 42  LYS A HE2  3  
ATOM 3769  H HE3  . LYS A 1 42  ? 1.094   11.432  11.113  1.00 0.00 ? 42  LYS A HE3  3  
ATOM 3770  H HZ1  . LYS A 1 42  ? -0.869  10.597  9.235   1.00 0.00 ? 42  LYS A HZ1  3  
ATOM 3771  H HZ2  . LYS A 1 42  ? 0.259   9.366   9.504   1.00 0.00 ? 42  LYS A HZ2  3  
ATOM 3772  H HZ3  . LYS A 1 42  ? 0.780   10.894  8.999   1.00 0.00 ? 42  LYS A HZ3  3  
ATOM 3773  N N    . ARG A 1 43  ? 2.787   4.821   13.481  1.00 0.00 ? 43  ARG A N    3  
ATOM 3774  C CA   . ARG A 1 43  ? 2.622   3.532   14.142  1.00 0.00 ? 43  ARG A CA   3  
ATOM 3775  C C    . ARG A 1 43  ? 1.150   3.251   14.426  1.00 0.00 ? 43  ARG A C    3  
ATOM 3776  O O    . ARG A 1 43  ? 0.687   2.117   14.295  1.00 0.00 ? 43  ARG A O    3  
ATOM 3777  C CB   . ARG A 1 43  ? 3.420   3.500   15.448  1.00 0.00 ? 43  ARG A CB   3  
ATOM 3778  C CG   . ARG A 1 43  ? 4.918   3.347   15.243  1.00 0.00 ? 43  ARG A CG   3  
ATOM 3779  C CD   . ARG A 1 43  ? 5.681   3.543   16.543  1.00 0.00 ? 43  ARG A CD   3  
ATOM 3780  N NE   . ARG A 1 43  ? 5.651   2.347   17.381  1.00 0.00 ? 43  ARG A NE   3  
ATOM 3781  C CZ   . ARG A 1 43  ? 6.417   2.182   18.454  1.00 0.00 ? 43  ARG A CZ   3  
ATOM 3782  N NH1  . ARG A 1 43  ? 7.268   3.132   18.817  1.00 0.00 ? 43  ARG A NH1  3  
ATOM 3783  N NH2  . ARG A 1 43  ? 6.332   1.066   19.166  1.00 0.00 ? 43  ARG A NH2  3  
ATOM 3784  H H    . ARG A 1 43  ? 3.283   5.533   13.937  1.00 0.00 ? 43  ARG A H    3  
ATOM 3785  H HA   . ARG A 1 43  ? 3.002   2.769   13.480  1.00 0.00 ? 43  ARG A HA   3  
ATOM 3786  H HB2  . ARG A 1 43  ? 3.245   4.420   15.986  1.00 0.00 ? 43  ARG A HB2  3  
ATOM 3787  H HB3  . ARG A 1 43  ? 3.073   2.670   16.046  1.00 0.00 ? 43  ARG A HB3  3  
ATOM 3788  H HG2  . ARG A 1 43  ? 5.121   2.355   14.865  1.00 0.00 ? 43  ARG A HG2  3  
ATOM 3789  H HG3  . ARG A 1 43  ? 5.250   4.082   14.525  1.00 0.00 ? 43  ARG A HG3  3  
ATOM 3790  H HD2  . ARG A 1 43  ? 6.708   3.782   16.310  1.00 0.00 ? 43  ARG A HD2  3  
ATOM 3791  H HD3  . ARG A 1 43  ? 5.235   4.363   17.086  1.00 0.00 ? 43  ARG A HD3  3  
ATOM 3792  H HE   . ARG A 1 43  ? 5.029   1.633   17.131  1.00 0.00 ? 43  ARG A HE   3  
ATOM 3793  H HH11 . ARG A 1 43  ? 7.333   3.975   18.283  1.00 0.00 ? 43  ARG A HH11 3  
ATOM 3794  H HH12 . ARG A 1 43  ? 7.843   3.006   19.626  1.00 0.00 ? 43  ARG A HH12 3  
ATOM 3795  H HH21 . ARG A 1 43  ? 5.692   0.348   18.895  1.00 0.00 ? 43  ARG A HH21 3  
ATOM 3796  H HH22 . ARG A 1 43  ? 6.909   0.943   19.973  1.00 0.00 ? 43  ARG A HH22 3  
ATOM 3797  N N    . HIS A 1 44  ? 0.418   4.290   14.815  1.00 0.00 ? 44  HIS A N    3  
ATOM 3798  C CA   . HIS A 1 44  ? -1.002  4.155   15.118  1.00 0.00 ? 44  HIS A CA   3  
ATOM 3799  C C    . HIS A 1 44  ? -1.853  4.521   13.905  1.00 0.00 ? 44  HIS A C    3  
ATOM 3800  O O    . HIS A 1 44  ? -2.883  5.184   14.032  1.00 0.00 ? 44  HIS A O    3  
ATOM 3801  C CB   . HIS A 1 44  ? -1.379  5.041   16.305  1.00 0.00 ? 44  HIS A CB   3  
ATOM 3802  C CG   . HIS A 1 44  ? -1.644  6.466   15.929  1.00 0.00 ? 44  HIS A CG   3  
ATOM 3803  N ND1  . HIS A 1 44  ? -2.739  7.173   16.381  1.00 0.00 ? 44  HIS A ND1  3  
ATOM 3804  C CD2  . HIS A 1 44  ? -0.947  7.318   15.141  1.00 0.00 ? 44  HIS A CD2  3  
ATOM 3805  C CE1  . HIS A 1 44  ? -2.705  8.397   15.885  1.00 0.00 ? 44  HIS A CE1  3  
ATOM 3806  N NE2  . HIS A 1 44  ? -1.627  8.511   15.130  1.00 0.00 ? 44  HIS A NE2  3  
ATOM 3807  H H    . HIS A 1 44  ? 0.844   5.169   14.901  1.00 0.00 ? 44  HIS A H    3  
ATOM 3808  H HA   . HIS A 1 44  ? -1.190  3.124   15.375  1.00 0.00 ? 44  HIS A HA   3  
ATOM 3809  H HB2  . HIS A 1 44  ? -2.273  4.649   16.769  1.00 0.00 ? 44  HIS A HB2  3  
ATOM 3810  H HB3  . HIS A 1 44  ? -0.573  5.031   17.024  1.00 0.00 ? 44  HIS A HB3  3  
ATOM 3811  H HD1  . HIS A 1 44  ? -3.437  6.828   16.975  1.00 0.00 ? 44  HIS A HD1  3  
ATOM 3812  H HD2  . HIS A 1 44  ? -0.027  7.100   14.617  1.00 0.00 ? 44  HIS A HD2  3  
ATOM 3813  H HE1  . HIS A 1 44  ? -3.433  9.173   16.066  1.00 0.00 ? 44  HIS A HE1  3  
ATOM 3814  H HE2  . HIS A 1 44  ? -1.406  9.288   14.575  1.00 0.00 ? 44  HIS A HE2  3  
ATOM 3815  N N    . THR A 1 45  ? -1.416  4.084   12.728  1.00 0.00 ? 45  THR A N    3  
ATOM 3816  C CA   . THR A 1 45  ? -2.135  4.367   11.492  1.00 0.00 ? 45  THR A CA   3  
ATOM 3817  C C    . THR A 1 45  ? -2.486  3.080   10.754  1.00 0.00 ? 45  THR A C    3  
ATOM 3818  O O    . THR A 1 45  ? -1.655  2.188   10.582  1.00 0.00 ? 45  THR A O    3  
ATOM 3819  C CB   . THR A 1 45  ? -1.313  5.274   10.558  1.00 0.00 ? 45  THR A CB   3  
ATOM 3820  O OG1  . THR A 1 45  ? -1.370  6.629   11.016  1.00 0.00 ? 45  THR A OG1  3  
ATOM 3821  C CG2  . THR A 1 45  ? -1.832  5.194   9.131   1.00 0.00 ? 45  THR A CG2  3  
ATOM 3822  H H    . THR A 1 45  ? -0.588  3.560   12.691  1.00 0.00 ? 45  THR A H    3  
ATOM 3823  H HA   . THR A 1 45  ? -3.049  4.883   11.749  1.00 0.00 ? 45  THR A HA   3  
ATOM 3824  H HB   . THR A 1 45  ? -0.285  4.940   10.571  1.00 0.00 ? 45  THR A HB   3  
ATOM 3825  H HG1  . THR A 1 45  ? -2.109  7.078   10.598  1.00 0.00 ? 45  THR A HG1  3  
ATOM 3826  H HG21 . THR A 1 45  ? -1.803  4.168   8.794   1.00 0.00 ? 45  THR A HG21 3  
ATOM 3827  H HG22 . THR A 1 45  ? -1.213  5.802   8.488   1.00 0.00 ? 45  THR A HG22 3  
ATOM 3828  H HG23 . THR A 1 45  ? -2.849  5.554   9.097   1.00 0.00 ? 45  THR A HG23 3  
ATOM 3829  N N    . PRO A 1 46  ? -3.746  2.979   10.305  1.00 0.00 ? 46  PRO A N    3  
ATOM 3830  C CA   . PRO A 1 46  ? -4.235  1.805   9.575   1.00 0.00 ? 46  PRO A CA   3  
ATOM 3831  C C    . PRO A 1 46  ? -3.625  1.693   8.182   1.00 0.00 ? 46  PRO A C    3  
ATOM 3832  O O    . PRO A 1 46  ? -3.750  2.605   7.363   1.00 0.00 ? 46  PRO A O    3  
ATOM 3833  C CB   . PRO A 1 46  ? -5.743  2.049   9.481   1.00 0.00 ? 46  PRO A CB   3  
ATOM 3834  C CG   . PRO A 1 46  ? -5.894  3.529   9.570   1.00 0.00 ? 46  PRO A CG   3  
ATOM 3835  C CD   . PRO A 1 46  ? -4.790  4.004   10.474  1.00 0.00 ? 46  PRO A CD   3  
ATOM 3836  H HA   . PRO A 1 46  ? -4.049  0.893   10.123  1.00 0.00 ? 46  PRO A HA   3  
ATOM 3837  H HB2  . PRO A 1 46  ? -6.113  1.669   8.539   1.00 0.00 ? 46  PRO A HB2  3  
ATOM 3838  H HB3  . PRO A 1 46  ? -6.243  1.552   10.298  1.00 0.00 ? 46  PRO A HB3  3  
ATOM 3839  H HG2  . PRO A 1 46  ? -5.791  3.968   8.590   1.00 0.00 ? 46  PRO A HG2  3  
ATOM 3840  H HG3  . PRO A 1 46  ? -6.856  3.774   9.994   1.00 0.00 ? 46  PRO A HG3  3  
ATOM 3841  H HD2  . PRO A 1 46  ? -4.434  4.973   10.157  1.00 0.00 ? 46  PRO A HD2  3  
ATOM 3842  H HD3  . PRO A 1 46  ? -5.130  4.041   11.498  1.00 0.00 ? 46  PRO A HD3  3  
ATOM 3843  N N    . LEU A 1 47  ? -2.966  0.570   7.919   1.00 0.00 ? 47  LEU A N    3  
ATOM 3844  C CA   . LEU A 1 47  ? -2.337  0.339   6.623   1.00 0.00 ? 47  LEU A CA   3  
ATOM 3845  C C    . LEU A 1 47  ? -3.269  0.745   5.485   1.00 0.00 ? 47  LEU A C    3  
ATOM 3846  O O    . LEU A 1 47  ? -2.822  1.015   4.370   1.00 0.00 ? 47  LEU A O    3  
ATOM 3847  C CB   . LEU A 1 47  ? -1.949  -1.134  6.478   1.00 0.00 ? 47  LEU A CB   3  
ATOM 3848  C CG   . LEU A 1 47  ? -1.021  -1.692  7.558   1.00 0.00 ? 47  LEU A CG   3  
ATOM 3849  C CD1  . LEU A 1 47  ? -0.832  -3.190  7.376   1.00 0.00 ? 47  LEU A CD1  3  
ATOM 3850  C CD2  . LEU A 1 47  ? 0.321   -0.976  7.530   1.00 0.00 ? 47  LEU A CD2  3  
ATOM 3851  H H    . LEU A 1 47  ? -2.901  -0.120  8.611   1.00 0.00 ? 47  LEU A H    3  
ATOM 3852  H HA   . LEU A 1 47  ? -1.445  0.944   6.575   1.00 0.00 ? 47  LEU A HA   3  
ATOM 3853  H HB2  . LEU A 1 47  ? -2.857  -1.718  6.489   1.00 0.00 ? 47  LEU A HB2  3  
ATOM 3854  H HB3  . LEU A 1 47  ? -1.457  -1.253  5.524   1.00 0.00 ? 47  LEU A HB3  3  
ATOM 3855  H HG   . LEU A 1 47  ? -1.469  -1.528  8.529   1.00 0.00 ? 47  LEU A HG   3  
ATOM 3856  H HD11 . LEU A 1 47  ? -0.533  -3.395  6.359   1.00 0.00 ? 47  LEU A HD11 3  
ATOM 3857  H HD12 . LEU A 1 47  ? -1.761  -3.699  7.588   1.00 0.00 ? 47  LEU A HD12 3  
ATOM 3858  H HD13 . LEU A 1 47  ? -0.067  -3.541  8.054   1.00 0.00 ? 47  LEU A HD13 3  
ATOM 3859  H HD21 . LEU A 1 47  ? 0.529   -0.564  8.507   1.00 0.00 ? 47  LEU A HD21 3  
ATOM 3860  H HD22 . LEU A 1 47  ? 0.288   -0.178  6.802   1.00 0.00 ? 47  LEU A HD22 3  
ATOM 3861  H HD23 . LEU A 1 47  ? 1.098   -1.677  7.262   1.00 0.00 ? 47  LEU A HD23 3  
ATOM 3862  N N    . SER A 1 48  ? -4.565  0.787   5.775   1.00 0.00 ? 48  SER A N    3  
ATOM 3863  C CA   . SER A 1 48  ? -5.560  1.159   4.776   1.00 0.00 ? 48  SER A CA   3  
ATOM 3864  C C    . SER A 1 48  ? -5.004  2.210   3.820   1.00 0.00 ? 48  SER A C    3  
ATOM 3865  O O    . SER A 1 48  ? -4.903  1.980   2.615   1.00 0.00 ? 48  SER A O    3  
ATOM 3866  C CB   . SER A 1 48  ? -6.824  1.689   5.456   1.00 0.00 ? 48  SER A CB   3  
ATOM 3867  O OG   . SER A 1 48  ? -7.794  2.077   4.499   1.00 0.00 ? 48  SER A OG   3  
ATOM 3868  H H    . SER A 1 48  ? -4.859  0.561   6.682   1.00 0.00 ? 48  SER A H    3  
ATOM 3869  H HA   . SER A 1 48  ? -5.810  0.273   4.211   1.00 0.00 ? 48  SER A HA   3  
ATOM 3870  H HB2  . SER A 1 48  ? -7.243  0.917   6.083   1.00 0.00 ? 48  SER A HB2  3  
ATOM 3871  H HB3  . SER A 1 48  ? -6.570  2.547   6.062   1.00 0.00 ? 48  SER A HB3  3  
ATOM 3872  H HG   . SER A 1 48  ? -8.223  2.886   4.787   1.00 0.00 ? 48  SER A HG   3  
ATOM 3873  N N    . LYS A 1 49  ? -4.644  3.366   4.367   1.00 0.00 ? 49  LYS A N    3  
ATOM 3874  C CA   . LYS A 1 49  ? -4.096  4.455   3.567   1.00 0.00 ? 49  LYS A CA   3  
ATOM 3875  C C    . LYS A 1 49  ? -2.890  3.984   2.760   1.00 0.00 ? 49  LYS A C    3  
ATOM 3876  O O    . LYS A 1 49  ? -2.784  4.259   1.564   1.00 0.00 ? 49  LYS A O    3  
ATOM 3877  C CB   . LYS A 1 49  ? -3.696  5.626   4.466   1.00 0.00 ? 49  LYS A CB   3  
ATOM 3878  C CG   . LYS A 1 49  ? -4.835  6.154   5.321   1.00 0.00 ? 49  LYS A CG   3  
ATOM 3879  C CD   . LYS A 1 49  ? -4.415  7.380   6.114   1.00 0.00 ? 49  LYS A CD   3  
ATOM 3880  C CE   . LYS A 1 49  ? -4.544  8.650   5.287   1.00 0.00 ? 49  LYS A CE   3  
ATOM 3881  N NZ   . LYS A 1 49  ? -5.959  9.102   5.182   1.00 0.00 ? 49  LYS A NZ   3  
ATOM 3882  H H    . LYS A 1 49  ? -4.748  3.490   5.335   1.00 0.00 ? 49  LYS A H    3  
ATOM 3883  H HA   . LYS A 1 49  ? -4.865  4.783   2.883   1.00 0.00 ? 49  LYS A HA   3  
ATOM 3884  H HB2  . LYS A 1 49  ? -2.900  5.305   5.123   1.00 0.00 ? 49  LYS A HB2  3  
ATOM 3885  H HB3  . LYS A 1 49  ? -3.335  6.434   3.846   1.00 0.00 ? 49  LYS A HB3  3  
ATOM 3886  H HG2  . LYS A 1 49  ? -5.662  6.420   4.678   1.00 0.00 ? 49  LYS A HG2  3  
ATOM 3887  H HG3  . LYS A 1 49  ? -5.146  5.380   6.009   1.00 0.00 ? 49  LYS A HG3  3  
ATOM 3888  H HD2  . LYS A 1 49  ? -5.046  7.467   6.987   1.00 0.00 ? 49  LYS A HD2  3  
ATOM 3889  H HD3  . LYS A 1 49  ? -3.386  7.264   6.422   1.00 0.00 ? 49  LYS A HD3  3  
ATOM 3890  H HE2  . LYS A 1 49  ? -3.961  9.429   5.753   1.00 0.00 ? 49  LYS A HE2  3  
ATOM 3891  H HE3  . LYS A 1 49  ? -4.162  8.459   4.295   1.00 0.00 ? 49  LYS A HE3  3  
ATOM 3892  H HZ1  . LYS A 1 49  ? -6.453  8.942   6.083   1.00 0.00 ? 49  LYS A HZ1  3  
ATOM 3893  H HZ2  . LYS A 1 49  ? -6.449  8.572   4.432   1.00 0.00 ? 49  LYS A HZ2  3  
ATOM 3894  H HZ3  . LYS A 1 49  ? -5.995  10.116  4.954   1.00 0.00 ? 49  LYS A HZ3  3  
ATOM 3895  N N    . LEU A 1 50  ? -1.984  3.272   3.422   1.00 0.00 ? 50  LEU A N    3  
ATOM 3896  C CA   . LEU A 1 50  ? -0.785  2.761   2.766   1.00 0.00 ? 50  LEU A CA   3  
ATOM 3897  C C    . LEU A 1 50  ? -1.148  1.916   1.549   1.00 0.00 ? 50  LEU A C    3  
ATOM 3898  O O    . LEU A 1 50  ? -0.724  2.206   0.431   1.00 0.00 ? 50  LEU A O    3  
ATOM 3899  C CB   . LEU A 1 50  ? 0.043   1.930   3.748   1.00 0.00 ? 50  LEU A CB   3  
ATOM 3900  C CG   . LEU A 1 50  ? 0.920   0.840   3.132   1.00 0.00 ? 50  LEU A CG   3  
ATOM 3901  C CD1  . LEU A 1 50  ? 1.849   1.431   2.084   1.00 0.00 ? 50  LEU A CD1  3  
ATOM 3902  C CD2  . LEU A 1 50  ? 1.718   0.124   4.212   1.00 0.00 ? 50  LEU A CD2  3  
ATOM 3903  H H    . LEU A 1 50  ? -2.123  3.085   4.373   1.00 0.00 ? 50  LEU A H    3  
ATOM 3904  H HA   . LEU A 1 50  ? -0.199  3.607   2.440   1.00 0.00 ? 50  LEU A HA   3  
ATOM 3905  H HB2  . LEU A 1 50  ? 0.687   2.605   4.291   1.00 0.00 ? 50  LEU A HB2  3  
ATOM 3906  H HB3  . LEU A 1 50  ? -0.641  1.456   4.438   1.00 0.00 ? 50  LEU A HB3  3  
ATOM 3907  H HG   . LEU A 1 50  ? 0.287   0.111   2.644   1.00 0.00 ? 50  LEU A HG   3  
ATOM 3908  H HD11 . LEU A 1 50  ? 1.960   2.490   2.257   1.00 0.00 ? 50  LEU A HD11 3  
ATOM 3909  H HD12 . LEU A 1 50  ? 1.432   1.269   1.101   1.00 0.00 ? 50  LEU A HD12 3  
ATOM 3910  H HD13 . LEU A 1 50  ? 2.815   0.952   2.148   1.00 0.00 ? 50  LEU A HD13 3  
ATOM 3911  H HD21 . LEU A 1 50  ? 1.534   -0.938  4.150   1.00 0.00 ? 50  LEU A HD21 3  
ATOM 3912  H HD22 . LEU A 1 50  ? 1.414   0.486   5.184   1.00 0.00 ? 50  LEU A HD22 3  
ATOM 3913  H HD23 . LEU A 1 50  ? 2.771   0.317   4.069   1.00 0.00 ? 50  LEU A HD23 3  
ATOM 3914  N N    . MET A 1 51  ? -1.938  0.872   1.774   1.00 0.00 ? 51  MET A N    3  
ATOM 3915  C CA   . MET A 1 51  ? -2.362  -0.013  0.695   1.00 0.00 ? 51  MET A CA   3  
ATOM 3916  C C    . MET A 1 51  ? -3.036  0.777   -0.423  1.00 0.00 ? 51  MET A C    3  
ATOM 3917  O O    . MET A 1 51  ? -2.517  0.863   -1.536  1.00 0.00 ? 51  MET A O    3  
ATOM 3918  C CB   . MET A 1 51  ? -3.318  -1.081  1.228   1.00 0.00 ? 51  MET A CB   3  
ATOM 3919  C CG   . MET A 1 51  ? -2.766  -1.854  2.415   1.00 0.00 ? 51  MET A CG   3  
ATOM 3920  S SD   . MET A 1 51  ? -4.059  -2.432  3.530   1.00 0.00 ? 51  MET A SD   3  
ATOM 3921  C CE   . MET A 1 51  ? -3.371  -3.998  4.063   1.00 0.00 ? 51  MET A CE   3  
ATOM 3922  H H    . MET A 1 51  ? -2.245  0.691   2.687   1.00 0.00 ? 51  MET A H    3  
ATOM 3923  H HA   . MET A 1 51  ? -1.482  -0.496  0.298   1.00 0.00 ? 51  MET A HA   3  
ATOM 3924  H HB2  . MET A 1 51  ? -4.238  -0.605  1.533   1.00 0.00 ? 51  MET A HB2  3  
ATOM 3925  H HB3  . MET A 1 51  ? -3.531  -1.785  0.436   1.00 0.00 ? 51  MET A HB3  3  
ATOM 3926  H HG2  . MET A 1 51  ? -2.218  -2.710  2.048   1.00 0.00 ? 51  MET A HG2  3  
ATOM 3927  H HG3  . MET A 1 51  ? -2.096  -1.210  2.965   1.00 0.00 ? 51  MET A HG3  3  
ATOM 3928  H HE1  . MET A 1 51  ? -4.112  -4.542  4.630   1.00 0.00 ? 51  MET A HE1  3  
ATOM 3929  H HE2  . MET A 1 51  ? -3.083  -4.577  3.199   1.00 0.00 ? 51  MET A HE2  3  
ATOM 3930  H HE3  . MET A 1 51  ? -2.504  -3.817  4.682   1.00 0.00 ? 51  MET A HE3  3  
ATOM 3931  N N    . LYS A 1 52  ? -4.194  1.352   -0.119  1.00 0.00 ? 52  LYS A N    3  
ATOM 3932  C CA   . LYS A 1 52  ? -4.939  2.136   -1.097  1.00 0.00 ? 52  LYS A CA   3  
ATOM 3933  C C    . LYS A 1 52  ? -3.995  2.955   -1.971  1.00 0.00 ? 52  LYS A C    3  
ATOM 3934  O O    . LYS A 1 52  ? -4.130  2.979   -3.194  1.00 0.00 ? 52  LYS A O    3  
ATOM 3935  C CB   . LYS A 1 52  ? -5.930  3.064   -0.390  1.00 0.00 ? 52  LYS A CB   3  
ATOM 3936  C CG   . LYS A 1 52  ? -7.089  2.331   0.264   1.00 0.00 ? 52  LYS A CG   3  
ATOM 3937  C CD   . LYS A 1 52  ? -8.317  3.218   0.377   1.00 0.00 ? 52  LYS A CD   3  
ATOM 3938  C CE   . LYS A 1 52  ? -9.595  2.396   0.439   1.00 0.00 ? 52  LYS A CE   3  
ATOM 3939  N NZ   . LYS A 1 52  ? -10.810 3.253   0.357   1.00 0.00 ? 52  LYS A NZ   3  
ATOM 3940  H H    . LYS A 1 52  ? -4.557  1.248   0.786   1.00 0.00 ? 52  LYS A H    3  
ATOM 3941  H HA   . LYS A 1 52  ? -5.487  1.450   -1.725  1.00 0.00 ? 52  LYS A HA   3  
ATOM 3942  H HB2  . LYS A 1 52  ? -5.404  3.617   0.374   1.00 0.00 ? 52  LYS A HB2  3  
ATOM 3943  H HB3  . LYS A 1 52  ? -6.333  3.759   -1.113  1.00 0.00 ? 52  LYS A HB3  3  
ATOM 3944  H HG2  . LYS A 1 52  ? -7.337  1.465   -0.332  1.00 0.00 ? 52  LYS A HG2  3  
ATOM 3945  H HG3  . LYS A 1 52  ? -6.791  2.016   1.254   1.00 0.00 ? 52  LYS A HG3  3  
ATOM 3946  H HD2  . LYS A 1 52  ? -8.240  3.811   1.276   1.00 0.00 ? 52  LYS A HD2  3  
ATOM 3947  H HD3  . LYS A 1 52  ? -8.360  3.870   -0.484  1.00 0.00 ? 52  LYS A HD3  3  
ATOM 3948  H HE2  . LYS A 1 52  ? -9.600  1.700   -0.386  1.00 0.00 ? 52  LYS A HE2  3  
ATOM 3949  H HE3  . LYS A 1 52  ? -9.611  1.850   1.370   1.00 0.00 ? 52  LYS A HE3  3  
ATOM 3950  H HZ1  . LYS A 1 52  ? -11.659 2.688   0.563   1.00 0.00 ? 52  LYS A HZ1  3  
ATOM 3951  H HZ2  . LYS A 1 52  ? -10.899 3.657   -0.597  1.00 0.00 ? 52  LYS A HZ2  3  
ATOM 3952  H HZ3  . LYS A 1 52  ? -10.748 4.029   1.046   1.00 0.00 ? 52  LYS A HZ3  3  
ATOM 3953  N N    . ALA A 1 53  ? -3.038  3.624   -1.335  1.00 0.00 ? 53  ALA A N    3  
ATOM 3954  C CA   . ALA A 1 53  ? -2.069  4.441   -2.056  1.00 0.00 ? 53  ALA A CA   3  
ATOM 3955  C C    . ALA A 1 53  ? -1.174  3.580   -2.940  1.00 0.00 ? 53  ALA A C    3  
ATOM 3956  O O    . ALA A 1 53  ? -0.805  3.981   -4.044  1.00 0.00 ? 53  ALA A O    3  
ATOM 3957  C CB   . ALA A 1 53  ? -1.229  5.248   -1.077  1.00 0.00 ? 53  ALA A CB   3  
ATOM 3958  H H    . ALA A 1 53  ? -2.982  3.566   -0.359  1.00 0.00 ? 53  ALA A H    3  
ATOM 3959  H HA   . ALA A 1 53  ? -2.616  5.134   -2.680  1.00 0.00 ? 53  ALA A HA   3  
ATOM 3960  H HB1  . ALA A 1 53  ? -0.869  6.142   -1.566  1.00 0.00 ? 53  ALA A HB1  3  
ATOM 3961  H HB2  . ALA A 1 53  ? -1.832  5.521   -0.224  1.00 0.00 ? 53  ALA A HB2  3  
ATOM 3962  H HB3  . ALA A 1 53  ? -0.389  4.654   -0.750  1.00 0.00 ? 53  ALA A HB3  3  
ATOM 3963  N N    . TYR A 1 54  ? -0.829  2.395   -2.448  1.00 0.00 ? 54  TYR A N    3  
ATOM 3964  C CA   . TYR A 1 54  ? 0.026   1.479   -3.193  1.00 0.00 ? 54  TYR A CA   3  
ATOM 3965  C C    . TYR A 1 54  ? -0.595  1.129   -4.542  1.00 0.00 ? 54  TYR A C    3  
ATOM 3966  O O    . TYR A 1 54  ? 0.113   0.854   -5.512  1.00 0.00 ? 54  TYR A O    3  
ATOM 3967  C CB   . TYR A 1 54  ? 0.268   0.203   -2.385  1.00 0.00 ? 54  TYR A CB   3  
ATOM 3968  C CG   . TYR A 1 54  ? 1.147   -0.804  -3.091  1.00 0.00 ? 54  TYR A CG   3  
ATOM 3969  C CD1  . TYR A 1 54  ? 2.530   -0.676  -3.082  1.00 0.00 ? 54  TYR A CD1  3  
ATOM 3970  C CD2  . TYR A 1 54  ? 0.594   -1.884  -3.768  1.00 0.00 ? 54  TYR A CD2  3  
ATOM 3971  C CE1  . TYR A 1 54  ? 3.337   -1.593  -3.726  1.00 0.00 ? 54  TYR A CE1  3  
ATOM 3972  C CE2  . TYR A 1 54  ? 1.393   -2.808  -4.414  1.00 0.00 ? 54  TYR A CE2  3  
ATOM 3973  C CZ   . TYR A 1 54  ? 2.764   -2.657  -4.391  1.00 0.00 ? 54  TYR A CZ   3  
ATOM 3974  O OH   . TYR A 1 54  ? 3.564   -3.574  -5.033  1.00 0.00 ? 54  TYR A OH   3  
ATOM 3975  H H    . TYR A 1 54  ? -1.155  2.132   -1.563  1.00 0.00 ? 54  TYR A H    3  
ATOM 3976  H HA   . TYR A 1 54  ? 0.973   1.971   -3.362  1.00 0.00 ? 54  TYR A HA   3  
ATOM 3977  H HB2  . TYR A 1 54  ? 0.744   0.461   -1.452  1.00 0.00 ? 54  TYR A HB2  3  
ATOM 3978  H HB3  . TYR A 1 54  ? -0.681  -0.271  -2.180  1.00 0.00 ? 54  TYR A HB3  3  
ATOM 3979  H HD1  . TYR A 1 54  ? 2.976   0.158   -2.559  1.00 0.00 ? 54  TYR A HD1  3  
ATOM 3980  H HD2  . TYR A 1 54  ? -0.480  -1.999  -3.785  1.00 0.00 ? 54  TYR A HD2  3  
ATOM 3981  H HE1  . TYR A 1 54  ? 4.411   -1.476  -3.708  1.00 0.00 ? 54  TYR A HE1  3  
ATOM 3982  H HE2  . TYR A 1 54  ? 0.945   -3.641  -4.935  1.00 0.00 ? 54  TYR A HE2  3  
ATOM 3983  H HH   . TYR A 1 54  ? 4.376   -3.147  -5.316  1.00 0.00 ? 54  TYR A HH   3  
ATOM 3984  N N    . CYS A 1 55  ? -1.922  1.143   -4.596  1.00 0.00 ? 55  CYS A N    3  
ATOM 3985  C CA   . CYS A 1 55  ? -2.641  0.827   -5.826  1.00 0.00 ? 55  CYS A CA   3  
ATOM 3986  C C    . CYS A 1 55  ? -2.605  2.006   -6.794  1.00 0.00 ? 55  CYS A C    3  
ATOM 3987  O O    . CYS A 1 55  ? -2.146  1.875   -7.928  1.00 0.00 ? 55  CYS A O    3  
ATOM 3988  C CB   . CYS A 1 55  ? -4.090  0.453   -5.512  1.00 0.00 ? 55  CYS A CB   3  
ATOM 3989  S SG   . CYS A 1 55  ? -4.263  -0.975  -4.416  1.00 0.00 ? 55  CYS A SG   3  
ATOM 3990  H H    . CYS A 1 55  ? -2.432  1.370   -3.790  1.00 0.00 ? 55  CYS A H    3  
ATOM 3991  H HA   . CYS A 1 55  ? -2.152  -0.017  -6.287  1.00 0.00 ? 55  CYS A HA   3  
ATOM 3992  H HB2  . CYS A 1 55  ? -4.576  1.292   -5.036  1.00 0.00 ? 55  CYS A HB2  3  
ATOM 3993  H HB3  . CYS A 1 55  ? -4.603  0.225   -6.435  1.00 0.00 ? 55  CYS A HB3  3  
ATOM 3994  H HG   . CYS A 1 55  ? -4.908  -0.579  -3.329  1.00 0.00 ? 55  CYS A HG   3  
ATOM 3995  N N    . GLU A 1 56  ? -3.094  3.155   -6.338  1.00 0.00 ? 56  GLU A N    3  
ATOM 3996  C CA   . GLU A 1 56  ? -3.120  4.355   -7.166  1.00 0.00 ? 56  GLU A CA   3  
ATOM 3997  C C    . GLU A 1 56  ? -1.735  4.657   -7.729  1.00 0.00 ? 56  GLU A C    3  
ATOM 3998  O O    . GLU A 1 56  ? -1.593  5.013   -8.900  1.00 0.00 ? 56  GLU A O    3  
ATOM 3999  C CB   . GLU A 1 56  ? -3.625  5.550   -6.354  1.00 0.00 ? 56  GLU A CB   3  
ATOM 4000  C CG   . GLU A 1 56  ? -2.525  6.286   -5.607  1.00 0.00 ? 56  GLU A CG   3  
ATOM 4001  C CD   . GLU A 1 56  ? -3.050  7.460   -4.804  1.00 0.00 ? 56  GLU A CD   3  
ATOM 4002  O OE1  . GLU A 1 56  ? -4.010  7.268   -4.030  1.00 0.00 ? 56  GLU A OE1  3  
ATOM 4003  O OE2  . GLU A 1 56  ? -2.499  8.572   -4.951  1.00 0.00 ? 56  GLU A OE2  3  
ATOM 4004  H H    . GLU A 1 56  ? -3.446  3.196   -5.424  1.00 0.00 ? 56  GLU A H    3  
ATOM 4005  H HA   . GLU A 1 56  ? -3.799  4.177   -7.986  1.00 0.00 ? 56  GLU A HA   3  
ATOM 4006  H HB2  . GLU A 1 56  ? -4.106  6.247   -7.024  1.00 0.00 ? 56  GLU A HB2  3  
ATOM 4007  H HB3  . GLU A 1 56  ? -4.348  5.200   -5.633  1.00 0.00 ? 56  GLU A HB3  3  
ATOM 4008  H HG2  . GLU A 1 56  ? -2.041  5.596   -4.932  1.00 0.00 ? 56  GLU A HG2  3  
ATOM 4009  H HG3  . GLU A 1 56  ? -1.804  6.652   -6.323  1.00 0.00 ? 56  GLU A HG3  3  
ATOM 4010  N N    . ARG A 1 57  ? -0.716  4.513   -6.888  1.00 0.00 ? 57  ARG A N    3  
ATOM 4011  C CA   . ARG A 1 57  ? 0.658   4.772   -7.301  1.00 0.00 ? 57  ARG A CA   3  
ATOM 4012  C C    . ARG A 1 57  ? 0.992   4.014   -8.583  1.00 0.00 ? 57  ARG A C    3  
ATOM 4013  O O    . ARG A 1 57  ? 1.515   4.590   -9.537  1.00 0.00 ? 57  ARG A O    3  
ATOM 4014  C CB   . ARG A 1 57  ? 1.631   4.372   -6.191  1.00 0.00 ? 57  ARG A CB   3  
ATOM 4015  C CG   . ARG A 1 57  ? 3.056   4.842   -6.431  1.00 0.00 ? 57  ARG A CG   3  
ATOM 4016  C CD   . ARG A 1 57  ? 3.870   4.832   -5.147  1.00 0.00 ? 57  ARG A CD   3  
ATOM 4017  N NE   . ARG A 1 57  ? 5.199   5.407   -5.337  1.00 0.00 ? 57  ARG A NE   3  
ATOM 4018  C CZ   . ARG A 1 57  ? 5.971   5.821   -4.338  1.00 0.00 ? 57  ARG A CZ   3  
ATOM 4019  N NH1  . ARG A 1 57  ? 5.548   5.724   -3.086  1.00 0.00 ? 57  ARG A NH1  3  
ATOM 4020  N NH2  . ARG A 1 57  ? 7.169   6.332   -4.592  1.00 0.00 ? 57  ARG A NH2  3  
ATOM 4021  H H    . ARG A 1 57  ? -0.892  4.227   -5.968  1.00 0.00 ? 57  ARG A H    3  
ATOM 4022  H HA   . ARG A 1 57  ? 0.754   5.831   -7.488  1.00 0.00 ? 57  ARG A HA   3  
ATOM 4023  H HB2  . ARG A 1 57  ? 1.289   4.796   -5.258  1.00 0.00 ? 57  ARG A HB2  3  
ATOM 4024  H HB3  . ARG A 1 57  ? 1.639   3.296   -6.106  1.00 0.00 ? 57  ARG A HB3  3  
ATOM 4025  H HG2  . ARG A 1 57  ? 3.526   4.183   -7.147  1.00 0.00 ? 57  ARG A HG2  3  
ATOM 4026  H HG3  . ARG A 1 57  ? 3.033   5.847   -6.825  1.00 0.00 ? 57  ARG A HG3  3  
ATOM 4027  H HD2  . ARG A 1 57  ? 3.344   5.406   -4.399  1.00 0.00 ? 57  ARG A HD2  3  
ATOM 4028  H HD3  . ARG A 1 57  ? 3.974   3.812   -4.810  1.00 0.00 ? 57  ARG A HD3  3  
ATOM 4029  H HE   . ARG A 1 57  ? 5.532   5.487   -6.255  1.00 0.00 ? 57  ARG A HE   3  
ATOM 4030  H HH11 . ARG A 1 57  ? 4.646   5.338   -2.892  1.00 0.00 ? 57  ARG A HH11 3  
ATOM 4031  H HH12 . ARG A 1 57  ? 6.131   6.035   -2.335  1.00 0.00 ? 57  ARG A HH12 3  
ATOM 4032  H HH21 . ARG A 1 57  ? 7.491   6.407   -5.535  1.00 0.00 ? 57  ARG A HH21 3  
ATOM 4033  H HH22 . ARG A 1 57  ? 7.748   6.644   -3.839  1.00 0.00 ? 57  ARG A HH22 3  
ATOM 4034  N N    . GLN A 1 58  ? 0.688   2.720   -8.595  1.00 0.00 ? 58  GLN A N    3  
ATOM 4035  C CA   . GLN A 1 58  ? 0.958   1.884   -9.759  1.00 0.00 ? 58  GLN A CA   3  
ATOM 4036  C C    . GLN A 1 58  ? -0.303  1.693   -10.596 1.00 0.00 ? 58  GLN A C    3  
ATOM 4037  O O    . GLN A 1 58  ? -0.304  0.943   -11.571 1.00 0.00 ? 58  GLN A O    3  
ATOM 4038  C CB   . GLN A 1 58  ? 1.504   0.524   -9.320  1.00 0.00 ? 58  GLN A CB   3  
ATOM 4039  C CG   . GLN A 1 58  ? 2.755   0.619   -8.462  1.00 0.00 ? 58  GLN A CG   3  
ATOM 4040  C CD   . GLN A 1 58  ? 4.026   0.675   -9.286  1.00 0.00 ? 58  GLN A CD   3  
ATOM 4041  O OE1  . GLN A 1 58  ? 4.144   0.005   -10.313 1.00 0.00 ? 58  GLN A OE1  3  
ATOM 4042  N NE2  . GLN A 1 58  ? 4.987   1.476   -8.841  1.00 0.00 ? 58  GLN A NE2  3  
ATOM 4043  H H    . GLN A 1 58  ? 0.273   2.319   -7.804  1.00 0.00 ? 58  GLN A H    3  
ATOM 4044  H HA   . GLN A 1 58  ? 1.702   2.383   -10.360 1.00 0.00 ? 58  GLN A HA   3  
ATOM 4045  H HB2  . GLN A 1 58  ? 0.743   0.009   -8.754  1.00 0.00 ? 58  GLN A HB2  3  
ATOM 4046  H HB3  . GLN A 1 58  ? 1.741   -0.056  -10.200 1.00 0.00 ? 58  GLN A HB3  3  
ATOM 4047  H HG2  . GLN A 1 58  ? 2.696   1.514   -7.860  1.00 0.00 ? 58  GLN A HG2  3  
ATOM 4048  H HG3  . GLN A 1 58  ? 2.799   -0.245  -7.816  1.00 0.00 ? 58  GLN A HG3  3  
ATOM 4049  H HE21 . GLN A 1 58  ? 4.823   1.979   -8.015  1.00 0.00 ? 58  GLN A HE21 3  
ATOM 4050  H HE22 . GLN A 1 58  ? 5.819   1.531   -9.354  1.00 0.00 ? 58  GLN A HE22 3  
ATOM 4051  N N    . GLY A 1 59  ? -1.375  2.377   -10.208 1.00 0.00 ? 59  GLY A N    3  
ATOM 4052  C CA   . GLY A 1 59  ? -2.627  2.268   -10.933 1.00 0.00 ? 59  GLY A CA   3  
ATOM 4053  C C    . GLY A 1 59  ? -3.120  0.837   -11.027 1.00 0.00 ? 59  GLY A C    3  
ATOM 4054  O O    . GLY A 1 59  ? -3.695  0.436   -12.039 1.00 0.00 ? 59  GLY A O    3  
ATOM 4055  H H    . GLY A 1 59  ? -1.315  2.960   -9.422  1.00 0.00 ? 59  GLY A H    3  
ATOM 4056  H HA2  . GLY A 1 59  ? -3.374  2.863   -10.430 1.00 0.00 ? 59  GLY A HA2  3  
ATOM 4057  H HA3  . GLY A 1 59  ? -2.486  2.654   -11.932 1.00 0.00 ? 59  GLY A HA3  3  
ATOM 4058  N N    . LEU A 1 60  ? -2.894  0.065   -9.970  1.00 0.00 ? 60  LEU A N    3  
ATOM 4059  C CA   . LEU A 1 60  ? -3.318  -1.330  -9.937  1.00 0.00 ? 60  LEU A CA   3  
ATOM 4060  C C    . LEU A 1 60  ? -4.633  -1.482  -9.180  1.00 0.00 ? 60  LEU A C    3  
ATOM 4061  O O    . LEU A 1 60  ? -5.184  -0.507  -8.670  1.00 0.00 ? 60  LEU A O    3  
ATOM 4062  C CB   . LEU A 1 60  ? -2.238  -2.197  -9.287  1.00 0.00 ? 60  LEU A CB   3  
ATOM 4063  C CG   . LEU A 1 60  ? -0.846  -2.117  -9.913  1.00 0.00 ? 60  LEU A CG   3  
ATOM 4064  C CD1  . LEU A 1 60  ? 0.138   -2.979  -9.138  1.00 0.00 ? 60  LEU A CD1  3  
ATOM 4065  C CD2  . LEU A 1 60  ? -0.892  -2.539  -11.374 1.00 0.00 ? 60  LEU A CD2  3  
ATOM 4066  H H    . LEU A 1 60  ? -2.431  0.441   -9.193  1.00 0.00 ? 60  LEU A H    3  
ATOM 4067  H HA   . LEU A 1 60  ? -3.464  -1.656  -10.957 1.00 0.00 ? 60  LEU A HA   3  
ATOM 4068  H HB2  . LEU A 1 60  ? -2.154  -1.899  -8.253  1.00 0.00 ? 60  LEU A HB2  3  
ATOM 4069  H HB3  . LEU A 1 60  ? -2.566  -3.226  -9.338  1.00 0.00 ? 60  LEU A HB3  3  
ATOM 4070  H HG   . LEU A 1 60  ? -0.498  -1.094  -9.871  1.00 0.00 ? 60  LEU A HG   3  
ATOM 4071  H HD11 . LEU A 1 60  ? 0.850   -2.345  -8.630  1.00 0.00 ? 60  LEU A HD11 3  
ATOM 4072  H HD12 . LEU A 1 60  ? 0.661   -3.631  -9.822  1.00 0.00 ? 60  LEU A HD12 3  
ATOM 4073  H HD13 . LEU A 1 60  ? -0.398  -3.573  -8.413  1.00 0.00 ? 60  LEU A HD13 3  
ATOM 4074  H HD21 . LEU A 1 60  ? 0.032   -3.033  -11.635 1.00 0.00 ? 60  LEU A HD21 3  
ATOM 4075  H HD22 . LEU A 1 60  ? -1.022  -1.666  -11.997 1.00 0.00 ? 60  LEU A HD22 3  
ATOM 4076  H HD23 . LEU A 1 60  ? -1.719  -3.217  -11.526 1.00 0.00 ? 60  LEU A HD23 3  
ATOM 4077  N N    . SER A 1 61  ? -5.130  -2.713  -9.109  1.00 0.00 ? 61  SER A N    3  
ATOM 4078  C CA   . SER A 1 61  ? -6.382  -2.993  -8.415  1.00 0.00 ? 61  SER A CA   3  
ATOM 4079  C C    . SER A 1 61  ? -6.117  -3.605  -7.043  1.00 0.00 ? 61  SER A C    3  
ATOM 4080  O O    . SER A 1 61  ? -5.339  -4.549  -6.912  1.00 0.00 ? 61  SER A O    3  
ATOM 4081  C CB   . SER A 1 61  ? -7.252  -3.937  -9.247  1.00 0.00 ? 61  SER A CB   3  
ATOM 4082  O OG   . SER A 1 61  ? -7.926  -3.234  -10.277 1.00 0.00 ? 61  SER A OG   3  
ATOM 4083  H H    . SER A 1 61  ? -4.645  -3.450  -9.536  1.00 0.00 ? 61  SER A H    3  
ATOM 4084  H HA   . SER A 1 61  ? -6.905  -2.057  -8.284  1.00 0.00 ? 61  SER A HA   3  
ATOM 4085  H HB2  . SER A 1 61  ? -6.628  -4.696  -9.695  1.00 0.00 ? 61  SER A HB2  3  
ATOM 4086  H HB3  . SER A 1 61  ? -7.985  -4.405  -8.607  1.00 0.00 ? 61  SER A HB3  3  
ATOM 4087  H HG   . SER A 1 61  ? -8.164  -3.844  -10.979 1.00 0.00 ? 61  SER A HG   3  
ATOM 4088  N N    . MET A 1 62  ? -6.770  -3.059  -6.022  1.00 0.00 ? 62  MET A N    3  
ATOM 4089  C CA   . MET A 1 62  ? -6.607  -3.552  -4.659  1.00 0.00 ? 62  MET A CA   3  
ATOM 4090  C C    . MET A 1 62  ? -6.849  -5.056  -4.592  1.00 0.00 ? 62  MET A C    3  
ATOM 4091  O O    . MET A 1 62  ? -5.994  -5.812  -4.130  1.00 0.00 ? 62  MET A O    3  
ATOM 4092  C CB   . MET A 1 62  ? -7.565  -2.826  -3.713  1.00 0.00 ? 62  MET A CB   3  
ATOM 4093  C CG   . MET A 1 62  ? -7.301  -3.111  -2.244  1.00 0.00 ? 62  MET A CG   3  
ATOM 4094  S SD   . MET A 1 62  ? -5.689  -2.513  -1.699  1.00 0.00 ? 62  MET A SD   3  
ATOM 4095  C CE   . MET A 1 62  ? -6.157  -1.518  -0.286  1.00 0.00 ? 62  MET A CE   3  
ATOM 4096  H H    . MET A 1 62  ? -7.378  -2.308  -6.189  1.00 0.00 ? 62  MET A H    3  
ATOM 4097  H HA   . MET A 1 62  ? -5.591  -3.349  -4.353  1.00 0.00 ? 62  MET A HA   3  
ATOM 4098  H HB2  . MET A 1 62  ? -7.474  -1.762  -3.874  1.00 0.00 ? 62  MET A HB2  3  
ATOM 4099  H HB3  . MET A 1 62  ? -8.576  -3.131  -3.940  1.00 0.00 ? 62  MET A HB3  3  
ATOM 4100  H HG2  . MET A 1 62  ? -8.065  -2.629  -1.653  1.00 0.00 ? 62  MET A HG2  3  
ATOM 4101  H HG3  . MET A 1 62  ? -7.346  -4.178  -2.085  1.00 0.00 ? 62  MET A HG3  3  
ATOM 4102  H HE1  . MET A 1 62  ? -5.647  -1.880  0.595   1.00 0.00 ? 62  MET A HE1  3  
ATOM 4103  H HE2  . MET A 1 62  ? -5.883  -0.489  -0.463  1.00 0.00 ? 62  MET A HE2  3  
ATOM 4104  H HE3  . MET A 1 62  ? -7.225  -1.585  -0.136  1.00 0.00 ? 62  MET A HE3  3  
ATOM 4105  N N    . ARG A 1 63  ? -8.019  -5.484  -5.056  1.00 0.00 ? 63  ARG A N    3  
ATOM 4106  C CA   . ARG A 1 63  ? -8.374  -6.898  -5.046  1.00 0.00 ? 63  ARG A CA   3  
ATOM 4107  C C    . ARG A 1 63  ? -7.361  -7.718  -5.840  1.00 0.00 ? 63  ARG A C    3  
ATOM 4108  O O    . ARG A 1 63  ? -6.989  -8.820  -5.437  1.00 0.00 ? 63  ARG A O    3  
ATOM 4109  C CB   . ARG A 1 63  ? -9.775  -7.098  -5.627  1.00 0.00 ? 63  ARG A CB   3  
ATOM 4110  C CG   . ARG A 1 63  ? -9.892  -6.692  -7.087  1.00 0.00 ? 63  ARG A CG   3  
ATOM 4111  C CD   . ARG A 1 63  ? -9.584  -7.857  -8.016  1.00 0.00 ? 63  ARG A CD   3  
ATOM 4112  N NE   . ARG A 1 63  ? -10.749 -8.710  -8.230  1.00 0.00 ? 63  ARG A NE   3  
ATOM 4113  C CZ   . ARG A 1 63  ? -10.824 -9.624  -9.190  1.00 0.00 ? 63  ARG A CZ   3  
ATOM 4114  N NH1  . ARG A 1 63  ? -9.806  -9.804  -10.020 1.00 0.00 ? 63  ARG A NH1  3  
ATOM 4115  N NH2  . ARG A 1 63  ? -11.919 -10.362 -9.321  1.00 0.00 ? 63  ARG A NH2  3  
ATOM 4116  H H    . ARG A 1 63  ? -8.659  -4.833  -5.412  1.00 0.00 ? 63  ARG A H    3  
ATOM 4117  H HA   . ARG A 1 63  ? -8.368  -7.235  -4.021  1.00 0.00 ? 63  ARG A HA   3  
ATOM 4118  H HB2  . ARG A 1 63  ? -10.041 -8.141  -5.544  1.00 0.00 ? 63  ARG A HB2  3  
ATOM 4119  H HB3  . ARG A 1 63  ? -10.476 -6.509  -5.055  1.00 0.00 ? 63  ARG A HB3  3  
ATOM 4120  H HG2  . ARG A 1 63  ? -10.900 -6.352  -7.277  1.00 0.00 ? 63  ARG A HG2  3  
ATOM 4121  H HG3  . ARG A 1 63  ? -9.197  -5.891  -7.286  1.00 0.00 ? 63  ARG A HG3  3  
ATOM 4122  H HD2  . ARG A 1 63  ? -9.257  -7.464  -8.967  1.00 0.00 ? 63  ARG A HD2  3  
ATOM 4123  H HD3  . ARG A 1 63  ? -8.792  -8.447  -7.579  1.00 0.00 ? 63  ARG A HD3  3  
ATOM 4124  H HE   . ARG A 1 63  ? -11.513 -8.594  -7.628  1.00 0.00 ? 63  ARG A HE   3  
ATOM 4125  H HH11 . ARG A 1 63  ? -8.980  -9.250  -9.923  1.00 0.00 ? 63  ARG A HH11 3  
ATOM 4126  H HH12 . ARG A 1 63  ? -9.865  -10.494 -10.742 1.00 0.00 ? 63  ARG A HH12 3  
ATOM 4127  H HH21 . ARG A 1 63  ? -12.689 -10.230 -8.697  1.00 0.00 ? 63  ARG A HH21 3  
ATOM 4128  H HH22 . ARG A 1 63  ? -11.975 -11.050 -10.044 1.00 0.00 ? 63  ARG A HH22 3  
ATOM 4129  N N    . GLN A 1 64  ? -6.920  -7.172  -6.969  1.00 0.00 ? 64  GLN A N    3  
ATOM 4130  C CA   . GLN A 1 64  ? -5.951  -7.854  -7.819  1.00 0.00 ? 64  GLN A CA   3  
ATOM 4131  C C    . GLN A 1 64  ? -4.649  -8.106  -7.066  1.00 0.00 ? 64  GLN A C    3  
ATOM 4132  O O    . GLN A 1 64  ? -3.989  -9.125  -7.272  1.00 0.00 ? 64  GLN A O    3  
ATOM 4133  C CB   . GLN A 1 64  ? -5.676  -7.030  -9.077  1.00 0.00 ? 64  GLN A CB   3  
ATOM 4134  C CG   . GLN A 1 64  ? -4.587  -7.615  -9.962  1.00 0.00 ? 64  GLN A CG   3  
ATOM 4135  C CD   . GLN A 1 64  ? -3.990  -6.592  -10.908 1.00 0.00 ? 64  GLN A CD   3  
ATOM 4136  O OE1  . GLN A 1 64  ? -4.556  -6.298  -11.961 1.00 0.00 ? 64  GLN A OE1  3  
ATOM 4137  N NE2  . GLN A 1 64  ? -2.840  -6.042  -10.536 1.00 0.00 ? 64  GLN A NE2  3  
ATOM 4138  H H    . GLN A 1 64  ? -7.254  -6.291  -7.236  1.00 0.00 ? 64  GLN A H    3  
ATOM 4139  H HA   . GLN A 1 64  ? -6.375  -8.804  -8.108  1.00 0.00 ? 64  GLN A HA   3  
ATOM 4140  H HB2  . GLN A 1 64  ? -6.584  -6.964  -9.656  1.00 0.00 ? 64  GLN A HB2  3  
ATOM 4141  H HB3  . GLN A 1 64  ? -5.373  -6.035  -8.783  1.00 0.00 ? 64  GLN A HB3  3  
ATOM 4142  H HG2  . GLN A 1 64  ? -3.800  -8.004  -9.334  1.00 0.00 ? 64  GLN A HG2  3  
ATOM 4143  H HG3  . GLN A 1 64  ? -5.010  -8.420  -10.546 1.00 0.00 ? 64  GLN A HG3  3  
ATOM 4144  H HE21 . GLN A 1 64  ? -2.447  -6.325  -9.684  1.00 0.00 ? 64  GLN A HE21 3  
ATOM 4145  H HE22 . GLN A 1 64  ? -2.432  -5.378  -11.128 1.00 0.00 ? 64  GLN A HE22 3  
ATOM 4146  N N    . ILE A 1 65  ? -4.284  -7.171  -6.195  1.00 0.00 ? 65  ILE A N    3  
ATOM 4147  C CA   . ILE A 1 65  ? -3.061  -7.293  -5.412  1.00 0.00 ? 65  ILE A CA   3  
ATOM 4148  C C    . ILE A 1 65  ? -3.366  -7.706  -3.976  1.00 0.00 ? 65  ILE A C    3  
ATOM 4149  O O    . ILE A 1 65  ? -4.519  -7.684  -3.545  1.00 0.00 ? 65  ILE A O    3  
ATOM 4150  C CB   . ILE A 1 65  ? -2.269  -5.972  -5.396  1.00 0.00 ? 65  ILE A CB   3  
ATOM 4151  C CG1  . ILE A 1 65  ? -3.055  -4.889  -4.654  1.00 0.00 ? 65  ILE A CG1  3  
ATOM 4152  C CG2  . ILE A 1 65  ? -1.954  -5.526  -6.817  1.00 0.00 ? 65  ILE A CG2  3  
ATOM 4153  C CD1  . ILE A 1 65  ? -2.192  -3.755  -4.149  1.00 0.00 ? 65  ILE A CD1  3  
ATOM 4154  H H    . ILE A 1 65  ? -4.852  -6.381  -6.076  1.00 0.00 ? 65  ILE A H    3  
ATOM 4155  H HA   . ILE A 1 65  ? -2.446  -8.053  -5.871  1.00 0.00 ? 65  ILE A HA   3  
ATOM 4156  H HB   . ILE A 1 65  ? -1.335  -6.144  -4.883  1.00 0.00 ? 65  ILE A HB   3  
ATOM 4157  H HG12 . ILE A 1 65  ? -3.795  -4.471  -5.319  1.00 0.00 ? 65  ILE A HG12 3  
ATOM 4158  H HG13 . ILE A 1 65  ? -3.551  -5.334  -3.804  1.00 0.00 ? 65  ILE A HG13 3  
ATOM 4159  H HG21 . ILE A 1 65  ? -0.883  -5.489  -6.953  1.00 0.00 ? 65  ILE A HG21 3  
ATOM 4160  H HG22 . ILE A 1 65  ? -2.381  -6.229  -7.517  1.00 0.00 ? 65  ILE A HG22 3  
ATOM 4161  H HG23 . ILE A 1 65  ? -2.374  -4.547  -6.988  1.00 0.00 ? 65  ILE A HG23 3  
ATOM 4162  H HD11 . ILE A 1 65  ? -1.672  -3.300  -4.979  1.00 0.00 ? 65  ILE A HD11 3  
ATOM 4163  H HD12 . ILE A 1 65  ? -2.813  -3.017  -3.664  1.00 0.00 ? 65  ILE A HD12 3  
ATOM 4164  H HD13 . ILE A 1 65  ? -1.470  -4.139  -3.442  1.00 0.00 ? 65  ILE A HD13 3  
ATOM 4165  N N    . ARG A 1 66  ? -2.325  -8.082  -3.240  1.00 0.00 ? 66  ARG A N    3  
ATOM 4166  C CA   . ARG A 1 66  ? -2.482  -8.500  -1.852  1.00 0.00 ? 66  ARG A CA   3  
ATOM 4167  C C    . ARG A 1 66  ? -1.290  -8.052  -1.012  1.00 0.00 ? 66  ARG A C    3  
ATOM 4168  O O    . ARG A 1 66  ? -0.194  -7.843  -1.532  1.00 0.00 ? 66  ARG A O    3  
ATOM 4169  C CB   . ARG A 1 66  ? -2.636  -10.019 -1.770  1.00 0.00 ? 66  ARG A CB   3  
ATOM 4170  C CG   . ARG A 1 66  ? -3.982  -10.523 -2.265  1.00 0.00 ? 66  ARG A CG   3  
ATOM 4171  C CD   . ARG A 1 66  ? -5.006  -10.574 -1.141  1.00 0.00 ? 66  ARG A CD   3  
ATOM 4172  N NE   . ARG A 1 66  ? -6.369  -10.703 -1.648  1.00 0.00 ? 66  ARG A NE   3  
ATOM 4173  C CZ   . ARG A 1 66  ? -7.074  -9.685  -2.129  1.00 0.00 ? 66  ARG A CZ   3  
ATOM 4174  N NH1  . ARG A 1 66  ? -6.547  -8.469  -2.168  1.00 0.00 ? 66  ARG A NH1  3  
ATOM 4175  N NH2  . ARG A 1 66  ? -8.309  -9.882  -2.572  1.00 0.00 ? 66  ARG A NH2  3  
ATOM 4176  H H    . ARG A 1 66  ? -1.431  -8.078  -3.640  1.00 0.00 ? 66  ARG A H    3  
ATOM 4177  H HA   . ARG A 1 66  ? -3.376  -8.034  -1.464  1.00 0.00 ? 66  ARG A HA   3  
ATOM 4178  H HB2  . ARG A 1 66  ? -1.863  -10.481 -2.365  1.00 0.00 ? 66  ARG A HB2  3  
ATOM 4179  H HB3  . ARG A 1 66  ? -2.518  -10.325 -0.741  1.00 0.00 ? 66  ARG A HB3  3  
ATOM 4180  H HG2  . ARG A 1 66  ? -4.344  -9.858  -3.036  1.00 0.00 ? 66  ARG A HG2  3  
ATOM 4181  H HG3  . ARG A 1 66  ? -3.857  -11.515 -2.672  1.00 0.00 ? 66  ARG A HG3  3  
ATOM 4182  H HD2  . ARG A 1 66  ? -4.785  -11.422 -0.510  1.00 0.00 ? 66  ARG A HD2  3  
ATOM 4183  H HD3  . ARG A 1 66  ? -4.931  -9.666  -0.563  1.00 0.00 ? 66  ARG A HD3  3  
ATOM 4184  H HE   . ARG A 1 66  ? -6.778  -11.593 -1.629  1.00 0.00 ? 66  ARG A HE   3  
ATOM 4185  H HH11 . ARG A 1 66  ? -5.616  -8.318  -1.836  1.00 0.00 ? 66  ARG A HH11 3  
ATOM 4186  H HH12 . ARG A 1 66  ? -7.079  -7.705  -2.532  1.00 0.00 ? 66  ARG A HH12 3  
ATOM 4187  H HH21 . ARG A 1 66  ? -8.710  -10.797 -2.545  1.00 0.00 ? 66  ARG A HH21 3  
ATOM 4188  H HH22 . ARG A 1 66  ? -8.839  -9.115  -2.934  1.00 0.00 ? 66  ARG A HH22 3  
ATOM 4189  N N    . PHE A 1 67  ? -1.511  -7.908  0.290   1.00 0.00 ? 67  PHE A N    3  
ATOM 4190  C CA   . PHE A 1 67  ? -0.456  -7.484  1.203   1.00 0.00 ? 67  PHE A CA   3  
ATOM 4191  C C    . PHE A 1 67  ? -0.155  -8.572  2.229   1.00 0.00 ? 67  PHE A C    3  
ATOM 4192  O O    . PHE A 1 67  ? -1.023  -9.375  2.571   1.00 0.00 ? 67  PHE A O    3  
ATOM 4193  C CB   . PHE A 1 67  ? -0.858  -6.191  1.916   1.00 0.00 ? 67  PHE A CB   3  
ATOM 4194  C CG   . PHE A 1 67  ? -1.053  -5.029  0.985   1.00 0.00 ? 67  PHE A CG   3  
ATOM 4195  C CD1  . PHE A 1 67  ? -2.276  -4.816  0.368   1.00 0.00 ? 67  PHE A CD1  3  
ATOM 4196  C CD2  . PHE A 1 67  ? -0.015  -4.148  0.727   1.00 0.00 ? 67  PHE A CD2  3  
ATOM 4197  C CE1  . PHE A 1 67  ? -2.458  -3.748  -0.489  1.00 0.00 ? 67  PHE A CE1  3  
ATOM 4198  C CE2  . PHE A 1 67  ? -0.192  -3.078  -0.130  1.00 0.00 ? 67  PHE A CE2  3  
ATOM 4199  C CZ   . PHE A 1 67  ? -1.416  -2.877  -0.738  1.00 0.00 ? 67  PHE A CZ   3  
ATOM 4200  H H    . PHE A 1 67  ? -2.406  -8.090  0.646   1.00 0.00 ? 67  PHE A H    3  
ATOM 4201  H HA   . PHE A 1 67  ? 0.433   -7.301  0.619   1.00 0.00 ? 67  PHE A HA   3  
ATOM 4202  H HB2  . PHE A 1 67  ? -1.786  -6.353  2.443   1.00 0.00 ? 67  PHE A HB2  3  
ATOM 4203  H HB3  . PHE A 1 67  ? -0.088  -5.925  2.624   1.00 0.00 ? 67  PHE A HB3  3  
ATOM 4204  H HD1  . PHE A 1 67  ? -3.093  -5.496  0.562   1.00 0.00 ? 67  PHE A HD1  3  
ATOM 4205  H HD2  . PHE A 1 67  ? 0.943   -4.304  1.203   1.00 0.00 ? 67  PHE A HD2  3  
ATOM 4206  H HE1  . PHE A 1 67  ? -3.416  -3.593  -0.964  1.00 0.00 ? 67  PHE A HE1  3  
ATOM 4207  H HE2  . PHE A 1 67  ? 0.626   -2.399  -0.321  1.00 0.00 ? 67  PHE A HE2  3  
ATOM 4208  H HZ   . PHE A 1 67  ? -1.555  -2.042  -1.408  1.00 0.00 ? 67  PHE A HZ   3  
ATOM 4209  N N    . ARG A 1 68  ? 1.081   -8.591  2.717   1.00 0.00 ? 68  ARG A N    3  
ATOM 4210  C CA   . ARG A 1 68  ? 1.498   -9.581  3.703   1.00 0.00 ? 68  ARG A CA   3  
ATOM 4211  C C    . ARG A 1 68  ? 2.659   -9.056  4.543   1.00 0.00 ? 68  ARG A C    3  
ATOM 4212  O O    . ARG A 1 68  ? 3.392   -8.162  4.118   1.00 0.00 ? 68  ARG A O    3  
ATOM 4213  C CB   . ARG A 1 68  ? 1.903   -10.883 3.010   1.00 0.00 ? 68  ARG A CB   3  
ATOM 4214  C CG   . ARG A 1 68  ? 0.746   -11.844 2.796   1.00 0.00 ? 68  ARG A CG   3  
ATOM 4215  C CD   . ARG A 1 68  ? 1.214   -13.291 2.805   1.00 0.00 ? 68  ARG A CD   3  
ATOM 4216  N NE   . ARG A 1 68  ? 0.184   -14.203 2.315   1.00 0.00 ? 68  ARG A NE   3  
ATOM 4217  C CZ   . ARG A 1 68  ? 0.356   -15.516 2.206   1.00 0.00 ? 68  ARG A CZ   3  
ATOM 4218  N NH1  . ARG A 1 68  ? 1.512   -16.067 2.551   1.00 0.00 ? 68  ARG A NH1  3  
ATOM 4219  N NH2  . ARG A 1 68  ? -0.629  -16.280 1.751   1.00 0.00 ? 68  ARG A NH2  3  
ATOM 4220  H H    . ARG A 1 68  ? 1.729   -7.924  2.407   1.00 0.00 ? 68  ARG A H    3  
ATOM 4221  H HA   . ARG A 1 68  ? 0.658   -9.775  4.354   1.00 0.00 ? 68  ARG A HA   3  
ATOM 4222  H HB2  . ARG A 1 68  ? 2.329   -10.647 2.046   1.00 0.00 ? 68  ARG A HB2  3  
ATOM 4223  H HB3  . ARG A 1 68  ? 2.649   -11.380 3.612   1.00 0.00 ? 68  ARG A HB3  3  
ATOM 4224  H HG2  . ARG A 1 68  ? 0.024   -11.706 3.588   1.00 0.00 ? 68  ARG A HG2  3  
ATOM 4225  H HG3  . ARG A 1 68  ? 0.284   -11.630 1.844   1.00 0.00 ? 68  ARG A HG3  3  
ATOM 4226  H HD2  . ARG A 1 68  ? 2.087   -13.377 2.175   1.00 0.00 ? 68  ARG A HD2  3  
ATOM 4227  H HD3  . ARG A 1 68  ? 1.473   -13.565 3.817   1.00 0.00 ? 68  ARG A HD3  3  
ATOM 4228  H HE   . ARG A 1 68  ? -0.677  -13.817 2.054   1.00 0.00 ? 68  ARG A HE   3  
ATOM 4229  H HH11 . ARG A 1 68  ? 2.255   -15.494 2.895   1.00 0.00 ? 68  ARG A HH11 3  
ATOM 4230  H HH12 . ARG A 1 68  ? 1.638   -17.056 2.469   1.00 0.00 ? 68  ARG A HH12 3  
ATOM 4231  H HH21 . ARG A 1 68  ? -1.501  -15.867 1.490   1.00 0.00 ? 68  ARG A HH21 3  
ATOM 4232  H HH22 . ARG A 1 68  ? -0.498  -17.267 1.669   1.00 0.00 ? 68  ARG A HH22 3  
ATOM 4233  N N    . PHE A 1 69  ? 2.821   -9.617  5.736   1.00 0.00 ? 69  PHE A N    3  
ATOM 4234  C CA   . PHE A 1 69  ? 3.892   -9.205  6.637   1.00 0.00 ? 69  PHE A CA   3  
ATOM 4235  C C    . PHE A 1 69  ? 4.439   -10.400 7.413   1.00 0.00 ? 69  PHE A C    3  
ATOM 4236  O O    . PHE A 1 69  ? 3.681   -11.168 8.007   1.00 0.00 ? 69  PHE A O    3  
ATOM 4237  C CB   . PHE A 1 69  ? 3.387   -8.138  7.609   1.00 0.00 ? 69  PHE A CB   3  
ATOM 4238  C CG   . PHE A 1 69  ? 4.380   -7.783  8.679   1.00 0.00 ? 69  PHE A CG   3  
ATOM 4239  C CD1  . PHE A 1 69  ? 5.301   -6.768  8.478   1.00 0.00 ? 69  PHE A CD1  3  
ATOM 4240  C CD2  . PHE A 1 69  ? 4.393   -8.466  9.885   1.00 0.00 ? 69  PHE A CD2  3  
ATOM 4241  C CE1  . PHE A 1 69  ? 6.217   -6.439  9.460   1.00 0.00 ? 69  PHE A CE1  3  
ATOM 4242  C CE2  . PHE A 1 69  ? 5.305   -8.141  10.870  1.00 0.00 ? 69  PHE A CE2  3  
ATOM 4243  C CZ   . PHE A 1 69  ? 6.219   -7.127  10.657  1.00 0.00 ? 69  PHE A CZ   3  
ATOM 4244  H H    . PHE A 1 69  ? 2.204   -10.325 6.019   1.00 0.00 ? 69  PHE A H    3  
ATOM 4245  H HA   . PHE A 1 69  ? 4.685   -8.787  6.037   1.00 0.00 ? 69  PHE A HA   3  
ATOM 4246  H HB2  . PHE A 1 69  ? 3.158   -7.238  7.058   1.00 0.00 ? 69  PHE A HB2  3  
ATOM 4247  H HB3  . PHE A 1 69  ? 2.491   -8.497  8.093   1.00 0.00 ? 69  PHE A HB3  3  
ATOM 4248  H HD1  . PHE A 1 69  ? 5.300   -6.229  7.541   1.00 0.00 ? 69  PHE A HD1  3  
ATOM 4249  H HD2  . PHE A 1 69  ? 3.680   -9.259  10.052  1.00 0.00 ? 69  PHE A HD2  3  
ATOM 4250  H HE1  . PHE A 1 69  ? 6.930   -5.646  9.290   1.00 0.00 ? 69  PHE A HE1  3  
ATOM 4251  H HE2  . PHE A 1 69  ? 5.305   -8.680  11.806  1.00 0.00 ? 69  PHE A HE2  3  
ATOM 4252  H HZ   . PHE A 1 69  ? 6.933   -6.871  11.426  1.00 0.00 ? 69  PHE A HZ   3  
ATOM 4253  N N    . ASP A 1 70  ? 5.759   -10.549 7.404   1.00 0.00 ? 70  ASP A N    3  
ATOM 4254  C CA   . ASP A 1 70  ? 6.409   -11.649 8.107   1.00 0.00 ? 70  ASP A CA   3  
ATOM 4255  C C    . ASP A 1 70  ? 5.767   -12.984 7.740   1.00 0.00 ? 70  ASP A C    3  
ATOM 4256  O O    . ASP A 1 70  ? 5.799   -13.935 8.520   1.00 0.00 ? 70  ASP A O    3  
ATOM 4257  C CB   . ASP A 1 70  ? 6.333   -11.431 9.619   1.00 0.00 ? 70  ASP A CB   3  
ATOM 4258  C CG   . ASP A 1 70  ? 7.498   -12.064 10.354  1.00 0.00 ? 70  ASP A CG   3  
ATOM 4259  O OD1  . ASP A 1 70  ? 8.553   -12.278 9.722   1.00 0.00 ? 70  ASP A OD1  3  
ATOM 4260  O OD2  . ASP A 1 70  ? 7.354   -12.345 11.562  1.00 0.00 ? 70  ASP A OD2  3  
ATOM 4261  H H    . ASP A 1 70  ? 6.309   -9.904  6.912   1.00 0.00 ? 70  ASP A H    3  
ATOM 4262  H HA   . ASP A 1 70  ? 7.445   -11.668 7.807   1.00 0.00 ? 70  ASP A HA   3  
ATOM 4263  H HB2  . ASP A 1 70  ? 6.336   -10.370 9.824   1.00 0.00 ? 70  ASP A HB2  3  
ATOM 4264  H HB3  . ASP A 1 70  ? 5.416   -11.863 9.993   1.00 0.00 ? 70  ASP A HB3  3  
ATOM 4265  N N    . GLY A 1 71  ? 5.183   -13.046 6.547   1.00 0.00 ? 71  GLY A N    3  
ATOM 4266  C CA   . GLY A 1 71  ? 4.541   -14.267 6.098   1.00 0.00 ? 71  GLY A CA   3  
ATOM 4267  C C    . GLY A 1 71  ? 3.170   -14.462 6.714   1.00 0.00 ? 71  GLY A C    3  
ATOM 4268  O O    . GLY A 1 71  ? 2.771   -15.587 7.013   1.00 0.00 ? 71  GLY A O    3  
ATOM 4269  H H    . GLY A 1 71  ? 5.188   -12.255 5.967   1.00 0.00 ? 71  GLY A H    3  
ATOM 4270  H HA2  . GLY A 1 71  ? 4.440   -14.234 5.024   1.00 0.00 ? 71  GLY A HA2  3  
ATOM 4271  H HA3  . GLY A 1 71  ? 5.165   -15.107 6.365   1.00 0.00 ? 71  GLY A HA3  3  
ATOM 4272  N N    . GLN A 1 72  ? 2.447   -13.362 6.905   1.00 0.00 ? 72  GLN A N    3  
ATOM 4273  C CA   . GLN A 1 72  ? 1.114   -13.418 7.492   1.00 0.00 ? 72  GLN A CA   3  
ATOM 4274  C C    . GLN A 1 72  ? 0.171   -12.444 6.793   1.00 0.00 ? 72  GLN A C    3  
ATOM 4275  O O    . GLN A 1 72  ? 0.566   -11.360 6.362   1.00 0.00 ? 72  GLN A O    3  
ATOM 4276  C CB   . GLN A 1 72  ? 1.178   -13.100 8.987   1.00 0.00 ? 72  GLN A CB   3  
ATOM 4277  C CG   . GLN A 1 72  ? 1.024   -11.621 9.302   1.00 0.00 ? 72  GLN A CG   3  
ATOM 4278  C CD   . GLN A 1 72  ? 1.572   -11.255 10.667  1.00 0.00 ? 72  GLN A CD   3  
ATOM 4279  O OE1  . GLN A 1 72  ? 0.818   -10.932 11.585  1.00 0.00 ? 72  GLN A OE1  3  
ATOM 4280  N NE2  . GLN A 1 72  ? 2.891   -11.304 10.808  1.00 0.00 ? 72  GLN A NE2  3  
ATOM 4281  H H    . GLN A 1 72  ? 2.820   -12.494 6.646   1.00 0.00 ? 72  GLN A H    3  
ATOM 4282  H HA   . GLN A 1 72  ? 0.736   -14.420 7.362   1.00 0.00 ? 72  GLN A HA   3  
ATOM 4283  H HB2  . GLN A 1 72  ? 0.389   -13.638 9.491   1.00 0.00 ? 72  GLN A HB2  3  
ATOM 4284  H HB3  . GLN A 1 72  ? 2.131   -13.431 9.372   1.00 0.00 ? 72  GLN A HB3  3  
ATOM 4285  H HG2  . GLN A 1 72  ? 1.553   -11.050 8.554   1.00 0.00 ? 72  GLN A HG2  3  
ATOM 4286  H HG3  . GLN A 1 72  ? -0.026  -11.367 9.271   1.00 0.00 ? 72  GLN A HG3  3  
ATOM 4287  H HE21 . GLN A 1 72  ? 3.430   -11.569 10.032  1.00 0.00 ? 72  GLN A HE21 3  
ATOM 4288  H HE22 . GLN A 1 72  ? 3.273   -11.071 11.679  1.00 0.00 ? 72  GLN A HE22 3  
ATOM 4289  N N    . PRO A 1 73  ? -1.107  -12.836 6.677   1.00 0.00 ? 73  PRO A N    3  
ATOM 4290  C CA   . PRO A 1 73  ? -2.133  -12.012 6.031   1.00 0.00 ? 73  PRO A CA   3  
ATOM 4291  C C    . PRO A 1 73  ? -2.485  -10.776 6.852   1.00 0.00 ? 73  PRO A C    3  
ATOM 4292  O O    . PRO A 1 73  ? -3.000  -10.885 7.965   1.00 0.00 ? 73  PRO A O    3  
ATOM 4293  C CB   . PRO A 1 73  ? -3.336  -12.953 5.938   1.00 0.00 ? 73  PRO A CB   3  
ATOM 4294  C CG   . PRO A 1 73  ? -3.135  -13.936 7.039   1.00 0.00 ? 73  PRO A CG   3  
ATOM 4295  C CD   . PRO A 1 73  ? -1.648  -14.115 7.168   1.00 0.00 ? 73  PRO A CD   3  
ATOM 4296  H HA   . PRO A 1 73  ? -1.832  -11.710 5.039   1.00 0.00 ? 73  PRO A HA   3  
ATOM 4297  H HB2  . PRO A 1 73  ? -4.249  -12.389 6.073   1.00 0.00 ? 73  PRO A HB2  3  
ATOM 4298  H HB3  . PRO A 1 73  ? -3.345  -13.438 4.973   1.00 0.00 ? 73  PRO A HB3  3  
ATOM 4299  H HG2  . PRO A 1 73  ? -3.547  -13.547 7.958   1.00 0.00 ? 73  PRO A HG2  3  
ATOM 4300  H HG3  . PRO A 1 73  ? -3.604  -14.874 6.783   1.00 0.00 ? 73  PRO A HG3  3  
ATOM 4301  H HD2  . PRO A 1 73  ? -1.375  -14.278 8.200   1.00 0.00 ? 73  PRO A HD2  3  
ATOM 4302  H HD3  . PRO A 1 73  ? -1.312  -14.936 6.552   1.00 0.00 ? 73  PRO A HD3  3  
ATOM 4303  N N    . ILE A 1 74  ? -2.204  -9.603  6.295   1.00 0.00 ? 74  ILE A N    3  
ATOM 4304  C CA   . ILE A 1 74  ? -2.493  -8.347  6.976   1.00 0.00 ? 74  ILE A CA   3  
ATOM 4305  C C    . ILE A 1 74  ? -3.771  -7.712  6.439   1.00 0.00 ? 74  ILE A C    3  
ATOM 4306  O O    . ILE A 1 74  ? -4.175  -7.968  5.306   1.00 0.00 ? 74  ILE A O    3  
ATOM 4307  C CB   . ILE A 1 74  ? -1.333  -7.345  6.825   1.00 0.00 ? 74  ILE A CB   3  
ATOM 4308  C CG1  . ILE A 1 74  ? -0.850  -7.305  5.374   1.00 0.00 ? 74  ILE A CG1  3  
ATOM 4309  C CG2  . ILE A 1 74  ? -0.190  -7.713  7.760   1.00 0.00 ? 74  ILE A CG2  3  
ATOM 4310  C CD1  . ILE A 1 74  ? 0.013   -6.104  5.057   1.00 0.00 ? 74  ILE A CD1  3  
ATOM 4311  H H    . ILE A 1 74  ? -1.794  -9.581  5.406   1.00 0.00 ? 74  ILE A H    3  
ATOM 4312  H HA   . ILE A 1 74  ? -2.624  -8.560  8.027   1.00 0.00 ? 74  ILE A HA   3  
ATOM 4313  H HB   . ILE A 1 74  ? -1.693  -6.366  7.105   1.00 0.00 ? 74  ILE A HB   3  
ATOM 4314  H HG12 . ILE A 1 74  ? -0.272  -8.192  5.169   1.00 0.00 ? 74  ILE A HG12 3  
ATOM 4315  H HG13 . ILE A 1 74  ? -1.708  -7.280  4.718   1.00 0.00 ? 74  ILE A HG13 3  
ATOM 4316  H HG21 . ILE A 1 74  ? 0.132   -8.723  7.553   1.00 0.00 ? 74  ILE A HG21 3  
ATOM 4317  H HG22 . ILE A 1 74  ? 0.635   -7.034  7.603   1.00 0.00 ? 74  ILE A HG22 3  
ATOM 4318  H HG23 . ILE A 1 74  ? -0.525  -7.644  8.783   1.00 0.00 ? 74  ILE A HG23 3  
ATOM 4319  H HD11 . ILE A 1 74  ? 0.811   -6.399  4.392   1.00 0.00 ? 74  ILE A HD11 3  
ATOM 4320  H HD12 . ILE A 1 74  ? -0.589  -5.342  4.585   1.00 0.00 ? 74  ILE A HD12 3  
ATOM 4321  H HD13 . ILE A 1 74  ? 0.435   -5.712  5.972   1.00 0.00 ? 74  ILE A HD13 3  
ATOM 4322  N N    . ASN A 1 75  ? -4.403  -6.880  7.261   1.00 0.00 ? 75  ASN A N    3  
ATOM 4323  C CA   . ASN A 1 75  ? -5.636  -6.206  6.868   1.00 0.00 ? 75  ASN A CA   3  
ATOM 4324  C C    . ASN A 1 75  ? -5.483  -4.692  6.966   1.00 0.00 ? 75  ASN A C    3  
ATOM 4325  O O    . ASN A 1 75  ? -4.725  -4.187  7.794   1.00 0.00 ? 75  ASN A O    3  
ATOM 4326  C CB   . ASN A 1 75  ? -6.798  -6.671  7.748   1.00 0.00 ? 75  ASN A CB   3  
ATOM 4327  C CG   . ASN A 1 75  ? -6.939  -8.181  7.769   1.00 0.00 ? 75  ASN A CG   3  
ATOM 4328  O OD1  . ASN A 1 75  ? -6.988  -8.796  8.834   1.00 0.00 ? 75  ASN A OD1  3  
ATOM 4329  N ND2  . ASN A 1 75  ? -7.005  -8.786  6.589   1.00 0.00 ? 75  ASN A ND2  3  
ATOM 4330  H H    . ASN A 1 75  ? -4.032  -6.715  8.153   1.00 0.00 ? 75  ASN A H    3  
ATOM 4331  H HA   . ASN A 1 75  ? -5.845  -6.470  5.842   1.00 0.00 ? 75  ASN A HA   3  
ATOM 4332  H HB2  . ASN A 1 75  ? -6.634  -6.330  8.760   1.00 0.00 ? 75  ASN A HB2  3  
ATOM 4333  H HB3  . ASN A 1 75  ? -7.717  -6.247  7.373   1.00 0.00 ? 75  ASN A HB3  3  
ATOM 4334  H HD21 . ASN A 1 75  ? -6.959  -8.232  5.781   1.00 0.00 ? 75  ASN A HD21 3  
ATOM 4335  H HD22 . ASN A 1 75  ? -7.097  -9.761  6.573   1.00 0.00 ? 75  ASN A HD22 3  
ATOM 4336  N N    . GLU A 1 76  ? -6.209  -3.973  6.116   1.00 0.00 ? 76  GLU A N    3  
ATOM 4337  C CA   . GLU A 1 76  ? -6.154  -2.515  6.108   1.00 0.00 ? 76  GLU A CA   3  
ATOM 4338  C C    . GLU A 1 76  ? -6.552  -1.948  7.467   1.00 0.00 ? 76  GLU A C    3  
ATOM 4339  O O    . GLU A 1 76  ? -6.039  -0.914  7.897   1.00 0.00 ? 76  GLU A O    3  
ATOM 4340  C CB   . GLU A 1 76  ? -7.072  -1.954  5.020   1.00 0.00 ? 76  GLU A CB   3  
ATOM 4341  C CG   . GLU A 1 76  ? -8.449  -2.596  4.995   1.00 0.00 ? 76  GLU A CG   3  
ATOM 4342  C CD   . GLU A 1 76  ? -9.392  -1.915  4.022   1.00 0.00 ? 76  GLU A CD   3  
ATOM 4343  O OE1  . GLU A 1 76  ? -9.055  -0.812  3.543   1.00 0.00 ? 76  GLU A OE1  3  
ATOM 4344  O OE2  . GLU A 1 76  ? -10.467 -2.485  3.740   1.00 0.00 ? 76  GLU A OE2  3  
ATOM 4345  H H    . GLU A 1 76  ? -6.795  -4.433  5.480   1.00 0.00 ? 76  GLU A H    3  
ATOM 4346  H HA   . GLU A 1 76  ? -5.137  -2.224  5.893   1.00 0.00 ? 76  GLU A HA   3  
ATOM 4347  H HB2  . GLU A 1 76  ? -7.194  -0.893  5.181   1.00 0.00 ? 76  GLU A HB2  3  
ATOM 4348  H HB3  . GLU A 1 76  ? -6.607  -2.112  4.058   1.00 0.00 ? 76  GLU A HB3  3  
ATOM 4349  H HG2  . GLU A 1 76  ? -8.344  -3.631  4.705   1.00 0.00 ? 76  GLU A HG2  3  
ATOM 4350  H HG3  . GLU A 1 76  ? -8.875  -2.542  5.985   1.00 0.00 ? 76  GLU A HG3  3  
ATOM 4351  N N    . THR A 1 77  ? -7.472  -2.632  8.141   1.00 0.00 ? 77  THR A N    3  
ATOM 4352  C CA   . THR A 1 77  ? -7.941  -2.196  9.450   1.00 0.00 ? 77  THR A CA   3  
ATOM 4353  C C    . THR A 1 77  ? -6.840  -2.318  10.497  1.00 0.00 ? 77  THR A C    3  
ATOM 4354  O O    . THR A 1 77  ? -6.827  -1.585  11.486  1.00 0.00 ? 77  THR A O    3  
ATOM 4355  C CB   . THR A 1 77  ? -9.163  -3.014  9.909   1.00 0.00 ? 77  THR A CB   3  
ATOM 4356  O OG1  . THR A 1 77  ? -8.952  -4.404  9.639   1.00 0.00 ? 77  THR A OG1  3  
ATOM 4357  C CG2  . THR A 1 77  ? -10.426 -2.541  9.205   1.00 0.00 ? 77  THR A CG2  3  
ATOM 4358  H H    . THR A 1 77  ? -7.843  -3.448  7.746   1.00 0.00 ? 77  THR A H    3  
ATOM 4359  H HA   . THR A 1 77  ? -8.237  -1.160  9.371   1.00 0.00 ? 77  THR A HA   3  
ATOM 4360  H HB   . THR A 1 77  ? -9.290  -2.877  10.974  1.00 0.00 ? 77  THR A HB   3  
ATOM 4361  H HG1  . THR A 1 77  ? -8.010  -4.582  9.594   1.00 0.00 ? 77  THR A HG1  3  
ATOM 4362  H HG21 . THR A 1 77  ? -11.019 -1.949  9.886   1.00 0.00 ? 77  THR A HG21 3  
ATOM 4363  H HG22 . THR A 1 77  ? -10.999 -3.397  8.880   1.00 0.00 ? 77  THR A HG22 3  
ATOM 4364  H HG23 . THR A 1 77  ? -10.157 -1.941  8.348   1.00 0.00 ? 77  THR A HG23 3  
ATOM 4365  N N    . ASP A 1 78  ? -5.918  -3.248  10.274  1.00 0.00 ? 78  ASP A N    3  
ATOM 4366  C CA   . ASP A 1 78  ? -4.811  -3.464  11.198  1.00 0.00 ? 78  ASP A CA   3  
ATOM 4367  C C    . ASP A 1 78  ? -3.797  -2.327  11.108  1.00 0.00 ? 78  ASP A C    3  
ATOM 4368  O O    . ASP A 1 78  ? -3.712  -1.635  10.093  1.00 0.00 ? 78  ASP A O    3  
ATOM 4369  C CB   . ASP A 1 78  ? -4.125  -4.799  10.903  1.00 0.00 ? 78  ASP A CB   3  
ATOM 4370  C CG   . ASP A 1 78  ? -4.736  -5.948  11.680  1.00 0.00 ? 78  ASP A CG   3  
ATOM 4371  O OD1  . ASP A 1 78  ? -5.157  -5.725  12.835  1.00 0.00 ? 78  ASP A OD1  3  
ATOM 4372  O OD2  . ASP A 1 78  ? -4.793  -7.070  11.135  1.00 0.00 ? 78  ASP A OD2  3  
ATOM 4373  H H    . ASP A 1 78  ? -5.982  -3.801  9.467   1.00 0.00 ? 78  ASP A H    3  
ATOM 4374  H HA   . ASP A 1 78  ? -5.214  -3.491  12.199  1.00 0.00 ? 78  ASP A HA   3  
ATOM 4375  H HB2  . ASP A 1 78  ? -4.214  -5.016  9.848   1.00 0.00 ? 78  ASP A HB2  3  
ATOM 4376  H HB3  . ASP A 1 78  ? -3.080  -4.725  11.165  1.00 0.00 ? 78  ASP A HB3  3  
ATOM 4377  N N    . THR A 1 79  ? -3.031  -2.138  12.178  1.00 0.00 ? 79  THR A N    3  
ATOM 4378  C CA   . THR A 1 79  ? -2.025  -1.084  12.221  1.00 0.00 ? 79  THR A CA   3  
ATOM 4379  C C    . THR A 1 79  ? -0.620  -1.669  12.305  1.00 0.00 ? 79  THR A C    3  
ATOM 4380  O O    . THR A 1 79  ? -0.422  -2.819  12.695  1.00 0.00 ? 79  THR A O    3  
ATOM 4381  C CB   . THR A 1 79  ? -2.250  -0.142  13.418  1.00 0.00 ? 79  THR A CB   3  
ATOM 4382  O OG1  . THR A 1 79  ? -2.806  -0.872  14.518  1.00 0.00 ? 79  THR A OG1  3  
ATOM 4383  C CG2  . THR A 1 79  ? -3.178  1.002   13.040  1.00 0.00 ? 79  THR A CG2  3  
ATOM 4384  H H    . THR A 1 79  ? -3.146  -2.722  12.956  1.00 0.00 ? 79  THR A H    3  
ATOM 4385  H HA   . THR A 1 79  ? -2.110  -0.505  11.313  1.00 0.00 ? 79  THR A HA   3  
ATOM 4386  H HB   . THR A 1 79  ? -1.296  0.271   13.716  1.00 0.00 ? 79  THR A HB   3  
ATOM 4387  H HG1  . THR A 1 79  ? -2.250  -1.629  14.714  1.00 0.00 ? 79  THR A HG1  3  
ATOM 4388  H HG21 . THR A 1 79  ? -2.764  1.934   13.396  1.00 0.00 ? 79  THR A HG21 3  
ATOM 4389  H HG22 . THR A 1 79  ? -4.147  0.843   13.490  1.00 0.00 ? 79  THR A HG22 3  
ATOM 4390  H HG23 . THR A 1 79  ? -3.281  1.041   11.966  1.00 0.00 ? 79  THR A HG23 3  
ATOM 4391  N N    . PRO A 1 80  ? 0.382   -0.859  11.931  1.00 0.00 ? 80  PRO A N    3  
ATOM 4392  C CA   . PRO A 1 80  ? 1.788   -1.274  11.956  1.00 0.00 ? 80  PRO A CA   3  
ATOM 4393  C C    . PRO A 1 80  ? 2.318   -1.436  13.377  1.00 0.00 ? 80  PRO A C    3  
ATOM 4394  O O    . PRO A 1 80  ? 3.371   -2.036  13.591  1.00 0.00 ? 80  PRO A O    3  
ATOM 4395  C CB   . PRO A 1 80  ? 2.510   -0.128  11.243  1.00 0.00 ? 80  PRO A CB   3  
ATOM 4396  C CG   . PRO A 1 80  ? 1.627   1.055   11.439  1.00 0.00 ? 80  PRO A CG   3  
ATOM 4397  C CD   . PRO A 1 80  ? 0.220   0.525   11.454  1.00 0.00 ? 80  PRO A CD   3  
ATOM 4398  H HA   . PRO A 1 80  ? 1.940   -2.194  11.410  1.00 0.00 ? 80  PRO A HA   3  
ATOM 4399  H HB2  . PRO A 1 80  ? 3.481   0.023   11.693  1.00 0.00 ? 80  PRO A HB2  3  
ATOM 4400  H HB3  . PRO A 1 80  ? 2.624   -0.366  10.197  1.00 0.00 ? 80  PRO A HB3  3  
ATOM 4401  H HG2  . PRO A 1 80  ? 1.857   1.534   12.379  1.00 0.00 ? 80  PRO A HG2  3  
ATOM 4402  H HG3  . PRO A 1 80  ? 1.757   1.749   10.622  1.00 0.00 ? 80  PRO A HG3  3  
ATOM 4403  H HD2  . PRO A 1 80  ? -0.392  1.098   12.135  1.00 0.00 ? 80  PRO A HD2  3  
ATOM 4404  H HD3  . PRO A 1 80  ? -0.201  0.543   10.460  1.00 0.00 ? 80  PRO A HD3  3  
ATOM 4405  N N    . ALA A 1 81  ? 1.582   -0.898  14.344  1.00 0.00 ? 81  ALA A N    3  
ATOM 4406  C CA   . ALA A 1 81  ? 1.978   -0.986  15.744  1.00 0.00 ? 81  ALA A CA   3  
ATOM 4407  C C    . ALA A 1 81  ? 1.494   -2.289  16.370  1.00 0.00 ? 81  ALA A C    3  
ATOM 4408  O O    . ALA A 1 81  ? 2.060   -2.761  17.356  1.00 0.00 ? 81  ALA A O    3  
ATOM 4409  C CB   . ALA A 1 81  ? 1.439   0.207   16.520  1.00 0.00 ? 81  ALA A CB   3  
ATOM 4410  H H    . ALA A 1 81  ? 0.752   -0.433  14.110  1.00 0.00 ? 81  ALA A H    3  
ATOM 4411  H HA   . ALA A 1 81  ? 3.057   -0.955  15.788  1.00 0.00 ? 81  ALA A HA   3  
ATOM 4412  H HB1  . ALA A 1 81  ? 0.645   0.673   15.955  1.00 0.00 ? 81  ALA A HB1  3  
ATOM 4413  H HB2  . ALA A 1 81  ? 1.056   -0.127  17.473  1.00 0.00 ? 81  ALA A HB2  3  
ATOM 4414  H HB3  . ALA A 1 81  ? 2.233   0.920   16.681  1.00 0.00 ? 81  ALA A HB3  3  
ATOM 4415  N N    . GLN A 1 82  ? 0.445   -2.865  15.792  1.00 0.00 ? 82  GLN A N    3  
ATOM 4416  C CA   . GLN A 1 82  ? -0.114  -4.114  16.296  1.00 0.00 ? 82  GLN A CA   3  
ATOM 4417  C C    . GLN A 1 82  ? 0.762   -5.300  15.906  1.00 0.00 ? 82  GLN A C    3  
ATOM 4418  O O    . GLN A 1 82  ? 0.865   -6.279  16.645  1.00 0.00 ? 82  GLN A O    3  
ATOM 4419  C CB   . GLN A 1 82  ? -1.533  -4.314  15.761  1.00 0.00 ? 82  GLN A CB   3  
ATOM 4420  C CG   . GLN A 1 82  ? -2.318  -5.382  16.505  1.00 0.00 ? 82  GLN A CG   3  
ATOM 4421  C CD   . GLN A 1 82  ? -3.669  -5.660  15.874  1.00 0.00 ? 82  GLN A CD   3  
ATOM 4422  O OE1  . GLN A 1 82  ? -4.212  -4.825  15.150  1.00 0.00 ? 82  GLN A OE1  3  
ATOM 4423  N NE2  . GLN A 1 82  ? -4.218  -6.838  16.145  1.00 0.00 ? 82  GLN A NE2  3  
ATOM 4424  H H    . GLN A 1 82  ? 0.038   -2.440  15.010  1.00 0.00 ? 82  GLN A H    3  
ATOM 4425  H HA   . GLN A 1 82  ? -0.151  -4.049  17.373  1.00 0.00 ? 82  GLN A HA   3  
ATOM 4426  H HB2  . GLN A 1 82  ? -2.070  -3.381  15.841  1.00 0.00 ? 82  GLN A HB2  3  
ATOM 4427  H HB3  . GLN A 1 82  ? -1.476  -4.600  14.721  1.00 0.00 ? 82  GLN A HB3  3  
ATOM 4428  H HG2  . GLN A 1 82  ? -1.745  -6.297  16.507  1.00 0.00 ? 82  GLN A HG2  3  
ATOM 4429  H HG3  . GLN A 1 82  ? -2.473  -5.054  17.522  1.00 0.00 ? 82  GLN A HG3  3  
ATOM 4430  H HE21 . GLN A 1 82  ? -3.729  -7.453  16.731  1.00 0.00 ? 82  GLN A HE21 3  
ATOM 4431  H HE22 . GLN A 1 82  ? -5.091  -7.043  15.751  1.00 0.00 ? 82  GLN A HE22 3  
ATOM 4432  N N    . LEU A 1 83  ? 1.390   -5.205  14.739  1.00 0.00 ? 83  LEU A N    3  
ATOM 4433  C CA   . LEU A 1 83  ? 2.258   -6.271  14.249  1.00 0.00 ? 83  LEU A CA   3  
ATOM 4434  C C    . LEU A 1 83  ? 3.716   -5.990  14.599  1.00 0.00 ? 83  LEU A C    3  
ATOM 4435  O O    . LEU A 1 83  ? 4.617   -6.700  14.155  1.00 0.00 ? 83  LEU A O    3  
ATOM 4436  C CB   . LEU A 1 83  ? 2.105   -6.424  12.735  1.00 0.00 ? 83  LEU A CB   3  
ATOM 4437  C CG   . LEU A 1 83  ? 0.671   -6.524  12.211  1.00 0.00 ? 83  LEU A CG   3  
ATOM 4438  C CD1  . LEU A 1 83  ? 0.614   -6.155  10.737  1.00 0.00 ? 83  LEU A CD1  3  
ATOM 4439  C CD2  . LEU A 1 83  ? 0.119   -7.925  12.434  1.00 0.00 ? 83  LEU A CD2  3  
ATOM 4440  H H    . LEU A 1 83  ? 1.269   -4.401  14.194  1.00 0.00 ? 83  LEU A H    3  
ATOM 4441  H HA   . LEU A 1 83  ? 1.956   -7.190  14.728  1.00 0.00 ? 83  LEU A HA   3  
ATOM 4442  H HB2  . LEU A 1 83  ? 2.568   -5.569  12.267  1.00 0.00 ? 83  LEU A HB2  3  
ATOM 4443  H HB3  . LEU A 1 83  ? 2.630   -7.322  12.439  1.00 0.00 ? 83  LEU A HB3  3  
ATOM 4444  H HG   . LEU A 1 83  ? 0.047   -5.828  12.754  1.00 0.00 ? 83  LEU A HG   3  
ATOM 4445  H HD11 . LEU A 1 83  ? -0.390  -5.853  10.481  1.00 0.00 ? 83  LEU A HD11 3  
ATOM 4446  H HD12 . LEU A 1 83  ? 0.897   -7.009  10.141  1.00 0.00 ? 83  LEU A HD12 3  
ATOM 4447  H HD13 . LEU A 1 83  ? 1.297   -5.340  10.544  1.00 0.00 ? 83  LEU A HD13 3  
ATOM 4448  H HD21 . LEU A 1 83  ? 0.457   -8.575  11.640  1.00 0.00 ? 83  LEU A HD21 3  
ATOM 4449  H HD22 . LEU A 1 83  ? -0.961  -7.890  12.435  1.00 0.00 ? 83  LEU A HD22 3  
ATOM 4450  H HD23 . LEU A 1 83  ? 0.469   -8.303  13.383  1.00 0.00 ? 83  LEU A HD23 3  
ATOM 4451  N N    . GLU A 1 84  ? 3.938   -4.952  15.398  1.00 0.00 ? 84  GLU A N    3  
ATOM 4452  C CA   . GLU A 1 84  ? 5.287   -4.579  15.808  1.00 0.00 ? 84  GLU A CA   3  
ATOM 4453  C C    . GLU A 1 84  ? 6.146   -4.228  14.597  1.00 0.00 ? 84  GLU A C    3  
ATOM 4454  O O    . GLU A 1 84  ? 7.341   -4.521  14.564  1.00 0.00 ? 84  GLU A O    3  
ATOM 4455  C CB   . GLU A 1 84  ? 5.937   -5.718  16.596  1.00 0.00 ? 84  GLU A CB   3  
ATOM 4456  C CG   . GLU A 1 84  ? 5.634   -5.679  18.084  1.00 0.00 ? 84  GLU A CG   3  
ATOM 4457  C CD   . GLU A 1 84  ? 6.237   -6.852  18.833  1.00 0.00 ? 84  GLU A CD   3  
ATOM 4458  O OE1  . GLU A 1 84  ? 6.205   -7.978  18.295  1.00 0.00 ? 84  GLU A OE1  3  
ATOM 4459  O OE2  . GLU A 1 84  ? 6.740   -6.643  19.957  1.00 0.00 ? 84  GLU A OE2  3  
ATOM 4460  H H    . GLU A 1 84  ? 3.177   -4.424  15.719  1.00 0.00 ? 84  GLU A H    3  
ATOM 4461  H HA   . GLU A 1 84  ? 5.212   -3.710  16.445  1.00 0.00 ? 84  GLU A HA   3  
ATOM 4462  H HB2  . GLU A 1 84  ? 5.585   -6.660  16.201  1.00 0.00 ? 84  GLU A HB2  3  
ATOM 4463  H HB3  . GLU A 1 84  ? 7.008   -5.662  16.467  1.00 0.00 ? 84  GLU A HB3  3  
ATOM 4464  H HG2  . GLU A 1 84  ? 6.033   -4.765  18.497  1.00 0.00 ? 84  GLU A HG2  3  
ATOM 4465  H HG3  . GLU A 1 84  ? 4.562   -5.697  18.221  1.00 0.00 ? 84  GLU A HG3  3  
ATOM 4466  N N    . MET A 1 85  ? 5.528   -3.599  13.603  1.00 0.00 ? 85  MET A N    3  
ATOM 4467  C CA   . MET A 1 85  ? 6.236   -3.207  12.389  1.00 0.00 ? 85  MET A CA   3  
ATOM 4468  C C    . MET A 1 85  ? 7.420   -2.303  12.719  1.00 0.00 ? 85  MET A C    3  
ATOM 4469  O O    . MET A 1 85  ? 7.253   -1.105  12.944  1.00 0.00 ? 85  MET A O    3  
ATOM 4470  C CB   . MET A 1 85  ? 5.286   -2.492  11.427  1.00 0.00 ? 85  MET A CB   3  
ATOM 4471  C CG   . MET A 1 85  ? 4.212   -3.399  10.847  1.00 0.00 ? 85  MET A CG   3  
ATOM 4472  S SD   . MET A 1 85  ? 3.468   -2.725  9.349   1.00 0.00 ? 85  MET A SD   3  
ATOM 4473  C CE   . MET A 1 85  ? 3.821   -4.033  8.178   1.00 0.00 ? 85  MET A CE   3  
ATOM 4474  H H    . MET A 1 85  ? 4.574   -3.391  13.687  1.00 0.00 ? 85  MET A H    3  
ATOM 4475  H HA   . MET A 1 85  ? 6.604   -4.105  11.917  1.00 0.00 ? 85  MET A HA   3  
ATOM 4476  H HB2  . MET A 1 85  ? 4.798   -1.685  11.954  1.00 0.00 ? 85  MET A HB2  3  
ATOM 4477  H HB3  . MET A 1 85  ? 5.860   -2.083  10.610  1.00 0.00 ? 85  MET A HB3  3  
ATOM 4478  H HG2  . MET A 1 85  ? 4.656   -4.355  10.612  1.00 0.00 ? 85  MET A HG2  3  
ATOM 4479  H HG3  . MET A 1 85  ? 3.438   -3.536  11.588  1.00 0.00 ? 85  MET A HG3  3  
ATOM 4480  H HE1  . MET A 1 85  ? 3.722   -3.652  7.172   1.00 0.00 ? 85  MET A HE1  3  
ATOM 4481  H HE2  . MET A 1 85  ? 4.829   -4.389  8.330   1.00 0.00 ? 85  MET A HE2  3  
ATOM 4482  H HE3  . MET A 1 85  ? 3.125   -4.846  8.326   1.00 0.00 ? 85  MET A HE3  3  
ATOM 4483  N N    . GLU A 1 86  ? 8.614   -2.886  12.745  1.00 0.00 ? 86  GLU A N    3  
ATOM 4484  C CA   . GLU A 1 86  ? 9.825   -2.131  13.047  1.00 0.00 ? 86  GLU A CA   3  
ATOM 4485  C C    . GLU A 1 86  ? 10.194  -1.207  11.891  1.00 0.00 ? 86  GLU A C    3  
ATOM 4486  O O    . GLU A 1 86  ? 9.532   -1.199  10.853  1.00 0.00 ? 86  GLU A O    3  
ATOM 4487  C CB   . GLU A 1 86  ? 10.985  -3.084  13.344  1.00 0.00 ? 86  GLU A CB   3  
ATOM 4488  C CG   . GLU A 1 86  ? 10.909  -3.728  14.718  1.00 0.00 ? 86  GLU A CG   3  
ATOM 4489  C CD   . GLU A 1 86  ? 10.723  -2.712  15.828  1.00 0.00 ? 86  GLU A CD   3  
ATOM 4490  O OE1  . GLU A 1 86  ? 9.566   -2.312  16.078  1.00 0.00 ? 86  GLU A OE1  3  
ATOM 4491  O OE2  . GLU A 1 86  ? 11.733  -2.317  16.447  1.00 0.00 ? 86  GLU A OE2  3  
ATOM 4492  H H    . GLU A 1 86  ? 8.683   -3.845  12.556  1.00 0.00 ? 86  GLU A H    3  
ATOM 4493  H HA   . GLU A 1 86  ? 9.631   -1.532  13.924  1.00 0.00 ? 86  GLU A HA   3  
ATOM 4494  H HB2  . GLU A 1 86  ? 10.990  -3.868  12.601  1.00 0.00 ? 86  GLU A HB2  3  
ATOM 4495  H HB3  . GLU A 1 86  ? 11.912  -2.533  13.279  1.00 0.00 ? 86  GLU A HB3  3  
ATOM 4496  H HG2  . GLU A 1 86  ? 10.074  -4.413  14.734  1.00 0.00 ? 86  GLU A HG2  3  
ATOM 4497  H HG3  . GLU A 1 86  ? 11.824  -4.272  14.898  1.00 0.00 ? 86  GLU A HG3  3  
ATOM 4498  N N    . ASP A 1 87  ? 11.254  -0.429  12.078  1.00 0.00 ? 87  ASP A N    3  
ATOM 4499  C CA   . ASP A 1 87  ? 11.713  0.499   11.051  1.00 0.00 ? 87  ASP A CA   3  
ATOM 4500  C C    . ASP A 1 87  ? 12.474  -0.238  9.953   1.00 0.00 ? 87  ASP A C    3  
ATOM 4501  O O    . ASP A 1 87  ? 13.062  -1.292  10.193  1.00 0.00 ? 87  ASP A O    3  
ATOM 4502  C CB   . ASP A 1 87  ? 12.603  1.578   11.669  1.00 0.00 ? 87  ASP A CB   3  
ATOM 4503  C CG   . ASP A 1 87  ? 13.717  0.995   12.516  1.00 0.00 ? 87  ASP A CG   3  
ATOM 4504  O OD1  . ASP A 1 87  ? 14.429  0.094   12.022  1.00 0.00 ? 87  ASP A OD1  3  
ATOM 4505  O OD2  . ASP A 1 87  ? 13.878  1.439   13.671  1.00 0.00 ? 87  ASP A OD2  3  
ATOM 4506  H H    . ASP A 1 87  ? 11.741  -0.481  12.927  1.00 0.00 ? 87  ASP A H    3  
ATOM 4507  H HA   . ASP A 1 87  ? 10.843  0.968   10.616  1.00 0.00 ? 87  ASP A HA   3  
ATOM 4508  H HB2  . ASP A 1 87  ? 13.047  2.166   10.879  1.00 0.00 ? 87  ASP A HB2  3  
ATOM 4509  H HB3  . ASP A 1 87  ? 11.999  2.220   12.293  1.00 0.00 ? 87  ASP A HB3  3  
ATOM 4510  N N    . GLU A 1 88  ? 12.457  0.324   8.748   1.00 0.00 ? 88  GLU A N    3  
ATOM 4511  C CA   . GLU A 1 88  ? 13.143  -0.282  7.614   1.00 0.00 ? 88  GLU A CA   3  
ATOM 4512  C C    . GLU A 1 88  ? 12.608  -1.684  7.339   1.00 0.00 ? 88  GLU A C    3  
ATOM 4513  O O    . GLU A 1 88  ? 13.317  -2.537  6.805   1.00 0.00 ? 88  GLU A O    3  
ATOM 4514  C CB   . GLU A 1 88  ? 14.650  -0.341  7.874   1.00 0.00 ? 88  GLU A CB   3  
ATOM 4515  C CG   . GLU A 1 88  ? 15.371  0.963   7.575   1.00 0.00 ? 88  GLU A CG   3  
ATOM 4516  C CD   . GLU A 1 88  ? 16.838  0.757   7.249   1.00 0.00 ? 88  GLU A CD   3  
ATOM 4517  O OE1  . GLU A 1 88  ? 17.584  0.300   8.139   1.00 0.00 ? 88  GLU A OE1  3  
ATOM 4518  O OE2  . GLU A 1 88  ? 17.238  1.053   6.104   1.00 0.00 ? 88  GLU A OE2  3  
ATOM 4519  H H    . GLU A 1 88  ? 11.970  1.165   8.620   1.00 0.00 ? 88  GLU A H    3  
ATOM 4520  H HA   . GLU A 1 88  ? 12.961  0.336   6.747   1.00 0.00 ? 88  GLU A HA   3  
ATOM 4521  H HB2  . GLU A 1 88  ? 14.815  -0.591  8.911   1.00 0.00 ? 88  GLU A HB2  3  
ATOM 4522  H HB3  . GLU A 1 88  ? 15.079  -1.115  7.254   1.00 0.00 ? 88  GLU A HB3  3  
ATOM 4523  H HG2  . GLU A 1 88  ? 14.894  1.439   6.732   1.00 0.00 ? 88  GLU A HG2  3  
ATOM 4524  H HG3  . GLU A 1 88  ? 15.297  1.607   8.439   1.00 0.00 ? 88  GLU A HG3  3  
ATOM 4525  N N    . ASP A 1 89  ? 11.353  -1.914  7.707   1.00 0.00 ? 89  ASP A N    3  
ATOM 4526  C CA   . ASP A 1 89  ? 10.721  -3.212  7.501   1.00 0.00 ? 89  ASP A CA   3  
ATOM 4527  C C    . ASP A 1 89  ? 10.421  -3.441  6.023   1.00 0.00 ? 89  ASP A C    3  
ATOM 4528  O O    . ASP A 1 89  ? 10.599  -2.546  5.195   1.00 0.00 ? 89  ASP A O    3  
ATOM 4529  C CB   . ASP A 1 89  ? 9.431   -3.311  8.317   1.00 0.00 ? 89  ASP A CB   3  
ATOM 4530  C CG   . ASP A 1 89  ? 8.864   -4.717  8.334   1.00 0.00 ? 89  ASP A CG   3  
ATOM 4531  O OD1  . ASP A 1 89  ? 9.253   -5.503  9.223   1.00 0.00 ? 89  ASP A OD1  3  
ATOM 4532  O OD2  . ASP A 1 89  ? 8.029   -5.030  7.460   1.00 0.00 ? 89  ASP A OD2  3  
ATOM 4533  H H    . ASP A 1 89  ? 10.838  -1.193  8.128   1.00 0.00 ? 89  ASP A H    3  
ATOM 4534  H HA   . ASP A 1 89  ? 11.409  -3.973  7.837   1.00 0.00 ? 89  ASP A HA   3  
ATOM 4535  H HB2  . ASP A 1 89  ? 9.634   -3.012  9.336   1.00 0.00 ? 89  ASP A HB2  3  
ATOM 4536  H HB3  . ASP A 1 89  ? 8.692   -2.648  7.892   1.00 0.00 ? 89  ASP A HB3  3  
ATOM 4537  N N    . THR A 1 90  ? 9.965   -4.646  5.696   1.00 0.00 ? 90  THR A N    3  
ATOM 4538  C CA   . THR A 1 90  ? 9.642   -4.994  4.318   1.00 0.00 ? 90  THR A CA   3  
ATOM 4539  C C    . THR A 1 90  ? 8.271   -5.655  4.225   1.00 0.00 ? 90  THR A C    3  
ATOM 4540  O O    . THR A 1 90  ? 7.974   -6.597  4.960   1.00 0.00 ? 90  THR A O    3  
ATOM 4541  C CB   . THR A 1 90  ? 10.697  -5.941  3.716   1.00 0.00 ? 90  THR A CB   3  
ATOM 4542  O OG1  . THR A 1 90  ? 12.004  -5.376  3.867   1.00 0.00 ? 90  THR A OG1  3  
ATOM 4543  C CG2  . THR A 1 90  ? 10.416  -6.197  2.243   1.00 0.00 ? 90  THR A CG2  3  
ATOM 4544  H H    . THR A 1 90  ? 9.844   -5.317  6.400   1.00 0.00 ? 90  THR A H    3  
ATOM 4545  H HA   . THR A 1 90  ? 9.632   -4.083  3.738   1.00 0.00 ? 90  THR A HA   3  
ATOM 4546  H HB   . THR A 1 90  ? 10.657  -6.883  4.244   1.00 0.00 ? 90  THR A HB   3  
ATOM 4547  H HG1  . THR A 1 90  ? 12.068  -4.939  4.719   1.00 0.00 ? 90  THR A HG1  3  
ATOM 4548  H HG21 . THR A 1 90  ? 11.105  -6.940  1.869   1.00 0.00 ? 90  THR A HG21 3  
ATOM 4549  H HG22 . THR A 1 90  ? 10.540  -5.279  1.688   1.00 0.00 ? 90  THR A HG22 3  
ATOM 4550  H HG23 . THR A 1 90  ? 9.404   -6.554  2.127   1.00 0.00 ? 90  THR A HG23 3  
ATOM 4551  N N    . ILE A 1 91  ? 7.440   -5.155  3.316   1.00 0.00 ? 91  ILE A N    3  
ATOM 4552  C CA   . ILE A 1 91  ? 6.101   -5.699  3.126   1.00 0.00 ? 91  ILE A CA   3  
ATOM 4553  C C    . ILE A 1 91  ? 6.063   -6.668  1.950   1.00 0.00 ? 91  ILE A C    3  
ATOM 4554  O O    . ILE A 1 91  ? 6.857   -6.558  1.015   1.00 0.00 ? 91  ILE A O    3  
ATOM 4555  C CB   . ILE A 1 91  ? 5.068   -4.581  2.890   1.00 0.00 ? 91  ILE A CB   3  
ATOM 4556  C CG1  . ILE A 1 91  ? 5.307   -3.422  3.859   1.00 0.00 ? 91  ILE A CG1  3  
ATOM 4557  C CG2  . ILE A 1 91  ? 3.655   -5.125  3.043   1.00 0.00 ? 91  ILE A CG2  3  
ATOM 4558  C CD1  . ILE A 1 91  ? 4.425   -2.222  3.595   1.00 0.00 ? 91  ILE A CD1  3  
ATOM 4559  H H    . ILE A 1 91  ? 7.734   -4.404  2.761   1.00 0.00 ? 91  ILE A H    3  
ATOM 4560  H HA   . ILE A 1 91  ? 5.826   -6.231  4.026   1.00 0.00 ? 91  ILE A HA   3  
ATOM 4561  H HB   . ILE A 1 91  ? 5.182   -4.224  1.878   1.00 0.00 ? 91  ILE A HB   3  
ATOM 4562  H HG12 . ILE A 1 91  ? 5.115   -3.758  4.866   1.00 0.00 ? 91  ILE A HG12 3  
ATOM 4563  H HG13 . ILE A 1 91  ? 6.336   -3.103  3.780   1.00 0.00 ? 91  ILE A HG13 3  
ATOM 4564  H HG21 . ILE A 1 91  ? 3.559   -6.042  2.481   1.00 0.00 ? 91  ILE A HG21 3  
ATOM 4565  H HG22 . ILE A 1 91  ? 3.456   -5.320  4.086   1.00 0.00 ? 91  ILE A HG22 3  
ATOM 4566  H HG23 . ILE A 1 91  ? 2.948   -4.399  2.671   1.00 0.00 ? 91  ILE A HG23 3  
ATOM 4567  H HD11 . ILE A 1 91  ? 3.553   -2.530  3.038   1.00 0.00 ? 91  ILE A HD11 3  
ATOM 4568  H HD12 . ILE A 1 91  ? 4.118   -1.786  4.534   1.00 0.00 ? 91  ILE A HD12 3  
ATOM 4569  H HD13 . ILE A 1 91  ? 4.977   -1.489  3.023   1.00 0.00 ? 91  ILE A HD13 3  
ATOM 4570  N N    . ASP A 1 92  ? 5.134   -7.616  2.001   1.00 0.00 ? 92  ASP A N    3  
ATOM 4571  C CA   . ASP A 1 92  ? 4.990   -8.604  0.938   1.00 0.00 ? 92  ASP A CA   3  
ATOM 4572  C C    . ASP A 1 92  ? 3.758   -8.311  0.087   1.00 0.00 ? 92  ASP A C    3  
ATOM 4573  O O    . ASP A 1 92  ? 2.636   -8.276  0.592   1.00 0.00 ? 92  ASP A O    3  
ATOM 4574  C CB   . ASP A 1 92  ? 4.894   -10.011 1.529   1.00 0.00 ? 92  ASP A CB   3  
ATOM 4575  C CG   . ASP A 1 92  ? 6.229   -10.518 2.037   1.00 0.00 ? 92  ASP A CG   3  
ATOM 4576  O OD1  . ASP A 1 92  ? 7.195   -10.537 1.247   1.00 0.00 ? 92  ASP A OD1  3  
ATOM 4577  O OD2  . ASP A 1 92  ? 6.307   -10.896 3.225   1.00 0.00 ? 92  ASP A OD2  3  
ATOM 4578  H H    . ASP A 1 92  ? 4.530   -7.652  2.772   1.00 0.00 ? 92  ASP A H    3  
ATOM 4579  H HA   . ASP A 1 92  ? 5.867   -8.546  0.310   1.00 0.00 ? 92  ASP A HA   3  
ATOM 4580  H HB2  . ASP A 1 92  ? 4.196   -10.001 2.354   1.00 0.00 ? 92  ASP A HB2  3  
ATOM 4581  H HB3  . ASP A 1 92  ? 4.536   -10.690 0.769   1.00 0.00 ? 92  ASP A HB3  3  
ATOM 4582  N N    . VAL A 1 93  ? 3.975   -8.099  -1.207  1.00 0.00 ? 93  VAL A N    3  
ATOM 4583  C CA   . VAL A 1 93  ? 2.883   -7.809  -2.128  1.00 0.00 ? 93  VAL A CA   3  
ATOM 4584  C C    . VAL A 1 93  ? 3.133   -8.440  -3.494  1.00 0.00 ? 93  VAL A C    3  
ATOM 4585  O O    . VAL A 1 93  ? 4.269   -8.495  -3.965  1.00 0.00 ? 93  VAL A O    3  
ATOM 4586  C CB   . VAL A 1 93  ? 2.685   -6.292  -2.304  1.00 0.00 ? 93  VAL A CB   3  
ATOM 4587  C CG1  . VAL A 1 93  ? 1.515   -6.010  -3.235  1.00 0.00 ? 93  VAL A CG1  3  
ATOM 4588  C CG2  . VAL A 1 93  ? 2.477   -5.622  -0.954  1.00 0.00 ? 93  VAL A CG2  3  
ATOM 4589  H H    . VAL A 1 93  ? 4.892   -8.140  -1.551  1.00 0.00 ? 93  VAL A H    3  
ATOM 4590  H HA   . VAL A 1 93  ? 1.976   -8.223  -1.712  1.00 0.00 ? 93  VAL A HA   3  
ATOM 4591  H HB   . VAL A 1 93  ? 3.579   -5.882  -2.752  1.00 0.00 ? 93  VAL A HB   3  
ATOM 4592  H HG11 . VAL A 1 93  ? 1.116   -6.943  -3.603  1.00 0.00 ? 93  VAL A HG11 3  
ATOM 4593  H HG12 . VAL A 1 93  ? 0.747   -5.475  -2.696  1.00 0.00 ? 93  VAL A HG12 3  
ATOM 4594  H HG13 . VAL A 1 93  ? 1.854   -5.411  -4.067  1.00 0.00 ? 93  VAL A HG13 3  
ATOM 4595  H HG21 . VAL A 1 93  ? 1.731   -6.167  -0.395  1.00 0.00 ? 93  VAL A HG21 3  
ATOM 4596  H HG22 . VAL A 1 93  ? 3.408   -5.619  -0.406  1.00 0.00 ? 93  VAL A HG22 3  
ATOM 4597  H HG23 . VAL A 1 93  ? 2.145   -4.606  -1.104  1.00 0.00 ? 93  VAL A HG23 3  
ATOM 4598  N N    . PHE A 1 94  ? 2.065   -8.914  -4.125  1.00 0.00 ? 94  PHE A N    3  
ATOM 4599  C CA   . PHE A 1 94  ? 2.168   -9.541  -5.437  1.00 0.00 ? 94  PHE A CA   3  
ATOM 4600  C C    . PHE A 1 94  ? 1.548   -8.656  -6.514  1.00 0.00 ? 94  PHE A C    3  
ATOM 4601  O O    . PHE A 1 94  ? 0.329   -8.493  -6.572  1.00 0.00 ? 94  PHE A O    3  
ATOM 4602  C CB   . PHE A 1 94  ? 1.481   -10.909 -5.428  1.00 0.00 ? 94  PHE A CB   3  
ATOM 4603  C CG   . PHE A 1 94  ? 2.000   -11.832 -4.362  1.00 0.00 ? 94  PHE A CG   3  
ATOM 4604  C CD1  . PHE A 1 94  ? 1.606   -11.678 -3.043  1.00 0.00 ? 94  PHE A CD1  3  
ATOM 4605  C CD2  . PHE A 1 94  ? 2.879   -12.854 -4.680  1.00 0.00 ? 94  PHE A CD2  3  
ATOM 4606  C CE1  . PHE A 1 94  ? 2.082   -12.526 -2.060  1.00 0.00 ? 94  PHE A CE1  3  
ATOM 4607  C CE2  . PHE A 1 94  ? 3.358   -13.705 -3.702  1.00 0.00 ? 94  PHE A CE2  3  
ATOM 4608  C CZ   . PHE A 1 94  ? 2.958   -13.541 -2.391  1.00 0.00 ? 94  PHE A CZ   3  
ATOM 4609  H H    . PHE A 1 94  ? 1.185   -8.840  -3.698  1.00 0.00 ? 94  PHE A H    3  
ATOM 4610  H HA   . PHE A 1 94  ? 3.216   -9.676  -5.658  1.00 0.00 ? 94  PHE A HA   3  
ATOM 4611  H HB2  . PHE A 1 94  ? 0.424   -10.772 -5.261  1.00 0.00 ? 94  PHE A HB2  3  
ATOM 4612  H HB3  . PHE A 1 94  ? 1.632   -11.386 -6.384  1.00 0.00 ? 94  PHE A HB3  3  
ATOM 4613  H HD1  . PHE A 1 94  ? 0.920   -10.885 -2.783  1.00 0.00 ? 94  PHE A HD1  3  
ATOM 4614  H HD2  . PHE A 1 94  ? 3.193   -12.983 -5.707  1.00 0.00 ? 94  PHE A HD2  3  
ATOM 4615  H HE1  . PHE A 1 94  ? 1.768   -12.396 -1.035  1.00 0.00 ? 94  PHE A HE1  3  
ATOM 4616  H HE2  . PHE A 1 94  ? 4.043   -14.498 -3.964  1.00 0.00 ? 94  PHE A HE2  3  
ATOM 4617  H HZ   . PHE A 1 94  ? 3.332   -14.205 -1.625  1.00 0.00 ? 94  PHE A HZ   3  
ATOM 4618  N N    . GLN A 1 95  ? 2.395   -8.086  -7.365  1.00 0.00 ? 95  GLN A N    3  
ATOM 4619  C CA   . GLN A 1 95  ? 1.931   -7.216  -8.438  1.00 0.00 ? 95  GLN A CA   3  
ATOM 4620  C C    . GLN A 1 95  ? 1.639   -8.019  -9.702  1.00 0.00 ? 95  GLN A C    3  
ATOM 4621  O O    . GLN A 1 95  ? 2.555   -8.421  -10.418 1.00 0.00 ? 95  GLN A O    3  
ATOM 4622  C CB   . GLN A 1 95  ? 2.973   -6.137  -8.736  1.00 0.00 ? 95  GLN A CB   3  
ATOM 4623  C CG   . GLN A 1 95  ? 2.821   -4.891  -7.878  1.00 0.00 ? 95  GLN A CG   3  
ATOM 4624  C CD   . GLN A 1 95  ? 3.447   -3.665  -8.512  1.00 0.00 ? 95  GLN A CD   3  
ATOM 4625  O OE1  . GLN A 1 95  ? 3.816   -3.680  -9.687  1.00 0.00 ? 95  GLN A OE1  3  
ATOM 4626  N NE2  . GLN A 1 95  ? 3.570   -2.594  -7.737  1.00 0.00 ? 95  GLN A NE2  3  
ATOM 4627  H H    . GLN A 1 95  ? 3.355   -8.254  -7.267  1.00 0.00 ? 95  GLN A H    3  
ATOM 4628  H HA   . GLN A 1 95  ? 1.019   -6.742  -8.109  1.00 0.00 ? 95  GLN A HA   3  
ATOM 4629  H HB2  . GLN A 1 95  ? 3.957   -6.547  -8.566  1.00 0.00 ? 95  GLN A HB2  3  
ATOM 4630  H HB3  . GLN A 1 95  ? 2.887   -5.846  -9.772  1.00 0.00 ? 95  GLN A HB3  3  
ATOM 4631  H HG2  . GLN A 1 95  ? 1.769   -4.701  -7.726  1.00 0.00 ? 95  GLN A HG2  3  
ATOM 4632  H HG3  . GLN A 1 95  ? 3.295   -5.067  -6.924  1.00 0.00 ? 95  GLN A HG3  3  
ATOM 4633  H HE21 . GLN A 1 95  ? 3.254   -2.656  -6.810  1.00 0.00 ? 95  GLN A HE21 3  
ATOM 4634  H HE22 . GLN A 1 95  ? 3.972   -1.788  -8.121  1.00 0.00 ? 95  GLN A HE22 3  
ATOM 4635  N N    . GLN A 1 96  ? 0.357   -8.250  -9.967  1.00 0.00 ? 96  GLN A N    3  
ATOM 4636  C CA   . GLN A 1 96  ? -0.055  -9.006  -11.144 1.00 0.00 ? 96  GLN A CA   3  
ATOM 4637  C C    . GLN A 1 96  ? 0.257   -8.236  -12.423 1.00 0.00 ? 96  GLN A C    3  
ATOM 4638  O O    . GLN A 1 96  ? 0.080   -7.020  -12.485 1.00 0.00 ? 96  GLN A O    3  
ATOM 4639  C CB   . GLN A 1 96  ? -1.551  -9.320  -11.076 1.00 0.00 ? 96  GLN A CB   3  
ATOM 4640  C CG   . GLN A 1 96  ? -2.092  -9.976  -12.336 1.00 0.00 ? 96  GLN A CG   3  
ATOM 4641  C CD   . GLN A 1 96  ? -1.847  -11.472 -12.367 1.00 0.00 ? 96  GLN A CD   3  
ATOM 4642  O OE1  . GLN A 1 96  ? -1.661  -12.104 -11.327 1.00 0.00 ? 96  GLN A OE1  3  
ATOM 4643  N NE2  . GLN A 1 96  ? -1.845  -12.047 -13.564 1.00 0.00 ? 96  GLN A NE2  3  
ATOM 4644  H H    . GLN A 1 96  ? -0.327  -7.903  -9.358  1.00 0.00 ? 96  GLN A H    3  
ATOM 4645  H HA   . GLN A 1 96  ? 0.498   -9.933  -11.152 1.00 0.00 ? 96  GLN A HA   3  
ATOM 4646  H HB2  . GLN A 1 96  ? -1.730  -9.985  -10.244 1.00 0.00 ? 96  GLN A HB2  3  
ATOM 4647  H HB3  . GLN A 1 96  ? -2.093  -8.400  -10.914 1.00 0.00 ? 96  GLN A HB3  3  
ATOM 4648  H HG2  . GLN A 1 96  ? -3.156  -9.801  -12.390 1.00 0.00 ? 96  GLN A HG2  3  
ATOM 4649  H HG3  . GLN A 1 96  ? -1.611  -9.529  -13.194 1.00 0.00 ? 96  GLN A HG3  3  
ATOM 4650  H HE21 . GLN A 1 96  ? -1.999  -11.481 -14.349 1.00 0.00 ? 96  GLN A HE21 3  
ATOM 4651  H HE22 . GLN A 1 96  ? -1.688  -13.012 -13.613 1.00 0.00 ? 96  GLN A HE22 3  
ATOM 4652  N N    . GLN A 1 97  ? 0.724   -8.953  -13.440 1.00 0.00 ? 97  GLN A N    3  
ATOM 4653  C CA   . GLN A 1 97  ? 1.062   -8.336  -14.717 1.00 0.00 ? 97  GLN A CA   3  
ATOM 4654  C C    . GLN A 1 97  ? -0.164  -7.685  -15.349 1.00 0.00 ? 97  GLN A C    3  
ATOM 4655  O O    . GLN A 1 97  ? -1.044  -8.370  -15.872 1.00 0.00 ? 97  GLN A O    3  
ATOM 4656  C CB   . GLN A 1 97  ? 1.649   -9.378  -15.671 1.00 0.00 ? 97  GLN A CB   3  
ATOM 4657  C CG   . GLN A 1 97  ? 2.955   -9.984  -15.181 1.00 0.00 ? 97  GLN A CG   3  
ATOM 4658  C CD   . GLN A 1 97  ? 3.751   -10.634 -16.296 1.00 0.00 ? 97  GLN A CD   3  
ATOM 4659  O OE1  . GLN A 1 97  ? 3.511   -11.788 -16.654 1.00 0.00 ? 97  GLN A OE1  3  
ATOM 4660  N NE2  . GLN A 1 97  ? 4.705   -9.896  -16.851 1.00 0.00 ? 97  GLN A NE2  3  
ATOM 4661  H H    . GLN A 1 97  ? 0.843   -9.919  -13.329 1.00 0.00 ? 97  GLN A H    3  
ATOM 4662  H HA   . GLN A 1 97  ? 1.803   -7.574  -14.531 1.00 0.00 ? 97  GLN A HA   3  
ATOM 4663  H HB2  . GLN A 1 97  ? 0.933   -10.176 -15.800 1.00 0.00 ? 97  GLN A HB2  3  
ATOM 4664  H HB3  . GLN A 1 97  ? 1.832   -8.911  -16.627 1.00 0.00 ? 97  GLN A HB3  3  
ATOM 4665  H HG2  . GLN A 1 97  ? 3.556   -9.203  -14.739 1.00 0.00 ? 97  GLN A HG2  3  
ATOM 4666  H HG3  . GLN A 1 97  ? 2.732   -10.731 -14.434 1.00 0.00 ? 97  GLN A HG3  3  
ATOM 4667  H HE21 . GLN A 1 97  ? 4.840   -8.985  -16.513 1.00 0.00 ? 97  GLN A HE21 3  
ATOM 4668  H HE22 . GLN A 1 97  ? 5.235   -10.291 -17.572 1.00 0.00 ? 97  GLN A HE22 3  
ATOM 4669  N N    . THR A 1 98  ? -0.216  -6.358  -15.296 1.00 0.00 ? 98  THR A N    3  
ATOM 4670  C CA   . THR A 1 98  ? -1.335  -5.614  -15.862 1.00 0.00 ? 98  THR A CA   3  
ATOM 4671  C C    . THR A 1 98  ? -1.815  -6.248  -17.163 1.00 0.00 ? 98  THR A C    3  
ATOM 4672  O O    . THR A 1 98  ? -1.074  -6.312  -18.143 1.00 0.00 ? 98  THR A O    3  
ATOM 4673  C CB   . THR A 1 98  ? -0.955  -4.145  -16.129 1.00 0.00 ? 98  THR A CB   3  
ATOM 4674  O OG1  . THR A 1 98  ? -0.395  -3.561  -14.947 1.00 0.00 ? 98  THR A OG1  3  
ATOM 4675  C CG2  . THR A 1 98  ? -2.171  -3.344  -16.570 1.00 0.00 ? 98  THR A CG2  3  
ATOM 4676  H H    . THR A 1 98  ? 0.516   -5.869  -14.866 1.00 0.00 ? 98  THR A H    3  
ATOM 4677  H HA   . THR A 1 98  ? -2.143  -5.631  -15.145 1.00 0.00 ? 98  THR A HA   3  
ATOM 4678  H HB   . THR A 1 98  ? -0.218  -4.118  -16.919 1.00 0.00 ? 98  THR A HB   3  
ATOM 4679  H HG1  . THR A 1 98  ? 0.531   -3.360  -15.098 1.00 0.00 ? 98  THR A HG1  3  
ATOM 4680  H HG21 . THR A 1 98  ? -3.025  -4.000  -16.648 1.00 0.00 ? 98  THR A HG21 3  
ATOM 4681  H HG22 . THR A 1 98  ? -1.974  -2.892  -17.531 1.00 0.00 ? 98  THR A HG22 3  
ATOM 4682  H HG23 . THR A 1 98  ? -2.375  -2.572  -15.843 1.00 0.00 ? 98  THR A HG23 3  
ATOM 4683  N N    . SER A 1 99  ? -3.060  -6.713  -17.164 1.00 0.00 ? 99  SER A N    3  
ATOM 4684  C CA   . SER A 1 99  ? -3.638  -7.345  -18.345 1.00 0.00 ? 99  SER A CA   3  
ATOM 4685  C C    . SER A 1 99  ? -4.128  -6.295  -19.338 1.00 0.00 ? 99  SER A C    3  
ATOM 4686  O O    . SER A 1 99  ? -5.310  -5.957  -19.369 1.00 0.00 ? 99  SER A O    3  
ATOM 4687  C CB   . SER A 1 99  ? -4.795  -8.263  -17.943 1.00 0.00 ? 99  SER A CB   3  
ATOM 4688  O OG   . SER A 1 99  ? -5.758  -7.563  -17.175 1.00 0.00 ? 99  SER A OG   3  
ATOM 4689  H H    . SER A 1 99  ? -3.601  -6.632  -16.351 1.00 0.00 ? 99  SER A H    3  
ATOM 4690  H HA   . SER A 1 99  ? -2.867  -7.937  -18.815 1.00 0.00 ? 99  SER A HA   3  
ATOM 4691  H HB2  . SER A 1 99  ? -5.271  -8.646  -18.832 1.00 0.00 ? 99  SER A HB2  3  
ATOM 4692  H HB3  . SER A 1 99  ? -4.411  -9.085  -17.357 1.00 0.00 ? 99  SER A HB3  3  
ATOM 4693  H HG   . SER A 1 99  ? -5.408  -6.703  -16.930 1.00 0.00 ? 99  SER A HG   3  
ATOM 4694  N N    . GLY A 1 100 ? -3.208  -5.783  -20.149 1.00 0.00 ? 100 GLY A N    3  
ATOM 4695  C CA   . GLY A 1 100 ? -3.564  -4.776  -21.133 1.00 0.00 ? 100 GLY A CA   3  
ATOM 4696  C C    . GLY A 1 100 ? -4.023  -3.480  -20.496 1.00 0.00 ? 100 GLY A C    3  
ATOM 4697  O O    . GLY A 1 100 ? -5.214  -3.260  -20.275 1.00 0.00 ? 100 GLY A O    3  
ATOM 4698  H H    . GLY A 1 100 ? -2.279  -6.090  -20.080 1.00 0.00 ? 100 GLY A H    3  
ATOM 4699  H HA2  . GLY A 1 100 ? -2.703  -4.575  -21.754 1.00 0.00 ? 100 GLY A HA2  3  
ATOM 4700  H HA3  . GLY A 1 100 ? -4.360  -5.161  -21.752 1.00 0.00 ? 100 GLY A HA3  3  
ATOM 4701  N N    . PRO A 1 101 ? -3.064  -2.595  -20.187 1.00 0.00 ? 101 PRO A N    3  
ATOM 4702  C CA   . PRO A 1 101 ? -3.352  -1.299  -19.566 1.00 0.00 ? 101 PRO A CA   3  
ATOM 4703  C C    . PRO A 1 101 ? -4.063  -0.344  -20.519 1.00 0.00 ? 101 PRO A C    3  
ATOM 4704  O O    . PRO A 1 101 ? -3.466  0.152   -21.475 1.00 0.00 ? 101 PRO A O    3  
ATOM 4705  C CB   . PRO A 1 101 ? -1.965  -0.762  -19.206 1.00 0.00 ? 101 PRO A CB   3  
ATOM 4706  C CG   . PRO A 1 101 ? -1.040  -1.430  -20.164 1.00 0.00 ? 101 PRO A CG   3  
ATOM 4707  C CD   . PRO A 1 101 ? -1.623  -2.791  -20.422 1.00 0.00 ? 101 PRO A CD   3  
ATOM 4708  H HA   . PRO A 1 101 ? -3.940  -1.412  -18.667 1.00 0.00 ? 101 PRO A HA   3  
ATOM 4709  H HB2  . PRO A 1 101 ? -1.950  0.313   -19.325 1.00 0.00 ? 101 PRO A HB2  3  
ATOM 4710  H HB3  . PRO A 1 101 ? -1.729  -1.019  -18.184 1.00 0.00 ? 101 PRO A HB3  3  
ATOM 4711  H HG2  . PRO A 1 101 ? -0.989  -0.863  -21.081 1.00 0.00 ? 101 PRO A HG2  3  
ATOM 4712  H HG3  . PRO A 1 101 ? -0.058  -1.521  -19.722 1.00 0.00 ? 101 PRO A HG3  3  
ATOM 4713  H HD2  . PRO A 1 101 ? -1.436  -3.095  -21.441 1.00 0.00 ? 101 PRO A HD2  3  
ATOM 4714  H HD3  . PRO A 1 101 ? -1.216  -3.514  -19.730 1.00 0.00 ? 101 PRO A HD3  3  
ATOM 4715  N N    . SER A 1 102 ? -5.340  -0.091  -20.253 1.00 0.00 ? 102 SER A N    3  
ATOM 4716  C CA   . SER A 1 102 ? -6.133  0.802   -21.090 1.00 0.00 ? 102 SER A CA   3  
ATOM 4717  C C    . SER A 1 102 ? -6.136  0.328   -22.540 1.00 0.00 ? 102 SER A C    3  
ATOM 4718  O O    . SER A 1 102 ? -6.082  1.134   -23.469 1.00 0.00 ? 102 SER A O    3  
ATOM 4719  C CB   . SER A 1 102 ? -5.587  2.229   -21.009 1.00 0.00 ? 102 SER A CB   3  
ATOM 4720  O OG   . SER A 1 102 ? -5.666  2.731   -19.687 1.00 0.00 ? 102 SER A OG   3  
ATOM 4721  H H    . SER A 1 102 ? -5.760  -0.517  -19.476 1.00 0.00 ? 102 SER A H    3  
ATOM 4722  H HA   . SER A 1 102 ? -7.146  0.792   -20.718 1.00 0.00 ? 102 SER A HA   3  
ATOM 4723  H HB2  . SER A 1 102 ? -4.554  2.235   -21.322 1.00 0.00 ? 102 SER A HB2  3  
ATOM 4724  H HB3  . SER A 1 102 ? -6.164  2.869   -21.660 1.00 0.00 ? 102 SER A HB3  3  
ATOM 4725  H HG   . SER A 1 102 ? -6.090  3.592   -19.696 1.00 0.00 ? 102 SER A HG   3  
ATOM 4726  N N    . SER A 1 103 ? -6.198  -0.987  -22.726 1.00 0.00 ? 103 SER A N    3  
ATOM 4727  C CA   . SER A 1 103 ? -6.204  -1.571  -24.062 1.00 0.00 ? 103 SER A CA   3  
ATOM 4728  C C    . SER A 1 103 ? -7.337  -2.582  -24.208 1.00 0.00 ? 103 SER A C    3  
ATOM 4729  O O    . SER A 1 103 ? -8.046  -2.880  -23.248 1.00 0.00 ? 103 SER A O    3  
ATOM 4730  C CB   . SER A 1 103 ? -4.862  -2.245  -24.353 1.00 0.00 ? 103 SER A CB   3  
ATOM 4731  O OG   . SER A 1 103 ? -4.623  -3.314  -23.454 1.00 0.00 ? 103 SER A OG   3  
ATOM 4732  H H    . SER A 1 103 ? -6.238  -1.578  -21.945 1.00 0.00 ? 103 SER A H    3  
ATOM 4733  H HA   . SER A 1 103 ? -6.357  -0.772  -24.772 1.00 0.00 ? 103 SER A HA   3  
ATOM 4734  H HB2  . SER A 1 103 ? -4.868  -2.632  -25.360 1.00 0.00 ? 103 SER A HB2  3  
ATOM 4735  H HB3  . SER A 1 103 ? -4.068  -1.519  -24.251 1.00 0.00 ? 103 SER A HB3  3  
ATOM 4736  H HG   . SER A 1 103 ? -4.701  -4.149  -23.921 1.00 0.00 ? 103 SER A HG   3  
ATOM 4737  N N    . GLY A 1 104 ? -7.500  -3.108  -25.418 1.00 0.00 ? 104 GLY A N    3  
ATOM 4738  C CA   . GLY A 1 104 ? -8.548  -4.080  -25.669 1.00 0.00 ? 104 GLY A CA   3  
ATOM 4739  C C    . GLY A 1 104 ? -9.584  -3.575  -26.654 1.00 0.00 ? 104 GLY A C    3  
ATOM 4740  O O    . GLY A 1 104 ? -9.681  -2.374  -26.900 1.00 0.00 ? 104 GLY A O    3  
ATOM 4741  H H    . GLY A 1 104 ? -6.905  -2.833  -26.147 1.00 0.00 ? 104 GLY A H    3  
ATOM 4742  H HA2  . GLY A 1 104 ? -8.101  -4.981  -26.063 1.00 0.00 ? 104 GLY A HA2  3  
ATOM 4743  H HA3  . GLY A 1 104 ? -9.039  -4.313  -24.736 1.00 0.00 ? 104 GLY A HA3  3  
ATOM 4744  N N    . GLY A 1 1   ? 37.240  -8.985  -30.374 1.00 0.00 ? 1   GLY A N    4  
ATOM 4745  C CA   . GLY A 1 1   ? 35.894  -8.933  -29.836 1.00 0.00 ? 1   GLY A CA   4  
ATOM 4746  C C    . GLY A 1 1   ? 35.327  -7.528  -29.825 1.00 0.00 ? 1   GLY A C    4  
ATOM 4747  O O    . GLY A 1 1   ? 35.894  -6.618  -30.430 1.00 0.00 ? 1   GLY A O    4  
ATOM 4748  H H1   . GLY A 1 1   ? 37.728  -8.153  -30.550 1.00 0.00 ? 1   GLY A H1   4  
ATOM 4749  H HA2  . GLY A 1 1   ? 35.254  -9.564  -30.435 1.00 0.00 ? 1   GLY A HA2  4  
ATOM 4750  H HA3  . GLY A 1 1   ? 35.908  -9.311  -28.824 1.00 0.00 ? 1   GLY A HA3  4  
ATOM 4751  N N    . SER A 1 2   ? 34.203  -7.349  -29.138 1.00 0.00 ? 2   SER A N    4  
ATOM 4752  C CA   . SER A 1 2   ? 33.556  -6.045  -29.055 1.00 0.00 ? 2   SER A CA   4  
ATOM 4753  C C    . SER A 1 2   ? 32.728  -5.929  -27.779 1.00 0.00 ? 2   SER A C    4  
ATOM 4754  O O    . SER A 1 2   ? 32.597  -6.890  -27.021 1.00 0.00 ? 2   SER A O    4  
ATOM 4755  C CB   . SER A 1 2   ? 32.665  -5.817  -30.278 1.00 0.00 ? 2   SER A CB   4  
ATOM 4756  O OG   . SER A 1 2   ? 32.259  -4.462  -30.366 1.00 0.00 ? 2   SER A OG   4  
ATOM 4757  H H    . SER A 1 2   ? 33.799  -8.114  -28.677 1.00 0.00 ? 2   SER A H    4  
ATOM 4758  H HA   . SER A 1 2   ? 34.330  -5.292  -29.038 1.00 0.00 ? 2   SER A HA   4  
ATOM 4759  H HB2  . SER A 1 2   ? 33.212  -6.075  -31.172 1.00 0.00 ? 2   SER A HB2  4  
ATOM 4760  H HB3  . SER A 1 2   ? 31.786  -6.440  -30.200 1.00 0.00 ? 2   SER A HB3  4  
ATOM 4761  H HG   . SER A 1 2   ? 31.426  -4.346  -29.902 1.00 0.00 ? 2   SER A HG   4  
ATOM 4762  N N    . SER A 1 3   ? 32.171  -4.745  -27.549 1.00 0.00 ? 3   SER A N    4  
ATOM 4763  C CA   . SER A 1 3   ? 31.358  -4.500  -26.363 1.00 0.00 ? 3   SER A CA   4  
ATOM 4764  C C    . SER A 1 3   ? 30.522  -3.235  -26.529 1.00 0.00 ? 3   SER A C    4  
ATOM 4765  O O    . SER A 1 3   ? 30.767  -2.429  -27.426 1.00 0.00 ? 3   SER A O    4  
ATOM 4766  C CB   . SER A 1 3   ? 32.248  -4.378  -25.125 1.00 0.00 ? 3   SER A CB   4  
ATOM 4767  O OG   . SER A 1 3   ? 32.877  -3.109  -25.072 1.00 0.00 ? 3   SER A OG   4  
ATOM 4768  H H    . SER A 1 3   ? 32.312  -4.017  -28.191 1.00 0.00 ? 3   SER A H    4  
ATOM 4769  H HA   . SER A 1 3   ? 30.694  -5.342  -26.237 1.00 0.00 ? 3   SER A HA   4  
ATOM 4770  H HB2  . SER A 1 3   ? 31.647  -4.506  -24.238 1.00 0.00 ? 3   SER A HB2  4  
ATOM 4771  H HB3  . SER A 1 3   ? 33.010  -5.144  -25.156 1.00 0.00 ? 3   SER A HB3  4  
ATOM 4772  H HG   . SER A 1 3   ? 32.334  -2.504  -24.562 1.00 0.00 ? 3   SER A HG   4  
ATOM 4773  N N    . GLY A 1 4   ? 29.533  -3.067  -25.656 1.00 0.00 ? 4   GLY A N    4  
ATOM 4774  C CA   . GLY A 1 4   ? 28.675  -1.899  -25.722 1.00 0.00 ? 4   GLY A CA   4  
ATOM 4775  C C    . GLY A 1 4   ? 28.484  -1.243  -24.369 1.00 0.00 ? 4   GLY A C    4  
ATOM 4776  O O    . GLY A 1 4   ? 28.999  -1.724  -23.360 1.00 0.00 ? 4   GLY A O    4  
ATOM 4777  H H    . GLY A 1 4   ? 29.385  -3.743  -24.962 1.00 0.00 ? 4   GLY A H    4  
ATOM 4778  H HA2  . GLY A 1 4   ? 29.114  -1.181  -26.399 1.00 0.00 ? 4   GLY A HA2  4  
ATOM 4779  H HA3  . GLY A 1 4   ? 27.710  -2.196  -26.104 1.00 0.00 ? 4   GLY A HA3  4  
ATOM 4780  N N    . SER A 1 5   ? 27.742  -0.141  -24.347 1.00 0.00 ? 5   SER A N    4  
ATOM 4781  C CA   . SER A 1 5   ? 27.488  0.586   -23.108 1.00 0.00 ? 5   SER A CA   4  
ATOM 4782  C C    . SER A 1 5   ? 26.231  1.442   -23.228 1.00 0.00 ? 5   SER A C    4  
ATOM 4783  O O    . SER A 1 5   ? 25.785  1.758   -24.331 1.00 0.00 ? 5   SER A O    4  
ATOM 4784  C CB   . SER A 1 5   ? 28.688  1.467   -22.754 1.00 0.00 ? 5   SER A CB   4  
ATOM 4785  O OG   . SER A 1 5   ? 29.866  0.693   -22.613 1.00 0.00 ? 5   SER A OG   4  
ATOM 4786  H H    . SER A 1 5   ? 27.358  0.194   -25.185 1.00 0.00 ? 5   SER A H    4  
ATOM 4787  H HA   . SER A 1 5   ? 27.342  -0.140  -22.322 1.00 0.00 ? 5   SER A HA   4  
ATOM 4788  H HB2  . SER A 1 5   ? 28.841  2.194   -23.538 1.00 0.00 ? 5   SER A HB2  4  
ATOM 4789  H HB3  . SER A 1 5   ? 28.493  1.978   -21.822 1.00 0.00 ? 5   SER A HB3  4  
ATOM 4790  H HG   . SER A 1 5   ? 30.317  0.639   -23.458 1.00 0.00 ? 5   SER A HG   4  
ATOM 4791  N N    . SER A 1 6   ? 25.665  1.814   -22.084 1.00 0.00 ? 6   SER A N    4  
ATOM 4792  C CA   . SER A 1 6   ? 24.457  2.631   -22.059 1.00 0.00 ? 6   SER A CA   4  
ATOM 4793  C C    . SER A 1 6   ? 24.576  3.745   -21.024 1.00 0.00 ? 6   SER A C    4  
ATOM 4794  O O    . SER A 1 6   ? 25.521  3.779   -20.238 1.00 0.00 ? 6   SER A O    4  
ATOM 4795  C CB   . SER A 1 6   ? 23.236  1.762   -21.753 1.00 0.00 ? 6   SER A CB   4  
ATOM 4796  O OG   . SER A 1 6   ? 23.352  1.150   -20.480 1.00 0.00 ? 6   SER A OG   4  
ATOM 4797  H H    . SER A 1 6   ? 26.069  1.531   -21.237 1.00 0.00 ? 6   SER A H    4  
ATOM 4798  H HA   . SER A 1 6   ? 24.337  3.074   -23.036 1.00 0.00 ? 6   SER A HA   4  
ATOM 4799  H HB2  . SER A 1 6   ? 22.348  2.377   -21.763 1.00 0.00 ? 6   SER A HB2  4  
ATOM 4800  H HB3  . SER A 1 6   ? 23.148  0.991   -22.504 1.00 0.00 ? 6   SER A HB3  4  
ATOM 4801  H HG   . SER A 1 6   ? 23.155  1.793   -19.795 1.00 0.00 ? 6   SER A HG   4  
ATOM 4802  N N    . GLY A 1 7   ? 23.608  4.657   -21.032 1.00 0.00 ? 7   GLY A N    4  
ATOM 4803  C CA   . GLY A 1 7   ? 23.622  5.761   -20.090 1.00 0.00 ? 7   GLY A CA   4  
ATOM 4804  C C    . GLY A 1 7   ? 22.353  5.835   -19.265 1.00 0.00 ? 7   GLY A C    4  
ATOM 4805  O O    . GLY A 1 7   ? 21.401  5.094   -19.509 1.00 0.00 ? 7   GLY A O    4  
ATOM 4806  H H    . GLY A 1 7   ? 22.879  4.579   -21.682 1.00 0.00 ? 7   GLY A H    4  
ATOM 4807  H HA2  . GLY A 1 7   ? 24.465  5.643   -19.425 1.00 0.00 ? 7   GLY A HA2  4  
ATOM 4808  H HA3  . GLY A 1 7   ? 23.735  6.685   -20.638 1.00 0.00 ? 7   GLY A HA3  4  
ATOM 4809  N N    . MET A 1 8   ? 22.338  6.731   -18.283 1.00 0.00 ? 8   MET A N    4  
ATOM 4810  C CA   . MET A 1 8   ? 21.175  6.899   -17.419 1.00 0.00 ? 8   MET A CA   4  
ATOM 4811  C C    . MET A 1 8   ? 20.511  8.251   -17.657 1.00 0.00 ? 8   MET A C    4  
ATOM 4812  O O    . MET A 1 8   ? 21.185  9.245   -17.928 1.00 0.00 ? 8   MET A O    4  
ATOM 4813  C CB   . MET A 1 8   ? 21.582  6.768   -15.950 1.00 0.00 ? 8   MET A CB   4  
ATOM 4814  C CG   . MET A 1 8   ? 20.410  6.526   -15.014 1.00 0.00 ? 8   MET A CG   4  
ATOM 4815  S SD   . MET A 1 8   ? 20.839  6.785   -13.282 1.00 0.00 ? 8   MET A SD   4  
ATOM 4816  C CE   . MET A 1 8   ? 19.641  8.033   -12.818 1.00 0.00 ? 8   MET A CE   4  
ATOM 4817  H H    . MET A 1 8   ? 23.127  7.294   -18.137 1.00 0.00 ? 8   MET A H    4  
ATOM 4818  H HA   . MET A 1 8   ? 20.470  6.117   -17.658 1.00 0.00 ? 8   MET A HA   4  
ATOM 4819  H HB2  . MET A 1 8   ? 22.271  5.942   -15.851 1.00 0.00 ? 8   MET A HB2  4  
ATOM 4820  H HB3  . MET A 1 8   ? 22.078  7.678   -15.644 1.00 0.00 ? 8   MET A HB3  4  
ATOM 4821  H HG2  . MET A 1 8   ? 19.611  7.204   -15.276 1.00 0.00 ? 8   MET A HG2  4  
ATOM 4822  H HG3  . MET A 1 8   ? 20.072  5.508   -15.139 1.00 0.00 ? 8   MET A HG3  4  
ATOM 4823  H HE1  . MET A 1 8   ? 18.751  7.919   -13.419 1.00 0.00 ? 8   MET A HE1  4  
ATOM 4824  H HE2  . MET A 1 8   ? 19.388  7.918   -11.775 1.00 0.00 ? 8   MET A HE2  4  
ATOM 4825  H HE3  . MET A 1 8   ? 20.063  9.014   -12.981 1.00 0.00 ? 8   MET A HE3  4  
ATOM 4826  N N    . ALA A 1 9   ? 19.187  8.281   -17.553 1.00 0.00 ? 9   ALA A N    4  
ATOM 4827  C CA   . ALA A 1 9   ? 18.432  9.512   -17.755 1.00 0.00 ? 9   ALA A CA   4  
ATOM 4828  C C    . ALA A 1 9   ? 18.190  10.231  -16.432 1.00 0.00 ? 9   ALA A C    4  
ATOM 4829  O O    . ALA A 1 9   ? 17.227  9.939   -15.723 1.00 0.00 ? 9   ALA A O    4  
ATOM 4830  C CB   . ALA A 1 9   ? 17.110  9.214   -18.445 1.00 0.00 ? 9   ALA A CB   4  
ATOM 4831  H H    . ALA A 1 9   ? 18.706  7.456   -17.334 1.00 0.00 ? 9   ALA A H    4  
ATOM 4832  H HA   . ALA A 1 9   ? 19.011  10.156  -18.402 1.00 0.00 ? 9   ALA A HA   4  
ATOM 4833  H HB1  . ALA A 1 9   ? 16.502  10.107  -18.459 1.00 0.00 ? 9   ALA A HB1  4  
ATOM 4834  H HB2  . ALA A 1 9   ? 17.298  8.890   -19.458 1.00 0.00 ? 9   ALA A HB2  4  
ATOM 4835  H HB3  . ALA A 1 9   ? 16.592  8.433   -17.908 1.00 0.00 ? 9   ALA A HB3  4  
ATOM 4836  N N    . ASP A 1 10  ? 19.070  11.171  -16.105 1.00 0.00 ? 10  ASP A N    4  
ATOM 4837  C CA   . ASP A 1 10  ? 18.951  11.932  -14.867 1.00 0.00 ? 10  ASP A CA   4  
ATOM 4838  C C    . ASP A 1 10  ? 17.795  12.924  -14.948 1.00 0.00 ? 10  ASP A C    4  
ATOM 4839  O O    . ASP A 1 10  ? 17.941  14.020  -15.489 1.00 0.00 ? 10  ASP A O    4  
ATOM 4840  C CB   . ASP A 1 10  ? 20.256  12.674  -14.572 1.00 0.00 ? 10  ASP A CB   4  
ATOM 4841  C CG   . ASP A 1 10  ? 21.217  11.847  -13.741 1.00 0.00 ? 10  ASP A CG   4  
ATOM 4842  O OD1  . ASP A 1 10  ? 20.849  11.470  -12.609 1.00 0.00 ? 10  ASP A OD1  4  
ATOM 4843  O OD2  . ASP A 1 10  ? 22.337  11.577  -14.223 1.00 0.00 ? 10  ASP A OD2  4  
ATOM 4844  H H    . ASP A 1 10  ? 19.817  11.359  -16.712 1.00 0.00 ? 10  ASP A H    4  
ATOM 4845  H HA   . ASP A 1 10  ? 18.755  11.235  -14.067 1.00 0.00 ? 10  ASP A HA   4  
ATOM 4846  H HB2  . ASP A 1 10  ? 20.739  12.924  -15.505 1.00 0.00 ? 10  ASP A HB2  4  
ATOM 4847  H HB3  . ASP A 1 10  ? 20.032  13.583  -14.033 1.00 0.00 ? 10  ASP A HB3  4  
ATOM 4848  N N    . GLU A 1 11  ? 16.646  12.531  -14.407 1.00 0.00 ? 11  GLU A N    4  
ATOM 4849  C CA   . GLU A 1 11  ? 15.464  13.386  -14.420 1.00 0.00 ? 11  GLU A CA   4  
ATOM 4850  C C    . GLU A 1 11  ? 15.369  14.202  -13.134 1.00 0.00 ? 11  GLU A C    4  
ATOM 4851  O O    . GLU A 1 11  ? 14.388  14.109  -12.396 1.00 0.00 ? 11  GLU A O    4  
ATOM 4852  C CB   . GLU A 1 11  ? 14.200  12.543  -14.596 1.00 0.00 ? 11  GLU A CB   4  
ATOM 4853  C CG   . GLU A 1 11  ? 14.114  11.850  -15.945 1.00 0.00 ? 11  GLU A CG   4  
ATOM 4854  C CD   . GLU A 1 11  ? 12.928  10.910  -16.044 1.00 0.00 ? 11  GLU A CD   4  
ATOM 4855  O OE1  . GLU A 1 11  ? 11.788  11.405  -16.170 1.00 0.00 ? 11  GLU A OE1  4  
ATOM 4856  O OE2  . GLU A 1 11  ? 13.139  9.680   -15.995 1.00 0.00 ? 11  GLU A OE2  4  
ATOM 4857  H H    . GLU A 1 11  ? 16.591  11.646  -13.990 1.00 0.00 ? 11  GLU A H    4  
ATOM 4858  H HA   . GLU A 1 11  ? 15.554  14.063  -15.256 1.00 0.00 ? 11  GLU A HA   4  
ATOM 4859  H HB2  . GLU A 1 11  ? 14.174  11.788  -13.824 1.00 0.00 ? 11  GLU A HB2  4  
ATOM 4860  H HB3  . GLU A 1 11  ? 13.337  13.184  -14.489 1.00 0.00 ? 11  GLU A HB3  4  
ATOM 4861  H HG2  . GLU A 1 11  ? 14.023  12.600  -16.716 1.00 0.00 ? 11  GLU A HG2  4  
ATOM 4862  H HG3  . GLU A 1 11  ? 15.019  11.282  -16.102 1.00 0.00 ? 11  GLU A HG3  4  
ATOM 4863  N N    . LYS A 1 12  ? 16.396  15.003  -12.871 1.00 0.00 ? 12  LYS A N    4  
ATOM 4864  C CA   . LYS A 1 12  ? 16.431  15.837  -11.676 1.00 0.00 ? 12  LYS A CA   4  
ATOM 4865  C C    . LYS A 1 12  ? 16.032  15.035  -10.441 1.00 0.00 ? 12  LYS A C    4  
ATOM 4866  O O    . LYS A 1 12  ? 15.143  15.421  -9.681  1.00 0.00 ? 12  LYS A O    4  
ATOM 4867  C CB   . LYS A 1 12  ? 15.497  17.039  -11.840 1.00 0.00 ? 12  LYS A CB   4  
ATOM 4868  C CG   . LYS A 1 12  ? 15.903  17.974  -12.966 1.00 0.00 ? 12  LYS A CG   4  
ATOM 4869  C CD   . LYS A 1 12  ? 15.432  19.395  -12.707 1.00 0.00 ? 12  LYS A CD   4  
ATOM 4870  C CE   . LYS A 1 12  ? 14.043  19.635  -13.277 1.00 0.00 ? 12  LYS A CE   4  
ATOM 4871  N NZ   . LYS A 1 12  ? 12.974  19.277  -12.304 1.00 0.00 ? 12  LYS A NZ   4  
ATOM 4872  H H    . LYS A 1 12  ? 17.150  15.034  -13.497 1.00 0.00 ? 12  LYS A H    4  
ATOM 4873  H HA   . LYS A 1 12  ? 17.442  16.193  -11.548 1.00 0.00 ? 12  LYS A HA   4  
ATOM 4874  H HB2  . LYS A 1 12  ? 14.499  16.679  -12.041 1.00 0.00 ? 12  LYS A HB2  4  
ATOM 4875  H HB3  . LYS A 1 12  ? 15.489  17.602  -10.918 1.00 0.00 ? 12  LYS A HB3  4  
ATOM 4876  H HG2  . LYS A 1 12  ? 16.979  17.973  -13.053 1.00 0.00 ? 12  LYS A HG2  4  
ATOM 4877  H HG3  . LYS A 1 12  ? 15.465  17.622  -13.889 1.00 0.00 ? 12  LYS A HG3  4  
ATOM 4878  H HD2  . LYS A 1 12  ? 15.406  19.568  -11.641 1.00 0.00 ? 12  LYS A HD2  4  
ATOM 4879  H HD3  . LYS A 1 12  ? 16.125  20.085  -13.168 1.00 0.00 ? 12  LYS A HD3  4  
ATOM 4880  H HE2  . LYS A 1 12  ? 13.948  20.679  -13.534 1.00 0.00 ? 12  LYS A HE2  4  
ATOM 4881  H HE3  . LYS A 1 12  ? 13.924  19.034  -14.166 1.00 0.00 ? 12  LYS A HE3  4  
ATOM 4882  H HZ1  . LYS A 1 12  ? 12.278  18.649  -12.753 1.00 0.00 ? 12  LYS A HZ1  4  
ATOM 4883  H HZ2  . LYS A 1 12  ? 12.488  20.135  -11.975 1.00 0.00 ? 12  LYS A HZ2  4  
ATOM 4884  H HZ3  . LYS A 1 12  ? 13.387  18.789  -11.483 1.00 0.00 ? 12  LYS A HZ3  4  
ATOM 4885  N N    . PRO A 1 13  ? 16.704  13.893  -10.233 1.00 0.00 ? 13  PRO A N    4  
ATOM 4886  C CA   . PRO A 1 13  ? 16.438  13.015  -9.090  1.00 0.00 ? 13  PRO A CA   4  
ATOM 4887  C C    . PRO A 1 13  ? 16.883  13.632  -7.769  1.00 0.00 ? 13  PRO A C    4  
ATOM 4888  O O    . PRO A 1 13  ? 17.953  13.312  -7.251  1.00 0.00 ? 13  PRO A O    4  
ATOM 4889  C CB   . PRO A 1 13  ? 17.265  11.766  -9.402  1.00 0.00 ? 13  PRO A CB   4  
ATOM 4890  C CG   . PRO A 1 13  ? 18.362  12.250  -10.287 1.00 0.00 ? 13  PRO A CG   4  
ATOM 4891  C CD   . PRO A 1 13  ? 17.776  13.372  -11.098 1.00 0.00 ? 13  PRO A CD   4  
ATOM 4892  H HA   . PRO A 1 13  ? 15.392  12.750  -9.028  1.00 0.00 ? 13  PRO A HA   4  
ATOM 4893  H HB2  . PRO A 1 13  ? 17.653  11.348  -8.484  1.00 0.00 ? 13  PRO A HB2  4  
ATOM 4894  H HB3  . PRO A 1 13  ? 16.647  11.036  -9.904  1.00 0.00 ? 13  PRO A HB3  4  
ATOM 4895  H HG2  . PRO A 1 13  ? 19.185  12.609  -9.688  1.00 0.00 ? 13  PRO A HG2  4  
ATOM 4896  H HG3  . PRO A 1 13  ? 18.690  11.451  -10.936 1.00 0.00 ? 13  PRO A HG3  4  
ATOM 4897  H HD2  . PRO A 1 13  ? 18.522  14.130  -11.287 1.00 0.00 ? 13  PRO A HD2  4  
ATOM 4898  H HD3  . PRO A 1 13  ? 17.373  12.996  -12.026 1.00 0.00 ? 13  PRO A HD3  4  
ATOM 4899  N N    . LYS A 1 14  ? 16.055  14.519  -7.227  1.00 0.00 ? 14  LYS A N    4  
ATOM 4900  C CA   . LYS A 1 14  ? 16.361  15.180  -5.964  1.00 0.00 ? 14  LYS A CA   4  
ATOM 4901  C C    . LYS A 1 14  ? 15.083  15.526  -5.206  1.00 0.00 ? 14  LYS A C    4  
ATOM 4902  O O    . LYS A 1 14  ? 14.031  15.734  -5.809  1.00 0.00 ? 14  LYS A O    4  
ATOM 4903  C CB   . LYS A 1 14  ? 17.177  16.451  -6.215  1.00 0.00 ? 14  LYS A CB   4  
ATOM 4904  C CG   . LYS A 1 14  ? 18.678  16.216  -6.233  1.00 0.00 ? 14  LYS A CG   4  
ATOM 4905  C CD   . LYS A 1 14  ? 19.225  15.999  -4.833  1.00 0.00 ? 14  LYS A CD   4  
ATOM 4906  C CE   . LYS A 1 14  ? 19.247  17.294  -4.036  1.00 0.00 ? 14  LYS A CE   4  
ATOM 4907  N NZ   . LYS A 1 14  ? 17.977  17.507  -3.289  1.00 0.00 ? 14  LYS A NZ   4  
ATOM 4908  H H    . LYS A 1 14  ? 15.216  14.733  -7.687  1.00 0.00 ? 14  LYS A H    4  
ATOM 4909  H HA   . LYS A 1 14  ? 16.947  14.499  -5.366  1.00 0.00 ? 14  LYS A HA   4  
ATOM 4910  H HB2  . LYS A 1 14  ? 16.887  16.868  -7.168  1.00 0.00 ? 14  LYS A HB2  4  
ATOM 4911  H HB3  . LYS A 1 14  ? 16.955  17.166  -5.436  1.00 0.00 ? 14  LYS A HB3  4  
ATOM 4912  H HG2  . LYS A 1 14  ? 18.889  15.342  -6.831  1.00 0.00 ? 14  LYS A HG2  4  
ATOM 4913  H HG3  . LYS A 1 14  ? 19.162  17.078  -6.670  1.00 0.00 ? 14  LYS A HG3  4  
ATOM 4914  H HD2  . LYS A 1 14  ? 18.601  15.283  -4.319  1.00 0.00 ? 14  LYS A HD2  4  
ATOM 4915  H HD3  . LYS A 1 14  ? 20.233  15.614  -4.906  1.00 0.00 ? 14  LYS A HD3  4  
ATOM 4916  H HE2  . LYS A 1 14  ? 20.065  17.255  -3.333  1.00 0.00 ? 14  LYS A HE2  4  
ATOM 4917  H HE3  . LYS A 1 14  ? 19.397  18.118  -4.717  1.00 0.00 ? 14  LYS A HE3  4  
ATOM 4918  H HZ1  . LYS A 1 14  ? 18.145  17.422  -2.266  1.00 0.00 ? 14  LYS A HZ1  4  
ATOM 4919  H HZ2  . LYS A 1 14  ? 17.272  16.796  -3.572  1.00 0.00 ? 14  LYS A HZ2  4  
ATOM 4920  H HZ3  . LYS A 1 14  ? 17.598  18.454  -3.490  1.00 0.00 ? 14  LYS A HZ3  4  
ATOM 4921  N N    . GLU A 1 15  ? 15.184  15.586  -3.882  1.00 0.00 ? 15  GLU A N    4  
ATOM 4922  C CA   . GLU A 1 15  ? 14.035  15.907  -3.044  1.00 0.00 ? 15  GLU A CA   4  
ATOM 4923  C C    . GLU A 1 15  ? 14.473  16.215  -1.615  1.00 0.00 ? 15  GLU A C    4  
ATOM 4924  O O    . GLU A 1 15  ? 15.485  15.702  -1.140  1.00 0.00 ? 15  GLU A O    4  
ATOM 4925  C CB   . GLU A 1 15  ? 13.036  14.747  -3.043  1.00 0.00 ? 15  GLU A CB   4  
ATOM 4926  C CG   . GLU A 1 15  ? 11.695  15.099  -2.420  1.00 0.00 ? 15  GLU A CG   4  
ATOM 4927  C CD   . GLU A 1 15  ? 10.873  13.873  -2.075  1.00 0.00 ? 15  GLU A CD   4  
ATOM 4928  O OE1  . GLU A 1 15  ? 11.218  13.185  -1.092  1.00 0.00 ? 15  GLU A OE1  4  
ATOM 4929  O OE2  . GLU A 1 15  ? 9.884   13.603  -2.788  1.00 0.00 ? 15  GLU A OE2  4  
ATOM 4930  H H    . GLU A 1 15  ? 16.050  15.409  -3.459  1.00 0.00 ? 15  GLU A H    4  
ATOM 4931  H HA   . GLU A 1 15  ? 13.556  16.781  -3.457  1.00 0.00 ? 15  GLU A HA   4  
ATOM 4932  H HB2  . GLU A 1 15  ? 12.865  14.434  -4.062  1.00 0.00 ? 15  GLU A HB2  4  
ATOM 4933  H HB3  . GLU A 1 15  ? 13.461  13.923  -2.489  1.00 0.00 ? 15  GLU A HB3  4  
ATOM 4934  H HG2  . GLU A 1 15  ? 11.870  15.663  -1.516  1.00 0.00 ? 15  GLU A HG2  4  
ATOM 4935  H HG3  . GLU A 1 15  ? 11.136  15.705  -3.119  1.00 0.00 ? 15  GLU A HG3  4  
ATOM 4936  N N    . GLY A 1 16  ? 13.703  17.059  -0.935  1.00 0.00 ? 16  GLY A N    4  
ATOM 4937  C CA   . GLY A 1 16  ? 14.028  17.423  0.432   1.00 0.00 ? 16  GLY A CA   4  
ATOM 4938  C C    . GLY A 1 16  ? 12.999  16.920  1.426   1.00 0.00 ? 16  GLY A C    4  
ATOM 4939  O O    . GLY A 1 16  ? 11.878  17.427  1.480   1.00 0.00 ? 16  GLY A O    4  
ATOM 4940  H H    . GLY A 1 16  ? 12.908  17.438  -1.365  1.00 0.00 ? 16  GLY A H    4  
ATOM 4941  H HA2  . GLY A 1 16  ? 14.991  17.006  0.685   1.00 0.00 ? 16  GLY A HA2  4  
ATOM 4942  H HA3  . GLY A 1 16  ? 14.083  18.499  0.502   1.00 0.00 ? 16  GLY A HA3  4  
ATOM 4943  N N    . VAL A 1 17  ? 13.380  15.920  2.214   1.00 0.00 ? 17  VAL A N    4  
ATOM 4944  C CA   . VAL A 1 17  ? 12.482  15.348  3.210   1.00 0.00 ? 17  VAL A CA   4  
ATOM 4945  C C    . VAL A 1 17  ? 12.903  15.744  4.621   1.00 0.00 ? 17  VAL A C    4  
ATOM 4946  O O    . VAL A 1 17  ? 13.853  15.190  5.176   1.00 0.00 ? 17  VAL A O    4  
ATOM 4947  C CB   . VAL A 1 17  ? 12.440  13.811  3.111   1.00 0.00 ? 17  VAL A CB   4  
ATOM 4948  C CG1  . VAL A 1 17  ? 11.537  13.231  4.189   1.00 0.00 ? 17  VAL A CG1  4  
ATOM 4949  C CG2  . VAL A 1 17  ? 11.978  13.380  1.728   1.00 0.00 ? 17  VAL A CG2  4  
ATOM 4950  H H    . VAL A 1 17  ? 14.286  15.558  2.124   1.00 0.00 ? 17  VAL A H    4  
ATOM 4951  H HA   . VAL A 1 17  ? 11.488  15.727  3.022   1.00 0.00 ? 17  VAL A HA   4  
ATOM 4952  H HB   . VAL A 1 17  ? 13.439  13.433  3.269   1.00 0.00 ? 17  VAL A HB   4  
ATOM 4953  H HG11 . VAL A 1 17  ? 11.613  12.154  4.180   1.00 0.00 ? 17  VAL A HG11 4  
ATOM 4954  H HG12 . VAL A 1 17  ? 11.840  13.608  5.155   1.00 0.00 ? 17  VAL A HG12 4  
ATOM 4955  H HG13 . VAL A 1 17  ? 10.514  13.520  3.995   1.00 0.00 ? 17  VAL A HG13 4  
ATOM 4956  H HG21 . VAL A 1 17  ? 11.466  12.432  1.800   1.00 0.00 ? 17  VAL A HG21 4  
ATOM 4957  H HG22 . VAL A 1 17  ? 11.305  14.122  1.324   1.00 0.00 ? 17  VAL A HG22 4  
ATOM 4958  H HG23 . VAL A 1 17  ? 12.834  13.279  1.077   1.00 0.00 ? 17  VAL A HG23 4  
ATOM 4959  N N    . LYS A 1 18  ? 12.190  16.706  5.197   1.00 0.00 ? 18  LYS A N    4  
ATOM 4960  C CA   . LYS A 1 18  ? 12.487  17.176  6.545   1.00 0.00 ? 18  LYS A CA   4  
ATOM 4961  C C    . LYS A 1 18  ? 11.625  16.455  7.576   1.00 0.00 ? 18  LYS A C    4  
ATOM 4962  O O    . LYS A 1 18  ? 10.397  16.543  7.545   1.00 0.00 ? 18  LYS A O    4  
ATOM 4963  C CB   . LYS A 1 18  ? 12.260  18.687  6.642   1.00 0.00 ? 18  LYS A CB   4  
ATOM 4964  C CG   . LYS A 1 18  ? 13.303  19.507  5.903   1.00 0.00 ? 18  LYS A CG   4  
ATOM 4965  C CD   . LYS A 1 18  ? 12.991  19.600  4.419   1.00 0.00 ? 18  LYS A CD   4  
ATOM 4966  C CE   . LYS A 1 18  ? 13.642  20.821  3.788   1.00 0.00 ? 18  LYS A CE   4  
ATOM 4967  N NZ   . LYS A 1 18  ? 12.777  22.028  3.894   1.00 0.00 ? 18  LYS A NZ   4  
ATOM 4968  H H    . LYS A 1 18  ? 11.444  17.109  4.704   1.00 0.00 ? 18  LYS A H    4  
ATOM 4969  H HA   . LYS A 1 18  ? 13.525  16.963  6.749   1.00 0.00 ? 18  LYS A HA   4  
ATOM 4970  H HB2  . LYS A 1 18  ? 11.289  18.919  6.228   1.00 0.00 ? 18  LYS A HB2  4  
ATOM 4971  H HB3  . LYS A 1 18  ? 12.276  18.975  7.683   1.00 0.00 ? 18  LYS A HB3  4  
ATOM 4972  H HG2  . LYS A 1 18  ? 13.324  20.504  6.318   1.00 0.00 ? 18  LYS A HG2  4  
ATOM 4973  H HG3  . LYS A 1 18  ? 14.270  19.042  6.030   1.00 0.00 ? 18  LYS A HG3  4  
ATOM 4974  H HD2  . LYS A 1 18  ? 13.361  18.714  3.926   1.00 0.00 ? 18  LYS A HD2  4  
ATOM 4975  H HD3  . LYS A 1 18  ? 11.920  19.666  4.288   1.00 0.00 ? 18  LYS A HD3  4  
ATOM 4976  H HE2  . LYS A 1 18  ? 14.577  21.014  4.290   1.00 0.00 ? 18  LYS A HE2  4  
ATOM 4977  H HE3  . LYS A 1 18  ? 13.829  20.614  2.744   1.00 0.00 ? 18  LYS A HE3  4  
ATOM 4978  H HZ1  . LYS A 1 18  ? 13.265  22.854  3.492   1.00 0.00 ? 18  LYS A HZ1  4  
ATOM 4979  H HZ2  . LYS A 1 18  ? 12.555  22.222  4.891   1.00 0.00 ? 18  LYS A HZ2  4  
ATOM 4980  H HZ3  . LYS A 1 18  ? 11.888  21.878  3.375   1.00 0.00 ? 18  LYS A HZ3  4  
ATOM 4981  N N    . THR A 1 19  ? 12.275  15.740  8.489   1.00 0.00 ? 19  THR A N    4  
ATOM 4982  C CA   . THR A 1 19  ? 11.568  15.004  9.529   1.00 0.00 ? 19  THR A CA   4  
ATOM 4983  C C    . THR A 1 19  ? 11.464  15.824  10.810  1.00 0.00 ? 19  THR A C    4  
ATOM 4984  O O    . THR A 1 19  ? 12.464  16.336  11.313  1.00 0.00 ? 19  THR A O    4  
ATOM 4985  C CB   . THR A 1 19  ? 12.266  13.668  9.845   1.00 0.00 ? 19  THR A CB   4  
ATOM 4986  O OG1  . THR A 1 19  ? 12.380  12.881  8.654   1.00 0.00 ? 19  THR A OG1  4  
ATOM 4987  C CG2  . THR A 1 19  ? 11.495  12.890  10.900  1.00 0.00 ? 19  THR A CG2  4  
ATOM 4988  H H    . THR A 1 19  ? 13.254  15.708  8.461   1.00 0.00 ? 19  THR A H    4  
ATOM 4989  H HA   . THR A 1 19  ? 10.573  14.790  9.168   1.00 0.00 ? 19  THR A HA   4  
ATOM 4990  H HB   . THR A 1 19  ? 13.256  13.877  10.225  1.00 0.00 ? 19  THR A HB   4  
ATOM 4991  H HG1  . THR A 1 19  ? 12.807  13.400  7.967   1.00 0.00 ? 19  THR A HG1  4  
ATOM 4992  H HG21 . THR A 1 19  ? 10.492  13.283  10.976  1.00 0.00 ? 19  THR A HG21 4  
ATOM 4993  H HG22 . THR A 1 19  ? 11.992  12.986  11.854  1.00 0.00 ? 19  THR A HG22 4  
ATOM 4994  H HG23 . THR A 1 19  ? 11.452  11.848  10.620  1.00 0.00 ? 19  THR A HG23 4  
ATOM 4995  N N    . GLU A 1 20  ? 10.247  15.945  11.332  1.00 0.00 ? 20  GLU A N    4  
ATOM 4996  C CA   . GLU A 1 20  ? 10.014  16.705  12.555  1.00 0.00 ? 20  GLU A CA   4  
ATOM 4997  C C    . GLU A 1 20  ? 9.990   15.784  13.771  1.00 0.00 ? 20  GLU A C    4  
ATOM 4998  O O    . GLU A 1 20  ? 10.549  16.106  14.818  1.00 0.00 ? 20  GLU A O    4  
ATOM 4999  C CB   . GLU A 1 20  ? 8.696   17.476  12.459  1.00 0.00 ? 20  GLU A CB   4  
ATOM 5000  C CG   . GLU A 1 20  ? 8.648   18.711  13.343  1.00 0.00 ? 20  GLU A CG   4  
ATOM 5001  C CD   . GLU A 1 20  ? 7.634   19.732  12.864  1.00 0.00 ? 20  GLU A CD   4  
ATOM 5002  O OE1  . GLU A 1 20  ? 6.421   19.483  13.024  1.00 0.00 ? 20  GLU A OE1  4  
ATOM 5003  O OE2  . GLU A 1 20  ? 8.054   20.779  12.329  1.00 0.00 ? 20  GLU A OE2  4  
ATOM 5004  H H    . GLU A 1 20  ? 9.490   15.515  10.884  1.00 0.00 ? 20  GLU A H    4  
ATOM 5005  H HA   . GLU A 1 20  ? 10.825  17.409  12.668  1.00 0.00 ? 20  GLU A HA   4  
ATOM 5006  H HB2  . GLU A 1 20  ? 8.547   17.785  11.435  1.00 0.00 ? 20  GLU A HB2  4  
ATOM 5007  H HB3  . GLU A 1 20  ? 7.888   16.821  12.748  1.00 0.00 ? 20  GLU A HB3  4  
ATOM 5008  H HG2  . GLU A 1 20  ? 8.385   18.410  14.346  1.00 0.00 ? 20  GLU A HG2  4  
ATOM 5009  H HG3  . GLU A 1 20  ? 9.625   19.171  13.350  1.00 0.00 ? 20  GLU A HG3  4  
ATOM 5010  N N    . ASN A 1 21  ? 9.336   14.636  13.623  1.00 0.00 ? 21  ASN A N    4  
ATOM 5011  C CA   . ASN A 1 21  ? 9.237   13.667  14.710  1.00 0.00 ? 21  ASN A CA   4  
ATOM 5012  C C    . ASN A 1 21  ? 9.267   12.240  14.171  1.00 0.00 ? 21  ASN A C    4  
ATOM 5013  O O    . ASN A 1 21  ? 8.981   12.003  12.998  1.00 0.00 ? 21  ASN A O    4  
ATOM 5014  C CB   . ASN A 1 21  ? 7.953   13.896  15.509  1.00 0.00 ? 21  ASN A CB   4  
ATOM 5015  C CG   . ASN A 1 21  ? 6.771   14.234  14.620  1.00 0.00 ? 21  ASN A CG   4  
ATOM 5016  O OD1  . ASN A 1 21  ? 6.127   15.268  14.792  1.00 0.00 ? 21  ASN A OD1  4  
ATOM 5017  N ND2  . ASN A 1 21  ? 6.482   13.360  13.663  1.00 0.00 ? 21  ASN A ND2  4  
ATOM 5018  H H    . ASN A 1 21  ? 8.910   14.435  12.764  1.00 0.00 ? 21  ASN A H    4  
ATOM 5019  H HA   . ASN A 1 21  ? 10.086  13.812  15.361  1.00 0.00 ? 21  ASN A HA   4  
ATOM 5020  H HB2  . ASN A 1 21  ? 7.716   12.999  16.063  1.00 0.00 ? 21  ASN A HB2  4  
ATOM 5021  H HB3  . ASN A 1 21  ? 8.105   14.711  16.199  1.00 0.00 ? 21  ASN A HB3  4  
ATOM 5022  H HD21 . ASN A 1 21  ? 7.039   12.557  13.585  1.00 0.00 ? 21  ASN A HD21 4  
ATOM 5023  H HD22 . ASN A 1 21  ? 5.724   13.553  13.073  1.00 0.00 ? 21  ASN A HD22 4  
ATOM 5024  N N    . ASN A 1 22  ? 9.616   11.294  15.036  1.00 0.00 ? 22  ASN A N    4  
ATOM 5025  C CA   . ASN A 1 22  ? 9.683   9.890   14.648  1.00 0.00 ? 22  ASN A CA   4  
ATOM 5026  C C    . ASN A 1 22  ? 8.350   9.192   14.897  1.00 0.00 ? 22  ASN A C    4  
ATOM 5027  O O    . ASN A 1 22  ? 8.298   8.140   15.536  1.00 0.00 ? 22  ASN A O    4  
ATOM 5028  C CB   . ASN A 1 22  ? 10.796  9.179   15.420  1.00 0.00 ? 22  ASN A CB   4  
ATOM 5029  C CG   . ASN A 1 22  ? 12.177  9.544   14.911  1.00 0.00 ? 22  ASN A CG   4  
ATOM 5030  O OD1  . ASN A 1 22  ? 12.708  8.900   14.006  1.00 0.00 ? 22  ASN A OD1  4  
ATOM 5031  N ND2  . ASN A 1 22  ? 12.766  10.583  15.492  1.00 0.00 ? 22  ASN A ND2  4  
ATOM 5032  H H    . ASN A 1 22  ? 9.833   11.545  15.958  1.00 0.00 ? 22  ASN A H    4  
ATOM 5033  H HA   . ASN A 1 22  ? 9.906   9.849   13.592  1.00 0.00 ? 22  ASN A HA   4  
ATOM 5034  H HB2  . ASN A 1 22  ? 10.734  9.452   16.463  1.00 0.00 ? 22  ASN A HB2  4  
ATOM 5035  H HB3  . ASN A 1 22  ? 10.668  8.111   15.323  1.00 0.00 ? 22  ASN A HB3  4  
ATOM 5036  H HD21 . ASN A 1 22  ? 12.283  11.049  16.206  1.00 0.00 ? 22  ASN A HD21 4  
ATOM 5037  H HD22 . ASN A 1 22  ? 13.659  10.842  15.182  1.00 0.00 ? 22  ASN A HD22 4  
ATOM 5038  N N    . ASP A 1 23  ? 7.274   9.783   14.389  1.00 0.00 ? 23  ASP A N    4  
ATOM 5039  C CA   . ASP A 1 23  ? 5.940   9.218   14.555  1.00 0.00 ? 23  ASP A CA   4  
ATOM 5040  C C    . ASP A 1 23  ? 5.508   8.467   13.299  1.00 0.00 ? 23  ASP A C    4  
ATOM 5041  O O    . ASP A 1 23  ? 4.326   8.436   12.957  1.00 0.00 ? 23  ASP A O    4  
ATOM 5042  C CB   . ASP A 1 23  ? 4.932   10.322  14.877  1.00 0.00 ? 23  ASP A CB   4  
ATOM 5043  C CG   . ASP A 1 23  ? 4.807   10.576  16.366  1.00 0.00 ? 23  ASP A CG   4  
ATOM 5044  O OD1  . ASP A 1 23  ? 4.235   9.717   17.069  1.00 0.00 ? 23  ASP A OD1  4  
ATOM 5045  O OD2  . ASP A 1 23  ? 5.283   11.634  16.828  1.00 0.00 ? 23  ASP A OD2  4  
ATOM 5046  H H    . ASP A 1 23  ? 7.380   10.620  13.890  1.00 0.00 ? 23  ASP A H    4  
ATOM 5047  H HA   . ASP A 1 23  ? 5.975   8.523   15.380  1.00 0.00 ? 23  ASP A HA   4  
ATOM 5048  H HB2  . ASP A 1 23  ? 5.246   11.238  14.399  1.00 0.00 ? 23  ASP A HB2  4  
ATOM 5049  H HB3  . ASP A 1 23  ? 3.962   10.036  14.496  1.00 0.00 ? 23  ASP A HB3  4  
ATOM 5050  N N    . HIS A 1 24  ? 6.475   7.863   12.615  1.00 0.00 ? 24  HIS A N    4  
ATOM 5051  C CA   . HIS A 1 24  ? 6.195   7.112   11.396  1.00 0.00 ? 24  HIS A CA   4  
ATOM 5052  C C    . HIS A 1 24  ? 7.240   6.022   11.177  1.00 0.00 ? 24  HIS A C    4  
ATOM 5053  O O    . HIS A 1 24  ? 8.367   6.124   11.661  1.00 0.00 ? 24  HIS A O    4  
ATOM 5054  C CB   . HIS A 1 24  ? 6.160   8.051   10.190  1.00 0.00 ? 24  HIS A CB   4  
ATOM 5055  C CG   . HIS A 1 24  ? 5.610   9.409   10.504  1.00 0.00 ? 24  HIS A CG   4  
ATOM 5056  N ND1  . HIS A 1 24  ? 4.437   9.890   9.962   1.00 0.00 ? 24  HIS A ND1  4  
ATOM 5057  C CD2  . HIS A 1 24  ? 6.080   10.389  11.312  1.00 0.00 ? 24  HIS A CD2  4  
ATOM 5058  C CE1  . HIS A 1 24  ? 4.210   11.108  10.421  1.00 0.00 ? 24  HIS A CE1  4  
ATOM 5059  N NE2  . HIS A 1 24  ? 5.192   11.434  11.242  1.00 0.00 ? 24  HIS A NE2  4  
ATOM 5060  H H    . HIS A 1 24  ? 7.398   7.923   12.938  1.00 0.00 ? 24  HIS A H    4  
ATOM 5061  H HA   . HIS A 1 24  ? 5.227   6.648   11.508  1.00 0.00 ? 24  HIS A HA   4  
ATOM 5062  H HB2  . HIS A 1 24  ? 7.163   8.179   9.813   1.00 0.00 ? 24  HIS A HB2  4  
ATOM 5063  H HB3  . HIS A 1 24  ? 5.543   7.613   9.419   1.00 0.00 ? 24  HIS A HB3  4  
ATOM 5064  H HD1  . HIS A 1 24  ? 3.859   9.411   9.333   1.00 0.00 ? 24  HIS A HD1  4  
ATOM 5065  H HD2  . HIS A 1 24  ? 6.985   10.356  11.902  1.00 0.00 ? 24  HIS A HD2  4  
ATOM 5066  H HE1  . HIS A 1 24  ? 3.365   11.731  10.168  1.00 0.00 ? 24  HIS A HE1  4  
ATOM 5067  H HE2  . HIS A 1 24  ? 5.314   12.314  11.654  1.00 0.00 ? 24  HIS A HE2  4  
ATOM 5068  N N    . ILE A 1 25  ? 6.857   4.981   10.446  1.00 0.00 ? 25  ILE A N    4  
ATOM 5069  C CA   . ILE A 1 25  ? 7.761   3.873   10.163  1.00 0.00 ? 25  ILE A CA   4  
ATOM 5070  C C    . ILE A 1 25  ? 7.865   3.618   8.663   1.00 0.00 ? 25  ILE A C    4  
ATOM 5071  O O    . ILE A 1 25  ? 6.873   3.696   7.940   1.00 0.00 ? 25  ILE A O    4  
ATOM 5072  C CB   . ILE A 1 25  ? 7.303   2.580   10.862  1.00 0.00 ? 25  ILE A CB   4  
ATOM 5073  C CG1  . ILE A 1 25  ? 5.928   2.154   10.344  1.00 0.00 ? 25  ILE A CG1  4  
ATOM 5074  C CG2  . ILE A 1 25  ? 7.270   2.776   12.370  1.00 0.00 ? 25  ILE A CG2  4  
ATOM 5075  C CD1  . ILE A 1 25  ? 5.553   0.738   10.719  1.00 0.00 ? 25  ILE A CD1  4  
ATOM 5076  H H    . ILE A 1 25  ? 5.946   4.958   10.087  1.00 0.00 ? 25  ILE A H    4  
ATOM 5077  H HA   . ILE A 1 25  ? 8.739   4.137   10.541  1.00 0.00 ? 25  ILE A HA   4  
ATOM 5078  H HB   . ILE A 1 25  ? 8.019   1.804   10.640  1.00 0.00 ? 25  ILE A HB   4  
ATOM 5079  H HG12 . ILE A 1 25  ? 5.177   2.814   10.750  1.00 0.00 ? 25  ILE A HG12 4  
ATOM 5080  H HG13 . ILE A 1 25  ? 5.919   2.226   9.266   1.00 0.00 ? 25  ILE A HG13 4  
ATOM 5081  H HG21 . ILE A 1 25  ? 7.653   3.756   12.614  1.00 0.00 ? 25  ILE A HG21 4  
ATOM 5082  H HG22 . ILE A 1 25  ? 6.252   2.692   12.721  1.00 0.00 ? 25  ILE A HG22 4  
ATOM 5083  H HG23 . ILE A 1 25  ? 7.879   2.023   12.845  1.00 0.00 ? 25  ILE A HG23 4  
ATOM 5084  H HD11 . ILE A 1 25  ? 6.425   0.104   10.652  1.00 0.00 ? 25  ILE A HD11 4  
ATOM 5085  H HD12 . ILE A 1 25  ? 5.171   0.721   11.728  1.00 0.00 ? 25  ILE A HD12 4  
ATOM 5086  H HD13 . ILE A 1 25  ? 4.793   0.375   10.041  1.00 0.00 ? 25  ILE A HD13 4  
ATOM 5087  N N    . ASN A 1 26  ? 9.074   3.311   8.203   1.00 0.00 ? 26  ASN A N    4  
ATOM 5088  C CA   . ASN A 1 26  ? 9.308   3.042   6.789   1.00 0.00 ? 26  ASN A CA   4  
ATOM 5089  C C    . ASN A 1 26  ? 9.106   1.563   6.475   1.00 0.00 ? 26  ASN A C    4  
ATOM 5090  O O    . ASN A 1 26  ? 9.514   0.693   7.246   1.00 0.00 ? 26  ASN A O    4  
ATOM 5091  C CB   . ASN A 1 26  ? 10.722  3.471   6.394   1.00 0.00 ? 26  ASN A CB   4  
ATOM 5092  C CG   . ASN A 1 26  ? 11.240  4.613   7.247   1.00 0.00 ? 26  ASN A CG   4  
ATOM 5093  O OD1  . ASN A 1 26  ? 11.142  4.580   8.473   1.00 0.00 ? 26  ASN A OD1  4  
ATOM 5094  N ND2  . ASN A 1 26  ? 11.794  5.631   6.599   1.00 0.00 ? 26  ASN A ND2  4  
ATOM 5095  H H    . ASN A 1 26  ? 9.826   3.264   8.829   1.00 0.00 ? 26  ASN A H    4  
ATOM 5096  H HA   . ASN A 1 26  ? 8.594   3.619   6.219   1.00 0.00 ? 26  ASN A HA   4  
ATOM 5097  H HB2  . ASN A 1 26  ? 11.391  2.630   6.508   1.00 0.00 ? 26  ASN A HB2  4  
ATOM 5098  H HB3  . ASN A 1 26  ? 10.722  3.787   5.362   1.00 0.00 ? 26  ASN A HB3  4  
ATOM 5099  H HD21 . ASN A 1 26  ? 11.837  5.589   5.620   1.00 0.00 ? 26  ASN A HD21 4  
ATOM 5100  H HD22 . ASN A 1 26  ? 12.137  6.383   7.126   1.00 0.00 ? 26  ASN A HD22 4  
ATOM 5101  N N    . LEU A 1 27  ? 8.475   1.285   5.340   1.00 0.00 ? 27  LEU A N    4  
ATOM 5102  C CA   . LEU A 1 27  ? 8.219   -0.090  4.923   1.00 0.00 ? 27  LEU A CA   4  
ATOM 5103  C C    . LEU A 1 27  ? 8.547   -0.281  3.446   1.00 0.00 ? 27  LEU A C    4  
ATOM 5104  O O    . LEU A 1 27  ? 7.992   0.398   2.582   1.00 0.00 ? 27  LEU A O    4  
ATOM 5105  C CB   . LEU A 1 27  ? 6.758   -0.459  5.185   1.00 0.00 ? 27  LEU A CB   4  
ATOM 5106  C CG   . LEU A 1 27  ? 6.115   0.178   6.417   1.00 0.00 ? 27  LEU A CG   4  
ATOM 5107  C CD1  . LEU A 1 27  ? 4.601   0.041   6.360   1.00 0.00 ? 27  LEU A CD1  4  
ATOM 5108  C CD2  . LEU A 1 27  ? 6.662   -0.453  7.690   1.00 0.00 ? 27  LEU A CD2  4  
ATOM 5109  H H    . LEU A 1 27  ? 8.173   2.021   4.768   1.00 0.00 ? 27  LEU A H    4  
ATOM 5110  H HA   . LEU A 1 27  ? 8.856   -0.737  5.508   1.00 0.00 ? 27  LEU A HA   4  
ATOM 5111  H HB2  . LEU A 1 27  ? 6.183   -0.163  4.322   1.00 0.00 ? 27  LEU A HB2  4  
ATOM 5112  H HB3  . LEU A 1 27  ? 6.705   -1.533  5.300   1.00 0.00 ? 27  LEU A HB3  4  
ATOM 5113  H HG   . LEU A 1 27  ? 6.354   1.232   6.436   1.00 0.00 ? 27  LEU A HG   4  
ATOM 5114  H HD11 . LEU A 1 27  ? 4.323   -0.978  6.585   1.00 0.00 ? 27  LEU A HD11 4  
ATOM 5115  H HD12 . LEU A 1 27  ? 4.254   0.299   5.371   1.00 0.00 ? 27  LEU A HD12 4  
ATOM 5116  H HD13 . LEU A 1 27  ? 4.153   0.705   7.084   1.00 0.00 ? 27  LEU A HD13 4  
ATOM 5117  H HD21 . LEU A 1 27  ? 7.536   0.092   8.014   1.00 0.00 ? 27  LEU A HD21 4  
ATOM 5118  H HD22 . LEU A 1 27  ? 6.930   -1.481  7.496   1.00 0.00 ? 27  LEU A HD22 4  
ATOM 5119  H HD23 . LEU A 1 27  ? 5.908   -0.416  8.462   1.00 0.00 ? 27  LEU A HD23 4  
ATOM 5120  N N    . LYS A 1 28  ? 9.452   -1.211  3.162   1.00 0.00 ? 28  LYS A N    4  
ATOM 5121  C CA   . LYS A 1 28  ? 9.853   -1.496  1.789   1.00 0.00 ? 28  LYS A CA   4  
ATOM 5122  C C    . LYS A 1 28  ? 9.002   -2.613  1.194   1.00 0.00 ? 28  LYS A C    4  
ATOM 5123  O O    . LYS A 1 28  ? 9.097   -3.768  1.611   1.00 0.00 ? 28  LYS A O    4  
ATOM 5124  C CB   . LYS A 1 28  ? 11.332  -1.884  1.738   1.00 0.00 ? 28  LYS A CB   4  
ATOM 5125  C CG   . LYS A 1 28  ? 12.276  -0.698  1.825   1.00 0.00 ? 28  LYS A CG   4  
ATOM 5126  C CD   . LYS A 1 28  ? 13.673  -1.126  2.242   1.00 0.00 ? 28  LYS A CD   4  
ATOM 5127  C CE   . LYS A 1 28  ? 13.788  -1.258  3.753   1.00 0.00 ? 28  LYS A CE   4  
ATOM 5128  N NZ   . LYS A 1 28  ? 14.911  -2.152  4.148   1.00 0.00 ? 28  LYS A NZ   4  
ATOM 5129  H H    . LYS A 1 28  ? 9.861   -1.720  3.894   1.00 0.00 ? 28  LYS A H    4  
ATOM 5130  H HA   . LYS A 1 28  ? 9.705   -0.598  1.208   1.00 0.00 ? 28  LYS A HA   4  
ATOM 5131  H HB2  . LYS A 1 28  ? 11.546  -2.549  2.562   1.00 0.00 ? 28  LYS A HB2  4  
ATOM 5132  H HB3  . LYS A 1 28  ? 11.524  -2.403  0.809   1.00 0.00 ? 28  LYS A HB3  4  
ATOM 5133  H HG2  . LYS A 1 28  ? 12.332  -0.221  0.858   1.00 0.00 ? 28  LYS A HG2  4  
ATOM 5134  H HG3  . LYS A 1 28  ? 11.892  0.003   2.553   1.00 0.00 ? 28  LYS A HG3  4  
ATOM 5135  H HD2  . LYS A 1 28  ? 13.897  -2.081  1.791   1.00 0.00 ? 28  LYS A HD2  4  
ATOM 5136  H HD3  . LYS A 1 28  ? 14.384  -0.388  1.898   1.00 0.00 ? 28  LYS A HD3  4  
ATOM 5137  H HE2  . LYS A 1 28  ? 13.954  -0.278  4.175   1.00 0.00 ? 28  LYS A HE2  4  
ATOM 5138  H HE3  . LYS A 1 28  ? 12.864  -1.663  4.137   1.00 0.00 ? 28  LYS A HE3  4  
ATOM 5139  H HZ1  . LYS A 1 28  ? 14.560  -2.920  4.755   1.00 0.00 ? 28  LYS A HZ1  4  
ATOM 5140  H HZ2  . LYS A 1 28  ? 15.630  -1.613  4.672   1.00 0.00 ? 28  LYS A HZ2  4  
ATOM 5141  H HZ3  . LYS A 1 28  ? 15.352  -2.567  3.303   1.00 0.00 ? 28  LYS A HZ3  4  
ATOM 5142  N N    . VAL A 1 29  ? 8.171   -2.262  0.218   1.00 0.00 ? 29  VAL A N    4  
ATOM 5143  C CA   . VAL A 1 29  ? 7.305   -3.236  -0.436  1.00 0.00 ? 29  VAL A CA   4  
ATOM 5144  C C    . VAL A 1 29  ? 7.977   -3.827  -1.671  1.00 0.00 ? 29  VAL A C    4  
ATOM 5145  O O    . VAL A 1 29  ? 8.556   -3.103  -2.481  1.00 0.00 ? 29  VAL A O    4  
ATOM 5146  C CB   . VAL A 1 29  ? 5.962   -2.606  -0.848  1.00 0.00 ? 29  VAL A CB   4  
ATOM 5147  C CG1  . VAL A 1 29  ? 4.970   -3.683  -1.258  1.00 0.00 ? 29  VAL A CG1  4  
ATOM 5148  C CG2  . VAL A 1 29  ? 5.403   -1.757  0.284   1.00 0.00 ? 29  VAL A CG2  4  
ATOM 5149  H H    . VAL A 1 29  ? 8.141   -1.326  -0.071  1.00 0.00 ? 29  VAL A H    4  
ATOM 5150  H HA   . VAL A 1 29  ? 7.106   -4.031  0.268   1.00 0.00 ? 29  VAL A HA   4  
ATOM 5151  H HB   . VAL A 1 29  ? 6.134   -1.964  -1.699  1.00 0.00 ? 29  VAL A HB   4  
ATOM 5152  H HG11 . VAL A 1 29  ? 4.686   -4.260  -0.390  1.00 0.00 ? 29  VAL A HG11 4  
ATOM 5153  H HG12 . VAL A 1 29  ? 4.093   -3.221  -1.687  1.00 0.00 ? 29  VAL A HG12 4  
ATOM 5154  H HG13 . VAL A 1 29  ? 5.427   -4.335  -1.988  1.00 0.00 ? 29  VAL A HG13 4  
ATOM 5155  H HG21 . VAL A 1 29  ? 4.459   -2.169  0.609   1.00 0.00 ? 29  VAL A HG21 4  
ATOM 5156  H HG22 . VAL A 1 29  ? 6.099   -1.756  1.111   1.00 0.00 ? 29  VAL A HG22 4  
ATOM 5157  H HG23 . VAL A 1 29  ? 5.255   -0.745  -0.062  1.00 0.00 ? 29  VAL A HG23 4  
ATOM 5158  N N    . ALA A 1 30  ? 7.894   -5.146  -1.809  1.00 0.00 ? 30  ALA A N    4  
ATOM 5159  C CA   . ALA A 1 30  ? 8.491   -5.834  -2.947  1.00 0.00 ? 30  ALA A CA   4  
ATOM 5160  C C    . ALA A 1 30  ? 7.436   -6.592  -3.746  1.00 0.00 ? 30  ALA A C    4  
ATOM 5161  O O    . ALA A 1 30  ? 6.713   -7.426  -3.203  1.00 0.00 ? 30  ALA A O    4  
ATOM 5162  C CB   . ALA A 1 30  ? 9.582   -6.784  -2.476  1.00 0.00 ? 30  ALA A CB   4  
ATOM 5163  H H    . ALA A 1 30  ? 7.418   -5.668  -1.130  1.00 0.00 ? 30  ALA A H    4  
ATOM 5164  H HA   . ALA A 1 30  ? 8.946   -5.090  -3.585  1.00 0.00 ? 30  ALA A HA   4  
ATOM 5165  H HB1  . ALA A 1 30  ? 9.229   -7.802  -2.553  1.00 0.00 ? 30  ALA A HB1  4  
ATOM 5166  H HB2  . ALA A 1 30  ? 10.459  -6.659  -3.093  1.00 0.00 ? 30  ALA A HB2  4  
ATOM 5167  H HB3  . ALA A 1 30  ? 9.830   -6.566  -1.448  1.00 0.00 ? 30  ALA A HB3  4  
ATOM 5168  N N    . GLY A 1 31  ? 7.353   -6.294  -5.039  1.00 0.00 ? 31  GLY A N    4  
ATOM 5169  C CA   . GLY A 1 31  ? 6.382   -6.955  -5.891  1.00 0.00 ? 31  GLY A CA   4  
ATOM 5170  C C    . GLY A 1 31  ? 6.737   -6.853  -7.362  1.00 0.00 ? 31  GLY A C    4  
ATOM 5171  O O    . GLY A 1 31  ? 6.752   -7.857  -8.073  1.00 0.00 ? 31  GLY A O    4  
ATOM 5172  H H    . GLY A 1 31  ? 7.955   -5.619  -5.417  1.00 0.00 ? 31  GLY A H    4  
ATOM 5173  H HA2  . GLY A 1 31  ? 6.329   -7.998  -5.616  1.00 0.00 ? 31  GLY A HA2  4  
ATOM 5174  H HA3  . GLY A 1 31  ? 5.414   -6.502  -5.734  1.00 0.00 ? 31  GLY A HA3  4  
ATOM 5175  N N    . GLN A 1 32  ? 7.021   -5.637  -7.817  1.00 0.00 ? 32  GLN A N    4  
ATOM 5176  C CA   . GLN A 1 32  ? 7.375   -5.409  -9.213  1.00 0.00 ? 32  GLN A CA   4  
ATOM 5177  C C    . GLN A 1 32  ? 8.451   -6.388  -9.670  1.00 0.00 ? 32  GLN A C    4  
ATOM 5178  O O    . GLN A 1 32  ? 8.955   -7.185  -8.878  1.00 0.00 ? 32  GLN A O    4  
ATOM 5179  C CB   . GLN A 1 32  ? 7.860   -3.971  -9.409  1.00 0.00 ? 32  GLN A CB   4  
ATOM 5180  C CG   . GLN A 1 32  ? 6.732   -2.966  -9.580  1.00 0.00 ? 32  GLN A CG   4  
ATOM 5181  C CD   . GLN A 1 32  ? 7.135   -1.776  -10.428 1.00 0.00 ? 32  GLN A CD   4  
ATOM 5182  O OE1  . GLN A 1 32  ? 8.299   -1.631  -10.803 1.00 0.00 ? 32  GLN A OE1  4  
ATOM 5183  N NE2  . GLN A 1 32  ? 6.172   -0.915  -10.736 1.00 0.00 ? 32  GLN A NE2  4  
ATOM 5184  H H    . GLN A 1 32  ? 6.992   -4.877  -7.201  1.00 0.00 ? 32  GLN A H    4  
ATOM 5185  H HA   . GLN A 1 32  ? 6.488   -5.564  -9.809  1.00 0.00 ? 32  GLN A HA   4  
ATOM 5186  H HB2  . GLN A 1 32  ? 8.445   -3.681  -8.550  1.00 0.00 ? 32  GLN A HB2  4  
ATOM 5187  H HB3  . GLN A 1 32  ? 8.484   -3.932  -10.290 1.00 0.00 ? 32  GLN A HB3  4  
ATOM 5188  H HG2  . GLN A 1 32  ? 5.896   -3.459  -10.054 1.00 0.00 ? 32  GLN A HG2  4  
ATOM 5189  H HG3  . GLN A 1 32  ? 6.434   -2.611  -8.605  1.00 0.00 ? 32  GLN A HG3  4  
ATOM 5190  H HE21 . GLN A 1 32  ? 5.267   -1.094  -10.401 1.00 0.00 ? 32  GLN A HE21 4  
ATOM 5191  H HE22 . GLN A 1 32  ? 6.404   -0.137  -11.282 1.00 0.00 ? 32  GLN A HE22 4  
ATOM 5192  N N    . ASP A 1 33  ? 8.798   -6.324  -10.950 1.00 0.00 ? 33  ASP A N    4  
ATOM 5193  C CA   . ASP A 1 33  ? 9.815   -7.204  -11.513 1.00 0.00 ? 33  ASP A CA   4  
ATOM 5194  C C    . ASP A 1 33  ? 11.214  -6.653  -11.255 1.00 0.00 ? 33  ASP A C    4  
ATOM 5195  O O    . ASP A 1 33  ? 12.170  -7.013  -11.940 1.00 0.00 ? 33  ASP A O    4  
ATOM 5196  C CB   . ASP A 1 33  ? 9.592   -7.382  -13.015 1.00 0.00 ? 33  ASP A CB   4  
ATOM 5197  C CG   . ASP A 1 33  ? 8.687   -8.556  -13.332 1.00 0.00 ? 33  ASP A CG   4  
ATOM 5198  O OD1  . ASP A 1 33  ? 9.034   -9.693  -12.948 1.00 0.00 ? 33  ASP A OD1  4  
ATOM 5199  O OD2  . ASP A 1 33  ? 7.632   -8.339  -13.963 1.00 0.00 ? 33  ASP A OD2  4  
ATOM 5200  H H    . ASP A 1 33  ? 8.359   -5.667  -11.532 1.00 0.00 ? 33  ASP A H    4  
ATOM 5201  H HA   . ASP A 1 33  ? 9.725   -8.165  -11.029 1.00 0.00 ? 33  ASP A HA   4  
ATOM 5202  H HB2  . ASP A 1 33  ? 9.140   -6.486  -13.414 1.00 0.00 ? 33  ASP A HB2  4  
ATOM 5203  H HB3  . ASP A 1 33  ? 10.545  -7.545  -13.497 1.00 0.00 ? 33  ASP A HB3  4  
ATOM 5204  N N    . GLY A 1 34  ? 11.325  -5.777  -10.261 1.00 0.00 ? 34  GLY A N    4  
ATOM 5205  C CA   . GLY A 1 34  ? 12.610  -5.189  -9.931  1.00 0.00 ? 34  GLY A CA   4  
ATOM 5206  C C    . GLY A 1 34  ? 12.488  -3.753  -9.463  1.00 0.00 ? 34  GLY A C    4  
ATOM 5207  O O    . GLY A 1 34  ? 13.309  -2.906  -9.814  1.00 0.00 ? 34  GLY A O    4  
ATOM 5208  H H    . GLY A 1 34  ? 10.528  -5.527  -9.748  1.00 0.00 ? 34  GLY A H    4  
ATOM 5209  H HA2  . GLY A 1 34  ? 13.071  -5.774  -9.149  1.00 0.00 ? 34  GLY A HA2  4  
ATOM 5210  H HA3  . GLY A 1 34  ? 13.242  -5.217  -10.807 1.00 0.00 ? 34  GLY A HA3  4  
ATOM 5211  N N    . SER A 1 35  ? 11.458  -3.476  -8.669  1.00 0.00 ? 35  SER A N    4  
ATOM 5212  C CA   . SER A 1 35  ? 11.228  -2.131  -8.156  1.00 0.00 ? 35  SER A CA   4  
ATOM 5213  C C    . SER A 1 35  ? 10.642  -2.179  -6.748  1.00 0.00 ? 35  SER A C    4  
ATOM 5214  O O    . SER A 1 35  ? 9.569   -2.741  -6.528  1.00 0.00 ? 35  SER A O    4  
ATOM 5215  C CB   . SER A 1 35  ? 10.287  -1.362  -9.086  1.00 0.00 ? 35  SER A CB   4  
ATOM 5216  O OG   . SER A 1 35  ? 10.559  0.028   -9.050  1.00 0.00 ? 35  SER A OG   4  
ATOM 5217  H H    . SER A 1 35  ? 10.837  -4.195  -8.424  1.00 0.00 ? 35  SER A H    4  
ATOM 5218  H HA   . SER A 1 35  ? 12.180  -1.622  -8.120  1.00 0.00 ? 35  SER A HA   4  
ATOM 5219  H HB2  . SER A 1 35  ? 10.416  -1.716  -10.097 1.00 0.00 ? 35  SER A HB2  4  
ATOM 5220  H HB3  . SER A 1 35  ? 9.265   -1.526  -8.774  1.00 0.00 ? 35  SER A HB3  4  
ATOM 5221  H HG   . SER A 1 35  ? 9.732   0.516   -9.060  1.00 0.00 ? 35  SER A HG   4  
ATOM 5222  N N    . VAL A 1 36  ? 11.356  -1.585  -5.796  1.00 0.00 ? 36  VAL A N    4  
ATOM 5223  C CA   . VAL A 1 36  ? 10.909  -1.558  -4.409  1.00 0.00 ? 36  VAL A CA   4  
ATOM 5224  C C    . VAL A 1 36  ? 10.263  -0.221  -4.066  1.00 0.00 ? 36  VAL A C    4  
ATOM 5225  O O    . VAL A 1 36  ? 10.857  0.838   -4.268  1.00 0.00 ? 36  VAL A O    4  
ATOM 5226  C CB   . VAL A 1 36  ? 12.076  -1.817  -3.438  1.00 0.00 ? 36  VAL A CB   4  
ATOM 5227  C CG1  . VAL A 1 36  ? 11.616  -1.660  -1.996  1.00 0.00 ? 36  VAL A CG1  4  
ATOM 5228  C CG2  . VAL A 1 36  ? 12.665  -3.200  -3.670  1.00 0.00 ? 36  VAL A CG2  4  
ATOM 5229  H H    . VAL A 1 36  ? 12.204  -1.154  -6.034  1.00 0.00 ? 36  VAL A H    4  
ATOM 5230  H HA   . VAL A 1 36  ? 10.178  -2.344  -4.279  1.00 0.00 ? 36  VAL A HA   4  
ATOM 5231  H HB   . VAL A 1 36  ? 12.845  -1.084  -3.629  1.00 0.00 ? 36  VAL A HB   4  
ATOM 5232  H HG11 . VAL A 1 36  ? 12.443  -1.860  -1.331  1.00 0.00 ? 36  VAL A HG11 4  
ATOM 5233  H HG12 . VAL A 1 36  ? 11.261  -0.651  -1.839  1.00 0.00 ? 36  VAL A HG12 4  
ATOM 5234  H HG13 . VAL A 1 36  ? 10.817  -2.358  -1.796  1.00 0.00 ? 36  VAL A HG13 4  
ATOM 5235  H HG21 . VAL A 1 36  ? 13.157  -3.537  -2.769  1.00 0.00 ? 36  VAL A HG21 4  
ATOM 5236  H HG22 . VAL A 1 36  ? 11.875  -3.890  -3.928  1.00 0.00 ? 36  VAL A HG22 4  
ATOM 5237  H HG23 . VAL A 1 36  ? 13.382  -3.155  -4.477  1.00 0.00 ? 36  VAL A HG23 4  
ATOM 5238  N N    . VAL A 1 37  ? 9.041   -0.276  -3.545  1.00 0.00 ? 37  VAL A N    4  
ATOM 5239  C CA   . VAL A 1 37  ? 8.314   0.931   -3.171  1.00 0.00 ? 37  VAL A CA   4  
ATOM 5240  C C    . VAL A 1 37  ? 8.243   1.083   -1.656  1.00 0.00 ? 37  VAL A C    4  
ATOM 5241  O O    . VAL A 1 37  ? 7.737   0.204   -0.958  1.00 0.00 ? 37  VAL A O    4  
ATOM 5242  C CB   . VAL A 1 37  ? 6.884   0.924   -3.743  1.00 0.00 ? 37  VAL A CB   4  
ATOM 5243  C CG1  . VAL A 1 37  ? 6.288   2.324   -3.708  1.00 0.00 ? 37  VAL A CG1  4  
ATOM 5244  C CG2  . VAL A 1 37  ? 6.880   0.370   -5.160  1.00 0.00 ? 37  VAL A CG2  4  
ATOM 5245  H H    . VAL A 1 37  ? 8.619   -1.150  -3.407  1.00 0.00 ? 37  VAL A H    4  
ATOM 5246  H HA   . VAL A 1 37  ? 8.840   1.779   -3.584  1.00 0.00 ? 37  VAL A HA   4  
ATOM 5247  H HB   . VAL A 1 37  ? 6.274   0.282   -3.126  1.00 0.00 ? 37  VAL A HB   4  
ATOM 5248  H HG11 . VAL A 1 37  ? 6.410   2.741   -2.719  1.00 0.00 ? 37  VAL A HG11 4  
ATOM 5249  H HG12 . VAL A 1 37  ? 6.793   2.949   -4.429  1.00 0.00 ? 37  VAL A HG12 4  
ATOM 5250  H HG13 . VAL A 1 37  ? 5.236   2.273   -3.948  1.00 0.00 ? 37  VAL A HG13 4  
ATOM 5251  H HG21 . VAL A 1 37  ? 6.849   -0.709  -5.123  1.00 0.00 ? 37  VAL A HG21 4  
ATOM 5252  H HG22 . VAL A 1 37  ? 6.011   0.737   -5.688  1.00 0.00 ? 37  VAL A HG22 4  
ATOM 5253  H HG23 . VAL A 1 37  ? 7.774   0.688   -5.674  1.00 0.00 ? 37  VAL A HG23 4  
ATOM 5254  N N    . GLN A 1 38  ? 8.752   2.204   -1.154  1.00 0.00 ? 38  GLN A N    4  
ATOM 5255  C CA   . GLN A 1 38  ? 8.746   2.470   0.279   1.00 0.00 ? 38  GLN A CA   4  
ATOM 5256  C C    . GLN A 1 38  ? 7.540   3.319   0.670   1.00 0.00 ? 38  GLN A C    4  
ATOM 5257  O O    . GLN A 1 38  ? 7.023   4.090   -0.138  1.00 0.00 ? 38  GLN A O    4  
ATOM 5258  C CB   . GLN A 1 38  ? 10.038  3.177   0.693   1.00 0.00 ? 38  GLN A CB   4  
ATOM 5259  C CG   . GLN A 1 38  ? 11.215  2.233   0.876   1.00 0.00 ? 38  GLN A CG   4  
ATOM 5260  C CD   . GLN A 1 38  ? 12.547  2.956   0.881   1.00 0.00 ? 38  GLN A CD   4  
ATOM 5261  O OE1  . GLN A 1 38  ? 13.030  3.386   1.930   1.00 0.00 ? 38  GLN A OE1  4  
ATOM 5262  N NE2  . GLN A 1 38  ? 13.150  3.096   -0.294  1.00 0.00 ? 38  GLN A NE2  4  
ATOM 5263  H H    . GLN A 1 38  ? 9.140   2.866   -1.762  1.00 0.00 ? 38  GLN A H    4  
ATOM 5264  H HA   . GLN A 1 38  ? 8.684   1.522   0.792   1.00 0.00 ? 38  GLN A HA   4  
ATOM 5265  H HB2  . GLN A 1 38  ? 10.297  3.900   -0.065  1.00 0.00 ? 38  GLN A HB2  4  
ATOM 5266  H HB3  . GLN A 1 38  ? 9.869   3.691   1.628   1.00 0.00 ? 38  GLN A HB3  4  
ATOM 5267  H HG2  . GLN A 1 38  ? 11.102  1.714   1.816   1.00 0.00 ? 38  GLN A HG2  4  
ATOM 5268  H HG3  . GLN A 1 38  ? 11.214  1.516   0.068   1.00 0.00 ? 38  GLN A HG3  4  
ATOM 5269  H HE21 . GLN A 1 38  ? 12.706  2.730   -1.087  1.00 0.00 ? 38  GLN A HE21 4  
ATOM 5270  H HE22 . GLN A 1 38  ? 14.012  3.560   -0.320  1.00 0.00 ? 38  GLN A HE22 4  
ATOM 5271  N N    . PHE A 1 39  ? 7.098   3.172   1.914   1.00 0.00 ? 39  PHE A N    4  
ATOM 5272  C CA   . PHE A 1 39  ? 5.952   3.924   2.412   1.00 0.00 ? 39  PHE A CA   4  
ATOM 5273  C C    . PHE A 1 39  ? 6.180   4.372   3.853   1.00 0.00 ? 39  PHE A C    4  
ATOM 5274  O O    . PHE A 1 39  ? 6.480   3.559   4.728   1.00 0.00 ? 39  PHE A O    4  
ATOM 5275  C CB   . PHE A 1 39  ? 4.681   3.076   2.324   1.00 0.00 ? 39  PHE A CB   4  
ATOM 5276  C CG   . PHE A 1 39  ? 4.251   2.785   0.915   1.00 0.00 ? 39  PHE A CG   4  
ATOM 5277  C CD1  . PHE A 1 39  ? 4.864   1.781   0.183   1.00 0.00 ? 39  PHE A CD1  4  
ATOM 5278  C CD2  . PHE A 1 39  ? 3.233   3.514   0.323   1.00 0.00 ? 39  PHE A CD2  4  
ATOM 5279  C CE1  . PHE A 1 39  ? 4.471   1.512   -1.114  1.00 0.00 ? 39  PHE A CE1  4  
ATOM 5280  C CE2  . PHE A 1 39  ? 2.835   3.249   -0.974  1.00 0.00 ? 39  PHE A CE2  4  
ATOM 5281  C CZ   . PHE A 1 39  ? 3.454   2.246   -1.693  1.00 0.00 ? 39  PHE A CZ   4  
ATOM 5282  H H    . PHE A 1 39  ? 7.552   2.542   2.512   1.00 0.00 ? 39  PHE A H    4  
ATOM 5283  H HA   . PHE A 1 39  ? 5.835   4.798   1.790   1.00 0.00 ? 39  PHE A HA   4  
ATOM 5284  H HB2  . PHE A 1 39  ? 4.852   2.133   2.820   1.00 0.00 ? 39  PHE A HB2  4  
ATOM 5285  H HB3  . PHE A 1 39  ? 3.875   3.597   2.818   1.00 0.00 ? 39  PHE A HB3  4  
ATOM 5286  H HD1  . PHE A 1 39  ? 5.659   1.206   0.635   1.00 0.00 ? 39  PHE A HD1  4  
ATOM 5287  H HD2  . PHE A 1 39  ? 2.747   4.300   0.885   1.00 0.00 ? 39  PHE A HD2  4  
ATOM 5288  H HE1  . PHE A 1 39  ? 4.956   0.726   -1.674  1.00 0.00 ? 39  PHE A HE1  4  
ATOM 5289  H HE2  . PHE A 1 39  ? 2.039   3.825   -1.423  1.00 0.00 ? 39  PHE A HE2  4  
ATOM 5290  H HZ   . PHE A 1 39  ? 3.145   2.037   -2.706  1.00 0.00 ? 39  PHE A HZ   4  
ATOM 5291  N N    . LYS A 1 40  ? 6.036   5.671   4.092   1.00 0.00 ? 40  LYS A N    4  
ATOM 5292  C CA   . LYS A 1 40  ? 6.224   6.229   5.426   1.00 0.00 ? 40  LYS A CA   4  
ATOM 5293  C C    . LYS A 1 40  ? 4.887   6.618   6.047   1.00 0.00 ? 40  LYS A C    4  
ATOM 5294  O O    . LYS A 1 40  ? 4.316   7.657   5.714   1.00 0.00 ? 40  LYS A O    4  
ATOM 5295  C CB   . LYS A 1 40  ? 7.144   7.451   5.364   1.00 0.00 ? 40  LYS A CB   4  
ATOM 5296  C CG   . LYS A 1 40  ? 7.294   8.167   6.695   1.00 0.00 ? 40  LYS A CG   4  
ATOM 5297  C CD   . LYS A 1 40  ? 7.755   9.603   6.507   1.00 0.00 ? 40  LYS A CD   4  
ATOM 5298  C CE   . LYS A 1 40  ? 7.339   10.480  7.678   1.00 0.00 ? 40  LYS A CE   4  
ATOM 5299  N NZ   . LYS A 1 40  ? 7.947   11.837  7.598   1.00 0.00 ? 40  LYS A NZ   4  
ATOM 5300  H H    . LYS A 1 40  ? 5.795   6.269   3.353   1.00 0.00 ? 40  LYS A H    4  
ATOM 5301  H HA   . LYS A 1 40  ? 6.687   5.472   6.040   1.00 0.00 ? 40  LYS A HA   4  
ATOM 5302  H HB2  . LYS A 1 40  ? 8.123   7.133   5.038   1.00 0.00 ? 40  LYS A HB2  4  
ATOM 5303  H HB3  . LYS A 1 40  ? 6.745   8.151   4.645   1.00 0.00 ? 40  LYS A HB3  4  
ATOM 5304  H HG2  . LYS A 1 40  ? 6.340   8.170   7.201   1.00 0.00 ? 40  LYS A HG2  4  
ATOM 5305  H HG3  . LYS A 1 40  ? 8.021   7.641   7.297   1.00 0.00 ? 40  LYS A HG3  4  
ATOM 5306  H HD2  . LYS A 1 40  ? 8.832   9.618   6.425   1.00 0.00 ? 40  LYS A HD2  4  
ATOM 5307  H HD3  . LYS A 1 40  ? 7.318   9.996   5.600   1.00 0.00 ? 40  LYS A HD3  4  
ATOM 5308  H HE2  . LYS A 1 40  ? 6.264   10.576  7.674   1.00 0.00 ? 40  LYS A HE2  4  
ATOM 5309  H HE3  . LYS A 1 40  ? 7.655   10.006  8.595   1.00 0.00 ? 40  LYS A HE3  4  
ATOM 5310  H HZ1  . LYS A 1 40  ? 8.920   11.814  7.966   1.00 0.00 ? 40  LYS A HZ1  4  
ATOM 5311  H HZ2  . LYS A 1 40  ? 7.391   12.511  8.161   1.00 0.00 ? 40  LYS A HZ2  4  
ATOM 5312  H HZ3  . LYS A 1 40  ? 7.969   12.161  6.610   1.00 0.00 ? 40  LYS A HZ3  4  
ATOM 5313  N N    . ILE A 1 41  ? 4.394   5.779   6.952   1.00 0.00 ? 41  ILE A N    4  
ATOM 5314  C CA   . ILE A 1 41  ? 3.125   6.037   7.621   1.00 0.00 ? 41  ILE A CA   4  
ATOM 5315  C C    . ILE A 1 41  ? 3.302   6.086   9.135   1.00 0.00 ? 41  ILE A C    4  
ATOM 5316  O O    . ILE A 1 41  ? 4.370   5.768   9.657   1.00 0.00 ? 41  ILE A O    4  
ATOM 5317  C CB   . ILE A 1 41  ? 2.076   4.965   7.272   1.00 0.00 ? 41  ILE A CB   4  
ATOM 5318  C CG1  . ILE A 1 41  ? 2.296   3.710   8.120   1.00 0.00 ? 41  ILE A CG1  4  
ATOM 5319  C CG2  . ILE A 1 41  ? 2.137   4.627   5.790   1.00 0.00 ? 41  ILE A CG2  4  
ATOM 5320  C CD1  . ILE A 1 41  ? 1.357   2.575   7.774   1.00 0.00 ? 41  ILE A CD1  4  
ATOM 5321  H H    . ILE A 1 41  ? 4.896   4.968   7.175   1.00 0.00 ? 41  ILE A H    4  
ATOM 5322  H HA   . ILE A 1 41  ? 2.758   6.995   7.281   1.00 0.00 ? 41  ILE A HA   4  
ATOM 5323  H HB   . ILE A 1 41  ? 1.097   5.368   7.485   1.00 0.00 ? 41  ILE A HB   4  
ATOM 5324  H HG12 . ILE A 1 41  ? 3.306   3.360   7.978   1.00 0.00 ? 41  ILE A HG12 4  
ATOM 5325  H HG13 . ILE A 1 41  ? 2.148   3.958   9.161   1.00 0.00 ? 41  ILE A HG13 4  
ATOM 5326  H HG21 . ILE A 1 41  ? 2.366   3.578   5.669   1.00 0.00 ? 41  ILE A HG21 4  
ATOM 5327  H HG22 . ILE A 1 41  ? 1.183   4.841   5.333   1.00 0.00 ? 41  ILE A HG22 4  
ATOM 5328  H HG23 . ILE A 1 41  ? 2.905   5.220   5.316   1.00 0.00 ? 41  ILE A HG23 4  
ATOM 5329  H HD11 . ILE A 1 41  ? 1.918   1.656   7.693   1.00 0.00 ? 41  ILE A HD11 4  
ATOM 5330  H HD12 . ILE A 1 41  ? 0.611   2.476   8.547   1.00 0.00 ? 41  ILE A HD12 4  
ATOM 5331  H HD13 . ILE A 1 41  ? 0.873   2.784   6.831   1.00 0.00 ? 41  ILE A HD13 4  
ATOM 5332  N N    . LYS A 1 42  ? 2.245   6.484   9.836   1.00 0.00 ? 42  LYS A N    4  
ATOM 5333  C CA   . LYS A 1 42  ? 2.281   6.571   11.291  1.00 0.00 ? 42  LYS A CA   4  
ATOM 5334  C C    . LYS A 1 42  ? 2.102   5.195   11.923  1.00 0.00 ? 42  LYS A C    4  
ATOM 5335  O O    . LYS A 1 42  ? 1.292   4.390   11.462  1.00 0.00 ? 42  LYS A O    4  
ATOM 5336  C CB   . LYS A 1 42  ? 1.190   7.520   11.792  1.00 0.00 ? 42  LYS A CB   4  
ATOM 5337  C CG   . LYS A 1 42  ? 1.036   8.771   10.944  1.00 0.00 ? 42  LYS A CG   4  
ATOM 5338  C CD   . LYS A 1 42  ? 0.481   9.930   11.756  1.00 0.00 ? 42  LYS A CD   4  
ATOM 5339  C CE   . LYS A 1 42  ? 1.543   10.533  12.664  1.00 0.00 ? 42  LYS A CE   4  
ATOM 5340  N NZ   . LYS A 1 42  ? 0.976   11.577  13.562  1.00 0.00 ? 42  LYS A NZ   4  
ATOM 5341  H H    . LYS A 1 42  ? 1.421   6.724   9.363   1.00 0.00 ? 42  LYS A H    4  
ATOM 5342  H HA   . LYS A 1 42  ? 3.246   6.962   11.576  1.00 0.00 ? 42  LYS A HA   4  
ATOM 5343  H HB2  . LYS A 1 42  ? 0.247   6.995   11.797  1.00 0.00 ? 42  LYS A HB2  4  
ATOM 5344  H HB3  . LYS A 1 42  ? 1.429   7.823   12.802  1.00 0.00 ? 42  LYS A HB3  4  
ATOM 5345  H HG2  . LYS A 1 42  ? 2.002   9.051   10.552  1.00 0.00 ? 42  LYS A HG2  4  
ATOM 5346  H HG3  . LYS A 1 42  ? 0.361   8.560   10.127  1.00 0.00 ? 42  LYS A HG3  4  
ATOM 5347  H HD2  . LYS A 1 42  ? 0.126   10.694  11.081  1.00 0.00 ? 42  LYS A HD2  4  
ATOM 5348  H HD3  . LYS A 1 42  ? -0.339  9.573   12.363  1.00 0.00 ? 42  LYS A HD3  4  
ATOM 5349  H HE2  . LYS A 1 42  ? 1.972   9.746   13.266  1.00 0.00 ? 42  LYS A HE2  4  
ATOM 5350  H HE3  . LYS A 1 42  ? 2.312   10.977  12.050  1.00 0.00 ? 42  LYS A HE3  4  
ATOM 5351  H HZ1  . LYS A 1 42  ? -0.002  11.334  13.819  1.00 0.00 ? 42  LYS A HZ1  4  
ATOM 5352  H HZ2  . LYS A 1 42  ? 0.978   12.500  13.084  1.00 0.00 ? 42  LYS A HZ2  4  
ATOM 5353  H HZ3  . LYS A 1 42  ? 1.544   11.647  14.431  1.00 0.00 ? 42  LYS A HZ3  4  
ATOM 5354  N N    . ARG A 1 43  ? 2.860   4.932   12.982  1.00 0.00 ? 43  ARG A N    4  
ATOM 5355  C CA   . ARG A 1 43  ? 2.784   3.653   13.678  1.00 0.00 ? 43  ARG A CA   4  
ATOM 5356  C C    . ARG A 1 43  ? 1.368   3.390   14.180  1.00 0.00 ? 43  ARG A C    4  
ATOM 5357  O O    . ARG A 1 43  ? 0.995   2.248   14.450  1.00 0.00 ? 43  ARG A O    4  
ATOM 5358  C CB   . ARG A 1 43  ? 3.766   3.626   14.851  1.00 0.00 ? 43  ARG A CB   4  
ATOM 5359  C CG   . ARG A 1 43  ? 3.272   4.378   16.075  1.00 0.00 ? 43  ARG A CG   4  
ATOM 5360  C CD   . ARG A 1 43  ? 2.501   3.465   17.016  1.00 0.00 ? 43  ARG A CD   4  
ATOM 5361  N NE   . ARG A 1 43  ? 1.832   4.213   18.078  1.00 0.00 ? 43  ARG A NE   4  
ATOM 5362  C CZ   . ARG A 1 43  ? 1.399   3.659   19.205  1.00 0.00 ? 43  ARG A CZ   4  
ATOM 5363  N NH1  . ARG A 1 43  ? 1.564   2.361   19.417  1.00 0.00 ? 43  ARG A NH1  4  
ATOM 5364  N NH2  . ARG A 1 43  ? 0.799   4.405   20.124  1.00 0.00 ? 43  ARG A NH2  4  
ATOM 5365  H H    . ARG A 1 43  ? 3.487   5.614   13.303  1.00 0.00 ? 43  ARG A H    4  
ATOM 5366  H HA   . ARG A 1 43  ? 3.054   2.877   12.977  1.00 0.00 ? 43  ARG A HA   4  
ATOM 5367  H HB2  . ARG A 1 43  ? 3.944   2.599   15.134  1.00 0.00 ? 43  ARG A HB2  4  
ATOM 5368  H HB3  . ARG A 1 43  ? 4.698   4.070   14.534  1.00 0.00 ? 43  ARG A HB3  4  
ATOM 5369  H HG2  . ARG A 1 43  ? 4.121   4.786   16.603  1.00 0.00 ? 43  ARG A HG2  4  
ATOM 5370  H HG3  . ARG A 1 43  ? 2.624   5.181   15.756  1.00 0.00 ? 43  ARG A HG3  4  
ATOM 5371  H HD2  . ARG A 1 43  ? 1.760   2.926   16.446  1.00 0.00 ? 43  ARG A HD2  4  
ATOM 5372  H HD3  . ARG A 1 43  ? 3.192   2.765   17.462  1.00 0.00 ? 43  ARG A HD3  4  
ATOM 5373  H HE   . ARG A 1 43  ? 1.699   5.174   17.942  1.00 0.00 ? 43  ARG A HE   4  
ATOM 5374  H HH11 . ARG A 1 43  ? 2.017   1.796   18.726  1.00 0.00 ? 43  ARG A HH11 4  
ATOM 5375  H HH12 . ARG A 1 43  ? 1.238   1.947   20.267  1.00 0.00 ? 43  ARG A HH12 4  
ATOM 5376  H HH21 . ARG A 1 43  ? 0.672   5.385   19.968  1.00 0.00 ? 43  ARG A HH21 4  
ATOM 5377  H HH22 . ARG A 1 43  ? 0.473   3.988   20.972  1.00 0.00 ? 43  ARG A HH22 4  
ATOM 5378  N N    . HIS A 1 44  ? 0.583   4.456   14.305  1.00 0.00 ? 44  HIS A N    4  
ATOM 5379  C CA   . HIS A 1 44  ? -0.793  4.341   14.775  1.00 0.00 ? 44  HIS A CA   4  
ATOM 5380  C C    . HIS A 1 44  ? -1.776  4.474   13.616  1.00 0.00 ? 44  HIS A C    4  
ATOM 5381  O O    . HIS A 1 44  ? -2.992  4.433   13.810  1.00 0.00 ? 44  HIS A O    4  
ATOM 5382  C CB   . HIS A 1 44  ? -1.084  5.408   15.831  1.00 0.00 ? 44  HIS A CB   4  
ATOM 5383  C CG   . HIS A 1 44  ? -1.086  6.803   15.287  1.00 0.00 ? 44  HIS A CG   4  
ATOM 5384  N ND1  . HIS A 1 44  ? -0.295  7.811   15.798  1.00 0.00 ? 44  HIS A ND1  4  
ATOM 5385  C CD2  . HIS A 1 44  ? -1.788  7.357   14.271  1.00 0.00 ? 44  HIS A CD2  4  
ATOM 5386  C CE1  . HIS A 1 44  ? -0.512  8.924   15.120  1.00 0.00 ? 44  HIS A CE1  4  
ATOM 5387  N NE2  . HIS A 1 44  ? -1.413  8.675   14.187  1.00 0.00 ? 44  HIS A NE2  4  
ATOM 5388  H H    . HIS A 1 44  ? 0.937   5.340   14.074  1.00 0.00 ? 44  HIS A H    4  
ATOM 5389  H HA   . HIS A 1 44  ? -0.911  3.365   15.220  1.00 0.00 ? 44  HIS A HA   4  
ATOM 5390  H HB2  . HIS A 1 44  ? -2.056  5.220   16.265  1.00 0.00 ? 44  HIS A HB2  4  
ATOM 5391  H HB3  . HIS A 1 44  ? -0.333  5.353   16.605  1.00 0.00 ? 44  HIS A HB3  4  
ATOM 5392  H HD1  . HIS A 1 44  ? 0.330   7.723   16.547  1.00 0.00 ? 44  HIS A HD1  4  
ATOM 5393  H HD2  . HIS A 1 44  ? -2.510  6.855   13.641  1.00 0.00 ? 44  HIS A HD2  4  
ATOM 5394  H HE1  . HIS A 1 44  ? -0.033  9.875   15.297  1.00 0.00 ? 44  HIS A HE1  4  
ATOM 5395  H HE2  . HIS A 1 44  ? -1.817  9.347   13.600  1.00 0.00 ? 44  HIS A HE2  4  
ATOM 5396  N N    . THR A 1 45  ? -1.243  4.633   12.409  1.00 0.00 ? 45  THR A N    4  
ATOM 5397  C CA   . THR A 1 45  ? -2.073  4.774   11.219  1.00 0.00 ? 45  THR A CA   4  
ATOM 5398  C C    . THR A 1 45  ? -2.304  3.426   10.547  1.00 0.00 ? 45  THR A C    4  
ATOM 5399  O O    . THR A 1 45  ? -1.374  2.650   10.320  1.00 0.00 ? 45  THR A O    4  
ATOM 5400  C CB   . THR A 1 45  ? -1.436  5.740   10.201  1.00 0.00 ? 45  THR A CB   4  
ATOM 5401  O OG1  . THR A 1 45  ? -1.718  7.095   10.569  1.00 0.00 ? 45  THR A OG1  4  
ATOM 5402  C CG2  . THR A 1 45  ? -1.960  5.470   8.799   1.00 0.00 ? 45  THR A CG2  4  
ATOM 5403  H H    . THR A 1 45  ? -0.267  4.657   12.318  1.00 0.00 ? 45  THR A H    4  
ATOM 5404  H HA   . THR A 1 45  ? -3.026  5.182   11.523  1.00 0.00 ? 45  THR A HA   4  
ATOM 5405  H HB   . THR A 1 45  ? -0.366  5.589   10.205  1.00 0.00 ? 45  THR A HB   4  
ATOM 5406  H HG1  . THR A 1 45  ? -1.432  7.683   9.867   1.00 0.00 ? 45  THR A HG1  4  
ATOM 5407  H HG21 . THR A 1 45  ? -1.727  6.309   8.160   1.00 0.00 ? 45  THR A HG21 4  
ATOM 5408  H HG22 . THR A 1 45  ? -3.031  5.332   8.835   1.00 0.00 ? 45  THR A HG22 4  
ATOM 5409  H HG23 . THR A 1 45  ? -1.495  4.579   8.406   1.00 0.00 ? 45  THR A HG23 4  
ATOM 5410  N N    . PRO A 1 46  ? -3.572  3.137   10.219  1.00 0.00 ? 46  PRO A N    4  
ATOM 5411  C CA   . PRO A 1 46  ? -3.954  1.881   9.566   1.00 0.00 ? 46  PRO A CA   4  
ATOM 5412  C C    . PRO A 1 46  ? -3.460  1.802   8.126   1.00 0.00 ? 46  PRO A C    4  
ATOM 5413  O O    . PRO A 1 46  ? -3.629  2.743   7.348   1.00 0.00 ? 46  PRO A O    4  
ATOM 5414  C CB   . PRO A 1 46  ? -5.484  1.912   9.606   1.00 0.00 ? 46  PRO A CB   4  
ATOM 5415  C CG   . PRO A 1 46  ? -5.832  3.359   9.673   1.00 0.00 ? 46  PRO A CG   4  
ATOM 5416  C CD   . PRO A 1 46  ? -4.730  4.014   10.459  1.00 0.00 ? 46  PRO A CD   4  
ATOM 5417  H HA   . PRO A 1 46  ? -3.595  1.023   10.116  1.00 0.00 ? 46  PRO A HA   4  
ATOM 5418  H HB2  . PRO A 1 46  ? -5.879  1.450   8.712   1.00 0.00 ? 46  PRO A HB2  4  
ATOM 5419  H HB3  . PRO A 1 46  ? -5.836  1.380   10.477  1.00 0.00 ? 46  PRO A HB3  4  
ATOM 5420  H HG2  . PRO A 1 46  ? -5.878  3.772   8.677   1.00 0.00 ? 46  PRO A HG2  4  
ATOM 5421  H HG3  . PRO A 1 46  ? -6.778  3.485   10.178  1.00 0.00 ? 46  PRO A HG3  4  
ATOM 5422  H HD2  . PRO A 1 46  ? -4.542  5.010   10.088  1.00 0.00 ? 46  PRO A HD2  4  
ATOM 5423  H HD3  . PRO A 1 46  ? -4.980  4.041   11.509  1.00 0.00 ? 46  PRO A HD3  4  
ATOM 5424  N N    . LEU A 1 47  ? -2.849  0.676   7.775   1.00 0.00 ? 47  LEU A N    4  
ATOM 5425  C CA   . LEU A 1 47  ? -2.331  0.474   6.426   1.00 0.00 ? 47  LEU A CA   4  
ATOM 5426  C C    . LEU A 1 47  ? -3.361  0.887   5.380   1.00 0.00 ? 47  LEU A C    4  
ATOM 5427  O O    . LEU A 1 47  ? -3.017  1.155   4.229   1.00 0.00 ? 47  LEU A O    4  
ATOM 5428  C CB   . LEU A 1 47  ? -1.938  -0.990  6.223   1.00 0.00 ? 47  LEU A CB   4  
ATOM 5429  C CG   . LEU A 1 47  ? -1.027  -1.596  7.292   1.00 0.00 ? 47  LEU A CG   4  
ATOM 5430  C CD1  . LEU A 1 47  ? -0.860  -3.090  7.066   1.00 0.00 ? 47  LEU A CD1  4  
ATOM 5431  C CD2  . LEU A 1 47  ? 0.326   -0.900  7.295   1.00 0.00 ? 47  LEU A CD2  4  
ATOM 5432  H H    . LEU A 1 47  ? -2.744  -0.038  8.438   1.00 0.00 ? 47  LEU A H    4  
ATOM 5433  H HA   . LEU A 1 47  ? -1.453  1.093   6.313   1.00 0.00 ? 47  LEU A HA   4  
ATOM 5434  H HB2  . LEU A 1 47  ? -2.845  -1.574  6.193   1.00 0.00 ? 47  LEU A HB2  4  
ATOM 5435  H HB3  . LEU A 1 47  ? -1.431  -1.067  5.272   1.00 0.00 ? 47  LEU A HB3  4  
ATOM 5436  H HG   . LEU A 1 47  ? -1.479  -1.454  8.264   1.00 0.00 ? 47  LEU A HG   4  
ATOM 5437  H HD11 . LEU A 1 47  ? -1.806  -3.586  7.223   1.00 0.00 ? 47  LEU A HD11 4  
ATOM 5438  H HD12 . LEU A 1 47  ? -0.130  -3.479  7.760   1.00 0.00 ? 47  LEU A HD12 4  
ATOM 5439  H HD13 . LEU A 1 47  ? -0.524  -3.266  6.055   1.00 0.00 ? 47  LEU A HD13 4  
ATOM 5440  H HD21 . LEU A 1 47  ? 0.312   -0.084  6.588   1.00 0.00 ? 47  LEU A HD21 4  
ATOM 5441  H HD22 . LEU A 1 47  ? 1.094   -1.606  7.014   1.00 0.00 ? 47  LEU A HD22 4  
ATOM 5442  H HD23 . LEU A 1 47  ? 0.532   -0.517  8.283   1.00 0.00 ? 47  LEU A HD23 4  
ATOM 5443  N N    . SER A 1 48  ? -4.624  0.937   5.788   1.00 0.00 ? 48  SER A N    4  
ATOM 5444  C CA   . SER A 1 48  ? -5.705  1.315   4.885   1.00 0.00 ? 48  SER A CA   4  
ATOM 5445  C C    . SER A 1 48  ? -5.233  2.363   3.882   1.00 0.00 ? 48  SER A C    4  
ATOM 5446  O O    . SER A 1 48  ? -5.360  2.183   2.671   1.00 0.00 ? 48  SER A O    4  
ATOM 5447  C CB   . SER A 1 48  ? -6.897  1.853   5.680   1.00 0.00 ? 48  SER A CB   4  
ATOM 5448  O OG   . SER A 1 48  ? -6.531  2.993   6.438   1.00 0.00 ? 48  SER A OG   4  
ATOM 5449  H H    . SER A 1 48  ? -4.835  0.711   6.719   1.00 0.00 ? 48  SER A H    4  
ATOM 5450  H HA   . SER A 1 48  ? -6.012  0.431   4.347   1.00 0.00 ? 48  SER A HA   4  
ATOM 5451  H HB2  . SER A 1 48  ? -7.687  2.128   4.997   1.00 0.00 ? 48  SER A HB2  4  
ATOM 5452  H HB3  . SER A 1 48  ? -7.253  1.087   6.353   1.00 0.00 ? 48  SER A HB3  4  
ATOM 5453  H HG   . SER A 1 48  ? -7.061  3.745   6.162   1.00 0.00 ? 48  SER A HG   4  
ATOM 5454  N N    . LYS A 1 49  ? -4.688  3.461   4.396   1.00 0.00 ? 49  LYS A N    4  
ATOM 5455  C CA   . LYS A 1 49  ? -4.195  4.539   3.547   1.00 0.00 ? 49  LYS A CA   4  
ATOM 5456  C C    . LYS A 1 49  ? -3.007  4.074   2.711   1.00 0.00 ? 49  LYS A C    4  
ATOM 5457  O O    . LYS A 1 49  ? -2.947  4.325   1.506   1.00 0.00 ? 49  LYS A O    4  
ATOM 5458  C CB   . LYS A 1 49  ? -3.790  5.743   4.401   1.00 0.00 ? 49  LYS A CB   4  
ATOM 5459  C CG   . LYS A 1 49  ? -4.967  6.580   4.870   1.00 0.00 ? 49  LYS A CG   4  
ATOM 5460  C CD   . LYS A 1 49  ? -4.562  7.545   5.971   1.00 0.00 ? 49  LYS A CD   4  
ATOM 5461  C CE   . LYS A 1 49  ? -5.728  8.423   6.400   1.00 0.00 ? 49  LYS A CE   4  
ATOM 5462  N NZ   . LYS A 1 49  ? -5.487  9.058   7.725   1.00 0.00 ? 49  LYS A NZ   4  
ATOM 5463  H H    . LYS A 1 49  ? -4.614  3.547   5.370   1.00 0.00 ? 49  LYS A H    4  
ATOM 5464  H HA   . LYS A 1 49  ? -4.994  4.832   2.884   1.00 0.00 ? 49  LYS A HA   4  
ATOM 5465  H HB2  . LYS A 1 49  ? -3.258  5.389   5.272   1.00 0.00 ? 49  LYS A HB2  4  
ATOM 5466  H HB3  . LYS A 1 49  ? -3.133  6.376   3.822   1.00 0.00 ? 49  LYS A HB3  4  
ATOM 5467  H HG2  . LYS A 1 49  ? -5.351  7.146   4.033   1.00 0.00 ? 49  LYS A HG2  4  
ATOM 5468  H HG3  . LYS A 1 49  ? -5.738  5.922   5.245   1.00 0.00 ? 49  LYS A HG3  4  
ATOM 5469  H HD2  . LYS A 1 49  ? -4.220  6.980   6.825   1.00 0.00 ? 49  LYS A HD2  4  
ATOM 5470  H HD3  . LYS A 1 49  ? -3.762  8.176   5.610   1.00 0.00 ? 49  LYS A HD3  4  
ATOM 5471  H HE2  . LYS A 1 49  ? -5.870  9.196   5.661   1.00 0.00 ? 49  LYS A HE2  4  
ATOM 5472  H HE3  . LYS A 1 49  ? -6.618  7.814   6.458   1.00 0.00 ? 49  LYS A HE3  4  
ATOM 5473  H HZ1  . LYS A 1 49  ? -4.631  8.659   8.161   1.00 0.00 ? 49  LYS A HZ1  4  
ATOM 5474  H HZ2  . LYS A 1 49  ? -6.296  8.886   8.356   1.00 0.00 ? 49  LYS A HZ2  4  
ATOM 5475  H HZ3  . LYS A 1 49  ? -5.361  10.084  7.613   1.00 0.00 ? 49  LYS A HZ3  4  
ATOM 5476  N N    . LEU A 1 50  ? -2.065  3.395   3.355   1.00 0.00 ? 50  LEU A N    4  
ATOM 5477  C CA   . LEU A 1 50  ? -0.880  2.892   2.670   1.00 0.00 ? 50  LEU A CA   4  
ATOM 5478  C C    . LEU A 1 50  ? -1.266  2.061   1.451   1.00 0.00 ? 50  LEU A C    4  
ATOM 5479  O O    . LEU A 1 50  ? -0.868  2.366   0.327   1.00 0.00 ? 50  LEU A O    4  
ATOM 5480  C CB   . LEU A 1 50  ? -0.031  2.052   3.626   1.00 0.00 ? 50  LEU A CB   4  
ATOM 5481  C CG   . LEU A 1 50  ? 0.782   0.925   2.988   1.00 0.00 ? 50  LEU A CG   4  
ATOM 5482  C CD1  . LEU A 1 50  ? 1.605   1.454   1.823   1.00 0.00 ? 50  LEU A CD1  4  
ATOM 5483  C CD2  . LEU A 1 50  ? 1.682   0.265   4.023   1.00 0.00 ? 50  LEU A CD2  4  
ATOM 5484  H H    . LEU A 1 50  ? -2.168  3.226   4.315   1.00 0.00 ? 50  LEU A H    4  
ATOM 5485  H HA   . LEU A 1 50  ? -0.302  3.743   2.341   1.00 0.00 ? 50  LEU A HA   4  
ATOM 5486  H HB2  . LEU A 1 50  ? 0.659   2.716   4.125   1.00 0.00 ? 50  LEU A HB2  4  
ATOM 5487  H HB3  . LEU A 1 50  ? -0.695  1.611   4.355   1.00 0.00 ? 50  LEU A HB3  4  
ATOM 5488  H HG   . LEU A 1 50  ? 0.105   0.174   2.605   1.00 0.00 ? 50  LEU A HG   4  
ATOM 5489  H HD11 . LEU A 1 50  ? 2.579   0.988   1.830   1.00 0.00 ? 50  LEU A HD11 4  
ATOM 5490  H HD12 . LEU A 1 50  ? 1.716   2.524   1.918   1.00 0.00 ? 50  LEU A HD12 4  
ATOM 5491  H HD13 . LEU A 1 50  ? 1.102   1.225   0.895   1.00 0.00 ? 50  LEU A HD13 4  
ATOM 5492  H HD21 . LEU A 1 50  ? 1.516   -0.802  4.015   1.00 0.00 ? 50  LEU A HD21 4  
ATOM 5493  H HD22 . LEU A 1 50  ? 1.452   0.658   5.003   1.00 0.00 ? 50  LEU A HD22 4  
ATOM 5494  H HD23 . LEU A 1 50  ? 2.715   0.471   3.785   1.00 0.00 ? 50  LEU A HD23 4  
ATOM 5495  N N    . MET A 1 51  ? -2.047  1.010   1.682   1.00 0.00 ? 51  MET A N    4  
ATOM 5496  C CA   . MET A 1 51  ? -2.491  0.136   0.602   1.00 0.00 ? 51  MET A CA   4  
ATOM 5497  C C    . MET A 1 51  ? -3.141  0.943   -0.518  1.00 0.00 ? 51  MET A C    4  
ATOM 5498  O O    . MET A 1 51  ? -2.776  0.811   -1.686  1.00 0.00 ? 51  MET A O    4  
ATOM 5499  C CB   . MET A 1 51  ? -3.475  -0.907  1.133   1.00 0.00 ? 51  MET A CB   4  
ATOM 5500  C CG   . MET A 1 51  ? -2.929  -1.722  2.294   1.00 0.00 ? 51  MET A CG   4  
ATOM 5501  S SD   . MET A 1 51  ? -4.223  -2.279  3.420   1.00 0.00 ? 51  MET A SD   4  
ATOM 5502  C CE   . MET A 1 51  ? -3.583  -3.880  3.906   1.00 0.00 ? 51  MET A CE   4  
ATOM 5503  H H    . MET A 1 51  ? -2.332  0.817   2.599   1.00 0.00 ? 51  MET A H    4  
ATOM 5504  H HA   . MET A 1 51  ? -1.622  -0.370  0.207   1.00 0.00 ? 51  MET A HA   4  
ATOM 5505  H HB2  . MET A 1 51  ? -4.371  -0.404  1.464   1.00 0.00 ? 51  MET A HB2  4  
ATOM 5506  H HB3  . MET A 1 51  ? -3.729  -1.586  0.333   1.00 0.00 ? 51  MET A HB3  4  
ATOM 5507  H HG2  . MET A 1 51  ? -2.418  -2.588  1.900   1.00 0.00 ? 51  MET A HG2  4  
ATOM 5508  H HG3  . MET A 1 51  ? -2.228  -1.113  2.845   1.00 0.00 ? 51  MET A HG3  4  
ATOM 5509  H HE1  . MET A 1 51  ? -3.403  -4.479  3.025   1.00 0.00 ? 51  MET A HE1  4  
ATOM 5510  H HE2  . MET A 1 51  ? -2.657  -3.749  4.446   1.00 0.00 ? 51  MET A HE2  4  
ATOM 5511  H HE3  . MET A 1 51  ? -4.302  -4.378  4.539   1.00 0.00 ? 51  MET A HE3  4  
ATOM 5512  N N    . LYS A 1 52  ? -4.108  1.779   -0.154  1.00 0.00 ? 52  LYS A N    4  
ATOM 5513  C CA   . LYS A 1 52  ? -4.809  2.608   -1.126  1.00 0.00 ? 52  LYS A CA   4  
ATOM 5514  C C    . LYS A 1 52  ? -3.824  3.423   -1.958  1.00 0.00 ? 52  LYS A C    4  
ATOM 5515  O O    . LYS A 1 52  ? -4.064  3.692   -3.134  1.00 0.00 ? 52  LYS A O    4  
ATOM 5516  C CB   . LYS A 1 52  ? -5.790  3.544   -0.416  1.00 0.00 ? 52  LYS A CB   4  
ATOM 5517  C CG   . LYS A 1 52  ? -7.041  2.846   0.088   1.00 0.00 ? 52  LYS A CG   4  
ATOM 5518  C CD   . LYS A 1 52  ? -8.237  3.783   0.097   1.00 0.00 ? 52  LYS A CD   4  
ATOM 5519  C CE   . LYS A 1 52  ? -8.911  3.840   -1.265  1.00 0.00 ? 52  LYS A CE   4  
ATOM 5520  N NZ   . LYS A 1 52  ? -9.974  2.807   -1.402  1.00 0.00 ? 52  LYS A NZ   4  
ATOM 5521  H H    . LYS A 1 52  ? -4.355  1.840   0.794   1.00 0.00 ? 52  LYS A H    4  
ATOM 5522  H HA   . LYS A 1 52  ? -5.362  1.954   -1.783  1.00 0.00 ? 52  LYS A HA   4  
ATOM 5523  H HB2  . LYS A 1 52  ? -5.290  3.996   0.428   1.00 0.00 ? 52  LYS A HB2  4  
ATOM 5524  H HB3  . LYS A 1 52  ? -6.089  4.322   -1.104  1.00 0.00 ? 52  LYS A HB3  4  
ATOM 5525  H HG2  . LYS A 1 52  ? -7.259  2.008   -0.557  1.00 0.00 ? 52  LYS A HG2  4  
ATOM 5526  H HG3  . LYS A 1 52  ? -6.864  2.492   1.094   1.00 0.00 ? 52  LYS A HG3  4  
ATOM 5527  H HD2  . LYS A 1 52  ? -8.953  3.432   0.826   1.00 0.00 ? 52  LYS A HD2  4  
ATOM 5528  H HD3  . LYS A 1 52  ? -7.904  4.775   0.367   1.00 0.00 ? 52  LYS A HD3  4  
ATOM 5529  H HE2  . LYS A 1 52  ? -9.352  4.817   -1.393  1.00 0.00 ? 52  LYS A HE2  4  
ATOM 5530  H HE3  . LYS A 1 52  ? -8.164  3.680   -2.028  1.00 0.00 ? 52  LYS A HE3  4  
ATOM 5531  H HZ1  . LYS A 1 52  ? -9.548  1.883   -1.620  1.00 0.00 ? 52  LYS A HZ1  4  
ATOM 5532  H HZ2  . LYS A 1 52  ? -10.625 3.064   -2.171  1.00 0.00 ? 52  LYS A HZ2  4  
ATOM 5533  H HZ3  . LYS A 1 52  ? -10.513 2.728   -0.517  1.00 0.00 ? 52  LYS A HZ3  4  
ATOM 5534  N N    . ALA A 1 53  ? -2.714  3.812   -1.339  1.00 0.00 ? 53  ALA A N    4  
ATOM 5535  C CA   . ALA A 1 53  ? -1.691  4.593   -2.023  1.00 0.00 ? 53  ALA A CA   4  
ATOM 5536  C C    . ALA A 1 53  ? -0.818  3.704   -2.902  1.00 0.00 ? 53  ALA A C    4  
ATOM 5537  O O    . ALA A 1 53  ? -0.231  4.166   -3.881  1.00 0.00 ? 53  ALA A O    4  
ATOM 5538  C CB   . ALA A 1 53  ? -0.836  5.343   -1.013  1.00 0.00 ? 53  ALA A CB   4  
ATOM 5539  H H    . ALA A 1 53  ? -2.580  3.567   -0.400  1.00 0.00 ? 53  ALA A H    4  
ATOM 5540  H HA   . ALA A 1 53  ? -2.189  5.321   -2.647  1.00 0.00 ? 53  ALA A HA   4  
ATOM 5541  H HB1  . ALA A 1 53  ? -0.658  6.348   -1.368  1.00 0.00 ? 53  ALA A HB1  4  
ATOM 5542  H HB2  . ALA A 1 53  ? -1.350  5.382   -0.064  1.00 0.00 ? 53  ALA A HB2  4  
ATOM 5543  H HB3  . ALA A 1 53  ? 0.108   4.832   -0.891  1.00 0.00 ? 53  ALA A HB3  4  
ATOM 5544  N N    . TYR A 1 54  ? -0.736  2.426   -2.546  1.00 0.00 ? 54  TYR A N    4  
ATOM 5545  C CA   . TYR A 1 54  ? 0.068   1.473   -3.301  1.00 0.00 ? 54  TYR A CA   4  
ATOM 5546  C C    . TYR A 1 54  ? -0.676  0.997   -4.545  1.00 0.00 ? 54  TYR A C    4  
ATOM 5547  O O    . TYR A 1 54  ? -0.074  0.784   -5.598  1.00 0.00 ? 54  TYR A O    4  
ATOM 5548  C CB   . TYR A 1 54  ? 0.434   0.275   -2.423  1.00 0.00 ? 54  TYR A CB   4  
ATOM 5549  C CG   . TYR A 1 54  ? 1.253   -0.774  -3.141  1.00 0.00 ? 54  TYR A CG   4  
ATOM 5550  C CD1  . TYR A 1 54  ? 0.638   -1.787  -3.866  1.00 0.00 ? 54  TYR A CD1  4  
ATOM 5551  C CD2  . TYR A 1 54  ? 2.641   -0.753  -3.094  1.00 0.00 ? 54  TYR A CD2  4  
ATOM 5552  C CE1  . TYR A 1 54  ? 1.381   -2.748  -4.523  1.00 0.00 ? 54  TYR A CE1  4  
ATOM 5553  C CE2  . TYR A 1 54  ? 3.393   -1.709  -3.749  1.00 0.00 ? 54  TYR A CE2  4  
ATOM 5554  C CZ   . TYR A 1 54  ? 2.759   -2.705  -4.462  1.00 0.00 ? 54  TYR A CZ   4  
ATOM 5555  O OH   . TYR A 1 54  ? 3.504   -3.660  -5.115  1.00 0.00 ? 54  TYR A OH   4  
ATOM 5556  H H    . TYR A 1 54  ? -1.227  2.117   -1.756  1.00 0.00 ? 54  TYR A H    4  
ATOM 5557  H HA   . TYR A 1 54  ? 0.975   1.973   -3.607  1.00 0.00 ? 54  TYR A HA   4  
ATOM 5558  H HB2  . TYR A 1 54  ? 1.008   0.620   -1.577  1.00 0.00 ? 54  TYR A HB2  4  
ATOM 5559  H HB3  . TYR A 1 54  ? -0.472  -0.195  -2.071  1.00 0.00 ? 54  TYR A HB3  4  
ATOM 5560  H HD1  . TYR A 1 54  ? -0.441  -1.819  -3.912  1.00 0.00 ? 54  TYR A HD1  4  
ATOM 5561  H HD2  . TYR A 1 54  ? 3.135   0.028   -2.534  1.00 0.00 ? 54  TYR A HD2  4  
ATOM 5562  H HE1  . TYR A 1 54  ? 0.885   -3.528  -5.082  1.00 0.00 ? 54  TYR A HE1  4  
ATOM 5563  H HE2  . TYR A 1 54  ? 4.471   -1.675  -3.700  1.00 0.00 ? 54  TYR A HE2  4  
ATOM 5564  H HH   . TYR A 1 54  ? 4.219   -3.952  -4.544  1.00 0.00 ? 54  TYR A HH   4  
ATOM 5565  N N    . CYS A 1 55  ? -1.988  0.834   -4.416  1.00 0.00 ? 55  CYS A N    4  
ATOM 5566  C CA   . CYS A 1 55  ? -2.816  0.383   -5.529  1.00 0.00 ? 55  CYS A CA   4  
ATOM 5567  C C    . CYS A 1 55  ? -3.029  1.507   -6.538  1.00 0.00 ? 55  CYS A C    4  
ATOM 5568  O O    . CYS A 1 55  ? -3.095  1.267   -7.743  1.00 0.00 ? 55  CYS A O    4  
ATOM 5569  C CB   . CYS A 1 55  ? -4.166  -0.120  -5.016  1.00 0.00 ? 55  CYS A CB   4  
ATOM 5570  S SG   . CYS A 1 55  ? -5.283  1.191   -4.468  1.00 0.00 ? 55  CYS A SG   4  
ATOM 5571  H H    . CYS A 1 55  ? -2.410  1.020   -3.551  1.00 0.00 ? 55  CYS A H    4  
ATOM 5572  H HA   . CYS A 1 55  ? -2.300  -0.429  -6.017  1.00 0.00 ? 55  CYS A HA   4  
ATOM 5573  H HB2  . CYS A 1 55  ? -4.662  -0.665  -5.806  1.00 0.00 ? 55  CYS A HB2  4  
ATOM 5574  H HB3  . CYS A 1 55  ? -4.000  -0.784  -4.180  1.00 0.00 ? 55  CYS A HB3  4  
ATOM 5575  H HG   . CYS A 1 55  ? -4.560  2.112   -3.850  1.00 0.00 ? 55  CYS A HG   4  
ATOM 5576  N N    . GLU A 1 56  ? -3.137  2.733   -6.036  1.00 0.00 ? 56  GLU A N    4  
ATOM 5577  C CA   . GLU A 1 56  ? -3.345  3.894   -6.894  1.00 0.00 ? 56  GLU A CA   4  
ATOM 5578  C C    . GLU A 1 56  ? -2.055  4.275   -7.615  1.00 0.00 ? 56  GLU A C    4  
ATOM 5579  O O    . GLU A 1 56  ? -2.069  4.610   -8.800  1.00 0.00 ? 56  GLU A O    4  
ATOM 5580  C CB   . GLU A 1 56  ? -3.853  5.080   -6.072  1.00 0.00 ? 56  GLU A CB   4  
ATOM 5581  C CG   . GLU A 1 56  ? -2.744  5.878   -5.406  1.00 0.00 ? 56  GLU A CG   4  
ATOM 5582  C CD   . GLU A 1 56  ? -3.270  6.863   -4.381  1.00 0.00 ? 56  GLU A CD   4  
ATOM 5583  O OE1  . GLU A 1 56  ? -4.196  6.498   -3.626  1.00 0.00 ? 56  GLU A OE1  4  
ATOM 5584  O OE2  . GLU A 1 56  ? -2.756  8.000   -4.333  1.00 0.00 ? 56  GLU A OE2  4  
ATOM 5585  H H    . GLU A 1 56  ? -3.076  2.861   -5.066  1.00 0.00 ? 56  GLU A H    4  
ATOM 5586  H HA   . GLU A 1 56  ? -4.090  3.632   -7.630  1.00 0.00 ? 56  GLU A HA   4  
ATOM 5587  H HB2  . GLU A 1 56  ? -4.406  5.742   -6.722  1.00 0.00 ? 56  GLU A HB2  4  
ATOM 5588  H HB3  . GLU A 1 56  ? -4.514  4.711   -5.302  1.00 0.00 ? 56  GLU A HB3  4  
ATOM 5589  H HG2  . GLU A 1 56  ? -2.072  5.193   -4.912  1.00 0.00 ? 56  GLU A HG2  4  
ATOM 5590  H HG3  . GLU A 1 56  ? -2.206  6.425   -6.166  1.00 0.00 ? 56  GLU A HG3  4  
ATOM 5591  N N    . ARG A 1 57  ? -0.942  4.224   -6.891  1.00 0.00 ? 57  ARG A N    4  
ATOM 5592  C CA   . ARG A 1 57  ? 0.356   4.566   -7.460  1.00 0.00 ? 57  ARG A CA   4  
ATOM 5593  C C    . ARG A 1 57  ? 0.582   3.832   -8.779  1.00 0.00 ? 57  ARG A C    4  
ATOM 5594  O O    . ARG A 1 57  ? 0.964   4.439   -9.779  1.00 0.00 ? 57  ARG A O    4  
ATOM 5595  C CB   . ARG A 1 57  ? 1.475   4.222   -6.475  1.00 0.00 ? 57  ARG A CB   4  
ATOM 5596  C CG   . ARG A 1 57  ? 2.859   4.214   -7.104  1.00 0.00 ? 57  ARG A CG   4  
ATOM 5597  C CD   . ARG A 1 57  ? 3.894   3.615   -6.165  1.00 0.00 ? 57  ARG A CD   4  
ATOM 5598  N NE   . ARG A 1 57  ? 4.431   4.607   -5.237  1.00 0.00 ? 57  ARG A NE   4  
ATOM 5599  C CZ   . ARG A 1 57  ? 5.223   5.607   -5.608  1.00 0.00 ? 57  ARG A CZ   4  
ATOM 5600  N NH1  . ARG A 1 57  ? 5.570   5.746   -6.880  1.00 0.00 ? 57  ARG A NH1  4  
ATOM 5601  N NH2  . ARG A 1 57  ? 5.671   6.470   -4.705  1.00 0.00 ? 57  ARG A NH2  4  
ATOM 5602  H H    . ARG A 1 57  ? -0.995  3.950   -5.952  1.00 0.00 ? 57  ARG A H    4  
ATOM 5603  H HA   . ARG A 1 57  ? 0.367   5.629   -7.647  1.00 0.00 ? 57  ARG A HA   4  
ATOM 5604  H HB2  . ARG A 1 57  ? 1.471   4.948   -5.676  1.00 0.00 ? 57  ARG A HB2  4  
ATOM 5605  H HB3  . ARG A 1 57  ? 1.286   3.242   -6.062  1.00 0.00 ? 57  ARG A HB3  4  
ATOM 5606  H HG2  . ARG A 1 57  ? 2.829   3.627   -8.010  1.00 0.00 ? 57  ARG A HG2  4  
ATOM 5607  H HG3  . ARG A 1 57  ? 3.143   5.229   -7.339  1.00 0.00 ? 57  ARG A HG3  4  
ATOM 5608  H HD2  . ARG A 1 57  ? 3.430   2.821   -5.599  1.00 0.00 ? 57  ARG A HD2  4  
ATOM 5609  H HD3  . ARG A 1 57  ? 4.704   3.212   -6.754  1.00 0.00 ? 57  ARG A HD3  4  
ATOM 5610  H HE   . ARG A 1 57  ? 4.187   4.523   -4.292  1.00 0.00 ? 57  ARG A HE   4  
ATOM 5611  H HH11 . ARG A 1 57  ? 5.233   5.098   -7.563  1.00 0.00 ? 57  ARG A HH11 4  
ATOM 5612  H HH12 . ARG A 1 57  ? 6.166   6.500   -7.156  1.00 0.00 ? 57  ARG A HH12 4  
ATOM 5613  H HH21 . ARG A 1 57  ? 5.412   6.368   -3.745  1.00 0.00 ? 57  ARG A HH21 4  
ATOM 5614  H HH22 . ARG A 1 57  ? 6.268   7.221   -4.984  1.00 0.00 ? 57  ARG A HH22 4  
ATOM 5615  N N    . GLN A 1 58  ? 0.343   2.525   -8.772  1.00 0.00 ? 58  GLN A N    4  
ATOM 5616  C CA   . GLN A 1 58  ? 0.522   1.709   -9.967  1.00 0.00 ? 58  GLN A CA   4  
ATOM 5617  C C    . GLN A 1 58  ? -0.744  1.706   -10.818 1.00 0.00 ? 58  GLN A C    4  
ATOM 5618  O O    . GLN A 1 58  ? -0.686  1.880   -12.035 1.00 0.00 ? 58  GLN A O    4  
ATOM 5619  C CB   . GLN A 1 58  ? 0.895   0.277   -9.582  1.00 0.00 ? 58  GLN A CB   4  
ATOM 5620  C CG   . GLN A 1 58  ? 2.149   0.184   -8.727  1.00 0.00 ? 58  GLN A CG   4  
ATOM 5621  C CD   . GLN A 1 58  ? 3.347   0.851   -9.373  1.00 0.00 ? 58  GLN A CD   4  
ATOM 5622  O OE1  . GLN A 1 58  ? 3.439   0.937   -10.598 1.00 0.00 ? 58  GLN A OE1  4  
ATOM 5623  N NE2  . GLN A 1 58  ? 4.273   1.330   -8.551  1.00 0.00 ? 58  GLN A NE2  4  
ATOM 5624  H H    . GLN A 1 58  ? 0.041   2.099   -7.943  1.00 0.00 ? 58  GLN A H    4  
ATOM 5625  H HA   . GLN A 1 58  ? 1.327   2.139   -10.544 1.00 0.00 ? 58  GLN A HA   4  
ATOM 5626  H HB2  . GLN A 1 58  ? 0.076   -0.160  -9.031  1.00 0.00 ? 58  GLN A HB2  4  
ATOM 5627  H HB3  . GLN A 1 58  ? 1.058   -0.295  -10.484 1.00 0.00 ? 58  GLN A HB3  4  
ATOM 5628  H HG2  . GLN A 1 58  ? 1.958   0.663   -7.778  1.00 0.00 ? 58  GLN A HG2  4  
ATOM 5629  H HG3  . GLN A 1 58  ? 2.380   -0.858  -8.563  1.00 0.00 ? 58  GLN A HG3  4  
ATOM 5630  H HE21 . GLN A 1 58  ? 4.134   1.225   -7.586  1.00 0.00 ? 58  GLN A HE21 4  
ATOM 5631  H HE22 . GLN A 1 58  ? 5.059   1.765   -8.941  1.00 0.00 ? 58  GLN A HE22 4  
ATOM 5632  N N    . GLY A 1 59  ? -1.887  1.507   -10.169 1.00 0.00 ? 59  GLY A N    4  
ATOM 5633  C CA   . GLY A 1 59  ? -3.151  1.484   -10.882 1.00 0.00 ? 59  GLY A CA   4  
ATOM 5634  C C    . GLY A 1 59  ? -3.794  0.111   -10.879 1.00 0.00 ? 59  GLY A C    4  
ATOM 5635  O O    . GLY A 1 59  ? -4.532  -0.239  -11.800 1.00 0.00 ? 59  GLY A O    4  
ATOM 5636  H H    . GLY A 1 59  ? -1.872  1.373   -9.198  1.00 0.00 ? 59  GLY A H    4  
ATOM 5637  H HA2  . GLY A 1 59  ? -3.826  2.188   -10.419 1.00 0.00 ? 59  GLY A HA2  4  
ATOM 5638  H HA3  . GLY A 1 59  ? -2.979  1.785   -11.905 1.00 0.00 ? 59  GLY A HA3  4  
ATOM 5639  N N    . LEU A 1 60  ? -3.512  -0.670  -9.842  1.00 0.00 ? 60  LEU A N    4  
ATOM 5640  C CA   . LEU A 1 60  ? -4.067  -2.013  -9.723  1.00 0.00 ? 60  LEU A CA   4  
ATOM 5641  C C    . LEU A 1 60  ? -5.240  -2.034  -8.748  1.00 0.00 ? 60  LEU A C    4  
ATOM 5642  O O    . LEU A 1 60  ? -5.523  -1.039  -8.080  1.00 0.00 ? 60  LEU A O    4  
ATOM 5643  C CB   . LEU A 1 60  ? -2.988  -2.993  -9.260  1.00 0.00 ? 60  LEU A CB   4  
ATOM 5644  C CG   . LEU A 1 60  ? -1.600  -2.802  -9.874  1.00 0.00 ? 60  LEU A CG   4  
ATOM 5645  C CD1  . LEU A 1 60  ? -0.521  -3.274  -8.911  1.00 0.00 ? 60  LEU A CD1  4  
ATOM 5646  C CD2  . LEU A 1 60  ? -1.497  -3.544  -11.199 1.00 0.00 ? 60  LEU A CD2  4  
ATOM 5647  H H    . LEU A 1 60  ? -2.917  -0.335  -9.139  1.00 0.00 ? 60  LEU A H    4  
ATOM 5648  H HA   . LEU A 1 60  ? -4.420  -2.313  -10.698 1.00 0.00 ? 60  LEU A HA   4  
ATOM 5649  H HB2  . LEU A 1 60  ? -2.891  -2.898  -8.189  1.00 0.00 ? 60  LEU A HB2  4  
ATOM 5650  H HB3  . LEU A 1 60  ? -3.323  -3.992  -9.502  1.00 0.00 ? 60  LEU A HB3  4  
ATOM 5651  H HG   . LEU A 1 60  ? -1.440  -1.750  -10.065 1.00 0.00 ? 60  LEU A HG   4  
ATOM 5652  H HD11 . LEU A 1 60  ? 0.252   -3.788  -9.461  1.00 0.00 ? 60  LEU A HD11 4  
ATOM 5653  H HD12 . LEU A 1 60  ? -0.955  -3.946  -8.186  1.00 0.00 ? 60  LEU A HD12 4  
ATOM 5654  H HD13 . LEU A 1 60  ? -0.096  -2.421  -8.402  1.00 0.00 ? 60  LEU A HD13 4  
ATOM 5655  H HD21 . LEU A 1 60  ? -1.922  -4.531  -11.092 1.00 0.00 ? 60  LEU A HD21 4  
ATOM 5656  H HD22 . LEU A 1 60  ? -0.458  -3.629  -11.483 1.00 0.00 ? 60  LEU A HD22 4  
ATOM 5657  H HD23 . LEU A 1 60  ? -2.036  -2.999  -11.959 1.00 0.00 ? 60  LEU A HD23 4  
ATOM 5658  N N    . SER A 1 61  ? -5.919  -3.174  -8.670  1.00 0.00 ? 61  SER A N    4  
ATOM 5659  C CA   . SER A 1 61  ? -7.062  -3.324  -7.777  1.00 0.00 ? 61  SER A CA   4  
ATOM 5660  C C    . SER A 1 61  ? -6.643  -3.969  -6.460  1.00 0.00 ? 61  SER A C    4  
ATOM 5661  O O    . SER A 1 61  ? -5.741  -4.807  -6.426  1.00 0.00 ? 61  SER A O    4  
ATOM 5662  C CB   . SER A 1 61  ? -8.151  -4.164  -8.446  1.00 0.00 ? 61  SER A CB   4  
ATOM 5663  O OG   . SER A 1 61  ? -9.350  -4.142  -7.690  1.00 0.00 ? 61  SER A OG   4  
ATOM 5664  H H    . SER A 1 61  ? -5.645  -3.932  -9.228  1.00 0.00 ? 61  SER A H    4  
ATOM 5665  H HA   . SER A 1 61  ? -7.454  -2.339  -7.573  1.00 0.00 ? 61  SER A HA   4  
ATOM 5666  H HB2  . SER A 1 61  ? -8.354  -3.770  -9.430  1.00 0.00 ? 61  SER A HB2  4  
ATOM 5667  H HB3  . SER A 1 61  ? -7.812  -5.187  -8.531  1.00 0.00 ? 61  SER A HB3  4  
ATOM 5668  H HG   . SER A 1 61  ? -9.608  -3.232  -7.527  1.00 0.00 ? 61  SER A HG   4  
ATOM 5669  N N    . MET A 1 62  ? -7.303  -3.573  -5.377  1.00 0.00 ? 62  MET A N    4  
ATOM 5670  C CA   . MET A 1 62  ? -7.000  -4.114  -4.057  1.00 0.00 ? 62  MET A CA   4  
ATOM 5671  C C    . MET A 1 62  ? -7.192  -5.627  -4.032  1.00 0.00 ? 62  MET A C    4  
ATOM 5672  O O    . MET A 1 62  ? -6.378  -6.355  -3.464  1.00 0.00 ? 62  MET A O    4  
ATOM 5673  C CB   . MET A 1 62  ? -7.888  -3.458  -2.998  1.00 0.00 ? 62  MET A CB   4  
ATOM 5674  C CG   . MET A 1 62  ? -7.512  -2.016  -2.698  1.00 0.00 ? 62  MET A CG   4  
ATOM 5675  S SD   . MET A 1 62  ? -5.786  -1.835  -2.210  1.00 0.00 ? 62  MET A SD   4  
ATOM 5676  C CE   . MET A 1 62  ? -5.959  -0.901  -0.692  1.00 0.00 ? 62  MET A CE   4  
ATOM 5677  H H    . MET A 1 62  ? -8.012  -2.902  -5.467  1.00 0.00 ? 62  MET A H    4  
ATOM 5678  H HA   . MET A 1 62  ? -5.967  -3.889  -3.837  1.00 0.00 ? 62  MET A HA   4  
ATOM 5679  H HB2  . MET A 1 62  ? -8.911  -3.476  -3.341  1.00 0.00 ? 62  MET A HB2  4  
ATOM 5680  H HB3  . MET A 1 62  ? -7.814  -4.024  -2.081  1.00 0.00 ? 62  MET A HB3  4  
ATOM 5681  H HG2  . MET A 1 62  ? -7.685  -1.421  -3.582  1.00 0.00 ? 62  MET A HG2  4  
ATOM 5682  H HG3  . MET A 1 62  ? -8.139  -1.655  -1.896  1.00 0.00 ? 62  MET A HG3  4  
ATOM 5683  H HE1  . MET A 1 62  ? -5.261  -0.078  -0.693  1.00 0.00 ? 62  MET A HE1  4  
ATOM 5684  H HE2  . MET A 1 62  ? -6.966  -0.520  -0.617  1.00 0.00 ? 62  MET A HE2  4  
ATOM 5685  H HE3  . MET A 1 62  ? -5.754  -1.545  0.152   1.00 0.00 ? 62  MET A HE3  4  
ATOM 5686  N N    . ARG A 1 63  ? -8.272  -6.092  -4.651  1.00 0.00 ? 63  ARG A N    4  
ATOM 5687  C CA   . ARG A 1 63  ? -8.570  -7.518  -4.698  1.00 0.00 ? 63  ARG A CA   4  
ATOM 5688  C C    . ARG A 1 63  ? -7.541  -8.262  -5.545  1.00 0.00 ? 63  ARG A C    4  
ATOM 5689  O O    . ARG A 1 63  ? -7.254  -9.434  -5.302  1.00 0.00 ? 63  ARG A O    4  
ATOM 5690  C CB   . ARG A 1 63  ? -9.973  -7.749  -5.262  1.00 0.00 ? 63  ARG A CB   4  
ATOM 5691  C CG   . ARG A 1 63  ? -10.035 -7.699  -6.780  1.00 0.00 ? 63  ARG A CG   4  
ATOM 5692  C CD   . ARG A 1 63  ? -9.804  -9.071  -7.393  1.00 0.00 ? 63  ARG A CD   4  
ATOM 5693  N NE   . ARG A 1 63  ? -11.050 -9.814  -7.559  1.00 0.00 ? 63  ARG A NE   4  
ATOM 5694  C CZ   . ARG A 1 63  ? -11.113 -11.040 -8.066  1.00 0.00 ? 63  ARG A CZ   4  
ATOM 5695  N NH1  . ARG A 1 63  ? -10.006 -11.658 -8.455  1.00 0.00 ? 63  ARG A NH1  4  
ATOM 5696  N NH2  . ARG A 1 63  ? -12.285 -11.651 -8.186  1.00 0.00 ? 63  ARG A NH2  4  
ATOM 5697  H H    . ARG A 1 63  ? -8.883  -5.462  -5.086  1.00 0.00 ? 63  ARG A H    4  
ATOM 5698  H HA   . ARG A 1 63  ? -8.531  -7.899  -3.688  1.00 0.00 ? 63  ARG A HA   4  
ATOM 5699  H HB2  . ARG A 1 63  ? -10.322 -8.720  -4.942  1.00 0.00 ? 63  ARG A HB2  4  
ATOM 5700  H HB3  . ARG A 1 63  ? -10.634 -6.991  -4.871  1.00 0.00 ? 63  ARG A HB3  4  
ATOM 5701  H HG2  . ARG A 1 63  ? -11.010 -7.343  -7.080  1.00 0.00 ? 63  ARG A HG2  4  
ATOM 5702  H HG3  . ARG A 1 63  ? -9.276  -7.020  -7.139  1.00 0.00 ? 63  ARG A HG3  4  
ATOM 5703  H HD2  . ARG A 1 63  ? -9.339  -8.945  -8.360  1.00 0.00 ? 63  ARG A HD2  4  
ATOM 5704  H HD3  . ARG A 1 63  ? -9.144  -9.632  -6.748  1.00 0.00 ? 63  ARG A HD3  4  
ATOM 5705  H HE   . ARG A 1 63  ? -11.880 -9.376  -7.278  1.00 0.00 ? 63  ARG A HE   4  
ATOM 5706  H HH11 . ARG A 1 63  ? -9.121  -11.200 -8.365  1.00 0.00 ? 63  ARG A HH11 4  
ATOM 5707  H HH12 . ARG A 1 63  ? -10.056 -12.581 -8.835  1.00 0.00 ? 63  ARG A HH12 4  
ATOM 5708  H HH21 . ARG A 1 63  ? -13.121 -11.188 -7.894  1.00 0.00 ? 63  ARG A HH21 4  
ATOM 5709  H HH22 . ARG A 1 63  ? -12.331 -12.573 -8.568  1.00 0.00 ? 63  ARG A HH22 4  
ATOM 5710  N N    . GLN A 1 64  ? -6.991  -7.572  -6.538  1.00 0.00 ? 64  GLN A N    4  
ATOM 5711  C CA   . GLN A 1 64  ? -5.995  -8.167  -7.421  1.00 0.00 ? 64  GLN A CA   4  
ATOM 5712  C C    . GLN A 1 64  ? -4.680  -8.395  -6.684  1.00 0.00 ? 64  GLN A C    4  
ATOM 5713  O O    . GLN A 1 64  ? -4.008  -9.406  -6.890  1.00 0.00 ? 64  GLN A O    4  
ATOM 5714  C CB   . GLN A 1 64  ? -5.762  -7.272  -8.640  1.00 0.00 ? 64  GLN A CB   4  
ATOM 5715  C CG   . GLN A 1 64  ? -6.823  -7.423  -9.718  1.00 0.00 ? 64  GLN A CG   4  
ATOM 5716  C CD   . GLN A 1 64  ? -6.628  -6.456  -10.869 1.00 0.00 ? 64  GLN A CD   4  
ATOM 5717  O OE1  . GLN A 1 64  ? -6.805  -5.248  -10.716 1.00 0.00 ? 64  GLN A OE1  4  
ATOM 5718  N NE2  . GLN A 1 64  ? -6.260  -6.985  -12.030 1.00 0.00 ? 64  GLN A NE2  4  
ATOM 5719  H H    . GLN A 1 64  ? -7.261  -6.641  -6.681  1.00 0.00 ? 64  GLN A H    4  
ATOM 5720  H HA   . GLN A 1 64  ? -6.376  -9.121  -7.755  1.00 0.00 ? 64  GLN A HA   4  
ATOM 5721  H HB2  . GLN A 1 64  ? -5.751  -6.242  -8.317  1.00 0.00 ? 64  GLN A HB2  4  
ATOM 5722  H HB3  . GLN A 1 64  ? -4.803  -7.516  -9.073  1.00 0.00 ? 64  GLN A HB3  4  
ATOM 5723  H HG2  . GLN A 1 64  ? -6.785  -8.431  -10.104 1.00 0.00 ? 64  GLN A HG2  4  
ATOM 5724  H HG3  . GLN A 1 64  ? -7.793  -7.245  -9.277  1.00 0.00 ? 64  GLN A HG3  4  
ATOM 5725  H HE21 . GLN A 1 64  ? -6.139  -7.957  -12.078 1.00 0.00 ? 64  GLN A HE21 4  
ATOM 5726  H HE22 . GLN A 1 64  ? -6.128  -6.384  -12.791 1.00 0.00 ? 64  GLN A HE22 4  
ATOM 5727  N N    . ILE A 1 65  ? -4.318  -7.448  -5.825  1.00 0.00 ? 65  ILE A N    4  
ATOM 5728  C CA   . ILE A 1 65  ? -3.083  -7.546  -5.056  1.00 0.00 ? 65  ILE A CA   4  
ATOM 5729  C C    . ILE A 1 65  ? -3.363  -7.960  -3.616  1.00 0.00 ? 65  ILE A C    4  
ATOM 5730  O O    . ILE A 1 65  ? -4.477  -7.795  -3.117  1.00 0.00 ? 65  ILE A O    4  
ATOM 5731  C CB   . ILE A 1 65  ? -2.313  -6.212  -5.055  1.00 0.00 ? 65  ILE A CB   4  
ATOM 5732  C CG1  . ILE A 1 65  ? -3.158  -5.111  -4.410  1.00 0.00 ? 65  ILE A CG1  4  
ATOM 5733  C CG2  . ILE A 1 65  ? -1.922  -5.824  -6.473  1.00 0.00 ? 65  ILE A CG2  4  
ATOM 5734  C CD1  . ILE A 1 65  ? -2.368  -3.871  -4.057  1.00 0.00 ? 65  ILE A CD1  4  
ATOM 5735  H H    . ILE A 1 65  ? -4.895  -6.665  -5.704  1.00 0.00 ? 65  ILE A H    4  
ATOM 5736  H HA   . ILE A 1 65  ? -2.460  -8.297  -5.521  1.00 0.00 ? 65  ILE A HA   4  
ATOM 5737  H HB   . ILE A 1 65  ? -1.409  -6.344  -4.481  1.00 0.00 ? 65  ILE A HB   4  
ATOM 5738  H HG12 . ILE A 1 65  ? -3.942  -4.821  -5.092  1.00 0.00 ? 65  ILE A HG12 4  
ATOM 5739  H HG13 . ILE A 1 65  ? -3.601  -5.493  -3.501  1.00 0.00 ? 65  ILE A HG13 4  
ATOM 5740  H HG21 . ILE A 1 65  ? -2.688  -5.192  -6.898  1.00 0.00 ? 65  ILE A HG21 4  
ATOM 5741  H HG22 . ILE A 1 65  ? -0.985  -5.289  -6.454  1.00 0.00 ? 65  ILE A HG22 4  
ATOM 5742  H HG23 . ILE A 1 65  ? -1.817  -6.715  -7.074  1.00 0.00 ? 65  ILE A HG23 4  
ATOM 5743  H HD11 . ILE A 1 65  ? -2.749  -3.450  -3.138  1.00 0.00 ? 65  ILE A HD11 4  
ATOM 5744  H HD12 . ILE A 1 65  ? -1.327  -4.130  -3.931  1.00 0.00 ? 65  ILE A HD12 4  
ATOM 5745  H HD13 . ILE A 1 65  ? -2.464  -3.145  -4.851  1.00 0.00 ? 65  ILE A HD13 4  
ATOM 5746  N N    . ARG A 1 66  ? -2.345  -8.495  -2.951  1.00 0.00 ? 66  ARG A N    4  
ATOM 5747  C CA   . ARG A 1 66  ? -2.482  -8.932  -1.566  1.00 0.00 ? 66  ARG A CA   4  
ATOM 5748  C C    . ARG A 1 66  ? -1.256  -8.536  -0.748  1.00 0.00 ? 66  ARG A C    4  
ATOM 5749  O O    . ARG A 1 66  ? -0.122  -8.821  -1.131  1.00 0.00 ? 66  ARG A O    4  
ATOM 5750  C CB   . ARG A 1 66  ? -2.681  -10.447 -1.505  1.00 0.00 ? 66  ARG A CB   4  
ATOM 5751  C CG   . ARG A 1 66  ? -4.057  -10.900 -1.964  1.00 0.00 ? 66  ARG A CG   4  
ATOM 5752  C CD   . ARG A 1 66  ? -5.051  -10.917 -0.813  1.00 0.00 ? 66  ARG A CD   4  
ATOM 5753  N NE   . ARG A 1 66  ? -6.263  -11.660 -1.148  1.00 0.00 ? 66  ARG A NE   4  
ATOM 5754  C CZ   . ARG A 1 66  ? -7.195  -11.208 -1.981  1.00 0.00 ? 66  ARG A CZ   4  
ATOM 5755  N NH1  . ARG A 1 66  ? -7.053  -10.024 -2.561  1.00 0.00 ? 66  ARG A NH1  4  
ATOM 5756  N NH2  . ARG A 1 66  ? -8.271  -11.942 -2.236  1.00 0.00 ? 66  ARG A NH2  4  
ATOM 5757  H H    . ARG A 1 66  ? -1.481  -8.600  -3.402  1.00 0.00 ? 66  ARG A H    4  
ATOM 5758  H HA   . ARG A 1 66  ? -3.351  -8.446  -1.149  1.00 0.00 ? 66  ARG A HA   4  
ATOM 5759  H HB2  . ARG A 1 66  ? -1.942  -10.922 -2.133  1.00 0.00 ? 66  ARG A HB2  4  
ATOM 5760  H HB3  . ARG A 1 66  ? -2.540  -10.776 -0.486  1.00 0.00 ? 66  ARG A HB3  4  
ATOM 5761  H HG2  . ARG A 1 66  ? -4.415  -10.220 -2.723  1.00 0.00 ? 66  ARG A HG2  4  
ATOM 5762  H HG3  . ARG A 1 66  ? -3.980  -11.894 -2.377  1.00 0.00 ? 66  ARG A HG3  4  
ATOM 5763  H HD2  . ARG A 1 66  ? -4.582  -11.380 0.042   1.00 0.00 ? 66  ARG A HD2  4  
ATOM 5764  H HD3  . ARG A 1 66  ? -5.318  -9.900  -0.571  1.00 0.00 ? 66  ARG A HD3  4  
ATOM 5765  H HE   . ARG A 1 66  ? -6.388  -12.537 -0.731  1.00 0.00 ? 66  ARG A HE   4  
ATOM 5766  H HH11 . ARG A 1 66  ? -6.243  -9.470  -2.371  1.00 0.00 ? 66  ARG A HH11 4  
ATOM 5767  H HH12 . ARG A 1 66  ? -7.755  -9.688  -3.189  1.00 0.00 ? 66  ARG A HH12 4  
ATOM 5768  H HH21 . ARG A 1 66  ? -8.381  -12.836 -1.801  1.00 0.00 ? 66  ARG A HH21 4  
ATOM 5769  H HH22 . ARG A 1 66  ? -8.971  -11.602 -2.862  1.00 0.00 ? 66  ARG A HH22 4  
ATOM 5770  N N    . PHE A 1 67  ? -1.493  -7.876  0.381   1.00 0.00 ? 67  PHE A N    4  
ATOM 5771  C CA   . PHE A 1 67  ? -0.409  -7.439  1.253   1.00 0.00 ? 67  PHE A CA   4  
ATOM 5772  C C    . PHE A 1 67  ? -0.086  -8.505  2.295   1.00 0.00 ? 67  PHE A C    4  
ATOM 5773  O O    . PHE A 1 67  ? -0.966  -9.246  2.735   1.00 0.00 ? 67  PHE A O    4  
ATOM 5774  C CB   . PHE A 1 67  ? -0.782  -6.128  1.948   1.00 0.00 ? 67  PHE A CB   4  
ATOM 5775  C CG   . PHE A 1 67  ? -1.049  -4.998  0.994   1.00 0.00 ? 67  PHE A CG   4  
ATOM 5776  C CD1  . PHE A 1 67  ? -2.284  -4.871  0.378   1.00 0.00 ? 67  PHE A CD1  4  
ATOM 5777  C CD2  . PHE A 1 67  ? -0.065  -4.064  0.713   1.00 0.00 ? 67  PHE A CD2  4  
ATOM 5778  C CE1  . PHE A 1 67  ? -2.532  -3.833  -0.500  1.00 0.00 ? 67  PHE A CE1  4  
ATOM 5779  C CE2  . PHE A 1 67  ? -0.307  -3.024  -0.165  1.00 0.00 ? 67  PHE A CE2  4  
ATOM 5780  C CZ   . PHE A 1 67  ? -1.542  -2.908  -0.771  1.00 0.00 ? 67  PHE A CZ   4  
ATOM 5781  H H    . PHE A 1 67  ? -2.420  -7.677  0.633   1.00 0.00 ? 67  PHE A H    4  
ATOM 5782  H HA   . PHE A 1 67  ? 0.463   -7.276  0.640   1.00 0.00 ? 67  PHE A HA   4  
ATOM 5783  H HB2  . PHE A 1 67  ? -1.674  -6.281  2.536   1.00 0.00 ? 67  PHE A HB2  4  
ATOM 5784  H HB3  . PHE A 1 67  ? 0.027   -5.830  2.598   1.00 0.00 ? 67  PHE A HB3  4  
ATOM 5785  H HD1  . PHE A 1 67  ? -3.059  -5.593  0.590   1.00 0.00 ? 67  PHE A HD1  4  
ATOM 5786  H HD2  . PHE A 1 67  ? 0.902   -4.154  1.188   1.00 0.00 ? 67  PHE A HD2  4  
ATOM 5787  H HE1  . PHE A 1 67  ? -3.498  -3.745  -0.973  1.00 0.00 ? 67  PHE A HE1  4  
ATOM 5788  H HE2  . PHE A 1 67  ? 0.469   -2.303  -0.374  1.00 0.00 ? 67  PHE A HE2  4  
ATOM 5789  H HZ   . PHE A 1 67  ? -1.733  -2.097  -1.458  1.00 0.00 ? 67  PHE A HZ   4  
ATOM 5790  N N    . ARG A 1 68  ? 1.183   -8.578  2.685   1.00 0.00 ? 68  ARG A N    4  
ATOM 5791  C CA   . ARG A 1 68  ? 1.623   -9.555  3.673   1.00 0.00 ? 68  ARG A CA   4  
ATOM 5792  C C    . ARG A 1 68  ? 2.815   -9.026  4.466   1.00 0.00 ? 68  ARG A C    4  
ATOM 5793  O O    . ARG A 1 68  ? 3.559   -8.168  3.991   1.00 0.00 ? 68  ARG A O    4  
ATOM 5794  C CB   . ARG A 1 68  ? 1.996   -10.872 2.990   1.00 0.00 ? 68  ARG A CB   4  
ATOM 5795  C CG   . ARG A 1 68  ? 0.795   -11.674 2.517   1.00 0.00 ? 68  ARG A CG   4  
ATOM 5796  C CD   . ARG A 1 68  ? 1.174   -13.113 2.205   1.00 0.00 ? 68  ARG A CD   4  
ATOM 5797  N NE   . ARG A 1 68  ? 0.089   -13.834 1.545   1.00 0.00 ? 68  ARG A NE   4  
ATOM 5798  C CZ   . ARG A 1 68  ? 0.156   -15.118 1.211   1.00 0.00 ? 68  ARG A CZ   4  
ATOM 5799  N NH1  . ARG A 1 68  ? 1.250   -15.819 1.475   1.00 0.00 ? 68  ARG A NH1  4  
ATOM 5800  N NH2  . ARG A 1 68  ? -0.873  -15.704 0.612   1.00 0.00 ? 68  ARG A NH2  4  
ATOM 5801  H H    . ARG A 1 68  ? 1.838   -7.961  2.298   1.00 0.00 ? 68  ARG A H    4  
ATOM 5802  H HA   . ARG A 1 68  ? 0.804   -9.732  4.353   1.00 0.00 ? 68  ARG A HA   4  
ATOM 5803  H HB2  . ARG A 1 68  ? 2.617   -10.656 2.132   1.00 0.00 ? 68  ARG A HB2  4  
ATOM 5804  H HB3  . ARG A 1 68  ? 2.556   -11.479 3.685   1.00 0.00 ? 68  ARG A HB3  4  
ATOM 5805  H HG2  . ARG A 1 68  ? 0.044   -11.671 3.293   1.00 0.00 ? 68  ARG A HG2  4  
ATOM 5806  H HG3  . ARG A 1 68  ? 0.396   -11.214 1.625   1.00 0.00 ? 68  ARG A HG3  4  
ATOM 5807  H HD2  . ARG A 1 68  ? 2.039   -13.112 1.559   1.00 0.00 ? 68  ARG A HD2  4  
ATOM 5808  H HD3  . ARG A 1 68  ? 1.417   -13.615 3.130   1.00 0.00 ? 68  ARG A HD3  4  
ATOM 5809  H HE   . ARG A 1 68  ? -0.729  -13.335 1.340   1.00 0.00 ? 68  ARG A HE   4  
ATOM 5810  H HH11 . ARG A 1 68  ? 2.027   -15.380 1.927   1.00 0.00 ? 68  ARG A HH11 4  
ATOM 5811  H HH12 . ARG A 1 68  ? 1.298   -16.786 1.223   1.00 0.00 ? 68  ARG A HH12 4  
ATOM 5812  H HH21 . ARG A 1 68  ? -1.699  -15.179 0.411   1.00 0.00 ? 68  ARG A HH21 4  
ATOM 5813  H HH22 . ARG A 1 68  ? -0.821  -16.670 0.361   1.00 0.00 ? 68  ARG A HH22 4  
ATOM 5814  N N    . PHE A 1 69  ? 2.990   -9.544  5.678   1.00 0.00 ? 69  PHE A N    4  
ATOM 5815  C CA   . PHE A 1 69  ? 4.090   -9.123  6.538   1.00 0.00 ? 69  PHE A CA   4  
ATOM 5816  C C    . PHE A 1 69  ? 4.600   -10.290 7.378   1.00 0.00 ? 69  PHE A C    4  
ATOM 5817  O O    . PHE A 1 69  ? 3.929   -10.740 8.307   1.00 0.00 ? 69  PHE A O    4  
ATOM 5818  C CB   . PHE A 1 69  ? 3.643   -7.979  7.450   1.00 0.00 ? 69  PHE A CB   4  
ATOM 5819  C CG   . PHE A 1 69  ? 4.750   -7.418  8.296   1.00 0.00 ? 69  PHE A CG   4  
ATOM 5820  C CD1  . PHE A 1 69  ? 5.725   -6.608  7.736   1.00 0.00 ? 69  PHE A CD1  4  
ATOM 5821  C CD2  . PHE A 1 69  ? 4.818   -7.702  9.650   1.00 0.00 ? 69  PHE A CD2  4  
ATOM 5822  C CE1  . PHE A 1 69  ? 6.746   -6.091  8.510   1.00 0.00 ? 69  PHE A CE1  4  
ATOM 5823  C CE2  . PHE A 1 69  ? 5.835   -7.187  10.430  1.00 0.00 ? 69  PHE A CE2  4  
ATOM 5824  C CZ   . PHE A 1 69  ? 6.801   -6.381  9.859   1.00 0.00 ? 69  PHE A CZ   4  
ATOM 5825  H H    . PHE A 1 69  ? 2.363   -10.225 6.001   1.00 0.00 ? 69  PHE A H    4  
ATOM 5826  H HA   . PHE A 1 69  ? 4.890   -8.774  5.904   1.00 0.00 ? 69  PHE A HA   4  
ATOM 5827  H HB2  . PHE A 1 69  ? 3.250   -7.177  6.844   1.00 0.00 ? 69  PHE A HB2  4  
ATOM 5828  H HB3  . PHE A 1 69  ? 2.868   -8.338  8.111   1.00 0.00 ? 69  PHE A HB3  4  
ATOM 5829  H HD1  . PHE A 1 69  ? 5.682   -6.381  6.680   1.00 0.00 ? 69  PHE A HD1  4  
ATOM 5830  H HD2  . PHE A 1 69  ? 4.064   -8.333  10.098  1.00 0.00 ? 69  PHE A HD2  4  
ATOM 5831  H HE1  . PHE A 1 69  ? 7.499   -5.461  8.061   1.00 0.00 ? 69  PHE A HE1  4  
ATOM 5832  H HE2  . PHE A 1 69  ? 5.877   -7.416  11.485  1.00 0.00 ? 69  PHE A HE2  4  
ATOM 5833  H HZ   . PHE A 1 69  ? 7.597   -5.977  10.467  1.00 0.00 ? 69  PHE A HZ   4  
ATOM 5834  N N    . ASP A 1 70  ? 5.791   -10.775 7.045   1.00 0.00 ? 70  ASP A N    4  
ATOM 5835  C CA   . ASP A 1 70  ? 6.393   -11.889 7.768   1.00 0.00 ? 70  ASP A CA   4  
ATOM 5836  C C    . ASP A 1 70  ? 5.685   -13.198 7.435   1.00 0.00 ? 70  ASP A C    4  
ATOM 5837  O O    . ASP A 1 70  ? 5.680   -14.133 8.234   1.00 0.00 ? 70  ASP A O    4  
ATOM 5838  C CB   . ASP A 1 70  ? 6.339   -11.634 9.275   1.00 0.00 ? 70  ASP A CB   4  
ATOM 5839  C CG   . ASP A 1 70  ? 7.431   -12.371 10.026  1.00 0.00 ? 70  ASP A CG   4  
ATOM 5840  O OD1  . ASP A 1 70  ? 8.607   -12.262 9.620   1.00 0.00 ? 70  ASP A OD1  4  
ATOM 5841  O OD2  . ASP A 1 70  ? 7.109   -13.055 11.019  1.00 0.00 ? 70  ASP A OD2  4  
ATOM 5842  H H    . ASP A 1 70  ? 6.277   -10.373 6.294   1.00 0.00 ? 70  ASP A H    4  
ATOM 5843  H HA   . ASP A 1 70  ? 7.425   -11.964 7.462   1.00 0.00 ? 70  ASP A HA   4  
ATOM 5844  H HB2  . ASP A 1 70  ? 6.452   -10.576 9.460   1.00 0.00 ? 70  ASP A HB2  4  
ATOM 5845  H HB3  . ASP A 1 70  ? 5.382   -11.961 9.655   1.00 0.00 ? 70  ASP A HB3  4  
ATOM 5846  N N    . GLY A 1 71  ? 5.088   -13.258 6.249   1.00 0.00 ? 71  GLY A N    4  
ATOM 5847  C CA   . GLY A 1 71  ? 4.384   -14.456 5.831   1.00 0.00 ? 71  GLY A CA   4  
ATOM 5848  C C    . GLY A 1 71  ? 3.013   -14.575 6.467   1.00 0.00 ? 71  GLY A C    4  
ATOM 5849  O O    . GLY A 1 71  ? 2.562   -15.676 6.781   1.00 0.00 ? 71  GLY A O    4  
ATOM 5850  H H    . GLY A 1 71  ? 5.125   -12.481 5.652   1.00 0.00 ? 71  GLY A H    4  
ATOM 5851  H HA2  . GLY A 1 71  ? 4.271   -14.439 4.757   1.00 0.00 ? 71  GLY A HA2  4  
ATOM 5852  H HA3  . GLY A 1 71  ? 4.972   -15.319 6.107   1.00 0.00 ? 71  GLY A HA3  4  
ATOM 5853  N N    . GLN A 1 72  ? 2.351   -13.439 6.660   1.00 0.00 ? 72  GLN A N    4  
ATOM 5854  C CA   . GLN A 1 72  ? 1.025   -13.421 7.265   1.00 0.00 ? 72  GLN A CA   4  
ATOM 5855  C C    . GLN A 1 72  ? 0.127   -12.398 6.578   1.00 0.00 ? 72  GLN A C    4  
ATOM 5856  O O    . GLN A 1 72  ? 0.565   -11.319 6.179   1.00 0.00 ? 72  GLN A O    4  
ATOM 5857  C CB   . GLN A 1 72  ? 1.127   -13.106 8.758   1.00 0.00 ? 72  GLN A CB   4  
ATOM 5858  C CG   . GLN A 1 72  ? 1.615   -14.277 9.595   1.00 0.00 ? 72  GLN A CG   4  
ATOM 5859  C CD   . GLN A 1 72  ? 1.206   -14.165 11.051  1.00 0.00 ? 72  GLN A CD   4  
ATOM 5860  O OE1  . GLN A 1 72  ? 0.104   -14.565 11.430  1.00 0.00 ? 72  GLN A OE1  4  
ATOM 5861  N NE2  . GLN A 1 72  ? 2.093   -13.621 11.875  1.00 0.00 ? 72  GLN A NE2  4  
ATOM 5862  H H    . GLN A 1 72  ? 2.765   -12.593 6.389   1.00 0.00 ? 72  GLN A H    4  
ATOM 5863  H HA   . GLN A 1 72  ? 0.592   -14.402 7.142   1.00 0.00 ? 72  GLN A HA   4  
ATOM 5864  H HB2  . GLN A 1 72  ? 1.813   -12.283 8.894   1.00 0.00 ? 72  GLN A HB2  4  
ATOM 5865  H HB3  . GLN A 1 72  ? 0.152   -12.815 9.120   1.00 0.00 ? 72  GLN A HB3  4  
ATOM 5866  H HG2  . GLN A 1 72  ? 1.203   -15.189 9.191   1.00 0.00 ? 72  GLN A HG2  4  
ATOM 5867  H HG3  . GLN A 1 72  ? 2.693   -14.316 9.542   1.00 0.00 ? 72  GLN A HG3  4  
ATOM 5868  H HE21 . GLN A 1 72  ? 2.950   -13.324 11.502  1.00 0.00 ? 72  GLN A HE21 4  
ATOM 5869  H HE22 . GLN A 1 72  ? 1.854   -13.535 12.821  1.00 0.00 ? 72  GLN A HE22 4  
ATOM 5870  N N    . PRO A 1 73  ? -1.162  -12.744 6.434   1.00 0.00 ? 73  PRO A N    4  
ATOM 5871  C CA   . PRO A 1 73  ? -2.149  -11.869 5.795   1.00 0.00 ? 73  PRO A CA   4  
ATOM 5872  C C    . PRO A 1 73  ? -2.470  -10.642 6.641   1.00 0.00 ? 73  PRO A C    4  
ATOM 5873  O O    . PRO A 1 73  ? -2.933  -10.763 7.775   1.00 0.00 ? 73  PRO A O    4  
ATOM 5874  C CB   . PRO A 1 73  ? -3.383  -12.765 5.661   1.00 0.00 ? 73  PRO A CB   4  
ATOM 5875  C CG   . PRO A 1 73  ? -3.232  -13.780 6.740   1.00 0.00 ? 73  PRO A CG   4  
ATOM 5876  C CD   . PRO A 1 73  ? -1.754  -14.014 6.885   1.00 0.00 ? 73  PRO A CD   4  
ATOM 5877  H HA   . PRO A 1 73  ? -1.823  -11.553 4.814   1.00 0.00 ? 73  PRO A HA   4  
ATOM 5878  H HB2  . PRO A 1 73  ? -4.277  -12.172 5.797   1.00 0.00 ? 73  PRO A HB2  4  
ATOM 5879  H HB3  . PRO A 1 73  ? -3.394  -13.225 4.685   1.00 0.00 ? 73  PRO A HB3  4  
ATOM 5880  H HG2  . PRO A 1 73  ? -3.644  -13.400 7.663   1.00 0.00 ? 73  PRO A HG2  4  
ATOM 5881  H HG3  . PRO A 1 73  ? -3.729  -14.696 6.455   1.00 0.00 ? 73  PRO A HG3  4  
ATOM 5882  H HD2  . PRO A 1 73  ? -1.502  -14.212 7.917   1.00 0.00 ? 73  PRO A HD2  4  
ATOM 5883  H HD3  . PRO A 1 73  ? -1.437  -14.832 6.254   1.00 0.00 ? 73  PRO A HD3  4  
ATOM 5884  N N    . ILE A 1 74  ? -2.223  -9.462  6.082   1.00 0.00 ? 74  ILE A N    4  
ATOM 5885  C CA   . ILE A 1 74  ? -2.488  -8.213  6.785   1.00 0.00 ? 74  ILE A CA   4  
ATOM 5886  C C    . ILE A 1 74  ? -3.730  -7.523  6.232   1.00 0.00 ? 74  ILE A C    4  
ATOM 5887  O O    . ILE A 1 74  ? -3.997  -7.572  5.032   1.00 0.00 ? 74  ILE A O    4  
ATOM 5888  C CB   . ILE A 1 74  ? -1.292  -7.248  6.688   1.00 0.00 ? 74  ILE A CB   4  
ATOM 5889  C CG1  . ILE A 1 74  ? -0.720  -7.250  5.269   1.00 0.00 ? 74  ILE A CG1  4  
ATOM 5890  C CG2  . ILE A 1 74  ? -0.219  -7.629  7.698   1.00 0.00 ? 74  ILE A CG2  4  
ATOM 5891  C CD1  . ILE A 1 74  ? 0.358   -6.212  5.050   1.00 0.00 ? 74  ILE A CD1  4  
ATOM 5892  H H    . ILE A 1 74  ? -1.854  -9.431  5.175   1.00 0.00 ? 74  ILE A H    4  
ATOM 5893  H HA   . ILE A 1 74  ? -2.652  -8.447  7.827   1.00 0.00 ? 74  ILE A HA   4  
ATOM 5894  H HB   . ILE A 1 74  ? -1.639  -6.254  6.927   1.00 0.00 ? 74  ILE A HB   4  
ATOM 5895  H HG12 . ILE A 1 74  ? -0.294  -8.219  5.061   1.00 0.00 ? 74  ILE A HG12 4  
ATOM 5896  H HG13 . ILE A 1 74  ? -1.518  -7.055  4.567   1.00 0.00 ? 74  ILE A HG13 4  
ATOM 5897  H HG21 . ILE A 1 74  ? 0.282   -8.527  7.368   1.00 0.00 ? 74  ILE A HG21 4  
ATOM 5898  H HG22 . ILE A 1 74  ? 0.498   -6.827  7.781   1.00 0.00 ? 74  ILE A HG22 4  
ATOM 5899  H HG23 . ILE A 1 74  ? -0.676  -7.805  8.660   1.00 0.00 ? 74  ILE A HG23 4  
ATOM 5900  H HD11 . ILE A 1 74  ? -0.063  -5.358  4.540   1.00 0.00 ? 74  ILE A HD11 4  
ATOM 5901  H HD12 . ILE A 1 74  ? 0.759   -5.902  6.003   1.00 0.00 ? 74  ILE A HD12 4  
ATOM 5902  H HD13 . ILE A 1 74  ? 1.148   -6.635  4.447   1.00 0.00 ? 74  ILE A HD13 4  
ATOM 5903  N N    . ASN A 1 75  ? -4.485  -6.879  7.116   1.00 0.00 ? 75  ASN A N    4  
ATOM 5904  C CA   . ASN A 1 75  ? -5.699  -6.177  6.715   1.00 0.00 ? 75  ASN A CA   4  
ATOM 5905  C C    . ASN A 1 75  ? -5.570  -4.678  6.970   1.00 0.00 ? 75  ASN A C    4  
ATOM 5906  O O    . ASN A 1 75  ? -4.912  -4.255  7.920   1.00 0.00 ? 75  ASN A O    4  
ATOM 5907  C CB   . ASN A 1 75  ? -6.907  -6.732  7.473   1.00 0.00 ? 75  ASN A CB   4  
ATOM 5908  C CG   . ASN A 1 75  ? -7.064  -8.230  7.292   1.00 0.00 ? 75  ASN A CG   4  
ATOM 5909  O OD1  . ASN A 1 75  ? -7.517  -8.697  6.247   1.00 0.00 ? 75  ASN A OD1  4  
ATOM 5910  N ND2  . ASN A 1 75  ? -6.690  -8.991  8.314   1.00 0.00 ? 75  ASN A ND2  4  
ATOM 5911  H H    . ASN A 1 75  ? -4.220  -6.875  8.059   1.00 0.00 ? 75  ASN A H    4  
ATOM 5912  H HA   . ASN A 1 75  ? -5.843  -6.340  5.658   1.00 0.00 ? 75  ASN A HA   4  
ATOM 5913  H HB2  . ASN A 1 75  ? -6.789  -6.527  8.527   1.00 0.00 ? 75  ASN A HB2  4  
ATOM 5914  H HB3  . ASN A 1 75  ? -7.803  -6.249  7.114   1.00 0.00 ? 75  ASN A HB3  4  
ATOM 5915  H HD21 . ASN A 1 75  ? -6.339  -8.550  9.116   1.00 0.00 ? 75  ASN A HD21 4  
ATOM 5916  H HD22 . ASN A 1 75  ? -6.780  -9.963  8.224   1.00 0.00 ? 75  ASN A HD22 4  
ATOM 5917  N N    . GLU A 1 76  ? -6.204  -3.882  6.115   1.00 0.00 ? 76  GLU A N    4  
ATOM 5918  C CA   . GLU A 1 76  ? -6.160  -2.430  6.248   1.00 0.00 ? 76  GLU A CA   4  
ATOM 5919  C C    . GLU A 1 76  ? -6.497  -2.004  7.674   1.00 0.00 ? 76  GLU A C    4  
ATOM 5920  O O    . GLU A 1 76  ? -5.862  -1.110  8.234   1.00 0.00 ? 76  GLU A O    4  
ATOM 5921  C CB   . GLU A 1 76  ? -7.132  -1.776  5.264   1.00 0.00 ? 76  GLU A CB   4  
ATOM 5922  C CG   . GLU A 1 76  ? -8.518  -2.397  5.274   1.00 0.00 ? 76  GLU A CG   4  
ATOM 5923  C CD   . GLU A 1 76  ? -9.477  -1.701  4.328   1.00 0.00 ? 76  GLU A CD   4  
ATOM 5924  O OE1  . GLU A 1 76  ? -9.374  -1.928  3.105   1.00 0.00 ? 76  GLU A OE1  4  
ATOM 5925  O OE2  . GLU A 1 76  ? -10.330 -0.928  4.812   1.00 0.00 ? 76  GLU A OE2  4  
ATOM 5926  H H    . GLU A 1 76  ? -6.713  -4.279  5.378   1.00 0.00 ? 76  GLU A H    4  
ATOM 5927  H HA   . GLU A 1 76  ? -5.156  -2.107  6.016   1.00 0.00 ? 76  GLU A HA   4  
ATOM 5928  H HB2  . GLU A 1 76  ? -7.227  -0.729  5.513   1.00 0.00 ? 76  GLU A HB2  4  
ATOM 5929  H HB3  . GLU A 1 76  ? -6.728  -1.864  4.266   1.00 0.00 ? 76  GLU A HB3  4  
ATOM 5930  H HG2  . GLU A 1 76  ? -8.437  -3.433  4.981   1.00 0.00 ? 76  GLU A HG2  4  
ATOM 5931  H HG3  . GLU A 1 76  ? -8.918  -2.338  6.276   1.00 0.00 ? 76  GLU A HG3  4  
ATOM 5932  N N    . THR A 1 77  ? -7.503  -2.650  8.256   1.00 0.00 ? 77  THR A N    4  
ATOM 5933  C CA   . THR A 1 77  ? -7.927  -2.337  9.615   1.00 0.00 ? 77  THR A CA   4  
ATOM 5934  C C    . THR A 1 77  ? -6.760  -2.431  10.590  1.00 0.00 ? 77  THR A C    4  
ATOM 5935  O O    . THR A 1 77  ? -6.600  -1.580  11.466  1.00 0.00 ? 77  THR A O    4  
ATOM 5936  C CB   . THR A 1 77  ? -9.050  -3.282  10.084  1.00 0.00 ? 77  THR A CB   4  
ATOM 5937  O OG1  . THR A 1 77  ? -8.573  -4.631  10.118  1.00 0.00 ? 77  THR A OG1  4  
ATOM 5938  C CG2  . THR A 1 77  ? -10.256 -3.188  9.161   1.00 0.00 ? 77  THR A CG2  4  
ATOM 5939  H H    . THR A 1 77  ? -7.970  -3.352  7.758   1.00 0.00 ? 77  THR A H    4  
ATOM 5940  H HA   . THR A 1 77  ? -8.309  -1.327  9.621   1.00 0.00 ? 77  THR A HA   4  
ATOM 5941  H HB   . THR A 1 77  ? -9.353  -2.990  11.079  1.00 0.00 ? 77  THR A HB   4  
ATOM 5942  H HG1  . THR A 1 77  ? -8.438  -4.900  11.030  1.00 0.00 ? 77  THR A HG1  4  
ATOM 5943  H HG21 . THR A 1 77  ? -10.588 -4.182  8.900   1.00 0.00 ? 77  THR A HG21 4  
ATOM 5944  H HG22 . THR A 1 77  ? -9.983  -2.652  8.264   1.00 0.00 ? 77  THR A HG22 4  
ATOM 5945  H HG23 . THR A 1 77  ? -11.054 -2.664  9.665   1.00 0.00 ? 77  THR A HG23 4  
ATOM 5946  N N    . ASP A 1 78  ? -5.945  -3.469  10.433  1.00 0.00 ? 78  ASP A N    4  
ATOM 5947  C CA   . ASP A 1 78  ? -4.790  -3.672  11.300  1.00 0.00 ? 78  ASP A CA   4  
ATOM 5948  C C    . ASP A 1 78  ? -3.792  -2.528  11.152  1.00 0.00 ? 78  ASP A C    4  
ATOM 5949  O O    . ASP A 1 78  ? -3.622  -1.974  10.065  1.00 0.00 ? 78  ASP A O    4  
ATOM 5950  C CB   . ASP A 1 78  ? -4.111  -5.004  10.977  1.00 0.00 ? 78  ASP A CB   4  
ATOM 5951  C CG   . ASP A 1 78  ? -4.768  -6.174  11.682  1.00 0.00 ? 78  ASP A CG   4  
ATOM 5952  O OD1  . ASP A 1 78  ? -5.958  -6.060  12.041  1.00 0.00 ? 78  ASP A OD1  4  
ATOM 5953  O OD2  . ASP A 1 78  ? -4.090  -7.206  11.874  1.00 0.00 ? 78  ASP A OD2  4  
ATOM 5954  H H    . ASP A 1 78  ? -6.125  -4.113  9.717   1.00 0.00 ? 78  ASP A H    4  
ATOM 5955  H HA   . ASP A 1 78  ? -5.142  -3.696  12.321  1.00 0.00 ? 78  ASP A HA   4  
ATOM 5956  H HB2  . ASP A 1 78  ? -4.161  -5.176  9.911   1.00 0.00 ? 78  ASP A HB2  4  
ATOM 5957  H HB3  . ASP A 1 78  ? -3.077  -4.956  11.282  1.00 0.00 ? 78  ASP A HB3  4  
ATOM 5958  N N    . THR A 1 79  ? -3.133  -2.178  12.252  1.00 0.00 ? 79  THR A N    4  
ATOM 5959  C CA   . THR A 1 79  ? -2.153  -1.100  12.246  1.00 0.00 ? 79  THR A CA   4  
ATOM 5960  C C    . THR A 1 79  ? -0.731  -1.648  12.213  1.00 0.00 ? 79  THR A C    4  
ATOM 5961  O O    . THR A 1 79  ? -0.479  -2.807  12.545  1.00 0.00 ? 79  THR A O    4  
ATOM 5962  C CB   . THR A 1 79  ? -2.311  -0.189  13.478  1.00 0.00 ? 79  THR A CB   4  
ATOM 5963  O OG1  . THR A 1 79  ? -2.821  -0.944  14.583  1.00 0.00 ? 79  THR A OG1  4  
ATOM 5964  C CG2  . THR A 1 79  ? -3.247  0.972   13.176  1.00 0.00 ? 79  THR A CG2  4  
ATOM 5965  H H    . THR A 1 79  ? -3.312  -2.658  13.088  1.00 0.00 ? 79  THR A H    4  
ATOM 5966  H HA   . THR A 1 79  ? -2.319  -0.504  11.360  1.00 0.00 ? 79  THR A HA   4  
ATOM 5967  H HB   . THR A 1 79  ? -1.341  0.208   13.740  1.00 0.00 ? 79  THR A HB   4  
ATOM 5968  H HG1  . THR A 1 79  ? -2.292  -1.737  14.700  1.00 0.00 ? 79  THR A HG1  4  
ATOM 5969  H HG21 . THR A 1 79  ? -3.511  0.959   12.129  1.00 0.00 ? 79  THR A HG21 4  
ATOM 5970  H HG22 . THR A 1 79  ? -2.752  1.903   13.411  1.00 0.00 ? 79  THR A HG22 4  
ATOM 5971  H HG23 . THR A 1 79  ? -4.141  0.878   13.774  1.00 0.00 ? 79  THR A HG23 4  
ATOM 5972  N N    . PRO A 1 80  ? 0.223   -0.799  11.804  1.00 0.00 ? 80  PRO A N    4  
ATOM 5973  C CA   . PRO A 1 80  ? 1.637   -1.177  11.720  1.00 0.00 ? 80  PRO A CA   4  
ATOM 5974  C C    . PRO A 1 80  ? 2.266   -1.377  13.095  1.00 0.00 ? 80  PRO A C    4  
ATOM 5975  O O    . PRO A 1 80  ? 3.322   -1.997  13.220  1.00 0.00 ? 80  PRO A O    4  
ATOM 5976  C CB   . PRO A 1 80  ? 2.280   0.013   11.005  1.00 0.00 ? 80  PRO A CB   4  
ATOM 5977  C CG   . PRO A 1 80  ? 1.384   1.165   11.304  1.00 0.00 ? 80  PRO A CG   4  
ATOM 5978  C CD   . PRO A 1 80  ? -0.005  0.597   11.393  1.00 0.00 ? 80  PRO A CD   4  
ATOM 5979  H HA   . PRO A 1 80  ? 1.774   -2.071  11.129  1.00 0.00 ? 80  PRO A HA   4  
ATOM 5980  H HB2  . PRO A 1 80  ? 3.276   0.175   11.394  1.00 0.00 ? 80  PRO A HB2  4  
ATOM 5981  H HB3  . PRO A 1 80  ? 2.329   -0.183  9.944   1.00 0.00 ? 80  PRO A HB3  4  
ATOM 5982  H HG2  . PRO A 1 80  ? 1.666   1.615   12.244  1.00 0.00 ? 80  PRO A HG2  4  
ATOM 5983  H HG3  . PRO A 1 80  ? 1.441   1.891   10.507  1.00 0.00 ? 80  PRO A HG3  4  
ATOM 5984  H HD2  . PRO A 1 80  ? -0.583  1.128   12.135  1.00 0.00 ? 80  PRO A HD2  4  
ATOM 5985  H HD3  . PRO A 1 80  ? -0.492  0.639   10.430  1.00 0.00 ? 80  PRO A HD3  4  
ATOM 5986  N N    . ALA A 1 81  ? 1.611   -0.847  14.123  1.00 0.00 ? 81  ALA A N    4  
ATOM 5987  C CA   . ALA A 1 81  ? 2.106   -0.970  15.488  1.00 0.00 ? 81  ALA A CA   4  
ATOM 5988  C C    . ALA A 1 81  ? 1.694   -2.303  16.104  1.00 0.00 ? 81  ALA A C    4  
ATOM 5989  O O    . ALA A 1 81  ? 2.398   -2.848  16.953  1.00 0.00 ? 81  ALA A O    4  
ATOM 5990  C CB   . ALA A 1 81  ? 1.600   0.186   16.339  1.00 0.00 ? 81  ALA A CB   4  
ATOM 5991  H H    . ALA A 1 81  ? 0.775   -0.364  13.959  1.00 0.00 ? 81  ALA A H    4  
ATOM 5992  H HA   . ALA A 1 81  ? 3.185   -0.917  15.458  1.00 0.00 ? 81  ALA A HA   4  
ATOM 5993  H HB1  . ALA A 1 81  ? 1.390   -0.169  17.337  1.00 0.00 ? 81  ALA A HB1  4  
ATOM 5994  H HB2  . ALA A 1 81  ? 2.353   0.958   16.382  1.00 0.00 ? 81  ALA A HB2  4  
ATOM 5995  H HB3  . ALA A 1 81  ? 0.698   0.586   15.901  1.00 0.00 ? 81  ALA A HB3  4  
ATOM 5996  N N    . GLN A 1 82  ? 0.549   -2.820  15.671  1.00 0.00 ? 82  GLN A N    4  
ATOM 5997  C CA   . GLN A 1 82  ? 0.043   -4.089  16.182  1.00 0.00 ? 82  GLN A CA   4  
ATOM 5998  C C    . GLN A 1 82  ? 0.965   -5.239  15.791  1.00 0.00 ? 82  GLN A C    4  
ATOM 5999  O O    . GLN A 1 82  ? 1.223   -6.141  16.590  1.00 0.00 ? 82  GLN A O    4  
ATOM 6000  C CB   . GLN A 1 82  ? -1.369  -4.349  15.654  1.00 0.00 ? 82  GLN A CB   4  
ATOM 6001  C CG   . GLN A 1 82  ? -2.010  -5.604  16.224  1.00 0.00 ? 82  GLN A CG   4  
ATOM 6002  C CD   . GLN A 1 82  ? -1.714  -6.839  15.396  1.00 0.00 ? 82  GLN A CD   4  
ATOM 6003  O OE1  . GLN A 1 82  ? -0.739  -7.548  15.645  1.00 0.00 ? 82  GLN A OE1  4  
ATOM 6004  N NE2  . GLN A 1 82  ? -2.557  -7.102  14.404  1.00 0.00 ? 82  GLN A NE2  4  
ATOM 6005  H H    . GLN A 1 82  ? 0.032   -2.338  14.993  1.00 0.00 ? 82  GLN A H    4  
ATOM 6006  H HA   . GLN A 1 82  ? 0.008   -4.022  17.259  1.00 0.00 ? 82  GLN A HA   4  
ATOM 6007  H HB2  . GLN A 1 82  ? -1.995  -3.505  15.903  1.00 0.00 ? 82  GLN A HB2  4  
ATOM 6008  H HB3  . GLN A 1 82  ? -1.325  -4.450  14.580  1.00 0.00 ? 82  GLN A HB3  4  
ATOM 6009  H HG2  . GLN A 1 82  ? -1.634  -5.762  17.225  1.00 0.00 ? 82  GLN A HG2  4  
ATOM 6010  H HG3  . GLN A 1 82  ? -3.080  -5.460  16.261  1.00 0.00 ? 82  GLN A HG3  4  
ATOM 6011  H HE21 . GLN A 1 82  ? -3.311  -6.492  14.264  1.00 0.00 ? 82  GLN A HE21 4  
ATOM 6012  H HE22 . GLN A 1 82  ? -2.389  -7.893  13.853  1.00 0.00 ? 82  GLN A HE22 4  
ATOM 6013  N N    . LEU A 1 83  ? 1.459   -5.203  14.558  1.00 0.00 ? 83  LEU A N    4  
ATOM 6014  C CA   . LEU A 1 83  ? 2.352   -6.243  14.061  1.00 0.00 ? 83  LEU A CA   4  
ATOM 6015  C C    . LEU A 1 83  ? 3.795   -5.961  14.466  1.00 0.00 ? 83  LEU A C    4  
ATOM 6016  O O    . LEU A 1 83  ? 4.714   -6.671  14.060  1.00 0.00 ? 83  LEU A O    4  
ATOM 6017  C CB   . LEU A 1 83  ? 2.249   -6.346  12.538  1.00 0.00 ? 83  LEU A CB   4  
ATOM 6018  C CG   . LEU A 1 83  ? 0.846   -6.194  11.949  1.00 0.00 ? 83  LEU A CG   4  
ATOM 6019  C CD1  . LEU A 1 83  ? 0.918   -5.637  10.535  1.00 0.00 ? 83  LEU A CD1  4  
ATOM 6020  C CD2  . LEU A 1 83  ? 0.114   -7.528  11.962  1.00 0.00 ? 83  LEU A CD2  4  
ATOM 6021  H H    . LEU A 1 83  ? 1.217   -4.459  13.968  1.00 0.00 ? 83  LEU A H    4  
ATOM 6022  H HA   . LEU A 1 83  ? 2.045   -7.181  14.499  1.00 0.00 ? 83  LEU A HA   4  
ATOM 6023  H HB2  . LEU A 1 83  ? 2.872   -5.575  12.112  1.00 0.00 ? 83  LEU A HB2  4  
ATOM 6024  H HB3  . LEU A 1 83  ? 2.628   -7.315  12.247  1.00 0.00 ? 83  LEU A HB3  4  
ATOM 6025  H HG   . LEU A 1 83  ? 0.282   -5.496  12.553  1.00 0.00 ? 83  LEU A HG   4  
ATOM 6026  H HD11 . LEU A 1 83  ? 0.481   -6.345  9.847   1.00 0.00 ? 83  LEU A HD11 4  
ATOM 6027  H HD12 . LEU A 1 83  ? 1.951   -5.467  10.268  1.00 0.00 ? 83  LEU A HD12 4  
ATOM 6028  H HD13 . LEU A 1 83  ? 0.376   -4.705  10.488  1.00 0.00 ? 83  LEU A HD13 4  
ATOM 6029  H HD21 . LEU A 1 83  ? -0.493  -7.596  12.852  1.00 0.00 ? 83  LEU A HD21 4  
ATOM 6030  H HD22 . LEU A 1 83  ? 0.835   -8.334  11.955  1.00 0.00 ? 83  LEU A HD22 4  
ATOM 6031  H HD23 . LEU A 1 83  ? -0.516  -7.601  11.089  1.00 0.00 ? 83  LEU A HD23 4  
ATOM 6032  N N    . GLU A 1 84  ? 3.986   -4.920  15.270  1.00 0.00 ? 84  GLU A N    4  
ATOM 6033  C CA   . GLU A 1 84  ? 5.318   -4.545  15.731  1.00 0.00 ? 84  GLU A CA   4  
ATOM 6034  C C    . GLU A 1 84  ? 6.221   -4.191  14.554  1.00 0.00 ? 84  GLU A C    4  
ATOM 6035  O O    . GLU A 1 84  ? 7.383   -4.595  14.505  1.00 0.00 ? 84  GLU A O    4  
ATOM 6036  C CB   . GLU A 1 84  ? 5.941   -5.684  16.541  1.00 0.00 ? 84  GLU A CB   4  
ATOM 6037  C CG   . GLU A 1 84  ? 5.326   -5.857  17.920  1.00 0.00 ? 84  GLU A CG   4  
ATOM 6038  C CD   . GLU A 1 84  ? 6.012   -6.938  18.733  1.00 0.00 ? 84  GLU A CD   4  
ATOM 6039  O OE1  . GLU A 1 84  ? 6.577   -7.869  18.123  1.00 0.00 ? 84  GLU A OE1  4  
ATOM 6040  O OE2  . GLU A 1 84  ? 5.984   -6.852  19.979  1.00 0.00 ? 84  GLU A OE2  4  
ATOM 6041  H H    . GLU A 1 84  ? 3.213   -4.391  15.560  1.00 0.00 ? 84  GLU A H    4  
ATOM 6042  H HA   . GLU A 1 84  ? 5.217   -3.678  16.366  1.00 0.00 ? 84  GLU A HA   4  
ATOM 6043  H HB2  . GLU A 1 84  ? 5.816   -6.608  15.996  1.00 0.00 ? 84  GLU A HB2  4  
ATOM 6044  H HB3  . GLU A 1 84  ? 6.996   -5.488  16.663  1.00 0.00 ? 84  GLU A HB3  4  
ATOM 6045  H HG2  . GLU A 1 84  ? 5.405   -4.922  18.455  1.00 0.00 ? 84  GLU A HG2  4  
ATOM 6046  H HG3  . GLU A 1 84  ? 4.285   -6.119  17.806  1.00 0.00 ? 84  GLU A HG3  4  
ATOM 6047  N N    . MET A 1 85  ? 5.679   -3.433  13.606  1.00 0.00 ? 85  MET A N    4  
ATOM 6048  C CA   . MET A 1 85  ? 6.436   -3.024  12.429  1.00 0.00 ? 85  MET A CA   4  
ATOM 6049  C C    . MET A 1 85  ? 7.491   -1.985  12.795  1.00 0.00 ? 85  MET A C    4  
ATOM 6050  O O    . MET A 1 85  ? 7.168   -0.828  13.064  1.00 0.00 ? 85  MET A O    4  
ATOM 6051  C CB   . MET A 1 85  ? 5.495   -2.458  11.363  1.00 0.00 ? 85  MET A CB   4  
ATOM 6052  C CG   . MET A 1 85  ? 4.424   -3.440  10.916  1.00 0.00 ? 85  MET A CG   4  
ATOM 6053  S SD   . MET A 1 85  ? 3.559   -2.894  9.430   1.00 0.00 ? 85  MET A SD   4  
ATOM 6054  C CE   . MET A 1 85  ? 4.012   -4.190  8.280   1.00 0.00 ? 85  MET A CE   4  
ATOM 6055  H H    . MET A 1 85  ? 4.748   -3.142  13.701  1.00 0.00 ? 85  MET A H    4  
ATOM 6056  H HA   . MET A 1 85  ? 6.930   -3.898  12.033  1.00 0.00 ? 85  MET A HA   4  
ATOM 6057  H HB2  . MET A 1 85  ? 5.006   -1.581  11.760  1.00 0.00 ? 85  MET A HB2  4  
ATOM 6058  H HB3  . MET A 1 85  ? 6.078   -2.176  10.498  1.00 0.00 ? 85  MET A HB3  4  
ATOM 6059  H HG2  . MET A 1 85  ? 4.889   -4.393  10.714  1.00 0.00 ? 85  MET A HG2  4  
ATOM 6060  H HG3  . MET A 1 85  ? 3.705   -3.554  11.713  1.00 0.00 ? 85  MET A HG3  4  
ATOM 6061  H HE1  . MET A 1 85  ? 3.372   -5.046  8.431   1.00 0.00 ? 85  MET A HE1  4  
ATOM 6062  H HE2  . MET A 1 85  ? 3.897   -3.829  7.268   1.00 0.00 ? 85  MET A HE2  4  
ATOM 6063  H HE3  . MET A 1 85  ? 5.041   -4.475  8.446   1.00 0.00 ? 85  MET A HE3  4  
ATOM 6064  N N    . GLU A 1 86  ? 8.752   -2.406  12.804  1.00 0.00 ? 86  GLU A N    4  
ATOM 6065  C CA   . GLU A 1 86  ? 9.853   -1.510  13.139  1.00 0.00 ? 86  GLU A CA   4  
ATOM 6066  C C    . GLU A 1 86  ? 10.307  -0.724  11.912  1.00 0.00 ? 86  GLU A C    4  
ATOM 6067  O O    . GLU A 1 86  ? 9.926   -1.038  10.784  1.00 0.00 ? 86  GLU A O    4  
ATOM 6068  C CB   . GLU A 1 86  ? 11.028  -2.304  13.713  1.00 0.00 ? 86  GLU A CB   4  
ATOM 6069  C CG   . GLU A 1 86  ? 11.586  -3.344  12.755  1.00 0.00 ? 86  GLU A CG   4  
ATOM 6070  C CD   . GLU A 1 86  ? 12.659  -4.206  13.391  1.00 0.00 ? 86  GLU A CD   4  
ATOM 6071  O OE1  . GLU A 1 86  ? 13.696  -3.651  13.810  1.00 0.00 ? 86  GLU A OE1  4  
ATOM 6072  O OE2  . GLU A 1 86  ? 12.462  -5.437  13.469  1.00 0.00 ? 86  GLU A OE2  4  
ATOM 6073  H H    . GLU A 1 86  ? 8.946   -3.340  12.580  1.00 0.00 ? 86  GLU A H    4  
ATOM 6074  H HA   . GLU A 1 86  ? 9.500   -0.816  13.886  1.00 0.00 ? 86  GLU A HA   4  
ATOM 6075  H HB2  . GLU A 1 86  ? 11.822  -1.617  13.967  1.00 0.00 ? 86  GLU A HB2  4  
ATOM 6076  H HB3  . GLU A 1 86  ? 10.702  -2.810  14.609  1.00 0.00 ? 86  GLU A HB3  4  
ATOM 6077  H HG2  . GLU A 1 86  ? 10.779  -3.984  12.429  1.00 0.00 ? 86  GLU A HG2  4  
ATOM 6078  H HG3  . GLU A 1 86  ? 12.010  -2.838  11.901  1.00 0.00 ? 86  GLU A HG3  4  
ATOM 6079  N N    . ASP A 1 87  ? 11.122  0.300   12.142  1.00 0.00 ? 87  ASP A N    4  
ATOM 6080  C CA   . ASP A 1 87  ? 11.629  1.132   11.057  1.00 0.00 ? 87  ASP A CA   4  
ATOM 6081  C C    . ASP A 1 87  ? 12.461  0.305   10.081  1.00 0.00 ? 87  ASP A C    4  
ATOM 6082  O O    . ASP A 1 87  ? 13.137  -0.644  10.477  1.00 0.00 ? 87  ASP A O    4  
ATOM 6083  C CB   . ASP A 1 87  ? 12.468  2.281   11.616  1.00 0.00 ? 87  ASP A CB   4  
ATOM 6084  C CG   . ASP A 1 87  ? 12.519  3.471   10.678  1.00 0.00 ? 87  ASP A CG   4  
ATOM 6085  O OD1  . ASP A 1 87  ? 12.963  3.298   9.524   1.00 0.00 ? 87  ASP A OD1  4  
ATOM 6086  O OD2  . ASP A 1 87  ? 12.115  4.576   11.099  1.00 0.00 ? 87  ASP A OD2  4  
ATOM 6087  H H    . ASP A 1 87  ? 11.390  0.500   13.063  1.00 0.00 ? 87  ASP A H    4  
ATOM 6088  H HA   . ASP A 1 87  ? 10.781  1.541   10.529  1.00 0.00 ? 87  ASP A HA   4  
ATOM 6089  H HB2  . ASP A 1 87  ? 12.043  2.605   12.555  1.00 0.00 ? 87  ASP A HB2  4  
ATOM 6090  H HB3  . ASP A 1 87  ? 13.477  1.934   11.783  1.00 0.00 ? 87  ASP A HB3  4  
ATOM 6091  N N    . GLU A 1 88  ? 12.406  0.673   8.805   1.00 0.00 ? 88  GLU A N    4  
ATOM 6092  C CA   . GLU A 1 88  ? 13.153  -0.037  7.773   1.00 0.00 ? 88  GLU A CA   4  
ATOM 6093  C C    . GLU A 1 88  ? 12.606  -1.448  7.577   1.00 0.00 ? 88  GLU A C    4  
ATOM 6094  O O    . GLU A 1 88  ? 13.360  -2.389  7.332   1.00 0.00 ? 88  GLU A O    4  
ATOM 6095  C CB   . GLU A 1 88  ? 14.637  -0.101  8.141   1.00 0.00 ? 88  GLU A CB   4  
ATOM 6096  C CG   . GLU A 1 88  ? 15.230  1.247   8.519   1.00 0.00 ? 88  GLU A CG   4  
ATOM 6097  C CD   . GLU A 1 88  ? 16.608  1.125   9.138   1.00 0.00 ? 88  GLU A CD   4  
ATOM 6098  O OE1  . GLU A 1 88  ? 16.701  0.650   10.289  1.00 0.00 ? 88  GLU A OE1  4  
ATOM 6099  O OE2  . GLU A 1 88  ? 17.594  1.504   8.471   1.00 0.00 ? 88  GLU A OE2  4  
ATOM 6100  H H    . GLU A 1 88  ? 11.849  1.438   8.551   1.00 0.00 ? 88  GLU A H    4  
ATOM 6101  H HA   . GLU A 1 88  ? 13.044  0.510   6.849   1.00 0.00 ? 88  GLU A HA   4  
ATOM 6102  H HB2  . GLU A 1 88  ? 14.760  -0.773  8.978   1.00 0.00 ? 88  GLU A HB2  4  
ATOM 6103  H HB3  . GLU A 1 88  ? 15.188  -0.488  7.296   1.00 0.00 ? 88  GLU A HB3  4  
ATOM 6104  H HG2  . GLU A 1 88  ? 15.303  1.855   7.630   1.00 0.00 ? 88  GLU A HG2  4  
ATOM 6105  H HG3  . GLU A 1 88  ? 14.573  1.727   9.229   1.00 0.00 ? 88  GLU A HG3  4  
ATOM 6106  N N    . ASP A 1 89  ? 11.289  -1.585  7.688   1.00 0.00 ? 89  ASP A N    4  
ATOM 6107  C CA   . ASP A 1 89  ? 10.639  -2.880  7.523   1.00 0.00 ? 89  ASP A CA   4  
ATOM 6108  C C    . ASP A 1 89  ? 10.450  -3.208  6.045   1.00 0.00 ? 89  ASP A C    4  
ATOM 6109  O O    . ASP A 1 89  ? 10.890  -2.461  5.170   1.00 0.00 ? 89  ASP A O    4  
ATOM 6110  C CB   . ASP A 1 89  ? 9.286   -2.890  8.237   1.00 0.00 ? 89  ASP A CB   4  
ATOM 6111  C CG   . ASP A 1 89  ? 9.405   -3.285  9.696   1.00 0.00 ? 89  ASP A CG   4  
ATOM 6112  O OD1  . ASP A 1 89  ? 10.543  -3.330  10.208  1.00 0.00 ? 89  ASP A OD1  4  
ATOM 6113  O OD2  . ASP A 1 89  ? 8.360   -3.548  10.326  1.00 0.00 ? 89  ASP A OD2  4  
ATOM 6114  H H    . ASP A 1 89  ? 10.741  -0.796  7.885   1.00 0.00 ? 89  ASP A H    4  
ATOM 6115  H HA   . ASP A 1 89  ? 11.276  -3.630  7.967   1.00 0.00 ? 89  ASP A HA   4  
ATOM 6116  H HB2  . ASP A 1 89  ? 8.851   -1.903  8.185   1.00 0.00 ? 89  ASP A HB2  4  
ATOM 6117  H HB3  . ASP A 1 89  ? 8.632   -3.594  7.744   1.00 0.00 ? 89  ASP A HB3  4  
ATOM 6118  N N    . THR A 1 90  ? 9.794   -4.332  5.773   1.00 0.00 ? 90  THR A N    4  
ATOM 6119  C CA   . THR A 1 90  ? 9.549   -4.761  4.402   1.00 0.00 ? 90  THR A CA   4  
ATOM 6120  C C    . THR A 1 90  ? 8.155   -5.361  4.254   1.00 0.00 ? 90  THR A C    4  
ATOM 6121  O O    . THR A 1 90  ? 7.782   -6.275  4.989   1.00 0.00 ? 90  THR A O    4  
ATOM 6122  C CB   . THR A 1 90  ? 10.592  -5.797  3.942   1.00 0.00 ? 90  THR A CB   4  
ATOM 6123  O OG1  . THR A 1 90  ? 11.905  -5.227  3.995   1.00 0.00 ? 90  THR A OG1  4  
ATOM 6124  C CG2  . THR A 1 90  ? 10.297  -6.272  2.528   1.00 0.00 ? 90  THR A CG2  4  
ATOM 6125  H H    . THR A 1 90  ? 9.468   -4.885  6.513   1.00 0.00 ? 90  THR A H    4  
ATOM 6126  H HA   . THR A 1 90  ? 9.628   -3.894  3.762   1.00 0.00 ? 90  THR A HA   4  
ATOM 6127  H HB   . THR A 1 90  ? 10.550  -6.648  4.608   1.00 0.00 ? 90  THR A HB   4  
ATOM 6128  H HG1  . THR A 1 90  ? 11.961  -4.494  3.378   1.00 0.00 ? 90  THR A HG1  4  
ATOM 6129  H HG21 . THR A 1 90  ? 11.078  -5.933  1.863   1.00 0.00 ? 90  THR A HG21 4  
ATOM 6130  H HG22 . THR A 1 90  ? 9.349   -5.870  2.204   1.00 0.00 ? 90  THR A HG22 4  
ATOM 6131  H HG23 . THR A 1 90  ? 10.255  -7.351  2.512   1.00 0.00 ? 90  THR A HG23 4  
ATOM 6132  N N    . ILE A 1 91  ? 7.391   -4.840  3.300   1.00 0.00 ? 91  ILE A N    4  
ATOM 6133  C CA   . ILE A 1 91  ? 6.039   -5.326  3.055   1.00 0.00 ? 91  ILE A CA   4  
ATOM 6134  C C    . ILE A 1 91  ? 6.004   -6.278  1.864   1.00 0.00 ? 91  ILE A C    4  
ATOM 6135  O O    . ILE A 1 91  ? 6.747   -6.107  0.898   1.00 0.00 ? 91  ILE A O    4  
ATOM 6136  C CB   . ILE A 1 91  ? 5.061   -4.165  2.798   1.00 0.00 ? 91  ILE A CB   4  
ATOM 6137  C CG1  . ILE A 1 91  ? 5.302   -3.035  3.802   1.00 0.00 ? 91  ILE A CG1  4  
ATOM 6138  C CG2  . ILE A 1 91  ? 3.623   -4.655  2.880   1.00 0.00 ? 91  ILE A CG2  4  
ATOM 6139  C CD1  . ILE A 1 91  ? 4.265   -1.936  3.735   1.00 0.00 ? 91  ILE A CD1  4  
ATOM 6140  H H    . ILE A 1 91  ? 7.745   -4.113  2.747   1.00 0.00 ? 91  ILE A H    4  
ATOM 6141  H HA   . ILE A 1 91  ? 5.711   -5.858  3.937   1.00 0.00 ? 91  ILE A HA   4  
ATOM 6142  H HB   . ILE A 1 91  ? 5.233   -3.793  1.800   1.00 0.00 ? 91  ILE A HB   4  
ATOM 6143  H HG12 . ILE A 1 91  ? 5.291   -3.441  4.801   1.00 0.00 ? 91  ILE A HG12 4  
ATOM 6144  H HG13 . ILE A 1 91  ? 6.269   -2.592  3.608   1.00 0.00 ? 91  ILE A HG13 4  
ATOM 6145  H HG21 . ILE A 1 91  ? 3.615   -5.728  3.004   1.00 0.00 ? 91  ILE A HG21 4  
ATOM 6146  H HG22 . ILE A 1 91  ? 3.133   -4.193  3.724   1.00 0.00 ? 91  ILE A HG22 4  
ATOM 6147  H HG23 . ILE A 1 91  ? 3.101   -4.393  1.972   1.00 0.00 ? 91  ILE A HG23 4  
ATOM 6148  H HD11 . ILE A 1 91  ? 3.415   -2.277  3.163   1.00 0.00 ? 91  ILE A HD11 4  
ATOM 6149  H HD12 . ILE A 1 91  ? 3.948   -1.678  4.734   1.00 0.00 ? 91  ILE A HD12 4  
ATOM 6150  H HD13 . ILE A 1 91  ? 4.693   -1.066  3.257   1.00 0.00 ? 91  ILE A HD13 4  
ATOM 6151  N N    . ASP A 1 92  ? 5.134   -7.279  1.939   1.00 0.00 ? 92  ASP A N    4  
ATOM 6152  C CA   . ASP A 1 92  ? 4.999   -8.257  0.866   1.00 0.00 ? 92  ASP A CA   4  
ATOM 6153  C C    . ASP A 1 92  ? 3.718   -8.021  0.073   1.00 0.00 ? 92  ASP A C    4  
ATOM 6154  O O    . ASP A 1 92  ? 2.619   -8.043  0.627   1.00 0.00 ? 92  ASP A O    4  
ATOM 6155  C CB   . ASP A 1 92  ? 5.006   -9.677  1.437   1.00 0.00 ? 92  ASP A CB   4  
ATOM 6156  C CG   . ASP A 1 92  ? 6.394   -10.133 1.838   1.00 0.00 ? 92  ASP A CG   4  
ATOM 6157  O OD1  . ASP A 1 92  ? 7.354   -9.833  1.098   1.00 0.00 ? 92  ASP A OD1  4  
ATOM 6158  O OD2  . ASP A 1 92  ? 6.522   -10.791 2.892   1.00 0.00 ? 92  ASP A OD2  4  
ATOM 6159  H H    . ASP A 1 92  ? 4.568   -7.362  2.736   1.00 0.00 ? 92  ASP A H    4  
ATOM 6160  H HA   . ASP A 1 92  ? 5.844   -8.142  0.204   1.00 0.00 ? 92  ASP A HA   4  
ATOM 6161  H HB2  . ASP A 1 92  ? 4.370   -9.709  2.310   1.00 0.00 ? 92  ASP A HB2  4  
ATOM 6162  H HB3  . ASP A 1 92  ? 4.623   -10.359 0.692   1.00 0.00 ? 92  ASP A HB3  4  
ATOM 6163  N N    . VAL A 1 93  ? 3.867   -7.792  -1.228  1.00 0.00 ? 93  VAL A N    4  
ATOM 6164  C CA   . VAL A 1 93  ? 2.722   -7.551  -2.098  1.00 0.00 ? 93  VAL A CA   4  
ATOM 6165  C C    . VAL A 1 93  ? 2.915   -8.213  -3.457  1.00 0.00 ? 93  VAL A C    4  
ATOM 6166  O O    . VAL A 1 93  ? 4.043   -8.389  -3.919  1.00 0.00 ? 93  VAL A O    4  
ATOM 6167  C CB   . VAL A 1 93  ? 2.480   -6.044  -2.303  1.00 0.00 ? 93  VAL A CB   4  
ATOM 6168  C CG1  . VAL A 1 93  ? 1.329   -5.814  -3.270  1.00 0.00 ? 93  VAL A CG1  4  
ATOM 6169  C CG2  . VAL A 1 93  ? 2.212   -5.361  -0.970  1.00 0.00 ? 93  VAL A CG2  4  
ATOM 6170  H H    . VAL A 1 93  ? 4.768   -7.787  -1.612  1.00 0.00 ? 93  VAL A H    4  
ATOM 6171  H HA   . VAL A 1 93  ? 1.847   -7.973  -1.624  1.00 0.00 ? 93  VAL A HA   4  
ATOM 6172  H HB   . VAL A 1 93  ? 3.373   -5.612  -2.731  1.00 0.00 ? 93  VAL A HB   4  
ATOM 6173  H HG11 . VAL A 1 93  ? 0.496   -6.444  -2.994  1.00 0.00 ? 93  VAL A HG11 4  
ATOM 6174  H HG12 . VAL A 1 93  ? 1.027   -4.777  -3.231  1.00 0.00 ? 93  VAL A HG12 4  
ATOM 6175  H HG13 . VAL A 1 93  ? 1.647   -6.059  -4.273  1.00 0.00 ? 93  VAL A HG13 4  
ATOM 6176  H HG21 . VAL A 1 93  ? 3.067   -5.489  -0.323  1.00 0.00 ? 93  VAL A HG21 4  
ATOM 6177  H HG22 . VAL A 1 93  ? 2.039   -4.307  -1.133  1.00 0.00 ? 93  VAL A HG22 4  
ATOM 6178  H HG23 . VAL A 1 93  ? 1.341   -5.802  -0.508  1.00 0.00 ? 93  VAL A HG23 4  
ATOM 6179  N N    . PHE A 1 94  ? 1.808   -8.578  -4.095  1.00 0.00 ? 94  PHE A N    4  
ATOM 6180  C CA   . PHE A 1 94  ? 1.855   -9.222  -5.402  1.00 0.00 ? 94  PHE A CA   4  
ATOM 6181  C C    . PHE A 1 94  ? 1.279   -8.308  -6.480  1.00 0.00 ? 94  PHE A C    4  
ATOM 6182  O O    . PHE A 1 94  ? 0.080   -8.030  -6.495  1.00 0.00 ? 94  PHE A O    4  
ATOM 6183  C CB   . PHE A 1 94  ? 1.084   -10.543 -5.372  1.00 0.00 ? 94  PHE A CB   4  
ATOM 6184  C CG   . PHE A 1 94  ? 1.545   -11.482 -4.294  1.00 0.00 ? 94  PHE A CG   4  
ATOM 6185  C CD1  . PHE A 1 94  ? 1.145   -11.299 -2.980  1.00 0.00 ? 94  PHE A CD1  4  
ATOM 6186  C CD2  . PHE A 1 94  ? 2.377   -12.548 -4.595  1.00 0.00 ? 94  PHE A CD2  4  
ATOM 6187  C CE1  . PHE A 1 94  ? 1.569   -12.161 -1.986  1.00 0.00 ? 94  PHE A CE1  4  
ATOM 6188  C CE2  . PHE A 1 94  ? 2.804   -13.413 -3.605  1.00 0.00 ? 94  PHE A CE2  4  
ATOM 6189  C CZ   . PHE A 1 94  ? 2.398   -13.220 -2.299  1.00 0.00 ? 94  PHE A CZ   4  
ATOM 6190  H H    . PHE A 1 94  ? 0.938   -8.411  -3.675  1.00 0.00 ? 94  PHE A H    4  
ATOM 6191  H HA   . PHE A 1 94  ? 2.889   -9.424  -5.634  1.00 0.00 ? 94  PHE A HA   4  
ATOM 6192  H HB2  . PHE A 1 94  ? 0.037   -10.337 -5.206  1.00 0.00 ? 94  PHE A HB2  4  
ATOM 6193  H HB3  . PHE A 1 94  ? 1.202   -11.042 -6.322  1.00 0.00 ? 94  PHE A HB3  4  
ATOM 6194  H HD1  . PHE A 1 94  ? 0.496   -10.471 -2.734  1.00 0.00 ? 94  PHE A HD1  4  
ATOM 6195  H HD2  . PHE A 1 94  ? 2.695   -12.700 -5.617  1.00 0.00 ? 94  PHE A HD2  4  
ATOM 6196  H HE1  . PHE A 1 94  ? 1.250   -12.007 -0.966  1.00 0.00 ? 94  PHE A HE1  4  
ATOM 6197  H HE2  . PHE A 1 94  ? 3.452   -14.241 -3.854  1.00 0.00 ? 94  PHE A HE2  4  
ATOM 6198  H HZ   . PHE A 1 94  ? 2.731   -13.894 -1.524  1.00 0.00 ? 94  PHE A HZ   4  
ATOM 6199  N N    . GLN A 1 95  ? 2.142   -7.844  -7.378  1.00 0.00 ? 95  GLN A N    4  
ATOM 6200  C CA   . GLN A 1 95  ? 1.719   -6.961  -8.458  1.00 0.00 ? 95  GLN A CA   4  
ATOM 6201  C C    . GLN A 1 95  ? 1.331   -7.762  -9.696  1.00 0.00 ? 95  GLN A C    4  
ATOM 6202  O O    . GLN A 1 95  ? 2.187   -8.343  -10.363 1.00 0.00 ? 95  GLN A O    4  
ATOM 6203  C CB   . GLN A 1 95  ? 2.834   -5.973  -8.803  1.00 0.00 ? 95  GLN A CB   4  
ATOM 6204  C CG   . GLN A 1 95  ? 2.780   -4.687  -7.994  1.00 0.00 ? 95  GLN A CG   4  
ATOM 6205  C CD   . GLN A 1 95  ? 3.480   -3.533  -8.684  1.00 0.00 ? 95  GLN A CD   4  
ATOM 6206  O OE1  . GLN A 1 95  ? 3.532   -3.469  -9.913  1.00 0.00 ? 95  GLN A OE1  4  
ATOM 6207  N NE2  . GLN A 1 95  ? 4.022   -2.612  -7.896  1.00 0.00 ? 95  GLN A NE2  4  
ATOM 6208  H H    . GLN A 1 95  ? 3.084   -8.102  -7.312  1.00 0.00 ? 95  GLN A H    4  
ATOM 6209  H HA   . GLN A 1 95  ? 0.855   -6.410  -8.116  1.00 0.00 ? 95  GLN A HA   4  
ATOM 6210  H HB2  . GLN A 1 95  ? 3.787   -6.446  -8.623  1.00 0.00 ? 95  GLN A HB2  4  
ATOM 6211  H HB3  . GLN A 1 95  ? 2.760   -5.717  -9.850  1.00 0.00 ? 95  GLN A HB3  4  
ATOM 6212  H HG2  . GLN A 1 95  ? 1.745   -4.418  -7.838  1.00 0.00 ? 95  GLN A HG2  4  
ATOM 6213  H HG3  . GLN A 1 95  ? 3.254   -4.857  -7.039  1.00 0.00 ? 95  GLN A HG3  4  
ATOM 6214  H HE21 . GLN A 1 95  ? 3.942   -2.729  -6.925  1.00 0.00 ? 95  GLN A HE21 4  
ATOM 6215  H HE22 . GLN A 1 95  ? 4.481   -1.856  -8.315  1.00 0.00 ? 95  GLN A HE22 4  
ATOM 6216  N N    . GLN A 1 96  ? 0.037   -7.787  -9.998  1.00 0.00 ? 96  GLN A N    4  
ATOM 6217  C CA   . GLN A 1 96  ? -0.463  -8.519  -11.156 1.00 0.00 ? 96  GLN A CA   4  
ATOM 6218  C C    . GLN A 1 96  ? -0.287  -7.702  -12.432 1.00 0.00 ? 96  GLN A C    4  
ATOM 6219  O O    . GLN A 1 96  ? -0.891  -6.641  -12.589 1.00 0.00 ? 96  GLN A O    4  
ATOM 6220  C CB   . GLN A 1 96  ? -1.938  -8.875  -10.963 1.00 0.00 ? 96  GLN A CB   4  
ATOM 6221  C CG   . GLN A 1 96  ? -2.174  -9.929  -9.894  1.00 0.00 ? 96  GLN A CG   4  
ATOM 6222  C CD   . GLN A 1 96  ? -1.897  -11.335 -10.390 1.00 0.00 ? 96  GLN A CD   4  
ATOM 6223  O OE1  . GLN A 1 96  ? -2.651  -11.881 -11.195 1.00 0.00 ? 96  GLN A OE1  4  
ATOM 6224  N NE2  . GLN A 1 96  ? -0.811  -11.929 -9.909  1.00 0.00 ? 96  GLN A NE2  4  
ATOM 6225  H H    . GLN A 1 96  ? -0.596  -7.304  -9.428  1.00 0.00 ? 96  GLN A H    4  
ATOM 6226  H HA   . GLN A 1 96  ? 0.109   -9.429  -11.245 1.00 0.00 ? 96  GLN A HA   4  
ATOM 6227  H HB2  . GLN A 1 96  ? -2.478  -7.983  -10.684 1.00 0.00 ? 96  GLN A HB2  4  
ATOM 6228  H HB3  . GLN A 1 96  ? -2.331  -9.247  -11.898 1.00 0.00 ? 96  GLN A HB3  4  
ATOM 6229  H HG2  . GLN A 1 96  ? -1.524  -9.726  -9.056  1.00 0.00 ? 96  GLN A HG2  4  
ATOM 6230  H HG3  . GLN A 1 96  ? -3.203  -9.873  -9.572  1.00 0.00 ? 96  GLN A HG3  4  
ATOM 6231  H HE21 . GLN A 1 96  ? -0.258  -11.434 -9.269  1.00 0.00 ? 96  GLN A HE21 4  
ATOM 6232  H HE22 . GLN A 1 96  ? -0.609  -12.838 -10.212 1.00 0.00 ? 96  GLN A HE22 4  
ATOM 6233  N N    . GLN A 1 97  ? 0.542   -8.204  -13.341 1.00 0.00 ? 97  GLN A N    4  
ATOM 6234  C CA   . GLN A 1 97  ? 0.797   -7.520  -14.603 1.00 0.00 ? 97  GLN A CA   4  
ATOM 6235  C C    . GLN A 1 97  ? -0.479  -7.409  -15.430 1.00 0.00 ? 97  GLN A C    4  
ATOM 6236  O O    . GLN A 1 97  ? -0.938  -8.388  -16.019 1.00 0.00 ? 97  GLN A O    4  
ATOM 6237  C CB   . GLN A 1 97  ? 1.872   -8.260  -15.401 1.00 0.00 ? 97  GLN A CB   4  
ATOM 6238  C CG   . GLN A 1 97  ? 2.172   -7.628  -16.750 1.00 0.00 ? 97  GLN A CG   4  
ATOM 6239  C CD   . GLN A 1 97  ? 3.218   -8.395  -17.535 1.00 0.00 ? 97  GLN A CD   4  
ATOM 6240  O OE1  . GLN A 1 97  ? 2.911   -9.034  -18.541 1.00 0.00 ? 97  GLN A OE1  4  
ATOM 6241  N NE2  . GLN A 1 97  ? 4.463   -8.336  -17.077 1.00 0.00 ? 97  GLN A NE2  4  
ATOM 6242  H H    . GLN A 1 97  ? 0.994   -9.054  -13.158 1.00 0.00 ? 97  GLN A H    4  
ATOM 6243  H HA   . GLN A 1 97  ? 1.152   -6.526  -14.375 1.00 0.00 ? 97  GLN A HA   4  
ATOM 6244  H HB2  . GLN A 1 97  ? 2.785   -8.277  -14.824 1.00 0.00 ? 97  GLN A HB2  4  
ATOM 6245  H HB3  . GLN A 1 97  ? 1.544   -9.276  -15.569 1.00 0.00 ? 97  GLN A HB3  4  
ATOM 6246  H HG2  . GLN A 1 97  ? 1.262   -7.597  -17.329 1.00 0.00 ? 97  GLN A HG2  4  
ATOM 6247  H HG3  . GLN A 1 97  ? 2.530   -6.622  -16.590 1.00 0.00 ? 97  GLN A HG3  4  
ATOM 6248  H HE21 . GLN A 1 97  ? 4.634   -7.809  -16.268 1.00 0.00 ? 97  GLN A HE21 4  
ATOM 6249  H HE22 . GLN A 1 97  ? 5.159   -8.823  -17.564 1.00 0.00 ? 97  GLN A HE22 4  
ATOM 6250  N N    . THR A 1 98  ? -1.051  -6.209  -15.469 1.00 0.00 ? 98  THR A N    4  
ATOM 6251  C CA   . THR A 1 98  ? -2.275  -5.970  -16.221 1.00 0.00 ? 98  THR A CA   4  
ATOM 6252  C C    . THR A 1 98  ? -2.005  -5.957  -17.722 1.00 0.00 ? 98  THR A C    4  
ATOM 6253  O O    . THR A 1 98  ? -1.655  -4.923  -18.290 1.00 0.00 ? 98  THR A O    4  
ATOM 6254  C CB   . THR A 1 98  ? -2.931  -4.635  -15.818 1.00 0.00 ? 98  THR A CB   4  
ATOM 6255  O OG1  . THR A 1 98  ? -1.969  -3.577  -15.886 1.00 0.00 ? 98  THR A OG1  4  
ATOM 6256  C CG2  . THR A 1 98  ? -3.504  -4.717  -14.411 1.00 0.00 ? 98  THR A CG2  4  
ATOM 6257  H H    . THR A 1 98  ? -0.637  -5.468  -14.978 1.00 0.00 ? 98  THR A H    4  
ATOM 6258  H HA   . THR A 1 98  ? -2.967  -6.769  -15.997 1.00 0.00 ? 98  THR A HA   4  
ATOM 6259  H HB   . THR A 1 98  ? -3.737  -4.425  -16.507 1.00 0.00 ? 98  THR A HB   4  
ATOM 6260  H HG1  . THR A 1 98  ? -2.336  -2.843  -16.386 1.00 0.00 ? 98  THR A HG1  4  
ATOM 6261  H HG21 . THR A 1 98  ? -4.517  -5.089  -14.456 1.00 0.00 ? 98  THR A HG21 4  
ATOM 6262  H HG22 . THR A 1 98  ? -3.500  -3.735  -13.963 1.00 0.00 ? 98  THR A HG22 4  
ATOM 6263  H HG23 . THR A 1 98  ? -2.901  -5.387  -13.816 1.00 0.00 ? 98  THR A HG23 4  
ATOM 6264  N N    . SER A 1 99  ? -2.170  -7.112  -18.358 1.00 0.00 ? 99  SER A N    4  
ATOM 6265  C CA   . SER A 1 99  ? -1.941  -7.234  -19.793 1.00 0.00 ? 99  SER A CA   4  
ATOM 6266  C C    . SER A 1 99  ? -3.241  -7.551  -20.526 1.00 0.00 ? 99  SER A C    4  
ATOM 6267  O O    . SER A 1 99  ? -3.599  -8.715  -20.703 1.00 0.00 ? 99  SER A O    4  
ATOM 6268  C CB   . SER A 1 99  ? -0.905  -8.324  -20.074 1.00 0.00 ? 99  SER A CB   4  
ATOM 6269  O OG   . SER A 1 99  ? -0.479  -8.286  -21.425 1.00 0.00 ? 99  SER A OG   4  
ATOM 6270  H H    . SER A 1 99  ? -2.451  -7.902  -17.849 1.00 0.00 ? 99  SER A H    4  
ATOM 6271  H HA   . SER A 1 99  ? -1.562  -6.288  -20.149 1.00 0.00 ? 99  SER A HA   4  
ATOM 6272  H HB2  . SER A 1 99  ? -0.047  -8.175  -19.435 1.00 0.00 ? 99  SER A HB2  4  
ATOM 6273  H HB3  . SER A 1 99  ? -1.341  -9.292  -19.873 1.00 0.00 ? 99  SER A HB3  4  
ATOM 6274  H HG   . SER A 1 99  ? -0.566  -7.392  -21.764 1.00 0.00 ? 99  SER A HG   4  
ATOM 6275  N N    . GLY A 1 100 ? -3.944  -6.506  -20.950 1.00 0.00 ? 100 GLY A N    4  
ATOM 6276  C CA   . GLY A 1 100 ? -5.197  -6.693  -21.659 1.00 0.00 ? 100 GLY A CA   4  
ATOM 6277  C C    . GLY A 1 100 ? -6.085  -5.466  -21.600 1.00 0.00 ? 100 GLY A C    4  
ATOM 6278  O O    . GLY A 1 100 ? -5.863  -4.550  -20.807 1.00 0.00 ? 100 GLY A O    4  
ATOM 6279  H H    . GLY A 1 100 ? -3.610  -5.600  -20.781 1.00 0.00 ? 100 GLY A H    4  
ATOM 6280  H HA2  . GLY A 1 100 ? -4.983  -6.920  -22.692 1.00 0.00 ? 100 GLY A HA2  4  
ATOM 6281  H HA3  . GLY A 1 100 ? -5.725  -7.527  -21.219 1.00 0.00 ? 100 GLY A HA3  4  
ATOM 6282  N N    . PRO A 1 101 ? -7.117  -5.436  -22.456 1.00 0.00 ? 101 PRO A N    4  
ATOM 6283  C CA   . PRO A 1 101 ? -8.062  -4.317  -22.518 1.00 0.00 ? 101 PRO A CA   4  
ATOM 6284  C C    . PRO A 1 101 ? -8.956  -4.244  -21.285 1.00 0.00 ? 101 PRO A C    4  
ATOM 6285  O O    . PRO A 1 101 ? -8.862  -5.081  -20.388 1.00 0.00 ? 101 PRO A O    4  
ATOM 6286  C CB   . PRO A 1 101 ? -8.895  -4.625  -23.765 1.00 0.00 ? 101 PRO A CB   4  
ATOM 6287  C CG   . PRO A 1 101 ? -8.807  -6.103  -23.923 1.00 0.00 ? 101 PRO A CG   4  
ATOM 6288  C CD   . PRO A 1 101 ? -7.442  -6.493  -23.429 1.00 0.00 ? 101 PRO A CD   4  
ATOM 6289  H HA   . PRO A 1 101 ? -7.552  -3.374  -22.647 1.00 0.00 ? 101 PRO A HA   4  
ATOM 6290  H HB2  . PRO A 1 101 ? -9.915  -4.303  -23.608 1.00 0.00 ? 101 PRO A HB2  4  
ATOM 6291  H HB3  . PRO A 1 101 ? -8.477  -4.111  -24.617 1.00 0.00 ? 101 PRO A HB3  4  
ATOM 6292  H HG2  . PRO A 1 101 ? -9.571  -6.582  -23.331 1.00 0.00 ? 101 PRO A HG2  4  
ATOM 6293  H HG3  . PRO A 1 101 ? -8.917  -6.368  -24.965 1.00 0.00 ? 101 PRO A HG3  4  
ATOM 6294  H HD2  . PRO A 1 101 ? -7.475  -7.460  -22.950 1.00 0.00 ? 101 PRO A HD2  4  
ATOM 6295  H HD3  . PRO A 1 101 ? -6.732  -6.497  -24.243 1.00 0.00 ? 101 PRO A HD3  4  
ATOM 6296  N N    . SER A 1 102 ? -9.824  -3.238  -21.247 1.00 0.00 ? 102 SER A N    4  
ATOM 6297  C CA   . SER A 1 102 ? -10.733 -3.054  -20.122 1.00 0.00 ? 102 SER A CA   4  
ATOM 6298  C C    . SER A 1 102 ? -9.964  -2.687  -18.857 1.00 0.00 ? 102 SER A C    4  
ATOM 6299  O O    . SER A 1 102 ? -10.255 -3.191  -17.772 1.00 0.00 ? 102 SER A O    4  
ATOM 6300  C CB   . SER A 1 102 ? -11.549 -4.326  -19.886 1.00 0.00 ? 102 SER A CB   4  
ATOM 6301  O OG   . SER A 1 102 ? -12.568 -4.107  -18.925 1.00 0.00 ? 102 SER A OG   4  
ATOM 6302  H H    . SER A 1 102 ? -9.851  -2.602  -21.993 1.00 0.00 ? 102 SER A H    4  
ATOM 6303  H HA   . SER A 1 102 ? -11.405 -2.245  -20.368 1.00 0.00 ? 102 SER A HA   4  
ATOM 6304  H HB2  . SER A 1 102 ? -12.006 -4.635  -20.813 1.00 0.00 ? 102 SER A HB2  4  
ATOM 6305  H HB3  . SER A 1 102 ? -10.896 -5.108  -19.528 1.00 0.00 ? 102 SER A HB3  4  
ATOM 6306  H HG   . SER A 1 102 ? -12.297 -3.409  -18.324 1.00 0.00 ? 102 SER A HG   4  
ATOM 6307  N N    . SER A 1 103 ? -8.980  -1.806  -19.004 1.00 0.00 ? 103 SER A N    4  
ATOM 6308  C CA   . SER A 1 103 ? -8.165  -1.373  -17.875 1.00 0.00 ? 103 SER A CA   4  
ATOM 6309  C C    . SER A 1 103 ? -8.573  0.023   -17.414 1.00 0.00 ? 103 SER A C    4  
ATOM 6310  O O    . SER A 1 103 ? -7.964  1.019   -17.802 1.00 0.00 ? 103 SER A O    4  
ATOM 6311  C CB   . SER A 1 103 ? -6.683  -1.385  -18.254 1.00 0.00 ? 103 SER A CB   4  
ATOM 6312  O OG   . SER A 1 103 ? -6.116  -2.669  -18.056 1.00 0.00 ? 103 SER A OG   4  
ATOM 6313  H H    . SER A 1 103 ? -8.796  -1.439  -19.895 1.00 0.00 ? 103 SER A H    4  
ATOM 6314  H HA   . SER A 1 103 ? -8.326  -2.068  -17.064 1.00 0.00 ? 103 SER A HA   4  
ATOM 6315  H HB2  . SER A 1 103 ? -6.578  -1.115  -19.293 1.00 0.00 ? 103 SER A HB2  4  
ATOM 6316  H HB3  . SER A 1 103 ? -6.152  -0.671  -17.641 1.00 0.00 ? 103 SER A HB3  4  
ATOM 6317  H HG   . SER A 1 103 ? -5.159  -2.598  -18.044 1.00 0.00 ? 103 SER A HG   4  
ATOM 6318  N N    . GLY A 1 104 ? -9.608  0.086   -16.582 1.00 0.00 ? 104 GLY A N    4  
ATOM 6319  C CA   . GLY A 1 104 ? -10.081 1.363   -16.081 1.00 0.00 ? 104 GLY A CA   4  
ATOM 6320  C C    . GLY A 1 104 ? -10.898 1.222   -14.813 1.00 0.00 ? 104 GLY A C    4  
ATOM 6321  O O    . GLY A 1 104 ? -11.754 2.058   -14.522 1.00 0.00 ? 104 GLY A O    4  
ATOM 6322  H H    . GLY A 1 104 ? -10.055 -0.742  -16.307 1.00 0.00 ? 104 GLY A H    4  
ATOM 6323  H HA2  . GLY A 1 104 ? -9.229  1.996   -15.880 1.00 0.00 ? 104 GLY A HA2  4  
ATOM 6324  H HA3  . GLY A 1 104 ? -10.692 1.830   -16.840 1.00 0.00 ? 104 GLY A HA3  4  
ATOM 6325  N N    . GLY A 1 1   ? -20.649 -3.024  -30.519 1.00 0.00 ? 1   GLY A N    5  
ATOM 6326  C CA   . GLY A 1 1   ? -20.988 -2.309  -29.302 1.00 0.00 ? 1   GLY A CA   5  
ATOM 6327  C C    . GLY A 1 1   ? -19.775 -1.690  -28.636 1.00 0.00 ? 1   GLY A C    5  
ATOM 6328  O O    . GLY A 1 1   ? -19.225 -0.703  -29.126 1.00 0.00 ? 1   GLY A O    5  
ATOM 6329  H H1   . GLY A 1 1   ? -19.842 -3.579  -30.550 1.00 0.00 ? 1   GLY A H1   5  
ATOM 6330  H HA2  . GLY A 1 1   ? -21.693 -1.527  -29.541 1.00 0.00 ? 1   GLY A HA2  5  
ATOM 6331  H HA3  . GLY A 1 1   ? -21.450 -2.998  -28.610 1.00 0.00 ? 1   GLY A HA3  5  
ATOM 6332  N N    . SER A 1 2   ? -19.356 -2.269  -27.515 1.00 0.00 ? 2   SER A N    5  
ATOM 6333  C CA   . SER A 1 2   ? -18.204 -1.764  -26.778 1.00 0.00 ? 2   SER A CA   5  
ATOM 6334  C C    . SER A 1 2   ? -18.318 -0.259  -26.555 1.00 0.00 ? 2   SER A C    5  
ATOM 6335  O O    . SER A 1 2   ? -17.392 0.496   -26.852 1.00 0.00 ? 2   SER A O    5  
ATOM 6336  C CB   . SER A 1 2   ? -16.911 -2.083  -27.532 1.00 0.00 ? 2   SER A CB   5  
ATOM 6337  O OG   . SER A 1 2   ? -15.782 -1.954  -26.685 1.00 0.00 ? 2   SER A OG   5  
ATOM 6338  H H    . SER A 1 2   ? -19.836 -3.053  -27.175 1.00 0.00 ? 2   SER A H    5  
ATOM 6339  H HA   . SER A 1 2   ? -18.182 -2.258  -25.818 1.00 0.00 ? 2   SER A HA   5  
ATOM 6340  H HB2  . SER A 1 2   ? -16.953 -3.095  -27.903 1.00 0.00 ? 2   SER A HB2  5  
ATOM 6341  H HB3  . SER A 1 2   ? -16.803 -1.399  -28.362 1.00 0.00 ? 2   SER A HB3  5  
ATOM 6342  H HG   . SER A 1 2   ? -15.792 -1.090  -26.267 1.00 0.00 ? 2   SER A HG   5  
ATOM 6343  N N    . SER A 1 3   ? -19.461 0.169   -26.030 1.00 0.00 ? 3   SER A N    5  
ATOM 6344  C CA   . SER A 1 3   ? -19.700 1.584   -25.770 1.00 0.00 ? 3   SER A CA   5  
ATOM 6345  C C    . SER A 1 3   ? -19.301 1.949   -24.344 1.00 0.00 ? 3   SER A C    5  
ATOM 6346  O O    . SER A 1 3   ? -18.956 1.082   -23.542 1.00 0.00 ? 3   SER A O    5  
ATOM 6347  C CB   . SER A 1 3   ? -21.173 1.926   -26.003 1.00 0.00 ? 3   SER A CB   5  
ATOM 6348  O OG   . SER A 1 3   ? -21.435 2.142   -27.379 1.00 0.00 ? 3   SER A OG   5  
ATOM 6349  H H    . SER A 1 3   ? -20.162 -0.481  -25.815 1.00 0.00 ? 3   SER A H    5  
ATOM 6350  H HA   . SER A 1 3   ? -19.094 2.155   -26.458 1.00 0.00 ? 3   SER A HA   5  
ATOM 6351  H HB2  . SER A 1 3   ? -21.788 1.110   -25.655 1.00 0.00 ? 3   SER A HB2  5  
ATOM 6352  H HB3  . SER A 1 3   ? -21.422 2.824   -25.456 1.00 0.00 ? 3   SER A HB3  5  
ATOM 6353  H HG   . SER A 1 3   ? -20.822 1.626   -27.907 1.00 0.00 ? 3   SER A HG   5  
ATOM 6354  N N    . GLY A 1 4   ? -19.351 3.242   -24.034 1.00 0.00 ? 4   GLY A N    5  
ATOM 6355  C CA   . GLY A 1 4   ? -18.992 3.700   -22.705 1.00 0.00 ? 4   GLY A CA   5  
ATOM 6356  C C    . GLY A 1 4   ? -17.733 4.544   -22.703 1.00 0.00 ? 4   GLY A C    5  
ATOM 6357  O O    . GLY A 1 4   ? -17.800 5.772   -22.645 1.00 0.00 ? 4   GLY A O    5  
ATOM 6358  H H    . GLY A 1 4   ? -19.634 3.889   -24.714 1.00 0.00 ? 4   GLY A H    5  
ATOM 6359  H HA2  . GLY A 1 4   ? -19.806 4.287   -22.306 1.00 0.00 ? 4   GLY A HA2  5  
ATOM 6360  H HA3  . GLY A 1 4   ? -18.836 2.841   -22.070 1.00 0.00 ? 4   GLY A HA3  5  
ATOM 6361  N N    . SER A 1 5   ? -16.580 3.885   -22.764 1.00 0.00 ? 5   SER A N    5  
ATOM 6362  C CA   . SER A 1 5   ? -15.300 4.582   -22.764 1.00 0.00 ? 5   SER A CA   5  
ATOM 6363  C C    . SER A 1 5   ? -15.289 5.698   -21.724 1.00 0.00 ? 5   SER A C    5  
ATOM 6364  O O    . SER A 1 5   ? -14.928 6.836   -22.022 1.00 0.00 ? 5   SER A O    5  
ATOM 6365  C CB   . SER A 1 5   ? -15.009 5.160   -24.151 1.00 0.00 ? 5   SER A CB   5  
ATOM 6366  O OG   . SER A 1 5   ? -15.783 6.322   -24.392 1.00 0.00 ? 5   SER A OG   5  
ATOM 6367  H H    . SER A 1 5   ? -16.592 2.906   -22.809 1.00 0.00 ? 5   SER A H    5  
ATOM 6368  H HA   . SER A 1 5   ? -14.532 3.865   -22.514 1.00 0.00 ? 5   SER A HA   5  
ATOM 6369  H HB2  . SER A 1 5   ? -13.963 5.418   -24.218 1.00 0.00 ? 5   SER A HB2  5  
ATOM 6370  H HB3  . SER A 1 5   ? -15.246 4.420   -24.902 1.00 0.00 ? 5   SER A HB3  5  
ATOM 6371  H HG   . SER A 1 5   ? -16.618 6.253   -23.923 1.00 0.00 ? 5   SER A HG   5  
ATOM 6372  N N    . SER A 1 6   ? -15.688 5.362   -20.501 1.00 0.00 ? 6   SER A N    5  
ATOM 6373  C CA   . SER A 1 6   ? -15.729 6.336   -19.416 1.00 0.00 ? 6   SER A CA   5  
ATOM 6374  C C    . SER A 1 6   ? -14.693 6.002   -18.347 1.00 0.00 ? 6   SER A C    5  
ATOM 6375  O O    . SER A 1 6   ? -14.089 4.930   -18.365 1.00 0.00 ? 6   SER A O    5  
ATOM 6376  C CB   . SER A 1 6   ? -17.125 6.378   -18.793 1.00 0.00 ? 6   SER A CB   5  
ATOM 6377  O OG   . SER A 1 6   ? -17.542 5.086   -18.386 1.00 0.00 ? 6   SER A OG   5  
ATOM 6378  H H    . SER A 1 6   ? -15.964 4.438   -20.325 1.00 0.00 ? 6   SER A H    5  
ATOM 6379  H HA   . SER A 1 6   ? -15.500 7.306   -19.832 1.00 0.00 ? 6   SER A HA   5  
ATOM 6380  H HB2  . SER A 1 6   ? -17.112 7.027   -17.930 1.00 0.00 ? 6   SER A HB2  5  
ATOM 6381  H HB3  . SER A 1 6   ? -17.829 6.759   -19.519 1.00 0.00 ? 6   SER A HB3  5  
ATOM 6382  H HG   . SER A 1 6   ? -18.146 5.163   -17.644 1.00 0.00 ? 6   SER A HG   5  
ATOM 6383  N N    . GLY A 1 7   ? -14.492 6.929   -17.416 1.00 0.00 ? 7   GLY A N    5  
ATOM 6384  C CA   . GLY A 1 7   ? -13.528 6.715   -16.352 1.00 0.00 ? 7   GLY A CA   5  
ATOM 6385  C C    . GLY A 1 7   ? -12.828 7.994   -15.939 1.00 0.00 ? 7   GLY A C    5  
ATOM 6386  O O    . GLY A 1 7   ? -12.094 8.590   -16.727 1.00 0.00 ? 7   GLY A O    5  
ATOM 6387  H H    . GLY A 1 7   ? -15.002 7.765   -17.452 1.00 0.00 ? 7   GLY A H    5  
ATOM 6388  H HA2  . GLY A 1 7   ? -14.041 6.305   -15.494 1.00 0.00 ? 7   GLY A HA2  5  
ATOM 6389  H HA3  . GLY A 1 7   ? -12.788 6.006   -16.690 1.00 0.00 ? 7   GLY A HA3  5  
ATOM 6390  N N    . MET A 1 8   ? -13.055 8.418   -14.700 1.00 0.00 ? 8   MET A N    5  
ATOM 6391  C CA   . MET A 1 8   ? -12.439 9.635   -14.184 1.00 0.00 ? 8   MET A CA   5  
ATOM 6392  C C    . MET A 1 8   ? -12.023 9.459   -12.727 1.00 0.00 ? 8   MET A C    5  
ATOM 6393  O O    . MET A 1 8   ? -12.517 8.570   -12.034 1.00 0.00 ? 8   MET A O    5  
ATOM 6394  C CB   . MET A 1 8   ? -13.405 10.815  -14.312 1.00 0.00 ? 8   MET A CB   5  
ATOM 6395  C CG   . MET A 1 8   ? -13.444 11.420  -15.706 1.00 0.00 ? 8   MET A CG   5  
ATOM 6396  S SD   . MET A 1 8   ? -14.327 10.385  -16.889 1.00 0.00 ? 8   MET A SD   5  
ATOM 6397  C CE   . MET A 1 8   ? -16.015 10.916  -16.609 1.00 0.00 ? 8   MET A CE   5  
ATOM 6398  H H    . MET A 1 8   ? -13.649 7.900   -14.118 1.00 0.00 ? 8   MET A H    5  
ATOM 6399  H HA   . MET A 1 8   ? -11.559 9.837   -14.775 1.00 0.00 ? 8   MET A HA   5  
ATOM 6400  H HB2  . MET A 1 8   ? -14.400 10.478  -14.061 1.00 0.00 ? 8   MET A HB2  5  
ATOM 6401  H HB3  . MET A 1 8   ? -13.109 11.586  -13.616 1.00 0.00 ? 8   MET A HB3  5  
ATOM 6402  H HG2  . MET A 1 8   ? -13.935 12.381  -15.653 1.00 0.00 ? 8   MET A HG2  5  
ATOM 6403  H HG3  . MET A 1 8   ? -12.430 11.555  -16.052 1.00 0.00 ? 8   MET A HG3  5  
ATOM 6404  H HE1  . MET A 1 8   ? -16.141 11.184  -15.570 1.00 0.00 ? 8   MET A HE1  5  
ATOM 6405  H HE2  . MET A 1 8   ? -16.230 11.772  -17.230 1.00 0.00 ? 8   MET A HE2  5  
ATOM 6406  H HE3  . MET A 1 8   ? -16.691 10.111  -16.858 1.00 0.00 ? 8   MET A HE3  5  
ATOM 6407  N N    . ALA A 1 9   ? -11.113 10.312  -12.269 1.00 0.00 ? 9   ALA A N    5  
ATOM 6408  C CA   . ALA A 1 9   ? -10.633 10.251  -10.894 1.00 0.00 ? 9   ALA A CA   5  
ATOM 6409  C C    . ALA A 1 9   ? -10.405 11.649  -10.330 1.00 0.00 ? 9   ALA A C    5  
ATOM 6410  O O    . ALA A 1 9   ? -10.555 12.646  -11.036 1.00 0.00 ? 9   ALA A O    5  
ATOM 6411  C CB   . ALA A 1 9   ? -9.351  9.434   -10.818 1.00 0.00 ? 9   ALA A CB   5  
ATOM 6412  H H    . ALA A 1 9   ? -10.756 10.999  -12.870 1.00 0.00 ? 9   ALA A H    5  
ATOM 6413  H HA   . ALA A 1 9   ? -11.384 9.752   -10.300 1.00 0.00 ? 9   ALA A HA   5  
ATOM 6414  H HB1  . ALA A 1 9   ? -8.991  9.238   -11.818 1.00 0.00 ? 9   ALA A HB1  5  
ATOM 6415  H HB2  . ALA A 1 9   ? -8.604  9.986   -10.268 1.00 0.00 ? 9   ALA A HB2  5  
ATOM 6416  H HB3  . ALA A 1 9   ? -9.550  8.499   -10.317 1.00 0.00 ? 9   ALA A HB3  5  
ATOM 6417  N N    . ASP A 1 10  ? -10.042 11.715  -9.053  1.00 0.00 ? 10  ASP A N    5  
ATOM 6418  C CA   . ASP A 1 10  ? -9.793  12.992  -8.394  1.00 0.00 ? 10  ASP A CA   5  
ATOM 6419  C C    . ASP A 1 10  ? -8.447  12.979  -7.676  1.00 0.00 ? 10  ASP A C    5  
ATOM 6420  O O    . ASP A 1 10  ? -8.387  12.850  -6.454  1.00 0.00 ? 10  ASP A O    5  
ATOM 6421  C CB   . ASP A 1 10  ? -10.913 13.303  -7.400  1.00 0.00 ? 10  ASP A CB   5  
ATOM 6422  C CG   . ASP A 1 10  ? -11.346 12.081  -6.613  1.00 0.00 ? 10  ASP A CG   5  
ATOM 6423  O OD1  . ASP A 1 10  ? -10.523 11.154  -6.457  1.00 0.00 ? 10  ASP A OD1  5  
ATOM 6424  O OD2  . ASP A 1 10  ? -12.506 12.052  -6.154  1.00 0.00 ? 10  ASP A OD2  5  
ATOM 6425  H H    . ASP A 1 10  ? -9.938  10.885  -8.542  1.00 0.00 ? 10  ASP A H    5  
ATOM 6426  H HA   . ASP A 1 10  ? -9.775  13.759  -9.153  1.00 0.00 ? 10  ASP A HA   5  
ATOM 6427  H HB2  . ASP A 1 10  ? -10.568 14.053  -6.702  1.00 0.00 ? 10  ASP A HB2  5  
ATOM 6428  H HB3  . ASP A 1 10  ? -11.768 13.684  -7.938  1.00 0.00 ? 10  ASP A HB3  5  
ATOM 6429  N N    . GLU A 1 11  ? -7.371  13.114  -8.444  1.00 0.00 ? 11  GLU A N    5  
ATOM 6430  C CA   . GLU A 1 11  ? -6.026  13.116  -7.881  1.00 0.00 ? 11  GLU A CA   5  
ATOM 6431  C C    . GLU A 1 11  ? -5.515  14.542  -7.699  1.00 0.00 ? 11  GLU A C    5  
ATOM 6432  O O    . GLU A 1 11  ? -4.619  14.795  -6.893  1.00 0.00 ? 11  GLU A O    5  
ATOM 6433  C CB   . GLU A 1 11  ? -5.070  12.330  -8.781  1.00 0.00 ? 11  GLU A CB   5  
ATOM 6434  C CG   . GLU A 1 11  ? -3.910  11.697  -8.032  1.00 0.00 ? 11  GLU A CG   5  
ATOM 6435  C CD   . GLU A 1 11  ? -4.367  10.691  -6.993  1.00 0.00 ? 11  GLU A CD   5  
ATOM 6436  O OE1  . GLU A 1 11  ? -4.549  9.508   -7.352  1.00 0.00 ? 11  GLU A OE1  5  
ATOM 6437  O OE2  . GLU A 1 11  ? -4.543  11.085  -5.821  1.00 0.00 ? 11  GLU A OE2  5  
ATOM 6438  H H    . GLU A 1 11  ? -7.484  13.213  -9.413  1.00 0.00 ? 11  GLU A H    5  
ATOM 6439  H HA   . GLU A 1 11  ? -6.071  12.636  -6.914  1.00 0.00 ? 11  GLU A HA   5  
ATOM 6440  H HB2  . GLU A 1 11  ? -5.624  11.546  -9.276  1.00 0.00 ? 11  GLU A HB2  5  
ATOM 6441  H HB3  . GLU A 1 11  ? -4.667  12.999  -9.527  1.00 0.00 ? 11  GLU A HB3  5  
ATOM 6442  H HG2  . GLU A 1 11  ? -3.272  11.193  -8.742  1.00 0.00 ? 11  GLU A HG2  5  
ATOM 6443  H HG3  . GLU A 1 11  ? -3.351  12.476  -7.536  1.00 0.00 ? 11  GLU A HG3  5  
ATOM 6444  N N    . LYS A 1 12  ? -6.090  15.471  -8.454  1.00 0.00 ? 12  LYS A N    5  
ATOM 6445  C CA   . LYS A 1 12  ? -5.695  16.873  -8.378  1.00 0.00 ? 12  LYS A CA   5  
ATOM 6446  C C    . LYS A 1 12  ? -5.970  17.440  -6.989  1.00 0.00 ? 12  LYS A C    5  
ATOM 6447  O O    . LYS A 1 12  ? -5.066  17.896  -6.288  1.00 0.00 ? 12  LYS A O    5  
ATOM 6448  C CB   . LYS A 1 12  ? -6.441  17.693  -9.433  1.00 0.00 ? 12  LYS A CB   5  
ATOM 6449  C CG   . LYS A 1 12  ? -5.671  17.859  -10.731 1.00 0.00 ? 12  LYS A CG   5  
ATOM 6450  C CD   . LYS A 1 12  ? -6.497  18.583  -11.781 1.00 0.00 ? 12  LYS A CD   5  
ATOM 6451  C CE   . LYS A 1 12  ? -6.495  20.086  -11.552 1.00 0.00 ? 12  LYS A CE   5  
ATOM 6452  N NZ   . LYS A 1 12  ? -5.346  20.749  -12.229 1.00 0.00 ? 12  LYS A NZ   5  
ATOM 6453  H H    . LYS A 1 12  ? -6.799  15.208  -9.078  1.00 0.00 ? 12  LYS A H    5  
ATOM 6454  H HA   . LYS A 1 12  ? -4.635  16.929  -8.574  1.00 0.00 ? 12  LYS A HA   5  
ATOM 6455  H HB2  . LYS A 1 12  ? -7.378  17.204  -9.654  1.00 0.00 ? 12  LYS A HB2  5  
ATOM 6456  H HB3  . LYS A 1 12  ? -6.644  18.675  -9.030  1.00 0.00 ? 12  LYS A HB3  5  
ATOM 6457  H HG2  . LYS A 1 12  ? -4.775  18.429  -10.537 1.00 0.00 ? 12  LYS A HG2  5  
ATOM 6458  H HG3  . LYS A 1 12  ? -5.403  16.882  -11.108 1.00 0.00 ? 12  LYS A HG3  5  
ATOM 6459  H HD2  . LYS A 1 12  ? -6.083  18.378  -12.757 1.00 0.00 ? 12  LYS A HD2  5  
ATOM 6460  H HD3  . LYS A 1 12  ? -7.515  18.222  -11.737 1.00 0.00 ? 12  LYS A HD3  5  
ATOM 6461  H HE2  . LYS A 1 12  ? -7.415  20.497  -11.938 1.00 0.00 ? 12  LYS A HE2  5  
ATOM 6462  H HE3  . LYS A 1 12  ? -6.434  20.275  -10.490 1.00 0.00 ? 12  LYS A HE3  5  
ATOM 6463  H HZ1  . LYS A 1 12  ? -5.459  20.691  -13.262 1.00 0.00 ? 12  LYS A HZ1  5  
ATOM 6464  H HZ2  . LYS A 1 12  ? -4.457  20.282  -11.963 1.00 0.00 ? 12  LYS A HZ2  5  
ATOM 6465  H HZ3  . LYS A 1 12  ? -5.297  21.750  -11.952 1.00 0.00 ? 12  LYS A HZ3  5  
ATOM 6466  N N    . PRO A 1 13  ? -7.246  17.412  -6.579  1.00 0.00 ? 13  PRO A N    5  
ATOM 6467  C CA   . PRO A 1 13  ? -7.669  17.919  -5.270  1.00 0.00 ? 13  PRO A CA   5  
ATOM 6468  C C    . PRO A 1 13  ? -7.179  17.041  -4.123  1.00 0.00 ? 13  PRO A C    5  
ATOM 6469  O O    . PRO A 1 13  ? -7.474  17.303  -2.957  1.00 0.00 ? 13  PRO A O    5  
ATOM 6470  C CB   . PRO A 1 13  ? -9.197  17.886  -5.353  1.00 0.00 ? 13  PRO A CB   5  
ATOM 6471  C CG   . PRO A 1 13  ? -9.499  16.833  -6.363  1.00 0.00 ? 13  PRO A CG   5  
ATOM 6472  C CD   . PRO A 1 13  ? -8.376  16.883  -7.362  1.00 0.00 ? 13  PRO A CD   5  
ATOM 6473  H HA   . PRO A 1 13  ? -7.337  18.934  -5.111  1.00 0.00 ? 13  PRO A HA   5  
ATOM 6474  H HB2  . PRO A 1 13  ? -9.608  17.635  -4.385  1.00 0.00 ? 13  PRO A HB2  5  
ATOM 6475  H HB3  . PRO A 1 13  ? -9.565  18.851  -5.667  1.00 0.00 ? 13  PRO A HB3  5  
ATOM 6476  H HG2  . PRO A 1 13  ? -9.533  15.865  -5.886  1.00 0.00 ? 13  PRO A HG2  5  
ATOM 6477  H HG3  . PRO A 1 13  ? -10.440 17.048  -6.847  1.00 0.00 ? 13  PRO A HG3  5  
ATOM 6478  H HD2  . PRO A 1 13  ? -8.157  15.894  -7.734  1.00 0.00 ? 13  PRO A HD2  5  
ATOM 6479  H HD3  . PRO A 1 13  ? -8.625  17.548  -8.176  1.00 0.00 ? 13  PRO A HD3  5  
ATOM 6480  N N    . LYS A 1 14  ? -6.429  15.998  -4.462  1.00 0.00 ? 14  LYS A N    5  
ATOM 6481  C CA   . LYS A 1 14  ? -5.896  15.081  -3.461  1.00 0.00 ? 14  LYS A CA   5  
ATOM 6482  C C    . LYS A 1 14  ? -4.560  15.583  -2.921  1.00 0.00 ? 14  LYS A C    5  
ATOM 6483  O O    . LYS A 1 14  ? -3.691  16.005  -3.683  1.00 0.00 ? 14  LYS A O    5  
ATOM 6484  C CB   . LYS A 1 14  ? -5.723  13.684  -4.060  1.00 0.00 ? 14  LYS A CB   5  
ATOM 6485  C CG   . LYS A 1 14  ? -5.147  12.671  -3.085  1.00 0.00 ? 14  LYS A CG   5  
ATOM 6486  C CD   . LYS A 1 14  ? -6.232  12.046  -2.224  1.00 0.00 ? 14  LYS A CD   5  
ATOM 6487  C CE   . LYS A 1 14  ? -6.878  10.857  -2.919  1.00 0.00 ? 14  LYS A CE   5  
ATOM 6488  N NZ   . LYS A 1 14  ? -7.731  11.280  -4.064  1.00 0.00 ? 14  LYS A NZ   5  
ATOM 6489  H H    . LYS A 1 14  ? -6.228  15.841  -5.409  1.00 0.00 ? 14  LYS A H    5  
ATOM 6490  H HA   . LYS A 1 14  ? -6.603  15.031  -2.647  1.00 0.00 ? 14  LYS A HA   5  
ATOM 6491  H HB2  . LYS A 1 14  ? -6.687  13.325  -4.390  1.00 0.00 ? 14  LYS A HB2  5  
ATOM 6492  H HB3  . LYS A 1 14  ? -5.061  13.749  -4.911  1.00 0.00 ? 14  LYS A HB3  5  
ATOM 6493  H HG2  . LYS A 1 14  ? -4.650  11.891  -3.642  1.00 0.00 ? 14  LYS A HG2  5  
ATOM 6494  H HG3  . LYS A 1 14  ? -4.433  13.169  -2.444  1.00 0.00 ? 14  LYS A HG3  5  
ATOM 6495  H HD2  . LYS A 1 14  ? -5.794  11.711  -1.295  1.00 0.00 ? 14  LYS A HD2  5  
ATOM 6496  H HD3  . LYS A 1 14  ? -6.990  12.788  -2.020  1.00 0.00 ? 14  LYS A HD3  5  
ATOM 6497  H HE2  . LYS A 1 14  ? -6.101  10.203  -3.282  1.00 0.00 ? 14  LYS A HE2  5  
ATOM 6498  H HE3  . LYS A 1 14  ? -7.489  10.327  -2.202  1.00 0.00 ? 14  LYS A HE3  5  
ATOM 6499  H HZ1  . LYS A 1 14  ? -8.447  10.553  -4.263  1.00 0.00 ? 14  LYS A HZ1  5  
ATOM 6500  H HZ2  . LYS A 1 14  ? -7.146  11.416  -4.913  1.00 0.00 ? 14  LYS A HZ2  5  
ATOM 6501  H HZ3  . LYS A 1 14  ? -8.212  12.174  -3.840  1.00 0.00 ? 14  LYS A HZ3  5  
ATOM 6502  N N    . GLU A 1 15  ? -4.403  15.531  -1.602  1.00 0.00 ? 15  GLU A N    5  
ATOM 6503  C CA   . GLU A 1 15  ? -3.173  15.980  -0.961  1.00 0.00 ? 15  GLU A CA   5  
ATOM 6504  C C    . GLU A 1 15  ? -2.784  15.048  0.183   1.00 0.00 ? 15  GLU A C    5  
ATOM 6505  O O    . GLU A 1 15  ? -3.530  14.137  0.537   1.00 0.00 ? 15  GLU A O    5  
ATOM 6506  C CB   . GLU A 1 15  ? -3.335  17.409  -0.437  1.00 0.00 ? 15  GLU A CB   5  
ATOM 6507  C CG   . GLU A 1 15  ? -3.671  18.419  -1.521  1.00 0.00 ? 15  GLU A CG   5  
ATOM 6508  C CD   . GLU A 1 15  ? -3.682  19.845  -1.005  1.00 0.00 ? 15  GLU A CD   5  
ATOM 6509  O OE1  . GLU A 1 15  ? -2.645  20.292  -0.472  1.00 0.00 ? 15  GLU A OE1  5  
ATOM 6510  O OE2  . GLU A 1 15  ? -4.729  20.514  -1.136  1.00 0.00 ? 15  GLU A OE2  5  
ATOM 6511  H H    . GLU A 1 15  ? -5.133  15.185  -1.046  1.00 0.00 ? 15  GLU A H    5  
ATOM 6512  H HA   . GLU A 1 15  ? -2.389  15.966  -1.703  1.00 0.00 ? 15  GLU A HA   5  
ATOM 6513  H HB2  . GLU A 1 15  ? -4.127  17.422  0.297   1.00 0.00 ? 15  GLU A HB2  5  
ATOM 6514  H HB3  . GLU A 1 15  ? -2.413  17.713  0.035   1.00 0.00 ? 15  GLU A HB3  5  
ATOM 6515  H HG2  . GLU A 1 15  ? -2.935  18.343  -2.307  1.00 0.00 ? 15  GLU A HG2  5  
ATOM 6516  H HG3  . GLU A 1 15  ? -4.648  18.189  -1.921  1.00 0.00 ? 15  GLU A HG3  5  
ATOM 6517  N N    . GLY A 1 16  ? -1.608  15.285  0.758   1.00 0.00 ? 16  GLY A N    5  
ATOM 6518  C CA   . GLY A 1 16  ? -1.140  14.459  1.856   1.00 0.00 ? 16  GLY A CA   5  
ATOM 6519  C C    . GLY A 1 16  ? -0.385  15.257  2.900   1.00 0.00 ? 16  GLY A C    5  
ATOM 6520  O O    . GLY A 1 16  ? 0.337   16.198  2.571   1.00 0.00 ? 16  GLY A O    5  
ATOM 6521  H H    . GLY A 1 16  ? -1.055  16.026  0.434   1.00 0.00 ? 16  GLY A H    5  
ATOM 6522  H HA2  . GLY A 1 16  ? -1.990  13.986  2.324   1.00 0.00 ? 16  GLY A HA2  5  
ATOM 6523  H HA3  . GLY A 1 16  ? -0.486  13.695  1.462   1.00 0.00 ? 16  GLY A HA3  5  
ATOM 6524  N N    . VAL A 1 17  ? -0.552  14.882  4.164   1.00 0.00 ? 17  VAL A N    5  
ATOM 6525  C CA   . VAL A 1 17  ? 0.119   15.569  5.261   1.00 0.00 ? 17  VAL A CA   5  
ATOM 6526  C C    . VAL A 1 17  ? 1.310   14.763  5.768   1.00 0.00 ? 17  VAL A C    5  
ATOM 6527  O O    . VAL A 1 17  ? 1.155   13.638  6.244   1.00 0.00 ? 17  VAL A O    5  
ATOM 6528  C CB   . VAL A 1 17  ? -0.846  15.832  6.433   1.00 0.00 ? 17  VAL A CB   5  
ATOM 6529  C CG1  . VAL A 1 17  ? -0.119  16.516  7.580   1.00 0.00 ? 17  VAL A CG1  5  
ATOM 6530  C CG2  . VAL A 1 17  ? -2.031  16.665  5.970   1.00 0.00 ? 17  VAL A CG2  5  
ATOM 6531  H H    . VAL A 1 17  ? -1.140  14.124  4.364   1.00 0.00 ? 17  VAL A H    5  
ATOM 6532  H HA   . VAL A 1 17  ? 0.472   16.521  4.892   1.00 0.00 ? 17  VAL A HA   5  
ATOM 6533  H HB   . VAL A 1 17  ? -1.217  14.881  6.787   1.00 0.00 ? 17  VAL A HB   5  
ATOM 6534  H HG11 . VAL A 1 17  ? -0.346  17.572  7.571   1.00 0.00 ? 17  VAL A HG11 5  
ATOM 6535  H HG12 . VAL A 1 17  ? -0.439  16.085  8.518   1.00 0.00 ? 17  VAL A HG12 5  
ATOM 6536  H HG13 . VAL A 1 17  ? 0.946   16.377  7.465   1.00 0.00 ? 17  VAL A HG13 5  
ATOM 6537  H HG21 . VAL A 1 17  ? -2.943  16.246  6.370   1.00 0.00 ? 17  VAL A HG21 5  
ATOM 6538  H HG22 . VAL A 1 17  ? -1.917  17.680  6.320   1.00 0.00 ? 17  VAL A HG22 5  
ATOM 6539  H HG23 . VAL A 1 17  ? -2.076  16.660  4.891   1.00 0.00 ? 17  VAL A HG23 5  
ATOM 6540  N N    . LYS A 1 18  ? 2.499   15.346  5.664   1.00 0.00 ? 18  LYS A N    5  
ATOM 6541  C CA   . LYS A 1 18  ? 3.718   14.684  6.113   1.00 0.00 ? 18  LYS A CA   5  
ATOM 6542  C C    . LYS A 1 18  ? 4.366   15.457  7.258   1.00 0.00 ? 18  LYS A C    5  
ATOM 6543  O O    . LYS A 1 18  ? 4.670   16.643  7.127   1.00 0.00 ? 18  LYS A O    5  
ATOM 6544  C CB   . LYS A 1 18  ? 4.706   14.547  4.953   1.00 0.00 ? 18  LYS A CB   5  
ATOM 6545  C CG   . LYS A 1 18  ? 6.070   14.029  5.373   1.00 0.00 ? 18  LYS A CG   5  
ATOM 6546  C CD   . LYS A 1 18  ? 7.027   13.957  4.195   1.00 0.00 ? 18  LYS A CD   5  
ATOM 6547  C CE   . LYS A 1 18  ? 8.472   14.128  4.639   1.00 0.00 ? 18  LYS A CE   5  
ATOM 6548  N NZ   . LYS A 1 18  ? 9.041   12.861  5.177   1.00 0.00 ? 18  LYS A NZ   5  
ATOM 6549  H H    . LYS A 1 18  ? 2.558   16.245  5.276   1.00 0.00 ? 18  LYS A H    5  
ATOM 6550  H HA   . LYS A 1 18  ? 3.451   13.700  6.466   1.00 0.00 ? 18  LYS A HA   5  
ATOM 6551  H HB2  . LYS A 1 18  ? 4.294   13.865  4.224   1.00 0.00 ? 18  LYS A HB2  5  
ATOM 6552  H HB3  . LYS A 1 18  ? 4.839   15.516  4.492   1.00 0.00 ? 18  LYS A HB3  5  
ATOM 6553  H HG2  . LYS A 1 18  ? 6.484   14.692  6.119   1.00 0.00 ? 18  LYS A HG2  5  
ATOM 6554  H HG3  . LYS A 1 18  ? 5.956   13.039  5.793   1.00 0.00 ? 18  LYS A HG3  5  
ATOM 6555  H HD2  . LYS A 1 18  ? 6.922   12.996  3.715   1.00 0.00 ? 18  LYS A HD2  5  
ATOM 6556  H HD3  . LYS A 1 18  ? 6.780   14.741  3.494   1.00 0.00 ? 18  LYS A HD3  5  
ATOM 6557  H HE2  . LYS A 1 18  ? 9.060   14.445  3.792   1.00 0.00 ? 18  LYS A HE2  5  
ATOM 6558  H HE3  . LYS A 1 18  ? 8.511   14.885  5.408   1.00 0.00 ? 18  LYS A HE3  5  
ATOM 6559  H HZ1  . LYS A 1 18  ? 8.514   12.046  4.802   1.00 0.00 ? 18  LYS A HZ1  5  
ATOM 6560  H HZ2  . LYS A 1 18  ? 8.976   12.853  6.215   1.00 0.00 ? 18  LYS A HZ2  5  
ATOM 6561  H HZ3  . LYS A 1 18  ? 10.039  12.772  4.902   1.00 0.00 ? 18  LYS A HZ3  5  
ATOM 6562  N N    . THR A 1 19  ? 4.577   14.777  8.381   1.00 0.00 ? 19  THR A N    5  
ATOM 6563  C CA   . THR A 1 19  ? 5.190   15.399  9.548   1.00 0.00 ? 19  THR A CA   5  
ATOM 6564  C C    . THR A 1 19  ? 6.532   14.754  9.873   1.00 0.00 ? 19  THR A C    5  
ATOM 6565  O O    . THR A 1 19  ? 6.766   13.591  9.550   1.00 0.00 ? 19  THR A O    5  
ATOM 6566  C CB   . THR A 1 19  ? 4.273   15.302  10.782  1.00 0.00 ? 19  THR A CB   5  
ATOM 6567  O OG1  . THR A 1 19  ? 2.960   15.771  10.455  1.00 0.00 ? 19  THR A OG1  5  
ATOM 6568  C CG2  . THR A 1 19  ? 4.835   16.116  11.938  1.00 0.00 ? 19  THR A CG2  5  
ATOM 6569  H H    . THR A 1 19  ? 4.313   13.834  8.424   1.00 0.00 ? 19  THR A H    5  
ATOM 6570  H HA   . THR A 1 19  ? 5.348   16.444  9.324   1.00 0.00 ? 19  THR A HA   5  
ATOM 6571  H HB   . THR A 1 19  ? 4.212   14.267  11.086  1.00 0.00 ? 19  THR A HB   5  
ATOM 6572  H HG1  . THR A 1 19  ? 2.922   16.723  10.573  1.00 0.00 ? 19  THR A HG1  5  
ATOM 6573  H HG21 . THR A 1 19  ? 5.160   17.080  11.575  1.00 0.00 ? 19  THR A HG21 5  
ATOM 6574  H HG22 . THR A 1 19  ? 5.674   15.593  12.372  1.00 0.00 ? 19  THR A HG22 5  
ATOM 6575  H HG23 . THR A 1 19  ? 4.069   16.253  12.686  1.00 0.00 ? 19  THR A HG23 5  
ATOM 6576  N N    . GLU A 1 20  ? 7.410   15.518  10.516  1.00 0.00 ? 20  GLU A N    5  
ATOM 6577  C CA   . GLU A 1 20  ? 8.729   15.020  10.886  1.00 0.00 ? 20  GLU A CA   5  
ATOM 6578  C C    . GLU A 1 20  ? 8.881   14.955  12.403  1.00 0.00 ? 20  GLU A C    5  
ATOM 6579  O O    . GLU A 1 20  ? 9.645   14.144  12.926  1.00 0.00 ? 20  GLU A O    5  
ATOM 6580  C CB   . GLU A 1 20  ? 9.821   15.911  10.290  1.00 0.00 ? 20  GLU A CB   5  
ATOM 6581  C CG   . GLU A 1 20  ? 9.725   17.364  10.725  1.00 0.00 ? 20  GLU A CG   5  
ATOM 6582  C CD   . GLU A 1 20  ? 10.871  18.207  10.202  1.00 0.00 ? 20  GLU A CD   5  
ATOM 6583  O OE1  . GLU A 1 20  ? 11.052  18.261  8.967   1.00 0.00 ? 20  GLU A OE1  5  
ATOM 6584  O OE2  . GLU A 1 20  ? 11.588  18.812  11.026  1.00 0.00 ? 20  GLU A OE2  5  
ATOM 6585  H H    . GLU A 1 20  ? 7.164   16.439  10.747  1.00 0.00 ? 20  GLU A H    5  
ATOM 6586  H HA   . GLU A 1 20  ? 8.832   14.023  10.483  1.00 0.00 ? 20  GLU A HA   5  
ATOM 6587  H HB2  . GLU A 1 20  ? 10.785  15.529  10.592  1.00 0.00 ? 20  GLU A HB2  5  
ATOM 6588  H HB3  . GLU A 1 20  ? 9.750   15.875  9.213   1.00 0.00 ? 20  GLU A HB3  5  
ATOM 6589  H HG2  . GLU A 1 20  ? 8.798   17.776  10.356  1.00 0.00 ? 20  GLU A HG2  5  
ATOM 6590  H HG3  . GLU A 1 20  ? 9.731   17.404  11.804  1.00 0.00 ? 20  GLU A HG3  5  
ATOM 6591  N N    . ASN A 1 21  ? 8.149   15.816  13.102  1.00 0.00 ? 21  ASN A N    5  
ATOM 6592  C CA   . ASN A 1 21  ? 8.203   15.857  14.559  1.00 0.00 ? 21  ASN A CA   5  
ATOM 6593  C C    . ASN A 1 21  ? 7.870   14.493  15.155  1.00 0.00 ? 21  ASN A C    5  
ATOM 6594  O O    . ASN A 1 21  ? 8.681   13.899  15.863  1.00 0.00 ? 21  ASN A O    5  
ATOM 6595  C CB   . ASN A 1 21  ? 7.234   16.912  15.096  1.00 0.00 ? 21  ASN A CB   5  
ATOM 6596  C CG   . ASN A 1 21  ? 7.026   16.798  16.594  1.00 0.00 ? 21  ASN A CG   5  
ATOM 6597  O OD1  . ASN A 1 21  ? 6.006   16.284  17.053  1.00 0.00 ? 21  ASN A OD1  5  
ATOM 6598  N ND2  . ASN A 1 21  ? 7.996   17.278  17.364  1.00 0.00 ? 21  ASN A ND2  5  
ATOM 6599  H H    . ASN A 1 21  ? 7.559   16.438  12.628  1.00 0.00 ? 21  ASN A H    5  
ATOM 6600  H HA   . ASN A 1 21  ? 9.209   16.127  14.846  1.00 0.00 ? 21  ASN A HA   5  
ATOM 6601  H HB2  . ASN A 1 21  ? 7.626   17.896  14.881  1.00 0.00 ? 21  ASN A HB2  5  
ATOM 6602  H HB3  . ASN A 1 21  ? 6.278   16.796  14.608  1.00 0.00 ? 21  ASN A HB3  5  
ATOM 6603  H HD21 . ASN A 1 21  ? 8.780   17.673  16.928  1.00 0.00 ? 21  ASN A HD21 5  
ATOM 6604  H HD22 . ASN A 1 21  ? 7.888   17.216  18.336  1.00 0.00 ? 21  ASN A HD22 5  
ATOM 6605  N N    . ASN A 1 22  ? 6.669   14.003  14.863  1.00 0.00 ? 22  ASN A N    5  
ATOM 6606  C CA   . ASN A 1 22  ? 6.228   12.709  15.370  1.00 0.00 ? 22  ASN A CA   5  
ATOM 6607  C C    . ASN A 1 22  ? 7.110   11.586  14.834  1.00 0.00 ? 22  ASN A C    5  
ATOM 6608  O O    . ASN A 1 22  ? 7.891   11.785  13.904  1.00 0.00 ? 22  ASN A O    5  
ATOM 6609  C CB   . ASN A 1 22  ? 4.769   12.457  14.982  1.00 0.00 ? 22  ASN A CB   5  
ATOM 6610  C CG   . ASN A 1 22  ? 3.874   13.640  15.298  1.00 0.00 ? 22  ASN A CG   5  
ATOM 6611  O OD1  . ASN A 1 22  ? 4.241   14.520  16.076  1.00 0.00 ? 22  ASN A OD1  5  
ATOM 6612  N ND2  . ASN A 1 22  ? 2.692   13.665  14.693  1.00 0.00 ? 22  ASN A ND2  5  
ATOM 6613  H H    . ASN A 1 22  ? 6.066   14.525  14.293  1.00 0.00 ? 22  ASN A H    5  
ATOM 6614  H HA   . ASN A 1 22  ? 6.306   12.731  16.446  1.00 0.00 ? 22  ASN A HA   5  
ATOM 6615  H HB2  . ASN A 1 22  ? 4.714   12.262  13.921  1.00 0.00 ? 22  ASN A HB2  5  
ATOM 6616  H HB3  . ASN A 1 22  ? 4.403   11.597  15.522  1.00 0.00 ? 22  ASN A HB3  5  
ATOM 6617  H HD21 . ASN A 1 22  ? 2.467   12.929  14.085  1.00 0.00 ? 22  ASN A HD21 5  
ATOM 6618  H HD22 . ASN A 1 22  ? 2.094   14.418  14.878  1.00 0.00 ? 22  ASN A HD22 5  
ATOM 6619  N N    . ASP A 1 23  ? 6.979   10.404  15.428  1.00 0.00 ? 23  ASP A N    5  
ATOM 6620  C CA   . ASP A 1 23  ? 7.762   9.248   15.010  1.00 0.00 ? 23  ASP A CA   5  
ATOM 6621  C C    . ASP A 1 23  ? 6.998   8.415   13.985  1.00 0.00 ? 23  ASP A C    5  
ATOM 6622  O O    . ASP A 1 23  ? 5.820   8.110   14.172  1.00 0.00 ? 23  ASP A O    5  
ATOM 6623  C CB   . ASP A 1 23  ? 8.123   8.385   16.220  1.00 0.00 ? 23  ASP A CB   5  
ATOM 6624  C CG   . ASP A 1 23  ? 8.554   9.213   17.414  1.00 0.00 ? 23  ASP A CG   5  
ATOM 6625  O OD1  . ASP A 1 23  ? 7.706   9.947   17.964  1.00 0.00 ? 23  ASP A OD1  5  
ATOM 6626  O OD2  . ASP A 1 23  ? 9.739   9.129   17.799  1.00 0.00 ? 23  ASP A OD2  5  
ATOM 6627  H H    . ASP A 1 23  ? 6.339   10.308  16.164  1.00 0.00 ? 23  ASP A H    5  
ATOM 6628  H HA   . ASP A 1 23  ? 8.672   9.610   14.554  1.00 0.00 ? 23  ASP A HA   5  
ATOM 6629  H HB2  . ASP A 1 23  ? 7.262   7.798   16.505  1.00 0.00 ? 23  ASP A HB2  5  
ATOM 6630  H HB3  . ASP A 1 23  ? 8.933   7.722   15.953  1.00 0.00 ? 23  ASP A HB3  5  
ATOM 6631  N N    . HIS A 1 24  ? 7.676   8.051   12.902  1.00 0.00 ? 24  HIS A N    5  
ATOM 6632  C CA   . HIS A 1 24  ? 7.061   7.254   11.847  1.00 0.00 ? 24  HIS A CA   5  
ATOM 6633  C C    . HIS A 1 24  ? 8.003   6.148   11.382  1.00 0.00 ? 24  HIS A C    5  
ATOM 6634  O O    . HIS A 1 24  ? 9.215   6.224   11.587  1.00 0.00 ? 24  HIS A O    5  
ATOM 6635  C CB   . HIS A 1 24  ? 6.677   8.144   10.664  1.00 0.00 ? 24  HIS A CB   5  
ATOM 6636  C CG   . HIS A 1 24  ? 5.991   9.412   11.066  1.00 0.00 ? 24  HIS A CG   5  
ATOM 6637  N ND1  . HIS A 1 24  ? 4.644   9.635   10.869  1.00 0.00 ? 24  HIS A ND1  5  
ATOM 6638  C CD2  . HIS A 1 24  ? 6.472   10.529  11.661  1.00 0.00 ? 24  HIS A CD2  5  
ATOM 6639  C CE1  . HIS A 1 24  ? 4.327   10.834  11.322  1.00 0.00 ? 24  HIS A CE1  5  
ATOM 6640  N NE2  . HIS A 1 24  ? 5.418   11.398  11.808  1.00 0.00 ? 24  HIS A NE2  5  
ATOM 6641  H H    . HIS A 1 24  ? 8.612   8.325   12.810  1.00 0.00 ? 24  HIS A H    5  
ATOM 6642  H HA   . HIS A 1 24  ? 6.167   6.802   12.250  1.00 0.00 ? 24  HIS A HA   5  
ATOM 6643  H HB2  . HIS A 1 24  ? 7.570   8.409   10.117  1.00 0.00 ? 24  HIS A HB2  5  
ATOM 6644  H HB3  . HIS A 1 24  ? 6.011   7.597   10.012  1.00 0.00 ? 24  HIS A HB3  5  
ATOM 6645  H HD1  . HIS A 1 24  ? 4.015   9.007   10.456  1.00 0.00 ? 24  HIS A HD1  5  
ATOM 6646  H HD2  . HIS A 1 24  ? 7.495   10.706  11.962  1.00 0.00 ? 24  HIS A HD2  5  
ATOM 6647  H HE1  . HIS A 1 24  ? 3.344   11.279  11.300  1.00 0.00 ? 24  HIS A HE1  5  
ATOM 6648  H HE2  . HIS A 1 24  ? 5.482   12.321  12.129  1.00 0.00 ? 24  HIS A HE2  5  
ATOM 6649  N N    . ILE A 1 25  ? 7.439   5.121   10.756  1.00 0.00 ? 25  ILE A N    5  
ATOM 6650  C CA   . ILE A 1 25  ? 8.229   3.999   10.262  1.00 0.00 ? 25  ILE A CA   5  
ATOM 6651  C C    . ILE A 1 25  ? 8.096   3.857   8.750   1.00 0.00 ? 25  ILE A C    5  
ATOM 6652  O O    . ILE A 1 25  ? 7.075   4.222   8.169   1.00 0.00 ? 25  ILE A O    5  
ATOM 6653  C CB   . ILE A 1 25  ? 7.808   2.677   10.930  1.00 0.00 ? 25  ILE A CB   5  
ATOM 6654  C CG1  . ILE A 1 25  ? 6.412   2.264   10.458  1.00 0.00 ? 25  ILE A CG1  5  
ATOM 6655  C CG2  . ILE A 1 25  ? 7.842   2.814   12.445  1.00 0.00 ? 25  ILE A CG2  5  
ATOM 6656  C CD1  . ILE A 1 25  ? 5.801   1.152   11.282  1.00 0.00 ? 25  ILE A CD1  5  
ATOM 6657  H H    . ILE A 1 25  ? 6.468   5.117   10.622  1.00 0.00 ? 25  ILE A H    5  
ATOM 6658  H HA   . ILE A 1 25  ? 9.264   4.189   10.506  1.00 0.00 ? 25  ILE A HA   5  
ATOM 6659  H HB   . ILE A 1 25  ? 8.517   1.915   10.645  1.00 0.00 ? 25  ILE A HB   5  
ATOM 6660  H HG12 . ILE A 1 25  ? 5.754   3.116   10.512  1.00 0.00 ? 25  ILE A HG12 5  
ATOM 6661  H HG13 . ILE A 1 25  ? 6.473   1.924   9.434   1.00 0.00 ? 25  ILE A HG13 5  
ATOM 6662  H HG21 . ILE A 1 25  ? 8.466   2.038   12.862  1.00 0.00 ? 25  ILE A HG21 5  
ATOM 6663  H HG22 . ILE A 1 25  ? 8.245   3.780   12.709  1.00 0.00 ? 25  ILE A HG22 5  
ATOM 6664  H HG23 . ILE A 1 25  ? 6.841   2.722   12.837  1.00 0.00 ? 25  ILE A HG23 5  
ATOM 6665  H HD11 . ILE A 1 25  ? 5.187   1.577   12.062  1.00 0.00 ? 25  ILE A HD11 5  
ATOM 6666  H HD12 . ILE A 1 25  ? 5.193   0.525   10.647  1.00 0.00 ? 25  ILE A HD12 5  
ATOM 6667  H HD13 . ILE A 1 25  ? 6.587   0.559   11.727  1.00 0.00 ? 25  ILE A HD13 5  
ATOM 6668  N N    . ASN A 1 26  ? 9.135   3.322   8.118   1.00 0.00 ? 26  ASN A N    5  
ATOM 6669  C CA   . ASN A 1 26  ? 9.135   3.130   6.672   1.00 0.00 ? 26  ASN A CA   5  
ATOM 6670  C C    . ASN A 1 26  ? 9.208   1.647   6.320   1.00 0.00 ? 26  ASN A C    5  
ATOM 6671  O O    . ASN A 1 26  ? 10.056  0.917   6.834   1.00 0.00 ? 26  ASN A O    5  
ATOM 6672  C CB   . ASN A 1 26  ? 10.311  3.874   6.037   1.00 0.00 ? 26  ASN A CB   5  
ATOM 6673  C CG   . ASN A 1 26  ? 10.074  5.370   5.960   1.00 0.00 ? 26  ASN A CG   5  
ATOM 6674  O OD1  . ASN A 1 26  ? 9.644   5.890   4.930   1.00 0.00 ? 26  ASN A OD1  5  
ATOM 6675  N ND2  . ASN A 1 26  ? 10.356  6.071   7.053   1.00 0.00 ? 26  ASN A ND2  5  
ATOM 6676  H H    . ASN A 1 26  ? 9.922   3.051   8.635   1.00 0.00 ? 26  ASN A H    5  
ATOM 6677  H HA   . ASN A 1 26  ? 8.212   3.535   6.284   1.00 0.00 ? 26  ASN A HA   5  
ATOM 6678  H HB2  . ASN A 1 26  ? 11.200  3.700   6.626   1.00 0.00 ? 26  ASN A HB2  5  
ATOM 6679  H HB3  . ASN A 1 26  ? 10.468  3.501   5.036   1.00 0.00 ? 26  ASN A HB3  5  
ATOM 6680  H HD21 . ASN A 1 26  ? 10.695  5.590   7.837   1.00 0.00 ? 26  ASN A HD21 5  
ATOM 6681  H HD22 . ASN A 1 26  ? 10.212  7.040   7.031   1.00 0.00 ? 26  ASN A HD22 5  
ATOM 6682  N N    . LEU A 1 27  ? 8.313   1.209   5.441   1.00 0.00 ? 27  LEU A N    5  
ATOM 6683  C CA   . LEU A 1 27  ? 8.276   -0.187  5.020   1.00 0.00 ? 27  LEU A CA   5  
ATOM 6684  C C    . LEU A 1 27  ? 8.531   -0.310  3.521   1.00 0.00 ? 27  LEU A C    5  
ATOM 6685  O O    . LEU A 1 27  ? 7.918   0.391   2.716   1.00 0.00 ? 27  LEU A O    5  
ATOM 6686  C CB   . LEU A 1 27  ? 6.924   -0.811  5.371   1.00 0.00 ? 27  LEU A CB   5  
ATOM 6687  C CG   . LEU A 1 27  ? 6.226   -0.246  6.609   1.00 0.00 ? 27  LEU A CG   5  
ATOM 6688  C CD1  . LEU A 1 27  ? 4.828   -0.829  6.746   1.00 0.00 ? 27  LEU A CD1  5  
ATOM 6689  C CD2  . LEU A 1 27  ? 7.047   -0.526  7.859   1.00 0.00 ? 27  LEU A CD2  5  
ATOM 6690  H H    . LEU A 1 27  ? 7.662   1.838   5.066   1.00 0.00 ? 27  LEU A H    5  
ATOM 6691  H HA   . LEU A 1 27  ? 9.055   -0.715  5.550   1.00 0.00 ? 27  LEU A HA   5  
ATOM 6692  H HB2  . LEU A 1 27  ? 6.266   -0.670  4.528   1.00 0.00 ? 27  LEU A HB2  5  
ATOM 6693  H HB3  . LEU A 1 27  ? 7.080   -1.868  5.531   1.00 0.00 ? 27  LEU A HB3  5  
ATOM 6694  H HG   . LEU A 1 27  ? 6.131   0.826   6.503   1.00 0.00 ? 27  LEU A HG   5  
ATOM 6695  H HD11 . LEU A 1 27  ? 4.274   -0.654  5.836   1.00 0.00 ? 27  LEU A HD11 5  
ATOM 6696  H HD12 . LEU A 1 27  ? 4.320   -0.356  7.573   1.00 0.00 ? 27  LEU A HD12 5  
ATOM 6697  H HD13 . LEU A 1 27  ? 4.897   -1.892  6.927   1.00 0.00 ? 27  LEU A HD13 5  
ATOM 6698  H HD21 . LEU A 1 27  ? 6.453   -0.312  8.735   1.00 0.00 ? 27  LEU A HD21 5  
ATOM 6699  H HD22 . LEU A 1 27  ? 7.927   0.101   7.859   1.00 0.00 ? 27  LEU A HD22 5  
ATOM 6700  H HD23 . LEU A 1 27  ? 7.344   -1.564  7.869   1.00 0.00 ? 27  LEU A HD23 5  
ATOM 6701  N N    . LYS A 1 28  ? 9.439   -1.208  3.152   1.00 0.00 ? 28  LYS A N    5  
ATOM 6702  C CA   . LYS A 1 28  ? 9.774   -1.427  1.750   1.00 0.00 ? 28  LYS A CA   5  
ATOM 6703  C C    . LYS A 1 28  ? 8.941   -2.562  1.163   1.00 0.00 ? 28  LYS A C    5  
ATOM 6704  O O    . LYS A 1 28  ? 9.047   -3.711  1.594   1.00 0.00 ? 28  LYS A O    5  
ATOM 6705  C CB   . LYS A 1 28  ? 11.264  -1.744  1.604   1.00 0.00 ? 28  LYS A CB   5  
ATOM 6706  C CG   . LYS A 1 28  ? 12.173  -0.616  2.059   1.00 0.00 ? 28  LYS A CG   5  
ATOM 6707  C CD   . LYS A 1 28  ? 13.549  -1.131  2.446   1.00 0.00 ? 28  LYS A CD   5  
ATOM 6708  C CE   . LYS A 1 28  ? 14.208  -0.235  3.483   1.00 0.00 ? 28  LYS A CE   5  
ATOM 6709  N NZ   . LYS A 1 28  ? 15.642  -0.584  3.687   1.00 0.00 ? 28  LYS A NZ   5  
ATOM 6710  H H    . LYS A 1 28  ? 9.894   -1.738  3.841   1.00 0.00 ? 28  LYS A H    5  
ATOM 6711  H HA   . LYS A 1 28  ? 9.553   -0.519  1.211   1.00 0.00 ? 28  LYS A HA   5  
ATOM 6712  H HB2  . LYS A 1 28  ? 11.492  -2.622  2.191   1.00 0.00 ? 28  LYS A HB2  5  
ATOM 6713  H HB3  . LYS A 1 28  ? 11.475  -1.952  0.565   1.00 0.00 ? 28  LYS A HB3  5  
ATOM 6714  H HG2  . LYS A 1 28  ? 12.280  0.095   1.253   1.00 0.00 ? 28  LYS A HG2  5  
ATOM 6715  H HG3  . LYS A 1 28  ? 11.727  -0.129  2.914   1.00 0.00 ? 28  LYS A HG3  5  
ATOM 6716  H HD2  . LYS A 1 28  ? 13.450  -2.125  2.857   1.00 0.00 ? 28  LYS A HD2  5  
ATOM 6717  H HD3  . LYS A 1 28  ? 14.173  -1.165  1.563   1.00 0.00 ? 28  LYS A HD3  5  
ATOM 6718  H HE2  . LYS A 1 28  ? 14.140  0.789   3.150   1.00 0.00 ? 28  LYS A HE2  5  
ATOM 6719  H HE3  . LYS A 1 28  ? 13.683  -0.344  4.420   1.00 0.00 ? 28  LYS A HE3  5  
ATOM 6720  H HZ1  . LYS A 1 28  ? 15.792  -1.596  3.502   1.00 0.00 ? 28  LYS A HZ1  5  
ATOM 6721  H HZ2  . LYS A 1 28  ? 15.923  -0.377  4.667   1.00 0.00 ? 28  LYS A HZ2  5  
ATOM 6722  H HZ3  . LYS A 1 28  ? 16.240  -0.031  3.042   1.00 0.00 ? 28  LYS A HZ3  5  
ATOM 6723  N N    . VAL A 1 29  ? 8.114   -2.234  0.176   1.00 0.00 ? 29  VAL A N    5  
ATOM 6724  C CA   . VAL A 1 29  ? 7.265   -3.227  -0.473  1.00 0.00 ? 29  VAL A CA   5  
ATOM 6725  C C    . VAL A 1 29  ? 7.933   -3.788  -1.723  1.00 0.00 ? 29  VAL A C    5  
ATOM 6726  O O    . VAL A 1 29  ? 8.434   -3.039  -2.561  1.00 0.00 ? 29  VAL A O    5  
ATOM 6727  C CB   . VAL A 1 29  ? 5.898   -2.631  -0.857  1.00 0.00 ? 29  VAL A CB   5  
ATOM 6728  C CG1  . VAL A 1 29  ? 4.995   -3.704  -1.448  1.00 0.00 ? 29  VAL A CG1  5  
ATOM 6729  C CG2  . VAL A 1 29  ? 5.244   -1.977  0.350   1.00 0.00 ? 29  VAL A CG2  5  
ATOM 6730  H H    . VAL A 1 29  ? 8.074   -1.302  -0.125  1.00 0.00 ? 29  VAL A H    5  
ATOM 6731  H HA   . VAL A 1 29  ? 7.099   -4.033  0.227   1.00 0.00 ? 29  VAL A HA   5  
ATOM 6732  H HB   . VAL A 1 29  ? 6.057   -1.873  -1.610  1.00 0.00 ? 29  VAL A HB   5  
ATOM 6733  H HG11 . VAL A 1 29  ? 3.965   -3.470  -1.223  1.00 0.00 ? 29  VAL A HG11 5  
ATOM 6734  H HG12 . VAL A 1 29  ? 5.132   -3.741  -2.518  1.00 0.00 ? 29  VAL A HG12 5  
ATOM 6735  H HG13 . VAL A 1 29  ? 5.248   -4.663  -1.019  1.00 0.00 ? 29  VAL A HG13 5  
ATOM 6736  H HG21 . VAL A 1 29  ? 5.895   -2.071  1.206   1.00 0.00 ? 29  VAL A HG21 5  
ATOM 6737  H HG22 . VAL A 1 29  ? 5.070   -0.931  0.143   1.00 0.00 ? 29  VAL A HG22 5  
ATOM 6738  H HG23 . VAL A 1 29  ? 4.302   -2.464  0.557   1.00 0.00 ? 29  VAL A HG23 5  
ATOM 6739  N N    . ALA A 1 30  ? 7.936   -5.112  -1.843  1.00 0.00 ? 30  ALA A N    5  
ATOM 6740  C CA   . ALA A 1 30  ? 8.539   -5.774  -2.993  1.00 0.00 ? 30  ALA A CA   5  
ATOM 6741  C C    . ALA A 1 30  ? 7.473   -6.367  -3.907  1.00 0.00 ? 30  ALA A C    5  
ATOM 6742  O O    . ALA A 1 30  ? 6.472   -6.908  -3.440  1.00 0.00 ? 30  ALA A O    5  
ATOM 6743  C CB   . ALA A 1 30  ? 9.504   -6.857  -2.532  1.00 0.00 ? 30  ALA A CB   5  
ATOM 6744  H H    . ALA A 1 30  ? 7.520   -5.656  -1.142  1.00 0.00 ? 30  ALA A H    5  
ATOM 6745  H HA   . ALA A 1 30  ? 9.103   -5.035  -3.545  1.00 0.00 ? 30  ALA A HA   5  
ATOM 6746  H HB1  . ALA A 1 30  ? 9.377   -7.022  -1.471  1.00 0.00 ? 30  ALA A HB1  5  
ATOM 6747  H HB2  . ALA A 1 30  ? 9.299   -7.772  -3.066  1.00 0.00 ? 30  ALA A HB2  5  
ATOM 6748  H HB3  . ALA A 1 30  ? 10.518  -6.543  -2.729  1.00 0.00 ? 30  ALA A HB3  5  
ATOM 6749  N N    . GLY A 1 31  ? 7.694   -6.260  -5.214  1.00 0.00 ? 31  GLY A N    5  
ATOM 6750  C CA   . GLY A 1 31  ? 6.743   -6.790  -6.173  1.00 0.00 ? 31  GLY A CA   5  
ATOM 6751  C C    . GLY A 1 31  ? 7.415   -7.320  -7.424  1.00 0.00 ? 31  GLY A C    5  
ATOM 6752  O O    . GLY A 1 31  ? 8.589   -7.687  -7.396  1.00 0.00 ? 31  GLY A O    5  
ATOM 6753  H H    . GLY A 1 31  ? 8.510   -5.818  -5.529  1.00 0.00 ? 31  GLY A H    5  
ATOM 6754  H HA2  . GLY A 1 31  ? 6.187   -7.590  -5.708  1.00 0.00 ? 31  GLY A HA2  5  
ATOM 6755  H HA3  . GLY A 1 31  ? 6.056   -6.004  -6.453  1.00 0.00 ? 31  GLY A HA3  5  
ATOM 6756  N N    . GLN A 1 32  ? 6.668   -7.363  -8.522  1.00 0.00 ? 32  GLN A N    5  
ATOM 6757  C CA   . GLN A 1 32  ? 7.199   -7.855  -9.788  1.00 0.00 ? 32  GLN A CA   5  
ATOM 6758  C C    . GLN A 1 32  ? 8.045   -6.788  -10.475 1.00 0.00 ? 32  GLN A C    5  
ATOM 6759  O O    . GLN A 1 32  ? 7.782   -5.593  -10.343 1.00 0.00 ? 32  GLN A O    5  
ATOM 6760  C CB   . GLN A 1 32  ? 6.058   -8.290  -10.709 1.00 0.00 ? 32  GLN A CB   5  
ATOM 6761  C CG   . GLN A 1 32  ? 6.532   -8.915  -12.011 1.00 0.00 ? 32  GLN A CG   5  
ATOM 6762  C CD   . GLN A 1 32  ? 6.788   -7.886  -13.094 1.00 0.00 ? 32  GLN A CD   5  
ATOM 6763  O OE1  . GLN A 1 32  ? 6.184   -6.813  -13.101 1.00 0.00 ? 32  GLN A OE1  5  
ATOM 6764  N NE2  . GLN A 1 32  ? 7.687   -8.207  -14.017 1.00 0.00 ? 32  GLN A NE2  5  
ATOM 6765  H H    . GLN A 1 32  ? 5.739   -7.056  -8.481  1.00 0.00 ? 32  GLN A H    5  
ATOM 6766  H HA   . GLN A 1 32  ? 7.823   -8.710  -9.575  1.00 0.00 ? 32  GLN A HA   5  
ATOM 6767  H HB2  . GLN A 1 32  ? 5.447   -9.012  -10.189 1.00 0.00 ? 32  GLN A HB2  5  
ATOM 6768  H HB3  . GLN A 1 32  ? 5.455   -7.426  -10.949 1.00 0.00 ? 32  GLN A HB3  5  
ATOM 6769  H HG2  . GLN A 1 32  ? 7.449   -9.454  -11.824 1.00 0.00 ? 32  GLN A HG2  5  
ATOM 6770  H HG3  . GLN A 1 32  ? 5.777   -9.604  -12.361 1.00 0.00 ? 32  GLN A HG3  5  
ATOM 6771  H HE21 . GLN A 1 32  ? 8.128   -9.081  -13.948 1.00 0.00 ? 32  GLN A HE21 5  
ATOM 6772  H HE22 . GLN A 1 32  ? 7.871   -7.561  -14.729 1.00 0.00 ? 32  GLN A HE22 5  
ATOM 6773  N N    . ASP A 1 33  ? 9.061   -7.229  -11.209 1.00 0.00 ? 33  ASP A N    5  
ATOM 6774  C CA   . ASP A 1 33  ? 9.946   -6.311  -11.918 1.00 0.00 ? 33  ASP A CA   5  
ATOM 6775  C C    . ASP A 1 33  ? 10.863  -5.579  -10.944 1.00 0.00 ? 33  ASP A C    5  
ATOM 6776  O O    . ASP A 1 33  ? 11.061  -4.370  -11.052 1.00 0.00 ? 33  ASP A O    5  
ATOM 6777  C CB   . ASP A 1 33  ? 9.128   -5.302  -12.725 1.00 0.00 ? 33  ASP A CB   5  
ATOM 6778  C CG   . ASP A 1 33  ? 9.914   -4.709  -13.878 1.00 0.00 ? 33  ASP A CG   5  
ATOM 6779  O OD1  . ASP A 1 33  ? 10.814  -3.883  -13.619 1.00 0.00 ? 33  ASP A OD1  5  
ATOM 6780  O OD2  . ASP A 1 33  ? 9.629   -5.070  -15.039 1.00 0.00 ? 33  ASP A OD2  5  
ATOM 6781  H H    . ASP A 1 33  ? 9.219   -8.194  -11.276 1.00 0.00 ? 33  ASP A H    5  
ATOM 6782  H HA   . ASP A 1 33  ? 10.552  -6.893  -12.596 1.00 0.00 ? 33  ASP A HA   5  
ATOM 6783  H HB2  . ASP A 1 33  ? 8.254   -5.794  -13.126 1.00 0.00 ? 33  ASP A HB2  5  
ATOM 6784  H HB3  . ASP A 1 33  ? 8.816   -4.498  -12.074 1.00 0.00 ? 33  ASP A HB3  5  
ATOM 6785  N N    . GLY A 1 34  ? 11.421  -6.321  -9.992  1.00 0.00 ? 34  GLY A N    5  
ATOM 6786  C CA   . GLY A 1 34  ? 12.309  -5.725  -9.012  1.00 0.00 ? 34  GLY A CA   5  
ATOM 6787  C C    . GLY A 1 34  ? 11.884  -4.324  -8.620  1.00 0.00 ? 34  GLY A C    5  
ATOM 6788  O O    . GLY A 1 34  ? 12.712  -3.416  -8.542  1.00 0.00 ? 34  GLY A O    5  
ATOM 6789  H H    . GLY A 1 34  ? 11.227  -7.281  -9.955  1.00 0.00 ? 34  GLY A H    5  
ATOM 6790  H HA2  . GLY A 1 34  ? 12.322  -6.347  -8.129  1.00 0.00 ? 34  GLY A HA2  5  
ATOM 6791  H HA3  . GLY A 1 34  ? 13.306  -5.684  -9.425  1.00 0.00 ? 34  GLY A HA3  5  
ATOM 6792  N N    . SER A 1 35  ? 10.590  -4.146  -8.375  1.00 0.00 ? 35  SER A N    5  
ATOM 6793  C CA   . SER A 1 35  ? 10.056  -2.844  -7.995  1.00 0.00 ? 35  SER A CA   5  
ATOM 6794  C C    . SER A 1 35  ? 9.908   -2.738  -6.480  1.00 0.00 ? 35  SER A C    5  
ATOM 6795  O O    . SER A 1 35  ? 9.227   -3.550  -5.853  1.00 0.00 ? 35  SER A O    5  
ATOM 6796  C CB   . SER A 1 35  ? 8.702   -2.609  -8.668  1.00 0.00 ? 35  SER A CB   5  
ATOM 6797  O OG   . SER A 1 35  ? 8.368   -1.231  -8.674  1.00 0.00 ? 35  SER A OG   5  
ATOM 6798  H H    . SER A 1 35  ? 9.980   -4.910  -8.455  1.00 0.00 ? 35  SER A H    5  
ATOM 6799  H HA   . SER A 1 35  ? 10.751  -2.089  -8.331  1.00 0.00 ? 35  SER A HA   5  
ATOM 6800  H HB2  . SER A 1 35  ? 8.744   -2.960  -9.688  1.00 0.00 ? 35  SER A HB2  5  
ATOM 6801  H HB3  . SER A 1 35  ? 7.937   -3.150  -8.131  1.00 0.00 ? 35  SER A HB3  5  
ATOM 6802  H HG   . SER A 1 35  ? 7.489   -1.116  -9.042  1.00 0.00 ? 35  SER A HG   5  
ATOM 6803  N N    . VAL A 1 36  ? 10.552  -1.731  -5.898  1.00 0.00 ? 36  VAL A N    5  
ATOM 6804  C CA   . VAL A 1 36  ? 10.493  -1.517  -4.457  1.00 0.00 ? 36  VAL A CA   5  
ATOM 6805  C C    . VAL A 1 36  ? 9.826   -0.187  -4.126  1.00 0.00 ? 36  VAL A C    5  
ATOM 6806  O O    . VAL A 1 36  ? 10.354  0.880   -4.443  1.00 0.00 ? 36  VAL A O    5  
ATOM 6807  C CB   . VAL A 1 36  ? 11.898  -1.546  -3.828  1.00 0.00 ? 36  VAL A CB   5  
ATOM 6808  C CG1  . VAL A 1 36  ? 11.814  -1.331  -2.324  1.00 0.00 ? 36  VAL A CG1  5  
ATOM 6809  C CG2  . VAL A 1 36  ? 12.599  -2.857  -4.149  1.00 0.00 ? 36  VAL A CG2  5  
ATOM 6810  H H    . VAL A 1 36  ? 11.079  -1.118  -6.451  1.00 0.00 ? 36  VAL A H    5  
ATOM 6811  H HA   . VAL A 1 36  ? 9.911   -2.318  -4.024  1.00 0.00 ? 36  VAL A HA   5  
ATOM 6812  H HB   . VAL A 1 36  ? 12.477  -0.739  -4.252  1.00 0.00 ? 36  VAL A HB   5  
ATOM 6813  H HG11 . VAL A 1 36  ? 11.197  -0.469  -2.118  1.00 0.00 ? 36  VAL A HG11 5  
ATOM 6814  H HG12 . VAL A 1 36  ? 11.382  -2.204  -1.859  1.00 0.00 ? 36  VAL A HG12 5  
ATOM 6815  H HG13 . VAL A 1 36  ? 12.806  -1.165  -1.929  1.00 0.00 ? 36  VAL A HG13 5  
ATOM 6816  H HG21 . VAL A 1 36  ? 13.025  -3.267  -3.245  1.00 0.00 ? 36  VAL A HG21 5  
ATOM 6817  H HG22 . VAL A 1 36  ? 11.885  -3.556  -4.560  1.00 0.00 ? 36  VAL A HG22 5  
ATOM 6818  H HG23 . VAL A 1 36  ? 13.384  -2.680  -4.869  1.00 0.00 ? 36  VAL A HG23 5  
ATOM 6819  N N    . VAL A 1 37  ? 8.663   -0.257  -3.486  1.00 0.00 ? 37  VAL A N    5  
ATOM 6820  C CA   . VAL A 1 37  ? 7.924   0.943   -3.110  1.00 0.00 ? 37  VAL A CA   5  
ATOM 6821  C C    . VAL A 1 37  ? 7.916   1.131   -1.598  1.00 0.00 ? 37  VAL A C    5  
ATOM 6822  O O    . VAL A 1 37  ? 7.484   0.250   -0.855  1.00 0.00 ? 37  VAL A O    5  
ATOM 6823  C CB   . VAL A 1 37  ? 6.471   0.889   -3.618  1.00 0.00 ? 37  VAL A CB   5  
ATOM 6824  C CG1  . VAL A 1 37  ? 5.840   2.272   -3.577  1.00 0.00 ? 37  VAL A CG1  5  
ATOM 6825  C CG2  . VAL A 1 37  ? 6.420   0.311   -5.025  1.00 0.00 ? 37  VAL A CG2  5  
ATOM 6826  H H    . VAL A 1 37  ? 8.294   -1.136  -3.261  1.00 0.00 ? 37  VAL A H    5  
ATOM 6827  H HA   . VAL A 1 37  ? 8.412   1.792   -3.567  1.00 0.00 ? 37  VAL A HA   5  
ATOM 6828  H HB   . VAL A 1 37  ? 5.907   0.240   -2.964  1.00 0.00 ? 37  VAL A HB   5  
ATOM 6829  H HG11 . VAL A 1 37  ? 4.966   2.287   -4.212  1.00 0.00 ? 37  VAL A HG11 5  
ATOM 6830  H HG12 . VAL A 1 37  ? 5.553   2.508   -2.563  1.00 0.00 ? 37  VAL A HG12 5  
ATOM 6831  H HG13 . VAL A 1 37  ? 6.552   3.003   -3.930  1.00 0.00 ? 37  VAL A HG13 5  
ATOM 6832  H HG21 . VAL A 1 37  ? 7.189   0.769   -5.629  1.00 0.00 ? 37  VAL A HG21 5  
ATOM 6833  H HG22 . VAL A 1 37  ? 6.583   -0.756  -4.982  1.00 0.00 ? 37  VAL A HG22 5  
ATOM 6834  H HG23 . VAL A 1 37  ? 5.452   0.510   -5.461  1.00 0.00 ? 37  VAL A HG23 5  
ATOM 6835  N N    . GLN A 1 38  ? 8.396   2.286   -1.148  1.00 0.00 ? 38  GLN A N    5  
ATOM 6836  C CA   . GLN A 1 38  ? 8.443   2.590   0.277   1.00 0.00 ? 38  GLN A CA   5  
ATOM 6837  C C    . GLN A 1 38  ? 7.204   3.366   0.710   1.00 0.00 ? 38  GLN A C    5  
ATOM 6838  O O    . GLN A 1 38  ? 6.524   3.979   -0.113  1.00 0.00 ? 38  GLN A O    5  
ATOM 6839  C CB   . GLN A 1 38  ? 9.703   3.392   0.607   1.00 0.00 ? 38  GLN A CB   5  
ATOM 6840  C CG   . GLN A 1 38  ? 10.976  2.562   0.588   1.00 0.00 ? 38  GLN A CG   5  
ATOM 6841  C CD   . GLN A 1 38  ? 12.208  3.388   0.276   1.00 0.00 ? 38  GLN A CD   5  
ATOM 6842  O OE1  . GLN A 1 38  ? 12.365  4.503   0.775   1.00 0.00 ? 38  GLN A OE1  5  
ATOM 6843  N NE2  . GLN A 1 38  ? 13.091  2.845   -0.554  1.00 0.00 ? 38  GLN A NE2  5  
ATOM 6844  H H    . GLN A 1 38  ? 8.726   2.949   -1.789  1.00 0.00 ? 38  GLN A H    5  
ATOM 6845  H HA   . GLN A 1 38  ? 8.473   1.654   0.815   1.00 0.00 ? 38  GLN A HA   5  
ATOM 6846  H HB2  . GLN A 1 38  ? 9.808   4.189   -0.114  1.00 0.00 ? 38  GLN A HB2  5  
ATOM 6847  H HB3  . GLN A 1 38  ? 9.595   3.821   1.593   1.00 0.00 ? 38  GLN A HB3  5  
ATOM 6848  H HG2  . GLN A 1 38  ? 11.106  2.102   1.556   1.00 0.00 ? 38  GLN A HG2  5  
ATOM 6849  H HG3  . GLN A 1 38  ? 10.877  1.792   -0.164  1.00 0.00 ? 38  GLN A HG3  5  
ATOM 6850  H HE21 . GLN A 1 38  ? 12.899  1.954   -0.915  1.00 0.00 ? 38  GLN A HE21 5  
ATOM 6851  H HE22 . GLN A 1 38  ? 13.896  3.358   -0.774  1.00 0.00 ? 38  GLN A HE22 5  
ATOM 6852  N N    . PHE A 1 39  ? 6.915   3.335   2.007   1.00 0.00 ? 39  PHE A N    5  
ATOM 6853  C CA   . PHE A 1 39  ? 5.757   4.035   2.549   1.00 0.00 ? 39  PHE A CA   5  
ATOM 6854  C C    . PHE A 1 39  ? 6.010   4.471   3.989   1.00 0.00 ? 39  PHE A C    5  
ATOM 6855  O O    . PHE A 1 39  ? 6.397   3.666   4.836   1.00 0.00 ? 39  PHE A O    5  
ATOM 6856  C CB   . PHE A 1 39  ? 4.518   3.139   2.486   1.00 0.00 ? 39  PHE A CB   5  
ATOM 6857  C CG   . PHE A 1 39  ? 4.098   2.794   1.086   1.00 0.00 ? 39  PHE A CG   5  
ATOM 6858  C CD1  . PHE A 1 39  ? 4.662   1.715   0.425   1.00 0.00 ? 39  PHE A CD1  5  
ATOM 6859  C CD2  . PHE A 1 39  ? 3.138   3.549   0.431   1.00 0.00 ? 39  PHE A CD2  5  
ATOM 6860  C CE1  . PHE A 1 39  ? 4.278   1.396   -0.864  1.00 0.00 ? 39  PHE A CE1  5  
ATOM 6861  C CE2  . PHE A 1 39  ? 2.750   3.235   -0.858  1.00 0.00 ? 39  PHE A CE2  5  
ATOM 6862  C CZ   . PHE A 1 39  ? 3.320   2.156   -1.506  1.00 0.00 ? 39  PHE A CZ   5  
ATOM 6863  H H    . PHE A 1 39  ? 7.496   2.829   2.614   1.00 0.00 ? 39  PHE A H    5  
ATOM 6864  H HA   . PHE A 1 39  ? 5.587   4.912   1.944   1.00 0.00 ? 39  PHE A HA   5  
ATOM 6865  H HB2  . PHE A 1 39  ? 4.723   2.216   3.007   1.00 0.00 ? 39  PHE A HB2  5  
ATOM 6866  H HB3  . PHE A 1 39  ? 3.693   3.643   2.967   1.00 0.00 ? 39  PHE A HB3  5  
ATOM 6867  H HD1  . PHE A 1 39  ? 5.411   1.119   0.926   1.00 0.00 ? 39  PHE A HD1  5  
ATOM 6868  H HD2  . PHE A 1 39  ? 2.691   4.393   0.937   1.00 0.00 ? 39  PHE A HD2  5  
ATOM 6869  H HE1  . PHE A 1 39  ? 4.725   0.553   -1.368  1.00 0.00 ? 39  PHE A HE1  5  
ATOM 6870  H HE2  . PHE A 1 39  ? 2.000   3.831   -1.357  1.00 0.00 ? 39  PHE A HE2  5  
ATOM 6871  H HZ   . PHE A 1 39  ? 3.018   1.910   -2.512  1.00 0.00 ? 39  PHE A HZ   5  
ATOM 6872  N N    . LYS A 1 40  ? 5.788   5.753   4.260   1.00 0.00 ? 40  LYS A N    5  
ATOM 6873  C CA   . LYS A 1 40  ? 5.991   6.299   5.597   1.00 0.00 ? 40  LYS A CA   5  
ATOM 6874  C C    . LYS A 1 40  ? 4.660   6.679   6.237   1.00 0.00 ? 40  LYS A C    5  
ATOM 6875  O O    . LYS A 1 40  ? 4.006   7.632   5.813   1.00 0.00 ? 40  LYS A O    5  
ATOM 6876  C CB   . LYS A 1 40  ? 6.907   7.524   5.536   1.00 0.00 ? 40  LYS A CB   5  
ATOM 6877  C CG   . LYS A 1 40  ? 7.056   8.239   6.868   1.00 0.00 ? 40  LYS A CG   5  
ATOM 6878  C CD   . LYS A 1 40  ? 7.396   9.707   6.678   1.00 0.00 ? 40  LYS A CD   5  
ATOM 6879  C CE   . LYS A 1 40  ? 8.158   10.262  7.871   1.00 0.00 ? 40  LYS A CE   5  
ATOM 6880  N NZ   . LYS A 1 40  ? 9.511   9.652   7.998   1.00 0.00 ? 40  LYS A NZ   5  
ATOM 6881  H H    . LYS A 1 40  ? 5.480   6.347   3.543   1.00 0.00 ? 40  LYS A H    5  
ATOM 6882  H HA   . LYS A 1 40  ? 6.462   5.537   6.199   1.00 0.00 ? 40  LYS A HA   5  
ATOM 6883  H HB2  . LYS A 1 40  ? 7.887   7.209   5.208   1.00 0.00 ? 40  LYS A HB2  5  
ATOM 6884  H HB3  . LYS A 1 40  ? 6.505   8.224   4.819   1.00 0.00 ? 40  LYS A HB3  5  
ATOM 6885  H HG2  . LYS A 1 40  ? 6.126   8.163   7.413   1.00 0.00 ? 40  LYS A HG2  5  
ATOM 6886  H HG3  . LYS A 1 40  ? 7.846   7.766   7.434   1.00 0.00 ? 40  LYS A HG3  5  
ATOM 6887  H HD2  . LYS A 1 40  ? 8.007   9.815   5.794   1.00 0.00 ? 40  LYS A HD2  5  
ATOM 6888  H HD3  . LYS A 1 40  ? 6.480   10.267  6.555   1.00 0.00 ? 40  LYS A HD3  5  
ATOM 6889  H HE2  . LYS A 1 40  ? 8.264   11.329  7.750   1.00 0.00 ? 40  LYS A HE2  5  
ATOM 6890  H HE3  . LYS A 1 40  ? 7.595   10.056  8.769   1.00 0.00 ? 40  LYS A HE3  5  
ATOM 6891  H HZ1  . LYS A 1 40  ? 9.611   9.195   8.927   1.00 0.00 ? 40  LYS A HZ1  5  
ATOM 6892  H HZ2  . LYS A 1 40  ? 10.243  10.384  7.904   1.00 0.00 ? 40  LYS A HZ2  5  
ATOM 6893  H HZ3  . LYS A 1 40  ? 9.652   8.938   7.255   1.00 0.00 ? 40  LYS A HZ3  5  
ATOM 6894  N N    . ILE A 1 41  ? 4.265   5.928   7.260   1.00 0.00 ? 41  ILE A N    5  
ATOM 6895  C CA   . ILE A 1 41  ? 3.013   6.188   7.960   1.00 0.00 ? 41  ILE A CA   5  
ATOM 6896  C C    . ILE A 1 41  ? 3.228   6.246   9.468   1.00 0.00 ? 41  ILE A C    5  
ATOM 6897  O O    . ILE A 1 41  ? 4.341   6.049   9.956   1.00 0.00 ? 41  ILE A O    5  
ATOM 6898  C CB   . ILE A 1 41  ? 1.958   5.111   7.644   1.00 0.00 ? 41  ILE A CB   5  
ATOM 6899  C CG1  . ILE A 1 41  ? 2.215   3.854   8.478   1.00 0.00 ? 41  ILE A CG1  5  
ATOM 6900  C CG2  . ILE A 1 41  ? 1.967   4.780   6.159   1.00 0.00 ? 41  ILE A CG2  5  
ATOM 6901  C CD1  . ILE A 1 41  ? 1.187   2.766   8.262   1.00 0.00 ? 41  ILE A CD1  5  
ATOM 6902  H H    . ILE A 1 41  ? 4.830   5.182   7.551   1.00 0.00 ? 41  ILE A H    5  
ATOM 6903  H HA   . ILE A 1 41  ? 2.636   7.143   7.623   1.00 0.00 ? 41  ILE A HA   5  
ATOM 6904  H HB   . ILE A 1 41  ? 0.986   5.508   7.894   1.00 0.00 ? 41  ILE A HB   5  
ATOM 6905  H HG12 . ILE A 1 41  ? 3.182   3.452   8.221   1.00 0.00 ? 41  ILE A HG12 5  
ATOM 6906  H HG13 . ILE A 1 41  ? 2.206   4.118   9.525   1.00 0.00 ? 41  ILE A HG13 5  
ATOM 6907  H HG21 . ILE A 1 41  ? 2.191   3.732   6.026   1.00 0.00 ? 41  ILE A HG21 5  
ATOM 6908  H HG22 . ILE A 1 41  ? 0.997   4.996   5.737   1.00 0.00 ? 41  ILE A HG22 5  
ATOM 6909  H HG23 . ILE A 1 41  ? 2.718   5.375   5.662   1.00 0.00 ? 41  ILE A HG23 5  
ATOM 6910  H HD11 . ILE A 1 41  ? 0.678   2.931   7.324   1.00 0.00 ? 41  ILE A HD11 5  
ATOM 6911  H HD12 . ILE A 1 41  ? 1.678   1.805   8.242   1.00 0.00 ? 41  ILE A HD12 5  
ATOM 6912  H HD13 . ILE A 1 41  ? 0.468   2.785   9.069   1.00 0.00 ? 41  ILE A HD13 5  
ATOM 6913  N N    . LYS A 1 42  ? 2.155   6.517   10.203  1.00 0.00 ? 42  LYS A N    5  
ATOM 6914  C CA   . LYS A 1 42  ? 2.224   6.598   11.657  1.00 0.00 ? 42  LYS A CA   5  
ATOM 6915  C C    . LYS A 1 42  ? 2.006   5.228   12.290  1.00 0.00 ? 42  LYS A C    5  
ATOM 6916  O O    . LYS A 1 42  ? 1.440   4.329   11.667  1.00 0.00 ? 42  LYS A O    5  
ATOM 6917  C CB   . LYS A 1 42  ? 1.179   7.586   12.183  1.00 0.00 ? 42  LYS A CB   5  
ATOM 6918  C CG   . LYS A 1 42  ? 1.080   8.860   11.363  1.00 0.00 ? 42  LYS A CG   5  
ATOM 6919  C CD   . LYS A 1 42  ? -0.199  9.621   11.668  1.00 0.00 ? 42  LYS A CD   5  
ATOM 6920  C CE   . LYS A 1 42  ? -0.462  10.707  10.636  1.00 0.00 ? 42  LYS A CE   5  
ATOM 6921  N NZ   . LYS A 1 42  ? -0.727  10.137  9.286   1.00 0.00 ? 42  LYS A NZ   5  
ATOM 6922  H H    . LYS A 1 42  ? 1.295   6.665   9.756   1.00 0.00 ? 42  LYS A H    5  
ATOM 6923  H HA   . LYS A 1 42  ? 3.208   6.953   11.924  1.00 0.00 ? 42  LYS A HA   5  
ATOM 6924  H HB2  . LYS A 1 42  ? 0.213   7.104   12.181  1.00 0.00 ? 42  LYS A HB2  5  
ATOM 6925  H HB3  . LYS A 1 42  ? 1.435   7.855   13.198  1.00 0.00 ? 42  LYS A HB3  5  
ATOM 6926  H HG2  . LYS A 1 42  ? 1.925   9.492   11.591  1.00 0.00 ? 42  LYS A HG2  5  
ATOM 6927  H HG3  . LYS A 1 42  ? 1.093   8.603   10.313  1.00 0.00 ? 42  LYS A HG3  5  
ATOM 6928  H HD2  . LYS A 1 42  ? -1.029  8.930   11.665  1.00 0.00 ? 42  LYS A HD2  5  
ATOM 6929  H HD3  . LYS A 1 42  ? -0.112  10.078  12.644  1.00 0.00 ? 42  LYS A HD3  5  
ATOM 6930  H HE2  . LYS A 1 42  ? -1.319  11.283  10.948  1.00 0.00 ? 42  LYS A HE2  5  
ATOM 6931  H HE3  . LYS A 1 42  ? 0.404   11.351  10.582  1.00 0.00 ? 42  LYS A HE3  5  
ATOM 6932  H HZ1  . LYS A 1 42  ? -1.157  9.194   9.375   1.00 0.00 ? 42  LYS A HZ1  5  
ATOM 6933  H HZ2  . LYS A 1 42  ? 0.162   10.051  8.753   1.00 0.00 ? 42  LYS A HZ2  5  
ATOM 6934  H HZ3  . LYS A 1 42  ? -1.376  10.754  8.758   1.00 0.00 ? 42  LYS A HZ3  5  
ATOM 6935  N N    . ARG A 1 43  ? 2.459   5.075   13.530  1.00 0.00 ? 43  ARG A N    5  
ATOM 6936  C CA   . ARG A 1 43  ? 2.313   3.814   14.247  1.00 0.00 ? 43  ARG A CA   5  
ATOM 6937  C C    . ARG A 1 43  ? 0.863   3.592   14.668  1.00 0.00 ? 43  ARG A C    5  
ATOM 6938  O O    . ARG A 1 43  ? 0.482   2.490   15.064  1.00 0.00 ? 43  ARG A O    5  
ATOM 6939  C CB   . ARG A 1 43  ? 3.222   3.794   15.477  1.00 0.00 ? 43  ARG A CB   5  
ATOM 6940  C CG   . ARG A 1 43  ? 2.772   4.736   16.582  1.00 0.00 ? 43  ARG A CG   5  
ATOM 6941  C CD   . ARG A 1 43  ? 3.931   5.132   17.483  1.00 0.00 ? 43  ARG A CD   5  
ATOM 6942  N NE   . ARG A 1 43  ? 3.672   6.383   18.190  1.00 0.00 ? 43  ARG A NE   5  
ATOM 6943  C CZ   . ARG A 1 43  ? 4.419   6.828   19.195  1.00 0.00 ? 43  ARG A CZ   5  
ATOM 6944  N NH1  . ARG A 1 43  ? 5.466   6.127   19.607  1.00 0.00 ? 43  ARG A NH1  5  
ATOM 6945  N NH2  . ARG A 1 43  ? 4.119   7.976   19.788  1.00 0.00 ? 43  ARG A NH2  5  
ATOM 6946  H H    . ARG A 1 43  ? 2.901   5.828   13.974  1.00 0.00 ? 43  ARG A H    5  
ATOM 6947  H HA   . ARG A 1 43  ? 2.608   3.017   13.580  1.00 0.00 ? 43  ARG A HA   5  
ATOM 6948  H HB2  . ARG A 1 43  ? 3.245   2.791   15.877  1.00 0.00 ? 43  ARG A HB2  5  
ATOM 6949  H HB3  . ARG A 1 43  ? 4.219   4.076   15.177  1.00 0.00 ? 43  ARG A HB3  5  
ATOM 6950  H HG2  . ARG A 1 43  ? 2.357   5.627   16.135  1.00 0.00 ? 43  ARG A HG2  5  
ATOM 6951  H HG3  . ARG A 1 43  ? 2.016   4.244   17.176  1.00 0.00 ? 43  ARG A HG3  5  
ATOM 6952  H HD2  . ARG A 1 43  ? 4.091   4.347   18.207  1.00 0.00 ? 43  ARG A HD2  5  
ATOM 6953  H HD3  . ARG A 1 43  ? 4.817   5.248   16.877  1.00 0.00 ? 43  ARG A HD3  5  
ATOM 6954  H HE   . ARG A 1 43  ? 2.903   6.917   17.902  1.00 0.00 ? 43  ARG A HE   5  
ATOM 6955  H HH11 . ARG A 1 43  ? 5.695   5.262   19.161  1.00 0.00 ? 43  ARG A HH11 5  
ATOM 6956  H HH12 . ARG A 1 43  ? 6.028   6.465   20.363  1.00 0.00 ? 43  ARG A HH12 5  
ATOM 6957  H HH21 . ARG A 1 43  ? 3.331   8.507   19.480  1.00 0.00 ? 43  ARG A HH21 5  
ATOM 6958  H HH22 . ARG A 1 43  ? 4.682   8.310   20.544  1.00 0.00 ? 43  ARG A HH22 5  
ATOM 6959  N N    . HIS A 1 44  ? 0.059   4.647   14.580  1.00 0.00 ? 44  HIS A N    5  
ATOM 6960  C CA   . HIS A 1 44  ? -1.349  4.567   14.952  1.00 0.00 ? 44  HIS A CA   5  
ATOM 6961  C C    . HIS A 1 44  ? -2.245  4.755   13.731  1.00 0.00 ? 44  HIS A C    5  
ATOM 6962  O O    . HIS A 1 44  ? -3.428  5.072   13.859  1.00 0.00 ? 44  HIS A O    5  
ATOM 6963  C CB   . HIS A 1 44  ? -1.680  5.622   16.009  1.00 0.00 ? 44  HIS A CB   5  
ATOM 6964  C CG   . HIS A 1 44  ? -1.853  6.999   15.446  1.00 0.00 ? 44  HIS A CG   5  
ATOM 6965  N ND1  . HIS A 1 44  ? -3.082  7.523   15.104  1.00 0.00 ? 44  HIS A ND1  5  
ATOM 6966  C CD2  . HIS A 1 44  ? -0.944  7.963   15.168  1.00 0.00 ? 44  HIS A CD2  5  
ATOM 6967  C CE1  . HIS A 1 44  ? -2.921  8.749   14.638  1.00 0.00 ? 44  HIS A CE1  5  
ATOM 6968  N NE2  . HIS A 1 44  ? -1.633  9.040   14.667  1.00 0.00 ? 44  HIS A NE2  5  
ATOM 6969  H H    . HIS A 1 44  ? 0.421   5.498   14.257  1.00 0.00 ? 44  HIS A H    5  
ATOM 6970  H HA   . HIS A 1 44  ? -1.528  3.587   15.367  1.00 0.00 ? 44  HIS A HA   5  
ATOM 6971  H HB2  . HIS A 1 44  ? -2.599  5.349   16.505  1.00 0.00 ? 44  HIS A HB2  5  
ATOM 6972  H HB3  . HIS A 1 44  ? -0.880  5.658   16.735  1.00 0.00 ? 44  HIS A HB3  5  
ATOM 6973  H HD1  . HIS A 1 44  ? -3.943  7.064   15.189  1.00 0.00 ? 44  HIS A HD1  5  
ATOM 6974  H HD2  . HIS A 1 44  ? 0.125   7.898   15.312  1.00 0.00 ? 44  HIS A HD2  5  
ATOM 6975  H HE1  . HIS A 1 44  ? -3.709  9.402   14.293  1.00 0.00 ? 44  HIS A HE1  5  
ATOM 6976  H HE2  . HIS A 1 44  ? -1.231  9.853   14.298  1.00 0.00 ? 44  HIS A HE2  5  
ATOM 6977  N N    . THR A 1 45  ? -1.673  4.556   12.548  1.00 0.00 ? 45  THR A N    5  
ATOM 6978  C CA   . THR A 1 45  ? -2.419  4.705   11.304  1.00 0.00 ? 45  THR A CA   5  
ATOM 6979  C C    . THR A 1 45  ? -2.623  3.358   10.621  1.00 0.00 ? 45  THR A C    5  
ATOM 6980  O O    . THR A 1 45  ? -1.693  2.567   10.464  1.00 0.00 ? 45  THR A O    5  
ATOM 6981  C CB   . THR A 1 45  ? -1.702  5.659   10.330  1.00 0.00 ? 45  THR A CB   5  
ATOM 6982  O OG1  . THR A 1 45  ? -1.901  7.017   10.739  1.00 0.00 ? 45  THR A OG1  5  
ATOM 6983  C CG2  . THR A 1 45  ? -2.217  5.470   8.911   1.00 0.00 ? 45  THR A CG2  5  
ATOM 6984  H H    . THR A 1 45  ? -0.727  4.304   12.511  1.00 0.00 ? 45  THR A H    5  
ATOM 6985  H HA   . THR A 1 45  ? -3.385  5.127   11.543  1.00 0.00 ? 45  THR A HA   5  
ATOM 6986  H HB   . THR A 1 45  ? -0.644  5.437   10.346  1.00 0.00 ? 45  THR A HB   5  
ATOM 6987  H HG1  . THR A 1 45  ? -2.795  7.123   11.072  1.00 0.00 ? 45  THR A HG1  5  
ATOM 6988  H HG21 . THR A 1 45  ? -1.722  6.169   8.253   1.00 0.00 ? 45  THR A HG21 5  
ATOM 6989  H HG22 . THR A 1 45  ? -3.282  5.646   8.888   1.00 0.00 ? 45  THR A HG22 5  
ATOM 6990  H HG23 . THR A 1 45  ? -2.011  4.462   8.585   1.00 0.00 ? 45  THR A HG23 5  
ATOM 6991  N N    . PRO A 1 46  ? -3.869  3.088   10.203  1.00 0.00 ? 46  PRO A N    5  
ATOM 6992  C CA   . PRO A 1 46  ? -4.223  1.836   9.528   1.00 0.00 ? 46  PRO A CA   5  
ATOM 6993  C C    . PRO A 1 46  ? -3.628  1.744   8.127   1.00 0.00 ? 46  PRO A C    5  
ATOM 6994  O O    . PRO A 1 46  ? -3.732  2.682   7.335   1.00 0.00 ? 46  PRO A O    5  
ATOM 6995  C CB   . PRO A 1 46  ? -5.751  1.892   9.457   1.00 0.00 ? 46  PRO A CB   5  
ATOM 6996  C CG   . PRO A 1 46  ? -6.080  3.345   9.495   1.00 0.00 ? 46  PRO A CG   5  
ATOM 6997  C CD   . PRO A 1 46  ? -5.027  3.985   10.357  1.00 0.00 ? 46  PRO A CD   5  
ATOM 6998  H HA   . PRO A 1 46  ? -3.919  0.975   10.104  1.00 0.00 ? 46  PRO A HA   5  
ATOM 6999  H HB2  . PRO A 1 46  ? -6.089  1.434   8.538   1.00 0.00 ? 46  PRO A HB2  5  
ATOM 7000  H HB3  . PRO A 1 46  ? -6.174  1.370   10.303  1.00 0.00 ? 46  PRO A HB3  5  
ATOM 7001  H HG2  . PRO A 1 46  ? -6.048  3.755   8.497   1.00 0.00 ? 46  PRO A HG2  5  
ATOM 7002  H HG3  . PRO A 1 46  ? -7.058  3.488   9.931   1.00 0.00 ? 46  PRO A HG3  5  
ATOM 7003  H HD2  . PRO A 1 46  ? -4.797  4.977   9.998   1.00 0.00 ? 46  PRO A HD2  5  
ATOM 7004  H HD3  . PRO A 1 46  ? -5.352  4.020   11.386  1.00 0.00 ? 46  PRO A HD3  5  
ATOM 7005  N N    . LEU A 1 47  ? -3.006  0.610   7.827   1.00 0.00 ? 47  LEU A N    5  
ATOM 7006  C CA   . LEU A 1 47  ? -2.395  0.395   6.520   1.00 0.00 ? 47  LEU A CA   5  
ATOM 7007  C C    . LEU A 1 47  ? -3.367  0.747   5.399   1.00 0.00 ? 47  LEU A C    5  
ATOM 7008  O O    . LEU A 1 47  ? -2.961  0.978   4.260   1.00 0.00 ? 47  LEU A O    5  
ATOM 7009  C CB   . LEU A 1 47  ? -1.942  -1.059  6.379   1.00 0.00 ? 47  LEU A CB   5  
ATOM 7010  C CG   . LEU A 1 47  ? -1.037  -1.591  7.491   1.00 0.00 ? 47  LEU A CG   5  
ATOM 7011  C CD1  . LEU A 1 47  ? -0.916  -3.104  7.404   1.00 0.00 ? 47  LEU A CD1  5  
ATOM 7012  C CD2  . LEU A 1 47  ? 0.337   -0.940  7.418   1.00 0.00 ? 47  LEU A CD2  5  
ATOM 7013  H H    . LEU A 1 47  ? -2.956  -0.101  8.499   1.00 0.00 ? 47  LEU A H    5  
ATOM 7014  H HA   . LEU A 1 47  ? -1.532  1.041   6.448   1.00 0.00 ? 47  LEU A HA   5  
ATOM 7015  H HB2  . LEU A 1 47  ? -2.825  -1.679  6.347   1.00 0.00 ? 47  LEU A HB2  5  
ATOM 7016  H HB3  . LEU A 1 47  ? -1.407  -1.149  5.444   1.00 0.00 ? 47  LEU A HB3  5  
ATOM 7017  H HG   . LEU A 1 47  ? -1.473  -1.346  8.450   1.00 0.00 ? 47  LEU A HG   5  
ATOM 7018  H HD11 . LEU A 1 47  ? -0.262  -3.459  8.185   1.00 0.00 ? 47  LEU A HD11 5  
ATOM 7019  H HD12 . LEU A 1 47  ? -0.510  -3.378  6.441   1.00 0.00 ? 47  LEU A HD12 5  
ATOM 7020  H HD13 . LEU A 1 47  ? -1.893  -3.550  7.521   1.00 0.00 ? 47  LEU A HD13 5  
ATOM 7021  H HD21 . LEU A 1 47  ? 0.526   -0.397  8.333   1.00 0.00 ? 47  LEU A HD21 5  
ATOM 7022  H HD22 . LEU A 1 47  ? 0.367   -0.256  6.582   1.00 0.00 ? 47  LEU A HD22 5  
ATOM 7023  H HD23 . LEU A 1 47  ? 1.090   -1.702  7.288   1.00 0.00 ? 47  LEU A HD23 5  
ATOM 7024  N N    . SER A 1 48  ? -4.654  0.789   5.730   1.00 0.00 ? 48  SER A N    5  
ATOM 7025  C CA   . SER A 1 48  ? -5.685  1.112   4.751   1.00 0.00 ? 48  SER A CA   5  
ATOM 7026  C C    . SER A 1 48  ? -5.182  2.150   3.754   1.00 0.00 ? 48  SER A C    5  
ATOM 7027  O O    . SER A 1 48  ? -5.258  1.953   2.541   1.00 0.00 ? 48  SER A O    5  
ATOM 7028  C CB   . SER A 1 48  ? -6.941  1.630   5.454   1.00 0.00 ? 48  SER A CB   5  
ATOM 7029  O OG   . SER A 1 48  ? -6.689  2.864   6.104   1.00 0.00 ? 48  SER A OG   5  
ATOM 7030  H H    . SER A 1 48  ? -4.916  0.595   6.655   1.00 0.00 ? 48  SER A H    5  
ATOM 7031  H HA   . SER A 1 48  ? -5.930  0.206   4.217   1.00 0.00 ? 48  SER A HA   5  
ATOM 7032  H HB2  . SER A 1 48  ? -7.725  1.774   4.726   1.00 0.00 ? 48  SER A HB2  5  
ATOM 7033  H HB3  . SER A 1 48  ? -7.262  0.908   6.191   1.00 0.00 ? 48  SER A HB3  5  
ATOM 7034  H HG   . SER A 1 48  ? -7.323  2.987   6.814   1.00 0.00 ? 48  SER A HG   5  
ATOM 7035  N N    . LYS A 1 49  ? -4.666  3.259   4.274   1.00 0.00 ? 49  LYS A N    5  
ATOM 7036  C CA   . LYS A 1 49  ? -4.148  4.331   3.431   1.00 0.00 ? 49  LYS A CA   5  
ATOM 7037  C C    . LYS A 1 49  ? -2.901  3.876   2.679   1.00 0.00 ? 49  LYS A C    5  
ATOM 7038  O O    . LYS A 1 49  ? -2.729  4.184   1.499   1.00 0.00 ? 49  LYS A O    5  
ATOM 7039  C CB   . LYS A 1 49  ? -3.824  5.563   4.280   1.00 0.00 ? 49  LYS A CB   5  
ATOM 7040  C CG   . LYS A 1 49  ? -5.024  6.119   5.027   1.00 0.00 ? 49  LYS A CG   5  
ATOM 7041  C CD   . LYS A 1 49  ? -4.612  7.186   6.027   1.00 0.00 ? 49  LYS A CD   5  
ATOM 7042  C CE   . LYS A 1 49  ? -5.773  8.108   6.368   1.00 0.00 ? 49  LYS A CE   5  
ATOM 7043  N NZ   . LYS A 1 49  ? -5.345  9.239   7.237   1.00 0.00 ? 49  LYS A NZ   5  
ATOM 7044  H H    . LYS A 1 49  ? -4.633  3.359   5.249   1.00 0.00 ? 49  LYS A H    5  
ATOM 7045  H HA   . LYS A 1 49  ? -4.912  4.588   2.714   1.00 0.00 ? 49  LYS A HA   5  
ATOM 7046  H HB2  . LYS A 1 49  ? -3.067  5.298   5.003   1.00 0.00 ? 49  LYS A HB2  5  
ATOM 7047  H HB3  . LYS A 1 49  ? -3.438  6.338   3.634   1.00 0.00 ? 49  LYS A HB3  5  
ATOM 7048  H HG2  . LYS A 1 49  ? -5.710  6.553   4.316   1.00 0.00 ? 49  LYS A HG2  5  
ATOM 7049  H HG3  . LYS A 1 49  ? -5.513  5.312   5.555   1.00 0.00 ? 49  LYS A HG3  5  
ATOM 7050  H HD2  . LYS A 1 49  ? -4.271  6.706   6.933   1.00 0.00 ? 49  LYS A HD2  5  
ATOM 7051  H HD3  . LYS A 1 49  ? -3.809  7.773   5.604   1.00 0.00 ? 49  LYS A HD3  5  
ATOM 7052  H HE2  . LYS A 1 49  ? -6.181  8.504   5.451   1.00 0.00 ? 49  LYS A HE2  5  
ATOM 7053  H HE3  . LYS A 1 49  ? -6.531  7.536   6.882   1.00 0.00 ? 49  LYS A HE3  5  
ATOM 7054  H HZ1  . LYS A 1 49  ? -4.396  9.056   7.621   1.00 0.00 ? 49  LYS A HZ1  5  
ATOM 7055  H HZ2  . LYS A 1 49  ? -6.011  9.353   8.028   1.00 0.00 ? 49  LYS A HZ2  5  
ATOM 7056  H HZ3  . LYS A 1 49  ? -5.322  10.122  6.689   1.00 0.00 ? 49  LYS A HZ3  5  
ATOM 7057  N N    . LEU A 1 50  ? -2.034  3.143   3.369   1.00 0.00 ? 50  LEU A N    5  
ATOM 7058  C CA   . LEU A 1 50  ? -0.803  2.645   2.765   1.00 0.00 ? 50  LEU A CA   5  
ATOM 7059  C C    . LEU A 1 50  ? -1.104  1.815   1.521   1.00 0.00 ? 50  LEU A C    5  
ATOM 7060  O O    . LEU A 1 50  ? -0.618  2.115   0.431   1.00 0.00 ? 50  LEU A O    5  
ATOM 7061  C CB   . LEU A 1 50  ? -0.020  1.804   3.775   1.00 0.00 ? 50  LEU A CB   5  
ATOM 7062  C CG   . LEU A 1 50  ? 0.848   0.689   3.191   1.00 0.00 ? 50  LEU A CG   5  
ATOM 7063  C CD1  . LEU A 1 50  ? 1.709   1.222   2.056   1.00 0.00 ? 50  LEU A CD1  5  
ATOM 7064  C CD2  . LEU A 1 50  ? 1.717   0.067   4.275   1.00 0.00 ? 50  LEU A CD2  5  
ATOM 7065  H H    . LEU A 1 50  ? -2.225  2.931   4.306   1.00 0.00 ? 50  LEU A H    5  
ATOM 7066  H HA   . LEU A 1 50  ? -0.206  3.497   2.478   1.00 0.00 ? 50  LEU A HA   5  
ATOM 7067  H HB2  . LEU A 1 50  ? 0.625   2.469   4.329   1.00 0.00 ? 50  LEU A HB2  5  
ATOM 7068  H HB3  . LEU A 1 50  ? -0.732  1.351   4.450   1.00 0.00 ? 50  LEU A HB3  5  
ATOM 7069  H HG   . LEU A 1 50  ? 0.208   -0.084  2.789   1.00 0.00 ? 50  LEU A HG   5  
ATOM 7070  H HD11 . LEU A 1 50  ? 1.214   1.043   1.114   1.00 0.00 ? 50  LEU A HD11 5  
ATOM 7071  H HD12 . LEU A 1 50  ? 2.665   0.719   2.063   1.00 0.00 ? 50  LEU A HD12 5  
ATOM 7072  H HD13 . LEU A 1 50  ? 1.861   2.284   2.188   1.00 0.00 ? 50  LEU A HD13 5  
ATOM 7073  H HD21 . LEU A 1 50  ? 1.412   -0.957  4.435   1.00 0.00 ? 50  LEU A HD21 5  
ATOM 7074  H HD22 . LEU A 1 50  ? 1.601   0.624   5.193   1.00 0.00 ? 50  LEU A HD22 5  
ATOM 7075  H HD23 . LEU A 1 50  ? 2.751   0.091   3.965   1.00 0.00 ? 50  LEU A HD23 5  
ATOM 7076  N N    . MET A 1 51  ? -1.909  0.772   1.692   1.00 0.00 ? 51  MET A N    5  
ATOM 7077  C CA   . MET A 1 51  ? -2.278  -0.099  0.582   1.00 0.00 ? 51  MET A CA   5  
ATOM 7078  C C    . MET A 1 51  ? -2.858  0.710   -0.574  1.00 0.00 ? 51  MET A C    5  
ATOM 7079  O O    . MET A 1 51  ? -2.350  0.663   -1.695  1.00 0.00 ? 51  MET A O    5  
ATOM 7080  C CB   . MET A 1 51  ? -3.290  -1.149  1.043   1.00 0.00 ? 51  MET A CB   5  
ATOM 7081  C CG   . MET A 1 51  ? -2.841  -1.929  2.268   1.00 0.00 ? 51  MET A CG   5  
ATOM 7082  S SD   . MET A 1 51  ? -4.224  -2.487  3.282   1.00 0.00 ? 51  MET A SD   5  
ATOM 7083  C CE   . MET A 1 51  ? -3.518  -3.945  4.045   1.00 0.00 ? 51  MET A CE   5  
ATOM 7084  H H    . MET A 1 51  ? -2.266  0.583   2.585   1.00 0.00 ? 51  MET A H    5  
ATOM 7085  H HA   . MET A 1 51  ? -1.383  -0.599  0.242   1.00 0.00 ? 51  MET A HA   5  
ATOM 7086  H HB2  . MET A 1 51  ? -4.221  -0.655  1.279   1.00 0.00 ? 51  MET A HB2  5  
ATOM 7087  H HB3  . MET A 1 51  ? -3.457  -1.850  0.239   1.00 0.00 ? 51  MET A HB3  5  
ATOM 7088  H HG2  . MET A 1 51  ? -2.280  -2.793  1.944   1.00 0.00 ? 51  MET A HG2  5  
ATOM 7089  H HG3  . MET A 1 51  ? -2.205  -1.294  2.868   1.00 0.00 ? 51  MET A HG3  5  
ATOM 7090  H HE1  . MET A 1 51  ? -3.071  -4.569  3.285   1.00 0.00 ? 51  MET A HE1  5  
ATOM 7091  H HE2  . MET A 1 51  ? -2.762  -3.649  4.757   1.00 0.00 ? 51  MET A HE2  5  
ATOM 7092  H HE3  . MET A 1 51  ? -4.295  -4.497  4.553   1.00 0.00 ? 51  MET A HE3  5  
ATOM 7093  N N    . LYS A 1 52  ? -3.925  1.451   -0.295  1.00 0.00 ? 52  LYS A N    5  
ATOM 7094  C CA   . LYS A 1 52  ? -4.574  2.271   -1.311  1.00 0.00 ? 52  LYS A CA   5  
ATOM 7095  C C    . LYS A 1 52  ? -3.541  3.005   -2.160  1.00 0.00 ? 52  LYS A C    5  
ATOM 7096  O O    . LYS A 1 52  ? -3.524  2.875   -3.384  1.00 0.00 ? 52  LYS A O    5  
ATOM 7097  C CB   . LYS A 1 52  ? -5.519  3.280   -0.654  1.00 0.00 ? 52  LYS A CB   5  
ATOM 7098  C CG   . LYS A 1 52  ? -6.946  2.779   -0.520  1.00 0.00 ? 52  LYS A CG   5  
ATOM 7099  C CD   . LYS A 1 52  ? -7.615  3.329   0.728   1.00 0.00 ? 52  LYS A CD   5  
ATOM 7100  C CE   . LYS A 1 52  ? -8.630  2.348   1.296   1.00 0.00 ? 52  LYS A CE   5  
ATOM 7101  N NZ   . LYS A 1 52  ? -9.992  2.573   0.737   1.00 0.00 ? 52  LYS A NZ   5  
ATOM 7102  H H    . LYS A 1 52  ? -4.284  1.447   0.617   1.00 0.00 ? 52  LYS A H    5  
ATOM 7103  H HA   . LYS A 1 52  ? -5.148  1.617   -1.949  1.00 0.00 ? 52  LYS A HA   5  
ATOM 7104  H HB2  . LYS A 1 52  ? -5.147  3.514   0.333   1.00 0.00 ? 52  LYS A HB2  5  
ATOM 7105  H HB3  . LYS A 1 52  ? -5.531  4.183   -1.248  1.00 0.00 ? 52  LYS A HB3  5  
ATOM 7106  H HG2  . LYS A 1 52  ? -7.511  3.091   -1.385  1.00 0.00 ? 52  LYS A HG2  5  
ATOM 7107  H HG3  . LYS A 1 52  ? -6.935  1.699   -0.465  1.00 0.00 ? 52  LYS A HG3  5  
ATOM 7108  H HD2  . LYS A 1 52  ? -6.861  3.522   1.476   1.00 0.00 ? 52  LYS A HD2  5  
ATOM 7109  H HD3  . LYS A 1 52  ? -8.120  4.252   0.478   1.00 0.00 ? 52  LYS A HD3  5  
ATOM 7110  H HE2  . LYS A 1 52  ? -8.313  1.345   1.056   1.00 0.00 ? 52  LYS A HE2  5  
ATOM 7111  H HE3  . LYS A 1 52  ? -8.666  2.468   2.368   1.00 0.00 ? 52  LYS A HE3  5  
ATOM 7112  H HZ1  . LYS A 1 52  ? -10.183 3.593   0.662   1.00 0.00 ? 52  LYS A HZ1  5  
ATOM 7113  H HZ2  . LYS A 1 52  ? -10.708 2.143   1.356   1.00 0.00 ? 52  LYS A HZ2  5  
ATOM 7114  H HZ3  . LYS A 1 52  ? -10.065 2.147   -0.209  1.00 0.00 ? 52  LYS A HZ3  5  
ATOM 7115  N N    . ALA A 1 53  ? -2.679  3.774   -1.503  1.00 0.00 ? 53  ALA A N    5  
ATOM 7116  C CA   . ALA A 1 53  ? -1.641  4.525   -2.197  1.00 0.00 ? 53  ALA A CA   5  
ATOM 7117  C C    . ALA A 1 53  ? -0.804  3.612   -3.086  1.00 0.00 ? 53  ALA A C    5  
ATOM 7118  O O    . ALA A 1 53  ? -0.411  3.993   -4.189  1.00 0.00 ? 53  ALA A O    5  
ATOM 7119  C CB   . ALA A 1 53  ? -0.753  5.248   -1.195  1.00 0.00 ? 53  ALA A CB   5  
ATOM 7120  H H    . ALA A 1 53  ? -2.743  3.837   -0.527  1.00 0.00 ? 53  ALA A H    5  
ATOM 7121  H HA   . ALA A 1 53  ? -2.124  5.269   -2.815  1.00 0.00 ? 53  ALA A HA   5  
ATOM 7122  H HB1  . ALA A 1 53  ? -0.990  4.911   -0.197  1.00 0.00 ? 53  ALA A HB1  5  
ATOM 7123  H HB2  . ALA A 1 53  ? 0.283   5.033   -1.412  1.00 0.00 ? 53  ALA A HB2  5  
ATOM 7124  H HB3  . ALA A 1 53  ? -0.922  6.312   -1.266  1.00 0.00 ? 53  ALA A HB3  5  
ATOM 7125  N N    . TYR A 1 54  ? -0.535  2.405   -2.600  1.00 0.00 ? 54  TYR A N    5  
ATOM 7126  C CA   . TYR A 1 54  ? 0.258   1.438   -3.349  1.00 0.00 ? 54  TYR A CA   5  
ATOM 7127  C C    . TYR A 1 54  ? -0.490  0.968   -4.593  1.00 0.00 ? 54  TYR A C    5  
ATOM 7128  O O    . TYR A 1 54  ? 0.119   0.519   -5.565  1.00 0.00 ? 54  TYR A O    5  
ATOM 7129  C CB   . TYR A 1 54  ? 0.607   0.239   -2.466  1.00 0.00 ? 54  TYR A CB   5  
ATOM 7130  C CG   . TYR A 1 54  ? 1.357   -0.852  -3.196  1.00 0.00 ? 54  TYR A CG   5  
ATOM 7131  C CD1  . TYR A 1 54  ? 0.677   -1.874  -3.847  1.00 0.00 ? 54  TYR A CD1  5  
ATOM 7132  C CD2  . TYR A 1 54  ? 2.746   -0.863  -3.232  1.00 0.00 ? 54  TYR A CD2  5  
ATOM 7133  C CE1  . TYR A 1 54  ? 1.358   -2.873  -4.514  1.00 0.00 ? 54  TYR A CE1  5  
ATOM 7134  C CE2  . TYR A 1 54  ? 3.435   -1.857  -3.898  1.00 0.00 ? 54  TYR A CE2  5  
ATOM 7135  C CZ   . TYR A 1 54  ? 2.737   -2.861  -4.537  1.00 0.00 ? 54  TYR A CZ   5  
ATOM 7136  O OH   . TYR A 1 54  ? 3.420   -3.854  -5.201  1.00 0.00 ? 54  TYR A OH   5  
ATOM 7137  H H    . TYR A 1 54  ? -0.877  2.159   -1.715  1.00 0.00 ? 54  TYR A H    5  
ATOM 7138  H HA   . TYR A 1 54  ? 1.172   1.925   -3.656  1.00 0.00 ? 54  TYR A HA   5  
ATOM 7139  H HB2  . TYR A 1 54  ? 1.222   0.573   -1.645  1.00 0.00 ? 54  TYR A HB2  5  
ATOM 7140  H HB3  . TYR A 1 54  ? -0.305  -0.189  -2.075  1.00 0.00 ? 54  TYR A HB3  5  
ATOM 7141  H HD1  . TYR A 1 54  ? -0.404  -1.881  -3.827  1.00 0.00 ? 54  TYR A HD1  5  
ATOM 7142  H HD2  . TYR A 1 54  ? 3.290   -0.075  -2.730  1.00 0.00 ? 54  TYR A HD2  5  
ATOM 7143  H HE1  . TYR A 1 54  ? 0.812   -3.659  -5.015  1.00 0.00 ? 54  TYR A HE1  5  
ATOM 7144  H HE2  . TYR A 1 54  ? 4.515   -1.848  -3.916  1.00 0.00 ? 54  TYR A HE2  5  
ATOM 7145  H HH   . TYR A 1 54  ? 3.065   -4.710  -4.948  1.00 0.00 ? 54  TYR A HH   5  
ATOM 7146  N N    . CYS A 1 55  ? -1.814  1.074   -4.555  1.00 0.00 ? 55  CYS A N    5  
ATOM 7147  C CA   . CYS A 1 55  ? -2.647  0.660   -5.678  1.00 0.00 ? 55  CYS A CA   5  
ATOM 7148  C C    . CYS A 1 55  ? -2.780  1.784   -6.700  1.00 0.00 ? 55  CYS A C    5  
ATOM 7149  O O    . CYS A 1 55  ? -2.697  1.552   -7.906  1.00 0.00 ? 55  CYS A O    5  
ATOM 7150  C CB   . CYS A 1 55  ? -4.031  0.237   -5.184  1.00 0.00 ? 55  CYS A CB   5  
ATOM 7151  S SG   . CYS A 1 55  ? -4.010  -1.157  -4.032  1.00 0.00 ? 55  CYS A SG   5  
ATOM 7152  H H    . CYS A 1 55  ? -2.242  1.440   -3.752  1.00 0.00 ? 55  CYS A H    5  
ATOM 7153  H HA   . CYS A 1 55  ? -2.169  -0.185  -6.150  1.00 0.00 ? 55  CYS A HA   5  
ATOM 7154  H HB2  . CYS A 1 55  ? -4.496  1.071   -4.680  1.00 0.00 ? 55  CYS A HB2  5  
ATOM 7155  H HB3  . CYS A 1 55  ? -4.637  -0.046  -6.033  1.00 0.00 ? 55  CYS A HB3  5  
ATOM 7156  H HG   . CYS A 1 55  ? -2.751  -1.386  -3.691  1.00 0.00 ? 55  CYS A HG   5  
ATOM 7157  N N    . GLU A 1 56  ? -2.988  3.002   -6.210  1.00 0.00 ? 56  GLU A N    5  
ATOM 7158  C CA   . GLU A 1 56  ? -3.135  4.161   -7.081  1.00 0.00 ? 56  GLU A CA   5  
ATOM 7159  C C    . GLU A 1 56  ? -1.807  4.516   -7.744  1.00 0.00 ? 56  GLU A C    5  
ATOM 7160  O O    . GLU A 1 56  ? -1.758  4.823   -8.935  1.00 0.00 ? 56  GLU A O    5  
ATOM 7161  C CB   . GLU A 1 56  ? -3.658  5.361   -6.288  1.00 0.00 ? 56  GLU A CB   5  
ATOM 7162  C CG   . GLU A 1 56  ? -2.573  6.114   -5.538  1.00 0.00 ? 56  GLU A CG   5  
ATOM 7163  C CD   . GLU A 1 56  ? -3.129  7.220   -4.662  1.00 0.00 ? 56  GLU A CD   5  
ATOM 7164  O OE1  . GLU A 1 56  ? -4.346  7.202   -4.384  1.00 0.00 ? 56  GLU A OE1  5  
ATOM 7165  O OE2  . GLU A 1 56  ? -2.346  8.104   -4.255  1.00 0.00 ? 56  GLU A OE2  5  
ATOM 7166  H H    . GLU A 1 56  ? -3.045  3.123   -5.239  1.00 0.00 ? 56  GLU A H    5  
ATOM 7167  H HA   . GLU A 1 56  ? -3.851  3.910   -7.849  1.00 0.00 ? 56  GLU A HA   5  
ATOM 7168  H HB2  . GLU A 1 56  ? -4.139  6.046   -6.970  1.00 0.00 ? 56  GLU A HB2  5  
ATOM 7169  H HB3  . GLU A 1 56  ? -4.386  5.012   -5.570  1.00 0.00 ? 56  GLU A HB3  5  
ATOM 7170  H HG2  . GLU A 1 56  ? -2.034  5.418   -4.913  1.00 0.00 ? 56  GLU A HG2  5  
ATOM 7171  H HG3  . GLU A 1 56  ? -1.894  6.551   -6.256  1.00 0.00 ? 56  GLU A HG3  5  
ATOM 7172  N N    . ARG A 1 57  ? -0.733  4.470   -6.963  1.00 0.00 ? 57  ARG A N    5  
ATOM 7173  C CA   . ARG A 1 57  ? 0.596   4.788   -7.473  1.00 0.00 ? 57  ARG A CA   5  
ATOM 7174  C C    . ARG A 1 57  ? 0.862   4.062   -8.788  1.00 0.00 ? 57  ARG A C    5  
ATOM 7175  O O    . ARG A 1 57  ? 1.363   4.654   -9.744  1.00 0.00 ? 57  ARG A O    5  
ATOM 7176  C CB   . ARG A 1 57  ? 1.664   4.411   -6.445  1.00 0.00 ? 57  ARG A CB   5  
ATOM 7177  C CG   . ARG A 1 57  ? 3.084   4.507   -6.978  1.00 0.00 ? 57  ARG A CG   5  
ATOM 7178  C CD   . ARG A 1 57  ? 4.109   4.325   -5.869  1.00 0.00 ? 57  ARG A CD   5  
ATOM 7179  N NE   . ARG A 1 57  ? 4.471   5.594   -5.244  1.00 0.00 ? 57  ARG A NE   5  
ATOM 7180  C CZ   . ARG A 1 57  ? 5.055   6.593   -5.896  1.00 0.00 ? 57  ARG A CZ   5  
ATOM 7181  N NH1  . ARG A 1 57  ? 5.342   6.472   -7.184  1.00 0.00 ? 57  ARG A NH1  5  
ATOM 7182  N NH2  . ARG A 1 57  ? 5.353   7.718   -5.258  1.00 0.00 ? 57  ARG A NH2  5  
ATOM 7183  H H    . ARG A 1 57  ? -0.836  4.218   -6.022  1.00 0.00 ? 57  ARG A H    5  
ATOM 7184  H HA   . ARG A 1 57  ? 0.638   5.853   -7.648  1.00 0.00 ? 57  ARG A HA   5  
ATOM 7185  H HB2  . ARG A 1 57  ? 1.577   5.070   -5.594  1.00 0.00 ? 57  ARG A HB2  5  
ATOM 7186  H HB3  . ARG A 1 57  ? 1.492   3.395   -6.122  1.00 0.00 ? 57  ARG A HB3  5  
ATOM 7187  H HG2  . ARG A 1 57  ? 3.233   3.737   -7.721  1.00 0.00 ? 57  ARG A HG2  5  
ATOM 7188  H HG3  . ARG A 1 57  ? 3.223   5.478   -7.430  1.00 0.00 ? 57  ARG A HG3  5  
ATOM 7189  H HD2  . ARG A 1 57  ? 3.694   3.670   -5.118  1.00 0.00 ? 57  ARG A HD2  5  
ATOM 7190  H HD3  . ARG A 1 57  ? 4.996   3.874   -6.289  1.00 0.00 ? 57  ARG A HD3  5  
ATOM 7191  H HE   . ARG A 1 57  ? 4.268   5.705   -4.293  1.00 0.00 ? 57  ARG A HE   5  
ATOM 7192  H HH11 . ARG A 1 57  ? 5.117   5.626   -7.668  1.00 0.00 ? 57  ARG A HH11 5  
ATOM 7193  H HH12 . ARG A 1 57  ? 5.780   7.226   -7.673  1.00 0.00 ? 57  ARG A HH12 5  
ATOM 7194  H HH21 . ARG A 1 57  ? 5.139   7.813   -4.286  1.00 0.00 ? 57  ARG A HH21 5  
ATOM 7195  H HH22 . ARG A 1 57  ? 5.793   8.469   -5.748  1.00 0.00 ? 57  ARG A HH22 5  
ATOM 7196  N N    . GLN A 1 58  ? 0.523   2.777   -8.828  1.00 0.00 ? 58  GLN A N    5  
ATOM 7197  C CA   . GLN A 1 58  ? 0.726   1.971   -10.026 1.00 0.00 ? 58  GLN A CA   5  
ATOM 7198  C C    . GLN A 1 58  ? -0.504  2.013   -10.926 1.00 0.00 ? 58  GLN A C    5  
ATOM 7199  O O    . GLN A 1 58  ? -0.427  2.425   -12.082 1.00 0.00 ? 58  GLN A O    5  
ATOM 7200  C CB   . GLN A 1 58  ? 1.045   0.524   -9.644  1.00 0.00 ? 58  GLN A CB   5  
ATOM 7201  C CG   . GLN A 1 58  ? 2.117   0.400   -8.574  1.00 0.00 ? 58  GLN A CG   5  
ATOM 7202  C CD   . GLN A 1 58  ? 3.372   1.181   -8.912  1.00 0.00 ? 58  GLN A CD   5  
ATOM 7203  O OE1  . GLN A 1 58  ? 3.571   1.595   -10.054 1.00 0.00 ? 58  GLN A OE1  5  
ATOM 7204  N NE2  . GLN A 1 58  ? 4.227   1.387   -7.917  1.00 0.00 ? 58  GLN A NE2  5  
ATOM 7205  H H    . GLN A 1 58  ? 0.127   2.363   -8.034  1.00 0.00 ? 58  GLN A H    5  
ATOM 7206  H HA   . GLN A 1 58  ? 1.565   2.384   -10.565 1.00 0.00 ? 58  GLN A HA   5  
ATOM 7207  H HB2  . GLN A 1 58  ? 0.144   0.055   -9.277  1.00 0.00 ? 58  GLN A HB2  5  
ATOM 7208  H HB3  . GLN A 1 58  ? 1.383   -0.002  -10.525 1.00 0.00 ? 58  GLN A HB3  5  
ATOM 7209  H HG2  . GLN A 1 58  ? 1.721   0.771   -7.640  1.00 0.00 ? 58  GLN A HG2  5  
ATOM 7210  H HG3  . GLN A 1 58  ? 2.378   -0.643  -8.464  1.00 0.00 ? 58  GLN A HG3  5  
ATOM 7211  H HE21 . GLN A 1 58  ? 4.003   1.027   -7.033  1.00 0.00 ? 58  GLN A HE21 5  
ATOM 7212  H HE22 . GLN A 1 58  ? 5.046   1.888   -8.107  1.00 0.00 ? 58  GLN A HE22 5  
ATOM 7213  N N    . GLY A 1 59  ? -1.641  1.581   -10.387 1.00 0.00 ? 59  GLY A N    5  
ATOM 7214  C CA   . GLY A 1 59  ? -2.872  1.577   -11.155 1.00 0.00 ? 59  GLY A CA   5  
ATOM 7215  C C    . GLY A 1 59  ? -3.609  0.256   -11.063 1.00 0.00 ? 59  GLY A C    5  
ATOM 7216  O O    . GLY A 1 59  ? -4.305  -0.142  -11.998 1.00 0.00 ? 59  GLY A O    5  
ATOM 7217  H H    . GLY A 1 59  ? -1.643  1.263   -9.459  1.00 0.00 ? 59  GLY A H    5  
ATOM 7218  H HA2  . GLY A 1 59  ? -3.515  2.363   -10.788 1.00 0.00 ? 59  GLY A HA2  5  
ATOM 7219  H HA3  . GLY A 1 59  ? -2.637  1.773   -12.191 1.00 0.00 ? 59  GLY A HA3  5  
ATOM 7220  N N    . LEU A 1 60  ? -3.455  -0.428  -9.934  1.00 0.00 ? 60  LEU A N    5  
ATOM 7221  C CA   . LEU A 1 60  ? -4.110  -1.714  -9.723  1.00 0.00 ? 60  LEU A CA   5  
ATOM 7222  C C    . LEU A 1 60  ? -5.244  -1.588  -8.711  1.00 0.00 ? 60  LEU A C    5  
ATOM 7223  O O    . LEU A 1 60  ? -5.465  -0.520  -8.142  1.00 0.00 ? 60  LEU A O    5  
ATOM 7224  C CB   . LEU A 1 60  ? -3.095  -2.753  -9.243  1.00 0.00 ? 60  LEU A CB   5  
ATOM 7225  C CG   . LEU A 1 60  ? -1.714  -2.696  -9.897  1.00 0.00 ? 60  LEU A CG   5  
ATOM 7226  C CD1  . LEU A 1 60  ? -0.646  -3.191  -8.935  1.00 0.00 ? 60  LEU A CD1  5  
ATOM 7227  C CD2  . LEU A 1 60  ? -1.698  -3.513  -11.181 1.00 0.00 ? 60  LEU A CD2  5  
ATOM 7228  H H    . LEU A 1 60  ? -2.887  -0.060  -9.225  1.00 0.00 ? 60  LEU A H    5  
ATOM 7229  H HA   . LEU A 1 60  ? -4.521  -2.035  -10.669 1.00 0.00 ? 60  LEU A HA   5  
ATOM 7230  H HB2  . LEU A 1 60  ? -2.963  -2.619  -8.180  1.00 0.00 ? 60  LEU A HB2  5  
ATOM 7231  H HB3  . LEU A 1 60  ? -3.511  -3.733  -9.431  1.00 0.00 ? 60  LEU A HB3  5  
ATOM 7232  H HG   . LEU A 1 60  ? -1.485  -1.669  -10.150 1.00 0.00 ? 60  LEU A HG   5  
ATOM 7233  H HD11 . LEU A 1 60  ? 0.102   -3.745  -9.482  1.00 0.00 ? 60  LEU A HD11 5  
ATOM 7234  H HD12 . LEU A 1 60  ? -1.099  -3.833  -8.194  1.00 0.00 ? 60  LEU A HD12 5  
ATOM 7235  H HD13 . LEU A 1 60  ? -0.184  -2.347  -8.445  1.00 0.00 ? 60  LEU A HD13 5  
ATOM 7236  H HD21 . LEU A 1 60  ? -0.676  -3.706  -11.471 1.00 0.00 ? 60  LEU A HD21 5  
ATOM 7237  H HD22 . LEU A 1 60  ? -2.197  -2.960  -11.965 1.00 0.00 ? 60  LEU A HD22 5  
ATOM 7238  H HD23 . LEU A 1 60  ? -2.210  -4.449  -11.018 1.00 0.00 ? 60  LEU A HD23 5  
ATOM 7239  N N    . SER A 1 61  ? -5.958  -2.687  -8.491  1.00 0.00 ? 61  SER A N    5  
ATOM 7240  C CA   . SER A 1 61  ? -7.071  -2.699  -7.548  1.00 0.00 ? 61  SER A CA   5  
ATOM 7241  C C    . SER A 1 61  ? -6.666  -3.371  -6.239  1.00 0.00 ? 61  SER A C    5  
ATOM 7242  O O    . SER A 1 61  ? -5.602  -3.981  -6.145  1.00 0.00 ? 61  SER A O    5  
ATOM 7243  C CB   . SER A 1 61  ? -8.273  -3.424  -8.155  1.00 0.00 ? 61  SER A CB   5  
ATOM 7244  O OG   . SER A 1 61  ? -9.491  -2.908  -7.645  1.00 0.00 ? 61  SER A OG   5  
ATOM 7245  H H    . SER A 1 61  ? -5.733  -3.509  -8.976  1.00 0.00 ? 61  SER A H    5  
ATOM 7246  H HA   . SER A 1 61  ? -7.344  -1.675  -7.344  1.00 0.00 ? 61  SER A HA   5  
ATOM 7247  H HB2  . SER A 1 61  ? -8.264  -3.297  -9.227  1.00 0.00 ? 61  SER A HB2  5  
ATOM 7248  H HB3  . SER A 1 61  ? -8.214  -4.476  -7.917  1.00 0.00 ? 61  SER A HB3  5  
ATOM 7249  H HG   . SER A 1 61  ? -9.450  -1.949  -7.629  1.00 0.00 ? 61  SER A HG   5  
ATOM 7250  N N    . MET A 1 62  ? -7.524  -3.252  -5.231  1.00 0.00 ? 62  MET A N    5  
ATOM 7251  C CA   . MET A 1 62  ? -7.257  -3.848  -3.927  1.00 0.00 ? 62  MET A CA   5  
ATOM 7252  C C    . MET A 1 62  ? -7.563  -5.343  -3.939  1.00 0.00 ? 62  MET A C    5  
ATOM 7253  O O    . MET A 1 62  ? -6.780  -6.150  -3.439  1.00 0.00 ? 62  MET A O    5  
ATOM 7254  C CB   . MET A 1 62  ? -8.088  -3.155  -2.846  1.00 0.00 ? 62  MET A CB   5  
ATOM 7255  C CG   . MET A 1 62  ? -7.661  -1.721  -2.576  1.00 0.00 ? 62  MET A CG   5  
ATOM 7256  S SD   . MET A 1 62  ? -6.126  -1.620  -1.635  1.00 0.00 ? 62  MET A SD   5  
ATOM 7257  C CE   . MET A 1 62  ? -6.760  -1.536  0.038   1.00 0.00 ? 62  MET A CE   5  
ATOM 7258  H H    . MET A 1 62  ? -8.357  -2.753  -5.366  1.00 0.00 ? 62  MET A H    5  
ATOM 7259  H HA   . MET A 1 62  ? -6.209  -3.709  -3.707  1.00 0.00 ? 62  MET A HA   5  
ATOM 7260  H HB2  . MET A 1 62  ? -9.123  -3.147  -3.153  1.00 0.00 ? 62  MET A HB2  5  
ATOM 7261  H HB3  . MET A 1 62  ? -7.999  -3.713  -1.926  1.00 0.00 ? 62  MET A HB3  5  
ATOM 7262  H HG2  . MET A 1 62  ? -7.520  -1.218  -3.521  1.00 0.00 ? 62  MET A HG2  5  
ATOM 7263  H HG3  . MET A 1 62  ? -8.442  -1.226  -2.020  1.00 0.00 ? 62  MET A HG3  5  
ATOM 7264  H HE1  . MET A 1 62  ? -7.327  -0.625  0.163   1.00 0.00 ? 62  MET A HE1  5  
ATOM 7265  H HE2  . MET A 1 62  ? -7.400  -2.386  0.223   1.00 0.00 ? 62  MET A HE2  5  
ATOM 7266  H HE3  . MET A 1 62  ? -5.936  -1.546  0.736   1.00 0.00 ? 62  MET A HE3  5  
ATOM 7267  N N    . ARG A 1 63  ? -8.706  -5.704  -4.514  1.00 0.00 ? 63  ARG A N    5  
ATOM 7268  C CA   . ARG A 1 63  ? -9.115  -7.101  -4.589  1.00 0.00 ? 63  ARG A CA   5  
ATOM 7269  C C    . ARG A 1 63  ? -8.261  -7.864  -5.598  1.00 0.00 ? 63  ARG A C    5  
ATOM 7270  O O    . ARG A 1 63  ? -8.403  -9.076  -5.754  1.00 0.00 ? 63  ARG A O    5  
ATOM 7271  C CB   . ARG A 1 63  ? -10.591 -7.202  -4.976  1.00 0.00 ? 63  ARG A CB   5  
ATOM 7272  C CG   . ARG A 1 63  ? -10.872 -6.807  -6.416  1.00 0.00 ? 63  ARG A CG   5  
ATOM 7273  C CD   . ARG A 1 63  ? -11.015 -5.300  -6.563  1.00 0.00 ? 63  ARG A CD   5  
ATOM 7274  N NE   . ARG A 1 63  ? -11.792 -4.936  -7.745  1.00 0.00 ? 63  ARG A NE   5  
ATOM 7275  C CZ   . ARG A 1 63  ? -13.089 -5.192  -7.879  1.00 0.00 ? 63  ARG A CZ   5  
ATOM 7276  N NH1  . ARG A 1 63  ? -13.750 -5.810  -6.910  1.00 0.00 ? 63  ARG A NH1  5  
ATOM 7277  N NH2  . ARG A 1 63  ? -13.727 -4.830  -8.985  1.00 0.00 ? 63  ARG A NH2  5  
ATOM 7278  H H    . ARG A 1 63  ? -9.288  -5.014  -4.895  1.00 0.00 ? 63  ARG A H    5  
ATOM 7279  H HA   . ARG A 1 63  ? -8.976  -7.541  -3.613  1.00 0.00 ? 63  ARG A HA   5  
ATOM 7280  H HB2  . ARG A 1 63  ? -10.920 -8.221  -4.835  1.00 0.00 ? 63  ARG A HB2  5  
ATOM 7281  H HB3  . ARG A 1 63  ? -11.165 -6.555  -4.330  1.00 0.00 ? 63  ARG A HB3  5  
ATOM 7282  H HG2  . ARG A 1 63  ? -10.055 -7.142  -7.038  1.00 0.00 ? 63  ARG A HG2  5  
ATOM 7283  H HG3  . ARG A 1 63  ? -11.789 -7.280  -6.737  1.00 0.00 ? 63  ARG A HG3  5  
ATOM 7284  H HD2  . ARG A 1 63  ? -11.510 -4.912  -5.686  1.00 0.00 ? 63  ARG A HD2  5  
ATOM 7285  H HD3  . ARG A 1 63  ? -10.030 -4.865  -6.643  1.00 0.00 ? 63  ARG A HD3  5  
ATOM 7286  H HE   . ARG A 1 63  ? -11.324 -4.479  -8.474  1.00 0.00 ? 63  ARG A HE   5  
ATOM 7287  H HH11 . ARG A 1 63  ? -13.272 -6.083  -6.075  1.00 0.00 ? 63  ARG A HH11 5  
ATOM 7288  H HH12 . ARG A 1 63  ? -14.727 -6.000  -7.013  1.00 0.00 ? 63  ARG A HH12 5  
ATOM 7289  H HH21 . ARG A 1 63  ? -13.232 -4.364  -9.718  1.00 0.00 ? 63  ARG A HH21 5  
ATOM 7290  H HH22 . ARG A 1 63  ? -14.702 -5.023  -9.085  1.00 0.00 ? 63  ARG A HH22 5  
ATOM 7291  N N    . GLN A 1 64  ? -7.375  -7.144  -6.279  1.00 0.00 ? 64  GLN A N    5  
ATOM 7292  C CA   . GLN A 1 64  ? -6.499  -7.753  -7.273  1.00 0.00 ? 64  GLN A CA   5  
ATOM 7293  C C    . GLN A 1 64  ? -5.142  -8.095  -6.667  1.00 0.00 ? 64  GLN A C    5  
ATOM 7294  O O    . GLN A 1 64  ? -4.495  -9.061  -7.074  1.00 0.00 ? 64  GLN A O    5  
ATOM 7295  C CB   . GLN A 1 64  ? -6.316  -6.814  -8.467  1.00 0.00 ? 64  GLN A CB   5  
ATOM 7296  C CG   . GLN A 1 64  ? -5.593  -7.455  -9.640  1.00 0.00 ? 64  GLN A CG   5  
ATOM 7297  C CD   . GLN A 1 64  ? -5.313  -6.472  -10.760 1.00 0.00 ? 64  GLN A CD   5  
ATOM 7298  O OE1  . GLN A 1 64  ? -6.147  -6.264  -11.642 1.00 0.00 ? 64  GLN A OE1  5  
ATOM 7299  N NE2  . GLN A 1 64  ? -4.134  -5.862  -10.732 1.00 0.00 ? 64  GLN A NE2  5  
ATOM 7300  H H    . GLN A 1 64  ? -7.309  -6.182  -6.110  1.00 0.00 ? 64  GLN A H    5  
ATOM 7301  H HA   . GLN A 1 64  ? -6.967  -8.665  -7.613  1.00 0.00 ? 64  GLN A HA   5  
ATOM 7302  H HB2  . GLN A 1 64  ? -7.288  -6.488  -8.805  1.00 0.00 ? 64  GLN A HB2  5  
ATOM 7303  H HB3  . GLN A 1 64  ? -5.747  -5.953  -8.148  1.00 0.00 ? 64  GLN A HB3  5  
ATOM 7304  H HG2  . GLN A 1 64  ? -4.652  -7.856  -9.291  1.00 0.00 ? 64  GLN A HG2  5  
ATOM 7305  H HG3  . GLN A 1 64  ? -6.203  -8.257  -10.028 1.00 0.00 ? 64  GLN A HG3  5  
ATOM 7306  H HE21 . GLN A 1 64  ? -3.519  -6.078  -10.000 1.00 0.00 ? 64  GLN A HE21 5  
ATOM 7307  H HE22 . GLN A 1 64  ? -3.927  -5.222  -11.444 1.00 0.00 ? 64  GLN A HE22 5  
ATOM 7308  N N    . ILE A 1 65  ? -4.716  -7.296  -5.694  1.00 0.00 ? 65  ILE A N    5  
ATOM 7309  C CA   . ILE A 1 65  ? -3.436  -7.515  -5.032  1.00 0.00 ? 65  ILE A CA   5  
ATOM 7310  C C    . ILE A 1 65  ? -3.633  -7.904  -3.571  1.00 0.00 ? 65  ILE A C    5  
ATOM 7311  O O    . ILE A 1 65  ? -4.716  -7.729  -3.012  1.00 0.00 ? 65  ILE A O    5  
ATOM 7312  C CB   . ILE A 1 65  ? -2.544  -6.262  -5.103  1.00 0.00 ? 65  ILE A CB   5  
ATOM 7313  C CG1  . ILE A 1 65  ? -3.168  -5.119  -4.298  1.00 0.00 ? 65  ILE A CG1  5  
ATOM 7314  C CG2  . ILE A 1 65  ? -2.333  -5.843  -6.550  1.00 0.00 ? 65  ILE A CG2  5  
ATOM 7315  C CD1  . ILE A 1 65  ? -2.152  -4.137  -3.757  1.00 0.00 ? 65  ILE A CD1  5  
ATOM 7316  H H    . ILE A 1 65  ? -5.277  -6.543  -5.414  1.00 0.00 ? 65  ILE A H    5  
ATOM 7317  H HA   . ILE A 1 65  ? -2.931  -8.322  -5.543  1.00 0.00 ? 65  ILE A HA   5  
ATOM 7318  H HB   . ILE A 1 65  ? -1.582  -6.507  -4.680  1.00 0.00 ? 65  ILE A HB   5  
ATOM 7319  H HG12 . ILE A 1 65  ? -3.852  -4.574  -4.929  1.00 0.00 ? 65  ILE A HG12 5  
ATOM 7320  H HG13 . ILE A 1 65  ? -3.710  -5.533  -3.460  1.00 0.00 ? 65  ILE A HG13 5  
ATOM 7321  H HG21 . ILE A 1 65  ? -1.478  -6.365  -6.955  1.00 0.00 ? 65  ILE A HG21 5  
ATOM 7322  H HG22 . ILE A 1 65  ? -3.211  -6.091  -7.128  1.00 0.00 ? 65  ILE A HG22 5  
ATOM 7323  H HG23 . ILE A 1 65  ? -2.160  -4.779  -6.596  1.00 0.00 ? 65  ILE A HG23 5  
ATOM 7324  H HD11 . ILE A 1 65  ? -2.571  -3.616  -2.909  1.00 0.00 ? 65  ILE A HD11 5  
ATOM 7325  H HD12 . ILE A 1 65  ? -1.264  -4.669  -3.452  1.00 0.00 ? 65  ILE A HD12 5  
ATOM 7326  H HD13 . ILE A 1 65  ? -1.897  -3.423  -4.527  1.00 0.00 ? 65  ILE A HD13 5  
ATOM 7327  N N    . ARG A 1 66  ? -2.578  -8.429  -2.957  1.00 0.00 ? 66  ARG A N    5  
ATOM 7328  C CA   . ARG A 1 66  ? -2.634  -8.842  -1.560  1.00 0.00 ? 66  ARG A CA   5  
ATOM 7329  C C    . ARG A 1 66  ? -1.400  -8.361  -0.801  1.00 0.00 ? 66  ARG A C    5  
ATOM 7330  O O    . ARG A 1 66  ? -0.311  -8.259  -1.366  1.00 0.00 ? 66  ARG A O    5  
ATOM 7331  C CB   . ARG A 1 66  ? -2.746  -10.364 -1.459  1.00 0.00 ? 66  ARG A CB   5  
ATOM 7332  C CG   . ARG A 1 66  ? -4.178  -10.871 -1.471  1.00 0.00 ? 66  ARG A CG   5  
ATOM 7333  C CD   . ARG A 1 66  ? -4.798  -10.822 -0.083  1.00 0.00 ? 66  ARG A CD   5  
ATOM 7334  N NE   . ARG A 1 66  ? -5.419  -9.530  0.194   1.00 0.00 ? 66  ARG A NE   5  
ATOM 7335  C CZ   . ARG A 1 66  ? -6.580  -9.146  -0.325  1.00 0.00 ? 66  ARG A CZ   5  
ATOM 7336  N NH1  . ARG A 1 66  ? -7.243  -9.952  -1.142  1.00 0.00 ? 66  ARG A NH1  5  
ATOM 7337  N NH2  . ARG A 1 66  ? -7.081  -7.955  -0.025  1.00 0.00 ? 66  ARG A NH2  5  
ATOM 7338  H H    . ARG A 1 66  ? -1.742  -8.543  -3.456  1.00 0.00 ? 66  ARG A H    5  
ATOM 7339  H HA   . ARG A 1 66  ? -3.511  -8.395  -1.117  1.00 0.00 ? 66  ARG A HA   5  
ATOM 7340  H HB2  . ARG A 1 66  ? -2.224  -10.808 -2.294  1.00 0.00 ? 66  ARG A HB2  5  
ATOM 7341  H HB3  . ARG A 1 66  ? -2.280  -10.687 -0.541  1.00 0.00 ? 66  ARG A HB3  5  
ATOM 7342  H HG2  . ARG A 1 66  ? -4.764  -10.254 -2.136  1.00 0.00 ? 66  ARG A HG2  5  
ATOM 7343  H HG3  . ARG A 1 66  ? -4.186  -11.892 -1.823  1.00 0.00 ? 66  ARG A HG3  5  
ATOM 7344  H HD2  . ARG A 1 66  ? -5.549  -11.594 -0.011  1.00 0.00 ? 66  ARG A HD2  5  
ATOM 7345  H HD3  . ARG A 1 66  ? -4.024  -11.004 0.648   1.00 0.00 ? 66  ARG A HD3  5  
ATOM 7346  H HE   . ARG A 1 66  ? -4.946  -8.919  0.796   1.00 0.00 ? 66  ARG A HE   5  
ATOM 7347  H HH11 . ARG A 1 66  ? -6.869  -10.851 -1.369  1.00 0.00 ? 66  ARG A HH11 5  
ATOM 7348  H HH12 . ARG A 1 66  ? -8.118  -9.662  -1.531  1.00 0.00 ? 66  ARG A HH12 5  
ATOM 7349  H HH21 . ARG A 1 66  ? -6.584  -7.345  0.591   1.00 0.00 ? 66  ARG A HH21 5  
ATOM 7350  H HH22 . ARG A 1 66  ? -7.955  -7.667  -0.416  1.00 0.00 ? 66  ARG A HH22 5  
ATOM 7351  N N    . PHE A 1 67  ? -1.579  -8.065  0.482   1.00 0.00 ? 67  PHE A N    5  
ATOM 7352  C CA   . PHE A 1 67  ? -0.481  -7.594  1.319   1.00 0.00 ? 67  PHE A CA   5  
ATOM 7353  C C    . PHE A 1 67  ? -0.106  -8.640  2.364   1.00 0.00 ? 67  PHE A C    5  
ATOM 7354  O O    . PHE A 1 67  ? -0.965  -9.355  2.878   1.00 0.00 ? 67  PHE A O    5  
ATOM 7355  C CB   . PHE A 1 67  ? -0.864  -6.282  2.007   1.00 0.00 ? 67  PHE A CB   5  
ATOM 7356  C CG   . PHE A 1 67  ? -1.125  -5.156  1.049   1.00 0.00 ? 67  PHE A CG   5  
ATOM 7357  C CD1  . PHE A 1 67  ? -2.345  -5.050  0.399   1.00 0.00 ? 67  PHE A CD1  5  
ATOM 7358  C CD2  . PHE A 1 67  ? -0.152  -4.202  0.799   1.00 0.00 ? 67  PHE A CD2  5  
ATOM 7359  C CE1  . PHE A 1 67  ? -2.587  -4.015  -0.484  1.00 0.00 ? 67  PHE A CE1  5  
ATOM 7360  C CE2  . PHE A 1 67  ? -0.389  -3.164  -0.083  1.00 0.00 ? 67  PHE A CE2  5  
ATOM 7361  C CZ   . PHE A 1 67  ? -1.608  -3.070  -0.724  1.00 0.00 ? 67  PHE A CZ   5  
ATOM 7362  H H    . PHE A 1 67  ? -2.471  -8.167  0.876   1.00 0.00 ? 67  PHE A H    5  
ATOM 7363  H HA   . PHE A 1 67  ? 0.370   -7.419  0.679   1.00 0.00 ? 67  PHE A HA   5  
ATOM 7364  H HB2  . PHE A 1 67  ? -1.761  -6.437  2.588   1.00 0.00 ? 67  PHE A HB2  5  
ATOM 7365  H HB3  . PHE A 1 67  ? -0.062  -5.982  2.664   1.00 0.00 ? 67  PHE A HB3  5  
ATOM 7366  H HD1  . PHE A 1 67  ? -3.111  -5.787  0.587   1.00 0.00 ? 67  PHE A HD1  5  
ATOM 7367  H HD2  . PHE A 1 67  ? 0.803   -4.274  1.301   1.00 0.00 ? 67  PHE A HD2  5  
ATOM 7368  H HE1  . PHE A 1 67  ? -3.541  -3.943  -0.984  1.00 0.00 ? 67  PHE A HE1  5  
ATOM 7369  H HE2  . PHE A 1 67  ? 0.378   -2.427  -0.268  1.00 0.00 ? 67  PHE A HE2  5  
ATOM 7370  H HZ   . PHE A 1 67  ? -1.795  -2.260  -1.414  1.00 0.00 ? 67  PHE A HZ   5  
ATOM 7371  N N    . ARG A 1 68  ? 1.184   -8.722  2.673   1.00 0.00 ? 68  ARG A N    5  
ATOM 7372  C CA   . ARG A 1 68  ? 1.675   -9.681  3.655   1.00 0.00 ? 68  ARG A CA   5  
ATOM 7373  C C    . ARG A 1 68  ? 2.724   -9.043  4.561   1.00 0.00 ? 68  ARG A C    5  
ATOM 7374  O O    . ARG A 1 68  ? 3.423   -8.112  4.159   1.00 0.00 ? 68  ARG A O    5  
ATOM 7375  C CB   . ARG A 1 68  ? 2.267   -10.904 2.953   1.00 0.00 ? 68  ARG A CB   5  
ATOM 7376  C CG   . ARG A 1 68  ? 1.244   -11.985 2.646   1.00 0.00 ? 68  ARG A CG   5  
ATOM 7377  C CD   . ARG A 1 68  ? 1.914   -13.280 2.212   1.00 0.00 ? 68  ARG A CD   5  
ATOM 7378  N NE   . ARG A 1 68  ? 1.070   -14.056 1.307   1.00 0.00 ? 68  ARG A NE   5  
ATOM 7379  C CZ   . ARG A 1 68  ? -0.049  -14.663 1.685   1.00 0.00 ? 68  ARG A CZ   5  
ATOM 7380  N NH1  . ARG A 1 68  ? -0.458  -14.583 2.944   1.00 0.00 ? 68  ARG A NH1  5  
ATOM 7381  N NH2  . ARG A 1 68  ? -0.763  -15.350 0.803   1.00 0.00 ? 68  ARG A NH2  5  
ATOM 7382  H H    . ARG A 1 68  ? 1.822   -8.124  2.229   1.00 0.00 ? 68  ARG A H    5  
ATOM 7383  H HA   . ARG A 1 68  ? 0.837   -9.994  4.260   1.00 0.00 ? 68  ARG A HA   5  
ATOM 7384  H HB2  . ARG A 1 68  ? 2.716   -10.589 2.023   1.00 0.00 ? 68  ARG A HB2  5  
ATOM 7385  H HB3  . ARG A 1 68  ? 3.031   -11.332 3.585   1.00 0.00 ? 68  ARG A HB3  5  
ATOM 7386  H HG2  . ARG A 1 68  ? 0.658   -12.176 3.533   1.00 0.00 ? 68  ARG A HG2  5  
ATOM 7387  H HG3  . ARG A 1 68  ? 0.598   -11.641 1.853   1.00 0.00 ? 68  ARG A HG3  5  
ATOM 7388  H HD2  . ARG A 1 68  ? 2.839   -13.040 1.710   1.00 0.00 ? 68  ARG A HD2  5  
ATOM 7389  H HD3  . ARG A 1 68  ? 2.124   -13.872 3.090   1.00 0.00 ? 68  ARG A HD3  5  
ATOM 7390  H HE   . ARG A 1 68  ? 1.354   -14.128 0.373   1.00 0.00 ? 68  ARG A HE   5  
ATOM 7391  H HH11 . ARG A 1 68  ? 0.077   -14.064 3.611   1.00 0.00 ? 68  ARG A HH11 5  
ATOM 7392  H HH12 . ARG A 1 68  ? -1.302  -15.039 3.226   1.00 0.00 ? 68  ARG A HH12 5  
ATOM 7393  H HH21 . ARG A 1 68  ? -0.458  -15.413 -0.147  1.00 0.00 ? 68  ARG A HH21 5  
ATOM 7394  H HH22 . ARG A 1 68  ? -1.605  -15.807 1.089   1.00 0.00 ? 68  ARG A HH22 5  
ATOM 7395  N N    . PHE A 1 69  ? 2.829   -9.550  5.785   1.00 0.00 ? 69  PHE A N    5  
ATOM 7396  C CA   . PHE A 1 69  ? 3.792   -9.028  6.748   1.00 0.00 ? 69  PHE A CA   5  
ATOM 7397  C C    . PHE A 1 69  ? 4.382   -10.155 7.591   1.00 0.00 ? 69  PHE A C    5  
ATOM 7398  O O    . PHE A 1 69  ? 3.718   -10.697 8.475   1.00 0.00 ? 69  PHE A O    5  
ATOM 7399  C CB   . PHE A 1 69  ? 3.127   -7.992  7.656   1.00 0.00 ? 69  PHE A CB   5  
ATOM 7400  C CG   . PHE A 1 69  ? 4.064   -7.388  8.663   1.00 0.00 ? 69  PHE A CG   5  
ATOM 7401  C CD1  . PHE A 1 69  ? 5.122   -6.593  8.255   1.00 0.00 ? 69  PHE A CD1  5  
ATOM 7402  C CD2  . PHE A 1 69  ? 3.886   -7.617  10.018  1.00 0.00 ? 69  PHE A CD2  5  
ATOM 7403  C CE1  . PHE A 1 69  ? 5.986   -6.035  9.179   1.00 0.00 ? 69  PHE A CE1  5  
ATOM 7404  C CE2  . PHE A 1 69  ? 4.746   -7.062  10.947  1.00 0.00 ? 69  PHE A CE2  5  
ATOM 7405  C CZ   . PHE A 1 69  ? 5.798   -6.271  10.527  1.00 0.00 ? 69  PHE A CZ   5  
ATOM 7406  H H    . PHE A 1 69  ? 2.244   -10.291 6.047   1.00 0.00 ? 69  PHE A H    5  
ATOM 7407  H HA   . PHE A 1 69  ? 4.588   -8.553  6.196   1.00 0.00 ? 69  PHE A HA   5  
ATOM 7408  H HB2  . PHE A 1 69  ? 2.733   -7.191  7.048   1.00 0.00 ? 69  PHE A HB2  5  
ATOM 7409  H HB3  . PHE A 1 69  ? 2.317   -8.462  8.194   1.00 0.00 ? 69  PHE A HB3  5  
ATOM 7410  H HD1  . PHE A 1 69  ? 5.270   -6.408  7.200   1.00 0.00 ? 69  PHE A HD1  5  
ATOM 7411  H HD2  . PHE A 1 69  ? 3.065   -8.235  10.348  1.00 0.00 ? 69  PHE A HD2  5  
ATOM 7412  H HE1  . PHE A 1 69  ? 6.807   -5.418  8.847   1.00 0.00 ? 69  PHE A HE1  5  
ATOM 7413  H HE2  . PHE A 1 69  ? 4.597   -7.248  12.000  1.00 0.00 ? 69  PHE A HE2  5  
ATOM 7414  H HZ   . PHE A 1 69  ? 6.471   -5.836  11.250  1.00 0.00 ? 69  PHE A HZ   5  
ATOM 7415  N N    . ASP A 1 70  ? 5.633   -10.503 7.310   1.00 0.00 ? 70  ASP A N    5  
ATOM 7416  C CA   . ASP A 1 70  ? 6.314   -11.565 8.042   1.00 0.00 ? 70  ASP A CA   5  
ATOM 7417  C C    . ASP A 1 70  ? 5.713   -12.927 7.707   1.00 0.00 ? 70  ASP A C    5  
ATOM 7418  O O    . ASP A 1 70  ? 5.735   -13.844 8.527   1.00 0.00 ? 70  ASP A O    5  
ATOM 7419  C CB   . ASP A 1 70  ? 6.229   -11.312 9.548   1.00 0.00 ? 70  ASP A CB   5  
ATOM 7420  C CG   . ASP A 1 70  ? 7.391   -11.923 10.304  1.00 0.00 ? 70  ASP A CG   5  
ATOM 7421  O OD1  . ASP A 1 70  ? 8.499   -11.999 9.732   1.00 0.00 ? 70  ASP A OD1  5  
ATOM 7422  O OD2  . ASP A 1 70  ? 7.194   -12.326 11.470  1.00 0.00 ? 70  ASP A OD2  5  
ATOM 7423  H H    . ASP A 1 70  ? 6.110   -10.034 6.593   1.00 0.00 ? 70  ASP A H    5  
ATOM 7424  H HA   . ASP A 1 70  ? 7.352   -11.560 7.743   1.00 0.00 ? 70  ASP A HA   5  
ATOM 7425  H HB2  . ASP A 1 70  ? 6.227   -10.246 9.728   1.00 0.00 ? 70  ASP A HB2  5  
ATOM 7426  H HB3  . ASP A 1 70  ? 5.311   -11.738 9.926   1.00 0.00 ? 70  ASP A HB3  5  
ATOM 7427  N N    . GLY A 1 71  ? 5.177   -13.051 6.497   1.00 0.00 ? 71  GLY A N    5  
ATOM 7428  C CA   . GLY A 1 71  ? 4.577   -14.303 6.077   1.00 0.00 ? 71  GLY A CA   5  
ATOM 7429  C C    . GLY A 1 71  ? 3.166   -14.476 6.604   1.00 0.00 ? 71  GLY A C    5  
ATOM 7430  O O    . GLY A 1 71  ? 2.713   -15.599 6.824   1.00 0.00 ? 71  GLY A O    5  
ATOM 7431  H H    . GLY A 1 71  ? 5.188   -12.285 5.885   1.00 0.00 ? 71  GLY A H    5  
ATOM 7432  H HA2  . GLY A 1 71  ? 4.553   -14.334 4.997   1.00 0.00 ? 71  GLY A HA2  5  
ATOM 7433  H HA3  . GLY A 1 71  ? 5.185   -15.119 6.437   1.00 0.00 ? 71  GLY A HA3  5  
ATOM 7434  N N    . GLN A 1 72  ? 2.471   -13.361 6.808   1.00 0.00 ? 72  GLN A N    5  
ATOM 7435  C CA   . GLN A 1 72  ? 1.105   -13.396 7.315   1.00 0.00 ? 72  GLN A CA   5  
ATOM 7436  C C    . GLN A 1 72  ? 0.247   -12.330 6.640   1.00 0.00 ? 72  GLN A C    5  
ATOM 7437  O O    . GLN A 1 72  ? 0.715   -11.243 6.303   1.00 0.00 ? 72  GLN A O    5  
ATOM 7438  C CB   . GLN A 1 72  ? 1.096   -13.190 8.831   1.00 0.00 ? 72  GLN A CB   5  
ATOM 7439  C CG   . GLN A 1 72  ? 1.631   -14.380 9.610   1.00 0.00 ? 72  GLN A CG   5  
ATOM 7440  C CD   . GLN A 1 72  ? 1.500   -14.203 11.109  1.00 0.00 ? 72  GLN A CD   5  
ATOM 7441  O OE1  . GLN A 1 72  ? 0.545   -14.682 11.722  1.00 0.00 ? 72  GLN A OE1  5  
ATOM 7442  N NE2  . GLN A 1 72  ? 2.462   -13.512 11.710  1.00 0.00 ? 72  GLN A NE2  5  
ATOM 7443  H H    . GLN A 1 72  ? 2.888   -12.496 6.613   1.00 0.00 ? 72  GLN A H    5  
ATOM 7444  H HA   . GLN A 1 72  ? 0.692   -14.367 7.090   1.00 0.00 ? 72  GLN A HA   5  
ATOM 7445  H HB2  . GLN A 1 72  ? 1.702   -12.329 9.069   1.00 0.00 ? 72  GLN A HB2  5  
ATOM 7446  H HB3  . GLN A 1 72  ? 0.081   -13.005 9.151   1.00 0.00 ? 72  GLN A HB3  5  
ATOM 7447  H HG2  . GLN A 1 72  ? 1.080   -15.262 9.318   1.00 0.00 ? 72  GLN A HG2  5  
ATOM 7448  H HG3  . GLN A 1 72  ? 2.675   -14.513 9.367   1.00 0.00 ? 72  GLN A HG3  5  
ATOM 7449  H HE21 . GLN A 1 72  ? 3.191   -13.159 11.158  1.00 0.00 ? 72  GLN A HE21 5  
ATOM 7450  H HE22 . GLN A 1 72  ? 2.402   -13.382 12.679  1.00 0.00 ? 72  GLN A HE22 5  
ATOM 7451  N N    . PRO A 1 73  ? -1.040  -12.648 6.437   1.00 0.00 ? 73  PRO A N    5  
ATOM 7452  C CA   . PRO A 1 73  ? -1.991  -11.731 5.801   1.00 0.00 ? 73  PRO A CA   5  
ATOM 7453  C C    . PRO A 1 73  ? -2.324  -10.535 6.686   1.00 0.00 ? 73  PRO A C    5  
ATOM 7454  O O    . PRO A 1 73  ? -2.687  -10.696 7.852   1.00 0.00 ? 73  PRO A O    5  
ATOM 7455  C CB   . PRO A 1 73  ? -3.233  -12.600 5.587   1.00 0.00 ? 73  PRO A CB   5  
ATOM 7456  C CG   . PRO A 1 73  ? -3.136  -13.662 6.627   1.00 0.00 ? 73  PRO A CG   5  
ATOM 7457  C CD   . PRO A 1 73  ? -1.667  -13.926 6.813   1.00 0.00 ? 73  PRO A CD   5  
ATOM 7458  H HA   . PRO A 1 73  ? -1.626  -11.381 4.846   1.00 0.00 ? 73  PRO A HA   5  
ATOM 7459  H HB2  . PRO A 1 73  ? -4.122  -11.999 5.716   1.00 0.00 ? 73  PRO A HB2  5  
ATOM 7460  H HB3  . PRO A 1 73  ? -3.216  -13.019 4.592   1.00 0.00 ? 73  PRO A HB3  5  
ATOM 7461  H HG2  . PRO A 1 73  ? -3.574  -13.314 7.549   1.00 0.00 ? 73  PRO A HG2  5  
ATOM 7462  H HG3  . PRO A 1 73  ? -3.636  -14.556 6.286   1.00 0.00 ? 73  PRO A HG3  5  
ATOM 7463  H HD2  . PRO A 1 73  ? -1.456  -14.171 7.844   1.00 0.00 ? 73  PRO A HD2  5  
ATOM 7464  H HD3  . PRO A 1 73  ? -1.341  -14.722 6.160   1.00 0.00 ? 73  PRO A HD3  5  
ATOM 7465  N N    . ILE A 1 74  ? -2.199  -9.337  6.126   1.00 0.00 ? 74  ILE A N    5  
ATOM 7466  C CA   . ILE A 1 74  ? -2.488  -8.114  6.865   1.00 0.00 ? 74  ILE A CA   5  
ATOM 7467  C C    . ILE A 1 74  ? -3.724  -7.415  6.309   1.00 0.00 ? 74  ILE A C    5  
ATOM 7468  O O    . ILE A 1 74  ? -3.886  -7.290  5.095   1.00 0.00 ? 74  ILE A O    5  
ATOM 7469  C CB   . ILE A 1 74  ? -1.298  -7.137  6.825   1.00 0.00 ? 74  ILE A CB   5  
ATOM 7470  C CG1  . ILE A 1 74  ? -0.571  -7.239  5.482   1.00 0.00 ? 74  ILE A CG1  5  
ATOM 7471  C CG2  . ILE A 1 74  ? -0.342  -7.420  7.974   1.00 0.00 ? 74  ILE A CG2  5  
ATOM 7472  C CD1  . ILE A 1 74  ? 0.646   -6.346  5.385   1.00 0.00 ? 74  ILE A CD1  5  
ATOM 7473  H H    . ILE A 1 74  ? -1.906  -9.274  5.193   1.00 0.00 ? 74  ILE A H    5  
ATOM 7474  H HA   . ILE A 1 74  ? -2.673  -8.384  7.895   1.00 0.00 ? 74  ILE A HA   5  
ATOM 7475  H HB   . ILE A 1 74  ? -1.680  -6.135  6.944   1.00 0.00 ? 74  ILE A HB   5  
ATOM 7476  H HG12 . ILE A 1 74  ? -0.248  -8.257  5.331   1.00 0.00 ? 74  ILE A HG12 5  
ATOM 7477  H HG13 . ILE A 1 74  ? -1.252  -6.961  4.691   1.00 0.00 ? 74  ILE A HG13 5  
ATOM 7478  H HG21 . ILE A 1 74  ? 0.420   -8.112  7.646   1.00 0.00 ? 74  ILE A HG21 5  
ATOM 7479  H HG22 . ILE A 1 74  ? 0.122   -6.498  8.290   1.00 0.00 ? 74  ILE A HG22 5  
ATOM 7480  H HG23 . ILE A 1 74  ? -0.888  -7.850  8.799   1.00 0.00 ? 74  ILE A HG23 5  
ATOM 7481  H HD11 . ILE A 1 74  ? 0.795   -5.836  6.325   1.00 0.00 ? 74  ILE A HD11 5  
ATOM 7482  H HD12 . ILE A 1 74  ? 1.515   -6.945  5.156   1.00 0.00 ? 74  ILE A HD12 5  
ATOM 7483  H HD13 . ILE A 1 74  ? 0.495   -5.617  4.601   1.00 0.00 ? 74  ILE A HD13 5  
ATOM 7484  N N    . ASN A 1 75  ? -4.594  -6.960  7.205   1.00 0.00 ? 75  ASN A N    5  
ATOM 7485  C CA   . ASN A 1 75  ? -5.815  -6.272  6.804   1.00 0.00 ? 75  ASN A CA   5  
ATOM 7486  C C    . ASN A 1 75  ? -5.638  -4.759  6.883   1.00 0.00 ? 75  ASN A C    5  
ATOM 7487  O O    . ASN A 1 75  ? -4.870  -4.256  7.702   1.00 0.00 ? 75  ASN A O    5  
ATOM 7488  C CB   . ASN A 1 75  ? -6.984  -6.707  7.691   1.00 0.00 ? 75  ASN A CB   5  
ATOM 7489  C CG   . ASN A 1 75  ? -6.538  -7.098  9.086   1.00 0.00 ? 75  ASN A CG   5  
ATOM 7490  O OD1  . ASN A 1 75  ? -6.792  -6.382  10.055  1.00 0.00 ? 75  ASN A OD1  5  
ATOM 7491  N ND2  . ASN A 1 75  ? -5.868  -8.240  9.194   1.00 0.00 ? 75  ASN A ND2  5  
ATOM 7492  H H    . ASN A 1 75  ? -4.410  -7.091  8.159   1.00 0.00 ? 75  ASN A H    5  
ATOM 7493  H HA   . ASN A 1 75  ? -6.029  -6.546  5.782   1.00 0.00 ? 75  ASN A HA   5  
ATOM 7494  H HB2  . ASN A 1 75  ? -7.687  -5.891  7.774   1.00 0.00 ? 75  ASN A HB2  5  
ATOM 7495  H HB3  . ASN A 1 75  ? -7.476  -7.555  7.238   1.00 0.00 ? 75  ASN A HB3  5  
ATOM 7496  H HD21 . ASN A 1 75  ? -5.702  -8.759  8.379   1.00 0.00 ? 75  ASN A HD21 5  
ATOM 7497  H HD22 . ASN A 1 75  ? -5.568  -8.517  10.085  1.00 0.00 ? 75  ASN A HD22 5  
ATOM 7498  N N    . GLU A 1 76  ? -6.355  -4.039  6.025   1.00 0.00 ? 76  GLU A N    5  
ATOM 7499  C CA   . GLU A 1 76  ? -6.277  -2.584  5.998   1.00 0.00 ? 76  GLU A CA   5  
ATOM 7500  C C    . GLU A 1 76  ? -6.648  -1.993  7.355   1.00 0.00 ? 76  GLU A C    5  
ATOM 7501  O O    . GLU A 1 76  ? -6.159  -0.930  7.738   1.00 0.00 ? 76  GLU A O    5  
ATOM 7502  C CB   . GLU A 1 76  ? -7.200  -2.021  4.915   1.00 0.00 ? 76  GLU A CB   5  
ATOM 7503  C CG   . GLU A 1 76  ? -8.570  -2.676  4.883   1.00 0.00 ? 76  GLU A CG   5  
ATOM 7504  C CD   . GLU A 1 76  ? -9.631  -1.780  4.275   1.00 0.00 ? 76  GLU A CD   5  
ATOM 7505  O OE1  . GLU A 1 76  ? -9.513  -1.448  3.076   1.00 0.00 ? 76  GLU A OE1  5  
ATOM 7506  O OE2  . GLU A 1 76  ? -10.580 -1.410  4.998   1.00 0.00 ? 76  GLU A OE2  5  
ATOM 7507  H H    . GLU A 1 76  ? -6.951  -4.498  5.396   1.00 0.00 ? 76  GLU A H    5  
ATOM 7508  H HA   . GLU A 1 76  ? -5.258  -2.311  5.767   1.00 0.00 ? 76  GLU A HA   5  
ATOM 7509  H HB2  . GLU A 1 76  ? -7.333  -0.963  5.086   1.00 0.00 ? 76  GLU A HB2  5  
ATOM 7510  H HB3  . GLU A 1 76  ? -6.733  -2.165  3.952   1.00 0.00 ? 76  GLU A HB3  5  
ATOM 7511  H HG2  . GLU A 1 76  ? -8.509  -3.582  4.298   1.00 0.00 ? 76  GLU A HG2  5  
ATOM 7512  H HG3  . GLU A 1 76  ? -8.862  -2.920  5.893   1.00 0.00 ? 76  GLU A HG3  5  
ATOM 7513  N N    . THR A 1 77  ? -7.518  -2.691  8.079   1.00 0.00 ? 77  THR A N    5  
ATOM 7514  C CA   . THR A 1 77  ? -7.957  -2.236  9.393   1.00 0.00 ? 77  THR A CA   5  
ATOM 7515  C C    . THR A 1 77  ? -6.821  -2.304  10.407  1.00 0.00 ? 77  THR A C    5  
ATOM 7516  O O    . THR A 1 77  ? -6.631  -1.384  11.203  1.00 0.00 ? 77  THR A O    5  
ATOM 7517  C CB   . THR A 1 77  ? -9.142  -3.074  9.910   1.00 0.00 ? 77  THR A CB   5  
ATOM 7518  O OG1  . THR A 1 77  ? -8.727  -4.427  10.129  1.00 0.00 ? 77  THR A OG1  5  
ATOM 7519  C CG2  . THR A 1 77  ? -10.297 -3.046  8.920   1.00 0.00 ? 77  THR A CG2  5  
ATOM 7520  H H    . THR A 1 77  ? -7.873  -3.531  7.720   1.00 0.00 ? 77  THR A H    5  
ATOM 7521  H HA   . THR A 1 77  ? -8.283  -1.210  9.299   1.00 0.00 ? 77  THR A HA   5  
ATOM 7522  H HB   . THR A 1 77  ? -9.480  -2.653  10.846  1.00 0.00 ? 77  THR A HB   5  
ATOM 7523  H HG1  . THR A 1 77  ? -8.150  -4.704  9.413   1.00 0.00 ? 77  THR A HG1  5  
ATOM 7524  H HG21 . THR A 1 77  ? -9.983  -2.550  8.014   1.00 0.00 ? 77  THR A HG21 5  
ATOM 7525  H HG22 . THR A 1 77  ? -11.130 -2.512  9.353   1.00 0.00 ? 77  THR A HG22 5  
ATOM 7526  H HG23 . THR A 1 77  ? -10.598 -4.057  8.690   1.00 0.00 ? 77  THR A HG23 5  
ATOM 7527  N N    . ASP A 1 78  ? -6.068  -3.398  10.371  1.00 0.00 ? 78  ASP A N    5  
ATOM 7528  C CA   . ASP A 1 78  ? -4.948  -3.584  11.287  1.00 0.00 ? 78  ASP A CA   5  
ATOM 7529  C C    . ASP A 1 78  ? -3.973  -2.415  11.198  1.00 0.00 ? 78  ASP A C    5  
ATOM 7530  O O    . ASP A 1 78  ? -3.856  -1.767  10.157  1.00 0.00 ? 78  ASP A O    5  
ATOM 7531  C CB   . ASP A 1 78  ? -4.222  -4.895  10.978  1.00 0.00 ? 78  ASP A CB   5  
ATOM 7532  C CG   . ASP A 1 78  ? -4.848  -6.083  11.681  1.00 0.00 ? 78  ASP A CG   5  
ATOM 7533  O OD1  . ASP A 1 78  ? -5.505  -5.877  12.722  1.00 0.00 ? 78  ASP A OD1  5  
ATOM 7534  O OD2  . ASP A 1 78  ? -4.681  -7.219  11.189  1.00 0.00 ? 78  ASP A OD2  5  
ATOM 7535  H H    . ASP A 1 78  ? -6.269  -4.096  9.713   1.00 0.00 ? 78  ASP A H    5  
ATOM 7536  H HA   . ASP A 1 78  ? -5.344  -3.631  12.290  1.00 0.00 ? 78  ASP A HA   5  
ATOM 7537  H HB2  . ASP A 1 78  ? -4.253  -5.073  9.912   1.00 0.00 ? 78  ASP A HB2  5  
ATOM 7538  H HB3  . ASP A 1 78  ? -3.193  -4.812  11.295  1.00 0.00 ? 78  ASP A HB3  5  
ATOM 7539  N N    . THR A 1 79  ? -3.273  -2.149  12.297  1.00 0.00 ? 79  THR A N    5  
ATOM 7540  C CA   . THR A 1 79  ? -2.310  -1.057  12.344  1.00 0.00 ? 79  THR A CA   5  
ATOM 7541  C C    . THR A 1 79  ? -0.882  -1.586  12.421  1.00 0.00 ? 79  THR A C    5  
ATOM 7542  O O    . THR A 1 79  ? -0.640  -2.737  12.784  1.00 0.00 ? 79  THR A O    5  
ATOM 7543  C CB   . THR A 1 79  ? -2.568  -0.132  13.549  1.00 0.00 ? 79  THR A CB   5  
ATOM 7544  O OG1  . THR A 1 79  ? -3.155  -0.876  14.622  1.00 0.00 ? 79  THR A OG1  5  
ATOM 7545  C CG2  . THR A 1 79  ? -3.486  1.018   13.161  1.00 0.00 ? 79  THR A CG2  5  
ATOM 7546  H H    . THR A 1 79  ? -3.411  -2.701  13.095  1.00 0.00 ? 79  THR A H    5  
ATOM 7547  H HA   . THR A 1 79  ? -2.420  -0.475  11.440  1.00 0.00 ? 79  THR A HA   5  
ATOM 7548  H HB   . THR A 1 79  ? -1.624  0.277   13.878  1.00 0.00 ? 79  THR A HB   5  
ATOM 7549  H HG1  . THR A 1 79  ? -2.636  -1.668  14.783  1.00 0.00 ? 79  THR A HG1  5  
ATOM 7550  H HG21 . THR A 1 79  ? -3.269  1.877   13.779  1.00 0.00 ? 79  THR A HG21 5  
ATOM 7551  H HG22 . THR A 1 79  ? -4.515  0.721   13.305  1.00 0.00 ? 79  THR A HG22 5  
ATOM 7552  H HG23 . THR A 1 79  ? -3.326  1.271   12.124  1.00 0.00 ? 79  THR A HG23 5  
ATOM 7553  N N    . PRO A 1 80  ? 0.087   -0.727  12.073  1.00 0.00 ? 80  PRO A N    5  
ATOM 7554  C CA   . PRO A 1 80  ? 1.508   -1.086  12.096  1.00 0.00 ? 80  PRO A CA   5  
ATOM 7555  C C    . PRO A 1 80  ? 2.039   -1.262  13.515  1.00 0.00 ? 80  PRO A C    5  
ATOM 7556  O O    . PRO A 1 80  ? 3.066   -1.906  13.728  1.00 0.00 ? 80  PRO A O    5  
ATOM 7557  C CB   . PRO A 1 80  ? 2.186   0.106   11.416  1.00 0.00 ? 80  PRO A CB   5  
ATOM 7558  C CG   . PRO A 1 80  ? 1.256   1.248   11.637  1.00 0.00 ? 80  PRO A CG   5  
ATOM 7559  C CD   . PRO A 1 80  ? -0.129  0.661   11.631  1.00 0.00 ? 80  PRO A CD   5  
ATOM 7560  H HA   . PRO A 1 80  ? 1.700   -1.984  11.527  1.00 0.00 ? 80  PRO A HA   5  
ATOM 7561  H HB2  . PRO A 1 80  ? 3.149   0.286   11.874  1.00 0.00 ? 80  PRO A HB2  5  
ATOM 7562  H HB3  . PRO A 1 80  ? 2.315   -0.100  10.364  1.00 0.00 ? 80  PRO A HB3  5  
ATOM 7563  H HG2  . PRO A 1 80  ? 1.462   1.712   12.590  1.00 0.00 ? 80  PRO A HG2  5  
ATOM 7564  H HG3  . PRO A 1 80  ? 1.361   1.967   10.838  1.00 0.00 ? 80  PRO A HG3  5  
ATOM 7565  H HD2  . PRO A 1 80  ? -0.767  1.191   12.323  1.00 0.00 ? 80  PRO A HD2  5  
ATOM 7566  H HD3  . PRO A 1 80  ? -0.545  0.687   10.635  1.00 0.00 ? 80  PRO A HD3  5  
ATOM 7567  N N    . ALA A 1 81  ? 1.332   -0.686  14.482  1.00 0.00 ? 81  ALA A N    5  
ATOM 7568  C CA   . ALA A 1 81  ? 1.731   -0.782  15.880  1.00 0.00 ? 81  ALA A CA   5  
ATOM 7569  C C    . ALA A 1 81  ? 1.328   -2.128  16.475  1.00 0.00 ? 81  ALA A C    5  
ATOM 7570  O O    . ALA A 1 81  ? 1.995   -2.644  17.371  1.00 0.00 ? 81  ALA A O    5  
ATOM 7571  C CB   . ALA A 1 81  ? 1.119   0.356   16.683  1.00 0.00 ? 81  ALA A CB   5  
ATOM 7572  H H    . ALA A 1 81  ? 0.523   -0.186  14.249  1.00 0.00 ? 81  ALA A H    5  
ATOM 7573  H HA   . ALA A 1 81  ? 2.806   -0.687  15.928  1.00 0.00 ? 81  ALA A HA   5  
ATOM 7574  H HB1  . ALA A 1 81  ? 1.069   0.074   17.725  1.00 0.00 ? 81  ALA A HB1  5  
ATOM 7575  H HB2  . ALA A 1 81  ? 1.731   1.240   16.578  1.00 0.00 ? 81  ALA A HB2  5  
ATOM 7576  H HB3  . ALA A 1 81  ? 0.124   0.560   16.317  1.00 0.00 ? 81  ALA A HB3  5  
ATOM 7577  N N    . GLN A 1 82  ? 0.234   -2.688  15.971  1.00 0.00 ? 82  GLN A N    5  
ATOM 7578  C CA   . GLN A 1 82  ? -0.258  -3.973  16.454  1.00 0.00 ? 82  GLN A CA   5  
ATOM 7579  C C    . GLN A 1 82  ? 0.735   -5.088  16.142  1.00 0.00 ? 82  GLN A C    5  
ATOM 7580  O O    . GLN A 1 82  ? 0.971   -5.972  16.966  1.00 0.00 ? 82  GLN A O    5  
ATOM 7581  C CB   . GLN A 1 82  ? -1.616  -4.292  15.826  1.00 0.00 ? 82  GLN A CB   5  
ATOM 7582  C CG   . GLN A 1 82  ? -2.247  -5.568  16.359  1.00 0.00 ? 82  GLN A CG   5  
ATOM 7583  C CD   . GLN A 1 82  ? -1.838  -6.796  15.570  1.00 0.00 ? 82  GLN A CD   5  
ATOM 7584  O OE1  . GLN A 1 82  ? -0.693  -7.243  15.644  1.00 0.00 ? 82  GLN A OE1  5  
ATOM 7585  N NE2  . GLN A 1 82  ? -2.774  -7.349  14.807  1.00 0.00 ? 82  GLN A NE2  5  
ATOM 7586  H H    . GLN A 1 82  ? -0.254  -2.227  15.258  1.00 0.00 ? 82  GLN A H    5  
ATOM 7587  H HA   . GLN A 1 82  ? -0.375  -3.902  17.525  1.00 0.00 ? 82  GLN A HA   5  
ATOM 7588  H HB2  . GLN A 1 82  ? -2.291  -3.473  16.022  1.00 0.00 ? 82  GLN A HB2  5  
ATOM 7589  H HB3  . GLN A 1 82  ? -1.489  -4.398  14.759  1.00 0.00 ? 82  GLN A HB3  5  
ATOM 7590  H HG2  . GLN A 1 82  ? -1.944  -5.703  17.387  1.00 0.00 ? 82  GLN A HG2  5  
ATOM 7591  H HG3  . GLN A 1 82  ? -3.322  -5.470  16.312  1.00 0.00 ? 82  GLN A HG3  5  
ATOM 7592  H HE21 . GLN A 1 82  ? -3.664  -6.938  14.796  1.00 0.00 ? 82  GLN A HE21 5  
ATOM 7593  H HE22 . GLN A 1 82  ? -2.536  -8.143  14.285  1.00 0.00 ? 82  GLN A HE22 5  
ATOM 7594  N N    . LEU A 1 83  ? 1.313   -5.041  14.947  1.00 0.00 ? 83  LEU A N    5  
ATOM 7595  C CA   . LEU A 1 83  ? 2.281   -6.048  14.525  1.00 0.00 ? 83  LEU A CA   5  
ATOM 7596  C C    . LEU A 1 83  ? 3.699   -5.631  14.902  1.00 0.00 ? 83  LEU A C    5  
ATOM 7597  O O    . LEU A 1 83  ? 4.672   -6.262  14.489  1.00 0.00 ? 83  LEU A O    5  
ATOM 7598  C CB   . LEU A 1 83  ? 2.188   -6.272  13.015  1.00 0.00 ? 83  LEU A CB   5  
ATOM 7599  C CG   . LEU A 1 83  ? 0.775   -6.368  12.437  1.00 0.00 ? 83  LEU A CG   5  
ATOM 7600  C CD1  . LEU A 1 83  ? 0.751   -5.865  11.002  1.00 0.00 ? 83  LEU A CD1  5  
ATOM 7601  C CD2  . LEU A 1 83  ? 0.265   -7.800  12.511  1.00 0.00 ? 83  LEU A CD2  5  
ATOM 7602  H H    . LEU A 1 83  ? 1.085   -4.312  14.334  1.00 0.00 ? 83  LEU A H    5  
ATOM 7603  H HA   . LEU A 1 83  ? 2.043   -6.970  15.034  1.00 0.00 ? 83  LEU A HA   5  
ATOM 7604  H HB2  . LEU A 1 83  ? 2.689   -5.451  12.527  1.00 0.00 ? 83  LEU A HB2  5  
ATOM 7605  H HB3  . LEU A 1 83  ? 2.703   -7.194  12.786  1.00 0.00 ? 83  LEU A HB3  5  
ATOM 7606  H HG   . LEU A 1 83  ? 0.111   -5.745  13.020  1.00 0.00 ? 83  LEU A HG   5  
ATOM 7607  H HD11 . LEU A 1 83  ? 0.095   -6.489  10.413  1.00 0.00 ? 83  LEU A HD11 5  
ATOM 7608  H HD12 . LEU A 1 83  ? 1.748   -5.902  10.591  1.00 0.00 ? 83  LEU A HD12 5  
ATOM 7609  H HD13 . LEU A 1 83  ? 0.391   -4.847  10.984  1.00 0.00 ? 83  LEU A HD13 5  
ATOM 7610  H HD21 . LEU A 1 83  ? 0.275   -8.132  13.539  1.00 0.00 ? 83  LEU A HD21 5  
ATOM 7611  H HD22 . LEU A 1 83  ? 0.903   -8.441  11.920  1.00 0.00 ? 83  LEU A HD22 5  
ATOM 7612  H HD23 . LEU A 1 83  ? -0.744  -7.842  12.129  1.00 0.00 ? 83  LEU A HD23 5  
ATOM 7613  N N    . GLU A 1 84  ? 3.808   -4.566  15.690  1.00 0.00 ? 84  GLU A N    5  
ATOM 7614  C CA   . GLU A 1 84  ? 5.108   -4.067  16.124  1.00 0.00 ? 84  GLU A CA   5  
ATOM 7615  C C    . GLU A 1 84  ? 6.007   -3.779  14.925  1.00 0.00 ? 84  GLU A C    5  
ATOM 7616  O O    . GLU A 1 84  ? 7.224   -3.947  14.994  1.00 0.00 ? 84  GLU A O    5  
ATOM 7617  C CB   . GLU A 1 84  ? 5.785   -5.079  17.051  1.00 0.00 ? 84  GLU A CB   5  
ATOM 7618  C CG   . GLU A 1 84  ? 5.408   -4.912  18.513  1.00 0.00 ? 84  GLU A CG   5  
ATOM 7619  C CD   . GLU A 1 84  ? 6.479   -5.428  19.454  1.00 0.00 ? 84  GLU A CD   5  
ATOM 7620  O OE1  . GLU A 1 84  ? 6.756   -6.646  19.427  1.00 0.00 ? 84  GLU A OE1  5  
ATOM 7621  O OE2  . GLU A 1 84  ? 7.040   -4.615  20.218  1.00 0.00 ? 84  GLU A OE2  5  
ATOM 7622  H H    . GLU A 1 84  ? 2.996   -4.105  15.987  1.00 0.00 ? 84  GLU A H    5  
ATOM 7623  H HA   . GLU A 1 84  ? 4.947   -3.148  16.667  1.00 0.00 ? 84  GLU A HA   5  
ATOM 7624  H HB2  . GLU A 1 84  ? 5.507   -6.076  16.740  1.00 0.00 ? 84  GLU A HB2  5  
ATOM 7625  H HB3  . GLU A 1 84  ? 6.855   -4.970  16.962  1.00 0.00 ? 84  GLU A HB3  5  
ATOM 7626  H HG2  . GLU A 1 84  ? 5.249   -3.863  18.713  1.00 0.00 ? 84  GLU A HG2  5  
ATOM 7627  H HG3  . GLU A 1 84  ? 4.493   -5.456  18.700  1.00 0.00 ? 84  GLU A HG3  5  
ATOM 7628  N N    . MET A 1 85  ? 5.398   -3.343  13.827  1.00 0.00 ? 85  MET A N    5  
ATOM 7629  C CA   . MET A 1 85  ? 6.143   -3.030  12.613  1.00 0.00 ? 85  MET A CA   5  
ATOM 7630  C C    . MET A 1 85  ? 7.487   -2.391  12.949  1.00 0.00 ? 85  MET A C    5  
ATOM 7631  O O    . MET A 1 85  ? 7.541   -1.329  13.568  1.00 0.00 ? 85  MET A O    5  
ATOM 7632  C CB   . MET A 1 85  ? 5.330   -2.094  11.717  1.00 0.00 ? 85  MET A CB   5  
ATOM 7633  C CG   . MET A 1 85  ? 4.425   -2.825  10.738  1.00 0.00 ? 85  MET A CG   5  
ATOM 7634  S SD   . MET A 1 85  ? 5.243   -3.182  9.171   1.00 0.00 ? 85  MET A SD   5  
ATOM 7635  C CE   . MET A 1 85  ? 3.933   -4.029  8.291   1.00 0.00 ? 85  MET A CE   5  
ATOM 7636  H H    . MET A 1 85  ? 4.425   -3.229  13.833  1.00 0.00 ? 85  MET A H    5  
ATOM 7637  H HA   . MET A 1 85  ? 6.320   -3.956  12.086  1.00 0.00 ? 85  MET A HA   5  
ATOM 7638  H HB2  . MET A 1 85  ? 4.714   -1.463  12.340  1.00 0.00 ? 85  MET A HB2  5  
ATOM 7639  H HB3  . MET A 1 85  ? 6.010   -1.475  11.152  1.00 0.00 ? 85  MET A HB3  5  
ATOM 7640  H HG2  . MET A 1 85  ? 4.112   -3.757  11.183  1.00 0.00 ? 85  MET A HG2  5  
ATOM 7641  H HG3  . MET A 1 85  ? 3.558   -2.211  10.544  1.00 0.00 ? 85  MET A HG3  5  
ATOM 7642  H HE1  . MET A 1 85  ? 3.611   -4.886  8.863   1.00 0.00 ? 85  MET A HE1  5  
ATOM 7643  H HE2  . MET A 1 85  ? 3.101   -3.356  8.150   1.00 0.00 ? 85  MET A HE2  5  
ATOM 7644  H HE3  . MET A 1 85  ? 4.300   -4.356  7.328   1.00 0.00 ? 85  MET A HE3  5  
ATOM 7645  N N    . GLU A 1 86  ? 8.568   -3.046  12.539  1.00 0.00 ? 86  GLU A N    5  
ATOM 7646  C CA   . GLU A 1 86  ? 9.911   -2.541  12.798  1.00 0.00 ? 86  GLU A CA   5  
ATOM 7647  C C    . GLU A 1 86  ? 10.274  -1.431  11.816  1.00 0.00 ? 86  GLU A C    5  
ATOM 7648  O O    . GLU A 1 86  ? 9.639   -1.279  10.772  1.00 0.00 ? 86  GLU A O    5  
ATOM 7649  C CB   . GLU A 1 86  ? 10.934  -3.675  12.704  1.00 0.00 ? 86  GLU A CB   5  
ATOM 7650  C CG   . GLU A 1 86  ? 10.790  -4.717  13.800  1.00 0.00 ? 86  GLU A CG   5  
ATOM 7651  C CD   . GLU A 1 86  ? 11.773  -5.862  13.650  1.00 0.00 ? 86  GLU A CD   5  
ATOM 7652  O OE1  . GLU A 1 86  ? 11.440  -6.843  12.954  1.00 0.00 ? 86  GLU A OE1  5  
ATOM 7653  O OE2  . GLU A 1 86  ? 12.876  -5.774  14.229  1.00 0.00 ? 86  GLU A OE2  5  
ATOM 7654  H H    . GLU A 1 86  ? 8.460   -3.889  12.050  1.00 0.00 ? 86  GLU A H    5  
ATOM 7655  H HA   . GLU A 1 86  ? 9.926   -2.138  13.799  1.00 0.00 ? 86  GLU A HA   5  
ATOM 7656  H HB2  . GLU A 1 86  ? 10.820  -4.168  11.750  1.00 0.00 ? 86  GLU A HB2  5  
ATOM 7657  H HB3  . GLU A 1 86  ? 11.926  -3.254  12.765  1.00 0.00 ? 86  GLU A HB3  5  
ATOM 7658  H HG2  . GLU A 1 86  ? 10.957  -4.242  14.755  1.00 0.00 ? 86  GLU A HG2  5  
ATOM 7659  H HG3  . GLU A 1 86  ? 9.787   -5.117  13.769  1.00 0.00 ? 86  GLU A HG3  5  
ATOM 7660  N N    . ASP A 1 87  ? 11.299  -0.658  12.158  1.00 0.00 ? 87  ASP A N    5  
ATOM 7661  C CA   . ASP A 1 87  ? 11.747  0.438   11.307  1.00 0.00 ? 87  ASP A CA   5  
ATOM 7662  C C    . ASP A 1 87  ? 12.459  -0.093  10.067  1.00 0.00 ? 87  ASP A C    5  
ATOM 7663  O O    . ASP A 1 87  ? 13.306  -0.981  10.159  1.00 0.00 ? 87  ASP A O    5  
ATOM 7664  C CB   . ASP A 1 87  ? 12.679  1.368   12.086  1.00 0.00 ? 87  ASP A CB   5  
ATOM 7665  C CG   . ASP A 1 87  ? 12.344  1.419   13.564  1.00 0.00 ? 87  ASP A CG   5  
ATOM 7666  O OD1  . ASP A 1 87  ? 12.747  0.491   14.296  1.00 0.00 ? 87  ASP A OD1  5  
ATOM 7667  O OD2  . ASP A 1 87  ? 11.679  2.387   13.988  1.00 0.00 ? 87  ASP A OD2  5  
ATOM 7668  H H    . ASP A 1 87  ? 11.765  -0.829  13.004  1.00 0.00 ? 87  ASP A H    5  
ATOM 7669  H HA   . ASP A 1 87  ? 10.876  0.995   10.996  1.00 0.00 ? 87  ASP A HA   5  
ATOM 7670  H HB2  . ASP A 1 87  ? 13.696  1.020   11.979  1.00 0.00 ? 87  ASP A HB2  5  
ATOM 7671  H HB3  . ASP A 1 87  ? 12.600  2.367   11.682  1.00 0.00 ? 87  ASP A HB3  5  
ATOM 7672  N N    . GLU A 1 88  ? 12.108  0.456   8.908   1.00 0.00 ? 88  GLU A N    5  
ATOM 7673  C CA   . GLU A 1 88  ? 12.712  0.035   7.650   1.00 0.00 ? 88  GLU A CA   5  
ATOM 7674  C C    . GLU A 1 88  ? 12.368  -1.419  7.341   1.00 0.00 ? 88  GLU A C    5  
ATOM 7675  O O    . GLU A 1 88  ? 13.173  -2.149  6.761   1.00 0.00 ? 88  GLU A O    5  
ATOM 7676  C CB   . GLU A 1 88  ? 14.231  0.211   7.704   1.00 0.00 ? 88  GLU A CB   5  
ATOM 7677  C CG   . GLU A 1 88  ? 14.669  1.643   7.959   1.00 0.00 ? 88  GLU A CG   5  
ATOM 7678  C CD   . GLU A 1 88  ? 14.703  2.477   6.694   1.00 0.00 ? 88  GLU A CD   5  
ATOM 7679  O OE1  . GLU A 1 88  ? 13.910  2.190   5.772   1.00 0.00 ? 88  GLU A OE1  5  
ATOM 7680  O OE2  . GLU A 1 88  ? 15.522  3.418   6.625   1.00 0.00 ? 88  GLU A OE2  5  
ATOM 7681  H H    . GLU A 1 88  ? 11.426  1.160   8.900   1.00 0.00 ? 88  GLU A H    5  
ATOM 7682  H HA   . GLU A 1 88  ? 12.315  0.661   6.866   1.00 0.00 ? 88  GLU A HA   5  
ATOM 7683  H HB2  . GLU A 1 88  ? 14.626  -0.411  8.494   1.00 0.00 ? 88  GLU A HB2  5  
ATOM 7684  H HB3  . GLU A 1 88  ? 14.652  -0.110  6.762   1.00 0.00 ? 88  GLU A HB3  5  
ATOM 7685  H HG2  . GLU A 1 88  ? 13.980  2.099   8.654   1.00 0.00 ? 88  GLU A HG2  5  
ATOM 7686  H HG3  . GLU A 1 88  ? 15.659  1.632   8.392   1.00 0.00 ? 88  GLU A HG3  5  
ATOM 7687  N N    . ASP A 1 89  ? 11.168  -1.833  7.732   1.00 0.00 ? 89  ASP A N    5  
ATOM 7688  C CA   . ASP A 1 89  ? 10.716  -3.199  7.497   1.00 0.00 ? 89  ASP A CA   5  
ATOM 7689  C C    . ASP A 1 89  ? 10.500  -3.452  6.008   1.00 0.00 ? 89  ASP A C    5  
ATOM 7690  O O    . ASP A 1 89  ? 10.792  -2.595  5.173   1.00 0.00 ? 89  ASP A O    5  
ATOM 7691  C CB   . ASP A 1 89  ? 9.422   -3.470  8.266   1.00 0.00 ? 89  ASP A CB   5  
ATOM 7692  C CG   . ASP A 1 89  ? 9.285   -4.924  8.674   1.00 0.00 ? 89  ASP A CG   5  
ATOM 7693  O OD1  . ASP A 1 89  ? 8.793   -5.726  7.854   1.00 0.00 ? 89  ASP A OD1  5  
ATOM 7694  O OD2  . ASP A 1 89  ? 9.669   -5.258  9.815   1.00 0.00 ? 89  ASP A OD2  5  
ATOM 7695  H H    . ASP A 1 89  ? 10.571  -1.204  8.190   1.00 0.00 ? 89  ASP A H    5  
ATOM 7696  H HA   . ASP A 1 89  ? 11.483  -3.869  7.855   1.00 0.00 ? 89  ASP A HA   5  
ATOM 7697  H HB2  . ASP A 1 89  ? 9.406   -2.862  9.158   1.00 0.00 ? 89  ASP A HB2  5  
ATOM 7698  H HB3  . ASP A 1 89  ? 8.579   -3.209  7.642   1.00 0.00 ? 89  ASP A HB3  5  
ATOM 7699  N N    . THR A 1 90  ? 9.988   -4.634  5.681   1.00 0.00 ? 90  THR A N    5  
ATOM 7700  C CA   . THR A 1 90  ? 9.736   -5.001  4.294   1.00 0.00 ? 90  THR A CA   5  
ATOM 7701  C C    . THR A 1 90  ? 8.373   -5.667  4.140   1.00 0.00 ? 90  THR A C    5  
ATOM 7702  O O    . THR A 1 90  ? 8.087   -6.673  4.790   1.00 0.00 ? 90  THR A O    5  
ATOM 7703  C CB   . THR A 1 90  ? 10.823  -5.951  3.757   1.00 0.00 ? 90  THR A CB   5  
ATOM 7704  O OG1  . THR A 1 90  ? 12.120  -5.388  3.981   1.00 0.00 ? 90  THR A OG1  5  
ATOM 7705  C CG2  . THR A 1 90  ? 10.628  -6.212  2.271   1.00 0.00 ? 90  THR A CG2  5  
ATOM 7706  H H    . THR A 1 90  ? 9.777   -5.275  6.392   1.00 0.00 ? 90  THR A H    5  
ATOM 7707  H HA   . THR A 1 90  ? 9.753   -4.097  3.702   1.00 0.00 ? 90  THR A HA   5  
ATOM 7708  H HB   . THR A 1 90  ? 10.750  -6.891  4.285   1.00 0.00 ? 90  THR A HB   5  
ATOM 7709  H HG1  . THR A 1 90  ? 12.068  -4.431  3.923   1.00 0.00 ? 90  THR A HG1  5  
ATOM 7710  H HG21 . THR A 1 90  ? 10.734  -5.285  1.726   1.00 0.00 ? 90  THR A HG21 5  
ATOM 7711  H HG22 . THR A 1 90  ? 9.641   -6.617  2.103   1.00 0.00 ? 90  THR A HG22 5  
ATOM 7712  H HG23 . THR A 1 90  ? 11.370  -6.917  1.929   1.00 0.00 ? 90  THR A HG23 5  
ATOM 7713  N N    . ILE A 1 91  ? 7.537   -5.101  3.277   1.00 0.00 ? 91  ILE A N    5  
ATOM 7714  C CA   . ILE A 1 91  ? 6.205   -5.642  3.037   1.00 0.00 ? 91  ILE A CA   5  
ATOM 7715  C C    . ILE A 1 91  ? 6.179   -6.501  1.778   1.00 0.00 ? 91  ILE A C    5  
ATOM 7716  O O    . ILE A 1 91  ? 6.865   -6.207  0.799   1.00 0.00 ? 91  ILE A O    5  
ATOM 7717  C CB   . ILE A 1 91  ? 5.158   -4.521  2.902   1.00 0.00 ? 91  ILE A CB   5  
ATOM 7718  C CG1  . ILE A 1 91  ? 5.348   -3.480  4.007   1.00 0.00 ? 91  ILE A CG1  5  
ATOM 7719  C CG2  . ILE A 1 91  ? 3.752   -5.101  2.949   1.00 0.00 ? 91  ILE A CG2  5  
ATOM 7720  C CD1  . ILE A 1 91  ? 4.206   -2.493  4.110   1.00 0.00 ? 91  ILE A CD1  5  
ATOM 7721  H H    . ILE A 1 91  ? 7.823   -4.301  2.789   1.00 0.00 ? 91  ILE A H    5  
ATOM 7722  H HA   . ILE A 1 91  ? 5.938   -6.257  3.885   1.00 0.00 ? 91  ILE A HA   5  
ATOM 7723  H HB   . ILE A 1 91  ? 5.293   -4.046  1.942   1.00 0.00 ? 91  ILE A HB   5  
ATOM 7724  H HG12 . ILE A 1 91  ? 5.436   -3.984  4.956   1.00 0.00 ? 91  ILE A HG12 5  
ATOM 7725  H HG13 . ILE A 1 91  ? 6.253   -2.923  3.814   1.00 0.00 ? 91  ILE A HG13 5  
ATOM 7726  H HG21 . ILE A 1 91  ? 3.808   -6.179  2.980   1.00 0.00 ? 91  ILE A HG21 5  
ATOM 7727  H HG22 . ILE A 1 91  ? 3.245   -4.743  3.832   1.00 0.00 ? 91  ILE A HG22 5  
ATOM 7728  H HG23 . ILE A 1 91  ? 3.206   -4.794  2.070   1.00 0.00 ? 91  ILE A HG23 5  
ATOM 7729  H HD11 . ILE A 1 91  ? 3.809   -2.505  5.114   1.00 0.00 ? 91  ILE A HD11 5  
ATOM 7730  H HD12 . ILE A 1 91  ? 4.564   -1.502  3.874   1.00 0.00 ? 91  ILE A HD12 5  
ATOM 7731  H HD13 . ILE A 1 91  ? 3.428   -2.769  3.413   1.00 0.00 ? 91  ILE A HD13 5  
ATOM 7732  N N    . ASP A 1 92  ? 5.382   -7.564  1.809   1.00 0.00 ? 92  ASP A N    5  
ATOM 7733  C CA   . ASP A 1 92  ? 5.264   -8.465  0.669   1.00 0.00 ? 92  ASP A CA   5  
ATOM 7734  C C    . ASP A 1 92  ? 3.930   -8.268  -0.044  1.00 0.00 ? 92  ASP A C    5  
ATOM 7735  O O    . ASP A 1 92  ? 2.866   -8.381  0.566   1.00 0.00 ? 92  ASP A O    5  
ATOM 7736  C CB   . ASP A 1 92  ? 5.403   -9.919  1.124   1.00 0.00 ? 92  ASP A CB   5  
ATOM 7737  C CG   . ASP A 1 92  ? 6.773   -10.215 1.703   1.00 0.00 ? 92  ASP A CG   5  
ATOM 7738  O OD1  . ASP A 1 92  ? 7.779   -9.919  1.026   1.00 0.00 ? 92  ASP A OD1  5  
ATOM 7739  O OD2  . ASP A 1 92  ? 6.838   -10.744 2.832   1.00 0.00 ? 92  ASP A OD2  5  
ATOM 7740  H H    . ASP A 1 92  ? 4.860   -7.746  2.619   1.00 0.00 ? 92  ASP A H    5  
ATOM 7741  H HA   . ASP A 1 92  ? 6.063   -8.235  -0.020  1.00 0.00 ? 92  ASP A HA   5  
ATOM 7742  H HB2  . ASP A 1 92  ? 4.661   -10.125 1.881   1.00 0.00 ? 92  ASP A HB2  5  
ATOM 7743  H HB3  . ASP A 1 92  ? 5.240   -10.571 0.278   1.00 0.00 ? 92  ASP A HB3  5  
ATOM 7744  N N    . VAL A 1 93  ? 3.994   -7.971  -1.338  1.00 0.00 ? 93  VAL A N    5  
ATOM 7745  C CA   . VAL A 1 93  ? 2.791   -7.758  -2.134  1.00 0.00 ? 93  VAL A CA   5  
ATOM 7746  C C    . VAL A 1 93  ? 2.931   -8.380  -3.519  1.00 0.00 ? 93  VAL A C    5  
ATOM 7747  O O    . VAL A 1 93  ? 4.041   -8.615  -3.996  1.00 0.00 ? 93  VAL A O    5  
ATOM 7748  C CB   . VAL A 1 93  ? 2.477   -6.257  -2.286  1.00 0.00 ? 93  VAL A CB   5  
ATOM 7749  C CG1  . VAL A 1 93  ? 1.287   -6.052  -3.210  1.00 0.00 ? 93  VAL A CG1  5  
ATOM 7750  C CG2  . VAL A 1 93  ? 2.222   -5.626  -0.926  1.00 0.00 ? 93  VAL A CG2  5  
ATOM 7751  H H    . VAL A 1 93  ? 4.871   -7.894  -1.768  1.00 0.00 ? 93  VAL A H    5  
ATOM 7752  H HA   . VAL A 1 93  ? 1.964   -8.227  -1.621  1.00 0.00 ? 93  VAL A HA   5  
ATOM 7753  H HB   . VAL A 1 93  ? 3.336   -5.774  -2.728  1.00 0.00 ? 93  VAL A HB   5  
ATOM 7754  H HG11 . VAL A 1 93  ? 0.948   -5.029  -3.138  1.00 0.00 ? 93  VAL A HG11 5  
ATOM 7755  H HG12 . VAL A 1 93  ? 1.580   -6.264  -4.228  1.00 0.00 ? 93  VAL A HG12 5  
ATOM 7756  H HG13 . VAL A 1 93  ? 0.487   -6.717  -2.920  1.00 0.00 ? 93  VAL A HG13 5  
ATOM 7757  H HG21 . VAL A 1 93  ? 3.133   -5.174  -0.563  1.00 0.00 ? 93  VAL A HG21 5  
ATOM 7758  H HG22 . VAL A 1 93  ? 1.456   -4.869  -1.018  1.00 0.00 ? 93  VAL A HG22 5  
ATOM 7759  H HG23 . VAL A 1 93  ? 1.895   -6.386  -0.232  1.00 0.00 ? 93  VAL A HG23 5  
ATOM 7760  N N    . PHE A 1 94  ? 1.797   -8.644  -4.160  1.00 0.00 ? 94  PHE A N    5  
ATOM 7761  C CA   . PHE A 1 94  ? 1.793   -9.239  -5.491  1.00 0.00 ? 94  PHE A CA   5  
ATOM 7762  C C    . PHE A 1 94  ? 1.121   -8.312  -6.500  1.00 0.00 ? 94  PHE A C    5  
ATOM 7763  O O    . PHE A 1 94  ? -0.045  -7.949  -6.343  1.00 0.00 ? 94  PHE A O    5  
ATOM 7764  C CB   . PHE A 1 94  ? 1.075   -10.590 -5.466  1.00 0.00 ? 94  PHE A CB   5  
ATOM 7765  C CG   . PHE A 1 94  ? 1.463   -11.454 -4.301  1.00 0.00 ? 94  PHE A CG   5  
ATOM 7766  C CD1  . PHE A 1 94  ? 1.154   -11.072 -3.005  1.00 0.00 ? 94  PHE A CD1  5  
ATOM 7767  C CD2  . PHE A 1 94  ? 2.136   -12.648 -4.500  1.00 0.00 ? 94  PHE A CD2  5  
ATOM 7768  C CE1  . PHE A 1 94  ? 1.511   -11.864 -1.931  1.00 0.00 ? 94  PHE A CE1  5  
ATOM 7769  C CE2  . PHE A 1 94  ? 2.495   -13.445 -3.430  1.00 0.00 ? 94  PHE A CE2  5  
ATOM 7770  C CZ   . PHE A 1 94  ? 2.181   -13.053 -2.143  1.00 0.00 ? 94  PHE A CZ   5  
ATOM 7771  H H    . PHE A 1 94  ? 0.943   -8.433  -3.727  1.00 0.00 ? 94  PHE A H    5  
ATOM 7772  H HA   . PHE A 1 94  ? 2.819   -9.392  -5.788  1.00 0.00 ? 94  PHE A HA   5  
ATOM 7773  H HB2  . PHE A 1 94  ? 0.009   -10.422 -5.414  1.00 0.00 ? 94  PHE A HB2  5  
ATOM 7774  H HB3  . PHE A 1 94  ? 1.306   -11.129 -6.372  1.00 0.00 ? 94  PHE A HB3  5  
ATOM 7775  H HD1  . PHE A 1 94  ? 0.629   -10.143 -2.837  1.00 0.00 ? 94  PHE A HD1  5  
ATOM 7776  H HD2  . PHE A 1 94  ? 2.382   -12.956 -5.507  1.00 0.00 ? 94  PHE A HD2  5  
ATOM 7777  H HE1  . PHE A 1 94  ? 1.264   -11.556 -0.926  1.00 0.00 ? 94  PHE A HE1  5  
ATOM 7778  H HE2  . PHE A 1 94  ? 3.019   -14.374 -3.600  1.00 0.00 ? 94  PHE A HE2  5  
ATOM 7779  H HZ   . PHE A 1 94  ? 2.461   -13.674 -1.306  1.00 0.00 ? 94  PHE A HZ   5  
ATOM 7780  N N    . GLN A 1 95  ? 1.865   -7.932  -7.533  1.00 0.00 ? 95  GLN A N    5  
ATOM 7781  C CA   . GLN A 1 95  ? 1.343   -7.046  -8.566  1.00 0.00 ? 95  GLN A CA   5  
ATOM 7782  C C    . GLN A 1 95  ? 0.948   -7.834  -9.811  1.00 0.00 ? 95  GLN A C    5  
ATOM 7783  O O    . GLN A 1 95  ? 1.807   -8.323  -10.545 1.00 0.00 ? 95  GLN A O    5  
ATOM 7784  C CB   . GLN A 1 95  ? 2.381   -5.983  -8.929  1.00 0.00 ? 95  GLN A CB   5  
ATOM 7785  C CG   . GLN A 1 95  ? 2.318   -4.745  -8.048  1.00 0.00 ? 95  GLN A CG   5  
ATOM 7786  C CD   . GLN A 1 95  ? 3.110   -3.584  -8.616  1.00 0.00 ? 95  GLN A CD   5  
ATOM 7787  O OE1  . GLN A 1 95  ? 3.502   -3.596  -9.783  1.00 0.00 ? 95  GLN A OE1  5  
ATOM 7788  N NE2  . GLN A 1 95  ? 3.350   -2.572  -7.791  1.00 0.00 ? 95  GLN A NE2  5  
ATOM 7789  H H    . GLN A 1 95  ? 2.788   -8.255  -7.602  1.00 0.00 ? 95  GLN A H    5  
ATOM 7790  H HA   . GLN A 1 95  ? 0.464   -6.558  -8.171  1.00 0.00 ? 95  GLN A HA   5  
ATOM 7791  H HB2  . GLN A 1 95  ? 3.367   -6.413  -8.838  1.00 0.00 ? 95  GLN A HB2  5  
ATOM 7792  H HB3  . GLN A 1 95  ? 2.223   -5.677  -9.953  1.00 0.00 ? 95  GLN A HB3  5  
ATOM 7793  H HG2  . GLN A 1 95  ? 1.286   -4.442  -7.948  1.00 0.00 ? 95  GLN A HG2  5  
ATOM 7794  H HG3  . GLN A 1 95  ? 2.715   -4.992  -7.075  1.00 0.00 ? 95  GLN A HG3  5  
ATOM 7795  H HE21 . GLN A 1 95  ? 3.008   -2.631  -6.874  1.00 0.00 ? 95  GLN A HE21 5  
ATOM 7796  H HE22 . GLN A 1 95  ? 3.861   -1.808  -8.131  1.00 0.00 ? 95  GLN A HE22 5  
ATOM 7797  N N    . GLN A 1 96  ? -0.355  -7.954  -10.041 1.00 0.00 ? 96  GLN A N    5  
ATOM 7798  C CA   . GLN A 1 96  ? -0.863  -8.684  -11.197 1.00 0.00 ? 96  GLN A CA   5  
ATOM 7799  C C    . GLN A 1 96  ? -1.368  -7.724  -12.268 1.00 0.00 ? 96  GLN A C    5  
ATOM 7800  O O    . GLN A 1 96  ? -2.291  -6.945  -12.031 1.00 0.00 ? 96  GLN A O    5  
ATOM 7801  C CB   . GLN A 1 96  ? -1.986  -9.632  -10.774 1.00 0.00 ? 96  GLN A CB   5  
ATOM 7802  C CG   . GLN A 1 96  ? -2.458  -10.552 -11.889 1.00 0.00 ? 96  GLN A CG   5  
ATOM 7803  C CD   . GLN A 1 96  ? -3.169  -11.785 -11.368 1.00 0.00 ? 96  GLN A CD   5  
ATOM 7804  O OE1  . GLN A 1 96  ? -3.154  -12.063 -10.168 1.00 0.00 ? 96  GLN A OE1  5  
ATOM 7805  N NE2  . GLN A 1 96  ? -3.798  -12.531 -12.268 1.00 0.00 ? 96  GLN A NE2  5  
ATOM 7806  H H    . GLN A 1 96  ? -0.990  -7.542  -9.419  1.00 0.00 ? 96  GLN A H    5  
ATOM 7807  H HA   . GLN A 1 96  ? -0.049  -9.264  -11.605 1.00 0.00 ? 96  GLN A HA   5  
ATOM 7808  H HB2  . GLN A 1 96  ? -1.636  -10.244 -9.956  1.00 0.00 ? 96  GLN A HB2  5  
ATOM 7809  H HB3  . GLN A 1 96  ? -2.829  -9.046  -10.440 1.00 0.00 ? 96  GLN A HB3  5  
ATOM 7810  H HG2  . GLN A 1 96  ? -3.138  -10.005 -12.526 1.00 0.00 ? 96  GLN A HG2  5  
ATOM 7811  H HG3  . GLN A 1 96  ? -1.600  -10.865 -12.466 1.00 0.00 ? 96  GLN A HG3  5  
ATOM 7812  H HE21 . GLN A 1 96  ? -3.766  -12.248 -13.206 1.00 0.00 ? 96  GLN A HE21 5  
ATOM 7813  H HE22 . GLN A 1 96  ? -4.265  -13.334 -11.959 1.00 0.00 ? 96  GLN A HE22 5  
ATOM 7814  N N    . GLN A 1 97  ? -0.756  -7.785  -13.447 1.00 0.00 ? 97  GLN A N    5  
ATOM 7815  C CA   . GLN A 1 97  ? -1.144  -6.920  -14.554 1.00 0.00 ? 97  GLN A CA   5  
ATOM 7816  C C    . GLN A 1 97  ? -2.659  -6.752  -14.609 1.00 0.00 ? 97  GLN A C    5  
ATOM 7817  O O    . GLN A 1 97  ? -3.402  -7.733  -14.656 1.00 0.00 ? 97  GLN A O    5  
ATOM 7818  C CB   . GLN A 1 97  ? -0.634  -7.491  -15.878 1.00 0.00 ? 97  GLN A CB   5  
ATOM 7819  C CG   . GLN A 1 97  ? -0.512  -6.452  -16.982 1.00 0.00 ? 97  GLN A CG   5  
ATOM 7820  C CD   . GLN A 1 97  ? 0.747   -5.617  -16.861 1.00 0.00 ? 97  GLN A CD   5  
ATOM 7821  O OE1  . GLN A 1 97  ? 1.612   -5.892  -16.028 1.00 0.00 ? 97  GLN A OE1  5  
ATOM 7822  N NE2  . GLN A 1 97  ? 0.858   -4.589  -17.694 1.00 0.00 ? 97  GLN A NE2  5  
ATOM 7823  H H    . GLN A 1 97  ? -0.027  -8.426  -13.574 1.00 0.00 ? 97  GLN A H    5  
ATOM 7824  H HA   . GLN A 1 97  ? -0.693  -5.952  -14.392 1.00 0.00 ? 97  GLN A HA   5  
ATOM 7825  H HB2  . GLN A 1 97  ? 0.340   -7.929  -15.716 1.00 0.00 ? 97  GLN A HB2  5  
ATOM 7826  H HB3  . GLN A 1 97  ? -1.315  -8.260  -16.211 1.00 0.00 ? 97  GLN A HB3  5  
ATOM 7827  H HG2  . GLN A 1 97  ? -0.498  -6.959  -17.936 1.00 0.00 ? 97  GLN A HG2  5  
ATOM 7828  H HG3  . GLN A 1 97  ? -1.368  -5.796  -16.936 1.00 0.00 ? 97  GLN A HG3  5  
ATOM 7829  H HE21 . GLN A 1 97  ? 0.130   -4.428  -18.330 1.00 0.00 ? 97  GLN A HE21 5  
ATOM 7830  H HE22 . GLN A 1 97  ? 1.661   -4.031  -17.637 1.00 0.00 ? 97  GLN A HE22 5  
ATOM 7831  N N    . THR A 1 98  ? -3.112  -5.502  -14.603 1.00 0.00 ? 98  THR A N    5  
ATOM 7832  C CA   . THR A 1 98  ? -4.538  -5.206  -14.650 1.00 0.00 ? 98  THR A CA   5  
ATOM 7833  C C    . THR A 1 98  ? -5.083  -5.353  -16.066 1.00 0.00 ? 98  THR A C    5  
ATOM 7834  O O    . THR A 1 98  ? -4.546  -4.776  -17.012 1.00 0.00 ? 98  THR A O    5  
ATOM 7835  C CB   . THR A 1 98  ? -4.833  -3.781  -14.144 1.00 0.00 ? 98  THR A CB   5  
ATOM 7836  O OG1  . THR A 1 98  ? -4.383  -3.639  -12.792 1.00 0.00 ? 98  THR A OG1  5  
ATOM 7837  C CG2  . THR A 1 98  ? -6.321  -3.476  -14.224 1.00 0.00 ? 98  THR A CG2  5  
ATOM 7838  H H    . THR A 1 98  ? -2.470  -4.763  -14.564 1.00 0.00 ? 98  THR A H    5  
ATOM 7839  H HA   . THR A 1 98  ? -5.046  -5.907  -14.005 1.00 0.00 ? 98  THR A HA   5  
ATOM 7840  H HB   . THR A 1 98  ? -4.302  -3.076  -14.768 1.00 0.00 ? 98  THR A HB   5  
ATOM 7841  H HG1  . THR A 1 98  ? -5.084  -3.903  -12.192 1.00 0.00 ? 98  THR A HG1  5  
ATOM 7842  H HG21 . THR A 1 98  ? -6.581  -2.750  -13.467 1.00 0.00 ? 98  THR A HG21 5  
ATOM 7843  H HG22 . THR A 1 98  ? -6.884  -4.383  -14.061 1.00 0.00 ? 98  THR A HG22 5  
ATOM 7844  H HG23 . THR A 1 98  ? -6.555  -3.077  -15.199 1.00 0.00 ? 98  THR A HG23 5  
ATOM 7845  N N    . SER A 1 99  ? -6.154  -6.128  -16.206 1.00 0.00 ? 99  SER A N    5  
ATOM 7846  C CA   . SER A 1 99  ? -6.770  -6.353  -17.508 1.00 0.00 ? 99  SER A CA   5  
ATOM 7847  C C    . SER A 1 99  ? -7.873  -5.332  -17.771 1.00 0.00 ? 99  SER A C    5  
ATOM 7848  O O    . SER A 1 99  ? -8.950  -5.399  -17.180 1.00 0.00 ? 99  SER A O    5  
ATOM 7849  C CB   . SER A 1 99  ? -7.341  -7.770  -17.588 1.00 0.00 ? 99  SER A CB   5  
ATOM 7850  O OG   . SER A 1 99  ? -7.985  -7.991  -18.830 1.00 0.00 ? 99  SER A OG   5  
ATOM 7851  H H    . SER A 1 99  ? -6.537  -6.561  -15.414 1.00 0.00 ? 99  SER A H    5  
ATOM 7852  H HA   . SER A 1 99  ? -6.004  -6.240  -18.261 1.00 0.00 ? 99  SER A HA   5  
ATOM 7853  H HB2  . SER A 1 99  ? -6.540  -8.485  -17.479 1.00 0.00 ? 99  SER A HB2  5  
ATOM 7854  H HB3  . SER A 1 99  ? -8.060  -7.910  -16.793 1.00 0.00 ? 99  SER A HB3  5  
ATOM 7855  H HG   . SER A 1 99  ? -8.775  -7.447  -18.883 1.00 0.00 ? 99  SER A HG   5  
ATOM 7856  N N    . GLY A 1 100 ? -7.596  -4.386  -18.663 1.00 0.00 ? 100 GLY A N    5  
ATOM 7857  C CA   . GLY A 1 100 ? -8.573  -3.364  -18.989 1.00 0.00 ? 100 GLY A CA   5  
ATOM 7858  C C    . GLY A 1 100 ? -8.125  -2.478  -20.135 1.00 0.00 ? 100 GLY A C    5  
ATOM 7859  O O    . GLY A 1 100 ? -7.077  -2.696  -20.743 1.00 0.00 ? 100 GLY A O    5  
ATOM 7860  H H    . GLY A 1 100 ? -6.720  -4.382  -19.103 1.00 0.00 ? 100 GLY A H    5  
ATOM 7861  H HA2  . GLY A 1 100 ? -9.502  -3.843  -19.260 1.00 0.00 ? 100 GLY A HA2  5  
ATOM 7862  H HA3  . GLY A 1 100 ? -8.738  -2.749  -18.117 1.00 0.00 ? 100 GLY A HA3  5  
ATOM 7863  N N    . PRO A 1 101 ? -8.933  -1.453  -20.446 1.00 0.00 ? 101 PRO A N    5  
ATOM 7864  C CA   . PRO A 1 101 ? -8.635  -0.512  -21.529 1.00 0.00 ? 101 PRO A CA   5  
ATOM 7865  C C    . PRO A 1 101 ? -7.451  0.392   -21.202 1.00 0.00 ? 101 PRO A C    5  
ATOM 7866  O O    . PRO A 1 101 ? -7.053  1.228   -22.014 1.00 0.00 ? 101 PRO A O    5  
ATOM 7867  C CB   . PRO A 1 101 ? -9.920  0.312   -21.646 1.00 0.00 ? 101 PRO A CB   5  
ATOM 7868  C CG   . PRO A 1 101 ? -10.549 0.226   -20.298 1.00 0.00 ? 101 PRO A CG   5  
ATOM 7869  C CD   . PRO A 1 101 ? -10.198 -1.134  -19.763 1.00 0.00 ? 101 PRO A CD   5  
ATOM 7870  H HA   . PRO A 1 101 ? -8.448  -1.025  -22.461 1.00 0.00 ? 101 PRO A HA   5  
ATOM 7871  H HB2  . PRO A 1 101 ? -9.674  1.333   -21.904 1.00 0.00 ? 101 PRO A HB2  5  
ATOM 7872  H HB3  . PRO A 1 101 ? -10.557 -0.114  -22.406 1.00 0.00 ? 101 PRO A HB3  5  
ATOM 7873  H HG2  . PRO A 1 101 ? -10.149 0.996   -19.657 1.00 0.00 ? 101 PRO A HG2  5  
ATOM 7874  H HG3  . PRO A 1 101 ? -11.620 0.329   -20.387 1.00 0.00 ? 101 PRO A HG3  5  
ATOM 7875  H HD2  . PRO A 1 101 ? -10.059 -1.095  -18.693 1.00 0.00 ? 101 PRO A HD2  5  
ATOM 7876  H HD3  . PRO A 1 101 ? -10.965 -1.850  -20.020 1.00 0.00 ? 101 PRO A HD3  5  
ATOM 7877  N N    . SER A 1 102 ? -6.891  0.219   -20.009 1.00 0.00 ? 102 SER A N    5  
ATOM 7878  C CA   . SER A 1 102 ? -5.754  1.022   -19.574 1.00 0.00 ? 102 SER A CA   5  
ATOM 7879  C C    . SER A 1 102 ? -4.822  1.322   -20.744 1.00 0.00 ? 102 SER A C    5  
ATOM 7880  O O    . SER A 1 102 ? -4.262  0.412   -21.355 1.00 0.00 ? 102 SER A O    5  
ATOM 7881  C CB   . SER A 1 102 ? -4.986  0.297   -18.467 1.00 0.00 ? 102 SER A CB   5  
ATOM 7882  O OG   . SER A 1 102 ? -4.367  1.221   -17.588 1.00 0.00 ? 102 SER A OG   5  
ATOM 7883  H H    . SER A 1 102 ? -7.254  -0.464  -19.406 1.00 0.00 ? 102 SER A H    5  
ATOM 7884  H HA   . SER A 1 102 ? -6.136  1.954   -19.185 1.00 0.00 ? 102 SER A HA   5  
ATOM 7885  H HB2  . SER A 1 102 ? -5.668  -0.318  -17.902 1.00 0.00 ? 102 SER A HB2  5  
ATOM 7886  H HB3  . SER A 1 102 ? -4.222  -0.325  -18.911 1.00 0.00 ? 102 SER A HB3  5  
ATOM 7887  H HG   . SER A 1 102 ? -5.032  1.612   -17.016 1.00 0.00 ? 102 SER A HG   5  
ATOM 7888  N N    . SER A 1 103 ? -4.660  2.605   -21.049 1.00 0.00 ? 103 SER A N    5  
ATOM 7889  C CA   . SER A 1 103 ? -3.799  3.027   -22.148 1.00 0.00 ? 103 SER A CA   5  
ATOM 7890  C C    . SER A 1 103 ? -2.817  4.099   -21.687 1.00 0.00 ? 103 SER A C    5  
ATOM 7891  O O    . SER A 1 103 ? -2.757  4.436   -20.505 1.00 0.00 ? 103 SER A O    5  
ATOM 7892  C CB   . SER A 1 103 ? -4.642  3.557   -23.310 1.00 0.00 ? 103 SER A CB   5  
ATOM 7893  O OG   . SER A 1 103 ? -3.872  3.652   -24.496 1.00 0.00 ? 103 SER A OG   5  
ATOM 7894  H H    . SER A 1 103 ? -5.134  3.284   -20.524 1.00 0.00 ? 103 SER A H    5  
ATOM 7895  H HA   . SER A 1 103 ? -3.242  2.165   -22.482 1.00 0.00 ? 103 SER A HA   5  
ATOM 7896  H HB2  . SER A 1 103 ? -5.470  2.887   -23.485 1.00 0.00 ? 103 SER A HB2  5  
ATOM 7897  H HB3  . SER A 1 103 ? -5.019  4.538   -23.059 1.00 0.00 ? 103 SER A HB3  5  
ATOM 7898  H HG   . SER A 1 103 ? -4.328  4.211   -25.129 1.00 0.00 ? 103 SER A HG   5  
ATOM 7899  N N    . GLY A 1 104 ? -2.047  4.633   -22.631 1.00 0.00 ? 104 GLY A N    5  
ATOM 7900  C CA   . GLY A 1 104 ? -1.077  5.661   -22.303 1.00 0.00 ? 104 GLY A CA   5  
ATOM 7901  C C    . GLY A 1 104 ? -1.315  6.948   -23.068 1.00 0.00 ? 104 GLY A C    5  
ATOM 7902  O O    . GLY A 1 104 ? -1.415  6.939   -24.295 1.00 0.00 ? 104 GLY A O    5  
ATOM 7903  H H    . GLY A 1 104 ? -2.138  4.325   -23.557 1.00 0.00 ? 104 GLY A H    5  
ATOM 7904  H HA2  . GLY A 1 104 ? -1.131  5.868   -21.245 1.00 0.00 ? 104 GLY A HA2  5  
ATOM 7905  H HA3  . GLY A 1 104 ? -0.088  5.295   -22.538 1.00 0.00 ? 104 GLY A HA3  5  
ATOM 7906  N N    . GLY A 1 1   ? -24.625 -13.769 14.938  1.00 0.00 ? 1   GLY A N    6  
ATOM 7907  C CA   . GLY A 1 1   ? -23.479 -13.420 14.119  1.00 0.00 ? 1   GLY A CA   6  
ATOM 7908  C C    . GLY A 1 1   ? -23.488 -11.963 13.700  1.00 0.00 ? 1   GLY A C    6  
ATOM 7909  O O    . GLY A 1 1   ? -23.985 -11.104 14.429  1.00 0.00 ? 1   GLY A O    6  
ATOM 7910  H H1   . GLY A 1 1   ? -25.356 -13.126 15.054  1.00 0.00 ? 1   GLY A H1   6  
ATOM 7911  H HA2  . GLY A 1 1   ? -22.577 -13.617 14.678  1.00 0.00 ? 1   GLY A HA2  6  
ATOM 7912  H HA3  . GLY A 1 1   ? -23.484 -14.037 13.232  1.00 0.00 ? 1   GLY A HA3  6  
ATOM 7913  N N    . SER A 1 2   ? -22.936 -11.683 12.524  1.00 0.00 ? 2   SER A N    6  
ATOM 7914  C CA   . SER A 1 2   ? -22.877 -10.319 12.012  1.00 0.00 ? 2   SER A CA   6  
ATOM 7915  C C    . SER A 1 2   ? -23.789 -10.154 10.800  1.00 0.00 ? 2   SER A C    6  
ATOM 7916  O O    . SER A 1 2   ? -23.416 -9.525  9.810   1.00 0.00 ? 2   SER A O    6  
ATOM 7917  C CB   . SER A 1 2   ? -21.440 -9.954  11.636  1.00 0.00 ? 2   SER A CB   6  
ATOM 7918  O OG   . SER A 1 2   ? -20.668 -9.667  12.789  1.00 0.00 ? 2   SER A OG   6  
ATOM 7919  H H    . SER A 1 2   ? -22.556 -12.412 11.989  1.00 0.00 ? 2   SER A H    6  
ATOM 7920  H HA   . SER A 1 2   ? -23.214 -9.656  12.795  1.00 0.00 ? 2   SER A HA   6  
ATOM 7921  H HB2  . SER A 1 2   ? -20.986 -10.782 11.112  1.00 0.00 ? 2   SER A HB2  6  
ATOM 7922  H HB3  . SER A 1 2   ? -21.448 -9.084  10.996  1.00 0.00 ? 2   SER A HB3  6  
ATOM 7923  H HG   . SER A 1 2   ? -21.049 -10.113 13.549  1.00 0.00 ? 2   SER A HG   6  
ATOM 7924  N N    . SER A 1 3   ? -24.987 -10.722 10.888  1.00 0.00 ? 3   SER A N    6  
ATOM 7925  C CA   . SER A 1 3   ? -25.953 -10.642 9.798   1.00 0.00 ? 3   SER A CA   6  
ATOM 7926  C C    . SER A 1 3   ? -25.956 -9.249  9.176   1.00 0.00 ? 3   SER A C    6  
ATOM 7927  O O    . SER A 1 3   ? -25.802 -9.096  7.965   1.00 0.00 ? 3   SER A O    6  
ATOM 7928  C CB   . SER A 1 3   ? -27.354 -10.991 10.303  1.00 0.00 ? 3   SER A CB   6  
ATOM 7929  O OG   . SER A 1 3   ? -27.766 -10.097 11.322  1.00 0.00 ? 3   SER A OG   6  
ATOM 7930  H H    . SER A 1 3   ? -25.226 -11.210 11.704  1.00 0.00 ? 3   SER A H    6  
ATOM 7931  H HA   . SER A 1 3   ? -25.662 -11.359 9.044   1.00 0.00 ? 3   SER A HA   6  
ATOM 7932  H HB2  . SER A 1 3   ? -28.054 -10.932 9.484   1.00 0.00 ? 3   SER A HB2  6  
ATOM 7933  H HB3  . SER A 1 3   ? -27.350 -11.996 10.701  1.00 0.00 ? 3   SER A HB3  6  
ATOM 7934  H HG   . SER A 1 3   ? -28.327 -10.561 11.947  1.00 0.00 ? 3   SER A HG   6  
ATOM 7935  N N    . GLY A 1 4   ? -26.133 -8.233  10.016  1.00 0.00 ? 4   GLY A N    6  
ATOM 7936  C CA   . GLY A 1 4   ? -26.154 -6.865  9.533   1.00 0.00 ? 4   GLY A CA   6  
ATOM 7937  C C    . GLY A 1 4   ? -27.070 -5.975  10.349  1.00 0.00 ? 4   GLY A C    6  
ATOM 7938  O O    . GLY A 1 4   ? -28.191 -6.362  10.678  1.00 0.00 ? 4   GLY A O    6  
ATOM 7939  H H    . GLY A 1 4   ? -26.251 -8.415  10.973  1.00 0.00 ? 4   GLY A H    6  
ATOM 7940  H HA2  . GLY A 1 4   ? -25.151 -6.466  9.573   1.00 0.00 ? 4   GLY A HA2  6  
ATOM 7941  H HA3  . GLY A 1 4   ? -26.490 -6.864  8.506   1.00 0.00 ? 4   GLY A HA3  6  
ATOM 7942  N N    . SER A 1 5   ? -26.591 -4.780  10.679  1.00 0.00 ? 5   SER A N    6  
ATOM 7943  C CA   . SER A 1 5   ? -27.373 -3.835  11.467  1.00 0.00 ? 5   SER A CA   6  
ATOM 7944  C C    . SER A 1 5   ? -28.642 -3.428  10.725  1.00 0.00 ? 5   SER A C    6  
ATOM 7945  O O    . SER A 1 5   ? -29.684 -3.191  11.337  1.00 0.00 ? 5   SER A O    6  
ATOM 7946  C CB   . SER A 1 5   ? -26.538 -2.594  11.790  1.00 0.00 ? 5   SER A CB   6  
ATOM 7947  O OG   . SER A 1 5   ? -27.180 -1.785  12.761  1.00 0.00 ? 5   SER A OG   6  
ATOM 7948  H H    . SER A 1 5   ? -25.690 -4.529  10.387  1.00 0.00 ? 5   SER A H    6  
ATOM 7949  H HA   . SER A 1 5   ? -27.650 -4.322  12.390  1.00 0.00 ? 5   SER A HA   6  
ATOM 7950  H HB2  . SER A 1 5   ? -25.577 -2.901  12.174  1.00 0.00 ? 5   SER A HB2  6  
ATOM 7951  H HB3  . SER A 1 5   ? -26.398 -2.013  10.890  1.00 0.00 ? 5   SER A HB3  6  
ATOM 7952  H HG   . SER A 1 5   ? -28.111 -1.699  12.540  1.00 0.00 ? 5   SER A HG   6  
ATOM 7953  N N    . SER A 1 6   ? -28.547 -3.348  9.402   1.00 0.00 ? 6   SER A N    6  
ATOM 7954  C CA   . SER A 1 6   ? -29.685 -2.966  8.575   1.00 0.00 ? 6   SER A CA   6  
ATOM 7955  C C    . SER A 1 6   ? -30.303 -1.662  9.070   1.00 0.00 ? 6   SER A C    6  
ATOM 7956  O O    . SER A 1 6   ? -31.521 -1.550  9.203   1.00 0.00 ? 6   SER A O    6  
ATOM 7957  C CB   . SER A 1 6   ? -30.739 -4.075  8.576   1.00 0.00 ? 6   SER A CB   6  
ATOM 7958  O OG   . SER A 1 6   ? -30.505 -5.002  7.530   1.00 0.00 ? 6   SER A OG   6  
ATOM 7959  H H    . SER A 1 6   ? -27.689 -3.549  8.972   1.00 0.00 ? 6   SER A H    6  
ATOM 7960  H HA   . SER A 1 6   ? -29.328 -2.822  7.566   1.00 0.00 ? 6   SER A HA   6  
ATOM 7961  H HB2  . SER A 1 6   ? -30.705 -4.600  9.519   1.00 0.00 ? 6   SER A HB2  6  
ATOM 7962  H HB3  . SER A 1 6   ? -31.718 -3.638  8.442   1.00 0.00 ? 6   SER A HB3  6  
ATOM 7963  H HG   . SER A 1 6   ? -30.284 -4.528  6.725   1.00 0.00 ? 6   SER A HG   6  
ATOM 7964  N N    . GLY A 1 7   ? -29.452 -0.677  9.341   1.00 0.00 ? 7   GLY A N    6  
ATOM 7965  C CA   . GLY A 1 7   ? -29.932 0.607   9.819   1.00 0.00 ? 7   GLY A CA   6  
ATOM 7966  C C    . GLY A 1 7   ? -29.097 1.764   9.308   1.00 0.00 ? 7   GLY A C    6  
ATOM 7967  O O    . GLY A 1 7   ? -28.982 1.969   8.100   1.00 0.00 ? 7   GLY A O    6  
ATOM 7968  H H    . GLY A 1 7   ? -28.491 -0.823  9.216   1.00 0.00 ? 7   GLY A H    6  
ATOM 7969  H HA2  . GLY A 1 7   ? -30.952 0.741   9.493   1.00 0.00 ? 7   GLY A HA2  6  
ATOM 7970  H HA3  . GLY A 1 7   ? -29.905 0.609   10.899  1.00 0.00 ? 7   GLY A HA3  6  
ATOM 7971  N N    . MET A 1 8   ? -28.514 2.524   10.229  1.00 0.00 ? 8   MET A N    6  
ATOM 7972  C CA   . MET A 1 8   ? -27.686 3.668   9.864   1.00 0.00 ? 8   MET A CA   6  
ATOM 7973  C C    . MET A 1 8   ? -26.285 3.218   9.462   1.00 0.00 ? 8   MET A C    6  
ATOM 7974  O O    . MET A 1 8   ? -25.539 2.674   10.276  1.00 0.00 ? 8   MET A O    6  
ATOM 7975  C CB   . MET A 1 8   ? -27.602 4.656   11.029  1.00 0.00 ? 8   MET A CB   6  
ATOM 7976  C CG   . MET A 1 8   ? -26.635 5.803   10.784  1.00 0.00 ? 8   MET A CG   6  
ATOM 7977  S SD   . MET A 1 8   ? -26.276 6.741   12.282  1.00 0.00 ? 8   MET A SD   6  
ATOM 7978  C CE   . MET A 1 8   ? -26.629 8.408   11.730  1.00 0.00 ? 8   MET A CE   6  
ATOM 7979  H H    . MET A 1 8   ? -28.643 2.311   11.177  1.00 0.00 ? 8   MET A H    6  
ATOM 7980  H HA   . MET A 1 8   ? -28.150 4.157   9.022   1.00 0.00 ? 8   MET A HA   6  
ATOM 7981  H HB2  . MET A 1 8   ? -28.583 5.071   11.205  1.00 0.00 ? 8   MET A HB2  6  
ATOM 7982  H HB3  . MET A 1 8   ? -27.280 4.126   11.913  1.00 0.00 ? 8   MET A HB3  6  
ATOM 7983  H HG2  . MET A 1 8   ? -25.710 5.402   10.398  1.00 0.00 ? 8   MET A HG2  6  
ATOM 7984  H HG3  . MET A 1 8   ? -27.069 6.470   10.053  1.00 0.00 ? 8   MET A HG3  6  
ATOM 7985  H HE1  . MET A 1 8   ? -26.016 8.641   10.873  1.00 0.00 ? 8   MET A HE1  6  
ATOM 7986  H HE2  . MET A 1 8   ? -27.672 8.483   11.459  1.00 0.00 ? 8   MET A HE2  6  
ATOM 7987  H HE3  . MET A 1 8   ? -26.413 9.104   12.528  1.00 0.00 ? 8   MET A HE3  6  
ATOM 7988  N N    . ALA A 1 9   ? -25.934 3.448   8.200   1.00 0.00 ? 9   ALA A N    6  
ATOM 7989  C CA   . ALA A 1 9   ? -24.623 3.068   7.691   1.00 0.00 ? 9   ALA A CA   6  
ATOM 7990  C C    . ALA A 1 9   ? -23.624 4.211   7.837   1.00 0.00 ? 9   ALA A C    6  
ATOM 7991  O O    . ALA A 1 9   ? -23.436 5.005   6.915   1.00 0.00 ? 9   ALA A O    6  
ATOM 7992  C CB   . ALA A 1 9   ? -24.726 2.638   6.235   1.00 0.00 ? 9   ALA A CB   6  
ATOM 7993  H H    . ALA A 1 9   ? -26.573 3.885   7.599   1.00 0.00 ? 9   ALA A H    6  
ATOM 7994  H HA   . ALA A 1 9   ? -24.273 2.222   8.266   1.00 0.00 ? 9   ALA A HA   6  
ATOM 7995  H HB1  . ALA A 1 9   ? -24.752 3.514   5.603   1.00 0.00 ? 9   ALA A HB1  6  
ATOM 7996  H HB2  . ALA A 1 9   ? -23.870 2.033   5.977   1.00 0.00 ? 9   ALA A HB2  6  
ATOM 7997  H HB3  . ALA A 1 9   ? -25.630 2.065   6.093   1.00 0.00 ? 9   ALA A HB3  6  
ATOM 7998  N N    . ASP A 1 10  ? -22.989 4.290   9.001   1.00 0.00 ? 10  ASP A N    6  
ATOM 7999  C CA   . ASP A 1 10  ? -22.009 5.336   9.268   1.00 0.00 ? 10  ASP A CA   6  
ATOM 8000  C C    . ASP A 1 10  ? -20.608 4.748   9.400   1.00 0.00 ? 10  ASP A C    6  
ATOM 8001  O O    . ASP A 1 10  ? -20.170 4.403   10.497  1.00 0.00 ? 10  ASP A O    6  
ATOM 8002  C CB   . ASP A 1 10  ? -22.378 6.097   10.543  1.00 0.00 ? 10  ASP A CB   6  
ATOM 8003  C CG   . ASP A 1 10  ? -22.756 5.170   11.681  1.00 0.00 ? 10  ASP A CG   6  
ATOM 8004  O OD1  . ASP A 1 10  ? -23.886 4.639   11.663  1.00 0.00 ? 10  ASP A OD1  6  
ATOM 8005  O OD2  . ASP A 1 10  ? -21.922 4.977   12.591  1.00 0.00 ? 10  ASP A OD2  6  
ATOM 8006  H H    . ASP A 1 10  ? -23.182 3.627   9.697   1.00 0.00 ? 10  ASP A H    6  
ATOM 8007  H HA   . ASP A 1 10  ? -22.021 6.022   8.434   1.00 0.00 ? 10  ASP A HA   6  
ATOM 8008  H HB2  . ASP A 1 10  ? -21.534 6.694   10.855  1.00 0.00 ? 10  ASP A HB2  6  
ATOM 8009  H HB3  . ASP A 1 10  ? -23.217 6.746   10.337  1.00 0.00 ? 10  ASP A HB3  6  
ATOM 8010  N N    . GLU A 1 11  ? -19.910 4.637   8.274   1.00 0.00 ? 11  GLU A N    6  
ATOM 8011  C CA   . GLU A 1 11  ? -18.559 4.088   8.265   1.00 0.00 ? 11  GLU A CA   6  
ATOM 8012  C C    . GLU A 1 11  ? -17.521 5.195   8.429   1.00 0.00 ? 11  GLU A C    6  
ATOM 8013  O O    . GLU A 1 11  ? -16.491 5.202   7.755   1.00 0.00 ? 11  GLU A O    6  
ATOM 8014  C CB   . GLU A 1 11  ? -18.303 3.324   6.964   1.00 0.00 ? 11  GLU A CB   6  
ATOM 8015  C CG   . GLU A 1 11  ? -19.017 1.985   6.894   1.00 0.00 ? 11  GLU A CG   6  
ATOM 8016  C CD   . GLU A 1 11  ? -18.335 1.009   5.955   1.00 0.00 ? 11  GLU A CD   6  
ATOM 8017  O OE1  . GLU A 1 11  ? -17.598 1.465   5.057   1.00 0.00 ? 11  GLU A OE1  6  
ATOM 8018  O OE2  . GLU A 1 11  ? -18.539 -0.213  6.119   1.00 0.00 ? 11  GLU A OE2  6  
ATOM 8019  H H    . GLU A 1 11  ? -20.313 4.929   7.430   1.00 0.00 ? 11  GLU A H    6  
ATOM 8020  H HA   . GLU A 1 11  ? -18.473 3.404   9.095   1.00 0.00 ? 11  GLU A HA   6  
ATOM 8021  H HB2  . GLU A 1 11  ? -18.636 3.930   6.133   1.00 0.00 ? 11  GLU A HB2  6  
ATOM 8022  H HB3  . GLU A 1 11  ? -17.242 3.148   6.866   1.00 0.00 ? 11  GLU A HB3  6  
ATOM 8023  H HG2  . GLU A 1 11  ? -19.040 1.552   7.883   1.00 0.00 ? 11  GLU A HG2  6  
ATOM 8024  H HG3  . GLU A 1 11  ? -20.028 2.147   6.549   1.00 0.00 ? 11  GLU A HG3  6  
ATOM 8025  N N    . LYS A 1 12  ? -17.800 6.130   9.331   1.00 0.00 ? 12  LYS A N    6  
ATOM 8026  C CA   . LYS A 1 12  ? -16.893 7.242   9.587   1.00 0.00 ? 12  LYS A CA   6  
ATOM 8027  C C    . LYS A 1 12  ? -16.233 7.715   8.296   1.00 0.00 ? 12  LYS A C    6  
ATOM 8028  O O    . LYS A 1 12  ? -15.010 7.803   8.191   1.00 0.00 ? 12  LYS A O    6  
ATOM 8029  C CB   . LYS A 1 12  ? -15.821 6.830   10.599  1.00 0.00 ? 12  LYS A CB   6  
ATOM 8030  C CG   . LYS A 1 12  ? -16.357 6.625   12.005  1.00 0.00 ? 12  LYS A CG   6  
ATOM 8031  C CD   . LYS A 1 12  ? -16.967 5.243   12.173  1.00 0.00 ? 12  LYS A CD   6  
ATOM 8032  C CE   . LYS A 1 12  ? -17.111 4.872   13.641  1.00 0.00 ? 12  LYS A CE   6  
ATOM 8033  N NZ   . LYS A 1 12  ? -15.860 4.279   14.189  1.00 0.00 ? 12  LYS A NZ   6  
ATOM 8034  H H    . LYS A 1 12  ? -18.638 6.070   9.838   1.00 0.00 ? 12  LYS A H    6  
ATOM 8035  H HA   . LYS A 1 12  ? -17.472 8.054   10.000  1.00 0.00 ? 12  LYS A HA   6  
ATOM 8036  H HB2  . LYS A 1 12  ? -15.369 5.906   10.270  1.00 0.00 ? 12  LYS A HB2  6  
ATOM 8037  H HB3  . LYS A 1 12  ? -15.062 7.599   10.634  1.00 0.00 ? 12  LYS A HB3  6  
ATOM 8038  H HG2  . LYS A 1 12  ? -15.547 6.737   12.710  1.00 0.00 ? 12  LYS A HG2  6  
ATOM 8039  H HG3  . LYS A 1 12  ? -17.115 7.369   12.203  1.00 0.00 ? 12  LYS A HG3  6  
ATOM 8040  H HD2  . LYS A 1 12  ? -17.943 5.231   11.713  1.00 0.00 ? 12  LYS A HD2  6  
ATOM 8041  H HD3  . LYS A 1 12  ? -16.329 4.517   11.688  1.00 0.00 ? 12  LYS A HD3  6  
ATOM 8042  H HE2  . LYS A 1 12  ? -17.352 5.762   14.201  1.00 0.00 ? 12  LYS A HE2  6  
ATOM 8043  H HE3  . LYS A 1 12  ? -17.913 4.156   13.740  1.00 0.00 ? 12  LYS A HE3  6  
ATOM 8044  H HZ1  . LYS A 1 12  ? -15.689 4.632   15.152  1.00 0.00 ? 12  LYS A HZ1  6  
ATOM 8045  H HZ2  . LYS A 1 12  ? -15.050 4.537   13.589  1.00 0.00 ? 12  LYS A HZ2  6  
ATOM 8046  H HZ3  . LYS A 1 12  ? -15.939 3.243   14.220  1.00 0.00 ? 12  LYS A HZ3  6  
ATOM 8047  N N    . PRO A 1 13  ? -17.061 8.027   7.288   1.00 0.00 ? 13  PRO A N    6  
ATOM 8048  C CA   . PRO A 1 13  ? -16.580 8.498   5.985   1.00 0.00 ? 13  PRO A CA   6  
ATOM 8049  C C    . PRO A 1 13  ? -15.984 9.899   6.060   1.00 0.00 ? 13  PRO A C    6  
ATOM 8050  O O    . PRO A 1 13  ? -16.666 10.857  6.425   1.00 0.00 ? 13  PRO A O    6  
ATOM 8051  C CB   . PRO A 1 13  ? -17.843 8.499   5.120   1.00 0.00 ? 13  PRO A CB   6  
ATOM 8052  C CG   . PRO A 1 13  ? -18.965 8.652   6.088   1.00 0.00 ? 13  PRO A CG   6  
ATOM 8053  C CD   . PRO A 1 13  ? -18.530 7.945   7.341   1.00 0.00 ? 13  PRO A CD   6  
ATOM 8054  H HA   . PRO A 1 13  ? -15.853 7.820   5.562   1.00 0.00 ? 13  PRO A HA   6  
ATOM 8055  H HB2  . PRO A 1 13  ? -17.805 9.325   4.424   1.00 0.00 ? 13  PRO A HB2  6  
ATOM 8056  H HB3  . PRO A 1 13  ? -17.914 7.568   4.578   1.00 0.00 ? 13  PRO A HB3  6  
ATOM 8057  H HG2  . PRO A 1 13  ? -19.137 9.699   6.288   1.00 0.00 ? 13  PRO A HG2  6  
ATOM 8058  H HG3  . PRO A 1 13  ? -19.858 8.194   5.690   1.00 0.00 ? 13  PRO A HG3  6  
ATOM 8059  H HD2  . PRO A 1 13  ? -18.913 8.453   8.214   1.00 0.00 ? 13  PRO A HD2  6  
ATOM 8060  H HD3  . PRO A 1 13  ? -18.859 6.916   7.327   1.00 0.00 ? 13  PRO A HD3  6  
ATOM 8061  N N    . LYS A 1 14  ? -14.707 10.013  5.710   1.00 0.00 ? 14  LYS A N    6  
ATOM 8062  C CA   . LYS A 1 14  ? -14.018 11.298  5.736   1.00 0.00 ? 14  LYS A CA   6  
ATOM 8063  C C    . LYS A 1 14  ? -12.847 11.307  4.758   1.00 0.00 ? 14  LYS A C    6  
ATOM 8064  O O    . LYS A 1 14  ? -12.504 10.277  4.178   1.00 0.00 ? 14  LYS A O    6  
ATOM 8065  C CB   . LYS A 1 14  ? -13.519 11.605  7.149   1.00 0.00 ? 14  LYS A CB   6  
ATOM 8066  C CG   . LYS A 1 14  ? -12.260 10.844  7.528   1.00 0.00 ? 14  LYS A CG   6  
ATOM 8067  C CD   . LYS A 1 14  ? -12.568 9.400   7.886   1.00 0.00 ? 14  LYS A CD   6  
ATOM 8068  C CE   . LYS A 1 14  ? -11.346 8.511   7.715   1.00 0.00 ? 14  LYS A CE   6  
ATOM 8069  N NZ   . LYS A 1 14  ? -10.490 8.504   8.934   1.00 0.00 ? 14  LYS A NZ   6  
ATOM 8070  H H    . LYS A 1 14  ? -14.216 9.213   5.428   1.00 0.00 ? 14  LYS A H    6  
ATOM 8071  H HA   . LYS A 1 14  ? -14.724 12.059  5.439   1.00 0.00 ? 14  LYS A HA   6  
ATOM 8072  H HB2  . LYS A 1 14  ? -13.312 12.662  7.223   1.00 0.00 ? 14  LYS A HB2  6  
ATOM 8073  H HB3  . LYS A 1 14  ? -14.296 11.349  7.856   1.00 0.00 ? 14  LYS A HB3  6  
ATOM 8074  H HG2  . LYS A 1 14  ? -11.576 10.858  6.692   1.00 0.00 ? 14  LYS A HG2  6  
ATOM 8075  H HG3  . LYS A 1 14  ? -11.801 11.327  8.379   1.00 0.00 ? 14  LYS A HG3  6  
ATOM 8076  H HD2  . LYS A 1 14  ? -12.891 9.354   8.915   1.00 0.00 ? 14  LYS A HD2  6  
ATOM 8077  H HD3  . LYS A 1 14  ? -13.358 9.039   7.242   1.00 0.00 ? 14  LYS A HD3  6  
ATOM 8078  H HE2  . LYS A 1 14  ? -11.675 7.503   7.512   1.00 0.00 ? 14  LYS A HE2  6  
ATOM 8079  H HE3  . LYS A 1 14  ? -10.766 8.875   6.880   1.00 0.00 ? 14  LYS A HE3  6  
ATOM 8080  H HZ1  . LYS A 1 14  ? -9.496  8.347   8.671   1.00 0.00 ? 14  LYS A HZ1  6  
ATOM 8081  H HZ2  . LYS A 1 14  ? -10.790 7.746   9.578   1.00 0.00 ? 14  LYS A HZ2  6  
ATOM 8082  H HZ3  . LYS A 1 14  ? -10.566 9.416   9.429   1.00 0.00 ? 14  LYS A HZ3  6  
ATOM 8083  N N    . GLU A 1 15  ? -12.237 12.475  4.583   1.00 0.00 ? 15  GLU A N    6  
ATOM 8084  C CA   . GLU A 1 15  ? -11.104 12.616  3.676   1.00 0.00 ? 15  GLU A CA   6  
ATOM 8085  C C    . GLU A 1 15  ? -9.798  12.256  4.378   1.00 0.00 ? 15  GLU A C    6  
ATOM 8086  O O    . GLU A 1 15  ? -9.782  11.968  5.574   1.00 0.00 ? 15  GLU A O    6  
ATOM 8087  C CB   . GLU A 1 15  ? -11.029 14.045  3.136   1.00 0.00 ? 15  GLU A CB   6  
ATOM 8088  C CG   . GLU A 1 15  ? -11.874 14.272  1.893   1.00 0.00 ? 15  GLU A CG   6  
ATOM 8089  C CD   . GLU A 1 15  ? -11.711 15.668  1.324   1.00 0.00 ? 15  GLU A CD   6  
ATOM 8090  O OE1  . GLU A 1 15  ? -11.474 16.606  2.113   1.00 0.00 ? 15  GLU A OE1  6  
ATOM 8091  O OE2  . GLU A 1 15  ? -11.820 15.822  0.089   1.00 0.00 ? 15  GLU A OE2  6  
ATOM 8092  H H    . GLU A 1 15  ? -12.557 13.260  5.074   1.00 0.00 ? 15  GLU A H    6  
ATOM 8093  H HA   . GLU A 1 15  ? -11.254 11.937  2.850   1.00 0.00 ? 15  GLU A HA   6  
ATOM 8094  H HB2  . GLU A 1 15  ? -11.365 14.726  3.904   1.00 0.00 ? 15  GLU A HB2  6  
ATOM 8095  H HB3  . GLU A 1 15  ? -10.001 14.271  2.893   1.00 0.00 ? 15  GLU A HB3  6  
ATOM 8096  H HG2  . GLU A 1 15  ? -11.582 13.556  1.140   1.00 0.00 ? 15  GLU A HG2  6  
ATOM 8097  H HG3  . GLU A 1 15  ? -12.913 14.122  2.148   1.00 0.00 ? 15  GLU A HG3  6  
ATOM 8098  N N    . GLY A 1 16  ? -8.703  12.274  3.623   1.00 0.00 ? 16  GLY A N    6  
ATOM 8099  C CA   . GLY A 1 16  ? -7.407  11.948  4.189   1.00 0.00 ? 16  GLY A CA   6  
ATOM 8100  C C    . GLY A 1 16  ? -6.334  12.941  3.791   1.00 0.00 ? 16  GLY A C    6  
ATOM 8101  O O    . GLY A 1 16  ? -6.173  13.254  2.611   1.00 0.00 ? 16  GLY A O    6  
ATOM 8102  H H    . GLY A 1 16  ? -8.776  12.511  2.675   1.00 0.00 ? 16  GLY A H    6  
ATOM 8103  H HA2  . GLY A 1 16  ? -7.489  11.934  5.266   1.00 0.00 ? 16  GLY A HA2  6  
ATOM 8104  H HA3  . GLY A 1 16  ? -7.115  10.965  3.848   1.00 0.00 ? 16  GLY A HA3  6  
ATOM 8105  N N    . VAL A 1 17  ? -5.597  13.442  4.778   1.00 0.00 ? 17  VAL A N    6  
ATOM 8106  C CA   . VAL A 1 17  ? -4.534  14.407  4.525   1.00 0.00 ? 17  VAL A CA   6  
ATOM 8107  C C    . VAL A 1 17  ? -3.236  13.985  5.204   1.00 0.00 ? 17  VAL A C    6  
ATOM 8108  O O    . VAL A 1 17  ? -3.221  13.652  6.390   1.00 0.00 ? 17  VAL A O    6  
ATOM 8109  C CB   . VAL A 1 17  ? -4.924  15.813  5.017   1.00 0.00 ? 17  VAL A CB   6  
ATOM 8110  C CG1  . VAL A 1 17  ? -5.158  15.808  6.520   1.00 0.00 ? 17  VAL A CG1  6  
ATOM 8111  C CG2  . VAL A 1 17  ? -3.852  16.825  4.639   1.00 0.00 ? 17  VAL A CG2  6  
ATOM 8112  H H    . VAL A 1 17  ? -5.773  13.154  5.698   1.00 0.00 ? 17  VAL A H    6  
ATOM 8113  H HA   . VAL A 1 17  ? -4.372  14.453  3.458   1.00 0.00 ? 17  VAL A HA   6  
ATOM 8114  H HB   . VAL A 1 17  ? -5.846  16.099  4.532   1.00 0.00 ? 17  VAL A HB   6  
ATOM 8115  H HG11 . VAL A 1 17  ? -4.269  16.159  7.023   1.00 0.00 ? 17  VAL A HG11 6  
ATOM 8116  H HG12 . VAL A 1 17  ? -5.987  16.458  6.757   1.00 0.00 ? 17  VAL A HG12 6  
ATOM 8117  H HG13 . VAL A 1 17  ? -5.382  14.803  6.845   1.00 0.00 ? 17  VAL A HG13 6  
ATOM 8118  H HG21 . VAL A 1 17  ? -3.739  17.543  5.438   1.00 0.00 ? 17  VAL A HG21 6  
ATOM 8119  H HG22 . VAL A 1 17  ? -2.914  16.314  4.479   1.00 0.00 ? 17  VAL A HG22 6  
ATOM 8120  H HG23 . VAL A 1 17  ? -4.142  17.336  3.733   1.00 0.00 ? 17  VAL A HG23 6  
ATOM 8121  N N    . LYS A 1 18  ? -2.145  14.000  4.445   1.00 0.00 ? 18  LYS A N    6  
ATOM 8122  C CA   . LYS A 1 18  ? -0.840  13.621  4.973   1.00 0.00 ? 18  LYS A CA   6  
ATOM 8123  C C    . LYS A 1 18  ? -0.227  14.762  5.780   1.00 0.00 ? 18  LYS A C    6  
ATOM 8124  O O    . LYS A 1 18  ? -0.067  15.875  5.279   1.00 0.00 ? 18  LYS A O    6  
ATOM 8125  C CB   . LYS A 1 18  ? 0.100   13.228  3.831   1.00 0.00 ? 18  LYS A CB   6  
ATOM 8126  C CG   . LYS A 1 18  ? -0.196  11.860  3.243   1.00 0.00 ? 18  LYS A CG   6  
ATOM 8127  C CD   . LYS A 1 18  ? -1.378  11.906  2.290   1.00 0.00 ? 18  LYS A CD   6  
ATOM 8128  C CE   . LYS A 1 18  ? -1.967  10.522  2.063   1.00 0.00 ? 18  LYS A CE   6  
ATOM 8129  N NZ   . LYS A 1 18  ? -1.319  9.825   0.918   1.00 0.00 ? 18  LYS A NZ   6  
ATOM 8130  H H    . LYS A 1 18  ? -2.220  14.275  3.507   1.00 0.00 ? 18  LYS A H    6  
ATOM 8131  H HA   . LYS A 1 18  ? -0.979  12.771  5.623   1.00 0.00 ? 18  LYS A HA   6  
ATOM 8132  H HB2  . LYS A 1 18  ? 0.016   13.962  3.043   1.00 0.00 ? 18  LYS A HB2  6  
ATOM 8133  H HB3  . LYS A 1 18  ? 1.115   13.226  4.201   1.00 0.00 ? 18  LYS A HB3  6  
ATOM 8134  H HG2  . LYS A 1 18  ? 0.673   11.513  2.704   1.00 0.00 ? 18  LYS A HG2  6  
ATOM 8135  H HG3  . LYS A 1 18  ? -0.421  11.173  4.047   1.00 0.00 ? 18  LYS A HG3  6  
ATOM 8136  H HD2  . LYS A 1 18  ? -2.142  12.546  2.707   1.00 0.00 ? 18  LYS A HD2  6  
ATOM 8137  H HD3  . LYS A 1 18  ? -1.049  12.308  1.341   1.00 0.00 ? 18  LYS A HD3  6  
ATOM 8138  H HE2  . LYS A 1 18  ? -1.827  9.935   2.957   1.00 0.00 ? 18  LYS A HE2  6  
ATOM 8139  H HE3  . LYS A 1 18  ? -3.023  10.624  1.861   1.00 0.00 ? 18  LYS A HE3  6  
ATOM 8140  H HZ1  . LYS A 1 18  ? -1.615  10.261  0.021   1.00 0.00 ? 18  LYS A HZ1  6  
ATOM 8141  H HZ2  . LYS A 1 18  ? -1.593  8.822   0.910   1.00 0.00 ? 18  LYS A HZ2  6  
ATOM 8142  H HZ3  . LYS A 1 18  ? -0.285  9.890   0.999   1.00 0.00 ? 18  LYS A HZ3  6  
ATOM 8143  N N    . THR A 1 19  ? 0.116   14.476  7.033   1.00 0.00 ? 19  THR A N    6  
ATOM 8144  C CA   . THR A 1 19  ? 0.711   15.477  7.909   1.00 0.00 ? 19  THR A CA   6  
ATOM 8145  C C    . THR A 1 19  ? 2.221   15.294  8.007   1.00 0.00 ? 19  THR A C    6  
ATOM 8146  O O    . THR A 1 19  ? 2.764   14.288  7.551   1.00 0.00 ? 19  THR A O    6  
ATOM 8147  C CB   . THR A 1 19  ? 0.105   15.418  9.323   1.00 0.00 ? 19  THR A CB   6  
ATOM 8148  O OG1  . THR A 1 19  ? 0.256   14.101  9.866   1.00 0.00 ? 19  THR A OG1  6  
ATOM 8149  C CG2  . THR A 1 19  ? -1.368  15.796  9.297   1.00 0.00 ? 19  THR A CG2  6  
ATOM 8150  H H    . THR A 1 19  ? -0.036  13.571  7.374   1.00 0.00 ? 19  THR A H    6  
ATOM 8151  H HA   . THR A 1 19  ? 0.503   16.452  7.491   1.00 0.00 ? 19  THR A HA   6  
ATOM 8152  H HB   . THR A 1 19  ? 0.631   16.121  9.954   1.00 0.00 ? 19  THR A HB   6  
ATOM 8153  H HG1  . THR A 1 19  ? -0.523  13.578  9.657   1.00 0.00 ? 19  THR A HG1  6  
ATOM 8154  H HG21 . THR A 1 19  ? -1.674  16.121  10.281  1.00 0.00 ? 19  THR A HG21 6  
ATOM 8155  H HG22 . THR A 1 19  ? -1.955  14.938  9.003   1.00 0.00 ? 19  THR A HG22 6  
ATOM 8156  H HG23 . THR A 1 19  ? -1.521  16.597  8.590   1.00 0.00 ? 19  THR A HG23 6  
ATOM 8157  N N    . GLU A 1 20  ? 2.894   16.272  8.605   1.00 0.00 ? 20  GLU A N    6  
ATOM 8158  C CA   . GLU A 1 20  ? 4.343   16.216  8.763   1.00 0.00 ? 20  GLU A CA   6  
ATOM 8159  C C    . GLU A 1 20  ? 4.723   15.997  10.224  1.00 0.00 ? 20  GLU A C    6  
ATOM 8160  O O    . GLU A 1 20  ? 4.951   16.951  10.967  1.00 0.00 ? 20  GLU A O    6  
ATOM 8161  C CB   . GLU A 1 20  ? 4.984   17.505  8.245   1.00 0.00 ? 20  GLU A CB   6  
ATOM 8162  C CG   . GLU A 1 20  ? 4.779   17.732  6.757   1.00 0.00 ? 20  GLU A CG   6  
ATOM 8163  C CD   . GLU A 1 20  ? 5.633   16.814  5.903   1.00 0.00 ? 20  GLU A CD   6  
ATOM 8164  O OE1  . GLU A 1 20  ? 5.415   15.585  5.955   1.00 0.00 ? 20  GLU A OE1  6  
ATOM 8165  O OE2  . GLU A 1 20  ? 6.518   17.323  5.185   1.00 0.00 ? 20  GLU A OE2  6  
ATOM 8166  H H    . GLU A 1 20  ? 2.405   17.048  8.949   1.00 0.00 ? 20  GLU A H    6  
ATOM 8167  H HA   . GLU A 1 20  ? 4.708   15.384  8.180   1.00 0.00 ? 20  GLU A HA   6  
ATOM 8168  H HB2  . GLU A 1 20  ? 4.560   18.343  8.778   1.00 0.00 ? 20  GLU A HB2  6  
ATOM 8169  H HB3  . GLU A 1 20  ? 6.046   17.467  8.438   1.00 0.00 ? 20  GLU A HB3  6  
ATOM 8170  H HG2  . GLU A 1 20  ? 3.741   17.556  6.518   1.00 0.00 ? 20  GLU A HG2  6  
ATOM 8171  H HG3  . GLU A 1 20  ? 5.032   18.755  6.523   1.00 0.00 ? 20  GLU A HG3  6  
ATOM 8172  N N    . ASN A 1 21  ? 4.790   14.733  10.630  1.00 0.00 ? 21  ASN A N    6  
ATOM 8173  C CA   . ASN A 1 21  ? 5.142   14.388  12.002  1.00 0.00 ? 21  ASN A CA   6  
ATOM 8174  C C    . ASN A 1 21  ? 6.334   13.438  12.036  1.00 0.00 ? 21  ASN A C    6  
ATOM 8175  O O    . ASN A 1 21  ? 6.866   13.056  10.994  1.00 0.00 ? 21  ASN A O    6  
ATOM 8176  C CB   . ASN A 1 21  ? 3.946   13.749  12.712  1.00 0.00 ? 21  ASN A CB   6  
ATOM 8177  C CG   . ASN A 1 21  ? 2.702   14.613  12.640  1.00 0.00 ? 21  ASN A CG   6  
ATOM 8178  O OD1  . ASN A 1 21  ? 2.712   15.687  12.038  1.00 0.00 ? 21  ASN A OD1  6  
ATOM 8179  N ND2  . ASN A 1 21  ? 1.622   14.148  13.257  1.00 0.00 ? 21  ASN A ND2  6  
ATOM 8180  H H    . ASN A 1 21  ? 4.598   14.015  9.991   1.00 0.00 ? 21  ASN A H    6  
ATOM 8181  H HA   . ASN A 1 21  ? 5.408   15.300  12.515  1.00 0.00 ? 21  ASN A HA   6  
ATOM 8182  H HB2  . ASN A 1 21  ? 3.727   12.798  12.249  1.00 0.00 ? 21  ASN A HB2  6  
ATOM 8183  H HB3  . ASN A 1 21  ? 4.193   13.591  13.751  1.00 0.00 ? 21  ASN A HB3  6  
ATOM 8184  H HD21 . ASN A 1 21  ? 1.687   13.285  13.717  1.00 0.00 ? 21  ASN A HD21 6  
ATOM 8185  H HD22 . ASN A 1 21  ? 0.803   14.686  13.226  1.00 0.00 ? 21  ASN A HD22 6  
ATOM 8186  N N    . ASN A 1 22  ? 6.749   13.059  13.240  1.00 0.00 ? 22  ASN A N    6  
ATOM 8187  C CA   . ASN A 1 22  ? 7.879   12.153  13.410  1.00 0.00 ? 22  ASN A CA   6  
ATOM 8188  C C    . ASN A 1 22  ? 7.440   10.855  14.081  1.00 0.00 ? 22  ASN A C    6  
ATOM 8189  O O    . ASN A 1 22  ? 6.264   10.676  14.399  1.00 0.00 ? 22  ASN A O    6  
ATOM 8190  C CB   . ASN A 1 22  ? 8.977   12.823  14.240  1.00 0.00 ? 22  ASN A CB   6  
ATOM 8191  C CG   . ASN A 1 22  ? 8.415   13.677  15.360  1.00 0.00 ? 22  ASN A CG   6  
ATOM 8192  O OD1  . ASN A 1 22  ? 8.405   13.270  16.521  1.00 0.00 ? 22  ASN A OD1  6  
ATOM 8193  N ND2  . ASN A 1 22  ? 7.943   14.870  15.014  1.00 0.00 ? 22  ASN A ND2  6  
ATOM 8194  H H    . ASN A 1 22  ? 6.285   13.398  14.034  1.00 0.00 ? 22  ASN A H    6  
ATOM 8195  H HA   . ASN A 1 22  ? 8.270   11.924  12.430  1.00 0.00 ? 22  ASN A HA   6  
ATOM 8196  H HB2  . ASN A 1 22  ? 9.606   12.060  14.676  1.00 0.00 ? 22  ASN A HB2  6  
ATOM 8197  H HB3  . ASN A 1 22  ? 9.573   13.452  13.596  1.00 0.00 ? 22  ASN A HB3  6  
ATOM 8198  H HD21 . ASN A 1 22  ? 7.983   15.128  14.070  1.00 0.00 ? 22  ASN A HD21 6  
ATOM 8199  H HD22 . ASN A 1 22  ? 7.574   15.443  15.719  1.00 0.00 ? 22  ASN A HD22 6  
ATOM 8200  N N    . ASP A 1 23  ? 8.392   9.954   14.293  1.00 0.00 ? 23  ASP A N    6  
ATOM 8201  C CA   . ASP A 1 23  ? 8.104   8.672   14.927  1.00 0.00 ? 23  ASP A CA   6  
ATOM 8202  C C    . ASP A 1 23  ? 7.366   7.744   13.968  1.00 0.00 ? 23  ASP A C    6  
ATOM 8203  O O    . ASP A 1 23  ? 6.552   6.921   14.387  1.00 0.00 ? 23  ASP A O    6  
ATOM 8204  C CB   . ASP A 1 23  ? 7.273   8.882   16.194  1.00 0.00 ? 23  ASP A CB   6  
ATOM 8205  C CG   . ASP A 1 23  ? 7.536   7.817   17.241  1.00 0.00 ? 23  ASP A CG   6  
ATOM 8206  O OD1  . ASP A 1 23  ? 8.715   7.615   17.598  1.00 0.00 ? 23  ASP A OD1  6  
ATOM 8207  O OD2  . ASP A 1 23  ? 6.562   7.186   17.704  1.00 0.00 ? 23  ASP A OD2  6  
ATOM 8208  H H    . ASP A 1 23  ? 9.311   10.155  14.017  1.00 0.00 ? 23  ASP A H    6  
ATOM 8209  H HA   . ASP A 1 23  ? 9.045   8.217   15.196  1.00 0.00 ? 23  ASP A HA   6  
ATOM 8210  H HB2  . ASP A 1 23  ? 7.514   9.845   16.620  1.00 0.00 ? 23  ASP A HB2  6  
ATOM 8211  H HB3  . ASP A 1 23  ? 6.225   8.858   15.937  1.00 0.00 ? 23  ASP A HB3  6  
ATOM 8212  N N    . HIS A 1 24  ? 7.655   7.884   12.678  1.00 0.00 ? 24  HIS A N    6  
ATOM 8213  C CA   . HIS A 1 24  ? 7.018   7.058   11.658  1.00 0.00 ? 24  HIS A CA   6  
ATOM 8214  C C    . HIS A 1 24  ? 7.943   5.926   11.220  1.00 0.00 ? 24  HIS A C    6  
ATOM 8215  O O    . HIS A 1 24  ? 9.156   5.988   11.423  1.00 0.00 ? 24  HIS A O    6  
ATOM 8216  C CB   . HIS A 1 24  ? 6.631   7.911   10.450  1.00 0.00 ? 24  HIS A CB   6  
ATOM 8217  C CG   . HIS A 1 24  ? 5.828   9.124   10.806  1.00 0.00 ? 24  HIS A CG   6  
ATOM 8218  N ND1  . HIS A 1 24  ? 4.898   9.139   11.824  1.00 0.00 ? 24  HIS A ND1  6  
ATOM 8219  C CD2  . HIS A 1 24  ? 5.823   10.369  10.275  1.00 0.00 ? 24  HIS A CD2  6  
ATOM 8220  C CE1  . HIS A 1 24  ? 4.354   10.340  11.902  1.00 0.00 ? 24  HIS A CE1  6  
ATOM 8221  N NE2  . HIS A 1 24  ? 4.898   11.106  10.973  1.00 0.00 ? 24  HIS A NE2  6  
ATOM 8222  H H    . HIS A 1 24  ? 8.313   8.557   12.406  1.00 0.00 ? 24  HIS A H    6  
ATOM 8223  H HA   . HIS A 1 24  ? 6.125   6.631   12.088  1.00 0.00 ? 24  HIS A HA   6  
ATOM 8224  H HB2  . HIS A 1 24  ? 7.528   8.243   9.949   1.00 0.00 ? 24  HIS A HB2  6  
ATOM 8225  H HB3  . HIS A 1 24  ? 6.043   7.312   9.768   1.00 0.00 ? 24  HIS A HB3  6  
ATOM 8226  H HD1  . HIS A 1 24  ? 4.670   8.382   12.402  1.00 0.00 ? 24  HIS A HD1  6  
ATOM 8227  H HD2  . HIS A 1 24  ? 6.432   10.719  9.454   1.00 0.00 ? 24  HIS A HD2  6  
ATOM 8228  H HE1  . HIS A 1 24  ? 3.593   10.646  12.606  1.00 0.00 ? 24  HIS A HE1  6  
ATOM 8229  H HE2  . HIS A 1 24  ? 4.614   12.018  10.757  1.00 0.00 ? 24  HIS A HE2  6  
ATOM 8230  N N    . ILE A 1 25  ? 7.362   4.892   10.621  1.00 0.00 ? 25  ILE A N    6  
ATOM 8231  C CA   . ILE A 1 25  ? 8.134   3.747   10.155  1.00 0.00 ? 25  ILE A CA   6  
ATOM 8232  C C    . ILE A 1 25  ? 8.041   3.601   8.640   1.00 0.00 ? 25  ILE A C    6  
ATOM 8233  O O    . ILE A 1 25  ? 6.994   3.855   8.045   1.00 0.00 ? 25  ILE A O    6  
ATOM 8234  C CB   . ILE A 1 25  ? 7.657   2.440   10.815  1.00 0.00 ? 25  ILE A CB   6  
ATOM 8235  C CG1  . ILE A 1 25  ? 6.205   2.149   10.430  1.00 0.00 ? 25  ILE A CG1  6  
ATOM 8236  C CG2  . ILE A 1 25  ? 7.802   2.527   12.327  1.00 0.00 ? 25  ILE A CG2  6  
ATOM 8237  C CD1  . ILE A 1 25  ? 5.620   0.949   11.143  1.00 0.00 ? 25  ILE A CD1  6  
ATOM 8238  H H    . ILE A 1 25  ? 6.391   4.900   10.488  1.00 0.00 ? 25  ILE A H    6  
ATOM 8239  H HA   . ILE A 1 25  ? 9.167   3.909   10.427  1.00 0.00 ? 25  ILE A HA   6  
ATOM 8240  H HB   . ILE A 1 25  ? 8.283   1.635   10.463  1.00 0.00 ? 25  ILE A HB   6  
ATOM 8241  H HG12 . ILE A 1 25  ? 5.596   3.006   10.671  1.00 0.00 ? 25  ILE A HG12 6  
ATOM 8242  H HG13 . ILE A 1 25  ? 6.153   1.963   9.367   1.00 0.00 ? 25  ILE A HG13 6  
ATOM 8243  H HG21 . ILE A 1 25  ? 8.262   1.622   12.697  1.00 0.00 ? 25  ILE A HG21 6  
ATOM 8244  H HG22 . ILE A 1 25  ? 8.422   3.374   12.581  1.00 0.00 ? 25  ILE A HG22 6  
ATOM 8245  H HG23 . ILE A 1 25  ? 6.828   2.646   12.777  1.00 0.00 ? 25  ILE A HG23 6  
ATOM 8246  H HD11 . ILE A 1 25  ? 4.892   0.470   10.504  1.00 0.00 ? 25  ILE A HD11 6  
ATOM 8247  H HD12 . ILE A 1 25  ? 6.408   0.251   11.380  1.00 0.00 ? 25  ILE A HD12 6  
ATOM 8248  H HD13 . ILE A 1 25  ? 5.139   1.272   12.055  1.00 0.00 ? 25  ILE A HD13 6  
ATOM 8249  N N    . ASN A 1 26  ? 9.143   3.188   8.022   1.00 0.00 ? 26  ASN A N    6  
ATOM 8250  C CA   . ASN A 1 26  ? 9.185   3.006   6.575   1.00 0.00 ? 26  ASN A CA   6  
ATOM 8251  C C    . ASN A 1 26  ? 9.197   1.524   6.213   1.00 0.00 ? 26  ASN A C    6  
ATOM 8252  O O    . ASN A 1 26  ? 10.052  0.768   6.676   1.00 0.00 ? 26  ASN A O    6  
ATOM 8253  C CB   . ASN A 1 26  ? 10.419  3.696   5.990   1.00 0.00 ? 26  ASN A CB   6  
ATOM 8254  C CG   . ASN A 1 26  ? 10.565  5.127   6.470   1.00 0.00 ? 26  ASN A CG   6  
ATOM 8255  O OD1  . ASN A 1 26  ? 9.702   5.968   6.219   1.00 0.00 ? 26  ASN A OD1  6  
ATOM 8256  N ND2  . ASN A 1 26  ? 11.660  5.409   7.166   1.00 0.00 ? 26  ASN A ND2  6  
ATOM 8257  H H    . ASN A 1 26  ? 9.946   3.001   8.551   1.00 0.00 ? 26  ASN A H    6  
ATOM 8258  H HA   . ASN A 1 26  ? 8.299   3.460   6.158   1.00 0.00 ? 26  ASN A HA   6  
ATOM 8259  H HB2  . ASN A 1 26  ? 11.303  3.147   6.282   1.00 0.00 ? 26  ASN A HB2  6  
ATOM 8260  H HB3  . ASN A 1 26  ? 10.345  3.702   4.913   1.00 0.00 ? 26  ASN A HB3  6  
ATOM 8261  H HD21 . ASN A 1 26  ? 12.305  4.689   7.328   1.00 0.00 ? 26  ASN A HD21 6  
ATOM 8262  H HD22 . ASN A 1 26  ? 11.779  6.327   7.489   1.00 0.00 ? 26  ASN A HD22 6  
ATOM 8263  N N    . LEU A 1 27  ? 8.244   1.116   5.383   1.00 0.00 ? 27  LEU A N    6  
ATOM 8264  C CA   . LEU A 1 27  ? 8.144   -0.276  4.957   1.00 0.00 ? 27  LEU A CA   6  
ATOM 8265  C C    . LEU A 1 27  ? 8.386   -0.405  3.457   1.00 0.00 ? 27  LEU A C    6  
ATOM 8266  O O    . LEU A 1 27  ? 7.729   0.257   2.652   1.00 0.00 ? 27  LEU A O    6  
ATOM 8267  C CB   . LEU A 1 27  ? 6.769   -0.842  5.315   1.00 0.00 ? 27  LEU A CB   6  
ATOM 8268  C CG   . LEU A 1 27  ? 6.126   -0.290  6.588   1.00 0.00 ? 27  LEU A CG   6  
ATOM 8269  C CD1  . LEU A 1 27  ? 4.637   -0.596  6.610   1.00 0.00 ? 27  LEU A CD1  6  
ATOM 8270  C CD2  . LEU A 1 27  ? 6.809   -0.863  7.822   1.00 0.00 ? 27  LEU A CD2  6  
ATOM 8271  H H    . LEU A 1 27  ? 7.591   1.765   5.048   1.00 0.00 ? 27  LEU A H    6  
ATOM 8272  H HA   . LEU A 1 27  ? 8.903   -0.837  5.481   1.00 0.00 ? 27  LEU A HA   6  
ATOM 8273  H HB2  . LEU A 1 27  ? 6.102   -0.635  4.492   1.00 0.00 ? 27  LEU A HB2  6  
ATOM 8274  H HB3  . LEU A 1 27  ? 6.873   -1.911  5.432   1.00 0.00 ? 27  LEU A HB3  6  
ATOM 8275  H HG   . LEU A 1 27  ? 6.246   0.785   6.607   1.00 0.00 ? 27  LEU A HG   6  
ATOM 8276  H HD11 . LEU A 1 27  ? 4.489   -1.665  6.591   1.00 0.00 ? 27  LEU A HD11 6  
ATOM 8277  H HD12 . LEU A 1 27  ? 4.165   -0.152  5.746   1.00 0.00 ? 27  LEU A HD12 6  
ATOM 8278  H HD13 . LEU A 1 27  ? 4.199   -0.187  7.509   1.00 0.00 ? 27  LEU A HD13 6  
ATOM 8279  H HD21 . LEU A 1 27  ? 6.495   -0.310  8.695   1.00 0.00 ? 27  LEU A HD21 6  
ATOM 8280  H HD22 . LEU A 1 27  ? 7.880   -0.782  7.710   1.00 0.00 ? 27  LEU A HD22 6  
ATOM 8281  H HD23 . LEU A 1 27  ? 6.535   -1.901  7.935   1.00 0.00 ? 27  LEU A HD23 6  
ATOM 8282  N N    . LYS A 1 28  ? 9.330   -1.262  3.086   1.00 0.00 ? 28  LYS A N    6  
ATOM 8283  C CA   . LYS A 1 28  ? 9.657   -1.482  1.683   1.00 0.00 ? 28  LYS A CA   6  
ATOM 8284  C C    . LYS A 1 28  ? 8.825   -2.621  1.102   1.00 0.00 ? 28  LYS A C    6  
ATOM 8285  O O    . LYS A 1 28  ? 8.954   -3.772  1.519   1.00 0.00 ? 28  LYS A O    6  
ATOM 8286  C CB   . LYS A 1 28  ? 11.147  -1.794  1.527   1.00 0.00 ? 28  LYS A CB   6  
ATOM 8287  C CG   . LYS A 1 28  ? 12.054  -0.634  1.899   1.00 0.00 ? 28  LYS A CG   6  
ATOM 8288  C CD   . LYS A 1 28  ? 13.405  -1.118  2.396   1.00 0.00 ? 28  LYS A CD   6  
ATOM 8289  C CE   . LYS A 1 28  ? 14.169  -0.010  3.104   1.00 0.00 ? 28  LYS A CE   6  
ATOM 8290  N NZ   . LYS A 1 28  ? 14.983  0.797   2.154   1.00 0.00 ? 28  LYS A NZ   6  
ATOM 8291  H H    . LYS A 1 28  ? 9.820   -1.761  3.775   1.00 0.00 ? 28  LYS A H    6  
ATOM 8292  H HA   . LYS A 1 28  ? 9.430   -0.575  1.143   1.00 0.00 ? 28  LYS A HA   6  
ATOM 8293  H HB2  . LYS A 1 28  ? 11.395  -2.634  2.160   1.00 0.00 ? 28  LYS A HB2  6  
ATOM 8294  H HB3  . LYS A 1 28  ? 11.342  -2.060  0.498   1.00 0.00 ? 28  LYS A HB3  6  
ATOM 8295  H HG2  . LYS A 1 28  ? 12.204  -0.013  1.028   1.00 0.00 ? 28  LYS A HG2  6  
ATOM 8296  H HG3  . LYS A 1 28  ? 11.580  -0.054  2.678   1.00 0.00 ? 28  LYS A HG3  6  
ATOM 8297  H HD2  . LYS A 1 28  ? 13.253  -1.934  3.087   1.00 0.00 ? 28  LYS A HD2  6  
ATOM 8298  H HD3  . LYS A 1 28  ? 13.987  -1.463  1.553   1.00 0.00 ? 28  LYS A HD3  6  
ATOM 8299  H HE2  . LYS A 1 28  ? 13.461  0.638   3.599   1.00 0.00 ? 28  LYS A HE2  6  
ATOM 8300  H HE3  . LYS A 1 28  ? 14.824  -0.455  3.839   1.00 0.00 ? 28  LYS A HE3  6  
ATOM 8301  H HZ1  . LYS A 1 28  ? 15.084  0.291   1.251   1.00 0.00 ? 28  LYS A HZ1  6  
ATOM 8302  H HZ2  . LYS A 1 28  ? 15.929  0.968   2.550   1.00 0.00 ? 28  LYS A HZ2  6  
ATOM 8303  H HZ3  . LYS A 1 28  ? 14.522  1.713   1.977   1.00 0.00 ? 28  LYS A HZ3  6  
ATOM 8304  N N    . VAL A 1 29  ? 7.972   -2.293  0.137   1.00 0.00 ? 29  VAL A N    6  
ATOM 8305  C CA   . VAL A 1 29  ? 7.121   -3.289  -0.503  1.00 0.00 ? 29  VAL A CA   6  
ATOM 8306  C C    . VAL A 1 29  ? 7.788   -3.865  -1.747  1.00 0.00 ? 29  VAL A C    6  
ATOM 8307  O O    . VAL A 1 29  ? 7.989   -3.163  -2.737  1.00 0.00 ? 29  VAL A O    6  
ATOM 8308  C CB   . VAL A 1 29  ? 5.756   -2.693  -0.895  1.00 0.00 ? 29  VAL A CB   6  
ATOM 8309  C CG1  . VAL A 1 29  ? 4.879   -3.750  -1.548  1.00 0.00 ? 29  VAL A CG1  6  
ATOM 8310  C CG2  . VAL A 1 29  ? 5.068   -2.095  0.322   1.00 0.00 ? 29  VAL A CG2  6  
ATOM 8311  H H    . VAL A 1 29  ? 7.915   -1.359  -0.153  1.00 0.00 ? 29  VAL A H    6  
ATOM 8312  H HA   . VAL A 1 29  ? 6.952   -4.088  0.205   1.00 0.00 ? 29  VAL A HA   6  
ATOM 8313  H HB   . VAL A 1 29  ? 5.924   -1.903  -1.612  1.00 0.00 ? 29  VAL A HB   6  
ATOM 8314  H HG11 . VAL A 1 29  ? 5.335   -4.076  -2.471  1.00 0.00 ? 29  VAL A HG11 6  
ATOM 8315  H HG12 . VAL A 1 29  ? 4.774   -4.593  -0.880  1.00 0.00 ? 29  VAL A HG12 6  
ATOM 8316  H HG13 . VAL A 1 29  ? 3.906   -3.331  -1.756  1.00 0.00 ? 29  VAL A HG13 6  
ATOM 8317  H HG21 . VAL A 1 29  ? 4.209   -2.696  0.581   1.00 0.00 ? 29  VAL A HG21 6  
ATOM 8318  H HG22 . VAL A 1 29  ? 5.757   -2.075  1.154   1.00 0.00 ? 29  VAL A HG22 6  
ATOM 8319  H HG23 . VAL A 1 29  ? 4.748   -1.088  0.097   1.00 0.00 ? 29  VAL A HG23 6  
ATOM 8320  N N    . ALA A 1 30  ? 8.129   -5.148  -1.689  1.00 0.00 ? 30  ALA A N    6  
ATOM 8321  C CA   . ALA A 1 30  ? 8.772   -5.819  -2.812  1.00 0.00 ? 30  ALA A CA   6  
ATOM 8322  C C    . ALA A 1 30  ? 7.738   -6.456  -3.735  1.00 0.00 ? 30  ALA A C    6  
ATOM 8323  O O    . ALA A 1 30  ? 6.895   -7.235  -3.294  1.00 0.00 ? 30  ALA A O    6  
ATOM 8324  C CB   . ALA A 1 30  ? 9.751   -6.870  -2.309  1.00 0.00 ? 30  ALA A CB   6  
ATOM 8325  H H    . ALA A 1 30  ? 7.943   -5.656  -0.872  1.00 0.00 ? 30  ALA A H    6  
ATOM 8326  H HA   . ALA A 1 30  ? 9.329   -5.080  -3.368  1.00 0.00 ? 30  ALA A HA   6  
ATOM 8327  H HB1  . ALA A 1 30  ? 10.139  -7.430  -3.148  1.00 0.00 ? 30  ALA A HB1  6  
ATOM 8328  H HB2  . ALA A 1 30  ? 10.565  -6.384  -1.792  1.00 0.00 ? 30  ALA A HB2  6  
ATOM 8329  H HB3  . ALA A 1 30  ? 9.243   -7.540  -1.632  1.00 0.00 ? 30  ALA A HB3  6  
ATOM 8330  N N    . GLY A 1 31  ? 7.810   -6.118  -5.019  1.00 0.00 ? 31  GLY A N    6  
ATOM 8331  C CA   . GLY A 1 31  ? 6.874   -6.665  -5.984  1.00 0.00 ? 31  GLY A CA   6  
ATOM 8332  C C    . GLY A 1 31  ? 7.537   -7.615  -6.960  1.00 0.00 ? 31  GLY A C    6  
ATOM 8333  O O    . GLY A 1 31  ? 8.759   -7.607  -7.111  1.00 0.00 ? 31  GLY A O    6  
ATOM 8334  H H    . GLY A 1 31  ? 8.504   -5.491  -5.313  1.00 0.00 ? 31  GLY A H    6  
ATOM 8335  H HA2  . GLY A 1 31  ? 6.096   -7.194  -5.454  1.00 0.00 ? 31  GLY A HA2  6  
ATOM 8336  H HA3  . GLY A 1 31  ? 6.429   -5.851  -6.537  1.00 0.00 ? 31  GLY A HA3  6  
ATOM 8337  N N    . GLN A 1 32  ? 6.731   -8.437  -7.624  1.00 0.00 ? 32  GLN A N    6  
ATOM 8338  C CA   . GLN A 1 32  ? 7.248   -9.400  -8.589  1.00 0.00 ? 32  GLN A CA   6  
ATOM 8339  C C    . GLN A 1 32  ? 8.016   -8.695  -9.703  1.00 0.00 ? 32  GLN A C    6  
ATOM 8340  O O    . GLN A 1 32  ? 9.016   -9.210  -10.203 1.00 0.00 ? 32  GLN A O    6  
ATOM 8341  C CB   . GLN A 1 32  ? 6.104   -10.223 -9.184  1.00 0.00 ? 32  GLN A CB   6  
ATOM 8342  C CG   . GLN A 1 32  ? 5.089   -9.389  -9.950  1.00 0.00 ? 32  GLN A CG   6  
ATOM 8343  C CD   . GLN A 1 32  ? 4.107   -10.239 -10.731 1.00 0.00 ? 32  GLN A CD   6  
ATOM 8344  O OE1  . GLN A 1 32  ? 3.287   -10.952 -10.152 1.00 0.00 ? 32  GLN A OE1  6  
ATOM 8345  N NE2  . GLN A 1 32  ? 4.183   -10.167 -12.055 1.00 0.00 ? 32  GLN A NE2  6  
ATOM 8346  H H    . GLN A 1 32  ? 5.766   -8.396  -7.460  1.00 0.00 ? 32  GLN A H    6  
ATOM 8347  H HA   . GLN A 1 32  ? 7.922   -10.062 -8.068  1.00 0.00 ? 32  GLN A HA   6  
ATOM 8348  H HB2  . GLN A 1 32  ? 6.518   -10.957 -9.860  1.00 0.00 ? 32  GLN A HB2  6  
ATOM 8349  H HB3  . GLN A 1 32  ? 5.589   -10.732 -8.384  1.00 0.00 ? 32  GLN A HB3  6  
ATOM 8350  H HG2  . GLN A 1 32  ? 4.537   -8.783  -9.247  1.00 0.00 ? 32  GLN A HG2  6  
ATOM 8351  H HG3  . GLN A 1 32  ? 5.617   -8.748  -10.640 1.00 0.00 ? 32  GLN A HG3  6  
ATOM 8352  H HE21 . GLN A 1 32  ? 4.862   -9.578  -12.447 1.00 0.00 ? 32  GLN A HE21 6  
ATOM 8353  H HE22 . GLN A 1 32  ? 3.561   -10.706 -12.584 1.00 0.00 ? 32  GLN A HE22 6  
ATOM 8354  N N    . ASP A 1 33  ? 7.542   -7.515  -10.086 1.00 0.00 ? 33  ASP A N    6  
ATOM 8355  C CA   . ASP A 1 33  ? 8.184   -6.738  -11.140 1.00 0.00 ? 33  ASP A CA   6  
ATOM 8356  C C    . ASP A 1 33  ? 9.670   -6.552  -10.850 1.00 0.00 ? 33  ASP A C    6  
ATOM 8357  O O    . ASP A 1 33  ? 10.501  -6.601  -11.756 1.00 0.00 ? 33  ASP A O    6  
ATOM 8358  C CB   . ASP A 1 33  ? 7.505   -5.375  -11.285 1.00 0.00 ? 33  ASP A CB   6  
ATOM 8359  C CG   . ASP A 1 33  ? 8.317   -4.411  -12.127 1.00 0.00 ? 33  ASP A CG   6  
ATOM 8360  O OD1  . ASP A 1 33  ? 8.668   -4.771  -13.270 1.00 0.00 ? 33  ASP A OD1  6  
ATOM 8361  O OD2  . ASP A 1 33  ? 8.601   -3.296  -11.643 1.00 0.00 ? 33  ASP A OD2  6  
ATOM 8362  H H    . ASP A 1 33  ? 6.740   -7.157  -9.649  1.00 0.00 ? 33  ASP A H    6  
ATOM 8363  H HA   . ASP A 1 33  ? 8.077   -7.284  -12.066 1.00 0.00 ? 33  ASP A HA   6  
ATOM 8364  H HB2  . ASP A 1 33  ? 6.541   -5.509  -11.753 1.00 0.00 ? 33  ASP A HB2  6  
ATOM 8365  H HB3  . ASP A 1 33  ? 7.368   -4.943  -10.305 1.00 0.00 ? 33  ASP A HB3  6  
ATOM 8366  N N    . GLY A 1 34  ? 9.997   -6.338  -9.579  1.00 0.00 ? 34  GLY A N    6  
ATOM 8367  C CA   . GLY A 1 34  ? 11.382  -6.146  -9.192  1.00 0.00 ? 34  GLY A CA   6  
ATOM 8368  C C    . GLY A 1 34  ? 11.596  -4.861  -8.417  1.00 0.00 ? 34  GLY A C    6  
ATOM 8369  O O    . GLY A 1 34  ? 12.368  -4.826  -7.460  1.00 0.00 ? 34  GLY A O    6  
ATOM 8370  H H    . GLY A 1 34  ? 9.292   -6.309  -8.899  1.00 0.00 ? 34  GLY A H    6  
ATOM 8371  H HA2  . GLY A 1 34  ? 11.692  -6.979  -8.579  1.00 0.00 ? 34  GLY A HA2  6  
ATOM 8372  H HA3  . GLY A 1 34  ? 11.993  -6.121  -10.083 1.00 0.00 ? 34  GLY A HA3  6  
ATOM 8373  N N    . SER A 1 35  ? 10.910  -3.800  -8.833  1.00 0.00 ? 35  SER A N    6  
ATOM 8374  C CA   . SER A 1 35  ? 11.033  -2.505  -8.175  1.00 0.00 ? 35  SER A CA   6  
ATOM 8375  C C    . SER A 1 35  ? 10.654  -2.607  -6.701  1.00 0.00 ? 35  SER A C    6  
ATOM 8376  O O    . SER A 1 35  ? 10.257  -3.669  -6.222  1.00 0.00 ? 35  SER A O    6  
ATOM 8377  C CB   . SER A 1 35  ? 10.147  -1.470  -8.871  1.00 0.00 ? 35  SER A CB   6  
ATOM 8378  O OG   . SER A 1 35  ? 10.837  -0.843  -9.938  1.00 0.00 ? 35  SER A OG   6  
ATOM 8379  H H    . SER A 1 35  ? 10.310  -3.891  -9.603  1.00 0.00 ? 35  SER A H    6  
ATOM 8380  H HA   . SER A 1 35  ? 12.063  -2.192  -8.249  1.00 0.00 ? 35  SER A HA   6  
ATOM 8381  H HB2  . SER A 1 35  ? 9.268   -1.958  -9.264  1.00 0.00 ? 35  SER A HB2  6  
ATOM 8382  H HB3  . SER A 1 35  ? 9.850   -0.715  -8.157  1.00 0.00 ? 35  SER A HB3  6  
ATOM 8383  H HG   . SER A 1 35  ? 11.067  -1.499  -10.600 1.00 0.00 ? 35  SER A HG   6  
ATOM 8384  N N    . VAL A 1 36  ? 10.779  -1.493  -5.986  1.00 0.00 ? 36  VAL A N    6  
ATOM 8385  C CA   . VAL A 1 36  ? 10.449  -1.455  -4.566  1.00 0.00 ? 36  VAL A CA   6  
ATOM 8386  C C    . VAL A 1 36  ? 9.743   -0.154  -4.201  1.00 0.00 ? 36  VAL A C    6  
ATOM 8387  O O    . VAL A 1 36  ? 10.255  0.936   -4.456  1.00 0.00 ? 36  VAL A O    6  
ATOM 8388  C CB   . VAL A 1 36  ? 11.709  -1.605  -3.693  1.00 0.00 ? 36  VAL A CB   6  
ATOM 8389  C CG1  . VAL A 1 36  ? 11.352  -1.495  -2.218  1.00 0.00 ? 36  VAL A CG1  6  
ATOM 8390  C CG2  . VAL A 1 36  ? 12.403  -2.927  -3.984  1.00 0.00 ? 36  VAL A CG2  6  
ATOM 8391  H H    . VAL A 1 36  ? 11.100  -0.677  -6.424  1.00 0.00 ? 36  VAL A H    6  
ATOM 8392  H HA   . VAL A 1 36  ? 9.788   -2.283  -4.354  1.00 0.00 ? 36  VAL A HA   6  
ATOM 8393  H HB   . VAL A 1 36  ? 12.389  -0.803  -3.937  1.00 0.00 ? 36  VAL A HB   6  
ATOM 8394  H HG11 . VAL A 1 36  ? 12.233  -1.682  -1.621  1.00 0.00 ? 36  VAL A HG11 6  
ATOM 8395  H HG12 . VAL A 1 36  ? 10.980  -0.502  -2.011  1.00 0.00 ? 36  VAL A HG12 6  
ATOM 8396  H HG13 . VAL A 1 36  ? 10.592  -2.223  -1.976  1.00 0.00 ? 36  VAL A HG13 6  
ATOM 8397  H HG21 . VAL A 1 36  ? 13.248  -3.043  -3.321  1.00 0.00 ? 36  VAL A HG21 6  
ATOM 8398  H HG22 . VAL A 1 36  ? 11.710  -3.741  -3.828  1.00 0.00 ? 36  VAL A HG22 6  
ATOM 8399  H HG23 . VAL A 1 36  ? 12.745  -2.937  -5.008  1.00 0.00 ? 36  VAL A HG23 6  
ATOM 8400  N N    . VAL A 1 37  ? 8.563   -0.275  -3.601  1.00 0.00 ? 37  VAL A N    6  
ATOM 8401  C CA   . VAL A 1 37  ? 7.787   0.891   -3.198  1.00 0.00 ? 37  VAL A CA   6  
ATOM 8402  C C    . VAL A 1 37  ? 7.809   1.070   -1.684  1.00 0.00 ? 37  VAL A C    6  
ATOM 8403  O O    . VAL A 1 37  ? 7.407   0.178   -0.938  1.00 0.00 ? 37  VAL A O    6  
ATOM 8404  C CB   . VAL A 1 37  ? 6.325   0.782   -3.670  1.00 0.00 ? 37  VAL A CB   6  
ATOM 8405  C CG1  . VAL A 1 37  ? 5.601   2.106   -3.476  1.00 0.00 ? 37  VAL A CG1  6  
ATOM 8406  C CG2  . VAL A 1 37  ? 6.266   0.341   -5.124  1.00 0.00 ? 37  VAL A CG2  6  
ATOM 8407  H H    . VAL A 1 37  ? 8.207   -1.171  -3.424  1.00 0.00 ? 37  VAL A H    6  
ATOM 8408  H HA   . VAL A 1 37  ? 8.228   1.762   -3.660  1.00 0.00 ? 37  VAL A HA   6  
ATOM 8409  H HB   . VAL A 1 37  ? 5.828   0.035   -3.068  1.00 0.00 ? 37  VAL A HB   6  
ATOM 8410  H HG11 . VAL A 1 37  ? 6.113   2.880   -4.028  1.00 0.00 ? 37  VAL A HG11 6  
ATOM 8411  H HG12 . VAL A 1 37  ? 4.586   2.018   -3.835  1.00 0.00 ? 37  VAL A HG12 6  
ATOM 8412  H HG13 . VAL A 1 37  ? 5.591   2.361   -2.427  1.00 0.00 ? 37  VAL A HG13 6  
ATOM 8413  H HG21 . VAL A 1 37  ? 5.454   0.850   -5.622  1.00 0.00 ? 37  VAL A HG21 6  
ATOM 8414  H HG22 . VAL A 1 37  ? 7.198   0.586   -5.613  1.00 0.00 ? 37  VAL A HG22 6  
ATOM 8415  H HG23 . VAL A 1 37  ? 6.105   -0.726  -5.171  1.00 0.00 ? 37  VAL A HG23 6  
ATOM 8416  N N    . GLN A 1 38  ? 8.280   2.230   -1.238  1.00 0.00 ? 38  GLN A N    6  
ATOM 8417  C CA   . GLN A 1 38  ? 8.355   2.526   0.188   1.00 0.00 ? 38  GLN A CA   6  
ATOM 8418  C C    . GLN A 1 38  ? 7.143   3.333   0.641   1.00 0.00 ? 38  GLN A C    6  
ATOM 8419  O O    . GLN A 1 38  ? 6.446   3.936   -0.176  1.00 0.00 ? 38  GLN A O    6  
ATOM 8420  C CB   . GLN A 1 38  ? 9.640   3.292   0.505   1.00 0.00 ? 38  GLN A CB   6  
ATOM 8421  C CG   . GLN A 1 38  ? 10.875  2.408   0.569   1.00 0.00 ? 38  GLN A CG   6  
ATOM 8422  C CD   . GLN A 1 38  ? 12.163  3.191   0.405   1.00 0.00 ? 38  GLN A CD   6  
ATOM 8423  O OE1  . GLN A 1 38  ? 12.568  3.936   1.298   1.00 0.00 ? 38  GLN A OE1  6  
ATOM 8424  N NE2  . GLN A 1 38  ? 12.814  3.026   -0.741  1.00 0.00 ? 38  GLN A NE2  6  
ATOM 8425  H H    . GLN A 1 38  ? 8.586   2.902   -1.882  1.00 0.00 ? 38  GLN A H    6  
ATOM 8426  H HA   . GLN A 1 38  ? 8.365   1.587   0.721   1.00 0.00 ? 38  GLN A HA   6  
ATOM 8427  H HB2  . GLN A 1 38  ? 9.798   4.039   -0.258  1.00 0.00 ? 38  GLN A HB2  6  
ATOM 8428  H HB3  . GLN A 1 38  ? 9.526   3.783   1.460   1.00 0.00 ? 38  GLN A HB3  6  
ATOM 8429  H HG2  . GLN A 1 38  ? 10.896  1.908   1.527   1.00 0.00 ? 38  GLN A HG2  6  
ATOM 8430  H HG3  . GLN A 1 38  ? 10.816  1.671   -0.218  1.00 0.00 ? 38  GLN A HG3  6  
ATOM 8431  H HE21 . GLN A 1 38  ? 12.431  2.417   -1.407  1.00 0.00 ? 38  GLN A HE21 6  
ATOM 8432  H HE22 . GLN A 1 38  ? 13.648  3.521   -0.874  1.00 0.00 ? 38  GLN A HE22 6  
ATOM 8433  N N    . PHE A 1 39  ? 6.897   3.341   1.946   1.00 0.00 ? 39  PHE A N    6  
ATOM 8434  C CA   . PHE A 1 39  ? 5.768   4.074   2.508   1.00 0.00 ? 39  PHE A CA   6  
ATOM 8435  C C    . PHE A 1 39  ? 6.073   4.539   3.928   1.00 0.00 ? 39  PHE A C    6  
ATOM 8436  O O    . PHE A 1 39  ? 6.622   3.788   4.735   1.00 0.00 ? 39  PHE A O    6  
ATOM 8437  C CB   . PHE A 1 39  ? 4.513   3.199   2.504   1.00 0.00 ? 39  PHE A CB   6  
ATOM 8438  C CG   . PHE A 1 39  ? 4.042   2.832   1.126   1.00 0.00 ? 39  PHE A CG   6  
ATOM 8439  C CD1  . PHE A 1 39  ? 4.515   1.689   0.500   1.00 0.00 ? 39  PHE A CD1  6  
ATOM 8440  C CD2  . PHE A 1 39  ? 3.128   3.628   0.456   1.00 0.00 ? 39  PHE A CD2  6  
ATOM 8441  C CE1  . PHE A 1 39  ? 4.084   1.349   -0.768  1.00 0.00 ? 39  PHE A CE1  6  
ATOM 8442  C CE2  . PHE A 1 39  ? 2.693   3.293   -0.813  1.00 0.00 ? 39  PHE A CE2  6  
ATOM 8443  C CZ   . PHE A 1 39  ? 3.171   2.151   -1.425  1.00 0.00 ? 39  PHE A CZ   6  
ATOM 8444  H H    . PHE A 1 39  ? 7.489   2.841   2.547   1.00 0.00 ? 39  PHE A H    6  
ATOM 8445  H HA   . PHE A 1 39  ? 5.595   4.940   1.888   1.00 0.00 ? 39  PHE A HA   6  
ATOM 8446  H HB2  . PHE A 1 39  ? 4.718   2.284   3.039   1.00 0.00 ? 39  PHE A HB2  6  
ATOM 8447  H HB3  . PHE A 1 39  ? 3.712   3.729   2.999   1.00 0.00 ? 39  PHE A HB3  6  
ATOM 8448  H HD1  . PHE A 1 39  ? 5.228   1.060   1.013   1.00 0.00 ? 39  PHE A HD1  6  
ATOM 8449  H HD2  . PHE A 1 39  ? 2.753   4.522   0.934   1.00 0.00 ? 39  PHE A HD2  6  
ATOM 8450  H HE1  . PHE A 1 39  ? 4.459   0.455   -1.245  1.00 0.00 ? 39  PHE A HE1  6  
ATOM 8451  H HE2  . PHE A 1 39  ? 1.979   3.922   -1.323  1.00 0.00 ? 39  PHE A HE2  6  
ATOM 8452  H HZ   . PHE A 1 39  ? 2.834   1.887   -2.416  1.00 0.00 ? 39  PHE A HZ   6  
ATOM 8453  N N    . LYS A 1 40  ? 5.714   5.783   4.228   1.00 0.00 ? 40  LYS A N    6  
ATOM 8454  C CA   . LYS A 1 40  ? 5.948   6.350   5.550   1.00 0.00 ? 40  LYS A CA   6  
ATOM 8455  C C    . LYS A 1 40  ? 4.632   6.734   6.218   1.00 0.00 ? 40  LYS A C    6  
ATOM 8456  O O    . LYS A 1 40  ? 4.007   7.730   5.853   1.00 0.00 ? 40  LYS A O    6  
ATOM 8457  C CB   . LYS A 1 40  ? 6.857   7.576   5.448   1.00 0.00 ? 40  LYS A CB   6  
ATOM 8458  C CG   . LYS A 1 40  ? 7.265   8.145   6.796   1.00 0.00 ? 40  LYS A CG   6  
ATOM 8459  C CD   . LYS A 1 40  ? 8.456   9.081   6.670   1.00 0.00 ? 40  LYS A CD   6  
ATOM 8460  C CE   . LYS A 1 40  ? 9.049   9.415   8.030   1.00 0.00 ? 40  LYS A CE   6  
ATOM 8461  N NZ   . LYS A 1 40  ? 9.971   10.582  7.961   1.00 0.00 ? 40  LYS A NZ   6  
ATOM 8462  H H    . LYS A 1 40  ? 5.280   6.333   3.542   1.00 0.00 ? 40  LYS A H    6  
ATOM 8463  H HA   . LYS A 1 40  ? 6.437   5.599   6.152   1.00 0.00 ? 40  LYS A HA   6  
ATOM 8464  H HB2  . LYS A 1 40  ? 7.753   7.302   4.911   1.00 0.00 ? 40  LYS A HB2  6  
ATOM 8465  H HB3  . LYS A 1 40  ? 6.340   8.348   4.897   1.00 0.00 ? 40  LYS A HB3  6  
ATOM 8466  H HG2  . LYS A 1 40  ? 6.433   8.694   7.212   1.00 0.00 ? 40  LYS A HG2  6  
ATOM 8467  H HG3  . LYS A 1 40  ? 7.527   7.330   7.456   1.00 0.00 ? 40  LYS A HG3  6  
ATOM 8468  H HD2  . LYS A 1 40  ? 9.214   8.605   6.066   1.00 0.00 ? 40  LYS A HD2  6  
ATOM 8469  H HD3  . LYS A 1 40  ? 8.134   9.996   6.192   1.00 0.00 ? 40  LYS A HD3  6  
ATOM 8470  H HE2  . LYS A 1 40  ? 8.245   9.642   8.713   1.00 0.00 ? 40  LYS A HE2  6  
ATOM 8471  H HE3  . LYS A 1 40  ? 9.595   8.556   8.391   1.00 0.00 ? 40  LYS A HE3  6  
ATOM 8472  H HZ1  . LYS A 1 40  ? 9.468   11.413  7.587   1.00 0.00 ? 40  LYS A HZ1  6  
ATOM 8473  H HZ2  . LYS A 1 40  ? 10.774  10.367  7.337   1.00 0.00 ? 40  LYS A HZ2  6  
ATOM 8474  H HZ3  . LYS A 1 40  ? 10.333  10.808  8.910   1.00 0.00 ? 40  LYS A HZ3  6  
ATOM 8475  N N    . ILE A 1 41  ? 4.217   5.939   7.198   1.00 0.00 ? 41  ILE A N    6  
ATOM 8476  C CA   . ILE A 1 41  ? 2.976   6.198   7.918   1.00 0.00 ? 41  ILE A CA   6  
ATOM 8477  C C    . ILE A 1 41  ? 3.206   6.202   9.426   1.00 0.00 ? 41  ILE A C    6  
ATOM 8478  O O    . ILE A 1 41  ? 4.316   5.956   9.897   1.00 0.00 ? 41  ILE A O    6  
ATOM 8479  C CB   . ILE A 1 41  ? 1.898   5.152   7.577   1.00 0.00 ? 41  ILE A CB   6  
ATOM 8480  C CG1  . ILE A 1 41  ? 2.183   3.837   8.307   1.00 0.00 ? 41  ILE A CG1  6  
ATOM 8481  C CG2  . ILE A 1 41  ? 1.836   4.927   6.074   1.00 0.00 ? 41  ILE A CG2  6  
ATOM 8482  C CD1  . ILE A 1 41  ? 1.081   2.813   8.159   1.00 0.00 ? 41  ILE A CD1  6  
ATOM 8483  H H    . ILE A 1 41  ? 4.758   5.160   7.444   1.00 0.00 ? 41  ILE A H    6  
ATOM 8484  H HA   . ILE A 1 41  ? 2.613   7.170   7.617   1.00 0.00 ? 41  ILE A HA   6  
ATOM 8485  H HB   . ILE A 1 41  ? 0.942   5.534   7.900   1.00 0.00 ? 41  ILE A HB   6  
ATOM 8486  H HG12 . ILE A 1 41  ? 3.092   3.406   7.917   1.00 0.00 ? 41  ILE A HG12 6  
ATOM 8487  H HG13 . ILE A 1 41  ? 2.310   4.040   9.361   1.00 0.00 ? 41  ILE A HG13 6  
ATOM 8488  H HG21 . ILE A 1 41  ? 2.697   5.380   5.606   1.00 0.00 ? 41  ILE A HG21 6  
ATOM 8489  H HG22 . ILE A 1 41  ? 1.833   3.867   5.869   1.00 0.00 ? 41  ILE A HG22 6  
ATOM 8490  H HG23 . ILE A 1 41  ? 0.935   5.372   5.680   1.00 0.00 ? 41  ILE A HG23 6  
ATOM 8491  H HD11 . ILE A 1 41  ? 1.476   1.827   8.354   1.00 0.00 ? 41  ILE A HD11 6  
ATOM 8492  H HD12 . ILE A 1 41  ? 0.290   3.030   8.860   1.00 0.00 ? 41  ILE A HD12 6  
ATOM 8493  H HD13 . ILE A 1 41  ? 0.689   2.849   7.152   1.00 0.00 ? 41  ILE A HD13 6  
ATOM 8494  N N    . LYS A 1 42  ? 2.147   6.481   10.179  1.00 0.00 ? 42  LYS A N    6  
ATOM 8495  C CA   . LYS A 1 42  ? 2.231   6.515   11.634  1.00 0.00 ? 42  LYS A CA   6  
ATOM 8496  C C    . LYS A 1 42  ? 1.969   5.134   12.226  1.00 0.00 ? 42  LYS A C    6  
ATOM 8497  O O    . LYS A 1 42  ? 1.390   4.267   11.571  1.00 0.00 ? 42  LYS A O    6  
ATOM 8498  C CB   . LYS A 1 42  ? 1.227   7.522   12.200  1.00 0.00 ? 42  LYS A CB   6  
ATOM 8499  C CG   . LYS A 1 42  ? 1.287   8.883   11.529  1.00 0.00 ? 42  LYS A CG   6  
ATOM 8500  C CD   . LYS A 1 42  ? 0.062   9.720   11.854  1.00 0.00 ? 42  LYS A CD   6  
ATOM 8501  C CE   . LYS A 1 42  ? -0.083  10.893  10.897  1.00 0.00 ? 42  LYS A CE   6  
ATOM 8502  N NZ   . LYS A 1 42  ? -0.297  10.441  9.494   1.00 0.00 ? 42  LYS A NZ   6  
ATOM 8503  H H    . LYS A 1 42  ? 1.288   6.669   9.745   1.00 0.00 ? 42  LYS A H    6  
ATOM 8504  H HA   . LYS A 1 42  ? 3.229   6.825   11.902  1.00 0.00 ? 42  LYS A HA   6  
ATOM 8505  H HB2  . LYS A 1 42  ? 0.230   7.127   12.077  1.00 0.00 ? 42  LYS A HB2  6  
ATOM 8506  H HB3  . LYS A 1 42  ? 1.424   7.655   13.254  1.00 0.00 ? 42  LYS A HB3  6  
ATOM 8507  H HG2  . LYS A 1 42  ? 2.168   9.406   11.873  1.00 0.00 ? 42  LYS A HG2  6  
ATOM 8508  H HG3  . LYS A 1 42  ? 1.343   8.744   10.459  1.00 0.00 ? 42  LYS A HG3  6  
ATOM 8509  H HD2  . LYS A 1 42  ? -0.818  9.099   11.779  1.00 0.00 ? 42  LYS A HD2  6  
ATOM 8510  H HD3  . LYS A 1 42  ? 0.152   10.099  12.863  1.00 0.00 ? 42  LYS A HD3  6  
ATOM 8511  H HE2  . LYS A 1 42  ? -0.926  11.491  11.206  1.00 0.00 ? 42  LYS A HE2  6  
ATOM 8512  H HE3  . LYS A 1 42  ? 0.817   11.489  10.940  1.00 0.00 ? 42  LYS A HE3  6  
ATOM 8513  H HZ1  . LYS A 1 42  ? 0.600   10.471  8.968   1.00 0.00 ? 42  LYS A HZ1  6  
ATOM 8514  H HZ2  . LYS A 1 42  ? -0.985  11.060  9.020   1.00 0.00 ? 42  LYS A HZ2  6  
ATOM 8515  H HZ3  . LYS A 1 42  ? -0.660  9.466   9.484   1.00 0.00 ? 42  LYS A HZ3  6  
ATOM 8516  N N    . ARG A 1 43  ? 2.399   4.936   13.468  1.00 0.00 ? 43  ARG A N    6  
ATOM 8517  C CA   . ARG A 1 43  ? 2.211   3.660   14.148  1.00 0.00 ? 43  ARG A CA   6  
ATOM 8518  C C    . ARG A 1 43  ? 0.733   3.410   14.435  1.00 0.00 ? 43  ARG A C    6  
ATOM 8519  O O    . ARG A 1 43  ? 0.254   2.279   14.340  1.00 0.00 ? 43  ARG A O    6  
ATOM 8520  C CB   . ARG A 1 43  ? 3.007   3.631   15.453  1.00 0.00 ? 43  ARG A CB   6  
ATOM 8521  C CG   . ARG A 1 43  ? 2.668   4.771   16.400  1.00 0.00 ? 43  ARG A CG   6  
ATOM 8522  C CD   . ARG A 1 43  ? 3.742   4.953   17.460  1.00 0.00 ? 43  ARG A CD   6  
ATOM 8523  N NE   . ARG A 1 43  ? 3.614   6.232   18.155  1.00 0.00 ? 43  ARG A NE   6  
ATOM 8524  C CZ   . ARG A 1 43  ? 4.273   6.532   19.268  1.00 0.00 ? 43  ARG A CZ   6  
ATOM 8525  N NH1  . ARG A 1 43  ? 5.102   5.651   19.810  1.00 0.00 ? 43  ARG A NH1  6  
ATOM 8526  N NH2  . ARG A 1 43  ? 4.103   7.717   19.842  1.00 0.00 ? 43  ARG A NH2  6  
ATOM 8527  H H    . ARG A 1 43  ? 2.854   5.665   13.939  1.00 0.00 ? 43  ARG A H    6  
ATOM 8528  H HA   . ARG A 1 43  ? 2.576   2.880   13.496  1.00 0.00 ? 43  ARG A HA   6  
ATOM 8529  H HB2  . ARG A 1 43  ? 2.809   2.699   15.962  1.00 0.00 ? 43  ARG A HB2  6  
ATOM 8530  H HB3  . ARG A 1 43  ? 4.060   3.687   15.220  1.00 0.00 ? 43  ARG A HB3  6  
ATOM 8531  H HG2  . ARG A 1 43  ? 2.580   5.685   15.831  1.00 0.00 ? 43  ARG A HG2  6  
ATOM 8532  H HG3  . ARG A 1 43  ? 1.728   4.555   16.885  1.00 0.00 ? 43  ARG A HG3  6  
ATOM 8533  H HD2  . ARG A 1 43  ? 3.658   4.153   18.180  1.00 0.00 ? 43  ARG A HD2  6  
ATOM 8534  H HD3  . ARG A 1 43  ? 4.710   4.909   16.984  1.00 0.00 ? 43  ARG A HD3  6  
ATOM 8535  H HE   . ARG A 1 43  ? 3.006   6.897   17.772  1.00 0.00 ? 43  ARG A HE   6  
ATOM 8536  H HH11 . ARG A 1 43  ? 5.233   4.758   19.379  1.00 0.00 ? 43  ARG A HH11 6  
ATOM 8537  H HH12 . ARG A 1 43  ? 5.598   5.881   20.648  1.00 0.00 ? 43  ARG A HH12 6  
ATOM 8538  H HH21 . ARG A 1 43  ? 3.478   8.383   19.436  1.00 0.00 ? 43  ARG A HH21 6  
ATOM 8539  H HH22 . ARG A 1 43  ? 4.599   7.942   20.680  1.00 0.00 ? 43  ARG A HH22 6  
ATOM 8540  N N    . HIS A 1 44  ? 0.016   4.472   14.788  1.00 0.00 ? 44  HIS A N    6  
ATOM 8541  C CA   . HIS A 1 44  ? -1.407  4.368   15.089  1.00 0.00 ? 44  HIS A CA   6  
ATOM 8542  C C    . HIS A 1 44  ? -2.239  4.431   13.812  1.00 0.00 ? 44  HIS A C    6  
ATOM 8543  O O    . HIS A 1 44  ? -3.452  4.219   13.837  1.00 0.00 ? 44  HIS A O    6  
ATOM 8544  C CB   . HIS A 1 44  ? -1.831  5.485   16.043  1.00 0.00 ? 44  HIS A CB   6  
ATOM 8545  C CG   . HIS A 1 44  ? -2.215  6.754   15.346  1.00 0.00 ? 44  HIS A CG   6  
ATOM 8546  N ND1  . HIS A 1 44  ? -3.511  7.048   14.978  1.00 0.00 ? 44  HIS A ND1  6  
ATOM 8547  C CD2  . HIS A 1 44  ? -1.465  7.809   14.952  1.00 0.00 ? 44  HIS A CD2  6  
ATOM 8548  C CE1  . HIS A 1 44  ? -3.541  8.229   14.386  1.00 0.00 ? 44  HIS A CE1  6  
ATOM 8549  N NE2  . HIS A 1 44  ? -2.312  8.712   14.358  1.00 0.00 ? 44  HIS A NE2  6  
ATOM 8550  H H    . HIS A 1 44  ? 0.454   5.346   14.846  1.00 0.00 ? 44  HIS A H    6  
ATOM 8551  H HA   . HIS A 1 44  ? -1.576  3.415   15.567  1.00 0.00 ? 44  HIS A HA   6  
ATOM 8552  H HB2  . HIS A 1 44  ? -2.682  5.154   16.620  1.00 0.00 ? 44  HIS A HB2  6  
ATOM 8553  H HB3  . HIS A 1 44  ? -1.013  5.708   16.713  1.00 0.00 ? 44  HIS A HB3  6  
ATOM 8554  H HD1  . HIS A 1 44  ? -4.292  6.476   15.127  1.00 0.00 ? 44  HIS A HD1  6  
ATOM 8555  H HD2  . HIS A 1 44  ? -0.397  7.921   15.080  1.00 0.00 ? 44  HIS A HD2  6  
ATOM 8556  H HE1  . HIS A 1 44  ? -4.420  8.717   13.992  1.00 0.00 ? 44  HIS A HE1  6  
ATOM 8557  H HE2  . HIS A 1 44  ? -2.039  9.534   13.899  1.00 0.00 ? 44  HIS A HE2  6  
ATOM 8558  N N    . THR A 1 45  ? -1.580  4.723   12.695  1.00 0.00 ? 45  THR A N    6  
ATOM 8559  C CA   . THR A 1 45  ? -2.258  4.816   11.409  1.00 0.00 ? 45  THR A CA   6  
ATOM 8560  C C    . THR A 1 45  ? -2.416  3.441   10.770  1.00 0.00 ? 45  THR A C    6  
ATOM 8561  O O    . THR A 1 45  ? -1.465  2.665   10.667  1.00 0.00 ? 45  THR A O    6  
ATOM 8562  C CB   . THR A 1 45  ? -1.496  5.736   10.437  1.00 0.00 ? 45  THR A CB   6  
ATOM 8563  O OG1  . THR A 1 45  ? -1.649  7.103   10.834  1.00 0.00 ? 45  THR A OG1  6  
ATOM 8564  C CG2  . THR A 1 45  ? -2.001  5.557   9.013   1.00 0.00 ? 45  THR A CG2  6  
ATOM 8565  H H    . THR A 1 45  ? -0.613  4.882   12.740  1.00 0.00 ? 45  THR A H    6  
ATOM 8566  H HA   . THR A 1 45  ? -3.238  5.238   11.578  1.00 0.00 ? 45  THR A HA   6  
ATOM 8567  H HB   . THR A 1 45  ? -0.447  5.476   10.466  1.00 0.00 ? 45  THR A HB   6  
ATOM 8568  H HG1  . THR A 1 45  ? -0.960  7.635   10.427  1.00 0.00 ? 45  THR A HG1  6  
ATOM 8569  H HG21 . THR A 1 45  ? -2.883  4.934   9.020   1.00 0.00 ? 45  THR A HG21 6  
ATOM 8570  H HG22 . THR A 1 45  ? -1.234  5.090   8.415   1.00 0.00 ? 45  THR A HG22 6  
ATOM 8571  H HG23 . THR A 1 45  ? -2.246  6.522   8.595   1.00 0.00 ? 45  THR A HG23 6  
ATOM 8572  N N    . PRO A 1 46  ? -3.644  3.129   10.330  1.00 0.00 ? 46  PRO A N    6  
ATOM 8573  C CA   . PRO A 1 46  ? -3.954  1.846   9.692   1.00 0.00 ? 46  PRO A CA   6  
ATOM 8574  C C    . PRO A 1 46  ? -3.320  1.717   8.312   1.00 0.00 ? 46  PRO A C    6  
ATOM 8575  O O    . PRO A 1 46  ? -3.325  2.663   7.524   1.00 0.00 ? 46  PRO A O    6  
ATOM 8576  C CB   . PRO A 1 46  ? -5.481  1.866   9.580   1.00 0.00 ? 46  PRO A CB   6  
ATOM 8577  C CG   . PRO A 1 46  ? -5.840  3.312   9.556   1.00 0.00 ? 46  PRO A CG   6  
ATOM 8578  C CD   . PRO A 1 46  ? -4.824  4.005   10.421  1.00 0.00 ? 46  PRO A CD   6  
ATOM 8579  H HA   . PRO A 1 46  ? -3.648  1.013   10.308  1.00 0.00 ? 46  PRO A HA   6  
ATOM 8580  H HB2  . PRO A 1 46  ? -5.784  1.368   8.670   1.00 0.00 ? 46  PRO A HB2  6  
ATOM 8581  H HB3  . PRO A 1 46  ? -5.915  1.366   10.432  1.00 0.00 ? 46  PRO A HB3  6  
ATOM 8582  H HG2  . PRO A 1 46  ? -5.790  3.686   8.545   1.00 0.00 ? 46  PRO A HG2  6  
ATOM 8583  H HG3  . PRO A 1 46  ? -6.832  3.450   9.960   1.00 0.00 ? 46  PRO A HG3  6  
ATOM 8584  H HD2  . PRO A 1 46  ? -4.605  4.989   10.031  1.00 0.00 ? 46  PRO A HD2  6  
ATOM 8585  H HD3  . PRO A 1 46  ? -5.177  4.071   11.439  1.00 0.00 ? 46  PRO A HD3  6  
ATOM 8586  N N    . LEU A 1 47  ? -2.775  0.540   8.024   1.00 0.00 ? 47  LEU A N    6  
ATOM 8587  C CA   . LEU A 1 47  ? -2.137  0.286   6.737   1.00 0.00 ? 47  LEU A CA   6  
ATOM 8588  C C    . LEU A 1 47  ? -3.062  0.668   5.586   1.00 0.00 ? 47  LEU A C    6  
ATOM 8589  O O    . LEU A 1 47  ? -2.610  0.905   4.466   1.00 0.00 ? 47  LEU A O    6  
ATOM 8590  C CB   . LEU A 1 47  ? -1.744  -1.188  6.623   1.00 0.00 ? 47  LEU A CB   6  
ATOM 8591  C CG   . LEU A 1 47  ? -0.795  -1.715  7.700   1.00 0.00 ? 47  LEU A CG   6  
ATOM 8592  C CD1  . LEU A 1 47  ? -0.650  -3.225  7.591   1.00 0.00 ? 47  LEU A CD1  6  
ATOM 8593  C CD2  . LEU A 1 47  ? 0.564   -1.038  7.592   1.00 0.00 ? 47  LEU A CD2  6  
ATOM 8594  H H    . LEU A 1 47  ? -2.802  -0.176  8.692   1.00 0.00 ? 47  LEU A H    6  
ATOM 8595  H HA   . LEU A 1 47  ? -1.246  0.893   6.684   1.00 0.00 ? 47  LEU A HA   6  
ATOM 8596  H HB2  . LEU A 1 47  ? -2.648  -1.775  6.662   1.00 0.00 ? 47  LEU A HB2  6  
ATOM 8597  H HB3  . LEU A 1 47  ? -1.267  -1.328  5.663   1.00 0.00 ? 47  LEU A HB3  6  
ATOM 8598  H HG   . LEU A 1 47  ? -1.206  -1.489  8.674   1.00 0.00 ? 47  LEU A HG   6  
ATOM 8599  H HD11 . LEU A 1 47  ? -1.611  -3.691  7.748   1.00 0.00 ? 47  LEU A HD11 6  
ATOM 8600  H HD12 . LEU A 1 47  ? 0.046   -3.575  8.339   1.00 0.00 ? 47  LEU A HD12 6  
ATOM 8601  H HD13 . LEU A 1 47  ? -0.281  -3.481  6.608   1.00 0.00 ? 47  LEU A HD13 6  
ATOM 8602  H HD21 . LEU A 1 47  ? 1.268   -1.716  7.133   1.00 0.00 ? 47  LEU A HD21 6  
ATOM 8603  H HD22 . LEU A 1 47  ? 0.912   -0.771  8.579   1.00 0.00 ? 47  LEU A HD22 6  
ATOM 8604  H HD23 . LEU A 1 47  ? 0.475   -0.148  6.988   1.00 0.00 ? 47  LEU A HD23 6  
ATOM 8605  N N    . SER A 1 48  ? -4.359  0.728   5.871   1.00 0.00 ? 48  SER A N    6  
ATOM 8606  C CA   . SER A 1 48  ? -5.348  1.080   4.859   1.00 0.00 ? 48  SER A CA   6  
ATOM 8607  C C    . SER A 1 48  ? -4.786  2.112   3.885   1.00 0.00 ? 48  SER A C    6  
ATOM 8608  O O    . SER A 1 48  ? -4.662  1.851   2.688   1.00 0.00 ? 48  SER A O    6  
ATOM 8609  C CB   . SER A 1 48  ? -6.615  1.625   5.521   1.00 0.00 ? 48  SER A CB   6  
ATOM 8610  O OG   . SER A 1 48  ? -7.687  1.686   4.597   1.00 0.00 ? 48  SER A OG   6  
ATOM 8611  H H    . SER A 1 48  ? -4.658  0.528   6.783   1.00 0.00 ? 48  SER A H    6  
ATOM 8612  H HA   . SER A 1 48  ? -5.596  0.183   4.311   1.00 0.00 ? 48  SER A HA   6  
ATOM 8613  H HB2  . SER A 1 48  ? -6.896  0.979   6.339   1.00 0.00 ? 48  SER A HB2  6  
ATOM 8614  H HB3  . SER A 1 48  ? -6.422  2.619   5.897   1.00 0.00 ? 48  SER A HB3  6  
ATOM 8615  H HG   . SER A 1 48  ? -7.782  2.586   4.275   1.00 0.00 ? 48  SER A HG   6  
ATOM 8616  N N    . LYS A 1 49  ? -4.446  3.285   4.408   1.00 0.00 ? 49  LYS A N    6  
ATOM 8617  C CA   . LYS A 1 49  ? -3.896  4.358   3.588   1.00 0.00 ? 49  LYS A CA   6  
ATOM 8618  C C    . LYS A 1 49  ? -2.696  3.867   2.784   1.00 0.00 ? 49  LYS A C    6  
ATOM 8619  O O    . LYS A 1 49  ? -2.580  4.144   1.589   1.00 0.00 ? 49  LYS A O    6  
ATOM 8620  C CB   . LYS A 1 49  ? -3.484  5.541   4.467   1.00 0.00 ? 49  LYS A CB   6  
ATOM 8621  C CG   . LYS A 1 49  ? -4.590  6.028   5.387   1.00 0.00 ? 49  LYS A CG   6  
ATOM 8622  C CD   . LYS A 1 49  ? -5.433  7.104   4.725   1.00 0.00 ? 49  LYS A CD   6  
ATOM 8623  C CE   . LYS A 1 49  ? -6.731  7.342   5.483   1.00 0.00 ? 49  LYS A CE   6  
ATOM 8624  N NZ   . LYS A 1 49  ? -7.554  6.105   5.574   1.00 0.00 ? 49  LYS A NZ   6  
ATOM 8625  H H    . LYS A 1 49  ? -4.568  3.434   5.369   1.00 0.00 ? 49  LYS A H    6  
ATOM 8626  H HA   . LYS A 1 49  ? -4.665  4.680   2.902   1.00 0.00 ? 49  LYS A HA   6  
ATOM 8627  H HB2  . LYS A 1 49  ? -2.642  5.246   5.076   1.00 0.00 ? 49  LYS A HB2  6  
ATOM 8628  H HB3  . LYS A 1 49  ? -3.187  6.361   3.830   1.00 0.00 ? 49  LYS A HB3  6  
ATOM 8629  H HG2  . LYS A 1 49  ? -5.227  5.194   5.643   1.00 0.00 ? 49  LYS A HG2  6  
ATOM 8630  H HG3  . LYS A 1 49  ? -4.147  6.433   6.286   1.00 0.00 ? 49  LYS A HG3  6  
ATOM 8631  H HD2  . LYS A 1 49  ? -4.871  8.026   4.700   1.00 0.00 ? 49  LYS A HD2  6  
ATOM 8632  H HD3  . LYS A 1 49  ? -5.667  6.796   3.716   1.00 0.00 ? 49  LYS A HD3  6  
ATOM 8633  H HE2  . LYS A 1 49  ? -6.493  7.680   6.479   1.00 0.00 ? 49  LYS A HE2  6  
ATOM 8634  H HE3  . LYS A 1 49  ? -7.297  8.105   4.969   1.00 0.00 ? 49  LYS A HE3  6  
ATOM 8635  H HZ1  . LYS A 1 49  ? -7.296  5.566   6.425   1.00 0.00 ? 49  LYS A HZ1  6  
ATOM 8636  H HZ2  . LYS A 1 49  ? -7.395  5.507   4.738   1.00 0.00 ? 49  LYS A HZ2  6  
ATOM 8637  H HZ3  . LYS A 1 49  ? -8.563  6.350   5.624   1.00 0.00 ? 49  LYS A HZ3  6  
ATOM 8638  N N    . LEU A 1 50  ? -1.805  3.137   3.446   1.00 0.00 ? 50  LEU A N    6  
ATOM 8639  C CA   . LEU A 1 50  ? -0.614  2.605   2.792   1.00 0.00 ? 50  LEU A CA   6  
ATOM 8640  C C    . LEU A 1 50  ? -0.990  1.734   1.598   1.00 0.00 ? 50  LEU A C    6  
ATOM 8641  O O    . LEU A 1 50  ? -0.629  2.034   0.461   1.00 0.00 ? 50  LEU A O    6  
ATOM 8642  C CB   . LEU A 1 50  ? 0.219   1.794   3.787   1.00 0.00 ? 50  LEU A CB   6  
ATOM 8643  C CG   . LEU A 1 50  ? 1.057   0.662   3.194   1.00 0.00 ? 50  LEU A CG   6  
ATOM 8644  C CD1  . LEU A 1 50  ? 1.919   1.177   2.052   1.00 0.00 ? 50  LEU A CD1  6  
ATOM 8645  C CD2  . LEU A 1 50  ? 1.922   0.019   4.269   1.00 0.00 ? 50  LEU A CD2  6  
ATOM 8646  H H    . LEU A 1 50  ? -1.951  2.949   4.396   1.00 0.00 ? 50  LEU A H    6  
ATOM 8647  H HA   . LEU A 1 50  ? -0.027  3.442   2.442   1.00 0.00 ? 50  LEU A HA   6  
ATOM 8648  H HB2  . LEU A 1 50  ? 0.890   2.475   4.288   1.00 0.00 ? 50  LEU A HB2  6  
ATOM 8649  H HB3  . LEU A 1 50  ? -0.459  1.362   4.510   1.00 0.00 ? 50  LEU A HB3  6  
ATOM 8650  H HG   . LEU A 1 50  ? 0.397   -0.097  2.797   1.00 0.00 ? 50  LEU A HG   6  
ATOM 8651  H HD11 . LEU A 1 50  ? 1.900   2.257   2.045   1.00 0.00 ? 50  LEU A HD11 6  
ATOM 8652  H HD12 . LEU A 1 50  ? 1.534   0.805   1.114   1.00 0.00 ? 50  LEU A HD12 6  
ATOM 8653  H HD13 . LEU A 1 50  ? 2.935   0.835   2.185   1.00 0.00 ? 50  LEU A HD13 6  
ATOM 8654  H HD21 . LEU A 1 50  ? 1.594   0.355   5.242   1.00 0.00 ? 50  LEU A HD21 6  
ATOM 8655  H HD22 . LEU A 1 50  ? 2.954   0.304   4.119   1.00 0.00 ? 50  LEU A HD22 6  
ATOM 8656  H HD23 . LEU A 1 50  ? 1.832   -1.055  4.208   1.00 0.00 ? 50  LEU A HD23 6  
ATOM 8657  N N    . MET A 1 51  ? -1.721  0.657   1.865   1.00 0.00 ? 51  MET A N    6  
ATOM 8658  C CA   . MET A 1 51  ? -2.149  -0.256  0.812   1.00 0.00 ? 51  MET A CA   6  
ATOM 8659  C C    . MET A 1 51  ? -2.779  0.510   -0.348  1.00 0.00 ? 51  MET A C    6  
ATOM 8660  O O    . MET A 1 51  ? -2.220  0.567   -1.443  1.00 0.00 ? 51  MET A O    6  
ATOM 8661  C CB   . MET A 1 51  ? -3.146  -1.276  1.365   1.00 0.00 ? 51  MET A CB   6  
ATOM 8662  C CG   . MET A 1 51  ? -2.625  -2.043  2.569   1.00 0.00 ? 51  MET A CG   6  
ATOM 8663  S SD   . MET A 1 51  ? -3.941  -2.557  3.689   1.00 0.00 ? 51  MET A SD   6  
ATOM 8664  C CE   . MET A 1 51  ? -3.338  -4.162  4.207   1.00 0.00 ? 51  MET A CE   6  
ATOM 8665  H H    . MET A 1 51  ? -1.978  0.470   2.792   1.00 0.00 ? 51  MET A H    6  
ATOM 8666  H HA   . MET A 1 51  ? -1.276  -0.778  0.451   1.00 0.00 ? 51  MET A HA   6  
ATOM 8667  H HB2  . MET A 1 51  ? -4.047  -0.759  1.658   1.00 0.00 ? 51  MET A HB2  6  
ATOM 8668  H HB3  . MET A 1 51  ? -3.384  -1.987  0.588   1.00 0.00 ? 51  MET A HB3  6  
ATOM 8669  H HG2  . MET A 1 51  ? -2.104  -2.923  2.222   1.00 0.00 ? 51  MET A HG2  6  
ATOM 8670  H HG3  . MET A 1 51  ? -1.936  -1.411  3.111   1.00 0.00 ? 51  MET A HG3  6  
ATOM 8671  H HE1  . MET A 1 51  ? -3.022  -4.725  3.341   1.00 0.00 ? 51  MET A HE1  6  
ATOM 8672  H HE2  . MET A 1 51  ? -2.502  -4.032  4.878   1.00 0.00 ? 51  MET A HE2  6  
ATOM 8673  H HE3  . MET A 1 51  ? -4.128  -4.696  4.715   1.00 0.00 ? 51  MET A HE3  6  
ATOM 8674  N N    . LYS A 1 52  ? -3.945  1.097   -0.100  1.00 0.00 ? 52  LYS A N    6  
ATOM 8675  C CA   . LYS A 1 52  ? -4.651  1.860   -1.122  1.00 0.00 ? 52  LYS A CA   6  
ATOM 8676  C C    . LYS A 1 52  ? -3.671  2.649   -1.985  1.00 0.00 ? 52  LYS A C    6  
ATOM 8677  O O    . LYS A 1 52  ? -3.692  2.551   -3.212  1.00 0.00 ? 52  LYS A O    6  
ATOM 8678  C CB   . LYS A 1 52  ? -5.656  2.813   -0.473  1.00 0.00 ? 52  LYS A CB   6  
ATOM 8679  C CG   . LYS A 1 52  ? -6.736  2.105   0.327   1.00 0.00 ? 52  LYS A CG   6  
ATOM 8680  C CD   . LYS A 1 52  ? -8.038  2.889   0.323   1.00 0.00 ? 52  LYS A CD   6  
ATOM 8681  C CE   . LYS A 1 52  ? -8.928  2.484   -0.842  1.00 0.00 ? 52  LYS A CE   6  
ATOM 8682  N NZ   . LYS A 1 52  ? -8.608  3.251   -2.078  1.00 0.00 ? 52  LYS A NZ   6  
ATOM 8683  H H    . LYS A 1 52  ? -4.340  1.015   0.794   1.00 0.00 ? 52  LYS A H    6  
ATOM 8684  H HA   . LYS A 1 52  ? -5.183  1.161   -1.750  1.00 0.00 ? 52  LYS A HA   6  
ATOM 8685  H HB2  . LYS A 1 52  ? -5.126  3.481   0.190   1.00 0.00 ? 52  LYS A HB2  6  
ATOM 8686  H HB3  . LYS A 1 52  ? -6.135  3.395   -1.248  1.00 0.00 ? 52  LYS A HB3  6  
ATOM 8687  H HG2  . LYS A 1 52  ? -6.913  1.132   -0.106  1.00 0.00 ? 52  LYS A HG2  6  
ATOM 8688  H HG3  . LYS A 1 52  ? -6.399  1.991   1.348   1.00 0.00 ? 52  LYS A HG3  6  
ATOM 8689  H HD2  . LYS A 1 52  ? -8.565  2.700   1.246   1.00 0.00 ? 52  LYS A HD2  6  
ATOM 8690  H HD3  . LYS A 1 52  ? -7.813  3.943   0.243   1.00 0.00 ? 52  LYS A HD3  6  
ATOM 8691  H HE2  . LYS A 1 52  ? -8.788  1.431   -1.037  1.00 0.00 ? 52  LYS A HE2  6  
ATOM 8692  H HE3  . LYS A 1 52  ? -9.958  2.666   -0.572  1.00 0.00 ? 52  LYS A HE3  6  
ATOM 8693  H HZ1  . LYS A 1 52  ? -8.452  4.253   -1.845  1.00 0.00 ? 52  LYS A HZ1  6  
ATOM 8694  H HZ2  . LYS A 1 52  ? -9.395  3.183   -2.755  1.00 0.00 ? 52  LYS A HZ2  6  
ATOM 8695  H HZ3  . LYS A 1 52  ? -7.748  2.872   -2.522  1.00 0.00 ? 52  LYS A HZ3  6  
ATOM 8696  N N    . ALA A 1 53  ? -2.813  3.429   -1.336  1.00 0.00 ? 53  ALA A N    6  
ATOM 8697  C CA   . ALA A 1 53  ? -1.823  4.231   -2.045  1.00 0.00 ? 53  ALA A CA   6  
ATOM 8698  C C    . ALA A 1 53  ? -0.999  3.371   -2.997  1.00 0.00 ? 53  ALA A C    6  
ATOM 8699  O O    . ALA A 1 53  ? -0.769  3.746   -4.147  1.00 0.00 ? 53  ALA A O    6  
ATOM 8700  C CB   . ALA A 1 53  ? -0.915  4.944   -1.054  1.00 0.00 ? 53  ALA A CB   6  
ATOM 8701  H H    . ALA A 1 53  ? -2.845  3.464   -0.358  1.00 0.00 ? 53  ALA A H    6  
ATOM 8702  H HA   . ALA A 1 53  ? -2.350  4.981   -2.618  1.00 0.00 ? 53  ALA A HA   6  
ATOM 8703  H HB1  . ALA A 1 53  ? 0.105   4.622   -1.206  1.00 0.00 ? 53  ALA A HB1  6  
ATOM 8704  H HB2  . ALA A 1 53  ? -0.983  6.011   -1.208  1.00 0.00 ? 53  ALA A HB2  6  
ATOM 8705  H HB3  . ALA A 1 53  ? -1.222  4.704   -0.047  1.00 0.00 ? 53  ALA A HB3  6  
ATOM 8706  N N    . TYR A 1 54  ? -0.556  2.217   -2.511  1.00 0.00 ? 54  TYR A N    6  
ATOM 8707  C CA   . TYR A 1 54  ? 0.246   1.305   -3.318  1.00 0.00 ? 54  TYR A CA   6  
ATOM 8708  C C    . TYR A 1 54  ? -0.459  0.975   -4.630  1.00 0.00 ? 54  TYR A C    6  
ATOM 8709  O O    . TYR A 1 54  ? 0.186   0.707   -5.644  1.00 0.00 ? 54  TYR A O    6  
ATOM 8710  C CB   . TYR A 1 54  ? 0.531   0.018   -2.541  1.00 0.00 ? 54  TYR A CB   6  
ATOM 8711  C CG   . TYR A 1 54  ? 1.379   -0.974  -3.303  1.00 0.00 ? 54  TYR A CG   6  
ATOM 8712  C CD1  . TYR A 1 54  ? 2.763   -0.853  -3.337  1.00 0.00 ? 54  TYR A CD1  6  
ATOM 8713  C CD2  . TYR A 1 54  ? 0.797   -2.034  -3.988  1.00 0.00 ? 54  TYR A CD2  6  
ATOM 8714  C CE1  . TYR A 1 54  ? 3.542   -1.757  -4.032  1.00 0.00 ? 54  TYR A CE1  6  
ATOM 8715  C CE2  . TYR A 1 54  ? 1.569   -2.943  -4.685  1.00 0.00 ? 54  TYR A CE2  6  
ATOM 8716  C CZ   . TYR A 1 54  ? 2.941   -2.801  -4.704  1.00 0.00 ? 54  TYR A CZ   6  
ATOM 8717  O OH   . TYR A 1 54  ? 3.713   -3.704  -5.397  1.00 0.00 ? 54  TYR A OH   6  
ATOM 8718  H H    . TYR A 1 54  ? -0.771  1.973   -1.586  1.00 0.00 ? 54  TYR A H    6  
ATOM 8719  H HA   . TYR A 1 54  ? 1.183   1.795   -3.539  1.00 0.00 ? 54  TYR A HA   6  
ATOM 8720  H HB2  . TYR A 1 54  ? 1.049   0.265   -1.627  1.00 0.00 ? 54  TYR A HB2  6  
ATOM 8721  H HB3  . TYR A 1 54  ? -0.406  -0.462  -2.299  1.00 0.00 ? 54  TYR A HB3  6  
ATOM 8722  H HD1  . TYR A 1 54  ? 3.231   -0.035  -2.808  1.00 0.00 ? 54  TYR A HD1  6  
ATOM 8723  H HD2  . TYR A 1 54  ? -0.277  -2.143  -3.971  1.00 0.00 ? 54  TYR A HD2  6  
ATOM 8724  H HE1  . TYR A 1 54  ? 4.616   -1.646  -4.047  1.00 0.00 ? 54  TYR A HE1  6  
ATOM 8725  H HE2  . TYR A 1 54  ? 1.098   -3.760  -5.212  1.00 0.00 ? 54  TYR A HE2  6  
ATOM 8726  H HH   . TYR A 1 54  ? 3.431   -4.597  -5.184  1.00 0.00 ? 54  TYR A HH   6  
ATOM 8727  N N    . CYS A 1 55  ? -1.787  0.997   -4.601  1.00 0.00 ? 55  CYS A N    6  
ATOM 8728  C CA   . CYS A 1 55  ? -2.582  0.700   -5.788  1.00 0.00 ? 55  CYS A CA   6  
ATOM 8729  C C    . CYS A 1 55  ? -2.607  1.893   -6.738  1.00 0.00 ? 55  CYS A C    6  
ATOM 8730  O O    . CYS A 1 55  ? -2.184  1.791   -7.889  1.00 0.00 ? 55  CYS A O    6  
ATOM 8731  C CB   . CYS A 1 55  ? -4.008  0.319   -5.389  1.00 0.00 ? 55  CYS A CB   6  
ATOM 8732  S SG   . CYS A 1 55  ? -4.104  -0.811  -3.981  1.00 0.00 ? 55  CYS A SG   6  
ATOM 8733  H H    . CYS A 1 55  ? -2.244  1.217   -3.763  1.00 0.00 ? 55  CYS A H    6  
ATOM 8734  H HA   . CYS A 1 55  ? -2.123  -0.137  -6.293  1.00 0.00 ? 55  CYS A HA   6  
ATOM 8735  H HB2  . CYS A 1 55  ? -4.552  1.215   -5.128  1.00 0.00 ? 55  CYS A HB2  6  
ATOM 8736  H HB3  . CYS A 1 55  ? -4.493  -0.157  -6.228  1.00 0.00 ? 55  CYS A HB3  6  
ATOM 8737  H HG   . CYS A 1 55  ? -3.075  -0.562  -3.186  1.00 0.00 ? 55  CYS A HG   6  
ATOM 8738  N N    . GLU A 1 56  ? -3.108  3.022   -6.247  1.00 0.00 ? 56  GLU A N    6  
ATOM 8739  C CA   . GLU A 1 56  ? -3.191  4.234   -7.054  1.00 0.00 ? 56  GLU A CA   6  
ATOM 8740  C C    . GLU A 1 56  ? -1.831  4.586   -7.650  1.00 0.00 ? 56  GLU A C    6  
ATOM 8741  O O    . GLU A 1 56  ? -1.734  4.984   -8.810  1.00 0.00 ? 56  GLU A O    6  
ATOM 8742  C CB   . GLU A 1 56  ? -3.708  5.401   -6.210  1.00 0.00 ? 56  GLU A CB   6  
ATOM 8743  C CG   . GLU A 1 56  ? -2.620  6.112   -5.423  1.00 0.00 ? 56  GLU A CG   6  
ATOM 8744  C CD   . GLU A 1 56  ? -3.154  7.270   -4.604  1.00 0.00 ? 56  GLU A CD   6  
ATOM 8745  O OE1  . GLU A 1 56  ? -3.941  7.021   -3.667  1.00 0.00 ? 56  GLU A OE1  6  
ATOM 8746  O OE2  . GLU A 1 56  ? -2.785  8.426   -4.900  1.00 0.00 ? 56  GLU A OE2  6  
ATOM 8747  H H    . GLU A 1 56  ? -3.430  3.041   -5.322  1.00 0.00 ? 56  GLU A H    6  
ATOM 8748  H HA   . GLU A 1 56  ? -3.886  4.049   -7.860  1.00 0.00 ? 56  GLU A HA   6  
ATOM 8749  H HB2  . GLU A 1 56  ? -4.180  6.120   -6.863  1.00 0.00 ? 56  GLU A HB2  6  
ATOM 8750  H HB3  . GLU A 1 56  ? -4.442  5.027   -5.512  1.00 0.00 ? 56  GLU A HB3  6  
ATOM 8751  H HG2  . GLU A 1 56  ? -2.155  5.403   -4.755  1.00 0.00 ? 56  GLU A HG2  6  
ATOM 8752  H HG3  . GLU A 1 56  ? -1.881  6.490   -6.115  1.00 0.00 ? 56  GLU A HG3  6  
ATOM 8753  N N    . ARG A 1 57  ? -0.783  4.435   -6.846  1.00 0.00 ? 57  ARG A N    6  
ATOM 8754  C CA   . ARG A 1 57  ? 0.571   4.738   -7.292  1.00 0.00 ? 57  ARG A CA   6  
ATOM 8755  C C    . ARG A 1 57  ? 0.827   4.165   -8.682  1.00 0.00 ? 57  ARG A C    6  
ATOM 8756  O O    . ARG A 1 57  ? 1.354   4.850   -9.558  1.00 0.00 ? 57  ARG A O    6  
ATOM 8757  C CB   . ARG A 1 57  ? 1.594   4.178   -6.302  1.00 0.00 ? 57  ARG A CB   6  
ATOM 8758  C CG   . ARG A 1 57  ? 3.023   4.603   -6.597  1.00 0.00 ? 57  ARG A CG   6  
ATOM 8759  C CD   . ARG A 1 57  ? 3.941   4.328   -5.416  1.00 0.00 ? 57  ARG A CD   6  
ATOM 8760  N NE   . ARG A 1 57  ? 3.837   5.362   -4.389  1.00 0.00 ? 57  ARG A NE   6  
ATOM 8761  C CZ   . ARG A 1 57  ? 4.428   6.548   -4.479  1.00 0.00 ? 57  ARG A CZ   6  
ATOM 8762  N NH1  . ARG A 1 57  ? 5.160   6.850   -5.543  1.00 0.00 ? 57  ARG A NH1  6  
ATOM 8763  N NH2  . ARG A 1 57  ? 4.286   7.437   -3.503  1.00 0.00 ? 57  ARG A NH2  6  
ATOM 8764  H H    . ARG A 1 57  ? -0.925  4.114   -5.931  1.00 0.00 ? 57  ARG A H    6  
ATOM 8765  H HA   . ARG A 1 57  ? 0.675   5.812   -7.333  1.00 0.00 ? 57  ARG A HA   6  
ATOM 8766  H HB2  . ARG A 1 57  ? 1.339   4.517   -5.308  1.00 0.00 ? 57  ARG A HB2  6  
ATOM 8767  H HB3  . ARG A 1 57  ? 1.549   3.100   -6.328  1.00 0.00 ? 57  ARG A HB3  6  
ATOM 8768  H HG2  . ARG A 1 57  ? 3.383   4.053   -7.454  1.00 0.00 ? 57  ARG A HG2  6  
ATOM 8769  H HG3  . ARG A 1 57  ? 3.037   5.661   -6.814  1.00 0.00 ? 57  ARG A HG3  6  
ATOM 8770  H HD2  . ARG A 1 57  ? 3.673   3.376   -4.983  1.00 0.00 ? 57  ARG A HD2  6  
ATOM 8771  H HD3  . ARG A 1 57  ? 4.960   4.288   -5.771  1.00 0.00 ? 57  ARG A HD3  6  
ATOM 8772  H HE   . ARG A 1 57  ? 3.301   5.160   -3.595  1.00 0.00 ? 57  ARG A HE   6  
ATOM 8773  H HH11 . ARG A 1 57  ? 5.267   6.183   -6.280  1.00 0.00 ? 57  ARG A HH11 6  
ATOM 8774  H HH12 . ARG A 1 57  ? 5.602   7.744   -5.608  1.00 0.00 ? 57  ARG A HH12 6  
ATOM 8775  H HH21 . ARG A 1 57  ? 3.735   7.213   -2.700  1.00 0.00 ? 57  ARG A HH21 6  
ATOM 8776  H HH22 . ARG A 1 57  ? 4.731   8.329   -3.572  1.00 0.00 ? 57  ARG A HH22 6  
ATOM 8777  N N    . GLN A 1 58  ? 0.450   2.905   -8.876  1.00 0.00 ? 58  GLN A N    6  
ATOM 8778  C CA   . GLN A 1 58  ? 0.640   2.241   -10.160 1.00 0.00 ? 58  GLN A CA   6  
ATOM 8779  C C    . GLN A 1 58  ? -0.621  2.333   -11.013 1.00 0.00 ? 58  GLN A C    6  
ATOM 8780  O O    . GLN A 1 58  ? -0.592  2.851   -12.128 1.00 0.00 ? 58  GLN A O    6  
ATOM 8781  C CB   . GLN A 1 58  ? 1.019   0.774   -9.947  1.00 0.00 ? 58  GLN A CB   6  
ATOM 8782  C CG   . GLN A 1 58  ? 2.241   0.584   -9.063  1.00 0.00 ? 58  GLN A CG   6  
ATOM 8783  C CD   . GLN A 1 58  ? 3.470   1.285   -9.608  1.00 0.00 ? 58  GLN A CD   6  
ATOM 8784  O OE1  . GLN A 1 58  ? 3.710   1.295   -10.816 1.00 0.00 ? 58  GLN A OE1  6  
ATOM 8785  N NE2  . GLN A 1 58  ? 4.257   1.878   -8.718  1.00 0.00 ? 58  GLN A NE2  6  
ATOM 8786  H H    . GLN A 1 58  ? 0.035   2.412   -8.139  1.00 0.00 ? 58  GLN A H    6  
ATOM 8787  H HA   . GLN A 1 58  ? 1.445   2.740   -10.676 1.00 0.00 ? 58  GLN A HA   6  
ATOM 8788  H HB2  . GLN A 1 58  ? 0.187   0.262   -9.489  1.00 0.00 ? 58  GLN A HB2  6  
ATOM 8789  H HB3  . GLN A 1 58  ? 1.223   0.325   -10.908 1.00 0.00 ? 58  GLN A HB3  6  
ATOM 8790  H HG2  . GLN A 1 58  ? 2.025   0.980   -8.082  1.00 0.00 ? 58  GLN A HG2  6  
ATOM 8791  H HG3  . GLN A 1 58  ? 2.452   -0.472  -8.986  1.00 0.00 ? 58  GLN A HG3  6  
ATOM 8792  H HE21 . GLN A 1 58  ? 4.004   1.828   -7.771  1.00 0.00 ? 58  GLN A HE21 6  
ATOM 8793  H HE22 . GLN A 1 58  ? 5.058   2.338   -9.042  1.00 0.00 ? 58  GLN A HE22 6  
ATOM 8794  N N    . GLY A 1 59  ? -1.729  1.827   -10.479 1.00 0.00 ? 59  GLY A N    6  
ATOM 8795  C CA   . GLY A 1 59  ? -2.985  1.862   -11.206 1.00 0.00 ? 59  GLY A CA   6  
ATOM 8796  C C    . GLY A 1 59  ? -3.677  0.514   -11.233 1.00 0.00 ? 59  GLY A C    6  
ATOM 8797  O O    . GLY A 1 59  ? -4.349  0.172   -12.207 1.00 0.00 ? 59  GLY A O    6  
ATOM 8798  H H    . GLY A 1 59  ? -1.694  1.427   -9.585  1.00 0.00 ? 59  GLY A H    6  
ATOM 8799  H HA2  . GLY A 1 59  ? -3.640  2.582   -10.737 1.00 0.00 ? 59  GLY A HA2  6  
ATOM 8800  H HA3  . GLY A 1 59  ? -2.792  2.175   -12.221 1.00 0.00 ? 59  GLY A HA3  6  
ATOM 8801  N N    . LEU A 1 60  ? -3.513  -0.255  -10.162 1.00 0.00 ? 60  LEU A N    6  
ATOM 8802  C CA   . LEU A 1 60  ? -4.126  -1.576  -10.067 1.00 0.00 ? 60  LEU A CA   6  
ATOM 8803  C C    . LEU A 1 60  ? -5.281  -1.569  -9.071  1.00 0.00 ? 60  LEU A C    6  
ATOM 8804  O O    . LEU A 1 60  ? -5.568  -0.549  -8.445  1.00 0.00 ? 60  LEU A O    6  
ATOM 8805  C CB   . LEU A 1 60  ? -3.083  -2.615  -9.651  1.00 0.00 ? 60  LEU A CB   6  
ATOM 8806  C CG   . LEU A 1 60  ? -1.703  -2.476  -10.294 1.00 0.00 ? 60  LEU A CG   6  
ATOM 8807  C CD1  . LEU A 1 60  ? -0.631  -3.061  -9.388  1.00 0.00 ? 60  LEU A CD1  6  
ATOM 8808  C CD2  . LEU A 1 60  ? -1.679  -3.153  -11.657 1.00 0.00 ? 60  LEU A CD2  6  
ATOM 8809  H H    . LEU A 1 60  ? -2.966  0.071   -9.418  1.00 0.00 ? 60  LEU A H    6  
ATOM 8810  H HA   . LEU A 1 60  ? -4.509  -1.834  -11.043 1.00 0.00 ? 60  LEU A HA   6  
ATOM 8811  H HB2  . LEU A 1 60  ? -2.958  -2.547  -8.581  1.00 0.00 ? 60  LEU A HB2  6  
ATOM 8812  H HB3  . LEU A 1 60  ? -3.471  -3.591  -9.905  1.00 0.00 ? 60  LEU A HB3  6  
ATOM 8813  H HG   . LEU A 1 60  ? -1.483  -1.427  -10.437 1.00 0.00 ? 60  LEU A HG   6  
ATOM 8814  H HD11 . LEU A 1 60  ? 0.098   -3.587  -9.985  1.00 0.00 ? 60  LEU A HD11 6  
ATOM 8815  H HD12 . LEU A 1 60  ? -1.085  -3.746  -8.687  1.00 0.00 ? 60  LEU A HD12 6  
ATOM 8816  H HD13 . LEU A 1 60  ? -0.144  -2.263  -8.846  1.00 0.00 ? 60  LEU A HD13 6  
ATOM 8817  H HD21 . LEU A 1 60  ? -2.269  -2.577  -12.354 1.00 0.00 ? 60  LEU A HD21 6  
ATOM 8818  H HD22 . LEU A 1 60  ? -2.092  -4.148  -11.572 1.00 0.00 ? 60  LEU A HD22 6  
ATOM 8819  H HD23 . LEU A 1 60  ? -0.661  -3.214  -12.010 1.00 0.00 ? 60  LEU A HD23 6  
ATOM 8820  N N    . SER A 1 61  ? -5.938  -2.716  -8.928  1.00 0.00 ? 61  SER A N    6  
ATOM 8821  C CA   . SER A 1 61  ? -7.063  -2.842  -8.009  1.00 0.00 ? 61  SER A CA   6  
ATOM 8822  C C    . SER A 1 61  ? -6.596  -3.335  -6.643  1.00 0.00 ? 61  SER A C    6  
ATOM 8823  O O    . SER A 1 61  ? -5.792  -4.262  -6.548  1.00 0.00 ? 61  SER A O    6  
ATOM 8824  C CB   . SER A 1 61  ? -8.110  -3.801  -8.580  1.00 0.00 ? 61  SER A CB   6  
ATOM 8825  O OG   . SER A 1 61  ? -8.932  -4.329  -7.553  1.00 0.00 ? 61  SER A OG   6  
ATOM 8826  H H    . SER A 1 61  ? -5.662  -3.494  -9.456  1.00 0.00 ? 61  SER A H    6  
ATOM 8827  H HA   . SER A 1 61  ? -7.508  -1.865  -7.893  1.00 0.00 ? 61  SER A HA   6  
ATOM 8828  H HB2  . SER A 1 61  ? -8.732  -3.272  -9.286  1.00 0.00 ? 61  SER A HB2  6  
ATOM 8829  H HB3  . SER A 1 61  ? -7.611  -4.618  -9.081  1.00 0.00 ? 61  SER A HB3  6  
ATOM 8830  H HG   . SER A 1 61  ? -9.854  -4.185  -7.775  1.00 0.00 ? 61  SER A HG   6  
ATOM 8831  N N    . MET A 1 62  ? -7.106  -2.708  -5.588  1.00 0.00 ? 62  MET A N    6  
ATOM 8832  C CA   . MET A 1 62  ? -6.742  -3.083  -4.227  1.00 0.00 ? 62  MET A CA   6  
ATOM 8833  C C    . MET A 1 62  ? -6.990  -4.569  -3.988  1.00 0.00 ? 62  MET A C    6  
ATOM 8834  O O    . MET A 1 62  ? -6.287  -5.207  -3.204  1.00 0.00 ? 62  MET A O    6  
ATOM 8835  C CB   . MET A 1 62  ? -7.536  -2.253  -3.217  1.00 0.00 ? 62  MET A CB   6  
ATOM 8836  C CG   . MET A 1 62  ? -6.792  -2.007  -1.914  1.00 0.00 ? 62  MET A CG   6  
ATOM 8837  S SD   . MET A 1 62  ? -6.948  -3.379  -0.755  1.00 0.00 ? 62  MET A SD   6  
ATOM 8838  C CE   . MET A 1 62  ? -5.932  -2.795  0.599   1.00 0.00 ? 62  MET A CE   6  
ATOM 8839  H H    . MET A 1 62  ? -7.742  -1.976  -5.728  1.00 0.00 ? 62  MET A H    6  
ATOM 8840  H HA   . MET A 1 62  ? -5.689  -2.880  -4.098  1.00 0.00 ? 62  MET A HA   6  
ATOM 8841  H HB2  . MET A 1 62  ? -7.770  -1.297  -3.659  1.00 0.00 ? 62  MET A HB2  6  
ATOM 8842  H HB3  . MET A 1 62  ? -8.456  -2.770  -2.988  1.00 0.00 ? 62  MET A HB3  6  
ATOM 8843  H HG2  . MET A 1 62  ? -5.746  -1.858  -2.135  1.00 0.00 ? 62  MET A HG2  6  
ATOM 8844  H HG3  . MET A 1 62  ? -7.190  -1.116  -1.452  1.00 0.00 ? 62  MET A HG3  6  
ATOM 8845  H HE1  . MET A 1 62  ? -6.384  -3.079  1.538   1.00 0.00 ? 62  MET A HE1  6  
ATOM 8846  H HE2  . MET A 1 62  ? -4.948  -3.235  0.526   1.00 0.00 ? 62  MET A HE2  6  
ATOM 8847  H HE3  . MET A 1 62  ? -5.851  -1.719  0.550   1.00 0.00 ? 62  MET A HE3  6  
ATOM 8848  N N    . ARG A 1 63  ? -7.993  -5.114  -4.669  1.00 0.00 ? 63  ARG A N    6  
ATOM 8849  C CA   . ARG A 1 63  ? -8.334  -6.525  -4.529  1.00 0.00 ? 63  ARG A CA   6  
ATOM 8850  C C    . ARG A 1 63  ? -7.352  -7.401  -5.302  1.00 0.00 ? 63  ARG A C    6  
ATOM 8851  O O    . ARG A 1 63  ? -6.839  -8.388  -4.776  1.00 0.00 ? 63  ARG A O    6  
ATOM 8852  C CB   . ARG A 1 63  ? -9.759  -6.779  -5.023  1.00 0.00 ? 63  ARG A CB   6  
ATOM 8853  C CG   . ARG A 1 63  ? -10.766 -5.751  -4.533  1.00 0.00 ? 63  ARG A CG   6  
ATOM 8854  C CD   . ARG A 1 63  ? -11.024 -5.891  -3.041  1.00 0.00 ? 63  ARG A CD   6  
ATOM 8855  N NE   . ARG A 1 63  ? -11.723 -7.133  -2.721  1.00 0.00 ? 63  ARG A NE   6  
ATOM 8856  C CZ   . ARG A 1 63  ? -12.359 -7.344  -1.574  1.00 0.00 ? 63  ARG A CZ   6  
ATOM 8857  N NH1  . ARG A 1 63  ? -12.384 -6.400  -0.643  1.00 0.00 ? 63  ARG A NH1  6  
ATOM 8858  N NH2  . ARG A 1 63  ? -12.972 -8.500  -1.357  1.00 0.00 ? 63  ARG A NH2  6  
ATOM 8859  H H    . ARG A 1 63  ? -8.517  -4.554  -5.279  1.00 0.00 ? 63  ARG A H    6  
ATOM 8860  H HA   . ARG A 1 63  ? -8.275  -6.778  -3.481  1.00 0.00 ? 63  ARG A HA   6  
ATOM 8861  H HB2  . ARG A 1 63  ? -9.761  -6.766  -6.103  1.00 0.00 ? 63  ARG A HB2  6  
ATOM 8862  H HB3  . ARG A 1 63  ? -10.077 -7.752  -4.682  1.00 0.00 ? 63  ARG A HB3  6  
ATOM 8863  H HG2  . ARG A 1 63  ? -10.379 -4.761  -4.728  1.00 0.00 ? 63  ARG A HG2  6  
ATOM 8864  H HG3  . ARG A 1 63  ? -11.695 -5.888  -5.066  1.00 0.00 ? 63  ARG A HG3  6  
ATOM 8865  H HD2  . ARG A 1 63  ? -10.077 -5.878  -2.522  1.00 0.00 ? 63  ARG A HD2  6  
ATOM 8866  H HD3  . ARG A 1 63  ? -11.625 -5.056  -2.714  1.00 0.00 ? 63  ARG A HD3  6  
ATOM 8867  H HE   . ARG A 1 63  ? -11.717 -7.843  -3.395  1.00 0.00 ? 63  ARG A HE   6  
ATOM 8868  H HH11 . ARG A 1 63  ? -11.924 -5.527  -0.804  1.00 0.00 ? 63  ARG A HH11 6  
ATOM 8869  H HH12 . ARG A 1 63  ? -12.864 -6.561  0.219   1.00 0.00 ? 63  ARG A HH12 6  
ATOM 8870  H HH21 . ARG A 1 63  ? -12.955 -9.214  -2.057  1.00 0.00 ? 63  ARG A HH21 6  
ATOM 8871  H HH22 . ARG A 1 63  ? -13.450 -8.658  -0.494  1.00 0.00 ? 63  ARG A HH22 6  
ATOM 8872  N N    . GLN A 1 64  ? -7.097  -7.032  -6.553  1.00 0.00 ? 64  GLN A N    6  
ATOM 8873  C CA   . GLN A 1 64  ? -6.178  -7.785  -7.399  1.00 0.00 ? 64  GLN A CA   6  
ATOM 8874  C C    . GLN A 1 64  ? -4.879  -8.085  -6.659  1.00 0.00 ? 64  GLN A C    6  
ATOM 8875  O O    . GLN A 1 64  ? -4.336  -9.186  -6.761  1.00 0.00 ? 64  GLN A O    6  
ATOM 8876  C CB   . GLN A 1 64  ? -5.880  -7.007  -8.682  1.00 0.00 ? 64  GLN A CB   6  
ATOM 8877  C CG   . GLN A 1 64  ? -5.550  -7.897  -9.870  1.00 0.00 ? 64  GLN A CG   6  
ATOM 8878  C CD   . GLN A 1 64  ? -5.800  -7.213  -11.199 1.00 0.00 ? 64  GLN A CD   6  
ATOM 8879  O OE1  . GLN A 1 64  ? -6.849  -7.396  -11.817 1.00 0.00 ? 64  GLN A OE1  6  
ATOM 8880  N NE2  . GLN A 1 64  ? -4.835  -6.418  -11.647 1.00 0.00 ? 64  GLN A NE2  6  
ATOM 8881  H H    . GLN A 1 64  ? -7.537  -6.235  -6.916  1.00 0.00 ? 64  GLN A H    6  
ATOM 8882  H HA   . GLN A 1 64  ? -6.655  -8.718  -7.657  1.00 0.00 ? 64  GLN A HA   6  
ATOM 8883  H HB2  . GLN A 1 64  ? -6.743  -6.410  -8.936  1.00 0.00 ? 64  GLN A HB2  6  
ATOM 8884  H HB3  . GLN A 1 64  ? -5.038  -6.354  -8.506  1.00 0.00 ? 64  GLN A HB3  6  
ATOM 8885  H HG2  . GLN A 1 64  ? -4.508  -8.176  -9.817  1.00 0.00 ? 64  GLN A HG2  6  
ATOM 8886  H HG3  . GLN A 1 64  ? -6.162  -8.786  -9.818  1.00 0.00 ? 64  GLN A HG3  6  
ATOM 8887  H HE21 . GLN A 1 64  ? -4.026  -6.321  -11.102 1.00 0.00 ? 64  GLN A HE21 6  
ATOM 8888  H HE22 . GLN A 1 64  ? -4.970  -5.964  -12.504 1.00 0.00 ? 64  GLN A HE22 6  
ATOM 8889  N N    . ILE A 1 65  ? -4.387  -7.101  -5.915  1.00 0.00 ? 65  ILE A N    6  
ATOM 8890  C CA   . ILE A 1 65  ? -3.152  -7.261  -5.157  1.00 0.00 ? 65  ILE A CA   6  
ATOM 8891  C C    . ILE A 1 65  ? -3.442  -7.607  -3.700  1.00 0.00 ? 65  ILE A C    6  
ATOM 8892  O O    . ILE A 1 65  ? -4.519  -7.310  -3.183  1.00 0.00 ? 65  ILE A O    6  
ATOM 8893  C CB   . ILE A 1 65  ? -2.291  -5.985  -5.208  1.00 0.00 ? 65  ILE A CB   6  
ATOM 8894  C CG1  . ILE A 1 65  ? -3.031  -4.818  -4.553  1.00 0.00 ? 65  ILE A CG1  6  
ATOM 8895  C CG2  . ILE A 1 65  ? -1.927  -5.649  -6.647  1.00 0.00 ? 65  ILE A CG2  6  
ATOM 8896  C CD1  . ILE A 1 65  ? -2.133  -3.651  -4.207  1.00 0.00 ? 65  ILE A CD1  6  
ATOM 8897  H H    . ILE A 1 65  ? -4.866  -6.247  -5.873  1.00 0.00 ? 65  ILE A H    6  
ATOM 8898  H HA   . ILE A 1 65  ? -2.590  -8.069  -5.603  1.00 0.00 ? 65  ILE A HA   6  
ATOM 8899  H HB   . ILE A 1 65  ? -1.377  -6.173  -4.666  1.00 0.00 ? 65  ILE A HB   6  
ATOM 8900  H HG12 . ILE A 1 65  ? -3.794  -4.460  -5.226  1.00 0.00 ? 65  ILE A HG12 6  
ATOM 8901  H HG13 . ILE A 1 65  ? -3.495  -5.162  -3.640  1.00 0.00 ? 65  ILE A HG13 6  
ATOM 8902  H HG21 . ILE A 1 65  ? -1.383  -4.716  -6.672  1.00 0.00 ? 65  ILE A HG21 6  
ATOM 8903  H HG22 . ILE A 1 65  ? -1.310  -6.435  -7.055  1.00 0.00 ? 65  ILE A HG22 6  
ATOM 8904  H HG23 . ILE A 1 65  ? -2.828  -5.557  -7.234  1.00 0.00 ? 65  ILE A HG23 6  
ATOM 8905  H HD11 . ILE A 1 65  ? -1.134  -3.844  -4.572  1.00 0.00 ? 65  ILE A HD11 6  
ATOM 8906  H HD12 . ILE A 1 65  ? -2.517  -2.752  -4.666  1.00 0.00 ? 65  ILE A HD12 6  
ATOM 8907  H HD13 . ILE A 1 65  ? -2.105  -3.523  -3.134  1.00 0.00 ? 65  ILE A HD13 6  
ATOM 8908  N N    . ARG A 1 66  ? -2.473  -8.236  -3.043  1.00 0.00 ? 66  ARG A N    6  
ATOM 8909  C CA   . ARG A 1 66  ? -2.623  -8.622  -1.646  1.00 0.00 ? 66  ARG A CA   6  
ATOM 8910  C C    . ARG A 1 66  ? -1.419  -8.171  -0.824  1.00 0.00 ? 66  ARG A C    6  
ATOM 8911  O O    . ARG A 1 66  ? -0.304  -8.079  -1.337  1.00 0.00 ? 66  ARG A O    6  
ATOM 8912  C CB   . ARG A 1 66  ? -2.794  -10.138 -1.529  1.00 0.00 ? 66  ARG A CB   6  
ATOM 8913  C CG   . ARG A 1 66  ? -2.368  -10.697 -0.181  1.00 0.00 ? 66  ARG A CG   6  
ATOM 8914  C CD   . ARG A 1 66  ? -3.363  -10.339 0.911   1.00 0.00 ? 66  ARG A CD   6  
ATOM 8915  N NE   . ARG A 1 66  ? -4.407  -11.350 1.053   1.00 0.00 ? 66  ARG A NE   6  
ATOM 8916  C CZ   . ARG A 1 66  ? -5.195  -11.448 2.118   1.00 0.00 ? 66  ARG A CZ   6  
ATOM 8917  N NH1  . ARG A 1 66  ? -5.059  -10.600 3.128   1.00 0.00 ? 66  ARG A NH1  6  
ATOM 8918  N NH2  . ARG A 1 66  ? -6.123  -12.395 2.174   1.00 0.00 ? 66  ARG A NH2  6  
ATOM 8919  H H    . ARG A 1 66  ? -1.637  -8.446  -3.510  1.00 0.00 ? 66  ARG A H    6  
ATOM 8920  H HA   . ARG A 1 66  ? -3.508  -8.139  -1.261  1.00 0.00 ? 66  ARG A HA   6  
ATOM 8921  H HB2  . ARG A 1 66  ? -3.834  -10.385 -1.683  1.00 0.00 ? 66  ARG A HB2  6  
ATOM 8922  H HB3  . ARG A 1 66  ? -2.202  -10.615 -2.296  1.00 0.00 ? 66  ARG A HB3  6  
ATOM 8923  H HG2  . ARG A 1 66  ? -2.301  -11.773 -0.253  1.00 0.00 ? 66  ARG A HG2  6  
ATOM 8924  H HG3  . ARG A 1 66  ? -1.401  -10.291 0.077   1.00 0.00 ? 66  ARG A HG3  6  
ATOM 8925  H HD2  . ARG A 1 66  ? -2.833  -10.248 1.847   1.00 0.00 ? 66  ARG A HD2  6  
ATOM 8926  H HD3  . ARG A 1 66  ? -3.822  -9.393  0.664   1.00 0.00 ? 66  ARG A HD3  6  
ATOM 8927  H HE   . ARG A 1 66  ? -4.525  -11.987 0.319   1.00 0.00 ? 66  ARG A HE   6  
ATOM 8928  H HH11 . ARG A 1 66  ? -4.362  -9.884  3.088   1.00 0.00 ? 66  ARG A HH11 6  
ATOM 8929  H HH12 . ARG A 1 66  ? -5.654  -10.675 3.928   1.00 0.00 ? 66  ARG A HH12 6  
ATOM 8930  H HH21 . ARG A 1 66  ? -6.229  -13.036 1.414   1.00 0.00 ? 66  ARG A HH21 6  
ATOM 8931  H HH22 . ARG A 1 66  ? -6.715  -12.468 2.976   1.00 0.00 ? 66  ARG A HH22 6  
ATOM 8932  N N    . PHE A 1 67  ? -1.653  -7.890  0.454   1.00 0.00 ? 67  PHE A N    6  
ATOM 8933  C CA   . PHE A 1 67  ? -0.589  -7.446  1.346   1.00 0.00 ? 67  PHE A CA   6  
ATOM 8934  C C    . PHE A 1 67  ? -0.359  -8.459  2.464   1.00 0.00 ? 67  PHE A C    6  
ATOM 8935  O O    . PHE A 1 67  ? -1.294  -9.115  2.923   1.00 0.00 ? 67  PHE A O    6  
ATOM 8936  C CB   . PHE A 1 67  ? -0.931  -6.080  1.943   1.00 0.00 ? 67  PHE A CB   6  
ATOM 8937  C CG   . PHE A 1 67  ? -1.045  -4.989  0.917   1.00 0.00 ? 67  PHE A CG   6  
ATOM 8938  C CD1  . PHE A 1 67  ? -2.226  -4.798  0.217   1.00 0.00 ? 67  PHE A CD1  6  
ATOM 8939  C CD2  . PHE A 1 67  ? 0.028   -4.154  0.651   1.00 0.00 ? 67  PHE A CD2  6  
ATOM 8940  C CE1  . PHE A 1 67  ? -2.334  -3.796  -0.728  1.00 0.00 ? 67  PHE A CE1  6  
ATOM 8941  C CE2  . PHE A 1 67  ? -0.073  -3.150  -0.293  1.00 0.00 ? 67  PHE A CE2  6  
ATOM 8942  C CZ   . PHE A 1 67  ? -1.256  -2.970  -0.983  1.00 0.00 ? 67  PHE A CZ   6  
ATOM 8943  H H    . PHE A 1 67  ? -2.564  -7.983  0.804   1.00 0.00 ? 67  PHE A H    6  
ATOM 8944  H HA   . PHE A 1 67  ? 0.316   -7.359  0.764   1.00 0.00 ? 67  PHE A HA   6  
ATOM 8945  H HB2  . PHE A 1 67  ? -1.876  -6.147  2.461   1.00 0.00 ? 67  PHE A HB2  6  
ATOM 8946  H HB3  . PHE A 1 67  ? -0.160  -5.798  2.644   1.00 0.00 ? 67  PHE A HB3  6  
ATOM 8947  H HD1  . PHE A 1 67  ? -3.070  -5.443  0.416   1.00 0.00 ? 67  PHE A HD1  6  
ATOM 8948  H HD2  . PHE A 1 67  ? 0.954   -4.294  1.191   1.00 0.00 ? 67  PHE A HD2  6  
ATOM 8949  H HE1  . PHE A 1 67  ? -3.260  -3.657  -1.266  1.00 0.00 ? 67  PHE A HE1  6  
ATOM 8950  H HE2  . PHE A 1 67  ? 0.771   -2.506  -0.489  1.00 0.00 ? 67  PHE A HE2  6  
ATOM 8951  H HZ   . PHE A 1 67  ? -1.338  -2.186  -1.721  1.00 0.00 ? 67  PHE A HZ   6  
ATOM 8952  N N    . ARG A 1 68  ? 0.892   -8.580  2.897   1.00 0.00 ? 68  ARG A N    6  
ATOM 8953  C CA   . ARG A 1 68  ? 1.245   -9.514  3.960   1.00 0.00 ? 68  ARG A CA   6  
ATOM 8954  C C    . ARG A 1 68  ? 2.489   -9.041  4.707   1.00 0.00 ? 68  ARG A C    6  
ATOM 8955  O O    . ARG A 1 68  ? 3.428   -8.521  4.104   1.00 0.00 ? 68  ARG A O    6  
ATOM 8956  C CB   . ARG A 1 68  ? 1.484   -10.910 3.382   1.00 0.00 ? 68  ARG A CB   6  
ATOM 8957  C CG   . ARG A 1 68  ? 2.684   -10.987 2.452   1.00 0.00 ? 68  ARG A CG   6  
ATOM 8958  C CD   . ARG A 1 68  ? 3.279   -12.386 2.425   1.00 0.00 ? 68  ARG A CD   6  
ATOM 8959  N NE   . ARG A 1 68  ? 3.886   -12.698 1.134   1.00 0.00 ? 68  ARG A NE   6  
ATOM 8960  C CZ   . ARG A 1 68  ? 4.393   -13.887 0.829   1.00 0.00 ? 68  ARG A CZ   6  
ATOM 8961  N NH1  . ARG A 1 68  ? 4.367   -14.871 1.717   1.00 0.00 ? 68  ARG A NH1  6  
ATOM 8962  N NH2  . ARG A 1 68  ? 4.928   -14.094 -0.368  1.00 0.00 ? 68  ARG A NH2  6  
ATOM 8963  H H    . ARG A 1 68  ? 1.594   -8.029  2.491   1.00 0.00 ? 68  ARG A H    6  
ATOM 8964  H HA   . ARG A 1 68  ? 0.418   -9.557  4.652   1.00 0.00 ? 68  ARG A HA   6  
ATOM 8965  H HB2  . ARG A 1 68  ? 1.644   -11.601 4.197   1.00 0.00 ? 68  ARG A HB2  6  
ATOM 8966  H HB3  . ARG A 1 68  ? 0.608   -11.213 2.830   1.00 0.00 ? 68  ARG A HB3  6  
ATOM 8967  H HG2  . ARG A 1 68  ? 2.370   -10.722 1.453   1.00 0.00 ? 68  ARG A HG2  6  
ATOM 8968  H HG3  . ARG A 1 68  ? 3.436   -10.291 2.792   1.00 0.00 ? 68  ARG A HG3  6  
ATOM 8969  H HD2  . ARG A 1 68  ? 4.035   -12.456 3.193   1.00 0.00 ? 68  ARG A HD2  6  
ATOM 8970  H HD3  . ARG A 1 68  ? 2.495   -13.100 2.627   1.00 0.00 ? 68  ARG A HD3  6  
ATOM 8971  H HE   . ARG A 1 68  ? 3.915   -11.986 0.462   1.00 0.00 ? 68  ARG A HE   6  
ATOM 8972  H HH11 . ARG A 1 68  ? 3.964   -14.718 2.619   1.00 0.00 ? 68  ARG A HH11 6  
ATOM 8973  H HH12 . ARG A 1 68  ? 4.749   -15.766 1.485   1.00 0.00 ? 68  ARG A HH12 6  
ATOM 8974  H HH21 . ARG A 1 68  ? 4.949   -13.355 -1.041  1.00 0.00 ? 68  ARG A HH21 6  
ATOM 8975  H HH22 . ARG A 1 68  ? 5.310   -14.989 -0.597  1.00 0.00 ? 68  ARG A HH22 6  
ATOM 8976  N N    . PHE A 1 69  ? 2.487   -9.224  6.023   1.00 0.00 ? 69  PHE A N    6  
ATOM 8977  C CA   . PHE A 1 69  ? 3.614   -8.815  6.854   1.00 0.00 ? 69  PHE A CA   6  
ATOM 8978  C C    . PHE A 1 69  ? 4.113   -9.979  7.705   1.00 0.00 ? 69  PHE A C    6  
ATOM 8979  O O    . PHE A 1 69  ? 3.328   -10.660 8.366   1.00 0.00 ? 69  PHE A O    6  
ATOM 8980  C CB   . PHE A 1 69  ? 3.213   -7.645  7.754   1.00 0.00 ? 69  PHE A CB   6  
ATOM 8981  C CG   . PHE A 1 69  ? 4.209   -7.356  8.840   1.00 0.00 ? 69  PHE A CG   6  
ATOM 8982  C CD1  . PHE A 1 69  ? 5.307   -6.547  8.594   1.00 0.00 ? 69  PHE A CD1  6  
ATOM 8983  C CD2  . PHE A 1 69  ? 4.047   -7.893  10.107  1.00 0.00 ? 69  PHE A CD2  6  
ATOM 8984  C CE1  . PHE A 1 69  ? 6.225   -6.279  9.592   1.00 0.00 ? 69  PHE A CE1  6  
ATOM 8985  C CE2  . PHE A 1 69  ? 4.962   -7.628  11.109  1.00 0.00 ? 69  PHE A CE2  6  
ATOM 8986  C CZ   . PHE A 1 69  ? 6.053   -6.821  10.851  1.00 0.00 ? 69  PHE A CZ   6  
ATOM 8987  H H    . PHE A 1 69  ? 1.709   -9.645  6.446   1.00 0.00 ? 69  PHE A H    6  
ATOM 8988  H HA   . PHE A 1 69  ? 4.410   -8.498  6.198   1.00 0.00 ? 69  PHE A HA   6  
ATOM 8989  H HB2  . PHE A 1 69  ? 3.112   -6.755  7.151   1.00 0.00 ? 69  PHE A HB2  6  
ATOM 8990  H HB3  . PHE A 1 69  ? 2.266   -7.868  8.221   1.00 0.00 ? 69  PHE A HB3  6  
ATOM 8991  H HD1  . PHE A 1 69  ? 5.443   -6.123  7.609   1.00 0.00 ? 69  PHE A HD1  6  
ATOM 8992  H HD2  . PHE A 1 69  ? 3.196   -8.525  10.310  1.00 0.00 ? 69  PHE A HD2  6  
ATOM 8993  H HE1  . PHE A 1 69  ? 7.077   -5.647  9.387   1.00 0.00 ? 69  PHE A HE1  6  
ATOM 8994  H HE2  . PHE A 1 69  ? 4.825   -8.053  12.092  1.00 0.00 ? 69  PHE A HE2  6  
ATOM 8995  H HZ   . PHE A 1 69  ? 6.769   -6.612  11.632  1.00 0.00 ? 69  PHE A HZ   6  
ATOM 8996  N N    . ASP A 1 70  ? 5.422   -10.201 7.684   1.00 0.00 ? 70  ASP A N    6  
ATOM 8997  C CA   . ASP A 1 70  ? 6.027   -11.282 8.454   1.00 0.00 ? 70  ASP A CA   6  
ATOM 8998  C C    . ASP A 1 70  ? 5.518   -12.639 7.979   1.00 0.00 ? 70  ASP A C    6  
ATOM 8999  O O    . ASP A 1 70  ? 5.382   -13.573 8.768   1.00 0.00 ? 70  ASP A O    6  
ATOM 9000  C CB   . ASP A 1 70  ? 5.729   -11.104 9.944   1.00 0.00 ? 70  ASP A CB   6  
ATOM 9001  C CG   . ASP A 1 70  ? 6.765   -11.772 10.826  1.00 0.00 ? 70  ASP A CG   6  
ATOM 9002  O OD1  . ASP A 1 70  ? 6.828   -13.019 10.826  1.00 0.00 ? 70  ASP A OD1  6  
ATOM 9003  O OD2  . ASP A 1 70  ? 7.512   -11.048 11.517  1.00 0.00 ? 70  ASP A OD2  6  
ATOM 9004  H H    . ASP A 1 70  ? 5.996   -9.623  7.138   1.00 0.00 ? 70  ASP A H    6  
ATOM 9005  H HA   . ASP A 1 70  ? 7.095   -11.239 8.303   1.00 0.00 ? 70  ASP A HA   6  
ATOM 9006  H HB2  . ASP A 1 70  ? 5.710   -10.049 10.178  1.00 0.00 ? 70  ASP A HB2  6  
ATOM 9007  H HB3  . ASP A 1 70  ? 4.763   -11.534 10.165  1.00 0.00 ? 70  ASP A HB3  6  
ATOM 9008  N N    . GLY A 1 71  ? 5.236   -12.739 6.683   1.00 0.00 ? 71  GLY A N    6  
ATOM 9009  C CA   . GLY A 1 71  ? 4.744   -13.985 6.126   1.00 0.00 ? 71  GLY A CA   6  
ATOM 9010  C C    . GLY A 1 71  ? 3.300   -14.256 6.497   1.00 0.00 ? 71  GLY A C    6  
ATOM 9011  O O    . GLY A 1 71  ? 2.883   -15.410 6.593   1.00 0.00 ? 71  GLY A O    6  
ATOM 9012  H H    . GLY A 1 71  ? 5.364   -11.960 6.102   1.00 0.00 ? 71  GLY A H    6  
ATOM 9013  H HA2  . GLY A 1 71  ? 4.826   -13.942 5.050   1.00 0.00 ? 71  GLY A HA2  6  
ATOM 9014  H HA3  . GLY A 1 71  ? 5.356   -14.796 6.491   1.00 0.00 ? 71  GLY A HA3  6  
ATOM 9015  N N    . GLN A 1 72  ? 2.535   -13.190 6.709   1.00 0.00 ? 72  GLN A N    6  
ATOM 9016  C CA   . GLN A 1 72  ? 1.129   -13.319 7.075   1.00 0.00 ? 72  GLN A CA   6  
ATOM 9017  C C    . GLN A 1 72  ? 0.287   -12.249 6.387   1.00 0.00 ? 72  GLN A C    6  
ATOM 9018  O O    . GLN A 1 72  ? 0.734   -11.125 6.158   1.00 0.00 ? 72  GLN A O    6  
ATOM 9019  C CB   . GLN A 1 72  ? 0.964   -13.218 8.592   1.00 0.00 ? 72  GLN A CB   6  
ATOM 9020  C CG   . GLN A 1 72  ? 1.835   -14.195 9.365   1.00 0.00 ? 72  GLN A CG   6  
ATOM 9021  C CD   . GLN A 1 72  ? 1.586   -14.142 10.859  1.00 0.00 ? 72  GLN A CD   6  
ATOM 9022  O OE1  . GLN A 1 72  ? 1.369   -13.071 11.427  1.00 0.00 ? 72  GLN A OE1  6  
ATOM 9023  N NE2  . GLN A 1 72  ? 1.616   -15.302 11.506  1.00 0.00 ? 72  GLN A NE2  6  
ATOM 9024  H H    . GLN A 1 72  ? 2.924   -12.296 6.617   1.00 0.00 ? 72  GLN A H    6  
ATOM 9025  H HA   . GLN A 1 72  ? 0.790   -14.291 6.749   1.00 0.00 ? 72  GLN A HA   6  
ATOM 9026  H HB2  . GLN A 1 72  ? 1.218   -12.216 8.904   1.00 0.00 ? 72  GLN A HB2  6  
ATOM 9027  H HB3  . GLN A 1 72  ? -0.068  -13.414 8.843   1.00 0.00 ? 72  GLN A HB3  6  
ATOM 9028  H HG2  . GLN A 1 72  ? 1.629   -15.196 9.017   1.00 0.00 ? 72  GLN A HG2  6  
ATOM 9029  H HG3  . GLN A 1 72  ? 2.872   -13.957 9.179   1.00 0.00 ? 72  GLN A HG3  6  
ATOM 9030  H HE21 . GLN A 1 72  ? 1.797   -16.115 10.989  1.00 0.00 ? 72  GLN A HE21 6  
ATOM 9031  H HE22 . GLN A 1 72  ? 1.459   -15.297 12.472  1.00 0.00 ? 72  GLN A HE22 6  
ATOM 9032  N N    . PRO A 1 73  ? -0.962  -12.605 6.050   1.00 0.00 ? 73  PRO A N    6  
ATOM 9033  C CA   . PRO A 1 73  ? -1.893  -11.689 5.384   1.00 0.00 ? 73  PRO A CA   6  
ATOM 9034  C C    . PRO A 1 73  ? -2.356  -10.564 6.303   1.00 0.00 ? 73  PRO A C    6  
ATOM 9035  O O    . PRO A 1 73  ? -3.077  -10.800 7.273   1.00 0.00 ? 73  PRO A O    6  
ATOM 9036  C CB   . PRO A 1 73  ? -3.070  -12.592 5.008   1.00 0.00 ? 73  PRO A CB   6  
ATOM 9037  C CG   . PRO A 1 73  ? -3.018  -13.712 5.989   1.00 0.00 ? 73  PRO A CG   6  
ATOM 9038  C CD   . PRO A 1 73  ? -1.561  -13.928 6.293   1.00 0.00 ? 73  PRO A CD   6  
ATOM 9039  H HA   . PRO A 1 73  ? -1.461  -11.266 4.489   1.00 0.00 ? 73  PRO A HA   6  
ATOM 9040  H HB2  . PRO A 1 73  ? -3.994  -12.036 5.090   1.00 0.00 ? 73  PRO A HB2  6  
ATOM 9041  H HB3  . PRO A 1 73  ? -2.947  -12.948 3.996   1.00 0.00 ? 73  PRO A HB3  6  
ATOM 9042  H HG2  . PRO A 1 73  ? -3.551  -13.439 6.886   1.00 0.00 ? 73  PRO A HG2  6  
ATOM 9043  H HG3  . PRO A 1 73  ? -3.445  -14.602 5.552   1.00 0.00 ? 73  PRO A HG3  6  
ATOM 9044  H HD2  . PRO A 1 73  ? -1.431  -14.227 7.322   1.00 0.00 ? 73  PRO A HD2  6  
ATOM 9045  H HD3  . PRO A 1 73  ? -1.142  -14.668 5.627   1.00 0.00 ? 73  PRO A HD3  6  
ATOM 9046  N N    . ILE A 1 74  ? -1.939  -9.342  5.991   1.00 0.00 ? 74  ILE A N    6  
ATOM 9047  C CA   . ILE A 1 74  ? -2.314  -8.181  6.789   1.00 0.00 ? 74  ILE A CA   6  
ATOM 9048  C C    . ILE A 1 74  ? -3.556  -7.502  6.222   1.00 0.00 ? 74  ILE A C    6  
ATOM 9049  O O    . ILE A 1 74  ? -3.786  -7.516  5.013   1.00 0.00 ? 74  ILE A O    6  
ATOM 9050  C CB   . ILE A 1 74  ? -1.168  -7.154  6.860   1.00 0.00 ? 74  ILE A CB   6  
ATOM 9051  C CG1  . ILE A 1 74  ? -0.553  -6.946  5.475   1.00 0.00 ? 74  ILE A CG1  6  
ATOM 9052  C CG2  . ILE A 1 74  ? -0.110  -7.609  7.854   1.00 0.00 ? 74  ILE A CG2  6  
ATOM 9053  C CD1  . ILE A 1 74  ? 0.072   -5.581  5.290   1.00 0.00 ? 74  ILE A CD1  6  
ATOM 9054  H H    . ILE A 1 74  ? -1.367  -9.218  5.206   1.00 0.00 ? 74  ILE A H    6  
ATOM 9055  H HA   . ILE A 1 74  ? -2.529  -8.521  7.792   1.00 0.00 ? 74  ILE A HA   6  
ATOM 9056  H HB   . ILE A 1 74  ? -1.576  -6.217  7.209   1.00 0.00 ? 74  ILE A HB   6  
ATOM 9057  H HG12 . ILE A 1 74  ? 0.215   -7.686  5.315   1.00 0.00 ? 74  ILE A HG12 6  
ATOM 9058  H HG13 . ILE A 1 74  ? -1.322  -7.065  4.726   1.00 0.00 ? 74  ILE A HG13 6  
ATOM 9059  H HG21 . ILE A 1 74  ? -0.591  -7.984  8.745   1.00 0.00 ? 74  ILE A HG21 6  
ATOM 9060  H HG22 . ILE A 1 74  ? 0.486   -8.393  7.410   1.00 0.00 ? 74  ILE A HG22 6  
ATOM 9061  H HG23 . ILE A 1 74  ? 0.525   -6.775  8.111   1.00 0.00 ? 74  ILE A HG23 6  
ATOM 9062  H HD11 . ILE A 1 74  ? 0.529   -5.265  6.216   1.00 0.00 ? 74  ILE A HD11 6  
ATOM 9063  H HD12 . ILE A 1 74  ? 0.822   -5.630  4.515   1.00 0.00 ? 74  ILE A HD12 6  
ATOM 9064  H HD13 . ILE A 1 74  ? -0.692  -4.871  5.006   1.00 0.00 ? 74  ILE A HD13 6  
ATOM 9065  N N    . ASN A 1 75  ? -4.352  -6.906  7.103   1.00 0.00 ? 75  ASN A N    6  
ATOM 9066  C CA   . ASN A 1 75  ? -5.571  -6.219  6.690   1.00 0.00 ? 75  ASN A CA   6  
ATOM 9067  C C    . ASN A 1 75  ? -5.465  -4.720  6.950   1.00 0.00 ? 75  ASN A C    6  
ATOM 9068  O O    . ASN A 1 75  ? -4.858  -4.291  7.931   1.00 0.00 ? 75  ASN A O    6  
ATOM 9069  C CB   . ASN A 1 75  ? -6.780  -6.793  7.432   1.00 0.00 ? 75  ASN A CB   6  
ATOM 9070  C CG   . ASN A 1 75  ? -6.899  -8.296  7.270   1.00 0.00 ? 75  ASN A CG   6  
ATOM 9071  O OD1  . ASN A 1 75  ? -7.033  -9.028  8.250   1.00 0.00 ? 75  ASN A OD1  6  
ATOM 9072  N ND2  . ASN A 1 75  ? -6.848  -8.762  6.028   1.00 0.00 ? 75  ASN A ND2  6  
ATOM 9073  H H    . ASN A 1 75  ? -4.115  -6.928  8.054   1.00 0.00 ? 75  ASN A H    6  
ATOM 9074  H HA   . ASN A 1 75  ? -5.700  -6.381  5.631   1.00 0.00 ? 75  ASN A HA   6  
ATOM 9075  H HB2  . ASN A 1 75  ? -6.688  -6.570  8.485   1.00 0.00 ? 75  ASN A HB2  6  
ATOM 9076  H HB3  . ASN A 1 75  ? -7.680  -6.335  7.049   1.00 0.00 ? 75  ASN A HB3  6  
ATOM 9077  H HD21 . ASN A 1 75  ? -6.739  -8.120  5.295   1.00 0.00 ? 75  ASN A HD21 6  
ATOM 9078  H HD22 . ASN A 1 75  ? -6.923  -9.730  5.894   1.00 0.00 ? 75  ASN A HD22 6  
ATOM 9079  N N    . GLU A 1 76  ? -6.061  -3.928  6.064   1.00 0.00 ? 76  GLU A N    6  
ATOM 9080  C CA   . GLU A 1 76  ? -6.033  -2.476  6.198   1.00 0.00 ? 76  GLU A CA   6  
ATOM 9081  C C    . GLU A 1 76  ? -6.444  -2.051  7.605   1.00 0.00 ? 76  GLU A C    6  
ATOM 9082  O O    . GLU A 1 76  ? -5.829  -1.169  8.205   1.00 0.00 ? 76  GLU A O    6  
ATOM 9083  C CB   . GLU A 1 76  ? -6.960  -1.829  5.167   1.00 0.00 ? 76  GLU A CB   6  
ATOM 9084  C CG   . GLU A 1 76  ? -8.352  -2.437  5.133   1.00 0.00 ? 76  GLU A CG   6  
ATOM 9085  C CD   . GLU A 1 76  ? -9.247  -1.790  4.093   1.00 0.00 ? 76  GLU A CD   6  
ATOM 9086  O OE1  . GLU A 1 76  ? -8.746  -1.471  2.995   1.00 0.00 ? 76  GLU A OE1  6  
ATOM 9087  O OE2  . GLU A 1 76  ? -10.448 -1.603  4.378   1.00 0.00 ? 76  GLU A OE2  6  
ATOM 9088  H H    . GLU A 1 76  ? -6.530  -4.329  5.303   1.00 0.00 ? 76  GLU A H    6  
ATOM 9089  H HA   . GLU A 1 76  ? -5.022  -2.145  6.016   1.00 0.00 ? 76  GLU A HA   6  
ATOM 9090  H HB2  . GLU A 1 76  ? -7.054  -0.777  5.395   1.00 0.00 ? 76  GLU A HB2  6  
ATOM 9091  H HB3  . GLU A 1 76  ? -6.520  -1.937  4.187   1.00 0.00 ? 76  GLU A HB3  6  
ATOM 9092  H HG2  . GLU A 1 76  ? -8.266  -3.489  4.907   1.00 0.00 ? 76  GLU A HG2  6  
ATOM 9093  H HG3  . GLU A 1 76  ? -8.808  -2.314  6.105   1.00 0.00 ? 76  GLU A HG3  6  
ATOM 9094  N N    . THR A 1 77  ? -7.490  -2.686  8.127   1.00 0.00 ? 77  THR A N    6  
ATOM 9095  C CA   . THR A 1 77  ? -7.985  -2.374  9.461   1.00 0.00 ? 77  THR A CA   6  
ATOM 9096  C C    . THR A 1 77  ? -6.860  -2.418  10.489  1.00 0.00 ? 77  THR A C    6  
ATOM 9097  O O    . THR A 1 77  ? -6.708  -1.502  11.297  1.00 0.00 ? 77  THR A O    6  
ATOM 9098  C CB   . THR A 1 77  ? -9.096  -3.350  9.891   1.00 0.00 ? 77  THR A CB   6  
ATOM 9099  O OG1  . THR A 1 77  ? -8.609  -4.696  9.849   1.00 0.00 ? 77  THR A OG1  6  
ATOM 9100  C CG2  . THR A 1 77  ? -10.312 -3.217  8.986   1.00 0.00 ? 77  THR A CG2  6  
ATOM 9101  H H    . THR A 1 77  ? -7.938  -3.379  7.599   1.00 0.00 ? 77  THR A H    6  
ATOM 9102  H HA   . THR A 1 77  ? -8.400  -1.376  9.438   1.00 0.00 ? 77  THR A HA   6  
ATOM 9103  H HB   . THR A 1 77  ? -9.392  -3.113  10.903  1.00 0.00 ? 77  THR A HB   6  
ATOM 9104  H HG1  . THR A 1 77  ? -8.985  -5.195  10.579  1.00 0.00 ? 77  THR A HG1  6  
ATOM 9105  H HG21 . THR A 1 77  ? -10.033 -2.699  8.081   1.00 0.00 ? 77  THR A HG21 6  
ATOM 9106  H HG22 . THR A 1 77  ? -11.082 -2.660  9.497   1.00 0.00 ? 77  THR A HG22 6  
ATOM 9107  H HG23 . THR A 1 77  ? -10.684 -4.200  8.737   1.00 0.00 ? 77  THR A HG23 6  
ATOM 9108  N N    . ASP A 1 78  ? -6.074  -3.488  10.453  1.00 0.00 ? 78  ASP A N    6  
ATOM 9109  C CA   . ASP A 1 78  ? -4.961  -3.651  11.381  1.00 0.00 ? 78  ASP A CA   6  
ATOM 9110  C C    . ASP A 1 78  ? -3.996  -2.474  11.284  1.00 0.00 ? 78  ASP A C    6  
ATOM 9111  O O    . ASP A 1 78  ? -3.934  -1.789  10.262  1.00 0.00 ? 78  ASP A O    6  
ATOM 9112  C CB   . ASP A 1 78  ? -4.220  -4.959  11.098  1.00 0.00 ? 78  ASP A CB   6  
ATOM 9113  C CG   . ASP A 1 78  ? -4.892  -6.156  11.740  1.00 0.00 ? 78  ASP A CG   6  
ATOM 9114  O OD1  . ASP A 1 78  ? -5.598  -5.967  12.753  1.00 0.00 ? 78  ASP A OD1  6  
ATOM 9115  O OD2  . ASP A 1 78  ? -4.712  -7.282  11.231  1.00 0.00 ? 78  ASP A OD2  6  
ATOM 9116  H H    . ASP A 1 78  ? -6.246  -4.185  9.785   1.00 0.00 ? 78  ASP A H    6  
ATOM 9117  H HA   . ASP A 1 78  ? -5.366  -3.687  12.381  1.00 0.00 ? 78  ASP A HA   6  
ATOM 9118  H HB2  . ASP A 1 78  ? -4.183  -5.120  10.030  1.00 0.00 ? 78  ASP A HB2  6  
ATOM 9119  H HB3  . ASP A 1 78  ? -3.213  -4.885  11.482  1.00 0.00 ? 78  ASP A HB3  6  
ATOM 9120  N N    . THR A 1 79  ? -3.243  -2.242  12.355  1.00 0.00 ? 79  THR A N    6  
ATOM 9121  C CA   . THR A 1 79  ? -2.283  -1.146  12.392  1.00 0.00 ? 79  THR A CA   6  
ATOM 9122  C C    . THR A 1 79  ? -0.851  -1.670  12.385  1.00 0.00 ? 79  THR A C    6  
ATOM 9123  O O    . THR A 1 79  ? -0.582  -2.816  12.744  1.00 0.00 ? 79  THR A O    6  
ATOM 9124  C CB   . THR A 1 79  ? -2.488  -0.261  13.636  1.00 0.00 ? 79  THR A CB   6  
ATOM 9125  O OG1  . THR A 1 79  ? -2.993  -1.049  14.720  1.00 0.00 ? 79  THR A OG1  6  
ATOM 9126  C CG2  . THR A 1 79  ? -3.452  0.877   13.337  1.00 0.00 ? 79  THR A CG2  6  
ATOM 9127  H H    . THR A 1 79  ? -3.338  -2.822  13.139  1.00 0.00 ? 79  THR A H    6  
ATOM 9128  H HA   . THR A 1 79  ? -2.438  -0.537  11.513  1.00 0.00 ? 79  THR A HA   6  
ATOM 9129  H HB   . THR A 1 79  ? -1.534  0.160   13.920  1.00 0.00 ? 79  THR A HB   6  
ATOM 9130  H HG1  . THR A 1 79  ? -2.443  -1.828  14.832  1.00 0.00 ? 79  THR A HG1  6  
ATOM 9131  H HG21 . THR A 1 79  ? -4.334  0.773   13.953  1.00 0.00 ? 79  THR A HG21 6  
ATOM 9132  H HG22 . THR A 1 79  ? -3.734  0.846   12.295  1.00 0.00 ? 79  THR A HG22 6  
ATOM 9133  H HG23 . THR A 1 79  ? -2.973  1.820   13.552  1.00 0.00 ? 79  THR A HG23 6  
ATOM 9134  N N    . PRO A 1 80  ? 0.091   -0.811  11.968  1.00 0.00 ? 80  PRO A N    6  
ATOM 9135  C CA   . PRO A 1 80  ? 1.512   -1.165  11.906  1.00 0.00 ? 80  PRO A CA   6  
ATOM 9136  C C    . PRO A 1 80  ? 2.131   -1.325  13.290  1.00 0.00 ? 80  PRO A C    6  
ATOM 9137  O O    . PRO A 1 80  ? 3.257   -1.804  13.426  1.00 0.00 ? 80  PRO A O    6  
ATOM 9138  C CB   . PRO A 1 80  ? 2.142   0.022   11.172  1.00 0.00 ? 80  PRO A CB   6  
ATOM 9139  C CG   . PRO A 1 80  ? 1.222   1.163   11.439  1.00 0.00 ? 80  PRO A CG   6  
ATOM 9140  C CD   . PRO A 1 80  ? -0.158  0.571   11.526  1.00 0.00 ? 80  PRO A CD   6  
ATOM 9141  H HA   . PRO A 1 80  ? 1.672   -2.069  11.335  1.00 0.00 ? 80  PRO A HA   6  
ATOM 9142  H HB2  . PRO A 1 80  ? 3.130   0.209   11.567  1.00 0.00 ? 80  PRO A HB2  6  
ATOM 9143  H HB3  . PRO A 1 80  ? 2.205   -0.196  10.117  1.00 0.00 ? 80  PRO A HB3  6  
ATOM 9144  H HG2  . PRO A 1 80  ? 1.486   1.637   12.372  1.00 0.00 ? 80  PRO A HG2  6  
ATOM 9145  H HG3  . PRO A 1 80  ? 1.274   1.873   10.627  1.00 0.00 ? 80  PRO A HG3  6  
ATOM 9146  H HD2  . PRO A 1 80  ? -0.753  1.106   12.250  1.00 0.00 ? 80  PRO A HD2  6  
ATOM 9147  H HD3  . PRO A 1 80  ? -0.636  0.585   10.557  1.00 0.00 ? 80  PRO A HD3  6  
ATOM 9148  N N    . ALA A 1 81  ? 1.389   -0.921  14.315  1.00 0.00 ? 81  ALA A N    6  
ATOM 9149  C CA   . ALA A 1 81  ? 1.864   -1.021  15.690  1.00 0.00 ? 81  ALA A CA   6  
ATOM 9150  C C    . ALA A 1 81  ? 1.465   -2.355  16.312  1.00 0.00 ? 81  ALA A C    6  
ATOM 9151  O O    . ALA A 1 81  ? 2.152   -2.868  17.195  1.00 0.00 ? 81  ALA A O    6  
ATOM 9152  C CB   . ALA A 1 81  ? 1.325   0.133   16.521  1.00 0.00 ? 81  ALA A CB   6  
ATOM 9153  H H    . ALA A 1 81  ? 0.499   -0.547  14.143  1.00 0.00 ? 81  ALA A H    6  
ATOM 9154  H HA   . ALA A 1 81  ? 2.942   -0.950  15.676  1.00 0.00 ? 81  ALA A HA   6  
ATOM 9155  H HB1  . ALA A 1 81  ? 2.149   0.668   16.970  1.00 0.00 ? 81  ALA A HB1  6  
ATOM 9156  H HB2  . ALA A 1 81  ? 0.765   0.803   15.885  1.00 0.00 ? 81  ALA A HB2  6  
ATOM 9157  H HB3  . ALA A 1 81  ? 0.679   -0.252  17.296  1.00 0.00 ? 81  ALA A HB3  6  
ATOM 9158  N N    . GLN A 1 82  ? 0.351   -2.911  15.846  1.00 0.00 ? 82  GLN A N    6  
ATOM 9159  C CA   . GLN A 1 82  ? -0.138  -4.185  16.359  1.00 0.00 ? 82  GLN A CA   6  
ATOM 9160  C C    . GLN A 1 82  ? 0.784   -5.328  15.949  1.00 0.00 ? 82  GLN A C    6  
ATOM 9161  O O    . GLN A 1 82  ? 0.991   -6.276  16.707  1.00 0.00 ? 82  GLN A O    6  
ATOM 9162  C CB   . GLN A 1 82  ? -1.557  -4.451  15.853  1.00 0.00 ? 82  GLN A CB   6  
ATOM 9163  C CG   . GLN A 1 82  ? -2.330  -5.446  16.703  1.00 0.00 ? 82  GLN A CG   6  
ATOM 9164  C CD   . GLN A 1 82  ? -3.824  -5.390  16.454  1.00 0.00 ? 82  GLN A CD   6  
ATOM 9165  O OE1  . GLN A 1 82  ? -4.270  -5.236  15.317  1.00 0.00 ? 82  GLN A OE1  6  
ATOM 9166  N NE2  . GLN A 1 82  ? -4.607  -5.515  17.519  1.00 0.00 ? 82  GLN A NE2  6  
ATOM 9167  H H    . GLN A 1 82  ? -0.152  -2.454  15.142  1.00 0.00 ? 82  GLN A H    6  
ATOM 9168  H HA   . GLN A 1 82  ? -0.156  -4.123  17.437  1.00 0.00 ? 82  GLN A HA   6  
ATOM 9169  H HB2  . GLN A 1 82  ? -2.103  -3.519  15.841  1.00 0.00 ? 82  GLN A HB2  6  
ATOM 9170  H HB3  . GLN A 1 82  ? -1.500  -4.839  14.847  1.00 0.00 ? 82  GLN A HB3  6  
ATOM 9171  H HG2  . GLN A 1 82  ? -1.980  -6.442  16.476  1.00 0.00 ? 82  GLN A HG2  6  
ATOM 9172  H HG3  . GLN A 1 82  ? -2.145  -5.229  17.745  1.00 0.00 ? 82  GLN A HG3  6  
ATOM 9173  H HE21 . GLN A 1 82  ? -4.182  -5.634  18.395  1.00 0.00 ? 82  GLN A HE21 6  
ATOM 9174  H HE22 . GLN A 1 82  ? -5.577  -5.482  17.387  1.00 0.00 ? 82  GLN A HE22 6  
ATOM 9175  N N    . LEU A 1 83  ? 1.335   -5.233  14.744  1.00 0.00 ? 83  LEU A N    6  
ATOM 9176  C CA   . LEU A 1 83  ? 2.235   -6.260  14.231  1.00 0.00 ? 83  LEU A CA   6  
ATOM 9177  C C    . LEU A 1 83  ? 3.682   -5.948  14.600  1.00 0.00 ? 83  LEU A C    6  
ATOM 9178  O O    . LEU A 1 83  ? 4.601   -6.667  14.208  1.00 0.00 ? 83  LEU A O    6  
ATOM 9179  C CB   . LEU A 1 83  ? 2.098   -6.375  12.712  1.00 0.00 ? 83  LEU A CB   6  
ATOM 9180  C CG   . LEU A 1 83  ? 0.669   -6.415  12.169  1.00 0.00 ? 83  LEU A CG   6  
ATOM 9181  C CD1  . LEU A 1 83  ? 0.644   -6.015  10.702  1.00 0.00 ? 83  LEU A CD1  6  
ATOM 9182  C CD2  . LEU A 1 83  ? 0.066   -7.800  12.356  1.00 0.00 ? 83  LEU A CD2  6  
ATOM 9183  H H    . LEU A 1 83  ? 1.132   -4.454  14.185  1.00 0.00 ? 83  LEU A H    6  
ATOM 9184  H HA   . LEU A 1 83  ? 1.956   -7.200  14.682  1.00 0.00 ? 83  LEU A HA   6  
ATOM 9185  H HB2  . LEU A 1 83  ? 2.596   -5.525  12.270  1.00 0.00 ? 83  LEU A HB2  6  
ATOM 9186  H HB3  . LEU A 1 83  ? 2.596   -7.283  12.403  1.00 0.00 ? 83  LEU A HB3  6  
ATOM 9187  H HG   . LEU A 1 83  ? 0.062   -5.708  12.717  1.00 0.00 ? 83  LEU A HG   6  
ATOM 9188  H HD11 . LEU A 1 83  ? 0.359   -6.866  10.101  1.00 0.00 ? 83  LEU A HD11 6  
ATOM 9189  H HD12 . LEU A 1 83  ? 1.626   -5.677  10.404  1.00 0.00 ? 83  LEU A HD12 6  
ATOM 9190  H HD13 . LEU A 1 83  ? -0.069  -5.217  10.558  1.00 0.00 ? 83  LEU A HD13 6  
ATOM 9191  H HD21 . LEU A 1 83  ? -0.048  -8.002  13.411  1.00 0.00 ? 83  LEU A HD21 6  
ATOM 9192  H HD22 . LEU A 1 83  ? 0.720   -8.539  11.917  1.00 0.00 ? 83  LEU A HD22 6  
ATOM 9193  H HD23 . LEU A 1 83  ? -0.899  -7.840  11.875  1.00 0.00 ? 83  LEU A HD23 6  
ATOM 9194  N N    . GLU A 1 84  ? 3.876   -4.874  15.358  1.00 0.00 ? 84  GLU A N    6  
ATOM 9195  C CA   . GLU A 1 84  ? 5.212   -4.469  15.781  1.00 0.00 ? 84  GLU A CA   6  
ATOM 9196  C C    . GLU A 1 84  ? 6.085   -4.131  14.576  1.00 0.00 ? 84  GLU A C    6  
ATOM 9197  O O    . GLU A 1 84  ? 7.284   -4.408  14.568  1.00 0.00 ? 84  GLU A O    6  
ATOM 9198  C CB   . GLU A 1 84  ? 5.868   -5.579  16.605  1.00 0.00 ? 84  GLU A CB   6  
ATOM 9199  C CG   . GLU A 1 84  ? 5.113   -5.919  17.879  1.00 0.00 ? 84  GLU A CG   6  
ATOM 9200  C CD   . GLU A 1 84  ? 6.010   -6.510  18.949  1.00 0.00 ? 84  GLU A CD   6  
ATOM 9201  O OE1  . GLU A 1 84  ? 7.179   -6.081  19.047  1.00 0.00 ? 84  GLU A OE1  6  
ATOM 9202  O OE2  . GLU A 1 84  ? 5.543   -7.401  19.689  1.00 0.00 ? 84  GLU A OE2  6  
ATOM 9203  H H    . GLU A 1 84  ? 3.104   -4.341  15.639  1.00 0.00 ? 84  GLU A H    6  
ATOM 9204  H HA   . GLU A 1 84  ? 5.112   -3.588  16.397  1.00 0.00 ? 84  GLU A HA   6  
ATOM 9205  H HB2  . GLU A 1 84  ? 5.932   -6.471  15.999  1.00 0.00 ? 84  GLU A HB2  6  
ATOM 9206  H HB3  . GLU A 1 84  ? 6.866   -5.267  16.876  1.00 0.00 ? 84  GLU A HB3  6  
ATOM 9207  H HG2  . GLU A 1 84  ? 4.662   -5.018  18.266  1.00 0.00 ? 84  GLU A HG2  6  
ATOM 9208  H HG3  . GLU A 1 84  ? 4.340   -6.635  17.643  1.00 0.00 ? 84  GLU A HG3  6  
ATOM 9209  N N    . MET A 1 85  ? 5.474   -3.532  13.560  1.00 0.00 ? 85  MET A N    6  
ATOM 9210  C CA   . MET A 1 85  ? 6.195   -3.155  12.349  1.00 0.00 ? 85  MET A CA   6  
ATOM 9211  C C    . MET A 1 85  ? 7.448   -2.355  12.690  1.00 0.00 ? 85  MET A C    6  
ATOM 9212  O O    . MET A 1 85  ? 7.365   -1.190  13.077  1.00 0.00 ? 85  MET A O    6  
ATOM 9213  C CB   . MET A 1 85  ? 5.291   -2.339  11.424  1.00 0.00 ? 85  MET A CB   6  
ATOM 9214  C CG   . MET A 1 85  ? 4.131   -3.136  10.850  1.00 0.00 ? 85  MET A CG   6  
ATOM 9215  S SD   . MET A 1 85  ? 3.438   -2.383  9.365   1.00 0.00 ? 85  MET A SD   6  
ATOM 9216  C CE   . MET A 1 85  ? 3.516   -3.758  8.220   1.00 0.00 ? 85  MET A CE   6  
ATOM 9217  H H    . MET A 1 85  ? 4.515   -3.337  13.625  1.00 0.00 ? 85  MET A H    6  
ATOM 9218  H HA   . MET A 1 85  ? 6.488   -4.063  11.843  1.00 0.00 ? 85  MET A HA   6  
ATOM 9219  H HB2  . MET A 1 85  ? 4.887   -1.505  11.979  1.00 0.00 ? 85  MET A HB2  6  
ATOM 9220  H HB3  . MET A 1 85  ? 5.881   -1.962  10.603  1.00 0.00 ? 85  MET A HB3  6  
ATOM 9221  H HG2  . MET A 1 85  ? 4.479   -4.128  10.603  1.00 0.00 ? 85  MET A HG2  6  
ATOM 9222  H HG3  . MET A 1 85  ? 3.355   -3.205  11.598  1.00 0.00 ? 85  MET A HG3  6  
ATOM 9223  H HE1  . MET A 1 85  ? 4.325   -4.416  8.502   1.00 0.00 ? 85  MET A HE1  6  
ATOM 9224  H HE2  . MET A 1 85  ? 2.583   -4.302  8.247   1.00 0.00 ? 85  MET A HE2  6  
ATOM 9225  H HE3  . MET A 1 85  ? 3.688   -3.385  7.221   1.00 0.00 ? 85  MET A HE3  6  
ATOM 9226  N N    . GLU A 1 86  ? 8.608   -2.990  12.544  1.00 0.00 ? 86  GLU A N    6  
ATOM 9227  C CA   . GLU A 1 86  ? 9.877   -2.336  12.838  1.00 0.00 ? 86  GLU A CA   6  
ATOM 9228  C C    . GLU A 1 86  ? 10.214  -1.296  11.773  1.00 0.00 ? 86  GLU A C    6  
ATOM 9229  O O    . GLU A 1 86  ? 9.540   -1.204  10.746  1.00 0.00 ? 86  GLU A O    6  
ATOM 9230  C CB   . GLU A 1 86  ? 11.001  -3.371  12.928  1.00 0.00 ? 86  GLU A CB   6  
ATOM 9231  C CG   . GLU A 1 86  ? 10.895  -4.279  14.142  1.00 0.00 ? 86  GLU A CG   6  
ATOM 9232  C CD   . GLU A 1 86  ? 10.522  -3.526  15.404  1.00 0.00 ? 86  GLU A CD   6  
ATOM 9233  O OE1  . GLU A 1 86  ? 11.067  -2.424  15.621  1.00 0.00 ? 86  GLU A OE1  6  
ATOM 9234  O OE2  . GLU A 1 86  ? 9.684   -4.040  16.175  1.00 0.00 ? 86  GLU A OE2  6  
ATOM 9235  H H    . GLU A 1 86  ? 8.609   -3.918  12.232  1.00 0.00 ? 86  GLU A H    6  
ATOM 9236  H HA   . GLU A 1 86  ? 9.782   -1.838  13.791  1.00 0.00 ? 86  GLU A HA   6  
ATOM 9237  H HB2  . GLU A 1 86  ? 10.980  -3.986  12.041  1.00 0.00 ? 86  GLU A HB2  6  
ATOM 9238  H HB3  . GLU A 1 86  ? 11.947  -2.853  12.974  1.00 0.00 ? 86  GLU A HB3  6  
ATOM 9239  H HG2  . GLU A 1 86  ? 10.140  -5.027  13.951  1.00 0.00 ? 86  GLU A HG2  6  
ATOM 9240  H HG3  . GLU A 1 86  ? 11.848  -4.764  14.297  1.00 0.00 ? 86  GLU A HG3  6  
ATOM 9241  N N    . ASP A 1 87  ? 11.258  -0.516  12.025  1.00 0.00 ? 87  ASP A N    6  
ATOM 9242  C CA   . ASP A 1 87  ? 11.685  0.517   11.088  1.00 0.00 ? 87  ASP A CA   6  
ATOM 9243  C C    . ASP A 1 87  ? 12.274  -0.104  9.826   1.00 0.00 ? 87  ASP A C    6  
ATOM 9244  O O    . ASP A 1 87  ? 12.759  -1.234  9.848   1.00 0.00 ? 87  ASP A O    6  
ATOM 9245  C CB   . ASP A 1 87  ? 12.713  1.439   11.746  1.00 0.00 ? 87  ASP A CB   6  
ATOM 9246  C CG   . ASP A 1 87  ? 13.625  0.698   12.705  1.00 0.00 ? 87  ASP A CG   6  
ATOM 9247  O OD1  . ASP A 1 87  ? 13.745  -0.538  12.575  1.00 0.00 ? 87  ASP A OD1  6  
ATOM 9248  O OD2  . ASP A 1 87  ? 14.218  1.355   13.586  1.00 0.00 ? 87  ASP A OD2  6  
ATOM 9249  H H    . ASP A 1 87  ? 11.755  -0.638  12.861  1.00 0.00 ? 87  ASP A H    6  
ATOM 9250  H HA   . ASP A 1 87  ? 10.817  1.098   10.817  1.00 0.00 ? 87  ASP A HA   6  
ATOM 9251  H HB2  . ASP A 1 87  ? 13.323  1.894   10.979  1.00 0.00 ? 87  ASP A HB2  6  
ATOM 9252  H HB3  . ASP A 1 87  ? 12.196  2.212   12.294  1.00 0.00 ? 87  ASP A HB3  6  
ATOM 9253  N N    . GLU A 1 88  ? 12.227  0.643   8.727   1.00 0.00 ? 88  GLU A N    6  
ATOM 9254  C CA   . GLU A 1 88  ? 12.755  0.164   7.455   1.00 0.00 ? 88  GLU A CA   6  
ATOM 9255  C C    . GLU A 1 88  ? 12.343  -1.284  7.206   1.00 0.00 ? 88  GLU A C    6  
ATOM 9256  O O    . GLU A 1 88  ? 13.124  -2.082  6.688   1.00 0.00 ? 88  GLU A O    6  
ATOM 9257  C CB   . GLU A 1 88  ? 14.280  0.283   7.433   1.00 0.00 ? 88  GLU A CB   6  
ATOM 9258  C CG   . GLU A 1 88  ? 14.969  -0.520  8.524   1.00 0.00 ? 88  GLU A CG   6  
ATOM 9259  C CD   . GLU A 1 88  ? 16.477  -0.548  8.364   1.00 0.00 ? 88  GLU A CD   6  
ATOM 9260  O OE1  . GLU A 1 88  ? 17.086  0.539   8.285   1.00 0.00 ? 88  GLU A OE1  6  
ATOM 9261  O OE2  . GLU A 1 88  ? 17.047  -1.659  8.317   1.00 0.00 ? 88  GLU A OE2  6  
ATOM 9262  H H    . GLU A 1 88  ? 11.828  1.537   8.773   1.00 0.00 ? 88  GLU A H    6  
ATOM 9263  H HA   . GLU A 1 88  ? 12.344  0.783   6.672   1.00 0.00 ? 88  GLU A HA   6  
ATOM 9264  H HB2  . GLU A 1 88  ? 14.643  -0.063  6.476   1.00 0.00 ? 88  GLU A HB2  6  
ATOM 9265  H HB3  . GLU A 1 88  ? 14.550  1.322   7.556   1.00 0.00 ? 88  GLU A HB3  6  
ATOM 9266  H HG2  . GLU A 1 88  ? 14.733  -0.081  9.481   1.00 0.00 ? 88  GLU A HG2  6  
ATOM 9267  H HG3  . GLU A 1 88  ? 14.600  -1.535  8.494   1.00 0.00 ? 88  GLU A HG3  6  
ATOM 9268  N N    . ASP A 1 89  ? 11.112  -1.615  7.579   1.00 0.00 ? 89  ASP A N    6  
ATOM 9269  C CA   . ASP A 1 89  ? 10.594  -2.966  7.396   1.00 0.00 ? 89  ASP A CA   6  
ATOM 9270  C C    . ASP A 1 89  ? 10.456  -3.299  5.914   1.00 0.00 ? 89  ASP A C    6  
ATOM 9271  O O    . ASP A 1 89  ? 10.845  -2.512  5.050   1.00 0.00 ? 89  ASP A O    6  
ATOM 9272  C CB   . ASP A 1 89  ? 9.242   -3.116  8.094   1.00 0.00 ? 89  ASP A CB   6  
ATOM 9273  C CG   . ASP A 1 89  ? 8.951   -4.549  8.492   1.00 0.00 ? 89  ASP A CG   6  
ATOM 9274  O OD1  . ASP A 1 89  ? 8.393   -5.294  7.660   1.00 0.00 ? 89  ASP A OD1  6  
ATOM 9275  O OD2  . ASP A 1 89  ? 9.282   -4.926  9.636   1.00 0.00 ? 89  ASP A OD2  6  
ATOM 9276  H H    . ASP A 1 89  ? 10.536  -0.933  7.986   1.00 0.00 ? 89  ASP A H    6  
ATOM 9277  H HA   . ASP A 1 89  ? 11.297  -3.653  7.842   1.00 0.00 ? 89  ASP A HA   6  
ATOM 9278  H HB2  . ASP A 1 89  ? 9.234   -2.506  8.986   1.00 0.00 ? 89  ASP A HB2  6  
ATOM 9279  H HB3  . ASP A 1 89  ? 8.461   -2.781  7.427   1.00 0.00 ? 89  ASP A HB3  6  
ATOM 9280  N N    . THR A 1 90  ? 9.900   -4.471  5.625   1.00 0.00 ? 90  THR A N    6  
ATOM 9281  C CA   . THR A 1 90  ? 9.712   -4.910  4.248   1.00 0.00 ? 90  THR A CA   6  
ATOM 9282  C C    . THR A 1 90  ? 8.387   -5.644  4.081   1.00 0.00 ? 90  THR A C    6  
ATOM 9283  O O    . THR A 1 90  ? 8.157   -6.679  4.706   1.00 0.00 ? 90  THR A O    6  
ATOM 9284  C CB   . THR A 1 90  ? 10.858  -5.832  3.791   1.00 0.00 ? 90  THR A CB   6  
ATOM 9285  O OG1  . THR A 1 90  ? 12.114  -5.160  3.933   1.00 0.00 ? 90  THR A OG1  6  
ATOM 9286  C CG2  . THR A 1 90  ? 10.666  -6.257  2.343   1.00 0.00 ? 90  THR A CG2  6  
ATOM 9287  H H    . THR A 1 90  ? 9.610   -5.055  6.357   1.00 0.00 ? 90  THR A H    6  
ATOM 9288  H HA   . THR A 1 90  ? 9.710   -4.033  3.616   1.00 0.00 ? 90  THR A HA   6  
ATOM 9289  H HB   . THR A 1 90  ? 10.858  -6.716  4.413   1.00 0.00 ? 90  THR A HB   6  
ATOM 9290  H HG1  . THR A 1 90  ? 12.319  -4.689  3.122   1.00 0.00 ? 90  THR A HG1  6  
ATOM 9291  H HG21 . THR A 1 90  ? 11.493  -6.881  2.038   1.00 0.00 ? 90  THR A HG21 6  
ATOM 9292  H HG22 . THR A 1 90  ? 10.624  -5.381  1.713   1.00 0.00 ? 90  THR A HG22 6  
ATOM 9293  H HG23 . THR A 1 90  ? 9.744   -6.811  2.250   1.00 0.00 ? 90  THR A HG23 6  
ATOM 9294  N N    . ILE A 1 91  ? 7.518   -5.101  3.233   1.00 0.00 ? 91  ILE A N    6  
ATOM 9295  C CA   . ILE A 1 91  ? 6.216   -5.706  2.983   1.00 0.00 ? 91  ILE A CA   6  
ATOM 9296  C C    . ILE A 1 91  ? 6.234   -6.541  1.707   1.00 0.00 ? 91  ILE A C    6  
ATOM 9297  O O    . ILE A 1 91  ? 6.940   -6.218  0.752   1.00 0.00 ? 91  ILE A O    6  
ATOM 9298  C CB   . ILE A 1 91  ? 5.112   -4.639  2.870   1.00 0.00 ? 91  ILE A CB   6  
ATOM 9299  C CG1  . ILE A 1 91  ? 5.276   -3.585  3.967   1.00 0.00 ? 91  ILE A CG1  6  
ATOM 9300  C CG2  . ILE A 1 91  ? 3.738   -5.288  2.953   1.00 0.00 ? 91  ILE A CG2  6  
ATOM 9301  C CD1  . ILE A 1 91  ? 4.089   -2.656  4.095   1.00 0.00 ? 91  ILE A CD1  6  
ATOM 9302  H H    . ILE A 1 91  ? 7.759   -4.275  2.765   1.00 0.00 ? 91  ILE A H    6  
ATOM 9303  H HA   . ILE A 1 91  ? 5.982   -6.351  3.819   1.00 0.00 ? 91  ILE A HA   6  
ATOM 9304  H HB   . ILE A 1 91  ? 5.200   -4.162  1.906   1.00 0.00 ? 91  ILE A HB   6  
ATOM 9305  H HG12 . ILE A 1 91  ? 5.414   -4.080  4.915   1.00 0.00 ? 91  ILE A HG12 6  
ATOM 9306  H HG13 . ILE A 1 91  ? 6.147   -2.983  3.749   1.00 0.00 ? 91  ILE A HG13 6  
ATOM 9307  H HG21 . ILE A 1 91  ? 3.200   -4.883  3.798   1.00 0.00 ? 91  ILE A HG21 6  
ATOM 9308  H HG22 . ILE A 1 91  ? 3.189   -5.084  2.046   1.00 0.00 ? 91  ILE A HG22 6  
ATOM 9309  H HG23 . ILE A 1 91  ? 3.850   -6.354  3.075   1.00 0.00 ? 91  ILE A HG23 6  
ATOM 9310  H HD11 . ILE A 1 91  ? 4.415   -1.709  4.498   1.00 0.00 ? 91  ILE A HD11 6  
ATOM 9311  H HD12 . ILE A 1 91  ? 3.645   -2.502  3.124   1.00 0.00 ? 91  ILE A HD12 6  
ATOM 9312  H HD13 . ILE A 1 91  ? 3.359   -3.097  4.759   1.00 0.00 ? 91  ILE A HD13 6  
ATOM 9313  N N    . ASP A 1 92  ? 5.451   -7.614  1.698   1.00 0.00 ? 92  ASP A N    6  
ATOM 9314  C CA   . ASP A 1 92  ? 5.374   -8.494  0.537   1.00 0.00 ? 92  ASP A CA   6  
ATOM 9315  C C    . ASP A 1 92  ? 4.031   -8.345  -0.170  1.00 0.00 ? 92  ASP A C    6  
ATOM 9316  O O    . ASP A 1 92  ? 2.976   -8.571  0.425   1.00 0.00 ? 92  ASP A O    6  
ATOM 9317  C CB   . ASP A 1 92  ? 5.584   -9.949  0.959   1.00 0.00 ? 92  ASP A CB   6  
ATOM 9318  C CG   . ASP A 1 92  ? 6.237   -10.779 -0.129  1.00 0.00 ? 92  ASP A CG   6  
ATOM 9319  O OD1  . ASP A 1 92  ? 5.584   -11.016 -1.166  1.00 0.00 ? 92  ASP A OD1  6  
ATOM 9320  O OD2  . ASP A 1 92  ? 7.401   -11.193 0.058   1.00 0.00 ? 92  ASP A OD2  6  
ATOM 9321  H H    . ASP A 1 92  ? 4.912   -7.819  2.490   1.00 0.00 ? 92  ASP A H    6  
ATOM 9322  H HA   . ASP A 1 92  ? 6.160   -8.211  -0.147  1.00 0.00 ? 92  ASP A HA   6  
ATOM 9323  H HB2  . ASP A 1 92  ? 6.217   -9.976  1.835   1.00 0.00 ? 92  ASP A HB2  6  
ATOM 9324  H HB3  . ASP A 1 92  ? 4.627   -10.389 1.198   1.00 0.00 ? 92  ASP A HB3  6  
ATOM 9325  N N    . VAL A 1 93  ? 4.076   -7.964  -1.442  1.00 0.00 ? 93  VAL A N    6  
ATOM 9326  C CA   . VAL A 1 93  ? 2.863   -7.784  -2.230  1.00 0.00 ? 93  VAL A CA   6  
ATOM 9327  C C    . VAL A 1 93  ? 2.979   -8.476  -3.584  1.00 0.00 ? 93  VAL A C    6  
ATOM 9328  O O    . VAL A 1 93  ? 4.081   -8.703  -4.084  1.00 0.00 ? 93  VAL A O    6  
ATOM 9329  C CB   . VAL A 1 93  ? 2.554   -6.292  -2.454  1.00 0.00 ? 93  VAL A CB   6  
ATOM 9330  C CG1  . VAL A 1 93  ? 1.327   -6.127  -3.338  1.00 0.00 ? 93  VAL A CG1  6  
ATOM 9331  C CG2  . VAL A 1 93  ? 2.361   -5.583  -1.122  1.00 0.00 ? 93  VAL A CG2  6  
ATOM 9332  H H    . VAL A 1 93  ? 4.947   -7.799  -1.861  1.00 0.00 ? 93  VAL A H    6  
ATOM 9333  H HA   . VAL A 1 93  ? 2.041   -8.222  -1.682  1.00 0.00 ? 93  VAL A HA   6  
ATOM 9334  H HB   . VAL A 1 93  ? 3.396   -5.842  -2.958  1.00 0.00 ? 93  VAL A HB   6  
ATOM 9335  H HG11 . VAL A 1 93  ? 0.584   -6.861  -3.062  1.00 0.00 ? 93  VAL A HG11 6  
ATOM 9336  H HG12 . VAL A 1 93  ? 0.921   -5.135  -3.209  1.00 0.00 ? 93  VAL A HG12 6  
ATOM 9337  H HG13 . VAL A 1 93  ? 1.606   -6.270  -4.371  1.00 0.00 ? 93  VAL A HG13 6  
ATOM 9338  H HG21 . VAL A 1 93  ? 1.416   -5.880  -0.690  1.00 0.00 ? 93  VAL A HG21 6  
ATOM 9339  H HG22 . VAL A 1 93  ? 3.164   -5.852  -0.450  1.00 0.00 ? 93  VAL A HG22 6  
ATOM 9340  H HG23 . VAL A 1 93  ? 2.365   -4.515  -1.278  1.00 0.00 ? 93  VAL A HG23 6  
ATOM 9341  N N    . PHE A 1 94  ? 1.835   -8.809  -4.172  1.00 0.00 ? 94  PHE A N    6  
ATOM 9342  C CA   . PHE A 1 94  ? 1.809   -9.476  -5.469  1.00 0.00 ? 94  PHE A CA   6  
ATOM 9343  C C    . PHE A 1 94  ? 1.178   -8.578  -6.530  1.00 0.00 ? 94  PHE A C    6  
ATOM 9344  O O    . PHE A 1 94  ? -0.028  -8.332  -6.512  1.00 0.00 ? 94  PHE A O    6  
ATOM 9345  C CB   . PHE A 1 94  ? 1.035   -10.792 -5.373  1.00 0.00 ? 94  PHE A CB   6  
ATOM 9346  C CG   . PHE A 1 94  ? 1.409   -11.623 -4.179  1.00 0.00 ? 94  PHE A CG   6  
ATOM 9347  C CD1  . PHE A 1 94  ? 1.080   -11.207 -2.899  1.00 0.00 ? 94  PHE A CD1  6  
ATOM 9348  C CD2  . PHE A 1 94  ? 2.091   -12.819 -4.336  1.00 0.00 ? 94  PHE A CD2  6  
ATOM 9349  C CE1  . PHE A 1 94  ? 1.424   -11.969 -1.798  1.00 0.00 ? 94  PHE A CE1  6  
ATOM 9350  C CE2  . PHE A 1 94  ? 2.438   -13.585 -3.239  1.00 0.00 ? 94  PHE A CE2  6  
ATOM 9351  C CZ   . PHE A 1 94  ? 2.103   -13.160 -1.969  1.00 0.00 ? 94  PHE A CZ   6  
ATOM 9352  H H    . PHE A 1 94  ? 0.989   -8.601  -3.724  1.00 0.00 ? 94  PHE A H    6  
ATOM 9353  H HA   . PHE A 1 94  ? 2.828   -9.687  -5.753  1.00 0.00 ? 94  PHE A HA   6  
ATOM 9354  H HB2  . PHE A 1 94  ? -0.021  -10.577 -5.309  1.00 0.00 ? 94  PHE A HB2  6  
ATOM 9355  H HB3  . PHE A 1 94  ? 1.225   -11.379 -6.259  1.00 0.00 ? 94  PHE A HB3  6  
ATOM 9356  H HD1  . PHE A 1 94  ? 0.548   -10.276 -2.764  1.00 0.00 ? 94  PHE A HD1  6  
ATOM 9357  H HD2  . PHE A 1 94  ? 2.353   -13.153 -5.331  1.00 0.00 ? 94  PHE A HD2  6  
ATOM 9358  H HE1  . PHE A 1 94  ? 1.161   -11.634 -0.806  1.00 0.00 ? 94  PHE A HE1  6  
ATOM 9359  H HE2  . PHE A 1 94  ? 2.968   -14.516 -3.377  1.00 0.00 ? 94  PHE A HE2  6  
ATOM 9360  H HZ   . PHE A 1 94  ? 2.373   -13.756 -1.110  1.00 0.00 ? 94  PHE A HZ   6  
ATOM 9361  N N    . GLN A 1 95  ? 2.003   -8.092  -7.451  1.00 0.00 ? 95  GLN A N    6  
ATOM 9362  C CA   . GLN A 1 95  ? 1.527   -7.220  -8.519  1.00 0.00 ? 95  GLN A CA   6  
ATOM 9363  C C    . GLN A 1 95  ? 1.162   -8.029  -9.759  1.00 0.00 ? 95  GLN A C    6  
ATOM 9364  O O    . GLN A 1 95  ? 2.038   -8.479  -10.497 1.00 0.00 ? 95  GLN A O    6  
ATOM 9365  C CB   . GLN A 1 95  ? 2.591   -6.179  -8.869  1.00 0.00 ? 95  GLN A CB   6  
ATOM 9366  C CG   . GLN A 1 95  ? 2.519   -4.924  -8.013  1.00 0.00 ? 95  GLN A CG   6  
ATOM 9367  C CD   . GLN A 1 95  ? 3.088   -3.707  -8.714  1.00 0.00 ? 95  GLN A CD   6  
ATOM 9368  O OE1  . GLN A 1 95  ? 3.194   -3.675  -9.941  1.00 0.00 ? 95  GLN A OE1  6  
ATOM 9369  N NE2  . GLN A 1 95  ? 3.458   -2.695  -7.938  1.00 0.00 ? 95  GLN A NE2  6  
ATOM 9370  H H    . GLN A 1 95  ? 2.954   -8.324  -7.412  1.00 0.00 ? 95  GLN A H    6  
ATOM 9371  H HA   . GLN A 1 95  ? 0.643   -6.713  -8.163  1.00 0.00 ? 95  GLN A HA   6  
ATOM 9372  H HB2  . GLN A 1 95  ? 3.567   -6.622  -8.739  1.00 0.00 ? 95  GLN A HB2  6  
ATOM 9373  H HB3  . GLN A 1 95  ? 2.469   -5.891  -9.902  1.00 0.00 ? 95  GLN A HB3  6  
ATOM 9374  H HG2  . GLN A 1 95  ? 1.485   -4.729  -7.769  1.00 0.00 ? 95  GLN A HG2  6  
ATOM 9375  H HG3  . GLN A 1 95  ? 3.077   -5.092  -7.104  1.00 0.00 ? 95  GLN A HG3  6  
ATOM 9376  H HE21 . GLN A 1 95  ? 3.345   -2.791  -6.968  1.00 0.00 ? 95  GLN A HE21 6  
ATOM 9377  H HE22 . GLN A 1 95  ? 3.830   -1.896  -8.364  1.00 0.00 ? 95  GLN A HE22 6  
ATOM 9378  N N    . GLN A 1 96  ? -0.136  -8.209  -9.982  1.00 0.00 ? 96  GLN A N    6  
ATOM 9379  C CA   . GLN A 1 96  ? -0.615  -8.964  -11.133 1.00 0.00 ? 96  GLN A CA   6  
ATOM 9380  C C    . GLN A 1 96  ? -0.404  -8.181  -12.425 1.00 0.00 ? 96  GLN A C    6  
ATOM 9381  O O    . GLN A 1 96  ? -0.274  -6.957  -12.405 1.00 0.00 ? 96  GLN A O    6  
ATOM 9382  C CB   . GLN A 1 96  ? -2.097  -9.304  -10.966 1.00 0.00 ? 96  GLN A CB   6  
ATOM 9383  C CG   . GLN A 1 96  ? -2.667  -10.125 -12.111 1.00 0.00 ? 96  GLN A CG   6  
ATOM 9384  C CD   . GLN A 1 96  ? -3.889  -10.924 -11.705 1.00 0.00 ? 96  GLN A CD   6  
ATOM 9385  O OE1  . GLN A 1 96  ? -3.799  -12.121 -11.430 1.00 0.00 ? 96  GLN A OE1  6  
ATOM 9386  N NE2  . GLN A 1 96  ? -5.041  -10.265 -11.667 1.00 0.00 ? 96  GLN A NE2  6  
ATOM 9387  H H    . GLN A 1 96  ? -0.786  -7.825  -9.358  1.00 0.00 ? 96  GLN A H    6  
ATOM 9388  H HA   . GLN A 1 96  ? -0.049  -9.882  -11.187 1.00 0.00 ? 96  GLN A HA   6  
ATOM 9389  H HB2  . GLN A 1 96  ? -2.225  -9.864  -10.051 1.00 0.00 ? 96  GLN A HB2  6  
ATOM 9390  H HB3  . GLN A 1 96  ? -2.660  -8.385  -10.897 1.00 0.00 ? 96  GLN A HB3  6  
ATOM 9391  H HG2  . GLN A 1 96  ? -2.943  -9.457  -12.914 1.00 0.00 ? 96  GLN A HG2  6  
ATOM 9392  H HG3  . GLN A 1 96  ? -1.907  -10.809 -12.459 1.00 0.00 ? 96  GLN A HG3  6  
ATOM 9393  H HE21 . GLN A 1 96  ? -5.038  -9.313  -11.900 1.00 0.00 ? 96  GLN A HE21 6  
ATOM 9394  H HE22 . GLN A 1 96  ? -5.848  -10.757 -11.408 1.00 0.00 ? 96  GLN A HE22 6  
ATOM 9395  N N    . GLN A 1 97  ? -0.371  -8.895  -13.545 1.00 0.00 ? 97  GLN A N    6  
ATOM 9396  C CA   . GLN A 1 97  ? -0.175  -8.265  -14.846 1.00 0.00 ? 97  GLN A CA   6  
ATOM 9397  C C    . GLN A 1 97  ? -1.513  -7.959  -15.510 1.00 0.00 ? 97  GLN A C    6  
ATOM 9398  O O    . GLN A 1 97  ? -2.207  -8.861  -15.980 1.00 0.00 ? 97  GLN A O    6  
ATOM 9399  C CB   . GLN A 1 97  ? 0.663   -9.169  -15.752 1.00 0.00 ? 97  GLN A CB   6  
ATOM 9400  C CG   . GLN A 1 97  ? 0.858   -8.613  -17.153 1.00 0.00 ? 97  GLN A CG   6  
ATOM 9401  C CD   . GLN A 1 97  ? 1.603   -7.293  -17.158 1.00 0.00 ? 97  GLN A CD   6  
ATOM 9402  O OE1  . GLN A 1 97  ? 1.039   -6.247  -16.835 1.00 0.00 ? 97  GLN A OE1  6  
ATOM 9403  N NE2  . GLN A 1 97  ? 2.879   -7.334  -17.526 1.00 0.00 ? 97  GLN A NE2  6  
ATOM 9404  H H    . GLN A 1 97  ? -0.481  -9.867  -13.496 1.00 0.00 ? 97  GLN A H    6  
ATOM 9405  H HA   . GLN A 1 97  ? 0.355   -7.338  -14.689 1.00 0.00 ? 97  GLN A HA   6  
ATOM 9406  H HB2  . GLN A 1 97  ? 1.635   -9.308  -15.304 1.00 0.00 ? 97  GLN A HB2  6  
ATOM 9407  H HB3  . GLN A 1 97  ? 0.174   -10.129 -15.835 1.00 0.00 ? 97  GLN A HB3  6  
ATOM 9408  H HG2  . GLN A 1 97  ? 1.421   -9.328  -17.735 1.00 0.00 ? 97  GLN A HG2  6  
ATOM 9409  H HG3  . GLN A 1 97  ? -0.111  -8.465  -17.606 1.00 0.00 ? 97  GLN A HG3  6  
ATOM 9410  H HE21 . GLN A 1 97  ? 3.262   -8.202  -17.771 1.00 0.00 ? 97  GLN A HE21 6  
ATOM 9411  H HE22 . GLN A 1 97  ? 3.384   -6.495  -17.539 1.00 0.00 ? 97  GLN A HE22 6  
ATOM 9412  N N    . THR A 1 98  ? -1.871  -6.679  -15.546 1.00 0.00 ? 98  THR A N    6  
ATOM 9413  C CA   . THR A 1 98  ? -3.127  -6.253  -16.151 1.00 0.00 ? 98  THR A CA   6  
ATOM 9414  C C    . THR A 1 98  ? -2.905  -5.724  -17.563 1.00 0.00 ? 98  THR A C    6  
ATOM 9415  O O    . THR A 1 98  ? -2.015  -4.908  -17.798 1.00 0.00 ? 98  THR A O    6  
ATOM 9416  C CB   . THR A 1 98  ? -3.815  -5.163  -15.308 1.00 0.00 ? 98  THR A CB   6  
ATOM 9417  O OG1  . THR A 1 98  ? -5.096  -4.849  -15.866 1.00 0.00 ? 98  THR A OG1  6  
ATOM 9418  C CG2  . THR A 1 98  ? -2.961  -3.905  -15.249 1.00 0.00 ? 98  THR A CG2  6  
ATOM 9419  H H    . THR A 1 98  ? -1.276  -6.006  -15.154 1.00 0.00 ? 98  THR A H    6  
ATOM 9420  H HA   . THR A 1 98  ? -3.783  -7.111  -16.197 1.00 0.00 ? 98  THR A HA   6  
ATOM 9421  H HB   . THR A 1 98  ? -3.950  -5.537  -14.304 1.00 0.00 ? 98  THR A HB   6  
ATOM 9422  H HG1  . THR A 1 98  ? -5.461  -4.081  -15.418 1.00 0.00 ? 98  THR A HG1  6  
ATOM 9423  H HG21 . THR A 1 98  ? -3.063  -3.356  -16.173 1.00 0.00 ? 98  THR A HG21 6  
ATOM 9424  H HG22 . THR A 1 98  ? -1.926  -4.180  -15.106 1.00 0.00 ? 98  THR A HG22 6  
ATOM 9425  H HG23 . THR A 1 98  ? -3.286  -3.288  -14.425 1.00 0.00 ? 98  THR A HG23 6  
ATOM 9426  N N    . SER A 1 99  ? -3.721  -6.195  -18.501 1.00 0.00 ? 99  SER A N    6  
ATOM 9427  C CA   . SER A 1 99  ? -3.612  -5.771  -19.892 1.00 0.00 ? 99  SER A CA   6  
ATOM 9428  C C    . SER A 1 99  ? -3.737  -4.255  -20.010 1.00 0.00 ? 99  SER A C    6  
ATOM 9429  O O    . SER A 1 99  ? -4.781  -3.681  -19.703 1.00 0.00 ? 99  SER A O    6  
ATOM 9430  C CB   . SER A 1 99  ? -4.688  -6.450  -20.741 1.00 0.00 ? 99  SER A CB   6  
ATOM 9431  O OG   . SER A 1 99  ? -4.644  -5.994  -22.081 1.00 0.00 ? 99  SER A OG   6  
ATOM 9432  H H    . SER A 1 99  ? -4.412  -6.844  -18.252 1.00 0.00 ? 99  SER A H    6  
ATOM 9433  H HA   . SER A 1 99  ? -2.639  -6.069  -20.254 1.00 0.00 ? 99  SER A HA   6  
ATOM 9434  H HB2  . SER A 1 99  ? -4.530  -7.518  -20.731 1.00 0.00 ? 99  SER A HB2  6  
ATOM 9435  H HB3  . SER A 1 99  ? -5.662  -6.226  -20.328 1.00 0.00 ? 99  SER A HB3  6  
ATOM 9436  H HG   . SER A 1 99  ? -5.055  -5.128  -22.139 1.00 0.00 ? 99  SER A HG   6  
ATOM 9437  N N    . GLY A 1 100 ? -2.662  -3.611  -20.456 1.00 0.00 ? 100 GLY A N    6  
ATOM 9438  C CA   . GLY A 1 100 ? -2.671  -2.168  -20.606 1.00 0.00 ? 100 GLY A CA   6  
ATOM 9439  C C    . GLY A 1 100 ? -1.874  -1.467  -19.524 1.00 0.00 ? 100 GLY A C    6  
ATOM 9440  O O    . GLY A 1 100 ? -2.417  -0.729  -18.703 1.00 0.00 ? 100 GLY A O    6  
ATOM 9441  H H    . GLY A 1 100 ? -1.857  -4.121  -20.685 1.00 0.00 ? 100 GLY A H    6  
ATOM 9442  H HA2  . GLY A 1 100 ? -2.252  -1.914  -21.569 1.00 0.00 ? 100 GLY A HA2  6  
ATOM 9443  H HA3  . GLY A 1 100 ? -3.693  -1.820  -20.567 1.00 0.00 ? 100 GLY A HA3  6  
ATOM 9444  N N    . PRO A 1 101 ? -0.553  -1.699  -19.513 1.00 0.00 ? 101 PRO A N    6  
ATOM 9445  C CA   . PRO A 1 101 ? 0.349   -1.095  -18.528 1.00 0.00 ? 101 PRO A CA   6  
ATOM 9446  C C    . PRO A 1 101 ? 0.515   0.406   -18.738 1.00 0.00 ? 101 PRO A C    6  
ATOM 9447  O O    . PRO A 1 101 ? 0.578   0.880   -19.872 1.00 0.00 ? 101 PRO A O    6  
ATOM 9448  C CB   . PRO A 1 101 ? 1.676   -1.819  -18.770 1.00 0.00 ? 101 PRO A CB   6  
ATOM 9449  C CG   . PRO A 1 101 ? 1.610   -2.265  -20.190 1.00 0.00 ? 101 PRO A CG   6  
ATOM 9450  C CD   . PRO A 1 101 ? 0.163   -2.569  -20.462 1.00 0.00 ? 101 PRO A CD   6  
ATOM 9451  H HA   . PRO A 1 101 ? 0.015   -1.281  -17.517 1.00 0.00 ? 101 PRO A HA   6  
ATOM 9452  H HB2  . PRO A 1 101 ? 2.497   -1.135  -18.607 1.00 0.00 ? 101 PRO A HB2  6  
ATOM 9453  H HB3  . PRO A 1 101 ? 1.760   -2.658  -18.096 1.00 0.00 ? 101 PRO A HB3  6  
ATOM 9454  H HG2  . PRO A 1 101 ? 1.956   -1.476  -20.839 1.00 0.00 ? 101 PRO A HG2  6  
ATOM 9455  H HG3  . PRO A 1 101 ? 2.211   -3.153  -20.323 1.00 0.00 ? 101 PRO A HG3  6  
ATOM 9456  H HD2  . PRO A 1 101 ? -0.090  -2.318  -21.481 1.00 0.00 ? 101 PRO A HD2  6  
ATOM 9457  H HD3  . PRO A 1 101 ? -0.048  -3.610  -20.264 1.00 0.00 ? 101 PRO A HD3  6  
ATOM 9458  N N    . SER A 1 102 ? 0.587   1.149   -17.638 1.00 0.00 ? 102 SER A N    6  
ATOM 9459  C CA   . SER A 1 102 ? 0.743   2.597   -17.702 1.00 0.00 ? 102 SER A CA   6  
ATOM 9460  C C    . SER A 1 102 ? 2.089   3.025   -17.127 1.00 0.00 ? 102 SER A C    6  
ATOM 9461  O O    . SER A 1 102 ? 2.228   3.215   -15.919 1.00 0.00 ? 102 SER A O    6  
ATOM 9462  C CB   . SER A 1 102 ? -0.392  3.288   -16.943 1.00 0.00 ? 102 SER A CB   6  
ATOM 9463  O OG   . SER A 1 102 ? -0.437  2.858   -15.593 1.00 0.00 ? 102 SER A OG   6  
ATOM 9464  H H    . SER A 1 102 ? 0.531   0.712   -16.762 1.00 0.00 ? 102 SER A H    6  
ATOM 9465  H HA   . SER A 1 102 ? 0.699   2.889   -18.741 1.00 0.00 ? 102 SER A HA   6  
ATOM 9466  H HB2  . SER A 1 102 ? -0.237  4.356   -16.962 1.00 0.00 ? 102 SER A HB2  6  
ATOM 9467  H HB3  . SER A 1 102 ? -1.334  3.051   -17.415 1.00 0.00 ? 102 SER A HB3  6  
ATOM 9468  H HG   . SER A 1 102 ? -0.132  3.565   -15.021 1.00 0.00 ? 102 SER A HG   6  
ATOM 9469  N N    . SER A 1 103 ? 3.079   3.173   -18.002 1.00 0.00 ? 103 SER A N    6  
ATOM 9470  C CA   . SER A 1 103 ? 4.417   3.575   -17.582 1.00 0.00 ? 103 SER A CA   6  
ATOM 9471  C C    . SER A 1 103 ? 5.191   4.186   -18.745 1.00 0.00 ? 103 SER A C    6  
ATOM 9472  O O    . SER A 1 103 ? 5.101   3.718   -19.880 1.00 0.00 ? 103 SER A O    6  
ATOM 9473  C CB   . SER A 1 103 ? 5.180   2.373   -17.022 1.00 0.00 ? 103 SER A CB   6  
ATOM 9474  O OG   . SER A 1 103 ? 4.685   2.003   -15.746 1.00 0.00 ? 103 SER A OG   6  
ATOM 9475  H H    . SER A 1 103 ? 2.906   3.007   -18.952 1.00 0.00 ? 103 SER A H    6  
ATOM 9476  H HA   . SER A 1 103 ? 4.311   4.317   -16.805 1.00 0.00 ? 103 SER A HA   6  
ATOM 9477  H HB2  . SER A 1 103 ? 5.071   1.535   -17.693 1.00 0.00 ? 103 SER A HB2  6  
ATOM 9478  H HB3  . SER A 1 103 ? 6.227   2.626   -16.929 1.00 0.00 ? 103 SER A HB3  6  
ATOM 9479  H HG   . SER A 1 103 ? 4.284   2.767   -15.325 1.00 0.00 ? 103 SER A HG   6  
ATOM 9480  N N    . GLY A 1 104 ? 5.953   5.236   -18.454 1.00 0.00 ? 104 GLY A N    6  
ATOM 9481  C CA   . GLY A 1 104 ? 6.732   5.896   -19.486 1.00 0.00 ? 104 GLY A CA   6  
ATOM 9482  C C    . GLY A 1 104 ? 6.980   7.359   -19.178 1.00 0.00 ? 104 GLY A C    6  
ATOM 9483  O O    . GLY A 1 104 ? 7.459   7.700   -18.097 1.00 0.00 ? 104 GLY A O    6  
ATOM 9484  H H    . GLY A 1 104 ? 5.986   5.566   -17.532 1.00 0.00 ? 104 GLY A H    6  
ATOM 9485  H HA2  . GLY A 1 104 ? 7.682   5.392   -19.581 1.00 0.00 ? 104 GLY A HA2  6  
ATOM 9486  H HA3  . GLY A 1 104 ? 6.201   5.823   -20.424 1.00 0.00 ? 104 GLY A HA3  6  
ATOM 9487  N N    . GLY A 1 1   ? 50.881  29.487  23.887  1.00 0.00 ? 1   GLY A N    7  
ATOM 9488  C CA   . GLY A 1 1   ? 50.634  28.065  24.045  1.00 0.00 ? 1   GLY A CA   7  
ATOM 9489  C C    . GLY A 1 1   ? 50.768  27.306  22.740  1.00 0.00 ? 1   GLY A C    7  
ATOM 9490  O O    . GLY A 1 1   ? 51.581  26.388  22.629  1.00 0.00 ? 1   GLY A O    7  
ATOM 9491  H H1   . GLY A 1 1   ? 50.144  30.087  23.650  1.00 0.00 ? 1   GLY A H1   7  
ATOM 9492  H HA2  . GLY A 1 1   ? 51.340  27.665  24.757  1.00 0.00 ? 1   GLY A HA2  7  
ATOM 9493  H HA3  . GLY A 1 1   ? 49.633  27.926  24.427  1.00 0.00 ? 1   GLY A HA3  7  
ATOM 9494  N N    . SER A 1 2   ? 49.967  27.687  21.750  1.00 0.00 ? 2   SER A N    7  
ATOM 9495  C CA   . SER A 1 2   ? 49.996  27.031  20.448  1.00 0.00 ? 2   SER A CA   7  
ATOM 9496  C C    . SER A 1 2   ? 49.247  27.857  19.407  1.00 0.00 ? 2   SER A C    7  
ATOM 9497  O O    . SER A 1 2   ? 48.236  28.490  19.711  1.00 0.00 ? 2   SER A O    7  
ATOM 9498  C CB   . SER A 1 2   ? 49.383  25.632  20.544  1.00 0.00 ? 2   SER A CB   7  
ATOM 9499  O OG   . SER A 1 2   ? 49.216  25.059  19.258  1.00 0.00 ? 2   SER A OG   7  
ATOM 9500  H H    . SER A 1 2   ? 49.340  28.425  21.900  1.00 0.00 ? 2   SER A H    7  
ATOM 9501  H HA   . SER A 1 2   ? 51.029  26.942  20.145  1.00 0.00 ? 2   SER A HA   7  
ATOM 9502  H HB2  . SER A 1 2   ? 50.032  24.997  21.126  1.00 0.00 ? 2   SER A HB2  7  
ATOM 9503  H HB3  . SER A 1 2   ? 48.417  25.698  21.024  1.00 0.00 ? 2   SER A HB3  7  
ATOM 9504  H HG   . SER A 1 2   ? 48.455  25.456  18.827  1.00 0.00 ? 2   SER A HG   7  
ATOM 9505  N N    . SER A 1 3   ? 49.751  27.845  18.177  1.00 0.00 ? 3   SER A N    7  
ATOM 9506  C CA   . SER A 1 3   ? 49.132  28.596  17.090  1.00 0.00 ? 3   SER A CA   7  
ATOM 9507  C C    . SER A 1 3   ? 47.725  28.079  16.805  1.00 0.00 ? 3   SER A C    7  
ATOM 9508  O O    . SER A 1 3   ? 46.753  28.831  16.854  1.00 0.00 ? 3   SER A O    7  
ATOM 9509  C CB   . SER A 1 3   ? 49.988  28.502  15.826  1.00 0.00 ? 3   SER A CB   7  
ATOM 9510  O OG   . SER A 1 3   ? 51.197  29.226  15.974  1.00 0.00 ? 3   SER A OG   7  
ATOM 9511  H H    . SER A 1 3   ? 50.559  27.321  17.997  1.00 0.00 ? 3   SER A H    7  
ATOM 9512  H HA   . SER A 1 3   ? 49.068  29.629  17.396  1.00 0.00 ? 3   SER A HA   7  
ATOM 9513  H HB2  . SER A 1 3   ? 50.224  27.467  15.630  1.00 0.00 ? 3   SER A HB2  7  
ATOM 9514  H HB3  . SER A 1 3   ? 49.437  28.910  14.991  1.00 0.00 ? 3   SER A HB3  7  
ATOM 9515  H HG   . SER A 1 3   ? 51.670  28.907  16.746  1.00 0.00 ? 3   SER A HG   7  
ATOM 9516  N N    . GLY A 1 4   ? 47.625  26.787  16.506  1.00 0.00 ? 4   GLY A N    7  
ATOM 9517  C CA   . GLY A 1 4   ? 46.334  26.190  16.217  1.00 0.00 ? 4   GLY A CA   7  
ATOM 9518  C C    . GLY A 1 4   ? 46.294  25.529  14.853  1.00 0.00 ? 4   GLY A C    7  
ATOM 9519  O O    . GLY A 1 4   ? 47.241  25.637  14.075  1.00 0.00 ? 4   GLY A O    7  
ATOM 9520  H H    . GLY A 1 4   ? 48.435  26.235  16.481  1.00 0.00 ? 4   GLY A H    7  
ATOM 9521  H HA2  . GLY A 1 4   ? 46.115  25.450  16.971  1.00 0.00 ? 4   GLY A HA2  7  
ATOM 9522  H HA3  . GLY A 1 4   ? 45.578  26.961  16.252  1.00 0.00 ? 4   GLY A HA3  7  
ATOM 9523  N N    . SER A 1 5   ? 45.194  24.840  14.564  1.00 0.00 ? 5   SER A N    7  
ATOM 9524  C CA   . SER A 1 5   ? 45.036  24.154  13.287  1.00 0.00 ? 5   SER A CA   7  
ATOM 9525  C C    . SER A 1 5   ? 43.596  23.689  13.095  1.00 0.00 ? 5   SER A C    7  
ATOM 9526  O O    . SER A 1 5   ? 42.885  23.417  14.062  1.00 0.00 ? 5   SER A O    7  
ATOM 9527  C CB   . SER A 1 5   ? 45.985  22.956  13.207  1.00 0.00 ? 5   SER A CB   7  
ATOM 9528  O OG   . SER A 1 5   ? 47.244  23.337  12.679  1.00 0.00 ? 5   SER A OG   7  
ATOM 9529  H H    . SER A 1 5   ? 44.473  24.791  15.226  1.00 0.00 ? 5   SER A H    7  
ATOM 9530  H HA   . SER A 1 5   ? 45.285  24.852  12.502  1.00 0.00 ? 5   SER A HA   7  
ATOM 9531  H HB2  . SER A 1 5   ? 46.132  22.549  14.196  1.00 0.00 ? 5   SER A HB2  7  
ATOM 9532  H HB3  . SER A 1 5   ? 45.553  22.200  12.567  1.00 0.00 ? 5   SER A HB3  7  
ATOM 9533  H HG   . SER A 1 5   ? 47.313  23.040  11.769  1.00 0.00 ? 5   SER A HG   7  
ATOM 9534  N N    . SER A 1 6   ? 43.172  23.601  11.838  1.00 0.00 ? 6   SER A N    7  
ATOM 9535  C CA   . SER A 1 6   ? 41.816  23.174  11.517  1.00 0.00 ? 6   SER A CA   7  
ATOM 9536  C C    . SER A 1 6   ? 41.833  21.936  10.625  1.00 0.00 ? 6   SER A C    7  
ATOM 9537  O O    . SER A 1 6   ? 42.885  21.521  10.140  1.00 0.00 ? 6   SER A O    7  
ATOM 9538  C CB   . SER A 1 6   ? 41.053  24.304  10.824  1.00 0.00 ? 6   SER A CB   7  
ATOM 9539  O OG   . SER A 1 6   ? 40.527  25.219  11.770  1.00 0.00 ? 6   SER A OG   7  
ATOM 9540  H H    . SER A 1 6   ? 43.786  23.832  11.110  1.00 0.00 ? 6   SER A H    7  
ATOM 9541  H HA   . SER A 1 6   ? 41.317  22.929  12.443  1.00 0.00 ? 6   SER A HA   7  
ATOM 9542  H HB2  . SER A 1 6   ? 41.721  24.834  10.162  1.00 0.00 ? 6   SER A HB2  7  
ATOM 9543  H HB3  . SER A 1 6   ? 40.236  23.886  10.253  1.00 0.00 ? 6   SER A HB3  7  
ATOM 9544  H HG   . SER A 1 6   ? 41.230  25.790  12.088  1.00 0.00 ? 6   SER A HG   7  
ATOM 9545  N N    . GLY A 1 7   ? 40.658  21.350  10.414  1.00 0.00 ? 7   GLY A N    7  
ATOM 9546  C CA   . GLY A 1 7   ? 40.559  20.165  9.582   1.00 0.00 ? 7   GLY A CA   7  
ATOM 9547  C C    . GLY A 1 7   ? 39.324  20.175  8.703   1.00 0.00 ? 7   GLY A C    7  
ATOM 9548  O O    . GLY A 1 7   ? 38.800  21.237  8.370   1.00 0.00 ? 7   GLY A O    7  
ATOM 9549  H H    . GLY A 1 7   ? 39.852  21.725  10.827  1.00 0.00 ? 7   GLY A H    7  
ATOM 9550  H HA2  . GLY A 1 7   ? 41.435  20.106  8.953   1.00 0.00 ? 7   GLY A HA2  7  
ATOM 9551  H HA3  . GLY A 1 7   ? 40.526  19.293  10.219  1.00 0.00 ? 7   GLY A HA3  7  
ATOM 9552  N N    . MET A 1 8   ? 38.858  18.989  8.327   1.00 0.00 ? 8   MET A N    7  
ATOM 9553  C CA   . MET A 1 8   ? 37.676  18.866  7.481   1.00 0.00 ? 8   MET A CA   7  
ATOM 9554  C C    . MET A 1 8   ? 36.401  18.944  8.314   1.00 0.00 ? 8   MET A C    7  
ATOM 9555  O O    . MET A 1 8   ? 36.220  18.182  9.263   1.00 0.00 ? 8   MET A O    7  
ATOM 9556  C CB   . MET A 1 8   ? 37.712  17.547  6.706   1.00 0.00 ? 8   MET A CB   7  
ATOM 9557  C CG   . MET A 1 8   ? 37.861  16.323  7.595   1.00 0.00 ? 8   MET A CG   7  
ATOM 9558  S SD   . MET A 1 8   ? 37.801  14.779  6.667   1.00 0.00 ? 8   MET A SD   7  
ATOM 9559  C CE   . MET A 1 8   ? 36.515  13.901  7.553   1.00 0.00 ? 8   MET A CE   7  
ATOM 9560  H H    . MET A 1 8   ? 39.318  18.177  8.625   1.00 0.00 ? 8   MET A H    7  
ATOM 9561  H HA   . MET A 1 8   ? 37.684  19.686  6.779   1.00 0.00 ? 8   MET A HA   7  
ATOM 9562  H HB2  . MET A 1 8   ? 36.795  17.448  6.144   1.00 0.00 ? 8   MET A HB2  7  
ATOM 9563  H HB3  . MET A 1 8   ? 38.545  17.569  6.019   1.00 0.00 ? 8   MET A HB3  7  
ATOM 9564  H HG2  . MET A 1 8   ? 38.809  16.381  8.109   1.00 0.00 ? 8   MET A HG2  7  
ATOM 9565  H HG3  . MET A 1 8   ? 37.060  16.324  8.320   1.00 0.00 ? 8   MET A HG3  7  
ATOM 9566  H HE1  . MET A 1 8   ? 36.663  12.837  7.441   1.00 0.00 ? 8   MET A HE1  7  
ATOM 9567  H HE2  . MET A 1 8   ? 36.557  14.163  8.600   1.00 0.00 ? 8   MET A HE2  7  
ATOM 9568  H HE3  . MET A 1 8   ? 35.550  14.175  7.151   1.00 0.00 ? 8   MET A HE3  7  
ATOM 9569  N N    . ALA A 1 9   ? 35.519  19.871  7.953   1.00 0.00 ? 9   ALA A N    7  
ATOM 9570  C CA   . ALA A 1 9   ? 34.260  20.047  8.666   1.00 0.00 ? 9   ALA A CA   7  
ATOM 9571  C C    . ALA A 1 9   ? 33.134  19.272  7.991   1.00 0.00 ? 9   ALA A C    7  
ATOM 9572  O O    . ALA A 1 9   ? 32.660  19.653  6.920   1.00 0.00 ? 9   ALA A O    7  
ATOM 9573  C CB   . ALA A 1 9   ? 33.907  21.525  8.756   1.00 0.00 ? 9   ALA A CB   7  
ATOM 9574  H H    . ALA A 1 9   ? 35.720  20.449  7.187   1.00 0.00 ? 9   ALA A H    7  
ATOM 9575  H HA   . ALA A 1 9   ? 34.390  19.672  9.671   1.00 0.00 ? 9   ALA A HA   7  
ATOM 9576  H HB1  . ALA A 1 9   ? 33.003  21.643  9.335   1.00 0.00 ? 9   ALA A HB1  7  
ATOM 9577  H HB2  . ALA A 1 9   ? 34.714  22.059  9.234   1.00 0.00 ? 9   ALA A HB2  7  
ATOM 9578  H HB3  . ALA A 1 9   ? 33.752  21.919  7.762   1.00 0.00 ? 9   ALA A HB3  7  
ATOM 9579  N N    . ASP A 1 10  ? 32.709  18.184  8.624   1.00 0.00 ? 10  ASP A N    7  
ATOM 9580  C CA   . ASP A 1 10  ? 31.637  17.355  8.084   1.00 0.00 ? 10  ASP A CA   7  
ATOM 9581  C C    . ASP A 1 10  ? 30.271  17.930  8.446   1.00 0.00 ? 10  ASP A C    7  
ATOM 9582  O O    . ASP A 1 10  ? 29.380  17.206  8.888   1.00 0.00 ? 10  ASP A O    7  
ATOM 9583  C CB   . ASP A 1 10  ? 31.757  15.924  8.609   1.00 0.00 ? 10  ASP A CB   7  
ATOM 9584  C CG   . ASP A 1 10  ? 31.715  15.857  10.123  1.00 0.00 ? 10  ASP A CG   7  
ATOM 9585  O OD1  . ASP A 1 10  ? 32.497  16.584  10.771  1.00 0.00 ? 10  ASP A OD1  7  
ATOM 9586  O OD2  . ASP A 1 10  ? 30.901  15.077  10.661  1.00 0.00 ? 10  ASP A OD2  7  
ATOM 9587  H H    . ASP A 1 10  ? 33.126  17.932  9.474   1.00 0.00 ? 10  ASP A H    7  
ATOM 9588  H HA   . ASP A 1 10  ? 31.736  17.344  7.009   1.00 0.00 ? 10  ASP A HA   7  
ATOM 9589  H HB2  . ASP A 1 10  ? 30.940  15.334  8.219   1.00 0.00 ? 10  ASP A HB2  7  
ATOM 9590  H HB3  . ASP A 1 10  ? 32.693  15.501  8.274   1.00 0.00 ? 10  ASP A HB3  7  
ATOM 9591  N N    . GLU A 1 11  ? 30.116  19.237  8.256   1.00 0.00 ? 11  GLU A N    7  
ATOM 9592  C CA   . GLU A 1 11  ? 28.859  19.908  8.564   1.00 0.00 ? 11  GLU A CA   7  
ATOM 9593  C C    . GLU A 1 11  ? 27.836  19.686  7.453   1.00 0.00 ? 11  GLU A C    7  
ATOM 9594  O O    . GLU A 1 11  ? 26.743  19.174  7.693   1.00 0.00 ? 11  GLU A O    7  
ATOM 9595  C CB   . GLU A 1 11  ? 29.091  21.407  8.766   1.00 0.00 ? 11  GLU A CB   7  
ATOM 9596  C CG   . GLU A 1 11  ? 29.512  21.773  10.179  1.00 0.00 ? 11  GLU A CG   7  
ATOM 9597  C CD   . GLU A 1 11  ? 29.285  23.239  10.495  1.00 0.00 ? 11  GLU A CD   7  
ATOM 9598  O OE1  . GLU A 1 11  ? 28.159  23.589  10.906  1.00 0.00 ? 11  GLU A OE1  7  
ATOM 9599  O OE2  . GLU A 1 11  ? 30.232  24.036  10.330  1.00 0.00 ? 11  GLU A OE2  7  
ATOM 9600  H H    . GLU A 1 11  ? 30.864  19.761  7.901   1.00 0.00 ? 11  GLU A H    7  
ATOM 9601  H HA   . GLU A 1 11  ? 28.474  19.487  9.481   1.00 0.00 ? 11  GLU A HA   7  
ATOM 9602  H HB2  . GLU A 1 11  ? 29.864  21.734  8.086   1.00 0.00 ? 11  GLU A HB2  7  
ATOM 9603  H HB3  . GLU A 1 11  ? 28.177  21.935  8.537   1.00 0.00 ? 11  GLU A HB3  7  
ATOM 9604  H HG2  . GLU A 1 11  ? 28.941  21.178  10.877  1.00 0.00 ? 11  GLU A HG2  7  
ATOM 9605  H HG3  . GLU A 1 11  ? 30.563  21.553  10.297  1.00 0.00 ? 11  GLU A HG3  7  
ATOM 9606  N N    . LYS A 1 12  ? 28.200  20.076  6.236   1.00 0.00 ? 12  LYS A N    7  
ATOM 9607  C CA   . LYS A 1 12  ? 27.317  19.920  5.087   1.00 0.00 ? 12  LYS A CA   7  
ATOM 9608  C C    . LYS A 1 12  ? 26.573  18.590  5.148   1.00 0.00 ? 12  LYS A C    7  
ATOM 9609  O O    . LYS A 1 12  ? 25.343  18.540  5.187   1.00 0.00 ? 12  LYS A O    7  
ATOM 9610  C CB   . LYS A 1 12  ? 28.118  20.009  3.786   1.00 0.00 ? 12  LYS A CB   7  
ATOM 9611  C CG   . LYS A 1 12  ? 28.155  21.404  3.188   1.00 0.00 ? 12  LYS A CG   7  
ATOM 9612  C CD   . LYS A 1 12  ? 28.551  21.372  1.721   1.00 0.00 ? 12  LYS A CD   7  
ATOM 9613  C CE   . LYS A 1 12  ? 29.981  20.887  1.540   1.00 0.00 ? 12  LYS A CE   7  
ATOM 9614  N NZ   . LYS A 1 12  ? 30.502  21.194  0.179   1.00 0.00 ? 12  LYS A NZ   7  
ATOM 9615  H H    . LYS A 1 12  ? 29.085  20.478  6.108   1.00 0.00 ? 12  LYS A H    7  
ATOM 9616  H HA   . LYS A 1 12  ? 26.596  20.723  5.111   1.00 0.00 ? 12  LYS A HA   7  
ATOM 9617  H HB2  . LYS A 1 12  ? 29.134  19.696  3.981   1.00 0.00 ? 12  LYS A HB2  7  
ATOM 9618  H HB3  . LYS A 1 12  ? 27.678  19.340  3.060   1.00 0.00 ? 12  LYS A HB3  7  
ATOM 9619  H HG2  . LYS A 1 12  ? 27.176  21.850  3.276   1.00 0.00 ? 12  LYS A HG2  7  
ATOM 9620  H HG3  . LYS A 1 12  ? 28.874  22.000  3.732   1.00 0.00 ? 12  LYS A HG3  7  
ATOM 9621  H HD2  . LYS A 1 12  ? 27.887  20.704  1.193   1.00 0.00 ? 12  LYS A HD2  7  
ATOM 9622  H HD3  . LYS A 1 12  ? 28.463  22.369  1.312   1.00 0.00 ? 12  LYS A HD3  7  
ATOM 9623  H HE2  . LYS A 1 12  ? 30.607  21.371  2.274   1.00 0.00 ? 12  LYS A HE2  7  
ATOM 9624  H HE3  . LYS A 1 12  ? 30.007  19.818  1.694   1.00 0.00 ? 12  LYS A HE3  7  
ATOM 9625  H HZ1  . LYS A 1 12  ? 29.865  20.803  -0.544  1.00 0.00 ? 12  LYS A HZ1  7  
ATOM 9626  H HZ2  . LYS A 1 12  ? 31.446  20.775  0.056   1.00 0.00 ? 12  LYS A HZ2  7  
ATOM 9627  H HZ3  . LYS A 1 12  ? 30.571  22.223  0.046   1.00 0.00 ? 12  LYS A HZ3  7  
ATOM 9628  N N    . PRO A 1 13  ? 27.334  17.485  5.160   1.00 0.00 ? 13  PRO A N    7  
ATOM 9629  C CA   . PRO A 1 13  ? 26.768  16.135  5.219   1.00 0.00 ? 13  PRO A CA   7  
ATOM 9630  C C    . PRO A 1 13  ? 26.134  15.831  6.573   1.00 0.00 ? 13  PRO A C    7  
ATOM 9631  O O    . PRO A 1 13  ? 26.504  16.418  7.589   1.00 0.00 ? 13  PRO A O    7  
ATOM 9632  C CB   . PRO A 1 13  ? 27.980  15.231  4.982   1.00 0.00 ? 13  PRO A CB   7  
ATOM 9633  C CG   . PRO A 1 13  ? 29.149  16.040  5.428   1.00 0.00 ? 13  PRO A CG   7  
ATOM 9634  C CD   . PRO A 1 13  ? 28.806  17.470  5.117   1.00 0.00 ? 13  PRO A CD   7  
ATOM 9635  H HA   . PRO A 1 13  ? 26.039  15.975  4.438   1.00 0.00 ? 13  PRO A HA   7  
ATOM 9636  H HB2  . PRO A 1 13  ? 27.878  14.327  5.565   1.00 0.00 ? 13  PRO A HB2  7  
ATOM 9637  H HB3  . PRO A 1 13  ? 28.049  14.984  3.933   1.00 0.00 ? 13  PRO A HB3  7  
ATOM 9638  H HG2  . PRO A 1 13  ? 29.299  15.913  6.490   1.00 0.00 ? 13  PRO A HG2  7  
ATOM 9639  H HG3  . PRO A 1 13  ? 30.032  15.740  4.884   1.00 0.00 ? 13  PRO A HG3  7  
ATOM 9640  H HD2  . PRO A 1 13  ? 29.221  18.130  5.865   1.00 0.00 ? 13  PRO A HD2  7  
ATOM 9641  H HD3  . PRO A 1 13  ? 29.165  17.739  4.134   1.00 0.00 ? 13  PRO A HD3  7  
ATOM 9642  N N    . LYS A 1 14  ? 25.177  14.909  6.579   1.00 0.00 ? 14  LYS A N    7  
ATOM 9643  C CA   . LYS A 1 14  ? 24.492  14.525  7.807   1.00 0.00 ? 14  LYS A CA   7  
ATOM 9644  C C    . LYS A 1 14  ? 23.883  15.743  8.494   1.00 0.00 ? 14  LYS A C    7  
ATOM 9645  O O    . LYS A 1 14  ? 23.946  15.873  9.716   1.00 0.00 ? 14  LYS A O    7  
ATOM 9646  C CB   . LYS A 1 14  ? 25.463  13.822  8.759   1.00 0.00 ? 14  LYS A CB   7  
ATOM 9647  C CG   . LYS A 1 14  ? 25.528  12.317  8.560   1.00 0.00 ? 14  LYS A CG   7  
ATOM 9648  C CD   . LYS A 1 14  ? 26.515  11.670  9.517   1.00 0.00 ? 14  LYS A CD   7  
ATOM 9649  C CE   . LYS A 1 14  ? 26.295  10.168  9.612   1.00 0.00 ? 14  LYS A CE   7  
ATOM 9650  N NZ   . LYS A 1 14  ? 26.966  9.438   8.501   1.00 0.00 ? 14  LYS A NZ   7  
ATOM 9651  H H    . LYS A 1 14  ? 24.926  14.476  5.736   1.00 0.00 ? 14  LYS A H    7  
ATOM 9652  H HA   . LYS A 1 14  ? 23.700  13.840  7.545   1.00 0.00 ? 14  LYS A HA   7  
ATOM 9653  H HB2  . LYS A 1 14  ? 26.453  14.227  8.607   1.00 0.00 ? 14  LYS A HB2  7  
ATOM 9654  H HB3  . LYS A 1 14  ? 25.156  14.017  9.776   1.00 0.00 ? 14  LYS A HB3  7  
ATOM 9655  H HG2  . LYS A 1 14  ? 24.548  11.898  8.733   1.00 0.00 ? 14  LYS A HG2  7  
ATOM 9656  H HG3  . LYS A 1 14  ? 25.836  12.110  7.545   1.00 0.00 ? 14  LYS A HG3  7  
ATOM 9657  H HD2  . LYS A 1 14  ? 27.519  11.855  9.165   1.00 0.00 ? 14  LYS A HD2  7  
ATOM 9658  H HD3  . LYS A 1 14  ? 26.390  12.107  10.498  1.00 0.00 ? 14  LYS A HD3  7  
ATOM 9659  H HE2  . LYS A 1 14  ? 26.693  9.819   10.553  1.00 0.00 ? 14  LYS A HE2  7  
ATOM 9660  H HE3  . LYS A 1 14  ? 25.235  9.969   9.574   1.00 0.00 ? 14  LYS A HE3  7  
ATOM 9661  H HZ1  . LYS A 1 14  ? 27.742  10.013  8.114   1.00 0.00 ? 14  LYS A HZ1  7  
ATOM 9662  H HZ2  . LYS A 1 14  ? 26.285  9.240   7.741   1.00 0.00 ? 14  LYS A HZ2  7  
ATOM 9663  H HZ3  . LYS A 1 14  ? 27.355  8.538   8.847   1.00 0.00 ? 14  LYS A HZ3  7  
ATOM 9664  N N    . GLU A 1 15  ? 23.292  16.631  7.701   1.00 0.00 ? 15  GLU A N    7  
ATOM 9665  C CA   . GLU A 1 15  ? 22.671  17.837  8.234   1.00 0.00 ? 15  GLU A CA   7  
ATOM 9666  C C    . GLU A 1 15  ? 21.293  17.530  8.813   1.00 0.00 ? 15  GLU A C    7  
ATOM 9667  O O    . GLU A 1 15  ? 20.445  16.938  8.145   1.00 0.00 ? 15  GLU A O    7  
ATOM 9668  C CB   . GLU A 1 15  ? 22.552  18.902  7.142   1.00 0.00 ? 15  GLU A CB   7  
ATOM 9669  C CG   . GLU A 1 15  ? 21.838  20.164  7.597   1.00 0.00 ? 15  GLU A CG   7  
ATOM 9670  C CD   . GLU A 1 15  ? 22.543  20.848  8.752   1.00 0.00 ? 15  GLU A CD   7  
ATOM 9671  O OE1  . GLU A 1 15  ? 22.246  20.505  9.915   1.00 0.00 ? 15  GLU A OE1  7  
ATOM 9672  O OE2  . GLU A 1 15  ? 23.393  21.726  8.493   1.00 0.00 ? 15  GLU A OE2  7  
ATOM 9673  H H    . GLU A 1 15  ? 23.274  16.471  6.734   1.00 0.00 ? 15  GLU A H    7  
ATOM 9674  H HA   . GLU A 1 15  ? 23.303  18.214  9.024   1.00 0.00 ? 15  GLU A HA   7  
ATOM 9675  H HB2  . GLU A 1 15  ? 23.543  19.173  6.810   1.00 0.00 ? 15  GLU A HB2  7  
ATOM 9676  H HB3  . GLU A 1 15  ? 22.005  18.485  6.309   1.00 0.00 ? 15  GLU A HB3  7  
ATOM 9677  H HG2  . GLU A 1 15  ? 21.788  20.853  6.768   1.00 0.00 ? 15  GLU A HG2  7  
ATOM 9678  H HG3  . GLU A 1 15  ? 20.837  19.904  7.909   1.00 0.00 ? 15  GLU A HG3  7  
ATOM 9679  N N    . GLY A 1 16  ? 21.077  17.936  10.060  1.00 0.00 ? 16  GLY A N    7  
ATOM 9680  C CA   . GLY A 1 16  ? 19.801  17.694  10.709  1.00 0.00 ? 16  GLY A CA   7  
ATOM 9681  C C    . GLY A 1 16  ? 19.649  16.259  11.173  1.00 0.00 ? 16  GLY A C    7  
ATOM 9682  O O    . GLY A 1 16  ? 19.026  15.442  10.496  1.00 0.00 ? 16  GLY A O    7  
ATOM 9683  H H    . GLY A 1 16  ? 21.790  18.403  10.544  1.00 0.00 ? 16  GLY A H    7  
ATOM 9684  H HA2  . GLY A 1 16  ? 19.714  18.349  11.563  1.00 0.00 ? 16  GLY A HA2  7  
ATOM 9685  H HA3  . GLY A 1 16  ? 19.008  17.921  10.012  1.00 0.00 ? 16  GLY A HA3  7  
ATOM 9686  N N    . VAL A 1 17  ? 20.222  15.950  12.332  1.00 0.00 ? 17  VAL A N    7  
ATOM 9687  C CA   . VAL A 1 17  ? 20.148  14.604  12.887  1.00 0.00 ? 17  VAL A CA   7  
ATOM 9688  C C    . VAL A 1 17  ? 20.304  14.625  14.403  1.00 0.00 ? 17  VAL A C    7  
ATOM 9689  O O    . VAL A 1 17  ? 21.295  15.131  14.930  1.00 0.00 ? 17  VAL A O    7  
ATOM 9690  C CB   . VAL A 1 17  ? 21.229  13.688  12.283  1.00 0.00 ? 17  VAL A CB   7  
ATOM 9691  C CG1  . VAL A 1 17  ? 22.598  14.344  12.378  1.00 0.00 ? 17  VAL A CG1  7  
ATOM 9692  C CG2  . VAL A 1 17  ? 21.229  12.335  12.977  1.00 0.00 ? 17  VAL A CG2  7  
ATOM 9693  H H    . VAL A 1 17  ? 20.705  16.645  12.827  1.00 0.00 ? 17  VAL A H    7  
ATOM 9694  H HA   . VAL A 1 17  ? 19.180  14.194  12.640  1.00 0.00 ? 17  VAL A HA   7  
ATOM 9695  H HB   . VAL A 1 17  ? 21.000  13.534  11.239  1.00 0.00 ? 17  VAL A HB   7  
ATOM 9696  H HG11 . VAL A 1 17  ? 23.169  13.873  13.164  1.00 0.00 ? 17  VAL A HG11 7  
ATOM 9697  H HG12 . VAL A 1 17  ? 23.117  14.232  11.437  1.00 0.00 ? 17  VAL A HG12 7  
ATOM 9698  H HG13 . VAL A 1 17  ? 22.479  15.394  12.600  1.00 0.00 ? 17  VAL A HG13 7  
ATOM 9699  H HG21 . VAL A 1 17  ? 21.408  11.557  12.250  1.00 0.00 ? 17  VAL A HG21 7  
ATOM 9700  H HG22 . VAL A 1 17  ? 22.008  12.313  13.726  1.00 0.00 ? 17  VAL A HG22 7  
ATOM 9701  H HG23 . VAL A 1 17  ? 20.271  12.172  13.450  1.00 0.00 ? 17  VAL A HG23 7  
ATOM 9702  N N    . LYS A 1 18  ? 19.318  14.071  15.101  1.00 0.00 ? 18  LYS A N    7  
ATOM 9703  C CA   . LYS A 1 18  ? 19.345  14.024  16.558  1.00 0.00 ? 18  LYS A CA   7  
ATOM 9704  C C    . LYS A 1 18  ? 19.135  12.599  17.060  1.00 0.00 ? 18  LYS A C    7  
ATOM 9705  O O    . LYS A 1 18  ? 18.584  11.755  16.353  1.00 0.00 ? 18  LYS A O    7  
ATOM 9706  C CB   . LYS A 1 18  ? 18.268  14.944  17.139  1.00 0.00 ? 18  LYS A CB   7  
ATOM 9707  C CG   . LYS A 1 18  ? 18.736  16.374  17.344  1.00 0.00 ? 18  LYS A CG   7  
ATOM 9708  C CD   . LYS A 1 18  ? 18.632  17.184  16.062  1.00 0.00 ? 18  LYS A CD   7  
ATOM 9709  C CE   . LYS A 1 18  ? 19.376  18.505  16.175  1.00 0.00 ? 18  LYS A CE   7  
ATOM 9710  N NZ   . LYS A 1 18  ? 18.723  19.428  17.145  1.00 0.00 ? 18  LYS A NZ   7  
ATOM 9711  H H    . LYS A 1 18  ? 18.554  13.684  14.624  1.00 0.00 ? 18  LYS A H    7  
ATOM 9712  H HA   . LYS A 1 18  ? 20.314  14.368  16.884  1.00 0.00 ? 18  LYS A HA   7  
ATOM 9713  H HB2  . LYS A 1 18  ? 17.422  14.956  16.468  1.00 0.00 ? 18  LYS A HB2  7  
ATOM 9714  H HB3  . LYS A 1 18  ? 17.953  14.550  18.095  1.00 0.00 ? 18  LYS A HB3  7  
ATOM 9715  H HG2  . LYS A 1 18  ? 18.123  16.839  18.101  1.00 0.00 ? 18  LYS A HG2  7  
ATOM 9716  H HG3  . LYS A 1 18  ? 19.767  16.363  17.669  1.00 0.00 ? 18  LYS A HG3  7  
ATOM 9717  H HD2  . LYS A 1 18  ? 19.058  16.613  15.250  1.00 0.00 ? 18  LYS A HD2  7  
ATOM 9718  H HD3  . LYS A 1 18  ? 17.590  17.383  15.856  1.00 0.00 ? 18  LYS A HD3  7  
ATOM 9719  H HE2  . LYS A 1 18  ? 20.385  18.308  16.503  1.00 0.00 ? 18  LYS A HE2  7  
ATOM 9720  H HE3  . LYS A 1 18  ? 19.398  18.975  15.203  1.00 0.00 ? 18  LYS A HE3  7  
ATOM 9721  H HZ1  . LYS A 1 18  ? 18.510  18.923  18.029  1.00 0.00 ? 18  LYS A HZ1  7  
ATOM 9722  H HZ2  . LYS A 1 18  ? 17.836  19.795  16.747  1.00 0.00 ? 18  LYS A HZ2  7  
ATOM 9723  H HZ3  . LYS A 1 18  ? 19.353  20.227  17.358  1.00 0.00 ? 18  LYS A HZ3  7  
ATOM 9724  N N    . THR A 1 19  ? 19.577  12.337  18.287  1.00 0.00 ? 19  THR A N    7  
ATOM 9725  C CA   . THR A 1 19  ? 19.437  11.014  18.883  1.00 0.00 ? 19  THR A CA   7  
ATOM 9726  C C    . THR A 1 19  ? 18.016  10.785  19.386  1.00 0.00 ? 19  THR A C    7  
ATOM 9727  O O    . THR A 1 19  ? 17.812  10.372  20.526  1.00 0.00 ? 19  THR A O    7  
ATOM 9728  C CB   . THR A 1 19  ? 20.421  10.818  20.052  1.00 0.00 ? 19  THR A CB   7  
ATOM 9729  O OG1  . THR A 1 19  ? 20.291  11.894  20.987  1.00 0.00 ? 19  THR A OG1  7  
ATOM 9730  C CG2  . THR A 1 19  ? 21.854  10.750  19.547  1.00 0.00 ? 19  THR A CG2  7  
ATOM 9731  H H    . THR A 1 19  ? 20.007  13.051  18.801  1.00 0.00 ? 19  THR A H    7  
ATOM 9732  H HA   . THR A 1 19  ? 19.663  10.280  18.123  1.00 0.00 ? 19  THR A HA   7  
ATOM 9733  H HB   . THR A 1 19  ? 20.185  9.888   20.549  1.00 0.00 ? 19  THR A HB   7  
ATOM 9734  H HG1  . THR A 1 19  ? 20.821  11.708  21.766  1.00 0.00 ? 19  THR A HG1  7  
ATOM 9735  H HG21 . THR A 1 19  ? 22.495  10.375  20.331  1.00 0.00 ? 19  THR A HG21 7  
ATOM 9736  H HG22 . THR A 1 19  ? 22.181  11.737  19.255  1.00 0.00 ? 19  THR A HG22 7  
ATOM 9737  H HG23 . THR A 1 19  ? 21.904  10.088  18.695  1.00 0.00 ? 19  THR A HG23 7  
ATOM 9738  N N    . GLU A 1 20  ? 17.038  11.056  18.527  1.00 0.00 ? 20  GLU A N    7  
ATOM 9739  C CA   . GLU A 1 20  ? 15.636  10.878  18.886  1.00 0.00 ? 20  GLU A CA   7  
ATOM 9740  C C    . GLU A 1 20  ? 15.084  9.583   18.298  1.00 0.00 ? 20  GLU A C    7  
ATOM 9741  O O    . GLU A 1 20  ? 15.749  8.914   17.508  1.00 0.00 ? 20  GLU A O    7  
ATOM 9742  C CB   . GLU A 1 20  ? 14.807  12.068  18.397  1.00 0.00 ? 20  GLU A CB   7  
ATOM 9743  C CG   . GLU A 1 20  ? 14.840  13.260  19.338  1.00 0.00 ? 20  GLU A CG   7  
ATOM 9744  C CD   . GLU A 1 20  ? 13.908  13.094  20.523  1.00 0.00 ? 20  GLU A CD   7  
ATOM 9745  O OE1  . GLU A 1 20  ? 14.291  12.395  21.484  1.00 0.00 ? 20  GLU A OE1  7  
ATOM 9746  O OE2  . GLU A 1 20  ? 12.796  13.661  20.488  1.00 0.00 ? 20  GLU A OE2  7  
ATOM 9747  H H    . GLU A 1 20  ? 17.265  11.382  17.631  1.00 0.00 ? 20  GLU A H    7  
ATOM 9748  H HA   . GLU A 1 20  ? 15.574  10.826  19.962  1.00 0.00 ? 20  GLU A HA   7  
ATOM 9749  H HB2  . GLU A 1 20  ? 15.185  12.383  17.435  1.00 0.00 ? 20  GLU A HB2  7  
ATOM 9750  H HB3  . GLU A 1 20  ? 13.780  11.752  18.284  1.00 0.00 ? 20  GLU A HB3  7  
ATOM 9751  H HG2  . GLU A 1 20  ? 15.847  13.384  19.707  1.00 0.00 ? 20  GLU A HG2  7  
ATOM 9752  H HG3  . GLU A 1 20  ? 14.547  14.143  18.790  1.00 0.00 ? 20  GLU A HG3  7  
ATOM 9753  N N    . ASN A 1 21  ? 13.862  9.236   18.690  1.00 0.00 ? 21  ASN A N    7  
ATOM 9754  C CA   . ASN A 1 21  ? 13.220  8.020   18.204  1.00 0.00 ? 21  ASN A CA   7  
ATOM 9755  C C    . ASN A 1 21  ? 12.241  8.336   17.077  1.00 0.00 ? 21  ASN A C    7  
ATOM 9756  O O    . ASN A 1 21  ? 11.317  9.130   17.249  1.00 0.00 ? 21  ASN A O    7  
ATOM 9757  C CB   . ASN A 1 21  ? 12.489  7.312   19.346  1.00 0.00 ? 21  ASN A CB   7  
ATOM 9758  C CG   . ASN A 1 21  ? 13.440  6.588   20.280  1.00 0.00 ? 21  ASN A CG   7  
ATOM 9759  O OD1  . ASN A 1 21  ? 14.547  7.057   20.542  1.00 0.00 ? 21  ASN A OD1  7  
ATOM 9760  N ND2  . ASN A 1 21  ? 13.010  5.438   20.786  1.00 0.00 ? 21  ASN A ND2  7  
ATOM 9761  H H    . ASN A 1 21  ? 13.382  9.810   19.322  1.00 0.00 ? 21  ASN A H    7  
ATOM 9762  H HA   . ASN A 1 21  ? 13.991  7.368   17.823  1.00 0.00 ? 21  ASN A HA   7  
ATOM 9763  H HB2  . ASN A 1 21  ? 11.939  8.043   19.921  1.00 0.00 ? 21  ASN A HB2  7  
ATOM 9764  H HB3  . ASN A 1 21  ? 11.800  6.591   18.933  1.00 0.00 ? 21  ASN A HB3  7  
ATOM 9765  H HD21 . ASN A 1 21  ? 12.116  5.125   20.532  1.00 0.00 ? 21  ASN A HD21 7  
ATOM 9766  H HD22 . ASN A 1 21  ? 13.604  4.949   21.393  1.00 0.00 ? 21  ASN A HD22 7  
ATOM 9767  N N    . ASN A 1 22  ? 12.451  7.708   15.925  1.00 0.00 ? 22  ASN A N    7  
ATOM 9768  C CA   . ASN A 1 22  ? 11.587  7.922   14.769  1.00 0.00 ? 22  ASN A CA   7  
ATOM 9769  C C    . ASN A 1 22  ? 10.149  7.519   15.083  1.00 0.00 ? 22  ASN A C    7  
ATOM 9770  O O    . ASN A 1 22  ? 9.882   6.380   15.466  1.00 0.00 ? 22  ASN A O    7  
ATOM 9771  C CB   . ASN A 1 22  ? 12.100  7.126   13.568  1.00 0.00 ? 22  ASN A CB   7  
ATOM 9772  C CG   . ASN A 1 22  ? 13.608  6.965   13.583  1.00 0.00 ? 22  ASN A CG   7  
ATOM 9773  O OD1  . ASN A 1 22  ? 14.127  5.908   13.943  1.00 0.00 ? 22  ASN A OD1  7  
ATOM 9774  N ND2  . ASN A 1 22  ? 14.319  8.016   13.190  1.00 0.00 ? 22  ASN A ND2  7  
ATOM 9775  H H    . ASN A 1 22  ? 13.205  7.086   15.849  1.00 0.00 ? 22  ASN A H    7  
ATOM 9776  H HA   . ASN A 1 22  ? 11.609  8.974   14.529  1.00 0.00 ? 22  ASN A HA   7  
ATOM 9777  H HB2  . ASN A 1 22  ? 11.653  6.142   13.578  1.00 0.00 ? 22  ASN A HB2  7  
ATOM 9778  H HB3  . ASN A 1 22  ? 11.820  7.636   12.659  1.00 0.00 ? 22  ASN A HB3  7  
ATOM 9779  H HD21 . ASN A 1 22  ? 13.838  8.825   12.917  1.00 0.00 ? 22  ASN A HD21 7  
ATOM 9780  H HD22 . ASN A 1 22  ? 15.296  7.939   13.189  1.00 0.00 ? 22  ASN A HD22 7  
ATOM 9781  N N    . ASP A 1 23  ? 9.227   8.462   14.918  1.00 0.00 ? 23  ASP A N    7  
ATOM 9782  C CA   . ASP A 1 23  ? 7.816   8.205   15.182  1.00 0.00 ? 23  ASP A CA   7  
ATOM 9783  C C    . ASP A 1 23  ? 7.210   7.327   14.092  1.00 0.00 ? 23  ASP A C    7  
ATOM 9784  O O    . ASP A 1 23  ? 6.734   6.224   14.362  1.00 0.00 ? 23  ASP A O    7  
ATOM 9785  C CB   . ASP A 1 23  ? 7.046   9.523   15.279  1.00 0.00 ? 23  ASP A CB   7  
ATOM 9786  C CG   . ASP A 1 23  ? 7.830   10.600  16.004  1.00 0.00 ? 23  ASP A CG   7  
ATOM 9787  O OD1  . ASP A 1 23  ? 8.943   10.932  15.546  1.00 0.00 ? 23  ASP A OD1  7  
ATOM 9788  O OD2  . ASP A 1 23  ? 7.330   11.110  17.029  1.00 0.00 ? 23  ASP A OD2  7  
ATOM 9789  H H    . ASP A 1 23  ? 9.502   9.351   14.611  1.00 0.00 ? 23  ASP A H    7  
ATOM 9790  H HA   . ASP A 1 23  ? 7.744   7.687   16.126  1.00 0.00 ? 23  ASP A HA   7  
ATOM 9791  H HB2  . ASP A 1 23  ? 6.822   9.876   14.283  1.00 0.00 ? 23  ASP A HB2  7  
ATOM 9792  H HB3  . ASP A 1 23  ? 6.122   9.354   15.813  1.00 0.00 ? 23  ASP A HB3  7  
ATOM 9793  N N    . HIS A 1 24  ? 7.230   7.823   12.859  1.00 0.00 ? 24  HIS A N    7  
ATOM 9794  C CA   . HIS A 1 24  ? 6.682   7.084   11.728  1.00 0.00 ? 24  HIS A CA   7  
ATOM 9795  C C    . HIS A 1 24  ? 7.633   5.972   11.294  1.00 0.00 ? 24  HIS A C    7  
ATOM 9796  O O    . HIS A 1 24  ? 8.813   5.980   11.644  1.00 0.00 ? 24  HIS A O    7  
ATOM 9797  C CB   . HIS A 1 24  ? 6.415   8.028   10.556  1.00 0.00 ? 24  HIS A CB   7  
ATOM 9798  C CG   . HIS A 1 24  ? 6.011   9.407   10.978  1.00 0.00 ? 24  HIS A CG   7  
ATOM 9799  N ND1  . HIS A 1 24  ? 4.917   9.659   11.778  1.00 0.00 ? 24  HIS A ND1  7  
ATOM 9800  C CD2  . HIS A 1 24  ? 6.563   10.613  10.707  1.00 0.00 ? 24  HIS A CD2  7  
ATOM 9801  C CE1  . HIS A 1 24  ? 4.812   10.961  11.980  1.00 0.00 ? 24  HIS A CE1  7  
ATOM 9802  N NE2  . HIS A 1 24  ? 5.800   11.562  11.341  1.00 0.00 ? 24  HIS A NE2  7  
ATOM 9803  H H    . HIS A 1 24  ? 7.623   8.708   12.707  1.00 0.00 ? 24  HIS A H    7  
ATOM 9804  H HA   . HIS A 1 24  ? 5.750   6.641   12.042  1.00 0.00 ? 24  HIS A HA   7  
ATOM 9805  H HB2  . HIS A 1 24  ? 7.311   8.113   9.959   1.00 0.00 ? 24  HIS A HB2  7  
ATOM 9806  H HB3  . HIS A 1 24  ? 5.620   7.620   9.947   1.00 0.00 ? 24  HIS A HB3  7  
ATOM 9807  H HD1  . HIS A 1 24  ? 4.307   8.985   12.142  1.00 0.00 ? 24  HIS A HD1  7  
ATOM 9808  H HD2  . HIS A 1 24  ? 7.441   10.796  10.103  1.00 0.00 ? 24  HIS A HD2  7  
ATOM 9809  H HE1  . HIS A 1 24  ? 4.051   11.450  12.568  1.00 0.00 ? 24  HIS A HE1  7  
ATOM 9810  H HE2  . HIS A 1 24  ? 5.908   12.532  11.255  1.00 0.00 ? 24  HIS A HE2  7  
ATOM 9811  N N    . ILE A 1 25  ? 7.110   5.018   10.532  1.00 0.00 ? 25  ILE A N    7  
ATOM 9812  C CA   . ILE A 1 25  ? 7.913   3.900   10.051  1.00 0.00 ? 25  ILE A CA   7  
ATOM 9813  C C    . ILE A 1 25  ? 7.830   3.777   8.533   1.00 0.00 ? 25  ILE A C    7  
ATOM 9814  O O    . ILE A 1 25  ? 6.788   4.040   7.935   1.00 0.00 ? 25  ILE A O    7  
ATOM 9815  C CB   . ILE A 1 25  ? 7.465   2.571   10.687  1.00 0.00 ? 25  ILE A CB   7  
ATOM 9816  C CG1  . ILE A 1 25  ? 5.971   2.343   10.449  1.00 0.00 ? 25  ILE A CG1  7  
ATOM 9817  C CG2  . ILE A 1 25  ? 7.777   2.565   12.176  1.00 0.00 ? 25  ILE A CG2  7  
ATOM 9818  C CD1  . ILE A 1 25  ? 5.406   1.177   11.229  1.00 0.00 ? 25  ILE A CD1  7  
ATOM 9819  H H    . ILE A 1 25  ? 6.163   5.067   10.286  1.00 0.00 ? 25  ILE A H    7  
ATOM 9820  H HA   . ILE A 1 25  ? 8.940   4.082   10.331  1.00 0.00 ? 25  ILE A HA   7  
ATOM 9821  H HB   . ILE A 1 25  ? 8.022   1.770   10.224  1.00 0.00 ? 25  ILE A HB   7  
ATOM 9822  H HG12 . ILE A 1 25  ? 5.428   3.229   10.739  1.00 0.00 ? 25  ILE A HG12 7  
ATOM 9823  H HG13 . ILE A 1 25  ? 5.807   2.153   9.399   1.00 0.00 ? 25  ILE A HG13 7  
ATOM 9824  H HG21 . ILE A 1 25  ? 8.607   3.228   12.372  1.00 0.00 ? 25  ILE A HG21 7  
ATOM 9825  H HG22 . ILE A 1 25  ? 6.911   2.901   12.726  1.00 0.00 ? 25  ILE A HG22 7  
ATOM 9826  H HG23 . ILE A 1 25  ? 8.036   1.564   12.487  1.00 0.00 ? 25  ILE A HG23 7  
ATOM 9827  H HD11 . ILE A 1 25  ? 4.691   0.647   10.617  1.00 0.00 ? 25  ILE A HD11 7  
ATOM 9828  H HD12 . ILE A 1 25  ? 6.206   0.509   11.509  1.00 0.00 ? 25  ILE A HD12 7  
ATOM 9829  H HD13 . ILE A 1 25  ? 4.915   1.543   12.119  1.00 0.00 ? 25  ILE A HD13 7  
ATOM 9830  N N    . ASN A 1 26  ? 8.936   3.373   7.916   1.00 0.00 ? 26  ASN A N    7  
ATOM 9831  C CA   . ASN A 1 26  ? 8.988   3.213   6.468   1.00 0.00 ? 26  ASN A CA   7  
ATOM 9832  C C    . ASN A 1 26  ? 9.142   1.744   6.087   1.00 0.00 ? 26  ASN A C    7  
ATOM 9833  O O    . ASN A 1 26  ? 10.157  1.116   6.389   1.00 0.00 ? 26  ASN A O    7  
ATOM 9834  C CB   . ASN A 1 26  ? 10.147  4.026   5.886   1.00 0.00 ? 26  ASN A CB   7  
ATOM 9835  C CG   . ASN A 1 26  ? 10.127  5.471   6.344   1.00 0.00 ? 26  ASN A CG   7  
ATOM 9836  O OD1  . ASN A 1 26  ? 9.767   6.370   5.584   1.00 0.00 ? 26  ASN A OD1  7  
ATOM 9837  N ND2  . ASN A 1 26  ? 10.516  5.701   7.593   1.00 0.00 ? 26  ASN A ND2  7  
ATOM 9838  H H    . ASN A 1 26  ? 9.736   3.178   8.448   1.00 0.00 ? 26  ASN A H    7  
ATOM 9839  H HA   . ASN A 1 26  ? 8.060   3.584   6.059   1.00 0.00 ? 26  ASN A HA   7  
ATOM 9840  H HB2  . ASN A 1 26  ? 11.082  3.582   6.198   1.00 0.00 ? 26  ASN A HB2  7  
ATOM 9841  H HB3  . ASN A 1 26  ? 10.087  4.007   4.808   1.00 0.00 ? 26  ASN A HB3  7  
ATOM 9842  H HD21 . ASN A 1 26  ? 10.791  4.936   8.141   1.00 0.00 ? 26  ASN A HD21 7  
ATOM 9843  H HD22 . ASN A 1 26  ? 10.513  6.627   7.915   1.00 0.00 ? 26  ASN A HD22 7  
ATOM 9844  N N    . LEU A 1 27  ? 8.127   1.201   5.423   1.00 0.00 ? 27  LEU A N    7  
ATOM 9845  C CA   . LEU A 1 27  ? 8.148   -0.195  5.001   1.00 0.00 ? 27  LEU A CA   7  
ATOM 9846  C C    . LEU A 1 27  ? 8.441   -0.307  3.508   1.00 0.00 ? 27  LEU A C    7  
ATOM 9847  O O    . LEU A 1 27  ? 7.815   0.366   2.689   1.00 0.00 ? 27  LEU A O    7  
ATOM 9848  C CB   . LEU A 1 27  ? 6.811   -0.865  5.321   1.00 0.00 ? 27  LEU A CB   7  
ATOM 9849  C CG   . LEU A 1 27  ? 6.133   -0.424  6.619   1.00 0.00 ? 27  LEU A CG   7  
ATOM 9850  C CD1  . LEU A 1 27  ? 4.781   -1.103  6.772   1.00 0.00 ? 27  LEU A CD1  7  
ATOM 9851  C CD2  . LEU A 1 27  ? 7.023   -0.727  7.815   1.00 0.00 ? 27  LEU A CD2  7  
ATOM 9852  H H    . LEU A 1 27  ? 7.345   1.752   5.212   1.00 0.00 ? 27  LEU A H    7  
ATOM 9853  H HA   . LEU A 1 27  ? 8.933   -0.695  5.548   1.00 0.00 ? 27  LEU A HA   7  
ATOM 9854  H HB2  . LEU A 1 27  ? 6.134   -0.658  4.507   1.00 0.00 ? 27  LEU A HB2  7  
ATOM 9855  H HB3  . LEU A 1 27  ? 6.983   -1.931  5.382   1.00 0.00 ? 27  LEU A HB3  7  
ATOM 9856  H HG   . LEU A 1 27  ? 5.967   0.644   6.586   1.00 0.00 ? 27  LEU A HG   7  
ATOM 9857  H HD11 . LEU A 1 27  ? 4.074   -0.657  6.089   1.00 0.00 ? 27  LEU A HD11 7  
ATOM 9858  H HD12 . LEU A 1 27  ? 4.429   -0.979  7.785   1.00 0.00 ? 27  LEU A HD12 7  
ATOM 9859  H HD13 . LEU A 1 27  ? 4.880   -2.156  6.552   1.00 0.00 ? 27  LEU A HD13 7  
ATOM 9860  H HD21 . LEU A 1 27  ? 7.070   0.141   8.456   1.00 0.00 ? 27  LEU A HD21 7  
ATOM 9861  H HD22 . LEU A 1 27  ? 8.016   -0.975  7.471   1.00 0.00 ? 27  LEU A HD22 7  
ATOM 9862  H HD23 . LEU A 1 27  ? 6.613   -1.560  8.367   1.00 0.00 ? 27  LEU A HD23 7  
ATOM 9863  N N    . LYS A 1 28  ? 9.396   -1.164  3.161   1.00 0.00 ? 28  LYS A N    7  
ATOM 9864  C CA   . LYS A 1 28  ? 9.771   -1.369  1.767   1.00 0.00 ? 28  LYS A CA   7  
ATOM 9865  C C    . LYS A 1 28  ? 8.959   -2.501  1.146   1.00 0.00 ? 28  LYS A C    7  
ATOM 9866  O O    . LYS A 1 28  ? 9.117   -3.665  1.512   1.00 0.00 ? 28  LYS A O    7  
ATOM 9867  C CB   . LYS A 1 28  ? 11.265  -1.680  1.660   1.00 0.00 ? 28  LYS A CB   7  
ATOM 9868  C CG   . LYS A 1 28  ? 12.156  -0.470  1.881   1.00 0.00 ? 28  LYS A CG   7  
ATOM 9869  C CD   . LYS A 1 28  ? 13.610  -0.874  2.064   1.00 0.00 ? 28  LYS A CD   7  
ATOM 9870  C CE   . LYS A 1 28  ? 13.884  -1.342  3.485   1.00 0.00 ? 28  LYS A CE   7  
ATOM 9871  N NZ   . LYS A 1 28  ? 14.983  -2.345  3.536   1.00 0.00 ? 28  LYS A NZ   7  
ATOM 9872  H H    . LYS A 1 28  ? 9.859   -1.672  3.860   1.00 0.00 ? 28  LYS A H    7  
ATOM 9873  H HA   . LYS A 1 28  ? 9.563   -0.456  1.230   1.00 0.00 ? 28  LYS A HA   7  
ATOM 9874  H HB2  . LYS A 1 28  ? 11.519  -2.428  2.397   1.00 0.00 ? 28  LYS A HB2  7  
ATOM 9875  H HB3  . LYS A 1 28  ? 11.469  -2.075  0.675   1.00 0.00 ? 28  LYS A HB3  7  
ATOM 9876  H HG2  . LYS A 1 28  ? 12.080  0.184   1.025   1.00 0.00 ? 28  LYS A HG2  7  
ATOM 9877  H HG3  . LYS A 1 28  ? 11.823  0.053   2.767   1.00 0.00 ? 28  LYS A HG3  7  
ATOM 9878  H HD2  . LYS A 1 28  ? 13.839  -1.679  1.381   1.00 0.00 ? 28  LYS A HD2  7  
ATOM 9879  H HD3  . LYS A 1 28  ? 14.240  -0.023  1.846   1.00 0.00 ? 28  LYS A HD3  7  
ATOM 9880  H HE2  . LYS A 1 28  ? 14.160  -0.487  4.084   1.00 0.00 ? 28  LYS A HE2  7  
ATOM 9881  H HE3  . LYS A 1 28  ? 12.984  -1.785  3.884   1.00 0.00 ? 28  LYS A HE3  7  
ATOM 9882  H HZ1  . LYS A 1 28  ? 14.832  -3.000  4.330   1.00 0.00 ? 28  LYS A HZ1  7  
ATOM 9883  H HZ2  . LYS A 1 28  ? 15.898  -1.868  3.664   1.00 0.00 ? 28  LYS A HZ2  7  
ATOM 9884  H HZ3  . LYS A 1 28  ? 15.010  -2.891  2.651   1.00 0.00 ? 28  LYS A HZ3  7  
ATOM 9885  N N    . VAL A 1 29  ? 8.090   -2.151  0.202   1.00 0.00 ? 29  VAL A N    7  
ATOM 9886  C CA   . VAL A 1 29  ? 7.256   -3.139  -0.472  1.00 0.00 ? 29  VAL A CA   7  
ATOM 9887  C C    . VAL A 1 29  ? 7.914   -3.630  -1.757  1.00 0.00 ? 29  VAL A C    7  
ATOM 9888  O O    . VAL A 1 29  ? 8.365   -2.833  -2.579  1.00 0.00 ? 29  VAL A O    7  
ATOM 9889  C CB   . VAL A 1 29  ? 5.866   -2.564  -0.807  1.00 0.00 ? 29  VAL A CB   7  
ATOM 9890  C CG1  . VAL A 1 29  ? 4.973   -3.641  -1.404  1.00 0.00 ? 29  VAL A CG1  7  
ATOM 9891  C CG2  . VAL A 1 29  ? 5.228   -1.957  0.433   1.00 0.00 ? 29  VAL A CG2  7  
ATOM 9892  H H    . VAL A 1 29  ? 8.010   -1.207  -0.047  1.00 0.00 ? 29  VAL A H    7  
ATOM 9893  H HA   . VAL A 1 29  ? 7.124   -3.977  0.197   1.00 0.00 ? 29  VAL A HA   7  
ATOM 9894  H HB   . VAL A 1 29  ? 5.990   -1.783  -1.542  1.00 0.00 ? 29  VAL A HB   7  
ATOM 9895  H HG11 . VAL A 1 29  ? 5.412   -4.612  -1.225  1.00 0.00 ? 29  VAL A HG11 7  
ATOM 9896  H HG12 . VAL A 1 29  ? 3.997   -3.595  -0.943  1.00 0.00 ? 29  VAL A HG12 7  
ATOM 9897  H HG13 . VAL A 1 29  ? 4.877   -3.480  -2.468  1.00 0.00 ? 29  VAL A HG13 7  
ATOM 9898  H HG21 . VAL A 1 29  ? 4.711   -1.048  0.162   1.00 0.00 ? 29  VAL A HG21 7  
ATOM 9899  H HG22 . VAL A 1 29  ? 4.524   -2.659  0.857   1.00 0.00 ? 29  VAL A HG22 7  
ATOM 9900  H HG23 . VAL A 1 29  ? 5.994   -1.733  1.160   1.00 0.00 ? 29  VAL A HG23 7  
ATOM 9901  N N    . ALA A 1 30  ? 7.964   -4.947  -1.923  1.00 0.00 ? 30  ALA A N    7  
ATOM 9902  C CA   . ALA A 1 30  ? 8.565   -5.545  -3.109  1.00 0.00 ? 30  ALA A CA   7  
ATOM 9903  C C    . ALA A 1 30  ? 7.498   -6.114  -4.037  1.00 0.00 ? 30  ALA A C    7  
ATOM 9904  O O    . ALA A 1 30  ? 6.635   -6.881  -3.611  1.00 0.00 ? 30  ALA A O    7  
ATOM 9905  C CB   . ALA A 1 30  ? 9.553   -6.631  -2.710  1.00 0.00 ? 30  ALA A CB   7  
ATOM 9906  H H    . ALA A 1 30  ? 7.587   -5.531  -1.232  1.00 0.00 ? 30  ALA A H    7  
ATOM 9907  H HA   . ALA A 1 30  ? 9.109   -4.772  -3.633  1.00 0.00 ? 30  ALA A HA   7  
ATOM 9908  H HB1  . ALA A 1 30  ? 9.587   -6.707  -1.633  1.00 0.00 ? 30  ALA A HB1  7  
ATOM 9909  H HB2  . ALA A 1 30  ? 9.239   -7.575  -3.128  1.00 0.00 ? 30  ALA A HB2  7  
ATOM 9910  H HB3  . ALA A 1 30  ? 10.534  -6.379  -3.084  1.00 0.00 ? 30  ALA A HB3  7  
ATOM 9911  N N    . GLY A 1 31  ? 7.562   -5.733  -5.310  1.00 0.00 ? 31  GLY A N    7  
ATOM 9912  C CA   . GLY A 1 31  ? 6.594   -6.214  -6.278  1.00 0.00 ? 31  GLY A CA   7  
ATOM 9913  C C    . GLY A 1 31  ? 7.251   -6.829  -7.498  1.00 0.00 ? 31  GLY A C    7  
ATOM 9914  O O    . GLY A 1 31  ? 6.758   -7.815  -8.044  1.00 0.00 ? 31  GLY A O    7  
ATOM 9915  H H    . GLY A 1 31  ? 8.272   -5.119  -5.593  1.00 0.00 ? 31  GLY A H    7  
ATOM 9916  H HA2  . GLY A 1 31  ? 5.968   -6.957  -5.806  1.00 0.00 ? 31  GLY A HA2  7  
ATOM 9917  H HA3  . GLY A 1 31  ? 5.977   -5.386  -6.595  1.00 0.00 ? 31  GLY A HA3  7  
ATOM 9918  N N    . GLN A 1 32  ? 8.365   -6.244  -7.926  1.00 0.00 ? 32  GLN A N    7  
ATOM 9919  C CA   . GLN A 1 32  ? 9.089   -6.740  -9.090  1.00 0.00 ? 32  GLN A CA   7  
ATOM 9920  C C    . GLN A 1 32  ? 10.578  -6.877  -8.788  1.00 0.00 ? 32  GLN A C    7  
ATOM 9921  O O    . GLN A 1 32  ? 11.062  -6.385  -7.769  1.00 0.00 ? 32  GLN A O    7  
ATOM 9922  C CB   . GLN A 1 32  ? 8.882   -5.804  -10.282 1.00 0.00 ? 32  GLN A CB   7  
ATOM 9923  C CG   . GLN A 1 32  ? 9.530   -6.300  -11.565 1.00 0.00 ? 32  GLN A CG   7  
ATOM 9924  C CD   . GLN A 1 32  ? 8.946   -5.650  -12.803 1.00 0.00 ? 32  GLN A CD   7  
ATOM 9925  O OE1  . GLN A 1 32  ? 9.157   -4.463  -13.054 1.00 0.00 ? 32  GLN A OE1  7  
ATOM 9926  N NE2  . GLN A 1 32  ? 8.205   -6.426  -13.586 1.00 0.00 ? 32  GLN A NE2  7  
ATOM 9927  H H    . GLN A 1 32  ? 8.708   -5.462  -7.447  1.00 0.00 ? 32  GLN A H    7  
ATOM 9928  H HA   . GLN A 1 32  ? 8.694   -7.714  -9.336  1.00 0.00 ? 32  GLN A HA   7  
ATOM 9929  H HB2  . GLN A 1 32  ? 7.823   -5.694  -10.459 1.00 0.00 ? 32  GLN A HB2  7  
ATOM 9930  H HB3  . GLN A 1 32  ? 9.302   -4.838  -10.043 1.00 0.00 ? 32  GLN A HB3  7  
ATOM 9931  H HG2  . GLN A 1 32  ? 10.587  -6.081  -11.527 1.00 0.00 ? 32  GLN A HG2  7  
ATOM 9932  H HG3  . GLN A 1 32  ? 9.388   -7.369  -11.635 1.00 0.00 ? 32  GLN A HG3  7  
ATOM 9933  H HE21 . GLN A 1 32  ? 8.079   -7.362  -13.323 1.00 0.00 ? 32  GLN A HE21 7  
ATOM 9934  H HE22 . GLN A 1 32  ? 7.815   -6.032  -14.393 1.00 0.00 ? 32  GLN A HE22 7  
ATOM 9935  N N    . ASP A 1 33  ? 11.298  -7.549  -9.680  1.00 0.00 ? 33  ASP A N    7  
ATOM 9936  C CA   . ASP A 1 33  ? 12.732  -7.750  -9.510  1.00 0.00 ? 33  ASP A CA   7  
ATOM 9937  C C    . ASP A 1 33  ? 13.516  -6.557  -10.047 1.00 0.00 ? 33  ASP A C    7  
ATOM 9938  O O    . ASP A 1 33  ? 14.656  -6.698  -10.487 1.00 0.00 ? 33  ASP A O    7  
ATOM 9939  C CB   . ASP A 1 33  ? 13.177  -9.030  -10.219 1.00 0.00 ? 33  ASP A CB   7  
ATOM 9940  C CG   . ASP A 1 33  ? 12.450  -10.258 -9.707  1.00 0.00 ? 33  ASP A CG   7  
ATOM 9941  O OD1  . ASP A 1 33  ? 12.893  -10.827 -8.687  1.00 0.00 ? 33  ASP A OD1  7  
ATOM 9942  O OD2  . ASP A 1 33  ? 11.440  -10.652 -10.327 1.00 0.00 ? 33  ASP A OD2  7  
ATOM 9943  H H    . ASP A 1 33  ? 10.854  -7.918  -10.473 1.00 0.00 ? 33  ASP A H    7  
ATOM 9944  H HA   . ASP A 1 33  ? 12.930  -7.848  -8.453  1.00 0.00 ? 33  ASP A HA   7  
ATOM 9945  H HB2  . ASP A 1 33  ? 12.981  -8.934  -11.277 1.00 0.00 ? 33  ASP A HB2  7  
ATOM 9946  H HB3  . ASP A 1 33  ? 14.237  -9.170  -10.064 1.00 0.00 ? 33  ASP A HB3  7  
ATOM 9947  N N    . GLY A 1 34  ? 12.895  -5.382  -10.010 1.00 0.00 ? 34  GLY A N    7  
ATOM 9948  C CA   . GLY A 1 34  ? 13.549  -4.182  -10.498 1.00 0.00 ? 34  GLY A CA   7  
ATOM 9949  C C    . GLY A 1 34  ? 12.831  -2.916  -10.071 1.00 0.00 ? 34  GLY A C    7  
ATOM 9950  O O    . GLY A 1 34  ? 12.954  -1.877  -10.719 1.00 0.00 ? 34  GLY A O    7  
ATOM 9951  H H    . GLY A 1 34  ? 11.985  -5.330  -9.649  1.00 0.00 ? 34  GLY A H    7  
ATOM 9952  H HA2  . GLY A 1 34  ? 14.559  -4.155  -10.118 1.00 0.00 ? 34  GLY A HA2  7  
ATOM 9953  H HA3  . GLY A 1 34  ? 13.582  -4.216  -11.577 1.00 0.00 ? 34  GLY A HA3  7  
ATOM 9954  N N    . SER A 1 35  ? 12.077  -3.004  -8.980  1.00 0.00 ? 35  SER A N    7  
ATOM 9955  C CA   . SER A 1 35  ? 11.332  -1.859  -8.471  1.00 0.00 ? 35  SER A CA   7  
ATOM 9956  C C    . SER A 1 35  ? 10.989  -2.046  -6.996  1.00 0.00 ? 35  SER A C    7  
ATOM 9957  O O    . SER A 1 35  ? 10.859  -3.172  -6.515  1.00 0.00 ? 35  SER A O    7  
ATOM 9958  C CB   . SER A 1 35  ? 10.051  -1.656  -9.283  1.00 0.00 ? 35  SER A CB   7  
ATOM 9959  O OG   . SER A 1 35  ? 9.587   -0.321  -9.177  1.00 0.00 ? 35  SER A OG   7  
ATOM 9960  H H    . SER A 1 35  ? 12.019  -3.861  -8.507  1.00 0.00 ? 35  SER A H    7  
ATOM 9961  H HA   . SER A 1 35  ? 11.957  -0.984  -8.575  1.00 0.00 ? 35  SER A HA   7  
ATOM 9962  H HB2  . SER A 1 35  ? 10.248  -1.874  -10.321 1.00 0.00 ? 35  SER A HB2  7  
ATOM 9963  H HB3  . SER A 1 35  ? 9.285   -2.321  -8.913  1.00 0.00 ? 35  SER A HB3  7  
ATOM 9964  H HG   . SER A 1 35  ? 8.680   -0.321  -8.863  1.00 0.00 ? 35  SER A HG   7  
ATOM 9965  N N    . VAL A 1 36  ? 10.843  -0.934  -6.283  1.00 0.00 ? 36  VAL A N    7  
ATOM 9966  C CA   . VAL A 1 36  ? 10.513  -0.973  -4.864  1.00 0.00 ? 36  VAL A CA   7  
ATOM 9967  C C    . VAL A 1 36  ? 9.679   0.237   -4.459  1.00 0.00 ? 36  VAL A C    7  
ATOM 9968  O O    . VAL A 1 36  ? 9.979   1.368   -4.842  1.00 0.00 ? 36  VAL A O    7  
ATOM 9969  C CB   . VAL A 1 36  ? 11.784  -1.021  -3.994  1.00 0.00 ? 36  VAL A CB   7  
ATOM 9970  C CG1  . VAL A 1 36  ? 11.428  -0.882  -2.521  1.00 0.00 ? 36  VAL A CG1  7  
ATOM 9971  C CG2  . VAL A 1 36  ? 12.554  -2.308  -4.246  1.00 0.00 ? 36  VAL A CG2  7  
ATOM 9972  H H    . VAL A 1 36  ? 10.959  -0.065  -6.723  1.00 0.00 ? 36  VAL A H    7  
ATOM 9973  H HA   . VAL A 1 36  ? 9.942   -1.871  -4.678  1.00 0.00 ? 36  VAL A HA   7  
ATOM 9974  H HB   . VAL A 1 36  ? 12.415  -0.188  -4.269  1.00 0.00 ? 36  VAL A HB   7  
ATOM 9975  H HG11 . VAL A 1 36  ? 12.333  -0.769  -1.942  1.00 0.00 ? 36  VAL A HG11 7  
ATOM 9976  H HG12 . VAL A 1 36  ? 10.799  -0.015  -2.382  1.00 0.00 ? 36  VAL A HG12 7  
ATOM 9977  H HG13 . VAL A 1 36  ? 10.901  -1.766  -2.194  1.00 0.00 ? 36  VAL A HG13 7  
ATOM 9978  H HG21 . VAL A 1 36  ? 11.900  -3.153  -4.093  1.00 0.00 ? 36  VAL A HG21 7  
ATOM 9979  H HG22 . VAL A 1 36  ? 12.919  -2.316  -5.263  1.00 0.00 ? 36  VAL A HG22 7  
ATOM 9980  H HG23 . VAL A 1 36  ? 13.388  -2.368  -3.564  1.00 0.00 ? 36  VAL A HG23 7  
ATOM 9981  N N    . VAL A 1 37  ? 8.628   -0.008  -3.682  1.00 0.00 ? 37  VAL A N    7  
ATOM 9982  C CA   . VAL A 1 37  ? 7.750   1.061   -3.224  1.00 0.00 ? 37  VAL A CA   7  
ATOM 9983  C C    . VAL A 1 37  ? 7.769   1.174   -1.704  1.00 0.00 ? 37  VAL A C    7  
ATOM 9984  O O    . VAL A 1 37  ? 7.458   0.216   -0.997  1.00 0.00 ? 37  VAL A O    7  
ATOM 9985  C CB   . VAL A 1 37  ? 6.300   0.837   -3.693  1.00 0.00 ? 37  VAL A CB   7  
ATOM 9986  C CG1  . VAL A 1 37  ? 5.527   2.147   -3.681  1.00 0.00 ? 37  VAL A CG1  7  
ATOM 9987  C CG2  . VAL A 1 37  ? 6.280   0.209   -5.079  1.00 0.00 ? 37  VAL A CG2  7  
ATOM 9988  H H    . VAL A 1 37  ? 8.440   -0.931  -3.411  1.00 0.00 ? 37  VAL A H    7  
ATOM 9989  H HA   . VAL A 1 37  ? 8.104   1.989   -3.649  1.00 0.00 ? 37  VAL A HA   7  
ATOM 9990  H HB   . VAL A 1 37  ? 5.822   0.156   -3.005  1.00 0.00 ? 37  VAL A HB   7  
ATOM 9991  H HG11 . VAL A 1 37  ? 5.901   2.793   -4.462  1.00 0.00 ? 37  VAL A HG11 7  
ATOM 9992  H HG12 . VAL A 1 37  ? 4.478   1.947   -3.850  1.00 0.00 ? 37  VAL A HG12 7  
ATOM 9993  H HG13 . VAL A 1 37  ? 5.652   2.630   -2.724  1.00 0.00 ? 37  VAL A HG13 7  
ATOM 9994  H HG21 . VAL A 1 37  ? 5.278   -0.117  -5.311  1.00 0.00 ? 37  VAL A HG21 7  
ATOM 9995  H HG22 . VAL A 1 37  ? 6.600   0.938   -5.810  1.00 0.00 ? 37  VAL A HG22 7  
ATOM 9996  H HG23 . VAL A 1 37  ? 6.949   -0.638  -5.100  1.00 0.00 ? 37  VAL A HG23 7  
ATOM 9997  N N    . GLN A 1 38  ? 8.135   2.352   -1.208  1.00 0.00 ? 38  GLN A N    7  
ATOM 9998  C CA   . GLN A 1 38  ? 8.194   2.590   0.230   1.00 0.00 ? 38  GLN A CA   7  
ATOM 9999  C C    . GLN A 1 38  ? 6.965   3.357   0.706   1.00 0.00 ? 38  GLN A C    7  
ATOM 10000 O O    . GLN A 1 38  ? 6.243   3.951   -0.095  1.00 0.00 ? 38  GLN A O    7  
ATOM 10001 C CB   . GLN A 1 38  ? 9.464   3.364   0.588   1.00 0.00 ? 38  GLN A CB   7  
ATOM 10002 C CG   . GLN A 1 38  ? 10.738  2.549   0.433   1.00 0.00 ? 38  GLN A CG   7  
ATOM 10003 C CD   . GLN A 1 38  ? 11.945  3.409   0.116   1.00 0.00 ? 38  GLN A CD   7  
ATOM 10004 O OE1  . GLN A 1 38  ? 12.598  3.939   1.016   1.00 0.00 ? 38  GLN A OE1  7  
ATOM 10005 N NE2  . GLN A 1 38  ? 12.250  3.552   -1.169  1.00 0.00 ? 38  GLN A NE2  7  
ATOM 10006 H H    . GLN A 1 38  ? 8.371   3.077   -1.822  1.00 0.00 ? 38  GLN A H    7  
ATOM 10007 H HA   . GLN A 1 38  ? 8.218   1.630   0.723   1.00 0.00 ? 38  GLN A HA   7  
ATOM 10008 H HB2  . GLN A 1 38  ? 9.535   4.230   -0.053  1.00 0.00 ? 38  GLN A HB2  7  
ATOM 10009 H HB3  . GLN A 1 38  ? 9.394   3.690   1.615   1.00 0.00 ? 38  GLN A HB3  7  
ATOM 10010 H HG2  . GLN A 1 38  ? 10.925  2.019   1.354   1.00 0.00 ? 38  GLN A HG2  7  
ATOM 10011 H HG3  . GLN A 1 38  ? 10.599  1.839   -0.369  1.00 0.00 ? 38  GLN A HG3  7  
ATOM 10012 H HE21 . GLN A 1 38  ? 11.684  3.101   -1.831  1.00 0.00 ? 38  GLN A HE21 7  
ATOM 10013 H HE22 . GLN A 1 38  ? 13.025  4.103   -1.402  1.00 0.00 ? 38  GLN A HE22 7  
ATOM 10014 N N    . PHE A 1 39  ? 6.733   3.339   2.014   1.00 0.00 ? 39  PHE A N    7  
ATOM 10015 C CA   . PHE A 1 39  ? 5.589   4.032   2.597   1.00 0.00 ? 39  PHE A CA   7  
ATOM 10016 C C    . PHE A 1 39  ? 5.871   4.422   4.045   1.00 0.00 ? 39  PHE A C    7  
ATOM 10017 O O    . PHE A 1 39  ? 6.208   3.577   4.874   1.00 0.00 ? 39  PHE A O    7  
ATOM 10018 C CB   . PHE A 1 39  ? 4.342   3.149   2.528   1.00 0.00 ? 39  PHE A CB   7  
ATOM 10019 C CG   . PHE A 1 39  ? 3.930   2.801   1.126   1.00 0.00 ? 39  PHE A CG   7  
ATOM 10020 C CD1  . PHE A 1 39  ? 4.486   1.709   0.478   1.00 0.00 ? 39  PHE A CD1  7  
ATOM 10021 C CD2  . PHE A 1 39  ? 2.988   3.565   0.456   1.00 0.00 ? 39  PHE A CD2  7  
ATOM 10022 C CE1  . PHE A 1 39  ? 4.110   1.387   -0.813  1.00 0.00 ? 39  PHE A CE1  7  
ATOM 10023 C CE2  . PHE A 1 39  ? 2.608   3.247   -0.835  1.00 0.00 ? 39  PHE A CE2  7  
ATOM 10024 C CZ   . PHE A 1 39  ? 3.169   2.156   -1.469  1.00 0.00 ? 39  PHE A CZ   7  
ATOM 10025 H H    . PHE A 1 39  ? 7.344   2.847   2.601   1.00 0.00 ? 39  PHE A H    7  
ATOM 10026 H HA   . PHE A 1 39  ? 5.418   4.928   2.022   1.00 0.00 ? 39  PHE A HA   7  
ATOM 10027 H HB2  . PHE A 1 39  ? 4.532   2.227   3.056   1.00 0.00 ? 39  PHE A HB2  7  
ATOM 10028 H HB3  . PHE A 1 39  ? 3.518   3.665   2.998   1.00 0.00 ? 39  PHE A HB3  7  
ATOM 10029 H HD1  . PHE A 1 39  ? 5.221   1.106   0.990   1.00 0.00 ? 39  PHE A HD1  7  
ATOM 10030 H HD2  . PHE A 1 39  ? 2.549   4.419   0.952   1.00 0.00 ? 39  PHE A HD2  7  
ATOM 10031 H HE1  . PHE A 1 39  ? 4.550   0.533   -1.307  1.00 0.00 ? 39  PHE A HE1  7  
ATOM 10032 H HE2  . PHE A 1 39  ? 1.872   3.851   -1.345  1.00 0.00 ? 39  PHE A HE2  7  
ATOM 10033 H HZ   . PHE A 1 39  ? 2.874   1.907   -2.477  1.00 0.00 ? 39  PHE A HZ   7  
ATOM 10034 N N    . LYS A 1 40  ? 5.729   5.709   4.342   1.00 0.00 ? 40  LYS A N    7  
ATOM 10035 C CA   . LYS A 1 40  ? 5.966   6.214   5.690   1.00 0.00 ? 40  LYS A CA   7  
ATOM 10036 C C    . LYS A 1 40  ? 4.654   6.602   6.364   1.00 0.00 ? 40  LYS A C    7  
ATOM 10037 O O    . LYS A 1 40  ? 4.009   7.575   5.974   1.00 0.00 ? 40  LYS A O    7  
ATOM 10038 C CB   . LYS A 1 40  ? 6.906   7.422   5.646   1.00 0.00 ? 40  LYS A CB   7  
ATOM 10039 C CG   . LYS A 1 40  ? 7.360   7.889   7.018   1.00 0.00 ? 40  LYS A CG   7  
ATOM 10040 C CD   . LYS A 1 40  ? 7.818   9.337   6.990   1.00 0.00 ? 40  LYS A CD   7  
ATOM 10041 C CE   . LYS A 1 40  ? 9.275   9.453   6.568   1.00 0.00 ? 40  LYS A CE   7  
ATOM 10042 N NZ   . LYS A 1 40  ? 9.586   10.799  6.011   1.00 0.00 ? 40  LYS A NZ   7  
ATOM 10043 H H    . LYS A 1 40  ? 5.457   6.335   3.638   1.00 0.00 ? 40  LYS A H    7  
ATOM 10044 H HA   . LYS A 1 40  ? 6.433   5.426   6.262   1.00 0.00 ? 40  LYS A HA   7  
ATOM 10045 H HB2  . LYS A 1 40  ? 7.781   7.161   5.069   1.00 0.00 ? 40  LYS A HB2  7  
ATOM 10046 H HB3  . LYS A 1 40  ? 6.396   8.241   5.160   1.00 0.00 ? 40  LYS A HB3  7  
ATOM 10047 H HG2  . LYS A 1 40  ? 6.537   7.796   7.711   1.00 0.00 ? 40  LYS A HG2  7  
ATOM 10048 H HG3  . LYS A 1 40  ? 8.182   7.267   7.345   1.00 0.00 ? 40  LYS A HG3  7  
ATOM 10049 H HD2  . LYS A 1 40  ? 7.208   9.886   6.288   1.00 0.00 ? 40  LYS A HD2  7  
ATOM 10050 H HD3  . LYS A 1 40  ? 7.704   9.761   7.978   1.00 0.00 ? 40  LYS A HD3  7  
ATOM 10051 H HE2  . LYS A 1 40  ? 9.901   9.276   7.429   1.00 0.00 ? 40  LYS A HE2  7  
ATOM 10052 H HE3  . LYS A 1 40  ? 9.479   8.706   5.815   1.00 0.00 ? 40  LYS A HE3  7  
ATOM 10053 H HZ1  . LYS A 1 40  ? 9.368   11.535  6.714   1.00 0.00 ? 40  LYS A HZ1  7  
ATOM 10054 H HZ2  . LYS A 1 40  ? 9.018   10.972  5.158   1.00 0.00 ? 40  LYS A HZ2  7  
ATOM 10055 H HZ3  . LYS A 1 40  ? 10.594  10.859  5.763   1.00 0.00 ? 40  LYS A HZ3  7  
ATOM 10056 N N    . ILE A 1 41  ? 4.267   5.836   7.379   1.00 0.00 ? 41  ILE A N    7  
ATOM 10057 C CA   . ILE A 1 41  ? 3.034   6.101   8.109   1.00 0.00 ? 41  ILE A CA   7  
ATOM 10058 C C    . ILE A 1 41  ? 3.269   6.069   9.615   1.00 0.00 ? 41  ILE A C    7  
ATOM 10059 O O    . ILE A 1 41  ? 4.380   5.807   10.076  1.00 0.00 ? 41  ILE A O    7  
ATOM 10060 C CB   . ILE A 1 41  ? 1.936   5.083   7.749   1.00 0.00 ? 41  ILE A CB   7  
ATOM 10061 C CG1  . ILE A 1 41  ? 2.126   3.792   8.549   1.00 0.00 ? 41  ILE A CG1  7  
ATOM 10062 C CG2  . ILE A 1 41  ? 1.951   4.793   6.256   1.00 0.00 ? 41  ILE A CG2  7  
ATOM 10063 C CD1  . ILE A 1 41  ? 1.088   2.735   8.245   1.00 0.00 ? 41  ILE A CD1  7  
ATOM 10064 H H    . ILE A 1 41  ? 4.825   5.074   7.643   1.00 0.00 ? 41  ILE A H    7  
ATOM 10065 H HA   . ILE A 1 41  ? 2.688   7.086   7.830   1.00 0.00 ? 41  ILE A HA   7  
ATOM 10066 H HB   . ILE A 1 41  ? 0.979   5.515   7.998   1.00 0.00 ? 41  ILE A HB   7  
ATOM 10067 H HG12 . ILE A 1 41  ? 3.096   3.377   8.327   1.00 0.00 ? 41  ILE A HG12 7  
ATOM 10068 H HG13 . ILE A 1 41  ? 2.070   4.020   9.604   1.00 0.00 ? 41  ILE A HG13 7  
ATOM 10069 H HG21 . ILE A 1 41  ? 2.324   3.794   6.086   1.00 0.00 ? 41  ILE A HG21 7  
ATOM 10070 H HG22 . ILE A 1 41  ? 0.948   4.873   5.864   1.00 0.00 ? 41  ILE A HG22 7  
ATOM 10071 H HG23 . ILE A 1 41  ? 2.591   5.505   5.757   1.00 0.00 ? 41  ILE A HG23 7  
ATOM 10072 H HD11 . ILE A 1 41  ? 0.430   3.089   7.466   1.00 0.00 ? 41  ILE A HD11 7  
ATOM 10073 H HD12 . ILE A 1 41  ? 1.579   1.830   7.920   1.00 0.00 ? 41  ILE A HD12 7  
ATOM 10074 H HD13 . ILE A 1 41  ? 0.511   2.530   9.136   1.00 0.00 ? 41  ILE A HD13 7  
ATOM 10075 N N    . LYS A 1 42  ? 2.214   6.333   10.378  1.00 0.00 ? 42  LYS A N    7  
ATOM 10076 C CA   . LYS A 1 42  ? 2.303   6.331   11.834  1.00 0.00 ? 42  LYS A CA   7  
ATOM 10077 C C    . LYS A 1 42  ? 2.035   4.938   12.393  1.00 0.00 ? 42  LYS A C    7  
ATOM 10078 O O    . LYS A 1 42  ? 1.433   4.096   11.727  1.00 0.00 ? 42  LYS A O    7  
ATOM 10079 C CB   . LYS A 1 42  ? 1.307   7.331   12.427  1.00 0.00 ? 42  LYS A CB   7  
ATOM 10080 C CG   . LYS A 1 42  ? 1.353   8.699   11.770  1.00 0.00 ? 42  LYS A CG   7  
ATOM 10081 C CD   . LYS A 1 42  ? 0.655   9.749   12.617  1.00 0.00 ? 42  LYS A CD   7  
ATOM 10082 C CE   . LYS A 1 42  ? 1.522   10.190  13.786  1.00 0.00 ? 42  LYS A CE   7  
ATOM 10083 N NZ   . LYS A 1 42  ? 0.999   11.427  14.430  1.00 0.00 ? 42  LYS A NZ   7  
ATOM 10084 H H    . LYS A 1 42  ? 1.354   6.534   9.952   1.00 0.00 ? 42  LYS A H    7  
ATOM 10085 H HA   . LYS A 1 42  ? 3.304   6.629   12.106  1.00 0.00 ? 42  LYS A HA   7  
ATOM 10086 H HB2  . LYS A 1 42  ? 0.308   6.935   12.316  1.00 0.00 ? 42  LYS A HB2  7  
ATOM 10087 H HB3  . LYS A 1 42  ? 1.522   7.453   13.479  1.00 0.00 ? 42  LYS A HB3  7  
ATOM 10088 H HG2  . LYS A 1 42  ? 2.385   8.989   11.635  1.00 0.00 ? 42  LYS A HG2  7  
ATOM 10089 H HG3  . LYS A 1 42  ? 0.865   8.643   10.807  1.00 0.00 ? 42  LYS A HG3  7  
ATOM 10090 H HD2  . LYS A 1 42  ? 0.436   10.609  12.002  1.00 0.00 ? 42  LYS A HD2  7  
ATOM 10091 H HD3  . LYS A 1 42  ? -0.267  9.335   13.000  1.00 0.00 ? 42  LYS A HD3  7  
ATOM 10092 H HE2  . LYS A 1 42  ? 1.548   9.397   14.517  1.00 0.00 ? 42  LYS A HE2  7  
ATOM 10093 H HE3  . LYS A 1 42  ? 2.522   10.378  13.424  1.00 0.00 ? 42  LYS A HE3  7  
ATOM 10094 H HZ1  . LYS A 1 42  ? 0.793   12.146  13.707  1.00 0.00 ? 42  LYS A HZ1  7  
ATOM 10095 H HZ2  . LYS A 1 42  ? 1.703   11.810  15.092  1.00 0.00 ? 42  LYS A HZ2  7  
ATOM 10096 H HZ3  . LYS A 1 42  ? 0.126   11.215  14.952  1.00 0.00 ? 42  LYS A HZ3  7  
ATOM 10097 N N    . ARG A 1 43  ? 2.485   4.702   13.622  1.00 0.00 ? 43  ARG A N    7  
ATOM 10098 C CA   . ARG A 1 43  ? 2.293   3.410   14.270  1.00 0.00 ? 43  ARG A CA   7  
ATOM 10099 C C    . ARG A 1 43  ? 0.815   3.156   14.550  1.00 0.00 ? 43  ARG A C    7  
ATOM 10100 O O    . ARG A 1 43  ? 0.350   2.017   14.501  1.00 0.00 ? 43  ARG A O    7  
ATOM 10101 C CB   . ARG A 1 43  ? 3.088   3.349   15.576  1.00 0.00 ? 43  ARG A CB   7  
ATOM 10102 C CG   . ARG A 1 43  ? 2.718   4.441   16.566  1.00 0.00 ? 43  ARG A CG   7  
ATOM 10103 C CD   . ARG A 1 43  ? 3.815   4.653   17.597  1.00 0.00 ? 43  ARG A CD   7  
ATOM 10104 N NE   . ARG A 1 43  ? 3.373   5.502   18.700  1.00 0.00 ? 43  ARG A NE   7  
ATOM 10105 C CZ   . ARG A 1 43  ? 2.551   5.092   19.659  1.00 0.00 ? 43  ARG A CZ   7  
ATOM 10106 N NH1  . ARG A 1 43  ? 2.084   3.851   19.651  1.00 0.00 ? 43  ARG A NH1  7  
ATOM 10107 N NH2  . ARG A 1 43  ? 2.194   5.923   20.630  1.00 0.00 ? 43  ARG A NH2  7  
ATOM 10108 H H    . ARG A 1 43  ? 2.957   5.413   14.103  1.00 0.00 ? 43  ARG A H    7  
ATOM 10109 H HA   . ARG A 1 43  ? 2.658   2.646   13.601  1.00 0.00 ? 43  ARG A HA   7  
ATOM 10110 H HB2  . ARG A 1 43  ? 2.911   2.393   16.047  1.00 0.00 ? 43  ARG A HB2  7  
ATOM 10111 H HB3  . ARG A 1 43  ? 4.139   3.441   15.348  1.00 0.00 ? 43  ARG A HB3  7  
ATOM 10112 H HG2  . ARG A 1 43  ? 2.562   5.365   16.028  1.00 0.00 ? 43  ARG A HG2  7  
ATOM 10113 H HG3  . ARG A 1 43  ? 1.808   4.160   17.074  1.00 0.00 ? 43  ARG A HG3  7  
ATOM 10114 H HD2  . ARG A 1 43  ? 4.111   3.693   17.991  1.00 0.00 ? 43  ARG A HD2  7  
ATOM 10115 H HD3  . ARG A 1 43  ? 4.660   5.119   17.113  1.00 0.00 ? 43  ARG A HD3  7  
ATOM 10116 H HE   . ARG A 1 43  ? 3.707   6.423   18.726  1.00 0.00 ? 43  ARG A HE   7  
ATOM 10117 H HH11 . ARG A 1 43  ? 2.351   3.222   18.921  1.00 0.00 ? 43  ARG A HH11 7  
ATOM 10118 H HH12 . ARG A 1 43  ? 1.465   3.544   20.374  1.00 0.00 ? 43  ARG A HH12 7  
ATOM 10119 H HH21 . ARG A 1 43  ? 2.545   6.859   20.640  1.00 0.00 ? 43  ARG A HH21 7  
ATOM 10120 H HH22 . ARG A 1 43  ? 1.575   5.614   21.351  1.00 0.00 ? 43  ARG A HH22 7  
ATOM 10121 N N    . HIS A 1 44  ? 0.081   4.225   14.842  1.00 0.00 ? 44  HIS A N    7  
ATOM 10122 C CA   . HIS A 1 44  ? -1.345  4.118   15.129  1.00 0.00 ? 44  HIS A CA   7  
ATOM 10123 C C    . HIS A 1 44  ? -2.168  4.237   13.850  1.00 0.00 ? 44  HIS A C    7  
ATOM 10124 O O    . HIS A 1 44  ? -3.381  4.026   13.856  1.00 0.00 ? 44  HIS A O    7  
ATOM 10125 C CB   . HIS A 1 44  ? -1.769  5.199   16.124  1.00 0.00 ? 44  HIS A CB   7  
ATOM 10126 C CG   . HIS A 1 44  ? -2.185  6.482   15.473  1.00 0.00 ? 44  HIS A CG   7  
ATOM 10127 N ND1  . HIS A 1 44  ? -3.495  6.776   15.158  1.00 0.00 ? 44  HIS A ND1  7  
ATOM 10128 C CD2  . HIS A 1 44  ? -1.456  7.552   15.079  1.00 0.00 ? 44  HIS A CD2  7  
ATOM 10129 C CE1  . HIS A 1 44  ? -3.553  7.971   14.597  1.00 0.00 ? 44  HIS A CE1  7  
ATOM 10130 N NE2  . HIS A 1 44  ? -2.329  8.463   14.538  1.00 0.00 ? 44  HIS A NE2  7  
ATOM 10131 H H    . HIS A 1 44  ? 0.508   5.107   14.865  1.00 0.00 ? 44  HIS A H    7  
ATOM 10132 H HA   . HIS A 1 44  ? -1.523  3.148   15.568  1.00 0.00 ? 44  HIS A HA   7  
ATOM 10133 H HB2  . HIS A 1 44  ? -2.605  4.836   16.705  1.00 0.00 ? 44  HIS A HB2  7  
ATOM 10134 H HB3  . HIS A 1 44  ? -0.943  5.414   16.786  1.00 0.00 ? 44  HIS A HB3  7  
ATOM 10135 H HD1  . HIS A 1 44  ? -4.267  6.195   15.320  1.00 0.00 ? 44  HIS A HD1  7  
ATOM 10136 H HD2  . HIS A 1 44  ? -0.385  7.668   15.172  1.00 0.00 ? 44  HIS A HD2  7  
ATOM 10137 H HE1  . HIS A 1 44  ? -4.448  8.462   14.247  1.00 0.00 ? 44  HIS A HE1  7  
ATOM 10138 H HE2  . HIS A 1 44  ? -2.077  9.298   14.090  1.00 0.00 ? 44  HIS A HE2  7  
ATOM 10139 N N    . THR A 1 45  ? -1.499  4.577   12.752  1.00 0.00 ? 45  THR A N    7  
ATOM 10140 C CA   . THR A 1 45  ? -2.168  4.726   11.465  1.00 0.00 ? 45  THR A CA   7  
ATOM 10141 C C    . THR A 1 45  ? -2.353  3.376   10.782  1.00 0.00 ? 45  THR A C    7  
ATOM 10142 O O    . THR A 1 45  ? -1.421  2.580   10.664  1.00 0.00 ? 45  THR A O    7  
ATOM 10143 C CB   . THR A 1 45  ? -1.379  5.659   10.527  1.00 0.00 ? 45  THR A CB   7  
ATOM 10144 O OG1  . THR A 1 45  ? -1.625  7.026   10.876  1.00 0.00 ? 45  THR A OG1  7  
ATOM 10145 C CG2  . THR A 1 45  ? -1.770  5.423   9.076   1.00 0.00 ? 45  THR A CG2  7  
ATOM 10146 H H    . THR A 1 45  ? -0.534  4.732   12.810  1.00 0.00 ? 45  THR A H    7  
ATOM 10147 H HA   . THR A 1 45  ? -3.139  5.165   11.643  1.00 0.00 ? 45  THR A HA   7  
ATOM 10148 H HB   . THR A 1 45  ? -0.325  5.450   10.639  1.00 0.00 ? 45  THR A HB   7  
ATOM 10149 H HG1  . THR A 1 45  ? -0.817  7.534   10.768  1.00 0.00 ? 45  THR A HG1  7  
ATOM 10150 H HG21 . THR A 1 45  ? -2.825  5.201   9.018   1.00 0.00 ? 45  THR A HG21 7  
ATOM 10151 H HG22 . THR A 1 45  ? -1.205  4.592   8.682   1.00 0.00 ? 45  THR A HG22 7  
ATOM 10152 H HG23 . THR A 1 45  ? -1.557  6.310   8.498   1.00 0.00 ? 45  THR A HG23 7  
ATOM 10153 N N    . PRO A 1 46  ? -3.584  3.109   10.321  1.00 0.00 ? 46  PRO A N    7  
ATOM 10154 C CA   . PRO A 1 46  ? -3.920  1.855   9.641   1.00 0.00 ? 46  PRO A CA   7  
ATOM 10155 C C    . PRO A 1 46  ? -3.275  1.752   8.263   1.00 0.00 ? 46  PRO A C    7  
ATOM 10156 O O    . PRO A 1 46  ? -3.033  2.764   7.602   1.00 0.00 ? 46  PRO A O    7  
ATOM 10157 C CB   . PRO A 1 46  ? -5.444  1.917   9.514   1.00 0.00 ? 46  PRO A CB   7  
ATOM 10158 C CG   . PRO A 1 46  ? -5.767  3.371   9.532   1.00 0.00 ? 46  PRO A CG   7  
ATOM 10159 C CD   . PRO A 1 46  ? -4.743  4.011   10.428  1.00 0.00 ? 46  PRO A CD   7  
ATOM 10160 H HA   . PRO A 1 46  ? -3.640  0.995   10.232  1.00 0.00 ? 46  PRO A HA   7  
ATOM 10161 H HB2  . PRO A 1 46  ? -5.750  1.455   8.586   1.00 0.00 ? 46  PRO A HB2  7  
ATOM 10162 H HB3  . PRO A 1 46  ? -5.899  1.401   10.347  1.00 0.00 ? 46  PRO A HB3  7  
ATOM 10163 H HG2  . PRO A 1 46  ? -5.697  3.775   8.534   1.00 0.00 ? 46  PRO A HG2  7  
ATOM 10164 H HG3  . PRO A 1 46  ? -6.759  3.521   9.931   1.00 0.00 ? 46  PRO A HG3  7  
ATOM 10165 H HD2  . PRO A 1 46  ? -4.496  5.000   10.072  1.00 0.00 ? 46  PRO A HD2  7  
ATOM 10166 H HD3  . PRO A 1 46  ? -5.105  4.054   11.445  1.00 0.00 ? 46  PRO A HD3  7  
ATOM 10167 N N    . LEU A 1 47  ? -2.999  0.526   7.834   1.00 0.00 ? 47  LEU A N    7  
ATOM 10168 C CA   . LEU A 1 47  ? -2.382  0.291   6.533   1.00 0.00 ? 47  LEU A CA   7  
ATOM 10169 C C    . LEU A 1 47  ? -3.326  0.690   5.403   1.00 0.00 ? 47  LEU A C    7  
ATOM 10170 O O    . LEU A 1 47  ? -2.900  0.882   4.264   1.00 0.00 ? 47  LEU A O    7  
ATOM 10171 C CB   . LEU A 1 47  ? -1.990  -1.181  6.390   1.00 0.00 ? 47  LEU A CB   7  
ATOM 10172 C CG   . LEU A 1 47  ? -1.070  -1.738  7.476   1.00 0.00 ? 47  LEU A CG   7  
ATOM 10173 C CD1  . LEU A 1 47  ? -0.851  -3.230  7.276   1.00 0.00 ? 47  LEU A CD1  7  
ATOM 10174 C CD2  . LEU A 1 47  ? 0.260   -0.998  7.480   1.00 0.00 ? 47  LEU A CD2  7  
ATOM 10175 H H    . LEU A 1 47  ? -3.214  -0.241  8.404   1.00 0.00 ? 47  LEU A H    7  
ATOM 10176 H HA   . LEU A 1 47  ? -1.492  0.900   6.473   1.00 0.00 ? 47  LEU A HA   7  
ATOM 10177 H HB2  . LEU A 1 47  ? -2.897  -1.766  6.393   1.00 0.00 ? 47  LEU A HB2  7  
ATOM 10178 H HB3  . LEU A 1 47  ? -1.490  -1.298  5.439   1.00 0.00 ? 47  LEU A HB3  7  
ATOM 10179 H HG   . LEU A 1 47  ? -1.536  -1.596  8.442   1.00 0.00 ? 47  LEU A HG   7  
ATOM 10180 H HD11 . LEU A 1 47  ? 0.076   -3.524  7.745   1.00 0.00 ? 47  LEU A HD11 7  
ATOM 10181 H HD12 . LEU A 1 47  ? -0.806  -3.449  6.220   1.00 0.00 ? 47  LEU A HD12 7  
ATOM 10182 H HD13 . LEU A 1 47  ? -1.669  -3.777  7.722   1.00 0.00 ? 47  LEU A HD13 7  
ATOM 10183 H HD21 . LEU A 1 47  ? 0.339   -0.406  8.380   1.00 0.00 ? 47  LEU A HD21 7  
ATOM 10184 H HD22 . LEU A 1 47  ? 0.314   -0.350  6.617   1.00 0.00 ? 47  LEU A HD22 7  
ATOM 10185 H HD23 . LEU A 1 47  ? 1.069   -1.712  7.446   1.00 0.00 ? 47  LEU A HD23 7  
ATOM 10186 N N    . SER A 1 48  ? -4.609  0.814   5.726   1.00 0.00 ? 48  SER A N    7  
ATOM 10187 C CA   . SER A 1 48  ? -5.614  1.188   4.738   1.00 0.00 ? 48  SER A CA   7  
ATOM 10188 C C    . SER A 1 48  ? -5.071  2.250   3.787   1.00 0.00 ? 48  SER A C    7  
ATOM 10189 O O    . SER A 1 48  ? -5.089  2.076   2.568   1.00 0.00 ? 48  SER A O    7  
ATOM 10190 C CB   . SER A 1 48  ? -6.875  1.706   5.433   1.00 0.00 ? 48  SER A CB   7  
ATOM 10191 O OG   . SER A 1 48  ? -7.942  1.850   4.512   1.00 0.00 ? 48  SER A OG   7  
ATOM 10192 H H    . SER A 1 48  ? -4.887  0.647   6.652   1.00 0.00 ? 48  SER A H    7  
ATOM 10193 H HA   . SER A 1 48  ? -5.864  0.305   4.169   1.00 0.00 ? 48  SER A HA   7  
ATOM 10194 H HB2  . SER A 1 48  ? -7.171  1.009   6.202   1.00 0.00 ? 48  SER A HB2  7  
ATOM 10195 H HB3  . SER A 1 48  ? -6.667  2.668   5.879   1.00 0.00 ? 48  SER A HB3  7  
ATOM 10196 H HG   . SER A 1 48  ? -8.420  1.020   4.443   1.00 0.00 ? 48  SER A HG   7  
ATOM 10197 N N    . LYS A 1 49  ? -4.589  3.351   4.353   1.00 0.00 ? 49  LYS A N    7  
ATOM 10198 C CA   . LYS A 1 49  ? -4.039  4.443   3.558   1.00 0.00 ? 49  LYS A CA   7  
ATOM 10199 C C    . LYS A 1 49  ? -2.833  3.974   2.750   1.00 0.00 ? 49  LYS A C    7  
ATOM 10200 O O    . LYS A 1 49  ? -2.689  4.316   1.575   1.00 0.00 ? 49  LYS A O    7  
ATOM 10201 C CB   . LYS A 1 49  ? -3.637  5.609   4.464   1.00 0.00 ? 49  LYS A CB   7  
ATOM 10202 C CG   . LYS A 1 49  ? -4.812  6.266   5.166   1.00 0.00 ? 49  LYS A CG   7  
ATOM 10203 C CD   . LYS A 1 49  ? -4.362  7.425   6.039   1.00 0.00 ? 49  LYS A CD   7  
ATOM 10204 C CE   . LYS A 1 49  ? -5.399  7.760   7.101   1.00 0.00 ? 49  LYS A CE   7  
ATOM 10205 N NZ   . LYS A 1 49  ? -6.431  8.704   6.589   1.00 0.00 ? 49  LYS A NZ   7  
ATOM 10206 H H    . LYS A 1 49  ? -4.602  3.431   5.330   1.00 0.00 ? 49  LYS A H    7  
ATOM 10207 H HA   . LYS A 1 49  ? -4.807  4.776   2.876   1.00 0.00 ? 49  LYS A HA   7  
ATOM 10208 H HB2  . LYS A 1 49  ? -2.952  5.245   5.216   1.00 0.00 ? 49  LYS A HB2  7  
ATOM 10209 H HB3  . LYS A 1 49  ? -3.137  6.357   3.866   1.00 0.00 ? 49  LYS A HB3  7  
ATOM 10210 H HG2  . LYS A 1 49  ? -5.503  6.636   4.424   1.00 0.00 ? 49  LYS A HG2  7  
ATOM 10211 H HG3  . LYS A 1 49  ? -5.306  5.531   5.786   1.00 0.00 ? 49  LYS A HG3  7  
ATOM 10212 H HD2  . LYS A 1 49  ? -3.437  7.159   6.528   1.00 0.00 ? 49  LYS A HD2  7  
ATOM 10213 H HD3  . LYS A 1 49  ? -4.205  8.294   5.416   1.00 0.00 ? 49  LYS A HD3  7  
ATOM 10214 H HE2  . LYS A 1 49  ? -5.882  6.847   7.413   1.00 0.00 ? 49  LYS A HE2  7  
ATOM 10215 H HE3  . LYS A 1 49  ? -4.899  8.210   7.945   1.00 0.00 ? 49  LYS A HE3  7  
ATOM 10216 H HZ1  . LYS A 1 49  ? -7.379  8.290   6.700   1.00 0.00 ? 49  LYS A HZ1  7  
ATOM 10217 H HZ2  . LYS A 1 49  ? -6.267  8.901   5.582   1.00 0.00 ? 49  LYS A HZ2  7  
ATOM 10218 H HZ3  . LYS A 1 49  ? -6.391  9.598   7.118   1.00 0.00 ? 49  LYS A HZ3  7  
ATOM 10219 N N    . LEU A 1 50  ? -1.971  3.188   3.385   1.00 0.00 ? 50  LEU A N    7  
ATOM 10220 C CA   . LEU A 1 50  ? -0.777  2.670   2.724   1.00 0.00 ? 50  LEU A CA   7  
ATOM 10221 C C    . LEU A 1 50  ? -1.148  1.873   1.477   1.00 0.00 ? 50  LEU A C    7  
ATOM 10222 O O    . LEU A 1 50  ? -0.737  2.212   0.368   1.00 0.00 ? 50  LEU A O    7  
ATOM 10223 C CB   . LEU A 1 50  ? 0.021   1.790   3.687   1.00 0.00 ? 50  LEU A CB   7  
ATOM 10224 C CG   . LEU A 1 50  ? 0.845   0.672   3.048   1.00 0.00 ? 50  LEU A CG   7  
ATOM 10225 C CD1  . LEU A 1 50  ? 1.703   1.220   1.918   1.00 0.00 ? 50  LEU A CD1  7  
ATOM 10226 C CD2  . LEU A 1 50  ? 1.712   -0.016  4.093   1.00 0.00 ? 50  LEU A CD2  7  
ATOM 10227 H H    . LEU A 1 50  ? -2.139  2.950   4.320   1.00 0.00 ? 50  LEU A H    7  
ATOM 10228 H HA   . LEU A 1 50  ? -0.169  3.513   2.431   1.00 0.00 ? 50  LEU A HA   7  
ATOM 10229 H HB2  . LEU A 1 50  ? 0.698   2.428   4.234   1.00 0.00 ? 50  LEU A HB2  7  
ATOM 10230 H HB3  . LEU A 1 50  ? -0.677  1.336   4.375   1.00 0.00 ? 50  LEU A HB3  7  
ATOM 10231 H HG   . LEU A 1 50  ? 0.175   -0.066  2.630   1.00 0.00 ? 50  LEU A HG   7  
ATOM 10232 H HD11 . LEU A 1 50  ? 1.276   0.931   0.970   1.00 0.00 ? 50  LEU A HD11 7  
ATOM 10233 H HD12 . LEU A 1 50  ? 2.703   0.821   1.999   1.00 0.00 ? 50  LEU A HD12 7  
ATOM 10234 H HD13 . LEU A 1 50  ? 1.739   2.298   1.984   1.00 0.00 ? 50  LEU A HD13 7  
ATOM 10235 H HD21 . LEU A 1 50  ? 1.925   0.676   4.895   1.00 0.00 ? 50  LEU A HD21 7  
ATOM 10236 H HD22 . LEU A 1 50  ? 2.639   -0.335  3.638   1.00 0.00 ? 50  LEU A HD22 7  
ATOM 10237 H HD23 . LEU A 1 50  ? 1.189   -0.874  4.486   1.00 0.00 ? 50  LEU A HD23 7  
ATOM 10238 N N    . MET A 1 51  ? -1.928  0.815   1.668   1.00 0.00 ? 51  MET A N    7  
ATOM 10239 C CA   . MET A 1 51  ? -2.357  -0.028  0.558   1.00 0.00 ? 51  MET A CA   7  
ATOM 10240 C C    . MET A 1 51  ? -2.901  0.819   -0.589  1.00 0.00 ? 51  MET A C    7  
ATOM 10241 O O    . MET A 1 51  ? -2.424  0.730   -1.720  1.00 0.00 ? 51  MET A O    7  
ATOM 10242 C CB   . MET A 1 51  ? -3.423  -1.020  1.025   1.00 0.00 ? 51  MET A CB   7  
ATOM 10243 C CG   . MET A 1 51  ? -2.979  -1.883  2.195   1.00 0.00 ? 51  MET A CG   7  
ATOM 10244 S SD   . MET A 1 51  ? -4.354  -2.386  3.248   1.00 0.00 ? 51  MET A SD   7  
ATOM 10245 C CE   . MET A 1 51  ? -3.787  -3.993  3.800   1.00 0.00 ? 51  MET A CE   7  
ATOM 10246 H H    . MET A 1 51  ? -2.224  0.595   2.576   1.00 0.00 ? 51  MET A H    7  
ATOM 10247 H HA   . MET A 1 51  ? -1.496  -0.577  0.207   1.00 0.00 ? 51  MET A HA   7  
ATOM 10248 H HB2  . MET A 1 51  ? -4.303  -0.471  1.325   1.00 0.00 ? 51  MET A HB2  7  
ATOM 10249 H HB3  . MET A 1 51  ? -3.678  -1.672  0.202   1.00 0.00 ? 51  MET A HB3  7  
ATOM 10250 H HG2  . MET A 1 51  ? -2.497  -2.769  1.810   1.00 0.00 ? 51  MET A HG2  7  
ATOM 10251 H HG3  . MET A 1 51  ? -2.274  -1.323  2.790   1.00 0.00 ? 51  MET A HG3  7  
ATOM 10252 H HE1  . MET A 1 51  ? -3.489  -4.583  2.946   1.00 0.00 ? 51  MET A HE1  7  
ATOM 10253 H HE2  . MET A 1 51  ? -2.944  -3.869  4.463   1.00 0.00 ? 51  MET A HE2  7  
ATOM 10254 H HE3  . MET A 1 51  ? -4.587  -4.497  4.324   1.00 0.00 ? 51  MET A HE3  7  
ATOM 10255 N N    . LYS A 1 52  ? -3.902  1.639   -0.289  1.00 0.00 ? 52  LYS A N    7  
ATOM 10256 C CA   . LYS A 1 52  ? -4.511  2.503   -1.294  1.00 0.00 ? 52  LYS A CA   7  
ATOM 10257 C C    . LYS A 1 52  ? -3.447  3.285   -2.056  1.00 0.00 ? 52  LYS A C    7  
ATOM 10258 O O    . LYS A 1 52  ? -3.509  3.407   -3.279  1.00 0.00 ? 52  LYS A O    7  
ATOM 10259 C CB   . LYS A 1 52  ? -5.497  3.470   -0.634  1.00 0.00 ? 52  LYS A CB   7  
ATOM 10260 C CG   . LYS A 1 52  ? -6.795  2.813   -0.198  1.00 0.00 ? 52  LYS A CG   7  
ATOM 10261 C CD   . LYS A 1 52  ? -7.933  3.817   -0.133  1.00 0.00 ? 52  LYS A CD   7  
ATOM 10262 C CE   . LYS A 1 52  ? -8.426  4.193   -1.522  1.00 0.00 ? 52  LYS A CE   7  
ATOM 10263 N NZ   . LYS A 1 52  ? -9.711  4.945   -1.470  1.00 0.00 ? 52  LYS A NZ   7  
ATOM 10264 H H    . LYS A 1 52  ? -4.239  1.665   0.632   1.00 0.00 ? 52  LYS A H    7  
ATOM 10265 H HA   . LYS A 1 52  ? -5.047  1.875   -1.990  1.00 0.00 ? 52  LYS A HA   7  
ATOM 10266 H HB2  . LYS A 1 52  ? -5.028  3.906   0.236   1.00 0.00 ? 52  LYS A HB2  7  
ATOM 10267 H HB3  . LYS A 1 52  ? -5.734  4.257   -1.336  1.00 0.00 ? 52  LYS A HB3  7  
ATOM 10268 H HG2  . LYS A 1 52  ? -7.052  2.040   -0.906  1.00 0.00 ? 52  LYS A HG2  7  
ATOM 10269 H HG3  . LYS A 1 52  ? -6.655  2.376   0.780   1.00 0.00 ? 52  LYS A HG3  7  
ATOM 10270 H HD2  . LYS A 1 52  ? -8.752  3.384   0.423   1.00 0.00 ? 52  LYS A HD2  7  
ATOM 10271 H HD3  . LYS A 1 52  ? -7.587  4.709   0.370   1.00 0.00 ? 52  LYS A HD3  7  
ATOM 10272 H HE2  . LYS A 1 52  ? -7.679  4.806   -2.001  1.00 0.00 ? 52  LYS A HE2  7  
ATOM 10273 H HE3  . LYS A 1 52  ? -8.571  3.288   -2.094  1.00 0.00 ? 52  LYS A HE3  7  
ATOM 10274 H HZ1  . LYS A 1 52  ? -9.609  5.784   -0.864  1.00 0.00 ? 52  LYS A HZ1  7  
ATOM 10275 H HZ2  . LYS A 1 52  ? -10.463 4.341   -1.082  1.00 0.00 ? 52  LYS A HZ2  7  
ATOM 10276 H HZ3  . LYS A 1 52  ? -9.984  5.251   -2.425  1.00 0.00 ? 52  LYS A HZ3  7  
ATOM 10277 N N    . ALA A 1 53  ? -2.470  3.813   -1.325  1.00 0.00 ? 53  ALA A N    7  
ATOM 10278 C CA   . ALA A 1 53  ? -1.390  4.581   -1.933  1.00 0.00 ? 53  ALA A CA   7  
ATOM 10279 C C    . ALA A 1 53  ? -0.501  3.690   -2.794  1.00 0.00 ? 53  ALA A C    7  
ATOM 10280 O O    . ALA A 1 53  ? 0.200   4.171   -3.685  1.00 0.00 ? 53  ALA A O    7  
ATOM 10281 C CB   . ALA A 1 53  ? -0.565  5.274   -0.859  1.00 0.00 ? 53  ALA A CB   7  
ATOM 10282 H H    . ALA A 1 53  ? -2.475  3.682   -0.354  1.00 0.00 ? 53  ALA A H    7  
ATOM 10283 H HA   . ALA A 1 53  ? -1.833  5.342   -2.559  1.00 0.00 ? 53  ALA A HA   7  
ATOM 10284 H HB1  . ALA A 1 53  ? 0.210   5.864   -1.326  1.00 0.00 ? 53  ALA A HB1  7  
ATOM 10285 H HB2  . ALA A 1 53  ? -1.205  5.917   -0.273  1.00 0.00 ? 53  ALA A HB2  7  
ATOM 10286 H HB3  . ALA A 1 53  ? -0.115  4.531   -0.217  1.00 0.00 ? 53  ALA A HB3  7  
ATOM 10287 N N    . TYR A 1 54  ? -0.532  2.390   -2.521  1.00 0.00 ? 54  TYR A N    7  
ATOM 10288 C CA   . TYR A 1 54  ? 0.274   1.433   -3.269  1.00 0.00 ? 54  TYR A CA   7  
ATOM 10289 C C    . TYR A 1 54  ? -0.456  0.970   -4.526  1.00 0.00 ? 54  TYR A C    7  
ATOM 10290 O O    . TYR A 1 54  ? 0.163   0.724   -5.562  1.00 0.00 ? 54  TYR A O    7  
ATOM 10291 C CB   . TYR A 1 54  ? 0.615   0.227   -2.392  1.00 0.00 ? 54  TYR A CB   7  
ATOM 10292 C CG   . TYR A 1 54  ? 1.315   -0.886  -3.138  1.00 0.00 ? 54  TYR A CG   7  
ATOM 10293 C CD1  . TYR A 1 54  ? 2.681   -0.831  -3.387  1.00 0.00 ? 54  TYR A CD1  7  
ATOM 10294 C CD2  . TYR A 1 54  ? 0.610   -1.994  -3.594  1.00 0.00 ? 54  TYR A CD2  7  
ATOM 10295 C CE1  . TYR A 1 54  ? 3.324   -1.845  -4.069  1.00 0.00 ? 54  TYR A CE1  7  
ATOM 10296 C CE2  . TYR A 1 54  ? 1.246   -3.014  -4.275  1.00 0.00 ? 54  TYR A CE2  7  
ATOM 10297 C CZ   . TYR A 1 54  ? 2.602   -2.935  -4.511  1.00 0.00 ? 54  TYR A CZ   7  
ATOM 10298 O OH   . TYR A 1 54  ? 3.240   -3.948  -5.190  1.00 0.00 ? 54  TYR A OH   7  
ATOM 10299 H H    . TYR A 1 54  ? -1.111  2.067   -1.799  1.00 0.00 ? 54  TYR A H    7  
ATOM 10300 H HA   . TYR A 1 54  ? 1.190   1.926   -3.559  1.00 0.00 ? 54  TYR A HA   7  
ATOM 10301 H HB2  . TYR A 1 54  ? 1.263   0.546   -1.590  1.00 0.00 ? 54  TYR A HB2  7  
ATOM 10302 H HB3  . TYR A 1 54  ? -0.296  -0.175  -1.974  1.00 0.00 ? 54  TYR A HB3  7  
ATOM 10303 H HD1  . TYR A 1 54  ? 3.243   0.023   -3.039  1.00 0.00 ? 54  TYR A HD1  7  
ATOM 10304 H HD2  . TYR A 1 54  ? -0.452  -2.053  -3.407  1.00 0.00 ? 54  TYR A HD2  7  
ATOM 10305 H HE1  . TYR A 1 54  ? 4.387   -1.784  -4.254  1.00 0.00 ? 54  TYR A HE1  7  
ATOM 10306 H HE2  . TYR A 1 54  ? 0.681   -3.867  -4.622  1.00 0.00 ? 54  TYR A HE2  7  
ATOM 10307 H HH   . TYR A 1 54  ? 4.189   -3.815  -5.146  1.00 0.00 ? 54  TYR A HH   7  
ATOM 10308 N N    . CYS A 1 55  ? -1.776  0.856   -4.428  1.00 0.00 ? 55  CYS A N    7  
ATOM 10309 C CA   . CYS A 1 55  ? -2.592  0.423   -5.556  1.00 0.00 ? 55  CYS A CA   7  
ATOM 10310 C C    . CYS A 1 55  ? -2.765  1.552   -6.567  1.00 0.00 ? 55  CYS A C    7  
ATOM 10311 O O    . CYS A 1 55  ? -2.882  1.310   -7.768  1.00 0.00 ? 55  CYS A O    7  
ATOM 10312 C CB   . CYS A 1 55  ? -3.960  -0.056  -5.069  1.00 0.00 ? 55  CYS A CB   7  
ATOM 10313 S SG   . CYS A 1 55  ? -5.161  1.273   -4.818  1.00 0.00 ? 55  CYS A SG   7  
ATOM 10314 H H    . CYS A 1 55  ? -2.212  1.066   -3.576  1.00 0.00 ? 55  CYS A H    7  
ATOM 10315 H HA   . CYS A 1 55  ? -2.083  -0.399  -6.037  1.00 0.00 ? 55  CYS A HA   7  
ATOM 10316 H HB2  . CYS A 1 55  ? -4.375  -0.739  -5.796  1.00 0.00 ? 55  CYS A HB2  7  
ATOM 10317 H HB3  . CYS A 1 55  ? -3.838  -0.572  -4.129  1.00 0.00 ? 55  CYS A HB3  7  
ATOM 10318 H HG   . CYS A 1 55  ? -4.825  2.281   -5.609  1.00 0.00 ? 55  CYS A HG   7  
ATOM 10319 N N    . GLU A 1 56  ? -2.781  2.785   -6.071  1.00 0.00 ? 56  GLU A N    7  
ATOM 10320 C CA   . GLU A 1 56  ? -2.943  3.951   -6.932  1.00 0.00 ? 56  GLU A CA   7  
ATOM 10321 C C    . GLU A 1 56  ? -1.630  4.300   -7.628  1.00 0.00 ? 56  GLU A C    7  
ATOM 10322 O O    . GLU A 1 56  ? -1.609  4.601   -8.821  1.00 0.00 ? 56  GLU A O    7  
ATOM 10323 C CB   . GLU A 1 56  ? -3.435  5.150   -6.117  1.00 0.00 ? 56  GLU A CB   7  
ATOM 10324 C CG   . GLU A 1 56  ? -2.313  5.981   -5.519  1.00 0.00 ? 56  GLU A CG   7  
ATOM 10325 C CD   . GLU A 1 56  ? -2.820  7.042   -4.562  1.00 0.00 ? 56  GLU A CD   7  
ATOM 10326 O OE1  . GLU A 1 56  ? -3.464  6.677   -3.556  1.00 0.00 ? 56  GLU A OE1  7  
ATOM 10327 O OE2  . GLU A 1 56  ? -2.571  8.239   -4.819  1.00 0.00 ? 56  GLU A OE2  7  
ATOM 10328 H H    . GLU A 1 56  ? -2.683  2.914   -5.105  1.00 0.00 ? 56  GLU A H    7  
ATOM 10329 H HA   . GLU A 1 56  ? -3.681  3.710   -7.682  1.00 0.00 ? 56  GLU A HA   7  
ATOM 10330 H HB2  . GLU A 1 56  ? -4.025  5.787   -6.759  1.00 0.00 ? 56  GLU A HB2  7  
ATOM 10331 H HB3  . GLU A 1 56  ? -4.057  4.790   -5.311  1.00 0.00 ? 56  GLU A HB3  7  
ATOM 10332 H HG2  . GLU A 1 56  ? -1.643  5.326   -4.983  1.00 0.00 ? 56  GLU A HG2  7  
ATOM 10333 H HG3  . GLU A 1 56  ? -1.775  6.467   -6.320  1.00 0.00 ? 56  GLU A HG3  7  
ATOM 10334 N N    . ARG A 1 57  ? -0.537  4.257   -6.872  1.00 0.00 ? 57  ARG A N    7  
ATOM 10335 C CA   . ARG A 1 57  ? 0.779   4.570   -7.415  1.00 0.00 ? 57  ARG A CA   7  
ATOM 10336 C C    . ARG A 1 57  ? 0.993   3.876   -8.757  1.00 0.00 ? 57  ARG A C    7  
ATOM 10337 O O    . ARG A 1 57  ? 1.628   4.426   -9.656  1.00 0.00 ? 57  ARG A O    7  
ATOM 10338 C CB   . ARG A 1 57  ? 1.873   4.150   -6.431  1.00 0.00 ? 57  ARG A CB   7  
ATOM 10339 C CG   . ARG A 1 57  ? 3.267   4.590   -6.846  1.00 0.00 ? 57  ARG A CG   7  
ATOM 10340 C CD   . ARG A 1 57  ? 4.292   4.290   -5.763  1.00 0.00 ? 57  ARG A CD   7  
ATOM 10341 N NE   . ARG A 1 57  ? 4.430   5.395   -4.819  1.00 0.00 ? 57  ARG A NE   7  
ATOM 10342 C CZ   . ARG A 1 57  ? 5.153   6.482   -5.060  1.00 0.00 ? 57  ARG A CZ   7  
ATOM 10343 N NH1  . ARG A 1 57  ? 5.801   6.609   -6.210  1.00 0.00 ? 57  ARG A NH1  7  
ATOM 10344 N NH2  . ARG A 1 57  ? 5.230   7.445   -4.151  1.00 0.00 ? 57  ARG A NH2  7  
ATOM 10345 H H    . ARG A 1 57  ? -0.618  4.010   -5.927  1.00 0.00 ? 57  ARG A H    7  
ATOM 10346 H HA   . ARG A 1 57  ? 0.832   5.638   -7.563  1.00 0.00 ? 57  ARG A HA   7  
ATOM 10347 H HB2  . ARG A 1 57  ? 1.656   4.581   -5.465  1.00 0.00 ? 57  ARG A HB2  7  
ATOM 10348 H HB3  . ARG A 1 57  ? 1.869   3.074   -6.345  1.00 0.00 ? 57  ARG A HB3  7  
ATOM 10349 H HG2  . ARG A 1 57  ? 3.547   4.064   -7.747  1.00 0.00 ? 57  ARG A HG2  7  
ATOM 10350 H HG3  . ARG A 1 57  ? 3.257   5.653   -7.036  1.00 0.00 ? 57  ARG A HG3  7  
ATOM 10351 H HD2  . ARG A 1 57  ? 3.979   3.407   -5.226  1.00 0.00 ? 57  ARG A HD2  7  
ATOM 10352 H HD3  . ARG A 1 57  ? 5.247   4.107   -6.232  1.00 0.00 ? 57  ARG A HD3  7  
ATOM 10353 H HE   . ARG A 1 57  ? 3.959   5.321   -3.963  1.00 0.00 ? 57  ARG A HE   7  
ATOM 10354 H HH11 . ARG A 1 57  ? 5.744   5.886   -6.898  1.00 0.00 ? 57  ARG A HH11 7  
ATOM 10355 H HH12 . ARG A 1 57  ? 6.344   7.430   -6.390  1.00 0.00 ? 57  ARG A HH12 7  
ATOM 10356 H HH21 . ARG A 1 57  ? 4.743   7.353   -3.283  1.00 0.00 ? 57  ARG A HH21 7  
ATOM 10357 H HH22 . ARG A 1 57  ? 5.775   8.263   -4.334  1.00 0.00 ? 57  ARG A HH22 7  
ATOM 10358 N N    . GLN A 1 58  ? 0.459   2.666   -8.883  1.00 0.00 ? 58  GLN A N    7  
ATOM 10359 C CA   . GLN A 1 58  ? 0.593   1.896   -10.114 1.00 0.00 ? 58  GLN A CA   7  
ATOM 10360 C C    . GLN A 1 58  ? -0.694  1.947   -10.931 1.00 0.00 ? 58  GLN A C    7  
ATOM 10361 O O    . GLN A 1 58  ? -0.681  2.303   -12.108 1.00 0.00 ? 58  GLN A O    7  
ATOM 10362 C CB   . GLN A 1 58  ? 0.952   0.444   -9.797  1.00 0.00 ? 58  GLN A CB   7  
ATOM 10363 C CG   . GLN A 1 58  ? 2.141   0.302   -8.860  1.00 0.00 ? 58  GLN A CG   7  
ATOM 10364 C CD   . GLN A 1 58  ? 3.322   1.155   -9.282  1.00 0.00 ? 58  GLN A CD   7  
ATOM 10365 O OE1  . GLN A 1 58  ? 3.705   1.169   -10.452 1.00 0.00 ? 58  GLN A OE1  7  
ATOM 10366 N NE2  . GLN A 1 58  ? 3.904   1.873   -8.329  1.00 0.00 ? 58  GLN A NE2  7  
ATOM 10367 H H    . GLN A 1 58  ? -0.036  2.281   -8.130  1.00 0.00 ? 58  GLN A H    7  
ATOM 10368 H HA   . GLN A 1 58  ? 1.390   2.336   -10.694 1.00 0.00 ? 58  GLN A HA   7  
ATOM 10369 H HB2  . GLN A 1 58  ? 0.100   -0.033  -9.336  1.00 0.00 ? 58  GLN A HB2  7  
ATOM 10370 H HB3  . GLN A 1 58  ? 1.186   -0.067  -10.719 1.00 0.00 ? 58  GLN A HB3  7  
ATOM 10371 H HG2  . GLN A 1 58  ? 1.839   0.600   -7.867  1.00 0.00 ? 58  GLN A HG2  7  
ATOM 10372 H HG3  . GLN A 1 58  ? 2.450   -0.733  -8.846  1.00 0.00 ? 58  GLN A HG3  7  
ATOM 10373 H HE21 . GLN A 1 58  ? 3.545   1.811   -7.419  1.00 0.00 ? 58  GLN A HE21 7  
ATOM 10374 H HE22 . GLN A 1 58  ? 4.670   2.432   -8.574  1.00 0.00 ? 58  GLN A HE22 7  
ATOM 10375 N N    . GLY A 1 59  ? -1.806  1.588   -10.296 1.00 0.00 ? 59  GLY A N    7  
ATOM 10376 C CA   . GLY A 1 59  ? -3.087  1.600   -10.980 1.00 0.00 ? 59  GLY A CA   7  
ATOM 10377 C C    . GLY A 1 59  ? -3.804  0.268   -10.888 1.00 0.00 ? 59  GLY A C    7  
ATOM 10378 O O    . GLY A 1 59  ? -4.576  -0.093  -11.778 1.00 0.00 ? 59  GLY A O    7  
ATOM 10379 H H    . GLY A 1 59  ? -1.757  1.314   -9.357  1.00 0.00 ? 59  GLY A H    7  
ATOM 10380 H HA2  . GLY A 1 59  ? -3.710  2.364   -10.540 1.00 0.00 ? 59  GLY A HA2  7  
ATOM 10381 H HA3  . GLY A 1 59  ? -2.924  1.837   -12.021 1.00 0.00 ? 59  GLY A HA3  7  
ATOM 10382 N N    . LEU A 1 60  ? -3.550  -0.467  -9.811  1.00 0.00 ? 60  LEU A N    7  
ATOM 10383 C CA   . LEU A 1 60  ? -4.177  -1.768  -9.606  1.00 0.00 ? 60  LEU A CA   7  
ATOM 10384 C C    . LEU A 1 60  ? -5.331  -1.667  -8.614  1.00 0.00 ? 60  LEU A C    7  
ATOM 10385 O O    . LEU A 1 60  ? -5.555  -0.617  -8.013  1.00 0.00 ? 60  LEU A O    7  
ATOM 10386 C CB   . LEU A 1 60  ? -3.145  -2.780  -9.105  1.00 0.00 ? 60  LEU A CB   7  
ATOM 10387 C CG   . LEU A 1 60  ? -1.754  -2.689  -9.734  1.00 0.00 ? 60  LEU A CG   7  
ATOM 10388 C CD1  . LEU A 1 60  ? -0.691  -3.149  -8.749  1.00 0.00 ? 60  LEU A CD1  7  
ATOM 10389 C CD2  . LEU A 1 60  ? -1.693  -3.513  -11.012 1.00 0.00 ? 60  LEU A CD2  7  
ATOM 10390 H H    . LEU A 1 60  ? -2.926  -0.127  -9.136  1.00 0.00 ? 60  LEU A H    7  
ATOM 10391 H HA   . LEU A 1 60  ? -4.564  -2.102  -10.557 1.00 0.00 ? 60  LEU A HA   7  
ATOM 10392 H HB2  . LEU A 1 60  ? -3.035  -2.640  -8.040  1.00 0.00 ? 60  LEU A HB2  7  
ATOM 10393 H HB3  . LEU A 1 60  ? -3.533  -3.770  -9.298  1.00 0.00 ? 60  LEU A HB3  7  
ATOM 10394 H HG   . LEU A 1 60  ? -1.548  -1.659  -9.990  1.00 0.00 ? 60  LEU A HG   7  
ATOM 10395 H HD11 . LEU A 1 60  ? -1.147  -3.765  -7.989  1.00 0.00 ? 60  LEU A HD11 7  
ATOM 10396 H HD12 . LEU A 1 60  ? -0.231  -2.288  -8.288  1.00 0.00 ? 60  LEU A HD12 7  
ATOM 10397 H HD13 . LEU A 1 60  ? 0.061   -3.721  -9.273  1.00 0.00 ? 60  LEU A HD13 7  
ATOM 10398 H HD21 . LEU A 1 60  ? -2.213  -4.448  -10.862 1.00 0.00 ? 60  LEU A HD21 7  
ATOM 10399 H HD22 . LEU A 1 60  ? -0.661  -3.712  -11.263 1.00 0.00 ? 60  LEU A HD22 7  
ATOM 10400 H HD23 . LEU A 1 60  ? -2.161  -2.966  -11.816 1.00 0.00 ? 60  LEU A HD23 7  
ATOM 10401 N N    . SER A 1 61  ? -6.059  -2.767  -8.447  1.00 0.00 ? 61  SER A N    7  
ATOM 10402 C CA   . SER A 1 61  ? -7.191  -2.801  -7.529  1.00 0.00 ? 61  SER A CA   7  
ATOM 10403 C C    . SER A 1 61  ? -6.796  -3.446  -6.204  1.00 0.00 ? 61  SER A C    7  
ATOM 10404 O O    . SER A 1 61  ? -6.070  -4.439  -6.177  1.00 0.00 ? 61  SER A O    7  
ATOM 10405 C CB   . SER A 1 61  ? -8.358  -3.568  -8.154  1.00 0.00 ? 61  SER A CB   7  
ATOM 10406 O OG   . SER A 1 61  ? -9.147  -2.719  -8.970  1.00 0.00 ? 61  SER A OG   7  
ATOM 10407 H H    . SER A 1 61  ? -5.830  -3.573  -8.956  1.00 0.00 ? 61  SER A H    7  
ATOM 10408 H HA   . SER A 1 61  ? -7.498  -1.783  -7.343  1.00 0.00 ? 61  SER A HA   7  
ATOM 10409 H HB2  . SER A 1 61  ? -7.973  -4.373  -8.760  1.00 0.00 ? 61  SER A HB2  7  
ATOM 10410 H HB3  . SER A 1 61  ? -8.981  -3.973  -7.369  1.00 0.00 ? 61  SER A HB3  7  
ATOM 10411 H HG   . SER A 1 61  ? -9.055  -2.981  -9.889  1.00 0.00 ? 61  SER A HG   7  
ATOM 10412 N N    . MET A 1 62  ? -7.281  -2.874  -5.107  1.00 0.00 ? 62  MET A N    7  
ATOM 10413 C CA   . MET A 1 62  ? -6.980  -3.393  -3.778  1.00 0.00 ? 62  MET A CA   7  
ATOM 10414 C C    . MET A 1 62  ? -7.114  -4.912  -3.744  1.00 0.00 ? 62  MET A C    7  
ATOM 10415 O O    . MET A 1 62  ? -6.193  -5.616  -3.329  1.00 0.00 ? 62  MET A O    7  
ATOM 10416 C CB   . MET A 1 62  ? -7.910  -2.764  -2.739  1.00 0.00 ? 62  MET A CB   7  
ATOM 10417 C CG   . MET A 1 62  ? -7.313  -2.709  -1.342  1.00 0.00 ? 62  MET A CG   7  
ATOM 10418 S SD   . MET A 1 62  ? -7.998  -1.372  -0.345  1.00 0.00 ? 62  MET A SD   7  
ATOM 10419 C CE   . MET A 1 62  ? -6.520  -0.754  0.455   1.00 0.00 ? 62  MET A CE   7  
ATOM 10420 H H    . MET A 1 62  ? -7.855  -2.084  -5.192  1.00 0.00 ? 62  MET A H    7  
ATOM 10421 H HA   . MET A 1 62  ? -5.960  -3.127  -3.542  1.00 0.00 ? 62  MET A HA   7  
ATOM 10422 H HB2  . MET A 1 62  ? -8.145  -1.756  -3.046  1.00 0.00 ? 62  MET A HB2  7  
ATOM 10423 H HB3  . MET A 1 62  ? -8.822  -3.340  -2.694  1.00 0.00 ? 62  MET A HB3  7  
ATOM 10424 H HG2  . MET A 1 62  ? -7.509  -3.647  -0.843  1.00 0.00 ? 62  MET A HG2  7  
ATOM 10425 H HG3  . MET A 1 62  ? -6.246  -2.566  -1.428  1.00 0.00 ? 62  MET A HG3  7  
ATOM 10426 H HE1  . MET A 1 62  ? -6.777  -0.349  1.423   1.00 0.00 ? 62  MET A HE1  7  
ATOM 10427 H HE2  . MET A 1 62  ? -5.814  -1.562  0.579   1.00 0.00 ? 62  MET A HE2  7  
ATOM 10428 H HE3  . MET A 1 62  ? -6.078  0.021   -0.154  1.00 0.00 ? 62  MET A HE3  7  
ATOM 10429 N N    . ARG A 1 63  ? -8.265  -5.410  -4.184  1.00 0.00 ? 63  ARG A N    7  
ATOM 10430 C CA   . ARG A 1 63  ? -8.519  -6.845  -4.202  1.00 0.00 ? 63  ARG A CA   7  
ATOM 10431 C C    . ARG A 1 63  ? -7.505  -7.565  -5.087  1.00 0.00 ? 63  ARG A C    7  
ATOM 10432 O O    . ARG A 1 63  ? -6.884  -8.541  -4.667  1.00 0.00 ? 63  ARG A O    7  
ATOM 10433 C CB   . ARG A 1 63  ? -9.937  -7.127  -4.700  1.00 0.00 ? 63  ARG A CB   7  
ATOM 10434 C CG   . ARG A 1 63  ? -10.185 -6.667  -6.127  1.00 0.00 ? 63  ARG A CG   7  
ATOM 10435 C CD   . ARG A 1 63  ? -11.667 -6.672  -6.465  1.00 0.00 ? 63  ARG A CD   7  
ATOM 10436 N NE   . ARG A 1 63  ? -11.900 -6.722  -7.906  1.00 0.00 ? 63  ARG A NE   7  
ATOM 10437 C CZ   . ARG A 1 63  ? -11.656 -5.705  -8.725  1.00 0.00 ? 63  ARG A CZ   7  
ATOM 10438 N NH1  . ARG A 1 63  ? -11.174 -4.566  -8.248  1.00 0.00 ? 63  ARG A NH1  7  
ATOM 10439 N NH2  . ARG A 1 63  ? -11.894 -5.827  -10.025 1.00 0.00 ? 63  ARG A NH2  7  
ATOM 10440 H H    . ARG A 1 63  ? -8.960  -4.797  -4.503  1.00 0.00 ? 63  ARG A H    7  
ATOM 10441 H HA   . ARG A 1 63  ? -8.422  -7.213  -3.192  1.00 0.00 ? 63  ARG A HA   7  
ATOM 10442 H HB2  . ARG A 1 63  ? -10.119 -8.191  -4.652  1.00 0.00 ? 63  ARG A HB2  7  
ATOM 10443 H HB3  . ARG A 1 63  ? -10.639 -6.621  -4.055  1.00 0.00 ? 63  ARG A HB3  7  
ATOM 10444 H HG2  . ARG A 1 63  ? -9.804  -5.663  -6.244  1.00 0.00 ? 63  ARG A HG2  7  
ATOM 10445 H HG3  . ARG A 1 63  ? -9.668  -7.331  -6.804  1.00 0.00 ? 63  ARG A HG3  7  
ATOM 10446 H HD2  . ARG A 1 63  ? -12.125 -7.536  -6.007  1.00 0.00 ? 63  ARG A HD2  7  
ATOM 10447 H HD3  . ARG A 1 63  ? -12.116 -5.774  -6.068  1.00 0.00 ? 63  ARG A HD3  7  
ATOM 10448 H HE   . ARG A 1 63  ? -12.257 -7.554  -8.280  1.00 0.00 ? 63  ARG A HE   7  
ATOM 10449 H HH11 . ARG A 1 63  ? -10.992 -4.472  -7.270  1.00 0.00 ? 63  ARG A HH11 7  
ATOM 10450 H HH12 . ARG A 1 63  ? -10.989 -3.802  -8.868  1.00 0.00 ? 63  ARG A HH12 7  
ATOM 10451 H HH21 . ARG A 1 63  ? -12.258 -6.684  -10.388 1.00 0.00 ? 63  ARG A HH21 7  
ATOM 10452 H HH22 . ARG A 1 63  ? -11.710 -5.061  -10.641 1.00 0.00 ? 63  ARG A HH22 7  
ATOM 10453 N N    . GLN A 1 64  ? -7.344  -7.077  -6.313  1.00 0.00 ? 64  GLN A N    7  
ATOM 10454 C CA   . GLN A 1 64  ? -6.407  -7.675  -7.256  1.00 0.00 ? 64  GLN A CA   7  
ATOM 10455 C C    . GLN A 1 64  ? -5.085  -8.006  -6.573  1.00 0.00 ? 64  GLN A C    7  
ATOM 10456 O O    . GLN A 1 64  ? -4.523  -9.083  -6.777  1.00 0.00 ? 64  GLN A O    7  
ATOM 10457 C CB   . GLN A 1 64  ? -6.164  -6.729  -8.434  1.00 0.00 ? 64  GLN A CB   7  
ATOM 10458 C CG   . GLN A 1 64  ? -5.613  -7.425  -9.668  1.00 0.00 ? 64  GLN A CG   7  
ATOM 10459 C CD   . GLN A 1 64  ? -5.265  -6.453  -10.779 1.00 0.00 ? 64  GLN A CD   7  
ATOM 10460 O OE1  . GLN A 1 64  ? -5.966  -5.465  -10.997 1.00 0.00 ? 64  GLN A OE1  7  
ATOM 10461 N NE2  . GLN A 1 64  ? -4.177  -6.730  -11.489 1.00 0.00 ? 64  GLN A NE2  7  
ATOM 10462 H H    . GLN A 1 64  ? -7.868  -6.296  -6.588  1.00 0.00 ? 64  GLN A H    7  
ATOM 10463 H HA   . GLN A 1 64  ? -6.847  -8.589  -7.625  1.00 0.00 ? 64  GLN A HA   7  
ATOM 10464 H HB2  . GLN A 1 64  ? -7.097  -6.256  -8.700  1.00 0.00 ? 64  GLN A HB2  7  
ATOM 10465 H HB3  . GLN A 1 64  ? -5.458  -5.970  -8.131  1.00 0.00 ? 64  GLN A HB3  7  
ATOM 10466 H HG2  . GLN A 1 64  ? -4.721  -7.967  -9.393  1.00 0.00 ? 64  GLN A HG2  7  
ATOM 10467 H HG3  . GLN A 1 64  ? -6.355  -8.118  -10.036 1.00 0.00 ? 64  GLN A HG3  7  
ATOM 10468 H HE21 . GLN A 1 64  ? -3.668  -7.536  -11.259 1.00 0.00 ? 64  GLN A HE21 7  
ATOM 10469 H HE22 . GLN A 1 64  ? -3.929  -6.120  -12.213 1.00 0.00 ? 64  GLN A HE22 7  
ATOM 10470 N N    . ILE A 1 65  ? -4.593  -7.075  -5.763  1.00 0.00 ? 65  ILE A N    7  
ATOM 10471 C CA   . ILE A 1 65  ? -3.336  -7.270  -5.050  1.00 0.00 ? 65  ILE A CA   7  
ATOM 10472 C C    . ILE A 1 65  ? -3.584  -7.689  -3.605  1.00 0.00 ? 65  ILE A C    7  
ATOM 10473 O O    . ILE A 1 65  ? -4.708  -7.613  -3.110  1.00 0.00 ? 65  ILE A O    7  
ATOM 10474 C CB   . ILE A 1 65  ? -2.478  -5.992  -5.063  1.00 0.00 ? 65  ILE A CB   7  
ATOM 10475 C CG1  . ILE A 1 65  ? -3.250  -4.827  -4.440  1.00 0.00 ? 65  ILE A CG1  7  
ATOM 10476 C CG2  . ILE A 1 65  ? -2.053  -5.653  -6.484  1.00 0.00 ? 65  ILE A CG2  7  
ATOM 10477 C CD1  . ILE A 1 65  ? -2.361  -3.695  -3.971  1.00 0.00 ? 65  ILE A CD1  7  
ATOM 10478 H H    . ILE A 1 65  ? -5.087  -6.238  -5.642  1.00 0.00 ? 65  ILE A H    7  
ATOM 10479 H HA   . ILE A 1 65  ? -2.787  -8.054  -5.552  1.00 0.00 ? 65  ILE A HA   7  
ATOM 10480 H HB   . ILE A 1 65  ? -1.588  -6.177  -4.481  1.00 0.00 ? 65  ILE A HB   7  
ATOM 10481 H HG12 . ILE A 1 65  ? -3.937  -4.427  -5.168  1.00 0.00 ? 65  ILE A HG12 7  
ATOM 10482 H HG13 . ILE A 1 65  ? -3.805  -5.189  -3.587  1.00 0.00 ? 65  ILE A HG13 7  
ATOM 10483 H HG21 . ILE A 1 65  ? -2.351  -6.451  -7.148  1.00 0.00 ? 65  ILE A HG21 7  
ATOM 10484 H HG22 . ILE A 1 65  ? -2.528  -4.733  -6.792  1.00 0.00 ? 65  ILE A HG22 7  
ATOM 10485 H HG23 . ILE A 1 65  ? -0.981  -5.534  -6.521  1.00 0.00 ? 65  ILE A HG23 7  
ATOM 10486 H HD11 . ILE A 1 65  ? -1.931  -3.197  -4.827  1.00 0.00 ? 65  ILE A HD11 7  
ATOM 10487 H HD12 . ILE A 1 65  ? -2.946  -2.991  -3.399  1.00 0.00 ? 65  ILE A HD12 7  
ATOM 10488 H HD13 . ILE A 1 65  ? -1.570  -4.092  -3.352  1.00 0.00 ? 65  ILE A HD13 7  
ATOM 10489 N N    . ARG A 1 66  ? -2.525  -8.128  -2.933  1.00 0.00 ? 66  ARG A N    7  
ATOM 10490 C CA   . ARG A 1 66  ? -2.627  -8.558  -1.543  1.00 0.00 ? 66  ARG A CA   7  
ATOM 10491 C C    . ARG A 1 66  ? -1.347  -8.234  -0.779  1.00 0.00 ? 66  ARG A C    7  
ATOM 10492 O O    . ARG A 1 66  ? -0.242  -8.409  -1.294  1.00 0.00 ? 66  ARG A O    7  
ATOM 10493 C CB   . ARG A 1 66  ? -2.910  -10.060 -1.471  1.00 0.00 ? 66  ARG A CB   7  
ATOM 10494 C CG   . ARG A 1 66  ? -4.343  -10.427 -1.820  1.00 0.00 ? 66  ARG A CG   7  
ATOM 10495 C CD   . ARG A 1 66  ? -5.311  -9.990  -0.732  1.00 0.00 ? 66  ARG A CD   7  
ATOM 10496 N NE   . ARG A 1 66  ? -6.636  -10.578 -0.909  1.00 0.00 ? 66  ARG A NE   7  
ATOM 10497 C CZ   . ARG A 1 66  ? -6.934  -11.830 -0.580  1.00 0.00 ? 66  ARG A CZ   7  
ATOM 10498 N NH1  . ARG A 1 66  ? -6.007  -12.621 -0.059  1.00 0.00 ? 66  ARG A NH1  7  
ATOM 10499 N NH2  . ARG A 1 66  ? -8.163  -12.292 -0.771  1.00 0.00 ? 66  ARG A NH2  7  
ATOM 10500 H H    . ARG A 1 66  ? -1.655  -8.165  -3.382  1.00 0.00 ? 66  ARG A H    7  
ATOM 10501 H HA   . ARG A 1 66  ? -3.448  -8.024  -1.090  1.00 0.00 ? 66  ARG A HA   7  
ATOM 10502 H HB2  . ARG A 1 66  ? -2.253  -10.572 -2.159  1.00 0.00 ? 66  ARG A HB2  7  
ATOM 10503 H HB3  . ARG A 1 66  ? -2.707  -10.404 -0.469  1.00 0.00 ? 66  ARG A HB3  7  
ATOM 10504 H HG2  . ARG A 1 66  ? -4.615  -9.940  -2.745  1.00 0.00 ? 66  ARG A HG2  7  
ATOM 10505 H HG3  . ARG A 1 66  ? -4.411  -11.498 -1.942  1.00 0.00 ? 66  ARG A HG3  7  
ATOM 10506 H HD2  . ARG A 1 66  ? -4.917  -10.296 0.226   1.00 0.00 ? 66  ARG A HD2  7  
ATOM 10507 H HD3  . ARG A 1 66  ? -5.398  -8.914  -0.757  1.00 0.00 ? 66  ARG A HD3  7  
ATOM 10508 H HE   . ARG A 1 66  ? -7.336  -10.010 -1.292  1.00 0.00 ? 66  ARG A HE   7  
ATOM 10509 H HH11 . ARG A 1 66  ? -5.080  -12.275 0.087   1.00 0.00 ? 66  ARG A HH11 7  
ATOM 10510 H HH12 . ARG A 1 66  ? -6.234  -13.563 0.189   1.00 0.00 ? 66  ARG A HH12 7  
ATOM 10511 H HH21 . ARG A 1 66  ? -8.865  -11.698 -1.163  1.00 0.00 ? 66  ARG A HH21 7  
ATOM 10512 H HH22 . ARG A 1 66  ? -8.387  -13.234 -0.524  1.00 0.00 ? 66  ARG A HH22 7  
ATOM 10513 N N    . PHE A 1 67  ? -1.504  -7.760  0.453   1.00 0.00 ? 67  PHE A N    7  
ATOM 10514 C CA   . PHE A 1 67  ? -0.361  -7.410  1.289   1.00 0.00 ? 67  PHE A CA   7  
ATOM 10515 C C    . PHE A 1 67  ? -0.075  -8.509  2.308   1.00 0.00 ? 67  PHE A C    7  
ATOM 10516 O O    . PHE A 1 67  ? -0.937  -9.337  2.601   1.00 0.00 ? 67  PHE A O    7  
ATOM 10517 C CB   . PHE A 1 67  ? -0.616  -6.084  2.008   1.00 0.00 ? 67  PHE A CB   7  
ATOM 10518 C CG   . PHE A 1 67  ? -0.744  -4.912  1.078   1.00 0.00 ? 67  PHE A CG   7  
ATOM 10519 C CD1  . PHE A 1 67  ? -1.952  -4.628  0.462   1.00 0.00 ? 67  PHE A CD1  7  
ATOM 10520 C CD2  . PHE A 1 67  ? 0.344   -4.094  0.819   1.00 0.00 ? 67  PHE A CD2  7  
ATOM 10521 C CE1  . PHE A 1 67  ? -2.073  -3.551  -0.395  1.00 0.00 ? 67  PHE A CE1  7  
ATOM 10522 C CE2  . PHE A 1 67  ? 0.229   -3.014  -0.037  1.00 0.00 ? 67  PHE A CE2  7  
ATOM 10523 C CZ   . PHE A 1 67  ? -0.981  -2.742  -0.644  1.00 0.00 ? 67  PHE A CZ   7  
ATOM 10524 H H    . PHE A 1 67  ? -2.410  -7.643  0.809   1.00 0.00 ? 67  PHE A H    7  
ATOM 10525 H HA   . PHE A 1 67  ? 0.498   -7.301  0.645   1.00 0.00 ? 67  PHE A HA   7  
ATOM 10526 H HB2  . PHE A 1 67  ? -1.532  -6.160  2.574   1.00 0.00 ? 67  PHE A HB2  7  
ATOM 10527 H HB3  . PHE A 1 67  ? 0.203   -5.886  2.683   1.00 0.00 ? 67  PHE A HB3  7  
ATOM 10528 H HD1  . PHE A 1 67  ? -2.807  -5.259  0.657   1.00 0.00 ? 67  PHE A HD1  7  
ATOM 10529 H HD2  . PHE A 1 67  ? 1.291   -4.306  1.294   1.00 0.00 ? 67  PHE A HD2  7  
ATOM 10530 H HE1  . PHE A 1 67  ? -3.020  -3.340  -0.868  1.00 0.00 ? 67  PHE A HE1  7  
ATOM 10531 H HE2  . PHE A 1 67  ? 1.085   -2.384  -0.229  1.00 0.00 ? 67  PHE A HE2  7  
ATOM 10532 H HZ   . PHE A 1 67  ? -1.072  -1.900  -1.313  1.00 0.00 ? 67  PHE A HZ   7  
ATOM 10533 N N    . ARG A 1 68  ? 1.140   -8.508  2.845   1.00 0.00 ? 68  ARG A N    7  
ATOM 10534 C CA   . ARG A 1 68  ? 1.541   -9.505  3.831   1.00 0.00 ? 68  ARG A CA   7  
ATOM 10535 C C    . ARG A 1 68  ? 2.794   -9.058  4.578   1.00 0.00 ? 68  ARG A C    7  
ATOM 10536 O O    . ARG A 1 68  ? 3.712   -8.490  3.987   1.00 0.00 ? 68  ARG A O    7  
ATOM 10537 C CB   . ARG A 1 68  ? 1.792   -10.853 3.151   1.00 0.00 ? 68  ARG A CB   7  
ATOM 10538 C CG   . ARG A 1 68  ? 0.521   -11.558 2.708   1.00 0.00 ? 68  ARG A CG   7  
ATOM 10539 C CD   . ARG A 1 68  ? 0.688   -13.070 2.726   1.00 0.00 ? 68  ARG A CD   7  
ATOM 10540 N NE   . ARG A 1 68  ? -0.591  -13.763 2.594   1.00 0.00 ? 68  ARG A NE   7  
ATOM 10541 C CZ   . ARG A 1 68  ? -0.705  -15.024 2.194   1.00 0.00 ? 68  ARG A CZ   7  
ATOM 10542 N NH1  . ARG A 1 68  ? 0.377   -15.727 1.890   1.00 0.00 ? 68  ARG A NH1  7  
ATOM 10543 N NH2  . ARG A 1 68  ? -1.904  -15.586 2.099   1.00 0.00 ? 68  ARG A NH2  7  
ATOM 10544 H H    . ARG A 1 68  ? 1.784   -7.822  2.571   1.00 0.00 ? 68  ARG A H    7  
ATOM 10545 H HA   . ARG A 1 68  ? 0.733   -9.615  4.539   1.00 0.00 ? 68  ARG A HA   7  
ATOM 10546 H HB2  . ARG A 1 68  ? 2.411   -10.694 2.280   1.00 0.00 ? 68  ARG A HB2  7  
ATOM 10547 H HB3  . ARG A 1 68  ? 2.315   -11.498 3.841   1.00 0.00 ? 68  ARG A HB3  7  
ATOM 10548 H HG2  . ARG A 1 68  ? -0.282  -11.288 3.378   1.00 0.00 ? 68  ARG A HG2  7  
ATOM 10549 H HG3  . ARG A 1 68  ? 0.277   -11.243 1.705   1.00 0.00 ? 68  ARG A HG3  7  
ATOM 10550 H HD2  . ARG A 1 68  ? 1.329   -13.358 1.906   1.00 0.00 ? 68  ARG A HD2  7  
ATOM 10551 H HD3  . ARG A 1 68  ? 1.147   -13.356 3.660   1.00 0.00 ? 68  ARG A HD3  7  
ATOM 10552 H HE   . ARG A 1 68  ? -1.404  -13.262 2.814   1.00 0.00 ? 68  ARG A HE   7  
ATOM 10553 H HH11 . ARG A 1 68  ? 1.282   -15.307 1.962   1.00 0.00 ? 68  ARG A HH11 7  
ATOM 10554 H HH12 . ARG A 1 68  ? 0.289   -16.678 1.590   1.00 0.00 ? 68  ARG A HH12 7  
ATOM 10555 H HH21 . ARG A 1 68  ? -2.722  -15.059 2.328   1.00 0.00 ? 68  ARG A HH21 7  
ATOM 10556 H HH22 . ARG A 1 68  ? -1.988  -16.535 1.798   1.00 0.00 ? 68  ARG A HH22 7  
ATOM 10557 N N    . PHE A 1 69  ? 2.824   -9.318  5.881   1.00 0.00 ? 69  PHE A N    7  
ATOM 10558 C CA   . PHE A 1 69  ? 3.964   -8.942  6.709   1.00 0.00 ? 69  PHE A CA   7  
ATOM 10559 C C    . PHE A 1 69  ? 4.520   -10.153 7.452   1.00 0.00 ? 69  PHE A C    7  
ATOM 10560 O O    . PHE A 1 69  ? 3.909   -10.649 8.399   1.00 0.00 ? 69  PHE A O    7  
ATOM 10561 C CB   . PHE A 1 69  ? 3.557   -7.858  7.710   1.00 0.00 ? 69  PHE A CB   7  
ATOM 10562 C CG   . PHE A 1 69  ? 4.705   -7.335  8.525   1.00 0.00 ? 69  PHE A CG   7  
ATOM 10563 C CD1  . PHE A 1 69  ? 5.860   -6.882  7.909   1.00 0.00 ? 69  PHE A CD1  7  
ATOM 10564 C CD2  . PHE A 1 69  ? 4.629   -7.295  9.908   1.00 0.00 ? 69  PHE A CD2  7  
ATOM 10565 C CE1  . PHE A 1 69  ? 6.918   -6.399  8.656   1.00 0.00 ? 69  PHE A CE1  7  
ATOM 10566 C CE2  . PHE A 1 69  ? 5.683   -6.813  10.661  1.00 0.00 ? 69  PHE A CE2  7  
ATOM 10567 C CZ   . PHE A 1 69  ? 6.830   -6.366  10.034  1.00 0.00 ? 69  PHE A CZ   7  
ATOM 10568 H H    . PHE A 1 69  ? 2.061   -9.774  6.295   1.00 0.00 ? 69  PHE A H    7  
ATOM 10569 H HA   . PHE A 1 69  ? 4.730   -8.550  6.059   1.00 0.00 ? 69  PHE A HA   7  
ATOM 10570 H HB2  . PHE A 1 69  ? 3.125   -7.027  7.174   1.00 0.00 ? 69  PHE A HB2  7  
ATOM 10571 H HB3  . PHE A 1 69  ? 2.823   -8.263  8.390   1.00 0.00 ? 69  PHE A HB3  7  
ATOM 10572 H HD1  . PHE A 1 69  ? 5.931   -6.908  6.830   1.00 0.00 ? 69  PHE A HD1  7  
ATOM 10573 H HD2  . PHE A 1 69  ? 3.733   -7.646  10.400  1.00 0.00 ? 69  PHE A HD2  7  
ATOM 10574 H HE1  . PHE A 1 69  ? 7.813   -6.050  8.162   1.00 0.00 ? 69  PHE A HE1  7  
ATOM 10575 H HE2  . PHE A 1 69  ? 5.611   -6.788  11.738  1.00 0.00 ? 69  PHE A HE2  7  
ATOM 10576 H HZ   . PHE A 1 69  ? 7.654   -5.988  10.619  1.00 0.00 ? 69  PHE A HZ   7  
ATOM 10577 N N    . ASP A 1 70  ? 5.682   -10.625 7.015   1.00 0.00 ? 70  ASP A N    7  
ATOM 10578 C CA   . ASP A 1 70  ? 6.322   -11.778 7.638   1.00 0.00 ? 70  ASP A CA   7  
ATOM 10579 C C    . ASP A 1 70  ? 5.605   -13.069 7.256   1.00 0.00 ? 70  ASP A C    7  
ATOM 10580 O O    . ASP A 1 70  ? 5.641   -14.052 7.995   1.00 0.00 ? 70  ASP A O    7  
ATOM 10581 C CB   . ASP A 1 70  ? 6.339   -11.619 9.159   1.00 0.00 ? 70  ASP A CB   7  
ATOM 10582 C CG   . ASP A 1 70  ? 7.363   -12.517 9.823   1.00 0.00 ? 70  ASP A CG   7  
ATOM 10583 O OD1  . ASP A 1 70  ? 8.447   -12.718 9.236   1.00 0.00 ? 70  ASP A OD1  7  
ATOM 10584 O OD2  . ASP A 1 70  ? 7.082   -13.019 10.931  1.00 0.00 ? 70  ASP A OD2  7  
ATOM 10585 H H    . ASP A 1 70  ? 6.121   -10.187 6.255   1.00 0.00 ? 70  ASP A H    7  
ATOM 10586 H HA   . ASP A 1 70  ? 7.339   -11.826 7.279   1.00 0.00 ? 70  ASP A HA   7  
ATOM 10587 H HB2  . ASP A 1 70  ? 6.574   -10.594 9.405   1.00 0.00 ? 70  ASP A HB2  7  
ATOM 10588 H HB3  . ASP A 1 70  ? 5.363   -11.864 9.550   1.00 0.00 ? 70  ASP A HB3  7  
ATOM 10589 N N    . GLY A 1 71  ? 4.954   -13.059 6.097   1.00 0.00 ? 71  GLY A N    7  
ATOM 10590 C CA   . GLY A 1 71  ? 4.236   -14.234 5.639   1.00 0.00 ? 71  GLY A CA   7  
ATOM 10591 C C    . GLY A 1 71  ? 2.875   -14.373 6.291   1.00 0.00 ? 71  GLY A C    7  
ATOM 10592 O O    . GLY A 1 71  ? 2.391   -15.486 6.499   1.00 0.00 ? 71  GLY A O    7  
ATOM 10593 H H    . GLY A 1 71  ? 4.960   -12.246 5.549   1.00 0.00 ? 71  GLY A H    7  
ATOM 10594 H HA2  . GLY A 1 71  ? 4.107   -14.168 4.569   1.00 0.00 ? 71  GLY A HA2  7  
ATOM 10595 H HA3  . GLY A 1 71  ? 4.823   -15.111 5.867   1.00 0.00 ? 71  GLY A HA3  7  
ATOM 10596 N N    . GLN A 1 72  ? 2.257   -13.242 6.615   1.00 0.00 ? 72  GLN A N    7  
ATOM 10597 C CA   . GLN A 1 72  ? 0.945   -13.244 7.250   1.00 0.00 ? 72  GLN A CA   7  
ATOM 10598 C C    . GLN A 1 72  ? 0.017   -12.232 6.585   1.00 0.00 ? 72  GLN A C    7  
ATOM 10599 O O    . GLN A 1 72  ? 0.431   -11.143 6.187   1.00 0.00 ? 72  GLN A O    7  
ATOM 10600 C CB   . GLN A 1 72  ? 1.075   -12.932 8.741   1.00 0.00 ? 72  GLN A CB   7  
ATOM 10601 C CG   . GLN A 1 72  ? 1.024   -11.446 9.059   1.00 0.00 ? 72  GLN A CG   7  
ATOM 10602 C CD   . GLN A 1 72  ? 1.613   -11.119 10.417  1.00 0.00 ? 72  GLN A CD   7  
ATOM 10603 O OE1  . GLN A 1 72  ? 2.827   -11.182 10.611  1.00 0.00 ? 72  GLN A OE1  7  
ATOM 10604 N NE2  . GLN A 1 72  ? 0.753   -10.766 11.365  1.00 0.00 ? 72  GLN A NE2  7  
ATOM 10605 H H    . GLN A 1 72  ? 2.694   -12.387 6.423   1.00 0.00 ? 72  GLN A H    7  
ATOM 10606 H HA   . GLN A 1 72  ? 0.522   -14.231 7.133   1.00 0.00 ? 72  GLN A HA   7  
ATOM 10607 H HB2  . GLN A 1 72  ? 0.271   -13.420 9.271   1.00 0.00 ? 72  GLN A HB2  7  
ATOM 10608 H HB3  . GLN A 1 72  ? 2.018   -13.321 9.097   1.00 0.00 ? 72  GLN A HB3  7  
ATOM 10609 H HG2  . GLN A 1 72  ? 1.580   -10.910 8.304   1.00 0.00 ? 72  GLN A HG2  7  
ATOM 10610 H HG3  . GLN A 1 72  ? -0.007  -11.124 9.042   1.00 0.00 ? 72  GLN A HG3  7  
ATOM 10611 H HE21 . GLN A 1 72  ? -0.201  -10.739 11.139  1.00 0.00 ? 72  GLN A HE21 7  
ATOM 10612 H HE22 . GLN A 1 72  ? 1.106   -10.550 12.253  1.00 0.00 ? 72  GLN A HE22 7  
ATOM 10613 N N    . PRO A 1 73  ? -1.267  -12.597 6.462   1.00 0.00 ? 73  PRO A N    7  
ATOM 10614 C CA   . PRO A 1 73  ? -2.280  -11.734 5.846   1.00 0.00 ? 73  PRO A CA   7  
ATOM 10615 C C    . PRO A 1 73  ? -2.607  -10.519 6.707   1.00 0.00 ? 73  PRO A C    7  
ATOM 10616 O O    . PRO A 1 73  ? -2.991  -10.655 7.869   1.00 0.00 ? 73  PRO A O    7  
ATOM 10617 C CB   . PRO A 1 73  ? -3.501  -12.650 5.728   1.00 0.00 ? 73  PRO A CB   7  
ATOM 10618 C CG   . PRO A 1 73  ? -3.315  -13.670 6.797   1.00 0.00 ? 73  PRO A CG   7  
ATOM 10619 C CD   . PRO A 1 73  ? -1.830  -13.880 6.914   1.00 0.00 ? 73  PRO A CD   7  
ATOM 10620 H HA   . PRO A 1 73  ? -1.977  -11.407 4.863   1.00 0.00 ? 73  PRO A HA   7  
ATOM 10621 H HB2  . PRO A 1 73  ? -4.403  -12.073 5.884   1.00 0.00 ? 73  PRO A HB2  7  
ATOM 10622 H HB3  . PRO A 1 73  ? -3.522  -13.103 4.749   1.00 0.00 ? 73  PRO A HB3  7  
ATOM 10623 H HG2  . PRO A 1 73  ? -3.716  -13.304 7.729   1.00 0.00 ? 73  PRO A HG2  7  
ATOM 10624 H HG3  . PRO A 1 73  ? -3.802  -14.592 6.513   1.00 0.00 ? 73  PRO A HG3  7  
ATOM 10625 H HD2  . PRO A 1 73  ? -1.557  -14.081 7.940   1.00 0.00 ? 73  PRO A HD2  7  
ATOM 10626 H HD3  . PRO A 1 73  ? -1.512  -14.688 6.272   1.00 0.00 ? 73  PRO A HD3  7  
ATOM 10627 N N    . ILE A 1 74  ? -2.452  -9.332  6.130   1.00 0.00 ? 74  ILE A N    7  
ATOM 10628 C CA   . ILE A 1 74  ? -2.732  -8.093  6.844   1.00 0.00 ? 74  ILE A CA   7  
ATOM 10629 C C    . ILE A 1 74  ? -3.910  -7.352  6.220   1.00 0.00 ? 74  ILE A C    7  
ATOM 10630 O O    . ILE A 1 74  ? -4.013  -7.248  4.998   1.00 0.00 ? 74  ILE A O    7  
ATOM 10631 C CB   . ILE A 1 74  ? -1.505  -7.162  6.861   1.00 0.00 ? 74  ILE A CB   7  
ATOM 10632 C CG1  . ILE A 1 74  ? -0.762  -7.240  5.526   1.00 0.00 ? 74  ILE A CG1  7  
ATOM 10633 C CG2  . ILE A 1 74  ? -0.579  -7.527  8.011   1.00 0.00 ? 74  ILE A CG2  7  
ATOM 10634 C CD1  . ILE A 1 74  ? 0.534   -6.459  5.509   1.00 0.00 ? 74  ILE A CD1  7  
ATOM 10635 H H    . ILE A 1 74  ? -2.143  -9.289  5.201   1.00 0.00 ? 74  ILE A H    7  
ATOM 10636 H HA   . ILE A 1 74  ? -2.981  -8.346  7.865   1.00 0.00 ? 74  ILE A HA   7  
ATOM 10637 H HB   . ILE A 1 74  ? -1.850  -6.151  7.015   1.00 0.00 ? 74  ILE A HB   7  
ATOM 10638 H HG12 . ILE A 1 74  ? -0.530  -8.270  5.309   1.00 0.00 ? 74  ILE A HG12 7  
ATOM 10639 H HG13 . ILE A 1 74  ? -1.397  -6.846  4.745   1.00 0.00 ? 74  ILE A HG13 7  
ATOM 10640 H HG21 . ILE A 1 74  ? 0.171   -8.222  7.663   1.00 0.00 ? 74  ILE A HG21 7  
ATOM 10641 H HG22 . ILE A 1 74  ? -0.097  -6.635  8.381   1.00 0.00 ? 74  ILE A HG22 7  
ATOM 10642 H HG23 . ILE A 1 74  ? -1.152  -7.983  8.804   1.00 0.00 ? 74  ILE A HG23 7  
ATOM 10643 H HD11 . ILE A 1 74  ? 0.501   -5.723  4.720   1.00 0.00 ? 74  ILE A HD11 7  
ATOM 10644 H HD12 . ILE A 1 74  ? 0.668   -5.964  6.459   1.00 0.00 ? 74  ILE A HD12 7  
ATOM 10645 H HD13 . ILE A 1 74  ? 1.359   -7.135  5.336   1.00 0.00 ? 74  ILE A HD13 7  
ATOM 10646 N N    . ASN A 1 75  ? -4.796  -6.838  7.067   1.00 0.00 ? 75  ASN A N    7  
ATOM 10647 C CA   . ASN A 1 75  ? -5.966  -6.106  6.598   1.00 0.00 ? 75  ASN A CA   7  
ATOM 10648 C C    . ASN A 1 75  ? -5.766  -4.602  6.758   1.00 0.00 ? 75  ASN A C    7  
ATOM 10649 O O    . ASN A 1 75  ? -4.995  -4.155  7.606   1.00 0.00 ? 75  ASN A O    7  
ATOM 10650 C CB   . ASN A 1 75  ? -7.213  -6.550  7.365   1.00 0.00 ? 75  ASN A CB   7  
ATOM 10651 C CG   . ASN A 1 75  ? -7.388  -8.057  7.361   1.00 0.00 ? 75  ASN A CG   7  
ATOM 10652 O OD1  . ASN A 1 75  ? -7.569  -8.668  6.308   1.00 0.00 ? 75  ASN A OD1  7  
ATOM 10653 N ND2  . ASN A 1 75  ? -7.336  -8.662  8.542   1.00 0.00 ? 75  ASN A ND2  7  
ATOM 10654 H H    . ASN A 1 75  ? -4.659  -6.955  8.031   1.00 0.00 ? 75  ASN A H    7  
ATOM 10655 H HA   . ASN A 1 75  ? -6.100  -6.330  5.551   1.00 0.00 ? 75  ASN A HA   7  
ATOM 10656 H HB2  . ASN A 1 75  ? -7.134  -6.220  8.391   1.00 0.00 ? 75  ASN A HB2  7  
ATOM 10657 H HB3  . ASN A 1 75  ? -8.086  -6.103  6.914   1.00 0.00 ? 75  ASN A HB3  7  
ATOM 10658 H HD21 . ASN A 1 75  ? -7.190  -8.111  9.339   1.00 0.00 ? 75  ASN A HD21 7  
ATOM 10659 H HD22 . ASN A 1 75  ? -7.446  -9.635  8.568   1.00 0.00 ? 75  ASN A HD22 7  
ATOM 10660 N N    . GLU A 1 76  ? -6.468  -3.826  5.937   1.00 0.00 ? 76  GLU A N    7  
ATOM 10661 C CA   . GLU A 1 76  ? -6.367  -2.373  5.988   1.00 0.00 ? 76  GLU A CA   7  
ATOM 10662 C C    . GLU A 1 76  ? -6.718  -1.851  7.378   1.00 0.00 ? 76  GLU A C    7  
ATOM 10663 O O    . GLU A 1 76  ? -6.042  -0.973  7.914   1.00 0.00 ? 76  GLU A O    7  
ATOM 10664 C CB   . GLU A 1 76  ? -7.290  -1.738  4.945   1.00 0.00 ? 76  GLU A CB   7  
ATOM 10665 C CG   . GLU A 1 76  ? -8.710  -2.277  4.981   1.00 0.00 ? 76  GLU A CG   7  
ATOM 10666 C CD   . GLU A 1 76  ? -9.649  -1.506  4.074   1.00 0.00 ? 76  GLU A CD   7  
ATOM 10667 O OE1  . GLU A 1 76  ? -9.314  -1.328  2.885   1.00 0.00 ? 76  GLU A OE1  7  
ATOM 10668 O OE2  . GLU A 1 76  ? -10.721 -1.081  4.554   1.00 0.00 ? 76  GLU A OE2  7  
ATOM 10669 H H    . GLU A 1 76  ? -7.067  -4.242  5.282   1.00 0.00 ? 76  GLU A H    7  
ATOM 10670 H HA   . GLU A 1 76  ? -5.346  -2.103  5.763   1.00 0.00 ? 76  GLU A HA   7  
ATOM 10671 H HB2  . GLU A 1 76  ? -7.326  -0.672  5.114   1.00 0.00 ? 76  GLU A HB2  7  
ATOM 10672 H HB3  . GLU A 1 76  ? -6.882  -1.923  3.962   1.00 0.00 ? 76  GLU A HB3  7  
ATOM 10673 H HG2  . GLU A 1 76  ? -8.698  -3.310  4.666   1.00 0.00 ? 76  GLU A HG2  7  
ATOM 10674 H HG3  . GLU A 1 76  ? -9.079  -2.215  5.994   1.00 0.00 ? 76  GLU A HG3  7  
ATOM 10675 N N    . THR A 1 77  ? -7.783  -2.398  7.957   1.00 0.00 ? 77  THR A N    7  
ATOM 10676 C CA   . THR A 1 77  ? -8.226  -1.988  9.284   1.00 0.00 ? 77  THR A CA   7  
ATOM 10677 C C    . THR A 1 77  ? -7.113  -2.154  10.311  1.00 0.00 ? 77  THR A C    7  
ATOM 10678 O O    . THR A 1 77  ? -6.984  -1.352  11.237  1.00 0.00 ? 77  THR A O    7  
ATOM 10679 C CB   . THR A 1 77  ? -9.455  -2.796  9.740   1.00 0.00 ? 77  THR A CB   7  
ATOM 10680 O OG1  . THR A 1 77  ? -9.133  -4.191  9.790   1.00 0.00 ? 77  THR A OG1  7  
ATOM 10681 C CG2  . THR A 1 77  ? -10.629 -2.575  8.798   1.00 0.00 ? 77  THR A CG2  7  
ATOM 10682 H H    . THR A 1 77  ? -8.281  -3.093  7.479   1.00 0.00 ? 77  THR A H    7  
ATOM 10683 H HA   . THR A 1 77  ? -8.505  -0.945  9.234   1.00 0.00 ? 77  THR A HA   7  
ATOM 10684 H HB   . THR A 1 77  ? -9.739  -2.464  10.729  1.00 0.00 ? 77  THR A HB   7  
ATOM 10685 H HG1  . THR A 1 77  ? -8.642  -4.377  10.594  1.00 0.00 ? 77  THR A HG1  7  
ATOM 10686 H HG21 . THR A 1 77  ? -10.274 -2.561  7.778   1.00 0.00 ? 77  THR A HG21 7  
ATOM 10687 H HG22 . THR A 1 77  ? -11.102 -1.632  9.028   1.00 0.00 ? 77  THR A HG22 7  
ATOM 10688 H HG23 . THR A 1 77  ? -11.343 -3.376  8.919   1.00 0.00 ? 77  THR A HG23 7  
ATOM 10689 N N    . ASP A 1 78  ? -6.309  -3.198  10.143  1.00 0.00 ? 78  ASP A N    7  
ATOM 10690 C CA   . ASP A 1 78  ? -5.204  -3.468  11.055  1.00 0.00 ? 78  ASP A CA   7  
ATOM 10691 C C    . ASP A 1 78  ? -4.192  -2.327  11.036  1.00 0.00 ? 78  ASP A C    7  
ATOM 10692 O O    . ASP A 1 78  ? -4.136  -1.548  10.083  1.00 0.00 ? 78  ASP A O    7  
ATOM 10693 C CB   . ASP A 1 78  ? -4.517  -4.783  10.683  1.00 0.00 ? 78  ASP A CB   7  
ATOM 10694 C CG   . ASP A 1 78  ? -5.343  -5.996  11.065  1.00 0.00 ? 78  ASP A CG   7  
ATOM 10695 O OD1  . ASP A 1 78  ? -6.429  -6.183  10.477  1.00 0.00 ? 78  ASP A OD1  7  
ATOM 10696 O OD2  . ASP A 1 78  ? -4.902  -6.758  11.950  1.00 0.00 ? 78  ASP A OD2  7  
ATOM 10697 H H    . ASP A 1 78  ? -6.462  -3.802  9.386   1.00 0.00 ? 78  ASP A H    7  
ATOM 10698 H HA   . ASP A 1 78  ? -5.611  -3.555  12.052  1.00 0.00 ? 78  ASP A HA   7  
ATOM 10699 H HB2  . ASP A 1 78  ? -4.350  -4.805  9.616   1.00 0.00 ? 78  ASP A HB2  7  
ATOM 10700 H HB3  . ASP A 1 78  ? -3.567  -4.841  11.193  1.00 0.00 ? 78  ASP A HB3  7  
ATOM 10701 N N    . THR A 1 79  ? -3.393  -2.233  12.094  1.00 0.00 ? 79  THR A N    7  
ATOM 10702 C CA   . THR A 1 79  ? -2.385  -1.186  12.200  1.00 0.00 ? 79  THR A CA   7  
ATOM 10703 C C    . THR A 1 79  ? -0.980  -1.778  12.241  1.00 0.00 ? 79  THR A C    7  
ATOM 10704 O O    . THR A 1 79  ? -0.785  -2.954  12.548  1.00 0.00 ? 79  THR A O    7  
ATOM 10705 C CB   . THR A 1 79  ? -2.602  -0.321  13.456  1.00 0.00 ? 79  THR A CB   7  
ATOM 10706 O OG1  . THR A 1 79  ? -3.162  -1.116  14.507  1.00 0.00 ? 79  THR A OG1  7  
ATOM 10707 C CG2  . THR A 1 79  ? -3.523  0.850   13.154  1.00 0.00 ? 79  THR A CG2  7  
ATOM 10708 H H    . THR A 1 79  ? -3.486  -2.883  12.821  1.00 0.00 ? 79  THR A H    7  
ATOM 10709 H HA   . THR A 1 79  ? -2.472  -0.550  11.331  1.00 0.00 ? 79  THR A HA   7  
ATOM 10710 H HB   . THR A 1 79  ? -1.645  0.065   13.778  1.00 0.00 ? 79  THR A HB   7  
ATOM 10711 H HG1  . THR A 1 79  ? -3.908  -1.616  14.168  1.00 0.00 ? 79  THR A HG1  7  
ATOM 10712 H HG21 . THR A 1 79  ? -3.987  0.705   12.189  1.00 0.00 ? 79  THR A HG21 7  
ATOM 10713 H HG22 . THR A 1 79  ? -2.950  1.766   13.143  1.00 0.00 ? 79  THR A HG22 7  
ATOM 10714 H HG23 . THR A 1 79  ? -4.287  0.913   13.914  1.00 0.00 ? 79  THR A HG23 7  
ATOM 10715 N N    . PRO A 1 80  ? 0.023   -0.946  11.926  1.00 0.00 ? 80  PRO A N    7  
ATOM 10716 C CA   . PRO A 1 80  ? 1.428   -1.365  11.920  1.00 0.00 ? 80  PRO A CA   7  
ATOM 10717 C C    . PRO A 1 80  ? 1.959   -1.630  13.325  1.00 0.00 ? 80  PRO A C    7  
ATOM 10718 O O    . PRO A 1 80  ? 3.014   -2.240  13.495  1.00 0.00 ? 80  PRO A O    7  
ATOM 10719 C CB   . PRO A 1 80  ? 2.152   -0.172  11.291  1.00 0.00 ? 80  PRO A CB   7  
ATOM 10720 C CG   . PRO A 1 80  ? 1.271   0.997   11.572  1.00 0.00 ? 80  PRO A CG   7  
ATOM 10721 C CD   . PRO A 1 80  ? -0.137  0.469   11.550  1.00 0.00 ? 80  PRO A CD   7  
ATOM 10722 H HA   . PRO A 1 80  ? 1.577   -2.243  11.309  1.00 0.00 ? 80  PRO A HA   7  
ATOM 10723 H HB2  . PRO A 1 80  ? 3.123   -0.055  11.749  1.00 0.00 ? 80  PRO A HB2  7  
ATOM 10724 H HB3  . PRO A 1 80  ? 2.265   -0.334  10.230  1.00 0.00 ? 80  PRO A HB3  7  
ATOM 10725 H HG2  . PRO A 1 80  ? 1.503   1.406   12.544  1.00 0.00 ? 80  PRO A HG2  7  
ATOM 10726 H HG3  . PRO A 1 80  ? 1.402   1.747   10.806  1.00 0.00 ? 80  PRO A HG3  7  
ATOM 10727 H HD2  . PRO A 1 80  ? -0.747  0.993   12.271  1.00 0.00 ? 80  PRO A HD2  7  
ATOM 10728 H HD3  . PRO A 1 80  ? -0.558  0.559   10.559  1.00 0.00 ? 80  PRO A HD3  7  
ATOM 10729 N N    . ALA A 1 81  ? 1.220   -1.167  14.329  1.00 0.00 ? 81  ALA A N    7  
ATOM 10730 C CA   . ALA A 1 81  ? 1.616   -1.357  15.719  1.00 0.00 ? 81  ALA A CA   7  
ATOM 10731 C C    . ALA A 1 81  ? 1.161   -2.716  16.239  1.00 0.00 ? 81  ALA A C    7  
ATOM 10732 O O    . ALA A 1 81  ? 1.769   -3.277  17.150  1.00 0.00 ? 81  ALA A O    7  
ATOM 10733 C CB   . ALA A 1 81  ? 1.050   -0.241  16.585  1.00 0.00 ? 81  ALA A CB   7  
ATOM 10734 H H    . ALA A 1 81  ? 0.389   -0.688  14.130  1.00 0.00 ? 81  ALA A H    7  
ATOM 10735 H HA   . ALA A 1 81  ? 2.694   -1.306  15.769  1.00 0.00 ? 81  ALA A HA   7  
ATOM 10736 H HB1  . ALA A 1 81  ? 1.151   0.702   16.067  1.00 0.00 ? 81  ALA A HB1  7  
ATOM 10737 H HB2  . ALA A 1 81  ? 0.007   -0.434  16.784  1.00 0.00 ? 81  ALA A HB2  7  
ATOM 10738 H HB3  . ALA A 1 81  ? 1.593   -0.200  17.518  1.00 0.00 ? 81  ALA A HB3  7  
ATOM 10739 N N    . GLN A 1 82  ? 0.088   -3.239  15.655  1.00 0.00 ? 82  GLN A N    7  
ATOM 10740 C CA   . GLN A 1 82  ? -0.449  -4.532  16.061  1.00 0.00 ? 82  GLN A CA   7  
ATOM 10741 C C    . GLN A 1 82  ? 0.444   -5.669  15.577  1.00 0.00 ? 82  GLN A C    7  
ATOM 10742 O O    . GLN A 1 82  ? 0.512   -6.729  16.201  1.00 0.00 ? 82  GLN A O    7  
ATOM 10743 C CB   . GLN A 1 82  ? -1.867  -4.714  15.516  1.00 0.00 ? 82  GLN A CB   7  
ATOM 10744 C CG   . GLN A 1 82  ? -2.669  -5.778  16.248  1.00 0.00 ? 82  GLN A CG   7  
ATOM 10745 C CD   . GLN A 1 82  ? -3.208  -5.290  17.578  1.00 0.00 ? 82  GLN A CD   7  
ATOM 10746 O OE1  . GLN A 1 82  ? -2.694  -4.330  18.155  1.00 0.00 ? 82  GLN A OE1  7  
ATOM 10747 N NE2  . GLN A 1 82  ? -4.249  -5.948  18.073  1.00 0.00 ? 82  GLN A NE2  7  
ATOM 10748 H H    . GLN A 1 82  ? -0.354  -2.743  14.934  1.00 0.00 ? 82  GLN A H    7  
ATOM 10749 H HA   . GLN A 1 82  ? -0.483  -4.552  17.140  1.00 0.00 ? 82  GLN A HA   7  
ATOM 10750 H HB2  . GLN A 1 82  ? -2.394  -3.775  15.598  1.00 0.00 ? 82  GLN A HB2  7  
ATOM 10751 H HB3  . GLN A 1 82  ? -1.806  -4.993  14.474  1.00 0.00 ? 82  GLN A HB3  7  
ATOM 10752 H HG2  . GLN A 1 82  ? -3.501  -6.074  15.627  1.00 0.00 ? 82  GLN A HG2  7  
ATOM 10753 H HG3  . GLN A 1 82  ? -2.031  -6.631  16.426  1.00 0.00 ? 82  GLN A HG3  7  
ATOM 10754 H HE21 . GLN A 1 82  ? -4.605  -6.704  17.559  1.00 0.00 ? 82  GLN A HE21 7  
ATOM 10755 H HE22 . GLN A 1 82  ? -4.617  -5.655  18.931  1.00 0.00 ? 82  GLN A HE22 7  
ATOM 10756 N N    . LEU A 1 83  ? 1.129   -5.442  14.461  1.00 0.00 ? 83  LEU A N    7  
ATOM 10757 C CA   . LEU A 1 83  ? 2.019   -6.448  13.892  1.00 0.00 ? 83  LEU A CA   7  
ATOM 10758 C C    . LEU A 1 83  ? 3.418   -6.339  14.491  1.00 0.00 ? 83  LEU A C    7  
ATOM 10759 O O    . LEU A 1 83  ? 4.331   -7.060  14.093  1.00 0.00 ? 83  LEU A O    7  
ATOM 10760 C CB   . LEU A 1 83  ? 2.090   -6.294  12.372  1.00 0.00 ? 83  LEU A CB   7  
ATOM 10761 C CG   . LEU A 1 83  ? 0.750   -6.148  11.650  1.00 0.00 ? 83  LEU A CG   7  
ATOM 10762 C CD1  . LEU A 1 83  ? 0.929   -5.393  10.341  1.00 0.00 ? 83  LEU A CD1  7  
ATOM 10763 C CD2  . LEU A 1 83  ? 0.127   -7.513  11.399  1.00 0.00 ? 83  LEU A CD2  7  
ATOM 10764 H H    . LEU A 1 83  ? 1.034   -4.579  14.009  1.00 0.00 ? 83  LEU A H    7  
ATOM 10765 H HA   . LEU A 1 83  ? 1.614   -7.421  14.129  1.00 0.00 ? 83  LEU A HA   7  
ATOM 10766 H HB2  . LEU A 1 83  ? 2.679   -5.416  12.156  1.00 0.00 ? 83  LEU A HB2  7  
ATOM 10767 H HB3  . LEU A 1 83  ? 2.587   -7.167  11.975  1.00 0.00 ? 83  LEU A HB3  7  
ATOM 10768 H HG   . LEU A 1 83  ? 0.073   -5.579  12.272  1.00 0.00 ? 83  LEU A HG   7  
ATOM 10769 H HD11 . LEU A 1 83  ? 1.421   -4.452  10.533  1.00 0.00 ? 83  LEU A HD11 7  
ATOM 10770 H HD12 . LEU A 1 83  ? -0.038  -5.210  9.897   1.00 0.00 ? 83  LEU A HD12 7  
ATOM 10771 H HD13 . LEU A 1 83  ? 1.529   -5.983  9.665   1.00 0.00 ? 83  LEU A HD13 7  
ATOM 10772 H HD21 . LEU A 1 83  ? -0.297  -7.889  12.319  1.00 0.00 ? 83  LEU A HD21 7  
ATOM 10773 H HD22 . LEU A 1 83  ? 0.887   -8.196  11.048  1.00 0.00 ? 83  LEU A HD22 7  
ATOM 10774 H HD23 . LEU A 1 83  ? -0.650  -7.423  10.654  1.00 0.00 ? 83  LEU A HD23 7  
ATOM 10775 N N    . GLU A 1 84  ? 3.576   -5.433  15.452  1.00 0.00 ? 84  GLU A N    7  
ATOM 10776 C CA   . GLU A 1 84  ? 4.863   -5.231  16.106  1.00 0.00 ? 84  GLU A CA   7  
ATOM 10777 C C    . GLU A 1 84  ? 5.912   -4.751  15.107  1.00 0.00 ? 84  GLU A C    7  
ATOM 10778 O O    . GLU A 1 84  ? 7.028   -5.267  15.066  1.00 0.00 ? 84  GLU A O    7  
ATOM 10779 C CB   . GLU A 1 84  ? 5.332   -6.528  16.770  1.00 0.00 ? 84  GLU A CB   7  
ATOM 10780 C CG   . GLU A 1 84  ? 4.459   -6.965  17.935  1.00 0.00 ? 84  GLU A CG   7  
ATOM 10781 C CD   . GLU A 1 84  ? 4.900   -8.289  18.529  1.00 0.00 ? 84  GLU A CD   7  
ATOM 10782 O OE1  . GLU A 1 84  ? 4.752   -9.324  17.845  1.00 0.00 ? 84  GLU A OE1  7  
ATOM 10783 O OE2  . GLU A 1 84  ? 5.392   -8.291  19.676  1.00 0.00 ? 84  GLU A OE2  7  
ATOM 10784 H H    . GLU A 1 84  ? 2.809   -4.888  15.726  1.00 0.00 ? 84  GLU A H    7  
ATOM 10785 H HA   . GLU A 1 84  ? 4.734   -4.475  16.866  1.00 0.00 ? 84  GLU A HA   7  
ATOM 10786 H HB2  . GLU A 1 84  ? 5.333   -7.316  16.032  1.00 0.00 ? 84  GLU A HB2  7  
ATOM 10787 H HB3  . GLU A 1 84  ? 6.338   -6.387  17.135  1.00 0.00 ? 84  GLU A HB3  7  
ATOM 10788 H HG2  . GLU A 1 84  ? 4.505   -6.210  18.705  1.00 0.00 ? 84  GLU A HG2  7  
ATOM 10789 H HG3  . GLU A 1 84  ? 3.441   -7.064  17.588  1.00 0.00 ? 84  GLU A HG3  7  
ATOM 10790 N N    . MET A 1 85  ? 5.544   -3.758  14.303  1.00 0.00 ? 85  MET A N    7  
ATOM 10791 C CA   . MET A 1 85  ? 6.452   -3.207  13.305  1.00 0.00 ? 85  MET A CA   7  
ATOM 10792 C C    . MET A 1 85  ? 7.444   -2.242  13.946  1.00 0.00 ? 85  MET A C    7  
ATOM 10793 O O    . MET A 1 85  ? 7.054   -1.342  14.690  1.00 0.00 ? 85  MET A O    7  
ATOM 10794 C CB   . MET A 1 85  ? 5.664   -2.492  12.206  1.00 0.00 ? 85  MET A CB   7  
ATOM 10795 C CG   . MET A 1 85  ? 4.842   -3.431  11.338  1.00 0.00 ? 85  MET A CG   7  
ATOM 10796 S SD   . MET A 1 85  ? 4.545   -2.769  9.687   1.00 0.00 ? 85  MET A SD   7  
ATOM 10797 C CE   . MET A 1 85  ? 4.494   -4.277  8.722   1.00 0.00 ? 85  MET A CE   7  
ATOM 10798 H H    . MET A 1 85  ? 4.640   -3.387  14.384  1.00 0.00 ? 85  MET A H    7  
ATOM 10799 H HA   . MET A 1 85  ? 6.999   -4.028  12.866  1.00 0.00 ? 85  MET A HA   7  
ATOM 10800 H HB2  . MET A 1 85  ? 4.993   -1.781  12.666  1.00 0.00 ? 85  MET A HB2  7  
ATOM 10801 H HB3  . MET A 1 85  ? 6.356   -1.961  11.569  1.00 0.00 ? 85  MET A HB3  7  
ATOM 10802 H HG2  . MET A 1 85  ? 5.370   -4.368  11.244  1.00 0.00 ? 85  MET A HG2  7  
ATOM 10803 H HG3  . MET A 1 85  ? 3.891   -3.603  11.819  1.00 0.00 ? 85  MET A HG3  7  
ATOM 10804 H HE1  . MET A 1 85  ? 4.921   -4.095  7.747   1.00 0.00 ? 85  MET A HE1  7  
ATOM 10805 H HE2  . MET A 1 85  ? 5.061   -5.045  9.226   1.00 0.00 ? 85  MET A HE2  7  
ATOM 10806 H HE3  . MET A 1 85  ? 3.469   -4.598  8.612   1.00 0.00 ? 85  MET A HE3  7  
ATOM 10807 N N    . GLU A 1 86  ? 8.726   -2.435  13.653  1.00 0.00 ? 86  GLU A N    7  
ATOM 10808 C CA   . GLU A 1 86  ? 9.772   -1.581  14.203  1.00 0.00 ? 86  GLU A CA   7  
ATOM 10809 C C    . GLU A 1 86  ? 10.121  -0.455  13.234  1.00 0.00 ? 86  GLU A C    7  
ATOM 10810 O O    . GLU A 1 86  ? 9.801   0.709   13.477  1.00 0.00 ? 86  GLU A O    7  
ATOM 10811 C CB   . GLU A 1 86  ? 11.023  -2.406  14.515  1.00 0.00 ? 86  GLU A CB   7  
ATOM 10812 C CG   . GLU A 1 86  ? 10.832  -3.392  15.655  1.00 0.00 ? 86  GLU A CG   7  
ATOM 10813 C CD   . GLU A 1 86  ? 12.129  -3.712  16.373  1.00 0.00 ? 86  GLU A CD   7  
ATOM 10814 O OE1  . GLU A 1 86  ? 12.863  -4.606  15.904  1.00 0.00 ? 86  GLU A OE1  7  
ATOM 10815 O OE2  . GLU A 1 86  ? 12.410  -3.067  17.405  1.00 0.00 ? 86  GLU A OE2  7  
ATOM 10816 H H    . GLU A 1 86  ? 8.974   -3.169  13.053  1.00 0.00 ? 86  GLU A H    7  
ATOM 10817 H HA   . GLU A 1 86  ? 9.400   -1.149  15.119  1.00 0.00 ? 86  GLU A HA   7  
ATOM 10818 H HB2  . GLU A 1 86  ? 11.305  -2.958  13.631  1.00 0.00 ? 86  GLU A HB2  7  
ATOM 10819 H HB3  . GLU A 1 86  ? 11.825  -1.733  14.780  1.00 0.00 ? 86  GLU A HB3  7  
ATOM 10820 H HG2  . GLU A 1 86  ? 10.139  -2.971  16.367  1.00 0.00 ? 86  GLU A HG2  7  
ATOM 10821 H HG3  . GLU A 1 86  ? 10.423  -4.309  15.256  1.00 0.00 ? 86  GLU A HG3  7  
ATOM 10822 N N    . ASP A 1 87  ? 10.779  -0.810  12.136  1.00 0.00 ? 87  ASP A N    7  
ATOM 10823 C CA   . ASP A 1 87  ? 11.172  0.169   11.129  1.00 0.00 ? 87  ASP A CA   7  
ATOM 10824 C C    . ASP A 1 87  ? 11.816  -0.515  9.928   1.00 0.00 ? 87  ASP A C    7  
ATOM 10825 O O    . ASP A 1 87  ? 12.236  -1.669  10.011  1.00 0.00 ? 87  ASP A O    7  
ATOM 10826 C CB   . ASP A 1 87  ? 12.139  1.190   11.730  1.00 0.00 ? 87  ASP A CB   7  
ATOM 10827 C CG   . ASP A 1 87  ? 11.422  2.382   12.332  1.00 0.00 ? 87  ASP A CG   7  
ATOM 10828 O OD1  . ASP A 1 87  ? 10.706  3.082   11.586  1.00 0.00 ? 87  ASP A OD1  7  
ATOM 10829 O OD2  . ASP A 1 87  ? 11.578  2.617   13.549  1.00 0.00 ? 87  ASP A OD2  7  
ATOM 10830 H H    . ASP A 1 87  ? 11.006  -1.754  11.999  1.00 0.00 ? 87  ASP A H    7  
ATOM 10831 H HA   . ASP A 1 87  ? 10.281  0.682   10.800  1.00 0.00 ? 87  ASP A HA   7  
ATOM 10832 H HB2  . ASP A 1 87  ? 12.719  0.713   12.507  1.00 0.00 ? 87  ASP A HB2  7  
ATOM 10833 H HB3  . ASP A 1 87  ? 12.804  1.545   10.957  1.00 0.00 ? 87  ASP A HB3  7  
ATOM 10834 N N    . GLU A 1 88  ? 11.889  0.204   8.812   1.00 0.00 ? 88  GLU A N    7  
ATOM 10835 C CA   . GLU A 1 88  ? 12.481  -0.336  7.594   1.00 0.00 ? 88  GLU A CA   7  
ATOM 10836 C C    . GLU A 1 88  ? 12.020  -1.770  7.354   1.00 0.00 ? 88  GLU A C    7  
ATOM 10837 O O    . GLU A 1 88  ? 12.741  -2.575  6.764   1.00 0.00 ? 88  GLU A O    7  
ATOM 10838 C CB   . GLU A 1 88  ? 14.008  -0.286  7.676   1.00 0.00 ? 88  GLU A CB   7  
ATOM 10839 C CG   . GLU A 1 88  ? 14.570  1.125   7.722   1.00 0.00 ? 88  GLU A CG   7  
ATOM 10840 C CD   . GLU A 1 88  ? 16.085  1.150   7.749   1.00 0.00 ? 88  GLU A CD   7  
ATOM 10841 O OE1  . GLU A 1 88  ? 16.670  0.576   8.692   1.00 0.00 ? 88  GLU A OE1  7  
ATOM 10842 O OE2  . GLU A 1 88  ? 16.687  1.742   6.829   1.00 0.00 ? 88  GLU A OE2  7  
ATOM 10843 H H    . GLU A 1 88  ? 11.537  1.118   8.809   1.00 0.00 ? 88  GLU A H    7  
ATOM 10844 H HA   . GLU A 1 88  ? 12.154  0.277   6.767   1.00 0.00 ? 88  GLU A HA   7  
ATOM 10845 H HB2  . GLU A 1 88  ? 14.326  -0.807  8.568   1.00 0.00 ? 88  GLU A HB2  7  
ATOM 10846 H HB3  . GLU A 1 88  ? 14.419  -0.786  6.812   1.00 0.00 ? 88  GLU A HB3  7  
ATOM 10847 H HG2  . GLU A 1 88  ? 14.232  1.662   6.847   1.00 0.00 ? 88  GLU A HG2  7  
ATOM 10848 H HG3  . GLU A 1 88  ? 14.200  1.618   8.609   1.00 0.00 ? 88  GLU A HG3  7  
ATOM 10849 N N    . ASP A 1 89  ? 10.815  -2.083  7.817   1.00 0.00 ? 89  ASP A N    7  
ATOM 10850 C CA   . ASP A 1 89  ? 10.256  -3.420  7.653   1.00 0.00 ? 89  ASP A CA   7  
ATOM 10851 C C    . ASP A 1 89  ? 9.794   -3.644  6.217   1.00 0.00 ? 89  ASP A C    7  
ATOM 10852 O O    . ASP A 1 89  ? 8.995   -2.875  5.683   1.00 0.00 ? 89  ASP A O    7  
ATOM 10853 C CB   . ASP A 1 89  ? 9.087   -3.629  8.617   1.00 0.00 ? 89  ASP A CB   7  
ATOM 10854 C CG   . ASP A 1 89  ? 9.215   -2.790  9.873   1.00 0.00 ? 89  ASP A CG   7  
ATOM 10855 O OD1  . ASP A 1 89  ? 9.089   -1.551  9.774   1.00 0.00 ? 89  ASP A OD1  7  
ATOM 10856 O OD2  . ASP A 1 89  ? 9.439   -3.372  10.954  1.00 0.00 ? 89  ASP A OD2  7  
ATOM 10857 H H    . ASP A 1 89  ? 10.288  -1.398  8.279   1.00 0.00 ? 89  ASP A H    7  
ATOM 10858 H HA   . ASP A 1 89  ? 11.032  -4.134  7.884   1.00 0.00 ? 89  ASP A HA   7  
ATOM 10859 H HB2  . ASP A 1 89  ? 8.166   -3.361  8.119   1.00 0.00 ? 89  ASP A HB2  7  
ATOM 10860 H HB3  . ASP A 1 89  ? 9.046   -4.670  8.903   1.00 0.00 ? 89  ASP A HB3  7  
ATOM 10861 N N    . THR A 1 90  ? 10.304  -4.703  5.595   1.00 0.00 ? 90  THR A N    7  
ATOM 10862 C CA   . THR A 1 90  ? 9.946   -5.027  4.220   1.00 0.00 ? 90  THR A CA   7  
ATOM 10863 C C    . THR A 1 90  ? 8.578   -5.697  4.151   1.00 0.00 ? 90  THR A C    7  
ATOM 10864 O O    . THR A 1 90  ? 8.300   -6.638  4.895   1.00 0.00 ? 90  THR A O    7  
ATOM 10865 C CB   . THR A 1 90  ? 10.992  -5.953  3.570   1.00 0.00 ? 90  THR A CB   7  
ATOM 10866 O OG1  . THR A 1 90  ? 12.290  -5.355  3.647   1.00 0.00 ? 90  THR A OG1  7  
ATOM 10867 C CG2  . THR A 1 90  ? 10.641  -6.230  2.116   1.00 0.00 ? 90  THR A CG2  7  
ATOM 10868 H H    . THR A 1 90  ? 10.937  -5.278  6.073   1.00 0.00 ? 90  THR A H    7  
ATOM 10869 H HA   . THR A 1 90  ? 9.913   -4.105  3.657   1.00 0.00 ? 90  THR A HA   7  
ATOM 10870 H HB   . THR A 1 90  ? 11.003  -6.891  4.107   1.00 0.00 ? 90  THR A HB   7  
ATOM 10871 H HG1  . THR A 1 90  ? 12.705  -5.595  4.480   1.00 0.00 ? 90  THR A HG1  7  
ATOM 10872 H HG21 . THR A 1 90  ? 11.181  -5.546  1.479   1.00 0.00 ? 90  THR A HG21 7  
ATOM 10873 H HG22 . THR A 1 90  ? 9.579   -6.096  1.970   1.00 0.00 ? 90  THR A HG22 7  
ATOM 10874 H HG23 . THR A 1 90  ? 10.913  -7.244  1.867   1.00 0.00 ? 90  THR A HG23 7  
ATOM 10875 N N    . ILE A 1 91  ? 7.729   -5.207  3.254   1.00 0.00 ? 91  ILE A N    7  
ATOM 10876 C CA   . ILE A 1 91  ? 6.391   -5.761  3.088   1.00 0.00 ? 91  ILE A CA   7  
ATOM 10877 C C    . ILE A 1 91  ? 6.342   -6.739  1.919   1.00 0.00 ? 91  ILE A C    7  
ATOM 10878 O O    . ILE A 1 91  ? 7.108   -6.618  0.963   1.00 0.00 ? 91  ILE A O    7  
ATOM 10879 C CB   . ILE A 1 91  ? 5.348   -4.651  2.859   1.00 0.00 ? 91  ILE A CB   7  
ATOM 10880 C CG1  . ILE A 1 91  ? 5.590   -3.487  3.821   1.00 0.00 ? 91  ILE A CG1  7  
ATOM 10881 C CG2  . ILE A 1 91  ? 3.941   -5.204  3.031   1.00 0.00 ? 91  ILE A CG2  7  
ATOM 10882 C CD1  . ILE A 1 91  ? 4.659   -2.315  3.598   1.00 0.00 ? 91  ILE A CD1  7  
ATOM 10883 H H    . ILE A 1 91  ? 8.010   -4.457  2.690   1.00 0.00 ? 91  ILE A H    7  
ATOM 10884 H HA   . ILE A 1 91  ? 6.134   -6.288  3.995   1.00 0.00 ? 91  ILE A HA   7  
ATOM 10885 H HB   . ILE A 1 91  ? 5.448   -4.298  1.844   1.00 0.00 ? 91  ILE A HB   7  
ATOM 10886 H HG12 . ILE A 1 91  ? 5.453   -3.830  4.834   1.00 0.00 ? 91  ILE A HG12 7  
ATOM 10887 H HG13 . ILE A 1 91  ? 6.604   -3.134  3.698   1.00 0.00 ? 91  ILE A HG13 7  
ATOM 10888 H HG21 . ILE A 1 91  ? 3.734   -5.342  4.082   1.00 0.00 ? 91  ILE A HG21 7  
ATOM 10889 H HG22 . ILE A 1 91  ? 3.228   -4.509  2.613   1.00 0.00 ? 91  ILE A HG22 7  
ATOM 10890 H HG23 . ILE A 1 91  ? 3.861   -6.152  2.521   1.00 0.00 ? 91  ILE A HG23 7  
ATOM 10891 H HD11 . ILE A 1 91  ? 4.368   -1.899  4.551   1.00 0.00 ? 91  ILE A HD11 7  
ATOM 10892 H HD12 . ILE A 1 91  ? 5.163   -1.560  3.013   1.00 0.00 ? 91  ILE A HD12 7  
ATOM 10893 H HD13 . ILE A 1 91  ? 3.778   -2.651  3.069   1.00 0.00 ? 91  ILE A HD13 7  
ATOM 10894 N N    . ASP A 1 92  ? 5.435   -7.706  2.001   1.00 0.00 ? 92  ASP A N    7  
ATOM 10895 C CA   . ASP A 1 92  ? 5.283   -8.703  0.949   1.00 0.00 ? 92  ASP A CA   7  
ATOM 10896 C C    . ASP A 1 92  ? 3.975   -8.498  0.190   1.00 0.00 ? 92  ASP A C    7  
ATOM 10897 O O    . ASP A 1 92  ? 2.893   -8.540  0.775   1.00 0.00 ? 92  ASP A O    7  
ATOM 10898 C CB   . ASP A 1 92  ? 5.326   -10.112 1.542   1.00 0.00 ? 92  ASP A CB   7  
ATOM 10899 C CG   . ASP A 1 92  ? 5.781   -11.151 0.536   1.00 0.00 ? 92  ASP A CG   7  
ATOM 10900 O OD1  . ASP A 1 92  ? 6.913   -11.025 0.023   1.00 0.00 ? 92  ASP A OD1  7  
ATOM 10901 O OD2  . ASP A 1 92  ? 5.006   -12.090 0.262   1.00 0.00 ? 92  ASP A OD2  7  
ATOM 10902 H H    . ASP A 1 92  ? 4.853   -7.749  2.789   1.00 0.00 ? 92  ASP A H    7  
ATOM 10903 H HA   . ASP A 1 92  ? 6.106   -8.587  0.260   1.00 0.00 ? 92  ASP A HA   7  
ATOM 10904 H HB2  . ASP A 1 92  ? 6.012   -10.123 2.377   1.00 0.00 ? 92  ASP A HB2  7  
ATOM 10905 H HB3  . ASP A 1 92  ? 4.339   -10.381 1.889   1.00 0.00 ? 92  ASP A HB3  7  
ATOM 10906 N N    . VAL A 1 93  ? 4.084   -8.275  -1.116  1.00 0.00 ? 93  VAL A N    7  
ATOM 10907 C CA   . VAL A 1 93  ? 2.911   -8.063  -1.955  1.00 0.00 ? 93  VAL A CA   7  
ATOM 10908 C C    . VAL A 1 93  ? 3.049   -8.792  -3.287  1.00 0.00 ? 93  VAL A C    7  
ATOM 10909 O O    . VAL A 1 93  ? 4.153   -9.143  -3.704  1.00 0.00 ? 93  VAL A O    7  
ATOM 10910 C CB   . VAL A 1 93  ? 2.677   -6.565  -2.225  1.00 0.00 ? 93  VAL A CB   7  
ATOM 10911 C CG1  . VAL A 1 93  ? 1.437   -6.363  -3.082  1.00 0.00 ? 93  VAL A CG1  7  
ATOM 10912 C CG2  . VAL A 1 93  ? 2.560   -5.800  -0.915  1.00 0.00 ? 93  VAL A CG2  7  
ATOM 10913 H H    . VAL A 1 93  ? 4.974   -8.254  -1.525  1.00 0.00 ? 93  VAL A H    7  
ATOM 10914 H HA   . VAL A 1 93  ? 2.050   -8.451  -1.431  1.00 0.00 ? 93  VAL A HA   7  
ATOM 10915 H HB   . VAL A 1 93  ? 3.528   -6.180  -2.767  1.00 0.00 ? 93  VAL A HB   7  
ATOM 10916 H HG11 . VAL A 1 93  ? 0.663   -7.045  -2.761  1.00 0.00 ? 93  VAL A HG11 7  
ATOM 10917 H HG12 . VAL A 1 93  ? 1.088   -5.346  -2.979  1.00 0.00 ? 93  VAL A HG12 7  
ATOM 10918 H HG13 . VAL A 1 93  ? 1.679   -6.557  -4.117  1.00 0.00 ? 93  VAL A HG13 7  
ATOM 10919 H HG21 . VAL A 1 93  ? 1.951   -4.921  -1.066  1.00 0.00 ? 93  VAL A HG21 7  
ATOM 10920 H HG22 . VAL A 1 93  ? 2.101   -6.432  -0.169  1.00 0.00 ? 93  VAL A HG22 7  
ATOM 10921 H HG23 . VAL A 1 93  ? 3.543   -5.505  -0.581  1.00 0.00 ? 93  VAL A HG23 7  
ATOM 10922 N N    . PHE A 1 94  ? 1.920   -9.018  -3.952  1.00 0.00 ? 94  PHE A N    7  
ATOM 10923 C CA   . PHE A 1 94  ? 1.914   -9.706  -5.237  1.00 0.00 ? 94  PHE A CA   7  
ATOM 10924 C C    . PHE A 1 94  ? 1.221   -8.862  -6.303  1.00 0.00 ? 94  PHE A C    7  
ATOM 10925 O O    . PHE A 1 94  ? 0.004   -8.685  -6.274  1.00 0.00 ? 94  PHE A O    7  
ATOM 10926 C CB   . PHE A 1 94  ? 1.216   -11.062 -5.110  1.00 0.00 ? 94  PHE A CB   7  
ATOM 10927 C CG   . PHE A 1 94  ? 1.653   -11.851 -3.909  1.00 0.00 ? 94  PHE A CG   7  
ATOM 10928 C CD1  . PHE A 1 94  ? 1.230   -11.495 -2.639  1.00 0.00 ? 94  PHE A CD1  7  
ATOM 10929 C CD2  . PHE A 1 94  ? 2.486   -12.949 -4.051  1.00 0.00 ? 94  PHE A CD2  7  
ATOM 10930 C CE1  . PHE A 1 94  ? 1.631   -12.219 -1.532  1.00 0.00 ? 94  PHE A CE1  7  
ATOM 10931 C CE2  . PHE A 1 94  ? 2.890   -13.677 -2.948  1.00 0.00 ? 94  PHE A CE2  7  
ATOM 10932 C CZ   . PHE A 1 94  ? 2.461   -13.312 -1.687  1.00 0.00 ? 94  PHE A CZ   7  
ATOM 10933 H H    . PHE A 1 94  ? 1.071   -8.714  -3.568  1.00 0.00 ? 94  PHE A H    7  
ATOM 10934 H HA   . PHE A 1 94  ? 2.940   -9.865  -5.532  1.00 0.00 ? 94  PHE A HA   7  
ATOM 10935 H HB2  . PHE A 1 94  ? 0.151   -10.904 -5.034  1.00 0.00 ? 94  PHE A HB2  7  
ATOM 10936 H HB3  . PHE A 1 94  ? 1.427   -11.650 -5.990  1.00 0.00 ? 94  PHE A HB3  7  
ATOM 10937 H HD1  . PHE A 1 94  ? 0.580   -10.641 -2.516  1.00 0.00 ? 94  PHE A HD1  7  
ATOM 10938 H HD2  . PHE A 1 94  ? 2.822   -13.236 -5.038  1.00 0.00 ? 94  PHE A HD2  7  
ATOM 10939 H HE1  . PHE A 1 94  ? 1.294   -11.932 -0.547  1.00 0.00 ? 94  PHE A HE1  7  
ATOM 10940 H HE2  . PHE A 1 94  ? 3.540   -14.531 -3.072  1.00 0.00 ? 94  PHE A HE2  7  
ATOM 10941 H HZ   . PHE A 1 94  ? 2.776   -13.879 -0.823  1.00 0.00 ? 94  PHE A HZ   7  
ATOM 10942 N N    . GLN A 1 95  ? 2.007   -8.344  -7.242  1.00 0.00 ? 95  GLN A N    7  
ATOM 10943 C CA   . GLN A 1 95  ? 1.469   -7.518  -8.316  1.00 0.00 ? 95  GLN A CA   7  
ATOM 10944 C C    . GLN A 1 95  ? 1.112   -8.369  -9.531  1.00 0.00 ? 95  GLN A C    7  
ATOM 10945 O O    . GLN A 1 95  ? 1.990   -8.809  -10.271 1.00 0.00 ? 95  GLN A O    7  
ATOM 10946 C CB   . GLN A 1 95  ? 2.479   -6.440  -8.713  1.00 0.00 ? 95  GLN A CB   7  
ATOM 10947 C CG   . GLN A 1 95  ? 2.367   -5.168  -7.888  1.00 0.00 ? 95  GLN A CG   7  
ATOM 10948 C CD   . GLN A 1 95  ? 2.951   -3.961  -8.595  1.00 0.00 ? 95  GLN A CD   7  
ATOM 10949 O OE1  . GLN A 1 95  ? 2.874   -3.845  -9.818  1.00 0.00 ? 95  GLN A OE1  7  
ATOM 10950 N NE2  . GLN A 1 95  ? 3.541   -3.052  -7.826  1.00 0.00 ? 95  GLN A NE2  7  
ATOM 10951 H H    . GLN A 1 95  ? 2.969   -8.521  -7.211  1.00 0.00 ? 95  GLN A H    7  
ATOM 10952 H HA   . GLN A 1 95  ? 0.572   -7.041  -7.950  1.00 0.00 ? 95  GLN A HA   7  
ATOM 10953 H HB2  . GLN A 1 95  ? 3.476   -6.836  -8.592  1.00 0.00 ? 95  GLN A HB2  7  
ATOM 10954 H HB3  . GLN A 1 95  ? 2.325   -6.184  -9.751  1.00 0.00 ? 95  GLN A HB3  7  
ATOM 10955 H HG2  . GLN A 1 95  ? 1.324   -4.976  -7.685  1.00 0.00 ? 95  GLN A HG2  7  
ATOM 10956 H HG3  . GLN A 1 95  ? 2.894   -5.311  -6.956  1.00 0.00 ? 95  GLN A HG3  7  
ATOM 10957 H HE21 . GLN A 1 95  ? 3.566   -3.211  -6.859  1.00 0.00 ? 95  GLN A HE21 7  
ATOM 10958 H HE22 . GLN A 1 95  ? 3.928   -2.262  -8.257  1.00 0.00 ? 95  GLN A HE22 7  
ATOM 10959 N N    . GLN A 1 96  ? -0.183  -8.596  -9.727  1.00 0.00 ? 96  GLN A N    7  
ATOM 10960 C CA   . GLN A 1 96  ? -0.656  -9.395  -10.852 1.00 0.00 ? 96  GLN A CA   7  
ATOM 10961 C C    . GLN A 1 96  ? -0.579  -8.603  -12.153 1.00 0.00 ? 96  GLN A C    7  
ATOM 10962 O O    . GLN A 1 96  ? -1.322  -7.642  -12.349 1.00 0.00 ? 96  GLN A O    7  
ATOM 10963 C CB   . GLN A 1 96  ? -2.092  -9.859  -10.607 1.00 0.00 ? 96  GLN A CB   7  
ATOM 10964 C CG   . GLN A 1 96  ? -2.186  -11.190 -9.878  1.00 0.00 ? 96  GLN A CG   7  
ATOM 10965 C CD   . GLN A 1 96  ? -3.595  -11.750 -9.864  1.00 0.00 ? 96  GLN A CD   7  
ATOM 10966 O OE1  . GLN A 1 96  ? -4.316  -11.624 -8.874  1.00 0.00 ? 96  GLN A OE1  7  
ATOM 10967 N NE2  . GLN A 1 96  ? -3.995  -12.374 -10.967 1.00 0.00 ? 96  GLN A NE2  7  
ATOM 10968 H H    . GLN A 1 96  ? -0.835  -8.218  -9.102  1.00 0.00 ? 96  GLN A H    7  
ATOM 10969 H HA   . GLN A 1 96  ? -0.017  -10.261 -10.934 1.00 0.00 ? 96  GLN A HA   7  
ATOM 10970 H HB2  . GLN A 1 96  ? -2.603  -9.113  -10.017 1.00 0.00 ? 96  GLN A HB2  7  
ATOM 10971 H HB3  . GLN A 1 96  ? -2.593  -9.959  -11.558 1.00 0.00 ? 96  GLN A HB3  7  
ATOM 10972 H HG2  . GLN A 1 96  ? -1.538  -11.901 -10.368 1.00 0.00 ? 96  GLN A HG2  7  
ATOM 10973 H HG3  . GLN A 1 96  ? -1.860  -11.051 -8.858  1.00 0.00 ? 96  GLN A HG3  7  
ATOM 10974 H HE21 . GLN A 1 96  ? -3.365  -12.437 -11.716 1.00 0.00 ? 96  GLN A HE21 7  
ATOM 10975 H HE22 . GLN A 1 96  ? -4.900  -12.746 -10.985 1.00 0.00 ? 96  GLN A HE22 7  
ATOM 10976 N N    . GLN A 1 97  ? 0.323   -9.014  -13.038 1.00 0.00 ? 97  GLN A N    7  
ATOM 10977 C CA   . GLN A 1 97  ? 0.496   -8.341  -14.320 1.00 0.00 ? 97  GLN A CA   7  
ATOM 10978 C C    . GLN A 1 97  ? -0.591  -8.758  -15.304 1.00 0.00 ? 97  GLN A C    7  
ATOM 10979 O O    . GLN A 1 97  ? -0.390  -9.653  -16.126 1.00 0.00 ? 97  GLN A O    7  
ATOM 10980 C CB   . GLN A 1 97  ? 1.876   -8.654  -14.902 1.00 0.00 ? 97  GLN A CB   7  
ATOM 10981 C CG   . GLN A 1 97  ? 2.081   -8.112  -16.307 1.00 0.00 ? 97  GLN A CG   7  
ATOM 10982 C CD   . GLN A 1 97  ? 3.354   -8.625  -16.951 1.00 0.00 ? 97  GLN A CD   7  
ATOM 10983 O OE1  . GLN A 1 97  ? 4.344   -8.890  -16.269 1.00 0.00 ? 97  GLN A OE1  7  
ATOM 10984 N NE2  . GLN A 1 97  ? 3.334   -8.768  -18.271 1.00 0.00 ? 97  GLN A NE2  7  
ATOM 10985 H H    . GLN A 1 97  ? 0.886   -9.786  -12.823 1.00 0.00 ? 97  GLN A H    7  
ATOM 10986 H HA   . GLN A 1 97  ? 0.421   -7.278  -14.149 1.00 0.00 ? 97  GLN A HA   7  
ATOM 10987 H HB2  . GLN A 1 97  ? 2.630   -8.225  -14.260 1.00 0.00 ? 97  GLN A HB2  7  
ATOM 10988 H HB3  . GLN A 1 97  ? 2.006   -9.726  -14.930 1.00 0.00 ? 97  GLN A HB3  7  
ATOM 10989 H HG2  . GLN A 1 97  ? 1.242   -8.409  -16.920 1.00 0.00 ? 97  GLN A HG2  7  
ATOM 10990 H HG3  . GLN A 1 97  ? 2.127   -7.034  -16.260 1.00 0.00 ? 97  GLN A HG3  7  
ATOM 10991 H HE21 . GLN A 1 97  ? 2.510   -8.536  -18.749 1.00 0.00 ? 97  GLN A HE21 7  
ATOM 10992 H HE22 . GLN A 1 97  ? 4.144   -9.097  -18.713 1.00 0.00 ? 97  GLN A HE22 7  
ATOM 10993 N N    . THR A 1 98  ? -1.745  -8.103  -15.217 1.00 0.00 ? 98  THR A N    7  
ATOM 10994 C CA   . THR A 1 98  ? -2.865  -8.406  -16.099 1.00 0.00 ? 98  THR A CA   7  
ATOM 10995 C C    . THR A 1 98  ? -2.609  -7.890  -17.510 1.00 0.00 ? 98  THR A C    7  
ATOM 10996 O O    . THR A 1 98  ? -2.002  -6.835  -17.695 1.00 0.00 ? 98  THR A O    7  
ATOM 10997 C CB   . THR A 1 98  ? -4.177  -7.796  -15.571 1.00 0.00 ? 98  THR A CB   7  
ATOM 10998 O OG1  . THR A 1 98  ? -5.276  -8.216  -16.387 1.00 0.00 ? 98  THR A OG1  7  
ATOM 10999 C CG2  . THR A 1 98  ? -4.100  -6.277  -15.557 1.00 0.00 ? 98  THR A CG2  7  
ATOM 11000 H H    . THR A 1 98  ? -1.844  -7.400  -14.542 1.00 0.00 ? 98  THR A H    7  
ATOM 11001 H HA   . THR A 1 98  ? -2.980  -9.480  -16.134 1.00 0.00 ? 98  THR A HA   7  
ATOM 11002 H HB   . THR A 1 98  ? -4.336  -8.143  -14.560 1.00 0.00 ? 98  THR A HB   7  
ATOM 11003 H HG1  . THR A 1 98  ? -5.939  -8.641  -15.838 1.00 0.00 ? 98  THR A HG1  7  
ATOM 11004 H HG21 . THR A 1 98  ? -3.282  -5.963  -14.925 1.00 0.00 ? 98  THR A HG21 7  
ATOM 11005 H HG22 . THR A 1 98  ? -5.026  -5.873  -15.175 1.00 0.00 ? 98  THR A HG22 7  
ATOM 11006 H HG23 . THR A 1 98  ? -3.937  -5.916  -16.562 1.00 0.00 ? 98  THR A HG23 7  
ATOM 11007 N N    . SER A 1 99  ? -3.076  -8.640  -18.503 1.00 0.00 ? 99  SER A N    7  
ATOM 11008 C CA   . SER A 1 99  ? -2.894  -8.258  -19.899 1.00 0.00 ? 99  SER A CA   7  
ATOM 11009 C C    . SER A 1 99  ? -4.229  -8.251  -20.638 1.00 0.00 ? 99  SER A C    7  
ATOM 11010 O O    . SER A 1 99  ? -4.774  -9.304  -20.969 1.00 0.00 ? 99  SER A O    7  
ATOM 11011 C CB   . SER A 1 99  ? -1.922  -9.216  -20.589 1.00 0.00 ? 99  SER A CB   7  
ATOM 11012 O OG   . SER A 1 99  ? -0.666  -9.230  -19.932 1.00 0.00 ? 99  SER A OG   7  
ATOM 11013 H H    . SER A 1 99  ? -3.551  -9.470  -18.292 1.00 0.00 ? 99  SER A H    7  
ATOM 11014 H HA   . SER A 1 99  ? -2.480  -7.261  -19.919 1.00 0.00 ? 99  SER A HA   7  
ATOM 11015 H HB2  . SER A 1 99  ? -2.332  -10.214 -20.575 1.00 0.00 ? 99  SER A HB2  7  
ATOM 11016 H HB3  . SER A 1 99  ? -1.776  -8.901  -21.612 1.00 0.00 ? 99  SER A HB3  7  
ATOM 11017 H HG   . SER A 1 99  ? -0.803  -9.269  -18.982 1.00 0.00 ? 99  SER A HG   7  
ATOM 11018 N N    . GLY A 1 100 ? -4.751  -7.055  -20.893 1.00 0.00 ? 100 GLY A N    7  
ATOM 11019 C CA   . GLY A 1 100 ? -6.018  -6.932  -21.591 1.00 0.00 ? 100 GLY A CA   7  
ATOM 11020 C C    . GLY A 1 100 ? -6.511  -5.500  -21.648 1.00 0.00 ? 100 GLY A C    7  
ATOM 11021 O O    . GLY A 1 100 ? -6.163  -4.667  -20.811 1.00 0.00 ? 100 GLY A O    7  
ATOM 11022 H H    . GLY A 1 100 ? -4.272  -6.250  -20.605 1.00 0.00 ? 100 GLY A H    7  
ATOM 11023 H HA2  . GLY A 1 100 ? -5.899  -7.301  -22.598 1.00 0.00 ? 100 GLY A HA2  7  
ATOM 11024 H HA3  . GLY A 1 100 ? -6.756  -7.535  -21.082 1.00 0.00 ? 100 GLY A HA3  7  
ATOM 11025 N N    . PRO A 1 101 ? -7.341  -5.196  -22.657 1.00 0.00 ? 101 PRO A N    7  
ATOM 11026 C CA   . PRO A 1 101 ? -7.900  -3.854  -22.845 1.00 0.00 ? 101 PRO A CA   7  
ATOM 11027 C C    . PRO A 1 101 ? -8.918  -3.494  -21.768 1.00 0.00 ? 101 PRO A C    7  
ATOM 11028 O O    . PRO A 1 101 ? -9.831  -4.268  -21.480 1.00 0.00 ? 101 PRO A O    7  
ATOM 11029 C CB   . PRO A 1 101 ? -8.578  -3.940  -24.215 1.00 0.00 ? 101 PRO A CB   7  
ATOM 11030 C CG   . PRO A 1 101 ? -8.897  -5.385  -24.388 1.00 0.00 ? 101 PRO A CG   7  
ATOM 11031 C CD   . PRO A 1 101 ? -7.799  -6.139  -23.691 1.00 0.00 ? 101 PRO A CD   7  
ATOM 11032 H HA   . PRO A 1 101 ? -7.125  -3.101  -22.871 1.00 0.00 ? 101 PRO A HA   7  
ATOM 11033 H HB2  . PRO A 1 101 ? -9.473  -3.334  -24.215 1.00 0.00 ? 101 PRO A HB2  7  
ATOM 11034 H HB3  . PRO A 1 101 ? -7.899  -3.591  -24.979 1.00 0.00 ? 101 PRO A HB3  7  
ATOM 11035 H HG2  . PRO A 1 101 ? -9.851  -5.608  -23.935 1.00 0.00 ? 101 PRO A HG2  7  
ATOM 11036 H HG3  . PRO A 1 101 ? -8.912  -5.633  -25.439 1.00 0.00 ? 101 PRO A HG3  7  
ATOM 11037 H HD2  . PRO A 1 101 ? -8.186  -7.043  -23.245 1.00 0.00 ? 101 PRO A HD2  7  
ATOM 11038 H HD3  . PRO A 1 101 ? -7.001  -6.369  -24.382 1.00 0.00 ? 101 PRO A HD3  7  
ATOM 11039 N N    . SER A 1 102 ? -8.757  -2.314  -21.178 1.00 0.00 ? 102 SER A N    7  
ATOM 11040 C CA   . SER A 1 102 ? -9.660  -1.853  -20.131 1.00 0.00 ? 102 SER A CA   7  
ATOM 11041 C C    . SER A 1 102 ? -10.998 -1.418  -20.721 1.00 0.00 ? 102 SER A C    7  
ATOM 11042 O O    . SER A 1 102 ? -11.048 -0.784  -21.775 1.00 0.00 ? 102 SER A O    7  
ATOM 11043 C CB   . SER A 1 102 ? -9.030  -0.693  -19.357 1.00 0.00 ? 102 SER A CB   7  
ATOM 11044 O OG   . SER A 1 102 ? -9.913  -0.202  -18.364 1.00 0.00 ? 102 SER A OG   7  
ATOM 11045 H H    . SER A 1 102 ? -8.010  -1.741  -21.452 1.00 0.00 ? 102 SER A H    7  
ATOM 11046 H HA   . SER A 1 102 ? -9.830  -2.676  -19.453 1.00 0.00 ? 102 SER A HA   7  
ATOM 11047 H HB2  . SER A 1 102 ? -8.124  -1.033  -18.879 1.00 0.00 ? 102 SER A HB2  7  
ATOM 11048 H HB3  . SER A 1 102 ? -8.797  0.108   -20.043 1.00 0.00 ? 102 SER A HB3  7  
ATOM 11049 H HG   . SER A 1 102 ? -10.440 -0.926  -18.018 1.00 0.00 ? 102 SER A HG   7  
ATOM 11050 N N    . SER A 1 103 ? -12.082 -1.763  -20.032 1.00 0.00 ? 103 SER A N    7  
ATOM 11051 C CA   . SER A 1 103 ? -13.422 -1.412  -20.489 1.00 0.00 ? 103 SER A CA   7  
ATOM 11052 C C    . SER A 1 103 ? -14.112 -0.490  -19.489 1.00 0.00 ? 103 SER A C    7  
ATOM 11053 O O    . SER A 1 103 ? -15.299 -0.642  -19.204 1.00 0.00 ? 103 SER A O    7  
ATOM 11054 C CB   . SER A 1 103 ? -14.259 -2.675  -20.698 1.00 0.00 ? 103 SER A CB   7  
ATOM 11055 O OG   . SER A 1 103 ? -13.692 -3.504  -21.698 1.00 0.00 ? 103 SER A OG   7  
ATOM 11056 H H    . SER A 1 103 ? -11.977 -2.268  -19.199 1.00 0.00 ? 103 SER A H    7  
ATOM 11057 H HA   . SER A 1 103 ? -13.325 -0.894  -21.431 1.00 0.00 ? 103 SER A HA   7  
ATOM 11058 H HB2  . SER A 1 103 ? -14.307 -3.229  -19.773 1.00 0.00 ? 103 SER A HB2  7  
ATOM 11059 H HB3  . SER A 1 103 ? -15.257 -2.395  -21.003 1.00 0.00 ? 103 SER A HB3  7  
ATOM 11060 H HG   . SER A 1 103 ? -12.744 -3.355  -21.737 1.00 0.00 ? 103 SER A HG   7  
ATOM 11061 N N    . GLY A 1 104 ? -13.358 0.468   -18.958 1.00 0.00 ? 104 GLY A N    7  
ATOM 11062 C CA   . GLY A 1 104 ? -13.914 1.401   -17.995 1.00 0.00 ? 104 GLY A CA   7  
ATOM 11063 C C    . GLY A 1 104 ? -13.505 2.834   -18.274 1.00 0.00 ? 104 GLY A C    7  
ATOM 11064 O O    . GLY A 1 104 ? -14.338 3.740   -18.252 1.00 0.00 ? 104 GLY A O    7  
ATOM 11065 H H    . GLY A 1 104 ? -12.417 0.542   -19.223 1.00 0.00 ? 104 GLY A H    7  
ATOM 11066 H HA2  . GLY A 1 104 ? -14.991 1.333   -18.024 1.00 0.00 ? 104 GLY A HA2  7  
ATOM 11067 H HA3  . GLY A 1 104 ? -13.572 1.128   -17.008 1.00 0.00 ? 104 GLY A HA3  7  
ATOM 11068 N N    . GLY A 1 1   ? 32.774  16.133  -22.726 1.00 0.00 ? 1   GLY A N    8  
ATOM 11069 C CA   . GLY A 1 1   ? 32.932  14.939  -21.916 1.00 0.00 ? 1   GLY A CA   8  
ATOM 11070 C C    . GLY A 1 1   ? 31.604  14.366  -21.464 1.00 0.00 ? 1   GLY A C    8  
ATOM 11071 O O    . GLY A 1 1   ? 30.804  15.057  -20.834 1.00 0.00 ? 1   GLY A O    8  
ATOM 11072 H H1   . GLY A 1 1   ? 32.451  16.058  -23.648 1.00 0.00 ? 1   GLY A H1   8  
ATOM 11073 H HA2  . GLY A 1 1   ? 33.457  14.193  -22.493 1.00 0.00 ? 1   GLY A HA2  8  
ATOM 11074 H HA3  . GLY A 1 1   ? 33.520  15.185  -21.044 1.00 0.00 ? 1   GLY A HA3  8  
ATOM 11075 N N    . SER A 1 2   ? 31.368  13.098  -21.787 1.00 0.00 ? 2   SER A N    8  
ATOM 11076 C CA   . SER A 1 2   ? 30.124  12.433  -21.415 1.00 0.00 ? 2   SER A CA   8  
ATOM 11077 C C    . SER A 1 2   ? 30.401  11.211  -20.544 1.00 0.00 ? 2   SER A C    8  
ATOM 11078 O O    . SER A 1 2   ? 30.668  10.122  -21.051 1.00 0.00 ? 2   SER A O    8  
ATOM 11079 C CB   . SER A 1 2   ? 29.350  12.017  -22.667 1.00 0.00 ? 2   SER A CB   8  
ATOM 11080 O OG   . SER A 1 2   ? 28.010  11.682  -22.349 1.00 0.00 ? 2   SER A OG   8  
ATOM 11081 H H    . SER A 1 2   ? 32.045  12.599  -22.291 1.00 0.00 ? 2   SER A H    8  
ATOM 11082 H HA   . SER A 1 2   ? 29.529  13.136  -20.851 1.00 0.00 ? 2   SER A HA   8  
ATOM 11083 H HB2  . SER A 1 2   ? 29.346  12.833  -23.373 1.00 0.00 ? 2   SER A HB2  8  
ATOM 11084 H HB3  . SER A 1 2   ? 29.827  11.156  -23.112 1.00 0.00 ? 2   SER A HB3  8  
ATOM 11085 H HG   . SER A 1 2   ? 27.762  10.877  -22.811 1.00 0.00 ? 2   SER A HG   8  
ATOM 11086 N N    . SER A 1 3   ? 30.336  11.402  -19.230 1.00 0.00 ? 3   SER A N    8  
ATOM 11087 C CA   . SER A 1 3   ? 30.583  10.317  -18.287 1.00 0.00 ? 3   SER A CA   8  
ATOM 11088 C C    . SER A 1 3   ? 29.460  9.286   -18.339 1.00 0.00 ? 3   SER A C    8  
ATOM 11089 O O    . SER A 1 3   ? 29.630  8.144   -17.914 1.00 0.00 ? 3   SER A O    8  
ATOM 11090 C CB   . SER A 1 3   ? 30.719  10.869  -16.867 1.00 0.00 ? 3   SER A CB   8  
ATOM 11091 O OG   . SER A 1 3   ? 29.544  11.557  -16.472 1.00 0.00 ? 3   SER A OG   8  
ATOM 11092 H H    . SER A 1 3   ? 30.118  12.294  -18.887 1.00 0.00 ? 3   SER A H    8  
ATOM 11093 H HA   . SER A 1 3   ? 31.509  9.838   -18.569 1.00 0.00 ? 3   SER A HA   8  
ATOM 11094 H HB2  . SER A 1 3   ? 30.891  10.053  -16.182 1.00 0.00 ? 3   SER A HB2  8  
ATOM 11095 H HB3  . SER A 1 3   ? 31.553  11.555  -16.829 1.00 0.00 ? 3   SER A HB3  8  
ATOM 11096 H HG   . SER A 1 3   ? 29.216  12.079  -17.208 1.00 0.00 ? 3   SER A HG   8  
ATOM 11097 N N    . GLY A 1 4   ? 28.310  9.698   -18.864 1.00 0.00 ? 4   GLY A N    8  
ATOM 11098 C CA   . GLY A 1 4   ? 27.175  8.799   -18.962 1.00 0.00 ? 4   GLY A CA   8  
ATOM 11099 C C    . GLY A 1 4   ? 26.716  8.598   -20.393 1.00 0.00 ? 4   GLY A C    8  
ATOM 11100 O O    . GLY A 1 4   ? 26.020  9.445   -20.954 1.00 0.00 ? 4   GLY A O    8  
ATOM 11101 H H    . GLY A 1 4   ? 28.231  10.620  -19.188 1.00 0.00 ? 4   GLY A H    8  
ATOM 11102 H HA2  . GLY A 1 4   ? 27.450  7.842   -18.546 1.00 0.00 ? 4   GLY A HA2  8  
ATOM 11103 H HA3  . GLY A 1 4   ? 26.356  9.208   -18.389 1.00 0.00 ? 4   GLY A HA3  8  
ATOM 11104 N N    . SER A 1 5   ? 27.109  7.476   -20.986 1.00 0.00 ? 5   SER A N    8  
ATOM 11105 C CA   . SER A 1 5   ? 26.738  7.169   -22.363 1.00 0.00 ? 5   SER A CA   8  
ATOM 11106 C C    . SER A 1 5   ? 25.248  6.858   -22.468 1.00 0.00 ? 5   SER A C    8  
ATOM 11107 O O    . SER A 1 5   ? 24.486  7.615   -23.068 1.00 0.00 ? 5   SER A O    8  
ATOM 11108 C CB   . SER A 1 5   ? 27.556  5.984   -22.881 1.00 0.00 ? 5   SER A CB   8  
ATOM 11109 O OG   . SER A 1 5   ? 28.944  6.268   -22.846 1.00 0.00 ? 5   SER A OG   8  
ATOM 11110 H H    . SER A 1 5   ? 27.663  6.840   -20.487 1.00 0.00 ? 5   SER A H    8  
ATOM 11111 H HA   . SER A 1 5   ? 26.956  8.037   -22.967 1.00 0.00 ? 5   SER A HA   8  
ATOM 11112 H HB2  . SER A 1 5   ? 27.362  5.119   -22.266 1.00 0.00 ? 5   SER A HB2  8  
ATOM 11113 H HB3  . SER A 1 5   ? 27.270  5.771   -23.901 1.00 0.00 ? 5   SER A HB3  8  
ATOM 11114 H HG   . SER A 1 5   ? 29.424  5.578   -23.310 1.00 0.00 ? 5   SER A HG   8  
ATOM 11115 N N    . SER A 1 6   ? 24.841  5.737   -21.880 1.00 0.00 ? 6   SER A N    8  
ATOM 11116 C CA   . SER A 1 6   ? 23.444  5.323   -21.910 1.00 0.00 ? 6   SER A CA   8  
ATOM 11117 C C    . SER A 1 6   ? 22.999  4.811   -20.543 1.00 0.00 ? 6   SER A C    8  
ATOM 11118 O O    . SER A 1 6   ? 23.806  4.683   -19.623 1.00 0.00 ? 6   SER A O    8  
ATOM 11119 C CB   . SER A 1 6   ? 23.235  4.236   -22.967 1.00 0.00 ? 6   SER A CB   8  
ATOM 11120 O OG   . SER A 1 6   ? 23.616  4.694   -24.252 1.00 0.00 ? 6   SER A OG   8  
ATOM 11121 H H    . SER A 1 6   ? 25.497  5.175   -21.417 1.00 0.00 ? 6   SER A H    8  
ATOM 11122 H HA   . SER A 1 6   ? 22.848  6.185   -22.170 1.00 0.00 ? 6   SER A HA   8  
ATOM 11123 H HB2  . SER A 1 6   ? 23.831  3.373   -22.714 1.00 0.00 ? 6   SER A HB2  8  
ATOM 11124 H HB3  . SER A 1 6   ? 22.191  3.958   -22.991 1.00 0.00 ? 6   SER A HB3  8  
ATOM 11125 H HG   . SER A 1 6   ? 24.223  5.432   -24.162 1.00 0.00 ? 6   SER A HG   8  
ATOM 11126 N N    . GLY A 1 7   ? 21.708  4.520   -20.418 1.00 0.00 ? 7   GLY A N    8  
ATOM 11127 C CA   . GLY A 1 7   ? 21.177  4.026   -19.161 1.00 0.00 ? 7   GLY A CA   8  
ATOM 11128 C C    . GLY A 1 7   ? 20.674  5.141   -18.266 1.00 0.00 ? 7   GLY A C    8  
ATOM 11129 O O    . GLY A 1 7   ? 20.921  5.138   -17.061 1.00 0.00 ? 7   GLY A O    8  
ATOM 11130 H H    . GLY A 1 7   ? 21.111  4.642   -21.186 1.00 0.00 ? 7   GLY A H    8  
ATOM 11131 H HA2  . GLY A 1 7   ? 20.362  3.349   -19.368 1.00 0.00 ? 7   GLY A HA2  8  
ATOM 11132 H HA3  . GLY A 1 7   ? 21.956  3.487   -18.642 1.00 0.00 ? 7   GLY A HA3  8  
ATOM 11133 N N    . MET A 1 8   ? 19.968  6.099   -18.857 1.00 0.00 ? 8   MET A N    8  
ATOM 11134 C CA   . MET A 1 8   ? 19.429  7.227   -18.105 1.00 0.00 ? 8   MET A CA   8  
ATOM 11135 C C    . MET A 1 8   ? 17.916  7.108   -17.957 1.00 0.00 ? 8   MET A C    8  
ATOM 11136 O O    . MET A 1 8   ? 17.222  6.696   -18.886 1.00 0.00 ? 8   MET A O    8  
ATOM 11137 C CB   . MET A 1 8   ? 19.784  8.545   -18.795 1.00 0.00 ? 8   MET A CB   8  
ATOM 11138 C CG   . MET A 1 8   ? 19.480  9.773   -17.953 1.00 0.00 ? 8   MET A CG   8  
ATOM 11139 S SD   . MET A 1 8   ? 20.653  9.996   -16.602 1.00 0.00 ? 8   MET A SD   8  
ATOM 11140 C CE   . MET A 1 8   ? 19.575  10.623  -15.317 1.00 0.00 ? 8   MET A CE   8  
ATOM 11141 H H    . MET A 1 8   ? 19.804  6.048   -19.822 1.00 0.00 ? 8   MET A H    8  
ATOM 11142 H HA   . MET A 1 8   ? 19.877  7.213   -17.123 1.00 0.00 ? 8   MET A HA   8  
ATOM 11143 H HB2  . MET A 1 8   ? 20.839  8.544   -19.025 1.00 0.00 ? 8   MET A HB2  8  
ATOM 11144 H HB3  . MET A 1 8   ? 19.224  8.618   -19.715 1.00 0.00 ? 8   MET A HB3  8  
ATOM 11145 H HG2  . MET A 1 8   ? 19.515  10.646  -18.587 1.00 0.00 ? 8   MET A HG2  8  
ATOM 11146 H HG3  . MET A 1 8   ? 18.489  9.671   -17.538 1.00 0.00 ? 8   MET A HG3  8  
ATOM 11147 H HE1  . MET A 1 8   ? 18.557  10.329  -15.526 1.00 0.00 ? 8   MET A HE1  8  
ATOM 11148 H HE2  . MET A 1 8   ? 19.878  10.219  -14.363 1.00 0.00 ? 8   MET A HE2  8  
ATOM 11149 H HE3  . MET A 1 8   ? 19.639  11.702  -15.288 1.00 0.00 ? 8   MET A HE3  8  
ATOM 11150 N N    . ALA A 1 9   ? 17.410  7.471   -16.783 1.00 0.00 ? 9   ALA A N    8  
ATOM 11151 C CA   . ALA A 1 9   ? 15.979  7.407   -16.514 1.00 0.00 ? 9   ALA A CA   8  
ATOM 11152 C C    . ALA A 1 9   ? 15.356  8.799   -16.524 1.00 0.00 ? 9   ALA A C    8  
ATOM 11153 O O    . ALA A 1 9   ? 14.470  9.087   -17.329 1.00 0.00 ? 9   ALA A O    8  
ATOM 11154 C CB   . ALA A 1 9   ? 15.722  6.721   -15.181 1.00 0.00 ? 9   ALA A CB   8  
ATOM 11155 H H    . ALA A 1 9   ? 18.014  7.791   -16.081 1.00 0.00 ? 9   ALA A H    8  
ATOM 11156 H HA   . ALA A 1 9   ? 15.520  6.813   -17.292 1.00 0.00 ? 9   ALA A HA   8  
ATOM 11157 H HB1  . ALA A 1 9   ? 15.453  7.461   -14.442 1.00 0.00 ? 9   ALA A HB1  8  
ATOM 11158 H HB2  . ALA A 1 9   ? 14.915  6.011   -15.291 1.00 0.00 ? 9   ALA A HB2  8  
ATOM 11159 H HB3  . ALA A 1 9   ? 16.616  6.204   -14.864 1.00 0.00 ? 9   ALA A HB3  8  
ATOM 11160 N N    . ASP A 1 10  ? 15.823  9.657   -15.624 1.00 0.00 ? 10  ASP A N    8  
ATOM 11161 C CA   . ASP A 1 10  ? 15.312  11.020  -15.529 1.00 0.00 ? 10  ASP A CA   8  
ATOM 11162 C C    . ASP A 1 10  ? 13.789  11.023  -15.432 1.00 0.00 ? 10  ASP A C    8  
ATOM 11163 O O    . ASP A 1 10  ? 13.119  11.834  -16.070 1.00 0.00 ? 10  ASP A O    8  
ATOM 11164 C CB   . ASP A 1 10  ? 15.759  11.841  -16.740 1.00 0.00 ? 10  ASP A CB   8  
ATOM 11165 C CG   . ASP A 1 10  ? 15.648  13.333  -16.499 1.00 0.00 ? 10  ASP A CG   8  
ATOM 11166 O OD1  . ASP A 1 10  ? 14.826  13.738  -15.652 1.00 0.00 ? 10  ASP A OD1  8  
ATOM 11167 O OD2  . ASP A 1 10  ? 16.384  14.097  -17.160 1.00 0.00 ? 10  ASP A OD2  8  
ATOM 11168 H H    . ASP A 1 10  ? 16.530  9.368   -15.010 1.00 0.00 ? 10  ASP A H    8  
ATOM 11169 H HA   . ASP A 1 10  ? 15.718  11.465  -14.634 1.00 0.00 ? 10  ASP A HA   8  
ATOM 11170 H HB2  . ASP A 1 10  ? 16.789  11.606  -16.964 1.00 0.00 ? 10  ASP A HB2  8  
ATOM 11171 H HB3  . ASP A 1 10  ? 15.142  11.584  -17.588 1.00 0.00 ? 10  ASP A HB3  8  
ATOM 11172 N N    . GLU A 1 11  ? 13.251  10.110  -14.629 1.00 0.00 ? 11  GLU A N    8  
ATOM 11173 C CA   . GLU A 1 11  ? 11.807  10.007  -14.450 1.00 0.00 ? 11  GLU A CA   8  
ATOM 11174 C C    . GLU A 1 11  ? 11.327  10.950  -13.351 1.00 0.00 ? 11  GLU A C    8  
ATOM 11175 O O    . GLU A 1 11  ? 10.455  10.601  -12.555 1.00 0.00 ? 11  GLU A O    8  
ATOM 11176 C CB   . GLU A 1 11  ? 11.414  8.568   -14.110 1.00 0.00 ? 11  GLU A CB   8  
ATOM 11177 C CG   . GLU A 1 11  ? 11.331  7.657   -15.323 1.00 0.00 ? 11  GLU A CG   8  
ATOM 11178 C CD   . GLU A 1 11  ? 10.891  6.250   -14.967 1.00 0.00 ? 11  GLU A CD   8  
ATOM 11179 O OE1  . GLU A 1 11  ? 11.385  5.712   -13.954 1.00 0.00 ? 11  GLU A OE1  8  
ATOM 11180 O OE2  . GLU A 1 11  ? 10.052  5.688   -15.702 1.00 0.00 ? 11  GLU A OE2  8  
ATOM 11181 H H    . GLU A 1 11  ? 13.838  9.491   -14.147 1.00 0.00 ? 11  GLU A H    8  
ATOM 11182 H HA   . GLU A 1 11  ? 11.337  10.288  -15.380 1.00 0.00 ? 11  GLU A HA   8  
ATOM 11183 H HB2  . GLU A 1 11  ? 12.145  8.159   -13.428 1.00 0.00 ? 11  GLU A HB2  8  
ATOM 11184 H HB3  . GLU A 1 11  ? 10.449  8.576   -13.626 1.00 0.00 ? 11  GLU A HB3  8  
ATOM 11185 H HG2  . GLU A 1 11  ? 10.621  8.073   -16.022 1.00 0.00 ? 11  GLU A HG2  8  
ATOM 11186 H HG3  . GLU A 1 11  ? 12.304  7.607   -15.788 1.00 0.00 ? 11  GLU A HG3  8  
ATOM 11187 N N    . LYS A 1 12  ? 11.902  12.147  -13.314 1.00 0.00 ? 12  LYS A N    8  
ATOM 11188 C CA   . LYS A 1 12  ? 11.534  13.143  -12.315 1.00 0.00 ? 12  LYS A CA   8  
ATOM 11189 C C    . LYS A 1 12  ? 11.880  12.658  -10.911 1.00 0.00 ? 12  LYS A C    8  
ATOM 11190 O O    . LYS A 1 12  ? 11.071  12.733  -9.985  1.00 0.00 ? 12  LYS A O    8  
ATOM 11191 C CB   . LYS A 1 12  ? 10.038  13.456  -12.404 1.00 0.00 ? 12  LYS A CB   8  
ATOM 11192 C CG   . LYS A 1 12  ? 9.602   14.602  -11.507 1.00 0.00 ? 12  LYS A CG   8  
ATOM 11193 C CD   . LYS A 1 12  ? 9.622   15.928  -12.248 1.00 0.00 ? 12  LYS A CD   8  
ATOM 11194 C CE   . LYS A 1 12  ? 10.945  16.654  -12.055 1.00 0.00 ? 12  LYS A CE   8  
ATOM 11195 N NZ   . LYS A 1 12  ? 11.117  17.132  -10.655 1.00 0.00 ? 12  LYS A NZ   8  
ATOM 11196 H H    . LYS A 1 12  ? 12.591  12.367  -13.977 1.00 0.00 ? 12  LYS A H    8  
ATOM 11197 H HA   . LYS A 1 12  ? 12.094  14.043  -12.521 1.00 0.00 ? 12  LYS A HA   8  
ATOM 11198 H HB2  . LYS A 1 12  ? 9.796   13.713  -13.424 1.00 0.00 ? 12  LYS A HB2  8  
ATOM 11199 H HB3  . LYS A 1 12  ? 9.481   12.574  -12.122 1.00 0.00 ? 12  LYS A HB3  8  
ATOM 11200 H HG2  . LYS A 1 12  ? 8.598   14.412  -11.158 1.00 0.00 ? 12  LYS A HG2  8  
ATOM 11201 H HG3  . LYS A 1 12  ? 10.274  14.661  -10.662 1.00 0.00 ? 12  LYS A HG3  8  
ATOM 11202 H HD2  . LYS A 1 12  ? 9.476   15.745  -13.302 1.00 0.00 ? 12  LYS A HD2  8  
ATOM 11203 H HD3  . LYS A 1 12  ? 8.822   16.552  -11.874 1.00 0.00 ? 12  LYS A HD3  8  
ATOM 11204 H HE2  . LYS A 1 12  ? 11.751  15.978  -12.297 1.00 0.00 ? 12  LYS A HE2  8  
ATOM 11205 H HE3  . LYS A 1 12  ? 10.976  17.503  -12.723 1.00 0.00 ? 12  LYS A HE3  8  
ATOM 11206 H HZ1  . LYS A 1 12  ? 11.980  17.708  -10.578 1.00 0.00 ? 12  LYS A HZ1  8  
ATOM 11207 H HZ2  . LYS A 1 12  ? 11.196  16.322  -10.008 1.00 0.00 ? 12  LYS A HZ2  8  
ATOM 11208 H HZ3  . LYS A 1 12  ? 10.300  17.710  -10.372 1.00 0.00 ? 12  LYS A HZ3  8  
ATOM 11209 N N    . PRO A 1 13  ? 13.110  12.150  -10.746 1.00 0.00 ? 13  PRO A N    8  
ATOM 11210 C CA   . PRO A 1 13  ? 13.592  11.645  -9.457  1.00 0.00 ? 13  PRO A CA   8  
ATOM 11211 C C    . PRO A 1 13  ? 13.810  12.762  -8.442  1.00 0.00 ? 13  PRO A C    8  
ATOM 11212 O O    . PRO A 1 13  ? 14.711  13.588  -8.596  1.00 0.00 ? 13  PRO A O    8  
ATOM 11213 C CB   . PRO A 1 13  ? 14.923  10.978  -9.812  1.00 0.00 ? 13  PRO A CB   8  
ATOM 11214 C CG   . PRO A 1 13  ? 15.376  11.672  -11.050 1.00 0.00 ? 13  PRO A CG   8  
ATOM 11215 C CD   . PRO A 1 13  ? 14.126  12.030  -11.805 1.00 0.00 ? 13  PRO A CD   8  
ATOM 11216 H HA   . PRO A 1 13  ? 12.918  10.910  -9.041  1.00 0.00 ? 13  PRO A HA   8  
ATOM 11217 H HB2  . PRO A 1 13  ? 15.625  11.115  -9.001  1.00 0.00 ? 13  PRO A HB2  8  
ATOM 11218 H HB3  . PRO A 1 13  ? 14.766  9.924   -9.985  1.00 0.00 ? 13  PRO A HB3  8  
ATOM 11219 H HG2  . PRO A 1 13  ? 15.926  12.563  -10.790 1.00 0.00 ? 13  PRO A HG2  8  
ATOM 11220 H HG3  . PRO A 1 13  ? 15.991  11.007  -11.638 1.00 0.00 ? 13  PRO A HG3  8  
ATOM 11221 H HD2  . PRO A 1 13  ? 14.255  12.968  -12.324 1.00 0.00 ? 13  PRO A HD2  8  
ATOM 11222 H HD3  . PRO A 1 13  ? 13.867  11.245  -12.500 1.00 0.00 ? 13  PRO A HD3  8  
ATOM 11223 N N    . LYS A 1 14  ? 12.982  12.783  -7.403  1.00 0.00 ? 14  LYS A N    8  
ATOM 11224 C CA   . LYS A 1 14  ? 13.085  13.797  -6.361  1.00 0.00 ? 14  LYS A CA   8  
ATOM 11225 C C    . LYS A 1 14  ? 13.369  13.158  -5.006  1.00 0.00 ? 14  LYS A C    8  
ATOM 11226 O O    . LYS A 1 14  ? 13.177  11.956  -4.824  1.00 0.00 ? 14  LYS A O    8  
ATOM 11227 C CB   . LYS A 1 14  ? 11.795  14.617  -6.289  1.00 0.00 ? 14  LYS A CB   8  
ATOM 11228 C CG   . LYS A 1 14  ? 10.615  13.847  -5.723  1.00 0.00 ? 14  LYS A CG   8  
ATOM 11229 C CD   . LYS A 1 14  ? 9.839   13.132  -6.816  1.00 0.00 ? 14  LYS A CD   8  
ATOM 11230 C CE   . LYS A 1 14  ? 8.779   14.035  -7.429  1.00 0.00 ? 14  LYS A CE   8  
ATOM 11231 N NZ   . LYS A 1 14  ? 7.622   14.233  -6.512  1.00 0.00 ? 14  LYS A NZ   8  
ATOM 11232 H H    . LYS A 1 14  ? 12.284  12.097  -7.336  1.00 0.00 ? 14  LYS A H    8  
ATOM 11233 H HA   . LYS A 1 14  ? 13.904  14.452  -6.616  1.00 0.00 ? 14  LYS A HA   8  
ATOM 11234 H HB2  . LYS A 1 14  ? 11.967  15.482  -5.666  1.00 0.00 ? 14  LYS A HB2  8  
ATOM 11235 H HB3  . LYS A 1 14  ? 11.537  14.948  -7.285  1.00 0.00 ? 14  LYS A HB3  8  
ATOM 11236 H HG2  . LYS A 1 14  ? 10.980  13.114  -5.018  1.00 0.00 ? 14  LYS A HG2  8  
ATOM 11237 H HG3  . LYS A 1 14  ? 9.955   14.538  -5.218  1.00 0.00 ? 14  LYS A HG3  8  
ATOM 11238 H HD2  . LYS A 1 14  ? 10.525  12.824  -7.591  1.00 0.00 ? 14  LYS A HD2  8  
ATOM 11239 H HD3  . LYS A 1 14  ? 9.357   12.262  -6.393  1.00 0.00 ? 14  LYS A HD3  8  
ATOM 11240 H HE2  . LYS A 1 14  ? 9.224   14.994  -7.645  1.00 0.00 ? 14  LYS A HE2  8  
ATOM 11241 H HE3  . LYS A 1 14  ? 8.428   13.586  -8.346  1.00 0.00 ? 14  LYS A HE3  8  
ATOM 11242 H HZ1  . LYS A 1 14  ? 6.837   14.687  -7.022  1.00 0.00 ? 14  LYS A HZ1  8  
ATOM 11243 H HZ2  . LYS A 1 14  ? 7.898   14.840  -5.714  1.00 0.00 ? 14  LYS A HZ2  8  
ATOM 11244 H HZ3  . LYS A 1 14  ? 7.298   13.317  -6.143  1.00 0.00 ? 14  LYS A HZ3  8  
ATOM 11245 N N    . GLU A 1 15  ? 13.827  13.969  -4.058  1.00 0.00 ? 15  GLU A N    8  
ATOM 11246 C CA   . GLU A 1 15  ? 14.136  13.481  -2.719  1.00 0.00 ? 15  GLU A CA   8  
ATOM 11247 C C    . GLU A 1 15  ? 14.003  14.598  -1.688  1.00 0.00 ? 15  GLU A C    8  
ATOM 11248 O O    . GLU A 1 15  ? 13.864  15.769  -2.040  1.00 0.00 ? 15  GLU A O    8  
ATOM 11249 C CB   . GLU A 1 15  ? 15.551  12.901  -2.678  1.00 0.00 ? 15  GLU A CB   8  
ATOM 11250 C CG   . GLU A 1 15  ? 15.751  11.859  -1.590  1.00 0.00 ? 15  GLU A CG   8  
ATOM 11251 C CD   . GLU A 1 15  ? 16.903  10.919  -1.887  1.00 0.00 ? 15  GLU A CD   8  
ATOM 11252 O OE1  . GLU A 1 15  ? 18.056  11.272  -1.562  1.00 0.00 ? 15  GLU A OE1  8  
ATOM 11253 O OE2  . GLU A 1 15  ? 16.652  9.830   -2.444  1.00 0.00 ? 15  GLU A OE2  8  
ATOM 11254 H H    . GLU A 1 15  ? 13.959  14.918  -4.263  1.00 0.00 ? 15  GLU A H    8  
ATOM 11255 H HA   . GLU A 1 15  ? 13.430  12.701  -2.479  1.00 0.00 ? 15  GLU A HA   8  
ATOM 11256 H HB2  . GLU A 1 15  ? 15.767  12.442  -3.632  1.00 0.00 ? 15  GLU A HB2  8  
ATOM 11257 H HB3  . GLU A 1 15  ? 16.252  13.705  -2.509  1.00 0.00 ? 15  GLU A HB3  8  
ATOM 11258 H HG2  . GLU A 1 15  ? 15.950  12.364  -0.657  1.00 0.00 ? 15  GLU A HG2  8  
ATOM 11259 H HG3  . GLU A 1 15  ? 14.846  11.277  -1.497  1.00 0.00 ? 15  GLU A HG3  8  
ATOM 11260 N N    . GLY A 1 16  ? 14.045  14.227  -0.412  1.00 0.00 ? 16  GLY A N    8  
ATOM 11261 C CA   . GLY A 1 16  ? 13.927  15.208  0.651   1.00 0.00 ? 16  GLY A CA   8  
ATOM 11262 C C    . GLY A 1 16  ? 12.488  15.598  0.923   1.00 0.00 ? 16  GLY A C    8  
ATOM 11263 O O    . GLY A 1 16  ? 12.098  16.747  0.714   1.00 0.00 ? 16  GLY A O    8  
ATOM 11264 H H    . GLY A 1 16  ? 14.158  13.279  -0.191  1.00 0.00 ? 16  GLY A H    8  
ATOM 11265 H HA2  . GLY A 1 16  ? 14.355  14.798  1.553   1.00 0.00 ? 16  GLY A HA2  8  
ATOM 11266 H HA3  . GLY A 1 16  ? 14.481  16.093  0.371   1.00 0.00 ? 16  GLY A HA3  8  
ATOM 11267 N N    . VAL A 1 17  ? 11.695  14.638  1.389   1.00 0.00 ? 17  VAL A N    8  
ATOM 11268 C CA   . VAL A 1 17  ? 10.290  14.887  1.689   1.00 0.00 ? 17  VAL A CA   8  
ATOM 11269 C C    . VAL A 1 17  ? 10.088  15.179  3.172   1.00 0.00 ? 17  VAL A C    8  
ATOM 11270 O O    . VAL A 1 17  ? 9.007   15.590  3.594   1.00 0.00 ? 17  VAL A O    8  
ATOM 11271 C CB   . VAL A 1 17  ? 9.410   13.688  1.289   1.00 0.00 ? 17  VAL A CB   8  
ATOM 11272 C CG1  . VAL A 1 17  ? 9.936   12.406  1.916   1.00 0.00 ? 17  VAL A CG1  8  
ATOM 11273 C CG2  . VAL A 1 17  ? 7.963   13.933  1.690   1.00 0.00 ? 17  VAL A CG2  8  
ATOM 11274 H H    . VAL A 1 17  ? 12.063  13.742  1.535   1.00 0.00 ? 17  VAL A H    8  
ATOM 11275 H HA   . VAL A 1 17  ? 9.973   15.747  1.117   1.00 0.00 ? 17  VAL A HA   8  
ATOM 11276 H HB   . VAL A 1 17  ? 9.450   13.580  0.215   1.00 0.00 ? 17  VAL A HB   8  
ATOM 11277 H HG11 . VAL A 1 17  ? 10.500  11.851  1.181   1.00 0.00 ? 17  VAL A HG11 8  
ATOM 11278 H HG12 . VAL A 1 17  ? 10.574  12.650  2.753   1.00 0.00 ? 17  VAL A HG12 8  
ATOM 11279 H HG13 . VAL A 1 17  ? 9.106   11.806  2.259   1.00 0.00 ? 17  VAL A HG13 8  
ATOM 11280 H HG21 . VAL A 1 17  ? 7.768   14.995  1.702   1.00 0.00 ? 17  VAL A HG21 8  
ATOM 11281 H HG22 . VAL A 1 17  ? 7.306   13.455  0.977   1.00 0.00 ? 17  VAL A HG22 8  
ATOM 11282 H HG23 . VAL A 1 17  ? 7.787   13.522  2.673   1.00 0.00 ? 17  VAL A HG23 8  
ATOM 11283 N N    . LYS A 1 18  ? 11.136  14.963  3.960   1.00 0.00 ? 18  LYS A N    8  
ATOM 11284 C CA   . LYS A 1 18  ? 11.077  15.204  5.396   1.00 0.00 ? 18  LYS A CA   8  
ATOM 11285 C C    . LYS A 1 18  ? 11.144  16.698  5.701   1.00 0.00 ? 18  LYS A C    8  
ATOM 11286 O O    . LYS A 1 18  ? 11.697  17.476  4.923   1.00 0.00 ? 18  LYS A O    8  
ATOM 11287 C CB   . LYS A 1 18  ? 12.222  14.476  6.104   1.00 0.00 ? 18  LYS A CB   8  
ATOM 11288 C CG   . LYS A 1 18  ? 12.084  12.964  6.087   1.00 0.00 ? 18  LYS A CG   8  
ATOM 11289 C CD   . LYS A 1 18  ? 13.393  12.281  6.445   1.00 0.00 ? 18  LYS A CD   8  
ATOM 11290 C CE   . LYS A 1 18  ? 13.347  10.792  6.136   1.00 0.00 ? 18  LYS A CE   8  
ATOM 11291 N NZ   . LYS A 1 18  ? 12.763  10.010  7.260   1.00 0.00 ? 18  LYS A NZ   8  
ATOM 11292 H H    . LYS A 1 18  ? 11.971  14.635  3.564   1.00 0.00 ? 18  LYS A H    8  
ATOM 11293 H HA   . LYS A 1 18  ? 10.137  14.817  5.759   1.00 0.00 ? 18  LYS A HA   8  
ATOM 11294 H HB2  . LYS A 1 18  ? 13.152  14.738  5.621   1.00 0.00 ? 18  LYS A HB2  8  
ATOM 11295 H HB3  . LYS A 1 18  ? 12.257  14.802  7.134   1.00 0.00 ? 18  LYS A HB3  8  
ATOM 11296 H HG2  . LYS A 1 18  ? 11.331  12.672  6.804   1.00 0.00 ? 18  LYS A HG2  8  
ATOM 11297 H HG3  . LYS A 1 18  ? 11.783  12.650  5.097   1.00 0.00 ? 18  LYS A HG3  8  
ATOM 11298 H HD2  . LYS A 1 18  ? 14.192  12.731  5.874   1.00 0.00 ? 18  LYS A HD2  8  
ATOM 11299 H HD3  . LYS A 1 18  ? 13.582  12.415  7.501   1.00 0.00 ? 18  LYS A HD3  8  
ATOM 11300 H HE2  . LYS A 1 18  ? 12.747  10.639  5.252   1.00 0.00 ? 18  LYS A HE2  8  
ATOM 11301 H HE3  . LYS A 1 18  ? 14.353  10.445  5.952   1.00 0.00 ? 18  LYS A HE3  8  
ATOM 11302 H HZ1  . LYS A 1 18  ? 12.428  9.087   6.917   1.00 0.00 ? 18  LYS A HZ1  8  
ATOM 11303 H HZ2  . LYS A 1 18  ? 11.960  10.525  7.674   1.00 0.00 ? 18  LYS A HZ2  8  
ATOM 11304 H HZ3  . LYS A 1 18  ? 13.479  9.854   7.998   1.00 0.00 ? 18  LYS A HZ3  8  
ATOM 11305 N N    . THR A 1 19  ? 10.580  17.091  6.838   1.00 0.00 ? 19  THR A N    8  
ATOM 11306 C CA   . THR A 1 19  ? 10.576  18.491  7.245   1.00 0.00 ? 19  THR A CA   8  
ATOM 11307 C C    . THR A 1 19  ? 11.255  18.671  8.598   1.00 0.00 ? 19  THR A C    8  
ATOM 11308 O O    . THR A 1 19  ? 12.081  19.566  8.773   1.00 0.00 ? 19  THR A O    8  
ATOM 11309 C CB   . THR A 1 19  ? 9.143   19.049  7.324   1.00 0.00 ? 19  THR A CB   8  
ATOM 11310 O OG1  . THR A 1 19  ? 8.346   18.233  8.190   1.00 0.00 ? 19  THR A OG1  8  
ATOM 11311 C CG2  . THR A 1 19  ? 8.507   19.104  5.944   1.00 0.00 ? 19  THR A CG2  8  
ATOM 11312 H H    . THR A 1 19  ? 10.155  16.423  7.416   1.00 0.00 ? 19  THR A H    8  
ATOM 11313 H HA   . THR A 1 19  ? 11.120  19.056  6.502   1.00 0.00 ? 19  THR A HA   8  
ATOM 11314 H HB   . THR A 1 19  ? 9.185   20.052  7.725   1.00 0.00 ? 19  THR A HB   8  
ATOM 11315 H HG1  . THR A 1 19  ? 8.359   17.325  7.876   1.00 0.00 ? 19  THR A HG1  8  
ATOM 11316 H HG21 . THR A 1 19  ? 9.192   19.568  5.250   1.00 0.00 ? 19  THR A HG21 8  
ATOM 11317 H HG22 . THR A 1 19  ? 7.595   19.681  5.990   1.00 0.00 ? 19  THR A HG22 8  
ATOM 11318 H HG23 . THR A 1 19  ? 8.282   18.102  5.611   1.00 0.00 ? 19  THR A HG23 8  
ATOM 11319 N N    . GLU A 1 20  ? 10.901  17.815  9.552   1.00 0.00 ? 20  GLU A N    8  
ATOM 11320 C CA   . GLU A 1 20  ? 11.477  17.882  10.890  1.00 0.00 ? 20  GLU A CA   8  
ATOM 11321 C C    . GLU A 1 20  ? 11.427  16.518  11.573  1.00 0.00 ? 20  GLU A C    8  
ATOM 11322 O O    . GLU A 1 20  ? 10.741  15.607  11.112  1.00 0.00 ? 20  GLU A O    8  
ATOM 11323 C CB   . GLU A 1 20  ? 10.735  18.917  11.738  1.00 0.00 ? 20  GLU A CB   8  
ATOM 11324 C CG   . GLU A 1 20  ? 11.607  19.578  12.792  1.00 0.00 ? 20  GLU A CG   8  
ATOM 11325 C CD   . GLU A 1 20  ? 10.876  20.664  13.557  1.00 0.00 ? 20  GLU A CD   8  
ATOM 11326 O OE1  . GLU A 1 20  ? 9.630   20.605  13.625  1.00 0.00 ? 20  GLU A OE1  8  
ATOM 11327 O OE2  . GLU A 1 20  ? 11.548  21.573  14.086  1.00 0.00 ? 20  GLU A OE2  8  
ATOM 11328 H H    . GLU A 1 20  ? 10.237  17.123  9.351   1.00 0.00 ? 20  GLU A H    8  
ATOM 11329 H HA   . GLU A 1 20  ? 12.509  18.184  10.792  1.00 0.00 ? 20  GLU A HA   8  
ATOM 11330 H HB2  . GLU A 1 20  ? 10.347  19.687  11.087  1.00 0.00 ? 20  GLU A HB2  8  
ATOM 11331 H HB3  . GLU A 1 20  ? 9.910   18.430  12.237  1.00 0.00 ? 20  GLU A HB3  8  
ATOM 11332 H HG2  . GLU A 1 20  ? 11.935  18.825  13.493  1.00 0.00 ? 20  GLU A HG2  8  
ATOM 11333 H HG3  . GLU A 1 20  ? 12.467  20.016  12.308  1.00 0.00 ? 20  GLU A HG3  8  
ATOM 11334 N N    . ASN A 1 21  ? 12.160  16.387  12.674  1.00 0.00 ? 21  ASN A N    8  
ATOM 11335 C CA   . ASN A 1 21  ? 12.200  15.135  13.420  1.00 0.00 ? 21  ASN A CA   8  
ATOM 11336 C C    . ASN A 1 21  ? 10.795  14.693  13.819  1.00 0.00 ? 21  ASN A C    8  
ATOM 11337 O O    . ASN A 1 21  ? 10.048  15.450  14.437  1.00 0.00 ? 21  ASN A O    8  
ATOM 11338 C CB   . ASN A 1 21  ? 13.071  15.288  14.668  1.00 0.00 ? 21  ASN A CB   8  
ATOM 11339 C CG   . ASN A 1 21  ? 12.434  16.187  15.711  1.00 0.00 ? 21  ASN A CG   8  
ATOM 11340 O OD1  . ASN A 1 21  ? 12.373  17.405  15.543  1.00 0.00 ? 21  ASN A OD1  8  
ATOM 11341 N ND2  . ASN A 1 21  ? 11.957  15.587  16.796  1.00 0.00 ? 21  ASN A ND2  8  
ATOM 11342 H H    . ASN A 1 21  ? 12.686  17.150  12.992  1.00 0.00 ? 21  ASN A H    8  
ATOM 11343 H HA   . ASN A 1 21  ? 12.633  14.381  12.780  1.00 0.00 ? 21  ASN A HA   8  
ATOM 11344 H HB2  . ASN A 1 21  ? 13.232  14.315  15.109  1.00 0.00 ? 21  ASN A HB2  8  
ATOM 11345 H HB3  . ASN A 1 21  ? 14.023  15.713  14.386  1.00 0.00 ? 21  ASN A HB3  8  
ATOM 11346 H HD21 . ASN A 1 21  ? 12.041  14.613  16.861  1.00 0.00 ? 21  ASN A HD21 8  
ATOM 11347 H HD22 . ASN A 1 21  ? 11.539  16.144  17.485  1.00 0.00 ? 21  ASN A HD22 8  
ATOM 11348 N N    . ASN A 1 22  ? 10.442  13.463  13.459  1.00 0.00 ? 22  ASN A N    8  
ATOM 11349 C CA   . ASN A 1 22  ? 9.127   12.921  13.779  1.00 0.00 ? 22  ASN A CA   8  
ATOM 11350 C C    . ASN A 1 22  ? 9.222   11.442  14.143  1.00 0.00 ? 22  ASN A C    8  
ATOM 11351 O O    . ASN A 1 22  ? 10.296  10.844  14.078  1.00 0.00 ? 22  ASN A O    8  
ATOM 11352 C CB   . ASN A 1 22  ? 8.174   13.106  12.597  1.00 0.00 ? 22  ASN A CB   8  
ATOM 11353 C CG   . ASN A 1 22  ? 7.638   14.522  12.503  1.00 0.00 ? 22  ASN A CG   8  
ATOM 11354 O OD1  . ASN A 1 22  ? 8.087   15.314  11.674  1.00 0.00 ? 22  ASN A OD1  8  
ATOM 11355 N ND2  . ASN A 1 22  ? 6.673   14.846  13.354  1.00 0.00 ? 22  ASN A ND2  8  
ATOM 11356 H H    . ASN A 1 22  ? 11.082  12.907  12.967  1.00 0.00 ? 22  ASN A H    8  
ATOM 11357 H HA   . ASN A 1 22  ? 8.742   13.464  14.629  1.00 0.00 ? 22  ASN A HA   8  
ATOM 11358 H HB2  . ASN A 1 22  ? 8.699   12.879  11.680  1.00 0.00 ? 22  ASN A HB2  8  
ATOM 11359 H HB3  . ASN A 1 22  ? 7.339   12.431  12.705  1.00 0.00 ? 22  ASN A HB3  8  
ATOM 11360 H HD21 . ASN A 1 22  ? 6.364   14.164  13.987  1.00 0.00 ? 22  ASN A HD21 8  
ATOM 11361 H HD22 . ASN A 1 22  ? 6.307   15.755  13.315  1.00 0.00 ? 22  ASN A HD22 8  
ATOM 11362 N N    . ASP A 1 23  ? 8.091   10.858  14.524  1.00 0.00 ? 23  ASP A N    8  
ATOM 11363 C CA   . ASP A 1 23  ? 8.046   9.449   14.897  1.00 0.00 ? 23  ASP A CA   8  
ATOM 11364 C C    . ASP A 1 23  ? 7.208   8.651   13.903  1.00 0.00 ? 23  ASP A C    8  
ATOM 11365 O O    . ASP A 1 23  ? 5.980   8.617   13.997  1.00 0.00 ? 23  ASP A O    8  
ATOM 11366 C CB   . ASP A 1 23  ? 7.476   9.290   16.307  1.00 0.00 ? 23  ASP A CB   8  
ATOM 11367 C CG   . ASP A 1 23  ? 6.371   10.286  16.600  1.00 0.00 ? 23  ASP A CG   8  
ATOM 11368 O OD1  . ASP A 1 23  ? 5.648   10.664  15.656  1.00 0.00 ? 23  ASP A OD1  8  
ATOM 11369 O OD2  . ASP A 1 23  ? 6.231   10.688  17.775  1.00 0.00 ? 23  ASP A OD2  8  
ATOM 11370 H H    . ASP A 1 23  ? 7.267   11.388  14.556  1.00 0.00 ? 23  ASP A H    8  
ATOM 11371 H HA   . ASP A 1 23  ? 9.057   9.070   14.882  1.00 0.00 ? 23  ASP A HA   8  
ATOM 11372 H HB2  . ASP A 1 23  ? 7.075   8.293   16.416  1.00 0.00 ? 23  ASP A HB2  8  
ATOM 11373 H HB3  . ASP A 1 23  ? 8.268   9.436   17.027  1.00 0.00 ? 23  ASP A HB3  8  
ATOM 11374 N N    . HIS A 1 24  ? 7.878   8.012   12.950  1.00 0.00 ? 24  HIS A N    8  
ATOM 11375 C CA   . HIS A 1 24  ? 7.195   7.214   11.938  1.00 0.00 ? 24  HIS A CA   8  
ATOM 11376 C C    . HIS A 1 24  ? 8.070   6.052   11.479  1.00 0.00 ? 24  HIS A C    8  
ATOM 11377 O O    . HIS A 1 24  ? 9.243   5.963   11.846  1.00 0.00 ? 24  HIS A O    8  
ATOM 11378 C CB   . HIS A 1 24  ? 6.817   8.087   10.740  1.00 0.00 ? 24  HIS A CB   8  
ATOM 11379 C CG   . HIS A 1 24  ? 6.158   9.376   11.122  1.00 0.00 ? 24  HIS A CG   8  
ATOM 11380 N ND1  . HIS A 1 24  ? 4.978   9.436   11.833  1.00 0.00 ? 24  HIS A ND1  8  
ATOM 11381 C CD2  . HIS A 1 24  ? 6.522   10.659  10.890  1.00 0.00 ? 24  HIS A CD2  8  
ATOM 11382 C CE1  . HIS A 1 24  ? 4.643   10.700  12.020  1.00 0.00 ? 24  HIS A CE1  8  
ATOM 11383 N NE2  . HIS A 1 24  ? 5.564   11.463  11.458  1.00 0.00 ? 24  HIS A NE2  8  
ATOM 11384 H H    . HIS A 1 24  ? 8.856   8.078   12.927  1.00 0.00 ? 24  HIS A H    8  
ATOM 11385 H HA   . HIS A 1 24  ? 6.294   6.817   12.381  1.00 0.00 ? 24  HIS A HA   8  
ATOM 11386 H HB2  . HIS A 1 24  ? 7.710   8.324   10.180  1.00 0.00 ? 24  HIS A HB2  8  
ATOM 11387 H HB3  . HIS A 1 24  ? 6.135   7.540   10.105  1.00 0.00 ? 24  HIS A HB3  8  
ATOM 11388 H HD1  . HIS A 1 24  ? 4.462   8.667   12.151  1.00 0.00 ? 24  HIS A HD1  8  
ATOM 11389 H HD2  . HIS A 1 24  ? 7.402   10.990  10.357  1.00 0.00 ? 24  HIS A HD2  8  
ATOM 11390 H HE1  . HIS A 1 24  ? 3.767   11.052  12.544  1.00 0.00 ? 24  HIS A HE1  8  
ATOM 11391 H HE2  . HIS A 1 24  ? 5.515   12.438  11.376  1.00 0.00 ? 24  HIS A HE2  8  
ATOM 11392 N N    . ILE A 1 25  ? 7.493   5.163   10.677  1.00 0.00 ? 25  ILE A N    8  
ATOM 11393 C CA   . ILE A 1 25  ? 8.222   4.007   10.169  1.00 0.00 ? 25  ILE A CA   8  
ATOM 11394 C C    . ILE A 1 25  ? 8.036   3.859   8.663   1.00 0.00 ? 25  ILE A C    8  
ATOM 11395 O O    . ILE A 1 25  ? 6.971   4.160   8.126   1.00 0.00 ? 25  ILE A O    8  
ATOM 11396 C CB   . ILE A 1 25  ? 7.769   2.708   10.861  1.00 0.00 ? 25  ILE A CB   8  
ATOM 11397 C CG1  . ILE A 1 25  ? 6.268   2.492   10.658  1.00 0.00 ? 25  ILE A CG1  8  
ATOM 11398 C CG2  . ILE A 1 25  ? 8.106   2.753   12.344  1.00 0.00 ? 25  ILE A CG2  8  
ATOM 11399 C CD1  . ILE A 1 25  ? 5.742   1.238   11.319  1.00 0.00 ? 25  ILE A CD1  8  
ATOM 11400 H H    . ILE A 1 25  ? 6.556   5.289   10.420  1.00 0.00 ? 25  ILE A H    8  
ATOM 11401 H HA   . ILE A 1 25  ? 9.271   4.156   10.379  1.00 0.00 ? 25  ILE A HA   8  
ATOM 11402 H HB   . ILE A 1 25  ? 8.307   1.884   10.419  1.00 0.00 ? 25  ILE A HB   8  
ATOM 11403 H HG12 . ILE A 1 25  ? 5.730   3.333   11.067  1.00 0.00 ? 25  ILE A HG12 8  
ATOM 11404 H HG13 . ILE A 1 25  ? 6.063   2.421   9.599   1.00 0.00 ? 25  ILE A HG13 8  
ATOM 11405 H HG21 . ILE A 1 25  ? 8.562   1.819   12.638  1.00 0.00 ? 25  ILE A HG21 8  
ATOM 11406 H HG22 . ILE A 1 25  ? 8.795   3.563   12.532  1.00 0.00 ? 25  ILE A HG22 8  
ATOM 11407 H HG23 . ILE A 1 25  ? 7.203   2.908   12.915  1.00 0.00 ? 25  ILE A HG23 8  
ATOM 11408 H HD11 . ILE A 1 25  ? 5.856   0.401   10.647  1.00 0.00 ? 25  ILE A HD11 8  
ATOM 11409 H HD12 . ILE A 1 25  ? 6.296   1.050   12.227  1.00 0.00 ? 25  ILE A HD12 8  
ATOM 11410 H HD13 . ILE A 1 25  ? 4.696   1.368   11.557  1.00 0.00 ? 25  ILE A HD13 8  
ATOM 11411 N N    . ASN A 1 26  ? 9.080   3.392   7.987   1.00 0.00 ? 26  ASN A N    8  
ATOM 11412 C CA   . ASN A 1 26  ? 9.032   3.202   6.542   1.00 0.00 ? 26  ASN A CA   8  
ATOM 11413 C C    . ASN A 1 26  ? 9.093   1.719   6.185   1.00 0.00 ? 26  ASN A C    8  
ATOM 11414 O O    . ASN A 1 26  ? 10.053  1.027   6.525   1.00 0.00 ? 26  ASN A O    8  
ATOM 11415 C CB   . ASN A 1 26  ? 10.187  3.947   5.870   1.00 0.00 ? 26  ASN A CB   8  
ATOM 11416 C CG   . ASN A 1 26  ? 10.068  5.451   6.018   1.00 0.00 ? 26  ASN A CG   8  
ATOM 11417 O OD1  . ASN A 1 26  ? 9.857   6.168   5.039   1.00 0.00 ? 26  ASN A OD1  8  
ATOM 11418 N ND2  . ASN A 1 26  ? 10.204  5.937   7.246   1.00 0.00 ? 26  ASN A ND2  8  
ATOM 11419 H H    . ASN A 1 26  ? 9.903   3.169   8.471   1.00 0.00 ? 26  ASN A H    8  
ATOM 11420 H HA   . ASN A 1 26  ? 8.097   3.608   6.185   1.00 0.00 ? 26  ASN A HA   8  
ATOM 11421 H HB2  . ASN A 1 26  ? 11.119  3.633   6.317   1.00 0.00 ? 26  ASN A HB2  8  
ATOM 11422 H HB3  . ASN A 1 26  ? 10.199  3.707   4.817   1.00 0.00 ? 26  ASN A HB3  8  
ATOM 11423 H HD21 . ASN A 1 26  ? 10.371  5.307   7.978   1.00 0.00 ? 26  ASN A HD21 8  
ATOM 11424 H HD22 . ASN A 1 26  ? 10.131  6.907   7.370   1.00 0.00 ? 26  ASN A HD22 8  
ATOM 11425 N N    . LEU A 1 27  ? 8.062   1.239   5.499   1.00 0.00 ? 27  LEU A N    8  
ATOM 11426 C CA   . LEU A 1 27  ? 7.997   -0.162  5.096   1.00 0.00 ? 27  LEU A CA   8  
ATOM 11427 C C    . LEU A 1 27  ? 8.315   -0.316  3.612   1.00 0.00 ? 27  LEU A C    8  
ATOM 11428 O O    . LEU A 1 27  ? 7.757   0.387   2.770   1.00 0.00 ? 27  LEU A O    8  
ATOM 11429 C CB   . LEU A 1 27  ? 6.611   -0.736  5.394   1.00 0.00 ? 27  LEU A CB   8  
ATOM 11430 C CG   . LEU A 1 27  ? 5.894   -0.157  6.615   1.00 0.00 ? 27  LEU A CG   8  
ATOM 11431 C CD1  . LEU A 1 27  ? 4.443   -0.613  6.647   1.00 0.00 ? 27  LEU A CD1  8  
ATOM 11432 C CD2  . LEU A 1 27  ? 6.610   -0.561  7.895   1.00 0.00 ? 27  LEU A CD2  8  
ATOM 11433 H H    . LEU A 1 27  ? 7.326   1.839   5.258   1.00 0.00 ? 27  LEU A H    8  
ATOM 11434 H HA   . LEU A 1 27  ? 8.734   -0.706  5.668   1.00 0.00 ? 27  LEU A HA   8  
ATOM 11435 H HB2  . LEU A 1 27  ? 5.988   -0.561  4.531   1.00 0.00 ? 27  LEU A HB2  8  
ATOM 11436 H HB3  . LEU A 1 27  ? 6.721   -1.800  5.547   1.00 0.00 ? 27  LEU A HB3  8  
ATOM 11437 H HG   . LEU A 1 27  ? 5.903   0.922   6.551   1.00 0.00 ? 27  LEU A HG   8  
ATOM 11438 H HD11 . LEU A 1 27  ? 4.403   -1.691  6.598   1.00 0.00 ? 27  LEU A HD11 8  
ATOM 11439 H HD12 . LEU A 1 27  ? 3.916   -0.195  5.802   1.00 0.00 ? 27  LEU A HD12 8  
ATOM 11440 H HD13 . LEU A 1 27  ? 3.980   -0.276  7.563   1.00 0.00 ? 27  LEU A HD13 8  
ATOM 11441 H HD21 . LEU A 1 27  ? 6.802   0.319   8.492   1.00 0.00 ? 27  LEU A HD21 8  
ATOM 11442 H HD22 . LEU A 1 27  ? 7.546   -1.040  7.648   1.00 0.00 ? 27  LEU A HD22 8  
ATOM 11443 H HD23 . LEU A 1 27  ? 5.990   -1.247  8.454   1.00 0.00 ? 27  LEU A HD23 8  
ATOM 11444 N N    . LYS A 1 28  ? 9.215   -1.242  3.298   1.00 0.00 ? 28  LYS A N    8  
ATOM 11445 C CA   . LYS A 1 28  ? 9.606   -1.493  1.916   1.00 0.00 ? 28  LYS A CA   8  
ATOM 11446 C C    . LYS A 1 28  ? 8.768   -2.613  1.308   1.00 0.00 ? 28  LYS A C    8  
ATOM 11447 O O    . LYS A 1 28  ? 8.872   -3.771  1.715   1.00 0.00 ? 28  LYS A O    8  
ATOM 11448 C CB   . LYS A 1 28  ? 11.091  -1.855  1.842   1.00 0.00 ? 28  LYS A CB   8  
ATOM 11449 C CG   . LYS A 1 28  ? 12.012  -0.745  2.319   1.00 0.00 ? 28  LYS A CG   8  
ATOM 11450 C CD   . LYS A 1 28  ? 13.427  -1.251  2.539   1.00 0.00 ? 28  LYS A CD   8  
ATOM 11451 C CE   . LYS A 1 28  ? 13.593  -1.858  3.923   1.00 0.00 ? 28  LYS A CE   8  
ATOM 11452 N NZ   . LYS A 1 28  ? 14.654  -2.903  3.948   1.00 0.00 ? 28  LYS A NZ   8  
ATOM 11453 H H    . LYS A 1 28  ? 9.625   -1.772  4.015   1.00 0.00 ? 28  LYS A H    8  
ATOM 11454 H HA   . LYS A 1 28  ? 9.436   -0.587  1.354   1.00 0.00 ? 28  LYS A HA   8  
ATOM 11455 H HB2  . LYS A 1 28  ? 11.267  -2.728  2.453   1.00 0.00 ? 28  LYS A HB2  8  
ATOM 11456 H HB3  . LYS A 1 28  ? 11.342  -2.087  0.817   1.00 0.00 ? 28  LYS A HB3  8  
ATOM 11457 H HG2  . LYS A 1 28  ? 12.032  0.038   1.575   1.00 0.00 ? 28  LYS A HG2  8  
ATOM 11458 H HG3  . LYS A 1 28  ? 11.632  -0.349  3.250   1.00 0.00 ? 28  LYS A HG3  8  
ATOM 11459 H HD2  . LYS A 1 28  ? 13.650  -2.005  1.799   1.00 0.00 ? 28  LYS A HD2  8  
ATOM 11460 H HD3  . LYS A 1 28  ? 14.116  -0.425  2.433   1.00 0.00 ? 28  LYS A HD3  8  
ATOM 11461 H HE2  . LYS A 1 28  ? 13.856  -1.074  4.617   1.00 0.00 ? 28  LYS A HE2  8  
ATOM 11462 H HE3  . LYS A 1 28  ? 12.655  -2.303  4.222   1.00 0.00 ? 28  LYS A HE3  8  
ATOM 11463 H HZ1  . LYS A 1 28  ? 15.075  -3.007  3.002   1.00 0.00 ? 28  LYS A HZ1  8  
ATOM 11464 H HZ2  . LYS A 1 28  ? 14.250  -3.816  4.237   1.00 0.00 ? 28  LYS A HZ2  8  
ATOM 11465 H HZ3  . LYS A 1 28  ? 15.401  -2.638  4.620   1.00 0.00 ? 28  LYS A HZ3  8  
ATOM 11466 N N    . VAL A 1 29  ? 7.937   -2.262  0.332   1.00 0.00 ? 29  VAL A N    8  
ATOM 11467 C CA   . VAL A 1 29  ? 7.083   -3.238  -0.334  1.00 0.00 ? 29  VAL A CA   8  
ATOM 11468 C C    . VAL A 1 29  ? 7.752   -3.789  -1.588  1.00 0.00 ? 29  VAL A C    8  
ATOM 11469 O O    . VAL A 1 29  ? 8.210   -3.031  -2.444  1.00 0.00 ? 29  VAL A O    8  
ATOM 11470 C CB   . VAL A 1 29  ? 5.723   -2.626  -0.718  1.00 0.00 ? 29  VAL A CB   8  
ATOM 11471 C CG1  . VAL A 1 29  ? 4.885   -3.630  -1.494  1.00 0.00 ? 29  VAL A CG1  8  
ATOM 11472 C CG2  . VAL A 1 29  ? 4.985   -2.149  0.524   1.00 0.00 ? 29  VAL A CG2  8  
ATOM 11473 H H    . VAL A 1 29  ? 7.899   -1.324  0.052   1.00 0.00 ? 29  VAL A H    8  
ATOM 11474 H HA   . VAL A 1 29  ? 6.906   -4.052  0.355   1.00 0.00 ? 29  VAL A HA   8  
ATOM 11475 H HB   . VAL A 1 29  ? 5.903   -1.772  -1.354  1.00 0.00 ? 29  VAL A HB   8  
ATOM 11476 H HG11 . VAL A 1 29  ? 5.001   -4.610  -1.056  1.00 0.00 ? 29  VAL A HG11 8  
ATOM 11477 H HG12 . VAL A 1 29  ? 3.846   -3.337  -1.456  1.00 0.00 ? 29  VAL A HG12 8  
ATOM 11478 H HG13 . VAL A 1 29  ? 5.215   -3.655  -2.522  1.00 0.00 ? 29  VAL A HG13 8  
ATOM 11479 H HG21 . VAL A 1 29  ? 4.140   -2.795  0.709   1.00 0.00 ? 29  VAL A HG21 8  
ATOM 11480 H HG22 . VAL A 1 29  ? 5.652   -2.177  1.373   1.00 0.00 ? 29  VAL A HG22 8  
ATOM 11481 H HG23 . VAL A 1 29  ? 4.639   -1.138  0.372   1.00 0.00 ? 29  VAL A HG23 8  
ATOM 11482 N N    . ALA A 1 30  ? 7.806   -5.113  -1.691  1.00 0.00 ? 30  ALA A N    8  
ATOM 11483 C CA   . ALA A 1 30  ? 8.417   -5.766  -2.843  1.00 0.00 ? 30  ALA A CA   8  
ATOM 11484 C C    . ALA A 1 30  ? 7.386   -6.566  -3.631  1.00 0.00 ? 30  ALA A C    8  
ATOM 11485 O O    . ALA A 1 30  ? 6.440   -7.110  -3.062  1.00 0.00 ? 30  ALA A O    8  
ATOM 11486 C CB   . ALA A 1 30  ? 9.558   -6.667  -2.395  1.00 0.00 ? 30  ALA A CB   8  
ATOM 11487 H H    . ALA A 1 30  ? 7.424   -5.664  -0.977  1.00 0.00 ? 30  ALA A H    8  
ATOM 11488 H HA   . ALA A 1 30  ? 8.827   -4.998  -3.483  1.00 0.00 ? 30  ALA A HA   8  
ATOM 11489 H HB1  . ALA A 1 30  ? 9.352   -7.683  -2.697  1.00 0.00 ? 30  ALA A HB1  8  
ATOM 11490 H HB2  . ALA A 1 30  ? 10.479  -6.334  -2.849  1.00 0.00 ? 30  ALA A HB2  8  
ATOM 11491 H HB3  . ALA A 1 30  ? 9.650   -6.623  -1.320  1.00 0.00 ? 30  ALA A HB3  8  
ATOM 11492 N N    . GLY A 1 31  ? 7.575   -6.635  -4.945  1.00 0.00 ? 31  GLY A N    8  
ATOM 11493 C CA   . GLY A 1 31  ? 6.652   -7.371  -5.790  1.00 0.00 ? 31  GLY A CA   8  
ATOM 11494 C C    . GLY A 1 31  ? 7.325   -7.944  -7.021  1.00 0.00 ? 31  GLY A C    8  
ATOM 11495 O O    . GLY A 1 31  ? 8.435   -7.545  -7.371  1.00 0.00 ? 31  GLY A O    8  
ATOM 11496 H H    . GLY A 1 31  ? 8.347   -6.182  -5.345  1.00 0.00 ? 31  GLY A H    8  
ATOM 11497 H HA2  . GLY A 1 31  ? 6.224   -8.179  -5.217  1.00 0.00 ? 31  GLY A HA2  8  
ATOM 11498 H HA3  . GLY A 1 31  ? 5.861   -6.706  -6.104  1.00 0.00 ? 31  GLY A HA3  8  
ATOM 11499 N N    . GLN A 1 32  ? 6.653   -8.884  -7.678  1.00 0.00 ? 32  GLN A N    8  
ATOM 11500 C CA   . GLN A 1 32  ? 7.195   -9.514  -8.876  1.00 0.00 ? 32  GLN A CA   8  
ATOM 11501 C C    . GLN A 1 32  ? 7.521   -8.471  -9.940  1.00 0.00 ? 32  GLN A C    8  
ATOM 11502 O O    . GLN A 1 32  ? 8.571   -8.531  -10.580 1.00 0.00 ? 32  GLN A O    8  
ATOM 11503 C CB   . GLN A 1 32  ? 6.202   -10.535 -9.434  1.00 0.00 ? 32  GLN A CB   8  
ATOM 11504 C CG   . GLN A 1 32  ? 5.927   -11.695 -8.490  1.00 0.00 ? 32  GLN A CG   8  
ATOM 11505 C CD   . GLN A 1 32  ? 5.130   -12.805 -9.146  1.00 0.00 ? 32  GLN A CD   8  
ATOM 11506 O OE1  . GLN A 1 32  ? 3.952   -12.636 -9.462  1.00 0.00 ? 32  GLN A OE1  8  
ATOM 11507 N NE2  . GLN A 1 32  ? 5.770   -13.950 -9.356  1.00 0.00 ? 32  GLN A NE2  8  
ATOM 11508 H H    . GLN A 1 32  ? 5.772   -9.159  -7.349  1.00 0.00 ? 32  GLN A H    8  
ATOM 11509 H HA   . GLN A 1 32  ? 8.104   -10.025 -8.599  1.00 0.00 ? 32  GLN A HA   8  
ATOM 11510 H HB2  . GLN A 1 32  ? 5.267   -10.036 -9.638  1.00 0.00 ? 32  GLN A HB2  8  
ATOM 11511 H HB3  . GLN A 1 32  ? 6.596   -10.936 -10.356 1.00 0.00 ? 32  GLN A HB3  8  
ATOM 11512 H HG2  . GLN A 1 32  ? 6.870   -12.101 -8.154  1.00 0.00 ? 32  GLN A HG2  8  
ATOM 11513 H HG3  . GLN A 1 32  ? 5.372   -11.327 -7.640  1.00 0.00 ? 32  GLN A HG3  8  
ATOM 11514 H HE21 . GLN A 1 32  ? 6.708   -14.013 -9.077  1.00 0.00 ? 32  GLN A HE21 8  
ATOM 11515 H HE22 . GLN A 1 32  ? 5.279   -14.684 -9.777  1.00 0.00 ? 32  GLN A HE22 8  
ATOM 11516 N N    . ASP A 1 33  ? 6.616   -7.517  -10.123 1.00 0.00 ? 33  ASP A N    8  
ATOM 11517 C CA   . ASP A 1 33  ? 6.808   -6.460  -11.109 1.00 0.00 ? 33  ASP A CA   8  
ATOM 11518 C C    . ASP A 1 33  ? 8.280   -6.072  -11.210 1.00 0.00 ? 33  ASP A C    8  
ATOM 11519 O O    . ASP A 1 33  ? 8.798   -5.842  -12.302 1.00 0.00 ? 33  ASP A O    8  
ATOM 11520 C CB   . ASP A 1 33  ? 5.968   -5.235  -10.745 1.00 0.00 ? 33  ASP A CB   8  
ATOM 11521 C CG   . ASP A 1 33  ? 6.260   -4.046  -11.640 1.00 0.00 ? 33  ASP A CG   8  
ATOM 11522 O OD1  . ASP A 1 33  ? 6.537   -4.260  -12.839 1.00 0.00 ? 33  ASP A OD1  8  
ATOM 11523 O OD2  . ASP A 1 33  ? 6.211   -2.902  -11.142 1.00 0.00 ? 33  ASP A OD2  8  
ATOM 11524 H H    . ASP A 1 33  ? 5.798   -7.523  -9.582  1.00 0.00 ? 33  ASP A H    8  
ATOM 11525 H HA   . ASP A 1 33  ? 6.482   -6.837  -12.067 1.00 0.00 ? 33  ASP A HA   8  
ATOM 11526 H HB2  . ASP A 1 33  ? 4.921   -5.483  -10.838 1.00 0.00 ? 33  ASP A HB2  8  
ATOM 11527 H HB3  . ASP A 1 33  ? 6.178   -4.953  -9.723  1.00 0.00 ? 33  ASP A HB3  8  
ATOM 11528 N N    . GLY A 1 34  ? 8.948   -6.001  -10.063 1.00 0.00 ? 34  GLY A N    8  
ATOM 11529 C CA   . GLY A 1 34  ? 10.353  -5.639  -10.044 1.00 0.00 ? 34  GLY A CA   8  
ATOM 11530 C C    . GLY A 1 34  ? 10.576  -4.198  -9.631  1.00 0.00 ? 34  GLY A C    8  
ATOM 11531 O O    . GLY A 1 34  ? 11.516  -3.551  -10.092 1.00 0.00 ? 34  GLY A O    8  
ATOM 11532 H H    . GLY A 1 34  ? 8.483   -6.195  -9.222  1.00 0.00 ? 34  GLY A H    8  
ATOM 11533 H HA2  . GLY A 1 34  ? 10.871  -6.285  -9.351  1.00 0.00 ? 34  GLY A HA2  8  
ATOM 11534 H HA3  . GLY A 1 34  ? 10.764  -5.786  -11.032 1.00 0.00 ? 34  GLY A HA3  8  
ATOM 11535 N N    . SER A 1 35  ? 9.707   -3.692  -8.761  1.00 0.00 ? 35  SER A N    8  
ATOM 11536 C CA   . SER A 1 35  ? 9.810   -2.316  -8.290  1.00 0.00 ? 35  SER A CA   8  
ATOM 11537 C C    . SER A 1 35  ? 9.526   -2.231  -6.794  1.00 0.00 ? 35  SER A C    8  
ATOM 11538 O O    . SER A 1 35  ? 8.463   -2.642  -6.328  1.00 0.00 ? 35  SER A O    8  
ATOM 11539 C CB   . SER A 1 35  ? 8.837   -1.418  -9.057  1.00 0.00 ? 35  SER A CB   8  
ATOM 11540 O OG   . SER A 1 35  ? 9.162   -0.050  -8.886  1.00 0.00 ? 35  SER A OG   8  
ATOM 11541 H H    . SER A 1 35  ? 8.978   -4.258  -8.430  1.00 0.00 ? 35  SER A H    8  
ATOM 11542 H HA   . SER A 1 35  ? 10.819  -1.978  -8.473  1.00 0.00 ? 35  SER A HA   8  
ATOM 11543 H HB2  . SER A 1 35  ? 8.882   -1.658  -10.109 1.00 0.00 ? 35  SER A HB2  8  
ATOM 11544 H HB3  . SER A 1 35  ? 7.833   -1.586  -8.693  1.00 0.00 ? 35  SER A HB3  8  
ATOM 11545 H HG   . SER A 1 35  ? 10.097  0.034   -8.686  1.00 0.00 ? 35  SER A HG   8  
ATOM 11546 N N    . VAL A 1 36  ? 10.484  -1.695  -6.045  1.00 0.00 ? 36  VAL A N    8  
ATOM 11547 C CA   . VAL A 1 36  ? 10.338  -1.554  -4.602  1.00 0.00 ? 36  VAL A CA   8  
ATOM 11548 C C    . VA