data_1X47
# 
_entry.id   1X47 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1X47         
RCSB  RCSB024357   
WWPDB D_1000024357 
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          hss001001406.1 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1X47 
_pdbx_database_status.recvd_initial_deposition_date   2005-05-14 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'He, F.'                                                 1 
'Muto, Y.'                                               2 
'Inoue, M.'                                              3 
'Kigawa, T.'                                             4 
'Shirouzu, M.'                                           5 
'Terada, T.'                                             6 
'Yokoyama, S.'                                           7 
'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 8 
# 
_citation.id                        primary 
_citation.title                     'Solution structure of DSRM domain in DGCR8 protein' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'He, F.'       1 
primary 'Muto, Y.'     2 
primary 'Inoue, M.'    3 
primary 'Kigawa, T.'   4 
primary 'Shirouzu, M.' 5 
primary 'Terada, T.'   6 
primary 'Yokoyama, S.' 7 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'DGCR8 protein' 
_entity.formula_weight             10413.636 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'DSRM domain' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'DiGeorge syndrome critical region 8' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSSGSSGEFVINPNGKSEVCILHEYMQRVLKVRPVYNFFECENPSEPFGASVTIDGVTYGSGTASSKKLAKNKAARATLE
ILIPDFVKQTSESGPSSG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSSGSSGEFVINPNGKSEVCILHEYMQRVLKVRPVYNFFECENPSEPFGASVTIDGVTYGSGTASSKKLAKNKAARATLE
ILIPDFVKQTSESGPSSG
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         hss001001406.1 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  SER n 
1 3  SER n 
1 4  GLY n 
1 5  SER n 
1 6  SER n 
1 7  GLY n 
1 8  GLU n 
1 9  PHE n 
1 10 VAL n 
1 11 ILE n 
1 12 ASN n 
1 13 PRO n 
1 14 ASN n 
1 15 GLY n 
1 16 LYS n 
1 17 SER n 
1 18 GLU n 
1 19 VAL n 
1 20 CYS n 
1 21 ILE n 
1 22 LEU n 
1 23 HIS n 
1 24 GLU n 
1 25 TYR n 
1 26 MET n 
1 27 GLN n 
1 28 ARG n 
1 29 VAL n 
1 30 LEU n 
1 31 LYS n 
1 32 VAL n 
1 33 ARG n 
1 34 PRO n 
1 35 VAL n 
1 36 TYR n 
1 37 ASN n 
1 38 PHE n 
1 39 PHE n 
1 40 GLU n 
1 41 CYS n 
1 42 GLU n 
1 43 ASN n 
1 44 PRO n 
1 45 SER n 
1 46 GLU n 
1 47 PRO n 
1 48 PHE n 
1 49 GLY n 
1 50 ALA n 
1 51 SER n 
1 52 VAL n 
1 53 THR n 
1 54 ILE n 
1 55 ASP n 
1 56 GLY n 
1 57 VAL n 
1 58 THR n 
1 59 TYR n 
1 60 GLY n 
1 61 SER n 
1 62 GLY n 
1 63 THR n 
1 64 ALA n 
1 65 SER n 
1 66 SER n 
1 67 LYS n 
1 68 LYS n 
1 69 LEU n 
1 70 ALA n 
1 71 LYS n 
1 72 ASN n 
1 73 LYS n 
1 74 ALA n 
1 75 ALA n 
1 76 ARG n 
1 77 ALA n 
1 78 THR n 
1 79 LEU n 
1 80 GLU n 
1 81 ILE n 
1 82 LEU n 
1 83 ILE n 
1 84 PRO n 
1 85 ASP n 
1 86 PHE n 
1 87 VAL n 
1 88 LYS n 
1 89 GLN n 
1 90 THR n 
1 91 SER n 
1 92 GLU n 
1 93 SER n 
1 94 GLY n 
1 95 PRO n 
1 96 SER n 
1 97 SER n 
1 98 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'DGCR8, DGCRK6' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       P040223-57 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'Cell free protein synthesis' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    DGCR8_HUMAN 
_struct_ref.pdbx_db_accession          Q8WYQ5 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;EFVINPNGKSEVCILHEYMQRVLKVRPVYNFFECENPSEPFGASVTIDGVTYGSGTASSKKLAKNKAARATLEILIPDFV
KQTSE
;
_struct_ref.pdbx_align_begin           502 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1X47 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 8 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 92 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q8WYQ5 
_struct_ref_seq.db_align_beg                  502 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  586 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       8 
_struct_ref_seq.pdbx_auth_seq_align_end       92 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1X47 GLY A 1  ? UNP Q8WYQ5 ? ? 'CLONING ARTIFACT' 1  1  
1 1X47 SER A 2  ? UNP Q8WYQ5 ? ? 'CLONING ARTIFACT' 2  2  
1 1X47 SER A 3  ? UNP Q8WYQ5 ? ? 'CLONING ARTIFACT' 3  3  
1 1X47 GLY A 4  ? UNP Q8WYQ5 ? ? 'CLONING ARTIFACT' 4  4  
1 1X47 SER A 5  ? UNP Q8WYQ5 ? ? 'CLONING ARTIFACT' 5  5  
1 1X47 SER A 6  ? UNP Q8WYQ5 ? ? 'CLONING ARTIFACT' 6  6  
1 1X47 GLY A 7  ? UNP Q8WYQ5 ? ? 'CLONING ARTIFACT' 7  7  
1 1X47 SER A 93 ? UNP Q8WYQ5 ? ? 'CLONING ARTIFACT' 93 8  
1 1X47 GLY A 94 ? UNP Q8WYQ5 ? ? 'CLONING ARTIFACT' 94 9  
1 1X47 PRO A 95 ? UNP Q8WYQ5 ? ? 'CLONING ARTIFACT' 95 10 
1 1X47 SER A 96 ? UNP Q8WYQ5 ? ? 'CLONING ARTIFACT' 96 11 
1 1X47 SER A 97 ? UNP Q8WYQ5 ? ? 'CLONING ARTIFACT' 97 12 
1 1X47 GLY A 98 ? UNP Q8WYQ5 ? ? 'CLONING ARTIFACT' 98 13 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 3D_15N-separated_NOESY 1 
2 1 3D_13C-separated_NOESY 1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      120mM 
_pdbx_nmr_exptl_sample_conditions.pressure_units      . 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         '0.8mM U-15,13C; 20mM phosphate buffer NA; 100mM NaCl; 1mM d-DTT; 0.02% NaN3' 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.model             Avance 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.field_strength    700 
_pdbx_nmr_spectrometer.type              ? 
# 
_pdbx_nmr_refine.entry_id           1X47 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      1X47 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'target function, structures with the lowest energy' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             1X47 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
collection           XWINNMR 2.6      Bruker       1 
processing           NMRPipe 20031121 Delaglio,F.  2 
'data analysis'      NMRView 5.0.4    Johnson,B.A. 3 
'data analysis'      Kujira  0.863    Kobayashi,N. 4 
'structure solution' CYANA   1.0.8    Guntert,P.   5 
refinement           CYANA   1.0.8    Guntert,P.   6 
# 
_exptl.entry_id          1X47 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  1X47 
_struct.title                     'Solution structure of DSRM domain in DGCR8 protein' 
_struct.pdbx_descriptor           'DGCR8 protein' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1X47 
_struct_keywords.pdbx_keywords   'RNA BINDING PROTEIN' 
_struct_keywords.text            
;structural genomics, DSRM domain, DGCR8 protein, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN
;
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLU A 18 ? VAL A 29 ? GLU A 18 VAL A 29 1 ? 12 
HELX_P HELX_P2 2 LYS A 67 ? LEU A 82 ? LYS A 67 LEU A 82 1 ? 16 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   3 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 35 ? GLU A 40 ? VAL A 35 GLU A 40 
A 2 PHE A 48 ? ILE A 54 ? PHE A 48 ILE A 54 
A 3 VAL A 57 ? ALA A 64 ? VAL A 57 ALA A 64 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ASN A 37 ? N ASN A 37 O SER A 51 ? O SER A 51 
A 2 3 N ILE A 54 ? N ILE A 54 O VAL A 57 ? O VAL A 57 
# 
_database_PDB_matrix.entry_id          1X47 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1X47 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . GLY A 1 1  ? -10.382 -15.529 -7.931  1.00 0.00 ? 1  GLY A N    1  
ATOM 2     C CA   . GLY A 1 1  ? -10.561 -16.564 -8.934  1.00 0.00 ? 1  GLY A CA   1  
ATOM 3     C C    . GLY A 1 1  ? -10.298 -16.018 -10.339 1.00 0.00 ? 1  GLY A C    1  
ATOM 4     O O    . GLY A 1 1  ? -11.203 -15.974 -11.171 1.00 0.00 ? 1  GLY A O    1  
ATOM 5     H H1   . GLY A 1 1  ? -9.728  -14.813 -8.174  1.00 0.00 ? 1  GLY A H1   1  
ATOM 6     H HA2  . GLY A 1 1  ? -9.884  -17.394 -8.730  1.00 0.00 ? 1  GLY A HA2  1  
ATOM 7     H HA3  . GLY A 1 1  ? -11.575 -16.959 -8.877  1.00 0.00 ? 1  GLY A HA3  1  
ATOM 8     N N    . SER A 1 2  ? -9.056  -15.615 -10.560 1.00 0.00 ? 2  SER A N    1  
ATOM 9     C CA   . SER A 1 2  ? -8.662  -15.073 -11.849 1.00 0.00 ? 2  SER A CA   1  
ATOM 10    C C    . SER A 1 2  ? -7.143  -14.906 -11.906 1.00 0.00 ? 2  SER A C    1  
ATOM 11    O O    . SER A 1 2  ? -6.557  -14.227 -11.063 1.00 0.00 ? 2  SER A O    1  
ATOM 12    C CB   . SER A 1 2  ? -9.353  -13.735 -12.118 1.00 0.00 ? 2  SER A CB   1  
ATOM 13    O OG   . SER A 1 2  ? -9.117  -12.793 -11.075 1.00 0.00 ? 2  SER A OG   1  
ATOM 14    H H    . SER A 1 2  ? -8.325  -15.654 -9.877  1.00 0.00 ? 2  SER A H    1  
ATOM 15    H HA   . SER A 1 2  ? -8.994  -15.807 -12.584 1.00 0.00 ? 2  SER A HA   1  
ATOM 16    H HB2  . SER A 1 2  ? -8.997  -13.326 -13.064 1.00 0.00 ? 2  SER A HB2  1  
ATOM 17    H HB3  . SER A 1 2  ? -10.426 -13.896 -12.225 1.00 0.00 ? 2  SER A HB3  1  
ATOM 18    H HG   . SER A 1 2  ? -9.851  -12.114 -11.055 1.00 0.00 ? 2  SER A HG   1  
ATOM 19    N N    . SER A 1 3  ? -6.547  -15.538 -12.907 1.00 0.00 ? 3  SER A N    1  
ATOM 20    C CA   . SER A 1 3  ? -5.106  -15.468 -13.084 1.00 0.00 ? 3  SER A CA   1  
ATOM 21    C C    . SER A 1 3  ? -4.771  -14.627 -14.317 1.00 0.00 ? 3  SER A C    1  
ATOM 22    O O    . SER A 1 3  ? -4.073  -13.620 -14.215 1.00 0.00 ? 3  SER A O    1  
ATOM 23    C CB   . SER A 1 3  ? -4.499  -16.866 -13.213 1.00 0.00 ? 3  SER A CB   1  
ATOM 24    O OG   . SER A 1 3  ? -4.908  -17.726 -12.153 1.00 0.00 ? 3  SER A OG   1  
ATOM 25    H H    . SER A 1 3  ? -7.030  -16.088 -13.587 1.00 0.00 ? 3  SER A H    1  
ATOM 26    H HA   . SER A 1 3  ? -4.727  -14.990 -12.180 1.00 0.00 ? 3  SER A HA   1  
ATOM 27    H HB2  . SER A 1 3  ? -4.793  -17.302 -14.168 1.00 0.00 ? 3  SER A HB2  1  
ATOM 28    H HB3  . SER A 1 3  ? -3.412  -16.790 -13.219 1.00 0.00 ? 3  SER A HB3  1  
ATOM 29    H HG   . SER A 1 3  ? -4.139  -17.902 -11.539 1.00 0.00 ? 3  SER A HG   1  
ATOM 30    N N    . GLY A 1 4  ? -5.285  -15.072 -15.455 1.00 0.00 ? 4  GLY A N    1  
ATOM 31    C CA   . GLY A 1 4  ? -5.048  -14.373 -16.707 1.00 0.00 ? 4  GLY A CA   1  
ATOM 32    C C    . GLY A 1 4  ? -3.605  -13.871 -16.790 1.00 0.00 ? 4  GLY A C    1  
ATOM 33    O O    . GLY A 1 4  ? -3.365  -12.665 -16.820 1.00 0.00 ? 4  GLY A O    1  
ATOM 34    H H    . GLY A 1 4  ? -5.852  -15.892 -15.529 1.00 0.00 ? 4  GLY A H    1  
ATOM 35    H HA2  . GLY A 1 4  ? -5.254  -15.040 -17.544 1.00 0.00 ? 4  GLY A HA2  1  
ATOM 36    H HA3  . GLY A 1 4  ? -5.736  -13.531 -16.792 1.00 0.00 ? 4  GLY A HA3  1  
ATOM 37    N N    . SER A 1 5  ? -2.683  -14.821 -16.826 1.00 0.00 ? 5  SER A N    1  
ATOM 38    C CA   . SER A 1 5  ? -1.270  -14.491 -16.906 1.00 0.00 ? 5  SER A CA   1  
ATOM 39    C C    . SER A 1 5  ? -0.882  -13.569 -15.748 1.00 0.00 ? 5  SER A C    1  
ATOM 40    O O    . SER A 1 5  ? -1.008  -12.350 -15.851 1.00 0.00 ? 5  SER A O    1  
ATOM 41    C CB   . SER A 1 5  ? -0.934  -13.831 -18.245 1.00 0.00 ? 5  SER A CB   1  
ATOM 42    O OG   . SER A 1 5  ? -0.457  -14.775 -19.200 1.00 0.00 ? 5  SER A OG   1  
ATOM 43    H H    . SER A 1 5  ? -2.887  -15.800 -16.801 1.00 0.00 ? 5  SER A H    1  
ATOM 44    H HA   . SER A 1 5  ? -0.746  -15.443 -16.828 1.00 0.00 ? 5  SER A HA   1  
ATOM 45    H HB2  . SER A 1 5  ? -1.821  -13.335 -18.637 1.00 0.00 ? 5  SER A HB2  1  
ATOM 46    H HB3  . SER A 1 5  ? -0.179  -13.060 -18.089 1.00 0.00 ? 5  SER A HB3  1  
ATOM 47    H HG   . SER A 1 5  ? -1.215  -15.332 -19.538 1.00 0.00 ? 5  SER A HG   1  
ATOM 48    N N    . SER A 1 6  ? -0.419  -14.187 -14.671 1.00 0.00 ? 6  SER A N    1  
ATOM 49    C CA   . SER A 1 6  ? -0.012  -13.438 -13.495 1.00 0.00 ? 6  SER A CA   1  
ATOM 50    C C    . SER A 1 6  ? 1.385   -12.851 -13.706 1.00 0.00 ? 6  SER A C    1  
ATOM 51    O O    . SER A 1 6  ? 2.159   -13.358 -14.516 1.00 0.00 ? 6  SER A O    1  
ATOM 52    C CB   . SER A 1 6  ? -0.035  -14.319 -12.245 1.00 0.00 ? 6  SER A CB   1  
ATOM 53    O OG   . SER A 1 6  ? -0.723  -13.696 -11.164 1.00 0.00 ? 6  SER A OG   1  
ATOM 54    H H    . SER A 1 6  ? -0.320  -15.179 -14.595 1.00 0.00 ? 6  SER A H    1  
ATOM 55    H HA   . SER A 1 6  ? -0.749  -12.641 -13.391 1.00 0.00 ? 6  SER A HA   1  
ATOM 56    H HB2  . SER A 1 6  ? -0.514  -15.269 -12.480 1.00 0.00 ? 6  SER A HB2  1  
ATOM 57    H HB3  . SER A 1 6  ? 0.988   -14.545 -11.942 1.00 0.00 ? 6  SER A HB3  1  
ATOM 58    H HG   . SER A 1 6  ? -0.877  -12.729 -11.369 1.00 0.00 ? 6  SER A HG   1  
ATOM 59    N N    . GLY A 1 7  ? 1.666   -11.791 -12.962 1.00 0.00 ? 7  GLY A N    1  
ATOM 60    C CA   . GLY A 1 7  ? 2.956   -11.130 -13.057 1.00 0.00 ? 7  GLY A CA   1  
ATOM 61    C C    . GLY A 1 7  ? 2.858   -9.853  -13.895 1.00 0.00 ? 7  GLY A C    1  
ATOM 62    O O    . GLY A 1 7  ? 3.055   -9.886  -15.109 1.00 0.00 ? 7  GLY A O    1  
ATOM 63    H H    . GLY A 1 7  ? 1.031   -11.385 -12.305 1.00 0.00 ? 7  GLY A H    1  
ATOM 64    H HA2  . GLY A 1 7  ? 3.319   -10.887 -12.059 1.00 0.00 ? 7  GLY A HA2  1  
ATOM 65    H HA3  . GLY A 1 7  ? 3.684   -11.808 -13.505 1.00 0.00 ? 7  GLY A HA3  1  
ATOM 66    N N    . GLU A 1 8  ? 2.554   -8.759  -13.213 1.00 0.00 ? 8  GLU A N    1  
ATOM 67    C CA   . GLU A 1 8  ? 2.427   -7.474  -13.879 1.00 0.00 ? 8  GLU A CA   1  
ATOM 68    C C    . GLU A 1 8  ? 2.200   -6.363  -12.851 1.00 0.00 ? 8  GLU A C    1  
ATOM 69    O O    . GLU A 1 8  ? 1.083   -6.179  -12.368 1.00 0.00 ? 8  GLU A O    1  
ATOM 70    C CB   . GLU A 1 8  ? 1.301   -7.501  -14.914 1.00 0.00 ? 8  GLU A CB   1  
ATOM 71    C CG   . GLU A 1 8  ? 1.613   -6.570  -16.088 1.00 0.00 ? 8  GLU A CG   1  
ATOM 72    C CD   . GLU A 1 8  ? 1.779   -7.362  -17.387 1.00 0.00 ? 8  GLU A CD   1  
ATOM 73    O OE1  . GLU A 1 8  ? 0.775   -7.974  -17.811 1.00 0.00 ? 8  GLU A OE1  1  
ATOM 74    O OE2  . GLU A 1 8  ? 2.906   -7.337  -17.926 1.00 0.00 ? 8  GLU A OE2  1  
ATOM 75    H H    . GLU A 1 8  ? 2.395   -8.741  -12.226 1.00 0.00 ? 8  GLU A H    1  
ATOM 76    H HA   . GLU A 1 8  ? 3.378   -7.317  -14.389 1.00 0.00 ? 8  GLU A HA   1  
ATOM 77    H HB2  . GLU A 1 8  ? 1.163   -8.519  -15.280 1.00 0.00 ? 8  GLU A HB2  1  
ATOM 78    H HB3  . GLU A 1 8  ? 0.364   -7.201  -14.446 1.00 0.00 ? 8  GLU A HB3  1  
ATOM 79    H HG2  . GLU A 1 8  ? 0.810   -5.842  -16.202 1.00 0.00 ? 8  GLU A HG2  1  
ATOM 80    H HG3  . GLU A 1 8  ? 2.524   -6.010  -15.880 1.00 0.00 ? 8  GLU A HG3  1  
ATOM 81    N N    . PHE A 1 9  ? 3.276   -5.653  -12.547 1.00 0.00 ? 9  PHE A N    1  
ATOM 82    C CA   . PHE A 1 9  ? 3.207   -4.566  -11.585 1.00 0.00 ? 9  PHE A CA   1  
ATOM 83    C C    . PHE A 1 9  ? 3.910   -3.316  -12.119 1.00 0.00 ? 9  PHE A C    1  
ATOM 84    O O    . PHE A 1 9  ? 4.842   -2.810  -11.497 1.00 0.00 ? 9  PHE A O    1  
ATOM 85    C CB   . PHE A 1 9  ? 3.928   -5.041  -10.322 1.00 0.00 ? 9  PHE A CB   1  
ATOM 86    C CG   . PHE A 1 9  ? 3.106   -6.003  -9.461  1.00 0.00 ? 9  PHE A CG   1  
ATOM 87    C CD1  . PHE A 1 9  ? 2.968   -7.303  -9.836  1.00 0.00 ? 9  PHE A CD1  1  
ATOM 88    C CD2  . PHE A 1 9  ? 2.513   -5.558  -8.321  1.00 0.00 ? 9  PHE A CD2  1  
ATOM 89    C CE1  . PHE A 1 9  ? 2.206   -8.195  -9.038  1.00 0.00 ? 9  PHE A CE1  1  
ATOM 90    C CE2  . PHE A 1 9  ? 1.750   -6.450  -7.522  1.00 0.00 ? 9  PHE A CE2  1  
ATOM 91    C CZ   . PHE A 1 9  ? 1.613   -7.750  -7.898  1.00 0.00 ? 9  PHE A CZ   1  
ATOM 92    H H    . PHE A 1 9  ? 4.180   -5.809  -12.944 1.00 0.00 ? 9  PHE A H    1  
ATOM 93    H HA   . PHE A 1 9  ? 2.153   -4.345  -11.421 1.00 0.00 ? 9  PHE A HA   1  
ATOM 94    H HB2  . PHE A 1 9  ? 4.858   -5.531  -10.608 1.00 0.00 ? 9  PHE A HB2  1  
ATOM 95    H HB3  . PHE A 1 9  ? 4.197   -4.172  -9.721  1.00 0.00 ? 9  PHE A HB3  1  
ATOM 96    H HD1  . PHE A 1 9  ? 3.444   -7.659  -10.750 1.00 0.00 ? 9  PHE A HD1  1  
ATOM 97    H HD2  . PHE A 1 9  ? 2.623   -4.516  -8.020  1.00 0.00 ? 9  PHE A HD2  1  
ATOM 98    H HE1  . PHE A 1 9  ? 2.095   -9.237  -9.339  1.00 0.00 ? 9  PHE A HE1  1  
ATOM 99    H HE2  . PHE A 1 9  ? 1.275   -6.094  -6.609  1.00 0.00 ? 9  PHE A HE2  1  
ATOM 100   H HZ   . PHE A 1 9  ? 1.027   -8.436  -7.285  1.00 0.00 ? 9  PHE A HZ   1  
ATOM 101   N N    . VAL A 1 10 ? 3.436   -2.855  -13.267 1.00 0.00 ? 10 VAL A N    1  
ATOM 102   C CA   . VAL A 1 10 ? 4.008   -1.674  -13.892 1.00 0.00 ? 10 VAL A CA   1  
ATOM 103   C C    . VAL A 1 10 ? 5.532   -1.727  -13.775 1.00 0.00 ? 10 VAL A C    1  
ATOM 104   O O    . VAL A 1 10 ? 6.112   -1.094  -12.894 1.00 0.00 ? 10 VAL A O    1  
ATOM 105   C CB   . VAL A 1 10 ? 3.404   -0.411  -13.275 1.00 0.00 ? 10 VAL A CB   1  
ATOM 106   C CG1  . VAL A 1 10 ? 3.898   0.843   -13.999 1.00 0.00 ? 10 VAL A CG1  1  
ATOM 107   C CG2  . VAL A 1 10 ? 1.875   -0.478  -13.275 1.00 0.00 ? 10 VAL A CG2  1  
ATOM 108   H H    . VAL A 1 10 ? 2.678   -3.273  -13.767 1.00 0.00 ? 10 VAL A H    1  
ATOM 109   H HA   . VAL A 1 10 ? 3.736   -1.697  -14.948 1.00 0.00 ? 10 VAL A HA   1  
ATOM 110   H HB   . VAL A 1 10 ? 3.736   -0.353  -12.239 1.00 0.00 ? 10 VAL A HB   1  
ATOM 111   H HG11 . VAL A 1 10 ? 4.788   0.601   -14.579 1.00 0.00 ? 10 VAL A HG11 1  
ATOM 112   H HG12 . VAL A 1 10 ? 3.117   1.208   -14.666 1.00 0.00 ? 10 VAL A HG12 1  
ATOM 113   H HG13 . VAL A 1 10 ? 4.140   1.613   -13.267 1.00 0.00 ? 10 VAL A HG13 1  
ATOM 114   H HG21 . VAL A 1 10 ? 1.556   -1.496  -13.051 1.00 0.00 ? 10 VAL A HG21 1  
ATOM 115   H HG22 . VAL A 1 10 ? 1.482   0.201   -12.518 1.00 0.00 ? 10 VAL A HG22 1  
ATOM 116   H HG23 . VAL A 1 10 ? 1.498   -0.186  -14.255 1.00 0.00 ? 10 VAL A HG23 1  
ATOM 117   N N    . ILE A 1 11 ? 6.137   -2.488  -14.675 1.00 0.00 ? 11 ILE A N    1  
ATOM 118   C CA   . ILE A 1 11 ? 7.583   -2.632  -14.683 1.00 0.00 ? 11 ILE A CA   1  
ATOM 119   C C    . ILE A 1 11 ? 8.220   -1.311  -15.120 1.00 0.00 ? 11 ILE A C    1  
ATOM 120   O O    . ILE A 1 11 ? 7.710   -0.638  -16.014 1.00 0.00 ? 11 ILE A O    1  
ATOM 121   C CB   . ILE A 1 11 ? 7.998   -3.828  -15.541 1.00 0.00 ? 11 ILE A CB   1  
ATOM 122   C CG1  . ILE A 1 11 ? 7.351   -3.760  -16.926 1.00 0.00 ? 11 ILE A CG1  1  
ATOM 123   C CG2  . ILE A 1 11 ? 7.689   -5.147  -14.829 1.00 0.00 ? 11 ILE A CG2  1  
ATOM 124   C CD1  . ILE A 1 11 ? 8.263   -4.378  -17.988 1.00 0.00 ? 11 ILE A CD1  1  
ATOM 125   H H    . ILE A 1 11 ? 5.658   -2.999  -15.388 1.00 0.00 ? 11 ILE A H    1  
ATOM 126   H HA   . ILE A 1 11 ? 7.896   -2.845  -13.660 1.00 0.00 ? 11 ILE A HA   1  
ATOM 127   H HB   . ILE A 1 11 ? 9.077   -3.786  -15.687 1.00 0.00 ? 11 ILE A HB   1  
ATOM 128   H HG12 . ILE A 1 11 ? 6.396   -4.284  -16.912 1.00 0.00 ? 11 ILE A HG12 1  
ATOM 129   H HG13 . ILE A 1 11 ? 7.141   -2.721  -17.183 1.00 0.00 ? 11 ILE A HG13 1  
ATOM 130   H HG21 . ILE A 1 11 ? 6.875   -4.995  -14.121 1.00 0.00 ? 11 ILE A HG21 1  
ATOM 131   H HG22 . ILE A 1 11 ? 7.397   -5.897  -15.564 1.00 0.00 ? 11 ILE A HG22 1  
ATOM 132   H HG23 . ILE A 1 11 ? 8.577   -5.488  -14.296 1.00 0.00 ? 11 ILE A HG23 1  
ATOM 133   H HD11 . ILE A 1 11 ? 8.587   -3.605  -18.684 1.00 0.00 ? 11 ILE A HD11 1  
ATOM 134   H HD12 . ILE A 1 11 ? 9.134   -4.821  -17.506 1.00 0.00 ? 11 ILE A HD12 1  
ATOM 135   H HD13 . ILE A 1 11 ? 7.717   -5.150  -18.531 1.00 0.00 ? 11 ILE A HD13 1  
ATOM 136   N N    . ASN A 1 12 ? 9.325   -0.980  -14.468 1.00 0.00 ? 12 ASN A N    1  
ATOM 137   C CA   . ASN A 1 12 ? 10.037  0.248   -14.778 1.00 0.00 ? 12 ASN A CA   1  
ATOM 138   C C    . ASN A 1 12 ? 11.342  0.291   -13.981 1.00 0.00 ? 12 ASN A C    1  
ATOM 139   O O    . ASN A 1 12 ? 11.359  0.737   -12.834 1.00 0.00 ? 12 ASN A O    1  
ATOM 140   C CB   . ASN A 1 12 ? 9.209   1.477   -14.396 1.00 0.00 ? 12 ASN A CB   1  
ATOM 141   C CG   . ASN A 1 12 ? 9.085   2.443   -15.576 1.00 0.00 ? 12 ASN A CG   1  
ATOM 142   O OD1  . ASN A 1 12 ? 8.054   2.546   -16.221 1.00 0.00 ? 12 ASN A OD1  1  
ATOM 143   N ND2  . ASN A 1 12 ? 10.189  3.142   -15.821 1.00 0.00 ? 12 ASN A ND2  1  
ATOM 144   H H    . ASN A 1 12 ? 9.733   -1.533  -13.742 1.00 0.00 ? 12 ASN A H    1  
ATOM 145   H HA   . ASN A 1 12 ? 10.207  0.217   -15.854 1.00 0.00 ? 12 ASN A HA   1  
ATOM 146   H HB2  . ASN A 1 12 ? 8.217   1.164   -14.072 1.00 0.00 ? 12 ASN A HB2  1  
ATOM 147   H HB3  . ASN A 1 12 ? 9.675   1.986   -13.552 1.00 0.00 ? 12 ASN A HB3  1  
ATOM 148   H HD21 . ASN A 1 12 ? 11.002  3.009   -15.253 1.00 0.00 ? 12 ASN A HD21 1  
ATOM 149   H HD22 . ASN A 1 12 ? 10.207  3.801   -16.573 1.00 0.00 ? 12 ASN A HD22 1  
ATOM 150   N N    . PRO A 1 13 ? 12.432  -0.190  -14.636 1.00 0.00 ? 13 PRO A N    1  
ATOM 151   C CA   . PRO A 1 13 ? 13.739  -0.211  -14.000 1.00 0.00 ? 13 PRO A CA   1  
ATOM 152   C C    . PRO A 1 13 ? 14.346  1.193   -13.950 1.00 0.00 ? 13 PRO A C    1  
ATOM 153   O O    . PRO A 1 13 ? 15.042  1.605   -14.876 1.00 0.00 ? 13 PRO A O    1  
ATOM 154   C CB   . PRO A 1 13 ? 14.563  -1.185  -14.826 1.00 0.00 ? 13 PRO A CB   1  
ATOM 155   C CG   . PRO A 1 13 ? 13.840  -1.318  -16.157 1.00 0.00 ? 13 PRO A CG   1  
ATOM 156   C CD   . PRO A 1 13 ? 12.450  -0.726  -15.994 1.00 0.00 ? 13 PRO A CD   1  
ATOM 157   H HA   . PRO A 1 13 ? 13.657  -0.508  -13.049 1.00 0.00 ? 13 PRO A HA   1  
ATOM 158   H HB2  . PRO A 1 13 ? 15.578  -0.815  -14.969 1.00 0.00 ? 13 PRO A HB2  1  
ATOM 159   H HB3  . PRO A 1 13 ? 14.642  -2.151  -14.327 1.00 0.00 ? 13 PRO A HB3  1  
ATOM 160   H HG2  . PRO A 1 13 ? 14.388  -0.797  -16.943 1.00 0.00 ? 13 PRO A HG2  1  
ATOM 161   H HG3  . PRO A 1 13 ? 13.777  -2.365  -16.454 1.00 0.00 ? 13 PRO A HG3  1  
ATOM 162   H HD2  . PRO A 1 13 ? 12.264  0.056   -16.730 1.00 0.00 ? 13 PRO A HD2  1  
ATOM 163   H HD3  . PRO A 1 13 ? 11.678  -1.483  -16.131 1.00 0.00 ? 13 PRO A HD3  1  
ATOM 164   N N    . ASN A 1 14 ? 14.061  1.887   -12.859 1.00 0.00 ? 14 ASN A N    1  
ATOM 165   C CA   . ASN A 1 14 ? 14.570  3.236   -12.675 1.00 0.00 ? 14 ASN A CA   1  
ATOM 166   C C    . ASN A 1 14 ? 15.033  3.409   -11.227 1.00 0.00 ? 14 ASN A C    1  
ATOM 167   O O    . ASN A 1 14 ? 16.191  3.739   -10.977 1.00 0.00 ? 14 ASN A O    1  
ATOM 168   C CB   . ASN A 1 14 ? 13.484  4.277   -12.952 1.00 0.00 ? 14 ASN A CB   1  
ATOM 169   C CG   . ASN A 1 14 ? 14.069  5.510   -13.643 1.00 0.00 ? 14 ASN A CG   1  
ATOM 170   O OD1  . ASN A 1 14 ? 15.271  5.713   -13.693 1.00 0.00 ? 14 ASN A OD1  1  
ATOM 171   N ND2  . ASN A 1 14 ? 13.156  6.318   -14.173 1.00 0.00 ? 14 ASN A ND2  1  
ATOM 172   H H    . ASN A 1 14 ? 13.494  1.544   -12.110 1.00 0.00 ? 14 ASN A H    1  
ATOM 173   H HA   . ASN A 1 14 ? 15.388  3.333   -13.389 1.00 0.00 ? 14 ASN A HA   1  
ATOM 174   H HB2  . ASN A 1 14 ? 12.706  3.839   -13.577 1.00 0.00 ? 14 ASN A HB2  1  
ATOM 175   H HB3  . ASN A 1 14 ? 13.011  4.572   -12.015 1.00 0.00 ? 14 ASN A HB3  1  
ATOM 176   H HD21 . ASN A 1 14 ? 12.184  6.093   -14.096 1.00 0.00 ? 14 ASN A HD21 1  
ATOM 177   H HD22 . ASN A 1 14 ? 13.440  7.152   -14.647 1.00 0.00 ? 14 ASN A HD22 1  
ATOM 178   N N    . GLY A 1 15 ? 14.105  3.177   -10.311 1.00 0.00 ? 15 GLY A N    1  
ATOM 179   C CA   . GLY A 1 15 ? 14.403  3.303   -8.894  1.00 0.00 ? 15 GLY A CA   1  
ATOM 180   C C    . GLY A 1 15 ? 13.391  2.527   -8.049  1.00 0.00 ? 15 GLY A C    1  
ATOM 181   O O    . GLY A 1 15 ? 12.777  1.575   -8.528  1.00 0.00 ? 15 GLY A O    1  
ATOM 182   H H    . GLY A 1 15 ? 13.165  2.908   -10.522 1.00 0.00 ? 15 GLY A H    1  
ATOM 183   H HA2  . GLY A 1 15 ? 15.408  2.931   -8.696  1.00 0.00 ? 15 GLY A HA2  1  
ATOM 184   H HA3  . GLY A 1 15 ? 14.391  4.355   -8.609  1.00 0.00 ? 15 GLY A HA3  1  
ATOM 185   N N    . LYS A 1 16 ? 13.247  2.964   -6.807  1.00 0.00 ? 16 LYS A N    1  
ATOM 186   C CA   . LYS A 1 16 ? 12.319  2.323   -5.891  1.00 0.00 ? 16 LYS A CA   1  
ATOM 187   C C    . LYS A 1 16 ? 11.415  3.384   -5.261  1.00 0.00 ? 16 LYS A C    1  
ATOM 188   O O    . LYS A 1 16 ? 11.901  4.345   -4.666  1.00 0.00 ? 16 LYS A O    1  
ATOM 189   C CB   . LYS A 1 16 ? 13.077  1.475   -4.867  1.00 0.00 ? 16 LYS A CB   1  
ATOM 190   C CG   . LYS A 1 16 ? 14.269  2.244   -4.293  1.00 0.00 ? 16 LYS A CG   1  
ATOM 191   C CD   . LYS A 1 16 ? 14.327  2.107   -2.770  1.00 0.00 ? 16 LYS A CD   1  
ATOM 192   C CE   . LYS A 1 16 ? 15.768  2.203   -2.266  1.00 0.00 ? 16 LYS A CE   1  
ATOM 193   N NZ   . LYS A 1 16 ? 16.110  3.605   -1.938  1.00 0.00 ? 16 LYS A NZ   1  
ATOM 194   H H    . LYS A 1 16 ? 13.750  3.740   -6.425  1.00 0.00 ? 16 LYS A H    1  
ATOM 195   H HA   . LYS A 1 16 ? 11.699  1.643   -6.476  1.00 0.00 ? 16 LYS A HA   1  
ATOM 196   H HB2  . LYS A 1 16 ? 12.405  1.184   -4.060  1.00 0.00 ? 16 LYS A HB2  1  
ATOM 197   H HB3  . LYS A 1 16 ? 13.426  0.555   -5.338  1.00 0.00 ? 16 LYS A HB3  1  
ATOM 198   H HG2  . LYS A 1 16 ? 15.194  1.868   -4.731  1.00 0.00 ? 16 LYS A HG2  1  
ATOM 199   H HG3  . LYS A 1 16 ? 14.192  3.296   -4.564  1.00 0.00 ? 16 LYS A HG3  1  
ATOM 200   H HD2  . LYS A 1 16 ? 13.723  2.888   -2.308  1.00 0.00 ? 16 LYS A HD2  1  
ATOM 201   H HD3  . LYS A 1 16 ? 13.896  1.152   -2.470  1.00 0.00 ? 16 LYS A HD3  1  
ATOM 202   H HE2  . LYS A 1 16 ? 15.894  1.576   -1.383  1.00 0.00 ? 16 LYS A HE2  1  
ATOM 203   H HE3  . LYS A 1 16 ? 16.452  1.824   -3.026  1.00 0.00 ? 16 LYS A HE3  1  
ATOM 204   H HZ1  . LYS A 1 16 ? 15.959  3.766   -0.963  1.00 0.00 ? 16 LYS A HZ1  1  
ATOM 205   H HZ2  . LYS A 1 16 ? 17.071  3.775   -2.159  1.00 0.00 ? 16 LYS A HZ2  1  
ATOM 206   H HZ3  . LYS A 1 16 ? 15.532  4.223   -2.471  1.00 0.00 ? 16 LYS A HZ3  1  
ATOM 207   N N    . SER A 1 17 ? 10.116  3.175   -5.413  1.00 0.00 ? 17 SER A N    1  
ATOM 208   C CA   . SER A 1 17 ? 9.139   4.101   -4.867  1.00 0.00 ? 17 SER A CA   1  
ATOM 209   C C    . SER A 1 17 ? 8.415   3.460   -3.681  1.00 0.00 ? 17 SER A C    1  
ATOM 210   O O    . SER A 1 17 ? 8.640   2.292   -3.370  1.00 0.00 ? 17 SER A O    1  
ATOM 211   C CB   . SER A 1 17 ? 8.131   4.532   -5.934  1.00 0.00 ? 17 SER A CB   1  
ATOM 212   O OG   . SER A 1 17 ? 8.771   5.087   -7.080  1.00 0.00 ? 17 SER A OG   1  
ATOM 213   H H    . SER A 1 17 ? 9.729   2.390   -5.898  1.00 0.00 ? 17 SER A H    1  
ATOM 214   H HA   . SER A 1 17 ? 9.715   4.968   -4.541  1.00 0.00 ? 17 SER A HA   1  
ATOM 215   H HB2  . SER A 1 17 ? 7.532   3.672   -6.235  1.00 0.00 ? 17 SER A HB2  1  
ATOM 216   H HB3  . SER A 1 17 ? 7.446   5.266   -5.510  1.00 0.00 ? 17 SER A HB3  1  
ATOM 217   H HG   . SER A 1 17 ? 9.698   4.723   -7.164  1.00 0.00 ? 17 SER A HG   1  
ATOM 218   N N    . GLU A 1 18 ? 7.561   4.253   -3.051  1.00 0.00 ? 18 GLU A N    1  
ATOM 219   C CA   . GLU A 1 18 ? 6.803   3.778   -1.906  1.00 0.00 ? 18 GLU A CA   1  
ATOM 220   C C    . GLU A 1 18 ? 6.190   2.408   -2.207  1.00 0.00 ? 18 GLU A C    1  
ATOM 221   O O    . GLU A 1 18 ? 6.400   1.453   -1.462  1.00 0.00 ? 18 GLU A O    1  
ATOM 222   C CB   . GLU A 1 18 ? 5.724   4.786   -1.507  1.00 0.00 ? 18 GLU A CB   1  
ATOM 223   C CG   . GLU A 1 18 ? 5.718   5.011   0.007   1.00 0.00 ? 18 GLU A CG   1  
ATOM 224   C CD   . GLU A 1 18 ? 6.824   5.984   0.420   1.00 0.00 ? 18 GLU A CD   1  
ATOM 225   O OE1  . GLU A 1 18 ? 6.633   7.196   0.178   1.00 0.00 ? 18 GLU A OE1  1  
ATOM 226   O OE2  . GLU A 1 18 ? 7.834   5.494   0.969   1.00 0.00 ? 18 GLU A OE2  1  
ATOM 227   H H    . GLU A 1 18 ? 7.384   5.203   -3.310  1.00 0.00 ? 18 GLU A H    1  
ATOM 228   H HA   . GLU A 1 18 ? 7.527   3.689   -1.096  1.00 0.00 ? 18 GLU A HA   1  
ATOM 229   H HB2  . GLU A 1 18 ? 5.897   5.732   -2.018  1.00 0.00 ? 18 GLU A HB2  1  
ATOM 230   H HB3  . GLU A 1 18 ? 4.747   4.424   -1.828  1.00 0.00 ? 18 GLU A HB3  1  
ATOM 231   H HG2  . GLU A 1 18 ? 4.749   5.403   0.315   1.00 0.00 ? 18 GLU A HG2  1  
ATOM 232   H HG3  . GLU A 1 18 ? 5.855   4.060   0.520   1.00 0.00 ? 18 GLU A HG3  1  
ATOM 233   N N    . VAL A 1 19 ? 5.445   2.357   -3.302  1.00 0.00 ? 19 VAL A N    1  
ATOM 234   C CA   . VAL A 1 19 ? 4.801   1.120   -3.710  1.00 0.00 ? 19 VAL A CA   1  
ATOM 235   C C    . VAL A 1 19 ? 5.804   -0.031  -3.608  1.00 0.00 ? 19 VAL A C    1  
ATOM 236   O O    . VAL A 1 19 ? 5.450   -1.132  -3.189  1.00 0.00 ? 19 VAL A O    1  
ATOM 237   C CB   . VAL A 1 19 ? 4.211   1.277   -5.114  1.00 0.00 ? 19 VAL A CB   1  
ATOM 238   C CG1  . VAL A 1 19 ? 3.141   2.370   -5.140  1.00 0.00 ? 19 VAL A CG1  1  
ATOM 239   C CG2  . VAL A 1 19 ? 5.309   1.558   -6.141  1.00 0.00 ? 19 VAL A CG2  1  
ATOM 240   H H    . VAL A 1 19 ? 5.280   3.138   -3.903  1.00 0.00 ? 19 VAL A H    1  
ATOM 241   H HA   . VAL A 1 19 ? 3.980   0.933   -3.018  1.00 0.00 ? 19 VAL A HA   1  
ATOM 242   H HB   . VAL A 1 19 ? 3.733   0.335   -5.383  1.00 0.00 ? 19 VAL A HB   1  
ATOM 243   H HG11 . VAL A 1 19 ? 2.712   2.482   -4.144  1.00 0.00 ? 19 VAL A HG11 1  
ATOM 244   H HG12 . VAL A 1 19 ? 3.593   3.313   -5.449  1.00 0.00 ? 19 VAL A HG12 1  
ATOM 245   H HG13 . VAL A 1 19 ? 2.357   2.095   -5.845  1.00 0.00 ? 19 VAL A HG13 1  
ATOM 246   H HG21 . VAL A 1 19 ? 6.012   0.725   -6.159  1.00 0.00 ? 19 VAL A HG21 1  
ATOM 247   H HG22 . VAL A 1 19 ? 4.861   1.677   -7.128  1.00 0.00 ? 19 VAL A HG22 1  
ATOM 248   H HG23 . VAL A 1 19 ? 5.836   2.472   -5.869  1.00 0.00 ? 19 VAL A HG23 1  
ATOM 249   N N    . CYS A 1 20 ? 7.035   0.263   -3.999  1.00 0.00 ? 20 CYS A N    1  
ATOM 250   C CA   . CYS A 1 20 ? 8.092   -0.733  -3.956  1.00 0.00 ? 20 CYS A CA   1  
ATOM 251   C C    . CYS A 1 20 ? 8.476   -0.964  -2.494  1.00 0.00 ? 20 CYS A C    1  
ATOM 252   O O    . CYS A 1 20 ? 8.355   -2.077  -1.985  1.00 0.00 ? 20 CYS A O    1  
ATOM 253   C CB   . CYS A 1 20 ? 9.296   -0.317  -4.804  1.00 0.00 ? 20 CYS A CB   1  
ATOM 254   S SG   . CYS A 1 20 ? 9.830   -1.713  -5.860  1.00 0.00 ? 20 CYS A SG   1  
ATOM 255   H H    . CYS A 1 20 ? 7.314   1.161   -4.339  1.00 0.00 ? 20 CYS A H    1  
ATOM 256   H HA   . CYS A 1 20 ? 7.683   -1.642  -4.397  1.00 0.00 ? 20 CYS A HA   1  
ATOM 257   H HB2  . CYS A 1 20 ? 9.035   0.540   -5.425  1.00 0.00 ? 20 CYS A HB2  1  
ATOM 258   H HB3  . CYS A 1 20 ? 10.116  -0.005  -4.157  1.00 0.00 ? 20 CYS A HB3  1  
ATOM 259   H HG   . CYS A 1 20 ? 11.111  -1.675  -5.504  1.00 0.00 ? 20 CYS A HG   1  
ATOM 260   N N    . ILE A 1 21 ? 8.931   0.106   -1.859  1.00 0.00 ? 21 ILE A N    1  
ATOM 261   C CA   . ILE A 1 21 ? 9.334   0.034   -0.464  1.00 0.00 ? 21 ILE A CA   1  
ATOM 262   C C    . ILE A 1 21 ? 8.317   -0.805  0.313   1.00 0.00 ? 21 ILE A C    1  
ATOM 263   O O    . ILE A 1 21 ? 8.666   -1.837  0.884   1.00 0.00 ? 21 ILE A O    1  
ATOM 264   C CB   . ILE A 1 21 ? 9.538   1.438   0.108   1.00 0.00 ? 21 ILE A CB   1  
ATOM 265   C CG1  . ILE A 1 21 ? 10.805  2.082   -0.459  1.00 0.00 ? 21 ILE A CG1  1  
ATOM 266   C CG2  . ILE A 1 21 ? 9.543   1.412   1.637   1.00 0.00 ? 21 ILE A CG2  1  
ATOM 267   C CD1  . ILE A 1 21 ? 10.730  3.608   -0.371  1.00 0.00 ? 21 ILE A CD1  1  
ATOM 268   H H    . ILE A 1 21 ? 9.026   1.008   -2.280  1.00 0.00 ? 21 ILE A H    1  
ATOM 269   H HA   . ILE A 1 21 ? 10.299  -0.472  -0.429  1.00 0.00 ? 21 ILE A HA   1  
ATOM 270   H HB   . ILE A 1 21 ? 8.696   2.058   -0.201  1.00 0.00 ? 21 ILE A HB   1  
ATOM 271   H HG12 . ILE A 1 21 ? 11.675  1.725   0.091   1.00 0.00 ? 21 ILE A HG12 1  
ATOM 272   H HG13 . ILE A 1 21 ? 10.938  1.780   -1.497  1.00 0.00 ? 21 ILE A HG13 1  
ATOM 273   H HG21 . ILE A 1 21 ? 9.616   0.380   1.983   1.00 0.00 ? 21 ILE A HG21 1  
ATOM 274   H HG22 . ILE A 1 21 ? 10.395  1.980   2.008   1.00 0.00 ? 21 ILE A HG22 1  
ATOM 275   H HG23 . ILE A 1 21 ? 8.620   1.855   2.011   1.00 0.00 ? 21 ILE A HG23 1  
ATOM 276   H HD11 . ILE A 1 21 ? 10.086  3.893   0.460   1.00 0.00 ? 21 ILE A HD11 1  
ATOM 277   H HD12 . ILE A 1 21 ? 11.730  4.012   -0.212  1.00 0.00 ? 21 ILE A HD12 1  
ATOM 278   H HD13 . ILE A 1 21 ? 10.322  4.006   -1.300  1.00 0.00 ? 21 ILE A HD13 1  
ATOM 279   N N    . LEU A 1 22 ? 7.080   -0.331  0.309   1.00 0.00 ? 22 LEU A N    1  
ATOM 280   C CA   . LEU A 1 22 ? 6.011   -1.025  1.006   1.00 0.00 ? 22 LEU A CA   1  
ATOM 281   C C    . LEU A 1 22 ? 6.110   -2.524  0.720   1.00 0.00 ? 22 LEU A C    1  
ATOM 282   O O    . LEU A 1 22 ? 6.088   -3.339  1.641   1.00 0.00 ? 22 LEU A O    1  
ATOM 283   C CB   . LEU A 1 22 ? 4.654   -0.418  0.645   1.00 0.00 ? 22 LEU A CB   1  
ATOM 284   C CG   . LEU A 1 22 ? 3.428   -1.270  0.978   1.00 0.00 ? 22 LEU A CG   1  
ATOM 285   C CD1  . LEU A 1 22 ? 3.273   -2.421  -0.018  1.00 0.00 ? 22 LEU A CD1  1  
ATOM 286   C CD2  . LEU A 1 22 ? 3.482   -1.768  2.424   1.00 0.00 ? 22 LEU A CD2  1  
ATOM 287   H H    . LEU A 1 22 ? 6.805   0.509   -0.159  1.00 0.00 ? 22 LEU A H    1  
ATOM 288   H HA   . LEU A 1 22 ? 6.161   -0.867  2.074   1.00 0.00 ? 22 LEU A HA   1  
ATOM 289   H HB2  . LEU A 1 22 ? 4.557   0.538   1.160   1.00 0.00 ? 22 LEU A HB2  1  
ATOM 290   H HB3  . LEU A 1 22 ? 4.645   -0.207  -0.424  1.00 0.00 ? 22 LEU A HB3  1  
ATOM 291   H HG   . LEU A 1 22 ? 2.540   -0.644  0.887   1.00 0.00 ? 22 LEU A HG   1  
ATOM 292   H HD11 . LEU A 1 22 ? 3.481   -3.366  0.483   1.00 0.00 ? 22 LEU A HD11 1  
ATOM 293   H HD12 . LEU A 1 22 ? 2.254   -2.432  -0.406  1.00 0.00 ? 22 LEU A HD12 1  
ATOM 294   H HD13 . LEU A 1 22 ? 3.973   -2.285  -0.842  1.00 0.00 ? 22 LEU A HD13 1  
ATOM 295   H HD21 . LEU A 1 22 ? 4.473   -2.171  2.633   1.00 0.00 ? 22 LEU A HD21 1  
ATOM 296   H HD22 . LEU A 1 22 ? 3.277   -0.939  3.102   1.00 0.00 ? 22 LEU A HD22 1  
ATOM 297   H HD23 . LEU A 1 22 ? 2.734   -2.548  2.568   1.00 0.00 ? 22 LEU A HD23 1  
ATOM 298   N N    . HIS A 1 23 ? 6.216   -2.844  -0.562  1.00 0.00 ? 23 HIS A N    1  
ATOM 299   C CA   . HIS A 1 23 ? 6.318   -4.231  -0.981  1.00 0.00 ? 23 HIS A CA   1  
ATOM 300   C C    . HIS A 1 23 ? 7.518   -4.888  -0.294  1.00 0.00 ? 23 HIS A C    1  
ATOM 301   O O    . HIS A 1 23 ? 7.388   -5.956  0.301   1.00 0.00 ? 23 HIS A O    1  
ATOM 302   C CB   . HIS A 1 23 ? 6.379   -4.335  -2.506  1.00 0.00 ? 23 HIS A CB   1  
ATOM 303   C CG   . HIS A 1 23 ? 6.045   -5.706  -3.043  1.00 0.00 ? 23 HIS A CG   1  
ATOM 304   N ND1  . HIS A 1 23 ? 5.271   -5.901  -4.174  1.00 0.00 ? 23 HIS A ND1  1  
ATOM 305   C CD2  . HIS A 1 23 ? 6.388   -6.947  -2.593  1.00 0.00 ? 23 HIS A CD2  1  
ATOM 306   C CE1  . HIS A 1 23 ? 5.159   -7.204  -4.385  1.00 0.00 ? 23 HIS A CE1  1  
ATOM 307   N NE2  . HIS A 1 23 ? 5.851   -7.851  -3.403  1.00 0.00 ? 23 HIS A NE2  1  
ATOM 308   H H    . HIS A 1 23 ? 6.233   -2.175  -1.305  1.00 0.00 ? 23 HIS A H    1  
ATOM 309   H HA   . HIS A 1 23 ? 5.405   -4.726  -0.650  1.00 0.00 ? 23 HIS A HA   1  
ATOM 310   H HB2  . HIS A 1 23 ? 5.689   -3.609  -2.937  1.00 0.00 ? 23 HIS A HB2  1  
ATOM 311   H HB3  . HIS A 1 23 ? 7.380   -4.059  -2.840  1.00 0.00 ? 23 HIS A HB3  1  
ATOM 312   H HD1  . HIS A 1 23 ? 4.865   -5.180  -4.736  1.00 0.00 ? 23 HIS A HD1  1  
ATOM 313   H HD2  . HIS A 1 23 ? 6.999   -7.160  -1.715  1.00 0.00 ? 23 HIS A HD2  1  
ATOM 314   H HE1  . HIS A 1 23 ? 4.610   -7.676  -5.199  1.00 0.00 ? 23 HIS A HE1  1  
ATOM 315   N N    . GLU A 1 24 ? 8.658   -4.221  -0.400  1.00 0.00 ? 24 GLU A N    1  
ATOM 316   C CA   . GLU A 1 24 ? 9.879   -4.727  0.203   1.00 0.00 ? 24 GLU A CA   1  
ATOM 317   C C    . GLU A 1 24 ? 9.616   -5.169  1.644   1.00 0.00 ? 24 GLU A C    1  
ATOM 318   O O    . GLU A 1 24 ? 9.630   -6.362  1.944   1.00 0.00 ? 24 GLU A O    1  
ATOM 319   C CB   . GLU A 1 24 ? 10.993  -3.680  0.145   1.00 0.00 ? 24 GLU A CB   1  
ATOM 320   C CG   . GLU A 1 24 ? 12.045  -4.056  -0.900  1.00 0.00 ? 24 GLU A CG   1  
ATOM 321   C CD   . GLU A 1 24 ? 13.288  -4.652  -0.237  1.00 0.00 ? 24 GLU A CD   1  
ATOM 322   O OE1  . GLU A 1 24 ? 13.224  -5.850  0.116   1.00 0.00 ? 24 GLU A OE1  1  
ATOM 323   O OE2  . GLU A 1 24 ? 14.275  -3.897  -0.098  1.00 0.00 ? 24 GLU A OE2  1  
ATOM 324   H H    . GLU A 1 24 ? 8.755   -3.353  -0.887  1.00 0.00 ? 24 GLU A H    1  
ATOM 325   H HA   . GLU A 1 24 ? 10.166  -5.588  -0.401  1.00 0.00 ? 24 GLU A HA   1  
ATOM 326   H HB2  . GLU A 1 24 ? 10.569  -2.705  -0.095  1.00 0.00 ? 24 GLU A HB2  1  
ATOM 327   H HB3  . GLU A 1 24 ? 11.464  -3.590  1.124   1.00 0.00 ? 24 GLU A HB3  1  
ATOM 328   H HG2  . GLU A 1 24 ? 11.624  -4.774  -1.604  1.00 0.00 ? 24 GLU A HG2  1  
ATOM 329   H HG3  . GLU A 1 24 ? 12.323  -3.173  -1.475  1.00 0.00 ? 24 GLU A HG3  1  
ATOM 330   N N    . TYR A 1 25 ? 9.382   -4.183  2.498   1.00 0.00 ? 25 TYR A N    1  
ATOM 331   C CA   . TYR A 1 25 ? 9.116   -4.455  3.900   1.00 0.00 ? 25 TYR A CA   1  
ATOM 332   C C    . TYR A 1 25 ? 8.046   -5.538  4.055   1.00 0.00 ? 25 TYR A C    1  
ATOM 333   O O    . TYR A 1 25 ? 8.134   -6.379  4.949   1.00 0.00 ? 25 TYR A O    1  
ATOM 334   C CB   . TYR A 1 25 ? 8.589   -3.146  4.491   1.00 0.00 ? 25 TYR A CB   1  
ATOM 335   C CG   . TYR A 1 25 ? 7.859   -3.315  5.825   1.00 0.00 ? 25 TYR A CG   1  
ATOM 336   C CD1  . TYR A 1 25 ? 6.628   -3.937  5.864   1.00 0.00 ? 25 TYR A CD1  1  
ATOM 337   C CD2  . TYR A 1 25 ? 8.432   -2.845  6.990   1.00 0.00 ? 25 TYR A CD2  1  
ATOM 338   C CE1  . TYR A 1 25 ? 5.941   -4.096  7.120   1.00 0.00 ? 25 TYR A CE1  1  
ATOM 339   C CE2  . TYR A 1 25 ? 7.745   -3.003  8.245   1.00 0.00 ? 25 TYR A CE2  1  
ATOM 340   C CZ   . TYR A 1 25 ? 6.534   -3.621  8.248   1.00 0.00 ? 25 TYR A CZ   1  
ATOM 341   O OH   . TYR A 1 25 ? 5.885   -3.771  9.434   1.00 0.00 ? 25 TYR A OH   1  
ATOM 342   H H    . TYR A 1 25 ? 9.373   -3.215  2.246   1.00 0.00 ? 25 TYR A H    1  
ATOM 343   H HA   . TYR A 1 25 ? 10.043  -4.802  4.357   1.00 0.00 ? 25 TYR A HA   1  
ATOM 344   H HB2  . TYR A 1 25 ? 9.425   -2.460  4.630   1.00 0.00 ? 25 TYR A HB2  1  
ATOM 345   H HB3  . TYR A 1 25 ? 7.912   -2.682  3.774   1.00 0.00 ? 25 TYR A HB3  1  
ATOM 346   H HD1  . TYR A 1 25 ? 6.176   -4.309  4.945   1.00 0.00 ? 25 TYR A HD1  1  
ATOM 347   H HD2  . TYR A 1 25 ? 9.405   -2.353  6.959   1.00 0.00 ? 25 TYR A HD2  1  
ATOM 348   H HE1  . TYR A 1 25 ? 4.968   -4.586  7.165   1.00 0.00 ? 25 TYR A HE1  1  
ATOM 349   H HE2  . TYR A 1 25 ? 8.186   -2.637  9.172   1.00 0.00 ? 25 TYR A HE2  1  
ATOM 350   H HH   . TYR A 1 25 ? 5.415   -4.653  9.457   1.00 0.00 ? 25 TYR A HH   1  
ATOM 351   N N    . MET A 1 26 ? 7.060   -5.482  3.172   1.00 0.00 ? 26 MET A N    1  
ATOM 352   C CA   . MET A 1 26 ? 5.975   -6.447  3.199   1.00 0.00 ? 26 MET A CA   1  
ATOM 353   C C    . MET A 1 26 ? 6.487   -7.857  2.899   1.00 0.00 ? 26 MET A C    1  
ATOM 354   O O    . MET A 1 26 ? 6.299   -8.773  3.698   1.00 0.00 ? 26 MET A O    1  
ATOM 355   C CB   . MET A 1 26 ? 4.918   -6.056  2.164   1.00 0.00 ? 26 MET A CB   1  
ATOM 356   C CG   . MET A 1 26 ? 3.747   -5.325  2.825   1.00 0.00 ? 26 MET A CG   1  
ATOM 357   S SD   . MET A 1 26 ? 2.204   -5.885  2.123   1.00 0.00 ? 26 MET A SD   1  
ATOM 358   C CE   . MET A 1 26 ? 2.377   -7.646  2.360   1.00 0.00 ? 26 MET A CE   1  
ATOM 359   H H    . MET A 1 26 ? 6.997   -4.794  2.448   1.00 0.00 ? 26 MET A H    1  
ATOM 360   H HA   . MET A 1 26 ? 5.573   -6.406  4.211   1.00 0.00 ? 26 MET A HA   1  
ATOM 361   H HB2  . MET A 1 26 ? 5.367   -5.418  1.403   1.00 0.00 ? 26 MET A HB2  1  
ATOM 362   H HB3  . MET A 1 26 ? 4.554   -6.949  1.656   1.00 0.00 ? 26 MET A HB3  1  
ATOM 363   H HG2  . MET A 1 26 ? 3.755   -5.506  3.899   1.00 0.00 ? 26 MET A HG2  1  
ATOM 364   H HG3  . MET A 1 26 ? 3.852   -4.250  2.682   1.00 0.00 ? 26 MET A HG3  1  
ATOM 365   H HE1  . MET A 1 26 ? 2.424   -8.140  1.389   1.00 0.00 ? 26 MET A HE1  1  
ATOM 366   H HE2  . MET A 1 26 ? 3.292   -7.850  2.915   1.00 0.00 ? 26 MET A HE2  1  
ATOM 367   H HE3  . MET A 1 26 ? 1.521   -8.024  2.918   1.00 0.00 ? 26 MET A HE3  1  
ATOM 368   N N    . GLN A 1 27 ? 7.125   -7.987  1.745   1.00 0.00 ? 27 GLN A N    1  
ATOM 369   C CA   . GLN A 1 27 ? 7.666   -9.270  1.329   1.00 0.00 ? 27 GLN A CA   1  
ATOM 370   C C    . GLN A 1 27 ? 8.919   -9.606  2.140   1.00 0.00 ? 27 GLN A C    1  
ATOM 371   O O    . GLN A 1 27 ? 9.458   -10.706 2.030   1.00 0.00 ? 27 GLN A O    1  
ATOM 372   C CB   . GLN A 1 27 ? 7.964   -9.279  -0.171  1.00 0.00 ? 27 GLN A CB   1  
ATOM 373   C CG   . GLN A 1 27 ? 9.082   -10.270 -0.502  1.00 0.00 ? 27 GLN A CG   1  
ATOM 374   C CD   . GLN A 1 27 ? 9.267   -10.403 -2.015  1.00 0.00 ? 27 GLN A CD   1  
ATOM 375   O OE1  . GLN A 1 27 ? 9.041   -9.478  -2.777  1.00 0.00 ? 27 GLN A OE1  1  
ATOM 376   N NE2  . GLN A 1 27 ? 9.691   -11.602 -2.404  1.00 0.00 ? 27 GLN A NE2  1  
ATOM 377   H H    . GLN A 1 27 ? 7.274   -7.237  1.101   1.00 0.00 ? 27 GLN A H    1  
ATOM 378   H HA   . GLN A 1 27 ? 6.882   -9.997  1.542   1.00 0.00 ? 27 GLN A HA   1  
ATOM 379   H HB2  . GLN A 1 27 ? 7.063   -9.545  -0.723  1.00 0.00 ? 27 GLN A HB2  1  
ATOM 380   H HB3  . GLN A 1 27 ? 8.253   -8.279  -0.494  1.00 0.00 ? 27 GLN A HB3  1  
ATOM 381   H HG2  . GLN A 1 27 ? 10.015  -9.937  -0.045  1.00 0.00 ? 27 GLN A HG2  1  
ATOM 382   H HG3  . GLN A 1 27 ? 8.848   -11.245 -0.073  1.00 0.00 ? 27 GLN A HG3  1  
ATOM 383   H HE21 . GLN A 1 27 ? 9.858   -12.318 -1.727  1.00 0.00 ? 27 GLN A HE21 1  
ATOM 384   H HE22 . GLN A 1 27 ? 9.842   -11.788 -3.375  1.00 0.00 ? 27 GLN A HE22 1  
ATOM 385   N N    . ARG A 1 28 ? 9.346   -8.637  2.937   1.00 0.00 ? 28 ARG A N    1  
ATOM 386   C CA   . ARG A 1 28 ? 10.526  -8.816  3.766   1.00 0.00 ? 28 ARG A CA   1  
ATOM 387   C C    . ARG A 1 28 ? 10.122  -9.215  5.186   1.00 0.00 ? 28 ARG A C    1  
ATOM 388   O O    . ARG A 1 28 ? 10.764  -10.064 5.802   1.00 0.00 ? 28 ARG A O    1  
ATOM 389   C CB   . ARG A 1 28 ? 11.359  -7.533  3.822   1.00 0.00 ? 28 ARG A CB   1  
ATOM 390   C CG   . ARG A 1 28 ? 12.382  -7.593  4.958   1.00 0.00 ? 28 ARG A CG   1  
ATOM 391   C CD   . ARG A 1 28 ? 13.691  -6.911  4.554   1.00 0.00 ? 28 ARG A CD   1  
ATOM 392   N NE   . ARG A 1 28 ? 13.699  -5.510  5.030   1.00 0.00 ? 28 ARG A NE   1  
ATOM 393   C CZ   . ARG A 1 28 ? 13.645  -5.155  6.321   1.00 0.00 ? 28 ARG A CZ   1  
ATOM 394   N NH1  . ARG A 1 28 ? 13.579  -6.096  7.273   1.00 0.00 ? 28 ARG A NH1  1  
ATOM 395   N NH2  . ARG A 1 28 ? 13.658  -3.858  6.661   1.00 0.00 ? 28 ARG A NH2  1  
ATOM 396   H H    . ARG A 1 28 ? 8.902   -7.745  3.021   1.00 0.00 ? 28 ARG A H    1  
ATOM 397   H HA   . ARG A 1 28 ? 11.090  -9.612  3.280   1.00 0.00 ? 28 ARG A HA   1  
ATOM 398   H HB2  . ARG A 1 28 ? 11.874  -7.388  2.872   1.00 0.00 ? 28 ARG A HB2  1  
ATOM 399   H HB3  . ARG A 1 28 ? 10.703  -6.675  3.963   1.00 0.00 ? 28 ARG A HB3  1  
ATOM 400   H HG2  . ARG A 1 28 ? 11.974  -7.109  5.845   1.00 0.00 ? 28 ARG A HG2  1  
ATOM 401   H HG3  . ARG A 1 28 ? 12.576  -8.633  5.223   1.00 0.00 ? 28 ARG A HG3  1  
ATOM 402   H HD2  . ARG A 1 28 ? 14.538  -7.452  4.976   1.00 0.00 ? 28 ARG A HD2  1  
ATOM 403   H HD3  . ARG A 1 28 ? 13.804  -6.936  3.471   1.00 0.00 ? 28 ARG A HD3  1  
ATOM 404   H HE   . ARG A 1 28 ? 13.747  -4.783  4.346   1.00 0.00 ? 28 ARG A HE   1  
ATOM 405   H HH11 . ARG A 1 28 ? 13.570  -7.063  7.020   1.00 0.00 ? 28 ARG A HH11 1  
ATOM 406   H HH12 . ARG A 1 28 ? 13.539  -5.831  8.236   1.00 0.00 ? 28 ARG A HH12 1  
ATOM 407   H HH21 . ARG A 1 28 ? 13.707  -3.156  5.951   1.00 0.00 ? 28 ARG A HH21 1  
ATOM 408   H HH22 . ARG A 1 28 ? 13.617  -3.593  7.624   1.00 0.00 ? 28 ARG A HH22 1  
ATOM 409   N N    . VAL A 1 29 ? 9.059   -8.585  5.664   1.00 0.00 ? 29 VAL A N    1  
ATOM 410   C CA   . VAL A 1 29 ? 8.561   -8.864  7.000   1.00 0.00 ? 29 VAL A CA   1  
ATOM 411   C C    . VAL A 1 29 ? 7.396   -9.851  6.909   1.00 0.00 ? 29 VAL A C    1  
ATOM 412   O O    . VAL A 1 29 ? 7.487   -10.972 7.408   1.00 0.00 ? 29 VAL A O    1  
ATOM 413   C CB   . VAL A 1 29 ? 8.185   -7.558  7.702   1.00 0.00 ? 29 VAL A CB   1  
ATOM 414   C CG1  . VAL A 1 29 ? 7.613   -7.829  9.095   1.00 0.00 ? 29 VAL A CG1  1  
ATOM 415   C CG2  . VAL A 1 29 ? 9.383   -6.610  7.776   1.00 0.00 ? 29 VAL A CG2  1  
ATOM 416   H H    . VAL A 1 29 ? 8.542   -7.896  5.156   1.00 0.00 ? 29 VAL A H    1  
ATOM 417   H HA   . VAL A 1 29 ? 9.371   -9.328  7.563   1.00 0.00 ? 29 VAL A HA   1  
ATOM 418   H HB   . VAL A 1 29 ? 7.409   -7.071  7.110   1.00 0.00 ? 29 VAL A HB   1  
ATOM 419   H HG11 . VAL A 1 29 ? 7.870   -8.843  9.402   1.00 0.00 ? 29 VAL A HG11 1  
ATOM 420   H HG12 . VAL A 1 29 ? 8.034   -7.117  9.805   1.00 0.00 ? 29 VAL A HG12 1  
ATOM 421   H HG13 . VAL A 1 29 ? 6.529   -7.720  9.071   1.00 0.00 ? 29 VAL A HG13 1  
ATOM 422   H HG21 . VAL A 1 29 ? 10.306  -7.190  7.779   1.00 0.00 ? 29 VAL A HG21 1  
ATOM 423   H HG22 . VAL A 1 29 ? 9.375   -5.946  6.911   1.00 0.00 ? 29 VAL A HG22 1  
ATOM 424   H HG23 . VAL A 1 29 ? 9.323   -6.018  8.689   1.00 0.00 ? 29 VAL A HG23 1  
ATOM 425   N N    . LEU A 1 30 ? 6.327   -9.399  6.270   1.00 0.00 ? 30 LEU A N    1  
ATOM 426   C CA   . LEU A 1 30 ? 5.145   -10.229 6.107   1.00 0.00 ? 30 LEU A CA   1  
ATOM 427   C C    . LEU A 1 30 ? 5.497   -11.449 5.254   1.00 0.00 ? 30 LEU A C    1  
ATOM 428   O O    . LEU A 1 30 ? 5.005   -12.548 5.503   1.00 0.00 ? 30 LEU A O    1  
ATOM 429   C CB   . LEU A 1 30 ? 3.984   -9.403  5.551   1.00 0.00 ? 30 LEU A CB   1  
ATOM 430   C CG   . LEU A 1 30 ? 3.397   -8.350  6.493   1.00 0.00 ? 30 LEU A CG   1  
ATOM 431   C CD1  . LEU A 1 30 ? 2.531   -7.349  5.726   1.00 0.00 ? 30 LEU A CD1  1  
ATOM 432   C CD2  . LEU A 1 30 ? 2.630   -9.009  7.642   1.00 0.00 ? 30 LEU A CD2  1  
ATOM 433   H H    . LEU A 1 30 ? 6.261   -8.486  5.867   1.00 0.00 ? 30 LEU A H    1  
ATOM 434   H HA   . LEU A 1 30 ? 4.850   -10.574 7.098   1.00 0.00 ? 30 LEU A HA   1  
ATOM 435   H HB2  . LEU A 1 30 ? 4.322   -8.902  4.644   1.00 0.00 ? 30 LEU A HB2  1  
ATOM 436   H HB3  . LEU A 1 30 ? 3.186   -10.086 5.259   1.00 0.00 ? 30 LEU A HB3  1  
ATOM 437   H HG   . LEU A 1 30 ? 4.221   -7.791  6.936   1.00 0.00 ? 30 LEU A HG   1  
ATOM 438   H HD11 . LEU A 1 30 ? 3.103   -6.439  5.543   1.00 0.00 ? 30 LEU A HD11 1  
ATOM 439   H HD12 . LEU A 1 30 ? 2.229   -7.785  4.774   1.00 0.00 ? 30 LEU A HD12 1  
ATOM 440   H HD13 . LEU A 1 30 ? 1.645   -7.110  6.314   1.00 0.00 ? 30 LEU A HD13 1  
ATOM 441   H HD21 . LEU A 1 30 ? 1.596   -9.176  7.340   1.00 0.00 ? 30 LEU A HD21 1  
ATOM 442   H HD22 . LEU A 1 30 ? 3.095   -9.964  7.888   1.00 0.00 ? 30 LEU A HD22 1  
ATOM 443   H HD23 . LEU A 1 30 ? 2.653   -8.358  8.515   1.00 0.00 ? 30 LEU A HD23 1  
ATOM 444   N N    . LYS A 1 31 ? 6.347   -11.214 4.265   1.00 0.00 ? 31 LYS A N    1  
ATOM 445   C CA   . LYS A 1 31 ? 6.770   -12.280 3.373   1.00 0.00 ? 31 LYS A CA   1  
ATOM 446   C C    . LYS A 1 31 ? 5.582   -12.726 2.518   1.00 0.00 ? 31 LYS A C    1  
ATOM 447   O O    . LYS A 1 31 ? 5.297   -13.918 2.419   1.00 0.00 ? 31 LYS A O    1  
ATOM 448   C CB   . LYS A 1 31 ? 7.418   -13.417 4.166   1.00 0.00 ? 31 LYS A CB   1  
ATOM 449   C CG   . LYS A 1 31 ? 8.908   -13.534 3.839   1.00 0.00 ? 31 LYS A CG   1  
ATOM 450   C CD   . LYS A 1 31 ? 9.357   -14.997 3.848   1.00 0.00 ? 31 LYS A CD   1  
ATOM 451   C CE   . LYS A 1 31 ? 10.836  -15.114 4.221   1.00 0.00 ? 31 LYS A CE   1  
ATOM 452   N NZ   . LYS A 1 31 ? 11.041  -16.210 5.194   1.00 0.00 ? 31 LYS A NZ   1  
ATOM 453   H H    . LYS A 1 31 ? 6.743   -10.317 4.068   1.00 0.00 ? 31 LYS A H    1  
ATOM 454   H HA   . LYS A 1 31 ? 7.536   -11.870 2.714   1.00 0.00 ? 31 LYS A HA   1  
ATOM 455   H HB2  . LYS A 1 31 ? 7.289   -13.239 5.234   1.00 0.00 ? 31 LYS A HB2  1  
ATOM 456   H HB3  . LYS A 1 31 ? 6.916   -14.357 3.937   1.00 0.00 ? 31 LYS A HB3  1  
ATOM 457   H HG2  . LYS A 1 31 ? 9.105   -13.096 2.861   1.00 0.00 ? 31 LYS A HG2  1  
ATOM 458   H HG3  . LYS A 1 31 ? 9.489   -12.967 4.566   1.00 0.00 ? 31 LYS A HG3  1  
ATOM 459   H HD2  . LYS A 1 31 ? 8.754   -15.562 4.558   1.00 0.00 ? 31 LYS A HD2  1  
ATOM 460   H HD3  . LYS A 1 31 ? 9.190   -15.439 2.866   1.00 0.00 ? 31 LYS A HD3  1  
ATOM 461   H HE2  . LYS A 1 31 ? 11.430  -15.299 3.325   1.00 0.00 ? 31 LYS A HE2  1  
ATOM 462   H HE3  . LYS A 1 31 ? 11.186  -14.173 4.645   1.00 0.00 ? 31 LYS A HE3  1  
ATOM 463   H HZ1  . LYS A 1 31 ? 10.155  -16.591 5.458   1.00 0.00 ? 31 LYS A HZ1  1  
ATOM 464   H HZ2  . LYS A 1 31 ? 11.601  -16.926 4.776   1.00 0.00 ? 31 LYS A HZ2  1  
ATOM 465   H HZ3  . LYS A 1 31 ? 11.506  -15.854 6.004   1.00 0.00 ? 31 LYS A HZ3  1  
ATOM 466   N N    . VAL A 1 32 ? 4.922   -11.744 1.921   1.00 0.00 ? 32 VAL A N    1  
ATOM 467   C CA   . VAL A 1 32 ? 3.772   -12.020 1.078   1.00 0.00 ? 32 VAL A CA   1  
ATOM 468   C C    . VAL A 1 32 ? 3.640   -10.918 0.025   1.00 0.00 ? 32 VAL A C    1  
ATOM 469   O O    . VAL A 1 32 ? 3.971   -9.762  0.286   1.00 0.00 ? 32 VAL A O    1  
ATOM 470   C CB   . VAL A 1 32 ? 2.517   -12.177 1.939   1.00 0.00 ? 32 VAL A CB   1  
ATOM 471   C CG1  . VAL A 1 32 ? 2.666   -13.344 2.918   1.00 0.00 ? 32 VAL A CG1  1  
ATOM 472   C CG2  . VAL A 1 32 ? 2.194   -10.878 2.679   1.00 0.00 ? 32 VAL A CG2  1  
ATOM 473   H H    . VAL A 1 32 ? 5.161   -10.777 2.007   1.00 0.00 ? 32 VAL A H    1  
ATOM 474   H HA   . VAL A 1 32 ? 3.955   -12.968 0.572   1.00 0.00 ? 32 VAL A HA   1  
ATOM 475   H HB   . VAL A 1 32 ? 1.681   -12.402 1.276   1.00 0.00 ? 32 VAL A HB   1  
ATOM 476   H HG11 . VAL A 1 32 ? 3.306   -13.042 3.748   1.00 0.00 ? 32 VAL A HG11 1  
ATOM 477   H HG12 . VAL A 1 32 ? 1.685   -13.626 3.299   1.00 0.00 ? 32 VAL A HG12 1  
ATOM 478   H HG13 . VAL A 1 32 ? 3.115   -14.194 2.404   1.00 0.00 ? 32 VAL A HG13 1  
ATOM 479   H HG21 . VAL A 1 32 ? 3.095   -10.502 3.163   1.00 0.00 ? 32 VAL A HG21 1  
ATOM 480   H HG22 . VAL A 1 32 ? 1.827   -10.137 1.969   1.00 0.00 ? 32 VAL A HG22 1  
ATOM 481   H HG23 . VAL A 1 32 ? 1.430   -11.069 3.433   1.00 0.00 ? 32 VAL A HG23 1  
ATOM 482   N N    . ARG A 1 33 ? 3.157   -11.314 -1.143  1.00 0.00 ? 33 ARG A N    1  
ATOM 483   C CA   . ARG A 1 33 ? 2.977   -10.374 -2.237  1.00 0.00 ? 33 ARG A CA   1  
ATOM 484   C C    . ARG A 1 33 ? 1.631   -9.658  -2.106  1.00 0.00 ? 33 ARG A C    1  
ATOM 485   O O    . ARG A 1 33 ? 0.578   -10.285 -2.211  1.00 0.00 ? 33 ARG A O    1  
ATOM 486   C CB   . ARG A 1 33 ? 3.040   -11.085 -3.590  1.00 0.00 ? 33 ARG A CB   1  
ATOM 487   C CG   . ARG A 1 33 ? 4.468   -11.533 -3.908  1.00 0.00 ? 33 ARG A CG   1  
ATOM 488   C CD   . ARG A 1 33 ? 4.863   -11.136 -5.332  1.00 0.00 ? 33 ARG A CD   1  
ATOM 489   N NE   . ARG A 1 33 ? 6.311   -11.363 -5.537  1.00 0.00 ? 33 ARG A NE   1  
ATOM 490   C CZ   . ARG A 1 33 ? 7.029   -10.796 -6.517  1.00 0.00 ? 33 ARG A CZ   1  
ATOM 491   N NH1  . ARG A 1 33 ? 6.437   -9.966  -7.387  1.00 0.00 ? 33 ARG A NH1  1  
ATOM 492   N NH2  . ARG A 1 33 ? 8.338   -11.060 -6.627  1.00 0.00 ? 33 ARG A NH2  1  
ATOM 493   H H    . ARG A 1 33 ? 2.890   -12.256 -1.348  1.00 0.00 ? 33 ARG A H    1  
ATOM 494   H HA   . ARG A 1 33 ? 3.806   -9.672  -2.139  1.00 0.00 ? 33 ARG A HA   1  
ATOM 495   H HB2  . ARG A 1 33 ? 2.377   -11.950 -3.582  1.00 0.00 ? 33 ARG A HB2  1  
ATOM 496   H HB3  . ARG A 1 33 ? 2.682   -10.416 -4.373  1.00 0.00 ? 33 ARG A HB3  1  
ATOM 497   H HG2  . ARG A 1 33 ? 5.161   -11.084 -3.196  1.00 0.00 ? 33 ARG A HG2  1  
ATOM 498   H HG3  . ARG A 1 33 ? 4.548   -12.614 -3.793  1.00 0.00 ? 33 ARG A HG3  1  
ATOM 499   H HD2  . ARG A 1 33 ? 4.290   -11.718 -6.053  1.00 0.00 ? 33 ARG A HD2  1  
ATOM 500   H HD3  . ARG A 1 33 ? 4.623   -10.087 -5.506  1.00 0.00 ? 33 ARG A HD3  1  
ATOM 501   H HE   . ARG A 1 33 ? 6.784   -11.977 -4.906  1.00 0.00 ? 33 ARG A HE   1  
ATOM 502   H HH11 . ARG A 1 33 ? 5.460   -9.769  -7.305  1.00 0.00 ? 33 ARG A HH11 1  
ATOM 503   H HH12 . ARG A 1 33 ? 6.973   -9.543  -8.118  1.00 0.00 ? 33 ARG A HH12 1  
ATOM 504   H HH21 . ARG A 1 33 ? 8.780   -11.679 -5.978  1.00 0.00 ? 33 ARG A HH21 1  
ATOM 505   H HH22 . ARG A 1 33 ? 8.874   -10.637 -7.358  1.00 0.00 ? 33 ARG A HH22 1  
ATOM 506   N N    . PRO A 1 34 ? 1.711   -8.321  -1.873  1.00 0.00 ? 34 PRO A N    1  
ATOM 507   C CA   . PRO A 1 34 ? 0.512   -7.514  -1.727  1.00 0.00 ? 34 PRO A CA   1  
ATOM 508   C C    . PRO A 1 34 ? -0.155  -7.272  -3.083  1.00 0.00 ? 34 PRO A C    1  
ATOM 509   O O    . PRO A 1 34 ? 0.527   -7.057  -4.084  1.00 0.00 ? 34 PRO A O    1  
ATOM 510   C CB   . PRO A 1 34 ? 0.980   -6.231  -1.058  1.00 0.00 ? 34 PRO A CB   1  
ATOM 511   C CG   . PRO A 1 34 ? 2.484   -6.173  -1.276  1.00 0.00 ? 34 PRO A CG   1  
ATOM 512   C CD   . PRO A 1 34 ? 2.941   -7.545  -1.742  1.00 0.00 ? 34 PRO A CD   1  
ATOM 513   H HA   . PRO A 1 34 ? -0.165  -7.996  -1.171  1.00 0.00 ? 34 PRO A HA   1  
ATOM 514   H HB2  . PRO A 1 34 ? 0.488   -5.362  -1.494  1.00 0.00 ? 34 PRO A HB2  1  
ATOM 515   H HB3  . PRO A 1 34 ? 0.739   -6.235  0.005   1.00 0.00 ? 34 PRO A HB3  1  
ATOM 516   H HG2  . PRO A 1 34 ? 2.732   -5.415  -2.019  1.00 0.00 ? 34 PRO A HG2  1  
ATOM 517   H HG3  . PRO A 1 34 ? 2.992   -5.894  -0.353  1.00 0.00 ? 34 PRO A HG3  1  
ATOM 518   H HD2  . PRO A 1 34 ? 3.473   -7.484  -2.692  1.00 0.00 ? 34 PRO A HD2  1  
ATOM 519   H HD3  . PRO A 1 34 ? 3.622   -8.000  -1.024  1.00 0.00 ? 34 PRO A HD3  1  
ATOM 520   N N    . VAL A 1 35 ? -1.479  -7.317  -3.071  1.00 0.00 ? 35 VAL A N    1  
ATOM 521   C CA   . VAL A 1 35 ? -2.245  -7.106  -4.287  1.00 0.00 ? 35 VAL A CA   1  
ATOM 522   C C    . VAL A 1 35 ? -2.787  -5.675  -4.301  1.00 0.00 ? 35 VAL A C    1  
ATOM 523   O O    . VAL A 1 35 ? -3.450  -5.249  -3.357  1.00 0.00 ? 35 VAL A O    1  
ATOM 524   C CB   . VAL A 1 35 ? -3.345  -8.163  -4.403  1.00 0.00 ? 35 VAL A CB   1  
ATOM 525   C CG1  . VAL A 1 35 ? -4.499  -7.661  -5.274  1.00 0.00 ? 35 VAL A CG1  1  
ATOM 526   C CG2  . VAL A 1 35 ? -2.785  -9.481  -4.941  1.00 0.00 ? 35 VAL A CG2  1  
ATOM 527   H H    . VAL A 1 35 ? -2.025  -7.493  -2.252  1.00 0.00 ? 35 VAL A H    1  
ATOM 528   H HA   . VAL A 1 35 ? -1.566  -7.232  -5.130  1.00 0.00 ? 35 VAL A HA   1  
ATOM 529   H HB   . VAL A 1 35 ? -3.737  -8.349  -3.403  1.00 0.00 ? 35 VAL A HB   1  
ATOM 530   H HG11 . VAL A 1 35 ? -4.853  -8.472  -5.910  1.00 0.00 ? 35 VAL A HG11 1  
ATOM 531   H HG12 . VAL A 1 35 ? -5.313  -7.317  -4.636  1.00 0.00 ? 35 VAL A HG12 1  
ATOM 532   H HG13 . VAL A 1 35 ? -4.151  -6.836  -5.897  1.00 0.00 ? 35 VAL A HG13 1  
ATOM 533   H HG21 . VAL A 1 35 ? -2.125  -9.277  -5.785  1.00 0.00 ? 35 VAL A HG21 1  
ATOM 534   H HG22 . VAL A 1 35 ? -2.223  -9.985  -4.155  1.00 0.00 ? 35 VAL A HG22 1  
ATOM 535   H HG23 . VAL A 1 35 ? -3.606  -10.119 -5.267  1.00 0.00 ? 35 VAL A HG23 1  
ATOM 536   N N    . TYR A 1 36 ? -2.485  -4.972  -5.383  1.00 0.00 ? 36 TYR A N    1  
ATOM 537   C CA   . TYR A 1 36 ? -2.933  -3.598  -5.533  1.00 0.00 ? 36 TYR A CA   1  
ATOM 538   C C    . TYR A 1 36 ? -4.276  -3.536  -6.263  1.00 0.00 ? 36 TYR A C    1  
ATOM 539   O O    . TYR A 1 36 ? -4.347  -3.797  -7.463  1.00 0.00 ? 36 TYR A O    1  
ATOM 540   C CB   . TYR A 1 36 ? -1.871  -2.898  -6.383  1.00 0.00 ? 36 TYR A CB   1  
ATOM 541   C CG   . TYR A 1 36 ? -0.623  -2.484  -5.602  1.00 0.00 ? 36 TYR A CG   1  
ATOM 542   C CD1  . TYR A 1 36 ? 0.269   -3.443  -5.167  1.00 0.00 ? 36 TYR A CD1  1  
ATOM 543   C CD2  . TYR A 1 36 ? -0.388  -1.151  -5.331  1.00 0.00 ? 36 TYR A CD2  1  
ATOM 544   C CE1  . TYR A 1 36 ? 1.444   -3.053  -4.432  1.00 0.00 ? 36 TYR A CE1  1  
ATOM 545   C CE2  . TYR A 1 36 ? 0.787   -0.761  -4.596  1.00 0.00 ? 36 TYR A CE2  1  
ATOM 546   C CZ   . TYR A 1 36 ? 1.645   -1.731  -4.183  1.00 0.00 ? 36 TYR A CZ   1  
ATOM 547   O OH   . TYR A 1 36 ? 2.755   -1.363  -3.488  1.00 0.00 ? 36 TYR A OH   1  
ATOM 548   H H    . TYR A 1 36 ? -1.945  -5.326  -6.147  1.00 0.00 ? 36 TYR A H    1  
ATOM 549   H HA   . TYR A 1 36 ? -3.050  -3.172  -4.536  1.00 0.00 ? 36 TYR A HA   1  
ATOM 550   H HB2  . TYR A 1 36 ? -1.575  -3.561  -7.195  1.00 0.00 ? 36 TYR A HB2  1  
ATOM 551   H HB3  . TYR A 1 36 ? -2.312  -2.012  -6.839  1.00 0.00 ? 36 TYR A HB3  1  
ATOM 552   H HD1  . TYR A 1 36 ? 0.084   -4.496  -5.381  1.00 0.00 ? 36 TYR A HD1  1  
ATOM 553   H HD2  . TYR A 1 36 ? -1.093  -0.393  -5.675  1.00 0.00 ? 36 TYR A HD2  1  
ATOM 554   H HE1  . TYR A 1 36 ? 2.157   -3.800  -4.083  1.00 0.00 ? 36 TYR A HE1  1  
ATOM 555   H HE2  . TYR A 1 36 ? 0.984   0.288   -4.376  1.00 0.00 ? 36 TYR A HE2  1  
ATOM 556   H HH   . TYR A 1 36 ? 2.587   -0.503  -3.006  1.00 0.00 ? 36 TYR A HH   1  
ATOM 557   N N    . ASN A 1 37 ? -5.309  -3.190  -5.508  1.00 0.00 ? 37 ASN A N    1  
ATOM 558   C CA   . ASN A 1 37 ? -6.645  -3.090  -6.069  1.00 0.00 ? 37 ASN A CA   1  
ATOM 559   C C    . ASN A 1 37 ? -6.889  -1.657  -6.546  1.00 0.00 ? 37 ASN A C    1  
ATOM 560   O O    . ASN A 1 37 ? -6.444  -0.703  -5.909  1.00 0.00 ? 37 ASN A O    1  
ATOM 561   C CB   . ASN A 1 37 ? -7.708  -3.426  -5.021  1.00 0.00 ? 37 ASN A CB   1  
ATOM 562   C CG   . ASN A 1 37 ? -8.316  -4.807  -5.279  1.00 0.00 ? 37 ASN A CG   1  
ATOM 563   O OD1  . ASN A 1 37 ? -9.444  -4.944  -5.721  1.00 0.00 ? 37 ASN A OD1  1  
ATOM 564   N ND2  . ASN A 1 37 ? -7.506  -5.819  -4.980  1.00 0.00 ? 37 ASN A ND2  1  
ATOM 565   H H    . ASN A 1 37 ? -5.243  -2.979  -4.533  1.00 0.00 ? 37 ASN A H    1  
ATOM 566   H HA   . ASN A 1 37 ? -6.668  -3.811  -6.886  1.00 0.00 ? 37 ASN A HA   1  
ATOM 567   H HB2  . ASN A 1 37 ? -7.264  -3.401  -4.026  1.00 0.00 ? 37 ASN A HB2  1  
ATOM 568   H HB3  . ASN A 1 37 ? -8.494  -2.671  -5.039  1.00 0.00 ? 37 ASN A HB3  1  
ATOM 569   H HD21 . ASN A 1 37 ? -6.590  -5.637  -4.620  1.00 0.00 ? 37 ASN A HD21 1  
ATOM 570   H HD22 . ASN A 1 37 ? -7.812  -6.761  -5.114  1.00 0.00 ? 37 ASN A HD22 1  
ATOM 571   N N    . PHE A 1 38 ? -7.593  -1.551  -7.663  1.00 0.00 ? 38 PHE A N    1  
ATOM 572   C CA   . PHE A 1 38 ? -7.900  -0.250  -8.233  1.00 0.00 ? 38 PHE A CA   1  
ATOM 573   C C    . PHE A 1 38 ? -9.412  -0.050  -8.361  1.00 0.00 ? 38 PHE A C    1  
ATOM 574   O O    . PHE A 1 38 ? -10.136 -0.980  -8.714  1.00 0.00 ? 38 PHE A O    1  
ATOM 575   C CB   . PHE A 1 38 ? -7.273  -0.213  -9.628  1.00 0.00 ? 38 PHE A CB   1  
ATOM 576   C CG   . PHE A 1 38 ? -5.755  -0.408  -9.633  1.00 0.00 ? 38 PHE A CG   1  
ATOM 577   C CD1  . PHE A 1 38 ? -4.942  0.572   -9.155  1.00 0.00 ? 38 PHE A CD1  1  
ATOM 578   C CD2  . PHE A 1 38 ? -5.219  -1.561  -10.115 1.00 0.00 ? 38 PHE A CD2  1  
ATOM 579   C CE1  . PHE A 1 38 ? -3.534  0.391   -9.160  1.00 0.00 ? 38 PHE A CE1  1  
ATOM 580   C CE2  . PHE A 1 38 ? -3.811  -1.742  -10.120 1.00 0.00 ? 38 PHE A CE2  1  
ATOM 581   C CZ   . PHE A 1 38 ? -2.998  -0.762  -9.642  1.00 0.00 ? 38 PHE A CZ   1  
ATOM 582   H H    . PHE A 1 38 ? -7.950  -2.331  -8.175  1.00 0.00 ? 38 PHE A H    1  
ATOM 583   H HA   . PHE A 1 38 ? -7.492  0.503   -7.559  1.00 0.00 ? 38 PHE A HA   1  
ATOM 584   H HB2  . PHE A 1 38 ? -7.731  -0.989  -10.242 1.00 0.00 ? 38 PHE A HB2  1  
ATOM 585   H HB3  . PHE A 1 38 ? -7.508  0.743   -10.095 1.00 0.00 ? 38 PHE A HB3  1  
ATOM 586   H HD1  . PHE A 1 38 ? -5.372  1.497   -8.769  1.00 0.00 ? 38 PHE A HD1  1  
ATOM 587   H HD2  . PHE A 1 38 ? -5.871  -2.346  -10.498 1.00 0.00 ? 38 PHE A HD2  1  
ATOM 588   H HE1  . PHE A 1 38 ? -2.882  1.177   -8.777  1.00 0.00 ? 38 PHE A HE1  1  
ATOM 589   H HE2  . PHE A 1 38 ? -3.382  -2.666  -10.506 1.00 0.00 ? 38 PHE A HE2  1  
ATOM 590   H HZ   . PHE A 1 38 ? -1.917  -0.901  -9.646  1.00 0.00 ? 38 PHE A HZ   1  
ATOM 591   N N    . PHE A 1 39 ? -9.843  1.167   -8.067  1.00 0.00 ? 39 PHE A N    1  
ATOM 592   C CA   . PHE A 1 39 ? -11.255 1.500   -8.145  1.00 0.00 ? 39 PHE A CA   1  
ATOM 593   C C    . PHE A 1 39 ? -11.452 2.965   -8.541  1.00 0.00 ? 39 PHE A C    1  
ATOM 594   O O    . PHE A 1 39 ? -10.482 3.689   -8.760  1.00 0.00 ? 39 PHE A O    1  
ATOM 595   C CB   . PHE A 1 39 ? -11.845 1.278   -6.751  1.00 0.00 ? 39 PHE A CB   1  
ATOM 596   C CG   . PHE A 1 39 ? -11.065 1.965   -5.628  1.00 0.00 ? 39 PHE A CG   1  
ATOM 597   C CD1  . PHE A 1 39 ? -9.941  1.386   -5.128  1.00 0.00 ? 39 PHE A CD1  1  
ATOM 598   C CD2  . PHE A 1 39 ? -11.496 3.155   -5.131  1.00 0.00 ? 39 PHE A CD2  1  
ATOM 599   C CE1  . PHE A 1 39 ? -9.217  2.023   -4.086  1.00 0.00 ? 39 PHE A CE1  1  
ATOM 600   C CE2  . PHE A 1 39 ? -10.772 3.793   -4.089  1.00 0.00 ? 39 PHE A CE2  1  
ATOM 601   C CZ   . PHE A 1 39 ? -9.648  3.213   -3.588  1.00 0.00 ? 39 PHE A CZ   1  
ATOM 602   H H    . PHE A 1 39 ? -9.247  1.918   -7.781  1.00 0.00 ? 39 PHE A H    1  
ATOM 603   H HA   . PHE A 1 39 ? -11.698 0.858   -8.906  1.00 0.00 ? 39 PHE A HA   1  
ATOM 604   H HB2  . PHE A 1 39 ? -12.873 1.640   -6.740  1.00 0.00 ? 39 PHE A HB2  1  
ATOM 605   H HB3  . PHE A 1 39 ? -11.882 0.207   -6.551  1.00 0.00 ? 39 PHE A HB3  1  
ATOM 606   H HD1  . PHE A 1 39 ? -9.595  0.432   -5.527  1.00 0.00 ? 39 PHE A HD1  1  
ATOM 607   H HD2  . PHE A 1 39 ? -12.397 3.619   -5.532  1.00 0.00 ? 39 PHE A HD2  1  
ATOM 608   H HE1  . PHE A 1 39 ? -8.316  1.559   -3.685  1.00 0.00 ? 39 PHE A HE1  1  
ATOM 609   H HE2  . PHE A 1 39 ? -11.118 4.746   -3.690  1.00 0.00 ? 39 PHE A HE2  1  
ATOM 610   H HZ   . PHE A 1 39 ? -9.092  3.703   -2.788  1.00 0.00 ? 39 PHE A HZ   1  
ATOM 611   N N    . GLU A 1 40 ? -12.715 3.359   -8.621  1.00 0.00 ? 40 GLU A N    1  
ATOM 612   C CA   . GLU A 1 40 ? -13.051 4.724   -8.987  1.00 0.00 ? 40 GLU A CA   1  
ATOM 613   C C    . GLU A 1 40 ? -13.471 5.517   -7.748  1.00 0.00 ? 40 GLU A C    1  
ATOM 614   O O    . GLU A 1 40 ? -13.841 4.935   -6.729  1.00 0.00 ? 40 GLU A O    1  
ATOM 615   C CB   . GLU A 1 40 ? -14.148 4.751   -10.053 1.00 0.00 ? 40 GLU A CB   1  
ATOM 616   C CG   . GLU A 1 40 ? -13.562 5.042   -11.436 1.00 0.00 ? 40 GLU A CG   1  
ATOM 617   C CD   . GLU A 1 40 ? -14.446 6.019   -12.213 1.00 0.00 ? 40 GLU A CD   1  
ATOM 618   O OE1  . GLU A 1 40 ? -14.956 6.960   -11.566 1.00 0.00 ? 40 GLU A OE1  1  
ATOM 619   O OE2  . GLU A 1 40 ? -14.593 5.804   -13.435 1.00 0.00 ? 40 GLU A OE2  1  
ATOM 620   H H    . GLU A 1 40 ? -13.498 2.764   -8.442  1.00 0.00 ? 40 GLU A H    1  
ATOM 621   H HA   . GLU A 1 40 ? -12.137 5.146   -9.404  1.00 0.00 ? 40 GLU A HA   1  
ATOM 622   H HB2  . GLU A 1 40 ? -14.669 3.794   -10.069 1.00 0.00 ? 40 GLU A HB2  1  
ATOM 623   H HB3  . GLU A 1 40 ? -14.887 5.512   -9.800  1.00 0.00 ? 40 GLU A HB3  1  
ATOM 624   H HG2  . GLU A 1 40 ? -12.560 5.458   -11.330 1.00 0.00 ? 40 GLU A HG2  1  
ATOM 625   H HG3  . GLU A 1 40 ? -13.463 4.112   -11.996 1.00 0.00 ? 40 GLU A HG3  1  
ATOM 626   N N    . CYS A 1 41 ? -13.400 6.834   -7.875  1.00 0.00 ? 41 CYS A N    1  
ATOM 627   C CA   . CYS A 1 41 ? -13.768 7.713   -6.778  1.00 0.00 ? 41 CYS A CA   1  
ATOM 628   C C    . CYS A 1 41 ? -15.103 8.376   -7.121  1.00 0.00 ? 41 CYS A C    1  
ATOM 629   O O    . CYS A 1 41 ? -15.450 8.512   -8.294  1.00 0.00 ? 41 CYS A O    1  
ATOM 630   C CB   . CYS A 1 41 ? -12.676 8.746   -6.490  1.00 0.00 ? 41 CYS A CB   1  
ATOM 631   S SG   . CYS A 1 41 ? -12.807 9.329   -4.761  1.00 0.00 ? 41 CYS A SG   1  
ATOM 632   H H    . CYS A 1 41 ? -13.098 7.300   -8.707  1.00 0.00 ? 41 CYS A H    1  
ATOM 633   H HA   . CYS A 1 41 ? -13.863 7.085   -5.893  1.00 0.00 ? 41 CYS A HA   1  
ATOM 634   H HB2  . CYS A 1 41 ? -11.693 8.305   -6.660  1.00 0.00 ? 41 CYS A HB2  1  
ATOM 635   H HB3  . CYS A 1 41 ? -12.770 9.588   -7.175  1.00 0.00 ? 41 CYS A HB3  1  
ATOM 636   H HG   . CYS A 1 41 ? -13.400 10.484  -5.049  1.00 0.00 ? 41 CYS A HG   1  
ATOM 637   N N    . GLU A 1 42 ? -15.817 8.771   -6.077  1.00 0.00 ? 42 GLU A N    1  
ATOM 638   C CA   . GLU A 1 42 ? -17.107 9.416   -6.253  1.00 0.00 ? 42 GLU A CA   1  
ATOM 639   C C    . GLU A 1 42 ? -16.918 10.879  -6.656  1.00 0.00 ? 42 GLU A C    1  
ATOM 640   O O    . GLU A 1 42 ? -17.606 11.376  -7.547  1.00 0.00 ? 42 GLU A O    1  
ATOM 641   C CB   . GLU A 1 42 ? -17.954 9.302   -4.984  1.00 0.00 ? 42 GLU A CB   1  
ATOM 642   C CG   . GLU A 1 42 ? -17.402 10.198  -3.874  1.00 0.00 ? 42 GLU A CG   1  
ATOM 643   C CD   . GLU A 1 42 ? -18.183 10.003  -2.572  1.00 0.00 ? 42 GLU A CD   1  
ATOM 644   O OE1  . GLU A 1 42 ? -18.061 8.900   -1.997  1.00 0.00 ? 42 GLU A OE1  1  
ATOM 645   O OE2  . GLU A 1 42 ? -18.885 10.961  -2.183  1.00 0.00 ? 42 GLU A OE2  1  
ATOM 646   H H    . GLU A 1 42 ? -15.528 8.656   -5.127  1.00 0.00 ? 42 GLU A H    1  
ATOM 647   H HA   . GLU A 1 42 ? -17.596 8.870   -7.060  1.00 0.00 ? 42 GLU A HA   1  
ATOM 648   H HB2  . GLU A 1 42 ? -18.984 9.583   -5.204  1.00 0.00 ? 42 GLU A HB2  1  
ATOM 649   H HB3  . GLU A 1 42 ? -17.972 8.266   -4.646  1.00 0.00 ? 42 GLU A HB3  1  
ATOM 650   H HG2  . GLU A 1 42 ? -16.349 9.970   -3.708  1.00 0.00 ? 42 GLU A HG2  1  
ATOM 651   H HG3  . GLU A 1 42 ? -17.458 11.242  -4.182  1.00 0.00 ? 42 GLU A HG3  1  
ATOM 652   N N    . ASN A 1 43 ? -15.981 11.530  -5.982  1.00 0.00 ? 43 ASN A N    1  
ATOM 653   C CA   . ASN A 1 43 ? -15.693 12.927  -6.259  1.00 0.00 ? 43 ASN A CA   1  
ATOM 654   C C    . ASN A 1 43 ? -14.863 13.027  -7.540  1.00 0.00 ? 43 ASN A C    1  
ATOM 655   O O    . ASN A 1 43 ? -14.031 12.164  -7.815  1.00 0.00 ? 43 ASN A O    1  
ATOM 656   C CB   . ASN A 1 43 ? -14.886 13.558  -5.123  1.00 0.00 ? 43 ASN A CB   1  
ATOM 657   C CG   . ASN A 1 43 ? -15.543 14.851  -4.636  1.00 0.00 ? 43 ASN A CG   1  
ATOM 658   O OD1  . ASN A 1 43 ? -16.596 14.849  -4.020  1.00 0.00 ? 43 ASN A OD1  1  
ATOM 659   N ND2  . ASN A 1 43 ? -14.866 15.953  -4.947  1.00 0.00 ? 43 ASN A ND2  1  
ATOM 660   H H    . ASN A 1 43 ? -15.425 11.119  -5.259  1.00 0.00 ? 43 ASN A H    1  
ATOM 661   H HA   . ASN A 1 43 ? -16.667 13.407  -6.354  1.00 0.00 ? 43 ASN A HA   1  
ATOM 662   H HB2  . ASN A 1 43 ? -14.804 12.854  -4.295  1.00 0.00 ? 43 ASN A HB2  1  
ATOM 663   H HB3  . ASN A 1 43 ? -13.872 13.768  -5.465  1.00 0.00 ? 43 ASN A HB3  1  
ATOM 664   H HD21 . ASN A 1 43 ? -14.007 15.885  -5.456  1.00 0.00 ? 43 ASN A HD21 1  
ATOM 665   H HD22 . ASN A 1 43 ? -15.215 16.849  -4.673  1.00 0.00 ? 43 ASN A HD22 1  
ATOM 666   N N    . PRO A 1 44 ? -15.126 14.116  -8.311  1.00 0.00 ? 44 PRO A N    1  
ATOM 667   C CA   . PRO A 1 44 ? -14.413 14.341  -9.558  1.00 0.00 ? 44 PRO A CA   1  
ATOM 668   C C    . PRO A 1 44 ? -12.988 14.829  -9.294  1.00 0.00 ? 44 PRO A C    1  
ATOM 669   O O    . PRO A 1 44 ? -12.175 14.911  -10.214 1.00 0.00 ? 44 PRO A O    1  
ATOM 670   C CB   . PRO A 1 44 ? -15.257 15.353  -10.316 1.00 0.00 ? 44 PRO A CB   1  
ATOM 671   C CG   . PRO A 1 44 ? -16.158 16.005  -9.280  1.00 0.00 ? 44 PRO A CG   1  
ATOM 672   C CD   . PRO A 1 44 ? -16.105 15.159  -8.018  1.00 0.00 ? 44 PRO A CD   1  
ATOM 673   H HA   . PRO A 1 44 ? -14.320 13.483  -10.063 1.00 0.00 ? 44 PRO A HA   1  
ATOM 674   H HB2  . PRO A 1 44 ? -14.628 16.094  -10.809 1.00 0.00 ? 44 PRO A HB2  1  
ATOM 675   H HB3  . PRO A 1 44 ? -15.845 14.866  -11.094 1.00 0.00 ? 44 PRO A HB3  1  
ATOM 676   H HG2  . PRO A 1 44 ? -15.826 17.022  -9.072  1.00 0.00 ? 44 PRO A HG2  1  
ATOM 677   H HG3  . PRO A 1 44 ? -17.180 16.072  -9.652  1.00 0.00 ? 44 PRO A HG3  1  
ATOM 678   H HD2  . PRO A 1 44 ? -15.804 15.753  -7.155  1.00 0.00 ? 44 PRO A HD2  1  
ATOM 679   H HD3  . PRO A 1 44 ? -17.081 14.732  -7.787  1.00 0.00 ? 44 PRO A HD3  1  
ATOM 680   N N    . SER A 1 45 ? -12.727 15.140  -8.032  1.00 0.00 ? 45 SER A N    1  
ATOM 681   C CA   . SER A 1 45 ? -11.413 15.618  -7.636  1.00 0.00 ? 45 SER A CA   1  
ATOM 682   C C    . SER A 1 45 ? -10.344 14.597  -8.030  1.00 0.00 ? 45 SER A C    1  
ATOM 683   O O    . SER A 1 45 ? -9.456  14.898  -8.826  1.00 0.00 ? 45 SER A O    1  
ATOM 684   C CB   . SER A 1 45 ? -11.357 15.891  -6.131  1.00 0.00 ? 45 SER A CB   1  
ATOM 685   O OG   . SER A 1 45 ? -12.426 16.729  -5.701  1.00 0.00 ? 45 SER A OG   1  
ATOM 686   H H    . SER A 1 45 ? -13.393 15.070  -7.290  1.00 0.00 ? 45 SER A H    1  
ATOM 687   H HA   . SER A 1 45 ? -11.269 16.551  -8.179  1.00 0.00 ? 45 SER A HA   1  
ATOM 688   H HB2  . SER A 1 45 ? -11.397 14.946  -5.590  1.00 0.00 ? 45 SER A HB2  1  
ATOM 689   H HB3  . SER A 1 45 ? -10.406 16.360  -5.883  1.00 0.00 ? 45 SER A HB3  1  
ATOM 690   H HG   . SER A 1 45 ? -12.115 17.330  -4.965  1.00 0.00 ? 45 SER A HG   1  
ATOM 691   N N    . GLU A 1 46 ? -10.464 13.410  -7.454  1.00 0.00 ? 46 GLU A N    1  
ATOM 692   C CA   . GLU A 1 46 ? -9.519  12.342  -7.735  1.00 0.00 ? 46 GLU A CA   1  
ATOM 693   C C    . GLU A 1 46 ? -10.263 11.066  -8.134  1.00 0.00 ? 46 GLU A C    1  
ATOM 694   O O    . GLU A 1 46 ? -10.640 10.269  -7.277  1.00 0.00 ? 46 GLU A O    1  
ATOM 695   C CB   . GLU A 1 46 ? -8.604  12.090  -6.535  1.00 0.00 ? 46 GLU A CB   1  
ATOM 696   C CG   . GLU A 1 46 ? -7.905  13.380  -6.098  1.00 0.00 ? 46 GLU A CG   1  
ATOM 697   C CD   . GLU A 1 46 ? -8.375  13.815  -4.708  1.00 0.00 ? 46 GLU A CD   1  
ATOM 698   O OE1  . GLU A 1 46 ? -7.845  13.250  -3.728  1.00 0.00 ? 46 GLU A OE1  1  
ATOM 699   O OE2  . GLU A 1 46 ? -9.254  14.702  -4.659  1.00 0.00 ? 46 GLU A OE2  1  
ATOM 700   H H    . GLU A 1 46 ? -11.189 13.173  -6.807  1.00 0.00 ? 46 GLU A H    1  
ATOM 701   H HA   . GLU A 1 46 ? -8.920  12.699  -8.572  1.00 0.00 ? 46 GLU A HA   1  
ATOM 702   H HB2  . GLU A 1 46 ? -9.187  11.690  -5.706  1.00 0.00 ? 46 GLU A HB2  1  
ATOM 703   H HB3  . GLU A 1 46 ? -7.859  11.338  -6.793  1.00 0.00 ? 46 GLU A HB3  1  
ATOM 704   H HG2  . GLU A 1 46 ? -6.826  13.227  -6.090  1.00 0.00 ? 46 GLU A HG2  1  
ATOM 705   H HG3  . GLU A 1 46 ? -8.110  14.171  -6.819  1.00 0.00 ? 46 GLU A HG3  1  
ATOM 706   N N    . PRO A 1 47 ? -10.457 10.909  -9.471  1.00 0.00 ? 47 PRO A N    1  
ATOM 707   C CA   . PRO A 1 47 ? -11.149 9.744   -9.995  1.00 0.00 ? 47 PRO A CA   1  
ATOM 708   C C    . PRO A 1 47 ? -10.252 8.505   -9.944  1.00 0.00 ? 47 PRO A C    1  
ATOM 709   O O    . PRO A 1 47 ? -10.740 7.378   -10.015 1.00 0.00 ? 47 PRO A O    1  
ATOM 710   C CB   . PRO A 1 47 ? -11.551 10.128  -11.409 1.00 0.00 ? 47 PRO A CB   1  
ATOM 711   C CG   . PRO A 1 47 ? -10.671 11.308  -11.787 1.00 0.00 ? 47 PRO A CG   1  
ATOM 712   C CD   . PRO A 1 47 ? -10.024 11.833  -10.516 1.00 0.00 ? 47 PRO A CD   1  
ATOM 713   H HA   . PRO A 1 47 ? -11.944 9.528   -9.428  1.00 0.00 ? 47 PRO A HA   1  
ATOM 714   H HB2  . PRO A 1 47 ? -11.404 9.295   -12.097 1.00 0.00 ? 47 PRO A HB2  1  
ATOM 715   H HB3  . PRO A 1 47 ? -12.607 10.396  -11.456 1.00 0.00 ? 47 PRO A HB3  1  
ATOM 716   H HG2  . PRO A 1 47 ? -9.910  11.003  -12.505 1.00 0.00 ? 47 PRO A HG2  1  
ATOM 717   H HG3  . PRO A 1 47 ? -11.264 12.089  -12.263 1.00 0.00 ? 47 PRO A HG3  1  
ATOM 718   H HD2  . PRO A 1 47 ? -8.938  11.851  -10.603 1.00 0.00 ? 47 PRO A HD2  1  
ATOM 719   H HD3  . PRO A 1 47 ? -10.344 12.852  -10.300 1.00 0.00 ? 47 PRO A HD3  1  
ATOM 720   N N    . PHE A 1 48 ? -8.957  8.756   -9.822  1.00 0.00 ? 48 PHE A N    1  
ATOM 721   C CA   . PHE A 1 48 ? -7.988  7.675   -9.761  1.00 0.00 ? 48 PHE A CA   1  
ATOM 722   C C    . PHE A 1 48 ? -7.759  7.225   -8.316  1.00 0.00 ? 48 PHE A C    1  
ATOM 723   O O    . PHE A 1 48 ? -7.135  7.937   -7.532  1.00 0.00 ? 48 PHE A O    1  
ATOM 724   C CB   . PHE A 1 48 ? -6.675  8.219   -10.327 1.00 0.00 ? 48 PHE A CB   1  
ATOM 725   C CG   . PHE A 1 48 ? -6.785  8.744   -11.759 1.00 0.00 ? 48 PHE A CG   1  
ATOM 726   C CD1  . PHE A 1 48 ? -7.186  10.024  -11.986 1.00 0.00 ? 48 PHE A CD1  1  
ATOM 727   C CD2  . PHE A 1 48 ? -6.481  7.932   -12.807 1.00 0.00 ? 48 PHE A CD2  1  
ATOM 728   C CE1  . PHE A 1 48 ? -7.289  10.511  -13.315 1.00 0.00 ? 48 PHE A CE1  1  
ATOM 729   C CE2  . PHE A 1 48 ? -6.584  8.419   -14.137 1.00 0.00 ? 48 PHE A CE2  1  
ATOM 730   C CZ   . PHE A 1 48 ? -6.985  9.699   -14.363 1.00 0.00 ? 48 PHE A CZ   1  
ATOM 731   H H    . PHE A 1 48 ? -8.568  9.675   -9.765  1.00 0.00 ? 48 PHE A H    1  
ATOM 732   H HA   . PHE A 1 48 ? -8.393  6.844   -10.338 1.00 0.00 ? 48 PHE A HA   1  
ATOM 733   H HB2  . PHE A 1 48 ? -6.318  9.023   -9.682  1.00 0.00 ? 48 PHE A HB2  1  
ATOM 734   H HB3  . PHE A 1 48 ? -5.923  7.430   -10.297 1.00 0.00 ? 48 PHE A HB3  1  
ATOM 735   H HD1  . PHE A 1 48 ? -7.430  10.675  -11.146 1.00 0.00 ? 48 PHE A HD1  1  
ATOM 736   H HD2  . PHE A 1 48 ? -6.159  6.906   -12.626 1.00 0.00 ? 48 PHE A HD2  1  
ATOM 737   H HE1  . PHE A 1 48 ? -7.611  11.537  -13.497 1.00 0.00 ? 48 PHE A HE1  1  
ATOM 738   H HE2  . PHE A 1 48 ? -6.340  7.768   -14.976 1.00 0.00 ? 48 PHE A HE2  1  
ATOM 739   H HZ   . PHE A 1 48 ? -7.064  10.073  -15.384 1.00 0.00 ? 48 PHE A HZ   1  
ATOM 740   N N    . GLY A 1 49 ? -8.277  6.044   -8.009  1.00 0.00 ? 49 GLY A N    1  
ATOM 741   C CA   . GLY A 1 49 ? -8.137  5.490   -6.673  1.00 0.00 ? 49 GLY A CA   1  
ATOM 742   C C    . GLY A 1 49 ? -7.484  4.107   -6.719  1.00 0.00 ? 49 GLY A C    1  
ATOM 743   O O    . GLY A 1 49 ? -7.691  3.350   -7.666  1.00 0.00 ? 49 GLY A O    1  
ATOM 744   H H    . GLY A 1 49 ? -8.783  5.471   -8.653  1.00 0.00 ? 49 GLY A H    1  
ATOM 745   H HA2  . GLY A 1 49 ? -7.535  6.160   -6.059  1.00 0.00 ? 49 GLY A HA2  1  
ATOM 746   H HA3  . GLY A 1 49 ? -9.116  5.419   -6.201  1.00 0.00 ? 49 GLY A HA3  1  
ATOM 747   N N    . ALA A 1 50 ? -6.709  3.820   -5.683  1.00 0.00 ? 50 ALA A N    1  
ATOM 748   C CA   . ALA A 1 50 ? -6.025  2.541   -5.593  1.00 0.00 ? 50 ALA A CA   1  
ATOM 749   C C    . ALA A 1 50 ? -5.951  2.109   -4.127  1.00 0.00 ? 50 ALA A C    1  
ATOM 750   O O    . ALA A 1 50 ? -5.860  2.949   -3.233  1.00 0.00 ? 50 ALA A O    1  
ATOM 751   C CB   . ALA A 1 50 ? -4.642  2.655   -6.237  1.00 0.00 ? 50 ALA A CB   1  
ATOM 752   H H    . ALA A 1 50 ? -6.546  4.441   -4.917  1.00 0.00 ? 50 ALA A H    1  
ATOM 753   H HA   . ALA A 1 50 ? -6.612  1.810   -6.149  1.00 0.00 ? 50 ALA A HA   1  
ATOM 754   H HB1  . ALA A 1 50 ? -4.439  1.759   -6.823  1.00 0.00 ? 50 ALA A HB1  1  
ATOM 755   H HB2  . ALA A 1 50 ? -4.616  3.529   -6.889  1.00 0.00 ? 50 ALA A HB2  1  
ATOM 756   H HB3  . ALA A 1 50 ? -3.886  2.759   -5.459  1.00 0.00 ? 50 ALA A HB3  1  
ATOM 757   N N    . SER A 1 51 ? -5.993  0.800   -3.926  1.00 0.00 ? 51 SER A N    1  
ATOM 758   C CA   . SER A 1 51 ? -5.933  0.247   -2.583  1.00 0.00 ? 51 SER A CA   1  
ATOM 759   C C    . SER A 1 51 ? -4.863  -0.844  -2.516  1.00 0.00 ? 51 SER A C    1  
ATOM 760   O O    . SER A 1 51 ? -4.486  -1.414  -3.539  1.00 0.00 ? 51 SER A O    1  
ATOM 761   C CB   . SER A 1 51 ? -7.291  -0.313  -2.157  1.00 0.00 ? 51 SER A CB   1  
ATOM 762   O OG   . SER A 1 51 ? -8.117  -0.621  -3.276  1.00 0.00 ? 51 SER A OG   1  
ATOM 763   H H    . SER A 1 51 ? -6.068  0.124   -4.659  1.00 0.00 ? 51 SER A H    1  
ATOM 764   H HA   . SER A 1 51 ? -5.667  1.084   -1.938  1.00 0.00 ? 51 SER A HA   1  
ATOM 765   H HB2  . SER A 1 51 ? -7.140  -1.213  -1.559  1.00 0.00 ? 51 SER A HB2  1  
ATOM 766   H HB3  . SER A 1 51 ? -7.798  0.411   -1.520  1.00 0.00 ? 51 SER A HB3  1  
ATOM 767   H HG   . SER A 1 51 ? -9.056  -0.327  -3.099  1.00 0.00 ? 51 SER A HG   1  
ATOM 768   N N    . VAL A 1 52 ? -4.403  -1.103  -1.300  1.00 0.00 ? 52 VAL A N    1  
ATOM 769   C CA   . VAL A 1 52 ? -3.384  -2.116  -1.085  1.00 0.00 ? 52 VAL A CA   1  
ATOM 770   C C    . VAL A 1 52 ? -3.964  -3.243  -0.228  1.00 0.00 ? 52 VAL A C    1  
ATOM 771   O O    . VAL A 1 52 ? -4.047  -3.120  0.992   1.00 0.00 ? 52 VAL A O    1  
ATOM 772   C CB   . VAL A 1 52 ? -2.135  -1.481  -0.471  1.00 0.00 ? 52 VAL A CB   1  
ATOM 773   C CG1  . VAL A 1 52 ? -1.211  -2.547  0.120   1.00 0.00 ? 52 VAL A CG1  1  
ATOM 774   C CG2  . VAL A 1 52 ? -1.395  -0.622  -1.499  1.00 0.00 ? 52 VAL A CG2  1  
ATOM 775   H H    . VAL A 1 52 ? -4.714  -0.635  -0.473  1.00 0.00 ? 52 VAL A H    1  
ATOM 776   H HA   . VAL A 1 52 ? -3.112  -2.521  -2.060  1.00 0.00 ? 52 VAL A HA   1  
ATOM 777   H HB   . VAL A 1 52 ? -2.456  -0.828  0.341   1.00 0.00 ? 52 VAL A HB   1  
ATOM 778   H HG11 . VAL A 1 52 ? -0.843  -3.192  -0.679  1.00 0.00 ? 52 VAL A HG11 1  
ATOM 779   H HG12 . VAL A 1 52 ? -0.368  -2.064  0.614   1.00 0.00 ? 52 VAL A HG12 1  
ATOM 780   H HG13 . VAL A 1 52 ? -1.763  -3.145  0.844   1.00 0.00 ? 52 VAL A HG13 1  
ATOM 781   H HG21 . VAL A 1 52 ? -1.342  -1.156  -2.448  1.00 0.00 ? 52 VAL A HG21 1  
ATOM 782   H HG22 . VAL A 1 52 ? -1.930  0.317   -1.640  1.00 0.00 ? 52 VAL A HG22 1  
ATOM 783   H HG23 . VAL A 1 52 ? -0.386  -0.416  -1.141  1.00 0.00 ? 52 VAL A HG23 1  
ATOM 784   N N    . THR A 1 53 ? -4.350  -4.317  -0.902  1.00 0.00 ? 53 THR A N    1  
ATOM 785   C CA   . THR A 1 53 ? -4.920  -5.465  -0.218  1.00 0.00 ? 53 THR A CA   1  
ATOM 786   C C    . THR A 1 53 ? -3.832  -6.496  0.090   1.00 0.00 ? 53 THR A C    1  
ATOM 787   O O    . THR A 1 53 ? -3.133  -6.954  -0.812  1.00 0.00 ? 53 THR A O    1  
ATOM 788   C CB   . THR A 1 53 ? -6.053  -6.017  -1.084  1.00 0.00 ? 53 THR A CB   1  
ATOM 789   O OG1  . THR A 1 53 ? -5.547  -5.934  -2.413  1.00 0.00 ? 53 THR A OG1  1  
ATOM 790   C CG2  . THR A 1 53 ? -7.281  -5.104  -1.095  1.00 0.00 ? 53 THR A CG2  1  
ATOM 791   H H    . THR A 1 53 ? -4.279  -4.410  -1.895  1.00 0.00 ? 53 THR A H    1  
ATOM 792   H HA   . THR A 1 53 ? -5.322  -5.130  0.738   1.00 0.00 ? 53 THR A HA   1  
ATOM 793   H HB   . THR A 1 53 ? -6.323  -7.027  -0.775  1.00 0.00 ? 53 THR A HB   1  
ATOM 794   H HG1  . THR A 1 53 ? -5.194  -6.824  -2.702  1.00 0.00 ? 53 THR A HG1  1  
ATOM 795   H HG21 . THR A 1 53 ? -8.184  -5.707  -1.005  1.00 0.00 ? 53 THR A HG21 1  
ATOM 796   H HG22 . THR A 1 53 ? -7.223  -4.408  -0.258  1.00 0.00 ? 53 THR A HG22 1  
ATOM 797   H HG23 . THR A 1 53 ? -7.309  -4.545  -2.030  1.00 0.00 ? 53 THR A HG23 1  
ATOM 798   N N    . ILE A 1 54 ? -3.724  -6.832  1.367   1.00 0.00 ? 54 ILE A N    1  
ATOM 799   C CA   . ILE A 1 54 ? -2.734  -7.801  1.805   1.00 0.00 ? 54 ILE A CA   1  
ATOM 800   C C    . ILE A 1 54 ? -3.391  -9.177  1.924   1.00 0.00 ? 54 ILE A C    1  
ATOM 801   O O    . ILE A 1 54 ? -4.085  -9.455  2.901   1.00 0.00 ? 54 ILE A O    1  
ATOM 802   C CB   . ILE A 1 54 ? -2.056  -7.329  3.093   1.00 0.00 ? 54 ILE A CB   1  
ATOM 803   C CG1  . ILE A 1 54 ? -1.171  -6.109  2.832   1.00 0.00 ? 54 ILE A CG1  1  
ATOM 804   C CG2  . ILE A 1 54 ? -1.279  -8.470  3.754   1.00 0.00 ? 54 ILE A CG2  1  
ATOM 805   C CD1  . ILE A 1 54 ? -0.620  -5.541  4.142   1.00 0.00 ? 54 ILE A CD1  1  
ATOM 806   H H    . ILE A 1 54 ? -4.297  -6.455  2.095   1.00 0.00 ? 54 ILE A H    1  
ATOM 807   H HA   . ILE A 1 54 ? -1.964  -7.851  1.036   1.00 0.00 ? 54 ILE A HA   1  
ATOM 808   H HB   . ILE A 1 54 ? -2.832  -7.020  3.794   1.00 0.00 ? 54 ILE A HB   1  
ATOM 809   H HG12 . ILE A 1 54 ? -0.346  -6.387  2.177   1.00 0.00 ? 54 ILE A HG12 1  
ATOM 810   H HG13 . ILE A 1 54 ? -1.746  -5.342  2.313   1.00 0.00 ? 54 ILE A HG13 1  
ATOM 811   H HG21 . ILE A 1 54 ? -1.758  -8.738  4.695   1.00 0.00 ? 54 ILE A HG21 1  
ATOM 812   H HG22 . ILE A 1 54 ? -1.271  -9.335  3.091   1.00 0.00 ? 54 ILE A HG22 1  
ATOM 813   H HG23 . ILE A 1 54 ? -0.255  -8.149  3.945   1.00 0.00 ? 54 ILE A HG23 1  
ATOM 814   H HD11 . ILE A 1 54 ? -1.448  -5.282  4.802   1.00 0.00 ? 54 ILE A HD11 1  
ATOM 815   H HD12 . ILE A 1 54 ? 0.011   -6.287  4.625   1.00 0.00 ? 54 ILE A HD12 1  
ATOM 816   H HD13 . ILE A 1 54 ? -0.030  -4.648  3.931   1.00 0.00 ? 54 ILE A HD13 1  
ATOM 817   N N    . ASP A 1 55 ? -3.149  -10.002 0.917   1.00 0.00 ? 55 ASP A N    1  
ATOM 818   C CA   . ASP A 1 55 ? -3.708  -11.343 0.896   1.00 0.00 ? 55 ASP A CA   1  
ATOM 819   C C    . ASP A 1 55 ? -5.232  -11.254 0.791   1.00 0.00 ? 55 ASP A C    1  
ATOM 820   O O    . ASP A 1 55 ? -5.932  -12.242 1.004   1.00 0.00 ? 55 ASP A O    1  
ATOM 821   C CB   . ASP A 1 55 ? -3.367  -12.102 2.180   1.00 0.00 ? 55 ASP A CB   1  
ATOM 822   C CG   . ASP A 1 55 ? -3.685  -13.598 2.151   1.00 0.00 ? 55 ASP A CG   1  
ATOM 823   O OD1  . ASP A 1 55 ? -3.032  -14.302 1.350   1.00 0.00 ? 55 ASP A OD1  1  
ATOM 824   O OD2  . ASP A 1 55 ? -4.574  -14.005 2.930   1.00 0.00 ? 55 ASP A OD2  1  
ATOM 825   H H    . ASP A 1 55 ? -2.583  -9.769  0.126   1.00 0.00 ? 55 ASP A H    1  
ATOM 826   H HA   . ASP A 1 55 ? -3.258  -11.828 0.030   1.00 0.00 ? 55 ASP A HA   1  
ATOM 827   H HB2  . ASP A 1 55 ? -2.305  -11.976 2.388   1.00 0.00 ? 55 ASP A HB2  1  
ATOM 828   H HB3  . ASP A 1 55 ? -3.910  -11.646 3.009   1.00 0.00 ? 55 ASP A HB3  1  
ATOM 829   N N    . GLY A 1 56 ? -5.701  -10.059 0.461   1.00 0.00 ? 56 GLY A N    1  
ATOM 830   C CA   . GLY A 1 56 ? -7.129  -9.828  0.324   1.00 0.00 ? 56 GLY A CA   1  
ATOM 831   C C    . GLY A 1 56 ? -7.610  -8.768  1.317   1.00 0.00 ? 56 GLY A C    1  
ATOM 832   O O    . GLY A 1 56 ? -8.539  -8.016  1.026   1.00 0.00 ? 56 GLY A O    1  
ATOM 833   H H    . GLY A 1 56 ? -5.125  -9.260  0.288   1.00 0.00 ? 56 GLY A H    1  
ATOM 834   H HA2  . GLY A 1 56 ? -7.353  -9.506  -0.693  1.00 0.00 ? 56 GLY A HA2  1  
ATOM 835   H HA3  . GLY A 1 56 ? -7.670  -10.759 0.490   1.00 0.00 ? 56 GLY A HA3  1  
ATOM 836   N N    . VAL A 1 57 ? -6.957  -8.743  2.469   1.00 0.00 ? 57 VAL A N    1  
ATOM 837   C CA   . VAL A 1 57 ? -7.306  -7.787  3.507   1.00 0.00 ? 57 VAL A CA   1  
ATOM 838   C C    . VAL A 1 57 ? -6.823  -6.395  3.096   1.00 0.00 ? 57 VAL A C    1  
ATOM 839   O O    . VAL A 1 57 ? -5.635  -6.194  2.847   1.00 0.00 ? 57 VAL A O    1  
ATOM 840   C CB   . VAL A 1 57 ? -6.738  -8.245  4.852   1.00 0.00 ? 57 VAL A CB   1  
ATOM 841   C CG1  . VAL A 1 57 ? -6.755  -7.104  5.871   1.00 0.00 ? 57 VAL A CG1  1  
ATOM 842   C CG2  . VAL A 1 57 ? -7.495  -9.464  5.381   1.00 0.00 ? 57 VAL A CG2  1  
ATOM 843   H H    . VAL A 1 57 ? -6.202  -9.358  2.698   1.00 0.00 ? 57 VAL A H    1  
ATOM 844   H HA   . VAL A 1 57 ? -8.393  -7.772  3.588   1.00 0.00 ? 57 VAL A HA   1  
ATOM 845   H HB   . VAL A 1 57 ? -5.700  -8.538  4.695   1.00 0.00 ? 57 VAL A HB   1  
ATOM 846   H HG11 . VAL A 1 57 ? -5.862  -6.492  5.746   1.00 0.00 ? 57 VAL A HG11 1  
ATOM 847   H HG12 . VAL A 1 57 ? -7.641  -6.489  5.713   1.00 0.00 ? 57 VAL A HG12 1  
ATOM 848   H HG13 . VAL A 1 57 ? -6.774  -7.517  6.879   1.00 0.00 ? 57 VAL A HG13 1  
ATOM 849   H HG21 . VAL A 1 57 ? -7.115  -10.365 4.899   1.00 0.00 ? 57 VAL A HG21 1  
ATOM 850   H HG22 . VAL A 1 57 ? -7.351  -9.541  6.459   1.00 0.00 ? 57 VAL A HG22 1  
ATOM 851   H HG23 . VAL A 1 57 ? -8.557  -9.355  5.163   1.00 0.00 ? 57 VAL A HG23 1  
ATOM 852   N N    . THR A 1 58 ? -7.769  -5.469  3.038   1.00 0.00 ? 58 THR A N    1  
ATOM 853   C CA   . THR A 1 58 ? -7.455  -4.101  2.662   1.00 0.00 ? 58 THR A CA   1  
ATOM 854   C C    . THR A 1 58 ? -6.821  -3.356  3.839   1.00 0.00 ? 58 THR A C    1  
ATOM 855   O O    . THR A 1 58 ? -7.305  -3.443  4.966   1.00 0.00 ? 58 THR A O    1  
ATOM 856   C CB   . THR A 1 58 ? -8.738  -3.445  2.148   1.00 0.00 ? 58 THR A CB   1  
ATOM 857   O OG1  . THR A 1 58 ? -9.334  -4.445  1.326   1.00 0.00 ? 58 THR A OG1  1  
ATOM 858   C CG2  . THR A 1 58 ? -8.460  -2.289  1.186   1.00 0.00 ? 58 THR A CG2  1  
ATOM 859   H H    . THR A 1 58 ? -8.733  -5.640  3.243   1.00 0.00 ? 58 THR A H    1  
ATOM 860   H HA   . THR A 1 58 ? -6.714  -4.126  1.863   1.00 0.00 ? 58 THR A HA   1  
ATOM 861   H HB   . THR A 1 58 ? -9.368  -3.120  2.977   1.00 0.00 ? 58 THR A HB   1  
ATOM 862   H HG1  . THR A 1 58 ? -10.199 -4.110  0.953   1.00 0.00 ? 58 THR A HG1  1  
ATOM 863   H HG21 . THR A 1 58 ? -9.372  -1.708  1.043   1.00 0.00 ? 58 THR A HG21 1  
ATOM 864   H HG22 . THR A 1 58 ? -7.683  -1.648  1.603   1.00 0.00 ? 58 THR A HG22 1  
ATOM 865   H HG23 . THR A 1 58 ? -8.128  -2.686  0.227   1.00 0.00 ? 58 THR A HG23 1  
ATOM 866   N N    . TYR A 1 59 ? -5.748  -2.641  3.536   1.00 0.00 ? 59 TYR A N    1  
ATOM 867   C CA   . TYR A 1 59 ? -5.042  -1.882  4.554   1.00 0.00 ? 59 TYR A CA   1  
ATOM 868   C C    . TYR A 1 59 ? -5.071  -0.385  4.240   1.00 0.00 ? 59 TYR A C    1  
ATOM 869   O O    . TYR A 1 59 ? -5.930  0.342   4.737   1.00 0.00 ? 59 TYR A O    1  
ATOM 870   C CB   . TYR A 1 59 ? -3.593  -2.371  4.518   1.00 0.00 ? 59 TYR A CB   1  
ATOM 871   C CG   . TYR A 1 59 ? -3.326  -3.589  5.404   1.00 0.00 ? 59 TYR A CG   1  
ATOM 872   C CD1  . TYR A 1 59 ? -3.747  -4.841  5.003   1.00 0.00 ? 59 TYR A CD1  1  
ATOM 873   C CD2  . TYR A 1 59 ? -2.662  -3.436  6.604   1.00 0.00 ? 59 TYR A CD2  1  
ATOM 874   C CE1  . TYR A 1 59 ? -3.495  -5.987  5.837   1.00 0.00 ? 59 TYR A CE1  1  
ATOM 875   C CE2  . TYR A 1 59 ? -2.410  -4.583  7.439   1.00 0.00 ? 59 TYR A CE2  1  
ATOM 876   C CZ   . TYR A 1 59 ? -2.839  -5.801  7.014   1.00 0.00 ? 59 TYR A CZ   1  
ATOM 877   O OH   . TYR A 1 59 ? -2.601  -6.884  7.802   1.00 0.00 ? 59 TYR A OH   1  
ATOM 878   H H    . TYR A 1 59 ? -5.360  -2.576  2.616   1.00 0.00 ? 59 TYR A H    1  
ATOM 879   H HA   . TYR A 1 59 ? -5.541  -2.054  5.508   1.00 0.00 ? 59 TYR A HA   1  
ATOM 880   H HB2  . TYR A 1 59 ? -3.330  -2.618  3.489   1.00 0.00 ? 59 TYR A HB2  1  
ATOM 881   H HB3  . TYR A 1 59 ? -2.938  -1.558  4.828   1.00 0.00 ? 59 TYR A HB3  1  
ATOM 882   H HD1  . TYR A 1 59 ? -4.271  -4.961  4.055   1.00 0.00 ? 59 TYR A HD1  1  
ATOM 883   H HD2  . TYR A 1 59 ? -2.329  -2.448  6.921   1.00 0.00 ? 59 TYR A HD2  1  
ATOM 884   H HE1  . TYR A 1 59 ? -3.822  -6.981  5.532   1.00 0.00 ? 59 TYR A HE1  1  
ATOM 885   H HE2  . TYR A 1 59 ? -1.887  -4.476  8.389   1.00 0.00 ? 59 TYR A HE2  1  
ATOM 886   H HH   . TYR A 1 59 ? -2.234  -7.634  7.251   1.00 0.00 ? 59 TYR A HH   1  
ATOM 887   N N    . GLY A 1 60 ? -4.120  0.032   3.416   1.00 0.00 ? 60 GLY A N    1  
ATOM 888   C CA   . GLY A 1 60 ? -4.025  1.430   3.030   1.00 0.00 ? 60 GLY A CA   1  
ATOM 889   C C    . GLY A 1 60 ? -4.615  1.654   1.636   1.00 0.00 ? 60 GLY A C    1  
ATOM 890   O O    . GLY A 1 60 ? -4.240  0.974   0.682   1.00 0.00 ? 60 GLY A O    1  
ATOM 891   H H    . GLY A 1 60 ? -3.425  -0.565  3.017   1.00 0.00 ? 60 GLY A H    1  
ATOM 892   H HA2  . GLY A 1 60 ? -4.552  2.048   3.756   1.00 0.00 ? 60 GLY A HA2  1  
ATOM 893   H HA3  . GLY A 1 60 ? -2.981  1.744   3.042   1.00 0.00 ? 60 GLY A HA3  1  
ATOM 894   N N    . SER A 1 61 ? -5.528  2.612   1.562   1.00 0.00 ? 61 SER A N    1  
ATOM 895   C CA   . SER A 1 61 ? -6.174  2.934   0.301   1.00 0.00 ? 61 SER A CA   1  
ATOM 896   C C    . SER A 1 61 ? -6.376  4.447   0.189   1.00 0.00 ? 61 SER A C    1  
ATOM 897   O O    . SER A 1 61 ? -6.619  5.120   1.190   1.00 0.00 ? 61 SER A O    1  
ATOM 898   C CB   . SER A 1 61 ? -7.513  2.208   0.166   1.00 0.00 ? 61 SER A CB   1  
ATOM 899   O OG   . SER A 1 61 ? -8.467  2.665   1.121   1.00 0.00 ? 61 SER A OG   1  
ATOM 900   H H    . SER A 1 61 ? -5.827  3.160   2.343   1.00 0.00 ? 61 SER A H    1  
ATOM 901   H HA   . SER A 1 61 ? -5.490  2.582   -0.471  1.00 0.00 ? 61 SER A HA   1  
ATOM 902   H HB2  . SER A 1 61 ? -7.907  2.357   -0.839  1.00 0.00 ? 61 SER A HB2  1  
ATOM 903   H HB3  . SER A 1 61 ? -7.359  1.136   0.292   1.00 0.00 ? 61 SER A HB3  1  
ATOM 904   H HG   . SER A 1 61 ? -8.189  3.555   1.483   1.00 0.00 ? 61 SER A HG   1  
ATOM 905   N N    . GLY A 1 62 ? -6.270  4.937   -1.037  1.00 0.00 ? 62 GLY A N    1  
ATOM 906   C CA   . GLY A 1 62 ? -6.438  6.357   -1.293  1.00 0.00 ? 62 GLY A CA   1  
ATOM 907   C C    . GLY A 1 62 ? -6.545  6.635   -2.794  1.00 0.00 ? 62 GLY A C    1  
ATOM 908   O O    . GLY A 1 62 ? -6.524  5.709   -3.603  1.00 0.00 ? 62 GLY A O    1  
ATOM 909   H H    . GLY A 1 62 ? -6.072  4.382   -1.846  1.00 0.00 ? 62 GLY A H    1  
ATOM 910   H HA2  . GLY A 1 62 ? -7.335  6.717   -0.788  1.00 0.00 ? 62 GLY A HA2  1  
ATOM 911   H HA3  . GLY A 1 62 ? -5.595  6.908   -0.877  1.00 0.00 ? 62 GLY A HA3  1  
ATOM 912   N N    . THR A 1 63 ? -6.657  7.915   -3.120  1.00 0.00 ? 63 THR A N    1  
ATOM 913   C CA   . THR A 1 63 ? -6.767  8.326   -4.509  1.00 0.00 ? 63 THR A CA   1  
ATOM 914   C C    . THR A 1 63 ? -5.883  9.546   -4.775  1.00 0.00 ? 63 THR A C    1  
ATOM 915   O O    . THR A 1 63 ? -5.273  10.088  -3.854  1.00 0.00 ? 63 THR A O    1  
ATOM 916   C CB   . THR A 1 63 ? -8.246  8.569   -4.814  1.00 0.00 ? 63 THR A CB   1  
ATOM 917   O OG1  . THR A 1 63 ? -8.571  9.732   -4.058  1.00 0.00 ? 63 THR A OG1  1  
ATOM 918   C CG2  . THR A 1 63 ? -9.151  7.481   -4.231  1.00 0.00 ? 63 THR A CG2  1  
ATOM 919   H H    . THR A 1 63 ? -6.673  8.661   -2.455  1.00 0.00 ? 63 THR A H    1  
ATOM 920   H HA   . THR A 1 63 ? -6.394  7.518   -5.137  1.00 0.00 ? 63 THR A HA   1  
ATOM 921   H HB   . THR A 1 63 ? -8.410  8.678   -5.886  1.00 0.00 ? 63 THR A HB   1  
ATOM 922   H HG1  . THR A 1 63 ? -8.532  9.527   -3.080  1.00 0.00 ? 63 THR A HG1  1  
ATOM 923   H HG21 . THR A 1 63 ? -8.785  6.501   -4.538  1.00 0.00 ? 63 THR A HG21 1  
ATOM 924   H HG22 . THR A 1 63 ? -9.143  7.547   -3.143  1.00 0.00 ? 63 THR A HG22 1  
ATOM 925   H HG23 . THR A 1 63 ? -10.168 7.620   -4.596  1.00 0.00 ? 63 THR A HG23 1  
ATOM 926   N N    . ALA A 1 64 ? -5.843  9.943   -6.038  1.00 0.00 ? 64 ALA A N    1  
ATOM 927   C CA   . ALA A 1 64 ? -5.044  11.089  -6.437  1.00 0.00 ? 64 ALA A CA   1  
ATOM 928   C C    . ALA A 1 64 ? -5.419  11.495  -7.864  1.00 0.00 ? 64 ALA A C    1  
ATOM 929   O O    . ALA A 1 64 ? -6.320  10.910  -8.463  1.00 0.00 ? 64 ALA A O    1  
ATOM 930   C CB   . ALA A 1 64 ? -3.558  10.750  -6.300  1.00 0.00 ? 64 ALA A CB   1  
ATOM 931   H H    . ALA A 1 64 ? -6.342  9.497   -6.781  1.00 0.00 ? 64 ALA A H    1  
ATOM 932   H HA   . ALA A 1 64 ? -5.280  11.910  -5.761  1.00 0.00 ? 64 ALA A HA   1  
ATOM 933   H HB1  . ALA A 1 64 ? -3.391  10.226  -5.358  1.00 0.00 ? 64 ALA A HB1  1  
ATOM 934   H HB2  . ALA A 1 64 ? -3.253  10.112  -7.129  1.00 0.00 ? 64 ALA A HB2  1  
ATOM 935   H HB3  . ALA A 1 64 ? -2.973  11.669  -6.313  1.00 0.00 ? 64 ALA A HB3  1  
ATOM 936   N N    . SER A 1 65 ? -4.709  12.495  -8.367  1.00 0.00 ? 65 SER A N    1  
ATOM 937   C CA   . SER A 1 65 ? -4.957  12.986  -9.712  1.00 0.00 ? 65 SER A CA   1  
ATOM 938   C C    . SER A 1 65 ? -4.529  11.936  -10.739 1.00 0.00 ? 65 SER A C    1  
ATOM 939   O O    . SER A 1 65 ? -5.195  11.750  -11.757 1.00 0.00 ? 65 SER A O    1  
ATOM 940   C CB   . SER A 1 65 ? -4.220  14.303  -9.961  1.00 0.00 ? 65 SER A CB   1  
ATOM 941   O OG   . SER A 1 65 ? -4.819  15.391  -9.262  1.00 0.00 ? 65 SER A OG   1  
ATOM 942   H H    . SER A 1 65 ? -3.978  12.966  -7.873  1.00 0.00 ? 65 SER A H    1  
ATOM 943   H HA   . SER A 1 65 ? -6.032  13.156  -9.764  1.00 0.00 ? 65 SER A HA   1  
ATOM 944   H HB2  . SER A 1 65 ? -3.180  14.202  -9.651  1.00 0.00 ? 65 SER A HB2  1  
ATOM 945   H HB3  . SER A 1 65 ? -4.214  14.519  -11.030 1.00 0.00 ? 65 SER A HB3  1  
ATOM 946   H HG   . SER A 1 65 ? -5.749  15.542  -9.597  1.00 0.00 ? 65 SER A HG   1  
ATOM 947   N N    . SER A 1 66 ? -3.420  11.276  -10.437 1.00 0.00 ? 66 SER A N    1  
ATOM 948   C CA   . SER A 1 66 ? -2.896  10.249  -11.322 1.00 0.00 ? 66 SER A CA   1  
ATOM 949   C C    . SER A 1 66 ? -3.003  8.878   -10.653 1.00 0.00 ? 66 SER A C    1  
ATOM 950   O O    . SER A 1 66 ? -3.377  8.780   -9.485  1.00 0.00 ? 66 SER A O    1  
ATOM 951   C CB   . SER A 1 66 ? -1.444  10.542  -11.705 1.00 0.00 ? 66 SER A CB   1  
ATOM 952   O OG   . SER A 1 66 ? -1.243  10.488  -13.115 1.00 0.00 ? 66 SER A OG   1  
ATOM 953   H H    . SER A 1 66 ? -2.885  11.433  -9.608  1.00 0.00 ? 66 SER A H    1  
ATOM 954   H HA   . SER A 1 66 ? -3.522  10.290  -12.213 1.00 0.00 ? 66 SER A HA   1  
ATOM 955   H HB2  . SER A 1 66 ? -1.163  11.528  -11.336 1.00 0.00 ? 66 SER A HB2  1  
ATOM 956   H HB3  . SER A 1 66 ? -0.788  9.821   -11.218 1.00 0.00 ? 66 SER A HB3  1  
ATOM 957   H HG   . SER A 1 66 ? -0.600  9.757   -13.341 1.00 0.00 ? 66 SER A HG   1  
ATOM 958   N N    . LYS A 1 67 ? -2.667  7.852   -11.421 1.00 0.00 ? 67 LYS A N    1  
ATOM 959   C CA   . LYS A 1 67 ? -2.720  6.490   -10.917 1.00 0.00 ? 67 LYS A CA   1  
ATOM 960   C C    . LYS A 1 67 ? -1.584  6.277   -9.915  1.00 0.00 ? 67 LYS A C    1  
ATOM 961   O O    . LYS A 1 67 ? -1.807  5.771   -8.817  1.00 0.00 ? 67 LYS A O    1  
ATOM 962   C CB   . LYS A 1 67 ? -2.715  5.490   -12.075 1.00 0.00 ? 67 LYS A CB   1  
ATOM 963   C CG   . LYS A 1 67 ? -3.313  4.149   -11.644 1.00 0.00 ? 67 LYS A CG   1  
ATOM 964   C CD   . LYS A 1 67 ? -3.489  3.216   -12.844 1.00 0.00 ? 67 LYS A CD   1  
ATOM 965   C CE   . LYS A 1 67 ? -3.358  1.751   -12.423 1.00 0.00 ? 67 LYS A CE   1  
ATOM 966   N NZ   . LYS A 1 67 ? -2.492  1.015   -13.371 1.00 0.00 ? 67 LYS A NZ   1  
ATOM 967   H H    . LYS A 1 67 ? -2.364  7.940   -12.370 1.00 0.00 ? 67 LYS A H    1  
ATOM 968   H HA   . LYS A 1 67 ? -3.669  6.373   -10.394 1.00 0.00 ? 67 LYS A HA   1  
ATOM 969   H HB2  . LYS A 1 67 ? -3.283  5.894   -12.912 1.00 0.00 ? 67 LYS A HB2  1  
ATOM 970   H HB3  . LYS A 1 67 ? -1.694  5.341   -12.426 1.00 0.00 ? 67 LYS A HB3  1  
ATOM 971   H HG2  . LYS A 1 67 ? -2.665  3.679   -10.905 1.00 0.00 ? 67 LYS A HG2  1  
ATOM 972   H HG3  . LYS A 1 67 ? -4.277  4.315   -11.163 1.00 0.00 ? 67 LYS A HG3  1  
ATOM 973   H HD2  . LYS A 1 67 ? -4.466  3.382   -13.298 1.00 0.00 ? 67 LYS A HD2  1  
ATOM 974   H HD3  . LYS A 1 67 ? -2.741  3.449   -13.602 1.00 0.00 ? 67 LYS A HD3  1  
ATOM 975   H HE2  . LYS A 1 67 ? -2.940  1.692   -11.418 1.00 0.00 ? 67 LYS A HE2  1  
ATOM 976   H HE3  . LYS A 1 67 ? -4.344  1.288   -12.386 1.00 0.00 ? 67 LYS A HE3  1  
ATOM 977   H HZ1  . LYS A 1 67 ? -3.057  0.425   -13.949 1.00 0.00 ? 67 LYS A HZ1  1  
ATOM 978   H HZ2  . LYS A 1 67 ? -1.996  1.667   -13.945 1.00 0.00 ? 67 LYS A HZ2  1  
ATOM 979   H HZ3  . LYS A 1 67 ? -1.839  0.456   -12.861 1.00 0.00 ? 67 LYS A HZ3  1  
ATOM 980   N N    . LYS A 1 68 ? -0.390  6.675   -10.329 1.00 0.00 ? 68 LYS A N    1  
ATOM 981   C CA   . LYS A 1 68 ? 0.782   6.534   -9.482  1.00 0.00 ? 68 LYS A CA   1  
ATOM 982   C C    . LYS A 1 68 ? 0.468   7.086   -8.090  1.00 0.00 ? 68 LYS A C    1  
ATOM 983   O O    . LYS A 1 68 ? 0.450   6.339   -7.112  1.00 0.00 ? 68 LYS A O    1  
ATOM 984   C CB   . LYS A 1 68 ? 2.001   7.183   -10.140 1.00 0.00 ? 68 LYS A CB   1  
ATOM 985   C CG   . LYS A 1 68 ? 2.687   6.211   -11.102 1.00 0.00 ? 68 LYS A CG   1  
ATOM 986   C CD   . LYS A 1 68 ? 3.705   6.938   -11.983 1.00 0.00 ? 68 LYS A CD   1  
ATOM 987   C CE   . LYS A 1 68 ? 3.659   6.414   -13.420 1.00 0.00 ? 68 LYS A CE   1  
ATOM 988   N NZ   . LYS A 1 68 ? 5.011   6.432   -14.022 1.00 0.00 ? 68 LYS A NZ   1  
ATOM 989   H H    . LYS A 1 68 ? -0.217  7.086   -11.224 1.00 0.00 ? 68 LYS A H    1  
ATOM 990   H HA   . LYS A 1 68 ? 0.993   5.468   -9.392  1.00 0.00 ? 68 LYS A HA   1  
ATOM 991   H HB2  . LYS A 1 68 ? 1.694   8.078   -10.681 1.00 0.00 ? 68 LYS A HB2  1  
ATOM 992   H HB3  . LYS A 1 68 ? 2.707   7.501   -9.373  1.00 0.00 ? 68 LYS A HB3  1  
ATOM 993   H HG2  . LYS A 1 68 ? 3.188   5.425   -10.535 1.00 0.00 ? 68 LYS A HG2  1  
ATOM 994   H HG3  . LYS A 1 68 ? 1.940   5.724   -11.728 1.00 0.00 ? 68 LYS A HG3  1  
ATOM 995   H HD2  . LYS A 1 68 ? 3.499   8.008   -11.976 1.00 0.00 ? 68 LYS A HD2  1  
ATOM 996   H HD3  . LYS A 1 68 ? 4.707   6.804   -11.575 1.00 0.00 ? 68 LYS A HD3  1  
ATOM 997   H HE2  . LYS A 1 68 ? 3.263   5.399   -13.431 1.00 0.00 ? 68 LYS A HE2  1  
ATOM 998   H HE3  . LYS A 1 68 ? 2.981   7.026   -14.015 1.00 0.00 ? 68 LYS A HE3  1  
ATOM 999   H HZ1  . LYS A 1 68 ? 5.607   5.804   -13.521 1.00 0.00 ? 68 LYS A HZ1  1  
ATOM 1000  H HZ2  . LYS A 1 68 ? 4.954   6.146   -14.978 1.00 0.00 ? 68 LYS A HZ2  1  
ATOM 1001  H HZ3  . LYS A 1 68 ? 5.385   7.358   -13.973 1.00 0.00 ? 68 LYS A HZ3  1  
ATOM 1002  N N    . LEU A 1 69 ? 0.229   8.388   -8.044  1.00 0.00 ? 69 LEU A N    1  
ATOM 1003  C CA   . LEU A 1 69 ? -0.083  9.048   -6.788  1.00 0.00 ? 69 LEU A CA   1  
ATOM 1004  C C    . LEU A 1 69 ? -1.006  8.152   -5.961  1.00 0.00 ? 69 LEU A C    1  
ATOM 1005  O O    . LEU A 1 69 ? -0.720  7.862   -4.801  1.00 0.00 ? 69 LEU A O    1  
ATOM 1006  C CB   . LEU A 1 69 ? -0.650  10.446  -7.044  1.00 0.00 ? 69 LEU A CB   1  
ATOM 1007  C CG   . LEU A 1 69 ? 0.365   11.519  -7.442  1.00 0.00 ? 69 LEU A CG   1  
ATOM 1008  C CD1  . LEU A 1 69 ? 0.868   12.281  -6.214  1.00 0.00 ? 69 LEU A CD1  1  
ATOM 1009  C CD2  . LEU A 1 69 ? 1.515   10.914  -8.251  1.00 0.00 ? 69 LEU A CD2  1  
ATOM 1010  H H    . LEU A 1 69 ? 0.246   8.988   -8.844  1.00 0.00 ? 69 LEU A H    1  
ATOM 1011  H HA   . LEU A 1 69 ? 0.854   9.175   -6.244  1.00 0.00 ? 69 LEU A HA   1  
ATOM 1012  H HB2  . LEU A 1 69 ? -1.400  10.374  -7.832  1.00 0.00 ? 69 LEU A HB2  1  
ATOM 1013  H HB3  . LEU A 1 69 ? -1.165  10.778  -6.143  1.00 0.00 ? 69 LEU A HB3  1  
ATOM 1014  H HG   . LEU A 1 69 ? -0.136  12.242  -8.086  1.00 0.00 ? 69 LEU A HG   1  
ATOM 1015  H HD11 . LEU A 1 69 ? 1.387   11.594  -5.547  1.00 0.00 ? 69 LEU A HD11 1  
ATOM 1016  H HD12 . LEU A 1 69 ? 1.552   13.069  -6.530  1.00 0.00 ? 69 LEU A HD12 1  
ATOM 1017  H HD13 . LEU A 1 69 ? 0.021   12.725  -5.690  1.00 0.00 ? 69 LEU A HD13 1  
ATOM 1018  H HD21 . LEU A 1 69 ? 2.325   11.639  -8.330  1.00 0.00 ? 69 LEU A HD21 1  
ATOM 1019  H HD22 . LEU A 1 69 ? 1.878   10.017  -7.750  1.00 0.00 ? 69 LEU A HD22 1  
ATOM 1020  H HD23 . LEU A 1 69 ? 1.160   10.655  -9.248  1.00 0.00 ? 69 LEU A HD23 1  
ATOM 1021  N N    . ALA A 1 70 ? -2.096  7.738   -6.591  1.00 0.00 ? 70 ALA A N    1  
ATOM 1022  C CA   . ALA A 1 70 ? -3.063  6.880   -5.928  1.00 0.00 ? 70 ALA A CA   1  
ATOM 1023  C C    . ALA A 1 70 ? -2.345  5.657   -5.355  1.00 0.00 ? 70 ALA A C    1  
ATOM 1024  O O    . ALA A 1 70 ? -2.447  5.376   -4.162  1.00 0.00 ? 70 ALA A O    1  
ATOM 1025  C CB   . ALA A 1 70 ? -4.168  6.498   -6.915  1.00 0.00 ? 70 ALA A CB   1  
ATOM 1026  H H    . ALA A 1 70 ? -2.321  7.979   -7.535  1.00 0.00 ? 70 ALA A H    1  
ATOM 1027  H HA   . ALA A 1 70 ? -3.505  7.449   -5.110  1.00 0.00 ? 70 ALA A HA   1  
ATOM 1028  H HB1  . ALA A 1 70 ? -5.054  6.181   -6.364  1.00 0.00 ? 70 ALA A HB1  1  
ATOM 1029  H HB2  . ALA A 1 70 ? -4.415  7.360   -7.535  1.00 0.00 ? 70 ALA A HB2  1  
ATOM 1030  H HB3  . ALA A 1 70 ? -3.823  5.682   -7.549  1.00 0.00 ? 70 ALA A HB3  1  
ATOM 1031  N N    . LYS A 1 71 ? -1.636  4.962   -6.232  1.00 0.00 ? 71 LYS A N    1  
ATOM 1032  C CA   . LYS A 1 71 ? -0.901  3.775   -5.828  1.00 0.00 ? 71 LYS A CA   1  
ATOM 1033  C C    . LYS A 1 71 ? 0.063   4.138   -4.697  1.00 0.00 ? 71 LYS A C    1  
ATOM 1034  O O    . LYS A 1 71 ? 0.165   3.415   -3.707  1.00 0.00 ? 71 LYS A O    1  
ATOM 1035  C CB   . LYS A 1 71 ? -0.218  3.131   -7.036  1.00 0.00 ? 71 LYS A CB   1  
ATOM 1036  C CG   . LYS A 1 71 ? -0.416  1.614   -7.034  1.00 0.00 ? 71 LYS A CG   1  
ATOM 1037  C CD   . LYS A 1 71 ? 0.197   0.979   -8.283  1.00 0.00 ? 71 LYS A CD   1  
ATOM 1038  C CE   . LYS A 1 71 ? 1.408   0.117   -7.921  1.00 0.00 ? 71 LYS A CE   1  
ATOM 1039  N NZ   . LYS A 1 71 ? 1.967   -0.526  -9.132  1.00 0.00 ? 71 LYS A NZ   1  
ATOM 1040  H H    . LYS A 1 71 ? -1.558  5.198   -7.201  1.00 0.00 ? 71 LYS A H    1  
ATOM 1041  H HA   . LYS A 1 71 ? -1.626  3.056   -5.446  1.00 0.00 ? 71 LYS A HA   1  
ATOM 1042  H HB2  . LYS A 1 71 ? -0.622  3.553   -7.956  1.00 0.00 ? 71 LYS A HB2  1  
ATOM 1043  H HB3  . LYS A 1 71 ? 0.847   3.362   -7.022  1.00 0.00 ? 71 LYS A HB3  1  
ATOM 1044  H HG2  . LYS A 1 71 ? 0.040   1.185   -6.142  1.00 0.00 ? 71 LYS A HG2  1  
ATOM 1045  H HG3  . LYS A 1 71 ? -1.481  1.383   -6.989  1.00 0.00 ? 71 LYS A HG3  1  
ATOM 1046  H HD2  . LYS A 1 71 ? -0.551  0.368   -8.789  1.00 0.00 ? 71 LYS A HD2  1  
ATOM 1047  H HD3  . LYS A 1 71 ? 0.497   1.760   -8.982  1.00 0.00 ? 71 LYS A HD3  1  
ATOM 1048  H HE2  . LYS A 1 71 ? 2.171   0.733   -7.445  1.00 0.00 ? 71 LYS A HE2  1  
ATOM 1049  H HE3  . LYS A 1 71 ? 1.117   -0.645  -7.199  1.00 0.00 ? 71 LYS A HE3  1  
ATOM 1050  H HZ1  . LYS A 1 71 ? 2.805   -0.053  -9.404  1.00 0.00 ? 71 LYS A HZ1  1  
ATOM 1051  H HZ2  . LYS A 1 71 ? 2.173   -1.484  -8.935  1.00 0.00 ? 71 LYS A HZ2  1  
ATOM 1052  H HZ3  . LYS A 1 71 ? 1.299   -0.474  -9.875  1.00 0.00 ? 71 LYS A HZ3  1  
ATOM 1053  N N    . ASN A 1 72 ? 0.747   5.258   -4.882  1.00 0.00 ? 72 ASN A N    1  
ATOM 1054  C CA   . ASN A 1 72 ? 1.700   5.726   -3.889  1.00 0.00 ? 72 ASN A CA   1  
ATOM 1055  C C    . ASN A 1 72 ? 0.991   5.881   -2.542  1.00 0.00 ? 72 ASN A C    1  
ATOM 1056  O O    . ASN A 1 72 ? 1.511   5.456   -1.511  1.00 0.00 ? 72 ASN A O    1  
ATOM 1057  C CB   . ASN A 1 72 ? 2.278   7.087   -4.279  1.00 0.00 ? 72 ASN A CB   1  
ATOM 1058  C CG   . ASN A 1 72 ? 3.037   7.716   -3.109  1.00 0.00 ? 72 ASN A CG   1  
ATOM 1059  O OD1  . ASN A 1 72 ? 4.251   7.643   -3.012  1.00 0.00 ? 72 ASN A OD1  1  
ATOM 1060  N ND2  . ASN A 1 72 ? 2.256   8.337   -2.229  1.00 0.00 ? 72 ASN A ND2  1  
ATOM 1061  H H    . ASN A 1 72 ? 0.659   5.840   -5.690  1.00 0.00 ? 72 ASN A H    1  
ATOM 1062  H HA   . ASN A 1 72 ? 2.482   4.967   -3.864  1.00 0.00 ? 72 ASN A HA   1  
ATOM 1063  H HB2  . ASN A 1 72 ? 2.947   6.972   -5.131  1.00 0.00 ? 72 ASN A HB2  1  
ATOM 1064  H HB3  . ASN A 1 72 ? 1.473   7.752   -4.594  1.00 0.00 ? 72 ASN A HB3  1  
ATOM 1065  H HD21 . ASN A 1 72 ? 1.266   8.361   -2.368  1.00 0.00 ? 72 ASN A HD21 1  
ATOM 1066  H HD22 . ASN A 1 72 ? 2.659   8.780   -1.428  1.00 0.00 ? 72 ASN A HD22 1  
ATOM 1067  N N    . LYS A 1 73 ? -0.184  6.491   -2.594  1.00 0.00 ? 73 LYS A N    1  
ATOM 1068  C CA   . LYS A 1 73 ? -0.968  6.707   -1.391  1.00 0.00 ? 73 LYS A CA   1  
ATOM 1069  C C    . LYS A 1 73 ? -1.405  5.356   -0.822  1.00 0.00 ? 73 LYS A C    1  
ATOM 1070  O O    . LYS A 1 73 ? -1.269  5.109   0.376   1.00 0.00 ? 73 LYS A O    1  
ATOM 1071  C CB   . LYS A 1 73 ? -2.132  7.660   -1.674  1.00 0.00 ? 73 LYS A CB   1  
ATOM 1072  C CG   . LYS A 1 73 ? -1.656  9.114   -1.701  1.00 0.00 ? 73 LYS A CG   1  
ATOM 1073  C CD   . LYS A 1 73 ? -2.740  10.035  -2.263  1.00 0.00 ? 73 LYS A CD   1  
ATOM 1074  C CE   . LYS A 1 73 ? -2.606  11.450  -1.695  1.00 0.00 ? 73 LYS A CE   1  
ATOM 1075  N NZ   . LYS A 1 73 ? -2.852  12.457  -2.751  1.00 0.00 ? 73 LYS A NZ   1  
ATOM 1076  H H    . LYS A 1 73 ? -0.599  6.833   -3.437  1.00 0.00 ? 73 LYS A H    1  
ATOM 1077  H HA   . LYS A 1 73 ? -0.322  7.196   -0.662  1.00 0.00 ? 73 LYS A HA   1  
ATOM 1078  H HB2  . LYS A 1 73 ? -2.591  7.406   -2.629  1.00 0.00 ? 73 LYS A HB2  1  
ATOM 1079  H HB3  . LYS A 1 73 ? -2.900  7.539   -0.910  1.00 0.00 ? 73 LYS A HB3  1  
ATOM 1080  H HG2  . LYS A 1 73 ? -1.389  9.432   -0.693  1.00 0.00 ? 73 LYS A HG2  1  
ATOM 1081  H HG3  . LYS A 1 73 ? -0.755  9.194   -2.309  1.00 0.00 ? 73 LYS A HG3  1  
ATOM 1082  H HD2  . LYS A 1 73 ? -2.668  10.067  -3.350  1.00 0.00 ? 73 LYS A HD2  1  
ATOM 1083  H HD3  . LYS A 1 73 ? -3.725  9.634   -2.020  1.00 0.00 ? 73 LYS A HD3  1  
ATOM 1084  H HE2  . LYS A 1 73 ? -3.314  11.589  -0.879  1.00 0.00 ? 73 LYS A HE2  1  
ATOM 1085  H HE3  . LYS A 1 73 ? -1.608  11.587  -1.279  1.00 0.00 ? 73 LYS A HE3  1  
ATOM 1086  H HZ1  . LYS A 1 73 ? -3.058  13.340  -2.328  1.00 0.00 ? 73 LYS A HZ1  1  
ATOM 1087  H HZ2  . LYS A 1 73 ? -2.038  12.545  -3.325  1.00 0.00 ? 73 LYS A HZ2  1  
ATOM 1088  H HZ3  . LYS A 1 73 ? -3.627  12.168  -3.313  1.00 0.00 ? 73 LYS A HZ3  1  
ATOM 1089  N N    . ALA A 1 74 ? -1.921  4.516   -1.707  1.00 0.00 ? 74 ALA A N    1  
ATOM 1090  C CA   . ALA A 1 74 ? -2.378  3.195   -1.308  1.00 0.00 ? 74 ALA A CA   1  
ATOM 1091  C C    . ALA A 1 74 ? -1.284  2.508   -0.489  1.00 0.00 ? 74 ALA A C    1  
ATOM 1092  O O    . ALA A 1 74 ? -1.553  1.969   0.584   1.00 0.00 ? 74 ALA A O    1  
ATOM 1093  C CB   . ALA A 1 74 ? -2.768  2.393   -2.550  1.00 0.00 ? 74 ALA A CB   1  
ATOM 1094  H H    . ALA A 1 74 ? -2.028  4.724   -2.679  1.00 0.00 ? 74 ALA A H    1  
ATOM 1095  H HA   . ALA A 1 74 ? -3.261  3.325   -0.682  1.00 0.00 ? 74 ALA A HA   1  
ATOM 1096  H HB1  . ALA A 1 74 ? -3.469  1.606   -2.270  1.00 0.00 ? 74 ALA A HB1  1  
ATOM 1097  H HB2  . ALA A 1 74 ? -3.237  3.055   -3.278  1.00 0.00 ? 74 ALA A HB2  1  
ATOM 1098  H HB3  . ALA A 1 74 ? -1.876  1.945   -2.988  1.00 0.00 ? 74 ALA A HB3  1  
ATOM 1099  N N    . ALA A 1 75 ? -0.074  2.548   -1.026  1.00 0.00 ? 75 ALA A N    1  
ATOM 1100  C CA   . ALA A 1 75 ? 1.062   1.935   -0.358  1.00 0.00 ? 75 ALA A CA   1  
ATOM 1101  C C    . ALA A 1 75 ? 1.439   2.770   0.868   1.00 0.00 ? 75 ALA A C    1  
ATOM 1102  O O    . ALA A 1 75 ? 1.548   2.242   1.973   1.00 0.00 ? 75 ALA A O    1  
ATOM 1103  C CB   . ALA A 1 75 ? 2.221   1.795   -1.347  1.00 0.00 ? 75 ALA A CB   1  
ATOM 1104  H H    . ALA A 1 75 ? 0.136   2.987   -1.899  1.00 0.00 ? 75 ALA A H    1  
ATOM 1105  H HA   . ALA A 1 75 ? 0.758   0.941   -0.031  1.00 0.00 ? 75 ALA A HA   1  
ATOM 1106  H HB1  . ALA A 1 75 ? 1.856   1.957   -2.361  1.00 0.00 ? 75 ALA A HB1  1  
ATOM 1107  H HB2  . ALA A 1 75 ? 2.988   2.534   -1.114  1.00 0.00 ? 75 ALA A HB2  1  
ATOM 1108  H HB3  . ALA A 1 75 ? 2.646   0.794   -1.269  1.00 0.00 ? 75 ALA A HB3  1  
ATOM 1109  N N    . ARG A 1 76 ? 1.627   4.060   0.630   1.00 0.00 ? 76 ARG A N    1  
ATOM 1110  C CA   . ARG A 1 76 ? 1.989   4.973   1.701   1.00 0.00 ? 76 ARG A CA   1  
ATOM 1111  C C    . ARG A 1 76 ? 1.069   4.770   2.906   1.00 0.00 ? 76 ARG A C    1  
ATOM 1112  O O    . ARG A 1 76 ? 1.505   4.878   4.051   1.00 0.00 ? 76 ARG A O    1  
ATOM 1113  C CB   . ARG A 1 76 ? 1.899   6.428   1.238   1.00 0.00 ? 76 ARG A CB   1  
ATOM 1114  C CG   . ARG A 1 76 ? 2.133   7.390   2.405   1.00 0.00 ? 76 ARG A CG   1  
ATOM 1115  C CD   . ARG A 1 76 ? 0.951   8.348   2.570   1.00 0.00 ? 76 ARG A CD   1  
ATOM 1116  N NE   . ARG A 1 76 ? 1.311   9.689   2.058   1.00 0.00 ? 76 ARG A NE   1  
ATOM 1117  C CZ   . ARG A 1 76 ? 0.443   10.701  1.928   1.00 0.00 ? 76 ARG A CZ   1  
ATOM 1118  N NH1  . ARG A 1 76 ? -0.841  10.531  2.272   1.00 0.00 ? 76 ARG A NH1  1  
ATOM 1119  N NH2  . ARG A 1 76 ? 0.859   11.884  1.454   1.00 0.00 ? 76 ARG A NH2  1  
ATOM 1120  H H    . ARG A 1 76 ? 1.536   4.481   -0.272  1.00 0.00 ? 76 ARG A H    1  
ATOM 1121  H HA   . ARG A 1 76 ? 3.020   4.718   1.948   1.00 0.00 ? 76 ARG A HA   1  
ATOM 1122  H HB2  . ARG A 1 76 ? 2.637   6.612   0.457   1.00 0.00 ? 76 ARG A HB2  1  
ATOM 1123  H HB3  . ARG A 1 76 ? 0.918   6.614   0.800   1.00 0.00 ? 76 ARG A HB3  1  
ATOM 1124  H HG2  . ARG A 1 76 ? 2.278   6.823   3.324   1.00 0.00 ? 76 ARG A HG2  1  
ATOM 1125  H HG3  . ARG A 1 76 ? 3.046   7.960   2.233   1.00 0.00 ? 76 ARG A HG3  1  
ATOM 1126  H HD2  . ARG A 1 76 ? 0.084   7.965   2.033   1.00 0.00 ? 76 ARG A HD2  1  
ATOM 1127  H HD3  . ARG A 1 76 ? 0.671   8.414   3.622   1.00 0.00 ? 76 ARG A HD3  1  
ATOM 1128  H HE   . ARG A 1 76 ? 2.262   9.850   1.793   1.00 0.00 ? 76 ARG A HE   1  
ATOM 1129  H HH11 . ARG A 1 76 ? -1.151  9.649   2.625   1.00 0.00 ? 76 ARG A HH11 1  
ATOM 1130  H HH12 . ARG A 1 76 ? -1.489  11.287  2.174   1.00 0.00 ? 76 ARG A HH12 1  
ATOM 1131  H HH21 . ARG A 1 76 ? 1.817   12.011  1.198   1.00 0.00 ? 76 ARG A HH21 1  
ATOM 1132  H HH22 . ARG A 1 76 ? 0.211   12.639  1.357   1.00 0.00 ? 76 ARG A HH22 1  
ATOM 1133  N N    . ALA A 1 77 ? -0.189  4.478   2.607   1.00 0.00 ? 77 ALA A N    1  
ATOM 1134  C CA   . ALA A 1 77 ? -1.175  4.259   3.651   1.00 0.00 ? 77 ALA A CA   1  
ATOM 1135  C C    . ALA A 1 77 ? -0.860  2.950   4.377   1.00 0.00 ? 77 ALA A C    1  
ATOM 1136  O O    . ALA A 1 77 ? -0.742  2.927   5.602   1.00 0.00 ? 77 ALA A O    1  
ATOM 1137  C CB   . ALA A 1 77 ? -2.577  4.263   3.039   1.00 0.00 ? 77 ALA A CB   1  
ATOM 1138  H H    . ALA A 1 77 ? -0.536  4.392   1.673   1.00 0.00 ? 77 ALA A H    1  
ATOM 1139  H HA   . ALA A 1 77 ? -1.098  5.085   4.359   1.00 0.00 ? 77 ALA A HA   1  
ATOM 1140  H HB1  . ALA A 1 77 ? -3.308  4.004   3.804   1.00 0.00 ? 77 ALA A HB1  1  
ATOM 1141  H HB2  . ALA A 1 77 ? -2.799  5.256   2.646   1.00 0.00 ? 77 ALA A HB2  1  
ATOM 1142  H HB3  . ALA A 1 77 ? -2.623  3.534   2.230   1.00 0.00 ? 77 ALA A HB3  1  
ATOM 1143  N N    . THR A 1 78 ? -0.732  1.890   3.592   1.00 0.00 ? 78 THR A N    1  
ATOM 1144  C CA   . THR A 1 78 ? -0.433  0.580   4.145   1.00 0.00 ? 78 THR A CA   1  
ATOM 1145  C C    . THR A 1 78 ? 0.770   0.661   5.086   1.00 0.00 ? 78 THR A C    1  
ATOM 1146  O O    . THR A 1 78 ? 0.797   -0.001  6.123   1.00 0.00 ? 78 THR A O    1  
ATOM 1147  C CB   . THR A 1 78 ? -0.229  -0.389  2.979   1.00 0.00 ? 78 THR A CB   1  
ATOM 1148  O OG1  . THR A 1 78 ? -1.549  -0.661  2.517   1.00 0.00 ? 78 THR A OG1  1  
ATOM 1149  C CG2  . THR A 1 78 ? 0.294   -1.753  3.436   1.00 0.00 ? 78 THR A CG2  1  
ATOM 1150  H H    . THR A 1 78 ? -0.830  1.917   2.597   1.00 0.00 ? 78 THR A H    1  
ATOM 1151  H HA   . THR A 1 78 ? -1.286  0.257   4.742   1.00 0.00 ? 78 THR A HA   1  
ATOM 1152  H HB   . THR A 1 78 ? 0.425   0.044   2.222   1.00 0.00 ? 78 THR A HB   1  
ATOM 1153  H HG1  . THR A 1 78 ? -1.904  0.127   2.013   1.00 0.00 ? 78 THR A HG1  1  
ATOM 1154  H HG21 . THR A 1 78 ? 0.563   -2.350  2.565   1.00 0.00 ? 78 THR A HG21 1  
ATOM 1155  H HG22 . THR A 1 78 ? 1.172   -1.613  4.066   1.00 0.00 ? 78 THR A HG22 1  
ATOM 1156  H HG23 . THR A 1 78 ? -0.482  -2.267  4.003   1.00 0.00 ? 78 THR A HG23 1  
ATOM 1157  N N    . LEU A 1 79 ? 1.736   1.477   4.692   1.00 0.00 ? 79 LEU A N    1  
ATOM 1158  C CA   . LEU A 1 79 ? 2.939   1.653   5.487   1.00 0.00 ? 79 LEU A CA   1  
ATOM 1159  C C    . LEU A 1 79 ? 2.559   2.204   6.863   1.00 0.00 ? 79 LEU A C    1  
ATOM 1160  O O    . LEU A 1 79 ? 2.777   1.547   7.880   1.00 0.00 ? 79 LEU A O    1  
ATOM 1161  C CB   . LEU A 1 79 ? 3.956   2.516   4.738   1.00 0.00 ? 79 LEU A CB   1  
ATOM 1162  C CG   . LEU A 1 79 ? 4.854   1.782   3.741   1.00 0.00 ? 79 LEU A CG   1  
ATOM 1163  C CD1  . LEU A 1 79 ? 5.803   2.755   3.038   1.00 0.00 ? 79 LEU A CD1  1  
ATOM 1164  C CD2  . LEU A 1 79 ? 5.608   0.638   4.421   1.00 0.00 ? 79 LEU A CD2  1  
ATOM 1165  H H    . LEU A 1 79 ? 1.706   2.012   3.847   1.00 0.00 ? 79 LEU A H    1  
ATOM 1166  H HA   . LEU A 1 79 ? 3.389   0.669   5.621   1.00 0.00 ? 79 LEU A HA   1  
ATOM 1167  H HB2  . LEU A 1 79 ? 3.415   3.297   4.203   1.00 0.00 ? 79 LEU A HB2  1  
ATOM 1168  H HB3  . LEU A 1 79 ? 4.591   3.013   5.472   1.00 0.00 ? 79 LEU A HB3  1  
ATOM 1169  H HG   . LEU A 1 79 ? 4.221   1.339   2.973   1.00 0.00 ? 79 LEU A HG   1  
ATOM 1170  H HD11 . LEU A 1 79 ? 6.561   2.193   2.492   1.00 0.00 ? 79 LEU A HD11 1  
ATOM 1171  H HD12 . LEU A 1 79 ? 5.238   3.374   2.342   1.00 0.00 ? 79 LEU A HD12 1  
ATOM 1172  H HD13 . LEU A 1 79 ? 6.286   3.391   3.780   1.00 0.00 ? 79 LEU A HD13 1  
ATOM 1173  H HD21 . LEU A 1 79 ? 5.809   0.902   5.460   1.00 0.00 ? 79 LEU A HD21 1  
ATOM 1174  H HD22 . LEU A 1 79 ? 5.001   -0.267  4.387   1.00 0.00 ? 79 LEU A HD22 1  
ATOM 1175  H HD23 . LEU A 1 79 ? 6.550   0.463   3.902   1.00 0.00 ? 79 LEU A HD23 1  
ATOM 1176  N N    . GLU A 1 80 ? 1.998   3.404   6.850   1.00 0.00 ? 80 GLU A N    1  
ATOM 1177  C CA   . GLU A 1 80 ? 1.586   4.051   8.085   1.00 0.00 ? 80 GLU A CA   1  
ATOM 1178  C C    . GLU A 1 80 ? 0.959   3.029   9.035   1.00 0.00 ? 80 GLU A C    1  
ATOM 1179  O O    . GLU A 1 80 ? 1.295   2.988   10.218  1.00 0.00 ? 80 GLU A O    1  
ATOM 1180  C CB   . GLU A 1 80 ? 0.620   5.203   7.804   1.00 0.00 ? 80 GLU A CB   1  
ATOM 1181  C CG   . GLU A 1 80 ? 1.352   6.391   7.176   1.00 0.00 ? 80 GLU A CG   1  
ATOM 1182  C CD   . GLU A 1 80 ? 1.170   7.655   8.019   1.00 0.00 ? 80 GLU A CD   1  
ATOM 1183  O OE1  . GLU A 1 80 ? 0.001   8.071   8.173   1.00 0.00 ? 80 GLU A OE1  1  
ATOM 1184  O OE2  . GLU A 1 80 ? 2.203   8.177   8.490   1.00 0.00 ? 80 GLU A OE2  1  
ATOM 1185  H H    . GLU A 1 80 ? 1.825   3.931   6.019   1.00 0.00 ? 80 GLU A H    1  
ATOM 1186  H HA   . GLU A 1 80 ? 2.501   4.450   8.522   1.00 0.00 ? 80 GLU A HA   1  
ATOM 1187  H HB2  . GLU A 1 80 ? -0.171  4.865   7.135   1.00 0.00 ? 80 GLU A HB2  1  
ATOM 1188  H HB3  . GLU A 1 80 ? 0.142   5.516   8.732   1.00 0.00 ? 80 GLU A HB3  1  
ATOM 1189  H HG2  . GLU A 1 80 ? 2.414   6.162   7.084   1.00 0.00 ? 80 GLU A HG2  1  
ATOM 1190  H HG3  . GLU A 1 80 ? 0.975   6.564   6.168   1.00 0.00 ? 80 GLU A HG3  1  
ATOM 1191  N N    . ILE A 1 81 ? 0.059   2.229   8.483   1.00 0.00 ? 81 ILE A N    1  
ATOM 1192  C CA   . ILE A 1 81 ? -0.618  1.210   9.267   1.00 0.00 ? 81 ILE A CA   1  
ATOM 1193  C C    . ILE A 1 81 ? 0.421   0.384   10.028  1.00 0.00 ? 81 ILE A C    1  
ATOM 1194  O O    . ILE A 1 81 ? 0.326   0.229   11.245  1.00 0.00 ? 81 ILE A O    1  
ATOM 1195  C CB   . ILE A 1 81 ? -1.538  0.372   8.377   1.00 0.00 ? 81 ILE A CB   1  
ATOM 1196  C CG1  . ILE A 1 81 ? -2.764  1.178   7.943   1.00 0.00 ? 81 ILE A CG1  1  
ATOM 1197  C CG2  . ILE A 1 81 ? -1.927  -0.936  9.068   1.00 0.00 ? 81 ILE A CG2  1  
ATOM 1198  C CD1  . ILE A 1 81 ? -3.704  0.328   7.085   1.00 0.00 ? 81 ILE A CD1  1  
ATOM 1199  H H    . ILE A 1 81 ? -0.208  2.269   7.520   1.00 0.00 ? 81 ILE A H    1  
ATOM 1200  H HA   . ILE A 1 81 ? -1.251  1.723   9.992   1.00 0.00 ? 81 ILE A HA   1  
ATOM 1201  H HB   . ILE A 1 81 ? -0.990  0.108   7.472   1.00 0.00 ? 81 ILE A HB   1  
ATOM 1202  H HG12 . ILE A 1 81 ? -3.296  1.539   8.823   1.00 0.00 ? 81 ILE A HG12 1  
ATOM 1203  H HG13 . ILE A 1 81 ? -2.446  2.056   7.380   1.00 0.00 ? 81 ILE A HG13 1  
ATOM 1204  H HG21 . ILE A 1 81 ? -1.634  -0.894  10.117  1.00 0.00 ? 81 ILE A HG21 1  
ATOM 1205  H HG22 . ILE A 1 81 ? -3.006  -1.077  8.997   1.00 0.00 ? 81 ILE A HG22 1  
ATOM 1206  H HG23 . ILE A 1 81 ? -1.419  -1.769  8.582   1.00 0.00 ? 81 ILE A HG23 1  
ATOM 1207  H HD11 . ILE A 1 81 ? -3.338  -0.698  7.054   1.00 0.00 ? 81 ILE A HD11 1  
ATOM 1208  H HD12 . ILE A 1 81 ? -4.704  0.344   7.517   1.00 0.00 ? 81 ILE A HD12 1  
ATOM 1209  H HD13 . ILE A 1 81 ? -3.738  0.733   6.074   1.00 0.00 ? 81 ILE A HD13 1  
ATOM 1210  N N    . LEU A 1 82 ? 1.389   -0.124  9.280   1.00 0.00 ? 82 LEU A N    1  
ATOM 1211  C CA   . LEU A 1 82 ? 2.444   -0.931  9.869   1.00 0.00 ? 82 LEU A CA   1  
ATOM 1212  C C    . LEU A 1 82 ? 3.412   -0.021  10.629  1.00 0.00 ? 82 LEU A C    1  
ATOM 1213  O O    . LEU A 1 82 ? 3.481   -0.069  11.856  1.00 0.00 ? 82 LEU A O    1  
ATOM 1214  C CB   . LEU A 1 82 ? 3.121   -1.792  8.800   1.00 0.00 ? 82 LEU A CB   1  
ATOM 1215  C CG   . LEU A 1 82 ? 2.184   -2.539  7.849   1.00 0.00 ? 82 LEU A CG   1  
ATOM 1216  C CD1  . LEU A 1 82 ? 2.695   -2.470  6.409   1.00 0.00 ? 82 LEU A CD1  1  
ATOM 1217  C CD2  . LEU A 1 82 ? 1.969   -3.982  8.312   1.00 0.00 ? 82 LEU A CD2  1  
ATOM 1218  H H    . LEU A 1 82 ? 1.459   0.006   8.291   1.00 0.00 ? 82 LEU A H    1  
ATOM 1219  H HA   . LEU A 1 82 ? 1.977   -1.610  10.582  1.00 0.00 ? 82 LEU A HA   1  
ATOM 1220  H HB2  . LEU A 1 82 ? 3.774   -1.152  8.207   1.00 0.00 ? 82 LEU A HB2  1  
ATOM 1221  H HB3  . LEU A 1 82 ? 3.757   -2.522  9.300   1.00 0.00 ? 82 LEU A HB3  1  
ATOM 1222  H HG   . LEU A 1 82 ? 1.212   -2.047  7.870   1.00 0.00 ? 82 LEU A HG   1  
ATOM 1223  H HD11 . LEU A 1 82 ? 2.088   -1.763  5.842   1.00 0.00 ? 82 LEU A HD11 1  
ATOM 1224  H HD12 . LEU A 1 82 ? 3.733   -2.140  6.407   1.00 0.00 ? 82 LEU A HD12 1  
ATOM 1225  H HD13 . LEU A 1 82 ? 2.626   -3.456  5.951   1.00 0.00 ? 82 LEU A HD13 1  
ATOM 1226  H HD21 . LEU A 1 82 ? 2.519   -4.659  7.658   1.00 0.00 ? 82 LEU A HD21 1  
ATOM 1227  H HD22 . LEU A 1 82 ? 2.330   -4.092  9.335   1.00 0.00 ? 82 LEU A HD22 1  
ATOM 1228  H HD23 . LEU A 1 82 ? 0.907   -4.221  8.274   1.00 0.00 ? 82 LEU A HD23 1  
ATOM 1229  N N    . ILE A 1 83 ? 4.134   0.788   9.867   1.00 0.00 ? 83 ILE A N    1  
ATOM 1230  C CA   . ILE A 1 83 ? 5.095   1.707   10.453  1.00 0.00 ? 83 ILE A CA   1  
ATOM 1231  C C    . ILE A 1 83 ? 4.352   2.912   11.034  1.00 0.00 ? 83 ILE A C    1  
ATOM 1232  O O    . ILE A 1 83 ? 3.747   3.688   10.296  1.00 0.00 ? 83 ILE A O    1  
ATOM 1233  C CB   . ILE A 1 83 ? 6.170   2.082   9.431   1.00 0.00 ? 83 ILE A CB   1  
ATOM 1234  C CG1  . ILE A 1 83 ? 6.467   0.911   8.493   1.00 0.00 ? 83 ILE A CG1  1  
ATOM 1235  C CG2  . ILE A 1 83 ? 7.433   2.594   10.127  1.00 0.00 ? 83 ILE A CG2  1  
ATOM 1236  C CD1  . ILE A 1 83 ? 7.809   1.102   7.785   1.00 0.00 ? 83 ILE A CD1  1  
ATOM 1237  H H    . ILE A 1 83 ? 4.072   0.821   8.870   1.00 0.00 ? 83 ILE A H    1  
ATOM 1238  H HA   . ILE A 1 83 ? 5.593   1.183   11.268  1.00 0.00 ? 83 ILE A HA   1  
ATOM 1239  H HB   . ILE A 1 83 ? 5.788   2.898   8.817   1.00 0.00 ? 83 ILE A HB   1  
ATOM 1240  H HG12 . ILE A 1 83 ? 6.480   -0.020  9.061   1.00 0.00 ? 83 ILE A HG12 1  
ATOM 1241  H HG13 . ILE A 1 83 ? 5.671   0.821   7.754   1.00 0.00 ? 83 ILE A HG13 1  
ATOM 1242  H HG21 . ILE A 1 83 ? 8.021   3.185   9.425   1.00 0.00 ? 83 ILE A HG21 1  
ATOM 1243  H HG22 . ILE A 1 83 ? 7.153   3.214   10.978  1.00 0.00 ? 83 ILE A HG22 1  
ATOM 1244  H HG23 . ILE A 1 83 ? 8.025   1.747   10.474  1.00 0.00 ? 83 ILE A HG23 1  
ATOM 1245  H HD11 . ILE A 1 83 ? 7.846   2.096   7.339   1.00 0.00 ? 83 ILE A HD11 1  
ATOM 1246  H HD12 . ILE A 1 83 ? 8.619   0.997   8.506   1.00 0.00 ? 83 ILE A HD12 1  
ATOM 1247  H HD13 . ILE A 1 83 ? 7.918   0.350   7.003   1.00 0.00 ? 83 ILE A HD13 1  
ATOM 1248  N N    . PRO A 1 84 ? 4.424   3.035   12.387  1.00 0.00 ? 84 PRO A N    1  
ATOM 1249  C CA   . PRO A 1 84 ? 3.765   4.132   13.075  1.00 0.00 ? 84 PRO A CA   1  
ATOM 1250  C C    . PRO A 1 84 ? 4.534   5.441   12.881  1.00 0.00 ? 84 PRO A C    1  
ATOM 1251  O O    . PRO A 1 84 ? 3.936   6.515   12.842  1.00 0.00 ? 84 PRO A O    1  
ATOM 1252  C CB   . PRO A 1 84 ? 3.692   3.696   14.529  1.00 0.00 ? 84 PRO A CB   1  
ATOM 1253  C CG   . PRO A 1 84 ? 4.719   2.587   14.685  1.00 0.00 ? 84 PRO A CG   1  
ATOM 1254  C CD   . PRO A 1 84 ? 5.131   2.135   13.293  1.00 0.00 ? 84 PRO A CD   1  
ATOM 1255  H HA   . PRO A 1 84 ? 2.856   4.289   12.688  1.00 0.00 ? 84 PRO A HA   1  
ATOM 1256  H HB2  . PRO A 1 84 ? 3.912   4.528   15.198  1.00 0.00 ? 84 PRO A HB2  1  
ATOM 1257  H HB3  . PRO A 1 84 ? 2.692   3.341   14.781  1.00 0.00 ? 84 PRO A HB3  1  
ATOM 1258  H HG2  . PRO A 1 84 ? 5.585   2.943   15.242  1.00 0.00 ? 84 PRO A HG2  1  
ATOM 1259  H HG3  . PRO A 1 84 ? 4.298   1.753   15.248  1.00 0.00 ? 84 PRO A HG3  1  
ATOM 1260  H HD2  . PRO A 1 84 ? 6.210   2.205   13.158  1.00 0.00 ? 84 PRO A HD2  1  
ATOM 1261  H HD3  . PRO A 1 84 ? 4.854   1.096   13.116  1.00 0.00 ? 84 PRO A HD3  1  
ATOM 1262  N N    . ASP A 1 85 ? 5.847   5.307   12.765  1.00 0.00 ? 85 ASP A N    1  
ATOM 1263  C CA   . ASP A 1 85 ? 6.703   6.466   12.576  1.00 0.00 ? 85 ASP A CA   1  
ATOM 1264  C C    . ASP A 1 85 ? 7.564   6.260   11.329  1.00 0.00 ? 85 ASP A C    1  
ATOM 1265  O O    . ASP A 1 85 ? 8.753   5.962   11.433  1.00 0.00 ? 85 ASP A O    1  
ATOM 1266  C CB   . ASP A 1 85 ? 7.640   6.659   13.771  1.00 0.00 ? 85 ASP A CB   1  
ATOM 1267  C CG   . ASP A 1 85 ? 8.082   8.102   14.018  1.00 0.00 ? 85 ASP A CG   1  
ATOM 1268  O OD1  . ASP A 1 85 ? 7.763   8.950   13.157  1.00 0.00 ? 85 ASP A OD1  1  
ATOM 1269  O OD2  . ASP A 1 85 ? 8.730   8.326   15.064  1.00 0.00 ? 85 ASP A OD2  1  
ATOM 1270  H H    . ASP A 1 85 ? 6.325   4.429   12.798  1.00 0.00 ? 85 ASP A H    1  
ATOM 1271  H HA   . ASP A 1 85 ? 6.023   7.312   12.479  1.00 0.00 ? 85 ASP A HA   1  
ATOM 1272  H HB2  . ASP A 1 85 ? 7.142   6.288   14.667  1.00 0.00 ? 85 ASP A HB2  1  
ATOM 1273  H HB3  . ASP A 1 85 ? 8.527   6.043   13.621  1.00 0.00 ? 85 ASP A HB3  1  
ATOM 1274  N N    . PHE A 1 86 ? 6.931   6.427   10.177  1.00 0.00 ? 86 PHE A N    1  
ATOM 1275  C CA   . PHE A 1 86 ? 7.624   6.264   8.911   1.00 0.00 ? 86 PHE A CA   1  
ATOM 1276  C C    . PHE A 1 86 ? 8.193   7.597   8.421   1.00 0.00 ? 86 PHE A C    1  
ATOM 1277  O O    . PHE A 1 86 ? 9.372   7.686   8.083   1.00 0.00 ? 86 PHE A O    1  
ATOM 1278  C CB   . PHE A 1 86 ? 6.594   5.760   7.898   1.00 0.00 ? 86 PHE A CB   1  
ATOM 1279  C CG   . PHE A 1 86 ? 7.161   5.524   6.497   1.00 0.00 ? 86 PHE A CG   1  
ATOM 1280  C CD1  . PHE A 1 86 ? 8.285   4.775   6.336   1.00 0.00 ? 86 PHE A CD1  1  
ATOM 1281  C CD2  . PHE A 1 86 ? 6.543   6.065   5.413   1.00 0.00 ? 86 PHE A CD2  1  
ATOM 1282  C CE1  . PHE A 1 86 ? 8.812   4.557   5.035   1.00 0.00 ? 86 PHE A CE1  1  
ATOM 1283  C CE2  . PHE A 1 86 ? 7.069   5.846   4.113   1.00 0.00 ? 86 PHE A CE2  1  
ATOM 1284  C CZ   . PHE A 1 86 ? 8.193   5.097   3.951   1.00 0.00 ? 86 PHE A CZ   1  
ATOM 1285  H H    . PHE A 1 86 ? 5.963   6.670   10.101  1.00 0.00 ? 86 PHE A H    1  
ATOM 1286  H HA   . PHE A 1 86 ? 8.441   5.562   9.078   1.00 0.00 ? 86 PHE A HA   1  
ATOM 1287  H HB2  . PHE A 1 86 ? 6.164   4.828   8.266   1.00 0.00 ? 86 PHE A HB2  1  
ATOM 1288  H HB3  . PHE A 1 86 ? 5.780   6.482   7.833   1.00 0.00 ? 86 PHE A HB3  1  
ATOM 1289  H HD1  . PHE A 1 86 ? 8.781   4.342   7.204   1.00 0.00 ? 86 PHE A HD1  1  
ATOM 1290  H HD2  . PHE A 1 86 ? 5.642   6.665   5.543   1.00 0.00 ? 86 PHE A HD2  1  
ATOM 1291  H HE1  . PHE A 1 86 ? 9.712   3.957   4.906   1.00 0.00 ? 86 PHE A HE1  1  
ATOM 1292  H HE2  . PHE A 1 86 ? 6.573   6.279   3.244   1.00 0.00 ? 86 PHE A HE2  1  
ATOM 1293  H HZ   . PHE A 1 86 ? 8.597   4.930   2.953   1.00 0.00 ? 86 PHE A HZ   1  
ATOM 1294  N N    . VAL A 1 87 ? 7.327   8.600   8.398   1.00 0.00 ? 87 VAL A N    1  
ATOM 1295  C CA   . VAL A 1 87 ? 7.728   9.925   7.955   1.00 0.00 ? 87 VAL A CA   1  
ATOM 1296  C C    . VAL A 1 87 ? 7.555   10.917  9.106   1.00 0.00 ? 87 VAL A C    1  
ATOM 1297  O O    . VAL A 1 87 ? 6.678   10.745  9.952   1.00 0.00 ? 87 VAL A O    1  
ATOM 1298  C CB   . VAL A 1 87 ? 6.942   10.318  6.703   1.00 0.00 ? 87 VAL A CB   1  
ATOM 1299  C CG1  . VAL A 1 87 ? 7.448   11.644  6.132   1.00 0.00 ? 87 VAL A CG1  1  
ATOM 1300  C CG2  . VAL A 1 87 ? 6.999   9.210   5.649   1.00 0.00 ? 87 VAL A CG2  1  
ATOM 1301  H H    . VAL A 1 87 ? 6.370   8.519   8.675   1.00 0.00 ? 87 VAL A H    1  
ATOM 1302  H HA   . VAL A 1 87 ? 8.784   9.877   7.689   1.00 0.00 ? 87 VAL A HA   1  
ATOM 1303  H HB   . VAL A 1 87 ? 5.899   10.453  6.991   1.00 0.00 ? 87 VAL A HB   1  
ATOM 1304  H HG11 . VAL A 1 87 ? 6.887   12.468  6.574   1.00 0.00 ? 87 VAL A HG11 1  
ATOM 1305  H HG12 . VAL A 1 87 ? 8.507   11.760  6.364   1.00 0.00 ? 87 VAL A HG12 1  
ATOM 1306  H HG13 . VAL A 1 87 ? 7.310   11.651  5.051   1.00 0.00 ? 87 VAL A HG13 1  
ATOM 1307  H HG21 . VAL A 1 87 ? 5.986   8.889   5.405   1.00 0.00 ? 87 VAL A HG21 1  
ATOM 1308  H HG22 . VAL A 1 87 ? 7.486   9.588   4.750   1.00 0.00 ? 87 VAL A HG22 1  
ATOM 1309  H HG23 . VAL A 1 87 ? 7.564   8.365   6.041   1.00 0.00 ? 87 VAL A HG23 1  
ATOM 1310  N N    . LYS A 1 88 ? 8.405   11.934  9.102   1.00 0.00 ? 88 LYS A N    1  
ATOM 1311  C CA   . LYS A 1 88 ? 8.356   12.954  10.136  1.00 0.00 ? 88 LYS A CA   1  
ATOM 1312  C C    . LYS A 1 88 ? 7.581   14.165  9.615   1.00 0.00 ? 88 LYS A C    1  
ATOM 1313  O O    . LYS A 1 88 ? 8.174   15.108  9.093   1.00 0.00 ? 88 LYS A O    1  
ATOM 1314  C CB   . LYS A 1 88 ? 9.767   13.289  10.624  1.00 0.00 ? 88 LYS A CB   1  
ATOM 1315  C CG   . LYS A 1 88 ? 10.158  12.414  11.817  1.00 0.00 ? 88 LYS A CG   1  
ATOM 1316  C CD   . LYS A 1 88 ? 11.672  12.203  11.870  1.00 0.00 ? 88 LYS A CD   1  
ATOM 1317  C CE   . LYS A 1 88 ? 12.281  12.902  13.087  1.00 0.00 ? 88 LYS A CE   1  
ATOM 1318  N NZ   . LYS A 1 88 ? 12.795  14.239  12.714  1.00 0.00 ? 88 LYS A NZ   1  
ATOM 1319  H H    . LYS A 1 88 ? 9.115   12.066  8.411   1.00 0.00 ? 88 LYS A H    1  
ATOM 1320  H HA   . LYS A 1 88 ? 7.814   12.534  10.983  1.00 0.00 ? 88 LYS A HA   1  
ATOM 1321  H HB2  . LYS A 1 88 ? 10.481  13.144  9.813   1.00 0.00 ? 88 LYS A HB2  1  
ATOM 1322  H HB3  . LYS A 1 88 ? 9.817   14.340  10.908  1.00 0.00 ? 88 LYS A HB3  1  
ATOM 1323  H HG2  . LYS A 1 88 ? 9.819   12.882  12.741  1.00 0.00 ? 88 LYS A HG2  1  
ATOM 1324  H HG3  . LYS A 1 88 ? 9.655   11.450  11.745  1.00 0.00 ? 88 LYS A HG3  1  
ATOM 1325  H HD2  . LYS A 1 88 ? 11.893  11.137  11.910  1.00 0.00 ? 88 LYS A HD2  1  
ATOM 1326  H HD3  . LYS A 1 88 ? 12.129  12.590  10.958  1.00 0.00 ? 88 LYS A HD3  1  
ATOM 1327  H HE2  . LYS A 1 88 ? 11.529  13.001  13.871  1.00 0.00 ? 88 LYS A HE2  1  
ATOM 1328  H HE3  . LYS A 1 88 ? 13.089  12.296  13.496  1.00 0.00 ? 88 LYS A HE3  1  
ATOM 1329  H HZ1  . LYS A 1 88 ? 13.787  14.261  12.840  1.00 0.00 ? 88 LYS A HZ1  1  
ATOM 1330  H HZ2  . LYS A 1 88 ? 12.577  14.425  11.756  1.00 0.00 ? 88 LYS A HZ2  1  
ATOM 1331  H HZ3  . LYS A 1 88 ? 12.370  14.933  13.294  1.00 0.00 ? 88 LYS A HZ3  1  
ATOM 1332  N N    . GLN A 1 89 ? 6.268   14.100  9.774   1.00 0.00 ? 89 GLN A N    1  
ATOM 1333  C CA   . GLN A 1 89 ? 5.405   15.181  9.326   1.00 0.00 ? 89 GLN A CA   1  
ATOM 1334  C C    . GLN A 1 89 ? 4.019   15.051  9.961   1.00 0.00 ? 89 GLN A C    1  
ATOM 1335  O O    . GLN A 1 89 ? 3.177   14.298  9.474   1.00 0.00 ? 89 GLN A O    1  
ATOM 1336  C CB   . GLN A 1 89 ? 5.309   15.208  7.800   1.00 0.00 ? 89 GLN A CB   1  
ATOM 1337  C CG   . GLN A 1 89 ? 5.438   16.637  7.268   1.00 0.00 ? 89 GLN A CG   1  
ATOM 1338  C CD   . GLN A 1 89 ? 6.827   16.877  6.673   1.00 0.00 ? 89 GLN A CD   1  
ATOM 1339  O OE1  . GLN A 1 89 ? 7.444   15.997  6.096   1.00 0.00 ? 89 GLN A OE1  1  
ATOM 1340  N NE2  . GLN A 1 89 ? 7.284   18.114  6.846   1.00 0.00 ? 89 GLN A NE2  1  
ATOM 1341  H H    . GLN A 1 89 ? 5.793   13.330  10.200  1.00 0.00 ? 89 GLN A H    1  
ATOM 1342  H HA   . GLN A 1 89 ? 5.886   16.097  9.670   1.00 0.00 ? 89 GLN A HA   1  
ATOM 1343  H HB2  . GLN A 1 89 ? 6.093   14.584  7.371   1.00 0.00 ? 89 GLN A HB2  1  
ATOM 1344  H HB3  . GLN A 1 89 ? 4.356   14.784  7.484   1.00 0.00 ? 89 GLN A HB3  1  
ATOM 1345  H HG2  . GLN A 1 89 ? 4.678   16.816  6.508   1.00 0.00 ? 89 GLN A HG2  1  
ATOM 1346  H HG3  . GLN A 1 89 ? 5.257   17.347  8.075   1.00 0.00 ? 89 GLN A HG3  1  
ATOM 1347  H HE21 . GLN A 1 89 ? 6.727   18.789  7.330   1.00 0.00 ? 89 GLN A HE21 1  
ATOM 1348  H HE22 . GLN A 1 89 ? 8.184   18.369  6.492   1.00 0.00 ? 89 GLN A HE22 1  
ATOM 1349  N N    . THR A 1 90 ? 3.825   15.798  11.038  1.00 0.00 ? 90 THR A N    1  
ATOM 1350  C CA   . THR A 1 90 ? 2.555   15.776  11.745  1.00 0.00 ? 90 THR A CA   1  
ATOM 1351  C C    . THR A 1 90 ? 1.692   16.968  11.328  1.00 0.00 ? 90 THR A C    1  
ATOM 1352  O O    . THR A 1 90 ? 2.213   17.994  10.892  1.00 0.00 ? 90 THR A O    1  
ATOM 1353  C CB   . THR A 1 90 ? 2.849   15.734  13.245  1.00 0.00 ? 90 THR A CB   1  
ATOM 1354  O OG1  . THR A 1 90 ? 3.643   16.895  13.476  1.00 0.00 ? 90 THR A OG1  1  
ATOM 1355  C CG2  . THR A 1 90 ? 3.769   14.573  13.630  1.00 0.00 ? 90 THR A CG2  1  
ATOM 1356  H H    . THR A 1 90 ? 4.514   16.408  11.428  1.00 0.00 ? 90 THR A H    1  
ATOM 1357  H HA   . THR A 1 90 ? 2.016   14.874  11.455  1.00 0.00 ? 90 THR A HA   1  
ATOM 1358  H HB   . THR A 1 90 ? 1.925   15.707  13.823  1.00 0.00 ? 90 THR A HB   1  
ATOM 1359  H HG1  . THR A 1 90 ? 3.786   17.023  14.457  1.00 0.00 ? 90 THR A HG1  1  
ATOM 1360  H HG21 . THR A 1 90 ? 4.502   14.412  12.839  1.00 0.00 ? 90 THR A HG21 1  
ATOM 1361  H HG22 . THR A 1 90 ? 4.284   14.810  14.561  1.00 0.00 ? 90 THR A HG22 1  
ATOM 1362  H HG23 . THR A 1 90 ? 3.175   13.669  13.764  1.00 0.00 ? 90 THR A HG23 1  
ATOM 1363  N N    . SER A 1 91 ? 0.387   16.794  11.476  1.00 0.00 ? 91 SER A N    1  
ATOM 1364  C CA   . SER A 1 91 ? -0.553  17.843  11.120  1.00 0.00 ? 91 SER A CA   1  
ATOM 1365  C C    . SER A 1 91 ? -1.942  17.509  11.668  1.00 0.00 ? 91 SER A C    1  
ATOM 1366  O O    . SER A 1 91 ? -2.482  18.248  12.491  1.00 0.00 ? 91 SER A O    1  
ATOM 1367  C CB   . SER A 1 91 ? -0.614  18.037  9.604   1.00 0.00 ? 91 SER A CB   1  
ATOM 1368  O OG   . SER A 1 91 ? -1.794  18.726  9.200   1.00 0.00 ? 91 SER A OG   1  
ATOM 1369  H H    . SER A 1 91 ? -0.029  15.957  11.831  1.00 0.00 ? 91 SER A H    1  
ATOM 1370  H HA   . SER A 1 91 ? -0.165  18.749  11.586  1.00 0.00 ? 91 SER A HA   1  
ATOM 1371  H HB2  . SER A 1 91 ? 0.262   18.596  9.274   1.00 0.00 ? 91 SER A HB2  1  
ATOM 1372  H HB3  . SER A 1 91 ? -0.575  17.065  9.112   1.00 0.00 ? 91 SER A HB3  1  
ATOM 1373  H HG   . SER A 1 91 ? -2.372  18.122  8.651   1.00 0.00 ? 91 SER A HG   1  
ATOM 1374  N N    . GLU A 1 92 ? -2.480  16.397  11.191  1.00 0.00 ? 92 GLU A N    1  
ATOM 1375  C CA   . GLU A 1 92 ? -3.795  15.956  11.623  1.00 0.00 ? 92 GLU A CA   1  
ATOM 1376  C C    . GLU A 1 92 ? -3.850  14.428  11.684  1.00 0.00 ? 92 GLU A C    1  
ATOM 1377  O O    . GLU A 1 92 ? -3.428  13.751  10.748  1.00 0.00 ? 92 GLU A O    1  
ATOM 1378  C CB   . GLU A 1 92 ? -4.887  16.508  10.705  1.00 0.00 ? 92 GLU A CB   1  
ATOM 1379  C CG   . GLU A 1 92 ? -6.279  16.162  11.239  1.00 0.00 ? 92 GLU A CG   1  
ATOM 1380  C CD   . GLU A 1 92 ? -7.363  16.533  10.225  1.00 0.00 ? 92 GLU A CD   1  
ATOM 1381  O OE1  . GLU A 1 92 ? -7.420  15.850  9.179   1.00 0.00 ? 92 GLU A OE1  1  
ATOM 1382  O OE2  . GLU A 1 92 ? -8.111  17.491  10.518  1.00 0.00 ? 92 GLU A OE2  1  
ATOM 1383  H H    . GLU A 1 92 ? -2.034  15.802  10.523  1.00 0.00 ? 92 GLU A H    1  
ATOM 1384  H HA   . GLU A 1 92 ? -3.926  16.371  12.623  1.00 0.00 ? 92 GLU A HA   1  
ATOM 1385  H HB2  . GLU A 1 92 ? -4.785  17.590  10.621  1.00 0.00 ? 92 GLU A HB2  1  
ATOM 1386  H HB3  . GLU A 1 92 ? -4.766  16.098  9.702   1.00 0.00 ? 92 GLU A HB3  1  
ATOM 1387  H HG2  . GLU A 1 92 ? -6.333  15.096  11.460  1.00 0.00 ? 92 GLU A HG2  1  
ATOM 1388  H HG3  . GLU A 1 92 ? -6.455  16.692  12.175  1.00 0.00 ? 92 GLU A HG3  1  
ATOM 1389  N N    . SER A 1 93 ? -4.374  13.930  12.794  1.00 0.00 ? 93 SER A N    1  
ATOM 1390  C CA   . SER A 1 93 ? -4.490  12.495  12.989  1.00 0.00 ? 93 SER A CA   1  
ATOM 1391  C C    . SER A 1 93 ? -3.102  11.851  12.967  1.00 0.00 ? 93 SER A C    1  
ATOM 1392  O O    . SER A 1 93 ? -2.554  11.586  11.898  1.00 0.00 ? 93 SER A O    1  
ATOM 1393  C CB   . SER A 1 93 ? -5.385  11.864  11.920  1.00 0.00 ? 93 SER A CB   1  
ATOM 1394  O OG   . SER A 1 93 ? -6.742  11.779  12.343  1.00 0.00 ? 93 SER A OG   1  
ATOM 1395  H H    . SER A 1 93 ? -4.715  14.488  13.551  1.00 0.00 ? 93 SER A H    1  
ATOM 1396  H HA   . SER A 1 93 ? -4.953  12.373  13.968  1.00 0.00 ? 93 SER A HA   1  
ATOM 1397  H HB2  . SER A 1 93 ? -5.327  12.454  11.005  1.00 0.00 ? 93 SER A HB2  1  
ATOM 1398  H HB3  . SER A 1 93 ? -5.016  10.867  11.681  1.00 0.00 ? 93 SER A HB3  1  
ATOM 1399  H HG   . SER A 1 93 ? -6.816  11.176  13.138  1.00 0.00 ? 93 SER A HG   1  
ATOM 1400  N N    . GLY A 1 94 ? -2.574  11.617  14.159  1.00 0.00 ? 94 GLY A N    1  
ATOM 1401  C CA   . GLY A 1 94 ? -1.261  11.009  14.291  1.00 0.00 ? 94 GLY A CA   1  
ATOM 1402  C C    . GLY A 1 94 ? -1.183  10.137  15.546  1.00 0.00 ? 94 GLY A C    1  
ATOM 1403  O O    . GLY A 1 94 ? -2.205  9.669   16.045  1.00 0.00 ? 94 GLY A O    1  
ATOM 1404  H H    . GLY A 1 94 ? -3.027  11.836  15.024  1.00 0.00 ? 94 GLY A H    1  
ATOM 1405  H HA2  . GLY A 1 94 ? -1.047  10.404  13.410  1.00 0.00 ? 94 GLY A HA2  1  
ATOM 1406  H HA3  . GLY A 1 94 ? -0.499  11.787  14.336  1.00 0.00 ? 94 GLY A HA3  1  
ATOM 1407  N N    . PRO A 1 95 ? 0.071   9.941   16.033  1.00 0.00 ? 95 PRO A N    1  
ATOM 1408  C CA   . PRO A 1 95 ? 0.296   9.135   17.220  1.00 0.00 ? 95 PRO A CA   1  
ATOM 1409  C C    . PRO A 1 95 ? -0.114  9.893   18.484  1.00 0.00 ? 95 PRO A C    1  
ATOM 1410  O O    . PRO A 1 95 ? 0.735   10.252  19.299  1.00 0.00 ? 95 PRO A O    1  
ATOM 1411  C CB   . PRO A 1 95 ? 1.776   8.790   17.187  1.00 0.00 ? 95 PRO A CB   1  
ATOM 1412  C CG   . PRO A 1 95 ? 2.417   9.794   16.244  1.00 0.00 ? 95 PRO A CG   1  
ATOM 1413  C CD   . PRO A 1 95 ? 1.305   10.481  15.468  1.00 0.00 ? 95 PRO A CD   1  
ATOM 1414  H HA   . PRO A 1 95 ? -0.277  8.315   17.196  1.00 0.00 ? 95 PRO A HA   1  
ATOM 1415  H HB2  . PRO A 1 95 ? 2.214   8.854   18.183  1.00 0.00 ? 95 PRO A HB2  1  
ATOM 1416  H HB3  . PRO A 1 95 ? 1.931   7.769   16.836  1.00 0.00 ? 95 PRO A HB3  1  
ATOM 1417  H HG2  . PRO A 1 95 ? 3.000   10.525  16.803  1.00 0.00 ? 95 PRO A HG2  1  
ATOM 1418  H HG3  . PRO A 1 95 ? 3.104   9.293   15.562  1.00 0.00 ? 95 PRO A HG3  1  
ATOM 1419  H HD2  . PRO A 1 95 ? 1.352   11.563  15.582  1.00 0.00 ? 95 PRO A HD2  1  
ATOM 1420  H HD3  . PRO A 1 95 ? 1.377   10.269  14.401  1.00 0.00 ? 95 PRO A HD3  1  
ATOM 1421  N N    . SER A 1 96 ? -1.414  10.115  18.608  1.00 0.00 ? 96 SER A N    1  
ATOM 1422  C CA   . SER A 1 96 ? -1.946  10.825  19.758  1.00 0.00 ? 96 SER A CA   1  
ATOM 1423  C C    . SER A 1 96 ? -1.278  12.196  19.883  1.00 0.00 ? 96 SER A C    1  
ATOM 1424  O O    . SER A 1 96 ? -0.288  12.345  20.597  1.00 0.00 ? 96 SER A O    1  
ATOM 1425  C CB   . SER A 1 96 ? -1.746  10.019  21.043  1.00 0.00 ? 96 SER A CB   1  
ATOM 1426  O OG   . SER A 1 96 ? -1.888  10.827  22.208  1.00 0.00 ? 96 SER A OG   1  
ATOM 1427  H H    . SER A 1 96 ? -2.098  9.820   17.940  1.00 0.00 ? 96 SER A H    1  
ATOM 1428  H HA   . SER A 1 96 ? -3.012  10.936  19.562  1.00 0.00 ? 96 SER A HA   1  
ATOM 1429  H HB2  . SER A 1 96 ? -2.470  9.205   21.077  1.00 0.00 ? 96 SER A HB2  1  
ATOM 1430  H HB3  . SER A 1 96 ? -0.756  9.564   21.036  1.00 0.00 ? 96 SER A HB3  1  
ATOM 1431  H HG   . SER A 1 96 ? -2.396  10.329  22.911  1.00 0.00 ? 96 SER A HG   1  
ATOM 1432  N N    . SER A 1 97 ? -1.847  13.162  19.176  1.00 0.00 ? 97 SER A N    1  
ATOM 1433  C CA   . SER A 1 97 ? -1.318  14.515  19.199  1.00 0.00 ? 97 SER A CA   1  
ATOM 1434  C C    . SER A 1 97 ? -1.290  15.042  20.635  1.00 0.00 ? 97 SER A C    1  
ATOM 1435  O O    . SER A 1 97 ? -0.229  15.391  21.151  1.00 0.00 ? 97 SER A O    1  
ATOM 1436  C CB   . SER A 1 97 ? -2.147  15.444  18.309  1.00 0.00 ? 97 SER A CB   1  
ATOM 1437  O OG   . SER A 1 97 ? -1.326  16.323  17.544  1.00 0.00 ? 97 SER A OG   1  
ATOM 1438  H H    . SER A 1 97 ? -2.652  13.032  18.598  1.00 0.00 ? 97 SER A H    1  
ATOM 1439  H HA   . SER A 1 97 ? -0.307  14.437  18.800  1.00 0.00 ? 97 SER A HA   1  
ATOM 1440  H HB2  . SER A 1 97 ? -2.763  14.848  17.636  1.00 0.00 ? 97 SER A HB2  1  
ATOM 1441  H HB3  . SER A 1 97 ? -2.826  16.030  18.928  1.00 0.00 ? 97 SER A HB3  1  
ATOM 1442  H HG   . SER A 1 97 ? -1.193  15.954  16.625  1.00 0.00 ? 97 SER A HG   1  
ATOM 1443  N N    . GLY A 1 98 ? -2.468  15.084  21.240  1.00 0.00 ? 98 GLY A N    1  
ATOM 1444  C CA   . GLY A 1 98 ? -2.591  15.562  22.606  1.00 0.00 ? 98 GLY A CA   1  
ATOM 1445  C C    . GLY A 1 98 ? -3.650  14.767  23.372  1.00 0.00 ? 98 GLY A C    1  
ATOM 1446  O O    . GLY A 1 98 ? -4.499  14.114  22.768  1.00 0.00 ? 98 GLY A O    1  
ATOM 1447  H H    . GLY A 1 98 ? -3.326  14.798  20.813  1.00 0.00 ? 98 GLY A H    1  
ATOM 1448  H HA2  . GLY A 1 98 ? -1.630  15.478  23.113  1.00 0.00 ? 98 GLY A HA2  1  
ATOM 1449  H HA3  . GLY A 1 98 ? -2.858  16.619  22.602  1.00 0.00 ? 98 GLY A HA3  1  
ATOM 1450  N N    . GLY A 1 1  ? -14.729 -19.514 -1.192  1.00 0.00 ? 1  GLY A N    2  
ATOM 1451  C CA   . GLY A 1 1  ? -13.339 -19.103 -1.082  1.00 0.00 ? 1  GLY A CA   2  
ATOM 1452  C C    . GLY A 1 1  ? -13.072 -17.846 -1.912  1.00 0.00 ? 1  GLY A C    2  
ATOM 1453  O O    . GLY A 1 1  ? -14.005 -17.146 -2.304  1.00 0.00 ? 1  GLY A O    2  
ATOM 1454  H H1   . GLY A 1 1  ? -14.867 -20.478 -1.420  1.00 0.00 ? 1  GLY A H1   2  
ATOM 1455  H HA2  . GLY A 1 1  ? -13.095 -18.911 -0.037  1.00 0.00 ? 1  GLY A HA2  2  
ATOM 1456  H HA3  . GLY A 1 1  ? -12.689 -19.910 -1.418  1.00 0.00 ? 1  GLY A HA3  2  
ATOM 1457  N N    . SER A 1 2  ? -11.794 -17.597 -2.156  1.00 0.00 ? 2  SER A N    2  
ATOM 1458  C CA   . SER A 1 2  ? -11.392 -16.437 -2.933  1.00 0.00 ? 2  SER A CA   2  
ATOM 1459  C C    . SER A 1 2  ? -9.952  -16.606 -3.420  1.00 0.00 ? 2  SER A C    2  
ATOM 1460  O O    . SER A 1 2  ? -9.008  -16.443 -2.648  1.00 0.00 ? 2  SER A O    2  
ATOM 1461  C CB   . SER A 1 2  ? -11.527 -15.152 -2.113  1.00 0.00 ? 2  SER A CB   2  
ATOM 1462  O OG   . SER A 1 2  ? -12.844 -14.612 -2.181  1.00 0.00 ? 2  SER A OG   2  
ATOM 1463  H H    . SER A 1 2  ? -11.041 -18.171 -1.834  1.00 0.00 ? 2  SER A H    2  
ATOM 1464  H HA   . SER A 1 2  ? -12.080 -16.402 -3.777  1.00 0.00 ? 2  SER A HA   2  
ATOM 1465  H HB2  . SER A 1 2  ? -11.272 -15.357 -1.073  1.00 0.00 ? 2  SER A HB2  2  
ATOM 1466  H HB3  . SER A 1 2  ? -10.813 -14.413 -2.477  1.00 0.00 ? 2  SER A HB3  2  
ATOM 1467  H HG   . SER A 1 2  ? -12.802 -13.614 -2.241  1.00 0.00 ? 2  SER A HG   2  
ATOM 1468  N N    . SER A 1 3  ? -9.828  -16.932 -4.698  1.00 0.00 ? 3  SER A N    2  
ATOM 1469  C CA   . SER A 1 3  ? -8.519  -17.126 -5.298  1.00 0.00 ? 3  SER A CA   2  
ATOM 1470  C C    . SER A 1 3  ? -8.430  -16.359 -6.619  1.00 0.00 ? 3  SER A C    2  
ATOM 1471  O O    . SER A 1 3  ? -9.312  -16.474 -7.468  1.00 0.00 ? 3  SER A O    2  
ATOM 1472  C CB   . SER A 1 3  ? -8.231  -18.611 -5.526  1.00 0.00 ? 3  SER A CB   2  
ATOM 1473  O OG   . SER A 1 3  ? -7.866  -19.275 -4.319  1.00 0.00 ? 3  SER A OG   2  
ATOM 1474  H H    . SER A 1 3  ? -10.601 -17.063 -5.320  1.00 0.00 ? 3  SER A H    2  
ATOM 1475  H HA   . SER A 1 3  ? -7.808  -16.726 -4.575  1.00 0.00 ? 3  SER A HA   2  
ATOM 1476  H HB2  . SER A 1 3  ? -9.114  -19.090 -5.950  1.00 0.00 ? 3  SER A HB2  2  
ATOM 1477  H HB3  . SER A 1 3  ? -7.429  -18.718 -6.256  1.00 0.00 ? 3  SER A HB3  2  
ATOM 1478  H HG   . SER A 1 3  ? -6.955  -18.981 -4.029  1.00 0.00 ? 3  SER A HG   2  
ATOM 1479  N N    . GLY A 1 4  ? -7.356  -15.595 -6.752  1.00 0.00 ? 4  GLY A N    2  
ATOM 1480  C CA   . GLY A 1 4  ? -7.140  -14.810 -7.955  1.00 0.00 ? 4  GLY A CA   2  
ATOM 1481  C C    . GLY A 1 4  ? -6.649  -13.402 -7.611  1.00 0.00 ? 4  GLY A C    2  
ATOM 1482  O O    . GLY A 1 4  ? -6.790  -12.952 -6.474  1.00 0.00 ? 4  GLY A O    2  
ATOM 1483  H H    . GLY A 1 4  ? -6.642  -15.507 -6.056  1.00 0.00 ? 4  GLY A H    2  
ATOM 1484  H HA2  . GLY A 1 4  ? -6.409  -15.308 -8.592  1.00 0.00 ? 4  GLY A HA2  2  
ATOM 1485  H HA3  . GLY A 1 4  ? -8.068  -14.746 -8.523  1.00 0.00 ? 4  GLY A HA3  2  
ATOM 1486  N N    . SER A 1 5  ? -6.083  -12.746 -8.613  1.00 0.00 ? 5  SER A N    2  
ATOM 1487  C CA   . SER A 1 5  ? -5.571  -11.398 -8.430  1.00 0.00 ? 5  SER A CA   2  
ATOM 1488  C C    . SER A 1 5  ? -5.019  -10.865 -9.754  1.00 0.00 ? 5  SER A C    2  
ATOM 1489  O O    . SER A 1 5  ? -4.878  -11.614 -10.719 1.00 0.00 ? 5  SER A O    2  
ATOM 1490  C CB   . SER A 1 5  ? -4.488  -11.362 -7.350  1.00 0.00 ? 5  SER A CB   2  
ATOM 1491  O OG   . SER A 1 5  ? -3.266  -11.940 -7.800  1.00 0.00 ? 5  SER A OG   2  
ATOM 1492  H H    . SER A 1 5  ? -5.973  -13.119 -9.534  1.00 0.00 ? 5  SER A H    2  
ATOM 1493  H HA   . SER A 1 5  ? -6.427  -10.806 -8.106  1.00 0.00 ? 5  SER A HA   2  
ATOM 1494  H HB2  . SER A 1 5  ? -4.311  -10.330 -7.048  1.00 0.00 ? 5  SER A HB2  2  
ATOM 1495  H HB3  . SER A 1 5  ? -4.839  -11.897 -6.468  1.00 0.00 ? 5  SER A HB3  2  
ATOM 1496  H HG   . SER A 1 5  ? -3.341  -12.937 -7.809  1.00 0.00 ? 5  SER A HG   2  
ATOM 1497  N N    . SER A 1 6  ? -4.721  -9.573  -9.756  1.00 0.00 ? 6  SER A N    2  
ATOM 1498  C CA   . SER A 1 6  ? -4.187  -8.931  -10.945 1.00 0.00 ? 6  SER A CA   2  
ATOM 1499  C C    . SER A 1 6  ? -3.363  -7.704  -10.552 1.00 0.00 ? 6  SER A C    2  
ATOM 1500  O O    . SER A 1 6  ? -3.871  -6.794  -9.897  1.00 0.00 ? 6  SER A O    2  
ATOM 1501  C CB   . SER A 1 6  ? -5.309  -8.531  -11.906 1.00 0.00 ? 6  SER A CB   2  
ATOM 1502  O OG   . SER A 1 6  ? -5.213  -9.215  -13.152 1.00 0.00 ? 6  SER A OG   2  
ATOM 1503  H H    . SER A 1 6  ? -4.839  -8.971  -8.967  1.00 0.00 ? 6  SER A H    2  
ATOM 1504  H HA   . SER A 1 6  ? -3.554  -9.681  -11.419 1.00 0.00 ? 6  SER A HA   2  
ATOM 1505  H HB2  . SER A 1 6  ? -6.274  -8.748  -11.447 1.00 0.00 ? 6  SER A HB2  2  
ATOM 1506  H HB3  . SER A 1 6  ? -5.273  -7.456  -12.079 1.00 0.00 ? 6  SER A HB3  2  
ATOM 1507  H HG   . SER A 1 6  ? -6.126  -9.456  -13.481 1.00 0.00 ? 6  SER A HG   2  
ATOM 1508  N N    . GLY A 1 7  ? -2.105  -7.717  -10.967 1.00 0.00 ? 7  GLY A N    2  
ATOM 1509  C CA   . GLY A 1 7  ? -1.206  -6.616  -10.666 1.00 0.00 ? 7  GLY A CA   2  
ATOM 1510  C C    . GLY A 1 7  ? 0.135   -6.792  -11.381 1.00 0.00 ? 7  GLY A C    2  
ATOM 1511  O O    . GLY A 1 7  ? 0.545   -7.915  -11.671 1.00 0.00 ? 7  GLY A O    2  
ATOM 1512  H H    . GLY A 1 7  ? -1.700  -8.460  -11.500 1.00 0.00 ? 7  GLY A H    2  
ATOM 1513  H HA2  . GLY A 1 7  ? -1.664  -5.674  -10.970 1.00 0.00 ? 7  GLY A HA2  2  
ATOM 1514  H HA3  . GLY A 1 7  ? -1.044  -6.558  -9.590  1.00 0.00 ? 7  GLY A HA3  2  
ATOM 1515  N N    . GLU A 1 8  ? 0.781   -5.666  -11.645 1.00 0.00 ? 8  GLU A N    2  
ATOM 1516  C CA   . GLU A 1 8  ? 2.067   -5.681  -12.321 1.00 0.00 ? 8  GLU A CA   2  
ATOM 1517  C C    . GLU A 1 8  ? 3.048   -4.741  -11.618 1.00 0.00 ? 8  GLU A C    2  
ATOM 1518  O O    . GLU A 1 8  ? 2.641   -3.898  -10.819 1.00 0.00 ? 8  GLU A O    2  
ATOM 1519  C CB   . GLU A 1 8  ? 1.915   -5.311  -13.798 1.00 0.00 ? 8  GLU A CB   2  
ATOM 1520  C CG   . GLU A 1 8  ? 2.679   -6.292  -14.690 1.00 0.00 ? 8  GLU A CG   2  
ATOM 1521  C CD   . GLU A 1 8  ? 1.719   -7.084  -15.581 1.00 0.00 ? 8  GLU A CD   2  
ATOM 1522  O OE1  . GLU A 1 8  ? 0.625   -7.420  -15.078 1.00 0.00 ? 8  GLU A OE1  2  
ATOM 1523  O OE2  . GLU A 1 8  ? 2.101   -7.335  -16.744 1.00 0.00 ? 8  GLU A OE2  2  
ATOM 1524  H H    . GLU A 1 8  ? 0.440   -4.756  -11.406 1.00 0.00 ? 8  GLU A H    2  
ATOM 1525  H HA   . GLU A 1 8  ? 2.422   -6.709  -12.245 1.00 0.00 ? 8  GLU A HA   2  
ATOM 1526  H HB2  . GLU A 1 8  ? 0.860   -5.312  -14.070 1.00 0.00 ? 8  GLU A HB2  2  
ATOM 1527  H HB3  . GLU A 1 8  ? 2.286   -4.300  -13.963 1.00 0.00 ? 8  GLU A HB3  2  
ATOM 1528  H HG2  . GLU A 1 8  ? 3.390   -5.747  -15.310 1.00 0.00 ? 8  GLU A HG2  2  
ATOM 1529  H HG3  . GLU A 1 8  ? 3.256   -6.979  -14.071 1.00 0.00 ? 8  GLU A HG3  2  
ATOM 1530  N N    . PHE A 1 9  ? 4.321   -4.916  -11.940 1.00 0.00 ? 9  PHE A N    2  
ATOM 1531  C CA   . PHE A 1 9  ? 5.362   -4.093  -11.350 1.00 0.00 ? 9  PHE A CA   2  
ATOM 1532  C C    . PHE A 1 9  ? 5.988   -3.167  -12.395 1.00 0.00 ? 9  PHE A C    2  
ATOM 1533  O O    . PHE A 1 9  ? 5.953   -3.459  -13.589 1.00 0.00 ? 9  PHE A O    2  
ATOM 1534  C CB   . PHE A 1 9  ? 6.437   -5.044  -10.819 1.00 0.00 ? 9  PHE A CB   2  
ATOM 1535  C CG   . PHE A 1 9  ? 7.069   -5.930  -11.895 1.00 0.00 ? 9  PHE A CG   2  
ATOM 1536  C CD1  . PHE A 1 9  ? 6.505   -7.128  -12.205 1.00 0.00 ? 9  PHE A CD1  2  
ATOM 1537  C CD2  . PHE A 1 9  ? 8.194   -5.520  -12.539 1.00 0.00 ? 9  PHE A CD2  2  
ATOM 1538  C CE1  . PHE A 1 9  ? 7.092   -7.951  -13.203 1.00 0.00 ? 9  PHE A CE1  2  
ATOM 1539  C CE2  . PHE A 1 9  ? 8.780   -6.343  -13.537 1.00 0.00 ? 9  PHE A CE2  2  
ATOM 1540  C CZ   . PHE A 1 9  ? 8.217   -7.541  -13.848 1.00 0.00 ? 9  PHE A CZ   2  
ATOM 1541  H H    . PHE A 1 9  ? 4.643   -5.603  -12.591 1.00 0.00 ? 9  PHE A H    2  
ATOM 1542  H HA   . PHE A 1 9  ? 4.896   -3.493  -10.568 1.00 0.00 ? 9  PHE A HA   2  
ATOM 1543  H HB2  . PHE A 1 9  ? 7.221   -4.458  -10.339 1.00 0.00 ? 9  PHE A HB2  2  
ATOM 1544  H HB3  . PHE A 1 9  ? 5.998   -5.680  -10.051 1.00 0.00 ? 9  PHE A HB3  2  
ATOM 1545  H HD1  . PHE A 1 9  ? 5.604   -7.457  -11.689 1.00 0.00 ? 9  PHE A HD1  2  
ATOM 1546  H HD2  . PHE A 1 9  ? 8.645   -4.560  -12.290 1.00 0.00 ? 9  PHE A HD2  2  
ATOM 1547  H HE1  . PHE A 1 9  ? 6.640   -8.911  -13.452 1.00 0.00 ? 9  PHE A HE1  2  
ATOM 1548  H HE2  . PHE A 1 9  ? 9.682   -6.014  -14.054 1.00 0.00 ? 9  PHE A HE2  2  
ATOM 1549  H HZ   . PHE A 1 9  ? 8.667   -8.173  -14.614 1.00 0.00 ? 9  PHE A HZ   2  
ATOM 1550  N N    . VAL A 1 10 ? 6.546   -2.068  -11.907 1.00 0.00 ? 10 VAL A N    2  
ATOM 1551  C CA   . VAL A 1 10 ? 7.179   -1.098  -12.784 1.00 0.00 ? 10 VAL A CA   2  
ATOM 1552  C C    . VAL A 1 10 ? 8.697   -1.174  -12.610 1.00 0.00 ? 10 VAL A C    2  
ATOM 1553  O O    . VAL A 1 10 ? 9.208   -1.011  -11.503 1.00 0.00 ? 10 VAL A O    2  
ATOM 1554  C CB   . VAL A 1 10 ? 6.615   0.299   -12.512 1.00 0.00 ? 10 VAL A CB   2  
ATOM 1555  C CG1  . VAL A 1 10 ? 7.409   1.367   -13.267 1.00 0.00 ? 10 VAL A CG1  2  
ATOM 1556  C CG2  . VAL A 1 10 ? 5.128   0.368   -12.865 1.00 0.00 ? 10 VAL A CG2  2  
ATOM 1557  H H    . VAL A 1 10 ? 6.570   -1.838  -10.934 1.00 0.00 ? 10 VAL A H    2  
ATOM 1558  H HA   . VAL A 1 10 ? 6.929   -1.369  -13.809 1.00 0.00 ? 10 VAL A HA   2  
ATOM 1559  H HB   . VAL A 1 10 ? 6.715   0.499   -11.445 1.00 0.00 ? 10 VAL A HB   2  
ATOM 1560  H HG11 . VAL A 1 10 ? 6.726   1.974   -13.861 1.00 0.00 ? 10 VAL A HG11 2  
ATOM 1561  H HG12 . VAL A 1 10 ? 7.933   2.002   -12.553 1.00 0.00 ? 10 VAL A HG12 2  
ATOM 1562  H HG13 . VAL A 1 10 ? 8.132   0.885   -13.924 1.00 0.00 ? 10 VAL A HG13 2  
ATOM 1563  H HG21 . VAL A 1 10 ? 4.883   -0.433  -13.562 1.00 0.00 ? 10 VAL A HG21 2  
ATOM 1564  H HG22 . VAL A 1 10 ? 4.534   0.256   -11.959 1.00 0.00 ? 10 VAL A HG22 2  
ATOM 1565  H HG23 . VAL A 1 10 ? 4.909   1.331   -13.327 1.00 0.00 ? 10 VAL A HG23 2  
ATOM 1566  N N    . ILE A 1 11 ? 9.376   -1.421  -13.721 1.00 0.00 ? 11 ILE A N    2  
ATOM 1567  C CA   . ILE A 1 11 ? 10.825  -1.520  -13.706 1.00 0.00 ? 11 ILE A CA   2  
ATOM 1568  C C    . ILE A 1 11 ? 11.414  -0.238  -13.115 1.00 0.00 ? 11 ILE A C    2  
ATOM 1569  O O    . ILE A 1 11 ? 11.054  0.863   -13.529 1.00 0.00 ? 11 ILE A O    2  
ATOM 1570  C CB   . ILE A 1 11 ? 11.354  -1.853  -15.102 1.00 0.00 ? 11 ILE A CB   2  
ATOM 1571  C CG1  . ILE A 1 11 ? 11.029  -0.733  -16.093 1.00 0.00 ? 11 ILE A CG1  2  
ATOM 1572  C CG2  . ILE A 1 11 ? 10.830  -3.209  -15.578 1.00 0.00 ? 11 ILE A CG2  2  
ATOM 1573  C CD1  . ILE A 1 11 ? 12.263  0.129   -16.370 1.00 0.00 ? 11 ILE A CD1  2  
ATOM 1574  H H    . ILE A 1 11 ? 8.953   -1.551  -14.618 1.00 0.00 ? 11 ILE A H    2  
ATOM 1575  H HA   . ILE A 1 11 ? 11.089  -2.353  -13.054 1.00 0.00 ? 11 ILE A HA   2  
ATOM 1576  H HB   . ILE A 1 11 ? 12.440  -1.929  -15.047 1.00 0.00 ? 11 ILE A HB   2  
ATOM 1577  H HG12 . ILE A 1 11 ? 10.664  -1.163  -17.026 1.00 0.00 ? 11 ILE A HG12 2  
ATOM 1578  H HG13 . ILE A 1 11 ? 10.228  -0.111  -15.694 1.00 0.00 ? 11 ILE A HG13 2  
ATOM 1579  H HG21 . ILE A 1 11 ? 10.312  -3.707  -14.758 1.00 0.00 ? 11 ILE A HG21 2  
ATOM 1580  H HG22 . ILE A 1 11 ? 10.139  -3.061  -16.408 1.00 0.00 ? 11 ILE A HG22 2  
ATOM 1581  H HG23 . ILE A 1 11 ? 11.666  -3.826  -15.908 1.00 0.00 ? 11 ILE A HG23 2  
ATOM 1582  H HD11 . ILE A 1 11 ? 13.000  -0.028  -15.583 1.00 0.00 ? 11 ILE A HD11 2  
ATOM 1583  H HD12 . ILE A 1 11 ? 12.693  -0.151  -17.332 1.00 0.00 ? 11 ILE A HD12 2  
ATOM 1584  H HD13 . ILE A 1 11 ? 11.974  1.180   -16.393 1.00 0.00 ? 11 ILE A HD13 2  
ATOM 1585  N N    . ASN A 1 12 ? 12.310  -0.422  -12.156 1.00 0.00 ? 12 ASN A N    2  
ATOM 1586  C CA   . ASN A 1 12 ? 12.952  0.706   -11.504 1.00 0.00 ? 12 ASN A CA   2  
ATOM 1587  C C    . ASN A 1 12 ? 14.318  0.952   -12.147 1.00 0.00 ? 12 ASN A C    2  
ATOM 1588  O O    . ASN A 1 12 ? 15.012  0.007   -12.519 1.00 0.00 ? 12 ASN A O    2  
ATOM 1589  C CB   . ASN A 1 12 ? 13.173  0.429   -10.015 1.00 0.00 ? 12 ASN A CB   2  
ATOM 1590  C CG   . ASN A 1 12 ? 13.881  -0.911  -9.806  1.00 0.00 ? 12 ASN A CG   2  
ATOM 1591  O OD1  . ASN A 1 12 ? 13.418  -1.959  -10.225 1.00 0.00 ? 12 ASN A OD1  2  
ATOM 1592  N ND2  . ASN A 1 12 ? 15.026  -0.818  -9.136  1.00 0.00 ? 12 ASN A ND2  2  
ATOM 1593  H H    . ASN A 1 12 ? 12.597  -1.321  -11.825 1.00 0.00 ? 12 ASN A H    2  
ATOM 1594  H HA   . ASN A 1 12 ? 12.268  1.544   -11.643 1.00 0.00 ? 12 ASN A HA   2  
ATOM 1595  H HB2  . ASN A 1 12 ? 13.767  1.231   -9.577  1.00 0.00 ? 12 ASN A HB2  2  
ATOM 1596  H HB3  . ASN A 1 12 ? 12.214  0.423   -9.497  1.00 0.00 ? 12 ASN A HB3  2  
ATOM 1597  H HD21 . ASN A 1 12 ? 15.350  0.073   -8.820  1.00 0.00 ? 12 ASN A HD21 2  
ATOM 1598  H HD22 . ASN A 1 12 ? 15.564  -1.641  -8.949  1.00 0.00 ? 12 ASN A HD22 2  
ATOM 1599  N N    . PRO A 1 13 ? 14.672  2.260   -12.261 1.00 0.00 ? 13 PRO A N    2  
ATOM 1600  C CA   . PRO A 1 13 ? 15.943  2.641   -12.853 1.00 0.00 ? 13 PRO A CA   2  
ATOM 1601  C C    . PRO A 1 13 ? 17.100  2.376   -11.887 1.00 0.00 ? 13 PRO A C    2  
ATOM 1602  O O    . PRO A 1 13 ? 18.147  1.872   -12.290 1.00 0.00 ? 13 PRO A O    2  
ATOM 1603  C CB   . PRO A 1 13 ? 15.788  4.112   -13.204 1.00 0.00 ? 13 PRO A CB   2  
ATOM 1604  C CG   . PRO A 1 13 ? 14.615  4.616   -12.379 1.00 0.00 ? 13 PRO A CG   2  
ATOM 1605  C CD   . PRO A 1 13 ? 13.876  3.405   -11.832 1.00 0.00 ? 13 PRO A CD   2  
ATOM 1606  H HA   . PRO A 1 13 ? 16.130  2.085   -13.663 1.00 0.00 ? 13 PRO A HA   2  
ATOM 1607  H HB2  . PRO A 1 13 ? 16.696  4.668   -12.971 1.00 0.00 ? 13 PRO A HB2  2  
ATOM 1608  H HB3  . PRO A 1 13 ? 15.600  4.242   -14.270 1.00 0.00 ? 13 PRO A HB3  2  
ATOM 1609  H HG2  . PRO A 1 13 ? 14.965  5.250   -11.564 1.00 0.00 ? 13 PRO A HG2  2  
ATOM 1610  H HG3  . PRO A 1 13 ? 13.950  5.224   -12.992 1.00 0.00 ? 13 PRO A HG3  2  
ATOM 1611  H HD2  . PRO A 1 13 ? 13.797  3.447   -10.745 1.00 0.00 ? 13 PRO A HD2  2  
ATOM 1612  H HD3  . PRO A 1 13 ? 12.861  3.351   -12.223 1.00 0.00 ? 13 PRO A HD3  2  
ATOM 1613  N N    . ASN A 1 14 ? 16.872  2.729   -10.631 1.00 0.00 ? 14 ASN A N    2  
ATOM 1614  C CA   . ASN A 1 14 ? 17.882  2.535   -9.604  1.00 0.00 ? 14 ASN A CA   2  
ATOM 1615  C C    . ASN A 1 14 ? 17.245  2.725   -8.226  1.00 0.00 ? 14 ASN A C    2  
ATOM 1616  O O    . ASN A 1 14 ? 17.348  1.852   -7.365  1.00 0.00 ? 14 ASN A O    2  
ATOM 1617  C CB   . ASN A 1 14 ? 19.014  3.554   -9.746  1.00 0.00 ? 14 ASN A CB   2  
ATOM 1618  C CG   . ASN A 1 14 ? 20.378  2.889   -9.553  1.00 0.00 ? 14 ASN A CG   2  
ATOM 1619  O OD1  . ASN A 1 14 ? 20.522  1.900   -8.853  1.00 0.00 ? 14 ASN A OD1  2  
ATOM 1620  N ND2  . ASN A 1 14 ? 21.368  3.484   -10.212 1.00 0.00 ? 14 ASN A ND2  2  
ATOM 1621  H H    . ASN A 1 14 ? 16.018  3.139   -10.311 1.00 0.00 ? 14 ASN A H    2  
ATOM 1622  H HA   . ASN A 1 14 ? 18.254  1.522   -9.756  1.00 0.00 ? 14 ASN A HA   2  
ATOM 1623  H HB2  . ASN A 1 14 ? 18.968  4.019   -10.731 1.00 0.00 ? 14 ASN A HB2  2  
ATOM 1624  H HB3  . ASN A 1 14 ? 18.886  4.350   -9.012  1.00 0.00 ? 14 ASN A HB3  2  
ATOM 1625  H HD21 . ASN A 1 14 ? 21.182  4.292   -10.771 1.00 0.00 ? 14 ASN A HD21 2  
ATOM 1626  H HD22 . ASN A 1 14 ? 22.299  3.123   -10.150 1.00 0.00 ? 14 ASN A HD22 2  
ATOM 1627  N N    . GLY A 1 15 ? 16.600  3.870   -8.060  1.00 0.00 ? 15 GLY A N    2  
ATOM 1628  C CA   . GLY A 1 15 ? 15.946  4.185   -6.801  1.00 0.00 ? 15 GLY A CA   2  
ATOM 1629  C C    . GLY A 1 15 ? 14.616  3.440   -6.672  1.00 0.00 ? 15 GLY A C    2  
ATOM 1630  O O    . GLY A 1 15 ? 14.003  3.078   -7.676  1.00 0.00 ? 15 GLY A O    2  
ATOM 1631  H H    . GLY A 1 15 ? 16.520  4.574   -8.766  1.00 0.00 ? 15 GLY A H    2  
ATOM 1632  H HA2  . GLY A 1 15 ? 16.599  3.917   -5.971  1.00 0.00 ? 15 GLY A HA2  2  
ATOM 1633  H HA3  . GLY A 1 15 ? 15.773  5.260   -6.736  1.00 0.00 ? 15 GLY A HA3  2  
ATOM 1634  N N    . LYS A 1 16 ? 14.209  3.233   -5.429  1.00 0.00 ? 16 LYS A N    2  
ATOM 1635  C CA   . LYS A 1 16 ? 12.962  2.537   -5.156  1.00 0.00 ? 16 LYS A CA   2  
ATOM 1636  C C    . LYS A 1 16 ? 11.900  3.552   -4.728  1.00 0.00 ? 16 LYS A C    2  
ATOM 1637  O O    . LYS A 1 16 ? 12.229  4.626   -4.227  1.00 0.00 ? 16 LYS A O    2  
ATOM 1638  C CB   . LYS A 1 16 ? 13.186  1.416   -4.139  1.00 0.00 ? 16 LYS A CB   2  
ATOM 1639  C CG   . LYS A 1 16 ? 13.503  1.987   -2.755  1.00 0.00 ? 16 LYS A CG   2  
ATOM 1640  C CD   . LYS A 1 16 ? 14.992  2.312   -2.623  1.00 0.00 ? 16 LYS A CD   2  
ATOM 1641  C CE   . LYS A 1 16 ? 15.588  1.659   -1.375  1.00 0.00 ? 16 LYS A CE   2  
ATOM 1642  N NZ   . LYS A 1 16 ? 16.957  2.163   -1.130  1.00 0.00 ? 16 LYS A NZ   2  
ATOM 1643  H H    . LYS A 1 16 ? 14.713  3.531   -4.618  1.00 0.00 ? 16 LYS A H    2  
ATOM 1644  H HA   . LYS A 1 16 ? 12.639  2.069   -6.085  1.00 0.00 ? 16 LYS A HA   2  
ATOM 1645  H HB2  . LYS A 1 16 ? 12.297  0.788   -4.083  1.00 0.00 ? 16 LYS A HB2  2  
ATOM 1646  H HB3  . LYS A 1 16 ? 14.006  0.779   -4.470  1.00 0.00 ? 16 LYS A HB3  2  
ATOM 1647  H HG2  . LYS A 1 16 ? 12.913  2.888   -2.586  1.00 0.00 ? 16 LYS A HG2  2  
ATOM 1648  H HG3  . LYS A 1 16 ? 13.215  1.269   -1.987  1.00 0.00 ? 16 LYS A HG3  2  
ATOM 1649  H HD2  . LYS A 1 16 ? 15.523  1.964   -3.509  1.00 0.00 ? 16 LYS A HD2  2  
ATOM 1650  H HD3  . LYS A 1 16 ? 15.129  3.392   -2.573  1.00 0.00 ? 16 LYS A HD3  2  
ATOM 1651  H HE2  . LYS A 1 16 ? 14.957  1.869   -0.511  1.00 0.00 ? 16 LYS A HE2  2  
ATOM 1652  H HE3  . LYS A 1 16 ? 15.609  0.576   -1.498  1.00 0.00 ? 16 LYS A HE3  2  
ATOM 1653  H HZ1  . LYS A 1 16 ? 16.939  3.161   -1.062  1.00 0.00 ? 16 LYS A HZ1  2  
ATOM 1654  H HZ2  . LYS A 1 16 ? 17.306  1.778   -0.275  1.00 0.00 ? 16 LYS A HZ2  2  
ATOM 1655  H HZ3  . LYS A 1 16 ? 17.553  1.891   -1.885  1.00 0.00 ? 16 LYS A HZ3  2  
ATOM 1656  N N    . SER A 1 17 ? 10.648  3.176   -4.942  1.00 0.00 ? 17 SER A N    2  
ATOM 1657  C CA   . SER A 1 17 ? 9.535   4.040   -4.585  1.00 0.00 ? 17 SER A CA   2  
ATOM 1658  C C    . SER A 1 17 ? 8.750   3.428   -3.424  1.00 0.00 ? 17 SER A C    2  
ATOM 1659  O O    . SER A 1 17 ? 9.072   2.336   -2.959  1.00 0.00 ? 17 SER A O    2  
ATOM 1660  C CB   . SER A 1 17 ? 8.614   4.274   -5.784  1.00 0.00 ? 17 SER A CB   2  
ATOM 1661  O OG   . SER A 1 17 ? 7.804   5.435   -5.616  1.00 0.00 ? 17 SER A OG   2  
ATOM 1662  H H    . SER A 1 17 ? 10.389  2.300   -5.350  1.00 0.00 ? 17 SER A H    2  
ATOM 1663  H HA   . SER A 1 17 ? 9.988   4.984   -4.286  1.00 0.00 ? 17 SER A HA   2  
ATOM 1664  H HB2  . SER A 1 17 ? 9.214   4.379   -6.688  1.00 0.00 ? 17 SER A HB2  2  
ATOM 1665  H HB3  . SER A 1 17 ? 7.974   3.403   -5.926  1.00 0.00 ? 17 SER A HB3  2  
ATOM 1666  H HG   . SER A 1 17 ? 6.837   5.192   -5.696  1.00 0.00 ? 17 SER A HG   2  
ATOM 1667  N N    . GLU A 1 18 ? 7.735   4.159   -2.988  1.00 0.00 ? 18 GLU A N    2  
ATOM 1668  C CA   . GLU A 1 18 ? 6.901   3.703   -1.889  1.00 0.00 ? 18 GLU A CA   2  
ATOM 1669  C C    . GLU A 1 18 ? 6.312   2.327   -2.206  1.00 0.00 ? 18 GLU A C    2  
ATOM 1670  O O    . GLU A 1 18 ? 6.533   1.368   -1.469  1.00 0.00 ? 18 GLU A O    2  
ATOM 1671  C CB   . GLU A 1 18 ? 5.795   4.715   -1.583  1.00 0.00 ? 18 GLU A CB   2  
ATOM 1672  C CG   . GLU A 1 18 ? 5.713   4.999   -0.081  1.00 0.00 ? 18 GLU A CG   2  
ATOM 1673  C CD   . GLU A 1 18 ? 6.975   5.709   0.412   1.00 0.00 ? 18 GLU A CD   2  
ATOM 1674  O OE1  . GLU A 1 18 ? 6.999   6.955   0.318   1.00 0.00 ? 18 GLU A OE1  2  
ATOM 1675  O OE2  . GLU A 1 18 ? 7.887   4.989   0.873   1.00 0.00 ? 18 GLU A OE2  2  
ATOM 1676  H H    . GLU A 1 18 ? 7.479   5.047   -3.371  1.00 0.00 ? 18 GLU A H    2  
ATOM 1677  H HA   . GLU A 1 18 ? 7.567   3.631   -1.030  1.00 0.00 ? 18 GLU A HA   2  
ATOM 1678  H HB2  . GLU A 1 18 ? 5.986   5.642   -2.122  1.00 0.00 ? 18 GLU A HB2  2  
ATOM 1679  H HB3  . GLU A 1 18 ? 4.838   4.332   -1.937  1.00 0.00 ? 18 GLU A HB3  2  
ATOM 1680  H HG2  . GLU A 1 18 ? 4.839   5.616   0.128   1.00 0.00 ? 18 GLU A HG2  2  
ATOM 1681  H HG3  . GLU A 1 18 ? 5.581   4.064   0.463   1.00 0.00 ? 18 GLU A HG3  2  
ATOM 1682  N N    . VAL A 1 19 ? 5.572   2.274   -3.305  1.00 0.00 ? 19 VAL A N    2  
ATOM 1683  C CA   . VAL A 1 19 ? 4.950   1.031   -3.729  1.00 0.00 ? 19 VAL A CA   2  
ATOM 1684  C C    . VAL A 1 19 ? 5.948   -0.117  -3.563  1.00 0.00 ? 19 VAL A C    2  
ATOM 1685  O O    . VAL A 1 19 ? 5.640   -1.126  -2.930  1.00 0.00 ? 19 VAL A O    2  
ATOM 1686  C CB   . VAL A 1 19 ? 4.429   1.168   -5.161  1.00 0.00 ? 19 VAL A CB   2  
ATOM 1687  C CG1  . VAL A 1 19 ? 3.332   2.231   -5.245  1.00 0.00 ? 19 VAL A CG1  2  
ATOM 1688  C CG2  . VAL A 1 19 ? 5.570   1.479   -6.131  1.00 0.00 ? 19 VAL A CG2  2  
ATOM 1689  H H    . VAL A 1 19 ? 5.397   3.058   -3.899  1.00 0.00 ? 19 VAL A H    2  
ATOM 1690  H HA   . VAL A 1 19 ? 4.097   0.851   -3.075  1.00 0.00 ? 19 VAL A HA   2  
ATOM 1691  H HB   . VAL A 1 19 ? 3.993   0.213   -5.451  1.00 0.00 ? 19 VAL A HB   2  
ATOM 1692  H HG11 . VAL A 1 19 ? 2.859   2.188   -6.226  1.00 0.00 ? 19 VAL A HG11 2  
ATOM 1693  H HG12 . VAL A 1 19 ? 2.585   2.045   -4.474  1.00 0.00 ? 19 VAL A HG12 2  
ATOM 1694  H HG13 . VAL A 1 19 ? 3.770   3.218   -5.096  1.00 0.00 ? 19 VAL A HG13 2  
ATOM 1695  H HG21 . VAL A 1 19 ? 6.193   2.272   -5.718  1.00 0.00 ? 19 VAL A HG21 2  
ATOM 1696  H HG22 . VAL A 1 19 ? 6.173   0.584   -6.282  1.00 0.00 ? 19 VAL A HG22 2  
ATOM 1697  H HG23 . VAL A 1 19 ? 5.156   1.803   -7.086  1.00 0.00 ? 19 VAL A HG23 2  
ATOM 1698  N N    . CYS A 1 20 ? 7.124   0.076   -4.143  1.00 0.00 ? 20 CYS A N    2  
ATOM 1699  C CA   . CYS A 1 20 ? 8.169   -0.931  -4.067  1.00 0.00 ? 20 CYS A CA   2  
ATOM 1700  C C    . CYS A 1 20 ? 8.493   -1.178  -2.592  1.00 0.00 ? 20 CYS A C    2  
ATOM 1701  O O    . CYS A 1 20 ? 8.340   -2.294  -2.098  1.00 0.00 ? 20 CYS A O    2  
ATOM 1702  C CB   . CYS A 1 20 ? 9.410   -0.519  -4.862  1.00 0.00 ? 20 CYS A CB   2  
ATOM 1703  S SG   . CYS A 1 20 ? 9.422   -1.364  -6.486  1.00 0.00 ? 20 CYS A SG   2  
ATOM 1704  H H    . CYS A 1 20 ? 7.367   0.899   -4.655  1.00 0.00 ? 20 CYS A H    2  
ATOM 1705  H HA   . CYS A 1 20 ? 7.770   -1.832  -4.532  1.00 0.00 ? 20 CYS A HA   2  
ATOM 1706  H HB2  . CYS A 1 20 ? 9.418   0.562   -5.005  1.00 0.00 ? 20 CYS A HB2  2  
ATOM 1707  H HB3  . CYS A 1 20 ? 10.311  -0.773  -4.304  1.00 0.00 ? 20 CYS A HB3  2  
ATOM 1708  H HG   . CYS A 1 20 ? 9.054   -2.556  -6.025  1.00 0.00 ? 20 CYS A HG   2  
ATOM 1709  N N    . ILE A 1 21 ? 8.933   -0.118  -1.931  1.00 0.00 ? 21 ILE A N    2  
ATOM 1710  C CA   . ILE A 1 21 ? 9.280   -0.206  -0.522  1.00 0.00 ? 21 ILE A CA   2  
ATOM 1711  C C    . ILE A 1 21 ? 8.240   -1.065  0.202   1.00 0.00 ? 21 ILE A C    2  
ATOM 1712  O O    . ILE A 1 21 ? 8.570   -2.119  0.743   1.00 0.00 ? 21 ILE A O    2  
ATOM 1713  C CB   . ILE A 1 21 ? 9.447   1.192   0.077   1.00 0.00 ? 21 ILE A CB   2  
ATOM 1714  C CG1  . ILE A 1 21 ? 10.687  1.887   -0.490  1.00 0.00 ? 21 ILE A CG1  2  
ATOM 1715  C CG2  . ILE A 1 21 ? 9.470   1.135   1.605   1.00 0.00 ? 21 ILE A CG2  2  
ATOM 1716  C CD1  . ILE A 1 21 ? 10.566  3.407   -0.371  1.00 0.00 ? 21 ILE A CD1  2  
ATOM 1717  H H    . ILE A 1 21 ? 9.054   0.786   -2.340  1.00 0.00 ? 21 ILE A H    2  
ATOM 1718  H HA   . ILE A 1 21 ? 10.247  -0.703  -0.454  1.00 0.00 ? 21 ILE A HA   2  
ATOM 1719  H HB   . ILE A 1 21 ? 8.583   1.792   -0.210  1.00 0.00 ? 21 ILE A HB   2  
ATOM 1720  H HG12 . ILE A 1 21 ? 11.574  1.545   0.043   1.00 0.00 ? 21 ILE A HG12 2  
ATOM 1721  H HG13 . ILE A 1 21 ? 10.817  1.609   -1.536  1.00 0.00 ? 21 ILE A HG13 2  
ATOM 1722  H HG21 . ILE A 1 21 ? 9.419   0.095   1.931   1.00 0.00 ? 21 ILE A HG21 2  
ATOM 1723  H HG22 . ILE A 1 21 ? 10.392  1.585   1.972   1.00 0.00 ? 21 ILE A HG22 2  
ATOM 1724  H HG23 . ILE A 1 21 ? 8.615   1.682   2.003   1.00 0.00 ? 21 ILE A HG23 2  
ATOM 1725  H HD11 . ILE A 1 21 ? 10.618  3.855   -1.363  1.00 0.00 ? 21 ILE A HD11 2  
ATOM 1726  H HD12 . ILE A 1 21 ? 9.613   3.661   0.093   1.00 0.00 ? 21 ILE A HD12 2  
ATOM 1727  H HD13 . ILE A 1 21 ? 11.382  3.789   0.243   1.00 0.00 ? 21 ILE A HD13 2  
ATOM 1728  N N    . LEU A 1 22 ? 7.007   -0.581  0.188   1.00 0.00 ? 22 LEU A N    2  
ATOM 1729  C CA   . LEU A 1 22 ? 5.918   -1.291  0.836   1.00 0.00 ? 22 LEU A CA   2  
ATOM 1730  C C    . LEU A 1 22 ? 6.068   -2.792  0.578   1.00 0.00 ? 22 LEU A C    2  
ATOM 1731  O O    . LEU A 1 22 ? 6.140   -3.583  1.517   1.00 0.00 ? 22 LEU A O    2  
ATOM 1732  C CB   . LEU A 1 22 ? 4.568   -0.723  0.392   1.00 0.00 ? 22 LEU A CB   2  
ATOM 1733  C CG   . LEU A 1 22 ? 3.329   -1.454  0.913   1.00 0.00 ? 22 LEU A CG   2  
ATOM 1734  C CD1  . LEU A 1 22 ? 2.934   -2.598  -0.023  1.00 0.00 ? 22 LEU A CD1  2  
ATOM 1735  C CD2  . LEU A 1 22 ? 3.539   -1.934  2.350   1.00 0.00 ? 22 LEU A CD2  2  
ATOM 1736  H H    . LEU A 1 22 ? 6.747   0.277   -0.255  1.00 0.00 ? 22 LEU A H    2  
ATOM 1737  H HA   . LEU A 1 22 ? 6.005   -1.115  1.908   1.00 0.00 ? 22 LEU A HA   2  
ATOM 1738  H HB2  . LEU A 1 22 ? 4.512   0.318   0.710   1.00 0.00 ? 22 LEU A HB2  2  
ATOM 1739  H HB3  . LEU A 1 22 ? 4.536   -0.726  -0.698  1.00 0.00 ? 22 LEU A HB3  2  
ATOM 1740  H HG   . LEU A 1 22 ? 2.497   -0.749  0.927   1.00 0.00 ? 22 LEU A HG   2  
ATOM 1741  H HD11 . LEU A 1 22 ? 2.004   -2.347  -0.533  1.00 0.00 ? 22 LEU A HD11 2  
ATOM 1742  H HD12 . LEU A 1 22 ? 3.722   -2.754  -0.759  1.00 0.00 ? 22 LEU A HD12 2  
ATOM 1743  H HD13 . LEU A 1 22 ? 2.794   -3.510  0.558   1.00 0.00 ? 22 LEU A HD13 2  
ATOM 1744  H HD21 . LEU A 1 22 ? 3.509   -1.080  3.027   1.00 0.00 ? 22 LEU A HD21 2  
ATOM 1745  H HD22 . LEU A 1 22 ? 2.750   -2.637  2.617   1.00 0.00 ? 22 LEU A HD22 2  
ATOM 1746  H HD23 . LEU A 1 22 ? 4.508   -2.427  2.430   1.00 0.00 ? 22 LEU A HD23 2  
ATOM 1747  N N    . HIS A 1 23 ? 6.110   -3.139  -0.700  1.00 0.00 ? 23 HIS A N    2  
ATOM 1748  C CA   . HIS A 1 23 ? 6.250   -4.531  -1.094  1.00 0.00 ? 23 HIS A CA   2  
ATOM 1749  C C    . HIS A 1 23 ? 7.481   -5.134  -0.416  1.00 0.00 ? 23 HIS A C    2  
ATOM 1750  O O    . HIS A 1 23 ? 7.387   -6.165  0.248   1.00 0.00 ? 23 HIS A O    2  
ATOM 1751  C CB   . HIS A 1 23 ? 6.287   -4.663  -2.617  1.00 0.00 ? 23 HIS A CB   2  
ATOM 1752  C CG   . HIS A 1 23 ? 6.022   -6.063  -3.119  1.00 0.00 ? 23 HIS A CG   2  
ATOM 1753  N ND1  . HIS A 1 23 ? 5.459   -6.322  -4.356  1.00 0.00 ? 23 HIS A ND1  2  
ATOM 1754  C CD2  . HIS A 1 23 ? 6.250   -7.276  -2.538  1.00 0.00 ? 23 HIS A CD2  2  
ATOM 1755  C CE1  . HIS A 1 23 ? 5.357   -7.635  -4.502  1.00 0.00 ? 23 HIS A CE1  2  
ATOM 1756  N NE2  . HIS A 1 23 ? 5.847   -8.224  -3.374  1.00 0.00 ? 23 HIS A NE2  2  
ATOM 1757  H H    . HIS A 1 23 ? 6.050   -2.489  -1.458  1.00 0.00 ? 23 HIS A H    2  
ATOM 1758  H HA   . HIS A 1 23 ? 5.359   -5.048  -0.737  1.00 0.00 ? 23 HIS A HA   2  
ATOM 1759  H HB2  . HIS A 1 23 ? 5.548   -3.988  -3.049  1.00 0.00 ? 23 HIS A HB2  2  
ATOM 1760  H HB3  . HIS A 1 23 ? 7.263   -4.338  -2.977  1.00 0.00 ? 23 HIS A HB3  2  
ATOM 1761  H HD1  . HIS A 1 23 ? 5.177   -5.635  -5.026  1.00 0.00 ? 23 HIS A HD1  2  
ATOM 1762  H HD2  . HIS A 1 23 ? 6.689   -7.438  -1.553  1.00 0.00 ? 23 HIS A HD2  2  
ATOM 1763  H HE1  . HIS A 1 23 ? 4.952   -8.153  -5.371  1.00 0.00 ? 23 HIS A HE1  2  
ATOM 1764  N N    . GLU A 1 24 ? 8.609   -4.465  -0.606  1.00 0.00 ? 24 GLU A N    2  
ATOM 1765  C CA   . GLU A 1 24 ? 9.858   -4.923  -0.022  1.00 0.00 ? 24 GLU A CA   2  
ATOM 1766  C C    . GLU A 1 24 ? 9.651   -5.299  1.447   1.00 0.00 ? 24 GLU A C    2  
ATOM 1767  O O    . GLU A 1 24 ? 9.694   -6.475  1.802   1.00 0.00 ? 24 GLU A O    2  
ATOM 1768  C CB   . GLU A 1 24 ? 10.952  -3.863  -0.167  1.00 0.00 ? 24 GLU A CB   2  
ATOM 1769  C CG   . GLU A 1 24 ? 12.258  -4.487  -0.663  1.00 0.00 ? 24 GLU A CG   2  
ATOM 1770  C CD   . GLU A 1 24 ? 13.467  -3.851  0.027   1.00 0.00 ? 24 GLU A CD   2  
ATOM 1771  O OE1  . GLU A 1 24 ? 13.327  -3.518  1.223   1.00 0.00 ? 24 GLU A OE1  2  
ATOM 1772  O OE2  . GLU A 1 24 ? 14.503  -3.712  -0.658  1.00 0.00 ? 24 GLU A OE2  2  
ATOM 1773  H H    . GLU A 1 24 ? 8.678   -3.627  -1.148  1.00 0.00 ? 24 GLU A H    2  
ATOM 1774  H HA   . GLU A 1 24 ? 10.139  -5.807  -0.594  1.00 0.00 ? 24 GLU A HA   2  
ATOM 1775  H HB2  . GLU A 1 24 ? 10.626  -3.091  -0.864  1.00 0.00 ? 24 GLU A HB2  2  
ATOM 1776  H HB3  . GLU A 1 24 ? 11.120  -3.374  0.793   1.00 0.00 ? 24 GLU A HB3  2  
ATOM 1777  H HG2  . GLU A 1 24 ? 12.248  -5.560  -0.471  1.00 0.00 ? 24 GLU A HG2  2  
ATOM 1778  H HG3  . GLU A 1 24 ? 12.341  -4.357  -1.742  1.00 0.00 ? 24 GLU A HG3  2  
ATOM 1779  N N    . TYR A 1 25 ? 9.430   -4.277  2.261   1.00 0.00 ? 25 TYR A N    2  
ATOM 1780  C CA   . TYR A 1 25 ? 9.216   -4.485  3.683   1.00 0.00 ? 25 TYR A CA   2  
ATOM 1781  C C    . TYR A 1 25 ? 8.173   -5.578  3.926   1.00 0.00 ? 25 TYR A C    2  
ATOM 1782  O O    . TYR A 1 25 ? 8.318   -6.387  4.841   1.00 0.00 ? 25 TYR A O    2  
ATOM 1783  C CB   . TYR A 1 25 ? 8.683   -3.158  4.228   1.00 0.00 ? 25 TYR A CB   2  
ATOM 1784  C CG   . TYR A 1 25 ? 8.017   -3.272  5.600   1.00 0.00 ? 25 TYR A CG   2  
ATOM 1785  C CD1  . TYR A 1 25 ? 6.791   -3.894  5.723   1.00 0.00 ? 25 TYR A CD1  2  
ATOM 1786  C CD2  . TYR A 1 25 ? 8.642   -2.753  6.716   1.00 0.00 ? 25 TYR A CD2  2  
ATOM 1787  C CE1  . TYR A 1 25 ? 6.164   -4.001  7.015   1.00 0.00 ? 25 TYR A CE1  2  
ATOM 1788  C CE2  . TYR A 1 25 ? 8.015   -2.860  8.008   1.00 0.00 ? 25 TYR A CE2  2  
ATOM 1789  C CZ   . TYR A 1 25 ? 6.807   -3.479  8.094   1.00 0.00 ? 25 TYR A CZ   2  
ATOM 1790  O OH   . TYR A 1 25 ? 6.215   -3.580  9.314   1.00 0.00 ? 25 TYR A OH   2  
ATOM 1791  H H    . TYR A 1 25 ? 9.397   -3.322  1.964   1.00 0.00 ? 25 TYR A H    2  
ATOM 1792  H HA   . TYR A 1 25 ? 10.163  -4.793  4.124   1.00 0.00 ? 25 TYR A HA   2  
ATOM 1793  H HB2  . TYR A 1 25 ? 9.507   -2.447  4.293   1.00 0.00 ? 25 TYR A HB2  2  
ATOM 1794  H HB3  . TYR A 1 25 ? 7.963   -2.749  3.519   1.00 0.00 ? 25 TYR A HB3  2  
ATOM 1795  H HD1  . TYR A 1 25 ? 6.297   -4.303  4.842   1.00 0.00 ? 25 TYR A HD1  2  
ATOM 1796  H HD2  . TYR A 1 25 ? 9.611   -2.262  6.619   1.00 0.00 ? 25 TYR A HD2  2  
ATOM 1797  H HE1  . TYR A 1 25 ? 5.196   -4.489  7.126   1.00 0.00 ? 25 TYR A HE1  2  
ATOM 1798  H HE2  . TYR A 1 25 ? 8.498   -2.455  8.897   1.00 0.00 ? 25 TYR A HE2  2  
ATOM 1799  H HH   . TYR A 1 25 ? 5.233   -3.733  9.205   1.00 0.00 ? 25 TYR A HH   2  
ATOM 1800  N N    . MET A 1 26 ? 7.145   -5.567  3.089   1.00 0.00 ? 26 MET A N    2  
ATOM 1801  C CA   . MET A 1 26 ? 6.078   -6.547  3.202   1.00 0.00 ? 26 MET A CA   2  
ATOM 1802  C C    . MET A 1 26 ? 6.609   -7.963  2.970   1.00 0.00 ? 26 MET A C    2  
ATOM 1803  O O    . MET A 1 26 ? 6.457   -8.834  3.826   1.00 0.00 ? 26 MET A O    2  
ATOM 1804  C CB   . MET A 1 26 ? 4.988   -6.236  2.174   1.00 0.00 ? 26 MET A CB   2  
ATOM 1805  C CG   . MET A 1 26 ? 3.861   -5.415  2.803   1.00 0.00 ? 26 MET A CG   2  
ATOM 1806  S SD   . MET A 1 26 ? 2.282   -5.968  2.180   1.00 0.00 ? 26 MET A SD   2  
ATOM 1807  C CE   . MET A 1 26 ? 2.396   -7.710  2.550   1.00 0.00 ? 26 MET A CE   2  
ATOM 1808  H H    . MET A 1 26 ? 7.035   -4.905  2.347   1.00 0.00 ? 26 MET A H    2  
ATOM 1809  H HA   . MET A 1 26 ? 5.702   -6.454  4.221   1.00 0.00 ? 26 MET A HA   2  
ATOM 1810  H HB2  . MET A 1 26 ? 5.419   -5.687  1.337   1.00 0.00 ? 26 MET A HB2  2  
ATOM 1811  H HB3  . MET A 1 26 ? 4.586   -7.166  1.773   1.00 0.00 ? 26 MET A HB3  2  
ATOM 1812  H HG2  . MET A 1 26 ? 3.888   -5.515  3.888   1.00 0.00 ? 26 MET A HG2  2  
ATOM 1813  H HG3  . MET A 1 26 ? 4.000   -4.357  2.577   1.00 0.00 ? 26 MET A HG3  2  
ATOM 1814  H HE1  . MET A 1 26 ? 3.309   -7.903  3.114   1.00 0.00 ? 26 MET A HE1  2  
ATOM 1815  H HE2  . MET A 1 26 ? 1.533   -8.013  3.143   1.00 0.00 ? 26 MET A HE2  2  
ATOM 1816  H HE3  . MET A 1 26 ? 2.416   -8.279  1.621   1.00 0.00 ? 26 MET A HE3  2  
ATOM 1817  N N    . GLN A 1 27 ? 7.219   -8.150  1.810   1.00 0.00 ? 27 GLN A N    2  
ATOM 1818  C CA   . GLN A 1 27 ? 7.773   -9.446  1.455   1.00 0.00 ? 27 GLN A CA   2  
ATOM 1819  C C    . GLN A 1 27 ? 9.036   -9.725  2.272   1.00 0.00 ? 27 GLN A C    2  
ATOM 1820  O O    . GLN A 1 27 ? 9.589   -10.822 2.212   1.00 0.00 ? 27 GLN A O    2  
ATOM 1821  C CB   . GLN A 1 27 ? 8.061   -9.527  -0.045  1.00 0.00 ? 27 GLN A CB   2  
ATOM 1822  C CG   . GLN A 1 27 ? 9.192   -10.517 -0.334  1.00 0.00 ? 27 GLN A CG   2  
ATOM 1823  C CD   . GLN A 1 27 ? 9.438   -10.644 -1.839  1.00 0.00 ? 27 GLN A CD   2  
ATOM 1824  O OE1  . GLN A 1 27 ? 9.623   -9.670  -2.548  1.00 0.00 ? 27 GLN A OE1  2  
ATOM 1825  N NE2  . GLN A 1 27 ? 9.430   -11.898 -2.284  1.00 0.00 ? 27 GLN A NE2  2  
ATOM 1826  H H    . GLN A 1 27 ? 7.338   -7.436  1.119   1.00 0.00 ? 27 GLN A H    2  
ATOM 1827  H HA   . GLN A 1 27 ? 7.000   -10.171 1.710   1.00 0.00 ? 27 GLN A HA   2  
ATOM 1828  H HB2  . GLN A 1 27 ? 7.160   -9.833  -0.576  1.00 0.00 ? 27 GLN A HB2  2  
ATOM 1829  H HB3  . GLN A 1 27 ? 8.332   -8.540  -0.421  1.00 0.00 ? 27 GLN A HB3  2  
ATOM 1830  H HG2  . GLN A 1 27 ? 10.105  -10.186 0.161   1.00 0.00 ? 27 GLN A HG2  2  
ATOM 1831  H HG3  . GLN A 1 27 ? 8.940   -11.493 0.081   1.00 0.00 ? 27 GLN A HG3  2  
ATOM 1832  H HE21 . GLN A 1 27 ? 9.272   -12.653 -1.648  1.00 0.00 ? 27 GLN A HE21 2  
ATOM 1833  H HE22 . GLN A 1 27 ? 9.582   -12.085 -3.254  1.00 0.00 ? 27 GLN A HE22 2  
ATOM 1834  N N    . ARG A 1 28 ? 9.457   -8.713  3.017   1.00 0.00 ? 28 ARG A N    2  
ATOM 1835  C CA   . ARG A 1 28 ? 10.644  -8.835  3.845   1.00 0.00 ? 28 ARG A CA   2  
ATOM 1836  C C    . ARG A 1 28 ? 10.256  -9.198  5.279   1.00 0.00 ? 28 ARG A C    2  
ATOM 1837  O O    . ARG A 1 28 ? 10.878  -10.063 5.895   1.00 0.00 ? 28 ARG A O    2  
ATOM 1838  C CB   . ARG A 1 28 ? 11.446  -7.532  3.855   1.00 0.00 ? 28 ARG A CB   2  
ATOM 1839  C CG   . ARG A 1 28 ? 12.475  -7.530  4.986   1.00 0.00 ? 28 ARG A CG   2  
ATOM 1840  C CD   . ARG A 1 28 ? 13.781  -6.869  4.539   1.00 0.00 ? 28 ARG A CD   2  
ATOM 1841  N NE   . ARG A 1 28 ? 13.824  -5.466  5.008   1.00 0.00 ? 28 ARG A NE   2  
ATOM 1842  C CZ   . ARG A 1 28 ? 14.944  -4.736  5.092   1.00 0.00 ? 28 ARG A CZ   2  
ATOM 1843  N NH1  . ARG A 1 28 ? 16.121  -5.272  4.740   1.00 0.00 ? 28 ARG A NH1  2  
ATOM 1844  N NH2  . ARG A 1 28 ? 14.889  -3.471  5.529   1.00 0.00 ? 28 ARG A NH2  2  
ATOM 1845  H H    . ARG A 1 28 ? 9.001   -7.823  3.060   1.00 0.00 ? 28 ARG A H    2  
ATOM 1846  H HA   . ARG A 1 28 ? 11.225  -9.633  3.382   1.00 0.00 ? 28 ARG A HA   2  
ATOM 1847  H HB2  . ARG A 1 28 ? 11.952  -7.405  2.898   1.00 0.00 ? 28 ARG A HB2  2  
ATOM 1848  H HB3  . ARG A 1 28 ? 10.769  -6.686  3.972   1.00 0.00 ? 28 ARG A HB3  2  
ATOM 1849  H HG2  . ARG A 1 28 ? 12.072  -7.000  5.849   1.00 0.00 ? 28 ARG A HG2  2  
ATOM 1850  H HG3  . ARG A 1 28 ? 12.673  -8.554  5.305   1.00 0.00 ? 28 ARG A HG3  2  
ATOM 1851  H HD2  . ARG A 1 28 ? 14.632  -7.420  4.937   1.00 0.00 ? 28 ARG A HD2  2  
ATOM 1852  H HD3  . ARG A 1 28 ? 13.860  -6.901  3.452   1.00 0.00 ? 28 ARG A HD3  2  
ATOM 1853  H HE   . ARG A 1 28 ? 12.963  -5.035  5.278   1.00 0.00 ? 28 ARG A HE   2  
ATOM 1854  H HH11 . ARG A 1 28 ? 16.163  -6.217  4.415   1.00 0.00 ? 28 ARG A HH11 2  
ATOM 1855  H HH12 . ARG A 1 28 ? 16.957  -4.728  4.804   1.00 0.00 ? 28 ARG A HH12 2  
ATOM 1856  H HH21 . ARG A 1 28 ? 14.011  -3.071  5.792   1.00 0.00 ? 28 ARG A HH21 2  
ATOM 1857  H HH22 . ARG A 1 28 ? 15.725  -2.926  5.592   1.00 0.00 ? 28 ARG A HH22 2  
ATOM 1858  N N    . VAL A 1 29 ? 9.230   -8.520  5.770   1.00 0.00 ? 29 VAL A N    2  
ATOM 1859  C CA   . VAL A 1 29 ? 8.751   -8.760  7.121   1.00 0.00 ? 29 VAL A CA   2  
ATOM 1860  C C    . VAL A 1 29 ? 7.612   -9.781  7.080   1.00 0.00 ? 29 VAL A C    2  
ATOM 1861  O O    . VAL A 1 29 ? 7.739   -10.879 7.619   1.00 0.00 ? 29 VAL A O    2  
ATOM 1862  C CB   . VAL A 1 29 ? 8.346   -7.438  7.776   1.00 0.00 ? 29 VAL A CB   2  
ATOM 1863  C CG1  . VAL A 1 29 ? 7.806   -7.668  9.188   1.00 0.00 ? 29 VAL A CG1  2  
ATOM 1864  C CG2  . VAL A 1 29 ? 9.515   -6.451  7.790   1.00 0.00 ? 29 VAL A CG2  2  
ATOM 1865  H H    . VAL A 1 29 ? 8.729   -7.818  5.263   1.00 0.00 ? 29 VAL A H    2  
ATOM 1866  H HA   . VAL A 1 29 ? 9.579   -9.180  7.693   1.00 0.00 ? 29 VAL A HA   2  
ATOM 1867  H HB   . VAL A 1 29 ? 7.545   -7.000  7.179   1.00 0.00 ? 29 VAL A HB   2  
ATOM 1868  H HG11 . VAL A 1 29 ? 6.717   -7.716  9.158   1.00 0.00 ? 29 VAL A HG11 2  
ATOM 1869  H HG12 . VAL A 1 29 ? 8.199   -8.607  9.579   1.00 0.00 ? 29 VAL A HG12 2  
ATOM 1870  H HG13 . VAL A 1 29 ? 8.115   -6.847  9.834   1.00 0.00 ? 29 VAL A HG13 2  
ATOM 1871  H HG21 . VAL A 1 29 ? 9.515   -5.875  6.864   1.00 0.00 ? 29 VAL A HG21 2  
ATOM 1872  H HG22 . VAL A 1 29 ? 9.410   -5.776  8.639   1.00 0.00 ? 29 VAL A HG22 2  
ATOM 1873  H HG23 . VAL A 1 29 ? 10.453  -7.001  7.876   1.00 0.00 ? 29 VAL A HG23 2  
ATOM 1874  N N    . LEU A 1 30 ? 6.526   -9.382  6.436   1.00 0.00 ? 30 LEU A N    2  
ATOM 1875  C CA   . LEU A 1 30 ? 5.365   -10.249 6.317   1.00 0.00 ? 30 LEU A CA   2  
ATOM 1876  C C    . LEU A 1 30 ? 5.742   -11.491 5.507   1.00 0.00 ? 30 LEU A C    2  
ATOM 1877  O O    . LEU A 1 30 ? 5.367   -12.606 5.864   1.00 0.00 ? 30 LEU A O    2  
ATOM 1878  C CB   . LEU A 1 30 ? 4.177   -9.477  5.742   1.00 0.00 ? 30 LEU A CB   2  
ATOM 1879  C CG   . LEU A 1 30 ? 3.577   -8.398  6.645   1.00 0.00 ? 30 LEU A CG   2  
ATOM 1880  C CD1  . LEU A 1 30 ? 2.648   -7.474  5.854   1.00 0.00 ? 30 LEU A CD1  2  
ATOM 1881  C CD2  . LEU A 1 30 ? 2.872   -9.022  7.852   1.00 0.00 ? 30 LEU A CD2  2  
ATOM 1882  H H    . LEU A 1 30 ? 6.431   -8.487  6.000   1.00 0.00 ? 30 LEU A H    2  
ATOM 1883  H HA   . LEU A 1 30 ? 5.089   -10.563 7.323   1.00 0.00 ? 30 LEU A HA   2  
ATOM 1884  H HB2  . LEU A 1 30 ? 4.490   -9.008  4.809   1.00 0.00 ? 30 LEU A HB2  2  
ATOM 1885  H HB3  . LEU A 1 30 ? 3.392   -10.191 5.491   1.00 0.00 ? 30 LEU A HB3  2  
ATOM 1886  H HG   . LEU A 1 30 ? 4.390   -7.783  7.031   1.00 0.00 ? 30 LEU A HG   2  
ATOM 1887  H HD11 . LEU A 1 30 ? 2.099   -8.057  5.116   1.00 0.00 ? 30 LEU A HD11 2  
ATOM 1888  H HD12 . LEU A 1 30 ? 1.945   -6.995  6.536   1.00 0.00 ? 30 LEU A HD12 2  
ATOM 1889  H HD13 . LEU A 1 30 ? 3.240   -6.711  5.348   1.00 0.00 ? 30 LEU A HD13 2  
ATOM 1890  H HD21 . LEU A 1 30 ? 3.082   -8.429  8.742   1.00 0.00 ? 30 LEU A HD21 2  
ATOM 1891  H HD22 . LEU A 1 30 ? 1.797   -9.042  7.674   1.00 0.00 ? 30 LEU A HD22 2  
ATOM 1892  H HD23 . LEU A 1 30 ? 3.235   -10.039 7.998   1.00 0.00 ? 30 LEU A HD23 2  
ATOM 1893  N N    . LYS A 1 31 ? 6.480   -11.255 4.432   1.00 0.00 ? 31 LYS A N    2  
ATOM 1894  C CA   . LYS A 1 31 ? 6.911   -12.341 3.568   1.00 0.00 ? 31 LYS A CA   2  
ATOM 1895  C C    . LYS A 1 31 ? 5.734   -12.801 2.707   1.00 0.00 ? 31 LYS A C    2  
ATOM 1896  O O    . LYS A 1 31 ? 5.479   -13.999 2.586   1.00 0.00 ? 31 LYS A O    2  
ATOM 1897  C CB   . LYS A 1 31 ? 7.545   -13.463 4.394   1.00 0.00 ? 31 LYS A CB   2  
ATOM 1898  C CG   . LYS A 1 31 ? 8.541   -12.900 5.409   1.00 0.00 ? 31 LYS A CG   2  
ATOM 1899  C CD   . LYS A 1 31 ? 9.876   -13.646 5.339   1.00 0.00 ? 31 LYS A CD   2  
ATOM 1900  C CE   . LYS A 1 31 ? 10.913  -12.840 4.555   1.00 0.00 ? 31 LYS A CE   2  
ATOM 1901  N NZ   . LYS A 1 31 ? 11.055  -13.375 3.182   1.00 0.00 ? 31 LYS A NZ   2  
ATOM 1902  H H    . LYS A 1 31 ? 6.781   -10.345 4.148   1.00 0.00 ? 31 LYS A H    2  
ATOM 1903  H HA   . LYS A 1 31 ? 7.687   -11.947 2.911   1.00 0.00 ? 31 LYS A HA   2  
ATOM 1904  H HB2  . LYS A 1 31 ? 6.767   -14.021 4.913   1.00 0.00 ? 31 LYS A HB2  2  
ATOM 1905  H HB3  . LYS A 1 31 ? 8.052   -14.165 3.732   1.00 0.00 ? 31 LYS A HB3  2  
ATOM 1906  H HG2  . LYS A 1 31 ? 8.703   -11.840 5.217   1.00 0.00 ? 31 LYS A HG2  2  
ATOM 1907  H HG3  . LYS A 1 31 ? 8.127   -12.982 6.414   1.00 0.00 ? 31 LYS A HG3  2  
ATOM 1908  H HD2  . LYS A 1 31 ? 10.244  -13.836 6.347   1.00 0.00 ? 31 LYS A HD2  2  
ATOM 1909  H HD3  . LYS A 1 31 ? 9.729   -14.616 4.865   1.00 0.00 ? 31 LYS A HD3  2  
ATOM 1910  H HE2  . LYS A 1 31 ? 10.614  -11.793 4.515   1.00 0.00 ? 31 LYS A HE2  2  
ATOM 1911  H HE3  . LYS A 1 31 ? 11.875  -12.878 5.067   1.00 0.00 ? 31 LYS A HE3  2  
ATOM 1912  H HZ1  . LYS A 1 31 ? 10.718  -12.700 2.525   1.00 0.00 ? 31 LYS A HZ1  2  
ATOM 1913  H HZ2  . LYS A 1 31 ? 12.019  -13.567 2.997   1.00 0.00 ? 31 LYS A HZ2  2  
ATOM 1914  H HZ3  . LYS A 1 31 ? 10.524  -14.218 3.096   1.00 0.00 ? 31 LYS A HZ3  2  
ATOM 1915  N N    . VAL A 1 32 ? 5.046   -11.826 2.131   1.00 0.00 ? 32 VAL A N    2  
ATOM 1916  C CA   . VAL A 1 32 ? 3.901   -12.116 1.284   1.00 0.00 ? 32 VAL A CA   2  
ATOM 1917  C C    . VAL A 1 32 ? 3.767   -11.022 0.223   1.00 0.00 ? 32 VAL A C    2  
ATOM 1918  O O    . VAL A 1 32 ? 4.078   -9.860  0.482   1.00 0.00 ? 32 VAL A O    2  
ATOM 1919  C CB   . VAL A 1 32 ? 2.644   -12.275 2.141   1.00 0.00 ? 32 VAL A CB   2  
ATOM 1920  C CG1  . VAL A 1 32 ? 2.822   -13.390 3.174   1.00 0.00 ? 32 VAL A CG1  2  
ATOM 1921  C CG2  . VAL A 1 32 ? 2.271   -10.955 2.819   1.00 0.00 ? 32 VAL A CG2  2  
ATOM 1922  H H    . VAL A 1 32 ? 5.260   -10.855 2.234   1.00 0.00 ? 32 VAL A H    2  
ATOM 1923  H HA   . VAL A 1 32 ? 4.093   -13.066 0.786   1.00 0.00 ? 32 VAL A HA   2  
ATOM 1924  H HB   . VAL A 1 32 ? 1.823   -12.557 1.483   1.00 0.00 ? 32 VAL A HB   2  
ATOM 1925  H HG11 . VAL A 1 32 ? 3.281   -14.257 2.698   1.00 0.00 ? 32 VAL A HG11 2  
ATOM 1926  H HG12 . VAL A 1 32 ? 3.464   -13.038 3.982   1.00 0.00 ? 32 VAL A HG12 2  
ATOM 1927  H HG13 . VAL A 1 32 ? 1.849   -13.670 3.578   1.00 0.00 ? 32 VAL A HG13 2  
ATOM 1928  H HG21 . VAL A 1 32 ? 1.391   -10.534 2.333   1.00 0.00 ? 32 VAL A HG21 2  
ATOM 1929  H HG22 . VAL A 1 32 ? 2.054   -11.135 3.871   1.00 0.00 ? 32 VAL A HG22 2  
ATOM 1930  H HG23 . VAL A 1 32 ? 3.103   -10.256 2.734   1.00 0.00 ? 32 VAL A HG23 2  
ATOM 1931  N N    . ARG A 1 33 ? 3.303   -11.432 -0.948  1.00 0.00 ? 33 ARG A N    2  
ATOM 1932  C CA   . ARG A 1 33 ? 3.123   -10.501 -2.049  1.00 0.00 ? 33 ARG A CA   2  
ATOM 1933  C C    . ARG A 1 33 ? 1.766   -9.803  -1.939  1.00 0.00 ? 33 ARG A C    2  
ATOM 1934  O O    . ARG A 1 33 ? 0.723   -10.450 -2.025  1.00 0.00 ? 33 ARG A O    2  
ATOM 1935  C CB   . ARG A 1 33 ? 3.212   -11.219 -3.397  1.00 0.00 ? 33 ARG A CB   2  
ATOM 1936  C CG   . ARG A 1 33 ? 4.659   -11.290 -3.887  1.00 0.00 ? 33 ARG A CG   2  
ATOM 1937  C CD   . ARG A 1 33 ? 4.737   -11.086 -5.401  1.00 0.00 ? 33 ARG A CD   2  
ATOM 1938  N NE   . ARG A 1 33 ? 5.888   -10.220 -5.738  1.00 0.00 ? 33 ARG A NE   2  
ATOM 1939  C CZ   . ARG A 1 33 ? 6.072   -9.645  -6.934  1.00 0.00 ? 33 ARG A CZ   2  
ATOM 1940  N NH1  . ARG A 1 33 ? 5.180   -9.841  -7.915  1.00 0.00 ? 33 ARG A NH1  2  
ATOM 1941  N NH2  . ARG A 1 33 ? 7.147   -8.875  -7.149  1.00 0.00 ? 33 ARG A NH2  2  
ATOM 1942  H H    . ARG A 1 33 ? 3.052   -12.379 -1.150  1.00 0.00 ? 33 ARG A H    2  
ATOM 1943  H HA   . ARG A 1 33 ? 3.941   -9.787  -1.947  1.00 0.00 ? 33 ARG A HA   2  
ATOM 1944  H HB2  . ARG A 1 33 ? 2.806   -12.226 -3.304  1.00 0.00 ? 33 ARG A HB2  2  
ATOM 1945  H HB3  . ARG A 1 33 ? 2.600   -10.696 -4.133  1.00 0.00 ? 33 ARG A HB3  2  
ATOM 1946  H HG2  . ARG A 1 33 ? 5.255   -10.528 -3.383  1.00 0.00 ? 33 ARG A HG2  2  
ATOM 1947  H HG3  . ARG A 1 33 ? 5.089   -12.256 -3.624  1.00 0.00 ? 33 ARG A HG3  2  
ATOM 1948  H HD2  . ARG A 1 33 ? 4.837   -12.050 -5.901  1.00 0.00 ? 33 ARG A HD2  2  
ATOM 1949  H HD3  . ARG A 1 33 ? 3.813   -10.634 -5.763  1.00 0.00 ? 33 ARG A HD3  2  
ATOM 1950  H HE   . ARG A 1 33 ? 6.573   -10.054 -5.028  1.00 0.00 ? 33 ARG A HE   2  
ATOM 1951  H HH11 . ARG A 1 33 ? 4.378   -10.416 -7.755  1.00 0.00 ? 33 ARG A HH11 2  
ATOM 1952  H HH12 . ARG A 1 33 ? 5.317   -9.412  -8.808  1.00 0.00 ? 33 ARG A HH12 2  
ATOM 1953  H HH21 . ARG A 1 33 ? 7.812   -8.729  -6.417  1.00 0.00 ? 33 ARG A HH21 2  
ATOM 1954  H HH22 . ARG A 1 33 ? 7.284   -8.445  -8.042  1.00 0.00 ? 33 ARG A HH22 2  
ATOM 1955  N N    . PRO A 1 34 ? 1.825   -8.459  -1.744  1.00 0.00 ? 34 PRO A N    2  
ATOM 1956  C CA   . PRO A 1 34 ? 0.613   -7.667  -1.621  1.00 0.00 ? 34 PRO A CA   2  
ATOM 1957  C C    . PRO A 1 34 ? -0.057  -7.475  -2.983  1.00 0.00 ? 34 PRO A C    2  
ATOM 1958  O O    . PRO A 1 34 ? 0.581   -7.636  -4.022  1.00 0.00 ? 34 PRO A O    2  
ATOM 1959  C CB   . PRO A 1 34 ? 1.061   -6.358  -0.990  1.00 0.00 ? 34 PRO A CB   2  
ATOM 1960  C CG   . PRO A 1 34 ? 2.563   -6.282  -1.211  1.00 0.00 ? 34 PRO A CG   2  
ATOM 1961  C CD   . PRO A 1 34 ? 3.042   -7.660  -1.637  1.00 0.00 ? 34 PRO A CD   2  
ATOM 1962  H HA   . PRO A 1 34 ? -0.056  -8.143  -1.051  1.00 0.00 ? 34 PRO A HA   2  
ATOM 1963  H HB2  . PRO A 1 34 ? 0.555   -5.509  -1.451  1.00 0.00 ? 34 PRO A HB2  2  
ATOM 1964  H HB3  . PRO A 1 34 ? 0.821   -6.334  0.073   1.00 0.00 ? 34 PRO A HB3  2  
ATOM 1965  H HG2  . PRO A 1 34 ? 2.800   -5.542  -1.975  1.00 0.00 ? 34 PRO A HG2  2  
ATOM 1966  H HG3  . PRO A 1 34 ? 3.068   -5.968  -0.297  1.00 0.00 ? 34 PRO A HG3  2  
ATOM 1967  H HD2  . PRO A 1 34 ? 3.573   -7.618  -2.588  1.00 0.00 ? 34 PRO A HD2  2  
ATOM 1968  H HD3  . PRO A 1 34 ? 3.731   -8.083  -0.906  1.00 0.00 ? 34 PRO A HD3  2  
ATOM 1969  N N    . VAL A 1 35 ? -1.337  -7.134  -2.934  1.00 0.00 ? 35 VAL A N    2  
ATOM 1970  C CA   . VAL A 1 35 ? -2.101  -6.918  -4.151  1.00 0.00 ? 35 VAL A CA   2  
ATOM 1971  C C    . VAL A 1 35 ? -2.710  -5.515  -4.124  1.00 0.00 ? 35 VAL A C    2  
ATOM 1972  O O    . VAL A 1 35 ? -3.281  -5.102  -3.116  1.00 0.00 ? 35 VAL A O    2  
ATOM 1973  C CB   . VAL A 1 35 ? -3.149  -8.022  -4.312  1.00 0.00 ? 35 VAL A CB   2  
ATOM 1974  C CG1  . VAL A 1 35 ? -4.279  -7.573  -5.241  1.00 0.00 ? 35 VAL A CG1  2  
ATOM 1975  C CG2  . VAL A 1 35 ? -2.508  -9.317  -4.815  1.00 0.00 ? 35 VAL A CG2  2  
ATOM 1976  H H    . VAL A 1 35 ? -1.849  -7.004  -2.085  1.00 0.00 ? 35 VAL A H    2  
ATOM 1977  H HA   . VAL A 1 35 ? -1.409  -6.985  -4.990  1.00 0.00 ? 35 VAL A HA   2  
ATOM 1978  H HB   . VAL A 1 35 ? -3.581  -8.220  -3.331  1.00 0.00 ? 35 VAL A HB   2  
ATOM 1979  H HG11 . VAL A 1 35 ? -5.057  -8.335  -5.261  1.00 0.00 ? 35 VAL A HG11 2  
ATOM 1980  H HG12 . VAL A 1 35 ? -4.697  -6.635  -4.877  1.00 0.00 ? 35 VAL A HG12 2  
ATOM 1981  H HG13 . VAL A 1 35 ? -3.886  -7.429  -6.248  1.00 0.00 ? 35 VAL A HG13 2  
ATOM 1982  H HG21 . VAL A 1 35 ? -1.884  -9.742  -4.029  1.00 0.00 ? 35 VAL A HG21 2  
ATOM 1983  H HG22 . VAL A 1 35 ? -3.289  -10.028 -5.083  1.00 0.00 ? 35 VAL A HG22 2  
ATOM 1984  H HG23 . VAL A 1 35 ? -1.894  -9.103  -5.690  1.00 0.00 ? 35 VAL A HG23 2  
ATOM 1985  N N    . TYR A 1 36 ? -2.567  -4.821  -5.243  1.00 0.00 ? 36 TYR A N    2  
ATOM 1986  C CA   . TYR A 1 36 ? -3.096  -3.473  -5.361  1.00 0.00 ? 36 TYR A CA   2  
ATOM 1987  C C    . TYR A 1 36 ? -4.491  -3.484  -5.989  1.00 0.00 ? 36 TYR A C    2  
ATOM 1988  O O    . TYR A 1 36 ? -4.642  -3.793  -7.170  1.00 0.00 ? 36 TYR A O    2  
ATOM 1989  C CB   . TYR A 1 36 ? -2.138  -2.724  -6.289  1.00 0.00 ? 36 TYR A CB   2  
ATOM 1990  C CG   . TYR A 1 36 ? -0.805  -2.350  -5.638  1.00 0.00 ? 36 TYR A CG   2  
ATOM 1991  C CD1  . TYR A 1 36 ? 0.058   -3.340  -5.214  1.00 0.00 ? 36 TYR A CD1  2  
ATOM 1992  C CD2  . TYR A 1 36 ? -0.465  -1.022  -5.474  1.00 0.00 ? 36 TYR A CD2  2  
ATOM 1993  C CE1  . TYR A 1 36 ? 1.313   -2.988  -4.601  1.00 0.00 ? 36 TYR A CE1  2  
ATOM 1994  C CE2  . TYR A 1 36 ? 0.789   -0.670  -4.860  1.00 0.00 ? 36 TYR A CE2  2  
ATOM 1995  C CZ   . TYR A 1 36 ? 1.616   -1.670  -4.454  1.00 0.00 ? 36 TYR A CZ   2  
ATOM 1996  O OH   . TYR A 1 36 ? 2.801   -1.338  -3.875  1.00 0.00 ? 36 TYR A OH   2  
ATOM 1997  H H    . TYR A 1 36 ? -2.100  -5.165  -6.059  1.00 0.00 ? 36 TYR A H    2  
ATOM 1998  H HA   . TYR A 1 36 ? -3.159  -3.048  -4.359  1.00 0.00 ? 36 TYR A HA   2  
ATOM 1999  H HB2  . TYR A 1 36 ? -1.941  -3.340  -7.166  1.00 0.00 ? 36 TYR A HB2  2  
ATOM 2000  H HB3  . TYR A 1 36 ? -2.626  -1.815  -6.642  1.00 0.00 ? 36 TYR A HB3  2  
ATOM 2001  H HD1  . TYR A 1 36 ? -0.210  -4.388  -5.344  1.00 0.00 ? 36 TYR A HD1  2  
ATOM 2002  H HD2  . TYR A 1 36 ? -1.147  -0.240  -5.808  1.00 0.00 ? 36 TYR A HD2  2  
ATOM 2003  H HE1  . TYR A 1 36 ? 2.003   -3.760  -4.262  1.00 0.00 ? 36 TYR A HE1  2  
ATOM 2004  H HE2  . TYR A 1 36 ? 1.069   0.375   -4.725  1.00 0.00 ? 36 TYR A HE2  2  
ATOM 2005  H HH   . TYR A 1 36 ? 3.486   -2.039  -4.072  1.00 0.00 ? 36 TYR A HH   2  
ATOM 2006  N N    . ASN A 1 37 ? -5.476  -3.143  -5.171  1.00 0.00 ? 37 ASN A N    2  
ATOM 2007  C CA   . ASN A 1 37 ? -6.853  -3.110  -5.631  1.00 0.00 ? 37 ASN A CA   2  
ATOM 2008  C C    . ASN A 1 37 ? -7.184  -1.704  -6.137  1.00 0.00 ? 37 ASN A C    2  
ATOM 2009  O O    . ASN A 1 37 ? -7.056  -0.729  -5.398  1.00 0.00 ? 37 ASN A O    2  
ATOM 2010  C CB   . ASN A 1 37 ? -7.822  -3.443  -4.494  1.00 0.00 ? 37 ASN A CB   2  
ATOM 2011  C CG   . ASN A 1 37 ? -8.390  -4.855  -4.654  1.00 0.00 ? 37 ASN A CG   2  
ATOM 2012  O OD1  . ASN A 1 37 ? -9.555  -5.052  -4.960  1.00 0.00 ? 37 ASN A OD1  2  
ATOM 2013  N ND2  . ASN A 1 37 ? -7.505  -5.822  -4.431  1.00 0.00 ? 37 ASN A ND2  2  
ATOM 2014  H H    . ASN A 1 37 ? -5.344  -2.893  -4.211  1.00 0.00 ? 37 ASN A H    2  
ATOM 2015  H HA   . ASN A 1 37 ? -6.910  -3.861  -6.419  1.00 0.00 ? 37 ASN A HA   2  
ATOM 2016  H HB2  . ASN A 1 37 ? -7.307  -3.361  -3.537  1.00 0.00 ? 37 ASN A HB2  2  
ATOM 2017  H HB3  . ASN A 1 37 ? -8.636  -2.719  -4.482  1.00 0.00 ? 37 ASN A HB3  2  
ATOM 2018  H HD21 . ASN A 1 37 ? -6.564  -5.592  -4.184  1.00 0.00 ? 37 ASN A HD21 2  
ATOM 2019  H HD22 . ASN A 1 37 ? -7.782  -6.780  -4.511  1.00 0.00 ? 37 ASN A HD22 2  
ATOM 2020  N N    . PHE A 1 38 ? -7.602  -1.645  -7.393  1.00 0.00 ? 38 PHE A N    2  
ATOM 2021  C CA   . PHE A 1 38 ? -7.952  -0.375  -8.006  1.00 0.00 ? 38 PHE A CA   2  
ATOM 2022  C C    . PHE A 1 38 ? -9.442  -0.324  -8.348  1.00 0.00 ? 38 PHE A C    2  
ATOM 2023  O O    . PHE A 1 38 ? -10.043 -1.346  -8.676  1.00 0.00 ? 38 PHE A O    2  
ATOM 2024  C CB   . PHE A 1 38 ? -7.140  -0.264  -9.297  1.00 0.00 ? 38 PHE A CB   2  
ATOM 2025  C CG   . PHE A 1 38 ? -5.635  -0.466  -9.106  1.00 0.00 ? 38 PHE A CG   2  
ATOM 2026  C CD1  . PHE A 1 38 ? -5.127  -1.722  -8.988  1.00 0.00 ? 38 PHE A CD1  2  
ATOM 2027  C CD2  . PHE A 1 38 ? -4.806  0.611   -9.053  1.00 0.00 ? 38 PHE A CD2  2  
ATOM 2028  C CE1  . PHE A 1 38 ? -3.731  -1.909  -8.810  1.00 0.00 ? 38 PHE A CE1  2  
ATOM 2029  C CE2  . PHE A 1 38 ? -3.410  0.424   -8.875  1.00 0.00 ? 38 PHE A CE2  2  
ATOM 2030  C CZ   . PHE A 1 38 ? -2.902  -0.833  -8.758  1.00 0.00 ? 38 PHE A CZ   2  
ATOM 2031  H H    . PHE A 1 38 ? -7.704  -2.443  -7.986  1.00 0.00 ? 38 PHE A H    2  
ATOM 2032  H HA   . PHE A 1 38 ? -7.720  0.408   -7.284  1.00 0.00 ? 38 PHE A HA   2  
ATOM 2033  H HB2  . PHE A 1 38 ? -7.507  -1.002  -10.011 1.00 0.00 ? 38 PHE A HB2  2  
ATOM 2034  H HB3  . PHE A 1 38 ? -7.311  0.719   -9.738  1.00 0.00 ? 38 PHE A HB3  2  
ATOM 2035  H HD1  . PHE A 1 38 ? -5.792  -2.585  -9.031  1.00 0.00 ? 38 PHE A HD1  2  
ATOM 2036  H HD2  . PHE A 1 38 ? -5.213  1.618   -9.147  1.00 0.00 ? 38 PHE A HD2  2  
ATOM 2037  H HE1  . PHE A 1 38 ? -3.324  -2.916  -8.716  1.00 0.00 ? 38 PHE A HE1  2  
ATOM 2038  H HE2  . PHE A 1 38 ? -2.745  1.286   -8.833  1.00 0.00 ? 38 PHE A HE2  2  
ATOM 2039  H HZ   . PHE A 1 38 ? -1.830  -0.976  -8.621  1.00 0.00 ? 38 PHE A HZ   2  
ATOM 2040  N N    . PHE A 1 39 ? -9.996  0.877   -8.261  1.00 0.00 ? 39 PHE A N    2  
ATOM 2041  C CA   . PHE A 1 39 ? -11.404 1.075   -8.558  1.00 0.00 ? 39 PHE A CA   2  
ATOM 2042  C C    . PHE A 1 39 ? -11.671 2.510   -9.016  1.00 0.00 ? 39 PHE A C    2  
ATOM 2043  O O    . PHE A 1 39 ? -10.812 3.380   -8.879  1.00 0.00 ? 39 PHE A O    2  
ATOM 2044  C CB   . PHE A 1 39 ? -12.175 0.814   -7.263  1.00 0.00 ? 39 PHE A CB   2  
ATOM 2045  C CG   . PHE A 1 39 ? -11.531 1.432   -6.020  1.00 0.00 ? 39 PHE A CG   2  
ATOM 2046  C CD1  . PHE A 1 39 ? -11.762 2.737   -5.712  1.00 0.00 ? 39 PHE A CD1  2  
ATOM 2047  C CD2  . PHE A 1 39 ? -10.729 0.677   -5.223  1.00 0.00 ? 39 PHE A CD2  2  
ATOM 2048  C CE1  . PHE A 1 39 ? -11.164 3.310   -4.559  1.00 0.00 ? 39 PHE A CE1  2  
ATOM 2049  C CE2  . PHE A 1 39 ? -10.131 1.250   -4.069  1.00 0.00 ? 39 PHE A CE2  2  
ATOM 2050  C CZ   . PHE A 1 39 ? -10.362 2.555   -3.762  1.00 0.00 ? 39 PHE A CZ   2  
ATOM 2051  H H    . PHE A 1 39 ? -9.500  1.703   -7.994  1.00 0.00 ? 39 PHE A H    2  
ATOM 2052  H HA   . PHE A 1 39 ? -11.666 0.385   -9.360  1.00 0.00 ? 39 PHE A HA   2  
ATOM 2053  H HB2  . PHE A 1 39 ? -13.187 1.206   -7.368  1.00 0.00 ? 39 PHE A HB2  2  
ATOM 2054  H HB3  . PHE A 1 39 ? -12.265 -0.262  -7.116  1.00 0.00 ? 39 PHE A HB3  2  
ATOM 2055  H HD1  . PHE A 1 39 ? -12.405 3.342   -6.351  1.00 0.00 ? 39 PHE A HD1  2  
ATOM 2056  H HD2  . PHE A 1 39 ? -10.544 -0.369  -5.470  1.00 0.00 ? 39 PHE A HD2  2  
ATOM 2057  H HE1  . PHE A 1 39 ? -11.349 4.356   -4.312  1.00 0.00 ? 39 PHE A HE1  2  
ATOM 2058  H HE2  . PHE A 1 39 ? -9.488  0.645   -3.431  1.00 0.00 ? 39 PHE A HE2  2  
ATOM 2059  H HZ   . PHE A 1 39 ? -9.903  2.995   -2.876  1.00 0.00 ? 39 PHE A HZ   2  
ATOM 2060  N N    . GLU A 1 40 ? -12.866 2.714   -9.551  1.00 0.00 ? 40 GLU A N    2  
ATOM 2061  C CA   . GLU A 1 40 ? -13.258 4.029   -10.030 1.00 0.00 ? 40 GLU A CA   2  
ATOM 2062  C C    . GLU A 1 40 ? -13.742 4.895   -8.866  1.00 0.00 ? 40 GLU A C    2  
ATOM 2063  O O    . GLU A 1 40 ? -14.556 4.455   -8.056  1.00 0.00 ? 40 GLU A O    2  
ATOM 2064  C CB   . GLU A 1 40 ? -14.330 3.920   -11.116 1.00 0.00 ? 40 GLU A CB   2  
ATOM 2065  C CG   . GLU A 1 40 ? -15.497 3.048   -10.648 1.00 0.00 ? 40 GLU A CG   2  
ATOM 2066  C CD   . GLU A 1 40 ? -16.735 3.276   -11.519 1.00 0.00 ? 40 GLU A CD   2  
ATOM 2067  O OE1  . GLU A 1 40 ? -16.822 4.378   -12.103 1.00 0.00 ? 40 GLU A OE1  2  
ATOM 2068  O OE2  . GLU A 1 40 ? -17.566 2.345   -11.579 1.00 0.00 ? 40 GLU A OE2  2  
ATOM 2069  H H    . GLU A 1 40 ? -13.560 2.001   -9.659  1.00 0.00 ? 40 GLU A H    2  
ATOM 2070  H HA   . GLU A 1 40 ? -12.355 4.460   -10.462 1.00 0.00 ? 40 GLU A HA   2  
ATOM 2071  H HB2  . GLU A 1 40 ? -14.694 4.914   -11.374 1.00 0.00 ? 40 GLU A HB2  2  
ATOM 2072  H HB3  . GLU A 1 40 ? -13.895 3.496   -12.021 1.00 0.00 ? 40 GLU A HB3  2  
ATOM 2073  H HG2  . GLU A 1 40 ? -15.210 1.998   -10.687 1.00 0.00 ? 40 GLU A HG2  2  
ATOM 2074  H HG3  . GLU A 1 40 ? -15.732 3.276   -9.609  1.00 0.00 ? 40 GLU A HG3  2  
ATOM 2075  N N    . CYS A 1 41 ? -13.221 6.113   -8.820  1.00 0.00 ? 41 CYS A N    2  
ATOM 2076  C CA   . CYS A 1 41 ? -13.590 7.045   -7.769  1.00 0.00 ? 41 CYS A CA   2  
ATOM 2077  C C    . CYS A 1 41 ? -14.449 8.150   -8.387  1.00 0.00 ? 41 CYS A C    2  
ATOM 2078  O O    . CYS A 1 41 ? -13.998 8.864   -9.281  1.00 0.00 ? 41 CYS A O    2  
ATOM 2079  C CB   . CYS A 1 41 ? -12.359 7.610   -7.056  1.00 0.00 ? 41 CYS A CB   2  
ATOM 2080  S SG   . CYS A 1 41 ? -12.656 7.674   -5.251  1.00 0.00 ? 41 CYS A SG   2  
ATOM 2081  H H    . CYS A 1 41 ? -12.559 6.463   -9.483  1.00 0.00 ? 41 CYS A H    2  
ATOM 2082  H HA   . CYS A 1 41 ? -14.159 6.478   -7.033  1.00 0.00 ? 41 CYS A HA   2  
ATOM 2083  H HB2  . CYS A 1 41 ? -11.489 6.989   -7.268  1.00 0.00 ? 41 CYS A HB2  2  
ATOM 2084  H HB3  . CYS A 1 41 ? -12.137 8.609   -7.432  1.00 0.00 ? 41 CYS A HB3  2  
ATOM 2085  H HG   . CYS A 1 41 ? -12.016 6.544   -4.965  1.00 0.00 ? 41 CYS A HG   2  
ATOM 2086  N N    . GLU A 1 42 ? -15.670 8.257   -7.884  1.00 0.00 ? 42 GLU A N    2  
ATOM 2087  C CA   . GLU A 1 42 ? -16.596 9.263   -8.376  1.00 0.00 ? 42 GLU A CA   2  
ATOM 2088  C C    . GLU A 1 42 ? -16.262 10.630  -7.775  1.00 0.00 ? 42 GLU A C    2  
ATOM 2089  O O    . GLU A 1 42 ? -17.123 11.278  -7.182  1.00 0.00 ? 42 GLU A O    2  
ATOM 2090  C CB   . GLU A 1 42 ? -18.044 8.870   -8.074  1.00 0.00 ? 42 GLU A CB   2  
ATOM 2091  C CG   . GLU A 1 42 ? -18.952 9.162   -9.270  1.00 0.00 ? 42 GLU A CG   2  
ATOM 2092  C CD   . GLU A 1 42 ? -20.286 8.425   -9.138  1.00 0.00 ? 42 GLU A CD   2  
ATOM 2093  O OE1  . GLU A 1 42 ? -20.259 7.293   -8.608  1.00 0.00 ? 42 GLU A OE1  2  
ATOM 2094  O OE2  . GLU A 1 42 ? -21.303 9.009   -9.571  1.00 0.00 ? 42 GLU A OE2  2  
ATOM 2095  H H    . GLU A 1 42 ? -16.029 7.672   -7.157  1.00 0.00 ? 42 GLU A H    2  
ATOM 2096  H HA   . GLU A 1 42 ? -16.451 9.288   -9.456  1.00 0.00 ? 42 GLU A HA   2  
ATOM 2097  H HB2  . GLU A 1 42 ? -18.092 7.809   -7.827  1.00 0.00 ? 42 GLU A HB2  2  
ATOM 2098  H HB3  . GLU A 1 42 ? -18.398 9.417   -7.201  1.00 0.00 ? 42 GLU A HB3  2  
ATOM 2099  H HG2  . GLU A 1 42 ? -19.131 10.235  -9.341  1.00 0.00 ? 42 GLU A HG2  2  
ATOM 2100  H HG3  . GLU A 1 42 ? -18.455 8.860   -10.191 1.00 0.00 ? 42 GLU A HG3  2  
ATOM 2101  N N    . ASN A 1 43 ? -15.011 11.028  -7.950  1.00 0.00 ? 43 ASN A N    2  
ATOM 2102  C CA   . ASN A 1 43 ? -14.553 12.306  -7.433  1.00 0.00 ? 43 ASN A CA   2  
ATOM 2103  C C    . ASN A 1 43 ? -13.811 13.062  -8.537  1.00 0.00 ? 43 ASN A C    2  
ATOM 2104  O O    . ASN A 1 43 ? -12.996 12.481  -9.252  1.00 0.00 ? 43 ASN A O    2  
ATOM 2105  C CB   . ASN A 1 43 ? -13.588 12.113  -6.262  1.00 0.00 ? 43 ASN A CB   2  
ATOM 2106  C CG   . ASN A 1 43 ? -14.196 12.634  -4.958  1.00 0.00 ? 43 ASN A CG   2  
ATOM 2107  O OD1  . ASN A 1 43 ? -15.343 12.376  -4.631  1.00 0.00 ? 43 ASN A OD1  2  
ATOM 2108  N ND2  . ASN A 1 43 ? -13.366 13.381  -4.235  1.00 0.00 ? 43 ASN A ND2  2  
ATOM 2109  H H    . ASN A 1 43 ? -14.317 10.495  -8.434  1.00 0.00 ? 43 ASN A H    2  
ATOM 2110  H HA   . ASN A 1 43 ? -15.456 12.824  -7.108  1.00 0.00 ? 43 ASN A HA   2  
ATOM 2111  H HB2  . ASN A 1 43 ? -13.346 11.055  -6.156  1.00 0.00 ? 43 ASN A HB2  2  
ATOM 2112  H HB3  . ASN A 1 43 ? -12.653 12.635  -6.466  1.00 0.00 ? 43 ASN A HB3  2  
ATOM 2113  H HD21 . ASN A 1 43 ? -12.437 13.555  -4.561  1.00 0.00 ? 43 ASN A HD21 2  
ATOM 2114  H HD22 . ASN A 1 43 ? -13.672 13.769  -3.365  1.00 0.00 ? 43 ASN A HD22 2  
ATOM 2115  N N    . PRO A 1 44 ? -14.127 14.380  -8.644  1.00 0.00 ? 44 PRO A N    2  
ATOM 2116  C CA   . PRO A 1 44 ? -13.500 15.222  -9.648  1.00 0.00 ? 44 PRO A CA   2  
ATOM 2117  C C    . PRO A 1 44 ? -12.061 15.563  -9.256  1.00 0.00 ? 44 PRO A C    2  
ATOM 2118  O O    . PRO A 1 44 ? -11.168 15.570  -10.102 1.00 0.00 ? 44 PRO A O    2  
ATOM 2119  C CB   . PRO A 1 44 ? -14.394 16.447  -9.750  1.00 0.00 ? 44 PRO A CB   2  
ATOM 2120  C CG   . PRO A 1 44 ? -15.226 16.462  -8.478  1.00 0.00 ? 44 PRO A CG   2  
ATOM 2121  C CD   . PRO A 1 44 ? -15.087 15.102  -7.814  1.00 0.00 ? 44 PRO A CD   2  
ATOM 2122  H HA   . PRO A 1 44 ? -13.437 14.735  -10.519 1.00 0.00 ? 44 PRO A HA   2  
ATOM 2123  H HB2  . PRO A 1 44 ? -13.801 17.357  -9.841  1.00 0.00 ? 44 PRO A HB2  2  
ATOM 2124  H HB3  . PRO A 1 44 ? -15.031 16.392  -10.633 1.00 0.00 ? 44 PRO A HB3  2  
ATOM 2125  H HG2  . PRO A 1 44 ? -14.884 17.251  -7.808  1.00 0.00 ? 44 PRO A HG2  2  
ATOM 2126  H HG3  . PRO A 1 44 ? -16.271 16.670  -8.708  1.00 0.00 ? 44 PRO A HG3  2  
ATOM 2127  H HD2  . PRO A 1 44 ? -14.731 15.197  -6.788  1.00 0.00 ? 44 PRO A HD2  2  
ATOM 2128  H HD3  . PRO A 1 44 ? -16.044 14.583  -7.772  1.00 0.00 ? 44 PRO A HD3  2  
ATOM 2129  N N    . SER A 1 45 ? -11.880 15.839  -7.973  1.00 0.00 ? 45 SER A N    2  
ATOM 2130  C CA   . SER A 1 45 ? -10.565 16.180  -7.459  1.00 0.00 ? 45 SER A CA   2  
ATOM 2131  C C    . SER A 1 45 ? -9.574  15.057  -7.768  1.00 0.00 ? 45 SER A C    2  
ATOM 2132  O O    . SER A 1 45 ? -8.525  15.297  -8.364  1.00 0.00 ? 45 SER A O    2  
ATOM 2133  C CB   . SER A 1 45 ? -10.614 16.444  -5.952  1.00 0.00 ? 45 SER A CB   2  
ATOM 2134  O OG   . SER A 1 45 ? -10.073 17.719  -5.616  1.00 0.00 ? 45 SER A OG   2  
ATOM 2135  H H    . SER A 1 45 ? -12.612 15.831  -7.291  1.00 0.00 ? 45 SER A H    2  
ATOM 2136  H HA   . SER A 1 45 ? -10.281 17.095  -7.978  1.00 0.00 ? 45 SER A HA   2  
ATOM 2137  H HB2  . SER A 1 45 ? -11.647 16.386  -5.608  1.00 0.00 ? 45 SER A HB2  2  
ATOM 2138  H HB3  . SER A 1 45 ? -10.059 15.665  -5.430  1.00 0.00 ? 45 SER A HB3  2  
ATOM 2139  H HG   . SER A 1 45 ? -10.798 18.408  -5.610  1.00 0.00 ? 45 SER A HG   2  
ATOM 2140  N N    . GLU A 1 46 ? -9.942  13.855  -7.351  1.00 0.00 ? 46 GLU A N    2  
ATOM 2141  C CA   . GLU A 1 46 ? -9.098  12.693  -7.576  1.00 0.00 ? 46 GLU A CA   2  
ATOM 2142  C C    . GLU A 1 46 ? -9.949  11.491  -7.990  1.00 0.00 ? 46 GLU A C    2  
ATOM 2143  O O    . GLU A 1 46 ? -10.434 10.747  -7.139  1.00 0.00 ? 46 GLU A O    2  
ATOM 2144  C CB   . GLU A 1 46 ? -8.263  12.373  -6.335  1.00 0.00 ? 46 GLU A CB   2  
ATOM 2145  C CG   . GLU A 1 46 ? -7.348  13.544  -5.972  1.00 0.00 ? 46 GLU A CG   2  
ATOM 2146  C CD   . GLU A 1 46 ? -6.960  13.498  -4.492  1.00 0.00 ? 46 GLU A CD   2  
ATOM 2147  O OE1  . GLU A 1 46 ? -6.841  12.368  -3.971  1.00 0.00 ? 46 GLU A OE1  2  
ATOM 2148  O OE2  . GLU A 1 46 ? -6.790  14.594  -3.916  1.00 0.00 ? 46 GLU A OE2  2  
ATOM 2149  H H    . GLU A 1 46 ? -10.797 13.668  -6.867  1.00 0.00 ? 46 GLU A H    2  
ATOM 2150  H HA   . GLU A 1 46 ? -8.432  12.973  -8.392  1.00 0.00 ? 46 GLU A HA   2  
ATOM 2151  H HB2  . GLU A 1 46 ? -8.923  12.149  -5.496  1.00 0.00 ? 46 GLU A HB2  2  
ATOM 2152  H HB3  . GLU A 1 46 ? -7.664  11.481  -6.516  1.00 0.00 ? 46 GLU A HB3  2  
ATOM 2153  H HG2  . GLU A 1 46 ? -6.450  13.513  -6.588  1.00 0.00 ? 46 GLU A HG2  2  
ATOM 2154  H HG3  . GLU A 1 46 ? -7.852  14.485  -6.190  1.00 0.00 ? 46 GLU A HG3  2  
ATOM 2155  N N    . PRO A 1 47 ? -10.108 11.334  -9.332  1.00 0.00 ? 47 PRO A N    2  
ATOM 2156  C CA   . PRO A 1 47 ? -10.892 10.235  -9.869  1.00 0.00 ? 47 PRO A CA   2  
ATOM 2157  C C    . PRO A 1 47 ? -10.125 8.915   -9.770  1.00 0.00 ? 47 PRO A C    2  
ATOM 2158  O O    . PRO A 1 47 ? -10.728 7.844   -9.734  1.00 0.00 ? 47 PRO A O    2  
ATOM 2159  C CB   . PRO A 1 47 ? -11.203 10.637  -11.301 1.00 0.00 ? 47 PRO A CB   2  
ATOM 2160  C CG   . PRO A 1 47 ? -10.197 11.719  -11.658 1.00 0.00 ? 47 PRO A CG   2  
ATOM 2161  C CD   . PRO A 1 47 ? -9.548  12.196  -10.369 1.00 0.00 ? 47 PRO A CD   2  
ATOM 2162  H HA   . PRO A 1 47 ? -11.726 10.108  -9.331  1.00 0.00 ? 47 PRO A HA   2  
ATOM 2163  H HB2  . PRO A 1 47 ? -11.113 9.784   -11.974 1.00 0.00 ? 47 PRO A HB2  2  
ATOM 2164  H HB3  . PRO A 1 47 ? -12.224 11.007  -11.391 1.00 0.00 ? 47 PRO A HB3  2  
ATOM 2165  H HG2  . PRO A 1 47 ? -9.444  11.330  -12.343 1.00 0.00 ? 47 PRO A HG2  2  
ATOM 2166  H HG3  . PRO A 1 47 ? -10.692 12.548  -12.165 1.00 0.00 ? 47 PRO A HG3  2  
ATOM 2167  H HD2  . PRO A 1 47 ? -8.463  12.106  -10.415 1.00 0.00 ? 47 PRO A HD2  2  
ATOM 2168  H HD3  . PRO A 1 47 ? -9.773  13.245  -10.176 1.00 0.00 ? 47 PRO A HD3  2  
ATOM 2169  N N    . PHE A 1 48 ? -8.806  9.036   -9.730  1.00 0.00 ? 48 PHE A N    2  
ATOM 2170  C CA   . PHE A 1 48 ? -7.951  7.865   -9.637  1.00 0.00 ? 48 PHE A CA   2  
ATOM 2171  C C    . PHE A 1 48 ? -7.787  7.420   -8.182  1.00 0.00 ? 48 PHE A C    2  
ATOM 2172  O O    . PHE A 1 48 ? -7.285  8.176   -7.351  1.00 0.00 ? 48 PHE A O    2  
ATOM 2173  C CB   . PHE A 1 48 ? -6.582  8.266   -10.192 1.00 0.00 ? 48 PHE A CB   2  
ATOM 2174  C CG   . PHE A 1 48 ? -6.646  9.005   -11.530 1.00 0.00 ? 48 PHE A CG   2  
ATOM 2175  C CD1  . PHE A 1 48 ? -6.806  10.356  -11.554 1.00 0.00 ? 48 PHE A CD1  2  
ATOM 2176  C CD2  . PHE A 1 48 ? -6.544  8.312   -12.696 1.00 0.00 ? 48 PHE A CD2  2  
ATOM 2177  C CE1  . PHE A 1 48 ? -6.865  11.042  -12.796 1.00 0.00 ? 48 PHE A CE1  2  
ATOM 2178  C CE2  . PHE A 1 48 ? -6.603  8.998   -13.937 1.00 0.00 ? 48 PHE A CE2  2  
ATOM 2179  C CZ   . PHE A 1 48 ? -6.762  10.348  -13.961 1.00 0.00 ? 48 PHE A CZ   2  
ATOM 2180  H H    . PHE A 1 48 ? -8.324  9.911   -9.760  1.00 0.00 ? 48 PHE A H    2  
ATOM 2181  H HA   . PHE A 1 48 ? -8.429  7.068   -10.207 1.00 0.00 ? 48 PHE A HA   2  
ATOM 2182  H HB2  . PHE A 1 48 ? -6.077  8.899   -9.463  1.00 0.00 ? 48 PHE A HB2  2  
ATOM 2183  H HB3  . PHE A 1 48 ? -5.974  7.370   -10.313 1.00 0.00 ? 48 PHE A HB3  2  
ATOM 2184  H HD1  . PHE A 1 48 ? -6.888  10.911  -10.620 1.00 0.00 ? 48 PHE A HD1  2  
ATOM 2185  H HD2  . PHE A 1 48 ? -6.416  7.229   -12.676 1.00 0.00 ? 48 PHE A HD2  2  
ATOM 2186  H HE1  . PHE A 1 48 ? -6.992  12.124  -12.815 1.00 0.00 ? 48 PHE A HE1  2  
ATOM 2187  H HE2  . PHE A 1 48 ? -6.521  8.442   -14.872 1.00 0.00 ? 48 PHE A HE2  2  
ATOM 2188  H HZ   . PHE A 1 48 ? -6.808  10.875  -14.915 1.00 0.00 ? 48 PHE A HZ   2  
ATOM 2189  N N    . GLY A 1 49 ? -8.219  6.196   -7.919  1.00 0.00 ? 49 GLY A N    2  
ATOM 2190  C CA   . GLY A 1 49 ? -8.127  5.641   -6.579  1.00 0.00 ? 49 GLY A CA   2  
ATOM 2191  C C    . GLY A 1 49 ? -7.581  4.212   -6.613  1.00 0.00 ? 49 GLY A C    2  
ATOM 2192  O O    . GLY A 1 49 ? -7.843  3.467   -7.556  1.00 0.00 ? 49 GLY A O    2  
ATOM 2193  H H    . GLY A 1 49 ? -8.626  5.588   -8.601  1.00 0.00 ? 49 GLY A H    2  
ATOM 2194  H HA2  . GLY A 1 49 ? -7.478  6.267   -5.966  1.00 0.00 ? 49 GLY A HA2  2  
ATOM 2195  H HA3  . GLY A 1 49 ? -9.111  5.648   -6.110  1.00 0.00 ? 49 GLY A HA3  2  
ATOM 2196  N N    . ALA A 1 50 ? -6.833  3.874   -5.574  1.00 0.00 ? 50 ALA A N    2  
ATOM 2197  C CA   . ALA A 1 50 ? -6.248  2.547   -5.473  1.00 0.00 ? 50 ALA A CA   2  
ATOM 2198  C C    . ALA A 1 50 ? -6.131  2.157   -3.998  1.00 0.00 ? 50 ALA A C    2  
ATOM 2199  O O    . ALA A 1 50 ? -6.203  3.013   -3.118  1.00 0.00 ? 50 ALA A O    2  
ATOM 2200  C CB   . ALA A 1 50 ? -4.897  2.529   -6.190  1.00 0.00 ? 50 ALA A CB   2  
ATOM 2201  H H    . ALA A 1 50 ? -6.625  4.486   -4.811  1.00 0.00 ? 50 ALA A H    2  
ATOM 2202  H HA   . ALA A 1 50 ? -6.920  1.849   -5.973  1.00 0.00 ? 50 ALA A HA   2  
ATOM 2203  H HB1  . ALA A 1 50 ? -4.096  2.445   -5.455  1.00 0.00 ? 50 ALA A HB1  2  
ATOM 2204  H HB2  . ALA A 1 50 ? -4.857  1.677   -6.869  1.00 0.00 ? 50 ALA A HB2  2  
ATOM 2205  H HB3  . ALA A 1 50 ? -4.774  3.452   -6.757  1.00 0.00 ? 50 ALA A HB3  2  
ATOM 2206  N N    . SER A 1 51 ? -5.953  0.863   -3.774  1.00 0.00 ? 51 SER A N    2  
ATOM 2207  C CA   . SER A 1 51 ? -5.825  0.349   -2.421  1.00 0.00 ? 51 SER A CA   2  
ATOM 2208  C C    . SER A 1 51 ? -4.785  -0.773  -2.384  1.00 0.00 ? 51 SER A C    2  
ATOM 2209  O O    . SER A 1 51 ? -4.403  -1.305  -3.425  1.00 0.00 ? 51 SER A O    2  
ATOM 2210  C CB   . SER A 1 51 ? -7.170  -0.156  -1.895  1.00 0.00 ? 51 SER A CB   2  
ATOM 2211  O OG   . SER A 1 51 ? -7.023  -0.917  -0.699  1.00 0.00 ? 51 SER A OG   2  
ATOM 2212  H H    . SER A 1 51 ? -5.895  0.173   -4.496  1.00 0.00 ? 51 SER A H    2  
ATOM 2213  H HA   . SER A 1 51 ? -5.495  1.196   -1.820  1.00 0.00 ? 51 SER A HA   2  
ATOM 2214  H HB2  . SER A 1 51 ? -7.827  0.693   -1.706  1.00 0.00 ? 51 SER A HB2  2  
ATOM 2215  H HB3  . SER A 1 51 ? -7.651  -0.768  -2.657  1.00 0.00 ? 51 SER A HB3  2  
ATOM 2216  H HG   . SER A 1 51 ? -7.645  -0.573  0.004   1.00 0.00 ? 51 SER A HG   2  
ATOM 2217  N N    . VAL A 1 52 ? -4.357  -1.099  -1.173  1.00 0.00 ? 52 VAL A N    2  
ATOM 2218  C CA   . VAL A 1 52 ? -3.369  -2.148  -0.987  1.00 0.00 ? 52 VAL A CA   2  
ATOM 2219  C C    . VAL A 1 52 ? -3.982  -3.280  -0.160  1.00 0.00 ? 52 VAL A C    2  
ATOM 2220  O O    . VAL A 1 52 ? -4.196  -3.130  1.042   1.00 0.00 ? 52 VAL A O    2  
ATOM 2221  C CB   . VAL A 1 52 ? -2.101  -1.567  -0.356  1.00 0.00 ? 52 VAL A CB   2  
ATOM 2222  C CG1  . VAL A 1 52 ? -1.138  -2.679  0.063   1.00 0.00 ? 52 VAL A CG1  2  
ATOM 2223  C CG2  . VAL A 1 52 ? -1.419  -0.580  -1.306  1.00 0.00 ? 52 VAL A CG2  2  
ATOM 2224  H H    . VAL A 1 52 ? -4.672  -0.661  -0.332  1.00 0.00 ? 52 VAL A H    2  
ATOM 2225  H HA   . VAL A 1 52 ? -3.109  -2.534  -1.972  1.00 0.00 ? 52 VAL A HA   2  
ATOM 2226  H HB   . VAL A 1 52 ? -2.393  -1.021  0.541   1.00 0.00 ? 52 VAL A HB   2  
ATOM 2227  H HG11 . VAL A 1 52 ? -0.799  -3.219  -0.821  1.00 0.00 ? 52 VAL A HG11 2  
ATOM 2228  H HG12 . VAL A 1 52 ? -0.279  -2.243  0.573   1.00 0.00 ? 52 VAL A HG12 2  
ATOM 2229  H HG13 . VAL A 1 52 ? -1.649  -3.368  0.735   1.00 0.00 ? 52 VAL A HG13 2  
ATOM 2230  H HG21 . VAL A 1 52 ? -2.009  0.334   -1.365  1.00 0.00 ? 52 VAL A HG21 2  
ATOM 2231  H HG22 . VAL A 1 52 ? -0.422  -0.346  -0.932  1.00 0.00 ? 52 VAL A HG22 2  
ATOM 2232  H HG23 . VAL A 1 52 ? -1.340  -1.026  -2.298  1.00 0.00 ? 52 VAL A HG23 2  
ATOM 2233  N N    . THR A 1 53 ? -4.250  -4.387  -0.838  1.00 0.00 ? 53 THR A N    2  
ATOM 2234  C CA   . THR A 1 53 ? -4.835  -5.543  -0.181  1.00 0.00 ? 53 THR A CA   2  
ATOM 2235  C C    . THR A 1 53 ? -3.752  -6.570  0.155   1.00 0.00 ? 53 THR A C    2  
ATOM 2236  O O    . THR A 1 53 ? -3.031  -7.030  -0.729  1.00 0.00 ? 53 THR A O    2  
ATOM 2237  C CB   . THR A 1 53 ? -5.935  -6.096  -1.089  1.00 0.00 ? 53 THR A CB   2  
ATOM 2238  O OG1  . THR A 1 53 ? -5.424  -5.911  -2.406  1.00 0.00 ? 53 THR A OG1  2  
ATOM 2239  C CG2  . THR A 1 53 ? -7.204  -5.242  -1.058  1.00 0.00 ? 53 THR A CG2  2  
ATOM 2240  H H    . THR A 1 53 ? -4.073  -4.500  -1.815  1.00 0.00 ? 53 THR A H    2  
ATOM 2241  H HA   . THR A 1 53 ? -5.271  -5.218  0.763   1.00 0.00 ? 53 THR A HA   2  
ATOM 2242  H HB   . THR A 1 53 ? -6.159  -7.134  -0.842  1.00 0.00 ? 53 THR A HB   2  
ATOM 2243  H HG1  . THR A 1 53 ? -5.408  -6.785  -2.892  1.00 0.00 ? 53 THR A HG1  2  
ATOM 2244  H HG21 . THR A 1 53 ? -7.353  -4.776  -2.033  1.00 0.00 ? 53 THR A HG21 2  
ATOM 2245  H HG22 . THR A 1 53 ? -8.061  -5.872  -0.822  1.00 0.00 ? 53 THR A HG22 2  
ATOM 2246  H HG23 . THR A 1 53 ? -7.102  -4.467  -0.298  1.00 0.00 ? 53 THR A HG23 2  
ATOM 2247  N N    . ILE A 1 54 ? -3.672  -6.900  1.436   1.00 0.00 ? 54 ILE A N    2  
ATOM 2248  C CA   . ILE A 1 54 ? -2.689  -7.864  1.900   1.00 0.00 ? 54 ILE A CA   2  
ATOM 2249  C C    . ILE A 1 54 ? -3.361  -9.228  2.073   1.00 0.00 ? 54 ILE A C    2  
ATOM 2250  O O    . ILE A 1 54 ? -4.111  -9.438  3.025   1.00 0.00 ? 54 ILE A O    2  
ATOM 2251  C CB   . ILE A 1 54 ? -1.995  -7.356  3.166   1.00 0.00 ? 54 ILE A CB   2  
ATOM 2252  C CG1  . ILE A 1 54 ? -1.110  -6.147  2.857   1.00 0.00 ? 54 ILE A CG1  2  
ATOM 2253  C CG2  . ILE A 1 54 ? -1.215  -8.478  3.852   1.00 0.00 ? 54 ILE A CG2  2  
ATOM 2254  C CD1  . ILE A 1 54 ? -0.569  -5.520  4.144   1.00 0.00 ? 54 ILE A CD1  2  
ATOM 2255  H H    . ILE A 1 54 ? -4.262  -6.522  2.149   1.00 0.00 ? 54 ILE A H    2  
ATOM 2256  H HA   . ILE A 1 54 ? -1.925  -7.951  1.127   1.00 0.00 ? 54 ILE A HA   2  
ATOM 2257  H HB   . ILE A 1 54 ? -2.762  -7.023  3.865   1.00 0.00 ? 54 ILE A HB   2  
ATOM 2258  H HG12 . ILE A 1 54 ? -0.279  -6.453  2.221   1.00 0.00 ? 54 ILE A HG12 2  
ATOM 2259  H HG13 . ILE A 1 54 ? -1.681  -5.405  2.300   1.00 0.00 ? 54 ILE A HG13 2  
ATOM 2260  H HG21 . ILE A 1 54 ? -1.116  -9.322  3.170   1.00 0.00 ? 54 ILE A HG21 2  
ATOM 2261  H HG22 . ILE A 1 54 ? -0.224  -8.116  4.128   1.00 0.00 ? 54 ILE A HG22 2  
ATOM 2262  H HG23 . ILE A 1 54 ? -1.747  -8.796  4.749   1.00 0.00 ? 54 ILE A HG23 2  
ATOM 2263  H HD11 . ILE A 1 54 ? 0.451   -5.173  3.979   1.00 0.00 ? 54 ILE A HD11 2  
ATOM 2264  H HD12 . ILE A 1 54 ? -1.198  -4.677  4.430   1.00 0.00 ? 54 ILE A HD12 2  
ATOM 2265  H HD13 . ILE A 1 54 ? -0.575  -6.264  4.941   1.00 0.00 ? 54 ILE A HD13 2  
ATOM 2266  N N    . ASP A 1 55 ? -3.067  -10.120 1.138   1.00 0.00 ? 55 ASP A N    2  
ATOM 2267  C CA   . ASP A 1 55 ? -3.633  -11.457 1.175   1.00 0.00 ? 55 ASP A CA   2  
ATOM 2268  C C    . ASP A 1 55 ? -5.158  -11.364 1.083   1.00 0.00 ? 55 ASP A C    2  
ATOM 2269  O O    . ASP A 1 55 ? -5.863  -12.306 1.440   1.00 0.00 ? 55 ASP A O    2  
ATOM 2270  C CB   . ASP A 1 55 ? -3.281  -12.168 2.483   1.00 0.00 ? 55 ASP A CB   2  
ATOM 2271  C CG   . ASP A 1 55 ? -3.844  -13.584 2.621   1.00 0.00 ? 55 ASP A CG   2  
ATOM 2272  O OD1  . ASP A 1 55 ? -3.761  -14.328 1.620   1.00 0.00 ? 55 ASP A OD1  2  
ATOM 2273  O OD2  . ASP A 1 55 ? -4.345  -13.891 3.725   1.00 0.00 ? 55 ASP A OD2  2  
ATOM 2274  H H    . ASP A 1 55 ? -2.456  -9.941  0.367   1.00 0.00 ? 55 ASP A H    2  
ATOM 2275  H HA   . ASP A 1 55 ? -3.195  -11.977 0.324   1.00 0.00 ? 55 ASP A HA   2  
ATOM 2276  H HB2  . ASP A 1 55 ? -2.196  -12.214 2.574   1.00 0.00 ? 55 ASP A HB2  2  
ATOM 2277  H HB3  . ASP A 1 55 ? -3.645  -11.566 3.316   1.00 0.00 ? 55 ASP A HB3  2  
ATOM 2278  N N    . GLY A 1 56 ? -5.620  -10.219 0.602   1.00 0.00 ? 56 GLY A N    2  
ATOM 2279  C CA   . GLY A 1 56 ? -7.048  -9.990  0.459   1.00 0.00 ? 56 GLY A CA   2  
ATOM 2280  C C    . GLY A 1 56 ? -7.530  -8.908  1.427   1.00 0.00 ? 56 GLY A C    2  
ATOM 2281  O O    . GLY A 1 56 ? -8.437  -8.142  1.105   1.00 0.00 ? 56 GLY A O    2  
ATOM 2282  H H    . GLY A 1 56 ? -5.039  -9.458  0.314   1.00 0.00 ? 56 GLY A H    2  
ATOM 2283  H HA2  . GLY A 1 56 ? -7.271  -9.693  -0.566  1.00 0.00 ? 56 GLY A HA2  2  
ATOM 2284  H HA3  . GLY A 1 56 ? -7.589  -10.918 0.646   1.00 0.00 ? 56 GLY A HA3  2  
ATOM 2285  N N    . VAL A 1 57 ? -6.902  -8.879  2.593   1.00 0.00 ? 57 VAL A N    2  
ATOM 2286  C CA   . VAL A 1 57 ? -7.255  -7.904  3.610   1.00 0.00 ? 57 VAL A CA   2  
ATOM 2287  C C    . VAL A 1 57 ? -6.793  -6.516  3.161   1.00 0.00 ? 57 VAL A C    2  
ATOM 2288  O O    . VAL A 1 57 ? -5.611  -6.308  2.893   1.00 0.00 ? 57 VAL A O    2  
ATOM 2289  C CB   . VAL A 1 57 ? -6.670  -8.320  4.961   1.00 0.00 ? 57 VAL A CB   2  
ATOM 2290  C CG1  . VAL A 1 57 ? -6.719  -7.163  5.960   1.00 0.00 ? 57 VAL A CG1  2  
ATOM 2291  C CG2  . VAL A 1 57 ? -7.390  -9.552  5.513   1.00 0.00 ? 57 VAL A CG2  2  
ATOM 2292  H H    . VAL A 1 57 ? -6.165  -9.506  2.847   1.00 0.00 ? 57 VAL A H    2  
ATOM 2293  H HA   . VAL A 1 57 ? -8.341  -7.900  3.699   1.00 0.00 ? 57 VAL A HA   2  
ATOM 2294  H HB   . VAL A 1 57 ? -5.624  -8.585  4.806   1.00 0.00 ? 57 VAL A HB   2  
ATOM 2295  H HG11 . VAL A 1 57 ? -5.703  -6.861  6.216   1.00 0.00 ? 57 VAL A HG11 2  
ATOM 2296  H HG12 . VAL A 1 57 ? -7.246  -6.320  5.514   1.00 0.00 ? 57 VAL A HG12 2  
ATOM 2297  H HG13 . VAL A 1 57 ? -7.241  -7.483  6.862   1.00 0.00 ? 57 VAL A HG13 2  
ATOM 2298  H HG21 . VAL A 1 57 ? -6.984  -10.450 5.047   1.00 0.00 ? 57 VAL A HG21 2  
ATOM 2299  H HG22 . VAL A 1 57 ? -7.243  -9.606  6.592   1.00 0.00 ? 57 VAL A HG22 2  
ATOM 2300  H HG23 . VAL A 1 57 ? -8.455  -9.479  5.295   1.00 0.00 ? 57 VAL A HG23 2  
ATOM 2301  N N    . THR A 1 58 ? -7.750  -5.602  3.093   1.00 0.00 ? 58 THR A N    2  
ATOM 2302  C CA   . THR A 1 58 ? -7.456  -4.240  2.681   1.00 0.00 ? 58 THR A CA   2  
ATOM 2303  C C    . THR A 1 58 ? -6.757  -3.480  3.811   1.00 0.00 ? 58 THR A C    2  
ATOM 2304  O O    . THR A 1 58 ? -7.045  -3.705  4.985   1.00 0.00 ? 58 THR A O    2  
ATOM 2305  C CB   . THR A 1 58 ? -8.765  -3.589  2.231   1.00 0.00 ? 58 THR A CB   2  
ATOM 2306  O OG1  . THR A 1 58 ? -9.281  -4.488  1.253   1.00 0.00 ? 58 THR A OG1  2  
ATOM 2307  C CG2  . THR A 1 58 ? -8.538  -2.288  1.458   1.00 0.00 ? 58 THR A CG2  2  
ATOM 2308  H H    . THR A 1 58 ? -8.709  -5.779  3.313   1.00 0.00 ? 58 THR A H    2  
ATOM 2309  H HA   . THR A 1 58 ? -6.761  -4.277  1.843   1.00 0.00 ? 58 THR A HA   2  
ATOM 2310  H HB   . THR A 1 58 ? -9.431  -3.427  3.079   1.00 0.00 ? 58 THR A HB   2  
ATOM 2311  H HG1  . THR A 1 58 ? -9.736  -5.257  1.701   1.00 0.00 ? 58 THR A HG1  2  
ATOM 2312  H HG21 . THR A 1 58 ? -8.551  -1.447  2.151   1.00 0.00 ? 58 THR A HG21 2  
ATOM 2313  H HG22 . THR A 1 58 ? -7.572  -2.329  0.955   1.00 0.00 ? 58 THR A HG22 2  
ATOM 2314  H HG23 . THR A 1 58 ? -9.328  -2.162  0.718   1.00 0.00 ? 58 THR A HG23 2  
ATOM 2315  N N    . TYR A 1 59 ? -5.853  -2.597  3.415   1.00 0.00 ? 59 TYR A N    2  
ATOM 2316  C CA   . TYR A 1 59 ? -5.111  -1.803  4.380   1.00 0.00 ? 59 TYR A CA   2  
ATOM 2317  C C    . TYR A 1 59 ? -5.128  -0.321  3.999   1.00 0.00 ? 59 TYR A C    2  
ATOM 2318  O O    . TYR A 1 59 ? -5.957  0.441   4.493   1.00 0.00 ? 59 TYR A O    2  
ATOM 2319  C CB   . TYR A 1 59 ? -3.670  -2.314  4.327   1.00 0.00 ? 59 TYR A CB   2  
ATOM 2320  C CG   . TYR A 1 59 ? -3.388  -3.481  5.275   1.00 0.00 ? 59 TYR A CG   2  
ATOM 2321  C CD1  . TYR A 1 59 ? -3.774  -4.760  4.929   1.00 0.00 ? 59 TYR A CD1  2  
ATOM 2322  C CD2  . TYR A 1 59 ? -2.748  -3.255  6.477   1.00 0.00 ? 59 TYR A CD2  2  
ATOM 2323  C CE1  . TYR A 1 59 ? -3.509  -5.859  5.821   1.00 0.00 ? 59 TYR A CE1  2  
ATOM 2324  C CE2  . TYR A 1 59 ? -2.483  -4.354  7.369   1.00 0.00 ? 59 TYR A CE2  2  
ATOM 2325  C CZ   . TYR A 1 59 ? -2.877  -5.601  6.997   1.00 0.00 ? 59 TYR A CZ   2  
ATOM 2326  O OH   . TYR A 1 59 ? -2.627  -6.639  7.840   1.00 0.00 ? 59 TYR A OH   2  
ATOM 2327  H H    . TYR A 1 59 ? -5.625  -2.420  2.458   1.00 0.00 ? 59 TYR A H    2  
ATOM 2328  H HA   . TYR A 1 59 ? -5.585  -1.926  5.353   1.00 0.00 ? 59 TYR A HA   2  
ATOM 2329  H HB2  . TYR A 1 59 ? -3.442  -2.625  3.307   1.00 0.00 ? 59 TYR A HB2  2  
ATOM 2330  H HB3  . TYR A 1 59 ? -2.994  -1.493  4.568   1.00 0.00 ? 59 TYR A HB3  2  
ATOM 2331  H HD1  . TYR A 1 59 ? -4.280  -4.938  3.979   1.00 0.00 ? 59 TYR A HD1  2  
ATOM 2332  H HD2  . TYR A 1 59 ? -2.443  -2.245  6.750   1.00 0.00 ? 59 TYR A HD2  2  
ATOM 2333  H HE1  . TYR A 1 59 ? -3.809  -6.874  5.560   1.00 0.00 ? 59 TYR A HE1  2  
ATOM 2334  H HE2  . TYR A 1 59 ? -1.979  -4.189  8.321   1.00 0.00 ? 59 TYR A HE2  2  
ATOM 2335  H HH   . TYR A 1 59 ? -1.811  -6.447  8.385   1.00 0.00 ? 59 TYR A HH   2  
ATOM 2336  N N    . GLY A 1 60 ? -4.202  0.043   3.124   1.00 0.00 ? 60 GLY A N    2  
ATOM 2337  C CA   . GLY A 1 60 ? -4.101  1.420   2.671   1.00 0.00 ? 60 GLY A CA   2  
ATOM 2338  C C    . GLY A 1 60 ? -4.936  1.645   1.409   1.00 0.00 ? 60 GLY A C    2  
ATOM 2339  O O    . GLY A 1 60 ? -4.903  0.833   0.486   1.00 0.00 ? 60 GLY A O    2  
ATOM 2340  H H    . GLY A 1 60 ? -3.531  -0.583  2.726   1.00 0.00 ? 60 GLY A H    2  
ATOM 2341  H HA2  . GLY A 1 60 ? -4.439  2.092   3.460   1.00 0.00 ? 60 GLY A HA2  2  
ATOM 2342  H HA3  . GLY A 1 60 ? -3.058  1.664   2.470   1.00 0.00 ? 60 GLY A HA3  2  
ATOM 2343  N N    . SER A 1 61 ? -5.664  2.752   1.409   1.00 0.00 ? 61 SER A N    2  
ATOM 2344  C CA   . SER A 1 61 ? -6.506  3.095   0.276   1.00 0.00 ? 61 SER A CA   2  
ATOM 2345  C C    . SER A 1 61 ? -6.664  4.614   0.181   1.00 0.00 ? 61 SER A C    2  
ATOM 2346  O O    . SER A 1 61 ? -6.931  5.277   1.181   1.00 0.00 ? 61 SER A O    2  
ATOM 2347  C CB   . SER A 1 61 ? -7.877  2.425   0.386   1.00 0.00 ? 61 SER A CB   2  
ATOM 2348  O OG   . SER A 1 61 ? -8.647  2.957   1.460   1.00 0.00 ? 61 SER A OG   2  
ATOM 2349  H H    . SER A 1 61 ? -5.684  3.408   2.164   1.00 0.00 ? 61 SER A H    2  
ATOM 2350  H HA   . SER A 1 61 ? -5.983  2.709   -0.599  1.00 0.00 ? 61 SER A HA   2  
ATOM 2351  H HB2  . SER A 1 61 ? -8.421  2.556   -0.550  1.00 0.00 ? 61 SER A HB2  2  
ATOM 2352  H HB3  . SER A 1 61 ? -7.746  1.352   0.530   1.00 0.00 ? 61 SER A HB3  2  
ATOM 2353  H HG   . SER A 1 61 ? -8.211  3.783   1.817   1.00 0.00 ? 61 SER A HG   2  
ATOM 2354  N N    . GLY A 1 62 ? -6.491  5.120   -1.031  1.00 0.00 ? 62 GLY A N    2  
ATOM 2355  C CA   . GLY A 1 62 ? -6.611  6.548   -1.270  1.00 0.00 ? 62 GLY A CA   2  
ATOM 2356  C C    . GLY A 1 62 ? -6.691  6.849   -2.768  1.00 0.00 ? 62 GLY A C    2  
ATOM 2357  O O    . GLY A 1 62 ? -6.678  5.935   -3.590  1.00 0.00 ? 62 GLY A O    2  
ATOM 2358  H H    . GLY A 1 62 ? -6.274  4.573   -1.840  1.00 0.00 ? 62 GLY A H    2  
ATOM 2359  H HA2  . GLY A 1 62 ? -7.501  6.930   -0.770  1.00 0.00 ? 62 GLY A HA2  2  
ATOM 2360  H HA3  . GLY A 1 62 ? -5.755  7.066   -0.836  1.00 0.00 ? 62 GLY A HA3  2  
ATOM 2361  N N    . THR A 1 63 ? -6.772  8.135   -3.077  1.00 0.00 ? 63 THR A N    2  
ATOM 2362  C CA   . THR A 1 63 ? -6.853  8.568   -4.461  1.00 0.00 ? 63 THR A CA   2  
ATOM 2363  C C    . THR A 1 63 ? -5.948  9.779   -4.696  1.00 0.00 ? 63 THR A C    2  
ATOM 2364  O O    . THR A 1 63 ? -5.366  10.315  -3.754  1.00 0.00 ? 63 THR A O    2  
ATOM 2365  C CB   . THR A 1 63 ? -8.324  8.838   -4.786  1.00 0.00 ? 63 THR A CB   2  
ATOM 2366  O OG1  . THR A 1 63 ? -8.744  9.744   -3.770  1.00 0.00 ? 63 THR A OG1  2  
ATOM 2367  C CG2  . THR A 1 63 ? -9.206  7.605   -4.574  1.00 0.00 ? 63 THR A CG2  2  
ATOM 2368  H H    . THR A 1 63 ? -6.782  8.873   -2.402  1.00 0.00 ? 63 THR A H    2  
ATOM 2369  H HA   . THR A 1 63 ? -6.482  7.763   -5.096  1.00 0.00 ? 63 THR A HA   2  
ATOM 2370  H HB   . THR A 1 63 ? -8.434  9.226   -5.799  1.00 0.00 ? 63 THR A HB   2  
ATOM 2371  H HG1  . THR A 1 63 ? -8.278  10.622  -3.881  1.00 0.00 ? 63 THR A HG1  2  
ATOM 2372  H HG21 . THR A 1 63 ? -9.791  7.418   -5.474  1.00 0.00 ? 63 THR A HG21 2  
ATOM 2373  H HG22 . THR A 1 63 ? -8.577  6.740   -4.363  1.00 0.00 ? 63 THR A HG22 2  
ATOM 2374  H HG23 . THR A 1 63 ? -9.878  7.780   -3.734  1.00 0.00 ? 63 THR A HG23 2  
ATOM 2375  N N    . ALA A 1 64 ? -5.857  10.174  -5.957  1.00 0.00 ? 64 ALA A N    2  
ATOM 2376  C CA   . ALA A 1 64 ? -5.032  11.311  -6.328  1.00 0.00 ? 64 ALA A CA   2  
ATOM 2377  C C    . ALA A 1 64 ? -5.356  11.725  -7.764  1.00 0.00 ? 64 ALA A C    2  
ATOM 2378  O O    . ALA A 1 64 ? -6.158  11.076  -8.435  1.00 0.00 ? 64 ALA A O    2  
ATOM 2379  C CB   . ALA A 1 64 ? -3.556  10.953  -6.143  1.00 0.00 ? 64 ALA A CB   2  
ATOM 2380  H H    . ALA A 1 64 ? -6.333  9.732   -6.717  1.00 0.00 ? 64 ALA A H    2  
ATOM 2381  H HA   . ALA A 1 64 ? -5.280  12.134  -5.657  1.00 0.00 ? 64 ALA A HA   2  
ATOM 2382  H HB1  . ALA A 1 64 ? -2.935  11.753  -6.547  1.00 0.00 ? 64 ALA A HB1  2  
ATOM 2383  H HB2  . ALA A 1 64 ? -3.342  10.828  -5.082  1.00 0.00 ? 64 ALA A HB2  2  
ATOM 2384  H HB3  . ALA A 1 64 ? -3.339  10.023  -6.669  1.00 0.00 ? 64 ALA A HB3  2  
ATOM 2385  N N    . SER A 1 65 ? -4.717  12.803  -8.195  1.00 0.00 ? 65 SER A N    2  
ATOM 2386  C CA   . SER A 1 65 ? -4.927  13.310  -9.540  1.00 0.00 ? 65 SER A CA   2  
ATOM 2387  C C    . SER A 1 65 ? -4.315  12.352  -10.563 1.00 0.00 ? 65 SER A C    2  
ATOM 2388  O O    . SER A 1 65 ? -4.824  12.217  -11.675 1.00 0.00 ? 65 SER A O    2  
ATOM 2389  C CB   . SER A 1 65 ? -4.330  14.710  -9.700  1.00 0.00 ? 65 SER A CB   2  
ATOM 2390  O OG   . SER A 1 65 ? -3.035  14.673  -10.295 1.00 0.00 ? 65 SER A OG   2  
ATOM 2391  H H    . SER A 1 65 ? -4.066  13.324  -7.643  1.00 0.00 ? 65 SER A H    2  
ATOM 2392  H HA   . SER A 1 65 ? -6.009  13.362  -9.663  1.00 0.00 ? 65 SER A HA   2  
ATOM 2393  H HB2  . SER A 1 65 ? -4.993  15.319  -10.314 1.00 0.00 ? 65 SER A HB2  2  
ATOM 2394  H HB3  . SER A 1 65 ? -4.267  15.191  -8.724  1.00 0.00 ? 65 SER A HB3  2  
ATOM 2395  H HG   . SER A 1 65 ? -2.910  15.466  -10.890 1.00 0.00 ? 65 SER A HG   2  
ATOM 2396  N N    . SER A 1 66 ? -3.232  11.709  -10.151 1.00 0.00 ? 66 SER A N    2  
ATOM 2397  C CA   . SER A 1 66 ? -2.546  10.767  -11.018 1.00 0.00 ? 66 SER A CA   2  
ATOM 2398  C C    . SER A 1 66 ? -2.692  9.347   -10.467 1.00 0.00 ? 66 SER A C    2  
ATOM 2399  O O    . SER A 1 66 ? -3.000  9.162   -9.291  1.00 0.00 ? 66 SER A O    2  
ATOM 2400  C CB   . SER A 1 66 ? -1.066  11.130  -11.164 1.00 0.00 ? 66 SER A CB   2  
ATOM 2401  O OG   . SER A 1 66 ? -0.579  10.865  -12.476 1.00 0.00 ? 66 SER A OG   2  
ATOM 2402  H H    . SER A 1 66 ? -2.825  11.824  -9.245  1.00 0.00 ? 66 SER A H    2  
ATOM 2403  H HA   . SER A 1 66 ? -3.038  10.854  -11.986 1.00 0.00 ? 66 SER A HA   2  
ATOM 2404  H HB2  . SER A 1 66 ? -0.928  12.186  -10.932 1.00 0.00 ? 66 SER A HB2  2  
ATOM 2405  H HB3  . SER A 1 66 ? -0.481  10.565  -10.438 1.00 0.00 ? 66 SER A HB3  2  
ATOM 2406  H HG   . SER A 1 66 ? -0.336  9.898   -12.562 1.00 0.00 ? 66 SER A HG   2  
ATOM 2407  N N    . LYS A 1 67 ? -2.463  8.380   -11.343 1.00 0.00 ? 67 LYS A N    2  
ATOM 2408  C CA   . LYS A 1 67 ? -2.566  6.982   -10.960 1.00 0.00 ? 67 LYS A CA   2  
ATOM 2409  C C    . LYS A 1 67 ? -1.481  6.660   -9.930  1.00 0.00 ? 67 LYS A C    2  
ATOM 2410  O O    . LYS A 1 67 ? -1.771  6.112   -8.868  1.00 0.00 ? 67 LYS A O    2  
ATOM 2411  C CB   . LYS A 1 67 ? -2.526  6.083   -12.197 1.00 0.00 ? 67 LYS A CB   2  
ATOM 2412  C CG   . LYS A 1 67 ? -3.729  5.138   -12.226 1.00 0.00 ? 67 LYS A CG   2  
ATOM 2413  C CD   . LYS A 1 67 ? -3.589  4.106   -13.346 1.00 0.00 ? 67 LYS A CD   2  
ATOM 2414  C CE   . LYS A 1 67 ? -4.888  3.982   -14.144 1.00 0.00 ? 67 LYS A CE   2  
ATOM 2415  N NZ   . LYS A 1 67 ? -5.279  2.561   -14.281 1.00 0.00 ? 67 LYS A NZ   2  
ATOM 2416  H H    . LYS A 1 67 ? -2.213  8.539   -12.298 1.00 0.00 ? 67 LYS A H    2  
ATOM 2417  H HA   . LYS A 1 67 ? -3.540  6.843   -10.491 1.00 0.00 ? 67 LYS A HA   2  
ATOM 2418  H HB2  . LYS A 1 67 ? -2.519  6.696   -13.097 1.00 0.00 ? 67 LYS A HB2  2  
ATOM 2419  H HB3  . LYS A 1 67 ? -1.603  5.503   -12.199 1.00 0.00 ? 67 LYS A HB3  2  
ATOM 2420  H HG2  . LYS A 1 67 ? -3.820  4.629   -11.267 1.00 0.00 ? 67 LYS A HG2  2  
ATOM 2421  H HG3  . LYS A 1 67 ? -4.644  5.713   -12.369 1.00 0.00 ? 67 LYS A HG3  2  
ATOM 2422  H HD2  . LYS A 1 67 ? -2.775  4.395   -14.012 1.00 0.00 ? 67 LYS A HD2  2  
ATOM 2423  H HD3  . LYS A 1 67 ? -3.324  3.137   -12.922 1.00 0.00 ? 67 LYS A HD3  2  
ATOM 2424  H HE2  . LYS A 1 67 ? -5.682  4.538   -13.646 1.00 0.00 ? 67 LYS A HE2  2  
ATOM 2425  H HE3  . LYS A 1 67 ? -4.759  4.426   -15.131 1.00 0.00 ? 67 LYS A HE3  2  
ATOM 2426  H HZ1  . LYS A 1 67 ? -4.460  1.988   -14.279 1.00 0.00 ? 67 LYS A HZ1  2  
ATOM 2427  H HZ2  . LYS A 1 67 ? -5.869  2.303   -13.515 1.00 0.00 ? 67 LYS A HZ2  2  
ATOM 2428  H HZ3  . LYS A 1 67 ? -5.774  2.432   -15.140 1.00 0.00 ? 67 LYS A HZ3  2  
ATOM 2429  N N    . LYS A 1 68 ? -0.253  7.014   -10.280 1.00 0.00 ? 68 LYS A N    2  
ATOM 2430  C CA   . LYS A 1 68 ? 0.876   6.769   -9.400  1.00 0.00 ? 68 LYS A CA   2  
ATOM 2431  C C    . LYS A 1 68 ? 0.534   7.258   -7.991  1.00 0.00 ? 68 LYS A C    2  
ATOM 2432  O O    . LYS A 1 68 ? 0.509   6.470   -7.046  1.00 0.00 ? 68 LYS A O    2  
ATOM 2433  C CB   . LYS A 1 68 ? 2.149   7.394   -9.975  1.00 0.00 ? 68 LYS A CB   2  
ATOM 2434  C CG   . LYS A 1 68 ? 2.828   6.443   -10.963 1.00 0.00 ? 68 LYS A CG   2  
ATOM 2435  C CD   . LYS A 1 68 ? 3.904   7.170   -11.772 1.00 0.00 ? 68 LYS A CD   2  
ATOM 2436  C CE   . LYS A 1 68 ? 3.381   7.556   -13.157 1.00 0.00 ? 68 LYS A CE   2  
ATOM 2437  N NZ   . LYS A 1 68 ? 4.314   7.098   -14.210 1.00 0.00 ? 68 LYS A NZ   2  
ATOM 2438  H H    . LYS A 1 68 ? -0.025  7.460   -11.146 1.00 0.00 ? 68 LYS A H    2  
ATOM 2439  H HA   . LYS A 1 68 ? 1.034   5.691   -9.363  1.00 0.00 ? 68 LYS A HA   2  
ATOM 2440  H HB2  . LYS A 1 68 ? 1.906   8.331   -10.476 1.00 0.00 ? 68 LYS A HB2  2  
ATOM 2441  H HB3  . LYS A 1 68 ? 2.838   7.635   -9.165  1.00 0.00 ? 68 LYS A HB3  2  
ATOM 2442  H HG2  . LYS A 1 68 ? 3.276   5.609   -10.422 1.00 0.00 ? 68 LYS A HG2  2  
ATOM 2443  H HG3  . LYS A 1 68 ? 2.083   6.021   -11.638 1.00 0.00 ? 68 LYS A HG3  2  
ATOM 2444  H HD2  . LYS A 1 68 ? 4.224   8.064   -11.238 1.00 0.00 ? 68 LYS A HD2  2  
ATOM 2445  H HD3  . LYS A 1 68 ? 4.780   6.530   -11.876 1.00 0.00 ? 68 LYS A HD3  2  
ATOM 2446  H HE2  . LYS A 1 68 ? 2.397   7.114   -13.317 1.00 0.00 ? 68 LYS A HE2  2  
ATOM 2447  H HE3  . LYS A 1 68 ? 3.258   8.638   -13.217 1.00 0.00 ? 68 LYS A HE3  2  
ATOM 2448  H HZ1  . LYS A 1 68 ? 4.401   6.103   -14.169 1.00 0.00 ? 68 LYS A HZ1  2  
ATOM 2449  H HZ2  . LYS A 1 68 ? 3.962   7.365   -15.107 1.00 0.00 ? 68 LYS A HZ2  2  
ATOM 2450  H HZ3  . LYS A 1 68 ? 5.211   7.517   -14.066 1.00 0.00 ? 68 LYS A HZ3  2  
ATOM 2451  N N    . LEU A 1 69 ? 0.280   8.554   -7.894  1.00 0.00 ? 69 LEU A N    2  
ATOM 2452  C CA   . LEU A 1 69 ? -0.059  9.157   -6.616  1.00 0.00 ? 69 LEU A CA   2  
ATOM 2453  C C    . LEU A 1 69 ? -0.985  8.216   -5.843  1.00 0.00 ? 69 LEU A C    2  
ATOM 2454  O O    . LEU A 1 69 ? -0.682  7.830   -4.715  1.00 0.00 ? 69 LEU A O    2  
ATOM 2455  C CB   . LEU A 1 69 ? -0.640  10.558  -6.822  1.00 0.00 ? 69 LEU A CB   2  
ATOM 2456  C CG   . LEU A 1 69 ? 0.368   11.659  -7.159  1.00 0.00 ? 69 LEU A CG   2  
ATOM 2457  C CD1  . LEU A 1 69 ? 0.842   12.375  -5.893  1.00 0.00 ? 69 LEU A CD1  2  
ATOM 2458  C CD2  . LEU A 1 69 ? 1.537   11.101  -7.974  1.00 0.00 ? 69 LEU A CD2  2  
ATOM 2459  H H    . LEU A 1 69 ? 0.303   9.188   -8.667  1.00 0.00 ? 69 LEU A H    2  
ATOM 2460  H HA   . LEU A 1 69 ? 0.867   9.271   -6.053  1.00 0.00 ? 69 LEU A HA   2  
ATOM 2461  H HB2  . LEU A 1 69 ? -1.377  10.510  -7.623  1.00 0.00 ? 69 LEU A HB2  2  
ATOM 2462  H HB3  . LEU A 1 69 ? -1.172  10.845  -5.915  1.00 0.00 ? 69 LEU A HB3  2  
ATOM 2463  H HG   . LEU A 1 69 ? -0.132  12.401  -7.780  1.00 0.00 ? 69 LEU A HG   2  
ATOM 2464  H HD11 . LEU A 1 69 ? 1.539   11.734  -5.352  1.00 0.00 ? 69 LEU A HD11 2  
ATOM 2465  H HD12 . LEU A 1 69 ? 1.341   13.304  -6.166  1.00 0.00 ? 69 LEU A HD12 2  
ATOM 2466  H HD13 . LEU A 1 69 ? -0.016  12.596  -5.258  1.00 0.00 ? 69 LEU A HD13 2  
ATOM 2467  H HD21 . LEU A 1 69 ? 1.902   10.187  -7.506  1.00 0.00 ? 69 LEU A HD21 2  
ATOM 2468  H HD22 . LEU A 1 69 ? 1.201   10.882  -8.987  1.00 0.00 ? 69 LEU A HD22 2  
ATOM 2469  H HD23 . LEU A 1 69 ? 2.340   11.837  -8.008  1.00 0.00 ? 69 LEU A HD23 2  
ATOM 2470  N N    . ALA A 1 70 ? -2.094  7.872   -6.481  1.00 0.00 ? 70 ALA A N    2  
ATOM 2471  C CA   . ALA A 1 70 ? -3.065  6.983   -5.867  1.00 0.00 ? 70 ALA A CA   2  
ATOM 2472  C C    . ALA A 1 70 ? -2.344  5.755   -5.306  1.00 0.00 ? 70 ALA A C    2  
ATOM 2473  O O    . ALA A 1 70 ? -2.472  5.442   -4.124  1.00 0.00 ? 70 ALA A O    2  
ATOM 2474  C CB   . ALA A 1 70 ? -4.138  6.611   -6.893  1.00 0.00 ? 70 ALA A CB   2  
ATOM 2475  H H    . ALA A 1 70 ? -2.333  8.190   -7.398  1.00 0.00 ? 70 ALA A H    2  
ATOM 2476  H HA   . ALA A 1 70 ? -3.537  7.523   -5.046  1.00 0.00 ? 70 ALA A HA   2  
ATOM 2477  H HB1  . ALA A 1 70 ? -5.039  6.284   -6.374  1.00 0.00 ? 70 ALA A HB1  2  
ATOM 2478  H HB2  . ALA A 1 70 ? -4.369  7.481   -7.508  1.00 0.00 ? 70 ALA A HB2  2  
ATOM 2479  H HB3  . ALA A 1 70 ? -3.770  5.805   -7.527  1.00 0.00 ? 70 ALA A HB3  2  
ATOM 2480  N N    . LYS A 1 71 ? -1.602  5.094   -6.182  1.00 0.00 ? 71 LYS A N    2  
ATOM 2481  C CA   . LYS A 1 71 ? -0.860  3.907   -5.790  1.00 0.00 ? 71 LYS A CA   2  
ATOM 2482  C C    . LYS A 1 71 ? 0.091   4.261   -4.645  1.00 0.00 ? 71 LYS A C    2  
ATOM 2483  O O    . LYS A 1 71 ? 0.170   3.538   -3.653  1.00 0.00 ? 71 LYS A O    2  
ATOM 2484  C CB   . LYS A 1 71 ? -0.161  3.288   -7.002  1.00 0.00 ? 71 LYS A CB   2  
ATOM 2485  C CG   . LYS A 1 71 ? -0.389  1.776   -7.053  1.00 0.00 ? 71 LYS A CG   2  
ATOM 2486  C CD   . LYS A 1 71 ? 0.210   1.174   -8.325  1.00 0.00 ? 71 LYS A CD   2  
ATOM 2487  C CE   . LYS A 1 71 ? 1.444   0.328   -8.003  1.00 0.00 ? 71 LYS A CE   2  
ATOM 2488  N NZ   . LYS A 1 71 ? 2.446   0.438   -9.087  1.00 0.00 ? 71 LYS A NZ   2  
ATOM 2489  H H    . LYS A 1 71 ? -1.504  5.355   -7.142  1.00 0.00 ? 71 LYS A H    2  
ATOM 2490  H HA   . LYS A 1 71 ? -1.582  3.176   -5.426  1.00 0.00 ? 71 LYS A HA   2  
ATOM 2491  H HB2  . LYS A 1 71 ? -0.535  3.747   -7.917  1.00 0.00 ? 71 LYS A HB2  2  
ATOM 2492  H HB3  . LYS A 1 71 ? 0.908   3.497   -6.955  1.00 0.00 ? 71 LYS A HB3  2  
ATOM 2493  H HG2  . LYS A 1 71 ? 0.060   1.307   -6.177  1.00 0.00 ? 71 LYS A HG2  2  
ATOM 2494  H HG3  . LYS A 1 71 ? -1.458  1.564   -7.015  1.00 0.00 ? 71 LYS A HG3  2  
ATOM 2495  H HD2  . LYS A 1 71 ? -0.536  0.558   -8.827  1.00 0.00 ? 71 LYS A HD2  2  
ATOM 2496  H HD3  . LYS A 1 71 ? 0.483   1.971   -9.016  1.00 0.00 ? 71 LYS A HD3  2  
ATOM 2497  H HE2  . LYS A 1 71 ? 1.882   0.657   -7.060  1.00 0.00 ? 71 LYS A HE2  2  
ATOM 2498  H HE3  . LYS A 1 71 ? 1.153   -0.715  -7.872  1.00 0.00 ? 71 LYS A HE3  2  
ATOM 2499  H HZ1  . LYS A 1 71 ? 3.365   0.401   -8.696  1.00 0.00 ? 71 LYS A HZ1  2  
ATOM 2500  H HZ2  . LYS A 1 71 ? 2.326   -0.319  -9.729  1.00 0.00 ? 71 LYS A HZ2  2  
ATOM 2501  H HZ3  . LYS A 1 71 ? 2.322   1.306   -9.568  1.00 0.00 ? 71 LYS A HZ3  2  
ATOM 2502  N N    . ASN A 1 72 ? 0.789   5.374   -4.821  1.00 0.00 ? 72 ASN A N    2  
ATOM 2503  C CA   . ASN A 1 72 ? 1.731   5.832   -3.814  1.00 0.00 ? 72 ASN A CA   2  
ATOM 2504  C C    . ASN A 1 72 ? 1.003   6.002   -2.479  1.00 0.00 ? 72 ASN A C    2  
ATOM 2505  O O    . ASN A 1 72 ? 1.560   5.708   -1.423  1.00 0.00 ? 72 ASN A O    2  
ATOM 2506  C CB   . ASN A 1 72 ? 2.334   7.185   -4.200  1.00 0.00 ? 72 ASN A CB   2  
ATOM 2507  C CG   . ASN A 1 72 ? 3.073   7.813   -3.016  1.00 0.00 ? 72 ASN A CG   2  
ATOM 2508  O OD1  . ASN A 1 72 ? 4.061   7.295   -2.523  1.00 0.00 ? 72 ASN A OD1  2  
ATOM 2509  N ND2  . ASN A 1 72 ? 2.540   8.954   -2.590  1.00 0.00 ? 72 ASN A ND2  2  
ATOM 2510  H H    . ASN A 1 72 ? 0.718   5.956   -5.630  1.00 0.00 ? 72 ASN A H    2  
ATOM 2511  H HA   . ASN A 1 72 ? 2.503   5.064   -3.774  1.00 0.00 ? 72 ASN A HA   2  
ATOM 2512  H HB2  . ASN A 1 72 ? 3.021   7.056   -5.036  1.00 0.00 ? 72 ASN A HB2  2  
ATOM 2513  H HB3  . ASN A 1 72 ? 1.544   7.856   -4.537  1.00 0.00 ? 72 ASN A HB3  2  
ATOM 2514  H HD21 . ASN A 1 72 ? 1.727   9.325   -3.039  1.00 0.00 ? 72 ASN A HD21 2  
ATOM 2515  H HD22 . ASN A 1 72 ? 2.952   9.442   -1.820  1.00 0.00 ? 72 ASN A HD22 2  
ATOM 2516  N N    . LYS A 1 73 ? -0.231  6.475   -2.571  1.00 0.00 ? 73 LYS A N    2  
ATOM 2517  C CA   . LYS A 1 73 ? -1.041  6.687   -1.383  1.00 0.00 ? 73 LYS A CA   2  
ATOM 2518  C C    . LYS A 1 73 ? -1.447  5.333   -0.800  1.00 0.00 ? 73 LYS A C    2  
ATOM 2519  O O    . LYS A 1 73 ? -1.237  5.074   0.384   1.00 0.00 ? 73 LYS A O    2  
ATOM 2520  C CB   . LYS A 1 73 ? -2.226  7.602   -1.699  1.00 0.00 ? 73 LYS A CB   2  
ATOM 2521  C CG   . LYS A 1 73 ? -1.831  9.074   -1.574  1.00 0.00 ? 73 LYS A CG   2  
ATOM 2522  C CD   . LYS A 1 73 ? -2.912  9.984   -2.161  1.00 0.00 ? 73 LYS A CD   2  
ATOM 2523  C CE   . LYS A 1 73 ? -2.896  11.359  -1.490  1.00 0.00 ? 73 LYS A CE   2  
ATOM 2524  N NZ   . LYS A 1 73 ? -3.134  12.425  -2.488  1.00 0.00 ? 73 LYS A NZ   2  
ATOM 2525  H H    . LYS A 1 73 ? -0.676  6.712   -3.434  1.00 0.00 ? 73 LYS A H    2  
ATOM 2526  H HA   . LYS A 1 73 ? -0.420  7.206   -0.653  1.00 0.00 ? 73 LYS A HA   2  
ATOM 2527  H HB2  . LYS A 1 73 ? -2.585  7.402   -2.709  1.00 0.00 ? 73 LYS A HB2  2  
ATOM 2528  H HB3  . LYS A 1 73 ? -3.050  7.383   -1.020  1.00 0.00 ? 73 LYS A HB3  2  
ATOM 2529  H HG2  . LYS A 1 73 ? -1.672  9.324   -0.525  1.00 0.00 ? 73 LYS A HG2  2  
ATOM 2530  H HG3  . LYS A 1 73 ? -0.886  9.247   -2.089  1.00 0.00 ? 73 LYS A HG3  2  
ATOM 2531  H HD2  . LYS A 1 73 ? -2.754  10.097  -3.234  1.00 0.00 ? 73 LYS A HD2  2  
ATOM 2532  H HD3  . LYS A 1 73 ? -3.891  9.523   -2.031  1.00 0.00 ? 73 LYS A HD3  2  
ATOM 2533  H HE2  . LYS A 1 73 ? -3.662  11.401  -0.715  1.00 0.00 ? 73 LYS A HE2  2  
ATOM 2534  H HE3  . LYS A 1 73 ? -1.937  11.519  -0.999  1.00 0.00 ? 73 LYS A HE3  2  
ATOM 2535  H HZ1  . LYS A 1 73 ? -3.589  12.037  -3.289  1.00 0.00 ? 73 LYS A HZ1  2  
ATOM 2536  H HZ2  . LYS A 1 73 ? -3.713  13.135  -2.087  1.00 0.00 ? 73 LYS A HZ2  2  
ATOM 2537  H HZ3  . LYS A 1 73 ? -2.259  12.825  -2.763  1.00 0.00 ? 73 LYS A HZ3  2  
ATOM 2538  N N    . ALA A 1 74 ? -2.022  4.503   -1.658  1.00 0.00 ? 74 ALA A N    2  
ATOM 2539  C CA   . ALA A 1 74 ? -2.460  3.182   -1.243  1.00 0.00 ? 74 ALA A CA   2  
ATOM 2540  C C    . ALA A 1 74 ? -1.339  2.501   -0.456  1.00 0.00 ? 74 ALA A C    2  
ATOM 2541  O O    . ALA A 1 74 ? -1.581  1.922   0.602   1.00 0.00 ? 74 ALA A O    2  
ATOM 2542  C CB   . ALA A 1 74 ? -2.883  2.374   -2.472  1.00 0.00 ? 74 ALA A CB   2  
ATOM 2543  H H    . ALA A 1 74 ? -2.190  4.721   -2.620  1.00 0.00 ? 74 ALA A H    2  
ATOM 2544  H HA   . ALA A 1 74 ? -3.325  3.308   -0.591  1.00 0.00 ? 74 ALA A HA   2  
ATOM 2545  H HB1  . ALA A 1 74 ? -1.997  1.984   -2.973  1.00 0.00 ? 74 ALA A HB1  2  
ATOM 2546  H HB2  . ALA A 1 74 ? -3.519  1.545   -2.161  1.00 0.00 ? 74 ALA A HB2  2  
ATOM 2547  H HB3  . ALA A 1 74 ? -3.435  3.017   -3.157  1.00 0.00 ? 74 ALA A HB3  2  
ATOM 2548  N N    . ALA A 1 75 ? -0.135  2.594   -1.002  1.00 0.00 ? 75 ALA A N    2  
ATOM 2549  C CA   . ALA A 1 75 ? 1.025   1.995   -0.364  1.00 0.00 ? 75 ALA A CA   2  
ATOM 2550  C C    . ALA A 1 75 ? 1.436   2.845   0.840   1.00 0.00 ? 75 ALA A C    2  
ATOM 2551  O O    . ALA A 1 75 ? 1.526   2.342   1.958   1.00 0.00 ? 75 ALA A O    2  
ATOM 2552  C CB   . ALA A 1 75 ? 2.153   1.850   -1.388  1.00 0.00 ? 75 ALA A CB   2  
ATOM 2553  H H    . ALA A 1 75 ? 0.053   3.068   -1.863  1.00 0.00 ? 75 ALA A H    2  
ATOM 2554  H HA   . ALA A 1 75 ? 0.737   1.003   -0.016  1.00 0.00 ? 75 ALA A HA   2  
ATOM 2555  H HB1  . ALA A 1 75 ? 2.540   0.831   -1.360  1.00 0.00 ? 75 ALA A HB1  2  
ATOM 2556  H HB2  . ALA A 1 75 ? 1.769   2.066   -2.385  1.00 0.00 ? 75 ALA A HB2  2  
ATOM 2557  H HB3  . ALA A 1 75 ? 2.953   2.549   -1.147  1.00 0.00 ? 75 ALA A HB3  2  
ATOM 2558  N N    . ARG A 1 76 ? 1.674   4.120   0.569   1.00 0.00 ? 76 ARG A N    2  
ATOM 2559  C CA   . ARG A 1 76 ? 2.073   5.046   1.616   1.00 0.00 ? 76 ARG A CA   2  
ATOM 2560  C C    . ARG A 1 76 ? 1.212   4.839   2.864   1.00 0.00 ? 76 ARG A C    2  
ATOM 2561  O O    . ARG A 1 76 ? 1.705   4.937   3.987   1.00 0.00 ? 76 ARG A O    2  
ATOM 2562  C CB   . ARG A 1 76 ? 1.941   6.496   1.149   1.00 0.00 ? 76 ARG A CB   2  
ATOM 2563  C CG   . ARG A 1 76 ? 2.335   7.469   2.263   1.00 0.00 ? 76 ARG A CG   2  
ATOM 2564  C CD   . ARG A 1 76 ? 1.400   8.680   2.289   1.00 0.00 ? 76 ARG A CD   2  
ATOM 2565  N NE   . ARG A 1 76 ? 1.537   9.397   3.576   1.00 0.00 ? 76 ARG A NE   2  
ATOM 2566  C CZ   . ARG A 1 76 ? 0.933   10.561  3.855   1.00 0.00 ? 76 ARG A CZ   2  
ATOM 2567  N NH1  . ARG A 1 76 ? 0.149   11.146  2.940   1.00 0.00 ? 76 ARG A NH1  2  
ATOM 2568  N NH2  . ARG A 1 76 ? 1.115   11.140  5.050   1.00 0.00 ? 76 ARG A NH2  2  
ATOM 2569  H H    . ARG A 1 76 ? 1.598   4.522   -0.343  1.00 0.00 ? 76 ARG A H    2  
ATOM 2570  H HA   . ARG A 1 76 ? 3.117   4.806   1.817   1.00 0.00 ? 76 ARG A HA   2  
ATOM 2571  H HB2  . ARG A 1 76 ? 2.575   6.660   0.277   1.00 0.00 ? 76 ARG A HB2  2  
ATOM 2572  H HB3  . ARG A 1 76 ? 0.915   6.690   0.838   1.00 0.00 ? 76 ARG A HB3  2  
ATOM 2573  H HG2  . ARG A 1 76 ? 2.301   6.958   3.225   1.00 0.00 ? 76 ARG A HG2  2  
ATOM 2574  H HG3  . ARG A 1 76 ? 3.362   7.801   2.114   1.00 0.00 ? 76 ARG A HG3  2  
ATOM 2575  H HD2  . ARG A 1 76 ? 1.637   9.350   1.462   1.00 0.00 ? 76 ARG A HD2  2  
ATOM 2576  H HD3  . ARG A 1 76 ? 0.368   8.357   2.151   1.00 0.00 ? 76 ARG A HD3  2  
ATOM 2577  H HE   . ARG A 1 76 ? 2.115   8.988   4.281   1.00 0.00 ? 76 ARG A HE   2  
ATOM 2578  H HH11 . ARG A 1 76 ? 0.014   10.714  2.048   1.00 0.00 ? 76 ARG A HH11 2  
ATOM 2579  H HH12 . ARG A 1 76 ? -0.301  12.014  3.148   1.00 0.00 ? 76 ARG A HH12 2  
ATOM 2580  H HH21 . ARG A 1 76 ? 1.700   10.703  5.733   1.00 0.00 ? 76 ARG A HH21 2  
ATOM 2581  H HH22 . ARG A 1 76 ? 0.665   12.008  5.259   1.00 0.00 ? 76 ARG A HH22 2  
ATOM 2582  N N    . ALA A 1 77 ? -0.061  4.557   2.626   1.00 0.00 ? 77 ALA A N    2  
ATOM 2583  C CA   . ALA A 1 77 ? -0.995  4.336   3.716   1.00 0.00 ? 77 ALA A CA   2  
ATOM 2584  C C    . ALA A 1 77 ? -0.615  3.051   4.455   1.00 0.00 ? 77 ALA A C    2  
ATOM 2585  O O    . ALA A 1 77 ? -0.238  3.093   5.626   1.00 0.00 ? 77 ALA A O    2  
ATOM 2586  C CB   . ALA A 1 77 ? -2.422  4.290   3.165   1.00 0.00 ? 77 ALA A CB   2  
ATOM 2587  H H    . ALA A 1 77 ? -0.454  4.479   1.710   1.00 0.00 ? 77 ALA A H    2  
ATOM 2588  H HA   . ALA A 1 77 ? -0.911  5.178   4.402   1.00 0.00 ? 77 ALA A HA   2  
ATOM 2589  H HB1  . ALA A 1 77 ? -2.924  3.393   3.528   1.00 0.00 ? 77 ALA A HB1  2  
ATOM 2590  H HB2  . ALA A 1 77 ? -2.968  5.173   3.498   1.00 0.00 ? 77 ALA A HB2  2  
ATOM 2591  H HB3  . ALA A 1 77 ? -2.390  4.272   2.075   1.00 0.00 ? 77 ALA A HB3  2  
ATOM 2592  N N    . THR A 1 78 ? -0.727  1.940   3.742   1.00 0.00 ? 78 THR A N    2  
ATOM 2593  C CA   . THR A 1 78 ? -0.399  0.646   4.316   1.00 0.00 ? 78 THR A CA   2  
ATOM 2594  C C    . THR A 1 78 ? 0.848   0.753   5.195   1.00 0.00 ? 78 THR A C    2  
ATOM 2595  O O    . THR A 1 78 ? 0.899   0.175   6.279   1.00 0.00 ? 78 THR A O    2  
ATOM 2596  C CB   . THR A 1 78 ? -0.250  -0.355  3.169   1.00 0.00 ? 78 THR A CB   2  
ATOM 2597  O OG1  . THR A 1 78 ? -1.575  -0.509  2.667   1.00 0.00 ? 78 THR A OG1  2  
ATOM 2598  C CG2  . THR A 1 78 ? 0.128   -1.755  3.659   1.00 0.00 ? 78 THR A CG2  2  
ATOM 2599  H H    . THR A 1 78 ? -1.034  1.915   2.791   1.00 0.00 ? 78 THR A H    2  
ATOM 2600  H HA   . THR A 1 78 ? -1.221  0.339   4.962   1.00 0.00 ? 78 THR A HA   2  
ATOM 2601  H HB   . THR A 1 78 ? 0.465   0.004   2.429   1.00 0.00 ? 78 THR A HB   2  
ATOM 2602  H HG1  . THR A 1 78 ? -1.773  0.208   1.999   1.00 0.00 ? 78 THR A HG1  2  
ATOM 2603  H HG21 . THR A 1 78 ? -0.238  -1.894  4.676   1.00 0.00 ? 78 THR A HG21 2  
ATOM 2604  H HG22 . THR A 1 78 ? -0.322  -2.502  3.005   1.00 0.00 ? 78 THR A HG22 2  
ATOM 2605  H HG23 . THR A 1 78 ? 1.212   -1.864  3.644   1.00 0.00 ? 78 THR A HG23 2  
ATOM 2606  N N    . LEU A 1 79 ? 1.824   1.498   4.695   1.00 0.00 ? 79 LEU A N    2  
ATOM 2607  C CA   . LEU A 1 79 ? 3.068   1.688   5.422   1.00 0.00 ? 79 LEU A CA   2  
ATOM 2608  C C    . LEU A 1 79 ? 2.764   2.293   6.794   1.00 0.00 ? 79 LEU A C    2  
ATOM 2609  O O    . LEU A 1 79 ? 3.225   1.787   7.816   1.00 0.00 ? 79 LEU A O    2  
ATOM 2610  C CB   . LEU A 1 79 ? 4.053   2.512   4.591   1.00 0.00 ? 79 LEU A CB   2  
ATOM 2611  C CG   . LEU A 1 79 ? 4.944   1.723   3.630   1.00 0.00 ? 79 LEU A CG   2  
ATOM 2612  C CD1  . LEU A 1 79 ? 5.992   2.630   2.983   1.00 0.00 ? 79 LEU A CD1  2  
ATOM 2613  C CD2  . LEU A 1 79 ? 5.580   0.522   4.332   1.00 0.00 ? 79 LEU A CD2  2  
ATOM 2614  H H    . LEU A 1 79 ? 1.774   1.965   3.813   1.00 0.00 ? 79 LEU A H    2  
ATOM 2615  H HA   . LEU A 1 79 ? 3.514   0.705   5.569   1.00 0.00 ? 79 LEU A HA   2  
ATOM 2616  H HB2  . LEU A 1 79 ? 3.488   3.244   4.013   1.00 0.00 ? 79 LEU A HB2  2  
ATOM 2617  H HB3  . LEU A 1 79 ? 4.694   3.071   5.273   1.00 0.00 ? 79 LEU A HB3  2  
ATOM 2618  H HG   . LEU A 1 79 ? 4.318   1.332   2.827   1.00 0.00 ? 79 LEU A HG   2  
ATOM 2619  H HD11 . LEU A 1 79 ? 6.687   2.025   2.401   1.00 0.00 ? 79 LEU A HD11 2  
ATOM 2620  H HD12 . LEU A 1 79 ? 5.497   3.347   2.327   1.00 0.00 ? 79 LEU A HD12 2  
ATOM 2621  H HD13 . LEU A 1 79 ? 6.538   3.165   3.760   1.00 0.00 ? 79 LEU A HD13 2  
ATOM 2622  H HD21 . LEU A 1 79 ? 4.848   -0.281  4.415   1.00 0.00 ? 79 LEU A HD21 2  
ATOM 2623  H HD22 . LEU A 1 79 ? 6.437   0.175   3.755   1.00 0.00 ? 79 LEU A HD22 2  
ATOM 2624  H HD23 . LEU A 1 79 ? 5.910   0.817   5.329   1.00 0.00 ? 79 LEU A HD23 2  
ATOM 2625  N N    . GLU A 1 80 ? 1.990   3.368   6.773   1.00 0.00 ? 80 GLU A N    2  
ATOM 2626  C CA   . GLU A 1 80 ? 1.619   4.047   8.003   1.00 0.00 ? 80 GLU A CA   2  
ATOM 2627  C C    . GLU A 1 80 ? 0.957   3.066   8.973   1.00 0.00 ? 80 GLU A C    2  
ATOM 2628  O O    . GLU A 1 80 ? 1.281   3.046   10.159  1.00 0.00 ? 80 GLU A O    2  
ATOM 2629  C CB   . GLU A 1 80 ? 0.702   5.238   7.717   1.00 0.00 ? 80 GLU A CB   2  
ATOM 2630  C CG   . GLU A 1 80 ? 1.483   6.391   7.081   1.00 0.00 ? 80 GLU A CG   2  
ATOM 2631  C CD   . GLU A 1 80 ? 1.231   7.702   7.828   1.00 0.00 ? 80 GLU A CD   2  
ATOM 2632  O OE1  . GLU A 1 80 ? 1.907   7.906   8.860   1.00 0.00 ? 80 GLU A OE1  2  
ATOM 2633  O OE2  . GLU A 1 80 ? 0.368   8.470   7.351   1.00 0.00 ? 80 GLU A OE2  2  
ATOM 2634  H H    . GLU A 1 80 ? 1.618   3.774   5.938   1.00 0.00 ? 80 GLU A H    2  
ATOM 2635  H HA   . GLU A 1 80 ? 2.555   4.411   8.427   1.00 0.00 ? 80 GLU A HA   2  
ATOM 2636  H HB2  . GLU A 1 80 ? -0.104  4.930   7.051   1.00 0.00 ? 80 GLU A HB2  2  
ATOM 2637  H HB3  . GLU A 1 80 ? 0.239   5.576   8.644   1.00 0.00 ? 80 GLU A HB3  2  
ATOM 2638  H HG2  . GLU A 1 80 ? 2.548   6.161   7.090   1.00 0.00 ? 80 GLU A HG2  2  
ATOM 2639  H HG3  . GLU A 1 80 ? 1.190   6.501   6.037   1.00 0.00 ? 80 GLU A HG3  2  
ATOM 2640  N N    . ILE A 1 81 ? 0.040   2.277   8.432   1.00 0.00 ? 81 ILE A N    2  
ATOM 2641  C CA   . ILE A 1 81 ? -0.670  1.296   9.234   1.00 0.00 ? 81 ILE A CA   2  
ATOM 2642  C C    . ILE A 1 81 ? 0.340   0.453   10.014  1.00 0.00 ? 81 ILE A C    2  
ATOM 2643  O O    . ILE A 1 81 ? 0.217   0.296   11.228  1.00 0.00 ? 81 ILE A O    2  
ATOM 2644  C CB   . ILE A 1 81 ? -1.614  0.470   8.358   1.00 0.00 ? 81 ILE A CB   2  
ATOM 2645  C CG1  . ILE A 1 81 ? -2.789  1.318   7.866   1.00 0.00 ? 81 ILE A CG1  2  
ATOM 2646  C CG2  . ILE A 1 81 ? -2.083  -0.788  9.092   1.00 0.00 ? 81 ILE A CG2  2  
ATOM 2647  C CD1  . ILE A 1 81 ? -3.747  0.484   7.012   1.00 0.00 ? 81 ILE A CD1  2  
ATOM 2648  H H    . ILE A 1 81 ? -0.218  2.300   7.466   1.00 0.00 ? 81 ILE A H    2  
ATOM 2649  H HA   . ILE A 1 81 ? -1.288  1.843   9.947   1.00 0.00 ? 81 ILE A HA   2  
ATOM 2650  H HB   . ILE A 1 81 ? -1.063  0.142   7.477   1.00 0.00 ? 81 ILE A HB   2  
ATOM 2651  H HG12 . ILE A 1 81 ? -3.324  1.733   8.719   1.00 0.00 ? 81 ILE A HG12 2  
ATOM 2652  H HG13 . ILE A 1 81 ? -2.415  2.160   7.283   1.00 0.00 ? 81 ILE A HG13 2  
ATOM 2653  H HG21 . ILE A 1 81 ? -3.172  -0.834  9.075   1.00 0.00 ? 81 ILE A HG21 2  
ATOM 2654  H HG22 . ILE A 1 81 ? -1.675  -1.670  8.599   1.00 0.00 ? 81 ILE A HG22 2  
ATOM 2655  H HG23 . ILE A 1 81 ? -1.737  -0.756  10.125  1.00 0.00 ? 81 ILE A HG23 2  
ATOM 2656  H HD11 . ILE A 1 81 ? -3.504  -0.573  7.120   1.00 0.00 ? 81 ILE A HD11 2  
ATOM 2657  H HD12 . ILE A 1 81 ? -4.771  0.658   7.341   1.00 0.00 ? 81 ILE A HD12 2  
ATOM 2658  H HD13 . ILE A 1 81 ? -3.648  0.775   5.966   1.00 0.00 ? 81 ILE A HD13 2  
ATOM 2659  N N    . LEU A 1 82 ? 1.317   -0.067  9.286   1.00 0.00 ? 82 LEU A N    2  
ATOM 2660  C CA   . LEU A 1 82 ? 2.348   -0.890  9.895   1.00 0.00 ? 82 LEU A CA   2  
ATOM 2661  C C    . LEU A 1 82 ? 3.283   -0.002  10.719  1.00 0.00 ? 82 LEU A C    2  
ATOM 2662  O O    . LEU A 1 82 ? 3.327   -0.110  11.943  1.00 0.00 ? 82 LEU A O    2  
ATOM 2663  C CB   . LEU A 1 82 ? 3.068   -1.721  8.831   1.00 0.00 ? 82 LEU A CB   2  
ATOM 2664  C CG   . LEU A 1 82 ? 2.173   -2.423  7.808   1.00 0.00 ? 82 LEU A CG   2  
ATOM 2665  C CD1  . LEU A 1 82 ? 2.562   -2.036  6.380   1.00 0.00 ? 82 LEU A CD1  2  
ATOM 2666  C CD2  . LEU A 1 82 ? 2.188   -3.939  8.016   1.00 0.00 ? 82 LEU A CD2  2  
ATOM 2667  H H    . LEU A 1 82 ? 1.410   0.065   8.299   1.00 0.00 ? 82 LEU A H    2  
ATOM 2668  H HA   . LEU A 1 82 ? 1.853   -1.589  10.569  1.00 0.00 ? 82 LEU A HA   2  
ATOM 2669  H HB2  . LEU A 1 82 ? 3.757   -1.068  8.294   1.00 0.00 ? 82 LEU A HB2  2  
ATOM 2670  H HB3  . LEU A 1 82 ? 3.672   -2.475  9.335   1.00 0.00 ? 82 LEU A HB3  2  
ATOM 2671  H HG   . LEU A 1 82 ? 1.148   -2.087  7.964   1.00 0.00 ? 82 LEU A HG   2  
ATOM 2672  H HD11 . LEU A 1 82 ? 3.124   -1.102  6.398   1.00 0.00 ? 82 LEU A HD11 2  
ATOM 2673  H HD12 . LEU A 1 82 ? 3.179   -2.823  5.946   1.00 0.00 ? 82 LEU A HD12 2  
ATOM 2674  H HD13 . LEU A 1 82 ? 1.662   -1.907  5.780   1.00 0.00 ? 82 LEU A HD13 2  
ATOM 2675  H HD21 . LEU A 1 82 ? 2.408   -4.160  9.060   1.00 0.00 ? 82 LEU A HD21 2  
ATOM 2676  H HD22 . LEU A 1 82 ? 1.213   -4.351  7.755   1.00 0.00 ? 82 LEU A HD22 2  
ATOM 2677  H HD23 . LEU A 1 82 ? 2.953   -4.385  7.380   1.00 0.00 ? 82 LEU A HD23 2  
ATOM 2678  N N    . ILE A 1 83 ? 4.006   0.856   10.013  1.00 0.00 ? 83 ILE A N    2  
ATOM 2679  C CA   . ILE A 1 83 ? 4.937   1.762   10.664  1.00 0.00 ? 83 ILE A CA   2  
ATOM 2680  C C    . ILE A 1 83 ? 4.167   2.955   11.233  1.00 0.00 ? 83 ILE A C    2  
ATOM 2681  O O    . ILE A 1 83 ? 3.599   3.747   10.483  1.00 0.00 ? 83 ILE A O    2  
ATOM 2682  C CB   . ILE A 1 83 ? 6.061   2.156   9.704   1.00 0.00 ? 83 ILE A CB   2  
ATOM 2683  C CG1  . ILE A 1 83 ? 6.443   0.985   8.796   1.00 0.00 ? 83 ILE A CG1  2  
ATOM 2684  C CG2  . ILE A 1 83 ? 7.267   2.707   10.467  1.00 0.00 ? 83 ILE A CG2  2  
ATOM 2685  C CD1  . ILE A 1 83 ? 7.770   1.253   8.085   1.00 0.00 ? 83 ILE A CD1  2  
ATOM 2686  H H    . ILE A 1 83 ? 3.963   0.937   9.018   1.00 0.00 ? 83 ILE A H    2  
ATOM 2687  H HA   . ILE A 1 83 ? 5.396   1.220   11.492  1.00 0.00 ? 83 ILE A HA   2  
ATOM 2688  H HB   . ILE A 1 83 ? 5.695   2.956   9.060   1.00 0.00 ? 83 ILE A HB   2  
ATOM 2689  H HG12 . ILE A 1 83 ? 6.521   0.073   9.388   1.00 0.00 ? 83 ILE A HG12 2  
ATOM 2690  H HG13 . ILE A 1 83 ? 5.657   0.821   8.059   1.00 0.00 ? 83 ILE A HG13 2  
ATOM 2691  H HG21 . ILE A 1 83 ? 7.660   3.579   9.945   1.00 0.00 ? 83 ILE A HG21 2  
ATOM 2692  H HG22 . ILE A 1 83 ? 6.960   2.993   11.473  1.00 0.00 ? 83 ILE A HG22 2  
ATOM 2693  H HG23 . ILE A 1 83 ? 8.039   1.941   10.528  1.00 0.00 ? 83 ILE A HG23 2  
ATOM 2694  H HD11 . ILE A 1 83 ? 7.936   2.328   8.018   1.00 0.00 ? 83 ILE A HD11 2  
ATOM 2695  H HD12 . ILE A 1 83 ? 8.583   0.795   8.648   1.00 0.00 ? 83 ILE A HD12 2  
ATOM 2696  H HD13 . ILE A 1 83 ? 7.738   0.828   7.082   1.00 0.00 ? 83 ILE A HD13 2  
ATOM 2697  N N    . PRO A 1 84 ? 4.173   3.049   12.590  1.00 0.00 ? 84 PRO A N    2  
ATOM 2698  C CA   . PRO A 1 84 ? 3.482   4.132   13.268  1.00 0.00 ? 84 PRO A CA   2  
ATOM 2699  C C    . PRO A 1 84 ? 4.260   5.444   13.140  1.00 0.00 ? 84 PRO A C    2  
ATOM 2700  O O    . PRO A 1 84 ? 3.666   6.520   13.101  1.00 0.00 ? 84 PRO A O    2  
ATOM 2701  C CB   . PRO A 1 84 ? 3.338   3.666   14.708  1.00 0.00 ? 84 PRO A CB   2  
ATOM 2702  C CG   . PRO A 1 84 ? 4.355   2.552   14.890  1.00 0.00 ? 84 PRO A CG   2  
ATOM 2703  C CD   . PRO A 1 84 ? 4.835   2.129   13.511  1.00 0.00 ? 84 PRO A CD   2  
ATOM 2704  H HA   . PRO A 1 84 ? 2.593   4.298   12.841  1.00 0.00 ? 84 PRO A HA   2  
ATOM 2705  H HB2  . PRO A 1 84 ? 3.525   4.484   15.404  1.00 0.00 ? 84 PRO A HB2  2  
ATOM 2706  H HB3  . PRO A 1 84 ? 2.327   3.307   14.903  1.00 0.00 ? 84 PRO A HB3  2  
ATOM 2707  H HG2  . PRO A 1 84 ? 5.193   2.896   15.497  1.00 0.00 ? 84 PRO A HG2  2  
ATOM 2708  H HG3  . PRO A 1 84 ? 3.908   1.708   15.414  1.00 0.00 ? 84 PRO A HG3  2  
ATOM 2709  H HD2  . PRO A 1 84 ? 5.920   2.200   13.430  1.00 0.00 ? 84 PRO A HD2  2  
ATOM 2710  H HD3  . PRO A 1 84 ? 4.567   1.094   13.298  1.00 0.00 ? 84 PRO A HD3  2  
ATOM 2711  N N    . ASP A 1 85 ? 5.576   5.310   13.077  1.00 0.00 ? 85 ASP A N    2  
ATOM 2712  C CA   . ASP A 1 85 ? 6.441   6.471   12.954  1.00 0.00 ? 85 ASP A CA   2  
ATOM 2713  C C    . ASP A 1 85 ? 7.207   6.393   11.631  1.00 0.00 ? 85 ASP A C    2  
ATOM 2714  O O    . ASP A 1 85 ? 8.426   6.228   11.624  1.00 0.00 ? 85 ASP A O    2  
ATOM 2715  C CB   . ASP A 1 85 ? 7.464   6.519   14.090  1.00 0.00 ? 85 ASP A CB   2  
ATOM 2716  C CG   . ASP A 1 85 ? 6.965   7.168   15.383  1.00 0.00 ? 85 ASP A CG   2  
ATOM 2717  O OD1  . ASP A 1 85 ? 6.341   8.245   15.273  1.00 0.00 ? 85 ASP A OD1  2  
ATOM 2718  O OD2  . ASP A 1 85 ? 7.219   6.571   16.452  1.00 0.00 ? 85 ASP A OD2  2  
ATOM 2719  H H    . ASP A 1 85 ? 6.051   4.431   13.109  1.00 0.00 ? 85 ASP A H    2  
ATOM 2720  H HA   . ASP A 1 85 ? 5.774   7.332   12.999  1.00 0.00 ? 85 ASP A HA   2  
ATOM 2721  H HB2  . ASP A 1 85 ? 7.786   5.502   14.312  1.00 0.00 ? 85 ASP A HB2  2  
ATOM 2722  H HB3  . ASP A 1 85 ? 8.344   7.063   13.745  1.00 0.00 ? 85 ASP A HB3  2  
ATOM 2723  N N    . PHE A 1 86 ? 6.460   6.515   10.544  1.00 0.00 ? 86 PHE A N    2  
ATOM 2724  C CA   . PHE A 1 86 ? 7.053   6.461   9.218   1.00 0.00 ? 86 PHE A CA   2  
ATOM 2725  C C    . PHE A 1 86 ? 7.453   7.857   8.739   1.00 0.00 ? 86 PHE A C    2  
ATOM 2726  O O    . PHE A 1 86 ? 8.629   8.119   8.490   1.00 0.00 ? 86 PHE A O    2  
ATOM 2727  C CB   . PHE A 1 86 ? 5.989   5.895   8.275   1.00 0.00 ? 86 PHE A CB   2  
ATOM 2728  C CG   . PHE A 1 86 ? 6.449   5.773   6.821   1.00 0.00 ? 86 PHE A CG   2  
ATOM 2729  C CD1  . PHE A 1 86 ? 7.629   5.164   6.529   1.00 0.00 ? 86 PHE A CD1  2  
ATOM 2730  C CD2  . PHE A 1 86 ? 5.677   6.274   5.820   1.00 0.00 ? 86 PHE A CD2  2  
ATOM 2731  C CE1  . PHE A 1 86 ? 8.056   5.050   5.180   1.00 0.00 ? 86 PHE A CE1  2  
ATOM 2732  C CE2  . PHE A 1 86 ? 6.103   6.161   4.470   1.00 0.00 ? 86 PHE A CE2  2  
ATOM 2733  C CZ   . PHE A 1 86 ? 7.284   5.551   4.178   1.00 0.00 ? 86 PHE A CZ   2  
ATOM 2734  H H    . PHE A 1 86 ? 5.469   6.649   10.558  1.00 0.00 ? 86 PHE A H    2  
ATOM 2735  H HA   . PHE A 1 86 ? 7.942   5.834   9.288   1.00 0.00 ? 86 PHE A HA   2  
ATOM 2736  H HB2  . PHE A 1 86 ? 5.686   4.911   8.634   1.00 0.00 ? 86 PHE A HB2  2  
ATOM 2737  H HB3  . PHE A 1 86 ? 5.107   6.534   8.314   1.00 0.00 ? 86 PHE A HB3  2  
ATOM 2738  H HD1  . PHE A 1 86 ? 8.248   4.762   7.332   1.00 0.00 ? 86 PHE A HD1  2  
ATOM 2739  H HD2  . PHE A 1 86 ? 4.731   6.763   6.053   1.00 0.00 ? 86 PHE A HD2  2  
ATOM 2740  H HE1  . PHE A 1 86 ? 9.001   4.562   4.946   1.00 0.00 ? 86 PHE A HE1  2  
ATOM 2741  H HE2  . PHE A 1 86 ? 5.485   6.563   3.667   1.00 0.00 ? 86 PHE A HE2  2  
ATOM 2742  H HZ   . PHE A 1 86 ? 7.611   5.465   3.142   1.00 0.00 ? 86 PHE A HZ   2  
ATOM 2743  N N    . VAL A 1 87 ? 6.452   8.717   8.623   1.00 0.00 ? 87 VAL A N    2  
ATOM 2744  C CA   . VAL A 1 87 ? 6.684   10.081  8.177   1.00 0.00 ? 87 VAL A CA   2  
ATOM 2745  C C    . VAL A 1 87 ? 7.176   10.921  9.357   1.00 0.00 ? 87 VAL A C    2  
ATOM 2746  O O    . VAL A 1 87 ? 6.877   10.615  10.510  1.00 0.00 ? 87 VAL A O    2  
ATOM 2747  C CB   . VAL A 1 87 ? 5.416   10.643  7.530   1.00 0.00 ? 87 VAL A CB   2  
ATOM 2748  C CG1  . VAL A 1 87 ? 5.697   11.984  6.850   1.00 0.00 ? 87 VAL A CG1  2  
ATOM 2749  C CG2  . VAL A 1 87 ? 4.815   9.642   6.541   1.00 0.00 ? 87 VAL A CG2  2  
ATOM 2750  H H    . VAL A 1 87 ? 5.498   8.496   8.827   1.00 0.00 ? 87 VAL A H    2  
ATOM 2751  H HA   . VAL A 1 87 ? 7.465   10.050  7.418   1.00 0.00 ? 87 VAL A HA   2  
ATOM 2752  H HB   . VAL A 1 87 ? 4.685   10.814  8.319   1.00 0.00 ? 87 VAL A HB   2  
ATOM 2753  H HG11 . VAL A 1 87 ? 5.379   12.797  7.504   1.00 0.00 ? 87 VAL A HG11 2  
ATOM 2754  H HG12 . VAL A 1 87 ? 6.765   12.075  6.651   1.00 0.00 ? 87 VAL A HG12 2  
ATOM 2755  H HG13 . VAL A 1 87 ? 5.146   12.038  5.911   1.00 0.00 ? 87 VAL A HG13 2  
ATOM 2756  H HG21 . VAL A 1 87 ? 5.441   8.750   6.502   1.00 0.00 ? 87 VAL A HG21 2  
ATOM 2757  H HG22 . VAL A 1 87 ? 3.812   9.368   6.867   1.00 0.00 ? 87 VAL A HG22 2  
ATOM 2758  H HG23 . VAL A 1 87 ? 4.765   10.095  5.551   1.00 0.00 ? 87 VAL A HG23 2  
ATOM 2759  N N    . LYS A 1 88 ? 7.922   11.965  9.028   1.00 0.00 ? 88 LYS A N    2  
ATOM 2760  C CA   . LYS A 1 88 ? 8.459   12.853  10.046  1.00 0.00 ? 88 LYS A CA   2  
ATOM 2761  C C    . LYS A 1 88 ? 8.357   14.300  9.560   1.00 0.00 ? 88 LYS A C    2  
ATOM 2762  O O    . LYS A 1 88 ? 9.118   14.722  8.691   1.00 0.00 ? 88 LYS A O    2  
ATOM 2763  C CB   . LYS A 1 88 ? 9.879   12.431  10.429  1.00 0.00 ? 88 LYS A CB   2  
ATOM 2764  C CG   . LYS A 1 88 ? 10.637  13.589  11.082  1.00 0.00 ? 88 LYS A CG   2  
ATOM 2765  C CD   . LYS A 1 88 ? 11.949  13.105  11.702  1.00 0.00 ? 88 LYS A CD   2  
ATOM 2766  C CE   . LYS A 1 88 ? 12.628  14.226  12.492  1.00 0.00 ? 88 LYS A CE   2  
ATOM 2767  N NZ   . LYS A 1 88 ? 13.760  14.789  11.723  1.00 0.00 ? 88 LYS A NZ   2  
ATOM 2768  H H    . LYS A 1 88 ? 8.161   12.208  8.087   1.00 0.00 ? 88 LYS A H    2  
ATOM 2769  H HA   . LYS A 1 88 ? 7.839   12.742  10.935  1.00 0.00 ? 88 LYS A HA   2  
ATOM 2770  H HB2  . LYS A 1 88 ? 9.839   11.586  11.115  1.00 0.00 ? 88 LYS A HB2  2  
ATOM 2771  H HB3  . LYS A 1 88 ? 10.415  12.096  9.541   1.00 0.00 ? 88 LYS A HB3  2  
ATOM 2772  H HG2  . LYS A 1 88 ? 10.845  14.358  10.337  1.00 0.00 ? 88 LYS A HG2  2  
ATOM 2773  H HG3  . LYS A 1 88 ? 10.015  14.049  11.849  1.00 0.00 ? 88 LYS A HG3  2  
ATOM 2774  H HD2  . LYS A 1 88 ? 11.754  12.259  12.360  1.00 0.00 ? 88 LYS A HD2  2  
ATOM 2775  H HD3  . LYS A 1 88 ? 12.618  12.751  10.918  1.00 0.00 ? 88 LYS A HD3  2  
ATOM 2776  H HE2  . LYS A 1 88 ? 11.906  15.011  12.715  1.00 0.00 ? 88 LYS A HE2  2  
ATOM 2777  H HE3  . LYS A 1 88 ? 12.986  13.841  13.447  1.00 0.00 ? 88 LYS A HE3  2  
ATOM 2778  H HZ1  . LYS A 1 88 ? 13.730  14.446  10.784  1.00 0.00 ? 88 LYS A HZ1  2  
ATOM 2779  H HZ2  . LYS A 1 88 ? 13.694  15.787  11.715  1.00 0.00 ? 88 LYS A HZ2  2  
ATOM 2780  H HZ3  . LYS A 1 88 ? 14.622  14.515  12.150  1.00 0.00 ? 88 LYS A HZ3  2  
ATOM 2781  N N    . GLN A 1 89 ? 7.409   15.020  10.143  1.00 0.00 ? 89 GLN A N    2  
ATOM 2782  C CA   . GLN A 1 89 ? 7.198   16.411  9.780   1.00 0.00 ? 89 GLN A CA   2  
ATOM 2783  C C    . GLN A 1 89 ? 6.512   16.506  8.416   1.00 0.00 ? 89 GLN A C    2  
ATOM 2784  O O    . GLN A 1 89 ? 7.146   16.297  7.382   1.00 0.00 ? 89 GLN A O    2  
ATOM 2785  C CB   . GLN A 1 89 ? 8.517   17.186  9.785   1.00 0.00 ? 89 GLN A CB   2  
ATOM 2786  C CG   . GLN A 1 89 ? 8.445   18.386  10.732  1.00 0.00 ? 89 GLN A CG   2  
ATOM 2787  C CD   . GLN A 1 89 ? 8.851   17.988  12.153  1.00 0.00 ? 89 GLN A CD   2  
ATOM 2788  O OE1  . GLN A 1 89 ? 9.963   17.557  12.411  1.00 0.00 ? 89 GLN A OE1  2  
ATOM 2789  N NE2  . GLN A 1 89 ? 7.890   18.155  13.057  1.00 0.00 ? 89 GLN A NE2  2  
ATOM 2790  H H    . GLN A 1 89 ? 6.794   14.669  10.849  1.00 0.00 ? 89 GLN A H    2  
ATOM 2791  H HA   . GLN A 1 89 ? 6.543   16.816  10.552  1.00 0.00 ? 89 GLN A HA   2  
ATOM 2792  H HB2  . GLN A 1 89 ? 9.329   16.526  10.090  1.00 0.00 ? 89 GLN A HB2  2  
ATOM 2793  H HB3  . GLN A 1 89 ? 8.746   17.529  8.776   1.00 0.00 ? 89 GLN A HB3  2  
ATOM 2794  H HG2  . GLN A 1 89 ? 9.100   19.178  10.372  1.00 0.00 ? 89 GLN A HG2  2  
ATOM 2795  H HG3  . GLN A 1 89 ? 7.432   18.788  10.739  1.00 0.00 ? 89 GLN A HG3  2  
ATOM 2796  H HE21 . GLN A 1 89 ? 6.999   18.513  12.779  1.00 0.00 ? 89 GLN A HE21 2  
ATOM 2797  H HE22 . GLN A 1 89 ? 8.059   17.923  14.015  1.00 0.00 ? 89 GLN A HE22 2  
ATOM 2798  N N    . THR A 1 90 ? 5.225   16.820  8.456   1.00 0.00 ? 90 THR A N    2  
ATOM 2799  C CA   . THR A 1 90 ? 4.446   16.945  7.236   1.00 0.00 ? 90 THR A CA   2  
ATOM 2800  C C    . THR A 1 90 ? 3.399   18.050  7.383   1.00 0.00 ? 90 THR A C    2  
ATOM 2801  O O    . THR A 1 90 ? 2.870   18.269  8.472   1.00 0.00 ? 90 THR A O    2  
ATOM 2802  C CB   . THR A 1 90 ? 3.844   15.575  6.918   1.00 0.00 ? 90 THR A CB   2  
ATOM 2803  O OG1  . THR A 1 90 ? 3.221   15.756  5.649   1.00 0.00 ? 90 THR A OG1  2  
ATOM 2804  C CG2  . THR A 1 90 ? 2.688   15.212  7.852   1.00 0.00 ? 90 THR A CG2  2  
ATOM 2805  H H    . THR A 1 90 ? 4.717   16.988  9.301   1.00 0.00 ? 90 THR A H    2  
ATOM 2806  H HA   . THR A 1 90 ? 5.116   17.244  6.430   1.00 0.00 ? 90 THR A HA   2  
ATOM 2807  H HB   . THR A 1 90 ? 4.611   14.801  6.928   1.00 0.00 ? 90 THR A HB   2  
ATOM 2808  H HG1  . THR A 1 90 ? 2.476   16.420  5.725   1.00 0.00 ? 90 THR A HG1  2  
ATOM 2809  H HG21 . THR A 1 90 ? 2.184   16.122  8.177   1.00 0.00 ? 90 THR A HG21 2  
ATOM 2810  H HG22 . THR A 1 90 ? 1.981   14.573  7.324   1.00 0.00 ? 90 THR A HG22 2  
ATOM 2811  H HG23 . THR A 1 90 ? 3.077   14.683  8.722   1.00 0.00 ? 90 THR A HG23 2  
ATOM 2812  N N    . SER A 1 91 ? 3.130   18.718  6.270   1.00 0.00 ? 91 SER A N    2  
ATOM 2813  C CA   . SER A 1 91 ? 2.155   19.796  6.261   1.00 0.00 ? 91 SER A CA   2  
ATOM 2814  C C    . SER A 1 91 ? 0.739   19.219  6.210   1.00 0.00 ? 91 SER A C    2  
ATOM 2815  O O    . SER A 1 91 ? 0.531   18.118  5.702   1.00 0.00 ? 91 SER A O    2  
ATOM 2816  C CB   . SER A 1 91 ? 2.388   20.739  5.080   1.00 0.00 ? 91 SER A CB   2  
ATOM 2817  O OG   . SER A 1 91 ? 3.353   21.743  5.380   1.00 0.00 ? 91 SER A OG   2  
ATOM 2818  H H    . SER A 1 91 ? 3.565   18.534  5.389   1.00 0.00 ? 91 SER A H    2  
ATOM 2819  H HA   . SER A 1 91 ? 2.314   20.337  7.194   1.00 0.00 ? 91 SER A HA   2  
ATOM 2820  H HB2  . SER A 1 91 ? 2.721   20.163  4.216   1.00 0.00 ? 91 SER A HB2  2  
ATOM 2821  H HB3  . SER A 1 91 ? 1.446   21.212  4.803   1.00 0.00 ? 91 SER A HB3  2  
ATOM 2822  H HG   . SER A 1 91 ? 3.218   22.536  4.785   1.00 0.00 ? 91 SER A HG   2  
ATOM 2823  N N    . GLU A 1 92 ? -0.199  19.989  6.742   1.00 0.00 ? 92 GLU A N    2  
ATOM 2824  C CA   . GLU A 1 92 ? -1.590  19.569  6.763   1.00 0.00 ? 92 GLU A CA   2  
ATOM 2825  C C    . GLU A 1 92 ? -1.696  18.106  7.201   1.00 0.00 ? 92 GLU A C    2  
ATOM 2826  O O    . GLU A 1 92 ? -1.637  17.200  6.370   1.00 0.00 ? 92 GLU A O    2  
ATOM 2827  C CB   . GLU A 1 92 ? -2.247  19.782  5.398   1.00 0.00 ? 92 GLU A CB   2  
ATOM 2828  C CG   . GLU A 1 92 ? -3.427  20.750  5.504   1.00 0.00 ? 92 GLU A CG   2  
ATOM 2829  C CD   . GLU A 1 92 ? -3.070  22.116  4.916   1.00 0.00 ? 92 GLU A CD   2  
ATOM 2830  O OE1  . GLU A 1 92 ? -1.967  22.604  5.245   1.00 0.00 ? 92 GLU A OE1  2  
ATOM 2831  O OE2  . GLU A 1 92 ? -3.907  22.642  4.151   1.00 0.00 ? 92 GLU A OE2  2  
ATOM 2832  H H    . GLU A 1 92 ? -0.021  20.883  7.153   1.00 0.00 ? 92 GLU A H    2  
ATOM 2833  H HA   . GLU A 1 92 ? -2.075  20.211  7.498   1.00 0.00 ? 92 GLU A HA   2  
ATOM 2834  H HB2  . GLU A 1 92 ? -1.513  20.173  4.694   1.00 0.00 ? 92 GLU A HB2  2  
ATOM 2835  H HB3  . GLU A 1 92 ? -2.591  18.826  5.003   1.00 0.00 ? 92 GLU A HB3  2  
ATOM 2836  H HG2  . GLU A 1 92 ? -4.288  20.338  4.977   1.00 0.00 ? 92 GLU A HG2  2  
ATOM 2837  H HG3  . GLU A 1 92 ? -3.717  20.863  6.548   1.00 0.00 ? 92 GLU A HG3  2  
ATOM 2838  N N    . SER A 1 93 ? -1.850  17.921  8.504   1.00 0.00 ? 93 SER A N    2  
ATOM 2839  C CA   . SER A 1 93 ? -1.964  16.584  9.061   1.00 0.00 ? 93 SER A CA   2  
ATOM 2840  C C    . SER A 1 93 ? -3.376  16.365  9.608   1.00 0.00 ? 93 SER A C    2  
ATOM 2841  O O    . SER A 1 93 ? -3.593  16.424  10.818  1.00 0.00 ? 93 SER A O    2  
ATOM 2842  C CB   . SER A 1 93 ? -0.927  16.356  10.162  1.00 0.00 ? 93 SER A CB   2  
ATOM 2843  O OG   . SER A 1 93 ? -1.203  17.132  11.325  1.00 0.00 ? 93 SER A OG   2  
ATOM 2844  H H    . SER A 1 93 ? -1.896  18.663  9.172   1.00 0.00 ? 93 SER A H    2  
ATOM 2845  H HA   . SER A 1 93 ? -1.766  15.907  8.230   1.00 0.00 ? 93 SER A HA   2  
ATOM 2846  H HB2  . SER A 1 93 ? -0.907  15.299  10.428  1.00 0.00 ? 93 SER A HB2  2  
ATOM 2847  H HB3  . SER A 1 93 ? 0.064   16.609  9.785   1.00 0.00 ? 93 SER A HB3  2  
ATOM 2848  H HG   . SER A 1 93 ? -0.493  16.983  12.013  1.00 0.00 ? 93 SER A HG   2  
ATOM 2849  N N    . GLY A 1 94 ? -4.300  16.116  8.691   1.00 0.00 ? 94 GLY A N    2  
ATOM 2850  C CA   . GLY A 1 94 ? -5.685  15.888  9.067   1.00 0.00 ? 94 GLY A CA   2  
ATOM 2851  C C    . GLY A 1 94 ? -6.425  15.106  7.980   1.00 0.00 ? 94 GLY A C    2  
ATOM 2852  O O    . GLY A 1 94 ? -6.831  15.675  6.968   1.00 0.00 ? 94 GLY A O    2  
ATOM 2853  H H    . GLY A 1 94 ? -4.115  16.070  7.710   1.00 0.00 ? 94 GLY A H    2  
ATOM 2854  H HA2  . GLY A 1 94 ? -5.724  15.337  10.007  1.00 0.00 ? 94 GLY A HA2  2  
ATOM 2855  H HA3  . GLY A 1 94 ? -6.182  16.843  9.236   1.00 0.00 ? 94 GLY A HA3  2  
ATOM 2856  N N    . PRO A 1 95 ? -6.584  13.779  8.233   1.00 0.00 ? 95 PRO A N    2  
ATOM 2857  C CA   . PRO A 1 95 ? -7.269  12.914  7.288   1.00 0.00 ? 95 PRO A CA   2  
ATOM 2858  C C    . PRO A 1 95 ? -8.781  13.139  7.336   1.00 0.00 ? 95 PRO A C    2  
ATOM 2859  O O    . PRO A 1 95 ? -9.534  12.244  7.717   1.00 0.00 ? 95 PRO A O    2  
ATOM 2860  C CB   . PRO A 1 95 ? -6.865  11.503  7.684   1.00 0.00 ? 95 PRO A CB   2  
ATOM 2861  C CG   . PRO A 1 95 ? -6.348  11.601  9.110   1.00 0.00 ? 95 PRO A CG   2  
ATOM 2862  C CD   . PRO A 1 95 ? -6.117  13.071  9.421   1.00 0.00 ? 95 PRO A CD   2  
ATOM 2863  H HA   . PRO A 1 95 ? -6.989  13.131  6.353   1.00 0.00 ? 95 PRO A HA   2  
ATOM 2864  H HB2  . PRO A 1 95 ? -7.715  10.822  7.623   1.00 0.00 ? 95 PRO A HB2  2  
ATOM 2865  H HB3  . PRO A 1 95 ? -6.097  11.114  7.016   1.00 0.00 ? 95 PRO A HB3  2  
ATOM 2866  H HG2  . PRO A 1 95 ? -7.067  11.172  9.808   1.00 0.00 ? 95 PRO A HG2  2  
ATOM 2867  H HG3  . PRO A 1 95 ? -5.422  11.037  9.220   1.00 0.00 ? 95 PRO A HG3  2  
ATOM 2868  H HD2  . PRO A 1 95 ? -6.669  13.379  10.309  1.00 0.00 ? 95 PRO A HD2  2  
ATOM 2869  H HD3  . PRO A 1 95 ? -5.064  13.274  9.615   1.00 0.00 ? 95 PRO A HD3  2  
ATOM 2870  N N    . SER A 1 96 ? -9.181  14.339  6.943   1.00 0.00 ? 96 SER A N    2  
ATOM 2871  C CA   . SER A 1 96 ? -10.591 14.693  6.935   1.00 0.00 ? 96 SER A CA   2  
ATOM 2872  C C    . SER A 1 96 ? -11.048 14.989  5.506   1.00 0.00 ? 96 SER A C    2  
ATOM 2873  O O    . SER A 1 96 ? -10.263 15.460  4.684   1.00 0.00 ? 96 SER A O    2  
ATOM 2874  C CB   . SER A 1 96 ? -10.861 15.897  7.840   1.00 0.00 ? 96 SER A CB   2  
ATOM 2875  O OG   . SER A 1 96 ? -12.256 16.139  8.004   1.00 0.00 ? 96 SER A OG   2  
ATOM 2876  H H    . SER A 1 96 ? -8.563  15.061  6.634   1.00 0.00 ? 96 SER A H    2  
ATOM 2877  H HA   . SER A 1 96 ? -11.110 13.819  7.330   1.00 0.00 ? 96 SER A HA   2  
ATOM 2878  H HB2  . SER A 1 96 ? -10.405 15.727  8.815   1.00 0.00 ? 96 SER A HB2  2  
ATOM 2879  H HB3  . SER A 1 96 ? -10.387 16.782  7.416   1.00 0.00 ? 96 SER A HB3  2  
ATOM 2880  H HG   . SER A 1 96 ? -12.406 16.769  8.766   1.00 0.00 ? 96 SER A HG   2  
ATOM 2881  N N    . SER A 1 97 ? -12.317 14.702  5.253   1.00 0.00 ? 97 SER A N    2  
ATOM 2882  C CA   . SER A 1 97 ? -12.888 14.932  3.937   1.00 0.00 ? 97 SER A CA   2  
ATOM 2883  C C    . SER A 1 97 ? -14.273 15.569  4.072   1.00 0.00 ? 97 SER A C    2  
ATOM 2884  O O    . SER A 1 97 ? -14.848 15.588  5.159   1.00 0.00 ? 97 SER A O    2  
ATOM 2885  C CB   . SER A 1 97 ? -12.978 13.630  3.140   1.00 0.00 ? 97 SER A CB   2  
ATOM 2886  O OG   . SER A 1 97 ? -11.753 12.901  3.168   1.00 0.00 ? 97 SER A OG   2  
ATOM 2887  H H    . SER A 1 97 ? -12.949 14.320  5.927   1.00 0.00 ? 97 SER A H    2  
ATOM 2888  H HA   . SER A 1 97 ? -12.200 15.616  3.439   1.00 0.00 ? 97 SER A HA   2  
ATOM 2889  H HB2  . SER A 1 97 ? -13.778 13.010  3.546   1.00 0.00 ? 97 SER A HB2  2  
ATOM 2890  H HB3  . SER A 1 97 ? -13.243 13.854  2.107   1.00 0.00 ? 97 SER A HB3  2  
ATOM 2891  H HG   . SER A 1 97 ? -11.683 12.384  4.021   1.00 0.00 ? 97 SER A HG   2  
ATOM 2892  N N    . GLY A 1 98 ? -14.769 16.074  2.952   1.00 0.00 ? 98 GLY A N    2  
ATOM 2893  C CA   . GLY A 1 98 ? -16.075 16.709  2.931   1.00 0.00 ? 98 GLY A CA   2  
ATOM 2894  C C    . GLY A 1 98 ? -17.193 15.666  2.994   1.00 0.00 ? 98 GLY A C    2  
ATOM 2895  O O    . GLY A 1 98 ? -17.008 14.526  2.571   1.00 0.00 ? 98 GLY A O    2  
ATOM 2896  H H    . GLY A 1 98 ? -14.295 16.054  2.071   1.00 0.00 ? 98 GLY A H    2  
ATOM 2897  H HA2  . GLY A 1 98 ? -16.164 17.394  3.774   1.00 0.00 ? 98 GLY A HA2  2  
ATOM 2898  H HA3  . GLY A 1 98 ? -16.180 17.305  2.024   1.00 0.00 ? 98 GLY A HA3  2  
ATOM 2899  N N    . GLY A 1 1  ? -12.272 -8.141  -8.225  1.00 0.00 ? 1  GLY A N    3  
ATOM 2900  C CA   . GLY A 1 1  ? -13.370 -8.308  -9.161  1.00 0.00 ? 1  GLY A CA   3  
ATOM 2901  C C    . GLY A 1 1  ? -14.141 -9.598  -8.878  1.00 0.00 ? 1  GLY A C    3  
ATOM 2902  O O    . GLY A 1 1  ? -15.263 -9.558  -8.376  1.00 0.00 ? 1  GLY A O    3  
ATOM 2903  H H1   . GLY A 1 1  ? -12.472 -7.557  -7.438  1.00 0.00 ? 1  GLY A H1   3  
ATOM 2904  H HA2  . GLY A 1 1  ? -14.044 -7.454  -9.092  1.00 0.00 ? 1  GLY A HA2  3  
ATOM 2905  H HA3  . GLY A 1 1  ? -12.984 -8.326  -10.181 1.00 0.00 ? 1  GLY A HA3  3  
ATOM 2906  N N    . SER A 1 2  ? -13.508 -10.713 -9.213  1.00 0.00 ? 2  SER A N    3  
ATOM 2907  C CA   . SER A 1 2  ? -14.121 -12.014 -9.001  1.00 0.00 ? 2  SER A CA   3  
ATOM 2908  C C    . SER A 1 2  ? -13.057 -13.031 -8.581  1.00 0.00 ? 2  SER A C    3  
ATOM 2909  O O    . SER A 1 2  ? -13.153 -13.627 -7.510  1.00 0.00 ? 2  SER A O    3  
ATOM 2910  C CB   . SER A 1 2  ? -14.846 -12.493 -10.260 1.00 0.00 ? 2  SER A CB   3  
ATOM 2911  O OG   . SER A 1 2  ? -16.259 -12.525 -10.082 1.00 0.00 ? 2  SER A OG   3  
ATOM 2912  H H    . SER A 1 2  ? -12.596 -10.738 -9.621  1.00 0.00 ? 2  SER A H    3  
ATOM 2913  H HA   . SER A 1 2  ? -14.845 -11.865 -8.200  1.00 0.00 ? 2  SER A HA   3  
ATOM 2914  H HB2  . SER A 1 2  ? -14.600 -11.834 -11.093 1.00 0.00 ? 2  SER A HB2  3  
ATOM 2915  H HB3  . SER A 1 2  ? -14.491 -13.489 -10.526 1.00 0.00 ? 2  SER A HB3  3  
ATOM 2916  H HG   . SER A 1 2  ? -16.523 -13.353 -9.587  1.00 0.00 ? 2  SER A HG   3  
ATOM 2917  N N    . SER A 1 3  ? -12.069 -13.197 -9.448  1.00 0.00 ? 3  SER A N    3  
ATOM 2918  C CA   . SER A 1 3  ? -10.989 -14.132 -9.180  1.00 0.00 ? 3  SER A CA   3  
ATOM 2919  C C    . SER A 1 3  ? -9.948  -14.063 -10.300 1.00 0.00 ? 3  SER A C    3  
ATOM 2920  O O    . SER A 1 3  ? -9.933  -14.909 -11.191 1.00 0.00 ? 3  SER A O    3  
ATOM 2921  C CB   . SER A 1 3  ? -11.519 -15.560 -9.036  1.00 0.00 ? 3  SER A CB   3  
ATOM 2922  O OG   . SER A 1 3  ? -12.391 -15.916 -10.105 1.00 0.00 ? 3  SER A OG   3  
ATOM 2923  H H    . SER A 1 3  ? -11.999 -12.708 -10.317 1.00 0.00 ? 3  SER A H    3  
ATOM 2924  H HA   . SER A 1 3  ? -10.555 -13.809 -8.234  1.00 0.00 ? 3  SER A HA   3  
ATOM 2925  H HB2  . SER A 1 3  ? -10.681 -16.256 -9.005  1.00 0.00 ? 3  SER A HB2  3  
ATOM 2926  H HB3  . SER A 1 3  ? -12.049 -15.656 -8.089  1.00 0.00 ? 3  SER A HB3  3  
ATOM 2927  H HG   . SER A 1 3  ? -13.343 -15.767 -9.835  1.00 0.00 ? 3  SER A HG   3  
ATOM 2928  N N    . GLY A 1 4  ? -9.103  -13.046 -10.216 1.00 0.00 ? 4  GLY A N    3  
ATOM 2929  C CA   . GLY A 1 4  ? -8.061  -12.855 -11.211 1.00 0.00 ? 4  GLY A CA   3  
ATOM 2930  C C    . GLY A 1 4  ? -7.744  -11.369 -11.395 1.00 0.00 ? 4  GLY A C    3  
ATOM 2931  O O    . GLY A 1 4  ? -8.606  -10.517 -11.186 1.00 0.00 ? 4  GLY A O    3  
ATOM 2932  H H    . GLY A 1 4  ? -9.122  -12.361 -9.487  1.00 0.00 ? 4  GLY A H    3  
ATOM 2933  H HA2  . GLY A 1 4  ? -7.160  -13.387 -10.906 1.00 0.00 ? 4  GLY A HA2  3  
ATOM 2934  H HA3  . GLY A 1 4  ? -8.378  -13.283 -12.161 1.00 0.00 ? 4  GLY A HA3  3  
ATOM 2935  N N    . SER A 1 5  ? -6.506  -11.105 -11.785 1.00 0.00 ? 5  SER A N    3  
ATOM 2936  C CA   . SER A 1 5  ? -6.065  -9.737  -12.000 1.00 0.00 ? 5  SER A CA   3  
ATOM 2937  C C    . SER A 1 5  ? -4.892  -9.714  -12.982 1.00 0.00 ? 5  SER A C    3  
ATOM 2938  O O    . SER A 1 5  ? -4.085  -10.641 -13.013 1.00 0.00 ? 5  SER A O    3  
ATOM 2939  C CB   . SER A 1 5  ? -5.666  -9.073  -10.681 1.00 0.00 ? 5  SER A CB   3  
ATOM 2940  O OG   . SER A 1 5  ? -6.791  -8.536  -9.991  1.00 0.00 ? 5  SER A OG   3  
ATOM 2941  H H    . SER A 1 5  ? -5.811  -11.804 -11.953 1.00 0.00 ? 5  SER A H    3  
ATOM 2942  H HA   . SER A 1 5  ? -6.927  -9.219  -12.420 1.00 0.00 ? 5  SER A HA   3  
ATOM 2943  H HB2  . SER A 1 5  ? -5.165  -9.804  -10.044 1.00 0.00 ? 5  SER A HB2  3  
ATOM 2944  H HB3  . SER A 1 5  ? -4.948  -8.277  -10.878 1.00 0.00 ? 5  SER A HB3  3  
ATOM 2945  H HG   . SER A 1 5  ? -7.557  -8.421  -10.624 1.00 0.00 ? 5  SER A HG   3  
ATOM 2946  N N    . SER A 1 6  ? -4.836  -8.643  -13.761 1.00 0.00 ? 6  SER A N    3  
ATOM 2947  C CA   . SER A 1 6  ? -3.775  -8.487  -14.742 1.00 0.00 ? 6  SER A CA   3  
ATOM 2948  C C    . SER A 1 6  ? -2.501  -7.984  -14.060 1.00 0.00 ? 6  SER A C    3  
ATOM 2949  O O    . SER A 1 6  ? -1.459  -8.633  -14.127 1.00 0.00 ? 6  SER A O    3  
ATOM 2950  C CB   . SER A 1 6  ? -4.194  -7.528  -15.858 1.00 0.00 ? 6  SER A CB   3  
ATOM 2951  O OG   . SER A 1 6  ? -4.885  -8.199  -16.908 1.00 0.00 ? 6  SER A OG   3  
ATOM 2952  H H    . SER A 1 6  ? -5.496  -7.893  -13.730 1.00 0.00 ? 6  SER A H    3  
ATOM 2953  H HA   . SER A 1 6  ? -3.619  -9.482  -15.159 1.00 0.00 ? 6  SER A HA   3  
ATOM 2954  H HB2  . SER A 1 6  ? -4.833  -6.747  -15.444 1.00 0.00 ? 6  SER A HB2  3  
ATOM 2955  H HB3  . SER A 1 6  ? -3.310  -7.035  -16.263 1.00 0.00 ? 6  SER A HB3  3  
ATOM 2956  H HG   . SER A 1 6  ? -4.249  -8.431  -17.643 1.00 0.00 ? 6  SER A HG   3  
ATOM 2957  N N    . GLY A 1 7  ? -2.627  -6.832  -13.418 1.00 0.00 ? 7  GLY A N    3  
ATOM 2958  C CA   . GLY A 1 7  ? -1.499  -6.234  -12.724 1.00 0.00 ? 7  GLY A CA   3  
ATOM 2959  C C    . GLY A 1 7  ? -0.639  -5.410  -13.684 1.00 0.00 ? 7  GLY A C    3  
ATOM 2960  O O    . GLY A 1 7  ? -1.051  -5.132  -14.810 1.00 0.00 ? 7  GLY A O    3  
ATOM 2961  H H    . GLY A 1 7  ? -3.479  -6.310  -13.368 1.00 0.00 ? 7  GLY A H    3  
ATOM 2962  H HA2  . GLY A 1 7  ? -1.860  -5.598  -11.916 1.00 0.00 ? 7  GLY A HA2  3  
ATOM 2963  H HA3  . GLY A 1 7  ? -0.893  -7.016  -12.267 1.00 0.00 ? 7  GLY A HA3  3  
ATOM 2964  N N    . GLU A 1 8  ? 0.540   -5.043  -13.205 1.00 0.00 ? 8  GLU A N    3  
ATOM 2965  C CA   . GLU A 1 8  ? 1.462   -4.256  -14.006 1.00 0.00 ? 8  GLU A CA   3  
ATOM 2966  C C    . GLU A 1 8  ? 2.908   -4.586  -13.630 1.00 0.00 ? 8  GLU A C    3  
ATOM 2967  O O    . GLU A 1 8  ? 3.155   -5.249  -12.624 1.00 0.00 ? 8  GLU A O    3  
ATOM 2968  C CB   . GLU A 1 8  ? 1.183   -2.759  -13.852 1.00 0.00 ? 8  GLU A CB   3  
ATOM 2969  C CG   . GLU A 1 8  ? 0.803   -2.131  -15.194 1.00 0.00 ? 8  GLU A CG   3  
ATOM 2970  C CD   . GLU A 1 8  ? -0.695  -1.825  -15.252 1.00 0.00 ? 8  GLU A CD   3  
ATOM 2971  O OE1  . GLU A 1 8  ? -1.095  -0.826  -14.617 1.00 0.00 ? 8  GLU A OE1  3  
ATOM 2972  O OE2  . GLU A 1 8  ? -1.406  -2.598  -15.931 1.00 0.00 ? 8  GLU A OE2  3  
ATOM 2973  H H    . GLU A 1 8  ? 0.867   -5.273  -12.288 1.00 0.00 ? 8  GLU A H    3  
ATOM 2974  H HA   . GLU A 1 8  ? 1.272   -4.550  -15.039 1.00 0.00 ? 8  GLU A HA   3  
ATOM 2975  H HB2  . GLU A 1 8  ? 0.377   -2.608  -13.134 1.00 0.00 ? 8  GLU A HB2  3  
ATOM 2976  H HB3  . GLU A 1 8  ? 2.065   -2.261  -13.450 1.00 0.00 ? 8  GLU A HB3  3  
ATOM 2977  H HG2  . GLU A 1 8  ? 1.372   -1.213  -15.344 1.00 0.00 ? 8  GLU A HG2  3  
ATOM 2978  H HG3  . GLU A 1 8  ? 1.072   -2.808  -16.006 1.00 0.00 ? 8  GLU A HG3  3  
ATOM 2979  N N    . PHE A 1 9  ? 3.825   -4.108  -14.458 1.00 0.00 ? 9  PHE A N    3  
ATOM 2980  C CA   . PHE A 1 9  ? 5.240   -4.345  -14.225 1.00 0.00 ? 9  PHE A CA   3  
ATOM 2981  C C    . PHE A 1 9  ? 6.030   -3.035  -14.275 1.00 0.00 ? 9  PHE A C    3  
ATOM 2982  O O    . PHE A 1 9  ? 5.991   -2.321  -15.276 1.00 0.00 ? 9  PHE A O    3  
ATOM 2983  C CB   . PHE A 1 9  ? 5.730   -5.265  -15.344 1.00 0.00 ? 9  PHE A CB   3  
ATOM 2984  C CG   . PHE A 1 9  ? 5.549   -6.755  -15.048 1.00 0.00 ? 9  PHE A CG   3  
ATOM 2985  C CD1  . PHE A 1 9  ? 4.306   -7.259  -14.828 1.00 0.00 ? 9  PHE A CD1  3  
ATOM 2986  C CD2  . PHE A 1 9  ? 6.633   -7.576  -15.004 1.00 0.00 ? 9  PHE A CD2  3  
ATOM 2987  C CE1  . PHE A 1 9  ? 4.138   -8.642  -14.553 1.00 0.00 ? 9  PHE A CE1  3  
ATOM 2988  C CE2  . PHE A 1 9  ? 6.466   -8.959  -14.729 1.00 0.00 ? 9  PHE A CE2  3  
ATOM 2989  C CZ   . PHE A 1 9  ? 5.222   -9.463  -14.510 1.00 0.00 ? 9  PHE A CZ   3  
ATOM 2990  H H    . PHE A 1 9  ? 3.615   -3.570  -15.274 1.00 0.00 ? 9  PHE A H    3  
ATOM 2991  H HA   . PHE A 1 9  ? 5.334   -4.786  -13.233 1.00 0.00 ? 9  PHE A HA   3  
ATOM 2992  H HB2  . PHE A 1 9  ? 5.196   -5.021  -16.262 1.00 0.00 ? 9  PHE A HB2  3  
ATOM 2993  H HB3  . PHE A 1 9  ? 6.786   -5.067  -15.527 1.00 0.00 ? 9  PHE A HB3  3  
ATOM 2994  H HD1  . PHE A 1 9  ? 3.437   -6.602  -14.863 1.00 0.00 ? 9  PHE A HD1  3  
ATOM 2995  H HD2  . PHE A 1 9  ? 7.630   -7.172  -15.181 1.00 0.00 ? 9  PHE A HD2  3  
ATOM 2996  H HE1  . PHE A 1 9  ? 3.141   -9.046  -14.377 1.00 0.00 ? 9  PHE A HE1  3  
ATOM 2997  H HE2  . PHE A 1 9  ? 7.334   -9.617  -14.694 1.00 0.00 ? 9  PHE A HE2  3  
ATOM 2998  H HZ   . PHE A 1 9  ? 5.093   -10.525 -14.299 1.00 0.00 ? 9  PHE A HZ   3  
ATOM 2999  N N    . VAL A 1 10 ? 6.727   -2.760  -13.183 1.00 0.00 ? 10 VAL A N    3  
ATOM 3000  C CA   . VAL A 1 10 ? 7.525   -1.550  -13.090 1.00 0.00 ? 10 VAL A CA   3  
ATOM 3001  C C    . VAL A 1 10 ? 9.009   -1.921  -13.081 1.00 0.00 ? 10 VAL A C    3  
ATOM 3002  O O    . VAL A 1 10 ? 9.533   -2.377  -12.065 1.00 0.00 ? 10 VAL A O    3  
ATOM 3003  C CB   . VAL A 1 10 ? 7.105   -0.739  -11.862 1.00 0.00 ? 10 VAL A CB   3  
ATOM 3004  C CG1  . VAL A 1 10 ? 8.065   0.428   -11.621 1.00 0.00 ? 10 VAL A CG1  3  
ATOM 3005  C CG2  . VAL A 1 10 ? 5.664   -0.244  -11.999 1.00 0.00 ? 10 VAL A CG2  3  
ATOM 3006  H H    . VAL A 1 10 ? 6.753   -3.347  -12.373 1.00 0.00 ? 10 VAL A H    3  
ATOM 3007  H HA   . VAL A 1 10 ? 7.319   -0.951  -13.976 1.00 0.00 ? 10 VAL A HA   3  
ATOM 3008  H HB   . VAL A 1 10 ? 7.152   -1.397  -10.994 1.00 0.00 ? 10 VAL A HB   3  
ATOM 3009  H HG11 . VAL A 1 10 ? 7.501   1.297   -11.280 1.00 0.00 ? 10 VAL A HG11 3  
ATOM 3010  H HG12 . VAL A 1 10 ? 8.794   0.147   -10.861 1.00 0.00 ? 10 VAL A HG12 3  
ATOM 3011  H HG13 . VAL A 1 10 ? 8.582   0.671   -12.549 1.00 0.00 ? 10 VAL A HG13 3  
ATOM 3012  H HG21 . VAL A 1 10 ? 5.355   -0.308  -13.042 1.00 0.00 ? 10 VAL A HG21 3  
ATOM 3013  H HG22 . VAL A 1 10 ? 5.007   -0.864  -11.388 1.00 0.00 ? 10 VAL A HG22 3  
ATOM 3014  H HG23 . VAL A 1 10 ? 5.601   0.791   -11.664 1.00 0.00 ? 10 VAL A HG23 3  
ATOM 3015  N N    . ILE A 1 11 ? 9.646   -1.713  -14.224 1.00 0.00 ? 11 ILE A N    3  
ATOM 3016  C CA   . ILE A 1 11 ? 11.059  -2.021  -14.361 1.00 0.00 ? 11 ILE A CA   3  
ATOM 3017  C C    . ILE A 1 11 ? 11.886  -0.867  -13.788 1.00 0.00 ? 11 ILE A C    3  
ATOM 3018  O O    . ILE A 1 11 ? 12.212  0.081   -14.501 1.00 0.00 ? 11 ILE A O    3  
ATOM 3019  C CB   . ILE A 1 11 ? 11.396  -2.356  -15.815 1.00 0.00 ? 11 ILE A CB   3  
ATOM 3020  C CG1  . ILE A 1 11 ? 10.662  -3.618  -16.272 1.00 0.00 ? 11 ILE A CG1  3  
ATOM 3021  C CG2  . ILE A 1 11 ? 12.909  -2.468  -16.016 1.00 0.00 ? 11 ILE A CG2  3  
ATOM 3022  C CD1  . ILE A 1 11 ? 9.808   -3.338  -17.510 1.00 0.00 ? 11 ILE A CD1  3  
ATOM 3023  H H    . ILE A 1 11 ? 9.213   -1.342  -15.046 1.00 0.00 ? 11 ILE A H    3  
ATOM 3024  H HA   . ILE A 1 11 ? 11.258  -2.915  -13.770 1.00 0.00 ? 11 ILE A HA   3  
ATOM 3025  H HB   . ILE A 1 11 ? 11.049  -1.536  -16.444 1.00 0.00 ? 11 ILE A HB   3  
ATOM 3026  H HG12 . ILE A 1 11 ? 11.385  -4.403  -16.494 1.00 0.00 ? 11 ILE A HG12 3  
ATOM 3027  H HG13 . ILE A 1 11 ? 10.029  -3.987  -15.465 1.00 0.00 ? 11 ILE A HG13 3  
ATOM 3028  H HG21 . ILE A 1 11 ? 13.403  -1.627  -15.530 1.00 0.00 ? 11 ILE A HG21 3  
ATOM 3029  H HG22 . ILE A 1 11 ? 13.265  -3.401  -15.578 1.00 0.00 ? 11 ILE A HG22 3  
ATOM 3030  H HG23 . ILE A 1 11 ? 13.136  -2.457  -17.082 1.00 0.00 ? 11 ILE A HG23 3  
ATOM 3031  H HD11 . ILE A 1 11 ? 10.246  -2.516  -18.075 1.00 0.00 ? 11 ILE A HD11 3  
ATOM 3032  H HD12 . ILE A 1 11 ? 9.771   -4.230  -18.135 1.00 0.00 ? 11 ILE A HD12 3  
ATOM 3033  H HD13 . ILE A 1 11 ? 8.797   -3.069  -17.201 1.00 0.00 ? 11 ILE A HD13 3  
ATOM 3034  N N    . ASN A 1 12 ? 12.200  -0.986  -12.506 1.00 0.00 ? 12 ASN A N    3  
ATOM 3035  C CA   . ASN A 1 12 ? 12.981  0.034   -11.830 1.00 0.00 ? 12 ASN A CA   3  
ATOM 3036  C C    . ASN A 1 12 ? 14.198  -0.616  -11.168 1.00 0.00 ? 12 ASN A C    3  
ATOM 3037  O O    . ASN A 1 12 ? 14.081  -1.218  -10.102 1.00 0.00 ? 12 ASN A O    3  
ATOM 3038  C CB   . ASN A 1 12 ? 12.161  0.723   -10.737 1.00 0.00 ? 12 ASN A CB   3  
ATOM 3039  C CG   . ASN A 1 12 ? 11.508  -0.305  -9.812  1.00 0.00 ? 12 ASN A CG   3  
ATOM 3040  O OD1  . ASN A 1 12 ? 10.564  -0.991  -10.170 1.00 0.00 ? 12 ASN A OD1  3  
ATOM 3041  N ND2  . ASN A 1 12 ? 12.061  -0.374  -8.604  1.00 0.00 ? 12 ASN A ND2  3  
ATOM 3042  H H    . ASN A 1 12 ? 11.930  -1.761  -11.934 1.00 0.00 ? 12 ASN A H    3  
ATOM 3043  H HA   . ASN A 1 12 ? 13.260  0.744   -12.608 1.00 0.00 ? 12 ASN A HA   3  
ATOM 3044  H HB2  . ASN A 1 12 ? 12.804  1.384   -10.157 1.00 0.00 ? 12 ASN A HB2  3  
ATOM 3045  H HB3  . ASN A 1 12 ? 11.392  1.347   -11.194 1.00 0.00 ? 12 ASN A HB3  3  
ATOM 3046  H HD21 . ASN A 1 12 ? 12.834  0.217   -8.374  1.00 0.00 ? 12 ASN A HD21 3  
ATOM 3047  H HD22 . ASN A 1 12 ? 11.704  -1.017  -7.927  1.00 0.00 ? 12 ASN A HD22 3  
ATOM 3048  N N    . PRO A 1 13 ? 15.368  -0.469  -11.845 1.00 0.00 ? 13 PRO A N    3  
ATOM 3049  C CA   . PRO A 1 13 ? 16.605  -1.036  -11.334 1.00 0.00 ? 13 PRO A CA   3  
ATOM 3050  C C    . PRO A 1 13 ? 17.141  -0.213  -10.161 1.00 0.00 ? 13 PRO A C    3  
ATOM 3051  O O    . PRO A 1 13 ? 17.607  -0.771  -9.168  1.00 0.00 ? 13 PRO A O    3  
ATOM 3052  C CB   . PRO A 1 13 ? 17.549  -1.057  -12.525 1.00 0.00 ? 13 PRO A CB   3  
ATOM 3053  C CG   . PRO A 1 13 ? 16.969  -0.081  -13.535 1.00 0.00 ? 13 PRO A CG   3  
ATOM 3054  C CD   . PRO A 1 13 ? 15.544  0.237   -13.111 1.00 0.00 ? 13 PRO A CD   3  
ATOM 3055  H HA   . PRO A 1 13 ? 16.443  -1.954  -10.973 1.00 0.00 ? 13 PRO A HA   3  
ATOM 3056  H HB2  . PRO A 1 13 ? 18.556  -0.762  -12.230 1.00 0.00 ? 13 PRO A HB2  3  
ATOM 3057  H HB3  . PRO A 1 13 ? 17.622  -2.059  -12.948 1.00 0.00 ? 13 PRO A HB3  3  
ATOM 3058  H HG2  . PRO A 1 13 ? 17.567  0.830   -13.573 1.00 0.00 ? 13 PRO A HG2  3  
ATOM 3059  H HG3  . PRO A 1 13 ? 16.982  -0.513  -14.535 1.00 0.00 ? 13 PRO A HG3  3  
ATOM 3060  H HD2  . PRO A 1 13 ? 15.397  1.310   -12.989 1.00 0.00 ? 13 PRO A HD2  3  
ATOM 3061  H HD3  . PRO A 1 13 ? 14.824  -0.101  -13.856 1.00 0.00 ? 13 PRO A HD3  3  
ATOM 3062  N N    . ASN A 1 14 ? 17.056  1.100   -10.313 1.00 0.00 ? 14 ASN A N    3  
ATOM 3063  C CA   . ASN A 1 14 ? 17.527  2.005   -9.278  1.00 0.00 ? 14 ASN A CA   3  
ATOM 3064  C C    . ASN A 1 14 ? 16.349  2.829   -8.752  1.00 0.00 ? 14 ASN A C    3  
ATOM 3065  O O    . ASN A 1 14 ? 15.406  3.111   -9.490  1.00 0.00 ? 14 ASN A O    3  
ATOM 3066  C CB   . ASN A 1 14 ? 18.573  2.976   -9.829  1.00 0.00 ? 14 ASN A CB   3  
ATOM 3067  C CG   . ASN A 1 14 ? 18.030  3.739   -11.039 1.00 0.00 ? 14 ASN A CG   3  
ATOM 3068  O OD1  . ASN A 1 14 ? 16.944  3.482   -11.531 1.00 0.00 ? 14 ASN A OD1  3  
ATOM 3069  N ND2  . ASN A 1 14 ? 18.845  4.689   -11.489 1.00 0.00 ? 14 ASN A ND2  3  
ATOM 3070  H H    . ASN A 1 14 ? 16.675  1.546   -11.123 1.00 0.00 ? 14 ASN A H    3  
ATOM 3071  H HA   . ASN A 1 14 ? 17.962  1.363   -8.512  1.00 0.00 ? 14 ASN A HA   3  
ATOM 3072  H HB2  . ASN A 1 14 ? 18.866  3.681   -9.051  1.00 0.00 ? 14 ASN A HB2  3  
ATOM 3073  H HB3  . ASN A 1 14 ? 19.470  2.425   -10.114 1.00 0.00 ? 14 ASN A HB3  3  
ATOM 3074  H HD21 . ASN A 1 14 ? 19.724  4.848   -11.040 1.00 0.00 ? 14 ASN A HD21 3  
ATOM 3075  H HD22 . ASN A 1 14 ? 18.579  5.243   -12.278 1.00 0.00 ? 14 ASN A HD22 3  
ATOM 3076  N N    . GLY A 1 15 ? 16.443  3.191   -7.481  1.00 0.00 ? 15 GLY A N    3  
ATOM 3077  C CA   . GLY A 1 15 ? 15.397  3.977   -6.849  1.00 0.00 ? 15 GLY A CA   3  
ATOM 3078  C C    . GLY A 1 15 ? 14.199  3.099   -6.481  1.00 0.00 ? 15 GLY A C    3  
ATOM 3079  O O    . GLY A 1 15 ? 13.606  2.457   -7.346  1.00 0.00 ? 15 GLY A O    3  
ATOM 3080  H H    . GLY A 1 15 ? 17.213  2.958   -6.888  1.00 0.00 ? 15 GLY A H    3  
ATOM 3081  H HA2  . GLY A 1 15 ? 15.789  4.457   -5.952  1.00 0.00 ? 15 GLY A HA2  3  
ATOM 3082  H HA3  . GLY A 1 15 ? 15.077  4.772   -7.522  1.00 0.00 ? 15 GLY A HA3  3  
ATOM 3083  N N    . LYS A 1 16 ? 13.877  3.101   -5.195  1.00 0.00 ? 16 LYS A N    3  
ATOM 3084  C CA   . LYS A 1 16 ? 12.761  2.313   -4.702  1.00 0.00 ? 16 LYS A CA   3  
ATOM 3085  C C    . LYS A 1 16 ? 11.606  3.247   -4.335  1.00 0.00 ? 16 LYS A C    3  
ATOM 3086  O O    . LYS A 1 16 ? 11.765  4.139   -3.503  1.00 0.00 ? 16 LYS A O    3  
ATOM 3087  C CB   . LYS A 1 16 ? 13.209  1.408   -3.553  1.00 0.00 ? 16 LYS A CB   3  
ATOM 3088  C CG   . LYS A 1 16 ? 13.485  2.224   -2.288  1.00 0.00 ? 16 LYS A CG   3  
ATOM 3089  C CD   . LYS A 1 16 ? 14.128  1.356   -1.205  1.00 0.00 ? 16 LYS A CD   3  
ATOM 3090  C CE   . LYS A 1 16 ? 15.117  2.168   -0.366  1.00 0.00 ? 16 LYS A CE   3  
ATOM 3091  N NZ   . LYS A 1 16 ? 16.441  2.212   -1.026  1.00 0.00 ? 16 LYS A NZ   3  
ATOM 3092  H H    . LYS A 1 16 ? 14.364  3.626   -4.498  1.00 0.00 ? 16 LYS A H    3  
ATOM 3093  H HA   . LYS A 1 16 ? 12.435  1.664   -5.515  1.00 0.00 ? 16 LYS A HA   3  
ATOM 3094  H HB2  . LYS A 1 16 ? 12.440  0.664   -3.348  1.00 0.00 ? 16 LYS A HB2  3  
ATOM 3095  H HB3  . LYS A 1 16 ? 14.108  0.864   -3.843  1.00 0.00 ? 16 LYS A HB3  3  
ATOM 3096  H HG2  . LYS A 1 16 ? 14.143  3.060   -2.527  1.00 0.00 ? 16 LYS A HG2  3  
ATOM 3097  H HG3  . LYS A 1 16 ? 12.554  2.649   -1.915  1.00 0.00 ? 16 LYS A HG3  3  
ATOM 3098  H HD2  . LYS A 1 16 ? 13.353  0.942   -0.559  1.00 0.00 ? 16 LYS A HD2  3  
ATOM 3099  H HD3  . LYS A 1 16 ? 14.642  0.513   -1.666  1.00 0.00 ? 16 LYS A HD3  3  
ATOM 3100  H HE2  . LYS A 1 16 ? 14.739  3.181   -0.227  1.00 0.00 ? 16 LYS A HE2  3  
ATOM 3101  H HE3  . LYS A 1 16 ? 15.213  1.725   0.625   1.00 0.00 ? 16 LYS A HE3  3  
ATOM 3102  H HZ1  . LYS A 1 16 ? 16.960  1.391   -0.788  1.00 0.00 ? 16 LYS A HZ1  3  
ATOM 3103  H HZ2  . LYS A 1 16 ? 16.318  2.252   -2.018  1.00 0.00 ? 16 LYS A HZ2  3  
ATOM 3104  H HZ3  . LYS A 1 16 ? 16.940  3.023   -0.719  1.00 0.00 ? 16 LYS A HZ3  3  
ATOM 3105  N N    . SER A 1 17 ? 10.469  3.010   -4.973  1.00 0.00 ? 17 SER A N    3  
ATOM 3106  C CA   . SER A 1 17 ? 9.288   3.819   -4.724  1.00 0.00 ? 17 SER A CA   3  
ATOM 3107  C C    . SER A 1 17 ? 8.443   3.184   -3.618  1.00 0.00 ? 17 SER A C    3  
ATOM 3108  O O    . SER A 1 17 ? 8.593   2.001   -3.319  1.00 0.00 ? 17 SER A O    3  
ATOM 3109  C CB   . SER A 1 17 ? 8.457   3.986   -5.998  1.00 0.00 ? 17 SER A CB   3  
ATOM 3110  O OG   . SER A 1 17 ? 9.233   4.495   -7.079  1.00 0.00 ? 17 SER A OG   3  
ATOM 3111  H H    . SER A 1 17 ? 10.348  2.282   -5.649  1.00 0.00 ? 17 SER A H    3  
ATOM 3112  H HA   . SER A 1 17 ? 9.666   4.791   -4.407  1.00 0.00 ? 17 SER A HA   3  
ATOM 3113  H HB2  . SER A 1 17 ? 8.028   3.025   -6.280  1.00 0.00 ? 17 SER A HB2  3  
ATOM 3114  H HB3  . SER A 1 17 ? 7.623   4.661   -5.800  1.00 0.00 ? 17 SER A HB3  3  
ATOM 3115  H HG   . SER A 1 17 ? 9.810   5.248   -6.761  1.00 0.00 ? 17 SER A HG   3  
ATOM 3116  N N    . GLU A 1 18 ? 7.573   4.000   -3.040  1.00 0.00 ? 18 GLU A N    3  
ATOM 3117  C CA   . GLU A 1 18 ? 6.704   3.533   -1.974  1.00 0.00 ? 18 GLU A CA   3  
ATOM 3118  C C    . GLU A 1 18 ? 6.133   2.156   -2.319  1.00 0.00 ? 18 GLU A C    3  
ATOM 3119  O O    . GLU A 1 18 ? 6.353   1.189   -1.591  1.00 0.00 ? 18 GLU A O    3  
ATOM 3120  C CB   . GLU A 1 18 ? 5.584   4.538   -1.700  1.00 0.00 ? 18 GLU A CB   3  
ATOM 3121  C CG   . GLU A 1 18 ? 5.608   5.003   -0.242  1.00 0.00 ? 18 GLU A CG   3  
ATOM 3122  C CD   . GLU A 1 18 ? 6.887   5.785   0.063   1.00 0.00 ? 18 GLU A CD   3  
ATOM 3123  O OE1  . GLU A 1 18 ? 6.940   6.967   -0.341  1.00 0.00 ? 18 GLU A OE1  3  
ATOM 3124  O OE2  . GLU A 1 18 ? 7.784   5.183   0.692   1.00 0.00 ? 18 GLU A OE2  3  
ATOM 3125  H H    . GLU A 1 18 ? 7.458   4.961   -3.289  1.00 0.00 ? 18 GLU A H    3  
ATOM 3126  H HA   . GLU A 1 18 ? 7.341   3.459   -1.092  1.00 0.00 ? 18 GLU A HA   3  
ATOM 3127  H HB2  . GLU A 1 18 ? 5.692   5.398   -2.361  1.00 0.00 ? 18 GLU A HB2  3  
ATOM 3128  H HB3  . GLU A 1 18 ? 4.619   4.083   -1.924  1.00 0.00 ? 18 GLU A HB3  3  
ATOM 3129  H HG2  . GLU A 1 18 ? 4.738   5.629   -0.042  1.00 0.00 ? 18 GLU A HG2  3  
ATOM 3130  H HG3  . GLU A 1 18 ? 5.539   4.139   0.420   1.00 0.00 ? 18 GLU A HG3  3  
ATOM 3131  N N    . VAL A 1 19 ? 5.411   2.111   -3.429  1.00 0.00 ? 19 VAL A N    3  
ATOM 3132  C CA   . VAL A 1 19 ? 4.807   0.869   -3.879  1.00 0.00 ? 19 VAL A CA   3  
ATOM 3133  C C    . VAL A 1 19 ? 5.811   -0.273  -3.706  1.00 0.00 ? 19 VAL A C    3  
ATOM 3134  O O    . VAL A 1 19 ? 5.462   -1.341  -3.205  1.00 0.00 ? 19 VAL A O    3  
ATOM 3135  C CB   . VAL A 1 19 ? 4.314   1.018   -5.319  1.00 0.00 ? 19 VAL A CB   3  
ATOM 3136  C CG1  . VAL A 1 19 ? 3.208   2.071   -5.413  1.00 0.00 ? 19 VAL A CG1  3  
ATOM 3137  C CG2  . VAL A 1 19 ? 5.471   1.352   -6.263  1.00 0.00 ? 19 VAL A CG2  3  
ATOM 3138  H H    . VAL A 1 19 ? 5.237   2.902   -4.015  1.00 0.00 ? 19 VAL A H    3  
ATOM 3139  H HA   . VAL A 1 19 ? 3.942   0.675   -3.244  1.00 0.00 ? 19 VAL A HA   3  
ATOM 3140  H HB   . VAL A 1 19 ? 3.893   0.062   -5.631  1.00 0.00 ? 19 VAL A HB   3  
ATOM 3141  H HG11 . VAL A 1 19 ? 3.563   2.920   -5.998  1.00 0.00 ? 19 VAL A HG11 3  
ATOM 3142  H HG12 . VAL A 1 19 ? 2.333   1.637   -5.897  1.00 0.00 ? 19 VAL A HG12 3  
ATOM 3143  H HG13 . VAL A 1 19 ? 2.940   2.407   -4.412  1.00 0.00 ? 19 VAL A HG13 3  
ATOM 3144  H HG21 . VAL A 1 19 ? 5.090   1.470   -7.277  1.00 0.00 ? 19 VAL A HG21 3  
ATOM 3145  H HG22 . VAL A 1 19 ? 5.945   2.280   -5.943  1.00 0.00 ? 19 VAL A HG22 3  
ATOM 3146  H HG23 . VAL A 1 19 ? 6.202   0.544   -6.241  1.00 0.00 ? 19 VAL A HG23 3  
ATOM 3147  N N    . CYS A 1 20 ? 7.038   -0.009  -4.131  1.00 0.00 ? 20 CYS A N    3  
ATOM 3148  C CA   . CYS A 1 20 ? 8.094   -1.002  -4.030  1.00 0.00 ? 20 CYS A CA   3  
ATOM 3149  C C    . CYS A 1 20 ? 8.446   -1.180  -2.551  1.00 0.00 ? 20 CYS A C    3  
ATOM 3150  O O    . CYS A 1 20 ? 8.328   -2.278  -2.009  1.00 0.00 ? 20 CYS A O    3  
ATOM 3151  C CB   . CYS A 1 20 ? 9.316   -0.614  -4.864  1.00 0.00 ? 20 CYS A CB   3  
ATOM 3152  S SG   . CYS A 1 20 ? 9.501   -1.764  -6.275  1.00 0.00 ? 20 CYS A SG   3  
ATOM 3153  H H    . CYS A 1 20 ? 7.313   0.862   -4.537  1.00 0.00 ? 20 CYS A H    3  
ATOM 3154  H HA   . CYS A 1 20 ? 7.696   -1.927  -4.447  1.00 0.00 ? 20 CYS A HA   3  
ATOM 3155  H HB2  . CYS A 1 20 ? 9.209   0.408   -5.229  1.00 0.00 ? 20 CYS A HB2  3  
ATOM 3156  H HB3  . CYS A 1 20 ? 10.213  -0.638  -4.245  1.00 0.00 ? 20 CYS A HB3  3  
ATOM 3157  H HG   . CYS A 1 20 ? 9.790   -2.836  -5.544  1.00 0.00 ? 20 CYS A HG   3  
ATOM 3158  N N    . ILE A 1 21 ? 8.871   -0.083  -1.941  1.00 0.00 ? 21 ILE A N    3  
ATOM 3159  C CA   . ILE A 1 21 ? 9.240   -0.104  -0.536  1.00 0.00 ? 21 ILE A CA   3  
ATOM 3160  C C    . ILE A 1 21 ? 8.219   -0.935  0.243   1.00 0.00 ? 21 ILE A C    3  
ATOM 3161  O O    . ILE A 1 21 ? 8.576   -1.921  0.886   1.00 0.00 ? 21 ILE A O    3  
ATOM 3162  C CB   . ILE A 1 21 ? 9.408   1.320   -0.004  1.00 0.00 ? 21 ILE A CB   3  
ATOM 3163  C CG1  . ILE A 1 21 ? 10.537  2.049   -0.736  1.00 0.00 ? 21 ILE A CG1  3  
ATOM 3164  C CG2  . ILE A 1 21 ? 9.614   1.319   1.512   1.00 0.00 ? 21 ILE A CG2  3  
ATOM 3165  C CD1  . ILE A 1 21 ? 10.347  3.566   -0.664  1.00 0.00 ? 21 ILE A CD1  3  
ATOM 3166  H H    . ILE A 1 21 ? 8.964   0.806   -2.389  1.00 0.00 ? 21 ILE A H    3  
ATOM 3167  H HA   . ILE A 1 21 ? 10.212  -0.593  -0.461  1.00 0.00 ? 21 ILE A HA   3  
ATOM 3168  H HB   . ILE A 1 21 ? 8.488   1.870   -0.204  1.00 0.00 ? 21 ILE A HB   3  
ATOM 3169  H HG12 . ILE A 1 21 ? 11.496  1.778   -0.294  1.00 0.00 ? 21 ILE A HG12 3  
ATOM 3170  H HG13 . ILE A 1 21 ? 10.564  1.732   -1.778  1.00 0.00 ? 21 ILE A HG13 3  
ATOM 3171  H HG21 . ILE A 1 21 ? 9.295   2.277   1.923   1.00 0.00 ? 21 ILE A HG21 3  
ATOM 3172  H HG22 . ILE A 1 21 ? 9.025   0.518   1.958   1.00 0.00 ? 21 ILE A HG22 3  
ATOM 3173  H HG23 . ILE A 1 21 ? 10.669  1.162   1.735   1.00 0.00 ? 21 ILE A HG23 3  
ATOM 3174  H HD11 . ILE A 1 21 ? 10.437  3.991   -1.663  1.00 0.00 ? 21 ILE A HD11 3  
ATOM 3175  H HD12 . ILE A 1 21 ? 9.360   3.790   -0.260  1.00 0.00 ? 21 ILE A HD12 3  
ATOM 3176  H HD13 . ILE A 1 21 ? 11.111  3.997   -0.016  1.00 0.00 ? 21 ILE A HD13 3  
ATOM 3177  N N    . LEU A 1 22 ? 6.968   -0.507  0.160   1.00 0.00 ? 22 LEU A N    3  
ATOM 3178  C CA   . LEU A 1 22 ? 5.892   -1.199  0.850   1.00 0.00 ? 22 LEU A CA   3  
ATOM 3179  C C    . LEU A 1 22 ? 6.025   -2.704  0.611   1.00 0.00 ? 22 LEU A C    3  
ATOM 3180  O O    . LEU A 1 22 ? 6.065   -3.486  1.560   1.00 0.00 ? 22 LEU A O    3  
ATOM 3181  C CB   . LEU A 1 22 ? 4.535   -0.627  0.434   1.00 0.00 ? 22 LEU A CB   3  
ATOM 3182  C CG   . LEU A 1 22 ? 3.309   -1.446  0.844   1.00 0.00 ? 22 LEU A CG   3  
ATOM 3183  C CD1  . LEU A 1 22 ? 3.108   -2.638  -0.094  1.00 0.00 ? 22 LEU A CD1  3  
ATOM 3184  C CD2  . LEU A 1 22 ? 3.403   -1.879  2.308   1.00 0.00 ? 22 LEU A CD2  3  
ATOM 3185  H H    . LEU A 1 22 ? 6.686   0.296   -0.365  1.00 0.00 ? 22 LEU A H    3  
ATOM 3186  H HA   . LEU A 1 22 ? 6.010   -1.006  1.916   1.00 0.00 ? 22 LEU A HA   3  
ATOM 3187  H HB2  . LEU A 1 22 ? 4.438   0.372   0.859   1.00 0.00 ? 22 LEU A HB2  3  
ATOM 3188  H HB3  . LEU A 1 22 ? 4.527   -0.515  -0.650  1.00 0.00 ? 22 LEU A HB3  3  
ATOM 3189  H HG   . LEU A 1 22 ? 2.428   -0.811  0.751   1.00 0.00 ? 22 LEU A HG   3  
ATOM 3190  H HD11 . LEU A 1 22 ? 2.107   -2.597  -0.524  1.00 0.00 ? 22 LEU A HD11 3  
ATOM 3191  H HD12 . LEU A 1 22 ? 3.848   -2.601  -0.893  1.00 0.00 ? 22 LEU A HD12 3  
ATOM 3192  H HD13 . LEU A 1 22 ? 3.224   -3.566  0.467   1.00 0.00 ? 22 LEU A HD13 3  
ATOM 3193  H HD21 . LEU A 1 22 ? 2.597   -2.577  2.533   1.00 0.00 ? 22 LEU A HD21 3  
ATOM 3194  H HD22 . LEU A 1 22 ? 4.363   -2.363  2.483   1.00 0.00 ? 22 LEU A HD22 3  
ATOM 3195  H HD23 . LEU A 1 22 ? 3.315   -1.003  2.952   1.00 0.00 ? 22 LEU A HD23 3  
ATOM 3196  N N    . HIS A 1 23 ? 6.090   -3.066  -0.662  1.00 0.00 ? 23 HIS A N    3  
ATOM 3197  C CA   . HIS A 1 23 ? 6.217   -4.464  -1.037  1.00 0.00 ? 23 HIS A CA   3  
ATOM 3198  C C    . HIS A 1 23 ? 7.442   -5.070  -0.350  1.00 0.00 ? 23 HIS A C    3  
ATOM 3199  O O    . HIS A 1 23 ? 7.338   -6.094  0.322   1.00 0.00 ? 23 HIS A O    3  
ATOM 3200  C CB   . HIS A 1 23 ? 6.255   -4.616  -2.559  1.00 0.00 ? 23 HIS A CB   3  
ATOM 3201  C CG   . HIS A 1 23 ? 5.926   -6.008  -3.045  1.00 0.00 ? 23 HIS A CG   3  
ATOM 3202  N ND1  . HIS A 1 23 ? 5.254   -6.248  -4.232  1.00 0.00 ? 23 HIS A ND1  3  
ATOM 3203  C CD2  . HIS A 1 23 ? 6.183   -7.228  -2.494  1.00 0.00 ? 23 HIS A CD2  3  
ATOM 3204  C CE1  . HIS A 1 23 ? 5.118   -7.558  -4.377  1.00 0.00 ? 23 HIS A CE1  3  
ATOM 3205  N NE2  . HIS A 1 23 ? 5.694   -8.164  -3.299  1.00 0.00 ? 23 HIS A NE2  3  
ATOM 3206  H H    . HIS A 1 23 ? 6.057   -2.424  -1.428  1.00 0.00 ? 23 HIS A H    3  
ATOM 3207  H HA   . HIS A 1 23 ? 5.321   -4.968  -0.675  1.00 0.00 ? 23 HIS A HA   3  
ATOM 3208  H HB2  . HIS A 1 23 ? 5.551   -3.912  -3.002  1.00 0.00 ? 23 HIS A HB2  3  
ATOM 3209  H HB3  . HIS A 1 23 ? 7.247   -4.343  -2.917  1.00 0.00 ? 23 HIS A HB3  3  
ATOM 3210  H HD1  . HIS A 1 23 ? 4.928   -5.552  -4.870  1.00 0.00 ? 23 HIS A HD1  3  
ATOM 3211  H HD2  . HIS A 1 23 ? 6.701   -7.405  -1.552  1.00 0.00 ? 23 HIS A HD2  3  
ATOM 3212  H HE1  . HIS A 1 23 ? 4.632   -8.063  -5.212  1.00 0.00 ? 23 HIS A HE1  3  
ATOM 3213  N N    . GLU A 1 24 ? 8.576   -4.411  -0.543  1.00 0.00 ? 24 GLU A N    3  
ATOM 3214  C CA   . GLU A 1 24 ? 9.820   -4.873  0.049   1.00 0.00 ? 24 GLU A CA   3  
ATOM 3215  C C    . GLU A 1 24 ? 9.604   -5.237  1.520   1.00 0.00 ? 24 GLU A C    3  
ATOM 3216  O O    . GLU A 1 24 ? 9.617   -6.413  1.880   1.00 0.00 ? 24 GLU A O    3  
ATOM 3217  C CB   . GLU A 1 24 ? 10.921  -3.821  -0.100  1.00 0.00 ? 24 GLU A CB   3  
ATOM 3218  C CG   . GLU A 1 24 ? 12.148  -4.407  -0.801  1.00 0.00 ? 24 GLU A CG   3  
ATOM 3219  C CD   . GLU A 1 24 ? 13.259  -4.716  0.204   1.00 0.00 ? 24 GLU A CD   3  
ATOM 3220  O OE1  . GLU A 1 24 ? 13.092  -5.706  0.948   1.00 0.00 ? 24 GLU A OE1  3  
ATOM 3221  O OE2  . GLU A 1 24 ? 14.251  -3.954  0.205   1.00 0.00 ? 24 GLU A OE2  3  
ATOM 3222  H H    . GLU A 1 24 ? 8.652   -3.579  -1.092  1.00 0.00 ? 24 GLU A H    3  
ATOM 3223  H HA   . GLU A 1 24 ? 10.097  -5.763  -0.516  1.00 0.00 ? 24 GLU A HA   3  
ATOM 3224  H HB2  . GLU A 1 24 ? 10.543  -2.972  -0.669  1.00 0.00 ? 24 GLU A HB2  3  
ATOM 3225  H HB3  . GLU A 1 24 ? 11.205  -3.445  0.883   1.00 0.00 ? 24 GLU A HB3  3  
ATOM 3226  H HG2  . GLU A 1 24 ? 11.868  -5.318  -1.330  1.00 0.00 ? 24 GLU A HG2  3  
ATOM 3227  H HG3  . GLU A 1 24 ? 12.514  -3.704  -1.549  1.00 0.00 ? 24 GLU A HG3  3  
ATOM 3228  N N    . TYR A 1 25 ? 9.411   -4.206  2.329   1.00 0.00 ? 25 TYR A N    3  
ATOM 3229  C CA   . TYR A 1 25 ? 9.193   -4.402  3.752   1.00 0.00 ? 25 TYR A CA   3  
ATOM 3230  C C    . TYR A 1 25 ? 8.156   -5.499  4.002   1.00 0.00 ? 25 TYR A C    3  
ATOM 3231  O O    . TYR A 1 25 ? 8.312   -6.310  4.913   1.00 0.00 ? 25 TYR A O    3  
ATOM 3232  C CB   . TYR A 1 25 ? 8.651   -3.074  4.283   1.00 0.00 ? 25 TYR A CB   3  
ATOM 3233  C CG   . TYR A 1 25 ? 7.971   -3.181  5.650   1.00 0.00 ? 25 TYR A CG   3  
ATOM 3234  C CD1  . TYR A 1 25 ? 6.741   -3.798  5.762   1.00 0.00 ? 25 TYR A CD1  3  
ATOM 3235  C CD2  . TYR A 1 25 ? 8.587   -2.661  6.770   1.00 0.00 ? 25 TYR A CD2  3  
ATOM 3236  C CE1  . TYR A 1 25 ? 6.101   -3.899  7.048   1.00 0.00 ? 25 TYR A CE1  3  
ATOM 3237  C CE2  . TYR A 1 25 ? 7.947   -2.762  8.056   1.00 0.00 ? 25 TYR A CE2  3  
ATOM 3238  C CZ   . TYR A 1 25 ? 6.736   -3.376  8.132   1.00 0.00 ? 25 TYR A CZ   3  
ATOM 3239  O OH   . TYR A 1 25 ? 6.132   -3.471  9.346   1.00 0.00 ? 25 TYR A OH   3  
ATOM 3240  H H    . TYR A 1 25 ? 9.402   -3.252  2.028   1.00 0.00 ? 25 TYR A H    3  
ATOM 3241  H HA   . TYR A 1 25 ? 10.141  -4.700  4.200   1.00 0.00 ? 25 TYR A HA   3  
ATOM 3242  H HB2  . TYR A 1 25 ? 9.471   -2.360  4.352   1.00 0.00 ? 25 TYR A HB2  3  
ATOM 3243  H HB3  . TYR A 1 25 ? 7.937   -2.671  3.564   1.00 0.00 ? 25 TYR A HB3  3  
ATOM 3244  H HD1  . TYR A 1 25 ? 6.255   -4.209  4.878   1.00 0.00 ? 25 TYR A HD1  3  
ATOM 3245  H HD2  . TYR A 1 25 ? 9.558   -2.174  6.681   1.00 0.00 ? 25 TYR A HD2  3  
ATOM 3246  H HE1  . TYR A 1 25 ? 5.130   -4.383  7.151   1.00 0.00 ? 25 TYR A HE1  3  
ATOM 3247  H HE2  . TYR A 1 25 ? 8.423   -2.355  8.948   1.00 0.00 ? 25 TYR A HE2  3  
ATOM 3248  H HH   . TYR A 1 25 ? 5.976   -2.558  9.723   1.00 0.00 ? 25 TYR A HH   3  
ATOM 3249  N N    . MET A 1 26 ? 7.120   -5.489  3.176   1.00 0.00 ? 26 MET A N    3  
ATOM 3250  C CA   . MET A 1 26 ? 6.058   -6.473  3.295   1.00 0.00 ? 26 MET A CA   3  
ATOM 3251  C C    . MET A 1 26 ? 6.587   -7.885  3.037   1.00 0.00 ? 26 MET A C    3  
ATOM 3252  O O    . MET A 1 26 ? 6.427   -8.774  3.872   1.00 0.00 ? 26 MET A O    3  
ATOM 3253  C CB   . MET A 1 26 ? 4.948   -6.151  2.291   1.00 0.00 ? 26 MET A CB   3  
ATOM 3254  C CG   . MET A 1 26 ? 3.816   -5.367  2.958   1.00 0.00 ? 26 MET A CG   3  
ATOM 3255  S SD   . MET A 1 26 ? 2.240   -5.909  2.319   1.00 0.00 ? 26 MET A SD   3  
ATOM 3256  C CE   . MET A 1 26 ? 2.373   -7.665  2.612   1.00 0.00 ? 26 MET A CE   3  
ATOM 3257  H H    . MET A 1 26 ? 7.001   -4.825  2.437   1.00 0.00 ? 26 MET A H    3  
ATOM 3258  H HA   . MET A 1 26 ? 5.699   -6.393  4.322   1.00 0.00 ? 26 MET A HA   3  
ATOM 3259  H HB2  . MET A 1 26 ? 5.359   -5.572  1.464   1.00 0.00 ? 26 MET A HB2  3  
ATOM 3260  H HB3  . MET A 1 26 ? 4.556   -7.076  1.869   1.00 0.00 ? 26 MET A HB3  3  
ATOM 3261  H HG2  . MET A 1 26 ? 3.849   -5.512  4.038   1.00 0.00 ? 26 MET A HG2  3  
ATOM 3262  H HG3  . MET A 1 26 ? 3.945   -4.300  2.776   1.00 0.00 ? 26 MET A HG3  3  
ATOM 3263  H HE1  . MET A 1 26 ? 1.506   -8.005  3.177   1.00 0.00 ? 26 MET A HE1  3  
ATOM 3264  H HE2  . MET A 1 26 ? 2.415   -8.190  1.658   1.00 0.00 ? 26 MET A HE2  3  
ATOM 3265  H HE3  . MET A 1 26 ? 3.280   -7.870  3.180   1.00 0.00 ? 26 MET A HE3  3  
ATOM 3266  N N    . GLN A 1 27 ? 7.206   -8.047  1.877   1.00 0.00 ? 27 GLN A N    3  
ATOM 3267  C CA   . GLN A 1 27 ? 7.760   -9.336  1.498   1.00 0.00 ? 27 GLN A CA   3  
ATOM 3268  C C    . GLN A 1 27 ? 9.034   -9.621  2.295   1.00 0.00 ? 27 GLN A C    3  
ATOM 3269  O O    . GLN A 1 27 ? 9.591   -10.715 2.212   1.00 0.00 ? 27 GLN A O    3  
ATOM 3270  C CB   . GLN A 1 27 ? 8.028   -9.397  -0.007  1.00 0.00 ? 27 GLN A CB   3  
ATOM 3271  C CG   . GLN A 1 27 ? 9.154   -10.383 -0.324  1.00 0.00 ? 27 GLN A CG   3  
ATOM 3272  C CD   . GLN A 1 27 ? 9.386   -10.484 -1.833  1.00 0.00 ? 27 GLN A CD   3  
ATOM 3273  O OE1  . GLN A 1 27 ? 9.902   -9.579  -2.469  1.00 0.00 ? 27 GLN A OE1  3  
ATOM 3274  N NE2  . GLN A 1 27 ? 8.979   -11.631 -2.367  1.00 0.00 ? 27 GLN A NE2  3  
ATOM 3275  H H    . GLN A 1 27 ? 7.332   -7.319  1.203   1.00 0.00 ? 27 GLN A H    3  
ATOM 3276  H HA   . GLN A 1 27 ? 6.992   -10.067 1.754   1.00 0.00 ? 27 GLN A HA   3  
ATOM 3277  H HB2  . GLN A 1 27 ? 7.120   -9.695  -0.530  1.00 0.00 ? 27 GLN A HB2  3  
ATOM 3278  H HB3  . GLN A 1 27 ? 8.296   -8.405  -0.372  1.00 0.00 ? 27 GLN A HB3  3  
ATOM 3279  H HG2  . GLN A 1 27 ? 10.072  -10.063 0.169   1.00 0.00 ? 27 GLN A HG2  3  
ATOM 3280  H HG3  . GLN A 1 27 ? 8.904   -11.366 0.076   1.00 0.00 ? 27 GLN A HG3  3  
ATOM 3281  H HE21 . GLN A 1 27 ? 8.564   -12.333 -1.789  1.00 0.00 ? 27 GLN A HE21 3  
ATOM 3282  H HE22 . GLN A 1 27 ? 9.088   -11.792 -3.348  1.00 0.00 ? 27 GLN A HE22 3  
ATOM 3283  N N    . ARG A 1 28 ? 9.460   -8.618  3.048   1.00 0.00 ? 28 ARG A N    3  
ATOM 3284  C CA   . ARG A 1 28 ? 10.659  -8.747  3.859   1.00 0.00 ? 28 ARG A CA   3  
ATOM 3285  C C    . ARG A 1 28 ? 10.289  -9.097  5.301   1.00 0.00 ? 28 ARG A C    3  
ATOM 3286  O O    . ARG A 1 28 ? 10.963  -9.904  5.940   1.00 0.00 ? 28 ARG A O    3  
ATOM 3287  C CB   . ARG A 1 28 ? 11.473  -7.452  3.848   1.00 0.00 ? 28 ARG A CB   3  
ATOM 3288  C CG   . ARG A 1 28 ? 12.507  -7.444  4.976   1.00 0.00 ? 28 ARG A CG   3  
ATOM 3289  C CD   . ARG A 1 28 ? 13.810  -6.784  4.522   1.00 0.00 ? 28 ARG A CD   3  
ATOM 3290  N NE   . ARG A 1 28 ? 14.030  -5.529  5.275   1.00 0.00 ? 28 ARG A NE   3  
ATOM 3291  C CZ   . ARG A 1 28 ? 15.101  -4.738  5.120   1.00 0.00 ? 28 ARG A CZ   3  
ATOM 3292  N NH1  . ARG A 1 28 ? 16.056  -5.068  4.239   1.00 0.00 ? 28 ARG A NH1  3  
ATOM 3293  N NH2  . ARG A 1 28 ? 15.218  -3.618  5.847   1.00 0.00 ? 28 ARG A NH2  3  
ATOM 3294  H H    . ARG A 1 28 ? 9.002   -7.731  3.109   1.00 0.00 ? 28 ARG A H    3  
ATOM 3295  H HA   . ARG A 1 28 ? 11.225  -9.553  3.392   1.00 0.00 ? 28 ARG A HA   3  
ATOM 3296  H HB2  . ARG A 1 28 ? 11.977  -7.342  2.888   1.00 0.00 ? 28 ARG A HB2  3  
ATOM 3297  H HB3  . ARG A 1 28 ? 10.805  -6.597  3.957   1.00 0.00 ? 28 ARG A HB3  3  
ATOM 3298  H HG2  . ARG A 1 28 ? 12.106  -6.911  5.838   1.00 0.00 ? 28 ARG A HG2  3  
ATOM 3299  H HG3  . ARG A 1 28 ? 12.706  -8.466  5.299   1.00 0.00 ? 28 ARG A HG3  3  
ATOM 3300  H HD2  . ARG A 1 28 ? 14.646  -7.464  4.680   1.00 0.00 ? 28 ARG A HD2  3  
ATOM 3301  H HD3  . ARG A 1 28 ? 13.767  -6.574  3.453   1.00 0.00 ? 28 ARG A HD3  3  
ATOM 3302  H HE   . ARG A 1 28 ? 13.337  -5.254  5.941   1.00 0.00 ? 28 ARG A HE   3  
ATOM 3303  H HH11 . ARG A 1 28 ? 15.969  -5.904  3.697   1.00 0.00 ? 28 ARG A HH11 3  
ATOM 3304  H HH12 . ARG A 1 28 ? 16.855  -4.478  4.124   1.00 0.00 ? 28 ARG A HH12 3  
ATOM 3305  H HH21 . ARG A 1 28 ? 14.505  -3.372  6.504   1.00 0.00 ? 28 ARG A HH21 3  
ATOM 3306  H HH22 . ARG A 1 28 ? 16.017  -3.028  5.731   1.00 0.00 ? 28 ARG A HH22 3  
ATOM 3307  N N    . VAL A 1 29 ? 9.219   -8.473  5.772   1.00 0.00 ? 29 VAL A N    3  
ATOM 3308  C CA   . VAL A 1 29 ? 8.752   -8.709  7.127   1.00 0.00 ? 29 VAL A CA   3  
ATOM 3309  C C    . VAL A 1 29 ? 7.610   -9.727  7.099   1.00 0.00 ? 29 VAL A C    3  
ATOM 3310  O O    . VAL A 1 29 ? 7.739   -10.825 7.638   1.00 0.00 ? 29 VAL A O    3  
ATOM 3311  C CB   . VAL A 1 29 ? 8.355   -7.384  7.782   1.00 0.00 ? 29 VAL A CB   3  
ATOM 3312  C CG1  . VAL A 1 29 ? 7.778   -7.615  9.180   1.00 0.00 ? 29 VAL A CG1  3  
ATOM 3313  C CG2  . VAL A 1 29 ? 9.541   -6.420  7.830   1.00 0.00 ? 29 VAL A CG2  3  
ATOM 3314  H H    . VAL A 1 29 ? 8.677   -7.819  5.246   1.00 0.00 ? 29 VAL A H    3  
ATOM 3315  H HA   . VAL A 1 29 ? 9.583   -9.130  7.694   1.00 0.00 ? 29 VAL A HA   3  
ATOM 3316  H HB   . VAL A 1 29 ? 7.577   -6.928  7.170   1.00 0.00 ? 29 VAL A HB   3  
ATOM 3317  H HG11 . VAL A 1 29 ? 8.209   -6.893  9.874   1.00 0.00 ? 29 VAL A HG11 3  
ATOM 3318  H HG12 . VAL A 1 29 ? 6.695   -7.490  9.152   1.00 0.00 ? 29 VAL A HG12 3  
ATOM 3319  H HG13 . VAL A 1 29 ? 8.019   -8.625  9.511   1.00 0.00 ? 29 VAL A HG13 3  
ATOM 3320  H HG21 . VAL A 1 29 ? 9.444   -5.767  8.698   1.00 0.00 ? 29 VAL A HG21 3  
ATOM 3321  H HG22 . VAL A 1 29 ? 10.469  -6.988  7.905   1.00 0.00 ? 29 VAL A HG22 3  
ATOM 3322  H HG23 . VAL A 1 29 ? 9.557   -5.817  6.922   1.00 0.00 ? 29 VAL A HG23 3  
ATOM 3323  N N    . LEU A 1 30 ? 6.518   -9.327  6.464   1.00 0.00 ? 30 LEU A N    3  
ATOM 3324  C CA   . LEU A 1 30 ? 5.355   -10.190 6.357   1.00 0.00 ? 30 LEU A CA   3  
ATOM 3325  C C    . LEU A 1 30 ? 5.722   -11.436 5.548   1.00 0.00 ? 30 LEU A C    3  
ATOM 3326  O O    . LEU A 1 30 ? 5.357   -12.551 5.918   1.00 0.00 ? 30 LEU A O    3  
ATOM 3327  C CB   . LEU A 1 30 ? 4.163   -9.417  5.790   1.00 0.00 ? 30 LEU A CB   3  
ATOM 3328  C CG   . LEU A 1 30 ? 3.563   -8.346  6.702   1.00 0.00 ? 30 LEU A CG   3  
ATOM 3329  C CD1  . LEU A 1 30 ? 2.644   -7.408  5.917   1.00 0.00 ? 30 LEU A CD1  3  
ATOM 3330  C CD2  . LEU A 1 30 ? 2.847   -8.981  7.896   1.00 0.00 ? 30 LEU A CD2  3  
ATOM 3331  H H    . LEU A 1 30 ? 6.422   -8.432  6.027   1.00 0.00 ? 30 LEU A H    3  
ATOM 3332  H HA   . LEU A 1 30 ? 5.086   -10.502 7.367   1.00 0.00 ? 30 LEU A HA   3  
ATOM 3333  H HB2  . LEU A 1 30 ? 4.474   -8.941  4.860   1.00 0.00 ? 30 LEU A HB2  3  
ATOM 3334  H HB3  . LEU A 1 30 ? 3.380   -10.131 5.536   1.00 0.00 ? 30 LEU A HB3  3  
ATOM 3335  H HG   . LEU A 1 30 ? 4.377   -7.740  7.100   1.00 0.00 ? 30 LEU A HG   3  
ATOM 3336  H HD11 . LEU A 1 30 ? 1.781   -7.146  6.530   1.00 0.00 ? 30 LEU A HD11 3  
ATOM 3337  H HD12 . LEU A 1 30 ? 3.190   -6.502  5.652   1.00 0.00 ? 30 LEU A HD12 3  
ATOM 3338  H HD13 . LEU A 1 30 ? 2.306   -7.907  5.008   1.00 0.00 ? 30 LEU A HD13 3  
ATOM 3339  H HD21 . LEU A 1 30 ? 3.485   -9.747  8.336   1.00 0.00 ? 30 LEU A HD21 3  
ATOM 3340  H HD22 . LEU A 1 30 ? 2.633   -8.215  8.641   1.00 0.00 ? 30 LEU A HD22 3  
ATOM 3341  H HD23 . LEU A 1 30 ? 1.914   -9.434  7.562   1.00 0.00 ? 30 LEU A HD23 3  
ATOM 3342  N N    . LYS A 1 31 ? 6.438   -11.204 4.458   1.00 0.00 ? 31 LYS A N    3  
ATOM 3343  C CA   . LYS A 1 31 ? 6.858   -12.293 3.592   1.00 0.00 ? 31 LYS A CA   3  
ATOM 3344  C C    . LYS A 1 31 ? 5.675   -12.741 2.732   1.00 0.00 ? 31 LYS A C    3  
ATOM 3345  O O    . LYS A 1 31 ? 5.393   -13.933 2.631   1.00 0.00 ? 31 LYS A O    3  
ATOM 3346  C CB   . LYS A 1 31 ? 7.482   -13.422 4.416   1.00 0.00 ? 31 LYS A CB   3  
ATOM 3347  C CG   . LYS A 1 31 ? 8.944   -13.642 4.025   1.00 0.00 ? 31 LYS A CG   3  
ATOM 3348  C CD   . LYS A 1 31 ? 9.300   -15.130 4.050   1.00 0.00 ? 31 LYS A CD   3  
ATOM 3349  C CE   . LYS A 1 31 ? 10.808  -15.331 4.212   1.00 0.00 ? 31 LYS A CE   3  
ATOM 3350  N NZ   . LYS A 1 31 ? 11.285  -16.413 3.322   1.00 0.00 ? 31 LYS A NZ   3  
ATOM 3351  H H    . LYS A 1 31 ? 6.730   -10.294 4.164   1.00 0.00 ? 31 LYS A H    3  
ATOM 3352  H HA   . LYS A 1 31 ? 7.637   -11.906 2.935   1.00 0.00 ? 31 LYS A HA   3  
ATOM 3353  H HB2  . LYS A 1 31 ? 7.417   -13.181 5.477   1.00 0.00 ? 31 LYS A HB2  3  
ATOM 3354  H HB3  . LYS A 1 31 ? 6.918   -14.342 4.264   1.00 0.00 ? 31 LYS A HB3  3  
ATOM 3355  H HG2  . LYS A 1 31 ? 9.123   -13.239 3.028   1.00 0.00 ? 31 LYS A HG2  3  
ATOM 3356  H HG3  . LYS A 1 31 ? 9.594   -13.098 4.711   1.00 0.00 ? 31 LYS A HG3  3  
ATOM 3357  H HD2  . LYS A 1 31 ? 8.774   -15.620 4.869   1.00 0.00 ? 31 LYS A HD2  3  
ATOM 3358  H HD3  . LYS A 1 31 ? 8.963   -15.604 3.127   1.00 0.00 ? 31 LYS A HD3  3  
ATOM 3359  H HE2  . LYS A 1 31 ? 11.331  -14.404 3.980   1.00 0.00 ? 31 LYS A HE2  3  
ATOM 3360  H HE3  . LYS A 1 31 ? 11.039  -15.577 5.249   1.00 0.00 ? 31 LYS A HE3  3  
ATOM 3361  H HZ1  . LYS A 1 31 ? 10.598  -16.593 2.618   1.00 0.00 ? 31 LYS A HZ1  3  
ATOM 3362  H HZ2  . LYS A 1 31 ? 12.142  -16.134 2.888   1.00 0.00 ? 31 LYS A HZ2  3  
ATOM 3363  H HZ3  . LYS A 1 31 ? 11.439  -17.243 3.859   1.00 0.00 ? 31 LYS A HZ3  3  
ATOM 3364  N N    . VAL A 1 32 ? 5.015   -11.760 2.134   1.00 0.00 ? 32 VAL A N    3  
ATOM 3365  C CA   . VAL A 1 32 ? 3.868   -12.038 1.286   1.00 0.00 ? 32 VAL A CA   3  
ATOM 3366  C C    . VAL A 1 32 ? 3.746   -10.942 0.226   1.00 0.00 ? 32 VAL A C    3  
ATOM 3367  O O    . VAL A 1 32 ? 4.075   -9.785  0.483   1.00 0.00 ? 32 VAL A O    3  
ATOM 3368  C CB   . VAL A 1 32 ? 2.608   -12.186 2.141   1.00 0.00 ? 32 VAL A CB   3  
ATOM 3369  C CG1  . VAL A 1 32 ? 2.738   -13.362 3.111   1.00 0.00 ? 32 VAL A CG1  3  
ATOM 3370  C CG2  . VAL A 1 32 ? 2.299   -10.889 2.891   1.00 0.00 ? 32 VAL A CG2  3  
ATOM 3371  H H    . VAL A 1 32 ? 5.251   -10.792 2.222   1.00 0.00 ? 32 VAL A H    3  
ATOM 3372  H HA   . VAL A 1 32 ? 4.051   -12.990 0.787   1.00 0.00 ? 32 VAL A HA   3  
ATOM 3373  H HB   . VAL A 1 32 ? 1.772   -12.393 1.473   1.00 0.00 ? 32 VAL A HB   3  
ATOM 3374  H HG11 . VAL A 1 32 ? 3.133   -14.229 2.579   1.00 0.00 ? 32 VAL A HG11 3  
ATOM 3375  H HG12 . VAL A 1 32 ? 3.417   -13.093 3.920   1.00 0.00 ? 32 VAL A HG12 3  
ATOM 3376  H HG13 . VAL A 1 32 ? 1.759   -13.604 3.523   1.00 0.00 ? 32 VAL A HG13 3  
ATOM 3377  H HG21 . VAL A 1 32 ? 3.193   -10.266 2.924   1.00 0.00 ? 32 VAL A HG21 3  
ATOM 3378  H HG22 . VAL A 1 32 ? 1.502   -10.352 2.376   1.00 0.00 ? 32 VAL A HG22 3  
ATOM 3379  H HG23 . VAL A 1 32 ? 1.981   -11.123 3.907   1.00 0.00 ? 32 VAL A HG23 3  
ATOM 3380  N N    . ARG A 1 33 ? 3.271   -11.344 -0.944  1.00 0.00 ? 33 ARG A N    3  
ATOM 3381  C CA   . ARG A 1 33 ? 3.102   -10.411 -2.044  1.00 0.00 ? 33 ARG A CA   3  
ATOM 3382  C C    . ARG A 1 33 ? 1.753   -9.697  -1.931  1.00 0.00 ? 33 ARG A C    3  
ATOM 3383  O O    . ARG A 1 33 ? 0.702   -10.324 -2.056  1.00 0.00 ? 33 ARG A O    3  
ATOM 3384  C CB   . ARG A 1 33 ? 3.179   -11.129 -3.393  1.00 0.00 ? 33 ARG A CB   3  
ATOM 3385  C CG   . ARG A 1 33 ? 4.621   -11.517 -3.725  1.00 0.00 ? 33 ARG A CG   3  
ATOM 3386  C CD   . ARG A 1 33 ? 5.022   -11.004 -5.110  1.00 0.00 ? 33 ARG A CD   3  
ATOM 3387  N NE   . ARG A 1 33 ? 6.472   -10.709 -5.140  1.00 0.00 ? 33 ARG A NE   3  
ATOM 3388  C CZ   . ARG A 1 33 ? 7.056   -9.900  -6.035  1.00 0.00 ? 33 ARG A CZ   3  
ATOM 3389  N NH1  . ARG A 1 33 ? 6.317   -9.302  -6.979  1.00 0.00 ? 33 ARG A NH1  3  
ATOM 3390  N NH2  . ARG A 1 33 ? 8.379   -9.691  -5.986  1.00 0.00 ? 33 ARG A NH2  3  
ATOM 3391  H H    . ARG A 1 33 ? 3.006   -12.287 -1.145  1.00 0.00 ? 33 ARG A H    3  
ATOM 3392  H HA   . ARG A 1 33 ? 3.928   -9.707  -1.943  1.00 0.00 ? 33 ARG A HA   3  
ATOM 3393  H HB2  . ARG A 1 33 ? 2.554   -12.021 -3.370  1.00 0.00 ? 33 ARG A HB2  3  
ATOM 3394  H HB3  . ARG A 1 33 ? 2.783   -10.482 -4.176  1.00 0.00 ? 33 ARG A HB3  3  
ATOM 3395  H HG2  . ARG A 1 33 ? 5.295   -11.107 -2.973  1.00 0.00 ? 33 ARG A HG2  3  
ATOM 3396  H HG3  . ARG A 1 33 ? 4.727   -12.601 -3.691  1.00 0.00 ? 33 ARG A HG3  3  
ATOM 3397  H HD2  . ARG A 1 33 ? 4.779   -11.749 -5.867  1.00 0.00 ? 33 ARG A HD2  3  
ATOM 3398  H HD3  . ARG A 1 33 ? 4.455   -10.105 -5.352  1.00 0.00 ? 33 ARG A HD3  3  
ATOM 3399  H HE   . ARG A 1 33 ? 7.053   -11.139 -4.449  1.00 0.00 ? 33 ARG A HE   3  
ATOM 3400  H HH11 . ARG A 1 33 ? 5.330   -9.458  -7.016  1.00 0.00 ? 33 ARG A HH11 3  
ATOM 3401  H HH12 . ARG A 1 33 ? 6.753   -8.699  -7.647  1.00 0.00 ? 33 ARG A HH12 3  
ATOM 3402  H HH21 . ARG A 1 33 ? 8.930   -10.137 -5.281  1.00 0.00 ? 33 ARG A HH21 3  
ATOM 3403  H HH22 . ARG A 1 33 ? 8.814   -9.087  -6.654  1.00 0.00 ? 33 ARG A HH22 3  
ATOM 3404  N N    . PRO A 1 34 ? 1.829   -8.360  -1.690  1.00 0.00 ? 34 PRO A N    3  
ATOM 3405  C CA   . PRO A 1 34 ? 0.627   -7.554  -1.559  1.00 0.00 ? 34 PRO A CA   3  
ATOM 3406  C C    . PRO A 1 34 ? -0.019  -7.307  -2.924  1.00 0.00 ? 34 PRO A C    3  
ATOM 3407  O O    . PRO A 1 34 ? 0.677   -7.082  -3.912  1.00 0.00 ? 34 PRO A O    3  
ATOM 3408  C CB   . PRO A 1 34 ? 1.084   -6.275  -0.877  1.00 0.00 ? 34 PRO A CB   3  
ATOM 3409  C CG   . PRO A 1 34 ? 2.590   -6.214  -1.071  1.00 0.00 ? 34 PRO A CG   3  
ATOM 3410  C CD   . PRO A 1 34 ? 3.056   -7.584  -1.537  1.00 0.00 ? 34 PRO A CD   3  
ATOM 3411  H HA   . PRO A 1 34 ? -0.059  -8.039  -1.016  1.00 0.00 ? 34 PRO A HA   3  
ATOM 3412  H HB2  . PRO A 1 34 ? 0.598   -5.404  -1.316  1.00 0.00 ? 34 PRO A HB2  3  
ATOM 3413  H HB3  . PRO A 1 34 ? 0.826   -6.284  0.182   1.00 0.00 ? 34 PRO A HB3  3  
ATOM 3414  H HG2  . PRO A 1 34 ? 2.850   -5.452  -1.806  1.00 0.00 ? 34 PRO A HG2  3  
ATOM 3415  H HG3  . PRO A 1 34 ? 3.084   -5.939  -0.139  1.00 0.00 ? 34 PRO A HG3  3  
ATOM 3416  H HD2  . PRO A 1 34 ? 3.602   -7.518  -2.477  1.00 0.00 ? 34 PRO A HD2  3  
ATOM 3417  H HD3  . PRO A 1 34 ? 3.726   -8.043  -0.810  1.00 0.00 ? 34 PRO A HD3  3  
ATOM 3418  N N    . VAL A 1 35 ? -1.343  -7.357  -2.934  1.00 0.00 ? 35 VAL A N    3  
ATOM 3419  C CA   . VAL A 1 35 ? -2.091  -7.141  -4.161  1.00 0.00 ? 35 VAL A CA   3  
ATOM 3420  C C    . VAL A 1 35 ? -2.629  -5.709  -4.180  1.00 0.00 ? 35 VAL A C    3  
ATOM 3421  O O    . VAL A 1 35 ? -3.103  -5.207  -3.162  1.00 0.00 ? 35 VAL A O    3  
ATOM 3422  C CB   . VAL A 1 35 ? -3.191  -8.195  -4.295  1.00 0.00 ? 35 VAL A CB   3  
ATOM 3423  C CG1  . VAL A 1 35 ? -4.260  -7.747  -5.295  1.00 0.00 ? 35 VAL A CG1  3  
ATOM 3424  C CG2  . VAL A 1 35 ? -2.606  -9.552  -4.690  1.00 0.00 ? 35 VAL A CG2  3  
ATOM 3425  H H    . VAL A 1 35 ? -1.902  -7.540  -2.125  1.00 0.00 ? 35 VAL A H    3  
ATOM 3426  H HA   . VAL A 1 35 ? -1.399  -7.267  -4.994  1.00 0.00 ? 35 VAL A HA   3  
ATOM 3427  H HB   . VAL A 1 35 ? -3.669  -8.306  -3.322  1.00 0.00 ? 35 VAL A HB   3  
ATOM 3428  H HG11 . VAL A 1 35 ? -5.091  -8.452  -5.278  1.00 0.00 ? 35 VAL A HG11 3  
ATOM 3429  H HG12 . VAL A 1 35 ? -4.619  -6.755  -5.023  1.00 0.00 ? 35 VAL A HG12 3  
ATOM 3430  H HG13 . VAL A 1 35 ? -3.830  -7.717  -6.296  1.00 0.00 ? 35 VAL A HG13 3  
ATOM 3431  H HG21 . VAL A 1 35 ? -2.077  -9.981  -3.838  1.00 0.00 ? 35 VAL A HG21 3  
ATOM 3432  H HG22 . VAL A 1 35 ? -3.411  -10.221 -4.992  1.00 0.00 ? 35 VAL A HG22 3  
ATOM 3433  H HG23 . VAL A 1 35 ? -1.911  -9.421  -5.520  1.00 0.00 ? 35 VAL A HG23 3  
ATOM 3434  N N    . TYR A 1 36 ? -2.537  -5.091  -5.348  1.00 0.00 ? 36 TYR A N    3  
ATOM 3435  C CA   . TYR A 1 36 ? -3.009  -3.727  -5.513  1.00 0.00 ? 36 TYR A CA   3  
ATOM 3436  C C    . TYR A 1 36 ? -4.392  -3.700  -6.166  1.00 0.00 ? 36 TYR A C    3  
ATOM 3437  O O    . TYR A 1 36 ? -4.522  -3.953  -7.363  1.00 0.00 ? 36 TYR A O    3  
ATOM 3438  C CB   . TYR A 1 36 ? -2.005  -3.043  -6.443  1.00 0.00 ? 36 TYR A CB   3  
ATOM 3439  C CG   . TYR A 1 36 ? -0.696  -2.642  -5.760  1.00 0.00 ? 36 TYR A CG   3  
ATOM 3440  C CD1  . TYR A 1 36 ? 0.060   -3.594  -5.106  1.00 0.00 ? 36 TYR A CD1  3  
ATOM 3441  C CD2  . TYR A 1 36 ? -0.272  -1.330  -5.797  1.00 0.00 ? 36 TYR A CD2  3  
ATOM 3442  C CE1  . TYR A 1 36 ? 1.292   -3.217  -4.463  1.00 0.00 ? 36 TYR A CE1  3  
ATOM 3443  C CE2  . TYR A 1 36 ? 0.960   -0.953  -5.153  1.00 0.00 ? 36 TYR A CE2  3  
ATOM 3444  C CZ   . TYR A 1 36 ? 1.681   -1.915  -4.518  1.00 0.00 ? 36 TYR A CZ   3  
ATOM 3445  O OH   . TYR A 1 36 ? 2.845   -1.559  -3.911  1.00 0.00 ? 36 TYR A OH   3  
ATOM 3446  H H    . TYR A 1 36 ? -2.150  -5.507  -6.171  1.00 0.00 ? 36 TYR A H    3  
ATOM 3447  H HA   . TYR A 1 36 ? -3.073  -3.272  -4.525  1.00 0.00 ? 36 TYR A HA   3  
ATOM 3448  H HB2  . TYR A 1 36 ? -1.779  -3.713  -7.273  1.00 0.00 ? 36 TYR A HB2  3  
ATOM 3449  H HB3  . TYR A 1 36 ? -2.468  -2.153  -6.869  1.00 0.00 ? 36 TYR A HB3  3  
ATOM 3450  H HD1  . TYR A 1 36 ? -0.275  -4.631  -5.077  1.00 0.00 ? 36 TYR A HD1  3  
ATOM 3451  H HD2  . TYR A 1 36 ? -0.869  -0.578  -6.313  1.00 0.00 ? 36 TYR A HD2  3  
ATOM 3452  H HE1  . TYR A 1 36 ? 1.899   -3.958  -3.943  1.00 0.00 ? 36 TYR A HE1  3  
ATOM 3453  H HE2  . TYR A 1 36 ? 1.307   0.081   -5.175  1.00 0.00 ? 36 TYR A HE2  3  
ATOM 3454  H HH   . TYR A 1 36 ? 3.054   -2.198  -3.171  1.00 0.00 ? 36 TYR A HH   3  
ATOM 3455  N N    . ASN A 1 37 ? -5.390  -3.391  -5.352  1.00 0.00 ? 37 ASN A N    3  
ATOM 3456  C CA   . ASN A 1 37 ? -6.759  -3.328  -5.836  1.00 0.00 ? 37 ASN A CA   3  
ATOM 3457  C C    . ASN A 1 37 ? -7.080  -1.893  -6.260  1.00 0.00 ? 37 ASN A C    3  
ATOM 3458  O O    . ASN A 1 37 ? -6.884  -0.956  -5.488  1.00 0.00 ? 37 ASN A O    3  
ATOM 3459  C CB   . ASN A 1 37 ? -7.749  -3.730  -4.741  1.00 0.00 ? 37 ASN A CB   3  
ATOM 3460  C CG   . ASN A 1 37 ? -8.388  -5.085  -5.051  1.00 0.00 ? 37 ASN A CG   3  
ATOM 3461  O OD1  . ASN A 1 37 ? -9.471  -5.178  -5.606  1.00 0.00 ? 37 ASN A OD1  3  
ATOM 3462  N ND2  . ASN A 1 37 ? -7.661  -6.128  -4.662  1.00 0.00 ? 37 ASN A ND2  3  
ATOM 3463  H H    . ASN A 1 37 ? -5.276  -3.187  -4.380  1.00 0.00 ? 37 ASN A H    3  
ATOM 3464  H HA   . ASN A 1 37 ? -6.800  -4.029  -6.670  1.00 0.00 ? 37 ASN A HA   3  
ATOM 3465  H HB2  . ASN A 1 37 ? -7.236  -3.777  -3.781  1.00 0.00 ? 37 ASN A HB2  3  
ATOM 3466  H HB3  . ASN A 1 37 ? -8.525  -2.970  -4.651  1.00 0.00 ? 37 ASN A HB3  3  
ATOM 3467  H HD21 . ASN A 1 37 ? -6.780  -5.983  -4.212  1.00 0.00 ? 37 ASN A HD21 3  
ATOM 3468  H HD22 . ASN A 1 37 ? -7.994  -7.058  -4.821  1.00 0.00 ? 37 ASN A HD22 3  
ATOM 3469  N N    . PHE A 1 38 ? -7.567  -1.767  -7.485  1.00 0.00 ? 38 PHE A N    3  
ATOM 3470  C CA   . PHE A 1 38 ? -7.917  -0.463  -8.021  1.00 0.00 ? 38 PHE A CA   3  
ATOM 3471  C C    . PHE A 1 38 ? -9.411  -0.385  -8.342  1.00 0.00 ? 38 PHE A C    3  
ATOM 3472  O O    . PHE A 1 38 ? -10.046 -1.403  -8.609  1.00 0.00 ? 38 PHE A O    3  
ATOM 3473  C CB   . PHE A 1 38 ? -7.120  -0.282  -9.314  1.00 0.00 ? 38 PHE A CB   3  
ATOM 3474  C CG   . PHE A 1 38 ? -5.611  -0.478  -9.147  1.00 0.00 ? 38 PHE A CG   3  
ATOM 3475  C CD1  . PHE A 1 38 ? -5.090  -1.733  -9.101  1.00 0.00 ? 38 PHE A CD1  3  
ATOM 3476  C CD2  . PHE A 1 38 ? -4.793  0.604   -9.046  1.00 0.00 ? 38 PHE A CD2  3  
ATOM 3477  C CE1  . PHE A 1 38 ? -3.690  -1.914  -8.946  1.00 0.00 ? 38 PHE A CE1  3  
ATOM 3478  C CE2  . PHE A 1 38 ? -3.393  0.422   -8.892  1.00 0.00 ? 38 PHE A CE2  3  
ATOM 3479  C CZ   . PHE A 1 38 ? -2.871  -0.833  -8.845  1.00 0.00 ? 38 PHE A CZ   3  
ATOM 3480  H H    . PHE A 1 38 ? -7.724  -2.535  -8.106  1.00 0.00 ? 38 PHE A H    3  
ATOM 3481  H HA   . PHE A 1 38 ? -7.672  0.276   -7.258  1.00 0.00 ? 38 PHE A HA   3  
ATOM 3482  H HB2  . PHE A 1 38 ? -7.487  -0.989  -10.058 1.00 0.00 ? 38 PHE A HB2  3  
ATOM 3483  H HB3  . PHE A 1 38 ? -7.305  0.718   -9.706  1.00 0.00 ? 38 PHE A HB3  3  
ATOM 3484  H HD1  . PHE A 1 38 ? -5.746  -2.599  -9.182  1.00 0.00 ? 38 PHE A HD1  3  
ATOM 3485  H HD2  . PHE A 1 38 ? -5.211  1.609   -9.084  1.00 0.00 ? 38 PHE A HD2  3  
ATOM 3486  H HE1  . PHE A 1 38 ? -3.271  -2.920  -8.909  1.00 0.00 ? 38 PHE A HE1  3  
ATOM 3487  H HE2  . PHE A 1 38 ? -2.736  1.288   -8.810  1.00 0.00 ? 38 PHE A HE2  3  
ATOM 3488  H HZ   . PHE A 1 38 ? -1.796  -0.973  -8.726  1.00 0.00 ? 38 PHE A HZ   3  
ATOM 3489  N N    . PHE A 1 39 ? -9.929  0.834   -8.305  1.00 0.00 ? 39 PHE A N    3  
ATOM 3490  C CA   . PHE A 1 39 ? -11.336 1.059   -8.589  1.00 0.00 ? 39 PHE A CA   3  
ATOM 3491  C C    . PHE A 1 39 ? -11.580 2.498   -9.049  1.00 0.00 ? 39 PHE A C    3  
ATOM 3492  O O    . PHE A 1 39 ? -10.671 3.326   -9.017  1.00 0.00 ? 39 PHE A O    3  
ATOM 3493  C CB   . PHE A 1 39 ? -12.099 0.816   -7.285  1.00 0.00 ? 39 PHE A CB   3  
ATOM 3494  C CG   . PHE A 1 39 ? -11.513 1.548   -6.076  1.00 0.00 ? 39 PHE A CG   3  
ATOM 3495  C CD1  . PHE A 1 39 ? -11.926 2.809   -5.778  1.00 0.00 ? 39 PHE A CD1  3  
ATOM 3496  C CD2  . PHE A 1 39 ? -10.580 0.936   -5.298  1.00 0.00 ? 39 PHE A CD2  3  
ATOM 3497  C CE1  . PHE A 1 39 ? -11.382 3.487   -4.656  1.00 0.00 ? 39 PHE A CE1  3  
ATOM 3498  C CE2  . PHE A 1 39 ? -10.036 1.615   -4.175  1.00 0.00 ? 39 PHE A CE2  3  
ATOM 3499  C CZ   . PHE A 1 39 ? -10.449 2.876   -3.878  1.00 0.00 ? 39 PHE A CZ   3  
ATOM 3500  H H    . PHE A 1 39 ? -9.405  1.658   -8.087  1.00 0.00 ? 39 PHE A H    3  
ATOM 3501  H HA   . PHE A 1 39 ? -11.619 0.372   -9.386  1.00 0.00 ? 39 PHE A HA   3  
ATOM 3502  H HB2  . PHE A 1 39 ? -13.135 1.129   -7.419  1.00 0.00 ? 39 PHE A HB2  3  
ATOM 3503  H HB3  . PHE A 1 39 ? -12.113 -0.254  -7.078  1.00 0.00 ? 39 PHE A HB3  3  
ATOM 3504  H HD1  . PHE A 1 39 ? -12.674 3.299   -6.401  1.00 0.00 ? 39 PHE A HD1  3  
ATOM 3505  H HD2  . PHE A 1 39 ? -10.249 -0.075  -5.536  1.00 0.00 ? 39 PHE A HD2  3  
ATOM 3506  H HE1  . PHE A 1 39 ? -11.712 4.499   -4.417  1.00 0.00 ? 39 PHE A HE1  3  
ATOM 3507  H HE2  . PHE A 1 39 ? -9.288  1.125   -3.552  1.00 0.00 ? 39 PHE A HE2  3  
ATOM 3508  H HZ   . PHE A 1 39 ? -10.031 3.397   -3.016  1.00 0.00 ? 39 PHE A HZ   3  
ATOM 3509  N N    . GLU A 1 40 ? -12.812 2.751   -9.465  1.00 0.00 ? 40 GLU A N    3  
ATOM 3510  C CA   . GLU A 1 40 ? -13.187 4.076   -9.931  1.00 0.00 ? 40 GLU A CA   3  
ATOM 3511  C C    . GLU A 1 40 ? -13.734 4.911   -8.771  1.00 0.00 ? 40 GLU A C    3  
ATOM 3512  O O    . GLU A 1 40 ? -14.470 4.401   -7.928  1.00 0.00 ? 40 GLU A O    3  
ATOM 3513  C CB   . GLU A 1 40 ? -14.203 3.988   -11.071 1.00 0.00 ? 40 GLU A CB   3  
ATOM 3514  C CG   . GLU A 1 40 ? -13.500 3.899   -12.427 1.00 0.00 ? 40 GLU A CG   3  
ATOM 3515  C CD   . GLU A 1 40 ? -12.726 2.585   -12.557 1.00 0.00 ? 40 GLU A CD   3  
ATOM 3516  O OE1  . GLU A 1 40 ? -13.382 1.527   -12.450 1.00 0.00 ? 40 GLU A OE1  3  
ATOM 3517  O OE2  . GLU A 1 40 ? -11.496 2.669   -12.762 1.00 0.00 ? 40 GLU A OE2  3  
ATOM 3518  H H    . GLU A 1 40 ? -13.545 2.072   -9.487  1.00 0.00 ? 40 GLU A H    3  
ATOM 3519  H HA   . GLU A 1 40 ? -12.266 4.522   -10.306 1.00 0.00 ? 40 GLU A HA   3  
ATOM 3520  H HB2  . GLU A 1 40 ? -14.840 3.115   -10.929 1.00 0.00 ? 40 GLU A HB2  3  
ATOM 3521  H HB3  . GLU A 1 40 ? -14.853 4.863   -11.051 1.00 0.00 ? 40 GLU A HB3  3  
ATOM 3522  H HG2  . GLU A 1 40 ? -14.235 3.973   -13.228 1.00 0.00 ? 40 GLU A HG2  3  
ATOM 3523  H HG3  . GLU A 1 40 ? -12.817 4.740   -12.542 1.00 0.00 ? 40 GLU A HG3  3  
ATOM 3524  N N    . CYS A 1 41 ? -13.353 6.180   -8.767  1.00 0.00 ? 41 CYS A N    3  
ATOM 3525  C CA   . CYS A 1 41 ? -13.796 7.090   -7.725  1.00 0.00 ? 41 CYS A CA   3  
ATOM 3526  C C    . CYS A 1 41 ? -14.710 8.140   -8.361  1.00 0.00 ? 41 CYS A C    3  
ATOM 3527  O O    . CYS A 1 41 ? -14.465 8.584   -9.482  1.00 0.00 ? 41 CYS A O    3  
ATOM 3528  C CB   . CYS A 1 41 ? -12.615 7.730   -6.993  1.00 0.00 ? 41 CYS A CB   3  
ATOM 3529  S SG   . CYS A 1 41 ? -12.898 7.683   -5.186  1.00 0.00 ? 41 CYS A SG   3  
ATOM 3530  H H    . CYS A 1 41 ? -12.754 6.586   -9.457  1.00 0.00 ? 41 CYS A H    3  
ATOM 3531  H HA   . CYS A 1 41 ? -14.343 6.491   -6.997  1.00 0.00 ? 41 CYS A HA   3  
ATOM 3532  H HB2  . CYS A 1 41 ? -11.694 7.201   -7.239  1.00 0.00 ? 41 CYS A HB2  3  
ATOM 3533  H HB3  . CYS A 1 41 ? -12.487 8.762   -7.323  1.00 0.00 ? 41 CYS A HB3  3  
ATOM 3534  H HG   . CYS A 1 41 ? -14.226 7.738   -5.252  1.00 0.00 ? 41 CYS A HG   3  
ATOM 3535  N N    . GLU A 1 42 ? -15.744 8.507   -7.618  1.00 0.00 ? 42 GLU A N    3  
ATOM 3536  C CA   . GLU A 1 42 ? -16.695 9.496   -8.095  1.00 0.00 ? 42 GLU A CA   3  
ATOM 3537  C C    . GLU A 1 42 ? -16.337 10.881  -7.554  1.00 0.00 ? 42 GLU A C    3  
ATOM 3538  O O    . GLU A 1 42 ? -17.207 11.612  -7.084  1.00 0.00 ? 42 GLU A O    3  
ATOM 3539  C CB   . GLU A 1 42 ? -18.125 9.110   -7.712  1.00 0.00 ? 42 GLU A CB   3  
ATOM 3540  C CG   . GLU A 1 42 ? -19.136 9.713   -8.689  1.00 0.00 ? 42 GLU A CG   3  
ATOM 3541  C CD   . GLU A 1 42 ? -19.687 8.646   -9.637  1.00 0.00 ? 42 GLU A CD   3  
ATOM 3542  O OE1  . GLU A 1 42 ? -18.867 8.081   -10.393 1.00 0.00 ? 42 GLU A OE1  3  
ATOM 3543  O OE2  . GLU A 1 42 ? -20.914 8.418   -9.583  1.00 0.00 ? 42 GLU A OE2  3  
ATOM 3544  H H    . GLU A 1 42 ? -15.935 8.141   -6.707  1.00 0.00 ? 42 GLU A H    3  
ATOM 3545  H HA   . GLU A 1 42 ? -16.602 9.487   -9.181  1.00 0.00 ? 42 GLU A HA   3  
ATOM 3546  H HB2  . GLU A 1 42 ? -18.224 8.025   -7.705  1.00 0.00 ? 42 GLU A HB2  3  
ATOM 3547  H HB3  . GLU A 1 42 ? -18.340 9.456   -6.701  1.00 0.00 ? 42 GLU A HB3  3  
ATOM 3548  H HG2  . GLU A 1 42 ? -19.956 10.170  -8.134  1.00 0.00 ? 42 GLU A HG2  3  
ATOM 3549  H HG3  . GLU A 1 42 ? -18.661 10.507  -9.266  1.00 0.00 ? 42 GLU A HG3  3  
ATOM 3550  N N    . ASN A 1 43 ? -15.054 11.200  -7.638  1.00 0.00 ? 43 ASN A N    3  
ATOM 3551  C CA   . ASN A 1 43 ? -14.570 12.485  -7.162  1.00 0.00 ? 43 ASN A CA   3  
ATOM 3552  C C    . ASN A 1 43 ? -13.763 13.164  -8.271  1.00 0.00 ? 43 ASN A C    3  
ATOM 3553  O O    . ASN A 1 43 ? -12.952 12.521  -8.936  1.00 0.00 ? 43 ASN A O    3  
ATOM 3554  C CB   . ASN A 1 43 ? -13.654 12.314  -5.948  1.00 0.00 ? 43 ASN A CB   3  
ATOM 3555  C CG   . ASN A 1 43 ? -14.379 12.695  -4.656  1.00 0.00 ? 43 ASN A CG   3  
ATOM 3556  O OD1  . ASN A 1 43 ? -15.596 12.756  -4.592  1.00 0.00 ? 43 ASN A OD1  3  
ATOM 3557  N ND2  . ASN A 1 43 ? -13.567 12.947  -3.634  1.00 0.00 ? 43 ASN A ND2  3  
ATOM 3558  H H    . ASN A 1 43 ? -14.352 10.600  -8.021  1.00 0.00 ? 43 ASN A H    3  
ATOM 3559  H HA   . ASN A 1 43 ? -15.464 13.047  -6.894  1.00 0.00 ? 43 ASN A HA   3  
ATOM 3560  H HB2  . ASN A 1 43 ? -13.314 11.280  -5.888  1.00 0.00 ? 43 ASN A HB2  3  
ATOM 3561  H HB3  . ASN A 1 43 ? -12.766 12.935  -6.068  1.00 0.00 ? 43 ASN A HB3  3  
ATOM 3562  H HD21 . ASN A 1 43 ? -12.576 12.879  -3.754  1.00 0.00 ? 43 ASN A HD21 3  
ATOM 3563  H HD22 . ASN A 1 43 ? -13.946 13.205  -2.745  1.00 0.00 ? 43 ASN A HD22 3  
ATOM 3564  N N    . PRO A 1 44 ? -14.020 14.488  -8.441  1.00 0.00 ? 44 PRO A N    3  
ATOM 3565  C CA   . PRO A 1 44 ? -13.327 15.261  -9.458  1.00 0.00 ? 44 PRO A CA   3  
ATOM 3566  C C    . PRO A 1 44 ? -11.888 15.559  -9.034  1.00 0.00 ? 44 PRO A C    3  
ATOM 3567  O O    . PRO A 1 44 ? -10.952 15.338  -9.801  1.00 0.00 ? 44 PRO A O    3  
ATOM 3568  C CB   . PRO A 1 44 ? -14.165 16.516  -9.638  1.00 0.00 ? 44 PRO A CB   3  
ATOM 3569  C CG   . PRO A 1 44 ? -15.034 16.618  -8.395  1.00 0.00 ? 44 PRO A CG   3  
ATOM 3570  C CD   . PRO A 1 44 ? -14.974 15.283  -7.672  1.00 0.00 ? 44 PRO A CD   3  
ATOM 3571  H HA   . PRO A 1 44 ? -13.259 14.736  -10.306 1.00 0.00 ? 44 PRO A HA   3  
ATOM 3572  H HB2  . PRO A 1 44 ? -13.532 17.396  -9.746  1.00 0.00 ? 44 PRO A HB2  3  
ATOM 3573  H HB3  . PRO A 1 44 ? -14.777 16.451  -10.538 1.00 0.00 ? 44 PRO A HB3  3  
ATOM 3574  H HG2  . PRO A 1 44 ? -14.680 17.420  -7.747  1.00 0.00 ? 44 PRO A HG2  3  
ATOM 3575  H HG3  . PRO A 1 44 ? -16.062 16.859  -8.667  1.00 0.00 ? 44 PRO A HG3  3  
ATOM 3576  H HD2  . PRO A 1 44 ? -14.646 15.405  -6.640  1.00 0.00 ? 44 PRO A HD2  3  
ATOM 3577  H HD3  . PRO A 1 44 ? -15.953 14.805  -7.641  1.00 0.00 ? 44 PRO A HD3  3  
ATOM 3578  N N    . SER A 1 45 ? -11.755 16.058  -7.813  1.00 0.00 ? 45 SER A N    3  
ATOM 3579  C CA   . SER A 1 45 ? -10.446 16.389  -7.278  1.00 0.00 ? 45 SER A CA   3  
ATOM 3580  C C    . SER A 1 45 ? -9.458  15.259  -7.575  1.00 0.00 ? 45 SER A C    3  
ATOM 3581  O O    . SER A 1 45 ? -8.396  15.494  -8.150  1.00 0.00 ? 45 SER A O    3  
ATOM 3582  C CB   . SER A 1 45 ? -10.516 16.650  -5.772  1.00 0.00 ? 45 SER A CB   3  
ATOM 3583  O OG   . SER A 1 45 ? -10.377 18.034  -5.463  1.00 0.00 ? 45 SER A OG   3  
ATOM 3584  H H    . SER A 1 45 ? -12.522 16.235  -7.196  1.00 0.00 ? 45 SER A H    3  
ATOM 3585  H HA   . SER A 1 45 ? -10.147 17.303  -7.791  1.00 0.00 ? 45 SER A HA   3  
ATOM 3586  H HB2  . SER A 1 45 ? -11.468 16.286  -5.385  1.00 0.00 ? 45 SER A HB2  3  
ATOM 3587  H HB3  . SER A 1 45 ? -9.731  16.085  -5.269  1.00 0.00 ? 45 SER A HB3  3  
ATOM 3588  H HG   . SER A 1 45 ? -10.512 18.584  -6.287  1.00 0.00 ? 45 SER A HG   3  
ATOM 3589  N N    . GLU A 1 46 ? -9.843  14.058  -7.170  1.00 0.00 ? 46 GLU A N    3  
ATOM 3590  C CA   . GLU A 1 46 ? -9.004  12.891  -7.386  1.00 0.00 ? 46 GLU A CA   3  
ATOM 3591  C C    . GLU A 1 46 ? -9.856  11.698  -7.823  1.00 0.00 ? 46 GLU A C    3  
ATOM 3592  O O    . GLU A 1 46 ? -10.364 10.953  -6.986  1.00 0.00 ? 46 GLU A O    3  
ATOM 3593  C CB   . GLU A 1 46 ? -8.196  12.557  -6.130  1.00 0.00 ? 46 GLU A CB   3  
ATOM 3594  C CG   . GLU A 1 46 ? -7.228  13.689  -5.783  1.00 0.00 ? 46 GLU A CG   3  
ATOM 3595  C CD   . GLU A 1 46 ? -6.838  13.644  -4.304  1.00 0.00 ? 46 GLU A CD   3  
ATOM 3596  O OE1  . GLU A 1 46 ? -6.622  12.517  -3.809  1.00 0.00 ? 46 GLU A OE1  3  
ATOM 3597  O OE2  . GLU A 1 46 ? -6.766  14.737  -3.703  1.00 0.00 ? 46 GLU A OE2  3  
ATOM 3598  H H    . GLU A 1 46 ? -10.708 13.876  -6.703  1.00 0.00 ? 46 GLU A H    3  
ATOM 3599  H HA   . GLU A 1 46 ? -8.320  13.170  -8.187  1.00 0.00 ? 46 GLU A HA   3  
ATOM 3600  H HB2  . GLU A 1 46 ? -8.873  12.383  -5.294  1.00 0.00 ? 46 GLU A HB2  3  
ATOM 3601  H HB3  . GLU A 1 46 ? -7.640  11.633  -6.287  1.00 0.00 ? 46 GLU A HB3  3  
ATOM 3602  H HG2  . GLU A 1 46 ? -6.334  13.610  -6.401  1.00 0.00 ? 46 GLU A HG2  3  
ATOM 3603  H HG3  . GLU A 1 46 ? -7.690  14.650  -6.012  1.00 0.00 ? 46 GLU A HG3  3  
ATOM 3604  N N    . PRO A 1 47 ? -9.991  11.551  -9.168  1.00 0.00 ? 47 PRO A N    3  
ATOM 3605  C CA   . PRO A 1 47 ? -10.774 10.461  -9.727  1.00 0.00 ? 47 PRO A CA   3  
ATOM 3606  C C    . PRO A 1 47 ? -10.019 9.134   -9.623  1.00 0.00 ? 47 PRO A C    3  
ATOM 3607  O O    . PRO A 1 47 ? -10.631 8.077   -9.478  1.00 0.00 ? 47 PRO A O    3  
ATOM 3608  C CB   . PRO A 1 47 ? -11.053 10.874  -11.163 1.00 0.00 ? 47 PRO A CB   3  
ATOM 3609  C CG   . PRO A 1 47 ? -10.033 11.951  -11.494 1.00 0.00 ? 47 PRO A CG   3  
ATOM 3610  C CD   . PRO A 1 47 ? -9.405  12.414  -10.189 1.00 0.00 ? 47 PRO A CD   3  
ATOM 3611  H HA   . PRO A 1 47 ? -11.618 10.337  -9.206  1.00 0.00 ? 47 PRO A HA   3  
ATOM 3612  H HB2  . PRO A 1 47 ? -10.958 10.024  -11.839 1.00 0.00 ? 47 PRO A HB2  3  
ATOM 3613  H HB3  . PRO A 1 47 ? -12.070 11.253  -11.270 1.00 0.00 ? 47 PRO A HB3  3  
ATOM 3614  H HG2  . PRO A 1 47 ? -9.270  11.560  -12.167 1.00 0.00 ? 47 PRO A HG2  3  
ATOM 3615  H HG3  . PRO A 1 47 ? -10.511 12.786  -12.005 1.00 0.00 ? 47 PRO A HG3  3  
ATOM 3616  H HD2  . PRO A 1 47 ? -8.320  12.316  -10.215 1.00 0.00 ? 47 PRO A HD2  3  
ATOM 3617  H HD3  . PRO A 1 47 ? -9.626  13.464  -9.995  1.00 0.00 ? 47 PRO A HD3  3  
ATOM 3618  N N    . PHE A 1 48 ? -8.700  9.233   -9.700  1.00 0.00 ? 48 PHE A N    3  
ATOM 3619  C CA   . PHE A 1 48 ? -7.855  8.054   -9.616  1.00 0.00 ? 48 PHE A CA   3  
ATOM 3620  C C    . PHE A 1 48 ? -7.718  7.580   -8.167  1.00 0.00 ? 48 PHE A C    3  
ATOM 3621  O O    . PHE A 1 48 ? -7.148  8.280   -7.332  1.00 0.00 ? 48 PHE A O    3  
ATOM 3622  C CB   . PHE A 1 48 ? -6.475  8.454   -10.141 1.00 0.00 ? 48 PHE A CB   3  
ATOM 3623  C CG   . PHE A 1 48 ? -6.505  9.148   -11.505 1.00 0.00 ? 48 PHE A CG   3  
ATOM 3624  C CD1  . PHE A 1 48 ? -6.675  10.495  -11.579 1.00 0.00 ? 48 PHE A CD1  3  
ATOM 3625  C CD2  . PHE A 1 48 ? -6.363  8.417   -12.643 1.00 0.00 ? 48 PHE A CD2  3  
ATOM 3626  C CE1  . PHE A 1 48 ? -6.703  11.139  -12.844 1.00 0.00 ? 48 PHE A CE1  3  
ATOM 3627  C CE2  . PHE A 1 48 ? -6.392  9.060   -13.908 1.00 0.00 ? 48 PHE A CE2  3  
ATOM 3628  C CZ   . PHE A 1 48 ? -6.561  10.408  -13.982 1.00 0.00 ? 48 PHE A CZ   3  
ATOM 3629  H H    . PHE A 1 48 ? -8.209  10.097  -9.817  1.00 0.00 ? 48 PHE A H    3  
ATOM 3630  H HA   . PHE A 1 48 ? -8.330  7.272   -10.208 1.00 0.00 ? 48 PHE A HA   3  
ATOM 3631  H HB2  . PHE A 1 48 ? -6.000  9.117   -9.418  1.00 0.00 ? 48 PHE A HB2  3  
ATOM 3632  H HB3  . PHE A 1 48 ? -5.852  7.562   -10.213 1.00 0.00 ? 48 PHE A HB3  3  
ATOM 3633  H HD1  . PHE A 1 48 ? -6.788  11.081  -10.666 1.00 0.00 ? 48 PHE A HD1  3  
ATOM 3634  H HD2  . PHE A 1 48 ? -6.228  7.337   -12.583 1.00 0.00 ? 48 PHE A HD2  3  
ATOM 3635  H HE1  . PHE A 1 48 ? -6.838  12.219  -12.903 1.00 0.00 ? 48 PHE A HE1  3  
ATOM 3636  H HE2  . PHE A 1 48 ? -6.278  8.475   -14.820 1.00 0.00 ? 48 PHE A HE2  3  
ATOM 3637  H HZ   . PHE A 1 48 ? -6.582  10.902  -14.953 1.00 0.00 ? 48 PHE A HZ   3  
ATOM 3638  N N    . GLY A 1 49 ? -8.251  6.393   -7.914  1.00 0.00 ? 49 GLY A N    3  
ATOM 3639  C CA   . GLY A 1 49 ? -8.195  5.817   -6.581  1.00 0.00 ? 49 GLY A CA   3  
ATOM 3640  C C    . GLY A 1 49 ? -7.650  4.388   -6.624  1.00 0.00 ? 49 GLY A C    3  
ATOM 3641  O O    . GLY A 1 49 ? -7.925  3.643   -7.563  1.00 0.00 ? 49 GLY A O    3  
ATOM 3642  H H    . GLY A 1 49 ? -8.713  5.830   -8.599  1.00 0.00 ? 49 GLY A H    3  
ATOM 3643  H HA2  . GLY A 1 49 ? -7.563  6.433   -5.941  1.00 0.00 ? 49 GLY A HA2  3  
ATOM 3644  H HA3  . GLY A 1 49 ? -9.192  5.817   -6.139  1.00 0.00 ? 49 GLY A HA3  3  
ATOM 3645  N N    . ALA A 1 50 ? -6.886  4.049   -5.595  1.00 0.00 ? 50 ALA A N    3  
ATOM 3646  C CA   . ALA A 1 50 ? -6.300  2.723   -5.503  1.00 0.00 ? 50 ALA A CA   3  
ATOM 3647  C C    . ALA A 1 50 ? -6.264  2.287   -4.037  1.00 0.00 ? 50 ALA A C    3  
ATOM 3648  O O    . ALA A 1 50 ? -6.343  3.120   -3.136  1.00 0.00 ? 50 ALA A O    3  
ATOM 3649  C CB   . ALA A 1 50 ? -4.910  2.734   -6.142  1.00 0.00 ? 50 ALA A CB   3  
ATOM 3650  H H    . ALA A 1 50 ? -6.668  4.662   -4.836  1.00 0.00 ? 50 ALA A H    3  
ATOM 3651  H HA   . ALA A 1 50 ? -6.938  2.039   -6.062  1.00 0.00 ? 50 ALA A HA   3  
ATOM 3652  H HB1  . ALA A 1 50 ? -4.572  3.763   -6.260  1.00 0.00 ? 50 ALA A HB1  3  
ATOM 3653  H HB2  . ALA A 1 50 ? -4.212  2.193   -5.503  1.00 0.00 ? 50 ALA A HB2  3  
ATOM 3654  H HB3  . ALA A 1 50 ? -4.956  2.253   -7.119  1.00 0.00 ? 50 ALA A HB3  3  
ATOM 3655  N N    . SER A 1 51 ? -6.146  0.981   -3.845  1.00 0.00 ? 51 SER A N    3  
ATOM 3656  C CA   . SER A 1 51 ? -6.099  0.424   -2.503  1.00 0.00 ? 51 SER A CA   3  
ATOM 3657  C C    . SER A 1 51 ? -5.107  -0.740  -2.455  1.00 0.00 ? 51 SER A C    3  
ATOM 3658  O O    . SER A 1 51 ? -4.930  -1.451  -3.443  1.00 0.00 ? 51 SER A O    3  
ATOM 3659  C CB   . SER A 1 51 ? -7.484  -0.041  -2.051  1.00 0.00 ? 51 SER A CB   3  
ATOM 3660  O OG   . SER A 1 51 ? -8.154  -0.787  -3.063  1.00 0.00 ? 51 SER A OG   3  
ATOM 3661  H H    . SER A 1 51 ? -6.083  0.310   -4.583  1.00 0.00 ? 51 SER A H    3  
ATOM 3662  H HA   . SER A 1 51 ? -5.763  1.240   -1.864  1.00 0.00 ? 51 SER A HA   3  
ATOM 3663  H HB2  . SER A 1 51 ? -7.387  -0.652  -1.154  1.00 0.00 ? 51 SER A HB2  3  
ATOM 3664  H HB3  . SER A 1 51 ? -8.087  0.826   -1.781  1.00 0.00 ? 51 SER A HB3  3  
ATOM 3665  H HG   . SER A 1 51 ? -9.097  -0.971  -2.786  1.00 0.00 ? 51 SER A HG   3  
ATOM 3666  N N    . VAL A 1 52 ? -4.485  -0.898  -1.296  1.00 0.00 ? 52 VAL A N    3  
ATOM 3667  C CA   . VAL A 1 52 ? -3.515  -1.963  -1.105  1.00 0.00 ? 52 VAL A CA   3  
ATOM 3668  C C    . VAL A 1 52 ? -4.161  -3.099  -0.309  1.00 0.00 ? 52 VAL A C    3  
ATOM 3669  O O    . VAL A 1 52 ? -4.603  -2.897  0.821   1.00 0.00 ? 52 VAL A O    3  
ATOM 3670  C CB   . VAL A 1 52 ? -2.253  -1.410  -0.441  1.00 0.00 ? 52 VAL A CB   3  
ATOM 3671  C CG1  . VAL A 1 52 ? -1.369  -2.542  0.085   1.00 0.00 ? 52 VAL A CG1  3  
ATOM 3672  C CG2  . VAL A 1 52 ? -1.477  -0.509  -1.403  1.00 0.00 ? 52 VAL A CG2  3  
ATOM 3673  H H    . VAL A 1 52 ? -4.634  -0.315  -0.497  1.00 0.00 ? 52 VAL A H    3  
ATOM 3674  H HA   . VAL A 1 52 ? -3.241  -2.338  -2.091  1.00 0.00 ? 52 VAL A HA   3  
ATOM 3675  H HB   . VAL A 1 52 ? -2.562  -0.803  0.411   1.00 0.00 ? 52 VAL A HB   3  
ATOM 3676  H HG11 . VAL A 1 52 ? -1.949  -3.174  0.757   1.00 0.00 ? 52 VAL A HG11 3  
ATOM 3677  H HG12 . VAL A 1 52 ? -1.007  -3.139  -0.752  1.00 0.00 ? 52 VAL A HG12 3  
ATOM 3678  H HG13 . VAL A 1 52 ? -0.521  -2.120  0.624   1.00 0.00 ? 52 VAL A HG13 3  
ATOM 3679  H HG21 . VAL A 1 52 ? -1.523  -0.926  -2.409  1.00 0.00 ? 52 VAL A HG21 3  
ATOM 3680  H HG22 . VAL A 1 52 ? -1.918  0.488   -1.403  1.00 0.00 ? 52 VAL A HG22 3  
ATOM 3681  H HG23 . VAL A 1 52 ? -0.437  -0.446  -1.083  1.00 0.00 ? 52 VAL A HG23 3  
ATOM 3682  N N    . THR A 1 53 ? -4.196  -4.269  -0.930  1.00 0.00 ? 53 THR A N    3  
ATOM 3683  C CA   . THR A 1 53 ? -4.781  -5.437  -0.294  1.00 0.00 ? 53 THR A CA   3  
ATOM 3684  C C    . THR A 1 53 ? -3.692  -6.452  0.061   1.00 0.00 ? 53 THR A C    3  
ATOM 3685  O O    . THR A 1 53 ? -2.922  -6.869  -0.802  1.00 0.00 ? 53 THR A O    3  
ATOM 3686  C CB   . THR A 1 53 ? -5.853  -5.998  -1.230  1.00 0.00 ? 53 THR A CB   3  
ATOM 3687  O OG1  . THR A 1 53 ? -5.366  -5.699  -2.535  1.00 0.00 ? 53 THR A OG1  3  
ATOM 3688  C CG2  . THR A 1 53 ? -7.172  -5.227  -1.139  1.00 0.00 ? 53 THR A CG2  3  
ATOM 3689  H H    . THR A 1 53 ? -3.835  -4.425  -1.849  1.00 0.00 ? 53 THR A H    3  
ATOM 3690  H HA   . THR A 1 53 ? -5.243  -5.123  0.642   1.00 0.00 ? 53 THR A HA   3  
ATOM 3691  H HB   . THR A 1 53 ? -6.010  -7.061  -1.048  1.00 0.00 ? 53 THR A HB   3  
ATOM 3692  H HG1  . THR A 1 53 ? -5.520  -4.734  -2.745  1.00 0.00 ? 53 THR A HG1  3  
ATOM 3693  H HG21 . THR A 1 53 ? -7.045  -4.366  -0.482  1.00 0.00 ? 53 THR A HG21 3  
ATOM 3694  H HG22 . THR A 1 53 ? -7.463  -4.887  -2.132  1.00 0.00 ? 53 THR A HG22 3  
ATOM 3695  H HG23 . THR A 1 53 ? -7.947  -5.879  -0.736  1.00 0.00 ? 53 THR A HG23 3  
ATOM 3696  N N    . ILE A 1 54 ? -3.664  -6.820  1.333   1.00 0.00 ? 54 ILE A N    3  
ATOM 3697  C CA   . ILE A 1 54 ? -2.682  -7.778  1.813   1.00 0.00 ? 54 ILE A CA   3  
ATOM 3698  C C    . ILE A 1 54 ? -3.336  -9.157  1.927   1.00 0.00 ? 54 ILE A C    3  
ATOM 3699  O O    . ILE A 1 54 ? -4.178  -9.379  2.795   1.00 0.00 ? 54 ILE A O    3  
ATOM 3700  C CB   . ILE A 1 54 ? -2.048  -7.289  3.117   1.00 0.00 ? 54 ILE A CB   3  
ATOM 3701  C CG1  . ILE A 1 54 ? -1.163  -6.066  2.870   1.00 0.00 ? 54 ILE A CG1  3  
ATOM 3702  C CG2  . ILE A 1 54 ? -1.285  -8.417  3.813   1.00 0.00 ? 54 ILE A CG2  3  
ATOM 3703  C CD1  . ILE A 1 54 ? -0.646  -5.488  4.189   1.00 0.00 ? 54 ILE A CD1  3  
ATOM 3704  H H    . ILE A 1 54 ? -4.294  -6.476  2.029   1.00 0.00 ? 54 ILE A H    3  
ATOM 3705  H HA   . ILE A 1 54 ? -1.888  -7.833  1.069   1.00 0.00 ? 54 ILE A HA   3  
ATOM 3706  H HB   . ILE A 1 54 ? -2.847  -6.977  3.789   1.00 0.00 ? 54 ILE A HB   3  
ATOM 3707  H HG12 . ILE A 1 54 ? -0.321  -6.344  2.236   1.00 0.00 ? 54 ILE A HG12 3  
ATOM 3708  H HG13 . ILE A 1 54 ? -1.729  -5.305  2.333   1.00 0.00 ? 54 ILE A HG13 3  
ATOM 3709  H HG21 . ILE A 1 54 ? -0.282  -8.075  4.068   1.00 0.00 ? 54 ILE A HG21 3  
ATOM 3710  H HG22 . ILE A 1 54 ? -1.813  -8.705  4.723   1.00 0.00 ? 54 ILE A HG22 3  
ATOM 3711  H HG23 . ILE A 1 54 ? -1.217  -9.276  3.145   1.00 0.00 ? 54 ILE A HG23 3  
ATOM 3712  H HD11 . ILE A 1 54 ? -0.592  -6.280  4.936   1.00 0.00 ? 54 ILE A HD11 3  
ATOM 3713  H HD12 . ILE A 1 54 ? 0.347   -5.064  4.036   1.00 0.00 ? 54 ILE A HD12 3  
ATOM 3714  H HD13 . ILE A 1 54 ? -1.324  -4.708  4.535   1.00 0.00 ? 54 ILE A HD13 3  
ATOM 3715  N N    . ASP A 1 55 ? -2.922  -10.048 1.038   1.00 0.00 ? 55 ASP A N    3  
ATOM 3716  C CA   . ASP A 1 55 ? -3.456  -11.399 1.028   1.00 0.00 ? 55 ASP A CA   3  
ATOM 3717  C C    . ASP A 1 55 ? -4.971  -11.342 0.817   1.00 0.00 ? 55 ASP A C    3  
ATOM 3718  O O    . ASP A 1 55 ? -5.679  -12.303 1.115   1.00 0.00 ? 55 ASP A O    3  
ATOM 3719  C CB   . ASP A 1 55 ? -3.190  -12.107 2.358   1.00 0.00 ? 55 ASP A CB   3  
ATOM 3720  C CG   . ASP A 1 55 ? -3.263  -13.634 2.304   1.00 0.00 ? 55 ASP A CG   3  
ATOM 3721  O OD1  . ASP A 1 55 ? -4.276  -14.135 1.771   1.00 0.00 ? 55 ASP A OD1  3  
ATOM 3722  O OD2  . ASP A 1 55 ? -2.303  -14.265 2.797   1.00 0.00 ? 55 ASP A OD2  3  
ATOM 3723  H H    . ASP A 1 55 ? -2.236  -9.860  0.335   1.00 0.00 ? 55 ASP A H    3  
ATOM 3724  H HA   . ASP A 1 55 ? -2.940  -11.905 0.212   1.00 0.00 ? 55 ASP A HA   3  
ATOM 3725  H HB2  . ASP A 1 55 ? -2.202  -11.817 2.715   1.00 0.00 ? 55 ASP A HB2  3  
ATOM 3726  H HB3  . ASP A 1 55 ? -3.911  -11.749 3.093   1.00 0.00 ? 55 ASP A HB3  3  
ATOM 3727  N N    . GLY A 1 56 ? -5.423  -10.207 0.306   1.00 0.00 ? 56 GLY A N    3  
ATOM 3728  C CA   . GLY A 1 56 ? -6.840  -10.012 0.052   1.00 0.00 ? 56 GLY A CA   3  
ATOM 3729  C C    . GLY A 1 56 ? -7.481  -9.158  1.148   1.00 0.00 ? 56 GLY A C    3  
ATOM 3730  O O    . GLY A 1 56 ? -8.680  -8.884  1.105   1.00 0.00 ? 56 GLY A O    3  
ATOM 3731  H H    . GLY A 1 56 ? -4.840  -9.430  0.067   1.00 0.00 ? 56 GLY A H    3  
ATOM 3732  H HA2  . GLY A 1 56 ? -6.977  -9.530  -0.916  1.00 0.00 ? 56 GLY A HA2  3  
ATOM 3733  H HA3  . GLY A 1 56 ? -7.340  -10.979 0.001   1.00 0.00 ? 56 GLY A HA3  3  
ATOM 3734  N N    . VAL A 1 57 ? -6.655  -8.762  2.105   1.00 0.00 ? 57 VAL A N    3  
ATOM 3735  C CA   . VAL A 1 57 ? -7.126  -7.945  3.210   1.00 0.00 ? 57 VAL A CA   3  
ATOM 3736  C C    . VAL A 1 57 ? -6.741  -6.485  2.960   1.00 0.00 ? 57 VAL A C    3  
ATOM 3737  O O    . VAL A 1 57 ? -5.561  -6.166  2.817   1.00 0.00 ? 57 VAL A O    3  
ATOM 3738  C CB   . VAL A 1 57 ? -6.581  -8.489  4.532   1.00 0.00 ? 57 VAL A CB   3  
ATOM 3739  C CG1  . VAL A 1 57 ? -6.741  -7.462  5.655   1.00 0.00 ? 57 VAL A CG1  3  
ATOM 3740  C CG2  . VAL A 1 57 ? -7.254  -9.813  4.899   1.00 0.00 ? 57 VAL A CG2  3  
ATOM 3741  H H    . VAL A 1 57 ? -5.681  -8.989  2.132   1.00 0.00 ? 57 VAL A H    3  
ATOM 3742  H HA   . VAL A 1 57 ? -8.213  -8.021  3.236   1.00 0.00 ? 57 VAL A HA   3  
ATOM 3743  H HB   . VAL A 1 57 ? -5.516  -8.679  4.402   1.00 0.00 ? 57 VAL A HB   3  
ATOM 3744  H HG11 . VAL A 1 57 ? -7.054  -7.968  6.568   1.00 0.00 ? 57 VAL A HG11 3  
ATOM 3745  H HG12 . VAL A 1 57 ? -5.790  -6.959  5.826   1.00 0.00 ? 57 VAL A HG12 3  
ATOM 3746  H HG13 . VAL A 1 57 ? -7.495  -6.727  5.371   1.00 0.00 ? 57 VAL A HG13 3  
ATOM 3747  H HG21 . VAL A 1 57 ? -7.202  -9.960  5.978   1.00 0.00 ? 57 VAL A HG21 3  
ATOM 3748  H HG22 . VAL A 1 57 ? -8.298  -9.789  4.586   1.00 0.00 ? 57 VAL A HG22 3  
ATOM 3749  H HG23 . VAL A 1 57 ? -6.742  -10.632 4.395   1.00 0.00 ? 57 VAL A HG23 3  
ATOM 3750  N N    . THR A 1 58 ? -7.758  -5.637  2.915   1.00 0.00 ? 58 THR A N    3  
ATOM 3751  C CA   . THR A 1 58 ? -7.541  -4.219  2.685   1.00 0.00 ? 58 THR A CA   3  
ATOM 3752  C C    . THR A 1 58 ? -6.873  -3.578  3.903   1.00 0.00 ? 58 THR A C    3  
ATOM 3753  O O    . THR A 1 58 ? -7.202  -3.907  5.041   1.00 0.00 ? 58 THR A O    3  
ATOM 3754  C CB   . THR A 1 58 ? -8.887  -3.587  2.327   1.00 0.00 ? 58 THR A CB   3  
ATOM 3755  O OG1  . THR A 1 58 ? -9.523  -4.565  1.508   1.00 0.00 ? 58 THR A OG1  3  
ATOM 3756  C CG2  . THR A 1 58 ? -8.738  -2.372  1.408   1.00 0.00 ? 58 THR A CG2  3  
ATOM 3757  H H    . THR A 1 58 ? -8.714  -5.905  3.033   1.00 0.00 ? 58 THR A H    3  
ATOM 3758  H HA   . THR A 1 58 ? -6.852  -4.109  1.847   1.00 0.00 ? 58 THR A HA   3  
ATOM 3759  H HB   . THR A 1 58 ? -9.448  -3.329  3.225   1.00 0.00 ? 58 THR A HB   3  
ATOM 3760  H HG1  . THR A 1 58 ? -8.896  -4.871  0.791   1.00 0.00 ? 58 THR A HG1  3  
ATOM 3761  H HG21 . THR A 1 58 ? -8.260  -1.560  1.956   1.00 0.00 ? 58 THR A HG21 3  
ATOM 3762  H HG22 . THR A 1 58 ? -8.124  -2.640  0.548   1.00 0.00 ? 58 THR A HG22 3  
ATOM 3763  H HG23 . THR A 1 58 ? -9.722  -2.051  1.067   1.00 0.00 ? 58 THR A HG23 3  
ATOM 3764  N N    . TYR A 1 59 ? -5.947  -2.673  3.621   1.00 0.00 ? 59 TYR A N    3  
ATOM 3765  C CA   . TYR A 1 59 ? -5.230  -1.982  4.680   1.00 0.00 ? 59 TYR A CA   3  
ATOM 3766  C C    . TYR A 1 59 ? -5.224  -0.470  4.441   1.00 0.00 ? 59 TYR A C    3  
ATOM 3767  O O    . TYR A 1 59 ? -6.063  0.250   4.979   1.00 0.00 ? 59 TYR A O    3  
ATOM 3768  C CB   . TYR A 1 59 ? -3.792  -2.501  4.623   1.00 0.00 ? 59 TYR A CB   3  
ATOM 3769  C CG   . TYR A 1 59 ? -3.523  -3.689  5.549   1.00 0.00 ? 59 TYR A CG   3  
ATOM 3770  C CD1  . TYR A 1 59 ? -3.727  -4.976  5.096   1.00 0.00 ? 59 TYR A CD1  3  
ATOM 3771  C CD2  . TYR A 1 59 ? -3.075  -3.473  6.836   1.00 0.00 ? 59 TYR A CD2  3  
ATOM 3772  C CE1  . TYR A 1 59 ? -3.474  -6.095  5.967   1.00 0.00 ? 59 TYR A CE1  3  
ATOM 3773  C CE2  . TYR A 1 59 ? -2.821  -4.591  7.707   1.00 0.00 ? 59 TYR A CE2  3  
ATOM 3774  C CZ   . TYR A 1 59 ? -3.033  -5.847  7.230   1.00 0.00 ? 59 TYR A CZ   3  
ATOM 3775  O OH   . TYR A 1 59 ? -2.793  -6.903  8.052   1.00 0.00 ? 59 TYR A OH   3  
ATOM 3776  H H    . TYR A 1 59 ? -5.685  -2.410  2.692   1.00 0.00 ? 59 TYR A H    3  
ATOM 3777  H HA   . TYR A 1 59 ? -5.737  -2.191  5.622   1.00 0.00 ? 59 TYR A HA   3  
ATOM 3778  H HB2  . TYR A 1 59 ? -3.562  -2.792  3.598   1.00 0.00 ? 59 TYR A HB2  3  
ATOM 3779  H HB3  . TYR A 1 59 ? -3.113  -1.689  4.884   1.00 0.00 ? 59 TYR A HB3  3  
ATOM 3780  H HD1  . TYR A 1 59 ? -4.081  -5.147  4.079   1.00 0.00 ? 59 TYR A HD1  3  
ATOM 3781  H HD2  . TYR A 1 59 ? -2.913  -2.456  7.193   1.00 0.00 ? 59 TYR A HD2  3  
ATOM 3782  H HE1  . TYR A 1 59 ? -3.631  -7.117  5.622   1.00 0.00 ? 59 TYR A HE1  3  
ATOM 3783  H HE2  . TYR A 1 59 ? -2.467  -4.435  8.726   1.00 0.00 ? 59 TYR A HE2  3  
ATOM 3784  H HH   . TYR A 1 59 ? -3.435  -6.891  8.819   1.00 0.00 ? 59 TYR A HH   3  
ATOM 3785  N N    . GLY A 1 60 ? -4.268  -0.035  3.634   1.00 0.00 ? 60 GLY A N    3  
ATOM 3786  C CA   . GLY A 1 60 ? -4.141  1.378   3.318   1.00 0.00 ? 60 GLY A CA   3  
ATOM 3787  C C    . GLY A 1 60 ? -4.571  1.658   1.876   1.00 0.00 ? 60 GLY A C    3  
ATOM 3788  O O    . GLY A 1 60 ? -4.189  0.932   0.959   1.00 0.00 ? 60 GLY A O    3  
ATOM 3789  H H    . GLY A 1 60 ? -3.589  -0.627  3.201   1.00 0.00 ? 60 GLY A H    3  
ATOM 3790  H HA2  . GLY A 1 60 ? -4.753  1.964   4.004   1.00 0.00 ? 60 GLY A HA2  3  
ATOM 3791  H HA3  . GLY A 1 60 ? -3.108  1.695   3.462   1.00 0.00 ? 60 GLY A HA3  3  
ATOM 3792  N N    . SER A 1 61 ? -5.359  2.712   1.722   1.00 0.00 ? 61 SER A N    3  
ATOM 3793  C CA   . SER A 1 61 ? -5.844  3.096   0.407   1.00 0.00 ? 61 SER A CA   3  
ATOM 3794  C C    . SER A 1 61 ? -5.996  4.617   0.330   1.00 0.00 ? 61 SER A C    3  
ATOM 3795  O O    . SER A 1 61 ? -5.917  5.305   1.347   1.00 0.00 ? 61 SER A O    3  
ATOM 3796  C CB   . SER A 1 61 ? -7.175  2.413   0.090   1.00 0.00 ? 61 SER A CB   3  
ATOM 3797  O OG   . SER A 1 61 ? -7.866  3.058   -0.977  1.00 0.00 ? 61 SER A OG   3  
ATOM 3798  H H    . SER A 1 61 ? -5.664  3.297   2.473   1.00 0.00 ? 61 SER A H    3  
ATOM 3799  H HA   . SER A 1 61 ? -5.083  2.752   -0.293  1.00 0.00 ? 61 SER A HA   3  
ATOM 3800  H HB2  . SER A 1 61 ? -6.994  1.371   -0.173  1.00 0.00 ? 61 SER A HB2  3  
ATOM 3801  H HB3  . SER A 1 61 ? -7.804  2.412   0.981   1.00 0.00 ? 61 SER A HB3  3  
ATOM 3802  H HG   . SER A 1 61 ? -8.471  3.767   -0.613  1.00 0.00 ? 61 SER A HG   3  
ATOM 3803  N N    . GLY A 1 62 ? -6.213  5.097   -0.886  1.00 0.00 ? 62 GLY A N    3  
ATOM 3804  C CA   . GLY A 1 62 ? -6.377  6.523   -1.109  1.00 0.00 ? 62 GLY A CA   3  
ATOM 3805  C C    . GLY A 1 62 ? -6.512  6.833   -2.601  1.00 0.00 ? 62 GLY A C    3  
ATOM 3806  O O    . GLY A 1 62 ? -6.487  5.926   -3.432  1.00 0.00 ? 62 GLY A O    3  
ATOM 3807  H H    . GLY A 1 62 ? -6.276  4.531   -1.708  1.00 0.00 ? 62 GLY A H    3  
ATOM 3808  H HA2  . GLY A 1 62 ? -7.260  6.879   -0.579  1.00 0.00 ? 62 GLY A HA2  3  
ATOM 3809  H HA3  . GLY A 1 62 ? -5.521  7.060   -0.698  1.00 0.00 ? 62 GLY A HA3  3  
ATOM 3810  N N    . THR A 1 63 ? -6.652  8.117   -2.896  1.00 0.00 ? 63 THR A N    3  
ATOM 3811  C CA   . THR A 1 63 ? -6.791  8.557   -4.274  1.00 0.00 ? 63 THR A CA   3  
ATOM 3812  C C    . THR A 1 63 ? -5.899  9.771   -4.538  1.00 0.00 ? 63 THR A C    3  
ATOM 3813  O O    . THR A 1 63 ? -5.275  10.300  -3.619  1.00 0.00 ? 63 THR A O    3  
ATOM 3814  C CB   . THR A 1 63 ? -8.275  8.825   -4.537  1.00 0.00 ? 63 THR A CB   3  
ATOM 3815  O OG1  . THR A 1 63 ? -8.557  9.995   -3.774  1.00 0.00 ? 63 THR A OG1  3  
ATOM 3816  C CG2  . THR A 1 63 ? -9.180  7.754   -3.926  1.00 0.00 ? 63 THR A CG2  3  
ATOM 3817  H H    . THR A 1 63 ? -6.672  8.848   -2.214  1.00 0.00 ? 63 THR A H    3  
ATOM 3818  H HA   . THR A 1 63 ? -6.445  7.757   -4.927  1.00 0.00 ? 63 THR A HA   3  
ATOM 3819  H HB   . THR A 1 63 ? -8.467  8.935   -5.604  1.00 0.00 ? 63 THR A HB   3  
ATOM 3820  H HG1  . THR A 1 63 ? -9.309  10.503  -4.193  1.00 0.00 ? 63 THR A HG1  3  
ATOM 3821  H HG21 . THR A 1 63 ? -8.988  6.796   -4.409  1.00 0.00 ? 63 THR A HG21 3  
ATOM 3822  H HG22 . THR A 1 63 ? -8.975  7.670   -2.858  1.00 0.00 ? 63 THR A HG22 3  
ATOM 3823  H HG23 . THR A 1 63 ? -10.224 8.033   -4.074  1.00 0.00 ? 63 THR A HG23 3  
ATOM 3824  N N    . ALA A 1 64 ? -5.866  10.178  -5.799  1.00 0.00 ? 64 ALA A N    3  
ATOM 3825  C CA   . ALA A 1 64 ? -5.060  11.320  -6.196  1.00 0.00 ? 64 ALA A CA   3  
ATOM 3826  C C    . ALA A 1 64 ? -5.442  11.739  -7.617  1.00 0.00 ? 64 ALA A C    3  
ATOM 3827  O O    . ALA A 1 64 ? -6.334  11.148  -8.223  1.00 0.00 ? 64 ALA A O    3  
ATOM 3828  C CB   . ALA A 1 64 ? -3.576  10.966  -6.071  1.00 0.00 ? 64 ALA A CB   3  
ATOM 3829  H H    . ALA A 1 64 ? -6.376  9.743   -6.540  1.00 0.00 ? 64 ALA A H    3  
ATOM 3830  H HA   . ALA A 1 64 ? -5.284  12.138  -5.512  1.00 0.00 ? 64 ALA A HA   3  
ATOM 3831  H HB1  . ALA A 1 64 ? -3.451  9.888   -6.169  1.00 0.00 ? 64 ALA A HB1  3  
ATOM 3832  H HB2  . ALA A 1 64 ? -3.015  11.470  -6.859  1.00 0.00 ? 64 ALA A HB2  3  
ATOM 3833  H HB3  . ALA A 1 64 ? -3.206  11.289  -5.098  1.00 0.00 ? 64 ALA A HB3  3  
ATOM 3834  N N    . SER A 1 65 ? -4.748  12.756  -8.106  1.00 0.00 ? 65 SER A N    3  
ATOM 3835  C CA   . SER A 1 65 ? -5.003  13.261  -9.444  1.00 0.00 ? 65 SER A CA   3  
ATOM 3836  C C    . SER A 1 65 ? -4.333  12.358  -10.482 1.00 0.00 ? 65 SER A C    3  
ATOM 3837  O O    . SER A 1 65 ? -4.779  12.283  -11.626 1.00 0.00 ? 65 SER A O    3  
ATOM 3838  C CB   . SER A 1 65 ? -4.507  14.701  -9.594  1.00 0.00 ? 65 SER A CB   3  
ATOM 3839  O OG   . SER A 1 65 ? -5.257  15.610  -8.793  1.00 0.00 ? 65 SER A OG   3  
ATOM 3840  H H    . SER A 1 65 ? -4.024  13.231  -7.606  1.00 0.00 ? 65 SER A H    3  
ATOM 3841  H HA   . SER A 1 65 ? -6.087  13.237  -9.560  1.00 0.00 ? 65 SER A HA   3  
ATOM 3842  H HB2  . SER A 1 65 ? -3.455  14.753  -9.313  1.00 0.00 ? 65 SER A HB2  3  
ATOM 3843  H HB3  . SER A 1 65 ? -4.572  15.000  -10.640 1.00 0.00 ? 65 SER A HB3  3  
ATOM 3844  H HG   . SER A 1 65 ? -5.674  16.311  -9.371  1.00 0.00 ? 65 SER A HG   3  
ATOM 3845  N N    . SER A 1 66 ? -3.272  11.695  -10.045 1.00 0.00 ? 66 SER A N    3  
ATOM 3846  C CA   . SER A 1 66 ? -2.536  10.800  -10.921 1.00 0.00 ? 66 SER A CA   3  
ATOM 3847  C C    . SER A 1 66 ? -2.627  9.365   -10.399 1.00 0.00 ? 66 SER A C    3  
ATOM 3848  O O    . SER A 1 66 ? -2.716  9.143   -9.193  1.00 0.00 ? 66 SER A O    3  
ATOM 3849  C CB   . SER A 1 66 ? -1.072  11.229  -11.041 1.00 0.00 ? 66 SER A CB   3  
ATOM 3850  O OG   . SER A 1 66 ? -0.718  11.549  -12.384 1.00 0.00 ? 66 SER A OG   3  
ATOM 3851  H H    . SER A 1 66 ? -2.916  11.762  -9.113  1.00 0.00 ? 66 SER A H    3  
ATOM 3852  H HA   . SER A 1 66 ? -3.020  10.886  -11.894 1.00 0.00 ? 66 SER A HA   3  
ATOM 3853  H HB2  . SER A 1 66 ? -0.894  12.094  -10.403 1.00 0.00 ? 66 SER A HB2  3  
ATOM 3854  H HB3  . SER A 1 66 ? -0.428  10.427  -10.678 1.00 0.00 ? 66 SER A HB3  3  
ATOM 3855  H HG   . SER A 1 66 ? -1.171  10.921  -13.016 1.00 0.00 ? 66 SER A HG   3  
ATOM 3856  N N    . LYS A 1 67 ? -2.603  8.427   -11.335 1.00 0.00 ? 67 LYS A N    3  
ATOM 3857  C CA   . LYS A 1 67 ? -2.682  7.019   -10.985 1.00 0.00 ? 67 LYS A CA   3  
ATOM 3858  C C    . LYS A 1 67 ? -1.585  6.687   -9.972  1.00 0.00 ? 67 LYS A C    3  
ATOM 3859  O O    . LYS A 1 67 ? -1.871  6.207   -8.876  1.00 0.00 ? 67 LYS A O    3  
ATOM 3860  C CB   . LYS A 1 67 ? -2.639  6.150   -12.244 1.00 0.00 ? 67 LYS A CB   3  
ATOM 3861  C CG   . LYS A 1 67 ? -3.784  5.136   -12.249 1.00 0.00 ? 67 LYS A CG   3  
ATOM 3862  C CD   . LYS A 1 67 ? -3.431  3.915   -13.102 1.00 0.00 ? 67 LYS A CD   3  
ATOM 3863  C CE   . LYS A 1 67 ? -4.632  2.976   -13.238 1.00 0.00 ? 67 LYS A CE   3  
ATOM 3864  N NZ   . LYS A 1 67 ? -4.779  2.144   -12.024 1.00 0.00 ? 67 LYS A NZ   3  
ATOM 3865  H H    . LYS A 1 67 ? -2.531  8.615   -12.314 1.00 0.00 ? 67 LYS A H    3  
ATOM 3866  H HA   . LYS A 1 67 ? -3.650  6.854   -10.512 1.00 0.00 ? 67 LYS A HA   3  
ATOM 3867  H HB2  . LYS A 1 67 ? -2.705  6.783   -13.129 1.00 0.00 ? 67 LYS A HB2  3  
ATOM 3868  H HB3  . LYS A 1 67 ? -1.685  5.627   -12.297 1.00 0.00 ? 67 LYS A HB3  3  
ATOM 3869  H HG2  . LYS A 1 67 ? -4.001  4.821   -11.229 1.00 0.00 ? 67 LYS A HG2  3  
ATOM 3870  H HG3  . LYS A 1 67 ? -4.689  5.605   -12.636 1.00 0.00 ? 67 LYS A HG3  3  
ATOM 3871  H HD2  . LYS A 1 67 ? -3.105  4.240   -14.090 1.00 0.00 ? 67 LYS A HD2  3  
ATOM 3872  H HD3  . LYS A 1 67 ? -2.596  3.380   -12.650 1.00 0.00 ? 67 LYS A HD3  3  
ATOM 3873  H HE2  . LYS A 1 67 ? -5.539  3.558   -13.400 1.00 0.00 ? 67 LYS A HE2  3  
ATOM 3874  H HE3  . LYS A 1 67 ? -4.503  2.336   -14.111 1.00 0.00 ? 67 LYS A HE3  3  
ATOM 3875  H HZ1  . LYS A 1 67 ? -4.404  2.633   -11.236 1.00 0.00 ? 67 LYS A HZ1  3  
ATOM 3876  H HZ2  . LYS A 1 67 ? -5.748  1.952   -11.866 1.00 0.00 ? 67 LYS A HZ2  3  
ATOM 3877  H HZ3  . LYS A 1 67 ? -4.285  1.283   -12.147 1.00 0.00 ? 67 LYS A HZ3  3  
ATOM 3878  N N    . LYS A 1 68 ? -0.351  6.956   -10.374 1.00 0.00 ? 68 LYS A N    3  
ATOM 3879  C CA   . LYS A 1 68 ? 0.790   6.692   -9.515  1.00 0.00 ? 68 LYS A CA   3  
ATOM 3880  C C    . LYS A 1 68 ? 0.479   7.177   -8.097  1.00 0.00 ? 68 LYS A C    3  
ATOM 3881  O O    . LYS A 1 68 ? 0.479   6.388   -7.154  1.00 0.00 ? 68 LYS A O    3  
ATOM 3882  C CB   . LYS A 1 68 ? 2.061   7.303   -10.109 1.00 0.00 ? 68 LYS A CB   3  
ATOM 3883  C CG   . LYS A 1 68 ? 2.636   6.410   -11.210 1.00 0.00 ? 68 LYS A CG   3  
ATOM 3884  C CD   . LYS A 1 68 ? 4.116   6.716   -11.447 1.00 0.00 ? 68 LYS A CD   3  
ATOM 3885  C CE   . LYS A 1 68 ? 4.753   5.669   -12.363 1.00 0.00 ? 68 LYS A CE   3  
ATOM 3886  N NZ   . LYS A 1 68 ? 6.212   5.889   -12.467 1.00 0.00 ? 68 LYS A NZ   3  
ATOM 3887  H H    . LYS A 1 68 ? -0.127  7.346   -11.267 1.00 0.00 ? 68 LYS A H    3  
ATOM 3888  H HA   . LYS A 1 68 ? 0.935   5.612   -9.486  1.00 0.00 ? 68 LYS A HA   3  
ATOM 3889  H HB2  . LYS A 1 68 ? 1.839   8.290   -10.515 1.00 0.00 ? 68 LYS A HB2  3  
ATOM 3890  H HB3  . LYS A 1 68 ? 2.804   7.442   -9.323  1.00 0.00 ? 68 LYS A HB3  3  
ATOM 3891  H HG2  . LYS A 1 68 ? 2.517   5.363   -10.933 1.00 0.00 ? 68 LYS A HG2  3  
ATOM 3892  H HG3  . LYS A 1 68 ? 2.078   6.561   -12.134 1.00 0.00 ? 68 LYS A HG3  3  
ATOM 3893  H HD2  . LYS A 1 68 ? 4.220   7.705   -11.892 1.00 0.00 ? 68 LYS A HD2  3  
ATOM 3894  H HD3  . LYS A 1 68 ? 4.644   6.738   -10.493 1.00 0.00 ? 68 LYS A HD3  3  
ATOM 3895  H HE2  . LYS A 1 68 ? 4.556   4.670   -11.974 1.00 0.00 ? 68 LYS A HE2  3  
ATOM 3896  H HE3  . LYS A 1 68 ? 4.300   5.720   -13.353 1.00 0.00 ? 68 LYS A HE3  3  
ATOM 3897  H HZ1  . LYS A 1 68 ? 6.564   6.213   -11.588 1.00 0.00 ? 68 LYS A HZ1  3  
ATOM 3898  H HZ2  . LYS A 1 68 ? 6.663   5.030   -12.709 1.00 0.00 ? 68 LYS A HZ2  3  
ATOM 3899  H HZ3  . LYS A 1 68 ? 6.397   6.573   -13.172 1.00 0.00 ? 68 LYS A HZ3  3  
ATOM 3900  N N    . LEU A 1 69 ? 0.222   8.472   -7.992  1.00 0.00 ? 69 LEU A N    3  
ATOM 3901  C CA   . LEU A 1 69 ? -0.090  9.072   -6.706  1.00 0.00 ? 69 LEU A CA   3  
ATOM 3902  C C    . LEU A 1 69 ? -0.996  8.127   -5.914  1.00 0.00 ? 69 LEU A C    3  
ATOM 3903  O O    . LEU A 1 69 ? -0.664  7.736   -4.796  1.00 0.00 ? 69 LEU A O    3  
ATOM 3904  C CB   . LEU A 1 69 ? -0.678  10.472  -6.896  1.00 0.00 ? 69 LEU A CB   3  
ATOM 3905  C CG   . LEU A 1 69 ? 0.321   11.576  -7.250  1.00 0.00 ? 69 LEU A CG   3  
ATOM 3906  C CD1  . LEU A 1 69 ? 0.814   12.293  -5.992  1.00 0.00 ? 69 LEU A CD1  3  
ATOM 3907  C CD2  . LEU A 1 69 ? 1.477   11.022  -8.085  1.00 0.00 ? 69 LEU A CD2  3  
ATOM 3908  H H    . LEU A 1 69 ? 0.224   9.107   -8.765  1.00 0.00 ? 69 LEU A H    3  
ATOM 3909  H HA   . LEU A 1 69 ? 0.848   9.187   -6.163  1.00 0.00 ? 69 LEU A HA   3  
ATOM 3910  H HB2  . LEU A 1 69 ? -1.431  10.424  -7.682  1.00 0.00 ? 69 LEU A HB2  3  
ATOM 3911  H HB3  . LEU A 1 69 ? -1.192  10.755  -5.978  1.00 0.00 ? 69 LEU A HB3  3  
ATOM 3912  H HG   . LEU A 1 69 ? -0.193  12.317  -7.863  1.00 0.00 ? 69 LEU A HG   3  
ATOM 3913  H HD11 . LEU A 1 69 ? 1.685   11.771  -5.594  1.00 0.00 ? 69 LEU A HD11 3  
ATOM 3914  H HD12 . LEU A 1 69 ? 1.087   13.318  -6.242  1.00 0.00 ? 69 LEU A HD12 3  
ATOM 3915  H HD13 . LEU A 1 69 ? 0.022   12.300  -5.244  1.00 0.00 ? 69 LEU A HD13 3  
ATOM 3916  H HD21 . LEU A 1 69 ? 1.124   10.798  -9.092  1.00 0.00 ? 69 LEU A HD21 3  
ATOM 3917  H HD22 . LEU A 1 69 ? 2.275   11.763  -8.136  1.00 0.00 ? 69 LEU A HD22 3  
ATOM 3918  H HD23 . LEU A 1 69 ? 1.856   10.111  -7.622  1.00 0.00 ? 69 LEU A HD23 3  
ATOM 3919  N N    . ALA A 1 70 ? -2.121  7.787   -6.525  1.00 0.00 ? 70 ALA A N    3  
ATOM 3920  C CA   . ALA A 1 70 ? -3.077  6.895   -5.891  1.00 0.00 ? 70 ALA A CA   3  
ATOM 3921  C C    . ALA A 1 70 ? -2.345  5.656   -5.370  1.00 0.00 ? 70 ALA A C    3  
ATOM 3922  O O    . ALA A 1 70 ? -2.432  5.331   -4.187  1.00 0.00 ? 70 ALA A O    3  
ATOM 3923  C CB   . ALA A 1 70 ? -4.184  6.542   -6.886  1.00 0.00 ? 70 ALA A CB   3  
ATOM 3924  H H    . ALA A 1 70 ? -2.383  8.109   -7.435  1.00 0.00 ? 70 ALA A H    3  
ATOM 3925  H HA   . ALA A 1 70 ? -3.519  7.427   -5.049  1.00 0.00 ? 70 ALA A HA   3  
ATOM 3926  H HB1  . ALA A 1 70 ? -4.435  7.423   -7.478  1.00 0.00 ? 70 ALA A HB1  3  
ATOM 3927  H HB2  . ALA A 1 70 ? -3.839  5.747   -7.547  1.00 0.00 ? 70 ALA A HB2  3  
ATOM 3928  H HB3  . ALA A 1 70 ? -5.067  6.205   -6.343  1.00 0.00 ? 70 ALA A HB3  3  
ATOM 3929  N N    . LYS A 1 71 ? -1.640  4.999   -6.280  1.00 0.00 ? 71 LYS A N    3  
ATOM 3930  C CA   . LYS A 1 71 ? -0.893  3.803   -5.927  1.00 0.00 ? 71 LYS A CA   3  
ATOM 3931  C C    . LYS A 1 71 ? 0.077   4.130   -4.790  1.00 0.00 ? 71 LYS A C    3  
ATOM 3932  O O    . LYS A 1 71 ? 0.178   3.379   -3.821  1.00 0.00 ? 71 LYS A O    3  
ATOM 3933  C CB   . LYS A 1 71 ? -0.214  3.212   -7.164  1.00 0.00 ? 71 LYS A CB   3  
ATOM 3934  C CG   . LYS A 1 71 ? -0.381  1.691   -7.206  1.00 0.00 ? 71 LYS A CG   3  
ATOM 3935  C CD   . LYS A 1 71 ? 0.333   1.095   -8.421  1.00 0.00 ? 71 LYS A CD   3  
ATOM 3936  C CE   . LYS A 1 71 ? 1.809   0.835   -8.116  1.00 0.00 ? 71 LYS A CE   3  
ATOM 3937  N NZ   . LYS A 1 71 ? 2.468   0.177   -9.266  1.00 0.00 ? 71 LYS A NZ   3  
ATOM 3938  H H    . LYS A 1 71 ? -1.575  5.270   -7.240  1.00 0.00 ? 71 LYS A H    3  
ATOM 3939  H HA   . LYS A 1 71 ? -1.610  3.065   -5.568  1.00 0.00 ? 71 LYS A HA   3  
ATOM 3940  H HB2  . LYS A 1 71 ? -0.641  3.653   -8.064  1.00 0.00 ? 71 LYS A HB2  3  
ATOM 3941  H HB3  . LYS A 1 71 ? 0.846   3.464   -7.157  1.00 0.00 ? 71 LYS A HB3  3  
ATOM 3942  H HG2  . LYS A 1 71 ? 0.019   1.252   -6.292  1.00 0.00 ? 71 LYS A HG2  3  
ATOM 3943  H HG3  . LYS A 1 71 ? -1.441  1.439   -7.243  1.00 0.00 ? 71 LYS A HG3  3  
ATOM 3944  H HD2  . LYS A 1 71 ? -0.152  0.163   -8.711  1.00 0.00 ? 71 LYS A HD2  3  
ATOM 3945  H HD3  . LYS A 1 71 ? 0.247   1.775   -9.268  1.00 0.00 ? 71 LYS A HD3  3  
ATOM 3946  H HE2  . LYS A 1 71 ? 2.311   1.776   -7.890  1.00 0.00 ? 71 LYS A HE2  3  
ATOM 3947  H HE3  . LYS A 1 71 ? 1.899   0.206   -7.230  1.00 0.00 ? 71 LYS A HE3  3  
ATOM 3948  H HZ1  . LYS A 1 71 ? 2.320   -0.811  -9.215  1.00 0.00 ? 71 LYS A HZ1  3  
ATOM 3949  H HZ2  . LYS A 1 71 ? 2.081   0.529   -10.118 1.00 0.00 ? 71 LYS A HZ2  3  
ATOM 3950  H HZ3  . LYS A 1 71 ? 3.450   0.369   -9.242  1.00 0.00 ? 71 LYS A HZ3  3  
ATOM 3951  N N    . ASN A 1 72 ? 0.765   5.252   -4.946  1.00 0.00 ? 72 ASN A N    3  
ATOM 3952  C CA   . ASN A 1 72 ? 1.724   5.687   -3.945  1.00 0.00 ? 72 ASN A CA   3  
ATOM 3953  C C    . ASN A 1 72 ? 1.015   5.834   -2.597  1.00 0.00 ? 72 ASN A C    3  
ATOM 3954  O O    . ASN A 1 72 ? 1.475   5.303   -1.588  1.00 0.00 ? 72 ASN A O    3  
ATOM 3955  C CB   . ASN A 1 72 ? 2.327   7.044   -4.313  1.00 0.00 ? 72 ASN A CB   3  
ATOM 3956  C CG   . ASN A 1 72 ? 3.154   6.946   -5.596  1.00 0.00 ? 72 ASN A CG   3  
ATOM 3957  O OD1  . ASN A 1 72 ? 3.241   5.909   -6.232  1.00 0.00 ? 72 ASN A OD1  3  
ATOM 3958  N ND2  . ASN A 1 72 ? 3.754   8.082   -5.940  1.00 0.00 ? 72 ASN A ND2  3  
ATOM 3959  H H    . ASN A 1 72 ? 0.677   5.857   -5.737  1.00 0.00 ? 72 ASN A H    3  
ATOM 3960  H HA   . ASN A 1 72 ? 2.492   4.915   -3.929  1.00 0.00 ? 72 ASN A HA   3  
ATOM 3961  H HB2  . ASN A 1 72 ? 1.530   7.776   -4.444  1.00 0.00 ? 72 ASN A HB2  3  
ATOM 3962  H HB3  . ASN A 1 72 ? 2.956   7.400   -3.496  1.00 0.00 ? 72 ASN A HB3  3  
ATOM 3963  H HD21 . ASN A 1 72 ? 3.642   8.899   -5.374  1.00 0.00 ? 72 ASN A HD21 3  
ATOM 3964  H HD22 . ASN A 1 72 ? 4.319   8.120   -6.765  1.00 0.00 ? 72 ASN A HD22 3  
ATOM 3965  N N    . LYS A 1 73 ? -0.094  6.559   -2.624  1.00 0.00 ? 73 LYS A N    3  
ATOM 3966  C CA   . LYS A 1 73 ? -0.871  6.783   -1.416  1.00 0.00 ? 73 LYS A CA   3  
ATOM 3967  C C    . LYS A 1 73 ? -1.308  5.435   -0.839  1.00 0.00 ? 73 LYS A C    3  
ATOM 3968  O O    . LYS A 1 73 ? -1.162  5.192   0.358   1.00 0.00 ? 73 LYS A O    3  
ATOM 3969  C CB   . LYS A 1 73 ? -2.033  7.738   -1.697  1.00 0.00 ? 73 LYS A CB   3  
ATOM 3970  C CG   . LYS A 1 73 ? -1.581  9.196   -1.595  1.00 0.00 ? 73 LYS A CG   3  
ATOM 3971  C CD   . LYS A 1 73 ? -2.673  10.145  -2.095  1.00 0.00 ? 73 LYS A CD   3  
ATOM 3972  C CE   . LYS A 1 73 ? -2.592  11.497  -1.384  1.00 0.00 ? 73 LYS A CE   3  
ATOM 3973  N NZ   . LYS A 1 73 ? -2.709  12.604  -2.360  1.00 0.00 ? 73 LYS A NZ   3  
ATOM 3974  H H    . LYS A 1 73 ? -0.462  6.988   -3.449  1.00 0.00 ? 73 LYS A H    3  
ATOM 3975  H HA   . LYS A 1 73 ? -0.218  7.273   -0.694  1.00 0.00 ? 73 LYS A HA   3  
ATOM 3976  H HB2  . LYS A 1 73 ? -2.435  7.546   -2.692  1.00 0.00 ? 73 LYS A HB2  3  
ATOM 3977  H HB3  . LYS A 1 73 ? -2.840  7.553   -0.987  1.00 0.00 ? 73 LYS A HB3  3  
ATOM 3978  H HG2  . LYS A 1 73 ? -1.335  9.433   -0.560  1.00 0.00 ? 73 LYS A HG2  3  
ATOM 3979  H HG3  . LYS A 1 73 ? -0.673  9.341   -2.180  1.00 0.00 ? 73 LYS A HG3  3  
ATOM 3980  H HD2  . LYS A 1 73 ? -2.570  10.289  -3.171  1.00 0.00 ? 73 LYS A HD2  3  
ATOM 3981  H HD3  . LYS A 1 73 ? -3.653  9.699   -1.926  1.00 0.00 ? 73 LYS A HD3  3  
ATOM 3982  H HE2  . LYS A 1 73 ? -3.387  11.573  -0.643  1.00 0.00 ? 73 LYS A HE2  3  
ATOM 3983  H HE3  . LYS A 1 73 ? -1.647  11.576  -0.847  1.00 0.00 ? 73 LYS A HE3  3  
ATOM 3984  H HZ1  . LYS A 1 73 ? -3.495  12.441  -2.956  1.00 0.00 ? 73 LYS A HZ1  3  
ATOM 3985  H HZ2  . LYS A 1 73 ? -2.834  13.467  -1.871  1.00 0.00 ? 73 LYS A HZ2  3  
ATOM 3986  H HZ3  . LYS A 1 73 ? -1.876  12.650  -2.912  1.00 0.00 ? 73 LYS A HZ3  3  
ATOM 3987  N N    . ALA A 1 74 ? -1.836  4.595   -1.716  1.00 0.00 ? 74 ALA A N    3  
ATOM 3988  C CA   . ALA A 1 74 ? -2.295  3.278   -1.309  1.00 0.00 ? 74 ALA A CA   3  
ATOM 3989  C C    . ALA A 1 74 ? -1.198  2.589   -0.495  1.00 0.00 ? 74 ALA A C    3  
ATOM 3990  O O    . ALA A 1 74 ? -1.451  2.096   0.603   1.00 0.00 ? 74 ALA A O    3  
ATOM 3991  C CB   . ALA A 1 74 ? -2.697  2.472   -2.545  1.00 0.00 ? 74 ALA A CB   3  
ATOM 3992  H H    . ALA A 1 74 ? -1.951  4.800   -2.688  1.00 0.00 ? 74 ALA A H    3  
ATOM 3993  H HA   . ALA A 1 74 ? -3.173  3.414   -0.678  1.00 0.00 ? 74 ALA A HA   3  
ATOM 3994  H HB1  . ALA A 1 74 ? -3.485  1.767   -2.279  1.00 0.00 ? 74 ALA A HB1  3  
ATOM 3995  H HB2  . ALA A 1 74 ? -3.061  3.149   -3.318  1.00 0.00 ? 74 ALA A HB2  3  
ATOM 3996  H HB3  . ALA A 1 74 ? -1.832  1.925   -2.920  1.00 0.00 ? 74 ALA A HB3  3  
ATOM 3997  N N    . ALA A 1 75 ? -0.002  2.577   -1.065  1.00 0.00 ? 75 ALA A N    3  
ATOM 3998  C CA   . ALA A 1 75 ? 1.135   1.956   -0.406  1.00 0.00 ? 75 ALA A CA   3  
ATOM 3999  C C    . ALA A 1 75 ? 1.529   2.790   0.814   1.00 0.00 ? 75 ALA A C    3  
ATOM 4000  O O    . ALA A 1 75 ? 1.689   2.255   1.910   1.00 0.00 ? 75 ALA A O    3  
ATOM 4001  C CB   . ALA A 1 75 ? 2.284   1.806   -1.405  1.00 0.00 ? 75 ALA A CB   3  
ATOM 4002  H H    . ALA A 1 75 ? 0.196   2.980   -1.959  1.00 0.00 ? 75 ALA A H    3  
ATOM 4003  H HA   . ALA A 1 75 ? 0.826   0.965   -0.075  1.00 0.00 ? 75 ALA A HA   3  
ATOM 4004  H HB1  . ALA A 1 75 ? 2.634   0.773   -1.404  1.00 0.00 ? 75 ALA A HB1  3  
ATOM 4005  H HB2  . ALA A 1 75 ? 1.935   2.070   -2.403  1.00 0.00 ? 75 ALA A HB2  3  
ATOM 4006  H HB3  . ALA A 1 75 ? 3.103   2.467   -1.119  1.00 0.00 ? 75 ALA A HB3  3  
ATOM 4007  N N    . ARG A 1 76 ? 1.673   4.087   0.584   1.00 0.00 ? 76 ARG A N    3  
ATOM 4008  C CA   . ARG A 1 76 ? 2.045   5.000   1.651   1.00 0.00 ? 76 ARG A CA   3  
ATOM 4009  C C    . ARG A 1 76 ? 1.124   4.809   2.858   1.00 0.00 ? 76 ARG A C    3  
ATOM 4010  O O    . ARG A 1 76 ? 1.556   4.948   4.001   1.00 0.00 ? 76 ARG A O    3  
ATOM 4011  C CB   . ARG A 1 76 ? 1.967   6.455   1.184   1.00 0.00 ? 76 ARG A CB   3  
ATOM 4012  C CG   . ARG A 1 76 ? 2.332   7.415   2.318   1.00 0.00 ? 76 ARG A CG   3  
ATOM 4013  C CD   . ARG A 1 76 ? 1.374   8.608   2.356   1.00 0.00 ? 76 ARG A CD   3  
ATOM 4014  N NE   . ARG A 1 76 ? 1.382   9.220   3.704   1.00 0.00 ? 76 ARG A NE   3  
ATOM 4015  C CZ   . ARG A 1 76 ? 2.343   10.039  4.151   1.00 0.00 ? 76 ARG A CZ   3  
ATOM 4016  N NH1  . ARG A 1 76 ? 3.379   10.351  3.361   1.00 0.00 ? 76 ARG A NH1  3  
ATOM 4017  N NH2  . ARG A 1 76 ? 2.267   10.548  5.388   1.00 0.00 ? 76 ARG A NH2  3  
ATOM 4018  H H    . ARG A 1 76 ? 1.541   4.514   -0.311  1.00 0.00 ? 76 ARG A H    3  
ATOM 4019  H HA   . ARG A 1 76 ? 3.074   4.737   1.897   1.00 0.00 ? 76 ARG A HA   3  
ATOM 4020  H HB2  . ARG A 1 76 ? 2.642   6.607   0.342   1.00 0.00 ? 76 ARG A HB2  3  
ATOM 4021  H HB3  . ARG A 1 76 ? 0.960   6.673   0.829   1.00 0.00 ? 76 ARG A HB3  3  
ATOM 4022  H HG2  . ARG A 1 76 ? 2.300   6.887   3.271   1.00 0.00 ? 76 ARG A HG2  3  
ATOM 4023  H HG3  . ARG A 1 76 ? 3.354   7.769   2.184   1.00 0.00 ? 76 ARG A HG3  3  
ATOM 4024  H HD2  . ARG A 1 76 ? 1.669   9.346   1.611   1.00 0.00 ? 76 ARG A HD2  3  
ATOM 4025  H HD3  . ARG A 1 76 ? 0.365   8.283   2.101   1.00 0.00 ? 76 ARG A HD3  3  
ATOM 4026  H HE   . ARG A 1 76 ? 0.623   9.008   4.319   1.00 0.00 ? 76 ARG A HE   3  
ATOM 4027  H HH11 . ARG A 1 76 ? 3.436   9.971   2.437   1.00 0.00 ? 76 ARG A HH11 3  
ATOM 4028  H HH12 . ARG A 1 76 ? 4.096   10.962  3.694   1.00 0.00 ? 76 ARG A HH12 3  
ATOM 4029  H HH21 . ARG A 1 76 ? 1.494   10.316  5.978   1.00 0.00 ? 76 ARG A HH21 3  
ATOM 4030  H HH22 . ARG A 1 76 ? 2.984   11.160  5.722   1.00 0.00 ? 76 ARG A HH22 3  
ATOM 4031  N N    . ALA A 1 77 ? -0.128  4.493   2.563   1.00 0.00 ? 77 ALA A N    3  
ATOM 4032  C CA   . ALA A 1 77 ? -1.113  4.281   3.609   1.00 0.00 ? 77 ALA A CA   3  
ATOM 4033  C C    . ALA A 1 77 ? -0.767  3.005   4.379   1.00 0.00 ? 77 ALA A C    3  
ATOM 4034  O O    . ALA A 1 77 ? -0.461  3.058   5.569   1.00 0.00 ? 77 ALA A O    3  
ATOM 4035  C CB   . ALA A 1 77 ? -2.512  4.227   2.991   1.00 0.00 ? 77 ALA A CB   3  
ATOM 4036  H H    . ALA A 1 77 ? -0.471  4.381   1.630   1.00 0.00 ? 77 ALA A H    3  
ATOM 4037  H HA   . ALA A 1 77 ? -1.063  5.131   4.290   1.00 0.00 ? 77 ALA A HA   3  
ATOM 4038  H HB1  . ALA A 1 77 ? -3.260  4.234   3.783   1.00 0.00 ? 77 ALA A HB1  3  
ATOM 4039  H HB2  . ALA A 1 77 ? -2.658  5.094   2.346   1.00 0.00 ? 77 ALA A HB2  3  
ATOM 4040  H HB3  . ALA A 1 77 ? -2.614  3.316   2.402   1.00 0.00 ? 77 ALA A HB3  3  
ATOM 4041  N N    . THR A 1 78 ? -0.827  1.888   3.668   1.00 0.00 ? 78 THR A N    3  
ATOM 4042  C CA   . THR A 1 78 ? -0.524  0.601   4.270   1.00 0.00 ? 78 THR A CA   3  
ATOM 4043  C C    . THR A 1 78 ? 0.697   0.715   5.185   1.00 0.00 ? 78 THR A C    3  
ATOM 4044  O O    . THR A 1 78 ? 0.704   0.168   6.287   1.00 0.00 ? 78 THR A O    3  
ATOM 4045  C CB   . THR A 1 78 ? -0.345  -0.417  3.143   1.00 0.00 ? 78 THR A CB   3  
ATOM 4046  O OG1  . THR A 1 78 ? -1.676  -0.736  2.748   1.00 0.00 ? 78 THR A OG1  3  
ATOM 4047  C CG2  . THR A 1 78 ? 0.225   -1.748  3.640   1.00 0.00 ? 78 THR A CG2  3  
ATOM 4048  H H    . THR A 1 78 ? -1.077  1.854   2.701   1.00 0.00 ? 78 THR A H    3  
ATOM 4049  H HA   . THR A 1 78 ? -1.366  0.307   4.896   1.00 0.00 ? 78 THR A HA   3  
ATOM 4050  H HB   . THR A 1 78 ? 0.268   -0.007  2.341   1.00 0.00 ? 78 THR A HB   3  
ATOM 4051  H HG1  . THR A 1 78 ? -2.049  -0.004  2.177   1.00 0.00 ? 78 THR A HG1  3  
ATOM 4052  H HG21 . THR A 1 78 ? -0.386  -2.120  4.462   1.00 0.00 ? 78 THR A HG21 3  
ATOM 4053  H HG22 . THR A 1 78 ? 0.219   -2.472  2.826   1.00 0.00 ? 78 THR A HG22 3  
ATOM 4054  H HG23 . THR A 1 78 ? 1.248   -1.598  3.986   1.00 0.00 ? 78 THR A HG23 3  
ATOM 4055  N N    . LEU A 1 79 ? 1.700   1.428   4.695   1.00 0.00 ? 79 LEU A N    3  
ATOM 4056  C CA   . LEU A 1 79 ? 2.923   1.620   5.455   1.00 0.00 ? 79 LEU A CA   3  
ATOM 4057  C C    . LEU A 1 79 ? 2.580   2.208   6.825   1.00 0.00 ? 79 LEU A C    3  
ATOM 4058  O O    . LEU A 1 79 ? 2.840   1.586   7.855   1.00 0.00 ? 79 LEU A O    3  
ATOM 4059  C CB   . LEU A 1 79 ? 3.923   2.461   4.658   1.00 0.00 ? 79 LEU A CB   3  
ATOM 4060  C CG   . LEU A 1 79 ? 4.810   1.695   3.675   1.00 0.00 ? 79 LEU A CG   3  
ATOM 4061  C CD1  . LEU A 1 79 ? 5.727   2.648   2.906   1.00 0.00 ? 79 LEU A CD1  3  
ATOM 4062  C CD2  . LEU A 1 79 ? 5.597   0.594   4.389   1.00 0.00 ? 79 LEU A CD2  3  
ATOM 4063  H H    . LEU A 1 79 ? 1.686   1.869   3.798   1.00 0.00 ? 79 LEU A H    3  
ATOM 4064  H HA   . LEU A 1 79 ? 3.374   0.639   5.603   1.00 0.00 ? 79 LEU A HA   3  
ATOM 4065  H HB2  . LEU A 1 79 ? 3.370   3.218   4.103   1.00 0.00 ? 79 LEU A HB2  3  
ATOM 4066  H HB3  . LEU A 1 79 ? 4.567   2.988   5.362   1.00 0.00 ? 79 LEU A HB3  3  
ATOM 4067  H HG   . LEU A 1 79 ? 4.166   1.207   2.943   1.00 0.00 ? 79 LEU A HG   3  
ATOM 4068  H HD11 . LEU A 1 79 ? 5.790   3.598   3.436   1.00 0.00 ? 79 LEU A HD11 3  
ATOM 4069  H HD12 . LEU A 1 79 ? 6.722   2.210   2.827   1.00 0.00 ? 79 LEU A HD12 3  
ATOM 4070  H HD13 . LEU A 1 79 ? 5.323   2.815   1.908   1.00 0.00 ? 79 LEU A HD13 3  
ATOM 4071  H HD21 . LEU A 1 79 ? 4.928   -0.233  4.630   1.00 0.00 ? 79 LEU A HD21 3  
ATOM 4072  H HD22 . LEU A 1 79 ? 6.395   0.237   3.738   1.00 0.00 ? 79 LEU A HD22 3  
ATOM 4073  H HD23 . LEU A 1 79 ? 6.028   0.992   5.307   1.00 0.00 ? 79 LEU A HD23 3  
ATOM 4074  N N    . GLU A 1 80 ? 2.002   3.400   6.795   1.00 0.00 ? 80 GLU A N    3  
ATOM 4075  C CA   . GLU A 1 80 ? 1.620   4.079   8.021   1.00 0.00 ? 80 GLU A CA   3  
ATOM 4076  C C    . GLU A 1 80 ? 1.005   3.085   9.008   1.00 0.00 ? 80 GLU A C    3  
ATOM 4077  O O    . GLU A 1 80 ? 1.435   2.998   10.157  1.00 0.00 ? 80 GLU A O    3  
ATOM 4078  C CB   . GLU A 1 80 ? 0.658   5.233   7.733   1.00 0.00 ? 80 GLU A CB   3  
ATOM 4079  C CG   . GLU A 1 80 ? 1.385   6.397   7.057   1.00 0.00 ? 80 GLU A CG   3  
ATOM 4080  C CD   . GLU A 1 80 ? 1.210   7.690   7.855   1.00 0.00 ? 80 GLU A CD   3  
ATOM 4081  O OE1  . GLU A 1 80 ? 0.153   8.331   7.673   1.00 0.00 ? 80 GLU A OE1  3  
ATOM 4082  O OE2  . GLU A 1 80 ? 2.138   8.009   8.629   1.00 0.00 ? 80 GLU A OE2  3  
ATOM 4083  H H    . GLU A 1 80 ? 1.794   3.899   5.953   1.00 0.00 ? 80 GLU A H    3  
ATOM 4084  H HA   . GLU A 1 80 ? 2.547   4.480   8.430   1.00 0.00 ? 80 GLU A HA   3  
ATOM 4085  H HB2  . GLU A 1 80 ? -0.152  4.884   7.093   1.00 0.00 ? 80 GLU A HB2  3  
ATOM 4086  H HB3  . GLU A 1 80 ? 0.204   5.574   8.663   1.00 0.00 ? 80 GLU A HB3  3  
ATOM 4087  H HG2  . GLU A 1 80 ? 2.445   6.163   6.963   1.00 0.00 ? 80 GLU A HG2  3  
ATOM 4088  H HG3  . GLU A 1 80 ? 0.999   6.534   6.047   1.00 0.00 ? 80 GLU A HG3  3  
ATOM 4089  N N    . ILE A 1 81 ? 0.007   2.360   8.524   1.00 0.00 ? 81 ILE A N    3  
ATOM 4090  C CA   . ILE A 1 81 ? -0.672  1.376   9.350   1.00 0.00 ? 81 ILE A CA   3  
ATOM 4091  C C    . ILE A 1 81 ? 0.367   0.556   10.117  1.00 0.00 ? 81 ILE A C    3  
ATOM 4092  O O    . ILE A 1 81 ? 0.303   0.456   11.342  1.00 0.00 ? 81 ILE A O    3  
ATOM 4093  C CB   . ILE A 1 81 ? -1.620  0.526   8.500   1.00 0.00 ? 81 ILE A CB   3  
ATOM 4094  C CG1  . ILE A 1 81 ? -2.837  1.341   8.056   1.00 0.00 ? 81 ILE A CG1  3  
ATOM 4095  C CG2  . ILE A 1 81 ? -2.024  -0.751  9.240   1.00 0.00 ? 81 ILE A CG2  3  
ATOM 4096  C CD1  . ILE A 1 81 ? -3.751  0.512   7.151   1.00 0.00 ? 81 ILE A CD1  3  
ATOM 4097  H H    . ILE A 1 81 ? -0.337  2.436   7.588   1.00 0.00 ? 81 ILE A H    3  
ATOM 4098  H HA   . ILE A 1 81 ? -1.284  1.919   10.069  1.00 0.00 ? 81 ILE A HA   3  
ATOM 4099  H HB   . ILE A 1 81 ? -1.090  0.222   7.598   1.00 0.00 ? 81 ILE A HB   3  
ATOM 4100  H HG12 . ILE A 1 81 ? -3.393  1.676   8.932   1.00 0.00 ? 81 ILE A HG12 3  
ATOM 4101  H HG13 . ILE A 1 81 ? -2.507  2.234   7.527   1.00 0.00 ? 81 ILE A HG13 3  
ATOM 4102  H HG21 . ILE A 1 81 ? -3.109  -0.847  9.233   1.00 0.00 ? 81 ILE A HG21 3  
ATOM 4103  H HG22 . ILE A 1 81 ? -1.579  -1.614  8.744   1.00 0.00 ? 81 ILE A HG22 3  
ATOM 4104  H HG23 . ILE A 1 81 ? -1.670  -0.701  10.270  1.00 0.00 ? 81 ILE A HG23 3  
ATOM 4105  H HD11 . ILE A 1 81 ? -3.559  0.769   6.109   1.00 0.00 ? 81 ILE A HD11 3  
ATOM 4106  H HD12 . ILE A 1 81 ? -3.552  -0.548  7.307   1.00 0.00 ? 81 ILE A HD12 3  
ATOM 4107  H HD13 . ILE A 1 81 ? -4.792  0.726   7.393   1.00 0.00 ? 81 ILE A HD13 3  
ATOM 4108  N N    . LEU A 1 82 ? 1.300   -0.010  9.366   1.00 0.00 ? 82 LEU A N    3  
ATOM 4109  C CA   . LEU A 1 82 ? 2.351   -0.818  9.961   1.00 0.00 ? 82 LEU A CA   3  
ATOM 4110  C C    . LEU A 1 82 ? 3.356   0.097   10.663  1.00 0.00 ? 82 LEU A C    3  
ATOM 4111  O O    . LEU A 1 82 ? 3.411   0.139   11.891  1.00 0.00 ? 82 LEU A O    3  
ATOM 4112  C CB   . LEU A 1 82 ? 2.983   -1.734  8.910   1.00 0.00 ? 82 LEU A CB   3  
ATOM 4113  C CG   . LEU A 1 82 ? 2.010   -2.426  7.952   1.00 0.00 ? 82 LEU A CG   3  
ATOM 4114  C CD1  . LEU A 1 82 ? 2.509   -2.340  6.508   1.00 0.00 ? 82 LEU A CD1  3  
ATOM 4115  C CD2  . LEU A 1 82 ? 1.751   -3.870  8.384   1.00 0.00 ? 82 LEU A CD2  3  
ATOM 4116  H H    . LEU A 1 82 ? 1.345   0.075   8.371   1.00 0.00 ? 82 LEU A H    3  
ATOM 4117  H HA   . LEU A 1 82 ? 1.886   -1.460  10.709  1.00 0.00 ? 82 LEU A HA   3  
ATOM 4118  H HB2  . LEU A 1 82 ? 3.686   -1.146  8.320   1.00 0.00 ? 82 LEU A HB2  3  
ATOM 4119  H HB3  . LEU A 1 82 ? 3.561   -2.500  9.425   1.00 0.00 ? 82 LEU A HB3  3  
ATOM 4120  H HG   . LEU A 1 82 ? 1.056   -1.901  7.995   1.00 0.00 ? 82 LEU A HG   3  
ATOM 4121  H HD11 . LEU A 1 82 ? 1.864   -1.669  5.941   1.00 0.00 ? 82 LEU A HD11 3  
ATOM 4122  H HD12 . LEU A 1 82 ? 3.530   -1.958  6.498   1.00 0.00 ? 82 LEU A HD12 3  
ATOM 4123  H HD13 . LEU A 1 82 ? 2.488   -3.332  6.057   1.00 0.00 ? 82 LEU A HD13 3  
ATOM 4124  H HD21 . LEU A 1 82 ? 2.095   -4.550  7.604   1.00 0.00 ? 82 LEU A HD21 3  
ATOM 4125  H HD22 . LEU A 1 82 ? 2.290   -4.076  9.309   1.00 0.00 ? 82 LEU A HD22 3  
ATOM 4126  H HD23 . LEU A 1 82 ? 0.682   -4.015  8.546   1.00 0.00 ? 82 LEU A HD23 3  
ATOM 4127  N N    . ILE A 1 83 ? 4.127   0.807   9.853   1.00 0.00 ? 83 ILE A N    3  
ATOM 4128  C CA   . ILE A 1 83 ? 5.128   1.719   10.381  1.00 0.00 ? 83 ILE A CA   3  
ATOM 4129  C C    . ILE A 1 83 ? 4.432   2.949   10.967  1.00 0.00 ? 83 ILE A C    3  
ATOM 4130  O O    . ILE A 1 83 ? 3.818   3.726   10.238  1.00 0.00 ? 83 ILE A O    3  
ATOM 4131  C CB   . ILE A 1 83 ? 6.167   2.054   9.309   1.00 0.00 ? 83 ILE A CB   3  
ATOM 4132  C CG1  . ILE A 1 83 ? 6.509   0.819   8.472   1.00 0.00 ? 83 ILE A CG1  3  
ATOM 4133  C CG2  . ILE A 1 83 ? 7.413   2.687   9.932   1.00 0.00 ? 83 ILE A CG2  3  
ATOM 4134  C CD1  . ILE A 1 83 ? 7.821   1.018   7.712   1.00 0.00 ? 83 ILE A CD1  3  
ATOM 4135  H H    . ILE A 1 83 ? 4.077   0.767   8.855   1.00 0.00 ? 83 ILE A H    3  
ATOM 4136  H HA   . ILE A 1 83 ? 5.650   1.201   11.185  1.00 0.00 ? 83 ILE A HA   3  
ATOM 4137  H HB   . ILE A 1 83 ? 5.735   2.792   8.633   1.00 0.00 ? 83 ILE A HB   3  
ATOM 4138  H HG12 . ILE A 1 83 ? 6.589   -0.053  9.121   1.00 0.00 ? 83 ILE A HG12 3  
ATOM 4139  H HG13 . ILE A 1 83 ? 5.702   0.619   7.767   1.00 0.00 ? 83 ILE A HG13 3  
ATOM 4140  H HG21 . ILE A 1 83 ? 7.116   3.345   10.749  1.00 0.00 ? 83 ILE A HG21 3  
ATOM 4141  H HG22 . ILE A 1 83 ? 8.066   1.903   10.315  1.00 0.00 ? 83 ILE A HG22 3  
ATOM 4142  H HG23 . ILE A 1 83 ? 7.944   3.264   9.175   1.00 0.00 ? 83 ILE A HG23 3  
ATOM 4143  H HD11 . ILE A 1 83 ? 7.915   2.063   7.417   1.00 0.00 ? 83 ILE A HD11 3  
ATOM 4144  H HD12 . ILE A 1 83 ? 8.658   0.745   8.354   1.00 0.00 ? 83 ILE A HD12 3  
ATOM 4145  H HD13 . ILE A 1 83 ? 7.825   0.388   6.822   1.00 0.00 ? 83 ILE A HD13 3  
ATOM 4146  N N    . PRO A 1 84 ? 4.554   3.091   12.314  1.00 0.00 ? 84 PRO A N    3  
ATOM 4147  C CA   . PRO A 1 84 ? 3.944   4.213   13.007  1.00 0.00 ? 84 PRO A CA   3  
ATOM 4148  C C    . PRO A 1 84 ? 4.733   5.501   12.766  1.00 0.00 ? 84 PRO A C    3  
ATOM 4149  O O    . PRO A 1 84 ? 4.146   6.564   12.567  1.00 0.00 ? 84 PRO A O    3  
ATOM 4150  C CB   . PRO A 1 84 ? 3.912   3.801   14.470  1.00 0.00 ? 84 PRO A CB   3  
ATOM 4151  C CG   . PRO A 1 84 ? 4.920   2.672   14.608  1.00 0.00 ? 84 PRO A CG   3  
ATOM 4152  C CD   . PRO A 1 84 ? 5.273   2.190   13.210  1.00 0.00 ? 84 PRO A CD   3  
ATOM 4153  H HA   . PRO A 1 84 ? 3.025   4.383   12.650  1.00 0.00 ? 84 PRO A HA   3  
ATOM 4154  H HB2  . PRO A 1 84 ? 4.173   4.639   15.117  1.00 0.00 ? 84 PRO A HB2  3  
ATOM 4155  H HB3  . PRO A 1 84 ? 2.915   3.472   14.762  1.00 0.00 ? 84 PRO A HB3  3  
ATOM 4156  H HG2  . PRO A 1 84 ? 5.813   3.018   15.129  1.00 0.00 ? 84 PRO A HG2  3  
ATOM 4157  H HG3  . PRO A 1 84 ? 4.502   1.857   15.199  1.00 0.00 ? 84 PRO A HG3  3  
ATOM 4158  H HD2  . PRO A 1 84 ? 6.349   2.234   13.036  1.00 0.00 ? 84 PRO A HD2  3  
ATOM 4159  H HD3  . PRO A 1 84 ? 4.968   1.155   13.060  1.00 0.00 ? 84 PRO A HD3  3  
ATOM 4160  N N    . ASP A 1 85 ? 6.050   5.364   12.790  1.00 0.00 ? 85 ASP A N    3  
ATOM 4161  C CA   . ASP A 1 85 ? 6.925   6.504   12.576  1.00 0.00 ? 85 ASP A CA   3  
ATOM 4162  C C    . ASP A 1 85 ? 7.805   6.243   11.351  1.00 0.00 ? 85 ASP A C    3  
ATOM 4163  O O    . ASP A 1 85 ? 9.004   6.003   11.483  1.00 0.00 ? 85 ASP A O    3  
ATOM 4164  C CB   . ASP A 1 85 ? 7.844   6.726   13.779  1.00 0.00 ? 85 ASP A CB   3  
ATOM 4165  C CG   . ASP A 1 85 ? 7.170   7.355   15.000  1.00 0.00 ? 85 ASP A CG   3  
ATOM 4166  O OD1  . ASP A 1 85 ? 5.920   7.365   15.016  1.00 0.00 ? 85 ASP A OD1  3  
ATOM 4167  O OD2  . ASP A 1 85 ? 7.920   7.811   15.890  1.00 0.00 ? 85 ASP A OD2  3  
ATOM 4168  H H    . ASP A 1 85 ? 6.519   4.496   12.952  1.00 0.00 ? 85 ASP A H    3  
ATOM 4169  H HA   . ASP A 1 85 ? 6.259   7.355   12.437  1.00 0.00 ? 85 ASP A HA   3  
ATOM 4170  H HB2  . ASP A 1 85 ? 8.273   5.768   14.072  1.00 0.00 ? 85 ASP A HB2  3  
ATOM 4171  H HB3  . ASP A 1 85 ? 8.673   7.365   13.471  1.00 0.00 ? 85 ASP A HB3  3  
ATOM 4172  N N    . PHE A 1 86 ? 7.174   6.300   10.187  1.00 0.00 ? 86 PHE A N    3  
ATOM 4173  C CA   . PHE A 1 86 ? 7.884   6.073   8.940   1.00 0.00 ? 86 PHE A CA   3  
ATOM 4174  C C    . PHE A 1 86 ? 8.503   7.371   8.417   1.00 0.00 ? 86 PHE A C    3  
ATOM 4175  O O    . PHE A 1 86 ? 9.684   7.405   8.073   1.00 0.00 ? 86 PHE A O    3  
ATOM 4176  C CB   . PHE A 1 86 ? 6.857   5.568   7.926   1.00 0.00 ? 86 PHE A CB   3  
ATOM 4177  C CG   . PHE A 1 86 ? 7.457   5.176   6.574   1.00 0.00 ? 86 PHE A CG   3  
ATOM 4178  C CD1  . PHE A 1 86 ? 8.571   4.398   6.524   1.00 0.00 ? 86 PHE A CD1  3  
ATOM 4179  C CD2  . PHE A 1 86 ? 6.876   5.606   5.422   1.00 0.00 ? 86 PHE A CD2  3  
ATOM 4180  C CE1  . PHE A 1 86 ? 9.128   4.035   5.270   1.00 0.00 ? 86 PHE A CE1  3  
ATOM 4181  C CE2  . PHE A 1 86 ? 7.433   5.243   4.167   1.00 0.00 ? 86 PHE A CE2  3  
ATOM 4182  C CZ   . PHE A 1 86 ? 8.548   4.465   4.118   1.00 0.00 ? 86 PHE A CZ   3  
ATOM 4183  H H    . PHE A 1 86 ? 6.199   6.496   10.088  1.00 0.00 ? 86 PHE A H    3  
ATOM 4184  H HA   . PHE A 1 86 ? 8.676   5.352   9.145   1.00 0.00 ? 86 PHE A HA   3  
ATOM 4185  H HB2  . PHE A 1 86 ? 6.340   4.705   8.346   1.00 0.00 ? 86 PHE A HB2  3  
ATOM 4186  H HB3  . PHE A 1 86 ? 6.106   6.342   7.768   1.00 0.00 ? 86 PHE A HB3  3  
ATOM 4187  H HD1  . PHE A 1 86 ? 9.037   4.054   7.448   1.00 0.00 ? 86 PHE A HD1  3  
ATOM 4188  H HD2  . PHE A 1 86 ? 5.983   6.229   5.462   1.00 0.00 ? 86 PHE A HD2  3  
ATOM 4189  H HE1  . PHE A 1 86 ? 10.022  3.412   5.230   1.00 0.00 ? 86 PHE A HE1  3  
ATOM 4190  H HE2  . PHE A 1 86 ? 6.967   5.587   3.244   1.00 0.00 ? 86 PHE A HE2  3  
ATOM 4191  H HZ   . PHE A 1 86 ? 8.975   4.186   3.155   1.00 0.00 ? 86 PHE A HZ   3  
ATOM 4192  N N    . VAL A 1 87 ? 7.679   8.407   8.375   1.00 0.00 ? 87 VAL A N    3  
ATOM 4193  C CA   . VAL A 1 87 ? 8.130   9.704   7.900   1.00 0.00 ? 87 VAL A CA   3  
ATOM 4194  C C    . VAL A 1 87 ? 8.000   10.729  9.029   1.00 0.00 ? 87 VAL A C    3  
ATOM 4195  O O    . VAL A 1 87 ? 7.003   10.742  9.749   1.00 0.00 ? 87 VAL A O    3  
ATOM 4196  C CB   . VAL A 1 87 ? 7.355   10.100  6.642   1.00 0.00 ? 87 VAL A CB   3  
ATOM 4197  C CG1  . VAL A 1 87 ? 7.814   9.279   5.435   1.00 0.00 ? 87 VAL A CG1  3  
ATOM 4198  C CG2  . VAL A 1 87 ? 5.847   9.958   6.859   1.00 0.00 ? 87 VAL A CG2  3  
ATOM 4199  H H    . VAL A 1 87 ? 6.720   8.371   8.657   1.00 0.00 ? 87 VAL A H    3  
ATOM 4200  H HA   . VAL A 1 87 ? 9.182   9.608   7.632   1.00 0.00 ? 87 VAL A HA   3  
ATOM 4201  H HB   . VAL A 1 87 ? 7.566   11.149  6.434   1.00 0.00 ? 87 VAL A HB   3  
ATOM 4202  H HG11 . VAL A 1 87 ? 7.920   8.234   5.725   1.00 0.00 ? 87 VAL A HG11 3  
ATOM 4203  H HG12 . VAL A 1 87 ? 7.076   9.362   4.637   1.00 0.00 ? 87 VAL A HG12 3  
ATOM 4204  H HG13 . VAL A 1 87 ? 8.774   9.658   5.082   1.00 0.00 ? 87 VAL A HG13 3  
ATOM 4205  H HG21 . VAL A 1 87 ? 5.600   10.240  7.883   1.00 0.00 ? 87 VAL A HG21 3  
ATOM 4206  H HG22 . VAL A 1 87 ? 5.317   10.610  6.165   1.00 0.00 ? 87 VAL A HG22 3  
ATOM 4207  H HG23 . VAL A 1 87 ? 5.551   8.924   6.686   1.00 0.00 ? 87 VAL A HG23 3  
ATOM 4208  N N    . LYS A 1 88 ? 9.023   11.562  9.149   1.00 0.00 ? 88 LYS A N    3  
ATOM 4209  C CA   . LYS A 1 88 ? 9.036   12.588  10.178  1.00 0.00 ? 88 LYS A CA   3  
ATOM 4210  C C    . LYS A 1 88 ? 8.834   13.959  9.528   1.00 0.00 ? 88 LYS A C    3  
ATOM 4211  O O    . LYS A 1 88 ? 9.802   14.651  9.217   1.00 0.00 ? 88 LYS A O    3  
ATOM 4212  C CB   . LYS A 1 88 ? 10.311  12.488  11.018  1.00 0.00 ? 88 LYS A CB   3  
ATOM 4213  C CG   . LYS A 1 88 ? 10.070  11.665  12.285  1.00 0.00 ? 88 LYS A CG   3  
ATOM 4214  C CD   . LYS A 1 88 ? 11.015  12.096  13.407  1.00 0.00 ? 88 LYS A CD   3  
ATOM 4215  C CE   . LYS A 1 88 ? 10.660  11.398  14.722  1.00 0.00 ? 88 LYS A CE   3  
ATOM 4216  N NZ   . LYS A 1 88 ? 11.185  12.164  15.874  1.00 0.00 ? 88 LYS A NZ   3  
ATOM 4217  H H    . LYS A 1 88 ? 9.831   11.545  8.559   1.00 0.00 ? 88 LYS A H    3  
ATOM 4218  H HA   . LYS A 1 88 ? 8.195   12.394  10.843  1.00 0.00 ? 88 LYS A HA   3  
ATOM 4219  H HB2  . LYS A 1 88 ? 11.105  12.030  10.428  1.00 0.00 ? 88 LYS A HB2  3  
ATOM 4220  H HB3  . LYS A 1 88 ? 10.652  13.487  11.289  1.00 0.00 ? 88 LYS A HB3  3  
ATOM 4221  H HG2  . LYS A 1 88 ? 9.036   11.785  12.609  1.00 0.00 ? 88 LYS A HG2  3  
ATOM 4222  H HG3  . LYS A 1 88 ? 10.215  10.606  12.068  1.00 0.00 ? 88 LYS A HG3  3  
ATOM 4223  H HD2  . LYS A 1 88 ? 12.043  11.859  13.132  1.00 0.00 ? 88 LYS A HD2  3  
ATOM 4224  H HD3  . LYS A 1 88 ? 10.961  13.176  13.539  1.00 0.00 ? 88 LYS A HD3  3  
ATOM 4225  H HE2  . LYS A 1 88 ? 9.578   11.298  14.807  1.00 0.00 ? 88 LYS A HE2  3  
ATOM 4226  H HE3  . LYS A 1 88 ? 11.074  10.390  14.729  1.00 0.00 ? 88 LYS A HE3  3  
ATOM 4227  H HZ1  . LYS A 1 88 ? 12.168  12.001  15.963  1.00 0.00 ? 88 LYS A HZ1  3  
ATOM 4228  H HZ2  . LYS A 1 88 ? 11.021  13.140  15.728  1.00 0.00 ? 88 LYS A HZ2  3  
ATOM 4229  H HZ3  . LYS A 1 88 ? 10.722  11.869  16.709  1.00 0.00 ? 88 LYS A HZ3  3  
ATOM 4230  N N    . GLN A 1 89 ? 7.570   14.309  9.343   1.00 0.00 ? 89 GLN A N    3  
ATOM 4231  C CA   . GLN A 1 89 ? 7.228   15.585  8.736   1.00 0.00 ? 89 GLN A CA   3  
ATOM 4232  C C    . GLN A 1 89 ? 5.857   16.055  9.224   1.00 0.00 ? 89 GLN A C    3  
ATOM 4233  O O    . GLN A 1 89 ? 5.739   17.126  9.816   1.00 0.00 ? 89 GLN A O    3  
ATOM 4234  C CB   . GLN A 1 89 ? 7.264   15.492  7.209   1.00 0.00 ? 89 GLN A CB   3  
ATOM 4235  C CG   . GLN A 1 89 ? 8.601   15.996  6.660   1.00 0.00 ? 89 GLN A CG   3  
ATOM 4236  C CD   . GLN A 1 89 ? 8.386   16.948  5.481   1.00 0.00 ? 89 GLN A CD   3  
ATOM 4237  O OE1  . GLN A 1 89 ? 8.082   16.543  4.371   1.00 0.00 ? 89 GLN A OE1  3  
ATOM 4238  N NE2  . GLN A 1 89 ? 8.559   18.231  5.784   1.00 0.00 ? 89 GLN A NE2  3  
ATOM 4239  H H    . GLN A 1 89 ? 6.788   13.740  9.598   1.00 0.00 ? 89 GLN A H    3  
ATOM 4240  H HA   . GLN A 1 89 ? 7.998   16.280  9.069   1.00 0.00 ? 89 GLN A HA   3  
ATOM 4241  H HB2  . GLN A 1 89 ? 7.107   14.459  6.900   1.00 0.00 ? 89 GLN A HB2  3  
ATOM 4242  H HB3  . GLN A 1 89 ? 6.449   16.079  6.786   1.00 0.00 ? 89 GLN A HB3  3  
ATOM 4243  H HG2  . GLN A 1 89 ? 9.152   16.508  7.449   1.00 0.00 ? 89 GLN A HG2  3  
ATOM 4244  H HG3  . GLN A 1 89 ? 9.210   15.150  6.343   1.00 0.00 ? 89 GLN A HG3  3  
ATOM 4245  H HE21 . GLN A 1 89 ? 8.807   18.496  6.715   1.00 0.00 ? 89 GLN A HE21 3  
ATOM 4246  H HE22 . GLN A 1 89 ? 8.440   18.931  5.079   1.00 0.00 ? 89 GLN A HE22 3  
ATOM 4247  N N    . THR A 1 90 ? 4.855   15.229  8.959   1.00 0.00 ? 90 THR A N    3  
ATOM 4248  C CA   . THR A 1 90 ? 3.496   15.547  9.364   1.00 0.00 ? 90 THR A CA   3  
ATOM 4249  C C    . THR A 1 90 ? 3.185   14.920  10.725  1.00 0.00 ? 90 THR A C    3  
ATOM 4250  O O    . THR A 1 90 ? 4.013   14.204  11.286  1.00 0.00 ? 90 THR A O    3  
ATOM 4251  C CB   . THR A 1 90 ? 2.551   15.087  8.253   1.00 0.00 ? 90 THR A CB   3  
ATOM 4252  O OG1  . THR A 1 90 ? 2.825   13.695  8.118   1.00 0.00 ? 90 THR A OG1  3  
ATOM 4253  C CG2  . THR A 1 90 ? 2.922   15.674  6.889   1.00 0.00 ? 90 THR A CG2  3  
ATOM 4254  H H    . THR A 1 90 ? 4.959   14.359  8.477   1.00 0.00 ? 90 THR A H    3  
ATOM 4255  H HA   . THR A 1 90 ? 3.417   16.628  9.485   1.00 0.00 ? 90 THR A HA   3  
ATOM 4256  H HB   . THR A 1 90 ? 1.515   15.313  8.505   1.00 0.00 ? 90 THR A HB   3  
ATOM 4257  H HG1  . THR A 1 90 ? 2.376   13.336  7.300   1.00 0.00 ? 90 THR A HG1  3  
ATOM 4258  H HG21 . THR A 1 90 ? 3.994   15.867  6.856   1.00 0.00 ? 90 THR A HG21 3  
ATOM 4259  H HG22 . THR A 1 90 ? 2.656   14.965  6.104   1.00 0.00 ? 90 THR A HG22 3  
ATOM 4260  H HG23 . THR A 1 90 ? 2.380   16.607  6.735   1.00 0.00 ? 90 THR A HG23 3  
ATOM 4261  N N    . SER A 1 91 ? 1.989   15.212  11.215  1.00 0.00 ? 91 SER A N    3  
ATOM 4262  C CA   . SER A 1 91 ? 1.559   14.685  12.499  1.00 0.00 ? 91 SER A CA   3  
ATOM 4263  C C    . SER A 1 91 ? 0.057   14.916  12.683  1.00 0.00 ? 91 SER A C    3  
ATOM 4264  O O    . SER A 1 91 ? -0.367  16.020  13.022  1.00 0.00 ? 91 SER A O    3  
ATOM 4265  C CB   . SER A 1 91 ? 2.339   15.327  13.648  1.00 0.00 ? 91 SER A CB   3  
ATOM 4266  O OG   . SER A 1 91 ? 2.995   14.355  14.457  1.00 0.00 ? 91 SER A OG   3  
ATOM 4267  H H    . SER A 1 91 ? 1.322   15.795  10.752  1.00 0.00 ? 91 SER A H    3  
ATOM 4268  H HA   . SER A 1 91 ? 1.779   13.618  12.463  1.00 0.00 ? 91 SER A HA   3  
ATOM 4269  H HB2  . SER A 1 91 ? 3.077   16.020  13.242  1.00 0.00 ? 91 SER A HB2  3  
ATOM 4270  H HB3  . SER A 1 91 ? 1.658   15.913  14.265  1.00 0.00 ? 91 SER A HB3  3  
ATOM 4271  H HG   . SER A 1 91 ? 3.155   13.522  13.928  1.00 0.00 ? 91 SER A HG   3  
ATOM 4272  N N    . GLU A 1 92 ? -0.705  13.858  12.451  1.00 0.00 ? 92 GLU A N    3  
ATOM 4273  C CA   . GLU A 1 92 ? -2.150  13.932  12.586  1.00 0.00 ? 92 GLU A CA   3  
ATOM 4274  C C    . GLU A 1 92 ? -2.690  12.647  13.217  1.00 0.00 ? 92 GLU A C    3  
ATOM 4275  O O    . GLU A 1 92 ? -2.917  11.658  12.523  1.00 0.00 ? 92 GLU A O    3  
ATOM 4276  C CB   . GLU A 1 92 ? -2.814  14.200  11.234  1.00 0.00 ? 92 GLU A CB   3  
ATOM 4277  C CG   . GLU A 1 92 ? -4.336  14.267  11.375  1.00 0.00 ? 92 GLU A CG   3  
ATOM 4278  C CD   . GLU A 1 92 ? -5.019  14.133  10.012  1.00 0.00 ? 92 GLU A CD   3  
ATOM 4279  O OE1  . GLU A 1 92 ? -4.681  13.163  9.301   1.00 0.00 ? 92 GLU A OE1  3  
ATOM 4280  O OE2  . GLU A 1 92 ? -5.864  15.004  9.713   1.00 0.00 ? 92 GLU A OE2  3  
ATOM 4281  H H    . GLU A 1 92 ? -0.352  12.964  12.175  1.00 0.00 ? 92 GLU A H    3  
ATOM 4282  H HA   . GLU A 1 92 ? -2.336  14.777  13.249  1.00 0.00 ? 92 GLU A HA   3  
ATOM 4283  H HB2  . GLU A 1 92 ? -2.442  15.138  10.822  1.00 0.00 ? 92 GLU A HB2  3  
ATOM 4284  H HB3  . GLU A 1 92 ? -2.545  13.413  10.530  1.00 0.00 ? 92 GLU A HB3  3  
ATOM 4285  H HG2  . GLU A 1 92 ? -4.679  13.473  12.037  1.00 0.00 ? 92 GLU A HG2  3  
ATOM 4286  H HG3  . GLU A 1 92 ? -4.621  15.213  11.837  1.00 0.00 ? 92 GLU A HG3  3  
ATOM 4287  N N    . SER A 1 93 ? -2.881  12.704  14.527  1.00 0.00 ? 93 SER A N    3  
ATOM 4288  C CA   . SER A 1 93 ? -3.391  11.558  15.260  1.00 0.00 ? 93 SER A CA   3  
ATOM 4289  C C    . SER A 1 93 ? -4.682  11.935  15.990  1.00 0.00 ? 93 SER A C    3  
ATOM 4290  O O    . SER A 1 93 ? -4.670  12.780  16.883  1.00 0.00 ? 93 SER A O    3  
ATOM 4291  C CB   . SER A 1 93 ? -2.353  11.034  16.254  1.00 0.00 ? 93 SER A CB   3  
ATOM 4292  O OG   . SER A 1 93 ? -2.466  9.627   16.453  1.00 0.00 ? 93 SER A OG   3  
ATOM 4293  H H    . SER A 1 93 ? -2.695  13.513  15.085  1.00 0.00 ? 93 SER A H    3  
ATOM 4294  H HA   . SER A 1 93 ? -3.587  10.797  14.505  1.00 0.00 ? 93 SER A HA   3  
ATOM 4295  H HB2  . SER A 1 93 ? -1.352  11.269  15.891  1.00 0.00 ? 93 SER A HB2  3  
ATOM 4296  H HB3  . SER A 1 93 ? -2.474  11.546  17.209  1.00 0.00 ? 93 SER A HB3  3  
ATOM 4297  H HG   . SER A 1 93 ? -2.447  9.155   15.572  1.00 0.00 ? 93 SER A HG   3  
ATOM 4298  N N    . GLY A 1 94 ? -5.764  11.289  15.582  1.00 0.00 ? 94 GLY A N    3  
ATOM 4299  C CA   . GLY A 1 94 ? -7.061  11.546  16.186  1.00 0.00 ? 94 GLY A CA   3  
ATOM 4300  C C    . GLY A 1 94 ? -8.064  10.450  15.818  1.00 0.00 ? 94 GLY A C    3  
ATOM 4301  O O    . GLY A 1 94 ? -7.704  9.465   15.175  1.00 0.00 ? 94 GLY A O    3  
ATOM 4302  H H    . GLY A 1 94 ? -5.766  10.603  14.854  1.00 0.00 ? 94 GLY A H    3  
ATOM 4303  H HA2  . GLY A 1 94 ? -6.957  11.600  17.269  1.00 0.00 ? 94 GLY A HA2  3  
ATOM 4304  H HA3  . GLY A 1 94 ? -7.436  12.514  15.852  1.00 0.00 ? 94 GLY A HA3  3  
ATOM 4305  N N    . PRO A 1 95 ? -9.334  10.664  16.254  1.00 0.00 ? 95 PRO A N    3  
ATOM 4306  C CA   . PRO A 1 95 ? -10.391 9.707   15.978  1.00 0.00 ? 95 PRO A CA   3  
ATOM 4307  C C    . PRO A 1 95 ? -10.841 9.792   14.518  1.00 0.00 ? 95 PRO A C    3  
ATOM 4308  O O    . PRO A 1 95 ? -10.943 10.883  13.959  1.00 0.00 ? 95 PRO A O    3  
ATOM 4309  C CB   . PRO A 1 95 ? -11.498 10.048  16.962  1.00 0.00 ? 95 PRO A CB   3  
ATOM 4310  C CG   . PRO A 1 95 ? -11.215 11.466  17.432  1.00 0.00 ? 95 PRO A CG   3  
ATOM 4311  C CD   . PRO A 1 95 ? -9.796  11.819  17.019  1.00 0.00 ? 95 PRO A CD   3  
ATOM 4312  H HA   . PRO A 1 95 ? -10.056 8.773   16.107  1.00 0.00 ? 95 PRO A HA   3  
ATOM 4313  H HB2  . PRO A 1 95 ? -12.477 9.983   16.486  1.00 0.00 ? 95 PRO A HB2  3  
ATOM 4314  H HB3  . PRO A 1 95 ? -11.504 9.352   17.801  1.00 0.00 ? 95 PRO A HB3  3  
ATOM 4315  H HG2  . PRO A 1 95 ? -11.926 12.164  16.991  1.00 0.00 ? 95 PRO A HG2  3  
ATOM 4316  H HG3  . PRO A 1 95 ? -11.327 11.538  18.514  1.00 0.00 ? 95 PRO A HG3  3  
ATOM 4317  H HD2  . PRO A 1 95 ? -9.773  12.727  16.417  1.00 0.00 ? 95 PRO A HD2  3  
ATOM 4318  H HD3  . PRO A 1 95 ? -9.163  11.997  17.888  1.00 0.00 ? 95 PRO A HD3  3  
ATOM 4319  N N    . SER A 1 96 ? -11.098 8.627   13.942  1.00 0.00 ? 96 SER A N    3  
ATOM 4320  C CA   . SER A 1 96 ? -11.534 8.556   12.558  1.00 0.00 ? 96 SER A CA   3  
ATOM 4321  C C    . SER A 1 96 ? -12.027 7.144   12.236  1.00 0.00 ? 96 SER A C    3  
ATOM 4322  O O    . SER A 1 96 ? -11.225 6.228   12.061  1.00 0.00 ? 96 SER A O    3  
ATOM 4323  C CB   . SER A 1 96 ? -10.406 8.955   11.604  1.00 0.00 ? 96 SER A CB   3  
ATOM 4324  O OG   . SER A 1 96 ? -10.860 9.066   10.258  1.00 0.00 ? 96 SER A OG   3  
ATOM 4325  H H    . SER A 1 96 ? -11.012 7.744   14.404  1.00 0.00 ? 96 SER A H    3  
ATOM 4326  H HA   . SER A 1 96 ? -12.350 9.274   12.476  1.00 0.00 ? 96 SER A HA   3  
ATOM 4327  H HB2  . SER A 1 96 ? -9.982  9.907   11.923  1.00 0.00 ? 96 SER A HB2  3  
ATOM 4328  H HB3  . SER A 1 96 ? -9.607  8.216   11.658  1.00 0.00 ? 96 SER A HB3  3  
ATOM 4329  H HG   . SER A 1 96 ? -11.777 8.676   10.173  1.00 0.00 ? 96 SER A HG   3  
ATOM 4330  N N    . SER A 1 97 ? -13.343 7.012   12.168  1.00 0.00 ? 97 SER A N    3  
ATOM 4331  C CA   . SER A 1 97 ? -13.953 5.727   11.870  1.00 0.00 ? 97 SER A CA   3  
ATOM 4332  C C    . SER A 1 97 ? -14.831 5.841   10.623  1.00 0.00 ? 97 SER A C    3  
ATOM 4333  O O    . SER A 1 97 ? -15.782 6.621   10.598  1.00 0.00 ? 97 SER A O    3  
ATOM 4334  C CB   . SER A 1 97 ? -14.777 5.220   13.056  1.00 0.00 ? 97 SER A CB   3  
ATOM 4335  O OG   . SER A 1 97 ? -15.405 3.973   12.774  1.00 0.00 ? 97 SER A OG   3  
ATOM 4336  H H    . SER A 1 97 ? -13.989 7.763   12.312  1.00 0.00 ? 97 SER A H    3  
ATOM 4337  H HA   . SER A 1 97 ? -13.119 5.048   11.691  1.00 0.00 ? 97 SER A HA   3  
ATOM 4338  H HB2  . SER A 1 97 ? -14.131 5.113   13.927  1.00 0.00 ? 97 SER A HB2  3  
ATOM 4339  H HB3  . SER A 1 97 ? -15.536 5.959   13.311  1.00 0.00 ? 97 SER A HB3  3  
ATOM 4340  H HG   . SER A 1 97 ? -16.343 4.124   12.464  1.00 0.00 ? 97 SER A HG   3  
ATOM 4341  N N    . GLY A 1 98 ? -14.481 5.052   9.618   1.00 0.00 ? 98 GLY A N    3  
ATOM 4342  C CA   . GLY A 1 98 ? -15.226 5.054   8.370   1.00 0.00 ? 98 GLY A CA   3  
ATOM 4343  C C    . GLY A 1 98 ? -15.187 3.676   7.705   1.00 0.00 ? 98 GLY A C    3  
ATOM 4344  O O    . GLY A 1 98 ? -15.007 2.663   8.379   1.00 0.00 ? 98 GLY A O    3  
ATOM 4345  H H    . GLY A 1 98 ? -13.707 4.420   9.646   1.00 0.00 ? 98 GLY A H    3  
ATOM 4346  H HA2  . GLY A 1 98 ? -16.261 5.340   8.561   1.00 0.00 ? 98 GLY A HA2  3  
ATOM 4347  H HA3  . GLY A 1 98 ? -14.809 5.800   7.695   1.00 0.00 ? 98 GLY A HA3  3  
ATOM 4348  N N    . GLY A 1 1  ? -11.429 -6.945  -10.101 1.00 0.00 ? 1  GLY A N    4  
ATOM 4349  C CA   . GLY A 1 1  ? -11.570 -6.889  -11.546 1.00 0.00 ? 1  GLY A CA   4  
ATOM 4350  C C    . GLY A 1 1  ? -11.915 -8.266  -12.117 1.00 0.00 ? 1  GLY A C    4  
ATOM 4351  O O    . GLY A 1 1  ? -12.413 -9.132  -11.400 1.00 0.00 ? 1  GLY A O    4  
ATOM 4352  H H1   . GLY A 1 1  ? -12.193 -7.373  -9.618  1.00 0.00 ? 1  GLY A H1   4  
ATOM 4353  H HA2  . GLY A 1 1  ? -12.350 -6.175  -11.812 1.00 0.00 ? 1  GLY A HA2  4  
ATOM 4354  H HA3  . GLY A 1 1  ? -10.643 -6.529  -11.992 1.00 0.00 ? 1  GLY A HA3  4  
ATOM 4355  N N    . SER A 1 2  ? -11.637 -8.425  -13.403 1.00 0.00 ? 2  SER A N    4  
ATOM 4356  C CA   . SER A 1 2  ? -11.912 -9.682  -14.078 1.00 0.00 ? 2  SER A CA   4  
ATOM 4357  C C    . SER A 1 2  ? -10.656 -10.555 -14.089 1.00 0.00 ? 2  SER A C    4  
ATOM 4358  O O    . SER A 1 2  ? -10.670 -11.675 -13.579 1.00 0.00 ? 2  SER A O    4  
ATOM 4359  C CB   . SER A 1 2  ? -12.404 -9.443  -15.507 1.00 0.00 ? 2  SER A CB   4  
ATOM 4360  O OG   . SER A 1 2  ? -13.791 -9.118  -15.546 1.00 0.00 ? 2  SER A OG   4  
ATOM 4361  H H    . SER A 1 2  ? -11.231 -7.715  -13.979 1.00 0.00 ? 2  SER A H    4  
ATOM 4362  H HA   . SER A 1 2  ? -12.702 -10.155 -13.497 1.00 0.00 ? 2  SER A HA   4  
ATOM 4363  H HB2  . SER A 1 2  ? -11.830 -8.633  -15.958 1.00 0.00 ? 2  SER A HB2  4  
ATOM 4364  H HB3  . SER A 1 2  ? -12.223 -10.335 -16.107 1.00 0.00 ? 2  SER A HB3  4  
ATOM 4365  H HG   . SER A 1 2  ? -14.168 -9.115  -14.620 1.00 0.00 ? 2  SER A HG   4  
ATOM 4366  N N    . SER A 1 3  ? -9.600  -10.011 -14.676 1.00 0.00 ? 3  SER A N    4  
ATOM 4367  C CA   . SER A 1 3  ? -8.338  -10.727 -14.760 1.00 0.00 ? 3  SER A CA   4  
ATOM 4368  C C    . SER A 1 3  ? -7.442  -10.349 -13.578 1.00 0.00 ? 3  SER A C    4  
ATOM 4369  O O    . SER A 1 3  ? -7.708  -9.371  -12.882 1.00 0.00 ? 3  SER A O    4  
ATOM 4370  C CB   . SER A 1 3  ? -7.626  -10.435 -16.081 1.00 0.00 ? 3  SER A CB   4  
ATOM 4371  O OG   . SER A 1 3  ? -8.368  -10.905 -17.203 1.00 0.00 ? 3  SER A OG   4  
ATOM 4372  H H    . SER A 1 3  ? -9.597  -9.100  -15.088 1.00 0.00 ? 3  SER A H    4  
ATOM 4373  H HA   . SER A 1 3  ? -8.603  -11.784 -14.716 1.00 0.00 ? 3  SER A HA   4  
ATOM 4374  H HB2  . SER A 1 3  ? -7.466  -9.361  -16.177 1.00 0.00 ? 3  SER A HB2  4  
ATOM 4375  H HB3  . SER A 1 3  ? -6.642  -10.904 -16.075 1.00 0.00 ? 3  SER A HB3  4  
ATOM 4376  H HG   . SER A 1 3  ? -7.755  -11.349 -17.857 1.00 0.00 ? 3  SER A HG   4  
ATOM 4377  N N    . GLY A 1 4  ? -6.399  -11.144 -13.390 1.00 0.00 ? 4  GLY A N    4  
ATOM 4378  C CA   . GLY A 1 4  ? -5.463  -10.905 -12.305 1.00 0.00 ? 4  GLY A CA   4  
ATOM 4379  C C    . GLY A 1 4  ? -4.125  -11.599 -12.572 1.00 0.00 ? 4  GLY A C    4  
ATOM 4380  O O    . GLY A 1 4  ? -4.055  -12.826 -12.605 1.00 0.00 ? 4  GLY A O    4  
ATOM 4381  H H    . GLY A 1 4  ? -6.191  -11.938 -13.961 1.00 0.00 ? 4  GLY A H    4  
ATOM 4382  H HA2  . GLY A 1 4  ? -5.303  -9.833  -12.187 1.00 0.00 ? 4  GLY A HA2  4  
ATOM 4383  H HA3  . GLY A 1 4  ? -5.885  -11.269 -11.368 1.00 0.00 ? 4  GLY A HA3  4  
ATOM 4384  N N    . SER A 1 5  ? -3.098  -10.782 -12.757 1.00 0.00 ? 5  SER A N    4  
ATOM 4385  C CA   . SER A 1 5  ? -1.767  -11.302 -13.020 1.00 0.00 ? 5  SER A CA   4  
ATOM 4386  C C    . SER A 1 5  ? -0.730  -10.189 -12.861 1.00 0.00 ? 5  SER A C    4  
ATOM 4387  O O    . SER A 1 5  ? -0.843  -9.136  -13.487 1.00 0.00 ? 5  SER A O    4  
ATOM 4388  C CB   . SER A 1 5  ? -1.681  -11.912 -14.421 1.00 0.00 ? 5  SER A CB   4  
ATOM 4389  O OG   . SER A 1 5  ? -0.872  -13.084 -14.444 1.00 0.00 ? 5  SER A OG   4  
ATOM 4390  H H    . SER A 1 5  ? -3.165  -9.785  -12.729 1.00 0.00 ? 5  SER A H    4  
ATOM 4391  H HA   . SER A 1 5  ? -1.609  -12.082 -12.275 1.00 0.00 ? 5  SER A HA   4  
ATOM 4392  H HB2  . SER A 1 5  ? -2.684  -12.156 -14.772 1.00 0.00 ? 5  SER A HB2  4  
ATOM 4393  H HB3  . SER A 1 5  ? -1.273  -11.175 -15.112 1.00 0.00 ? 5  SER A HB3  4  
ATOM 4394  H HG   . SER A 1 5  ? -0.512  -13.233 -15.365 1.00 0.00 ? 5  SER A HG   4  
ATOM 4395  N N    . SER A 1 6  ? 0.257   -10.460 -12.020 1.00 0.00 ? 6  SER A N    4  
ATOM 4396  C CA   . SER A 1 6  ? 1.314   -9.494  -11.770 1.00 0.00 ? 6  SER A CA   4  
ATOM 4397  C C    . SER A 1 6  ? 2.301   -9.485  -12.939 1.00 0.00 ? 6  SER A C    4  
ATOM 4398  O O    . SER A 1 6  ? 2.534   -10.516 -13.568 1.00 0.00 ? 6  SER A O    4  
ATOM 4399  C CB   . SER A 1 6  ? 2.044   -9.803  -10.462 1.00 0.00 ? 6  SER A CB   4  
ATOM 4400  O OG   . SER A 1 6  ? 2.971   -8.777  -10.113 1.00 0.00 ? 6  SER A OG   4  
ATOM 4401  H H    . SER A 1 6  ? 0.342   -11.319 -11.514 1.00 0.00 ? 6  SER A H    4  
ATOM 4402  H HA   . SER A 1 6  ? 0.811   -8.531  -11.687 1.00 0.00 ? 6  SER A HA   4  
ATOM 4403  H HB2  . SER A 1 6  ? 1.316   -9.921  -9.659  1.00 0.00 ? 6  SER A HB2  4  
ATOM 4404  H HB3  . SER A 1 6  ? 2.572   -10.752 -10.556 1.00 0.00 ? 6  SER A HB3  4  
ATOM 4405  H HG   . SER A 1 6  ? 3.854   -8.952  -10.548 1.00 0.00 ? 6  SER A HG   4  
ATOM 4406  N N    . GLY A 1 7  ? 2.854   -8.309  -13.196 1.00 0.00 ? 7  GLY A N    4  
ATOM 4407  C CA   . GLY A 1 7  ? 3.811   -8.152  -14.278 1.00 0.00 ? 7  GLY A CA   4  
ATOM 4408  C C    . GLY A 1 7  ? 4.005   -6.675  -14.628 1.00 0.00 ? 7  GLY A C    4  
ATOM 4409  O O    . GLY A 1 7  ? 3.495   -6.201  -15.642 1.00 0.00 ? 7  GLY A O    4  
ATOM 4410  H H    . GLY A 1 7  ? 2.659   -7.475  -12.680 1.00 0.00 ? 7  GLY A H    4  
ATOM 4411  H HA2  . GLY A 1 7  ? 4.766   -8.590  -13.990 1.00 0.00 ? 7  GLY A HA2  4  
ATOM 4412  H HA3  . GLY A 1 7  ? 3.463   -8.695  -15.157 1.00 0.00 ? 7  GLY A HA3  4  
ATOM 4413  N N    . GLU A 1 8  ? 4.744   -5.989  -13.769 1.00 0.00 ? 8  GLU A N    4  
ATOM 4414  C CA   . GLU A 1 8  ? 5.012   -4.575  -13.975 1.00 0.00 ? 8  GLU A CA   4  
ATOM 4415  C C    . GLU A 1 8  ? 6.518   -4.307  -13.922 1.00 0.00 ? 8  GLU A C    4  
ATOM 4416  O O    . GLU A 1 8  ? 7.201   -4.761  -13.005 1.00 0.00 ? 8  GLU A O    4  
ATOM 4417  C CB   . GLU A 1 8  ? 4.267   -3.721  -12.947 1.00 0.00 ? 8  GLU A CB   4  
ATOM 4418  C CG   . GLU A 1 8  ? 3.014   -3.093  -13.562 1.00 0.00 ? 8  GLU A CG   4  
ATOM 4419  C CD   . GLU A 1 8  ? 3.385   -2.032  -14.600 1.00 0.00 ? 8  GLU A CD   4  
ATOM 4420  O OE1  . GLU A 1 8  ? 3.741   -0.915  -14.167 1.00 0.00 ? 8  GLU A OE1  4  
ATOM 4421  O OE2  . GLU A 1 8  ? 3.304   -2.362  -15.803 1.00 0.00 ? 8  GLU A OE2  4  
ATOM 4422  H H    . GLU A 1 8  ? 5.156   -6.381  -12.946 1.00 0.00 ? 8  GLU A H    4  
ATOM 4423  H HA   . GLU A 1 8  ? 4.631   -4.350  -14.971 1.00 0.00 ? 8  GLU A HA   4  
ATOM 4424  H HB2  . GLU A 1 8  ? 3.988   -4.335  -12.092 1.00 0.00 ? 8  GLU A HB2  4  
ATOM 4425  H HB3  . GLU A 1 8  ? 4.926   -2.936  -12.575 1.00 0.00 ? 8  GLU A HB3  4  
ATOM 4426  H HG2  . GLU A 1 8  ? 2.407   -3.868  -14.030 1.00 0.00 ? 8  GLU A HG2  4  
ATOM 4427  H HG3  . GLU A 1 8  ? 2.406   -2.643  -12.777 1.00 0.00 ? 8  GLU A HG3  4  
ATOM 4428  N N    . PHE A 1 9  ? 6.991   -3.572  -14.917 1.00 0.00 ? 9  PHE A N    4  
ATOM 4429  C CA   . PHE A 1 9  ? 8.403   -3.239  -14.996 1.00 0.00 ? 9  PHE A CA   4  
ATOM 4430  C C    . PHE A 1 9  ? 8.775   -2.181  -13.955 1.00 0.00 ? 9  PHE A C    4  
ATOM 4431  O O    . PHE A 1 9  ? 7.934   -1.378  -13.553 1.00 0.00 ? 9  PHE A O    4  
ATOM 4432  C CB   . PHE A 1 9  ? 8.651   -2.671  -16.394 1.00 0.00 ? 9  PHE A CB   4  
ATOM 4433  C CG   . PHE A 1 9  ? 9.090   -3.716  -17.422 1.00 0.00 ? 9  PHE A CG   4  
ATOM 4434  C CD1  . PHE A 1 9  ? 8.212   -4.667  -17.842 1.00 0.00 ? 9  PHE A CD1  4  
ATOM 4435  C CD2  . PHE A 1 9  ? 10.357  -3.695  -17.915 1.00 0.00 ? 9  PHE A CD2  4  
ATOM 4436  C CE1  . PHE A 1 9  ? 8.619   -5.637  -18.795 1.00 0.00 ? 9  PHE A CE1  4  
ATOM 4437  C CE2  . PHE A 1 9  ? 10.764  -4.666  -18.868 1.00 0.00 ? 9  PHE A CE2  4  
ATOM 4438  C CZ   . PHE A 1 9  ? 9.887   -5.616  -19.288 1.00 0.00 ? 9  PHE A CZ   4  
ATOM 4439  H H    . PHE A 1 9  ? 6.429   -3.208  -15.659 1.00 0.00 ? 9  PHE A H    4  
ATOM 4440  H HA   . PHE A 1 9  ? 8.963   -4.153  -14.798 1.00 0.00 ? 9  PHE A HA   4  
ATOM 4441  H HB2  . PHE A 1 9  ? 7.739   -2.190  -16.748 1.00 0.00 ? 9  PHE A HB2  4  
ATOM 4442  H HB3  . PHE A 1 9  ? 9.416   -1.896  -16.331 1.00 0.00 ? 9  PHE A HB3  4  
ATOM 4443  H HD1  . PHE A 1 9  ? 7.197   -4.683  -17.447 1.00 0.00 ? 9  PHE A HD1  4  
ATOM 4444  H HD2  . PHE A 1 9  ? 11.060  -2.934  -17.578 1.00 0.00 ? 9  PHE A HD2  4  
ATOM 4445  H HE1  . PHE A 1 9  ? 7.916   -6.399  -19.132 1.00 0.00 ? 9  PHE A HE1  4  
ATOM 4446  H HE2  . PHE A 1 9  ? 11.780  -4.649  -19.264 1.00 0.00 ? 9  PHE A HE2  4  
ATOM 4447  H HZ   . PHE A 1 9  ? 10.199  -6.361  -20.020 1.00 0.00 ? 9  PHE A HZ   4  
ATOM 4448  N N    . VAL A 1 10 ? 10.036  -2.214  -13.549 1.00 0.00 ? 10 VAL A N    4  
ATOM 4449  C CA   . VAL A 1 10 ? 10.529  -1.268  -12.563 1.00 0.00 ? 10 VAL A CA   4  
ATOM 4450  C C    . VAL A 1 10 ? 11.809  -0.613  -13.086 1.00 0.00 ? 10 VAL A C    4  
ATOM 4451  O O    . VAL A 1 10 ? 12.906  -0.938  -12.635 1.00 0.00 ? 10 VAL A O    4  
ATOM 4452  C CB   . VAL A 1 10 ? 10.724  -1.969  -11.217 1.00 0.00 ? 10 VAL A CB   4  
ATOM 4453  C CG1  . VAL A 1 10 ? 11.549  -1.103  -10.262 1.00 0.00 ? 10 VAL A CG1  4  
ATOM 4454  C CG2  . VAL A 1 10 ? 9.377   -2.342  -10.593 1.00 0.00 ? 10 VAL A CG2  4  
ATOM 4455  H H    . VAL A 1 10 ? 10.713  -2.870  -13.881 1.00 0.00 ? 10 VAL A H    4  
ATOM 4456  H HA   . VAL A 1 10 ? 9.768   -0.498  -12.436 1.00 0.00 ? 10 VAL A HA   4  
ATOM 4457  H HB   . VAL A 1 10 ? 11.277  -2.890  -11.396 1.00 0.00 ? 10 VAL A HB   4  
ATOM 4458  H HG11 . VAL A 1 10 ? 11.189  -1.243  -9.242  1.00 0.00 ? 10 VAL A HG11 4  
ATOM 4459  H HG12 . VAL A 1 10 ? 12.597  -1.395  -10.321 1.00 0.00 ? 10 VAL A HG12 4  
ATOM 4460  H HG13 . VAL A 1 10 ? 11.447  -0.055  -10.542 1.00 0.00 ? 10 VAL A HG13 4  
ATOM 4461  H HG21 . VAL A 1 10 ? 8.776   -2.882  -11.325 1.00 0.00 ? 10 VAL A HG21 4  
ATOM 4462  H HG22 . VAL A 1 10 ? 9.544   -2.976  -9.722  1.00 0.00 ? 10 VAL A HG22 4  
ATOM 4463  H HG23 . VAL A 1 10 ? 8.854   -1.436  -10.289 1.00 0.00 ? 10 VAL A HG23 4  
ATOM 4464  N N    . ILE A 1 11 ? 11.626  0.297   -14.031 1.00 0.00 ? 11 ILE A N    4  
ATOM 4465  C CA   . ILE A 1 11 ? 12.753  1.000   -14.621 1.00 0.00 ? 11 ILE A CA   4  
ATOM 4466  C C    . ILE A 1 11 ? 13.703  1.454   -13.511 1.00 0.00 ? 11 ILE A C    4  
ATOM 4467  O O    . ILE A 1 11 ? 14.917  1.493   -13.706 1.00 0.00 ? 11 ILE A O    4  
ATOM 4468  C CB   . ILE A 1 11 ? 12.264  2.140   -15.516 1.00 0.00 ? 11 ILE A CB   4  
ATOM 4469  C CG1  . ILE A 1 11 ? 11.382  3.114   -14.732 1.00 0.00 ? 11 ILE A CG1  4  
ATOM 4470  C CG2  . ILE A 1 11 ? 11.553  1.597   -16.758 1.00 0.00 ? 11 ILE A CG2  4  
ATOM 4471  C CD1  . ILE A 1 11 ? 12.010  4.508   -14.685 1.00 0.00 ? 11 ILE A CD1  4  
ATOM 4472  H H    . ILE A 1 11 ? 10.731  0.556   -14.393 1.00 0.00 ? 11 ILE A H    4  
ATOM 4473  H HA   . ILE A 1 11 ? 13.281  0.293   -15.260 1.00 0.00 ? 11 ILE A HA   4  
ATOM 4474  H HB   . ILE A 1 11 ? 13.133  2.700   -15.862 1.00 0.00 ? 11 ILE A HB   4  
ATOM 4475  H HG12 . ILE A 1 11 ? 10.396  3.171   -15.194 1.00 0.00 ? 11 ILE A HG12 4  
ATOM 4476  H HG13 . ILE A 1 11 ? 11.237  2.742   -13.717 1.00 0.00 ? 11 ILE A HG13 4  
ATOM 4477  H HG21 . ILE A 1 11 ? 12.215  0.907   -17.282 1.00 0.00 ? 11 ILE A HG21 4  
ATOM 4478  H HG22 . ILE A 1 11 ? 10.646  1.073   -16.457 1.00 0.00 ? 11 ILE A HG22 4  
ATOM 4479  H HG23 . ILE A 1 11 ? 11.293  2.424   -17.419 1.00 0.00 ? 11 ILE A HG23 4  
ATOM 4480  H HD11 . ILE A 1 11 ? 12.290  4.814   -15.693 1.00 0.00 ? 11 ILE A HD11 4  
ATOM 4481  H HD12 . ILE A 1 11 ? 11.291  5.217   -14.276 1.00 0.00 ? 11 ILE A HD12 4  
ATOM 4482  H HD13 . ILE A 1 11 ? 12.898  4.485   -14.053 1.00 0.00 ? 11 ILE A HD13 4  
ATOM 4483  N N    . ASN A 1 12 ? 13.115  1.786   -12.372 1.00 0.00 ? 12 ASN A N    4  
ATOM 4484  C CA   . ASN A 1 12 ? 13.894  2.236   -11.231 1.00 0.00 ? 12 ASN A CA   4  
ATOM 4485  C C    . ASN A 1 12 ? 14.811  3.381   -11.664 1.00 0.00 ? 12 ASN A C    4  
ATOM 4486  O O    . ASN A 1 12 ? 15.975  3.158   -11.994 1.00 0.00 ? 12 ASN A O    4  
ATOM 4487  C CB   . ASN A 1 12 ? 14.771  1.108   -10.684 1.00 0.00 ? 12 ASN A CB   4  
ATOM 4488  C CG   . ASN A 1 12 ? 15.058  1.310   -9.194  1.00 0.00 ? 12 ASN A CG   4  
ATOM 4489  O OD1  . ASN A 1 12 ? 14.453  0.696   -8.331  1.00 0.00 ? 12 ASN A OD1  4  
ATOM 4490  N ND2  . ASN A 1 12 ? 16.012  2.201   -8.943  1.00 0.00 ? 12 ASN A ND2  4  
ATOM 4491  H H    . ASN A 1 12 ? 12.127  1.752   -12.222 1.00 0.00 ? 12 ASN A H    4  
ATOM 4492  H HA   . ASN A 1 12 ? 13.160  2.548   -10.488 1.00 0.00 ? 12 ASN A HA   4  
ATOM 4493  H HB2  . ASN A 1 12 ? 14.275  0.150   -10.836 1.00 0.00 ? 12 ASN A HB2  4  
ATOM 4494  H HB3  . ASN A 1 12 ? 15.710  1.072   -11.237 1.00 0.00 ? 12 ASN A HB3  4  
ATOM 4495  H HD21 . ASN A 1 12 ? 16.470  2.670   -9.698  1.00 0.00 ? 12 ASN A HD21 4  
ATOM 4496  H HD22 . ASN A 1 12 ? 16.272  2.403   -7.998  1.00 0.00 ? 12 ASN A HD22 4  
ATOM 4497  N N    . PRO A 1 13 ? 14.238  4.614   -11.649 1.00 0.00 ? 13 PRO A N    4  
ATOM 4498  C CA   . PRO A 1 13 ? 14.991  5.795   -12.037 1.00 0.00 ? 13 PRO A CA   4  
ATOM 4499  C C    . PRO A 1 13 ? 15.976  6.201   -10.939 1.00 0.00 ? 13 PRO A C    4  
ATOM 4500  O O    . PRO A 1 13 ? 17.187  6.200   -11.155 1.00 0.00 ? 13 PRO A O    4  
ATOM 4501  C CB   . PRO A 1 13 ? 13.941  6.858   -12.315 1.00 0.00 ? 13 PRO A CB   4  
ATOM 4502  C CG   . PRO A 1 13 ? 12.671  6.379   -11.630 1.00 0.00 ? 13 PRO A CG   4  
ATOM 4503  C CD   . PRO A 1 13 ? 12.862  4.916   -11.264 1.00 0.00 ? 13 PRO A CD   4  
ATOM 4504  H HA   . PRO A 1 13 ? 15.547  5.602   -12.845 1.00 0.00 ? 13 PRO A HA   4  
ATOM 4505  H HB2  . PRO A 1 13 ? 14.253  7.827   -11.927 1.00 0.00 ? 13 PRO A HB2  4  
ATOM 4506  H HB3  . PRO A 1 13 ? 13.784  6.980   -13.387 1.00 0.00 ? 13 PRO A HB3  4  
ATOM 4507  H HG2  . PRO A 1 13 ? 12.472  6.973   -10.738 1.00 0.00 ? 13 PRO A HG2  4  
ATOM 4508  H HG3  . PRO A 1 13 ? 11.813  6.498   -12.291 1.00 0.00 ? 13 PRO A HG3  4  
ATOM 4509  H HD2  . PRO A 1 13 ? 12.704  4.751   -10.198 1.00 0.00 ? 13 PRO A HD2  4  
ATOM 4510  H HD3  . PRO A 1 13 ? 12.154  4.280   -11.793 1.00 0.00 ? 13 PRO A HD3  4  
ATOM 4511  N N    . ASN A 1 14 ? 15.421  6.539   -9.785  1.00 0.00 ? 14 ASN A N    4  
ATOM 4512  C CA   . ASN A 1 14 ? 16.235  6.947   -8.653  1.00 0.00 ? 14 ASN A CA   4  
ATOM 4513  C C    . ASN A 1 14 ? 15.563  6.493   -7.356  1.00 0.00 ? 14 ASN A C    4  
ATOM 4514  O O    . ASN A 1 14 ? 14.504  7.002   -6.991  1.00 0.00 ? 14 ASN A O    4  
ATOM 4515  C CB   . ASN A 1 14 ? 16.383  8.469   -8.601  1.00 0.00 ? 14 ASN A CB   4  
ATOM 4516  C CG   . ASN A 1 14 ? 15.024  9.147   -8.420  1.00 0.00 ? 14 ASN A CG   4  
ATOM 4517  O OD1  . ASN A 1 14 ? 14.028  8.766   -9.014  1.00 0.00 ? 14 ASN A OD1  4  
ATOM 4518  N ND2  . ASN A 1 14 ? 15.037  10.169  -7.570  1.00 0.00 ? 14 ASN A ND2  4  
ATOM 4519  H H    . ASN A 1 14 ? 14.435  6.538   -9.617  1.00 0.00 ? 14 ASN A H    4  
ATOM 4520  H HA   . ASN A 1 14 ? 17.203  6.471   -8.810  1.00 0.00 ? 14 ASN A HA   4  
ATOM 4521  H HB2  . ASN A 1 14 ? 17.044  8.746   -7.779  1.00 0.00 ? 14 ASN A HB2  4  
ATOM 4522  H HB3  . ASN A 1 14 ? 16.852  8.824   -9.519  1.00 0.00 ? 14 ASN A HB3  4  
ATOM 4523  H HD21 . ASN A 1 14 ? 15.889  10.430  -7.116  1.00 0.00 ? 14 ASN A HD21 4  
ATOM 4524  H HD22 . ASN A 1 14 ? 14.196  10.677  -7.385  1.00 0.00 ? 14 ASN A HD22 4  
ATOM 4525  N N    . GLY A 1 15 ? 16.205  5.541   -6.695  1.00 0.00 ? 15 GLY A N    4  
ATOM 4526  C CA   . GLY A 1 15 ? 15.682  5.013   -5.447  1.00 0.00 ? 15 GLY A CA   4  
ATOM 4527  C C    . GLY A 1 15 ? 14.379  4.245   -5.680  1.00 0.00 ? 15 GLY A C    4  
ATOM 4528  O O    . GLY A 1 15 ? 13.755  4.379   -6.731  1.00 0.00 ? 15 GLY A O    4  
ATOM 4529  H H    . GLY A 1 15 ? 17.066  5.133   -6.999  1.00 0.00 ? 15 GLY A H    4  
ATOM 4530  H HA2  . GLY A 1 15 ? 16.420  4.354   -4.989  1.00 0.00 ? 15 GLY A HA2  4  
ATOM 4531  H HA3  . GLY A 1 15 ? 15.506  5.830   -4.747  1.00 0.00 ? 15 GLY A HA3  4  
ATOM 4532  N N    . LYS A 1 16 ? 14.008  3.456   -4.681  1.00 0.00 ? 16 LYS A N    4  
ATOM 4533  C CA   . LYS A 1 16 ? 12.792  2.666   -4.764  1.00 0.00 ? 16 LYS A CA   4  
ATOM 4534  C C    . LYS A 1 16 ? 11.596  3.537   -4.373  1.00 0.00 ? 16 LYS A C    4  
ATOM 4535  O O    . LYS A 1 16 ? 11.728  4.450   -3.560  1.00 0.00 ? 16 LYS A O    4  
ATOM 4536  C CB   . LYS A 1 16 ? 12.923  1.391   -3.929  1.00 0.00 ? 16 LYS A CB   4  
ATOM 4537  C CG   . LYS A 1 16 ? 13.951  0.438   -4.540  1.00 0.00 ? 16 LYS A CG   4  
ATOM 4538  C CD   . LYS A 1 16 ? 13.326  -0.926  -4.838  1.00 0.00 ? 16 LYS A CD   4  
ATOM 4539  C CE   . LYS A 1 16 ? 13.650  -1.931  -3.731  1.00 0.00 ? 16 LYS A CE   4  
ATOM 4540  N NZ   . LYS A 1 16 ? 13.608  -3.314  -4.258  1.00 0.00 ? 16 LYS A NZ   4  
ATOM 4541  H H    . LYS A 1 16 ? 14.522  3.353   -3.830  1.00 0.00 ? 16 LYS A H    4  
ATOM 4542  H HA   . LYS A 1 16 ? 12.671  2.360   -5.803  1.00 0.00 ? 16 LYS A HA   4  
ATOM 4543  H HB2  . LYS A 1 16 ? 13.219  1.647   -2.911  1.00 0.00 ? 16 LYS A HB2  4  
ATOM 4544  H HB3  . LYS A 1 16 ? 11.955  0.894   -3.863  1.00 0.00 ? 16 LYS A HB3  4  
ATOM 4545  H HG2  . LYS A 1 16 ? 14.349  0.868   -5.460  1.00 0.00 ? 16 LYS A HG2  4  
ATOM 4546  H HG3  . LYS A 1 16 ? 14.791  0.316   -3.856  1.00 0.00 ? 16 LYS A HG3  4  
ATOM 4547  H HD2  . LYS A 1 16 ? 12.245  -0.821  -4.934  1.00 0.00 ? 16 LYS A HD2  4  
ATOM 4548  H HD3  . LYS A 1 16 ? 13.696  -1.299  -5.793  1.00 0.00 ? 16 LYS A HD3  4  
ATOM 4549  H HE2  . LYS A 1 16 ? 14.638  -1.722  -3.321  1.00 0.00 ? 16 LYS A HE2  4  
ATOM 4550  H HE3  . LYS A 1 16 ? 12.937  -1.825  -2.914  1.00 0.00 ? 16 LYS A HE3  4  
ATOM 4551  H HZ1  . LYS A 1 16 ? 12.843  -3.404  -4.896  1.00 0.00 ? 16 LYS A HZ1  4  
ATOM 4552  H HZ2  . LYS A 1 16 ? 14.464  -3.516  -4.734  1.00 0.00 ? 16 LYS A HZ2  4  
ATOM 4553  H HZ3  . LYS A 1 16 ? 13.488  -3.955  -3.500  1.00 0.00 ? 16 LYS A HZ3  4  
ATOM 4554  N N    . SER A 1 17 ? 10.456  3.225   -4.972  1.00 0.00 ? 17 SER A N    4  
ATOM 4555  C CA   . SER A 1 17 ? 9.238   3.967   -4.696  1.00 0.00 ? 17 SER A CA   4  
ATOM 4556  C C    . SER A 1 17 ? 8.453   3.287   -3.573  1.00 0.00 ? 17 SER A C    4  
ATOM 4557  O O    . SER A 1 17 ? 8.629   2.096   -3.320  1.00 0.00 ? 17 SER A O    4  
ATOM 4558  C CB   . SER A 1 17 ? 8.371   4.089   -5.951  1.00 0.00 ? 17 SER A CB   4  
ATOM 4559  O OG   . SER A 1 17 ? 8.261   5.438   -6.395  1.00 0.00 ? 17 SER A OG   4  
ATOM 4560  H H    . SER A 1 17 ? 10.357  2.480   -5.632  1.00 0.00 ? 17 SER A H    4  
ATOM 4561  H HA   . SER A 1 17 ? 9.568   4.959   -4.386  1.00 0.00 ? 17 SER A HA   4  
ATOM 4562  H HB2  . SER A 1 17 ? 8.799   3.479   -6.748  1.00 0.00 ? 17 SER A HB2  4  
ATOM 4563  H HB3  . SER A 1 17 ? 7.377   3.692   -5.745  1.00 0.00 ? 17 SER A HB3  4  
ATOM 4564  H HG   . SER A 1 17 ? 7.383   5.576   -6.855  1.00 0.00 ? 17 SER A HG   4  
ATOM 4565  N N    . GLU A 1 18 ? 7.602   4.073   -2.929  1.00 0.00 ? 18 GLU A N    4  
ATOM 4566  C CA   . GLU A 1 18 ? 6.790   3.561   -1.839  1.00 0.00 ? 18 GLU A CA   4  
ATOM 4567  C C    . GLU A 1 18 ? 6.196   2.201   -2.212  1.00 0.00 ? 18 GLU A C    4  
ATOM 4568  O O    . GLU A 1 18 ? 6.436   1.207   -1.528  1.00 0.00 ? 18 GLU A O    4  
ATOM 4569  C CB   . GLU A 1 18 ? 5.689   4.555   -1.462  1.00 0.00 ? 18 GLU A CB   4  
ATOM 4570  C CG   . GLU A 1 18 ? 5.735   4.885   0.031   1.00 0.00 ? 18 GLU A CG   4  
ATOM 4571  C CD   . GLU A 1 18 ? 7.108   5.432   0.429   1.00 0.00 ? 18 GLU A CD   4  
ATOM 4572  O OE1  . GLU A 1 18 ? 7.291   6.661   0.291   1.00 0.00 ? 18 GLU A OE1  4  
ATOM 4573  O OE2  . GLU A 1 18 ? 7.943   4.609   0.862   1.00 0.00 ? 18 GLU A OE2  4  
ATOM 4574  H H    . GLU A 1 18 ? 7.465   5.040   -3.141  1.00 0.00 ? 18 GLU A H    4  
ATOM 4575  H HA   . GLU A 1 18 ? 7.472   3.449   -0.996  1.00 0.00 ? 18 GLU A HA   4  
ATOM 4576  H HB2  . GLU A 1 18 ? 5.805   5.469   -2.044  1.00 0.00 ? 18 GLU A HB2  4  
ATOM 4577  H HB3  . GLU A 1 18 ? 4.714   4.137   -1.716  1.00 0.00 ? 18 GLU A HB3  4  
ATOM 4578  H HG2  . GLU A 1 18 ? 4.965   5.619   0.269   1.00 0.00 ? 18 GLU A HG2  4  
ATOM 4579  H HG3  . GLU A 1 18 ? 5.514   3.990   0.612   1.00 0.00 ? 18 GLU A HG3  4  
ATOM 4580  N N    . VAL A 1 19 ? 5.434   2.201   -3.295  1.00 0.00 ? 19 VAL A N    4  
ATOM 4581  C CA   . VAL A 1 19 ? 4.805   0.979   -3.767  1.00 0.00 ? 19 VAL A CA   4  
ATOM 4582  C C    . VAL A 1 19 ? 5.806   -0.174  -3.675  1.00 0.00 ? 19 VAL A C    4  
ATOM 4583  O O    . VAL A 1 19 ? 5.470   -1.256  -3.196  1.00 0.00 ? 19 VAL A O    4  
ATOM 4584  C CB   . VAL A 1 19 ? 4.258   1.185   -5.181  1.00 0.00 ? 19 VAL A CB   4  
ATOM 4585  C CG1  . VAL A 1 19 ? 3.210   2.299   -5.207  1.00 0.00 ? 19 VAL A CG1  4  
ATOM 4586  C CG2  . VAL A 1 19 ? 5.389   1.473   -6.170  1.00 0.00 ? 19 VAL A CG2  4  
ATOM 4587  H H    . VAL A 1 19 ? 5.244   3.014   -3.846  1.00 0.00 ? 19 VAL A H    4  
ATOM 4588  H HA   . VAL A 1 19 ? 3.963   0.767   -3.108  1.00 0.00 ? 19 VAL A HA   4  
ATOM 4589  H HB   . VAL A 1 19 ? 3.771   0.260   -5.490  1.00 0.00 ? 19 VAL A HB   4  
ATOM 4590  H HG11 . VAL A 1 19 ? 3.677   3.230   -5.530  1.00 0.00 ? 19 VAL A HG11 4  
ATOM 4591  H HG12 . VAL A 1 19 ? 2.413   2.033   -5.902  1.00 0.00 ? 19 VAL A HG12 4  
ATOM 4592  H HG13 . VAL A 1 19 ? 2.793   2.429   -4.209  1.00 0.00 ? 19 VAL A HG13 4  
ATOM 4593  H HG21 . VAL A 1 19 ? 6.122   2.130   -5.702  1.00 0.00 ? 19 VAL A HG21 4  
ATOM 4594  H HG22 . VAL A 1 19 ? 5.870   0.537   -6.455  1.00 0.00 ? 19 VAL A HG22 4  
ATOM 4595  H HG23 . VAL A 1 19 ? 4.982   1.957   -7.057  1.00 0.00 ? 19 VAL A HG23 4  
ATOM 4596  N N    . CYS A 1 20 ? 7.016   0.097   -4.141  1.00 0.00 ? 20 CYS A N    4  
ATOM 4597  C CA   . CYS A 1 20 ? 8.069   -0.904  -4.118  1.00 0.00 ? 20 CYS A CA   4  
ATOM 4598  C C    . CYS A 1 20 ? 8.428   -1.189  -2.658  1.00 0.00 ? 20 CYS A C    4  
ATOM 4599  O O    . CYS A 1 20 ? 8.261   -2.311  -2.182  1.00 0.00 ? 20 CYS A O    4  
ATOM 4600  C CB   . CYS A 1 20 ? 9.288   -0.462  -4.930  1.00 0.00 ? 20 CYS A CB   4  
ATOM 4601  S SG   . CYS A 1 20 ? 9.516   -1.569  -6.369  1.00 0.00 ? 20 CYS A SG   4  
ATOM 4602  H H    . CYS A 1 20 ? 7.281   0.980   -4.529  1.00 0.00 ? 20 CYS A H    4  
ATOM 4603  H HA   . CYS A 1 20 ? 7.665   -1.795  -4.598  1.00 0.00 ? 20 CYS A HA   4  
ATOM 4604  H HB2  . CYS A 1 20 ? 9.157   0.566   -5.268  1.00 0.00 ? 20 CYS A HB2  4  
ATOM 4605  H HB3  . CYS A 1 20 ? 10.180  -0.480  -4.302  1.00 0.00 ? 20 CYS A HB3  4  
ATOM 4606  H HG   . CYS A 1 20 ? 9.188   -0.668  -7.291  1.00 0.00 ? 20 CYS A HG   4  
ATOM 4607  N N    . ILE A 1 21 ? 8.915   -0.154  -1.989  1.00 0.00 ? 21 ILE A N    4  
ATOM 4608  C CA   . ILE A 1 21 ? 9.299   -0.279  -0.593  1.00 0.00 ? 21 ILE A CA   4  
ATOM 4609  C C    . ILE A 1 21 ? 8.256   -1.120  0.145   1.00 0.00 ? 21 ILE A C    4  
ATOM 4610  O O    . ILE A 1 21 ? 8.572   -2.185  0.674   1.00 0.00 ? 21 ILE A O    4  
ATOM 4611  C CB   . ILE A 1 21 ? 9.526   1.101   0.026   1.00 0.00 ? 21 ILE A CB   4  
ATOM 4612  C CG1  . ILE A 1 21 ? 10.800  1.746   -0.524  1.00 0.00 ? 21 ILE A CG1  4  
ATOM 4613  C CG2  . ILE A 1 21 ? 9.537   1.022   1.554   1.00 0.00 ? 21 ILE A CG2  4  
ATOM 4614  C CD1  . ILE A 1 21 ? 10.716  3.272   -0.454  1.00 0.00 ? 21 ILE A CD1  4  
ATOM 4615  H H    . ILE A 1 21 ? 9.048   0.755   -2.384  1.00 0.00 ? 21 ILE A H    4  
ATOM 4616  H HA   . ILE A 1 21 ? 10.252  -0.807  -0.563  1.00 0.00 ? 21 ILE A HA   4  
ATOM 4617  H HB   . ILE A 1 21 ? 8.692   1.744   -0.257  1.00 0.00 ? 21 ILE A HB   4  
ATOM 4618  H HG12 . ILE A 1 21 ? 11.662  1.399   0.046   1.00 0.00 ? 21 ILE A HG12 4  
ATOM 4619  H HG13 . ILE A 1 21 ? 10.954  1.433   -1.556  1.00 0.00 ? 21 ILE A HG13 4  
ATOM 4620  H HG21 . ILE A 1 21 ? 8.656   1.528   1.950   1.00 0.00 ? 21 ILE A HG21 4  
ATOM 4621  H HG22 . ILE A 1 21 ? 9.525   -0.023  1.864   1.00 0.00 ? 21 ILE A HG22 4  
ATOM 4622  H HG23 . ILE A 1 21 ? 10.436  1.504   1.936   1.00 0.00 ? 21 ILE A HG23 4  
ATOM 4623  H HD11 . ILE A 1 21 ? 10.013  3.632   -1.204  1.00 0.00 ? 21 ILE A HD11 4  
ATOM 4624  H HD12 . ILE A 1 21 ? 10.375  3.572   0.537   1.00 0.00 ? 21 ILE A HD12 4  
ATOM 4625  H HD13 . ILE A 1 21 ? 11.701  3.699   -0.643  1.00 0.00 ? 21 ILE A HD13 4  
ATOM 4626  N N    . LEU A 1 22 ? 7.033   -0.611  0.157   1.00 0.00 ? 22 LEU A N    4  
ATOM 4627  C CA   . LEU A 1 22 ? 5.941   -1.302  0.822   1.00 0.00 ? 22 LEU A CA   4  
ATOM 4628  C C    . LEU A 1 22 ? 6.049   -2.803  0.545   1.00 0.00 ? 22 LEU A C    4  
ATOM 4629  O O    . LEU A 1 22 ? 5.949   -3.615  1.463   1.00 0.00 ? 22 LEU A O    4  
ATOM 4630  C CB   . LEU A 1 22 ? 4.596   -0.697  0.414   1.00 0.00 ? 22 LEU A CB   4  
ATOM 4631  C CG   . LEU A 1 22 ? 3.351   -1.422  0.927   1.00 0.00 ? 22 LEU A CG   4  
ATOM 4632  C CD1  . LEU A 1 22 ? 3.006   -2.618  0.037   1.00 0.00 ? 22 LEU A CD1  4  
ATOM 4633  C CD2  . LEU A 1 22 ? 3.518   -1.828  2.393   1.00 0.00 ? 22 LEU A CD2  4  
ATOM 4634  H H    . LEU A 1 22 ? 6.783   0.256   -0.275  1.00 0.00 ? 22 LEU A H    4  
ATOM 4635  H HA   . LEU A 1 22 ? 6.055   -1.139  1.894   1.00 0.00 ? 22 LEU A HA   4  
ATOM 4636  H HB2  . LEU A 1 22 ? 4.562   0.335   0.765   1.00 0.00 ? 22 LEU A HB2  4  
ATOM 4637  H HB3  . LEU A 1 22 ? 4.551   -0.664  -0.675  1.00 0.00 ? 22 LEU A HB3  4  
ATOM 4638  H HG   . LEU A 1 22 ? 2.509   -0.731  0.878   1.00 0.00 ? 22 LEU A HG   4  
ATOM 4639  H HD11 . LEU A 1 22 ? 3.833   -2.812  -0.647  1.00 0.00 ? 22 LEU A HD11 4  
ATOM 4640  H HD12 . LEU A 1 22 ? 2.835   -3.496  0.659   1.00 0.00 ? 22 LEU A HD12 4  
ATOM 4641  H HD13 . LEU A 1 22 ? 2.105   -2.397  -0.536  1.00 0.00 ? 22 LEU A HD13 4  
ATOM 4642  H HD21 . LEU A 1 22 ? 2.766   -2.574  2.651   1.00 0.00 ? 22 LEU A HD21 4  
ATOM 4643  H HD22 . LEU A 1 22 ? 4.512   -2.248  2.542   1.00 0.00 ? 22 LEU A HD22 4  
ATOM 4644  H HD23 . LEU A 1 22 ? 3.394   -0.951  3.029   1.00 0.00 ? 22 LEU A HD23 4  
ATOM 4645  N N    . HIS A 1 23 ? 6.252   -3.125  -0.724  1.00 0.00 ? 23 HIS A N    4  
ATOM 4646  C CA   . HIS A 1 23 ? 6.375   -4.514  -1.133  1.00 0.00 ? 23 HIS A CA   4  
ATOM 4647  C C    . HIS A 1 23 ? 7.571   -5.153  -0.424  1.00 0.00 ? 23 HIS A C    4  
ATOM 4648  O O    . HIS A 1 23 ? 7.459   -6.249  0.124   1.00 0.00 ? 23 HIS A O    4  
ATOM 4649  C CB   . HIS A 1 23 ? 6.459   -4.626  -2.656  1.00 0.00 ? 23 HIS A CB   4  
ATOM 4650  C CG   . HIS A 1 23 ? 6.073   -5.983  -3.194  1.00 0.00 ? 23 HIS A CG   4  
ATOM 4651  N ND1  . HIS A 1 23 ? 5.425   -6.153  -4.405  1.00 0.00 ? 23 HIS A ND1  4  
ATOM 4652  C CD2  . HIS A 1 23 ? 6.251   -7.232  -2.674  1.00 0.00 ? 23 HIS A CD2  4  
ATOM 4653  C CE1  . HIS A 1 23 ? 5.226   -7.449  -4.595  1.00 0.00 ? 23 HIS A CE1  4  
ATOM 4654  N NE2  . HIS A 1 23 ? 5.738   -8.116  -3.521  1.00 0.00 ? 23 HIS A NE2  4  
ATOM 4655  H H    . HIS A 1 23 ? 6.332   -2.458  -1.464  1.00 0.00 ? 23 HIS A H    4  
ATOM 4656  H HA   . HIS A 1 23 ? 5.463   -5.016  -0.812  1.00 0.00 ? 23 HIS A HA   4  
ATOM 4657  H HB2  . HIS A 1 23 ? 5.811   -3.872  -3.102  1.00 0.00 ? 23 HIS A HB2  4  
ATOM 4658  H HB3  . HIS A 1 23 ? 7.477   -4.398  -2.971  1.00 0.00 ? 23 HIS A HB3  4  
ATOM 4659  H HD1  . HIS A 1 23 ? 5.153   -5.421  -5.030  1.00 0.00 ? 23 HIS A HD1  4  
ATOM 4660  H HD2  . HIS A 1 23 ? 6.733   -7.463  -1.724  1.00 0.00 ? 23 HIS A HD2  4  
ATOM 4661  H HE1  . HIS A 1 23 ? 4.739   -7.903  -5.458  1.00 0.00 ? 23 HIS A HE1  4  
ATOM 4662  N N    . GLU A 1 24 ? 8.688   -4.442  -0.458  1.00 0.00 ? 24 GLU A N    4  
ATOM 4663  C CA   . GLU A 1 24 ? 9.903   -4.926  0.174   1.00 0.00 ? 24 GLU A CA   4  
ATOM 4664  C C    . GLU A 1 24 ? 9.639   -5.266  1.642   1.00 0.00 ? 24 GLU A C    4  
ATOM 4665  O O    . GLU A 1 24 ? 9.700   -6.430  2.034   1.00 0.00 ? 24 GLU A O    4  
ATOM 4666  C CB   . GLU A 1 24 ? 11.034  -3.904  0.043   1.00 0.00 ? 24 GLU A CB   4  
ATOM 4667  C CG   . GLU A 1 24 ? 12.159  -4.442  -0.843  1.00 0.00 ? 24 GLU A CG   4  
ATOM 4668  C CD   . GLU A 1 24 ? 13.336  -4.933  0.002   1.00 0.00 ? 24 GLU A CD   4  
ATOM 4669  O OE1  . GLU A 1 24 ? 14.052  -4.060  0.540   1.00 0.00 ? 24 GLU A OE1  4  
ATOM 4670  O OE2  . GLU A 1 24 ? 13.494  -6.169  0.092   1.00 0.00 ? 24 GLU A OE2  4  
ATOM 4671  H H    . GLU A 1 24 ? 8.770   -3.551  -0.905  1.00 0.00 ? 24 GLU A H    4  
ATOM 4672  H HA   . GLU A 1 24 ? 10.173  -5.830  -0.372  1.00 0.00 ? 24 GLU A HA   4  
ATOM 4673  H HB2  . GLU A 1 24 ? 10.645  -2.978  -0.379  1.00 0.00 ? 24 GLU A HB2  4  
ATOM 4674  H HB3  . GLU A 1 24 ? 11.428  -3.663  1.031   1.00 0.00 ? 24 GLU A HB3  4  
ATOM 4675  H HG2  . GLU A 1 24 ? 11.783  -5.259  -1.459  1.00 0.00 ? 24 GLU A HG2  4  
ATOM 4676  H HG3  . GLU A 1 24 ? 12.497  -3.660  -1.524  1.00 0.00 ? 24 GLU A HG3  4  
ATOM 4677  N N    . TYR A 1 25 ? 9.350   -4.228  2.414   1.00 0.00 ? 25 TYR A N    4  
ATOM 4678  C CA   . TYR A 1 25 ? 9.076   -4.402  3.830   1.00 0.00 ? 25 TYR A CA   4  
ATOM 4679  C C    . TYR A 1 25 ? 8.051   -5.515  4.058   1.00 0.00 ? 25 TYR A C    4  
ATOM 4680  O O    . TYR A 1 25 ? 8.178   -6.298  4.998   1.00 0.00 ? 25 TYR A O    4  
ATOM 4681  C CB   . TYR A 1 25 ? 8.487   -3.075  4.312   1.00 0.00 ? 25 TYR A CB   4  
ATOM 4682  C CG   . TYR A 1 25 ? 7.759   -3.168  5.655   1.00 0.00 ? 25 TYR A CG   4  
ATOM 4683  C CD1  . TYR A 1 25 ? 6.550   -3.828  5.740   1.00 0.00 ? 25 TYR A CD1  4  
ATOM 4684  C CD2  . TYR A 1 25 ? 8.312   -2.592  6.781   1.00 0.00 ? 25 TYR A CD2  4  
ATOM 4685  C CE1  . TYR A 1 25 ? 5.865   -3.916  7.004   1.00 0.00 ? 25 TYR A CE1  4  
ATOM 4686  C CE2  . TYR A 1 25 ? 7.627   -2.680  8.044   1.00 0.00 ? 25 TYR A CE2  4  
ATOM 4687  C CZ   . TYR A 1 25 ? 6.438   -3.338  8.094   1.00 0.00 ? 25 TYR A CZ   4  
ATOM 4688  O OH   . TYR A 1 25 ? 5.791   -3.421  9.287   1.00 0.00 ? 25 TYR A OH   4  
ATOM 4689  H H    . TYR A 1 25 ? 9.302   -3.284  2.087   1.00 0.00 ? 25 TYR A H    4  
ATOM 4690  H HA   . TYR A 1 25 ? 10.010  -4.673  4.323   1.00 0.00 ? 25 TYR A HA   4  
ATOM 4691  H HB2  . TYR A 1 25 ? 9.289   -2.342  4.395   1.00 0.00 ? 25 TYR A HB2  4  
ATOM 4692  H HB3  . TYR A 1 25 ? 7.792   -2.703  3.559   1.00 0.00 ? 25 TYR A HB3  4  
ATOM 4693  H HD1  . TYR A 1 25 ? 6.114   -4.283  4.851   1.00 0.00 ? 25 TYR A HD1  4  
ATOM 4694  H HD2  . TYR A 1 25 ? 9.267   -2.071  6.713   1.00 0.00 ? 25 TYR A HD2  4  
ATOM 4695  H HE1  . TYR A 1 25 ? 4.910   -4.435  7.085   1.00 0.00 ? 25 TYR A HE1  4  
ATOM 4696  H HE2  . TYR A 1 25 ? 8.052   -2.230  8.941   1.00 0.00 ? 25 TYR A HE2  4  
ATOM 4697  H HH   . TYR A 1 25 ? 5.350   -2.549  9.498   1.00 0.00 ? 25 TYR A HH   4  
ATOM 4698  N N    . MET A 1 26 ? 7.058   -5.549  3.181   1.00 0.00 ? 26 MET A N    4  
ATOM 4699  C CA   . MET A 1 26 ? 6.011   -6.552  3.275   1.00 0.00 ? 26 MET A CA   4  
ATOM 4700  C C    . MET A 1 26 ? 6.581   -7.959  3.080   1.00 0.00 ? 26 MET A C    4  
ATOM 4701  O O    . MET A 1 26 ? 6.511   -8.791  3.982   1.00 0.00 ? 26 MET A O    4  
ATOM 4702  C CB   . MET A 1 26 ? 4.947   -6.281  2.210   1.00 0.00 ? 26 MET A CB   4  
ATOM 4703  C CG   . MET A 1 26 ? 3.802   -5.442  2.781   1.00 0.00 ? 26 MET A CG   4  
ATOM 4704  S SD   . MET A 1 26 ? 2.253   -5.945  2.049   1.00 0.00 ? 26 MET A SD   4  
ATOM 4705  C CE   . MET A 1 26 ? 2.296   -7.694  2.404   1.00 0.00 ? 26 MET A CE   4  
ATOM 4706  H H    . MET A 1 26 ? 6.963   -4.908  2.419   1.00 0.00 ? 26 MET A H    4  
ATOM 4707  H HA   . MET A 1 26 ? 5.601   -6.455  4.280   1.00 0.00 ? 26 MET A HA   4  
ATOM 4708  H HB2  . MET A 1 26 ? 5.397   -5.760  1.365   1.00 0.00 ? 26 MET A HB2  4  
ATOM 4709  H HB3  . MET A 1 26 ? 4.557   -7.225  1.831   1.00 0.00 ? 26 MET A HB3  4  
ATOM 4710  H HG2  . MET A 1 26 ? 3.757   -5.562  3.863   1.00 0.00 ? 26 MET A HG2  4  
ATOM 4711  H HG3  . MET A 1 26 ? 3.980   -4.385  2.584   1.00 0.00 ? 26 MET A HG3  4  
ATOM 4712  H HE1  . MET A 1 26 ? 1.375   -7.984  2.911   1.00 0.00 ? 26 MET A HE1  4  
ATOM 4713  H HE2  . MET A 1 26 ? 2.389   -8.252  1.473   1.00 0.00 ? 26 MET A HE2  4  
ATOM 4714  H HE3  . MET A 1 26 ? 3.148   -7.913  3.047   1.00 0.00 ? 26 MET A HE3  4  
ATOM 4715  N N    . GLN A 1 27 ? 7.133   -8.180  1.896   1.00 0.00 ? 27 GLN A N    4  
ATOM 4716  C CA   . GLN A 1 27 ? 7.715   -9.472  1.571   1.00 0.00 ? 27 GLN A CA   4  
ATOM 4717  C C    . GLN A 1 27 ? 8.991   -9.698  2.383   1.00 0.00 ? 27 GLN A C    4  
ATOM 4718  O O    . GLN A 1 27 ? 9.576   -10.779 2.338   1.00 0.00 ? 27 GLN A O    4  
ATOM 4719  C CB   . GLN A 1 27 ? 7.992   -9.586  0.071   1.00 0.00 ? 27 GLN A CB   4  
ATOM 4720  C CG   . GLN A 1 27 ? 9.151   -10.548 -0.201  1.00 0.00 ? 27 GLN A CG   4  
ATOM 4721  C CD   . GLN A 1 27 ? 9.390   -10.708 -1.704  1.00 0.00 ? 27 GLN A CD   4  
ATOM 4722  O OE1  . GLN A 1 27 ? 8.644   -11.365 -2.411  1.00 0.00 ? 27 GLN A OE1  4  
ATOM 4723  N NE2  . GLN A 1 27 ? 10.470  -10.072 -2.150  1.00 0.00 ? 27 GLN A NE2  4  
ATOM 4724  H H    . GLN A 1 27 ? 7.186   -7.498  1.167   1.00 0.00 ? 27 GLN A H    4  
ATOM 4725  H HA   . GLN A 1 27 ? 6.961   -10.208 1.852   1.00 0.00 ? 27 GLN A HA   4  
ATOM 4726  H HB2  . GLN A 1 27 ? 7.096   -9.936  -0.443  1.00 0.00 ? 27 GLN A HB2  4  
ATOM 4727  H HB3  . GLN A 1 27 ? 8.228   -8.603  -0.335  1.00 0.00 ? 27 GLN A HB3  4  
ATOM 4728  H HG2  . GLN A 1 27 ? 10.056  -10.176 0.278   1.00 0.00 ? 27 GLN A HG2  4  
ATOM 4729  H HG3  . GLN A 1 27 ? 8.932   -11.520 0.242   1.00 0.00 ? 27 GLN A HG3  4  
ATOM 4730  H HE21 . GLN A 1 27 ? 11.040  -9.550  -1.516  1.00 0.00 ? 27 GLN A HE21 4  
ATOM 4731  H HE22 . GLN A 1 27 ? 10.711  -10.116 -3.119  1.00 0.00 ? 27 GLN A HE22 4  
ATOM 4732  N N    . ARG A 1 28 ? 9.386   -8.661  3.107   1.00 0.00 ? 28 ARG A N    4  
ATOM 4733  C CA   . ARG A 1 28 ? 10.582  -8.733  3.929   1.00 0.00 ? 28 ARG A CA   4  
ATOM 4734  C C    . ARG A 1 28 ? 10.233  -9.234  5.332   1.00 0.00 ? 28 ARG A C    4  
ATOM 4735  O O    . ARG A 1 28 ? 10.926  -10.092 5.879   1.00 0.00 ? 28 ARG A O    4  
ATOM 4736  C CB   . ARG A 1 28 ? 11.259  -7.366  4.037   1.00 0.00 ? 28 ARG A CB   4  
ATOM 4737  C CG   . ARG A 1 28 ? 12.282  -7.349  5.175   1.00 0.00 ? 28 ARG A CG   4  
ATOM 4738  C CD   . ARG A 1 28 ? 13.561  -6.623  4.752   1.00 0.00 ? 28 ARG A CD   4  
ATOM 4739  N NE   . ARG A 1 28 ? 13.531  -5.223  5.232   1.00 0.00 ? 28 ARG A NE   4  
ATOM 4740  C CZ   . ARG A 1 28 ? 14.619  -4.456  5.379   1.00 0.00 ? 28 ARG A CZ   4  
ATOM 4741  N NH1  . ARG A 1 28 ? 15.830  -4.946  5.082   1.00 0.00 ? 28 ARG A NH1  4  
ATOM 4742  N NH2  . ARG A 1 28 ? 14.496  -3.197  5.821   1.00 0.00 ? 28 ARG A NH2  4  
ATOM 4743  H H    . ARG A 1 28 ? 8.904   -7.785  3.139   1.00 0.00 ? 28 ARG A H    4  
ATOM 4744  H HA   . ARG A 1 28 ? 11.233  -9.438  3.411   1.00 0.00 ? 28 ARG A HA   4  
ATOM 4745  H HB2  . ARG A 1 28 ? 11.753  -7.125  3.095   1.00 0.00 ? 28 ARG A HB2  4  
ATOM 4746  H HB3  . ARG A 1 28 ? 10.507  -6.596  4.208   1.00 0.00 ? 28 ARG A HB3  4  
ATOM 4747  H HG2  . ARG A 1 28 ? 11.853  -6.858  6.048   1.00 0.00 ? 28 ARG A HG2  4  
ATOM 4748  H HG3  . ARG A 1 28 ? 12.521  -8.371  5.469   1.00 0.00 ? 28 ARG A HG3  4  
ATOM 4749  H HD2  . ARG A 1 28 ? 14.432  -7.137  5.158   1.00 0.00 ? 28 ARG A HD2  4  
ATOM 4750  H HD3  . ARG A 1 28 ? 13.657  -6.641  3.666   1.00 0.00 ? 28 ARG A HD3  4  
ATOM 4751  H HE   . ARG A 1 28 ? 12.642  -4.826  5.463   1.00 0.00 ? 28 ARG A HE   4  
ATOM 4752  H HH11 . ARG A 1 28 ? 15.922  -5.886  4.752   1.00 0.00 ? 28 ARG A HH11 4  
ATOM 4753  H HH12 . ARG A 1 28 ? 16.642  -4.373  5.191   1.00 0.00 ? 28 ARG A HH12 4  
ATOM 4754  H HH21 . ARG A 1 28 ? 13.592  -2.830  6.043   1.00 0.00 ? 28 ARG A HH21 4  
ATOM 4755  H HH22 . ARG A 1 28 ? 15.308  -2.624  5.931   1.00 0.00 ? 28 ARG A HH22 4  
ATOM 4756  N N    . VAL A 1 29 ? 9.160   -8.678  5.874   1.00 0.00 ? 29 VAL A N    4  
ATOM 4757  C CA   . VAL A 1 29 ? 8.711   -9.058  7.203   1.00 0.00 ? 29 VAL A CA   4  
ATOM 4758  C C    . VAL A 1 29 ? 7.584   -10.086 7.081   1.00 0.00 ? 29 VAL A C    4  
ATOM 4759  O O    . VAL A 1 29 ? 7.630   -11.141 7.713   1.00 0.00 ? 29 VAL A O    4  
ATOM 4760  C CB   . VAL A 1 29 ? 8.302   -7.813  7.993   1.00 0.00 ? 29 VAL A CB   4  
ATOM 4761  C CG1  . VAL A 1 29 ? 9.298   -6.673  7.773   1.00 0.00 ? 29 VAL A CG1  4  
ATOM 4762  C CG2  . VAL A 1 29 ? 6.880   -7.377  7.631   1.00 0.00 ? 29 VAL A CG2  4  
ATOM 4763  H H    . VAL A 1 29 ? 8.602   -7.982  5.423   1.00 0.00 ? 29 VAL A H    4  
ATOM 4764  H HA   . VAL A 1 29 ? 9.554   -9.521  7.715   1.00 0.00 ? 29 VAL A HA   4  
ATOM 4765  H HB   . VAL A 1 29 ? 8.314   -8.069  9.052   1.00 0.00 ? 29 VAL A HB   4  
ATOM 4766  H HG11 . VAL A 1 29 ? 8.889   -5.967  7.050   1.00 0.00 ? 29 VAL A HG11 4  
ATOM 4767  H HG12 . VAL A 1 29 ? 9.478   -6.160  8.718   1.00 0.00 ? 29 VAL A HG12 4  
ATOM 4768  H HG13 . VAL A 1 29 ? 10.236  -7.078  7.395   1.00 0.00 ? 29 VAL A HG13 4  
ATOM 4769  H HG21 . VAL A 1 29 ? 6.828   -7.156  6.565   1.00 0.00 ? 29 VAL A HG21 4  
ATOM 4770  H HG22 . VAL A 1 29 ? 6.182   -8.180  7.870   1.00 0.00 ? 29 VAL A HG22 4  
ATOM 4771  H HG23 . VAL A 1 29 ? 6.618   -6.486  8.201   1.00 0.00 ? 29 VAL A HG23 4  
ATOM 4772  N N    . LEU A 1 30 ? 6.599   -9.743  6.265   1.00 0.00 ? 30 LEU A N    4  
ATOM 4773  C CA   . LEU A 1 30 ? 5.462   -10.623 6.053   1.00 0.00 ? 30 LEU A CA   4  
ATOM 4774  C C    . LEU A 1 30 ? 5.881   -11.780 5.143   1.00 0.00 ? 30 LEU A C    4  
ATOM 4775  O O    . LEU A 1 30 ? 5.643   -12.943 5.463   1.00 0.00 ? 30 LEU A O    4  
ATOM 4776  C CB   . LEU A 1 30 ? 4.262   -9.832  5.528   1.00 0.00 ? 30 LEU A CB   4  
ATOM 4777  C CG   . LEU A 1 30 ? 3.790   -8.670  6.405   1.00 0.00 ? 30 LEU A CG   4  
ATOM 4778  C CD1  . LEU A 1 30 ? 2.750   -7.819  5.674   1.00 0.00 ? 30 LEU A CD1  4  
ATOM 4779  C CD2  . LEU A 1 30 ? 3.271   -9.176  7.752   1.00 0.00 ? 30 LEU A CD2  4  
ATOM 4780  H H    . LEU A 1 30 ? 6.569   -8.883  5.755   1.00 0.00 ? 30 LEU A H    4  
ATOM 4781  H HA   . LEU A 1 30 ? 5.179   -11.031 7.023   1.00 0.00 ? 30 LEU A HA   4  
ATOM 4782  H HB2  . LEU A 1 30 ? 4.514   -9.438  4.543   1.00 0.00 ? 30 LEU A HB2  4  
ATOM 4783  H HB3  . LEU A 1 30 ? 3.429   -10.521 5.392   1.00 0.00 ? 30 LEU A HB3  4  
ATOM 4784  H HG   . LEU A 1 30 ? 4.646   -8.027  6.611   1.00 0.00 ? 30 LEU A HG   4  
ATOM 4785  H HD11 . LEU A 1 30 ? 2.120   -7.310  6.403   1.00 0.00 ? 30 LEU A HD11 4  
ATOM 4786  H HD12 . LEU A 1 30 ? 3.257   -7.080  5.053   1.00 0.00 ? 30 LEU A HD12 4  
ATOM 4787  H HD13 . LEU A 1 30 ? 2.133   -8.460  5.044   1.00 0.00 ? 30 LEU A HD13 4  
ATOM 4788  H HD21 . LEU A 1 30 ? 3.600   -10.204 7.906   1.00 0.00 ? 30 LEU A HD21 4  
ATOM 4789  H HD22 . LEU A 1 30 ? 3.661   -8.547  8.552   1.00 0.00 ? 30 LEU A HD22 4  
ATOM 4790  H HD23 . LEU A 1 30 ? 2.181   -9.139  7.759   1.00 0.00 ? 30 LEU A HD23 4  
ATOM 4791  N N    . LYS A 1 31 ? 6.498   -11.419 4.027   1.00 0.00 ? 31 LYS A N    4  
ATOM 4792  C CA   . LYS A 1 31 ? 6.952   -12.412 3.069   1.00 0.00 ? 31 LYS A CA   4  
ATOM 4793  C C    . LYS A 1 31 ? 5.785   -12.813 2.164   1.00 0.00 ? 31 LYS A C    4  
ATOM 4794  O O    . LYS A 1 31 ? 5.619   -13.989 1.844   1.00 0.00 ? 31 LYS A O    4  
ATOM 4795  C CB   . LYS A 1 31 ? 7.605   -13.593 3.790   1.00 0.00 ? 31 LYS A CB   4  
ATOM 4796  C CG   . LYS A 1 31 ? 8.863   -14.057 3.054   1.00 0.00 ? 31 LYS A CG   4  
ATOM 4797  C CD   . LYS A 1 31 ? 9.982   -14.397 4.040   1.00 0.00 ? 31 LYS A CD   4  
ATOM 4798  C CE   . LYS A 1 31 ? 11.233  -14.882 3.305   1.00 0.00 ? 31 LYS A CE   4  
ATOM 4799  N NZ   . LYS A 1 31 ? 12.441  -14.216 3.842   1.00 0.00 ? 31 LYS A NZ   4  
ATOM 4800  H H    . LYS A 1 31 ? 6.687   -10.470 3.774   1.00 0.00 ? 31 LYS A H    4  
ATOM 4801  H HA   . LYS A 1 31 ? 7.721   -11.945 2.454   1.00 0.00 ? 31 LYS A HA   4  
ATOM 4802  H HB2  . LYS A 1 31 ? 7.861   -13.305 4.809   1.00 0.00 ? 31 LYS A HB2  4  
ATOM 4803  H HB3  . LYS A 1 31 ? 6.896   -14.418 3.861   1.00 0.00 ? 31 LYS A HB3  4  
ATOM 4804  H HG2  . LYS A 1 31 ? 8.632   -14.932 2.446   1.00 0.00 ? 31 LYS A HG2  4  
ATOM 4805  H HG3  . LYS A 1 31 ? 9.200   -13.276 2.372   1.00 0.00 ? 31 LYS A HG3  4  
ATOM 4806  H HD2  . LYS A 1 31 ? 10.225  -13.518 4.637   1.00 0.00 ? 31 LYS A HD2  4  
ATOM 4807  H HD3  . LYS A 1 31 ? 9.641   -15.167 4.732   1.00 0.00 ? 31 LYS A HD3  4  
ATOM 4808  H HE2  . LYS A 1 31 ? 11.329  -15.963 3.412   1.00 0.00 ? 31 LYS A HE2  4  
ATOM 4809  H HE3  . LYS A 1 31 ? 11.139  -14.675 2.239   1.00 0.00 ? 31 LYS A HE3  4  
ATOM 4810  H HZ1  . LYS A 1 31 ? 12.168  -13.490 4.473   1.00 0.00 ? 31 LYS A HZ1  4  
ATOM 4811  H HZ2  . LYS A 1 31 ? 13.003  -14.886 4.327   1.00 0.00 ? 31 LYS A HZ2  4  
ATOM 4812  H HZ3  . LYS A 1 31 ? 12.967  -13.823 3.088   1.00 0.00 ? 31 LYS A HZ3  4  
ATOM 4813  N N    . VAL A 1 32 ? 5.006   -11.813 1.778   1.00 0.00 ? 32 VAL A N    4  
ATOM 4814  C CA   . VAL A 1 32 ? 3.859   -12.047 0.917   1.00 0.00 ? 32 VAL A CA   4  
ATOM 4815  C C    . VAL A 1 32 ? 3.739   -10.899 -0.087  1.00 0.00 ? 32 VAL A C    4  
ATOM 4816  O O    . VAL A 1 32 ? 4.040   -9.751  0.237   1.00 0.00 ? 32 VAL A O    4  
ATOM 4817  C CB   . VAL A 1 32 ? 2.599   -12.235 1.764   1.00 0.00 ? 32 VAL A CB   4  
ATOM 4818  C CG1  . VAL A 1 32 ? 2.753   -13.418 2.722   1.00 0.00 ? 32 VAL A CG1  4  
ATOM 4819  C CG2  . VAL A 1 32 ? 2.254   -10.954 2.526   1.00 0.00 ? 32 VAL A CG2  4  
ATOM 4820  H H    . VAL A 1 32 ? 5.148   -10.860 2.044   1.00 0.00 ? 32 VAL A H    4  
ATOM 4821  H HA   . VAL A 1 32 ? 4.041   -12.973 0.372   1.00 0.00 ? 32 VAL A HA   4  
ATOM 4822  H HB   . VAL A 1 32 ? 1.772   -12.456 1.089   1.00 0.00 ? 32 VAL A HB   4  
ATOM 4823  H HG11 . VAL A 1 32 ? 1.775   -13.700 3.112   1.00 0.00 ? 32 VAL A HG11 4  
ATOM 4824  H HG12 . VAL A 1 32 ? 3.188   -14.263 2.188   1.00 0.00 ? 32 VAL A HG12 4  
ATOM 4825  H HG13 . VAL A 1 32 ? 3.406   -13.135 3.547   1.00 0.00 ? 32 VAL A HG13 4  
ATOM 4826  H HG21 . VAL A 1 32 ? 1.225   -10.669 2.311   1.00 0.00 ? 32 VAL A HG21 4  
ATOM 4827  H HG22 . VAL A 1 32 ? 2.367   -11.127 3.597   1.00 0.00 ? 32 VAL A HG22 4  
ATOM 4828  H HG23 . VAL A 1 32 ? 2.926   -10.154 2.215   1.00 0.00 ? 32 VAL A HG23 4  
ATOM 4829  N N    . ARG A 1 33 ? 3.298   -11.249 -1.287  1.00 0.00 ? 33 ARG A N    4  
ATOM 4830  C CA   . ARG A 1 33 ? 3.135   -10.262 -2.341  1.00 0.00 ? 33 ARG A CA   4  
ATOM 4831  C C    . ARG A 1 33 ? 1.775   -9.572  -2.215  1.00 0.00 ? 33 ARG A C    4  
ATOM 4832  O O    . ARG A 1 33 ? 0.734   -10.217 -2.335  1.00 0.00 ? 33 ARG A O    4  
ATOM 4833  C CB   . ARG A 1 33 ? 3.245   -10.909 -3.723  1.00 0.00 ? 33 ARG A CB   4  
ATOM 4834  C CG   . ARG A 1 33 ? 4.620   -11.551 -3.920  1.00 0.00 ? 33 ARG A CG   4  
ATOM 4835  C CD   . ARG A 1 33 ? 5.345   -10.937 -5.118  1.00 0.00 ? 33 ARG A CD   4  
ATOM 4836  N NE   . ARG A 1 33 ? 6.349   -11.889 -5.645  1.00 0.00 ? 33 ARG A NE   4  
ATOM 4837  C CZ   . ARG A 1 33 ? 7.102   -11.663 -6.729  1.00 0.00 ? 33 ARG A CZ   4  
ATOM 4838  N NH1  . ARG A 1 33 ? 6.970   -10.516 -7.410  1.00 0.00 ? 33 ARG A NH1  4  
ATOM 4839  N NH2  . ARG A 1 33 ? 7.988   -12.583 -7.134  1.00 0.00 ? 33 ARG A NH2  4  
ATOM 4840  H H    . ARG A 1 33 ? 3.056   -12.185 -1.543  1.00 0.00 ? 33 ARG A H    4  
ATOM 4841  H HA   . ARG A 1 33 ? 3.949   -9.554  -2.189  1.00 0.00 ? 33 ARG A HA   4  
ATOM 4842  H HB2  . ARG A 1 33 ? 2.467   -11.664 -3.838  1.00 0.00 ? 33 ARG A HB2  4  
ATOM 4843  H HB3  . ARG A 1 33 ? 3.077   -10.158 -4.495  1.00 0.00 ? 33 ARG A HB3  4  
ATOM 4844  H HG2  . ARG A 1 33 ? 5.220   -11.418 -3.019  1.00 0.00 ? 33 ARG A HG2  4  
ATOM 4845  H HG3  . ARG A 1 33 ? 4.505   -12.625 -4.070  1.00 0.00 ? 33 ARG A HG3  4  
ATOM 4846  H HD2  . ARG A 1 33 ? 4.627   -10.685 -5.899  1.00 0.00 ? 33 ARG A HD2  4  
ATOM 4847  H HD3  . ARG A 1 33 ? 5.833   -10.008 -4.822  1.00 0.00 ? 33 ARG A HD3  4  
ATOM 4848  H HE   . ARG A 1 33 ? 6.473   -12.755 -5.160  1.00 0.00 ? 33 ARG A HE   4  
ATOM 4849  H HH11 . ARG A 1 33 ? 6.309   -9.829  -7.108  1.00 0.00 ? 33 ARG A HH11 4  
ATOM 4850  H HH12 . ARG A 1 33 ? 7.532   -10.347 -8.220  1.00 0.00 ? 33 ARG A HH12 4  
ATOM 4851  H HH21 . ARG A 1 33 ? 8.087   -13.439 -6.626  1.00 0.00 ? 33 ARG A HH21 4  
ATOM 4852  H HH22 . ARG A 1 33 ? 8.550   -12.415 -7.944  1.00 0.00 ? 33 ARG A HH22 4  
ATOM 4853  N N    . PRO A 1 34 ? 1.829   -8.236  -1.969  1.00 0.00 ? 34 PRO A N    4  
ATOM 4854  C CA   . PRO A 1 34 ? 0.615   -7.451  -1.826  1.00 0.00 ? 34 PRO A CA   4  
ATOM 4855  C C    . PRO A 1 34 ? -0.045  -7.209  -3.185  1.00 0.00 ? 34 PRO A C    4  
ATOM 4856  O O    . PRO A 1 34 ? 0.641   -7.006  -4.185  1.00 0.00 ? 34 PRO A O    4  
ATOM 4857  C CB   . PRO A 1 34 ? 1.054   -6.167  -1.142  1.00 0.00 ? 34 PRO A CB   4  
ATOM 4858  C CG   . PRO A 1 34 ? 2.558   -6.079  -1.347  1.00 0.00 ? 34 PRO A CG   4  
ATOM 4859  C CD   . PRO A 1 34 ? 3.044   -7.439  -1.821  1.00 0.00 ? 34 PRO A CD   4  
ATOM 4860  H HA   . PRO A 1 34 ? -0.059  -7.950  -1.281  1.00 0.00 ? 34 PRO A HA   4  
ATOM 4861  H HB2  . PRO A 1 34 ? 0.550   -5.302  -1.574  1.00 0.00 ? 34 PRO A HB2  4  
ATOM 4862  H HB3  . PRO A 1 34 ? 0.804   -6.184  -0.081  1.00 0.00 ? 34 PRO A HB3  4  
ATOM 4863  H HG2  . PRO A 1 34 ? 2.799   -5.310  -2.081  1.00 0.00 ? 34 PRO A HG2  4  
ATOM 4864  H HG3  . PRO A 1 34 ? 3.054   -5.800  -0.417  1.00 0.00 ? 34 PRO A HG3  4  
ATOM 4865  H HD2  . PRO A 1 34 ? 3.582   -7.360  -2.765  1.00 0.00 ? 34 PRO A HD2  4  
ATOM 4866  H HD3  . PRO A 1 34 ? 3.727   -7.889  -1.101  1.00 0.00 ? 34 PRO A HD3  4  
ATOM 4867  N N    . VAL A 1 35 ? -1.370  -7.240  -3.178  1.00 0.00 ? 35 VAL A N    4  
ATOM 4868  C CA   . VAL A 1 35 ? -2.130  -7.026  -4.398  1.00 0.00 ? 35 VAL A CA   4  
ATOM 4869  C C    . VAL A 1 35 ? -2.719  -5.615  -4.386  1.00 0.00 ? 35 VAL A C    4  
ATOM 4870  O O    . VAL A 1 35 ? -3.401  -5.230  -3.437  1.00 0.00 ? 35 VAL A O    4  
ATOM 4871  C CB   . VAL A 1 35 ? -3.193  -8.117  -4.550  1.00 0.00 ? 35 VAL A CB   4  
ATOM 4872  C CG1  . VAL A 1 35 ? -4.337  -7.645  -5.449  1.00 0.00 ? 35 VAL A CG1  4  
ATOM 4873  C CG2  . VAL A 1 35 ? -2.577  -9.413  -5.080  1.00 0.00 ? 35 VAL A CG2  4  
ATOM 4874  H H    . VAL A 1 35 ? -1.921  -7.406  -2.360  1.00 0.00 ? 35 VAL A H    4  
ATOM 4875  H HA   . VAL A 1 35 ? -1.438  -7.111  -5.236  1.00 0.00 ? 35 VAL A HA   4  
ATOM 4876  H HB   . VAL A 1 35 ? -3.606  -8.322  -3.562  1.00 0.00 ? 35 VAL A HB   4  
ATOM 4877  H HG11 . VAL A 1 35 ? -4.008  -6.789  -6.037  1.00 0.00 ? 35 VAL A HG11 4  
ATOM 4878  H HG12 . VAL A 1 35 ? -4.631  -8.454  -6.118  1.00 0.00 ? 35 VAL A HG12 4  
ATOM 4879  H HG13 . VAL A 1 35 ? -5.189  -7.356  -4.832  1.00 0.00 ? 35 VAL A HG13 4  
ATOM 4880  H HG21 . VAL A 1 35 ? -3.370  -10.079 -5.421  1.00 0.00 ? 35 VAL A HG21 4  
ATOM 4881  H HG22 . VAL A 1 35 ? -1.911  -9.185  -5.912  1.00 0.00 ? 35 VAL A HG22 4  
ATOM 4882  H HG23 . VAL A 1 35 ? -2.012  -9.899  -4.285  1.00 0.00 ? 35 VAL A HG23 4  
ATOM 4883  N N    . TYR A 1 36 ? -2.435  -4.880  -5.452  1.00 0.00 ? 36 TYR A N    4  
ATOM 4884  C CA   . TYR A 1 36 ? -2.928  -3.519  -5.576  1.00 0.00 ? 36 TYR A CA   4  
ATOM 4885  C C    . TYR A 1 36 ? -4.300  -3.493  -6.252  1.00 0.00 ? 36 TYR A C    4  
ATOM 4886  O O    . TYR A 1 36 ? -4.413  -3.763  -7.447  1.00 0.00 ? 36 TYR A O    4  
ATOM 4887  C CB   . TYR A 1 36 ? -1.921  -2.785  -6.463  1.00 0.00 ? 36 TYR A CB   4  
ATOM 4888  C CG   . TYR A 1 36 ? -0.685  -2.281  -5.716  1.00 0.00 ? 36 TYR A CG   4  
ATOM 4889  C CD1  . TYR A 1 36 ? 0.138   -3.175  -5.062  1.00 0.00 ? 36 TYR A CD1  4  
ATOM 4890  C CD2  . TYR A 1 36 ? -0.393  -0.932  -5.697  1.00 0.00 ? 36 TYR A CD2  4  
ATOM 4891  C CE1  . TYR A 1 36 ? 1.302   -2.700  -4.358  1.00 0.00 ? 36 TYR A CE1  4  
ATOM 4892  C CE2  . TYR A 1 36 ? 0.771   -0.458  -4.994  1.00 0.00 ? 36 TYR A CE2  4  
ATOM 4893  C CZ   . TYR A 1 36 ? 1.561   -1.365  -4.359  1.00 0.00 ? 36 TYR A CZ   4  
ATOM 4894  O OH   . TYR A 1 36 ? 2.660   -0.917  -3.695  1.00 0.00 ? 36 TYR A OH   4  
ATOM 4895  H H    . TYR A 1 36 ? -1.880  -5.200  -6.219  1.00 0.00 ? 36 TYR A H    4  
ATOM 4896  H HA   . TYR A 1 36 ? -3.018  -3.101  -4.573  1.00 0.00 ? 36 TYR A HA   4  
ATOM 4897  H HB2  . TYR A 1 36 ? -1.602  -3.453  -7.263  1.00 0.00 ? 36 TYR A HB2  4  
ATOM 4898  H HB3  . TYR A 1 36 ? -2.418  -1.938  -6.935  1.00 0.00 ? 36 TYR A HB3  4  
ATOM 4899  H HD1  . TYR A 1 36 ? -0.093  -4.240  -5.077  1.00 0.00 ? 36 TYR A HD1  4  
ATOM 4900  H HD2  . TYR A 1 36 ? -1.042  -0.226  -6.214  1.00 0.00 ? 36 TYR A HD2  4  
ATOM 4901  H HE1  . TYR A 1 36 ? 1.960   -3.396  -3.837  1.00 0.00 ? 36 TYR A HE1  4  
ATOM 4902  H HE2  . TYR A 1 36 ? 1.014   0.605   -4.970  1.00 0.00 ? 36 TYR A HE2  4  
ATOM 4903  H HH   . TYR A 1 36 ? 2.387   -0.478  -2.839  1.00 0.00 ? 36 TYR A HH   4  
ATOM 4904  N N    . ASN A 1 37 ? -5.310  -3.165  -5.459  1.00 0.00 ? 37 ASN A N    4  
ATOM 4905  C CA   . ASN A 1 37 ? -6.670  -3.100  -5.966  1.00 0.00 ? 37 ASN A CA   4  
ATOM 4906  C C    . ASN A 1 37 ? -6.968  -1.673  -6.430  1.00 0.00 ? 37 ASN A C    4  
ATOM 4907  O O    . ASN A 1 37 ? -6.744  -0.716  -5.690  1.00 0.00 ? 37 ASN A O    4  
ATOM 4908  C CB   . ASN A 1 37 ? -7.681  -3.465  -4.878  1.00 0.00 ? 37 ASN A CB   4  
ATOM 4909  C CG   . ASN A 1 37 ? -8.625  -4.571  -5.355  1.00 0.00 ? 37 ASN A CG   4  
ATOM 4910  O OD1  . ASN A 1 37 ? -9.316  -4.446  -6.353  1.00 0.00 ? 37 ASN A OD1  4  
ATOM 4911  N ND2  . ASN A 1 37 ? -8.615  -5.658  -4.589  1.00 0.00 ? 37 ASN A ND2  4  
ATOM 4912  H H    . ASN A 1 37 ? -5.210  -2.947  -4.488  1.00 0.00 ? 37 ASN A H    4  
ATOM 4913  H HA   . ASN A 1 37 ? -6.705  -3.820  -6.783  1.00 0.00 ? 37 ASN A HA   4  
ATOM 4914  H HB2  . ASN A 1 37 ? -7.155  -3.792  -3.982  1.00 0.00 ? 37 ASN A HB2  4  
ATOM 4915  H HB3  . ASN A 1 37 ? -8.259  -2.582  -4.603  1.00 0.00 ? 37 ASN A HB3  4  
ATOM 4916  H HD21 . ASN A 1 37 ? -8.024  -5.696  -3.783  1.00 0.00 ? 37 ASN A HD21 4  
ATOM 4917  H HD22 . ASN A 1 37 ? -9.198  -6.437  -4.818  1.00 0.00 ? 37 ASN A HD22 4  
ATOM 4918  N N    . PHE A 1 38 ? -7.470  -1.575  -7.653  1.00 0.00 ? 38 PHE A N    4  
ATOM 4919  C CA   . PHE A 1 38 ? -7.802  -0.281  -8.224  1.00 0.00 ? 38 PHE A CA   4  
ATOM 4920  C C    . PHE A 1 38 ? -9.315  -0.125  -8.387  1.00 0.00 ? 38 PHE A C    4  
ATOM 4921  O O    . PHE A 1 38 ? -10.030 -1.113  -8.549  1.00 0.00 ? 38 PHE A O    4  
ATOM 4922  C CB   . PHE A 1 38 ? -7.143  -0.219  -9.604  1.00 0.00 ? 38 PHE A CB   4  
ATOM 4923  C CG   . PHE A 1 38 ? -5.619  -0.348  -9.572  1.00 0.00 ? 38 PHE A CG   4  
ATOM 4924  C CD1  . PHE A 1 38 ? -4.852  0.730   -9.257  1.00 0.00 ? 38 PHE A CD1  4  
ATOM 4925  C CD2  . PHE A 1 38 ? -5.031  -1.540  -9.859  1.00 0.00 ? 38 PHE A CD2  4  
ATOM 4926  C CE1  . PHE A 1 38 ? -3.437  0.610   -9.227  1.00 0.00 ? 38 PHE A CE1  4  
ATOM 4927  C CE2  . PHE A 1 38 ? -3.617  -1.660  -9.830  1.00 0.00 ? 38 PHE A CE2  4  
ATOM 4928  C CZ   . PHE A 1 38 ? -2.849  -0.582  -9.514  1.00 0.00 ? 38 PHE A CZ   4  
ATOM 4929  H H    . PHE A 1 38 ? -7.649  -2.358  -8.248  1.00 0.00 ? 38 PHE A H    4  
ATOM 4930  H HA   . PHE A 1 38 ? -7.432  0.480   -7.537  1.00 0.00 ? 38 PHE A HA   4  
ATOM 4931  H HB2  . PHE A 1 38 ? -7.552  -1.015  -10.226 1.00 0.00 ? 38 PHE A HB2  4  
ATOM 4932  H HB3  . PHE A 1 38 ? -7.408  0.725   -10.079 1.00 0.00 ? 38 PHE A HB3  4  
ATOM 4933  H HD1  . PHE A 1 38 ? -5.323  1.685   -9.026  1.00 0.00 ? 38 PHE A HD1  4  
ATOM 4934  H HD2  . PHE A 1 38 ? -5.646  -2.404  -10.112 1.00 0.00 ? 38 PHE A HD2  4  
ATOM 4935  H HE1  . PHE A 1 38 ? -2.822  1.474   -8.974  1.00 0.00 ? 38 PHE A HE1  4  
ATOM 4936  H HE2  . PHE A 1 38 ? -3.146  -2.615  -10.060 1.00 0.00 ? 38 PHE A HE2  4  
ATOM 4937  H HZ   . PHE A 1 38 ? -1.764  -0.674  -9.492  1.00 0.00 ? 38 PHE A HZ   4  
ATOM 4938  N N    . PHE A 1 39 ? -9.758  1.123   -8.338  1.00 0.00 ? 39 PHE A N    4  
ATOM 4939  C CA   . PHE A 1 39 ? -11.173 1.420   -8.478  1.00 0.00 ? 39 PHE A CA   4  
ATOM 4940  C C    . PHE A 1 39 ? -11.392 2.895   -8.823  1.00 0.00 ? 39 PHE A C    4  
ATOM 4941  O O    . PHE A 1 39 ? -10.436 3.664   -8.909  1.00 0.00 ? 39 PHE A O    4  
ATOM 4942  C CB   . PHE A 1 39 ? -11.829 1.122   -7.128  1.00 0.00 ? 39 PHE A CB   4  
ATOM 4943  C CG   . PHE A 1 39 ? -11.186 1.855   -5.949  1.00 0.00 ? 39 PHE A CG   4  
ATOM 4944  C CD1  . PHE A 1 39 ? -10.017 1.402   -5.422  1.00 0.00 ? 39 PHE A CD1  4  
ATOM 4945  C CD2  . PHE A 1 39 ? -11.783 2.960   -5.427  1.00 0.00 ? 39 PHE A CD2  4  
ATOM 4946  C CE1  . PHE A 1 39 ? -9.420  2.082   -4.328  1.00 0.00 ? 39 PHE A CE1  4  
ATOM 4947  C CE2  . PHE A 1 39 ? -11.187 3.640   -4.333  1.00 0.00 ? 39 PHE A CE2  4  
ATOM 4948  C CZ   . PHE A 1 39 ? -10.018 3.187   -3.806  1.00 0.00 ? 39 PHE A CZ   4  
ATOM 4949  H H    . PHE A 1 39 ? -9.170  1.920   -8.205  1.00 0.00 ? 39 PHE A H    4  
ATOM 4950  H HA   . PHE A 1 39 ? -11.556 0.799   -9.287  1.00 0.00 ? 39 PHE A HA   4  
ATOM 4951  H HB2  . PHE A 1 39 ? -12.883 1.394   -7.180  1.00 0.00 ? 39 PHE A HB2  4  
ATOM 4952  H HB3  . PHE A 1 39 ? -11.785 0.049   -6.943  1.00 0.00 ? 39 PHE A HB3  4  
ATOM 4953  H HD1  . PHE A 1 39 ? -9.538  0.516   -5.840  1.00 0.00 ? 39 PHE A HD1  4  
ATOM 4954  H HD2  . PHE A 1 39 ? -12.720 3.323   -5.849  1.00 0.00 ? 39 PHE A HD2  4  
ATOM 4955  H HE1  . PHE A 1 39 ? -8.483  1.718   -3.906  1.00 0.00 ? 39 PHE A HE1  4  
ATOM 4956  H HE2  . PHE A 1 39 ? -11.665 4.525   -3.915  1.00 0.00 ? 39 PHE A HE2  4  
ATOM 4957  H HZ   . PHE A 1 39 ? -9.559  3.709   -2.966  1.00 0.00 ? 39 PHE A HZ   4  
ATOM 4958  N N    . GLU A 1 40 ? -12.656 3.244   -9.012  1.00 0.00 ? 40 GLU A N    4  
ATOM 4959  C CA   . GLU A 1 40 ? -13.012 4.612   -9.346  1.00 0.00 ? 40 GLU A CA   4  
ATOM 4960  C C    . GLU A 1 40 ? -13.533 5.343   -8.107  1.00 0.00 ? 40 GLU A C    4  
ATOM 4961  O O    . GLU A 1 40 ? -13.882 4.711   -7.111  1.00 0.00 ? 40 GLU A O    4  
ATOM 4962  C CB   . GLU A 1 40 ? -14.041 4.650   -10.478 1.00 0.00 ? 40 GLU A CB   4  
ATOM 4963  C CG   . GLU A 1 40 ? -13.353 4.667   -11.844 1.00 0.00 ? 40 GLU A CG   4  
ATOM 4964  C CD   . GLU A 1 40 ? -12.961 6.092   -12.243 1.00 0.00 ? 40 GLU A CD   4  
ATOM 4965  O OE1  . GLU A 1 40 ? -13.738 7.010   -11.904 1.00 0.00 ? 40 GLU A OE1  4  
ATOM 4966  O OE2  . GLU A 1 40 ? -11.893 6.230   -12.878 1.00 0.00 ? 40 GLU A OE2  4  
ATOM 4967  H H    . GLU A 1 40 ? -13.428 2.612   -8.940  1.00 0.00 ? 40 GLU A H    4  
ATOM 4968  H HA   . GLU A 1 40 ? -12.088 5.077   -9.688  1.00 0.00 ? 40 GLU A HA   4  
ATOM 4969  H HB2  . GLU A 1 40 ? -14.696 3.782   -10.408 1.00 0.00 ? 40 GLU A HB2  4  
ATOM 4970  H HB3  . GLU A 1 40 ? -14.670 5.534   -10.373 1.00 0.00 ? 40 GLU A HB3  4  
ATOM 4971  H HG2  . GLU A 1 40 ? -12.464 4.037   -11.816 1.00 0.00 ? 40 GLU A HG2  4  
ATOM 4972  H HG3  . GLU A 1 40 ? -14.019 4.246   -12.597 1.00 0.00 ? 40 GLU A HG3  4  
ATOM 4973  N N    . CYS A 1 41 ? -13.570 6.663   -8.209  1.00 0.00 ? 41 CYS A N    4  
ATOM 4974  C CA   . CYS A 1 41 ? -14.043 7.486   -7.109  1.00 0.00 ? 41 CYS A CA   4  
ATOM 4975  C C    . CYS A 1 41 ? -15.353 8.151   -7.535  1.00 0.00 ? 41 CYS A C    4  
ATOM 4976  O O    . CYS A 1 41 ? -15.553 8.439   -8.714  1.00 0.00 ? 41 CYS A O    4  
ATOM 4977  C CB   . CYS A 1 41 ? -12.994 8.515   -6.681  1.00 0.00 ? 41 CYS A CB   4  
ATOM 4978  S SG   . CYS A 1 41 ? -12.813 8.504   -4.860  1.00 0.00 ? 41 CYS A SG   4  
ATOM 4979  H H    . CYS A 1 41 ? -13.284 7.169   -9.023  1.00 0.00 ? 41 CYS A H    4  
ATOM 4980  H HA   . CYS A 1 41 ? -14.204 6.817   -6.264  1.00 0.00 ? 41 CYS A HA   4  
ATOM 4981  H HB2  . CYS A 1 41 ? -12.037 8.289   -7.151  1.00 0.00 ? 41 CYS A HB2  4  
ATOM 4982  H HB3  . CYS A 1 41 ? -13.288 9.509   -7.020  1.00 0.00 ? 41 CYS A HB3  4  
ATOM 4983  H HG   . CYS A 1 41 ? -14.022 8.992   -4.598  1.00 0.00 ? 41 CYS A HG   4  
ATOM 4984  N N    . GLU A 1 42 ? -16.213 8.375   -6.552  1.00 0.00 ? 42 GLU A N    4  
ATOM 4985  C CA   . GLU A 1 42 ? -17.499 9.000   -6.810  1.00 0.00 ? 42 GLU A CA   4  
ATOM 4986  C C    . GLU A 1 42 ? -17.321 10.501  -7.047  1.00 0.00 ? 42 GLU A C    4  
ATOM 4987  O O    . GLU A 1 42 ? -18.185 11.146  -7.640  1.00 0.00 ? 42 GLU A O    4  
ATOM 4988  C CB   . GLU A 1 42 ? -18.476 8.738   -5.662  1.00 0.00 ? 42 GLU A CB   4  
ATOM 4989  C CG   . GLU A 1 42 ? -19.818 8.227   -6.190  1.00 0.00 ? 42 GLU A CG   4  
ATOM 4990  C CD   . GLU A 1 42 ? -20.854 9.352   -6.234  1.00 0.00 ? 42 GLU A CD   4  
ATOM 4991  O OE1  . GLU A 1 42 ? -21.052 9.983   -5.173  1.00 0.00 ? 42 GLU A OE1  4  
ATOM 4992  O OE2  . GLU A 1 42 ? -21.424 9.557   -7.327  1.00 0.00 ? 42 GLU A OE2  4  
ATOM 4993  H H    . GLU A 1 42 ? -16.042 8.138   -5.595  1.00 0.00 ? 42 GLU A H    4  
ATOM 4994  H HA   . GLU A 1 42 ? -17.876 8.524   -7.715  1.00 0.00 ? 42 GLU A HA   4  
ATOM 4995  H HB2  . GLU A 1 42 ? -18.049 8.007   -4.976  1.00 0.00 ? 42 GLU A HB2  4  
ATOM 4996  H HB3  . GLU A 1 42 ? -18.630 9.656   -5.094  1.00 0.00 ? 42 GLU A HB3  4  
ATOM 4997  H HG2  . GLU A 1 42 ? -19.685 7.812   -7.189  1.00 0.00 ? 42 GLU A HG2  4  
ATOM 4998  H HG3  . GLU A 1 42 ? -20.179 7.420   -5.554  1.00 0.00 ? 42 GLU A HG3  4  
ATOM 4999  N N    . ASN A 1 43 ? -16.196 11.014  -6.572  1.00 0.00 ? 43 ASN A N    4  
ATOM 5000  C CA   . ASN A 1 43 ? -15.894 12.427  -6.724  1.00 0.00 ? 43 ASN A CA   4  
ATOM 5001  C C    . ASN A 1 43 ? -14.964 12.619  -7.924  1.00 0.00 ? 43 ASN A C    4  
ATOM 5002  O O    . ASN A 1 43 ? -14.098 11.784  -8.182  1.00 0.00 ? 43 ASN A O    4  
ATOM 5003  C CB   . ASN A 1 43 ? -15.186 12.977  -5.484  1.00 0.00 ? 43 ASN A CB   4  
ATOM 5004  C CG   . ASN A 1 43 ? -15.678 14.387  -5.152  1.00 0.00 ? 43 ASN A CG   4  
ATOM 5005  O OD1  . ASN A 1 43 ? -16.807 14.759  -5.427  1.00 0.00 ? 43 ASN A OD1  4  
ATOM 5006  N ND2  . ASN A 1 43 ? -14.771 15.147  -4.546  1.00 0.00 ? 43 ASN A ND2  4  
ATOM 5007  H H    . ASN A 1 43 ? -15.499 10.483  -6.090  1.00 0.00 ? 43 ASN A H    4  
ATOM 5008  H HA   . ASN A 1 43 ? -16.860 12.913  -6.864  1.00 0.00 ? 43 ASN A HA   4  
ATOM 5009  H HB2  . ASN A 1 43 ? -15.365 12.316  -4.636  1.00 0.00 ? 43 ASN A HB2  4  
ATOM 5010  H HB3  . ASN A 1 43 ? -14.110 12.994  -5.653  1.00 0.00 ? 43 ASN A HB3  4  
ATOM 5011  H HD21 . ASN A 1 43 ? -13.862 14.780  -4.348  1.00 0.00 ? 43 ASN A HD21 4  
ATOM 5012  H HD22 . ASN A 1 43 ? -14.998 16.086  -4.287  1.00 0.00 ? 43 ASN A HD22 4  
ATOM 5013  N N    . PRO A 1 44 ? -15.179 13.752  -8.643  1.00 0.00 ? 44 PRO A N    4  
ATOM 5014  C CA   . PRO A 1 44 ? -14.370 14.064  -9.809  1.00 0.00 ? 44 PRO A CA   4  
ATOM 5015  C C    . PRO A 1 44 ? -12.978 14.549  -9.397  1.00 0.00 ? 44 PRO A C    4  
ATOM 5016  O O    . PRO A 1 44 ? -12.018 14.403  -10.151 1.00 0.00 ? 44 PRO A O    4  
ATOM 5017  C CB   . PRO A 1 44 ? -15.164 15.114  -10.569 1.00 0.00 ? 44 PRO A CB   4  
ATOM 5018  C CG   . PRO A 1 44 ? -16.157 15.689  -9.573  1.00 0.00 ? 44 PRO A CG   4  
ATOM 5019  C CD   . PRO A 1 44 ? -16.195 14.764  -8.367  1.00 0.00 ? 44 PRO A CD   4  
ATOM 5020  H HA   . PRO A 1 44 ? -14.221 13.242  -10.358 1.00 0.00 ? 44 PRO A HA   4  
ATOM 5021  H HB2  . PRO A 1 44 ? -14.508 15.892  -10.960 1.00 0.00 ? 44 PRO A HB2  4  
ATOM 5022  H HB3  . PRO A 1 44 ? -15.678 14.672  -11.423 1.00 0.00 ? 44 PRO A HB3  4  
ATOM 5023  H HG2  . PRO A 1 44 ? -15.860 16.694  -9.274  1.00 0.00 ? 44 PRO A HG2  4  
ATOM 5024  H HG3  . PRO A 1 44 ? -17.146 15.769  -10.023 1.00 0.00 ? 44 PRO A HG3  4  
ATOM 5025  H HD2  . PRO A 1 44 ? -15.976 15.304  -7.446  1.00 0.00 ? 44 PRO A HD2  4  
ATOM 5026  H HD3  . PRO A 1 44 ? -17.180 14.313  -8.245  1.00 0.00 ? 44 PRO A HD3  4  
ATOM 5027  N N    . SER A 1 45 ? -12.914 15.116  -8.201  1.00 0.00 ? 45 SER A N    4  
ATOM 5028  C CA   . SER A 1 45 ? -11.657 15.623  -7.680  1.00 0.00 ? 45 SER A CA   4  
ATOM 5029  C C    . SER A 1 45 ? -10.523 14.649  -8.008  1.00 0.00 ? 45 SER A C    4  
ATOM 5030  O O    . SER A 1 45 ? -9.591  14.997  -8.730  1.00 0.00 ? 45 SER A O    4  
ATOM 5031  C CB   . SER A 1 45 ? -11.739 15.852  -6.169  1.00 0.00 ? 45 SER A CB   4  
ATOM 5032  O OG   . SER A 1 45 ? -11.453 17.203  -5.818  1.00 0.00 ? 45 SER A OG   4  
ATOM 5033  H H    . SER A 1 45 ? -13.701 15.231  -7.594  1.00 0.00 ? 45 SER A H    4  
ATOM 5034  H HA   . SER A 1 45 ? -11.499 16.577  -8.183  1.00 0.00 ? 45 SER A HA   4  
ATOM 5035  H HB2  . SER A 1 45 ? -12.736 15.589  -5.817  1.00 0.00 ? 45 SER A HB2  4  
ATOM 5036  H HB3  . SER A 1 45 ? -11.037 15.189  -5.663  1.00 0.00 ? 45 SER A HB3  4  
ATOM 5037  H HG   . SER A 1 45 ? -12.210 17.796  -6.093  1.00 0.00 ? 45 SER A HG   4  
ATOM 5038  N N    . GLU A 1 46 ? -10.641 13.448  -7.461  1.00 0.00 ? 46 GLU A N    4  
ATOM 5039  C CA   . GLU A 1 46 ? -9.638  12.421  -7.687  1.00 0.00 ? 46 GLU A CA   4  
ATOM 5040  C C    . GLU A 1 46 ? -10.307 11.104  -8.084  1.00 0.00 ? 46 GLU A C    4  
ATOM 5041  O O    . GLU A 1 46 ? -10.682 10.309  -7.223  1.00 0.00 ? 46 GLU A O    4  
ATOM 5042  C CB   . GLU A 1 46 ? -8.755  12.237  -6.451  1.00 0.00 ? 46 GLU A CB   4  
ATOM 5043  C CG   . GLU A 1 46 ? -8.018  13.532  -6.106  1.00 0.00 ? 46 GLU A CG   4  
ATOM 5044  C CD   . GLU A 1 46 ? -8.283  13.944  -4.656  1.00 0.00 ? 46 GLU A CD   4  
ATOM 5045  O OE1  . GLU A 1 46 ? -7.900  13.158  -3.763  1.00 0.00 ? 46 GLU A OE1  4  
ATOM 5046  O OE2  . GLU A 1 46 ? -8.864  15.036  -4.474  1.00 0.00 ? 46 GLU A OE2  4  
ATOM 5047  H H    . GLU A 1 46 ? -11.403 13.173  -6.874  1.00 0.00 ? 46 GLU A H    4  
ATOM 5048  H HA   . GLU A 1 46 ? -9.027  12.789  -8.511  1.00 0.00 ? 46 GLU A HA   4  
ATOM 5049  H HB2  . GLU A 1 46 ? -9.368  11.926  -5.605  1.00 0.00 ? 46 GLU A HB2  4  
ATOM 5050  H HB3  . GLU A 1 46 ? -8.033  11.440  -6.631  1.00 0.00 ? 46 GLU A HB3  4  
ATOM 5051  H HG2  . GLU A 1 46 ? -6.947  13.397  -6.259  1.00 0.00 ? 46 GLU A HG2  4  
ATOM 5052  H HG3  . GLU A 1 46 ? -8.338  14.327  -6.778  1.00 0.00 ? 46 GLU A HG3  4  
ATOM 5053  N N    . PRO A 1 47 ? -10.440 10.908  -9.423  1.00 0.00 ? 47 PRO A N    4  
ATOM 5054  C CA   . PRO A 1 47 ? -11.058 9.700   -9.945  1.00 0.00 ? 47 PRO A CA   4  
ATOM 5055  C C    . PRO A 1 47 ? -10.109 8.506   -9.830  1.00 0.00 ? 47 PRO A C    4  
ATOM 5056  O O    . PRO A 1 47 ? -10.547 7.356   -9.850  1.00 0.00 ? 47 PRO A O    4  
ATOM 5057  C CB   . PRO A 1 47 ? -11.420 10.034  -11.383 1.00 0.00 ? 47 PRO A CB   4  
ATOM 5058  C CG   . PRO A 1 47 ? -10.580 11.245  -11.755 1.00 0.00 ? 47 PRO A CG   4  
ATOM 5059  C CD   . PRO A 1 47 ? -10.008 11.827  -10.472 1.00 0.00 ? 47 PRO A CD   4  
ATOM 5060  H HA   . PRO A 1 47 ? -11.865 9.462   -9.405  1.00 0.00 ? 47 PRO A HA   4  
ATOM 5061  H HB2  . PRO A 1 47 ? -11.208 9.194   -12.044 1.00 0.00 ? 47 PRO A HB2  4  
ATOM 5062  H HB3  . PRO A 1 47 ? -12.484 10.253  -11.477 1.00 0.00 ? 47 PRO A HB3  4  
ATOM 5063  H HG2  . PRO A 1 47 ? -9.778  10.959  -12.435 1.00 0.00 ? 47 PRO A HG2  4  
ATOM 5064  H HG3  . PRO A 1 47 ? -11.188 11.987  -12.273 1.00 0.00 ? 47 PRO A HG3  4  
ATOM 5065  H HD2  . PRO A 1 47 ? -8.921  11.893  -10.517 1.00 0.00 ? 47 PRO A HD2  4  
ATOM 5066  H HD3  . PRO A 1 47 ? -10.382 12.835  -10.293 1.00 0.00 ? 47 PRO A HD3  4  
ATOM 5067  N N    . PHE A 1 48 ? -8.827  8.818   -9.710  1.00 0.00 ? 48 PHE A N    4  
ATOM 5068  C CA   . PHE A 1 48 ? -7.813  7.784   -9.591  1.00 0.00 ? 48 PHE A CA   4  
ATOM 5069  C C    . PHE A 1 48 ? -7.693  7.298   -8.146  1.00 0.00 ? 48 PHE A C    4  
ATOM 5070  O O    . PHE A 1 48 ? -7.161  8.005   -7.291  1.00 0.00 ? 48 PHE A O    4  
ATOM 5071  C CB   . PHE A 1 48 ? -6.484  8.410   -10.018 1.00 0.00 ? 48 PHE A CB   4  
ATOM 5072  C CG   . PHE A 1 48 ? -6.435  8.823   -11.491 1.00 0.00 ? 48 PHE A CG   4  
ATOM 5073  C CD1  . PHE A 1 48 ? -7.024  9.981   -11.892 1.00 0.00 ? 48 PHE A CD1  4  
ATOM 5074  C CD2  . PHE A 1 48 ? -5.803  8.032   -12.398 1.00 0.00 ? 48 PHE A CD2  4  
ATOM 5075  C CE1  . PHE A 1 48 ? -6.979  10.365  -13.259 1.00 0.00 ? 48 PHE A CE1  4  
ATOM 5076  C CE2  . PHE A 1 48 ? -5.757  8.415   -13.765 1.00 0.00 ? 48 PHE A CE2  4  
ATOM 5077  C CZ   . PHE A 1 48 ? -6.346  9.573   -14.166 1.00 0.00 ? 48 PHE A CZ   4  
ATOM 5078  H H    . PHE A 1 48 ? -8.479  9.755   -9.694  1.00 0.00 ? 48 PHE A H    4  
ATOM 5079  H HA   . PHE A 1 48 ? -8.121  6.954   -10.227 1.00 0.00 ? 48 PHE A HA   4  
ATOM 5080  H HB2  . PHE A 1 48 ? -6.291  9.286   -9.399  1.00 0.00 ? 48 PHE A HB2  4  
ATOM 5081  H HB3  . PHE A 1 48 ? -5.680  7.700   -9.824  1.00 0.00 ? 48 PHE A HB3  4  
ATOM 5082  H HD1  . PHE A 1 48 ? -7.531  10.616  -11.165 1.00 0.00 ? 48 PHE A HD1  4  
ATOM 5083  H HD2  . PHE A 1 48 ? -5.331  7.103   -12.077 1.00 0.00 ? 48 PHE A HD2  4  
ATOM 5084  H HE1  . PHE A 1 48 ? -7.451  11.293  -13.580 1.00 0.00 ? 48 PHE A HE1  4  
ATOM 5085  H HE2  . PHE A 1 48 ? -5.251  7.781   -14.492 1.00 0.00 ? 48 PHE A HE2  4  
ATOM 5086  H HZ   . PHE A 1 48 ? -6.312  9.867   -15.215 1.00 0.00 ? 48 PHE A HZ   4  
ATOM 5087  N N    . GLY A 1 49 ? -8.196  6.094   -7.916  1.00 0.00 ? 49 GLY A N    4  
ATOM 5088  C CA   . GLY A 1 49 ? -8.152  5.505   -6.589  1.00 0.00 ? 49 GLY A CA   4  
ATOM 5089  C C    . GLY A 1 49 ? -7.542  4.102   -6.632  1.00 0.00 ? 49 GLY A C    4  
ATOM 5090  O O    . GLY A 1 49 ? -7.773  3.349   -7.577  1.00 0.00 ? 49 GLY A O    4  
ATOM 5091  H H    . GLY A 1 49 ? -8.627  5.525   -8.617  1.00 0.00 ? 49 GLY A H    4  
ATOM 5092  H HA2  . GLY A 1 49 ? -7.565  6.140   -5.925  1.00 0.00 ? 49 GLY A HA2  4  
ATOM 5093  H HA3  . GLY A 1 49 ? -9.159  5.455   -6.175  1.00 0.00 ? 49 GLY A HA3  4  
ATOM 5094  N N    . ALA A 1 50 ? -6.775  3.793   -5.596  1.00 0.00 ? 50 ALA A N    4  
ATOM 5095  C CA   . ALA A 1 50 ? -6.131  2.494   -5.504  1.00 0.00 ? 50 ALA A CA   4  
ATOM 5096  C C    . ALA A 1 50 ? -6.051  2.072   -4.035  1.00 0.00 ? 50 ALA A C    4  
ATOM 5097  O O    . ALA A 1 50 ? -6.062  2.918   -3.142  1.00 0.00 ? 50 ALA A O    4  
ATOM 5098  C CB   . ALA A 1 50 ? -4.754  2.559   -6.167  1.00 0.00 ? 50 ALA A CB   4  
ATOM 5099  H H    . ALA A 1 50 ? -6.592  4.411   -4.832  1.00 0.00 ? 50 ALA A H    4  
ATOM 5100  H HA   . ALA A 1 50 ? -6.748  1.778   -6.046  1.00 0.00 ? 50 ALA A HA   4  
ATOM 5101  H HB1  . ALA A 1 50 ? -3.980  2.399   -5.415  1.00 0.00 ? 50 ALA A HB1  4  
ATOM 5102  H HB2  . ALA A 1 50 ? -4.682  1.785   -6.932  1.00 0.00 ? 50 ALA A HB2  4  
ATOM 5103  H HB3  . ALA A 1 50 ? -4.617  3.537   -6.627  1.00 0.00 ? 50 ALA A HB3  4  
ATOM 5104  N N    . SER A 1 51 ? -5.973  0.765   -3.831  1.00 0.00 ? 51 SER A N    4  
ATOM 5105  C CA   . SER A 1 51 ? -5.892  0.222   -2.486  1.00 0.00 ? 51 SER A CA   4  
ATOM 5106  C C    . SER A 1 51 ? -4.819  -0.868  -2.426  1.00 0.00 ? 51 SER A C    4  
ATOM 5107  O O    . SER A 1 51 ? -4.420  -1.409  -3.457  1.00 0.00 ? 51 SER A O    4  
ATOM 5108  C CB   . SER A 1 51 ? -7.243  -0.338  -2.036  1.00 0.00 ? 51 SER A CB   4  
ATOM 5109  O OG   . SER A 1 51 ? -7.641  -1.463  -2.815  1.00 0.00 ? 51 SER A OG   4  
ATOM 5110  H H    . SER A 1 51 ? -5.965  0.085   -4.563  1.00 0.00 ? 51 SER A H    4  
ATOM 5111  H HA   . SER A 1 51 ? -5.618  1.063   -1.850  1.00 0.00 ? 51 SER A HA   4  
ATOM 5112  H HB2  . SER A 1 51 ? -7.184  -0.626  -0.986  1.00 0.00 ? 51 SER A HB2  4  
ATOM 5113  H HB3  . SER A 1 51 ? -8.001  0.441   -2.110  1.00 0.00 ? 51 SER A HB3  4  
ATOM 5114  H HG   . SER A 1 51 ? -6.874  -1.782  -3.372  1.00 0.00 ? 51 SER A HG   4  
ATOM 5115  N N    . VAL A 1 52 ? -4.383  -1.158  -1.209  1.00 0.00 ? 52 VAL A N    4  
ATOM 5116  C CA   . VAL A 1 52 ? -3.364  -2.173  -1.002  1.00 0.00 ? 52 VAL A CA   4  
ATOM 5117  C C    . VAL A 1 52 ? -3.955  -3.322  -0.183  1.00 0.00 ? 52 VAL A C    4  
ATOM 5118  O O    . VAL A 1 52 ? -4.058  -3.229  1.040   1.00 0.00 ? 52 VAL A O    4  
ATOM 5119  C CB   . VAL A 1 52 ? -2.128  -1.548  -0.350  1.00 0.00 ? 52 VAL A CB   4  
ATOM 5120  C CG1  . VAL A 1 52 ? -1.237  -2.623  0.276   1.00 0.00 ? 52 VAL A CG1  4  
ATOM 5121  C CG2  . VAL A 1 52 ? -1.345  -0.704  -1.358  1.00 0.00 ? 52 VAL A CG2  4  
ATOM 5122  H H    . VAL A 1 52 ? -4.712  -0.713  -0.376  1.00 0.00 ? 52 VAL A H    4  
ATOM 5123  H HA   . VAL A 1 52 ? -3.074  -2.553  -1.981  1.00 0.00 ? 52 VAL A HA   4  
ATOM 5124  H HB   . VAL A 1 52 ? -2.468  -0.888  0.448   1.00 0.00 ? 52 VAL A HB   4  
ATOM 5125  H HG11 . VAL A 1 52 ? -0.382  -2.149  0.758   1.00 0.00 ? 52 VAL A HG11 4  
ATOM 5126  H HG12 . VAL A 1 52 ? -1.808  -3.182  1.016   1.00 0.00 ? 52 VAL A HG12 4  
ATOM 5127  H HG13 . VAL A 1 52 ? -0.886  -3.302  -0.501  1.00 0.00 ? 52 VAL A HG13 4  
ATOM 5128  H HG21 . VAL A 1 52 ? -0.847  -1.360  -2.072  1.00 0.00 ? 52 VAL A HG21 4  
ATOM 5129  H HG22 . VAL A 1 52 ? -2.030  -0.044  -1.889  1.00 0.00 ? 52 VAL A HG22 4  
ATOM 5130  H HG23 . VAL A 1 52 ? -0.600  -0.108  -0.831  1.00 0.00 ? 52 VAL A HG23 4  
ATOM 5131  N N    . THR A 1 53 ? -4.328  -4.379  -0.889  1.00 0.00 ? 53 THR A N    4  
ATOM 5132  C CA   . THR A 1 53 ? -4.906  -5.545  -0.243  1.00 0.00 ? 53 THR A CA   4  
ATOM 5133  C C    . THR A 1 53 ? -3.822  -6.581  0.057   1.00 0.00 ? 53 THR A C    4  
ATOM 5134  O O    . THR A 1 53 ? -3.126  -7.037  -0.850  1.00 0.00 ? 53 THR A O    4  
ATOM 5135  C CB   . THR A 1 53 ? -6.024  -6.078  -1.142  1.00 0.00 ? 53 THR A CB   4  
ATOM 5136  O OG1  . THR A 1 53 ? -5.516  -5.912  -2.463  1.00 0.00 ? 53 THR A OG1  4  
ATOM 5137  C CG2  . THR A 1 53 ? -7.273  -5.195  -1.109  1.00 0.00 ? 53 THR A CG2  4  
ATOM 5138  H H    . THR A 1 53 ? -4.241  -4.446  -1.883  1.00 0.00 ? 53 THR A H    4  
ATOM 5139  H HA   . THR A 1 53 ? -5.326  -5.235  0.714   1.00 0.00 ? 53 THR A HA   4  
ATOM 5140  H HB   . THR A 1 53 ? -6.269  -7.109  -0.888  1.00 0.00 ? 53 THR A HB   4  
ATOM 5141  H HG1  . THR A 1 53 ? -5.607  -6.767  -2.974  1.00 0.00 ? 53 THR A HG1  4  
ATOM 5142  H HG21 . THR A 1 53 ? -7.227  -4.470  -1.921  1.00 0.00 ? 53 THR A HG21 4  
ATOM 5143  H HG22 . THR A 1 53 ? -8.161  -5.817  -1.227  1.00 0.00 ? 53 THR A HG22 4  
ATOM 5144  H HG23 . THR A 1 53 ? -7.322  -4.670  -0.155  1.00 0.00 ? 53 THR A HG23 4  
ATOM 5145  N N    . ILE A 1 54 ? -3.711  -6.922  1.332   1.00 0.00 ? 54 ILE A N    4  
ATOM 5146  C CA   . ILE A 1 54 ? -2.722  -7.896  1.763   1.00 0.00 ? 54 ILE A CA   4  
ATOM 5147  C C    . ILE A 1 54 ? -3.391  -9.265  1.909   1.00 0.00 ? 54 ILE A C    4  
ATOM 5148  O O    . ILE A 1 54 ? -4.081  -9.520  2.895   1.00 0.00 ? 54 ILE A O    4  
ATOM 5149  C CB   . ILE A 1 54 ? -2.017  -7.418  3.033   1.00 0.00 ? 54 ILE A CB   4  
ATOM 5150  C CG1  . ILE A 1 54 ? -1.169  -6.174  2.755   1.00 0.00 ? 54 ILE A CG1  4  
ATOM 5151  C CG2  . ILE A 1 54 ? -1.193  -8.544  3.660   1.00 0.00 ? 54 ILE A CG2  4  
ATOM 5152  C CD1  . ILE A 1 54 ? -0.726  -5.509  4.060   1.00 0.00 ? 54 ILE A CD1  4  
ATOM 5153  H H    . ILE A 1 54 ? -4.280  -6.546  2.063   1.00 0.00 ? 54 ILE A H    4  
ATOM 5154  H HA   . ILE A 1 54 ? -1.966  -7.963  0.980   1.00 0.00 ? 54 ILE A HA   4  
ATOM 5155  H HB   . ILE A 1 54 ? -2.777  -7.133  3.760   1.00 0.00 ? 54 ILE A HB   4  
ATOM 5156  H HG12 . ILE A 1 54 ? -0.294  -6.451  2.168   1.00 0.00 ? 54 ILE A HG12 4  
ATOM 5157  H HG13 . ILE A 1 54 ? -1.743  -5.466  2.158   1.00 0.00 ? 54 ILE A HG13 4  
ATOM 5158  H HG21 . ILE A 1 54 ? -1.772  -9.021  4.451   1.00 0.00 ? 54 ILE A HG21 4  
ATOM 5159  H HG22 . ILE A 1 54 ? -0.944  -9.281  2.897   1.00 0.00 ? 54 ILE A HG22 4  
ATOM 5160  H HG23 . ILE A 1 54 ? -0.275  -8.132  4.080   1.00 0.00 ? 54 ILE A HG23 4  
ATOM 5161  H HD11 . ILE A 1 54 ? -1.101  -4.486  4.091   1.00 0.00 ? 54 ILE A HD11 4  
ATOM 5162  H HD12 . ILE A 1 54 ? -1.124  -6.069  4.906   1.00 0.00 ? 54 ILE A HD12 4  
ATOM 5163  H HD13 . ILE A 1 54 ? 0.363   -5.499  4.111   1.00 0.00 ? 54 ILE A HD13 4  
ATOM 5164  N N    . ASP A 1 55 ? -3.163  -10.109 0.914   1.00 0.00 ? 55 ASP A N    4  
ATOM 5165  C CA   . ASP A 1 55 ? -3.734  -11.444 0.919   1.00 0.00 ? 55 ASP A CA   4  
ATOM 5166  C C    . ASP A 1 55 ? -5.260  -11.342 0.879   1.00 0.00 ? 55 ASP A C    4  
ATOM 5167  O O    . ASP A 1 55 ? -5.959  -12.318 1.145   1.00 0.00 ? 55 ASP A O    4  
ATOM 5168  C CB   . ASP A 1 55 ? -3.345  -12.205 2.188   1.00 0.00 ? 55 ASP A CB   4  
ATOM 5169  C CG   . ASP A 1 55 ? -3.727  -13.686 2.197   1.00 0.00 ? 55 ASP A CG   4  
ATOM 5170  O OD1  . ASP A 1 55 ? -4.064  -14.192 1.105   1.00 0.00 ? 55 ASP A OD1  4  
ATOM 5171  O OD2  . ASP A 1 55 ? -3.674  -14.280 3.296   1.00 0.00 ? 55 ASP A OD2  4  
ATOM 5172  H H    . ASP A 1 55 ? -2.600  -9.893  0.116   1.00 0.00 ? 55 ASP A H    4  
ATOM 5173  H HA   . ASP A 1 55 ? -3.326  -11.934 0.035   1.00 0.00 ? 55 ASP A HA   4  
ATOM 5174  H HB2  . ASP A 1 55 ? -2.267  -12.122 2.328   1.00 0.00 ? 55 ASP A HB2  4  
ATOM 5175  H HB3  . ASP A 1 55 ? -3.815  -11.719 3.044   1.00 0.00 ? 55 ASP A HB3  4  
ATOM 5176  N N    . GLY A 1 56 ? -5.732  -10.150 0.543   1.00 0.00 ? 56 GLY A N    4  
ATOM 5177  C CA   . GLY A 1 56 ? -7.163  -9.907  0.464   1.00 0.00 ? 56 GLY A CA   4  
ATOM 5178  C C    . GLY A 1 56 ? -7.597  -8.855  1.487   1.00 0.00 ? 56 GLY A C    4  
ATOM 5179  O O    . GLY A 1 56 ? -8.568  -8.133  1.266   1.00 0.00 ? 56 GLY A O    4  
ATOM 5180  H H    . GLY A 1 56 ? -5.157  -9.361  0.328   1.00 0.00 ? 56 GLY A H    4  
ATOM 5181  H HA2  . GLY A 1 56 ? -7.424  -9.572  -0.540  1.00 0.00 ? 56 GLY A HA2  4  
ATOM 5182  H HA3  . GLY A 1 56 ? -7.704  -10.837 0.641   1.00 0.00 ? 56 GLY A HA3  4  
ATOM 5183  N N    . VAL A 1 57 ? -6.858  -8.803  2.586   1.00 0.00 ? 57 VAL A N    4  
ATOM 5184  C CA   . VAL A 1 57 ? -7.155  -7.852  3.643   1.00 0.00 ? 57 VAL A CA   4  
ATOM 5185  C C    . VAL A 1 57 ? -6.692  -6.458  3.215   1.00 0.00 ? 57 VAL A C    4  
ATOM 5186  O O    . VAL A 1 57 ? -5.514  -6.253  2.927   1.00 0.00 ? 57 VAL A O    4  
ATOM 5187  C CB   . VAL A 1 57 ? -6.520  -8.315  4.956   1.00 0.00 ? 57 VAL A CB   4  
ATOM 5188  C CG1  . VAL A 1 57 ? -6.469  -7.173  5.973   1.00 0.00 ? 57 VAL A CG1  4  
ATOM 5189  C CG2  . VAL A 1 57 ? -7.263  -9.525  5.528   1.00 0.00 ? 57 VAL A CG2  4  
ATOM 5190  H H    . VAL A 1 57 ? -6.070  -9.395  2.758   1.00 0.00 ? 57 VAL A H    4  
ATOM 5191  H HA   . VAL A 1 57 ? -8.236  -7.837  3.778   1.00 0.00 ? 57 VAL A HA   4  
ATOM 5192  H HB   . VAL A 1 57 ? -5.496  -8.621  4.744   1.00 0.00 ? 57 VAL A HB   4  
ATOM 5193  H HG11 . VAL A 1 57 ? -6.016  -7.530  6.898   1.00 0.00 ? 57 VAL A HG11 4  
ATOM 5194  H HG12 . VAL A 1 57 ? -5.873  -6.354  5.570   1.00 0.00 ? 57 VAL A HG12 4  
ATOM 5195  H HG13 . VAL A 1 57 ? -7.481  -6.821  6.176   1.00 0.00 ? 57 VAL A HG13 4  
ATOM 5196  H HG21 . VAL A 1 57 ? -7.138  -9.550  6.610   1.00 0.00 ? 57 VAL A HG21 4  
ATOM 5197  H HG22 . VAL A 1 57 ? -8.323  -9.448  5.286   1.00 0.00 ? 57 VAL A HG22 4  
ATOM 5198  H HG23 . VAL A 1 57 ? -6.857  -10.439 5.094   1.00 0.00 ? 57 VAL A HG23 4  
ATOM 5199  N N    . THR A 1 58 ? -7.644  -5.537  3.185   1.00 0.00 ? 58 THR A N    4  
ATOM 5200  C CA   . THR A 1 58 ? -7.349  -4.169  2.796   1.00 0.00 ? 58 THR A CA   4  
ATOM 5201  C C    . THR A 1 58 ? -6.668  -3.423  3.945   1.00 0.00 ? 58 THR A C    4  
ATOM 5202  O O    . THR A 1 58 ? -6.991  -3.643  5.111   1.00 0.00 ? 58 THR A O    4  
ATOM 5203  C CB   . THR A 1 58 ? -8.654  -3.516  2.336   1.00 0.00 ? 58 THR A CB   4  
ATOM 5204  O OG1  . THR A 1 58 ? -9.217  -4.463  1.432   1.00 0.00 ? 58 THR A OG1  4  
ATOM 5205  C CG2  . THR A 1 58 ? -8.416  -2.274  1.475   1.00 0.00 ? 58 THR A CG2  4  
ATOM 5206  H H    . THR A 1 58 ? -8.600  -5.713  3.420   1.00 0.00 ? 58 THR A H    4  
ATOM 5207  H HA   . THR A 1 58 ? -6.642  -4.192  1.966   1.00 0.00 ? 58 THR A HA   4  
ATOM 5208  H HB   . THR A 1 58 ? -9.293  -3.282  3.188   1.00 0.00 ? 58 THR A HB   4  
ATOM 5209  H HG1  . THR A 1 58 ? -9.766  -5.131  1.935   1.00 0.00 ? 58 THR A HG1  4  
ATOM 5210  H HG21 . THR A 1 58 ? -7.694  -1.623  1.967   1.00 0.00 ? 58 THR A HG21 4  
ATOM 5211  H HG22 . THR A 1 58 ? -8.029  -2.576  0.502   1.00 0.00 ? 58 THR A HG22 4  
ATOM 5212  H HG23 . THR A 1 58 ? -9.356  -1.738  1.342   1.00 0.00 ? 58 THR A HG23 4  
ATOM 5213  N N    . TYR A 1 59 ? -5.737  -2.555  3.575   1.00 0.00 ? 59 TYR A N    4  
ATOM 5214  C CA   . TYR A 1 59 ? -5.008  -1.775  4.561   1.00 0.00 ? 59 TYR A CA   4  
ATOM 5215  C C    . TYR A 1 59 ? -4.972  -0.296  4.172   1.00 0.00 ? 59 TYR A C    4  
ATOM 5216  O O    . TYR A 1 59 ? -5.806  0.488   4.622   1.00 0.00 ? 59 TYR A O    4  
ATOM 5217  C CB   . TYR A 1 59 ? -3.580  -2.325  4.561   1.00 0.00 ? 59 TYR A CB   4  
ATOM 5218  C CG   . TYR A 1 59 ? -3.374  -3.522  5.491   1.00 0.00 ? 59 TYR A CG   4  
ATOM 5219  C CD1  . TYR A 1 59 ? -3.735  -4.788  5.076   1.00 0.00 ? 59 TYR A CD1  4  
ATOM 5220  C CD2  . TYR A 1 59 ? -2.828  -3.336  6.744   1.00 0.00 ? 59 TYR A CD2  4  
ATOM 5221  C CE1  . TYR A 1 59 ? -3.542  -5.915  5.951   1.00 0.00 ? 59 TYR A CE1  4  
ATOM 5222  C CE2  . TYR A 1 59 ? -2.634  -4.463  7.620   1.00 0.00 ? 59 TYR A CE2  4  
ATOM 5223  C CZ   . TYR A 1 59 ? -3.000  -5.697  7.180   1.00 0.00 ? 59 TYR A CZ   4  
ATOM 5224  O OH   . TYR A 1 59 ? -2.817  -6.761  8.007   1.00 0.00 ? 59 TYR A OH   4  
ATOM 5225  H H    . TYR A 1 59 ? -5.480  -2.381  2.625   1.00 0.00 ? 59 TYR A H    4  
ATOM 5226  H HA   . TYR A 1 59 ? -5.519  -1.879  5.518   1.00 0.00 ? 59 TYR A HA   4  
ATOM 5227  H HB2  . TYR A 1 59 ? -3.314  -2.617  3.545   1.00 0.00 ? 59 TYR A HB2  4  
ATOM 5228  H HB3  . TYR A 1 59 ? -2.895  -1.529  4.853   1.00 0.00 ? 59 TYR A HB3  4  
ATOM 5229  H HD1  . TYR A 1 59 ? -4.167  -4.935  4.086   1.00 0.00 ? 59 TYR A HD1  4  
ATOM 5230  H HD2  . TYR A 1 59 ? -2.542  -2.337  7.072   1.00 0.00 ? 59 TYR A HD2  4  
ATOM 5231  H HE1  . TYR A 1 59 ? -3.822  -6.920  5.637   1.00 0.00 ? 59 TYR A HE1  4  
ATOM 5232  H HE2  . TYR A 1 59 ? -2.203  -4.331  8.612   1.00 0.00 ? 59 TYR A HE2  4  
ATOM 5233  H HH   . TYR A 1 59 ? -2.221  -6.505  8.767   1.00 0.00 ? 59 TYR A HH   4  
ATOM 5234  N N    . GLY A 1 60 ? -3.997  0.041   3.340   1.00 0.00 ? 60 GLY A N    4  
ATOM 5235  C CA   . GLY A 1 60 ? -3.842  1.412   2.886   1.00 0.00 ? 60 GLY A CA   4  
ATOM 5236  C C    . GLY A 1 60 ? -4.542  1.628   1.542   1.00 0.00 ? 60 GLY A C    4  
ATOM 5237  O O    . GLY A 1 60 ? -4.323  0.873   0.596   1.00 0.00 ? 60 GLY A O    4  
ATOM 5238  H H    . GLY A 1 60 ? -3.323  -0.603  2.978   1.00 0.00 ? 60 GLY A H    4  
ATOM 5239  H HA2  . GLY A 1 60 ? -4.255  2.094   3.629   1.00 0.00 ? 60 GLY A HA2  4  
ATOM 5240  H HA3  . GLY A 1 60 ? -2.782  1.649   2.789   1.00 0.00 ? 60 GLY A HA3  4  
ATOM 5241  N N    . SER A 1 61 ? -5.371  2.660   1.502   1.00 0.00 ? 61 SER A N    4  
ATOM 5242  C CA   . SER A 1 61 ? -6.105  2.984   0.291   1.00 0.00 ? 61 SER A CA   4  
ATOM 5243  C C    . SER A 1 61 ? -6.346  4.493   0.213   1.00 0.00 ? 61 SER A C    4  
ATOM 5244  O O    . SER A 1 61 ? -6.456  5.162   1.240   1.00 0.00 ? 61 SER A O    4  
ATOM 5245  C CB   . SER A 1 61 ? -7.435  2.231   0.235   1.00 0.00 ? 61 SER A CB   4  
ATOM 5246  O OG   . SER A 1 61 ? -8.530  3.048   0.639   1.00 0.00 ? 61 SER A OG   4  
ATOM 5247  H H    . SER A 1 61 ? -5.544  3.269   2.277   1.00 0.00 ? 61 SER A H    4  
ATOM 5248  H HA   . SER A 1 61 ? -5.467  2.656   -0.530  1.00 0.00 ? 61 SER A HA   4  
ATOM 5249  H HB2  . SER A 1 61 ? -7.606  1.873   -0.781  1.00 0.00 ? 61 SER A HB2  4  
ATOM 5250  H HB3  . SER A 1 61 ? -7.382  1.352   0.878   1.00 0.00 ? 61 SER A HB3  4  
ATOM 5251  H HG   . SER A 1 61 ? -9.192  3.127   -0.106  1.00 0.00 ? 61 SER A HG   4  
ATOM 5252  N N    . GLY A 1 62 ? -6.422  4.986   -1.015  1.00 0.00 ? 62 GLY A N    4  
ATOM 5253  C CA   . GLY A 1 62 ? -6.648  6.403   -1.240  1.00 0.00 ? 62 GLY A CA   4  
ATOM 5254  C C    . GLY A 1 62 ? -6.686  6.722   -2.736  1.00 0.00 ? 62 GLY A C    4  
ATOM 5255  O O    . GLY A 1 62 ? -6.467  5.842   -3.567  1.00 0.00 ? 62 GLY A O    4  
ATOM 5256  H H    . GLY A 1 62 ? -6.332  4.435   -1.844  1.00 0.00 ? 62 GLY A H    4  
ATOM 5257  H HA2  . GLY A 1 62 ? -7.588  6.703   -0.777  1.00 0.00 ? 62 GLY A HA2  4  
ATOM 5258  H HA3  . GLY A 1 62 ? -5.858  6.982   -0.761  1.00 0.00 ? 62 GLY A HA3  4  
ATOM 5259  N N    . THR A 1 63 ? -6.964  7.982   -3.033  1.00 0.00 ? 63 THR A N    4  
ATOM 5260  C CA   . THR A 1 63 ? -7.033  8.428   -4.414  1.00 0.00 ? 63 THR A CA   4  
ATOM 5261  C C    . THR A 1 63 ? -6.191  9.690   -4.610  1.00 0.00 ? 63 THR A C    4  
ATOM 5262  O O    . THR A 1 63 ? -5.642  10.229  -3.651  1.00 0.00 ? 63 THR A O    4  
ATOM 5263  C CB   . THR A 1 63 ? -8.508  8.618   -4.777  1.00 0.00 ? 63 THR A CB   4  
ATOM 5264  O OG1  . THR A 1 63 ? -8.981  9.563   -3.821  1.00 0.00 ? 63 THR A OG1  4  
ATOM 5265  C CG2  . THR A 1 63 ? -9.344  7.365   -4.507  1.00 0.00 ? 63 THR A CG2  4  
ATOM 5266  H H    . THR A 1 63 ? -7.141  8.692   -2.351  1.00 0.00 ? 63 THR A H    4  
ATOM 5267  H HA   . THR A 1 63 ? -6.600  7.653   -5.047  1.00 0.00 ? 63 THR A HA   4  
ATOM 5268  H HB   . THR A 1 63 ? -8.615  8.943   -5.812  1.00 0.00 ? 63 THR A HB   4  
ATOM 5269  H HG1  . THR A 1 63 ? -9.555  10.247  -4.271  1.00 0.00 ? 63 THR A HG1  4  
ATOM 5270  H HG21 . THR A 1 63 ? -8.682  6.531   -4.275  1.00 0.00 ? 63 THR A HG21 4  
ATOM 5271  H HG22 . THR A 1 63 ? -10.009 7.548   -3.663  1.00 0.00 ? 63 THR A HG22 4  
ATOM 5272  H HG23 . THR A 1 63 ? -9.935  7.126   -5.391  1.00 0.00 ? 63 THR A HG23 4  
ATOM 5273  N N    . ALA A 1 64 ? -6.117  10.125  -5.860  1.00 0.00 ? 64 ALA A N    4  
ATOM 5274  C CA   . ALA A 1 64 ? -5.351  11.314  -6.194  1.00 0.00 ? 64 ALA A CA   4  
ATOM 5275  C C    . ALA A 1 64 ? -5.708  11.763  -7.612  1.00 0.00 ? 64 ALA A C    4  
ATOM 5276  O O    . ALA A 1 64 ? -6.571  11.169  -8.257  1.00 0.00 ? 64 ALA A O    4  
ATOM 5277  C CB   . ALA A 1 64 ? -3.858  11.022  -6.033  1.00 0.00 ? 64 ALA A CB   4  
ATOM 5278  H H    . ALA A 1 64 ? -6.567  9.681   -6.634  1.00 0.00 ? 64 ALA A H    4  
ATOM 5279  H HA   . ALA A 1 64 ? -5.633  12.098  -5.491  1.00 0.00 ? 64 ALA A HA   4  
ATOM 5280  H HB1  . ALA A 1 64 ? -3.288  11.660  -6.708  1.00 0.00 ? 64 ALA A HB1  4  
ATOM 5281  H HB2  . ALA A 1 64 ? -3.558  11.221  -5.004  1.00 0.00 ? 64 ALA A HB2  4  
ATOM 5282  H HB3  . ALA A 1 64 ? -3.665  9.976   -6.272  1.00 0.00 ? 64 ALA A HB3  4  
ATOM 5283  N N    . SER A 1 65 ? -5.026  12.809  -8.057  1.00 0.00 ? 65 SER A N    4  
ATOM 5284  C CA   . SER A 1 65 ? -5.260  13.344  -9.387  1.00 0.00 ? 65 SER A CA   4  
ATOM 5285  C C    . SER A 1 65 ? -4.567  12.469  -10.433 1.00 0.00 ? 65 SER A C    4  
ATOM 5286  O O    . SER A 1 65 ? -4.961  12.459  -11.598 1.00 0.00 ? 65 SER A O    4  
ATOM 5287  C CB   . SER A 1 65 ? -4.767  14.789  -9.493  1.00 0.00 ? 65 SER A CB   4  
ATOM 5288  O OG   . SER A 1 65 ? -5.804  15.728  -9.222  1.00 0.00 ? 65 SER A OG   4  
ATOM 5289  H H    . SER A 1 65 ? -4.326  13.286  -7.526  1.00 0.00 ? 65 SER A H    4  
ATOM 5290  H HA   . SER A 1 65 ? -6.341  13.319  -9.522  1.00 0.00 ? 65 SER A HA   4  
ATOM 5291  H HB2  . SER A 1 65 ? -3.946  14.944  -8.794  1.00 0.00 ? 65 SER A HB2  4  
ATOM 5292  H HB3  . SER A 1 65 ? -4.372  14.964  -10.494 1.00 0.00 ? 65 SER A HB3  4  
ATOM 5293  H HG   . SER A 1 65 ? -6.658  15.427  -9.647  1.00 0.00 ? 65 SER A HG   4  
ATOM 5294  N N    . SER A 1 66 ? -3.548  11.754  -9.979  1.00 0.00 ? 66 SER A N    4  
ATOM 5295  C CA   . SER A 1 66 ? -2.797  10.877  -10.861 1.00 0.00 ? 66 SER A CA   4  
ATOM 5296  C C    . SER A 1 66 ? -2.906  9.430   -10.377 1.00 0.00 ? 66 SER A C    4  
ATOM 5297  O O    . SER A 1 66 ? -3.297  9.180   -9.238  1.00 0.00 ? 66 SER A O    4  
ATOM 5298  C CB   . SER A 1 66 ? -1.329  11.302  -10.940 1.00 0.00 ? 66 SER A CB   4  
ATOM 5299  O OG   . SER A 1 66 ? -0.853  11.329  -12.283 1.00 0.00 ? 66 SER A OG   4  
ATOM 5300  H H    . SER A 1 66 ? -3.235  11.767  -9.029  1.00 0.00 ? 66 SER A H    4  
ATOM 5301  H HA   . SER A 1 66 ? -3.260  10.989  -11.842 1.00 0.00 ? 66 SER A HA   4  
ATOM 5302  H HB2  . SER A 1 66 ? -1.213  12.289  -10.494 1.00 0.00 ? 66 SER A HB2  4  
ATOM 5303  H HB3  . SER A 1 66 ? -0.721  10.613  -10.354 1.00 0.00 ? 66 SER A HB3  4  
ATOM 5304  H HG   . SER A 1 66 ? -0.903  10.414  -12.683 1.00 0.00 ? 66 SER A HG   4  
ATOM 5305  N N    . LYS A 1 67 ? -2.553  8.514   -11.267 1.00 0.00 ? 67 LYS A N    4  
ATOM 5306  C CA   . LYS A 1 67 ? -2.606  7.098   -10.945 1.00 0.00 ? 67 LYS A CA   4  
ATOM 5307  C C    . LYS A 1 67 ? -1.505  6.768   -9.935  1.00 0.00 ? 67 LYS A C    4  
ATOM 5308  O O    . LYS A 1 67 ? -1.760  6.111   -8.926  1.00 0.00 ? 67 LYS A O    4  
ATOM 5309  C CB   . LYS A 1 67 ? -2.543  6.256   -12.220 1.00 0.00 ? 67 LYS A CB   4  
ATOM 5310  C CG   . LYS A 1 67 ? -2.801  4.779   -11.915 1.00 0.00 ? 67 LYS A CG   4  
ATOM 5311  C CD   . LYS A 1 67 ? -2.015  3.876   -12.868 1.00 0.00 ? 67 LYS A CD   4  
ATOM 5312  C CE   . LYS A 1 67 ? -2.524  2.435   -12.804 1.00 0.00 ? 67 LYS A CE   4  
ATOM 5313  N NZ   . LYS A 1 67 ? -1.681  1.550   -13.638 1.00 0.00 ? 67 LYS A NZ   4  
ATOM 5314  H H    . LYS A 1 67 ? -2.236  8.725   -12.191 1.00 0.00 ? 67 LYS A H    4  
ATOM 5315  H HA   . LYS A 1 67 ? -3.572  6.905   -10.478 1.00 0.00 ? 67 LYS A HA   4  
ATOM 5316  H HB2  . LYS A 1 67 ? -3.281  6.617   -12.937 1.00 0.00 ? 67 LYS A HB2  4  
ATOM 5317  H HB3  . LYS A 1 67 ? -1.564  6.369   -12.687 1.00 0.00 ? 67 LYS A HB3  4  
ATOM 5318  H HG2  . LYS A 1 67 ? -2.517  4.561   -10.886 1.00 0.00 ? 67 LYS A HG2  4  
ATOM 5319  H HG3  . LYS A 1 67 ? -3.866  4.566   -12.003 1.00 0.00 ? 67 LYS A HG3  4  
ATOM 5320  H HD2  . LYS A 1 67 ? -2.104  4.252   -13.888 1.00 0.00 ? 67 LYS A HD2  4  
ATOM 5321  H HD3  . LYS A 1 67 ? -0.956  3.904   -12.610 1.00 0.00 ? 67 LYS A HD3  4  
ATOM 5322  H HE2  . LYS A 1 67 ? -2.517  2.086   -11.771 1.00 0.00 ? 67 LYS A HE2  4  
ATOM 5323  H HE3  . LYS A 1 67 ? -3.557  2.392   -13.148 1.00 0.00 ? 67 LYS A HE3  4  
ATOM 5324  H HZ1  . LYS A 1 67 ? -2.233  0.791   -13.983 1.00 0.00 ? 67 LYS A HZ1  4  
ATOM 5325  H HZ2  . LYS A 1 67 ? -1.312  2.070   -14.408 1.00 0.00 ? 67 LYS A HZ2  4  
ATOM 5326  H HZ3  . LYS A 1 67 ? -0.928  1.190   -13.087 1.00 0.00 ? 67 LYS A HZ3  4  
ATOM 5327  N N    . LYS A 1 68 ? -0.305  7.238   -10.241 1.00 0.00 ? 68 LYS A N    4  
ATOM 5328  C CA   . LYS A 1 68 ? 0.836   7.001   -9.372  1.00 0.00 ? 68 LYS A CA   4  
ATOM 5329  C C    . LYS A 1 68 ? 0.466   7.381   -7.937  1.00 0.00 ? 68 LYS A C    4  
ATOM 5330  O O    . LYS A 1 68 ? 0.542   6.551   -7.032  1.00 0.00 ? 68 LYS A O    4  
ATOM 5331  C CB   . LYS A 1 68 ? 2.073   7.729   -9.901  1.00 0.00 ? 68 LYS A CB   4  
ATOM 5332  C CG   . LYS A 1 68 ? 3.296   6.810   -9.893  1.00 0.00 ? 68 LYS A CG   4  
ATOM 5333  C CD   . LYS A 1 68 ? 4.582   7.606   -10.121 1.00 0.00 ? 68 LYS A CD   4  
ATOM 5334  C CE   . LYS A 1 68 ? 5.209   8.028   -8.791  1.00 0.00 ? 68 LYS A CE   4  
ATOM 5335  N NZ   . LYS A 1 68 ? 6.686   7.999   -8.882  1.00 0.00 ? 68 LYS A NZ   4  
ATOM 5336  H H    . LYS A 1 68 ? -0.106  7.772   -11.063 1.00 0.00 ? 68 LYS A H    4  
ATOM 5337  H HA   . LYS A 1 68 ? 1.053   5.933   -9.402  1.00 0.00 ? 68 LYS A HA   4  
ATOM 5338  H HB2  . LYS A 1 68 ? 1.886   8.082   -10.915 1.00 0.00 ? 68 LYS A HB2  4  
ATOM 5339  H HB3  . LYS A 1 68 ? 2.271   8.609   -9.290  1.00 0.00 ? 68 LYS A HB3  4  
ATOM 5340  H HG2  . LYS A 1 68 ? 3.353   6.285   -8.939  1.00 0.00 ? 68 LYS A HG2  4  
ATOM 5341  H HG3  . LYS A 1 68 ? 3.190   6.052   -10.668 1.00 0.00 ? 68 LYS A HG3  4  
ATOM 5342  H HD2  . LYS A 1 68 ? 5.292   7.003   -10.687 1.00 0.00 ? 68 LYS A HD2  4  
ATOM 5343  H HD3  . LYS A 1 68 ? 4.365   8.489   -10.722 1.00 0.00 ? 68 LYS A HD3  4  
ATOM 5344  H HE2  . LYS A 1 68 ? 4.875   9.032   -8.527  1.00 0.00 ? 68 LYS A HE2  4  
ATOM 5345  H HE3  . LYS A 1 68 ? 4.874   7.362   -7.996  1.00 0.00 ? 68 LYS A HE3  4  
ATOM 5346  H HZ1  . LYS A 1 68 ? 6.991   7.060   -9.041  1.00 0.00 ? 68 LYS A HZ1  4  
ATOM 5347  H HZ2  . LYS A 1 68 ? 6.985   8.580   -9.639  1.00 0.00 ? 68 LYS A HZ2  4  
ATOM 5348  H HZ3  . LYS A 1 68 ? 7.079   8.337   -8.027  1.00 0.00 ? 68 LYS A HZ3  4  
ATOM 5349  N N    . LEU A 1 69 ? 0.072   8.635   -7.773  1.00 0.00 ? 69 LEU A N    4  
ATOM 5350  C CA   . LEU A 1 69 ? -0.309  9.135   -6.463  1.00 0.00 ? 69 LEU A CA   4  
ATOM 5351  C C    . LEU A 1 69 ? -1.182  8.094   -5.759  1.00 0.00 ? 69 LEU A C    4  
ATOM 5352  O O    . LEU A 1 69 ? -0.925  7.738   -4.610  1.00 0.00 ? 69 LEU A O    4  
ATOM 5353  C CB   . LEU A 1 69 ? -0.970  10.510  -6.586  1.00 0.00 ? 69 LEU A CB   4  
ATOM 5354  C CG   . LEU A 1 69 ? -0.030  11.683  -6.865  1.00 0.00 ? 69 LEU A CG   4  
ATOM 5355  C CD1  . LEU A 1 69 ? 0.413   12.353  -5.563  1.00 0.00 ? 69 LEU A CD1  4  
ATOM 5356  C CD2  . LEU A 1 69 ? 1.162   11.240  -7.716  1.00 0.00 ? 69 LEU A CD2  4  
ATOM 5357  H H    . LEU A 1 69 ? 0.013   9.304   -8.514  1.00 0.00 ? 69 LEU A H    4  
ATOM 5358  H HA   . LEU A 1 69 ? 0.605   9.267   -5.885  1.00 0.00 ? 69 LEU A HA   4  
ATOM 5359  H HB2  . LEU A 1 69 ? -1.711  10.465  -7.384  1.00 0.00 ? 69 LEU A HB2  4  
ATOM 5360  H HB3  . LEU A 1 69 ? -1.510  10.715  -5.662  1.00 0.00 ? 69 LEU A HB3  4  
ATOM 5361  H HG   . LEU A 1 69 ? -0.576  12.430  -7.441  1.00 0.00 ? 69 LEU A HG   4  
ATOM 5362  H HD11 . LEU A 1 69 ? -0.227  12.019  -4.746  1.00 0.00 ? 69 LEU A HD11 4  
ATOM 5363  H HD12 . LEU A 1 69 ? 1.447   12.083  -5.348  1.00 0.00 ? 69 LEU A HD12 4  
ATOM 5364  H HD13 . LEU A 1 69 ? 0.335   13.436  -5.666  1.00 0.00 ? 69 LEU A HD13 4  
ATOM 5365  H HD21 . LEU A 1 69 ? 1.587   10.327  -7.299  1.00 0.00 ? 69 LEU A HD21 4  
ATOM 5366  H HD22 . LEU A 1 69 ? 0.831   11.054  -8.737  1.00 0.00 ? 69 LEU A HD22 4  
ATOM 5367  H HD23 . LEU A 1 69 ? 1.919   12.025  -7.717  1.00 0.00 ? 69 LEU A HD23 4  
ATOM 5368  N N    . ALA A 1 70 ? -2.196  7.635   -6.478  1.00 0.00 ? 70 ALA A N    4  
ATOM 5369  C CA   . ALA A 1 70 ? -3.108  6.642   -5.937  1.00 0.00 ? 70 ALA A CA   4  
ATOM 5370  C C    . ALA A 1 70 ? -2.314  5.407   -5.506  1.00 0.00 ? 70 ALA A C    4  
ATOM 5371  O O    . ALA A 1 70 ? -2.391  4.986   -4.353  1.00 0.00 ? 70 ALA A O    4  
ATOM 5372  C CB   . ALA A 1 70 ? -4.179  6.311   -6.978  1.00 0.00 ? 70 ALA A CB   4  
ATOM 5373  H H    . ALA A 1 70 ? -2.398  7.930   -7.412  1.00 0.00 ? 70 ALA A H    4  
ATOM 5374  H HA   . ALA A 1 70 ? -3.591  7.076   -5.062  1.00 0.00 ? 70 ALA A HA   4  
ATOM 5375  H HB1  . ALA A 1 70 ? -4.466  7.221   -7.506  1.00 0.00 ? 70 ALA A HB1  4  
ATOM 5376  H HB2  . ALA A 1 70 ? -3.783  5.588   -7.691  1.00 0.00 ? 70 ALA A HB2  4  
ATOM 5377  H HB3  . ALA A 1 70 ? -5.052  5.889   -6.480  1.00 0.00 ? 70 ALA A HB3  4  
ATOM 5378  N N    . LYS A 1 71 ? -1.568  4.861   -6.456  1.00 0.00 ? 71 LYS A N    4  
ATOM 5379  C CA   . LYS A 1 71 ? -0.760  3.684   -6.189  1.00 0.00 ? 71 LYS A CA   4  
ATOM 5380  C C    . LYS A 1 71 ? 0.165   3.963   -5.003  1.00 0.00 ? 71 LYS A C    4  
ATOM 5381  O O    . LYS A 1 71 ? 0.433   3.073   -4.197  1.00 0.00 ? 71 LYS A O    4  
ATOM 5382  C CB   . LYS A 1 71 ? -0.021  3.243   -7.454  1.00 0.00 ? 71 LYS A CB   4  
ATOM 5383  C CG   . LYS A 1 71 ? -0.083  1.723   -7.624  1.00 0.00 ? 71 LYS A CG   4  
ATOM 5384  C CD   . LYS A 1 71 ? 0.818   1.262   -8.771  1.00 0.00 ? 71 LYS A CD   4  
ATOM 5385  C CE   . LYS A 1 71 ? 2.091   0.602   -8.238  1.00 0.00 ? 71 LYS A CE   4  
ATOM 5386  N NZ   . LYS A 1 71 ? 2.838   -0.046  -9.339  1.00 0.00 ? 71 LYS A NZ   4  
ATOM 5387  H H    . LYS A 1 71 ? -1.511  5.210   -7.392  1.00 0.00 ? 71 LYS A H    4  
ATOM 5388  H HA   . LYS A 1 71 ? -1.440  2.877   -5.915  1.00 0.00 ? 71 LYS A HA   4  
ATOM 5389  H HB2  . LYS A 1 71 ? -0.462  3.727   -8.325  1.00 0.00 ? 71 LYS A HB2  4  
ATOM 5390  H HB3  . LYS A 1 71 ? 1.019   3.564   -7.403  1.00 0.00 ? 71 LYS A HB3  4  
ATOM 5391  H HG2  . LYS A 1 71 ? 0.225   1.238   -6.698  1.00 0.00 ? 71 LYS A HG2  4  
ATOM 5392  H HG3  . LYS A 1 71 ? -1.111  1.417   -7.818  1.00 0.00 ? 71 LYS A HG3  4  
ATOM 5393  H HD2  . LYS A 1 71 ? 0.276   0.559   -9.403  1.00 0.00 ? 71 LYS A HD2  4  
ATOM 5394  H HD3  . LYS A 1 71 ? 1.081   2.115   -9.397  1.00 0.00 ? 71 LYS A HD3  4  
ATOM 5395  H HE2  . LYS A 1 71 ? 2.720   1.350   -7.754  1.00 0.00 ? 71 LYS A HE2  4  
ATOM 5396  H HE3  . LYS A 1 71 ? 1.834   -0.137  -7.480  1.00 0.00 ? 71 LYS A HE3  4  
ATOM 5397  H HZ1  . LYS A 1 71 ? 3.240   -0.901  -9.010  1.00 0.00 ? 71 LYS A HZ1  4  
ATOM 5398  H HZ2  . LYS A 1 71 ? 2.215   -0.240  -10.096 1.00 0.00 ? 71 LYS A HZ2  4  
ATOM 5399  H HZ3  . LYS A 1 71 ? 3.565   0.565   -9.653  1.00 0.00 ? 71 LYS A HZ3  4  
ATOM 5400  N N    . ASN A 1 72 ? 0.627   5.203   -4.933  1.00 0.00 ? 72 ASN A N    4  
ATOM 5401  C CA   . ASN A 1 72 ? 1.516   5.611   -3.858  1.00 0.00 ? 72 ASN A CA   4  
ATOM 5402  C C    . ASN A 1 72 ? 0.735   5.648   -2.543  1.00 0.00 ? 72 ASN A C    4  
ATOM 5403  O O    . ASN A 1 72 ? 1.094   4.965   -1.585  1.00 0.00 ? 72 ASN A O    4  
ATOM 5404  C CB   . ASN A 1 72 ? 2.081   7.010   -4.112  1.00 0.00 ? 72 ASN A CB   4  
ATOM 5405  C CG   . ASN A 1 72 ? 2.838   7.526   -2.887  1.00 0.00 ? 72 ASN A CG   4  
ATOM 5406  O OD1  . ASN A 1 72 ? 4.050   7.424   -2.785  1.00 0.00 ? 72 ASN A OD1  4  
ATOM 5407  N ND2  . ASN A 1 72 ? 2.059   8.083   -1.965  1.00 0.00 ? 72 ASN A ND2  4  
ATOM 5408  H H    . ASN A 1 72 ? 0.403   5.921   -5.592  1.00 0.00 ? 72 ASN A H    4  
ATOM 5409  H HA   . ASN A 1 72 ? 2.313   4.868   -3.849  1.00 0.00 ? 72 ASN A HA   4  
ATOM 5410  H HB2  . ASN A 1 72 ? 2.749   6.985   -4.973  1.00 0.00 ? 72 ASN A HB2  4  
ATOM 5411  H HB3  . ASN A 1 72 ? 1.269   7.695   -4.358  1.00 0.00 ? 72 ASN A HB3  4  
ATOM 5412  H HD21 . ASN A 1 72 ? 1.071   8.135   -2.110  1.00 0.00 ? 72 ASN A HD21 4  
ATOM 5413  H HD22 . ASN A 1 72 ? 2.461   8.451   -1.126  1.00 0.00 ? 72 ASN A HD22 4  
ATOM 5414  N N    . LYS A 1 73 ? -0.317  6.452   -2.538  1.00 0.00 ? 73 LYS A N    4  
ATOM 5415  C CA   . LYS A 1 73 ? -1.151  6.587   -1.356  1.00 0.00 ? 73 LYS A CA   4  
ATOM 5416  C C    . LYS A 1 73 ? -1.502  5.196   -0.824  1.00 0.00 ? 73 LYS A C    4  
ATOM 5417  O O    . LYS A 1 73 ? -1.343  4.924   0.365   1.00 0.00 ? 73 LYS A O    4  
ATOM 5418  C CB   . LYS A 1 73 ? -2.373  7.456   -1.659  1.00 0.00 ? 73 LYS A CB   4  
ATOM 5419  C CG   . LYS A 1 73 ? -1.964  8.909   -1.912  1.00 0.00 ? 73 LYS A CG   4  
ATOM 5420  C CD   . LYS A 1 73 ? -3.185  9.831   -1.906  1.00 0.00 ? 73 LYS A CD   4  
ATOM 5421  C CE   . LYS A 1 73 ? -3.195  10.720  -0.661  1.00 0.00 ? 73 LYS A CE   4  
ATOM 5422  N NZ   . LYS A 1 73 ? -3.167  9.892   0.566   1.00 0.00 ? 73 LYS A NZ   4  
ATOM 5423  H H    . LYS A 1 73 ? -0.602  7.004   -3.322  1.00 0.00 ? 73 LYS A H    4  
ATOM 5424  H HA   . LYS A 1 73 ? -0.564  7.108   -0.600  1.00 0.00 ? 73 LYS A HA   4  
ATOM 5425  H HB2  . LYS A 1 73 ? -2.896  7.065   -2.532  1.00 0.00 ? 73 LYS A HB2  4  
ATOM 5426  H HB3  . LYS A 1 73 ? -3.072  7.411   -0.824  1.00 0.00 ? 73 LYS A HB3  4  
ATOM 5427  H HG2  . LYS A 1 73 ? -1.258  9.230   -1.146  1.00 0.00 ? 73 LYS A HG2  4  
ATOM 5428  H HG3  . LYS A 1 73 ? -1.451  8.984   -2.870  1.00 0.00 ? 73 LYS A HG3  4  
ATOM 5429  H HD2  . LYS A 1 73 ? -3.179  10.453  -2.801  1.00 0.00 ? 73 LYS A HD2  4  
ATOM 5430  H HD3  . LYS A 1 73 ? -4.096  9.234   -1.939  1.00 0.00 ? 73 LYS A HD3  4  
ATOM 5431  H HE2  . LYS A 1 73 ? -2.334  11.388  -0.676  1.00 0.00 ? 73 LYS A HE2  4  
ATOM 5432  H HE3  . LYS A 1 73 ? -4.086  11.348  -0.662  1.00 0.00 ? 73 LYS A HE3  4  
ATOM 5433  H HZ1  . LYS A 1 73 ? -3.294  10.479  1.366   1.00 0.00 ? 73 LYS A HZ1  4  
ATOM 5434  H HZ2  . LYS A 1 73 ? -3.901  9.215   0.529   1.00 0.00 ? 73 LYS A HZ2  4  
ATOM 5435  H HZ3  . LYS A 1 73 ? -2.285  9.425   0.633   1.00 0.00 ? 73 LYS A HZ3  4  
ATOM 5436  N N    . ALA A 1 74 ? -1.974  4.352   -1.730  1.00 0.00 ? 74 ALA A N    4  
ATOM 5437  C CA   . ALA A 1 74 ? -2.350  2.997   -1.366  1.00 0.00 ? 74 ALA A CA   4  
ATOM 5438  C C    . ALA A 1 74 ? -1.235  2.372   -0.525  1.00 0.00 ? 74 ALA A C    4  
ATOM 5439  O O    . ALA A 1 74 ? -1.505  1.704   0.473   1.00 0.00 ? 74 ALA A O    4  
ATOM 5440  C CB   . ALA A 1 74 ? -2.645  2.191   -2.633  1.00 0.00 ? 74 ALA A CB   4  
ATOM 5441  H H    . ALA A 1 74 ? -2.101  4.582   -2.695  1.00 0.00 ? 74 ALA A H    4  
ATOM 5442  H HA   . ALA A 1 74 ? -3.258  3.053   -0.766  1.00 0.00 ? 74 ALA A HA   4  
ATOM 5443  H HB1  . ALA A 1 74 ? -3.349  1.393   -2.400  1.00 0.00 ? 74 ALA A HB1  4  
ATOM 5444  H HB2  . ALA A 1 74 ? -3.077  2.848   -3.388  1.00 0.00 ? 74 ALA A HB2  4  
ATOM 5445  H HB3  . ALA A 1 74 ? -1.719  1.759   -3.013  1.00 0.00 ? 74 ALA A HB3  4  
ATOM 5446  N N    . ALA A 1 75 ? -0.006  2.611   -0.957  1.00 0.00 ? 75 ALA A N    4  
ATOM 5447  C CA   . ALA A 1 75 ? 1.151   2.080   -0.256  1.00 0.00 ? 75 ALA A CA   4  
ATOM 5448  C C    . ALA A 1 75 ? 1.437   2.944   0.974   1.00 0.00 ? 75 ALA A C    4  
ATOM 5449  O O    . ALA A 1 75 ? 1.406   2.454   2.101   1.00 0.00 ? 75 ALA A O    4  
ATOM 5450  C CB   . ALA A 1 75 ? 2.343   2.016   -1.214  1.00 0.00 ? 75 ALA A CB   4  
ATOM 5451  H H    . ALA A 1 75 ? 0.205   3.155   -1.769  1.00 0.00 ? 75 ALA A H    4  
ATOM 5452  H HA   . ALA A 1 75 ? 0.907   1.069   0.069   1.00 0.00 ? 75 ALA A HA   4  
ATOM 5453  H HB1  . ALA A 1 75 ? 1.993   2.139   -2.238  1.00 0.00 ? 75 ALA A HB1  4  
ATOM 5454  H HB2  . ALA A 1 75 ? 3.047   2.813   -0.972  1.00 0.00 ? 75 ALA A HB2  4  
ATOM 5455  H HB3  . ALA A 1 75 ? 2.839   1.051   -1.112  1.00 0.00 ? 75 ALA A HB3  4  
ATOM 5456  N N    . ARG A 1 76 ? 1.710   4.214   0.715   1.00 0.00 ? 76 ARG A N    4  
ATOM 5457  C CA   . ARG A 1 76 ? 2.001   5.151   1.787   1.00 0.00 ? 76 ARG A CA   4  
ATOM 5458  C C    . ARG A 1 76 ? 1.017   4.957   2.943   1.00 0.00 ? 76 ARG A C    4  
ATOM 5459  O O    . ARG A 1 76 ? 1.370   5.160   4.104   1.00 0.00 ? 76 ARG A O    4  
ATOM 5460  C CB   . ARG A 1 76 ? 1.919   6.596   1.293   1.00 0.00 ? 76 ARG A CB   4  
ATOM 5461  C CG   . ARG A 1 76 ? 2.280   7.578   2.410   1.00 0.00 ? 76 ARG A CG   4  
ATOM 5462  C CD   . ARG A 1 76 ? 1.575   8.921   2.208   1.00 0.00 ? 76 ARG A CD   4  
ATOM 5463  N NE   . ARG A 1 76 ? 1.646   9.722   3.450   1.00 0.00 ? 76 ARG A NE   4  
ATOM 5464  C CZ   . ARG A 1 76 ? 2.712   10.446  3.818   1.00 0.00 ? 76 ARG A CZ   4  
ATOM 5465  N NH1  . ARG A 1 76 ? 3.804   10.473  3.041   1.00 0.00 ? 76 ARG A NH1  4  
ATOM 5466  N NH2  . ARG A 1 76 ? 2.688   11.142  4.962   1.00 0.00 ? 76 ARG A NH2  4  
ATOM 5467  H H    . ARG A 1 76 ? 1.734   4.605   -0.205  1.00 0.00 ? 76 ARG A H    4  
ATOM 5468  H HA   . ARG A 1 76 ? 3.020   4.913   2.095   1.00 0.00 ? 76 ARG A HA   4  
ATOM 5469  H HB2  . ARG A 1 76 ? 2.595   6.735   0.450   1.00 0.00 ? 76 ARG A HB2  4  
ATOM 5470  H HB3  . ARG A 1 76 ? 0.912   6.805   0.932   1.00 0.00 ? 76 ARG A HB3  4  
ATOM 5471  H HG2  . ARG A 1 76 ? 1.997   7.157   3.375   1.00 0.00 ? 76 ARG A HG2  4  
ATOM 5472  H HG3  . ARG A 1 76 ? 3.359   7.729   2.432   1.00 0.00 ? 76 ARG A HG3  4  
ATOM 5473  H HD2  . ARG A 1 76 ? 2.041   9.466   1.387   1.00 0.00 ? 76 ARG A HD2  4  
ATOM 5474  H HD3  . ARG A 1 76 ? 0.534   8.757   1.930   1.00 0.00 ? 76 ARG A HD3  4  
ATOM 5475  H HE   . ARG A 1 76 ? 0.848   9.724   4.053   1.00 0.00 ? 76 ARG A HE   4  
ATOM 5476  H HH11 . ARG A 1 76 ? 3.822   9.953   2.186   1.00 0.00 ? 76 ARG A HH11 4  
ATOM 5477  H HH12 . ARG A 1 76 ? 4.600   11.013  3.315   1.00 0.00 ? 76 ARG A HH12 4  
ATOM 5478  H HH21 . ARG A 1 76 ? 1.873   11.122  5.542   1.00 0.00 ? 76 ARG A HH21 4  
ATOM 5479  H HH22 . ARG A 1 76 ? 3.484   11.682  5.237   1.00 0.00 ? 76 ARG A HH22 4  
ATOM 5480  N N    . ALA A 1 77 ? -0.197  4.566   2.585   1.00 0.00 ? 77 ALA A N    4  
ATOM 5481  C CA   . ALA A 1 77 ? -1.234  4.343   3.578   1.00 0.00 ? 77 ALA A CA   4  
ATOM 5482  C C    . ALA A 1 77 ? -0.903  3.083   4.381   1.00 0.00 ? 77 ALA A C    4  
ATOM 5483  O O    . ALA A 1 77 ? -0.855  3.121   5.610   1.00 0.00 ? 77 ALA A O    4  
ATOM 5484  C CB   . ALA A 1 77 ? -2.594  4.250   2.883   1.00 0.00 ? 77 ALA A CB   4  
ATOM 5485  H H    . ALA A 1 77 ? -0.476  4.403   1.639   1.00 0.00 ? 77 ALA A H    4  
ATOM 5486  H HA   . ALA A 1 77 ? -1.241  5.201   4.250   1.00 0.00 ? 77 ALA A HA   4  
ATOM 5487  H HB1  . ALA A 1 77 ? -2.547  3.505   2.089   1.00 0.00 ? 77 ALA A HB1  4  
ATOM 5488  H HB2  . ALA A 1 77 ? -3.354  3.959   3.609   1.00 0.00 ? 77 ALA A HB2  4  
ATOM 5489  H HB3  . ALA A 1 77 ? -2.852  5.220   2.457   1.00 0.00 ? 77 ALA A HB3  4  
ATOM 5490  N N    . THR A 1 78 ? -0.682  1.998   3.654   1.00 0.00 ? 78 THR A N    4  
ATOM 5491  C CA   . THR A 1 78 ? -0.356  0.729   4.284   1.00 0.00 ? 78 THR A CA   4  
ATOM 5492  C C    . THR A 1 78 ? 0.890   0.873   5.160   1.00 0.00 ? 78 THR A C    4  
ATOM 5493  O O    . THR A 1 78 ? 0.921   0.382   6.287   1.00 0.00 ? 78 THR A O    4  
ATOM 5494  C CB   . THR A 1 78 ? -0.206  -0.321  3.182   1.00 0.00 ? 78 THR A CB   4  
ATOM 5495  O OG1  . THR A 1 78 ? -1.524  -0.469  2.662   1.00 0.00 ? 78 THR A OG1  4  
ATOM 5496  C CG2  . THR A 1 78 ? 0.135   -1.706  3.735   1.00 0.00 ? 78 THR A CG2  4  
ATOM 5497  H H    . THR A 1 78 ? -0.722  1.975   2.656   1.00 0.00 ? 78 THR A H    4  
ATOM 5498  H HA   . THR A 1 78 ? -1.179  0.451   4.942   1.00 0.00 ? 78 THR A HA   4  
ATOM 5499  H HB   . THR A 1 78 ? 0.529   -0.006  2.441   1.00 0.00 ? 78 THR A HB   4  
ATOM 5500  H HG1  . THR A 1 78 ? -1.681  0.195   1.932   1.00 0.00 ? 78 THR A HG1  4  
ATOM 5501  H HG21 . THR A 1 78 ? -0.358  -2.469  3.133   1.00 0.00 ? 78 THR A HG21 4  
ATOM 5502  H HG22 . THR A 1 78 ? 1.214   -1.856  3.700   1.00 0.00 ? 78 THR A HG22 4  
ATOM 5503  H HG23 . THR A 1 78 ? -0.209  -1.780  4.767   1.00 0.00 ? 78 THR A HG23 4  
ATOM 5504  N N    . LEU A 1 79 ? 1.887   1.550   4.608   1.00 0.00 ? 79 LEU A N    4  
ATOM 5505  C CA   . LEU A 1 79 ? 3.133   1.764   5.325   1.00 0.00 ? 79 LEU A CA   4  
ATOM 5506  C C    . LEU A 1 79 ? 2.841   2.495   6.638   1.00 0.00 ? 79 LEU A C    4  
ATOM 5507  O O    . LEU A 1 79 ? 3.414   2.166   7.676   1.00 0.00 ? 79 LEU A O    4  
ATOM 5508  C CB   . LEU A 1 79 ? 4.147   2.483   4.434   1.00 0.00 ? 79 LEU A CB   4  
ATOM 5509  C CG   . LEU A 1 79 ? 4.985   1.590   3.516   1.00 0.00 ? 79 LEU A CG   4  
ATOM 5510  C CD1  . LEU A 1 79 ? 6.048   2.406   2.778   1.00 0.00 ? 79 LEU A CD1  4  
ATOM 5511  C CD2  . LEU A 1 79 ? 5.596   0.424   4.295   1.00 0.00 ? 79 LEU A CD2  4  
ATOM 5512  H H    . LEU A 1 79 ? 1.854   1.946   3.691   1.00 0.00 ? 79 LEU A H    4  
ATOM 5513  H HA   . LEU A 1 79 ? 3.548   0.784   5.560   1.00 0.00 ? 79 LEU A HA   4  
ATOM 5514  H HB2  . LEU A 1 79 ? 3.611   3.204   3.816   1.00 0.00 ? 79 LEU A HB2  4  
ATOM 5515  H HB3  . LEU A 1 79 ? 4.824   3.051   5.072   1.00 0.00 ? 79 LEU A HB3  4  
ATOM 5516  H HG   . LEU A 1 79 ? 4.325   1.162   2.761   1.00 0.00 ? 79 LEU A HG   4  
ATOM 5517  H HD11 . LEU A 1 79 ? 7.037   2.015   3.016   1.00 0.00 ? 79 LEU A HD11 4  
ATOM 5518  H HD12 . LEU A 1 79 ? 5.878   2.336   1.703   1.00 0.00 ? 79 LEU A HD12 4  
ATOM 5519  H HD13 . LEU A 1 79 ? 5.985   3.449   3.088   1.00 0.00 ? 79 LEU A HD13 4  
ATOM 5520  H HD21 . LEU A 1 79 ? 5.720   0.710   5.340   1.00 0.00 ? 79 LEU A HD21 4  
ATOM 5521  H HD22 . LEU A 1 79 ? 4.937   -0.442  4.231   1.00 0.00 ? 79 LEU A HD22 4  
ATOM 5522  H HD23 . LEU A 1 79 ? 6.568   0.172   3.870   1.00 0.00 ? 79 LEU A HD23 4  
ATOM 5523  N N    . GLU A 1 80 ? 1.951   3.472   6.549   1.00 0.00 ? 80 GLU A N    4  
ATOM 5524  C CA   . GLU A 1 80 ? 1.577   4.252   7.716   1.00 0.00 ? 80 GLU A CA   4  
ATOM 5525  C C    . GLU A 1 80 ? 0.890   3.360   8.752   1.00 0.00 ? 80 GLU A C    4  
ATOM 5526  O O    . GLU A 1 80 ? 1.159   3.470   9.947   1.00 0.00 ? 80 GLU A O    4  
ATOM 5527  C CB   . GLU A 1 80 ? 0.680   5.429   7.325   1.00 0.00 ? 80 GLU A CB   4  
ATOM 5528  C CG   . GLU A 1 80 ? 1.487   6.522   6.621   1.00 0.00 ? 80 GLU A CG   4  
ATOM 5529  C CD   . GLU A 1 80 ? 1.676   7.736   7.532   1.00 0.00 ? 80 GLU A CD   4  
ATOM 5530  O OE1  . GLU A 1 80 ? 0.651   8.381   7.839   1.00 0.00 ? 80 GLU A OE1  4  
ATOM 5531  O OE2  . GLU A 1 80 ? 2.843   7.993   7.900   1.00 0.00 ? 80 GLU A OE2  4  
ATOM 5532  H H    . GLU A 1 80 ? 1.490   3.733   5.701   1.00 0.00 ? 80 GLU A H    4  
ATOM 5533  H HA   . GLU A 1 80 ? 2.513   4.636   8.121   1.00 0.00 ? 80 GLU A HA   4  
ATOM 5534  H HB2  . GLU A 1 80 ? -0.118  5.081   6.669   1.00 0.00 ? 80 GLU A HB2  4  
ATOM 5535  H HB3  . GLU A 1 80 ? 0.204   5.840   8.216   1.00 0.00 ? 80 GLU A HB3  4  
ATOM 5536  H HG2  . GLU A 1 80 ? 2.459   6.128   6.326   1.00 0.00 ? 80 GLU A HG2  4  
ATOM 5537  H HG3  . GLU A 1 80 ? 0.975   6.824   5.707   1.00 0.00 ? 80 GLU A HG3  4  
ATOM 5538  N N    . ILE A 1 81 ? 0.015   2.497   8.256   1.00 0.00 ? 81 ILE A N    4  
ATOM 5539  C CA   . ILE A 1 81 ? -0.712  1.587   9.124   1.00 0.00 ? 81 ILE A CA   4  
ATOM 5540  C C    . ILE A 1 81 ? 0.283   0.801   9.981   1.00 0.00 ? 81 ILE A C    4  
ATOM 5541  O O    . ILE A 1 81 ? 0.246   0.876   11.208  1.00 0.00 ? 81 ILE A O    4  
ATOM 5542  C CB   . ILE A 1 81 ? -1.652  0.701   8.304   1.00 0.00 ? 81 ILE A CB   4  
ATOM 5543  C CG1  . ILE A 1 81 ? -2.761  1.532   7.656   1.00 0.00 ? 81 ILE A CG1  4  
ATOM 5544  C CG2  . ILE A 1 81 ? -2.213  -0.439  9.156   1.00 0.00 ? 81 ILE A CG2  4  
ATOM 5545  C CD1  . ILE A 1 81 ? -3.679  0.651   6.804   1.00 0.00 ? 81 ILE A CD1  4  
ATOM 5546  H H    . ILE A 1 81 ? -0.198  2.414   7.283   1.00 0.00 ? 81 ILE A H    4  
ATOM 5547  H HA   . ILE A 1 81 ? -1.334  2.192   9.785   1.00 0.00 ? 81 ILE A HA   4  
ATOM 5548  H HB   . ILE A 1 81 ? -1.076  0.247   7.498   1.00 0.00 ? 81 ILE A HB   4  
ATOM 5549  H HG12 . ILE A 1 81 ? -3.346  2.031   8.428   1.00 0.00 ? 81 ILE A HG12 4  
ATOM 5550  H HG13 . ILE A 1 81 ? -2.321  2.312   7.035   1.00 0.00 ? 81 ILE A HG13 4  
ATOM 5551  H HG21 . ILE A 1 81 ? -1.849  -0.342  10.179  1.00 0.00 ? 81 ILE A HG21 4  
ATOM 5552  H HG22 . ILE A 1 81 ? -3.302  -0.393  9.153   1.00 0.00 ? 81 ILE A HG22 4  
ATOM 5553  H HG23 . ILE A 1 81 ? -1.889  -1.394  8.744   1.00 0.00 ? 81 ILE A HG23 4  
ATOM 5554  H HD11 . ILE A 1 81 ? -4.697  1.037   6.850   1.00 0.00 ? 81 ILE A HD11 4  
ATOM 5555  H HD12 . ILE A 1 81 ? -3.333  0.660   5.770   1.00 0.00 ? 81 ILE A HD12 4  
ATOM 5556  H HD13 . ILE A 1 81 ? -3.659  -0.370  7.185   1.00 0.00 ? 81 ILE A HD13 4  
ATOM 5557  N N    . LEU A 1 82 ? 1.149   0.065   9.299   1.00 0.00 ? 82 LEU A N    4  
ATOM 5558  C CA   . LEU A 1 82 ? 2.152   -0.734  9.982   1.00 0.00 ? 82 LEU A CA   4  
ATOM 5559  C C    . LEU A 1 82 ? 3.128   0.193   10.709  1.00 0.00 ? 82 LEU A C    4  
ATOM 5560  O O    . LEU A 1 82 ? 3.281   0.107   11.927  1.00 0.00 ? 82 LEU A O    4  
ATOM 5561  C CB   . LEU A 1 82 ? 2.830   -1.694  9.003   1.00 0.00 ? 82 LEU A CB   4  
ATOM 5562  C CG   . LEU A 1 82 ? 1.908   -2.392  8.001   1.00 0.00 ? 82 LEU A CG   4  
ATOM 5563  C CD1  . LEU A 1 82 ? 2.284   -2.027  6.563   1.00 0.00 ? 82 LEU A CD1  4  
ATOM 5564  C CD2  . LEU A 1 82 ? 1.901   -3.906  8.224   1.00 0.00 ? 82 LEU A CD2  4  
ATOM 5565  H H    . LEU A 1 82 ? 1.172   0.010   8.301   1.00 0.00 ? 82 LEU A H    4  
ATOM 5566  H HA   . LEU A 1 82 ? 1.635   -1.343  10.724  1.00 0.00 ? 82 LEU A HA   4  
ATOM 5567  H HB2  . LEU A 1 82 ? 3.586   -1.140  8.446   1.00 0.00 ? 82 LEU A HB2  4  
ATOM 5568  H HB3  . LEU A 1 82 ? 3.354   -2.458  9.577   1.00 0.00 ? 82 LEU A HB3  4  
ATOM 5569  H HG   . LEU A 1 82 ? 0.891   -2.037  8.168   1.00 0.00 ? 82 LEU A HG   4  
ATOM 5570  H HD11 . LEU A 1 82 ? 2.800   -2.866  6.098   1.00 0.00 ? 82 LEU A HD11 4  
ATOM 5571  H HD12 . LEU A 1 82 ? 1.380   -1.798  5.998   1.00 0.00 ? 82 LEU A HD12 4  
ATOM 5572  H HD13 . LEU A 1 82 ? 2.939   -1.156  6.569   1.00 0.00 ? 82 LEU A HD13 4  
ATOM 5573  H HD21 . LEU A 1 82 ? 1.192   -4.371  7.539   1.00 0.00 ? 82 LEU A HD21 4  
ATOM 5574  H HD22 . LEU A 1 82 ? 2.899   -4.304  8.042   1.00 0.00 ? 82 LEU A HD22 4  
ATOM 5575  H HD23 . LEU A 1 82 ? 1.606   -4.120  9.252   1.00 0.00 ? 82 LEU A HD23 4  
ATOM 5576  N N    . ILE A 1 83 ? 3.763   1.058   9.933   1.00 0.00 ? 83 ILE A N    4  
ATOM 5577  C CA   . ILE A 1 83 ? 4.720   2.000   10.488  1.00 0.00 ? 83 ILE A CA   4  
ATOM 5578  C C    . ILE A 1 83 ? 3.996   3.295   10.862  1.00 0.00 ? 83 ILE A C    4  
ATOM 5579  O O    . ILE A 1 83 ? 3.515   4.016   9.989   1.00 0.00 ? 83 ILE A O    4  
ATOM 5580  C CB   . ILE A 1 83 ? 5.890   2.206   9.524   1.00 0.00 ? 83 ILE A CB   4  
ATOM 5581  C CG1  . ILE A 1 83 ? 6.162   0.938   8.713   1.00 0.00 ? 83 ILE A CG1  4  
ATOM 5582  C CG2  . ILE A 1 83 ? 7.136   2.689   10.269  1.00 0.00 ? 83 ILE A CG2  4  
ATOM 5583  C CD1  . ILE A 1 83 ? 7.498   1.036   7.973   1.00 0.00 ? 83 ILE A CD1  4  
ATOM 5584  H H    . ILE A 1 83 ? 3.633   1.121   8.943   1.00 0.00 ? 83 ILE A H    4  
ATOM 5585  H HA   . ILE A 1 83 ? 5.126   1.556   11.397  1.00 0.00 ? 83 ILE A HA   4  
ATOM 5586  H HB   . ILE A 1 83 ? 5.615   2.988   8.815   1.00 0.00 ? 83 ILE A HB   4  
ATOM 5587  H HG12 . ILE A 1 83 ? 6.173   0.073   9.377   1.00 0.00 ? 83 ILE A HG12 4  
ATOM 5588  H HG13 . ILE A 1 83 ? 5.356   0.779   7.997   1.00 0.00 ? 83 ILE A HG13 4  
ATOM 5589  H HG21 . ILE A 1 83 ? 7.660   3.426   9.660   1.00 0.00 ? 83 ILE A HG21 4  
ATOM 5590  H HG22 . ILE A 1 83 ? 6.840   3.143   11.215  1.00 0.00 ? 83 ILE A HG22 4  
ATOM 5591  H HG23 . ILE A 1 83 ? 7.794   1.843   10.462  1.00 0.00 ? 83 ILE A HG23 4  
ATOM 5592  H HD11 . ILE A 1 83 ? 7.804   2.081   7.914   1.00 0.00 ? 83 ILE A HD11 4  
ATOM 5593  H HD12 . ILE A 1 83 ? 8.254   0.465   8.511   1.00 0.00 ? 83 ILE A HD12 4  
ATOM 5594  H HD13 . ILE A 1 83 ? 7.386   0.633   6.966   1.00 0.00 ? 83 ILE A HD13 4  
ATOM 5595  N N    . PRO A 1 84 ? 3.940   3.558   12.195  1.00 0.00 ? 84 PRO A N    4  
ATOM 5596  C CA   . PRO A 1 84 ? 3.282   4.753   12.696  1.00 0.00 ? 84 PRO A CA   4  
ATOM 5597  C C    . PRO A 1 84 ? 4.143   5.994   12.452  1.00 0.00 ? 84 PRO A C    4  
ATOM 5598  O O    . PRO A 1 84 ? 3.632   7.040   12.056  1.00 0.00 ? 84 PRO A O    4  
ATOM 5599  C CB   . PRO A 1 84 ? 3.038   4.479   14.171  1.00 0.00 ? 84 PRO A CB   4  
ATOM 5600  C CG   . PRO A 1 84 ? 3.977   3.344   14.545  1.00 0.00 ? 84 PRO A CG   4  
ATOM 5601  C CD   . PRO A 1 84 ? 4.498   2.726   13.258  1.00 0.00 ? 84 PRO A CD   4  
ATOM 5602  H HA   . PRO A 1 84 ? 2.428   4.912   12.201  1.00 0.00 ? 84 PRO A HA   4  
ATOM 5603  H HB2  . PRO A 1 84 ? 3.239   5.366   14.771  1.00 0.00 ? 84 PRO A HB2  4  
ATOM 5604  H HB3  . PRO A 1 84 ? 1.999   4.202   14.350  1.00 0.00 ? 84 PRO A HB3  4  
ATOM 5605  H HG2  . PRO A 1 84 ? 4.802   3.715   15.152  1.00 0.00 ? 84 PRO A HG2  4  
ATOM 5606  H HG3  . PRO A 1 84 ? 3.453   2.597   15.142  1.00 0.00 ? 84 PRO A HG3  4  
ATOM 5607  H HD2  . PRO A 1 84 ? 5.588   2.728   13.230  1.00 0.00 ? 84 PRO A HD2  4  
ATOM 5608  H HD3  . PRO A 1 84 ? 4.179   1.689   13.158  1.00 0.00 ? 84 PRO A HD3  4  
ATOM 5609  N N    . ASP A 1 85 ? 5.435   5.837   12.700  1.00 0.00 ? 85 ASP A N    4  
ATOM 5610  C CA   . ASP A 1 85 ? 6.371   6.933   12.513  1.00 0.00 ? 85 ASP A CA   4  
ATOM 5611  C C    . ASP A 1 85 ? 6.764   7.016   11.037  1.00 0.00 ? 85 ASP A C    4  
ATOM 5612  O O    . ASP A 1 85 ? 6.400   7.967   10.347  1.00 0.00 ? 85 ASP A O    4  
ATOM 5613  C CB   . ASP A 1 85 ? 7.646   6.712   13.330  1.00 0.00 ? 85 ASP A CB   4  
ATOM 5614  C CG   . ASP A 1 85 ? 7.453   6.724   14.847  1.00 0.00 ? 85 ASP A CG   4  
ATOM 5615  O OD1  . ASP A 1 85 ? 6.807   5.776   15.344  1.00 0.00 ? 85 ASP A OD1  4  
ATOM 5616  O OD2  . ASP A 1 85 ? 7.955   7.680   15.476  1.00 0.00 ? 85 ASP A OD2  4  
ATOM 5617  H H    . ASP A 1 85 ? 5.843   4.983   13.023  1.00 0.00 ? 85 ASP A H    4  
ATOM 5618  H HA   . ASP A 1 85 ? 5.843   7.822   12.855  1.00 0.00 ? 85 ASP A HA   4  
ATOM 5619  H HB2  . ASP A 1 85 ? 8.084   5.757   13.041  1.00 0.00 ? 85 ASP A HB2  4  
ATOM 5620  H HB3  . ASP A 1 85 ? 8.367   7.486   13.064  1.00 0.00 ? 85 ASP A HB3  4  
ATOM 5621  N N    . PHE A 1 86 ? 7.500   6.007   10.595  1.00 0.00 ? 86 PHE A N    4  
ATOM 5622  C CA   . PHE A 1 86 ? 7.946   5.954   9.213   1.00 0.00 ? 86 PHE A CA   4  
ATOM 5623  C C    . PHE A 1 86 ? 8.698   7.230   8.830   1.00 0.00 ? 86 PHE A C    4  
ATOM 5624  O O    . PHE A 1 86 ? 8.839   7.541   7.649   1.00 0.00 ? 86 PHE A O    4  
ATOM 5625  C CB   . PHE A 1 86 ? 6.693   5.834   8.344   1.00 0.00 ? 86 PHE A CB   4  
ATOM 5626  C CG   . PHE A 1 86 ? 6.985   5.665   6.851   1.00 0.00 ? 86 PHE A CG   4  
ATOM 5627  C CD1  . PHE A 1 86 ? 8.119   5.033   6.448   1.00 0.00 ? 86 PHE A CD1  4  
ATOM 5628  C CD2  . PHE A 1 86 ? 6.110   6.147   5.928   1.00 0.00 ? 86 PHE A CD2  4  
ATOM 5629  C CE1  . PHE A 1 86 ? 8.390   4.877   5.063   1.00 0.00 ? 86 PHE A CE1  4  
ATOM 5630  C CE2  . PHE A 1 86 ? 6.381   5.990   4.543   1.00 0.00 ? 86 PHE A CE2  4  
ATOM 5631  C CZ   . PHE A 1 86 ? 7.515   5.358   4.140   1.00 0.00 ? 86 PHE A CZ   4  
ATOM 5632  H H    . PHE A 1 86 ? 7.791   5.237   11.163  1.00 0.00 ? 86 PHE A H    4  
ATOM 5633  H HA   . PHE A 1 86 ? 8.615   5.099   9.122   1.00 0.00 ? 86 PHE A HA   4  
ATOM 5634  H HB2  . PHE A 1 86 ? 6.104   4.983   8.687   1.00 0.00 ? 86 PHE A HB2  4  
ATOM 5635  H HB3  . PHE A 1 86 ? 6.078   6.724   8.485   1.00 0.00 ? 86 PHE A HB3  4  
ATOM 5636  H HD1  . PHE A 1 86 ? 8.821   4.647   7.188   1.00 0.00 ? 86 PHE A HD1  4  
ATOM 5637  H HD2  . PHE A 1 86 ? 5.200   6.653   6.252   1.00 0.00 ? 86 PHE A HD2  4  
ATOM 5638  H HE1  . PHE A 1 86 ? 9.300   4.370   4.739   1.00 0.00 ? 86 PHE A HE1  4  
ATOM 5639  H HE2  . PHE A 1 86 ? 5.679   6.376   3.803   1.00 0.00 ? 86 PHE A HE2  4  
ATOM 5640  H HZ   . PHE A 1 86 ? 7.723   5.238   3.077   1.00 0.00 ? 86 PHE A HZ   4  
ATOM 5641  N N    . VAL A 1 87 ? 9.160   7.935   9.852   1.00 0.00 ? 87 VAL A N    4  
ATOM 5642  C CA   . VAL A 1 87 ? 9.894   9.171   9.638   1.00 0.00 ? 87 VAL A CA   4  
ATOM 5643  C C    . VAL A 1 87 ? 11.269  9.064   10.301  1.00 0.00 ? 87 VAL A C    4  
ATOM 5644  O O    . VAL A 1 87 ? 11.478  8.221   11.172  1.00 0.00 ? 87 VAL A O    4  
ATOM 5645  C CB   . VAL A 1 87 ? 9.076   10.360  10.145  1.00 0.00 ? 87 VAL A CB   4  
ATOM 5646  C CG1  . VAL A 1 87 ? 9.766   11.684  9.808   1.00 0.00 ? 87 VAL A CG1  4  
ATOM 5647  C CG2  . VAL A 1 87 ? 7.653   10.325  9.586   1.00 0.00 ? 87 VAL A CG2  4  
ATOM 5648  H H    . VAL A 1 87 ? 9.041   7.676   10.811  1.00 0.00 ? 87 VAL A H    4  
ATOM 5649  H HA   . VAL A 1 87 ? 10.031  9.290   8.563   1.00 0.00 ? 87 VAL A HA   4  
ATOM 5650  H HB   . VAL A 1 87 ? 9.011   10.284  11.231  1.00 0.00 ? 87 VAL A HB   4  
ATOM 5651  H HG11 . VAL A 1 87 ? 10.320  11.577  8.875   1.00 0.00 ? 87 VAL A HG11 4  
ATOM 5652  H HG12 . VAL A 1 87 ? 9.016   12.467  9.697   1.00 0.00 ? 87 VAL A HG12 4  
ATOM 5653  H HG13 . VAL A 1 87 ? 10.453  11.950  10.611  1.00 0.00 ? 87 VAL A HG13 4  
ATOM 5654  H HG21 . VAL A 1 87 ? 7.427   11.279  9.107   1.00 0.00 ? 87 VAL A HG21 4  
ATOM 5655  H HG22 . VAL A 1 87 ? 7.570   9.523   8.853   1.00 0.00 ? 87 VAL A HG22 4  
ATOM 5656  H HG23 . VAL A 1 87 ? 6.947   10.150  10.398  1.00 0.00 ? 87 VAL A HG23 4  
ATOM 5657  N N    . LYS A 1 88 ? 12.170  9.931   9.863   1.00 0.00 ? 88 LYS A N    4  
ATOM 5658  C CA   . LYS A 1 88 ? 13.519  9.944   10.404  1.00 0.00 ? 88 LYS A CA   4  
ATOM 5659  C C    . LYS A 1 88 ? 13.729  11.230  11.206  1.00 0.00 ? 88 LYS A C    4  
ATOM 5660  O O    . LYS A 1 88 ? 13.932  11.183  12.419  1.00 0.00 ? 88 LYS A O    4  
ATOM 5661  C CB   . LYS A 1 88 ? 14.546  9.741   9.288   1.00 0.00 ? 88 LYS A CB   4  
ATOM 5662  C CG   . LYS A 1 88 ? 15.427  8.522   9.568   1.00 0.00 ? 88 LYS A CG   4  
ATOM 5663  C CD   . LYS A 1 88 ? 16.743  8.607   8.792   1.00 0.00 ? 88 LYS A CD   4  
ATOM 5664  C CE   . LYS A 1 88 ? 17.333  7.214   8.560   1.00 0.00 ? 88 LYS A CE   4  
ATOM 5665  N NZ   . LYS A 1 88 ? 18.709  7.317   8.025   1.00 0.00 ? 88 LYS A NZ   4  
ATOM 5666  H H    . LYS A 1 88 ? 11.992  10.613  9.154   1.00 0.00 ? 88 LYS A H    4  
ATOM 5667  H HA   . LYS A 1 88 ? 13.608  9.095   11.082  1.00 0.00 ? 88 LYS A HA   4  
ATOM 5668  H HB2  . LYS A 1 88 ? 14.032  9.612   8.335   1.00 0.00 ? 88 LYS A HB2  4  
ATOM 5669  H HB3  . LYS A 1 88 ? 15.168  10.631  9.195   1.00 0.00 ? 88 LYS A HB3  4  
ATOM 5670  H HG2  . LYS A 1 88 ? 15.634  8.457   10.636  1.00 0.00 ? 88 LYS A HG2  4  
ATOM 5671  H HG3  . LYS A 1 88 ? 14.895  7.613   9.290   1.00 0.00 ? 88 LYS A HG3  4  
ATOM 5672  H HD2  . LYS A 1 88 ? 16.573  9.098   7.834   1.00 0.00 ? 88 LYS A HD2  4  
ATOM 5673  H HD3  . LYS A 1 88 ? 17.455  9.220   9.343   1.00 0.00 ? 88 LYS A HD3  4  
ATOM 5674  H HE2  . LYS A 1 88 ? 17.341  6.656   9.496   1.00 0.00 ? 88 LYS A HE2  4  
ATOM 5675  H HE3  . LYS A 1 88 ? 16.706  6.659   7.863   1.00 0.00 ? 88 LYS A HE3  4  
ATOM 5676  H HZ1  . LYS A 1 88 ? 19.032  6.409   7.759   1.00 0.00 ? 88 LYS A HZ1  4  
ATOM 5677  H HZ2  . LYS A 1 88 ? 18.712  7.920   7.227   1.00 0.00 ? 88 LYS A HZ2  4  
ATOM 5678  H HZ3  . LYS A 1 88 ? 19.313  7.692   8.729   1.00 0.00 ? 88 LYS A HZ3  4  
ATOM 5679  N N    . GLN A 1 89 ? 13.674  12.348  10.497  1.00 0.00 ? 89 GLN A N    4  
ATOM 5680  C CA   . GLN A 1 89 ? 13.856  13.644  11.129  1.00 0.00 ? 89 GLN A CA   4  
ATOM 5681  C C    . GLN A 1 89 ? 13.301  14.753  10.232  1.00 0.00 ? 89 GLN A C    4  
ATOM 5682  O O    . GLN A 1 89 ? 12.410  15.497  10.639  1.00 0.00 ? 89 GLN A O    4  
ATOM 5683  C CB   . GLN A 1 89 ? 15.329  13.891  11.459  1.00 0.00 ? 89 GLN A CB   4  
ATOM 5684  C CG   . GLN A 1 89 ? 15.576  13.793  12.966  1.00 0.00 ? 89 GLN A CG   4  
ATOM 5685  C CD   . GLN A 1 89 ? 16.803  12.928  13.265  1.00 0.00 ? 89 GLN A CD   4  
ATOM 5686  O OE1  . GLN A 1 89 ? 17.289  12.185  12.428  1.00 0.00 ? 89 GLN A OE1  4  
ATOM 5687  N NE2  . GLN A 1 89 ? 17.274  13.066  14.501  1.00 0.00 ? 89 GLN A NE2  4  
ATOM 5688  H H    . GLN A 1 89 ? 13.508  12.377  9.512   1.00 0.00 ? 89 GLN A H    4  
ATOM 5689  H HA   . GLN A 1 89 ? 13.284  13.597  12.056  1.00 0.00 ? 89 GLN A HA   4  
ATOM 5690  H HB2  . GLN A 1 89 ? 15.949  13.163  10.937  1.00 0.00 ? 89 GLN A HB2  4  
ATOM 5691  H HB3  . GLN A 1 89 ? 15.625  14.877  11.102  1.00 0.00 ? 89 GLN A HB3  4  
ATOM 5692  H HG2  . GLN A 1 89 ? 15.721  14.791  13.380  1.00 0.00 ? 89 GLN A HG2  4  
ATOM 5693  H HG3  . GLN A 1 89 ? 14.700  13.368  13.455  1.00 0.00 ? 89 GLN A HG3  4  
ATOM 5694  H HE21 . GLN A 1 89 ? 16.827  13.694  15.139  1.00 0.00 ? 89 GLN A HE21 4  
ATOM 5695  H HE22 . GLN A 1 89 ? 18.074  12.542  14.792  1.00 0.00 ? 89 GLN A HE22 4  
ATOM 5696  N N    . THR A 1 90 ? 13.852  14.829  9.030   1.00 0.00 ? 90 THR A N    4  
ATOM 5697  C CA   . THR A 1 90 ? 13.424  15.835  8.072   1.00 0.00 ? 90 THR A CA   4  
ATOM 5698  C C    . THR A 1 90 ? 12.467  15.223  7.048   1.00 0.00 ? 90 THR A C    4  
ATOM 5699  O O    . THR A 1 90 ? 12.851  14.335  6.287   1.00 0.00 ? 90 THR A O    4  
ATOM 5700  C CB   . THR A 1 90 ? 14.675  16.451  7.443   1.00 0.00 ? 90 THR A CB   4  
ATOM 5701  O OG1  . THR A 1 90 ? 14.997  17.539  8.305   1.00 0.00 ? 90 THR A OG1  4  
ATOM 5702  C CG2  . THR A 1 90 ? 14.385  17.116  6.096   1.00 0.00 ? 90 THR A CG2  4  
ATOM 5703  H H    . THR A 1 90 ? 14.576  14.220  8.707   1.00 0.00 ? 90 THR A H    4  
ATOM 5704  H HA   . THR A 1 90 ? 12.869  16.605  8.608   1.00 0.00 ? 90 THR A HA   4  
ATOM 5705  H HB   . THR A 1 90 ? 15.469  15.710  7.349   1.00 0.00 ? 90 THR A HB   4  
ATOM 5706  H HG1  . THR A 1 90 ? 15.270  17.195  9.203   1.00 0.00 ? 90 THR A HG1  4  
ATOM 5707  H HG21 . THR A 1 90 ? 13.938  16.388  5.420   1.00 0.00 ? 90 THR A HG21 4  
ATOM 5708  H HG22 . THR A 1 90 ? 13.696  17.948  6.242   1.00 0.00 ? 90 THR A HG22 4  
ATOM 5709  H HG23 . THR A 1 90 ? 15.316  17.487  5.666   1.00 0.00 ? 90 THR A HG23 4  
ATOM 5710  N N    . SER A 1 91 ? 11.239  15.721  7.060   1.00 0.00 ? 91 SER A N    4  
ATOM 5711  C CA   . SER A 1 91 ? 10.224  15.234  6.141   1.00 0.00 ? 91 SER A CA   4  
ATOM 5712  C C    . SER A 1 91 ? 8.991   16.138  6.197   1.00 0.00 ? 91 SER A C    4  
ATOM 5713  O O    . SER A 1 91 ? 8.590   16.709  5.184   1.00 0.00 ? 91 SER A O    4  
ATOM 5714  C CB   . SER A 1 91 ? 9.838   13.789  6.463   1.00 0.00 ? 91 SER A CB   4  
ATOM 5715  O OG   . SER A 1 91 ? 9.225   13.141  5.351   1.00 0.00 ? 91 SER A OG   4  
ATOM 5716  H H    . SER A 1 91 ? 10.935  16.443  7.682   1.00 0.00 ? 91 SER A H    4  
ATOM 5717  H HA   . SER A 1 91 ? 10.685  15.276  5.154   1.00 0.00 ? 91 SER A HA   4  
ATOM 5718  H HB2  . SER A 1 91 ? 10.728  13.234  6.761   1.00 0.00 ? 91 SER A HB2  4  
ATOM 5719  H HB3  . SER A 1 91 ? 9.155   13.777  7.312   1.00 0.00 ? 91 SER A HB3  4  
ATOM 5720  H HG   . SER A 1 91 ? 8.882   13.822  4.705   1.00 0.00 ? 91 SER A HG   4  
ATOM 5721  N N    . GLU A 1 92 ? 8.425   16.240  7.391   1.00 0.00 ? 92 GLU A N    4  
ATOM 5722  C CA   . GLU A 1 92 ? 7.246   17.065  7.591   1.00 0.00 ? 92 GLU A CA   4  
ATOM 5723  C C    . GLU A 1 92 ? 6.918   17.168  9.082   1.00 0.00 ? 92 GLU A C    4  
ATOM 5724  O O    . GLU A 1 92 ? 6.275   16.281  9.643   1.00 0.00 ? 92 GLU A O    4  
ATOM 5725  C CB   . GLU A 1 92 ? 6.053   16.517  6.805   1.00 0.00 ? 92 GLU A CB   4  
ATOM 5726  C CG   . GLU A 1 92 ? 5.439   17.601  5.916   1.00 0.00 ? 92 GLU A CG   4  
ATOM 5727  C CD   . GLU A 1 92 ? 4.679   18.631  6.753   1.00 0.00 ? 92 GLU A CD   4  
ATOM 5728  O OE1  . GLU A 1 92 ? 5.304   19.172  7.691   1.00 0.00 ? 92 GLU A OE1  4  
ATOM 5729  O OE2  . GLU A 1 92 ? 3.491   18.855  6.436   1.00 0.00 ? 92 GLU A OE2  4  
ATOM 5730  H H    . GLU A 1 92 ? 8.758   15.772  8.209   1.00 0.00 ? 92 GLU A H    4  
ATOM 5731  H HA   . GLU A 1 92 ? 7.510   18.048  7.202   1.00 0.00 ? 92 GLU A HA   4  
ATOM 5732  H HB2  . GLU A 1 92 ? 6.374   15.676  6.190   1.00 0.00 ? 92 GLU A HB2  4  
ATOM 5733  H HB3  . GLU A 1 92 ? 5.300   16.138  7.495   1.00 0.00 ? 92 GLU A HB3  4  
ATOM 5734  H HG2  . GLU A 1 92 ? 6.225   18.097  5.346   1.00 0.00 ? 92 GLU A HG2  4  
ATOM 5735  H HG3  . GLU A 1 92 ? 4.763   17.143  5.194   1.00 0.00 ? 92 GLU A HG3  4  
ATOM 5736  N N    . SER A 1 93 ? 7.374   18.258  9.682   1.00 0.00 ? 93 SER A N    4  
ATOM 5737  C CA   . SER A 1 93 ? 7.137   18.488  11.097  1.00 0.00 ? 93 SER A CA   4  
ATOM 5738  C C    . SER A 1 93 ? 6.174   19.662  11.282  1.00 0.00 ? 93 SER A C    4  
ATOM 5739  O O    . SER A 1 93 ? 6.370   20.728  10.701  1.00 0.00 ? 93 SER A O    4  
ATOM 5740  C CB   . SER A 1 93 ? 8.449   18.756  11.838  1.00 0.00 ? 93 SER A CB   4  
ATOM 5741  O OG   . SER A 1 93 ? 8.995   20.031  11.513  1.00 0.00 ? 93 SER A OG   4  
ATOM 5742  H H    . SER A 1 93 ? 7.896   18.974  9.219   1.00 0.00 ? 93 SER A H    4  
ATOM 5743  H HA   . SER A 1 93 ? 6.692   17.565  11.469  1.00 0.00 ? 93 SER A HA   4  
ATOM 5744  H HB2  . SER A 1 93 ? 8.276   18.699  12.913  1.00 0.00 ? 93 SER A HB2  4  
ATOM 5745  H HB3  . SER A 1 93 ? 9.171   17.978  11.591  1.00 0.00 ? 93 SER A HB3  4  
ATOM 5746  H HG   . SER A 1 93 ? 8.310   20.744  11.658  1.00 0.00 ? 93 SER A HG   4  
ATOM 5747  N N    . GLY A 1 94 ? 5.153   19.426  12.093  1.00 0.00 ? 94 GLY A N    4  
ATOM 5748  C CA   . GLY A 1 94 ? 4.159   20.451  12.362  1.00 0.00 ? 94 GLY A CA   4  
ATOM 5749  C C    . GLY A 1 94 ? 2.832   19.826  12.799  1.00 0.00 ? 94 GLY A C    4  
ATOM 5750  O O    . GLY A 1 94 ? 2.558   18.667  12.494  1.00 0.00 ? 94 GLY A O    4  
ATOM 5751  H H    . GLY A 1 94 ? 5.001   18.556  12.562  1.00 0.00 ? 94 GLY A H    4  
ATOM 5752  H HA2  . GLY A 1 94 ? 4.523   21.121  13.141  1.00 0.00 ? 94 GLY A HA2  4  
ATOM 5753  H HA3  . GLY A 1 94 ? 4.003   21.055  11.468  1.00 0.00 ? 94 GLY A HA3  4  
ATOM 5754  N N    . PRO A 1 95 ? 2.024   20.644  13.526  1.00 0.00 ? 95 PRO A N    4  
ATOM 5755  C CA   . PRO A 1 95 ? 0.733   20.184  14.009  1.00 0.00 ? 95 PRO A CA   4  
ATOM 5756  C C    . PRO A 1 95 ? -0.289  20.127  12.871  1.00 0.00 ? 95 PRO A C    4  
ATOM 5757  O O    . PRO A 1 95 ? -0.871  19.076  12.607  1.00 0.00 ? 95 PRO A O    4  
ATOM 5758  C CB   . PRO A 1 95 ? 0.349   21.165  15.103  1.00 0.00 ? 95 PRO A CB   4  
ATOM 5759  C CG   . PRO A 1 95 ? 1.210   22.398  14.878  1.00 0.00 ? 95 PRO A CG   4  
ATOM 5760  C CD   . PRO A 1 95 ? 2.317   22.023  13.907  1.00 0.00 ? 95 PRO A CD   4  
ATOM 5761  H HA   . PRO A 1 95 ? 0.806   19.249  14.357  1.00 0.00 ? 95 PRO A HA   4  
ATOM 5762  H HB2  . PRO A 1 95 ? -0.711  21.414  15.051  1.00 0.00 ? 95 PRO A HB2  4  
ATOM 5763  H HB3  . PRO A 1 95 ? 0.528   20.739  16.091  1.00 0.00 ? 95 PRO A HB3  4  
ATOM 5764  H HG2  . PRO A 1 95 ? 0.610   23.214  14.477  1.00 0.00 ? 95 PRO A HG2  4  
ATOM 5765  H HG3  . PRO A 1 95 ? 1.632   22.746  15.821  1.00 0.00 ? 95 PRO A HG3  4  
ATOM 5766  H HD2  . PRO A 1 95 ? 2.321   22.681  13.038  1.00 0.00 ? 95 PRO A HD2  4  
ATOM 5767  H HD3  . PRO A 1 95 ? 3.298   22.105  14.373  1.00 0.00 ? 95 PRO A HD3  4  
ATOM 5768  N N    . SER A 1 96 ? -0.475  21.271  12.229  1.00 0.00 ? 96 SER A N    4  
ATOM 5769  C CA   . SER A 1 96 ? -1.417  21.365  11.126  1.00 0.00 ? 96 SER A CA   4  
ATOM 5770  C C    . SER A 1 96 ? -2.842  21.140  11.634  1.00 0.00 ? 96 SER A C    4  
ATOM 5771  O O    . SER A 1 96 ? -3.084  20.240  12.437  1.00 0.00 ? 96 SER A O    4  
ATOM 5772  C CB   . SER A 1 96 ? -1.080  20.355  10.027  1.00 0.00 ? 96 SER A CB   4  
ATOM 5773  O OG   . SER A 1 96 ? -1.118  20.945  8.730   1.00 0.00 ? 96 SER A OG   4  
ATOM 5774  H H    . SER A 1 96 ? 0.002   22.121  12.450  1.00 0.00 ? 96 SER A H    4  
ATOM 5775  H HA   . SER A 1 96 ? -1.304  22.376  10.736  1.00 0.00 ? 96 SER A HA   4  
ATOM 5776  H HB2  . SER A 1 96 ? -0.088  19.940  10.207  1.00 0.00 ? 96 SER A HB2  4  
ATOM 5777  H HB3  . SER A 1 96 ? -1.785  19.525  10.068  1.00 0.00 ? 96 SER A HB3  4  
ATOM 5778  H HG   . SER A 1 96 ? -2.020  21.340  8.560   1.00 0.00 ? 96 SER A HG   4  
ATOM 5779  N N    . SER A 1 97 ? -3.749  21.973  11.145  1.00 0.00 ? 97 SER A N    4  
ATOM 5780  C CA   . SER A 1 97 ? -5.144  21.877  11.540  1.00 0.00 ? 97 SER A CA   4  
ATOM 5781  C C    . SER A 1 97 ? -6.028  21.716  10.301  1.00 0.00 ? 97 SER A C    4  
ATOM 5782  O O    . SER A 1 97 ? -5.792  22.356  9.278   1.00 0.00 ? 97 SER A O    4  
ATOM 5783  C CB   . SER A 1 97 ? -5.575  23.105  12.344  1.00 0.00 ? 97 SER A CB   4  
ATOM 5784  O OG   . SER A 1 97 ? -5.911  22.772  13.688  1.00 0.00 ? 97 SER A OG   4  
ATOM 5785  H H    . SER A 1 97 ? -3.544  22.702  10.492  1.00 0.00 ? 97 SER A H    4  
ATOM 5786  H HA   . SER A 1 97 ? -5.205  20.991  12.171  1.00 0.00 ? 97 SER A HA   4  
ATOM 5787  H HB2  . SER A 1 97 ? -4.770  23.840  12.342  1.00 0.00 ? 97 SER A HB2  4  
ATOM 5788  H HB3  . SER A 1 97 ? -6.433  23.572  11.860  1.00 0.00 ? 97 SER A HB3  4  
ATOM 5789  H HG   . SER A 1 97 ? -6.835  22.394  13.726  1.00 0.00 ? 97 SER A HG   4  
ATOM 5790  N N    . GLY A 1 98 ? -7.028  20.857  10.435  1.00 0.00 ? 98 GLY A N    4  
ATOM 5791  C CA   . GLY A 1 98 ? -7.949  20.604  9.340   1.00 0.00 ? 98 GLY A CA   4  
ATOM 5792  C C    . GLY A 1 98 ? -9.399  20.808  9.784   1.00 0.00 ? 98 GLY A C    4  
ATOM 5793  O O    . GLY A 1 98 ? -9.655  21.174  10.930  1.00 0.00 ? 98 GLY A O    4  
ATOM 5794  H H    . GLY A 1 98 ? -7.214  20.341  11.271  1.00 0.00 ? 98 GLY A H    4  
ATOM 5795  H HA2  . GLY A 1 98 ? -7.722  21.271  8.508   1.00 0.00 ? 98 GLY A HA2  4  
ATOM 5796  H HA3  . GLY A 1 98 ? -7.816  19.585  8.977   1.00 0.00 ? 98 GLY A HA3  4  
ATOM 5797  N N    . GLY A 1 1  ? -13.003 -9.983  -6.083  1.00 0.00 ? 1  GLY A N    5  
ATOM 5798  C CA   . GLY A 1 1  ? -12.787 -11.046 -7.049  1.00 0.00 ? 1  GLY A CA   5  
ATOM 5799  C C    . GLY A 1 1  ? -11.409 -10.922 -7.703  1.00 0.00 ? 1  GLY A C    5  
ATOM 5800  O O    . GLY A 1 1  ? -10.692 -9.951  -7.467  1.00 0.00 ? 1  GLY A O    5  
ATOM 5801  H H1   . GLY A 1 1  ? -12.181 -9.475  -5.823  1.00 0.00 ? 1  GLY A H1   5  
ATOM 5802  H HA2  . GLY A 1 1  ? -12.874 -12.014 -6.555  1.00 0.00 ? 1  GLY A HA2  5  
ATOM 5803  H HA3  . GLY A 1 1  ? -13.562 -11.009 -7.815  1.00 0.00 ? 1  GLY A HA3  5  
ATOM 5804  N N    . SER A 1 2  ? -11.082 -11.919 -8.511  1.00 0.00 ? 2  SER A N    5  
ATOM 5805  C CA   . SER A 1 2  ? -9.803  -11.934 -9.201  1.00 0.00 ? 2  SER A CA   5  
ATOM 5806  C C    . SER A 1 2  ? -9.917  -11.190 -10.532 1.00 0.00 ? 2  SER A C    5  
ATOM 5807  O O    . SER A 1 2  ? -10.849 -11.424 -11.300 1.00 0.00 ? 2  SER A O    5  
ATOM 5808  C CB   . SER A 1 2  ? -9.319  -13.367 -9.434  1.00 0.00 ? 2  SER A CB   5  
ATOM 5809  O OG   . SER A 1 2  ? -7.913  -13.426 -9.658  1.00 0.00 ? 2  SER A OG   5  
ATOM 5810  H H    . SER A 1 2  ? -11.671 -12.705 -8.697  1.00 0.00 ? 2  SER A H    5  
ATOM 5811  H HA   . SER A 1 2  ? -9.109  -11.421 -8.534  1.00 0.00 ? 2  SER A HA   5  
ATOM 5812  H HB2  . SER A 1 2  ? -9.575  -13.981 -8.570  1.00 0.00 ? 2  SER A HB2  5  
ATOM 5813  H HB3  . SER A 1 2  ? -9.841  -13.791 -10.291 1.00 0.00 ? 2  SER A HB3  5  
ATOM 5814  H HG   . SER A 1 2  ? -7.713  -14.049 -10.414 1.00 0.00 ? 2  SER A HG   5  
ATOM 5815  N N    . SER A 1 3  ? -8.957  -10.308 -10.766 1.00 0.00 ? 3  SER A N    5  
ATOM 5816  C CA   . SER A 1 3  ? -8.938  -9.527  -11.991 1.00 0.00 ? 3  SER A CA   5  
ATOM 5817  C C    . SER A 1 3  ? -7.600  -9.713  -12.709 1.00 0.00 ? 3  SER A C    5  
ATOM 5818  O O    . SER A 1 3  ? -7.563  -10.153 -13.857 1.00 0.00 ? 3  SER A O    5  
ATOM 5819  C CB   . SER A 1 3  ? -9.186  -8.045  -11.704 1.00 0.00 ? 3  SER A CB   5  
ATOM 5820  O OG   . SER A 1 3  ? -10.506 -7.645  -12.062 1.00 0.00 ? 3  SER A OG   5  
ATOM 5821  H H    . SER A 1 3  ? -8.202  -10.123 -10.136 1.00 0.00 ? 3  SER A H    5  
ATOM 5822  H HA   . SER A 1 3  ? -9.755  -9.921  -12.596 1.00 0.00 ? 3  SER A HA   5  
ATOM 5823  H HB2  . SER A 1 3  ? -9.022  -7.849  -10.645 1.00 0.00 ? 3  SER A HB2  5  
ATOM 5824  H HB3  . SER A 1 3  ? -8.463  -7.443  -12.255 1.00 0.00 ? 3  SER A HB3  5  
ATOM 5825  H HG   . SER A 1 3  ? -11.146 -8.398  -11.906 1.00 0.00 ? 3  SER A HG   5  
ATOM 5826  N N    . GLY A 1 4  ? -6.533  -9.367  -12.004 1.00 0.00 ? 4  GLY A N    5  
ATOM 5827  C CA   . GLY A 1 4  ? -5.196  -9.490  -12.559 1.00 0.00 ? 4  GLY A CA   5  
ATOM 5828  C C    . GLY A 1 4  ? -4.146  -8.958  -11.583 1.00 0.00 ? 4  GLY A C    5  
ATOM 5829  O O    . GLY A 1 4  ? -4.393  -8.883  -10.380 1.00 0.00 ? 4  GLY A O    5  
ATOM 5830  H H    . GLY A 1 4  ? -6.572  -9.010  -11.071 1.00 0.00 ? 4  GLY A H    5  
ATOM 5831  H HA2  . GLY A 1 4  ? -4.989  -10.535 -12.789 1.00 0.00 ? 4  GLY A HA2  5  
ATOM 5832  H HA3  . GLY A 1 4  ? -5.137  -8.939  -13.498 1.00 0.00 ? 4  GLY A HA3  5  
ATOM 5833  N N    . SER A 1 5  ? -2.995  -8.603  -12.136 1.00 0.00 ? 5  SER A N    5  
ATOM 5834  C CA   . SER A 1 5  ? -1.906  -8.080  -11.329 1.00 0.00 ? 5  SER A CA   5  
ATOM 5835  C C    . SER A 1 5  ? -1.332  -6.819  -11.978 1.00 0.00 ? 5  SER A C    5  
ATOM 5836  O O    . SER A 1 5  ? -1.498  -6.603  -13.178 1.00 0.00 ? 5  SER A O    5  
ATOM 5837  C CB   . SER A 1 5  ? -0.807  -9.128  -11.143 1.00 0.00 ? 5  SER A CB   5  
ATOM 5838  O OG   . SER A 1 5  ? -0.910  -9.792  -9.886  1.00 0.00 ? 5  SER A OG   5  
ATOM 5839  H H    . SER A 1 5  ? -2.803  -8.667  -13.116 1.00 0.00 ? 5  SER A H    5  
ATOM 5840  H HA   . SER A 1 5  ? -2.351  -7.845  -10.362 1.00 0.00 ? 5  SER A HA   5  
ATOM 5841  H HB2  . SER A 1 5  ? -0.866  -9.862  -11.946 1.00 0.00 ? 5  SER A HB2  5  
ATOM 5842  H HB3  . SER A 1 5  ? 0.168   -8.648  -11.220 1.00 0.00 ? 5  SER A HB3  5  
ATOM 5843  H HG   . SER A 1 5  ? -1.765  -9.537  -9.434  1.00 0.00 ? 5  SER A HG   5  
ATOM 5844  N N    . SER A 1 6  ? -0.669  -6.019  -11.156 1.00 0.00 ? 6  SER A N    5  
ATOM 5845  C CA   . SER A 1 6  ? -0.070  -4.785  -11.635 1.00 0.00 ? 6  SER A CA   5  
ATOM 5846  C C    . SER A 1 6  ? 1.242   -5.088  -12.362 1.00 0.00 ? 6  SER A C    5  
ATOM 5847  O O    . SER A 1 6  ? 2.321   -4.938  -11.792 1.00 0.00 ? 6  SER A O    5  
ATOM 5848  C CB   . SER A 1 6  ? 0.176   -3.808  -10.483 1.00 0.00 ? 6  SER A CB   5  
ATOM 5849  O OG   . SER A 1 6  ? -1.040  -3.401  -9.861  1.00 0.00 ? 6  SER A OG   5  
ATOM 5850  H H    . SER A 1 6  ? -0.538  -6.202  -10.182 1.00 0.00 ? 6  SER A H    5  
ATOM 5851  H HA   . SER A 1 6  ? -0.799  -4.358  -12.323 1.00 0.00 ? 6  SER A HA   5  
ATOM 5852  H HB2  . SER A 1 6  ? 0.823   -4.277  -9.742  1.00 0.00 ? 6  SER A HB2  5  
ATOM 5853  H HB3  . SER A 1 6  ? 0.703   -2.931  -10.858 1.00 0.00 ? 6  SER A HB3  5  
ATOM 5854  H HG   . SER A 1 6  ? -1.244  -2.451  -10.097 1.00 0.00 ? 6  SER A HG   5  
ATOM 5855  N N    . GLY A 1 7  ? 1.106   -5.508  -13.611 1.00 0.00 ? 7  GLY A N    5  
ATOM 5856  C CA   . GLY A 1 7  ? 2.266   -5.834  -14.423 1.00 0.00 ? 7  GLY A CA   5  
ATOM 5857  C C    . GLY A 1 7  ? 3.077   -6.967  -13.790 1.00 0.00 ? 7  GLY A C    5  
ATOM 5858  O O    . GLY A 1 7  ? 2.784   -7.397  -12.676 1.00 0.00 ? 7  GLY A O    5  
ATOM 5859  H H    . GLY A 1 7  ? 0.224   -5.627  -14.068 1.00 0.00 ? 7  GLY A H    5  
ATOM 5860  H HA2  . GLY A 1 7  ? 1.946   -6.126  -15.423 1.00 0.00 ? 7  GLY A HA2  5  
ATOM 5861  H HA3  . GLY A 1 7  ? 2.895   -4.950  -14.535 1.00 0.00 ? 7  GLY A HA3  5  
ATOM 5862  N N    . GLU A 1 8  ? 4.080   -7.417  -14.529 1.00 0.00 ? 8  GLU A N    5  
ATOM 5863  C CA   . GLU A 1 8  ? 4.936   -8.492  -14.054 1.00 0.00 ? 8  GLU A CA   5  
ATOM 5864  C C    . GLU A 1 8  ? 6.154   -7.919  -13.328 1.00 0.00 ? 8  GLU A C    5  
ATOM 5865  O O    . GLU A 1 8  ? 6.381   -8.217  -12.157 1.00 0.00 ? 8  GLU A O    5  
ATOM 5866  C CB   . GLU A 1 8  ? 5.362   -9.403  -15.207 1.00 0.00 ? 8  GLU A CB   5  
ATOM 5867  C CG   . GLU A 1 8  ? 4.199   -10.283 -15.670 1.00 0.00 ? 8  GLU A CG   5  
ATOM 5868  C CD   . GLU A 1 8  ? 3.564   -9.725  -16.946 1.00 0.00 ? 8  GLU A CD   5  
ATOM 5869  O OE1  . GLU A 1 8  ? 3.219   -8.524  -16.930 1.00 0.00 ? 8  GLU A OE1  5  
ATOM 5870  O OE2  . GLU A 1 8  ? 3.438   -10.513 -17.908 1.00 0.00 ? 8  GLU A OE2  5  
ATOM 5871  H H    . GLU A 1 8  ? 4.312   -7.062  -15.434 1.00 0.00 ? 8  GLU A H    5  
ATOM 5872  H HA   . GLU A 1 8  ? 4.323   -9.062  -13.356 1.00 0.00 ? 8  GLU A HA   5  
ATOM 5873  H HB2  . GLU A 1 8  ? 5.719   -8.798  -16.040 1.00 0.00 ? 8  GLU A HB2  5  
ATOM 5874  H HB3  . GLU A 1 8  ? 6.194   -10.032 -14.890 1.00 0.00 ? 8  GLU A HB3  5  
ATOM 5875  H HG2  . GLU A 1 8  ? 4.555   -11.297 -15.849 1.00 0.00 ? 8  GLU A HG2  5  
ATOM 5876  H HG3  . GLU A 1 8  ? 3.448   -10.343 -14.882 1.00 0.00 ? 8  GLU A HG3  5  
ATOM 5877  N N    . PHE A 1 9  ? 6.908   -7.106  -14.055 1.00 0.00 ? 9  PHE A N    5  
ATOM 5878  C CA   . PHE A 1 9  ? 8.098   -6.489  -13.494 1.00 0.00 ? 9  PHE A CA   5  
ATOM 5879  C C    . PHE A 1 9  ? 7.918   -4.975  -13.358 1.00 0.00 ? 9  PHE A C    5  
ATOM 5880  O O    . PHE A 1 9  ? 7.727   -4.278  -14.353 1.00 0.00 ? 9  PHE A O    5  
ATOM 5881  C CB   . PHE A 1 9  ? 9.246   -6.769  -14.466 1.00 0.00 ? 9  PHE A CB   5  
ATOM 5882  C CG   . PHE A 1 9  ? 10.613  -6.294  -13.967 1.00 0.00 ? 9  PHE A CG   5  
ATOM 5883  C CD1  . PHE A 1 9  ? 11.221  -6.937  -12.935 1.00 0.00 ? 9  PHE A CD1  5  
ATOM 5884  C CD2  . PHE A 1 9  ? 11.219  -5.229  -14.557 1.00 0.00 ? 9  PHE A CD2  5  
ATOM 5885  C CE1  . PHE A 1 9  ? 12.489  -6.496  -12.472 1.00 0.00 ? 9  PHE A CE1  5  
ATOM 5886  C CE2  . PHE A 1 9  ? 12.487  -4.788  -14.094 1.00 0.00 ? 9  PHE A CE2  5  
ATOM 5887  C CZ   . PHE A 1 9  ? 13.095  -5.431  -13.062 1.00 0.00 ? 9  PHE A CZ   5  
ATOM 5888  H H    . PHE A 1 9  ? 6.717   -6.869  -15.007 1.00 0.00 ? 9  PHE A H    5  
ATOM 5889  H HA   . PHE A 1 9  ? 8.254   -6.924  -12.508 1.00 0.00 ? 9  PHE A HA   5  
ATOM 5890  H HB2  . PHE A 1 9  ? 9.294   -7.841  -14.657 1.00 0.00 ? 9  PHE A HB2  5  
ATOM 5891  H HB3  . PHE A 1 9  ? 9.030   -6.284  -15.418 1.00 0.00 ? 9  PHE A HB3  5  
ATOM 5892  H HD1  . PHE A 1 9  ? 10.735  -7.790  -12.462 1.00 0.00 ? 9  PHE A HD1  5  
ATOM 5893  H HD2  . PHE A 1 9  ? 10.731  -4.714  -15.385 1.00 0.00 ? 9  PHE A HD2  5  
ATOM 5894  H HE1  . PHE A 1 9  ? 12.977  -7.011  -11.644 1.00 0.00 ? 9  PHE A HE1  5  
ATOM 5895  H HE2  . PHE A 1 9  ? 12.973  -3.934  -14.567 1.00 0.00 ? 9  PHE A HE2  5  
ATOM 5896  H HZ   . PHE A 1 9  ? 14.069  -5.092  -12.707 1.00 0.00 ? 9  PHE A HZ   5  
ATOM 5897  N N    . VAL A 1 10 ? 7.986   -4.513  -12.119 1.00 0.00 ? 10 VAL A N    5  
ATOM 5898  C CA   . VAL A 1 10 ? 7.834   -3.095  -11.840 1.00 0.00 ? 10 VAL A CA   5  
ATOM 5899  C C    . VAL A 1 10 ? 9.161   -2.381  -12.105 1.00 0.00 ? 10 VAL A C    5  
ATOM 5900  O O    . VAL A 1 10 ? 10.058  -2.398  -11.263 1.00 0.00 ? 10 VAL A O    5  
ATOM 5901  C CB   . VAL A 1 10 ? 7.322   -2.895  -10.412 1.00 0.00 ? 10 VAL A CB   5  
ATOM 5902  C CG1  . VAL A 1 10 ? 7.336   -1.414  -10.027 1.00 0.00 ? 10 VAL A CG1  5  
ATOM 5903  C CG2  . VAL A 1 10 ? 5.924   -3.492  -10.241 1.00 0.00 ? 10 VAL A CG2  5  
ATOM 5904  H H    . VAL A 1 10 ? 8.142   -5.087  -11.315 1.00 0.00 ? 10 VAL A H    5  
ATOM 5905  H HA   . VAL A 1 10 ? 7.082   -2.704  -12.526 1.00 0.00 ? 10 VAL A HA   5  
ATOM 5906  H HB   . VAL A 1 10 ? 7.996   -3.422  -9.737  1.00 0.00 ? 10 VAL A HB   5  
ATOM 5907  H HG11 . VAL A 1 10 ? 7.813   -0.837  -10.820 1.00 0.00 ? 10 VAL A HG11 5  
ATOM 5908  H HG12 . VAL A 1 10 ? 6.313   -1.065  -9.890  1.00 0.00 ? 10 VAL A HG12 5  
ATOM 5909  H HG13 . VAL A 1 10 ? 7.892   -1.285  -9.099  1.00 0.00 ? 10 VAL A HG13 5  
ATOM 5910  H HG21 . VAL A 1 10 ? 5.506   -3.723  -11.221 1.00 0.00 ? 10 VAL A HG21 5  
ATOM 5911  H HG22 . VAL A 1 10 ? 5.989   -4.406  -9.650  1.00 0.00 ? 10 VAL A HG22 5  
ATOM 5912  H HG23 . VAL A 1 10 ? 5.282   -2.774  -9.732  1.00 0.00 ? 10 VAL A HG23 5  
ATOM 5913  N N    . ILE A 1 11 ? 9.244   -1.772  -13.278 1.00 0.00 ? 11 ILE A N    5  
ATOM 5914  C CA   . ILE A 1 11 ? 10.447  -1.054  -13.665 1.00 0.00 ? 11 ILE A CA   5  
ATOM 5915  C C    . ILE A 1 11 ? 10.814  -0.054  -12.566 1.00 0.00 ? 11 ILE A C    5  
ATOM 5916  O O    . ILE A 1 11 ? 9.938   0.587   -11.987 1.00 0.00 ? 11 ILE A O    5  
ATOM 5917  C CB   . ILE A 1 11 ? 10.270  -0.415  -15.044 1.00 0.00 ? 11 ILE A CB   5  
ATOM 5918  C CG1  . ILE A 1 11 ? 9.047   0.505   -15.069 1.00 0.00 ? 11 ILE A CG1  5  
ATOM 5919  C CG2  . ILE A 1 11 ? 10.207  -1.482  -16.138 1.00 0.00 ? 11 ILE A CG2  5  
ATOM 5920  C CD1  . ILE A 1 11 ? 9.163   1.540   -16.189 1.00 0.00 ? 11 ILE A CD1  5  
ATOM 5921  H H    . ILE A 1 11 ? 8.510   -1.763  -13.957 1.00 0.00 ? 11 ILE A H    5  
ATOM 5922  H HA   . ILE A 1 11 ? 11.251  -1.785  -13.749 1.00 0.00 ? 11 ILE A HA   5  
ATOM 5923  H HB   . ILE A 1 11 ? 11.143  0.205   -15.248 1.00 0.00 ? 11 ILE A HB   5  
ATOM 5924  H HG12 . ILE A 1 11 ? 8.144   -0.089  -15.210 1.00 0.00 ? 11 ILE A HG12 5  
ATOM 5925  H HG13 . ILE A 1 11 ? 8.949   1.012   -14.109 1.00 0.00 ? 11 ILE A HG13 5  
ATOM 5926  H HG21 . ILE A 1 11 ? 9.199   -1.892  -16.189 1.00 0.00 ? 11 ILE A HG21 5  
ATOM 5927  H HG22 . ILE A 1 11 ? 10.465  -1.033  -17.098 1.00 0.00 ? 11 ILE A HG22 5  
ATOM 5928  H HG23 . ILE A 1 11 ? 10.914  -2.280  -15.909 1.00 0.00 ? 11 ILE A HG23 5  
ATOM 5929  H HD11 . ILE A 1 11 ? 8.906   2.526   -15.801 1.00 0.00 ? 11 ILE A HD11 5  
ATOM 5930  H HD12 . ILE A 1 11 ? 10.185  1.553   -16.568 1.00 0.00 ? 11 ILE A HD12 5  
ATOM 5931  H HD13 . ILE A 1 11 ? 8.480   1.279   -16.997 1.00 0.00 ? 11 ILE A HD13 5  
ATOM 5932  N N    . ASN A 1 12 ? 12.111  0.048   -12.312 1.00 0.00 ? 12 ASN A N    5  
ATOM 5933  C CA   . ASN A 1 12 ? 12.604  0.959   -11.294 1.00 0.00 ? 12 ASN A CA   5  
ATOM 5934  C C    . ASN A 1 12 ? 13.314  2.135   -11.968 1.00 0.00 ? 12 ASN A C    5  
ATOM 5935  O O    . ASN A 1 12 ? 14.379  1.966   -12.558 1.00 0.00 ? 12 ASN A O    5  
ATOM 5936  C CB   . ASN A 1 12 ? 13.611  0.264   -10.374 1.00 0.00 ? 12 ASN A CB   5  
ATOM 5937  C CG   . ASN A 1 12 ? 12.950  -0.165  -9.063  1.00 0.00 ? 12 ASN A CG   5  
ATOM 5938  O OD1  . ASN A 1 12 ? 11.769  0.040   -8.836  1.00 0.00 ? 12 ASN A OD1  5  
ATOM 5939  N ND2  . ASN A 1 12 ? 13.775  -0.771  -8.214  1.00 0.00 ? 12 ASN A ND2  5  
ATOM 5940  H H    . ASN A 1 12 ? 12.816  -0.477  -12.788 1.00 0.00 ? 12 ASN A H    5  
ATOM 5941  H HA   . ASN A 1 12 ? 11.721  1.269   -10.735 1.00 0.00 ? 12 ASN A HA   5  
ATOM 5942  H HB2  . ASN A 1 12 ? 14.027  -0.609  -10.878 1.00 0.00 ? 12 ASN A HB2  5  
ATOM 5943  H HB3  . ASN A 1 12 ? 14.442  0.937   -10.164 1.00 0.00 ? 12 ASN A HB3  5  
ATOM 5944  H HD21 . ASN A 1 12 ? 14.734  -0.908  -8.461  1.00 0.00 ? 12 ASN A HD21 5  
ATOM 5945  H HD22 . ASN A 1 12 ? 13.437  -1.088  -7.328  1.00 0.00 ? 12 ASN A HD22 5  
ATOM 5946  N N    . PRO A 1 13 ? 12.678  3.331   -11.854 1.00 0.00 ? 13 PRO A N    5  
ATOM 5947  C CA   . PRO A 1 13 ? 13.236  4.535   -12.446 1.00 0.00 ? 13 PRO A CA   5  
ATOM 5948  C C    . PRO A 1 13 ? 14.422  5.049   -11.627 1.00 0.00 ? 13 PRO A C    5  
ATOM 5949  O O    . PRO A 1 13 ? 15.517  5.226   -12.158 1.00 0.00 ? 13 PRO A O    5  
ATOM 5950  C CB   . PRO A 1 13 ? 12.080  5.520   -12.499 1.00 0.00 ? 13 PRO A CB   5  
ATOM 5951  C CG   . PRO A 1 13 ? 11.043  5.000   -11.517 1.00 0.00 ? 13 PRO A CG   5  
ATOM 5952  C CD   . PRO A 1 13 ? 11.414  3.569   -11.162 1.00 0.00 ? 13 PRO A CD   5  
ATOM 5953  H HA   . PRO A 1 13 ? 13.598  4.338   -13.357 1.00 0.00 ? 13 PRO A HA   5  
ATOM 5954  H HB2  . PRO A 1 13 ? 12.408  6.523   -12.225 1.00 0.00 ? 13 PRO A HB2  5  
ATOM 5955  H HB3  . PRO A 1 13 ? 11.667  5.584   -13.506 1.00 0.00 ? 13 PRO A HB3  5  
ATOM 5956  H HG2  . PRO A 1 13 ? 11.019  5.621   -10.622 1.00 0.00 ? 13 PRO A HG2  5  
ATOM 5957  H HG3  . PRO A 1 13 ? 10.047  5.038   -11.958 1.00 0.00 ? 13 PRO A HG3  5  
ATOM 5958  H HD2  . PRO A 1 13 ? 11.523  3.444   -10.085 1.00 0.00 ? 13 PRO A HD2  5  
ATOM 5959  H HD3  . PRO A 1 13 ? 10.646  2.868   -11.489 1.00 0.00 ? 13 PRO A HD3  5  
ATOM 5960  N N    . ASN A 1 14 ? 14.164  5.273   -10.347 1.00 0.00 ? 14 ASN A N    5  
ATOM 5961  C CA   . ASN A 1 14 ? 15.196  5.763   -9.449  1.00 0.00 ? 14 ASN A CA   5  
ATOM 5962  C C    . ASN A 1 14 ? 14.923  5.246   -8.035  1.00 0.00 ? 14 ASN A C    5  
ATOM 5963  O O    . ASN A 1 14 ? 13.805  5.357   -7.535  1.00 0.00 ? 14 ASN A O    5  
ATOM 5964  C CB   . ASN A 1 14 ? 15.204  7.292   -9.401  1.00 0.00 ? 14 ASN A CB   5  
ATOM 5965  C CG   . ASN A 1 14 ? 16.632  7.836   -9.475  1.00 0.00 ? 14 ASN A CG   5  
ATOM 5966  O OD1  . ASN A 1 14 ? 17.435  7.667   -8.572  1.00 0.00 ? 14 ASN A OD1  5  
ATOM 5967  N ND2  . ASN A 1 14 ? 16.902  8.496   -10.597 1.00 0.00 ? 14 ASN A ND2  5  
ATOM 5968  H H    . ASN A 1 14 ? 13.270  5.126   -9.923  1.00 0.00 ? 14 ASN A H    5  
ATOM 5969  H HA   . ASN A 1 14 ? 16.133  5.385   -9.858  1.00 0.00 ? 14 ASN A HA   5  
ATOM 5970  H HB2  . ASN A 1 14 ? 14.616  7.689   -10.229 1.00 0.00 ? 14 ASN A HB2  5  
ATOM 5971  H HB3  . ASN A 1 14 ? 14.728  7.633   -8.481  1.00 0.00 ? 14 ASN A HB3  5  
ATOM 5972  H HD21 . ASN A 1 14 ? 16.197  8.598   -11.299 1.00 0.00 ? 14 ASN A HD21 5  
ATOM 5973  H HD22 . ASN A 1 14 ? 17.810  8.889   -10.739 1.00 0.00 ? 14 ASN A HD22 5  
ATOM 5974  N N    . GLY A 1 15 ? 15.964  4.693   -7.431  1.00 0.00 ? 15 GLY A N    5  
ATOM 5975  C CA   . GLY A 1 15 ? 15.851  4.159   -6.084  1.00 0.00 ? 15 GLY A CA   5  
ATOM 5976  C C    . GLY A 1 15 ? 14.618  3.263   -5.951  1.00 0.00 ? 15 GLY A C    5  
ATOM 5977  O O    . GLY A 1 15 ? 14.217  2.606   -6.911  1.00 0.00 ? 15 GLY A O    5  
ATOM 5978  H H    . GLY A 1 15 ? 16.871  4.606   -7.845  1.00 0.00 ? 15 GLY A H    5  
ATOM 5979  H HA2  . GLY A 1 15 ? 16.747  3.589   -5.839  1.00 0.00 ? 15 GLY A HA2  5  
ATOM 5980  H HA3  . GLY A 1 15 ? 15.789  4.978   -5.368  1.00 0.00 ? 15 GLY A HA3  5  
ATOM 5981  N N    . LYS A 1 16 ? 14.050  3.266   -4.754  1.00 0.00 ? 16 LYS A N    5  
ATOM 5982  C CA   . LYS A 1 16 ? 12.870  2.462   -4.483  1.00 0.00 ? 16 LYS A CA   5  
ATOM 5983  C C    . LYS A 1 16 ? 11.686  3.385   -4.191  1.00 0.00 ? 16 LYS A C    5  
ATOM 5984  O O    . LYS A 1 16 ? 11.808  4.332   -3.416  1.00 0.00 ? 16 LYS A O    5  
ATOM 5985  C CB   . LYS A 1 16 ? 13.154  1.454   -3.368  1.00 0.00 ? 16 LYS A CB   5  
ATOM 5986  C CG   . LYS A 1 16 ? 14.084  0.342   -3.858  1.00 0.00 ? 16 LYS A CG   5  
ATOM 5987  C CD   . LYS A 1 16 ? 15.532  0.620   -3.449  1.00 0.00 ? 16 LYS A CD   5  
ATOM 5988  C CE   . LYS A 1 16 ? 16.505  0.173   -4.543  1.00 0.00 ? 16 LYS A CE   5  
ATOM 5989  N NZ   . LYS A 1 16 ? 17.253  -1.029  -4.112  1.00 0.00 ? 16 LYS A NZ   5  
ATOM 5990  H H    . LYS A 1 16 ? 14.382  3.804   -3.979  1.00 0.00 ? 16 LYS A H    5  
ATOM 5991  H HA   . LYS A 1 16 ? 12.650  1.892   -5.385  1.00 0.00 ? 16 LYS A HA   5  
ATOM 5992  H HB2  . LYS A 1 16 ? 13.607  1.963   -2.518  1.00 0.00 ? 16 LYS A HB2  5  
ATOM 5993  H HB3  . LYS A 1 16 ? 12.217  1.021   -3.018  1.00 0.00 ? 16 LYS A HB3  5  
ATOM 5994  H HG2  . LYS A 1 16 ? 13.763  -0.614  -3.444  1.00 0.00 ? 16 LYS A HG2  5  
ATOM 5995  H HG3  . LYS A 1 16 ? 14.018  0.259   -4.942  1.00 0.00 ? 16 LYS A HG3  5  
ATOM 5996  H HD2  . LYS A 1 16 ? 15.662  1.685   -3.255  1.00 0.00 ? 16 LYS A HD2  5  
ATOM 5997  H HD3  . LYS A 1 16 ? 15.759  0.097   -2.520  1.00 0.00 ? 16 LYS A HD3  5  
ATOM 5998  H HE2  . LYS A 1 16 ? 15.957  -0.042  -5.460  1.00 0.00 ? 16 LYS A HE2  5  
ATOM 5999  H HE3  . LYS A 1 16 ? 17.202  0.981   -4.770  1.00 0.00 ? 16 LYS A HE3  5  
ATOM 6000  H HZ1  . LYS A 1 16 ? 18.191  -0.979  -4.456  1.00 0.00 ? 16 LYS A HZ1  5  
ATOM 6001  H HZ2  . LYS A 1 16 ? 17.267  -1.072  -3.113  1.00 0.00 ? 16 LYS A HZ2  5  
ATOM 6002  H HZ3  . LYS A 1 16 ? 16.808  -1.847  -4.475  1.00 0.00 ? 16 LYS A HZ3  5  
ATOM 6003  N N    . SER A 1 17 ? 10.565  3.077   -4.827  1.00 0.00 ? 17 SER A N    5  
ATOM 6004  C CA   . SER A 1 17 ? 9.359   3.866   -4.646  1.00 0.00 ? 17 SER A CA   5  
ATOM 6005  C C    . SER A 1 17 ? 8.480   3.237   -3.563  1.00 0.00 ? 17 SER A C    5  
ATOM 6006  O O    . SER A 1 17 ? 8.573   2.039   -3.302  1.00 0.00 ? 17 SER A O    5  
ATOM 6007  C CB   . SER A 1 17 ? 8.580   3.992   -5.956  1.00 0.00 ? 17 SER A CB   5  
ATOM 6008  O OG   . SER A 1 17 ? 9.382   4.528   -7.005  1.00 0.00 ? 17 SER A OG   5  
ATOM 6009  H H    . SER A 1 17 ? 10.474  2.304   -5.456  1.00 0.00 ? 17 SER A H    5  
ATOM 6010  H HA   . SER A 1 17 ? 9.704   4.852   -4.333  1.00 0.00 ? 17 SER A HA   5  
ATOM 6011  H HB2  . SER A 1 17 ? 8.206   3.011   -6.251  1.00 0.00 ? 17 SER A HB2  5  
ATOM 6012  H HB3  . SER A 1 17 ? 7.711   4.631   -5.802  1.00 0.00 ? 17 SER A HB3  5  
ATOM 6013  H HG   . SER A 1 17 ? 9.146   4.092   -7.873  1.00 0.00 ? 17 SER A HG   5  
ATOM 6014  N N    . GLU A 1 18 ? 7.646   4.073   -2.963  1.00 0.00 ? 18 GLU A N    5  
ATOM 6015  C CA   . GLU A 1 18 ? 6.750   3.614   -1.915  1.00 0.00 ? 18 GLU A CA   5  
ATOM 6016  C C    . GLU A 1 18 ? 6.184   2.237   -2.267  1.00 0.00 ? 18 GLU A C    5  
ATOM 6017  O O    . GLU A 1 18 ? 6.456   1.255   -1.578  1.00 0.00 ? 18 GLU A O    5  
ATOM 6018  C CB   . GLU A 1 18 ? 5.626   4.623   -1.673  1.00 0.00 ? 18 GLU A CB   5  
ATOM 6019  C CG   . GLU A 1 18 ? 5.519   4.978   -0.189  1.00 0.00 ? 18 GLU A CG   5  
ATOM 6020  C CD   . GLU A 1 18 ? 6.444   6.144   0.165   1.00 0.00 ? 18 GLU A CD   5  
ATOM 6021  O OE1  . GLU A 1 18 ? 6.257   7.221   -0.443  1.00 0.00 ? 18 GLU A OE1  5  
ATOM 6022  O OE2  . GLU A 1 18 ? 7.317   5.933   1.034   1.00 0.00 ? 18 GLU A OE2  5  
ATOM 6023  H H    . GLU A 1 18 ? 7.576   5.047   -3.182  1.00 0.00 ? 18 GLU A H    5  
ATOM 6024  H HA   . GLU A 1 18 ? 7.366   3.543   -1.019  1.00 0.00 ? 18 GLU A HA   5  
ATOM 6025  H HB2  . GLU A 1 18 ? 5.812   5.526   -2.254  1.00 0.00 ? 18 GLU A HB2  5  
ATOM 6026  H HB3  . GLU A 1 18 ? 4.680   4.210   -2.021  1.00 0.00 ? 18 GLU A HB3  5  
ATOM 6027  H HG2  . GLU A 1 18 ? 4.489   5.240   0.053   1.00 0.00 ? 18 GLU A HG2  5  
ATOM 6028  H HG3  . GLU A 1 18 ? 5.776   4.109   0.416   1.00 0.00 ? 18 GLU A HG3  5  
ATOM 6029  N N    . VAL A 1 19 ? 5.406   2.208   -3.340  1.00 0.00 ? 19 VAL A N    5  
ATOM 6030  C CA   . VAL A 1 19 ? 4.799   0.968   -3.791  1.00 0.00 ? 19 VAL A CA   5  
ATOM 6031  C C    . VAL A 1 19 ? 5.819   -0.167  -3.672  1.00 0.00 ? 19 VAL A C    5  
ATOM 6032  O O    . VAL A 1 19 ? 5.478   -1.270  -3.249  1.00 0.00 ? 19 VAL A O    5  
ATOM 6033  C CB   . VAL A 1 19 ? 4.257   1.137   -5.212  1.00 0.00 ? 19 VAL A CB   5  
ATOM 6034  C CG1  . VAL A 1 19 ? 3.188   2.230   -5.264  1.00 0.00 ? 19 VAL A CG1  5  
ATOM 6035  C CG2  . VAL A 1 19 ? 5.389   1.430   -6.199  1.00 0.00 ? 19 VAL A CG2  5  
ATOM 6036  H H    . VAL A 1 19 ? 5.190   3.011   -3.895  1.00 0.00 ? 19 VAL A H    5  
ATOM 6037  H HA   . VAL A 1 19 ? 3.958   0.754   -3.132  1.00 0.00 ? 19 VAL A HA   5  
ATOM 6038  H HB   . VAL A 1 19 ? 3.790   0.197   -5.507  1.00 0.00 ? 19 VAL A HB   5  
ATOM 6039  H HG11 . VAL A 1 19 ? 2.503   2.108   -4.425  1.00 0.00 ? 19 VAL A HG11 5  
ATOM 6040  H HG12 . VAL A 1 19 ? 3.665   3.208   -5.205  1.00 0.00 ? 19 VAL A HG12 5  
ATOM 6041  H HG13 . VAL A 1 19 ? 2.634   2.152   -6.199  1.00 0.00 ? 19 VAL A HG13 5  
ATOM 6042  H HG21 . VAL A 1 19 ? 6.050   0.566   -6.260  1.00 0.00 ? 19 VAL A HG21 5  
ATOM 6043  H HG22 . VAL A 1 19 ? 4.968   1.635   -7.184  1.00 0.00 ? 19 VAL A HG22 5  
ATOM 6044  H HG23 . VAL A 1 19 ? 5.954   2.297   -5.858  1.00 0.00 ? 19 VAL A HG23 5  
ATOM 6045  N N    . CYS A 1 20 ? 7.049   0.144   -4.052  1.00 0.00 ? 20 CYS A N    5  
ATOM 6046  C CA   . CYS A 1 20 ? 8.121   -0.836  -3.993  1.00 0.00 ? 20 CYS A CA   5  
ATOM 6047  C C    . CYS A 1 20 ? 8.487   -1.059  -2.524  1.00 0.00 ? 20 CYS A C    5  
ATOM 6048  O O    . CYS A 1 20 ? 8.337   -2.163  -2.004  1.00 0.00 ? 20 CYS A O    5  
ATOM 6049  C CB   . CYS A 1 20 ? 9.330   -0.403  -4.824  1.00 0.00 ? 20 CYS A CB   5  
ATOM 6050  S SG   . CYS A 1 20 ? 9.329   -1.274  -6.433  1.00 0.00 ? 20 CYS A SG   5  
ATOM 6051  H H    . CYS A 1 20 ? 7.318   1.044   -4.395  1.00 0.00 ? 20 CYS A H    5  
ATOM 6052  H HA   . CYS A 1 20 ? 7.732   -1.752  -4.438  1.00 0.00 ? 20 CYS A HA   5  
ATOM 6053  H HB2  . CYS A 1 20 ? 9.304   0.675   -4.985  1.00 0.00 ? 20 CYS A HB2  5  
ATOM 6054  H HB3  . CYS A 1 20 ? 10.251  -0.622  -4.283  1.00 0.00 ? 20 CYS A HB3  5  
ATOM 6055  H HG   . CYS A 1 20 ? 8.262   -0.654  -6.926  1.00 0.00 ? 20 CYS A HG   5  
ATOM 6056  N N    . ILE A 1 21 ? 8.962   0.008   -1.898  1.00 0.00 ? 21 ILE A N    5  
ATOM 6057  C CA   . ILE A 1 21 ? 9.351   -0.058  -0.499  1.00 0.00 ? 21 ILE A CA   5  
ATOM 6058  C C    . ILE A 1 21 ? 8.336   -0.906  0.269   1.00 0.00 ? 21 ILE A C    5  
ATOM 6059  O O    . ILE A 1 21 ? 8.683   -1.951  0.818   1.00 0.00 ? 21 ILE A O    5  
ATOM 6060  C CB   . ILE A 1 21 ? 9.534   1.350   0.072   1.00 0.00 ? 21 ILE A CB   5  
ATOM 6061  C CG1  . ILE A 1 21 ? 10.780  2.020   -0.509  1.00 0.00 ? 21 ILE A CG1  5  
ATOM 6062  C CG2  . ILE A 1 21 ? 9.559   1.321   1.602   1.00 0.00 ? 21 ILE A CG2  5  
ATOM 6063  C CD1  . ILE A 1 21 ? 10.678  3.544   -0.415  1.00 0.00 ? 21 ILE A CD1  5  
ATOM 6064  H H    . ILE A 1 21 ? 9.081   0.902   -2.328  1.00 0.00 ? 21 ILE A H    5  
ATOM 6065  H HA   . ILE A 1 21 ? 10.321  -0.553  -0.453  1.00 0.00 ? 21 ILE A HA   5  
ATOM 6066  H HB   . ILE A 1 21 ? 8.676   1.953   -0.224  1.00 0.00 ? 21 ILE A HB   5  
ATOM 6067  H HG12 . ILE A 1 21 ? 11.665  1.677   0.027   1.00 0.00 ? 21 ILE A HG12 5  
ATOM 6068  H HG13 . ILE A 1 21 ? 10.904  1.724   -1.551  1.00 0.00 ? 21 ILE A HG13 5  
ATOM 6069  H HG21 . ILE A 1 21 ? 10.444  1.847   1.960   1.00 0.00 ? 21 ILE A HG21 5  
ATOM 6070  H HG22 . ILE A 1 21 ? 8.665   1.810   1.989   1.00 0.00 ? 21 ILE A HG22 5  
ATOM 6071  H HG23 . ILE A 1 21 ? 9.587   0.287   1.946   1.00 0.00 ? 21 ILE A HG23 5  
ATOM 6072  H HD11 . ILE A 1 21 ? 9.749   3.815   0.086   1.00 0.00 ? 21 ILE A HD11 5  
ATOM 6073  H HD12 . ILE A 1 21 ? 11.524  3.930   0.153   1.00 0.00 ? 21 ILE A HD12 5  
ATOM 6074  H HD13 . ILE A 1 21 ? 10.688  3.971   -1.418  1.00 0.00 ? 21 ILE A HD13 5  
ATOM 6075  N N    . LEU A 1 22 ? 7.101   -0.426  0.284   1.00 0.00 ? 22 LEU A N    5  
ATOM 6076  C CA   . LEU A 1 22 ? 6.033   -1.127  0.976   1.00 0.00 ? 22 LEU A CA   5  
ATOM 6077  C C    . LEU A 1 22 ? 6.166   -2.630  0.720   1.00 0.00 ? 22 LEU A C    5  
ATOM 6078  O O    . LEU A 1 22 ? 6.102   -3.430  1.652   1.00 0.00 ? 22 LEU A O    5  
ATOM 6079  C CB   . LEU A 1 22 ? 4.671   -0.554  0.580   1.00 0.00 ? 22 LEU A CB   5  
ATOM 6080  C CG   . LEU A 1 22 ? 3.451   -1.384  0.983   1.00 0.00 ? 22 LEU A CG   5  
ATOM 6081  C CD1  . LEU A 1 22 ? 3.282   -2.594  0.061   1.00 0.00 ? 22 LEU A CD1  5  
ATOM 6082  C CD2  . LEU A 1 22 ? 3.528   -1.792  2.456   1.00 0.00 ? 22 LEU A CD2  5  
ATOM 6083  H H    . LEU A 1 22 ? 6.827   0.425   -0.165  1.00 0.00 ? 22 LEU A H    5  
ATOM 6084  H HA   . LEU A 1 22 ? 6.161   -0.946  2.043   1.00 0.00 ? 22 LEU A HA   5  
ATOM 6085  H HB2  . LEU A 1 22 ? 4.574   0.437   1.023   1.00 0.00 ? 22 LEU A HB2  5  
ATOM 6086  H HB3  . LEU A 1 22 ? 4.655   -0.422  -0.502  1.00 0.00 ? 22 LEU A HB3  5  
ATOM 6087  H HG   . LEU A 1 22 ? 2.562   -0.764  0.866   1.00 0.00 ? 22 LEU A HG   5  
ATOM 6088  H HD11 . LEU A 1 22 ? 3.980   -2.515  -0.773  1.00 0.00 ? 22 LEU A HD11 5  
ATOM 6089  H HD12 . LEU A 1 22 ? 3.486   -3.508  0.620   1.00 0.00 ? 22 LEU A HD12 5  
ATOM 6090  H HD13 . LEU A 1 22 ? 2.261   -2.621  -0.320  1.00 0.00 ? 22 LEU A HD13 5  
ATOM 6091  H HD21 . LEU A 1 22 ? 2.618   -2.325  2.733   1.00 0.00 ? 22 LEU A HD21 5  
ATOM 6092  H HD22 . LEU A 1 22 ? 4.390   -2.441  2.609   1.00 0.00 ? 22 LEU A HD22 5  
ATOM 6093  H HD23 . LEU A 1 22 ? 3.629   -0.900  3.075   1.00 0.00 ? 22 LEU A HD23 5  
ATOM 6094  N N    . HIS A 1 23 ? 6.348   -2.968  -0.549  1.00 0.00 ? 23 HIS A N    5  
ATOM 6095  C CA   . HIS A 1 23 ? 6.491   -4.360  -0.939  1.00 0.00 ? 23 HIS A CA   5  
ATOM 6096  C C    . HIS A 1 23 ? 7.680   -4.980  -0.202  1.00 0.00 ? 23 HIS A C    5  
ATOM 6097  O O    . HIS A 1 23 ? 7.521   -5.958  0.527   1.00 0.00 ? 23 HIS A O    5  
ATOM 6098  C CB   . HIS A 1 23 ? 6.602   -4.489  -2.459  1.00 0.00 ? 23 HIS A CB   5  
ATOM 6099  C CG   . HIS A 1 23 ? 6.431   -5.900  -2.970  1.00 0.00 ? 23 HIS A CG   5  
ATOM 6100  N ND1  . HIS A 1 23 ? 5.908   -6.187  -4.219  1.00 0.00 ? 23 HIS A ND1  5  
ATOM 6101  C CD2  . HIS A 1 23 ? 6.720   -7.099  -2.389  1.00 0.00 ? 23 HIS A CD2  5  
ATOM 6102  C CE1  . HIS A 1 23 ? 5.886   -7.503  -4.371  1.00 0.00 ? 23 HIS A CE1  5  
ATOM 6103  N NE2  . HIS A 1 23 ? 6.390   -8.067  -3.235  1.00 0.00 ? 23 HIS A NE2  5  
ATOM 6104  H H    . HIS A 1 23 ? 6.399   -2.310  -1.301  1.00 0.00 ? 23 HIS A H    5  
ATOM 6105  H HA   . HIS A 1 23 ? 5.577   -4.867  -0.628  1.00 0.00 ? 23 HIS A HA   5  
ATOM 6106  H HB2  . HIS A 1 23 ? 5.850   -3.852  -2.924  1.00 0.00 ? 23 HIS A HB2  5  
ATOM 6107  H HB3  . HIS A 1 23 ? 7.576   -4.115  -2.775  1.00 0.00 ? 23 HIS A HB3  5  
ATOM 6108  H HD1  . HIS A 1 23 ? 5.598   -5.515  -4.892  1.00 0.00 ? 23 HIS A HD1  5  
ATOM 6109  H HD2  . HIS A 1 23 ? 7.149   -7.239  -1.397  1.00 0.00 ? 23 HIS A HD2  5  
ATOM 6110  H HE1  . HIS A 1 23 ? 5.530   -8.041  -5.249  1.00 0.00 ? 23 HIS A HE1  5  
ATOM 6111  N N    . GLU A 1 24 ? 8.844   -4.387  -0.419  1.00 0.00 ? 24 GLU A N    5  
ATOM 6112  C CA   . GLU A 1 24 ? 10.059  -4.869  0.214   1.00 0.00 ? 24 GLU A CA   5  
ATOM 6113  C C    . GLU A 1 24 ? 9.776   -5.280  1.661   1.00 0.00 ? 24 GLU A C    5  
ATOM 6114  O O    . GLU A 1 24 ? 9.802   -6.465  1.990   1.00 0.00 ? 24 GLU A O    5  
ATOM 6115  C CB   . GLU A 1 24 ? 11.167  -3.815  0.151   1.00 0.00 ? 24 GLU A CB   5  
ATOM 6116  C CG   . GLU A 1 24 ? 12.387  -4.348  -0.603  1.00 0.00 ? 24 GLU A CG   5  
ATOM 6117  C CD   . GLU A 1 24 ? 13.506  -4.731  0.367   1.00 0.00 ? 24 GLU A CD   5  
ATOM 6118  O OE1  . GLU A 1 24 ? 14.165  -3.796  0.872   1.00 0.00 ? 24 GLU A OE1  5  
ATOM 6119  O OE2  . GLU A 1 24 ? 13.678  -5.950  0.582   1.00 0.00 ? 24 GLU A OE2  5  
ATOM 6120  H H    . GLU A 1 24 ? 8.965   -3.593  -1.015  1.00 0.00 ? 24 GLU A H    5  
ATOM 6121  H HA   . GLU A 1 24 ? 10.362  -5.741  -0.365  1.00 0.00 ? 24 GLU A HA   5  
ATOM 6122  H HB2  . GLU A 1 24 ? 10.792  -2.919  -0.343  1.00 0.00 ? 24 GLU A HB2  5  
ATOM 6123  H HB3  . GLU A 1 24 ? 11.456  -3.525  1.161   1.00 0.00 ? 24 GLU A HB3  5  
ATOM 6124  H HG2  . GLU A 1 24 ? 12.102  -5.216  -1.197  1.00 0.00 ? 24 GLU A HG2  5  
ATOM 6125  H HG3  . GLU A 1 24 ? 12.748  -3.590  -1.299  1.00 0.00 ? 24 GLU A HG3  5  
ATOM 6126  N N    . TYR A 1 25 ? 9.513   -4.278  2.486   1.00 0.00 ? 25 TYR A N    5  
ATOM 6127  C CA   . TYR A 1 25 ? 9.225   -4.520  3.890   1.00 0.00 ? 25 TYR A CA   5  
ATOM 6128  C C    . TYR A 1 25 ? 8.168   -5.614  4.052   1.00 0.00 ? 25 TYR A C    5  
ATOM 6129  O O    . TYR A 1 25 ? 8.258   -6.440  4.959   1.00 0.00 ? 25 TYR A O    5  
ATOM 6130  C CB   . TYR A 1 25 ? 8.670   -3.205  4.440   1.00 0.00 ? 25 TYR A CB   5  
ATOM 6131  C CG   . TYR A 1 25 ? 7.954   -3.346  5.784   1.00 0.00 ? 25 TYR A CG   5  
ATOM 6132  C CD1  . TYR A 1 25 ? 6.740   -3.999  5.855   1.00 0.00 ? 25 TYR A CD1  5  
ATOM 6133  C CD2  . TYR A 1 25 ? 8.521   -2.819  6.927   1.00 0.00 ? 25 TYR A CD2  5  
ATOM 6134  C CE1  . TYR A 1 25 ? 6.066   -4.132  7.121   1.00 0.00 ? 25 TYR A CE1  5  
ATOM 6135  C CE2  . TYR A 1 25 ? 7.847   -2.951  8.193   1.00 0.00 ? 25 TYR A CE2  5  
ATOM 6136  C CZ   . TYR A 1 25 ? 6.653   -3.601  8.227   1.00 0.00 ? 25 TYR A CZ   5  
ATOM 6137  O OH   . TYR A 1 25 ? 6.017   -3.726  9.422   1.00 0.00 ? 25 TYR A OH   5  
ATOM 6138  H H    . TYR A 1 25 ? 9.494   -3.317  2.211   1.00 0.00 ? 25 TYR A H    5  
ATOM 6139  H HA   . TYR A 1 25 ? 10.148  -4.843  4.371   1.00 0.00 ? 25 TYR A HA   5  
ATOM 6140  H HB2  . TYR A 1 25 ? 9.488   -2.494  4.548   1.00 0.00 ? 25 TYR A HB2  5  
ATOM 6141  H HB3  . TYR A 1 25 ? 7.976   -2.783  3.713   1.00 0.00 ? 25 TYR A HB3  5  
ATOM 6142  H HD1  . TYR A 1 25 ? 6.292   -4.415  4.953   1.00 0.00 ? 25 TYR A HD1  5  
ATOM 6143  H HD2  . TYR A 1 25 ? 9.480   -2.303  6.871   1.00 0.00 ? 25 TYR A HD2  5  
ATOM 6144  H HE1  . TYR A 1 25 ? 5.107   -4.645  7.191   1.00 0.00 ? 25 TYR A HE1  5  
ATOM 6145  H HE2  . TYR A 1 25 ? 8.285   -2.540  9.102   1.00 0.00 ? 25 TYR A HE2  5  
ATOM 6146  H HH   . TYR A 1 25 ? 5.046   -3.913  9.275   1.00 0.00 ? 25 TYR A HH   5  
ATOM 6147  N N    . MET A 1 26 ? 7.190   -5.584  3.158   1.00 0.00 ? 26 MET A N    5  
ATOM 6148  C CA   . MET A 1 26 ? 6.116   -6.563  3.191   1.00 0.00 ? 26 MET A CA   5  
ATOM 6149  C C    . MET A 1 26 ? 6.651   -7.973  2.932   1.00 0.00 ? 26 MET A C    5  
ATOM 6150  O O    . MET A 1 26 ? 6.418   -8.885  3.724   1.00 0.00 ? 26 MET A O    5  
ATOM 6151  C CB   . MET A 1 26 ? 5.071   -6.210  2.131   1.00 0.00 ? 26 MET A CB   5  
ATOM 6152  C CG   . MET A 1 26 ? 3.854   -5.534  2.764   1.00 0.00 ? 26 MET A CG   5  
ATOM 6153  S SD   . MET A 1 26 ? 2.352   -6.216  2.080   1.00 0.00 ? 26 MET A SD   5  
ATOM 6154  C CE   . MET A 1 26 ? 2.650   -7.955  2.350   1.00 0.00 ? 26 MET A CE   5  
ATOM 6155  H H    . MET A 1 26 ? 7.124   -4.909  2.424   1.00 0.00 ? 26 MET A H    5  
ATOM 6156  H HA   . MET A 1 26 ? 5.698   -6.505  4.196   1.00 0.00 ? 26 MET A HA   5  
ATOM 6157  H HB2  . MET A 1 26 ? 5.513   -5.548  1.386   1.00 0.00 ? 26 MET A HB2  5  
ATOM 6158  H HB3  . MET A 1 26 ? 4.759   -7.114  1.608   1.00 0.00 ? 26 MET A HB3  5  
ATOM 6159  H HG2  . MET A 1 26 ? 3.869   -5.678  3.845   1.00 0.00 ? 26 MET A HG2  5  
ATOM 6160  H HG3  . MET A 1 26 ? 3.890   -4.460  2.585   1.00 0.00 ? 26 MET A HG3  5  
ATOM 6161  H HE1  . MET A 1 26 ? 1.778   -8.404  2.825   1.00 0.00 ? 26 MET A HE1  5  
ATOM 6162  H HE2  . MET A 1 26 ? 2.836   -8.444  1.394   1.00 0.00 ? 26 MET A HE2  5  
ATOM 6163  H HE3  . MET A 1 26 ? 3.519   -8.079  2.996   1.00 0.00 ? 26 MET A HE3  5  
ATOM 6164  N N    . GLN A 1 27 ? 7.359   -8.107  1.820   1.00 0.00 ? 27 GLN A N    5  
ATOM 6165  C CA   . GLN A 1 27 ? 7.929   -9.390  1.446   1.00 0.00 ? 27 GLN A CA   5  
ATOM 6166  C C    . GLN A 1 27 ? 9.151   -9.701  2.313   1.00 0.00 ? 27 GLN A C    5  
ATOM 6167  O O    . GLN A 1 27 ? 9.679   -10.811 2.273   1.00 0.00 ? 27 GLN A O    5  
ATOM 6168  C CB   . GLN A 1 27 ? 8.291   -9.418  -0.040  1.00 0.00 ? 27 GLN A CB   5  
ATOM 6169  C CG   . GLN A 1 27 ? 9.372   -10.462 -0.322  1.00 0.00 ? 27 GLN A CG   5  
ATOM 6170  C CD   . GLN A 1 27 ? 8.888   -11.866 0.046   1.00 0.00 ? 27 GLN A CD   5  
ATOM 6171  O OE1  . GLN A 1 27 ? 7.702   -12.138 0.137   1.00 0.00 ? 27 GLN A OE1  5  
ATOM 6172  N NE2  . GLN A 1 27 ? 9.869   -12.740 0.253   1.00 0.00 ? 27 GLN A NE2  5  
ATOM 6173  H H    . GLN A 1 27 ? 7.544   -7.360  1.181   1.00 0.00 ? 27 GLN A H    5  
ATOM 6174  H HA   . GLN A 1 27 ? 7.145   -10.122 1.636   1.00 0.00 ? 27 GLN A HA   5  
ATOM 6175  H HB2  . GLN A 1 27 ? 7.402   -9.641  -0.631  1.00 0.00 ? 27 GLN A HB2  5  
ATOM 6176  H HB3  . GLN A 1 27 ? 8.641   -8.433  -0.352  1.00 0.00 ? 27 GLN A HB3  5  
ATOM 6177  H HG2  . GLN A 1 27 ? 9.645   -10.433 -1.377  1.00 0.00 ? 27 GLN A HG2  5  
ATOM 6178  H HG3  . GLN A 1 27 ? 10.271  -10.223 0.246   1.00 0.00 ? 27 GLN A HG3  5  
ATOM 6179  H HE21 . GLN A 1 27 ? 10.823  -12.452 0.162   1.00 0.00 ? 27 GLN A HE21 5  
ATOM 6180  H HE22 . GLN A 1 27 ? 9.654   -13.685 0.499   1.00 0.00 ? 27 GLN A HE22 5  
ATOM 6181  N N    . ARG A 1 28 ? 9.564   -8.701  3.077   1.00 0.00 ? 28 ARG A N    5  
ATOM 6182  C CA   . ARG A 1 28 ? 10.714  -8.853  3.953   1.00 0.00 ? 28 ARG A CA   5  
ATOM 6183  C C    . ARG A 1 28 ? 10.261  -9.259  5.357   1.00 0.00 ? 28 ARG A C    5  
ATOM 6184  O O    . ARG A 1 28 ? 10.912  -10.072 6.012   1.00 0.00 ? 28 ARG A O    5  
ATOM 6185  C CB   . ARG A 1 28 ? 11.517  -7.554  4.039   1.00 0.00 ? 28 ARG A CB   5  
ATOM 6186  C CG   . ARG A 1 28 ? 12.495  -7.591  5.215   1.00 0.00 ? 28 ARG A CG   5  
ATOM 6187  C CD   . ARG A 1 28 ? 13.815  -6.909  4.852   1.00 0.00 ? 28 ARG A CD   5  
ATOM 6188  N NE   . ARG A 1 28 ? 14.482  -6.411  6.076   1.00 0.00 ? 28 ARG A NE   5  
ATOM 6189  C CZ   . ARG A 1 28 ? 15.479  -5.516  6.077   1.00 0.00 ? 28 ARG A CZ   5  
ATOM 6190  N NH1  . ARG A 1 28 ? 15.931  -5.015  4.920   1.00 0.00 ? 28 ARG A NH1  5  
ATOM 6191  N NH2  . ARG A 1 28 ? 16.024  -5.123  7.236   1.00 0.00 ? 28 ARG A NH2  5  
ATOM 6192  H H    . ARG A 1 28 ? 9.129   -7.801  3.104   1.00 0.00 ? 28 ARG A H    5  
ATOM 6193  H HA   . ARG A 1 28 ? 11.313  -9.638  3.492   1.00 0.00 ? 28 ARG A HA   5  
ATOM 6194  H HB2  . ARG A 1 28 ? 12.065  -7.399  3.110   1.00 0.00 ? 28 ARG A HB2  5  
ATOM 6195  H HB3  . ARG A 1 28 ? 10.838  -6.709  4.153   1.00 0.00 ? 28 ARG A HB3  5  
ATOM 6196  H HG2  . ARG A 1 28 ? 12.051  -7.095  6.078   1.00 0.00 ? 28 ARG A HG2  5  
ATOM 6197  H HG3  . ARG A 1 28 ? 12.683  -8.625  5.504   1.00 0.00 ? 28 ARG A HG3  5  
ATOM 6198  H HD2  . ARG A 1 28 ? 14.467  -7.612  4.333   1.00 0.00 ? 28 ARG A HD2  5  
ATOM 6199  H HD3  . ARG A 1 28 ? 13.630  -6.081  4.167   1.00 0.00 ? 28 ARG A HD3  5  
ATOM 6200  H HE   . ARG A 1 28 ? 14.169  -6.765  6.957   1.00 0.00 ? 28 ARG A HE   5  
ATOM 6201  H HH11 . ARG A 1 28 ? 15.525  -5.309  4.055   1.00 0.00 ? 28 ARG A HH11 5  
ATOM 6202  H HH12 . ARG A 1 28 ? 16.676  -4.347  4.921   1.00 0.00 ? 28 ARG A HH12 5  
ATOM 6203  H HH21 . ARG A 1 28 ? 15.687  -5.497  8.100   1.00 0.00 ? 28 ARG A HH21 5  
ATOM 6204  H HH22 . ARG A 1 28 ? 16.769  -4.455  7.238   1.00 0.00 ? 28 ARG A HH22 5  
ATOM 6205  N N    . VAL A 1 29 ? 9.149   -8.674  5.778   1.00 0.00 ? 29 VAL A N    5  
ATOM 6206  C CA   . VAL A 1 29 ? 8.602   -8.965  7.092   1.00 0.00 ? 29 VAL A CA   5  
ATOM 6207  C C    . VAL A 1 29 ? 7.489   -10.006 6.958   1.00 0.00 ? 29 VAL A C    5  
ATOM 6208  O O    . VAL A 1 29 ? 7.609   -11.117 7.471   1.00 0.00 ? 29 VAL A O    5  
ATOM 6209  C CB   . VAL A 1 29 ? 8.134   -7.671  7.762   1.00 0.00 ? 29 VAL A CB   5  
ATOM 6210  C CG1  . VAL A 1 29 ? 7.470   -7.961  9.110   1.00 0.00 ? 29 VAL A CG1  5  
ATOM 6211  C CG2  . VAL A 1 29 ? 9.293   -6.685  7.921   1.00 0.00 ? 29 VAL A CG2  5  
ATOM 6212  H H    . VAL A 1 29 ? 8.626   -8.014  5.239   1.00 0.00 ? 29 VAL A H    5  
ATOM 6213  H HA   . VAL A 1 29 ? 9.405   -9.386  7.697   1.00 0.00 ? 29 VAL A HA   5  
ATOM 6214  H HB   . VAL A 1 29 ? 7.388   -7.210  7.114   1.00 0.00 ? 29 VAL A HB   5  
ATOM 6215  H HG11 . VAL A 1 29 ? 7.666   -7.136  9.795   1.00 0.00 ? 29 VAL A HG11 5  
ATOM 6216  H HG12 . VAL A 1 29 ? 6.395   -8.070  8.970   1.00 0.00 ? 29 VAL A HG12 5  
ATOM 6217  H HG13 . VAL A 1 29 ? 7.879   -8.882  9.525   1.00 0.00 ? 29 VAL A HG13 5  
ATOM 6218  H HG21 . VAL A 1 29 ? 10.238  -7.226  7.877   1.00 0.00 ? 29 VAL A HG21 5  
ATOM 6219  H HG22 . VAL A 1 29 ? 9.257   -5.950  7.117   1.00 0.00 ? 29 VAL A HG22 5  
ATOM 6220  H HG23 . VAL A 1 29 ? 9.208   -6.178  8.882   1.00 0.00 ? 29 VAL A HG23 5  
ATOM 6221  N N    . LEU A 1 30 ? 6.432   -9.609  6.265   1.00 0.00 ? 30 LEU A N    5  
ATOM 6222  C CA   . LEU A 1 30 ? 5.298   -10.494 6.057   1.00 0.00 ? 30 LEU A CA   5  
ATOM 6223  C C    . LEU A 1 30 ? 5.731   -11.672 5.182   1.00 0.00 ? 30 LEU A C    5  
ATOM 6224  O O    . LEU A 1 30 ? 5.390   -12.819 5.468   1.00 0.00 ? 30 LEU A O    5  
ATOM 6225  C CB   . LEU A 1 30 ? 4.107   -9.715  5.495   1.00 0.00 ? 30 LEU A CB   5  
ATOM 6226  C CG   . LEU A 1 30 ? 3.465   -8.697  6.440   1.00 0.00 ? 30 LEU A CG   5  
ATOM 6227  C CD1  . LEU A 1 30 ? 2.621   -7.685  5.664   1.00 0.00 ? 30 LEU A CD1  5  
ATOM 6228  C CD2  . LEU A 1 30 ? 2.656   -9.399  7.533   1.00 0.00 ? 30 LEU A CD2  5  
ATOM 6229  H H    . LEU A 1 30 ? 6.343   -8.703  5.851   1.00 0.00 ? 30 LEU A H    5  
ATOM 6230  H HA   . LEU A 1 30 ? 5.000   -10.878 7.032   1.00 0.00 ? 30 LEU A HA   5  
ATOM 6231  H HB2  . LEU A 1 30 ? 4.432   -9.191  4.596   1.00 0.00 ? 30 LEU A HB2  5  
ATOM 6232  H HB3  . LEU A 1 30 ? 3.343   -10.430 5.189   1.00 0.00 ? 30 LEU A HB3  5  
ATOM 6233  H HG   . LEU A 1 30 ? 4.261   -8.141  6.935   1.00 0.00 ? 30 LEU A HG   5  
ATOM 6234  H HD11 . LEU A 1 30 ? 3.234   -6.820  5.409   1.00 0.00 ? 30 LEU A HD11 5  
ATOM 6235  H HD12 . LEU A 1 30 ? 2.248   -8.147  4.750   1.00 0.00 ? 30 LEU A HD12 5  
ATOM 6236  H HD13 . LEU A 1 30 ? 1.779   -7.366  6.279   1.00 0.00 ? 30 LEU A HD13 5  
ATOM 6237  H HD21 . LEU A 1 30 ? 3.091   -10.378 7.735   1.00 0.00 ? 30 LEU A HD21 5  
ATOM 6238  H HD22 . LEU A 1 30 ? 2.677   -8.798  8.442   1.00 0.00 ? 30 LEU A HD22 5  
ATOM 6239  H HD23 . LEU A 1 30 ? 1.625   -9.520  7.201   1.00 0.00 ? 30 LEU A HD23 5  
ATOM 6240  N N    . LYS A 1 31 ? 6.474   -11.348 4.135   1.00 0.00 ? 31 LYS A N    5  
ATOM 6241  C CA   . LYS A 1 31 ? 6.957   -12.366 3.216   1.00 0.00 ? 31 LYS A CA   5  
ATOM 6242  C C    . LYS A 1 31 ? 5.815   -12.796 2.293   1.00 0.00 ? 31 LYS A C    5  
ATOM 6243  O O    . LYS A 1 31 ? 5.572   -13.988 2.114   1.00 0.00 ? 31 LYS A O    5  
ATOM 6244  C CB   . LYS A 1 31 ? 7.594   -13.524 3.987   1.00 0.00 ? 31 LYS A CB   5  
ATOM 6245  C CG   . LYS A 1 31 ? 9.078   -13.663 3.640   1.00 0.00 ? 31 LYS A CG   5  
ATOM 6246  C CD   . LYS A 1 31 ? 9.500   -15.133 3.616   1.00 0.00 ? 31 LYS A CD   5  
ATOM 6247  C CE   . LYS A 1 31 ? 10.989  -15.271 3.294   1.00 0.00 ? 31 LYS A CE   5  
ATOM 6248  N NZ   . LYS A 1 31 ? 11.315  -16.668 2.933   1.00 0.00 ? 31 LYS A NZ   5  
ATOM 6249  H H    . LYS A 1 31 ? 6.747   -10.413 3.910   1.00 0.00 ? 31 LYS A H    5  
ATOM 6250  H HA   . LYS A 1 31 ? 7.740   -11.913 2.609   1.00 0.00 ? 31 LYS A HA   5  
ATOM 6251  H HB2  . LYS A 1 31 ? 7.481   -13.359 5.058   1.00 0.00 ? 31 LYS A HB2  5  
ATOM 6252  H HB3  . LYS A 1 31 ? 7.073   -14.452 3.751   1.00 0.00 ? 31 LYS A HB3  5  
ATOM 6253  H HG2  . LYS A 1 31 ? 9.271   -13.209 2.668   1.00 0.00 ? 31 LYS A HG2  5  
ATOM 6254  H HG3  . LYS A 1 31 ? 9.678   -13.121 4.371   1.00 0.00 ? 31 LYS A HG3  5  
ATOM 6255  H HD2  . LYS A 1 31 ? 9.289   -15.592 4.582   1.00 0.00 ? 31 LYS A HD2  5  
ATOM 6256  H HD3  . LYS A 1 31 ? 8.913   -15.672 2.872   1.00 0.00 ? 31 LYS A HD3  5  
ATOM 6257  H HE2  . LYS A 1 31 ? 11.253  -14.605 2.472   1.00 0.00 ? 31 LYS A HE2  5  
ATOM 6258  H HE3  . LYS A 1 31 ? 11.583  -14.964 4.156   1.00 0.00 ? 31 LYS A HE3  5  
ATOM 6259  H HZ1  . LYS A 1 31 ? 10.480  -17.219 2.945   1.00 0.00 ? 31 LYS A HZ1  5  
ATOM 6260  H HZ2  . LYS A 1 31 ? 11.716  -16.691 2.017   1.00 0.00 ? 31 LYS A HZ2  5  
ATOM 6261  H HZ3  . LYS A 1 31 ? 11.968  -17.040 3.592   1.00 0.00 ? 31 LYS A HZ3  5  
ATOM 6262  N N    . VAL A 1 32 ? 5.144   -11.801 1.731   1.00 0.00 ? 32 VAL A N    5  
ATOM 6263  C CA   . VAL A 1 32 ? 4.034   -12.061 0.830   1.00 0.00 ? 32 VAL A CA   5  
ATOM 6264  C C    . VAL A 1 32 ? 3.943   -10.934 -0.200  1.00 0.00 ? 32 VAL A C    5  
ATOM 6265  O O    . VAL A 1 32 ? 4.403   -9.821  0.051   1.00 0.00 ? 32 VAL A O    5  
ATOM 6266  C CB   . VAL A 1 32 ? 2.743   -12.245 1.631   1.00 0.00 ? 32 VAL A CB   5  
ATOM 6267  C CG1  . VAL A 1 32 ? 2.814   -13.500 2.504   1.00 0.00 ? 32 VAL A CG1  5  
ATOM 6268  C CG2  . VAL A 1 32 ? 2.440   -11.006 2.475   1.00 0.00 ? 32 VAL A CG2  5  
ATOM 6269  H H    . VAL A 1 32 ? 5.348   -10.834 1.882   1.00 0.00 ? 32 VAL A H    5  
ATOM 6270  H HA   . VAL A 1 32 ? 4.245   -12.996 0.310   1.00 0.00 ? 32 VAL A HA   5  
ATOM 6271  H HB   . VAL A 1 32 ? 1.925   -12.376 0.922   1.00 0.00 ? 32 VAL A HB   5  
ATOM 6272  H HG11 . VAL A 1 32 ? 3.144   -14.345 1.899   1.00 0.00 ? 32 VAL A HG11 5  
ATOM 6273  H HG12 . VAL A 1 32 ? 3.520   -13.337 3.318   1.00 0.00 ? 32 VAL A HG12 5  
ATOM 6274  H HG13 . VAL A 1 32 ? 1.827   -13.712 2.915   1.00 0.00 ? 32 VAL A HG13 5  
ATOM 6275  H HG21 . VAL A 1 32 ? 3.282   -10.316 2.423   1.00 0.00 ? 32 VAL A HG21 5  
ATOM 6276  H HG22 . VAL A 1 32 ? 1.545   -10.516 2.093   1.00 0.00 ? 32 VAL A HG22 5  
ATOM 6277  H HG23 . VAL A 1 32 ? 2.278   -11.303 3.511   1.00 0.00 ? 32 VAL A HG23 5  
ATOM 6278  N N    . ARG A 1 33 ? 3.348   -11.261 -1.337  1.00 0.00 ? 33 ARG A N    5  
ATOM 6279  C CA   . ARG A 1 33 ? 3.191   -10.289 -2.406  1.00 0.00 ? 33 ARG A CA   5  
ATOM 6280  C C    . ARG A 1 33 ? 1.932   -9.451  -2.180  1.00 0.00 ? 33 ARG A C    5  
ATOM 6281  O O    . ARG A 1 33 ? 0.831   -9.991  -2.079  1.00 0.00 ? 33 ARG A O    5  
ATOM 6282  C CB   . ARG A 1 33 ? 3.099   -10.980 -3.768  1.00 0.00 ? 33 ARG A CB   5  
ATOM 6283  C CG   . ARG A 1 33 ? 2.508   -10.039 -4.821  1.00 0.00 ? 33 ARG A CG   5  
ATOM 6284  C CD   . ARG A 1 33 ? 2.728   -10.588 -6.232  1.00 0.00 ? 33 ARG A CD   5  
ATOM 6285  N NE   . ARG A 1 33 ? 3.798   -9.823  -6.911  1.00 0.00 ? 33 ARG A NE   5  
ATOM 6286  C CZ   . ARG A 1 33 ? 4.275   -10.118 -8.128  1.00 0.00 ? 33 ARG A CZ   5  
ATOM 6287  N NH1  . ARG A 1 33 ? 3.780   -11.161 -8.807  1.00 0.00 ? 33 ARG A NH1  5  
ATOM 6288  N NH2  . ARG A 1 33 ? 5.247   -9.369  -8.665  1.00 0.00 ? 33 ARG A NH2  5  
ATOM 6289  H H    . ARG A 1 33 ? 2.977   -12.169 -1.533  1.00 0.00 ? 33 ARG A H    5  
ATOM 6290  H HA   . ARG A 1 33 ? 4.088   -9.672  -2.355  1.00 0.00 ? 33 ARG A HA   5  
ATOM 6291  H HB2  . ARG A 1 33 ? 4.090   -11.306 -4.083  1.00 0.00 ? 33 ARG A HB2  5  
ATOM 6292  H HB3  . ARG A 1 33 ? 2.480   -11.873 -3.686  1.00 0.00 ? 33 ARG A HB3  5  
ATOM 6293  H HG2  . ARG A 1 33 ? 1.441   -9.909  -4.639  1.00 0.00 ? 33 ARG A HG2  5  
ATOM 6294  H HG3  . ARG A 1 33 ? 2.968   -9.055  -4.733  1.00 0.00 ? 33 ARG A HG3  5  
ATOM 6295  H HD2  . ARG A 1 33 ? 2.998   -11.642 -6.183  1.00 0.00 ? 33 ARG A HD2  5  
ATOM 6296  H HD3  . ARG A 1 33 ? 1.803   -10.521 -6.805  1.00 0.00 ? 33 ARG A HD3  5  
ATOM 6297  H HE   . ARG A 1 33 ? 4.190   -9.038  -6.431  1.00 0.00 ? 33 ARG A HE   5  
ATOM 6298  H HH11 . ARG A 1 33 ? 3.054   -11.720 -8.406  1.00 0.00 ? 33 ARG A HH11 5  
ATOM 6299  H HH12 . ARG A 1 33 ? 4.135   -11.380 -9.716  1.00 0.00 ? 33 ARG A HH12 5  
ATOM 6300  H HH21 . ARG A 1 33 ? 5.617   -8.590  -8.158  1.00 0.00 ? 33 ARG A HH21 5  
ATOM 6301  H HH22 . ARG A 1 33 ? 5.603   -9.588  -9.574  1.00 0.00 ? 33 ARG A HH22 5  
ATOM 6302  N N    . PRO A 1 34 ? 2.140   -8.109  -2.107  1.00 0.00 ? 34 PRO A N    5  
ATOM 6303  C CA   . PRO A 1 34 ? 1.035   -7.190  -1.895  1.00 0.00 ? 34 PRO A CA   5  
ATOM 6304  C C    . PRO A 1 34 ? 0.206   -7.026  -3.171  1.00 0.00 ? 34 PRO A C    5  
ATOM 6305  O O    . PRO A 1 34 ? 0.756   -6.812  -4.250  1.00 0.00 ? 34 PRO A O    5  
ATOM 6306  C CB   . PRO A 1 34 ? 1.683   -5.894  -1.437  1.00 0.00 ? 34 PRO A CB   5  
ATOM 6307  C CG   . PRO A 1 34 ? 3.142   -5.987  -1.854  1.00 0.00 ? 34 PRO A CG   5  
ATOM 6308  C CD   . PRO A 1 34 ? 3.429   -7.433  -2.223  1.00 0.00 ? 34 PRO A CD   5  
ATOM 6309  H HA   . PRO A 1 34 ? 0.408   -7.554  -1.207  1.00 0.00 ? 34 PRO A HA   5  
ATOM 6310  H HB2  . PRO A 1 34 ? 1.200   -5.032  -1.897  1.00 0.00 ? 34 PRO A HB2  5  
ATOM 6311  H HB3  . PRO A 1 34 ? 1.592   -5.771  -0.358  1.00 0.00 ? 34 PRO A HB3  5  
ATOM 6312  H HG2  . PRO A 1 34 ? 3.340   -5.330  -2.701  1.00 0.00 ? 34 PRO A HG2  5  
ATOM 6313  H HG3  . PRO A 1 34 ? 3.792   -5.664  -1.041  1.00 0.00 ? 34 PRO A HG3  5  
ATOM 6314  H HD2  . PRO A 1 34 ? 3.828   -7.512  -3.234  1.00 0.00 ? 34 PRO A HD2  5  
ATOM 6315  H HD3  . PRO A 1 34 ? 4.169   -7.873  -1.554  1.00 0.00 ? 34 PRO A HD3  5  
ATOM 6316  N N    . VAL A 1 35 ? -1.104  -7.133  -3.005  1.00 0.00 ? 35 VAL A N    5  
ATOM 6317  C CA   . VAL A 1 35 ? -2.014  -7.000  -4.130  1.00 0.00 ? 35 VAL A CA   5  
ATOM 6318  C C    . VAL A 1 35 ? -2.652  -5.610  -4.102  1.00 0.00 ? 35 VAL A C    5  
ATOM 6319  O O    . VAL A 1 35 ? -3.157  -5.175  -3.068  1.00 0.00 ? 35 VAL A O    5  
ATOM 6320  C CB   . VAL A 1 35 ? -3.045  -8.131  -4.106  1.00 0.00 ? 35 VAL A CB   5  
ATOM 6321  C CG1  . VAL A 1 35 ? -4.282  -7.762  -4.927  1.00 0.00 ? 35 VAL A CG1  5  
ATOM 6322  C CG2  . VAL A 1 35 ? -2.430  -9.443  -4.599  1.00 0.00 ? 35 VAL A CG2  5  
ATOM 6323  H H    . VAL A 1 35 ? -1.544  -7.308  -2.124  1.00 0.00 ? 35 VAL A H    5  
ATOM 6324  H HA   . VAL A 1 35 ? -1.426  -7.098  -5.042  1.00 0.00 ? 35 VAL A HA   5  
ATOM 6325  H HB   . VAL A 1 35 ? -3.359  -8.276  -3.073  1.00 0.00 ? 35 VAL A HB   5  
ATOM 6326  H HG11 . VAL A 1 35 ? -4.060  -6.895  -5.550  1.00 0.00 ? 35 VAL A HG11 5  
ATOM 6327  H HG12 . VAL A 1 35 ? -4.560  -8.604  -5.562  1.00 0.00 ? 35 VAL A HG12 5  
ATOM 6328  H HG13 . VAL A 1 35 ? -5.107  -7.526  -4.255  1.00 0.00 ? 35 VAL A HG13 5  
ATOM 6329  H HG21 . VAL A 1 35 ? -3.225  -10.149 -4.838  1.00 0.00 ? 35 VAL A HG21 5  
ATOM 6330  H HG22 . VAL A 1 35 ? -1.833  -9.252  -5.491  1.00 0.00 ? 35 VAL A HG22 5  
ATOM 6331  H HG23 . VAL A 1 35 ? -1.794  -9.862  -3.819  1.00 0.00 ? 35 VAL A HG23 5  
ATOM 6332  N N    . TYR A 1 36 ? -2.609  -4.950  -5.250  1.00 0.00 ? 36 TYR A N    5  
ATOM 6333  C CA   . TYR A 1 36 ? -3.177  -3.618  -5.370  1.00 0.00 ? 36 TYR A CA   5  
ATOM 6334  C C    . TYR A 1 36 ? -4.578  -3.672  -5.983  1.00 0.00 ? 36 TYR A C    5  
ATOM 6335  O O    . TYR A 1 36 ? -4.758  -4.191  -7.084  1.00 0.00 ? 36 TYR A O    5  
ATOM 6336  C CB   . TYR A 1 36 ? -2.250  -2.849  -6.314  1.00 0.00 ? 36 TYR A CB   5  
ATOM 6337  C CG   . TYR A 1 36 ? -0.894  -2.492  -5.700  1.00 0.00 ? 36 TYR A CG   5  
ATOM 6338  C CD1  . TYR A 1 36 ? 0.015   -3.489  -5.410  1.00 0.00 ? 36 TYR A CD1  5  
ATOM 6339  C CD2  . TYR A 1 36 ? -0.581  -1.174  -5.437  1.00 0.00 ? 36 TYR A CD2  5  
ATOM 6340  C CE1  . TYR A 1 36 ? 1.291   -3.154  -4.833  1.00 0.00 ? 36 TYR A CE1  5  
ATOM 6341  C CE2  . TYR A 1 36 ? 0.695   -0.839  -4.860  1.00 0.00 ? 36 TYR A CE2  5  
ATOM 6342  C CZ   . TYR A 1 36 ? 1.568   -1.845  -4.587  1.00 0.00 ? 36 TYR A CZ   5  
ATOM 6343  O OH   . TYR A 1 36 ? 2.773   -1.528  -4.041  1.00 0.00 ? 36 TYR A OH   5  
ATOM 6344  H H    . TYR A 1 36 ? -2.197  -5.311  -6.087  1.00 0.00 ? 36 TYR A H    5  
ATOM 6345  H HA   . TYR A 1 36 ? -3.241  -3.189  -4.371  1.00 0.00 ? 36 TYR A HA   5  
ATOM 6346  H HB2  . TYR A 1 36 ? -2.086  -3.445  -7.211  1.00 0.00 ? 36 TYR A HB2  5  
ATOM 6347  H HB3  . TYR A 1 36 ? -2.748  -1.931  -6.627  1.00 0.00 ? 36 TYR A HB3  5  
ATOM 6348  H HD1  . TYR A 1 36 ? -0.232  -4.530  -5.618  1.00 0.00 ? 36 TYR A HD1  5  
ATOM 6349  H HD2  . TYR A 1 36 ? -1.299  -0.387  -5.666  1.00 0.00 ? 36 TYR A HD2  5  
ATOM 6350  H HE1  . TYR A 1 36 ? 2.019   -3.931  -4.599  1.00 0.00 ? 36 TYR A HE1  5  
ATOM 6351  H HE2  . TYR A 1 36 ? 0.955   0.198   -4.647  1.00 0.00 ? 36 TYR A HE2  5  
ATOM 6352  H HH   . TYR A 1 36 ? 3.494   -1.619  -4.729  1.00 0.00 ? 36 TYR A HH   5  
ATOM 6353  N N    . ASN A 1 37 ? -5.533  -3.130  -5.243  1.00 0.00 ? 37 ASN A N    5  
ATOM 6354  C CA   . ASN A 1 37 ? -6.913  -3.109  -5.699  1.00 0.00 ? 37 ASN A CA   5  
ATOM 6355  C C    . ASN A 1 37 ? -7.266  -1.700  -6.180  1.00 0.00 ? 37 ASN A C    5  
ATOM 6356  O O    . ASN A 1 37 ? -7.080  -0.727  -5.451  1.00 0.00 ? 37 ASN A O    5  
ATOM 6357  C CB   . ASN A 1 37 ? -7.873  -3.478  -4.567  1.00 0.00 ? 37 ASN A CB   5  
ATOM 6358  C CG   . ASN A 1 37 ? -8.222  -4.967  -4.606  1.00 0.00 ? 37 ASN A CG   5  
ATOM 6359  O OD1  . ASN A 1 37 ? -9.364  -5.359  -4.774  1.00 0.00 ? 37 ASN A OD1  5  
ATOM 6360  N ND2  . ASN A 1 37 ? -7.176  -5.771  -4.440  1.00 0.00 ? 37 ASN A ND2  5  
ATOM 6361  H H    . ASN A 1 37 ? -5.378  -2.710  -4.349  1.00 0.00 ? 37 ASN A H    5  
ATOM 6362  H HA   . ASN A 1 37 ? -6.960  -3.847  -6.500  1.00 0.00 ? 37 ASN A HA   5  
ATOM 6363  H HB2  . ASN A 1 37 ? -7.420  -3.231  -3.607  1.00 0.00 ? 37 ASN A HB2  5  
ATOM 6364  H HB3  . ASN A 1 37 ? -8.784  -2.885  -4.651  1.00 0.00 ? 37 ASN A HB3  5  
ATOM 6365  H HD21 . ASN A 1 37 ? -6.263  -5.385  -4.307  1.00 0.00 ? 37 ASN A HD21 5  
ATOM 6366  H HD22 . ASN A 1 37 ? -7.302  -6.764  -4.450  1.00 0.00 ? 37 ASN A HD22 5  
ATOM 6367  N N    . PHE A 1 38 ? -7.769  -1.636  -7.404  1.00 0.00 ? 38 PHE A N    5  
ATOM 6368  C CA   . PHE A 1 38 ? -8.150  -0.362  -7.990  1.00 0.00 ? 38 PHE A CA   5  
ATOM 6369  C C    . PHE A 1 38 ? -9.645  -0.333  -8.315  1.00 0.00 ? 38 PHE A C    5  
ATOM 6370  O O    . PHE A 1 38 ? -10.244 -1.372  -8.589  1.00 0.00 ? 38 PHE A O    5  
ATOM 6371  C CB   . PHE A 1 38 ? -7.355  -0.211  -9.288  1.00 0.00 ? 38 PHE A CB   5  
ATOM 6372  C CG   . PHE A 1 38 ? -5.855  -0.470  -9.133  1.00 0.00 ? 38 PHE A CG   5  
ATOM 6373  C CD1  . PHE A 1 38 ? -5.388  -1.745  -9.063  1.00 0.00 ? 38 PHE A CD1  5  
ATOM 6374  C CD2  . PHE A 1 38 ? -4.988  0.576   -9.064  1.00 0.00 ? 38 PHE A CD2  5  
ATOM 6375  C CE1  . PHE A 1 38 ? -3.996  -1.985  -8.919  1.00 0.00 ? 38 PHE A CE1  5  
ATOM 6376  C CE2  . PHE A 1 38 ? -3.596  0.336   -8.920  1.00 0.00 ? 38 PHE A CE2  5  
ATOM 6377  C CZ   . PHE A 1 38 ? -3.129  -0.939  -8.850  1.00 0.00 ? 38 PHE A CZ   5  
ATOM 6378  H H    . PHE A 1 38 ? -7.917  -2.432  -7.990  1.00 0.00 ? 38 PHE A H    5  
ATOM 6379  H HA   . PHE A 1 38 ? -7.925  0.412   -7.256  1.00 0.00 ? 38 PHE A HA   5  
ATOM 6380  H HB2  . PHE A 1 38 ? -7.757  -0.901  -10.031 1.00 0.00 ? 38 PHE A HB2  5  
ATOM 6381  H HB3  . PHE A 1 38 ? -7.501  0.797   -9.677  1.00 0.00 ? 38 PHE A HB3  5  
ATOM 6382  H HD1  . PHE A 1 38 ? -6.083  -2.584  -9.118  1.00 0.00 ? 38 PHE A HD1  5  
ATOM 6383  H HD2  . PHE A 1 38 ? -5.362  1.598   -9.119  1.00 0.00 ? 38 PHE A HD2  5  
ATOM 6384  H HE1  . PHE A 1 38 ? -3.622  -3.008  -8.863  1.00 0.00 ? 38 PHE A HE1  5  
ATOM 6385  H HE2  . PHE A 1 38 ? -2.901  1.174   -8.864  1.00 0.00 ? 38 PHE A HE2  5  
ATOM 6386  H HZ   . PHE A 1 38 ? -2.061  -1.124  -8.740  1.00 0.00 ? 38 PHE A HZ   5  
ATOM 6387  N N    . PHE A 1 39 ? -10.204 0.867   -8.274  1.00 0.00 ? 39 PHE A N    5  
ATOM 6388  C CA   . PHE A 1 39 ? -11.617 1.045   -8.561  1.00 0.00 ? 39 PHE A CA   5  
ATOM 6389  C C    . PHE A 1 39 ? -11.909 2.477   -9.014  1.00 0.00 ? 39 PHE A C    5  
ATOM 6390  O O    . PHE A 1 39 ? -11.060 3.358   -8.884  1.00 0.00 ? 39 PHE A O    5  
ATOM 6391  C CB   . PHE A 1 39 ? -12.376 0.770   -7.261  1.00 0.00 ? 39 PHE A CB   5  
ATOM 6392  C CG   . PHE A 1 39 ? -11.734 1.395   -6.021  1.00 0.00 ? 39 PHE A CG   5  
ATOM 6393  C CD1  . PHE A 1 39 ? -11.981 2.696   -5.711  1.00 0.00 ? 39 PHE A CD1  5  
ATOM 6394  C CD2  . PHE A 1 39 ? -10.915 0.651   -5.230  1.00 0.00 ? 39 PHE A CD2  5  
ATOM 6395  C CE1  . PHE A 1 39 ? -11.386 3.277   -4.560  1.00 0.00 ? 39 PHE A CE1  5  
ATOM 6396  C CE2  . PHE A 1 39 ? -10.320 1.232   -4.079  1.00 0.00 ? 39 PHE A CE2  5  
ATOM 6397  C CZ   . PHE A 1 39 ? -10.568 2.533   -3.768  1.00 0.00 ? 39 PHE A CZ   5  
ATOM 6398  H H    . PHE A 1 39 ? -9.709  1.707   -8.050  1.00 0.00 ? 39 PHE A H    5  
ATOM 6399  H HA   . PHE A 1 39 ? -11.874 0.353   -9.363  1.00 0.00 ? 39 PHE A HA   5  
ATOM 6400  H HB2  . PHE A 1 39 ? -13.394 1.146   -7.360  1.00 0.00 ? 39 PHE A HB2  5  
ATOM 6401  H HB3  . PHE A 1 39 ? -12.447 -0.308  -7.116  1.00 0.00 ? 39 PHE A HB3  5  
ATOM 6402  H HD1  . PHE A 1 39 ? -12.637 3.293   -6.345  1.00 0.00 ? 39 PHE A HD1  5  
ATOM 6403  H HD2  . PHE A 1 39 ? -10.717 -0.391  -5.479  1.00 0.00 ? 39 PHE A HD2  5  
ATOM 6404  H HE1  . PHE A 1 39 ? -11.584 4.320   -4.311  1.00 0.00 ? 39 PHE A HE1  5  
ATOM 6405  H HE2  . PHE A 1 39 ? -9.664  0.636   -3.445  1.00 0.00 ? 39 PHE A HE2  5  
ATOM 6406  H HZ   . PHE A 1 39 ? -10.110 2.979   -2.885  1.00 0.00 ? 39 PHE A HZ   5  
ATOM 6407  N N    . GLU A 1 40 ? -13.112 2.666   -9.535  1.00 0.00 ? 40 GLU A N    5  
ATOM 6408  C CA   . GLU A 1 40 ? -13.526 3.976   -10.008 1.00 0.00 ? 40 GLU A CA   5  
ATOM 6409  C C    . GLU A 1 40 ? -14.008 4.835   -8.837  1.00 0.00 ? 40 GLU A C    5  
ATOM 6410  O O    . GLU A 1 40 ? -14.825 4.391   -8.031  1.00 0.00 ? 40 GLU A O    5  
ATOM 6411  C CB   . GLU A 1 40 ? -14.610 3.854   -11.081 1.00 0.00 ? 40 GLU A CB   5  
ATOM 6412  C CG   . GLU A 1 40 ? -15.779 3.001   -10.585 1.00 0.00 ? 40 GLU A CG   5  
ATOM 6413  C CD   . GLU A 1 40 ? -17.015 3.199   -11.464 1.00 0.00 ? 40 GLU A CD   5  
ATOM 6414  O OE1  . GLU A 1 40 ? -17.150 4.316   -12.009 1.00 0.00 ? 40 GLU A OE1  5  
ATOM 6415  O OE2  . GLU A 1 40 ? -17.797 2.230   -11.572 1.00 0.00 ? 40 GLU A OE2  5  
ATOM 6416  H H    . GLU A 1 40 ? -13.797 1.944   -9.637  1.00 0.00 ? 40 GLU A H    5  
ATOM 6417  H HA   . GLU A 1 40 ? -12.634 4.419   -10.450 1.00 0.00 ? 40 GLU A HA   5  
ATOM 6418  H HB2  . GLU A 1 40 ? -14.970 4.846   -11.354 1.00 0.00 ? 40 GLU A HB2  5  
ATOM 6419  H HB3  . GLU A 1 40 ? -14.187 3.409   -11.981 1.00 0.00 ? 40 GLU A HB3  5  
ATOM 6420  H HG2  . GLU A 1 40 ? -15.493 1.949   -10.586 1.00 0.00 ? 40 GLU A HG2  5  
ATOM 6421  H HG3  . GLU A 1 40 ? -16.016 3.266   -9.554  1.00 0.00 ? 40 GLU A HG3  5  
ATOM 6422  N N    . CYS A 1 41 ? -13.481 6.049   -8.779  1.00 0.00 ? 41 CYS A N    5  
ATOM 6423  C CA   . CYS A 1 41 ? -13.847 6.974   -7.720  1.00 0.00 ? 41 CYS A CA   5  
ATOM 6424  C C    . CYS A 1 41 ? -14.685 8.098   -8.332  1.00 0.00 ? 41 CYS A C    5  
ATOM 6425  O O    . CYS A 1 41 ? -14.201 8.849   -9.177  1.00 0.00 ? 41 CYS A O    5  
ATOM 6426  C CB   . CYS A 1 41 ? -12.615 7.514   -6.990  1.00 0.00 ? 41 CYS A CB   5  
ATOM 6427  S SG   . CYS A 1 41 ? -12.882 7.447   -5.181  1.00 0.00 ? 41 CYS A SG   5  
ATOM 6428  H H    . CYS A 1 41 ? -12.817 6.402   -9.438  1.00 0.00 ? 41 CYS A H    5  
ATOM 6429  H HA   . CYS A 1 41 ? -14.431 6.406   -6.996  1.00 0.00 ? 41 CYS A HA   5  
ATOM 6430  H HB2  . CYS A 1 41 ? -11.737 6.927   -7.259  1.00 0.00 ? 41 CYS A HB2  5  
ATOM 6431  H HB3  . CYS A 1 41 ? -12.420 8.540   -7.300  1.00 0.00 ? 41 CYS A HB3  5  
ATOM 6432  H HG   . CYS A 1 41 ? -13.829 8.380   -5.145  1.00 0.00 ? 41 CYS A HG   5  
ATOM 6433  N N    . GLU A 1 42 ? -15.929 8.178   -7.882  1.00 0.00 ? 42 GLU A N    5  
ATOM 6434  C CA   . GLU A 1 42 ? -16.839 9.197   -8.375  1.00 0.00 ? 42 GLU A CA   5  
ATOM 6435  C C    . GLU A 1 42 ? -16.524 10.548  -7.729  1.00 0.00 ? 42 GLU A C    5  
ATOM 6436  O O    . GLU A 1 42 ? -17.397 11.171  -7.128  1.00 0.00 ? 42 GLU A O    5  
ATOM 6437  C CB   . GLU A 1 42 ? -18.295 8.798   -8.128  1.00 0.00 ? 42 GLU A CB   5  
ATOM 6438  C CG   . GLU A 1 42 ? -18.821 7.915   -9.261  1.00 0.00 ? 42 GLU A CG   5  
ATOM 6439  C CD   . GLU A 1 42 ? -19.317 6.571   -8.724  1.00 0.00 ? 42 GLU A CD   5  
ATOM 6440  O OE1  . GLU A 1 42 ? -18.527 5.919   -8.008  1.00 0.00 ? 42 GLU A OE1  5  
ATOM 6441  O OE2  . GLU A 1 42 ? -20.476 6.226   -9.040  1.00 0.00 ? 42 GLU A OE2  5  
ATOM 6442  H H    . GLU A 1 42 ? -16.315 7.563   -7.195  1.00 0.00 ? 42 GLU A H    5  
ATOM 6443  H HA   . GLU A 1 42 ? -16.661 9.250   -9.449  1.00 0.00 ? 42 GLU A HA   5  
ATOM 6444  H HB2  . GLU A 1 42 ? -18.374 8.265   -7.180  1.00 0.00 ? 42 GLU A HB2  5  
ATOM 6445  H HB3  . GLU A 1 42 ? -18.912 9.692   -8.043  1.00 0.00 ? 42 GLU A HB3  5  
ATOM 6446  H HG2  . GLU A 1 42 ? -19.634 8.426   -9.778  1.00 0.00 ? 42 GLU A HG2  5  
ATOM 6447  H HG3  . GLU A 1 42 ? -18.032 7.748   -9.994  1.00 0.00 ? 42 GLU A HG3  5  
ATOM 6448  N N    . ASN A 1 43 ? -15.273 10.960  -7.874  1.00 0.00 ? 43 ASN A N    5  
ATOM 6449  C CA   . ASN A 1 43 ? -14.832 12.225  -7.312  1.00 0.00 ? 43 ASN A CA   5  
ATOM 6450  C C    . ASN A 1 43 ? -14.049 13.003  -8.372  1.00 0.00 ? 43 ASN A C    5  
ATOM 6451  O O    . ASN A 1 43 ? -13.236 12.429  -9.094  1.00 0.00 ? 43 ASN A O    5  
ATOM 6452  C CB   . ASN A 1 43 ? -13.910 12.002  -6.111  1.00 0.00 ? 43 ASN A CB   5  
ATOM 6453  C CG   . ASN A 1 43 ? -14.610 12.383  -4.805  1.00 0.00 ? 43 ASN A CG   5  
ATOM 6454  O OD1  . ASN A 1 43 ? -15.495 11.695  -4.322  1.00 0.00 ? 43 ASN A OD1  5  
ATOM 6455  N ND2  . ASN A 1 43 ? -14.166 13.513  -4.263  1.00 0.00 ? 43 ASN A ND2  5  
ATOM 6456  H H    . ASN A 1 43 ? -14.569 10.446  -8.365  1.00 0.00 ? 43 ASN A H    5  
ATOM 6457  H HA   . ASN A 1 43 ? -15.744 12.737  -7.008  1.00 0.00 ? 43 ASN A HA   5  
ATOM 6458  H HB2  . ASN A 1 43 ? -13.603 10.957  -6.073  1.00 0.00 ? 43 ASN A HB2  5  
ATOM 6459  H HB3  . ASN A 1 43 ? -13.004 12.597  -6.229  1.00 0.00 ? 43 ASN A HB3  5  
ATOM 6460  H HD21 . ASN A 1 43 ? -13.437 14.030  -4.711  1.00 0.00 ? 43 ASN A HD21 5  
ATOM 6461  H HD22 . ASN A 1 43 ? -14.561 13.846  -3.407  1.00 0.00 ? 43 ASN A HD22 5  
ATOM 6462  N N    . PRO A 1 44 ? -14.328 14.333  -8.431  1.00 0.00 ? 44 PRO A N    5  
ATOM 6463  C CA   . PRO A 1 44 ? -13.659 15.196  -9.390  1.00 0.00 ? 44 PRO A CA   5  
ATOM 6464  C C    . PRO A 1 44 ? -12.219 15.482  -8.959  1.00 0.00 ? 44 PRO A C    5  
ATOM 6465  O O    . PRO A 1 44 ? -11.284 15.277  -9.730  1.00 0.00 ? 44 PRO A O    5  
ATOM 6466  C CB   . PRO A 1 44 ? -14.519 16.447  -9.460  1.00 0.00 ? 44 PRO A CB   5  
ATOM 6467  C CG   . PRO A 1 44 ? -15.374 16.436  -8.203  1.00 0.00 ? 44 PRO A CG   5  
ATOM 6468  C CD   . PRO A 1 44 ? -15.284 15.047  -7.591  1.00 0.00 ? 44 PRO A CD   5  
ATOM 6469  H HA   . PRO A 1 44 ? -13.593 14.741  -10.279 1.00 0.00 ? 44 PRO A HA   5  
ATOM 6470  H HB2  . PRO A 1 44 ? -13.900 17.344  -9.503  1.00 0.00 ? 44 PRO A HB2  5  
ATOM 6471  H HB3  . PRO A 1 44 ? -15.140 16.445  -10.356 1.00 0.00 ? 44 PRO A HB3  5  
ATOM 6472  H HG2  . PRO A 1 44 ? -15.025 17.188  -7.497  1.00 0.00 ? 44 PRO A HG2  5  
ATOM 6473  H HG3  . PRO A 1 44 ? -16.409 16.681  -8.444  1.00 0.00 ? 44 PRO A HG3  5  
ATOM 6474  H HD2  . PRO A 1 44 ? -14.946 15.092  -6.556  1.00 0.00 ? 44 PRO A HD2  5  
ATOM 6475  H HD3  . PRO A 1 44 ? -16.256 14.552  -7.588  1.00 0.00 ? 44 PRO A HD3  5  
ATOM 6476  N N    . SER A 1 45 ? -12.087 15.952  -7.727  1.00 0.00 ? 45 SER A N    5  
ATOM 6477  C CA   . SER A 1 45 ? -10.777 16.269  -7.184  1.00 0.00 ? 45 SER A CA   5  
ATOM 6478  C C    . SER A 1 45 ? -9.776  15.176  -7.562  1.00 0.00 ? 45 SER A C    5  
ATOM 6479  O O    . SER A 1 45 ? -8.770  15.450  -8.216  1.00 0.00 ? 45 SER A O    5  
ATOM 6480  C CB   . SER A 1 45 ? -10.836 16.433  -5.664  1.00 0.00 ? 45 SER A CB   5  
ATOM 6481  O OG   . SER A 1 45 ? -9.776  17.248  -5.173  1.00 0.00 ? 45 SER A OG   5  
ATOM 6482  H H    . SER A 1 45 ? -12.853 16.117  -7.106  1.00 0.00 ? 45 SER A H    5  
ATOM 6483  H HA   . SER A 1 45 ? -10.498 17.219  -7.640  1.00 0.00 ? 45 SER A HA   5  
ATOM 6484  H HB2  . SER A 1 45 ? -11.793 16.874  -5.383  1.00 0.00 ? 45 SER A HB2  5  
ATOM 6485  H HB3  . SER A 1 45 ? -10.787 15.452  -5.192  1.00 0.00 ? 45 SER A HB3  5  
ATOM 6486  H HG   . SER A 1 45 ? -9.102  16.684  -4.698  1.00 0.00 ? 45 SER A HG   5  
ATOM 6487  N N    . GLU A 1 46 ? -10.085 13.961  -7.134  1.00 0.00 ? 46 GLU A N    5  
ATOM 6488  C CA   . GLU A 1 46 ? -9.224  12.826  -7.419  1.00 0.00 ? 46 GLU A CA   5  
ATOM 6489  C C    . GLU A 1 46 ? -10.064 11.605  -7.797  1.00 0.00 ? 46 GLU A C    5  
ATOM 6490  O O    . GLU A 1 46 ? -10.482 10.841  -6.928  1.00 0.00 ? 46 GLU A O    5  
ATOM 6491  C CB   . GLU A 1 46 ? -8.312  12.517  -6.230  1.00 0.00 ? 46 GLU A CB   5  
ATOM 6492  C CG   . GLU A 1 46 ? -7.374  13.690  -5.939  1.00 0.00 ? 46 GLU A CG   5  
ATOM 6493  C CD   . GLU A 1 46 ? -7.257  13.939  -4.434  1.00 0.00 ? 46 GLU A CD   5  
ATOM 6494  O OE1  . GLU A 1 46 ? -7.287  12.935  -3.689  1.00 0.00 ? 46 GLU A OE1  5  
ATOM 6495  O OE2  . GLU A 1 46 ? -7.141  15.127  -4.062  1.00 0.00 ? 46 GLU A OE2  5  
ATOM 6496  H H    . GLU A 1 46 ? -10.904 13.747  -6.602  1.00 0.00 ? 46 GLU A H    5  
ATOM 6497  H HA   . GLU A 1 46 ? -8.613  13.132  -8.268  1.00 0.00 ? 46 GLU A HA   5  
ATOM 6498  H HB2  . GLU A 1 46 ? -8.917  12.303  -5.349  1.00 0.00 ? 46 GLU A HB2  5  
ATOM 6499  H HB3  . GLU A 1 46 ? -7.726  11.622  -6.439  1.00 0.00 ? 46 GLU A HB3  5  
ATOM 6500  H HG2  . GLU A 1 46 ? -6.388  13.484  -6.355  1.00 0.00 ? 46 GLU A HG2  5  
ATOM 6501  H HG3  . GLU A 1 46 ? -7.746  14.589  -6.432  1.00 0.00 ? 46 GLU A HG3  5  
ATOM 6502  N N    . PRO A 1 47 ? -10.292 11.454  -9.129  1.00 0.00 ? 47 PRO A N    5  
ATOM 6503  C CA   . PRO A 1 47 ? -11.075 10.339  -9.633  1.00 0.00 ? 47 PRO A CA   5  
ATOM 6504  C C    . PRO A 1 47 ? -10.269 9.039   -9.589  1.00 0.00 ? 47 PRO A C    5  
ATOM 6505  O O    . PRO A 1 47 ? -10.841 7.950   -9.579  1.00 0.00 ? 47 PRO A O    5  
ATOM 6506  C CB   . PRO A 1 47 ? -11.474 10.743  -11.043 1.00 0.00 ? 47 PRO A CB   5  
ATOM 6507  C CG   . PRO A 1 47 ? -10.519 11.855  -11.444 1.00 0.00 ? 47 PRO A CG   5  
ATOM 6508  C CD   . PRO A 1 47 ? -9.813  12.339  -10.187 1.00 0.00 ? 47 PRO A CD   5  
ATOM 6509  H HA   . PRO A 1 47 ? -11.874 10.184  -9.052  1.00 0.00 ? 47 PRO A HA   5  
ATOM 6510  H HB2  . PRO A 1 47 ? -11.399 9.898   -11.728 1.00 0.00 ? 47 PRO A HB2  5  
ATOM 6511  H HB3  . PRO A 1 47 ? -12.508 11.086  -11.073 1.00 0.00 ? 47 PRO A HB3  5  
ATOM 6512  H HG2  . PRO A 1 47 ? -9.794  11.492  -12.173 1.00 0.00 ? 47 PRO A HG2  5  
ATOM 6513  H HG3  . PRO A 1 47 ? -11.062 12.674  -11.915 1.00 0.00 ? 47 PRO A HG3  5  
ATOM 6514  H HD2  . PRO A 1 47 ? -8.730  12.278  -10.293 1.00 0.00 ? 47 PRO A HD2  5  
ATOM 6515  H HD3  . PRO A 1 47 ? -10.055 13.380  -9.973  1.00 0.00 ? 47 PRO A HD3  5  
ATOM 6516  N N    . PHE A 1 48 ? -8.954  9.196   -9.565  1.00 0.00 ? 48 PHE A N    5  
ATOM 6517  C CA   . PHE A 1 48 ? -8.064  8.049   -9.523  1.00 0.00 ? 48 PHE A CA   5  
ATOM 6518  C C    . PHE A 1 48 ? -7.833  7.587   -8.083  1.00 0.00 ? 48 PHE A C    5  
ATOM 6519  O O    . PHE A 1 48 ? -7.203  8.290   -7.295  1.00 0.00 ? 48 PHE A O    5  
ATOM 6520  C CB   . PHE A 1 48 ? -6.729  8.496   -10.122 1.00 0.00 ? 48 PHE A CB   5  
ATOM 6521  C CG   . PHE A 1 48 ? -6.837  9.040   -11.548 1.00 0.00 ? 48 PHE A CG   5  
ATOM 6522  C CD1  . PHE A 1 48 ? -7.154  10.346  -11.756 1.00 0.00 ? 48 PHE A CD1  5  
ATOM 6523  C CD2  . PHE A 1 48 ? -6.618  8.216   -12.608 1.00 0.00 ? 48 PHE A CD2  5  
ATOM 6524  C CE1  . PHE A 1 48 ? -7.255  10.850  -13.079 1.00 0.00 ? 48 PHE A CE1  5  
ATOM 6525  C CE2  . PHE A 1 48 ? -6.719  8.721   -13.932 1.00 0.00 ? 48 PHE A CE2  5  
ATOM 6526  C CZ   . PHE A 1 48 ? -7.035  10.027  -14.139 1.00 0.00 ? 48 PHE A CZ   5  
ATOM 6527  H H    . PHE A 1 48 ? -8.497  10.086  -9.574  1.00 0.00 ? 48 PHE A H    5  
ATOM 6528  H HA   . PHE A 1 48 ? -8.541  7.248   -10.088 1.00 0.00 ? 48 PHE A HA   5  
ATOM 6529  H HB2  . PHE A 1 48 ? -6.295  9.265   -9.483  1.00 0.00 ? 48 PHE A HB2  5  
ATOM 6530  H HB3  . PHE A 1 48 ? -6.039  7.652   -10.118 1.00 0.00 ? 48 PHE A HB3  5  
ATOM 6531  H HD1  . PHE A 1 48 ? -7.330  11.006  -10.906 1.00 0.00 ? 48 PHE A HD1  5  
ATOM 6532  H HD2  . PHE A 1 48 ? -6.364  7.169   -12.442 1.00 0.00 ? 48 PHE A HD2  5  
ATOM 6533  H HE1  . PHE A 1 48 ? -7.509  11.897  -13.246 1.00 0.00 ? 48 PHE A HE1  5  
ATOM 6534  H HE2  . PHE A 1 48 ? -6.542  8.061   -14.781 1.00 0.00 ? 48 PHE A HE2  5  
ATOM 6535  H HZ   . PHE A 1 48 ? -7.113  10.414  -15.155 1.00 0.00 ? 48 PHE A HZ   5  
ATOM 6536  N N    . GLY A 1 49 ? -8.357  6.407   -7.783  1.00 0.00 ? 49 GLY A N    5  
ATOM 6537  C CA   . GLY A 1 49 ? -8.216  5.842   -6.452  1.00 0.00 ? 49 GLY A CA   5  
ATOM 6538  C C    . GLY A 1 49 ? -7.711  4.400   -6.518  1.00 0.00 ? 49 GLY A C    5  
ATOM 6539  O O    . GLY A 1 49 ? -8.056  3.659   -7.437  1.00 0.00 ? 49 GLY A O    5  
ATOM 6540  H H    . GLY A 1 49 ? -8.868  5.841   -8.430  1.00 0.00 ? 49 GLY A H    5  
ATOM 6541  H HA2  . GLY A 1 49 ? -7.523  6.448   -5.867  1.00 0.00 ? 49 GLY A HA2  5  
ATOM 6542  H HA3  . GLY A 1 49 ? -9.177  5.871   -5.937  1.00 0.00 ? 49 GLY A HA3  5  
ATOM 6543  N N    . ALA A 1 50 ? -6.900  4.045   -5.532  1.00 0.00 ? 50 ALA A N    5  
ATOM 6544  C CA   . ALA A 1 50 ? -6.343  2.704   -5.467  1.00 0.00 ? 50 ALA A CA   5  
ATOM 6545  C C    . ALA A 1 50 ? -6.133  2.314   -4.003  1.00 0.00 ? 50 ALA A C    5  
ATOM 6546  O O    . ALA A 1 50 ? -6.098  3.176   -3.126  1.00 0.00 ? 50 ALA A O    5  
ATOM 6547  C CB   . ALA A 1 50 ? -5.047  2.650   -6.277  1.00 0.00 ? 50 ALA A CB   5  
ATOM 6548  H H    . ALA A 1 50 ? -6.624  4.653   -4.788  1.00 0.00 ? 50 ALA A H    5  
ATOM 6549  H HA   . ALA A 1 50 ? -7.066  2.022   -5.916  1.00 0.00 ? 50 ALA A HA   5  
ATOM 6550  H HB1  . ALA A 1 50 ? -4.238  2.282   -5.645  1.00 0.00 ? 50 ALA A HB1  5  
ATOM 6551  H HB2  . ALA A 1 50 ? -5.176  1.980   -7.127  1.00 0.00 ? 50 ALA A HB2  5  
ATOM 6552  H HB3  . ALA A 1 50 ? -4.801  3.649   -6.637  1.00 0.00 ? 50 ALA A HB3  5  
ATOM 6553  N N    . SER A 1 51 ? -5.999  1.015   -3.783  1.00 0.00 ? 51 SER A N    5  
ATOM 6554  C CA   . SER A 1 51 ? -5.793  0.500   -2.440  1.00 0.00 ? 51 SER A CA   5  
ATOM 6555  C C    . SER A 1 51 ? -4.756  -0.625  -2.464  1.00 0.00 ? 51 SER A C    5  
ATOM 6556  O O    . SER A 1 51 ? -4.424  -1.146  -3.527  1.00 0.00 ? 51 SER A O    5  
ATOM 6557  C CB   . SER A 1 51 ? -7.106  -0.001  -1.835  1.00 0.00 ? 51 SER A CB   5  
ATOM 6558  O OG   . SER A 1 51 ? -6.885  -0.928  -0.775  1.00 0.00 ? 51 SER A OG   5  
ATOM 6559  H H    . SER A 1 51 ? -6.029  0.320   -4.502  1.00 0.00 ? 51 SER A H    5  
ATOM 6560  H HA   . SER A 1 51 ? -5.426  1.347   -1.860  1.00 0.00 ? 51 SER A HA   5  
ATOM 6561  H HB2  . SER A 1 51 ? -7.680  0.847   -1.461  1.00 0.00 ? 51 SER A HB2  5  
ATOM 6562  H HB3  . SER A 1 51 ? -7.706  -0.474  -2.612  1.00 0.00 ? 51 SER A HB3  5  
ATOM 6563  H HG   . SER A 1 51 ? -6.884  -0.450  0.103   1.00 0.00 ? 51 SER A HG   5  
ATOM 6564  N N    . VAL A 1 52 ? -4.272  -0.966  -1.278  1.00 0.00 ? 52 VAL A N    5  
ATOM 6565  C CA   . VAL A 1 52 ? -3.280  -2.019  -1.149  1.00 0.00 ? 52 VAL A CA   5  
ATOM 6566  C C    . VAL A 1 52 ? -3.858  -3.159  -0.309  1.00 0.00 ? 52 VAL A C    5  
ATOM 6567  O O    . VAL A 1 52 ? -3.989  -3.033  0.908   1.00 0.00 ? 52 VAL A O    5  
ATOM 6568  C CB   . VAL A 1 52 ? -1.983  -1.448  -0.572  1.00 0.00 ? 52 VAL A CB   5  
ATOM 6569  C CG1  . VAL A 1 52 ? -1.057  -2.568  -0.093  1.00 0.00 ? 52 VAL A CG1  5  
ATOM 6570  C CG2  . VAL A 1 52 ? -1.277  -0.551  -1.591  1.00 0.00 ? 52 VAL A CG2  5  
ATOM 6571  H H    . VAL A 1 52 ? -4.547  -0.537  -0.418  1.00 0.00 ? 52 VAL A H    5  
ATOM 6572  H HA   . VAL A 1 52 ? -3.067  -2.394  -2.151  1.00 0.00 ? 52 VAL A HA   5  
ATOM 6573  H HB   . VAL A 1 52 ? -2.242  -0.835  0.291   1.00 0.00 ? 52 VAL A HB   5  
ATOM 6574  H HG11 . VAL A 1 52 ? -0.662  -3.106  -0.955  1.00 0.00 ? 52 VAL A HG11 5  
ATOM 6575  H HG12 . VAL A 1 52 ? -0.233  -2.139  0.477   1.00 0.00 ? 52 VAL A HG12 5  
ATOM 6576  H HG13 . VAL A 1 52 ? -1.616  -3.257  0.540   1.00 0.00 ? 52 VAL A HG13 5  
ATOM 6577  H HG21 . VAL A 1 52 ? -1.248  -1.053  -2.558  1.00 0.00 ? 52 VAL A HG21 5  
ATOM 6578  H HG22 . VAL A 1 52 ? -1.821  0.389   -1.685  1.00 0.00 ? 52 VAL A HG22 5  
ATOM 6579  H HG23 . VAL A 1 52 ? -0.260  -0.350  -1.255  1.00 0.00 ? 52 VAL A HG23 5  
ATOM 6580  N N    . THR A 1 53 ? -4.189  -4.246  -0.990  1.00 0.00 ? 53 THR A N    5  
ATOM 6581  C CA   . THR A 1 53 ? -4.750  -5.407  -0.321  1.00 0.00 ? 53 THR A CA   5  
ATOM 6582  C C    . THR A 1 53 ? -3.657  -6.438  -0.036  1.00 0.00 ? 53 THR A C    5  
ATOM 6583  O O    . THR A 1 53 ? -2.955  -6.872  -0.948  1.00 0.00 ? 53 THR A O    5  
ATOM 6584  C CB   . THR A 1 53 ? -5.886  -5.950  -1.190  1.00 0.00 ? 53 THR A CB   5  
ATOM 6585  O OG1  . THR A 1 53 ? -5.418  -5.773  -2.524  1.00 0.00 ? 53 THR A OG1  5  
ATOM 6586  C CG2  . THR A 1 53 ? -7.144  -5.082  -1.119  1.00 0.00 ? 53 THR A CG2  5  
ATOM 6587  H H    . THR A 1 53 ? -4.080  -4.340  -1.980  1.00 0.00 ? 53 THR A H    5  
ATOM 6588  H HA   . THR A 1 53 ? -5.149  -5.089  0.642   1.00 0.00 ? 53 THR A HA   5  
ATOM 6589  H HB   . THR A 1 53 ? -6.112  -6.985  -0.934  1.00 0.00 ? 53 THR A HB   5  
ATOM 6590  H HG1  . THR A 1 53 ? -4.635  -6.372  -2.694  1.00 0.00 ? 53 THR A HG1  5  
ATOM 6591  H HG21 . THR A 1 53 ? -8.026  -5.710  -1.250  1.00 0.00 ? 53 THR A HG21 5  
ATOM 6592  H HG22 . THR A 1 53 ? -7.190  -4.588  -0.149  1.00 0.00 ? 53 THR A HG22 5  
ATOM 6593  H HG23 . THR A 1 53 ? -7.113  -4.331  -1.908  1.00 0.00 ? 53 THR A HG23 5  
ATOM 6594  N N    . ILE A 1 54 ? -3.547  -6.801  1.233   1.00 0.00 ? 54 ILE A N    5  
ATOM 6595  C CA   . ILE A 1 54 ? -2.551  -7.774  1.650   1.00 0.00 ? 54 ILE A CA   5  
ATOM 6596  C C    . ILE A 1 54 ? -3.208  -9.150  1.772   1.00 0.00 ? 54 ILE A C    5  
ATOM 6597  O O    . ILE A 1 54 ? -3.920  -9.418  2.738   1.00 0.00 ? 54 ILE A O    5  
ATOM 6598  C CB   . ILE A 1 54 ? -1.852  -7.310  2.930   1.00 0.00 ? 54 ILE A CB   5  
ATOM 6599  C CG1  . ILE A 1 54 ? -1.012  -6.058  2.673   1.00 0.00 ? 54 ILE A CG1  5  
ATOM 6600  C CG2  . ILE A 1 54 ? -1.023  -8.441  3.542   1.00 0.00 ? 54 ILE A CG2  5  
ATOM 6601  C CD1  . ILE A 1 54 ? -0.353  -5.565  3.963   1.00 0.00 ? 54 ILE A CD1  5  
ATOM 6602  H H    . ILE A 1 54 ? -4.122  -6.444  1.969   1.00 0.00 ? 54 ILE A H    5  
ATOM 6603  H HA   . ILE A 1 54 ? -1.793  -7.821  0.868   1.00 0.00 ? 54 ILE A HA   5  
ATOM 6604  H HB   . ILE A 1 54 ? -2.617  -7.041  3.658   1.00 0.00 ? 54 ILE A HB   5  
ATOM 6605  H HG12 . ILE A 1 54 ? -0.245  -6.276  1.929   1.00 0.00 ? 54 ILE A HG12 5  
ATOM 6606  H HG13 . ILE A 1 54 ? -1.642  -5.271  2.259   1.00 0.00 ? 54 ILE A HG13 5  
ATOM 6607  H HG21 . ILE A 1 54 ? -1.616  -8.957  4.298   1.00 0.00 ? 54 ILE A HG21 5  
ATOM 6608  H HG22 . ILE A 1 54 ? -0.736  -9.145  2.762   1.00 0.00 ? 54 ILE A HG22 5  
ATOM 6609  H HG23 . ILE A 1 54 ? -0.128  -8.026  4.005   1.00 0.00 ? 54 ILE A HG23 5  
ATOM 6610  H HD11 . ILE A 1 54 ? -1.020  -5.750  4.805   1.00 0.00 ? 54 ILE A HD11 5  
ATOM 6611  H HD12 . ILE A 1 54 ? 0.585   -6.099  4.119   1.00 0.00 ? 54 ILE A HD12 5  
ATOM 6612  H HD13 . ILE A 1 54 ? -0.154  -4.496  3.885   1.00 0.00 ? 54 ILE A HD13 5  
ATOM 6613  N N    . ASP A 1 55 ? -2.945  -9.986  0.779   1.00 0.00 ? 55 ASP A N    5  
ATOM 6614  C CA   . ASP A 1 55 ? -3.501  -11.328 0.762   1.00 0.00 ? 55 ASP A CA   5  
ATOM 6615  C C    . ASP A 1 55 ? -5.023  -11.243 0.630   1.00 0.00 ? 55 ASP A C    5  
ATOM 6616  O O    . ASP A 1 55 ? -5.729  -12.214 0.899   1.00 0.00 ? 55 ASP A O    5  
ATOM 6617  C CB   . ASP A 1 55 ? -3.180  -12.073 2.060   1.00 0.00 ? 55 ASP A CB   5  
ATOM 6618  C CG   . ASP A 1 55 ? -3.398  -13.587 2.007   1.00 0.00 ? 55 ASP A CG   5  
ATOM 6619  O OD1  . ASP A 1 55 ? -3.400  -14.121 0.877   1.00 0.00 ? 55 ASP A OD1  5  
ATOM 6620  O OD2  . ASP A 1 55 ? -3.559  -14.175 3.098   1.00 0.00 ? 55 ASP A OD2  5  
ATOM 6621  H H    . ASP A 1 55 ? -2.364  -9.760  -0.004  1.00 0.00 ? 55 ASP A H    5  
ATOM 6622  H HA   . ASP A 1 55 ? -3.036  -11.821 -0.091  1.00 0.00 ? 55 ASP A HA   5  
ATOM 6623  H HB2  . ASP A 1 55 ? -2.141  -11.880 2.324   1.00 0.00 ? 55 ASP A HB2  5  
ATOM 6624  H HB3  . ASP A 1 55 ? -3.795  -11.660 2.860   1.00 0.00 ? 55 ASP A HB3  5  
ATOM 6625  N N    . GLY A 1 56 ? -5.485  -10.071 0.217   1.00 0.00 ? 56 GLY A N    5  
ATOM 6626  C CA   . GLY A 1 56 ? -6.910  -9.847  0.046   1.00 0.00 ? 56 GLY A CA   5  
ATOM 6627  C C    . GLY A 1 56 ? -7.446  -8.891  1.114   1.00 0.00 ? 56 GLY A C    5  
ATOM 6628  O O    . GLY A 1 56 ? -8.523  -8.318  0.955   1.00 0.00 ? 56 GLY A O    5  
ATOM 6629  H H    . GLY A 1 56 ? -4.904  -9.287  0.000   1.00 0.00 ? 56 GLY A H    5  
ATOM 6630  H HA2  . GLY A 1 56 ? -7.100  -9.434  -0.945  1.00 0.00 ? 56 GLY A HA2  5  
ATOM 6631  H HA3  . GLY A 1 56 ? -7.441  -10.797 0.103   1.00 0.00 ? 56 GLY A HA3  5  
ATOM 6632  N N    . VAL A 1 57 ? -6.670  -8.748  2.178   1.00 0.00 ? 57 VAL A N    5  
ATOM 6633  C CA   . VAL A 1 57 ? -7.053  -7.872  3.272   1.00 0.00 ? 57 VAL A CA   5  
ATOM 6634  C C    . VAL A 1 57 ? -6.675  -6.431  2.922   1.00 0.00 ? 57 VAL A C    5  
ATOM 6635  O O    . VAL A 1 57 ? -5.517  -6.144  2.625   1.00 0.00 ? 57 VAL A O    5  
ATOM 6636  C CB   . VAL A 1 57 ? -6.419  -8.356  4.577   1.00 0.00 ? 57 VAL A CB   5  
ATOM 6637  C CG1  . VAL A 1 57 ? -6.528  -7.289  5.668   1.00 0.00 ? 57 VAL A CG1  5  
ATOM 6638  C CG2  . VAL A 1 57 ? -7.046  -9.675  5.035   1.00 0.00 ? 57 VAL A CG2  5  
ATOM 6639  H H    . VAL A 1 57 ? -5.796  -9.218  2.299   1.00 0.00 ? 57 VAL A H    5  
ATOM 6640  H HA   . VAL A 1 57 ? -8.136  -7.934  3.379   1.00 0.00 ? 57 VAL A HA   5  
ATOM 6641  H HB   . VAL A 1 57 ? -5.361  -8.536  4.389   1.00 0.00 ? 57 VAL A HB   5  
ATOM 6642  H HG11 . VAL A 1 57 ? -7.101  -6.441  5.292   1.00 0.00 ? 57 VAL A HG11 5  
ATOM 6643  H HG12 . VAL A 1 57 ? -7.031  -7.709  6.539   1.00 0.00 ? 57 VAL A HG12 5  
ATOM 6644  H HG13 . VAL A 1 57 ? -5.530  -6.956  5.951   1.00 0.00 ? 57 VAL A HG13 5  
ATOM 6645  H HG21 . VAL A 1 57 ? -6.565  -10.504 4.517   1.00 0.00 ? 57 VAL A HG21 5  
ATOM 6646  H HG22 . VAL A 1 57 ? -6.907  -9.788  6.111   1.00 0.00 ? 57 VAL A HG22 5  
ATOM 6647  H HG23 . VAL A 1 57 ? -8.111  -9.670  4.804   1.00 0.00 ? 57 VAL A HG23 5  
ATOM 6648  N N    . THR A 1 58 ? -7.675  -5.563  2.967   1.00 0.00 ? 58 THR A N    5  
ATOM 6649  C CA   . THR A 1 58 ? -7.462  -4.159  2.659   1.00 0.00 ? 58 THR A CA   5  
ATOM 6650  C C    . THR A 1 58 ? -6.745  -3.462  3.816   1.00 0.00 ? 58 THR A C    5  
ATOM 6651  O O    . THR A 1 58 ? -6.928  -3.829  4.976   1.00 0.00 ? 58 THR A O    5  
ATOM 6652  C CB   . THR A 1 58 ? -8.819  -3.538  2.322   1.00 0.00 ? 58 THR A CB   5  
ATOM 6653  O OG1  . THR A 1 58 ? -9.477  -4.539  1.550   1.00 0.00 ? 58 THR A OG1  5  
ATOM 6654  C CG2  . THR A 1 58 ? -8.698  -2.350  1.366   1.00 0.00 ? 58 THR A CG2  5  
ATOM 6655  H H    . THR A 1 58 ? -8.615  -5.805  3.209   1.00 0.00 ? 58 THR A H    5  
ATOM 6656  H HA   . THR A 1 58 ? -6.807  -4.094  1.790   1.00 0.00 ? 58 THR A HA   5  
ATOM 6657  H HB   . THR A 1 58 ? -9.354  -3.256  3.229   1.00 0.00 ? 58 THR A HB   5  
ATOM 6658  H HG1  . THR A 1 58 ? -10.432 -4.619  1.836   1.00 0.00 ? 58 THR A HG1  5  
ATOM 6659  H HG21 . THR A 1 58 ? -9.694  -2.010  1.080   1.00 0.00 ? 58 THR A HG21 5  
ATOM 6660  H HG22 . THR A 1 58 ? -8.165  -1.538  1.861   1.00 0.00 ? 58 THR A HG22 5  
ATOM 6661  H HG23 . THR A 1 58 ? -8.149  -2.654  0.475   1.00 0.00 ? 58 THR A HG23 5  
ATOM 6662  N N    . TYR A 1 59 ? -5.944  -2.468  3.461   1.00 0.00 ? 59 TYR A N    5  
ATOM 6663  C CA   . TYR A 1 59 ? -5.198  -1.716  4.455   1.00 0.00 ? 59 TYR A CA   5  
ATOM 6664  C C    . TYR A 1 59 ? -5.190  -0.223  4.121   1.00 0.00 ? 59 TYR A C    5  
ATOM 6665  O O    . TYR A 1 59 ? -6.008  0.537   4.637   1.00 0.00 ? 59 TYR A O    5  
ATOM 6666  C CB   . TYR A 1 59 ? -3.764  -2.247  4.398   1.00 0.00 ? 59 TYR A CB   5  
ATOM 6667  C CG   . TYR A 1 59 ? -3.504  -3.438  5.321   1.00 0.00 ? 59 TYR A CG   5  
ATOM 6668  C CD1  . TYR A 1 59 ? -3.706  -4.724  4.862   1.00 0.00 ? 59 TYR A CD1  5  
ATOM 6669  C CD2  . TYR A 1 59 ? -3.069  -3.228  6.614   1.00 0.00 ? 59 TYR A CD2  5  
ATOM 6670  C CE1  . TYR A 1 59 ? -3.461  -5.846  5.731   1.00 0.00 ? 59 TYR A CE1  5  
ATOM 6671  C CE2  . TYR A 1 59 ? -2.825  -4.349  7.483   1.00 0.00 ? 59 TYR A CE2  5  
ATOM 6672  C CZ   . TYR A 1 59 ? -3.033  -5.603  6.999   1.00 0.00 ? 59 TYR A CZ   5  
ATOM 6673  O OH   . TYR A 1 59 ? -2.802  -6.663  7.820   1.00 0.00 ? 59 TYR A OH   5  
ATOM 6674  H H    . TYR A 1 59 ? -5.801  -2.176  2.515   1.00 0.00 ? 59 TYR A H    5  
ATOM 6675  H HA   . TYR A 1 59 ? -5.683  -1.862  5.420   1.00 0.00 ? 59 TYR A HA   5  
ATOM 6676  H HB2  . TYR A 1 59 ? -3.536  -2.538  3.372   1.00 0.00 ? 59 TYR A HB2  5  
ATOM 6677  H HB3  . TYR A 1 59 ? -3.079  -1.441  4.660   1.00 0.00 ? 59 TYR A HB3  5  
ATOM 6678  H HD1  . TYR A 1 59 ? -4.049  -4.891  3.841   1.00 0.00 ? 59 TYR A HD1  5  
ATOM 6679  H HD2  . TYR A 1 59 ? -2.910  -2.212  6.977   1.00 0.00 ? 59 TYR A HD2  5  
ATOM 6680  H HE1  . TYR A 1 59 ? -3.616  -6.866  5.381   1.00 0.00 ? 59 TYR A HE1  5  
ATOM 6681  H HE2  . TYR A 1 59 ? -2.481  -4.197  8.506   1.00 0.00 ? 59 TYR A HE2  5  
ATOM 6682  H HH   . TYR A 1 59 ? -2.713  -6.349  8.765   1.00 0.00 ? 59 TYR A HH   5  
ATOM 6683  N N    . GLY A 1 60 ? -4.256  0.153   3.259   1.00 0.00 ? 60 GLY A N    5  
ATOM 6684  C CA   . GLY A 1 60 ? -4.131  1.542   2.850   1.00 0.00 ? 60 GLY A CA   5  
ATOM 6685  C C    . GLY A 1 60 ? -4.841  1.786   1.517   1.00 0.00 ? 60 GLY A C    5  
ATOM 6686  O O    . GLY A 1 60 ? -4.689  1.008   0.577   1.00 0.00 ? 60 GLY A O    5  
ATOM 6687  H H    . GLY A 1 60 ? -3.594  -0.471  2.844   1.00 0.00 ? 60 GLY A H    5  
ATOM 6688  H HA2  . GLY A 1 60 ? -4.556  2.190   3.616   1.00 0.00 ? 60 GLY A HA2  5  
ATOM 6689  H HA3  . GLY A 1 60 ? -3.077  1.804   2.759   1.00 0.00 ? 60 GLY A HA3  5  
ATOM 6690  N N    . SER A 1 61 ? -5.600  2.871   1.478   1.00 0.00 ? 61 SER A N    5  
ATOM 6691  C CA   . SER A 1 61 ? -6.334  3.228   0.275   1.00 0.00 ? 61 SER A CA   5  
ATOM 6692  C C    . SER A 1 61 ? -6.489  4.748   0.189   1.00 0.00 ? 61 SER A C    5  
ATOM 6693  O O    . SER A 1 61 ? -6.760  5.406   1.192   1.00 0.00 ? 61 SER A O    5  
ATOM 6694  C CB   . SER A 1 61 ? -7.706  2.552   0.246   1.00 0.00 ? 61 SER A CB   5  
ATOM 6695  O OG   . SER A 1 61 ? -8.595  3.107   1.211   1.00 0.00 ? 61 SER A OG   5  
ATOM 6696  H H    . SER A 1 61 ? -5.718  3.499   2.247   1.00 0.00 ? 61 SER A H    5  
ATOM 6697  H HA   . SER A 1 61 ? -5.729  2.858   -0.552  1.00 0.00 ? 61 SER A HA   5  
ATOM 6698  H HB2  . SER A 1 61 ? -8.140  2.656   -0.749  1.00 0.00 ? 61 SER A HB2  5  
ATOM 6699  H HB3  . SER A 1 61 ? -7.588  1.485   0.433   1.00 0.00 ? 61 SER A HB3  5  
ATOM 6700  H HG   . SER A 1 61 ? -9.063  2.375   1.706   1.00 0.00 ? 61 SER A HG   5  
ATOM 6701  N N    . GLY A 1 62 ? -6.311  5.261   -1.019  1.00 0.00 ? 62 GLY A N    5  
ATOM 6702  C CA   . GLY A 1 62 ? -6.428  6.691   -1.250  1.00 0.00 ? 62 GLY A CA   5  
ATOM 6703  C C    . GLY A 1 62 ? -6.546  6.998   -2.744  1.00 0.00 ? 62 GLY A C    5  
ATOM 6704  O O    . GLY A 1 62 ? -6.548  6.087   -3.570  1.00 0.00 ? 62 GLY A O    5  
ATOM 6705  H H    . GLY A 1 62 ? -6.091  4.719   -1.830  1.00 0.00 ? 62 GLY A H    5  
ATOM 6706  H HA2  . GLY A 1 62 ? -7.301  7.078   -0.725  1.00 0.00 ? 62 GLY A HA2  5  
ATOM 6707  H HA3  . GLY A 1 62 ? -5.557  7.202   -0.838  1.00 0.00 ? 62 GLY A HA3  5  
ATOM 6708  N N    . THR A 1 63 ? -6.642  8.285   -3.046  1.00 0.00 ? 63 THR A N    5  
ATOM 6709  C CA   . THR A 1 63 ? -6.761  8.723   -4.426  1.00 0.00 ? 63 THR A CA   5  
ATOM 6710  C C    . THR A 1 63 ? -5.840  9.916   -4.688  1.00 0.00 ? 63 THR A C    5  
ATOM 6711  O O    . THR A 1 63 ? -5.279  10.488  -3.755  1.00 0.00 ? 63 THR A O    5  
ATOM 6712  C CB   . THR A 1 63 ? -8.236  9.022   -4.701  1.00 0.00 ? 63 THR A CB   5  
ATOM 6713  O OG1  . THR A 1 63 ? -8.562  10.049  -3.769  1.00 0.00 ? 63 THR A OG1  5  
ATOM 6714  C CG2  . THR A 1 63 ? -9.152  7.860   -4.312  1.00 0.00 ? 63 THR A CG2  5  
ATOM 6715  H H    . THR A 1 63 ? -6.640  9.020   -2.368  1.00 0.00 ? 63 THR A H    5  
ATOM 6716  H HA   . THR A 1 63 ? -6.427  7.912   -5.074  1.00 0.00 ? 63 THR A HA   5  
ATOM 6717  H HB   . THR A 1 63 ? -8.388  9.306   -5.743  1.00 0.00 ? 63 THR A HB   5  
ATOM 6718  H HG1  . THR A 1 63 ? -8.003  10.859  -3.942  1.00 0.00 ? 63 THR A HG1  5  
ATOM 6719  H HG21 . THR A 1 63 ? -9.690  8.112   -3.398  1.00 0.00 ? 63 THR A HG21 5  
ATOM 6720  H HG22 . THR A 1 63 ? -9.866  7.676   -5.115  1.00 0.00 ? 63 THR A HG22 5  
ATOM 6721  H HG23 . THR A 1 63 ? -8.553  6.965   -4.146  1.00 0.00 ? 63 THR A HG23 5  
ATOM 6722  N N    . ALA A 1 64 ? -5.712  10.255  -5.962  1.00 0.00 ? 64 ALA A N    5  
ATOM 6723  C CA   . ALA A 1 64 ? -4.868  11.369  -6.359  1.00 0.00 ? 64 ALA A CA   5  
ATOM 6724  C C    . ALA A 1 64 ? -5.264  11.829  -7.763  1.00 0.00 ? 64 ALA A C    5  
ATOM 6725  O O    . ALA A 1 64 ? -6.211  11.305  -8.348  1.00 0.00 ? 64 ALA A O    5  
ATOM 6726  C CB   . ALA A 1 64 ? -3.398  10.953  -6.274  1.00 0.00 ? 64 ALA A CB   5  
ATOM 6727  H H    . ALA A 1 64 ? -6.171  9.784   -6.715  1.00 0.00 ? 64 ALA A H    5  
ATOM 6728  H HA   . ALA A 1 64 ? -5.042  12.184  -5.656  1.00 0.00 ? 64 ALA A HA   5  
ATOM 6729  H HB1  . ALA A 1 64 ? -2.801  11.591  -6.926  1.00 0.00 ? 64 ALA A HB1  5  
ATOM 6730  H HB2  . ALA A 1 64 ? -3.050  11.055  -5.246  1.00 0.00 ? 64 ALA A HB2  5  
ATOM 6731  H HB3  . ALA A 1 64 ? -3.296  9.914   -6.590  1.00 0.00 ? 64 ALA A HB3  5  
ATOM 6732  N N    . SER A 1 65 ? -4.519  12.803  -8.265  1.00 0.00 ? 65 SER A N    5  
ATOM 6733  C CA   . SER A 1 65 ? -4.780  13.338  -9.590  1.00 0.00 ? 65 SER A CA   5  
ATOM 6734  C C    . SER A 1 65 ? -4.296  12.354  -10.657 1.00 0.00 ? 65 SER A C    5  
ATOM 6735  O O    . SER A 1 65 ? -4.789  12.363  -11.784 1.00 0.00 ? 65 SER A O    5  
ATOM 6736  C CB   . SER A 1 65 ? -4.105  14.699  -9.777  1.00 0.00 ? 65 SER A CB   5  
ATOM 6737  O OG   . SER A 1 65 ? -4.916  15.598  -10.527 1.00 0.00 ? 65 SER A OG   5  
ATOM 6738  H H    . SER A 1 65 ? -3.750  13.224  -7.783  1.00 0.00 ? 65 SER A H    5  
ATOM 6739  H HA   . SER A 1 65 ? -5.862  13.460  -9.644  1.00 0.00 ? 65 SER A HA   5  
ATOM 6740  H HB2  . SER A 1 65 ? -3.888  15.133  -8.801  1.00 0.00 ? 65 SER A HB2  5  
ATOM 6741  H HB3  . SER A 1 65 ? -3.150  14.563  -10.284 1.00 0.00 ? 65 SER A HB3  5  
ATOM 6742  H HG   . SER A 1 65 ? -5.105  16.419  -9.989  1.00 0.00 ? 65 SER A HG   5  
ATOM 6743  N N    . SER A 1 66 ? -3.337  11.529  -10.264 1.00 0.00 ? 66 SER A N    5  
ATOM 6744  C CA   . SER A 1 66 ? -2.781  10.541  -11.173 1.00 0.00 ? 66 SER A CA   5  
ATOM 6745  C C    . SER A 1 66 ? -3.020  9.133   -10.625 1.00 0.00 ? 66 SER A C    5  
ATOM 6746  O O    . SER A 1 66 ? -3.546  8.972   -9.524  1.00 0.00 ? 66 SER A O    5  
ATOM 6747  C CB   . SER A 1 66 ? -1.286  10.777  -11.395 1.00 0.00 ? 66 SER A CB   5  
ATOM 6748  O OG   . SER A 1 66 ? -0.975  10.971  -12.772 1.00 0.00 ? 66 SER A OG   5  
ATOM 6749  H H    . SER A 1 66 ? -2.941  11.529  -9.346  1.00 0.00 ? 66 SER A H    5  
ATOM 6750  H HA   . SER A 1 66 ? -3.314  10.681  -12.113 1.00 0.00 ? 66 SER A HA   5  
ATOM 6751  H HB2  . SER A 1 66 ? -0.968  11.650  -10.825 1.00 0.00 ? 66 SER A HB2  5  
ATOM 6752  H HB3  . SER A 1 66 ? -0.723  9.925   -11.014 1.00 0.00 ? 66 SER A HB3  5  
ATOM 6753  H HG   . SER A 1 66 ? -1.609  10.449  -13.343 1.00 0.00 ? 66 SER A HG   5  
ATOM 6754  N N    . LYS A 1 67 ? -2.622  8.148   -11.417 1.00 0.00 ? 67 LYS A N    5  
ATOM 6755  C CA   . LYS A 1 67 ? -2.787  6.759   -11.025 1.00 0.00 ? 67 LYS A CA   5  
ATOM 6756  C C    . LYS A 1 67 ? -1.666  6.370   -10.058 1.00 0.00 ? 67 LYS A C    5  
ATOM 6757  O O    . LYS A 1 67 ? -1.914  5.720   -9.044  1.00 0.00 ? 67 LYS A O    5  
ATOM 6758  C CB   . LYS A 1 67 ? -2.874  5.860   -12.260 1.00 0.00 ? 67 LYS A CB   5  
ATOM 6759  C CG   . LYS A 1 67 ? -3.448  4.489   -11.901 1.00 0.00 ? 67 LYS A CG   5  
ATOM 6760  C CD   . LYS A 1 67 ? -3.576  3.605   -13.143 1.00 0.00 ? 67 LYS A CD   5  
ATOM 6761  C CE   . LYS A 1 67 ? -4.815  2.712   -13.056 1.00 0.00 ? 67 LYS A CE   5  
ATOM 6762  N NZ   . LYS A 1 67 ? -4.557  1.403   -13.697 1.00 0.00 ? 67 LYS A NZ   5  
ATOM 6763  H H    . LYS A 1 67 ? -2.195  8.288   -12.310 1.00 0.00 ? 67 LYS A H    5  
ATOM 6764  H HA   . LYS A 1 67 ? -3.739  6.678   -10.500 1.00 0.00 ? 67 LYS A HA   5  
ATOM 6765  H HB2  . LYS A 1 67 ? -3.499  6.334   -13.016 1.00 0.00 ? 67 LYS A HB2  5  
ATOM 6766  H HB3  . LYS A 1 67 ? -1.882  5.740   -12.697 1.00 0.00 ? 67 LYS A HB3  5  
ATOM 6767  H HG2  . LYS A 1 67 ? -2.805  4.001   -11.168 1.00 0.00 ? 67 LYS A HG2  5  
ATOM 6768  H HG3  . LYS A 1 67 ? -4.426  4.611   -11.434 1.00 0.00 ? 67 LYS A HG3  5  
ATOM 6769  H HD2  . LYS A 1 67 ? -3.637  4.231   -14.034 1.00 0.00 ? 67 LYS A HD2  5  
ATOM 6770  H HD3  . LYS A 1 67 ? -2.684  2.987   -13.248 1.00 0.00 ? 67 LYS A HD3  5  
ATOM 6771  H HE2  . LYS A 1 67 ? -5.091  2.563   -12.011 1.00 0.00 ? 67 LYS A HE2  5  
ATOM 6772  H HE3  . LYS A 1 67 ? -5.659  3.201   -13.542 1.00 0.00 ? 67 LYS A HE3  5  
ATOM 6773  H HZ1  . LYS A 1 67 ? -4.512  0.691   -12.996 1.00 0.00 ? 67 LYS A HZ1  5  
ATOM 6774  H HZ2  . LYS A 1 67 ? -5.296  1.194   -14.337 1.00 0.00 ? 67 LYS A HZ2  5  
ATOM 6775  H HZ3  . LYS A 1 67 ? -3.688  1.440   -14.191 1.00 0.00 ? 67 LYS A HZ3  5  
ATOM 6776  N N    . LYS A 1 68 ? -0.457  6.785   -10.407 1.00 0.00 ? 68 LYS A N    5  
ATOM 6777  C CA   . LYS A 1 68 ? 0.702   6.488   -9.583  1.00 0.00 ? 68 LYS A CA   5  
ATOM 6778  C C    . LYS A 1 68 ? 0.452   6.987   -8.159  1.00 0.00 ? 68 LYS A C    5  
ATOM 6779  O O    . LYS A 1 68 ? 0.462   6.202   -7.212  1.00 0.00 ? 68 LYS A O    5  
ATOM 6780  C CB   . LYS A 1 68 ? 1.972   7.058   -10.220 1.00 0.00 ? 68 LYS A CB   5  
ATOM 6781  C CG   . LYS A 1 68 ? 3.136   6.073   -10.097 1.00 0.00 ? 68 LYS A CG   5  
ATOM 6782  C CD   . LYS A 1 68 ? 3.849   5.896   -11.439 1.00 0.00 ? 68 LYS A CD   5  
ATOM 6783  C CE   . LYS A 1 68 ? 3.224   4.755   -12.244 1.00 0.00 ? 68 LYS A CE   5  
ATOM 6784  N NZ   . LYS A 1 68 ? 2.096   5.254   -13.062 1.00 0.00 ? 68 LYS A NZ   5  
ATOM 6785  H H    . LYS A 1 68 ? -0.264  7.314   -11.234 1.00 0.00 ? 68 LYS A H    5  
ATOM 6786  H HA   . LYS A 1 68 ? 0.814   5.404   -9.556  1.00 0.00 ? 68 LYS A HA   5  
ATOM 6787  H HB2  . LYS A 1 68 ? 1.788   7.280   -11.271 1.00 0.00 ? 68 LYS A HB2  5  
ATOM 6788  H HB3  . LYS A 1 68 ? 2.234   7.999   -9.737  1.00 0.00 ? 68 LYS A HB3  5  
ATOM 6789  H HG2  . LYS A 1 68 ? 3.844   6.434   -9.350  1.00 0.00 ? 68 LYS A HG2  5  
ATOM 6790  H HG3  . LYS A 1 68 ? 2.767   5.110   -9.747  1.00 0.00 ? 68 LYS A HG3  5  
ATOM 6791  H HD2  . LYS A 1 68 ? 3.792   6.823   -12.010 1.00 0.00 ? 68 LYS A HD2  5  
ATOM 6792  H HD3  . LYS A 1 68 ? 4.906   5.690   -11.270 1.00 0.00 ? 68 LYS A HD3  5  
ATOM 6793  H HE2  . LYS A 1 68 ? 3.977   4.303   -12.890 1.00 0.00 ? 68 LYS A HE2  5  
ATOM 6794  H HE3  . LYS A 1 68 ? 2.873   3.975   -11.569 1.00 0.00 ? 68 LYS A HE3  5  
ATOM 6795  H HZ1  . LYS A 1 68 ? 2.071   6.253   -13.021 1.00 0.00 ? 68 LYS A HZ1  5  
ATOM 6796  H HZ2  . LYS A 1 68 ? 2.218   4.963   -14.011 1.00 0.00 ? 68 LYS A HZ2  5  
ATOM 6797  H HZ3  . LYS A 1 68 ? 1.238   4.884   -12.708 1.00 0.00 ? 68 LYS A HZ3  5  
ATOM 6798  N N    . LEU A 1 69 ? 0.232   8.289   -8.052  1.00 0.00 ? 69 LEU A N    5  
ATOM 6799  C CA   . LEU A 1 69 ? -0.021  8.901   -6.759  1.00 0.00 ? 69 LEU A CA   5  
ATOM 6800  C C    . LEU A 1 69 ? -0.922  7.982   -5.931  1.00 0.00 ? 69 LEU A C    5  
ATOM 6801  O O    . LEU A 1 69 ? -0.559  7.580   -4.827  1.00 0.00 ? 69 LEU A O    5  
ATOM 6802  C CB   . LEU A 1 69 ? -0.581  10.314  -6.935  1.00 0.00 ? 69 LEU A CB   5  
ATOM 6803  C CG   . LEU A 1 69 ? 0.428   11.388  -7.348  1.00 0.00 ? 69 LEU A CG   5  
ATOM 6804  C CD1  . LEU A 1 69 ? 1.023   12.082  -6.122  1.00 0.00 ? 69 LEU A CD1  5  
ATOM 6805  C CD2  . LEU A 1 69 ? 1.510   10.803  -8.257  1.00 0.00 ? 69 LEU A CD2  5  
ATOM 6806  H H    . LEU A 1 69 ? 0.225   8.920   -8.827  1.00 0.00 ? 69 LEU A H    5  
ATOM 6807  H HA   . LEU A 1 69 ? 0.937   8.995   -6.249  1.00 0.00 ? 69 LEU A HA   5  
ATOM 6808  H HB2  . LEU A 1 69 ? -1.372  10.279  -7.684  1.00 0.00 ? 69 LEU A HB2  5  
ATOM 6809  H HB3  . LEU A 1 69 ? -1.044  10.620  -5.997  1.00 0.00 ? 69 LEU A HB3  5  
ATOM 6810  H HG   . LEU A 1 69 ? -0.100  12.149  -7.924  1.00 0.00 ? 69 LEU A HG   5  
ATOM 6811  H HD11 . LEU A 1 69 ? 1.922   11.553  -5.805  1.00 0.00 ? 69 LEU A HD11 5  
ATOM 6812  H HD12 . LEU A 1 69 ? 1.277   13.111  -6.374  1.00 0.00 ? 69 LEU A HD12 5  
ATOM 6813  H HD13 . LEU A 1 69 ? 0.294   12.077  -5.311  1.00 0.00 ? 69 LEU A HD13 5  
ATOM 6814  H HD21 . LEU A 1 69 ? 1.881   9.872   -7.829  1.00 0.00 ? 69 LEU A HD21 5  
ATOM 6815  H HD22 . LEU A 1 69 ? 1.090   10.607  -9.243  1.00 0.00 ? 69 LEU A HD22 5  
ATOM 6816  H HD23 . LEU A 1 69 ? 2.332   11.514  -8.348  1.00 0.00 ? 69 LEU A HD23 5  
ATOM 6817  N N    . ALA A 1 70 ? -2.081  7.676   -6.497  1.00 0.00 ? 70 ALA A N    5  
ATOM 6818  C CA   . ALA A 1 70 ? -3.036  6.812   -5.826  1.00 0.00 ? 70 ALA A CA   5  
ATOM 6819  C C    . ALA A 1 70 ? -2.311  5.576   -5.289  1.00 0.00 ? 70 ALA A C    5  
ATOM 6820  O O    . ALA A 1 70 ? -2.388  5.275   -4.099  1.00 0.00 ? 70 ALA A O    5  
ATOM 6821  C CB   . ALA A 1 70 ? -4.165  6.450   -6.793  1.00 0.00 ? 70 ALA A CB   5  
ATOM 6822  H H    . ALA A 1 70 ? -2.369  8.007   -7.396  1.00 0.00 ? 70 ALA A H    5  
ATOM 6823  H HA   . ALA A 1 70 ? -3.456  7.369   -4.988  1.00 0.00 ? 70 ALA A HA   5  
ATOM 6824  H HB1  . ALA A 1 70 ? -3.844  5.632   -7.437  1.00 0.00 ? 70 ALA A HB1  5  
ATOM 6825  H HB2  . ALA A 1 70 ? -5.045  6.143   -6.227  1.00 0.00 ? 70 ALA A HB2  5  
ATOM 6826  H HB3  . ALA A 1 70 ? -4.412  7.318   -7.405  1.00 0.00 ? 70 ALA A HB3  5  
ATOM 6827  N N    . LYS A 1 71 ? -1.622  4.894   -6.192  1.00 0.00 ? 71 LYS A N    5  
ATOM 6828  C CA   . LYS A 1 71 ? -0.884  3.699   -5.824  1.00 0.00 ? 71 LYS A CA   5  
ATOM 6829  C C    . LYS A 1 71 ? 0.124   4.045   -4.726  1.00 0.00 ? 71 LYS A C    5  
ATOM 6830  O O    . LYS A 1 71 ? 0.326   3.265   -3.796  1.00 0.00 ? 71 LYS A O    5  
ATOM 6831  C CB   . LYS A 1 71 ? -0.250  3.059   -7.061  1.00 0.00 ? 71 LYS A CB   5  
ATOM 6832  C CG   . LYS A 1 71 ? -0.482  1.547   -7.076  1.00 0.00 ? 71 LYS A CG   5  
ATOM 6833  C CD   . LYS A 1 71 ? 0.158   0.906   -8.310  1.00 0.00 ? 71 LYS A CD   5  
ATOM 6834  C CE   . LYS A 1 71 ? 1.443   0.163   -7.938  1.00 0.00 ? 71 LYS A CE   5  
ATOM 6835  N NZ   . LYS A 1 71 ? 2.488   0.393   -8.960  1.00 0.00 ? 71 LYS A NZ   5  
ATOM 6836  H H    . LYS A 1 71 ? -1.565  5.146   -7.159  1.00 0.00 ? 71 LYS A H    5  
ATOM 6837  H HA   . LYS A 1 71 ? -1.600  2.982   -5.423  1.00 0.00 ? 71 LYS A HA   5  
ATOM 6838  H HB2  . LYS A 1 71 ? -0.671  3.504   -7.962  1.00 0.00 ? 71 LYS A HB2  5  
ATOM 6839  H HB3  . LYS A 1 71 ? 0.820   3.266   -7.074  1.00 0.00 ? 71 LYS A HB3  5  
ATOM 6840  H HG2  . LYS A 1 71 ? -0.064  1.102   -6.173  1.00 0.00 ? 71 LYS A HG2  5  
ATOM 6841  H HG3  . LYS A 1 71 ? -1.552  1.339   -7.068  1.00 0.00 ? 71 LYS A HG3  5  
ATOM 6842  H HD2  . LYS A 1 71 ? -0.547  0.213   -8.770  1.00 0.00 ? 71 LYS A HD2  5  
ATOM 6843  H HD3  . LYS A 1 71 ? 0.379   1.675   -9.050  1.00 0.00 ? 71 LYS A HD3  5  
ATOM 6844  H HE2  . LYS A 1 71 ? 1.797   0.502   -6.964  1.00 0.00 ? 71 LYS A HE2  5  
ATOM 6845  H HE3  . LYS A 1 71 ? 1.241   -0.904  -7.850  1.00 0.00 ? 71 LYS A HE3  5  
ATOM 6846  H HZ1  . LYS A 1 71 ? 2.304   1.252   -9.438  1.00 0.00 ? 71 LYS A HZ1  5  
ATOM 6847  H HZ2  . LYS A 1 71 ? 3.383   0.445   -8.516  1.00 0.00 ? 71 LYS A HZ2  5  
ATOM 6848  H HZ3  . LYS A 1 71 ? 2.485   -0.361  -9.616  1.00 0.00 ? 71 LYS A HZ3  5  
ATOM 6849  N N    . ASN A 1 72 ? 0.729   5.215   -4.869  1.00 0.00 ? 72 ASN A N    5  
ATOM 6850  C CA   . ASN A 1 72 ? 1.710   5.673   -3.901  1.00 0.00 ? 72 ASN A CA   5  
ATOM 6851  C C    . ASN A 1 72 ? 1.033   5.853   -2.541  1.00 0.00 ? 72 ASN A C    5  
ATOM 6852  O O    . ASN A 1 72 ? 1.576   5.446   -1.514  1.00 0.00 ? 72 ASN A O    5  
ATOM 6853  C CB   . ASN A 1 72 ? 2.304   7.021   -4.315  1.00 0.00 ? 72 ASN A CB   5  
ATOM 6854  C CG   . ASN A 1 72 ? 2.830   6.971   -5.750  1.00 0.00 ? 72 ASN A CG   5  
ATOM 6855  O OD1  . ASN A 1 72 ? 2.914   5.925   -6.372  1.00 0.00 ? 72 ASN A OD1  5  
ATOM 6856  N ND2  . ASN A 1 72 ? 3.179   8.157   -6.240  1.00 0.00 ? 72 ASN A ND2  5  
ATOM 6857  H H    . ASN A 1 72 ? 0.558   5.843   -5.628  1.00 0.00 ? 72 ASN A H    5  
ATOM 6858  H HA   . ASN A 1 72 ? 2.479   4.901   -3.885  1.00 0.00 ? 72 ASN A HA   5  
ATOM 6859  H HB2  . ASN A 1 72 ? 1.545   7.799   -4.229  1.00 0.00 ? 72 ASN A HB2  5  
ATOM 6860  H HB3  . ASN A 1 72 ? 3.114   7.290   -3.636  1.00 0.00 ? 72 ASN A HB3  5  
ATOM 6861  H HD21 . ASN A 1 72 ? 3.085   8.978   -5.677  1.00 0.00 ? 72 ASN A HD21 5  
ATOM 6862  H HD22 . ASN A 1 72 ? 3.535   8.228   -7.172  1.00 0.00 ? 72 ASN A HD22 5  
ATOM 6863  N N    . LYS A 1 73 ? -0.144  6.461   -2.577  1.00 0.00 ? 73 LYS A N    5  
ATOM 6864  C CA   . LYS A 1 73 ? -0.901  6.699   -1.360  1.00 0.00 ? 73 LYS A CA   5  
ATOM 6865  C C    . LYS A 1 73 ? -1.369  5.361   -0.785  1.00 0.00 ? 73 LYS A C    5  
ATOM 6866  O O    . LYS A 1 73 ? -1.243  5.118   0.414   1.00 0.00 ? 73 LYS A O    5  
ATOM 6867  C CB   . LYS A 1 73 ? -2.039  7.688   -1.622  1.00 0.00 ? 73 LYS A CB   5  
ATOM 6868  C CG   . LYS A 1 73 ? -1.502  9.112   -1.784  1.00 0.00 ? 73 LYS A CG   5  
ATOM 6869  C CD   . LYS A 1 73 ? -2.371  9.918   -2.751  1.00 0.00 ? 73 LYS A CD   5  
ATOM 6870  C CE   . LYS A 1 73 ? -2.569  11.349  -2.248  1.00 0.00 ? 73 LYS A CE   5  
ATOM 6871  N NZ   . LYS A 1 73 ? -1.657  12.277  -2.954  1.00 0.00 ? 73 LYS A NZ   5  
ATOM 6872  H H    . LYS A 1 73 ? -0.578  6.789   -3.416  1.00 0.00 ? 73 LYS A H    5  
ATOM 6873  H HA   . LYS A 1 73 ? -0.227  7.167   -0.642  1.00 0.00 ? 73 LYS A HA   5  
ATOM 6874  H HB2  . LYS A 1 73 ? -2.581  7.395   -2.521  1.00 0.00 ? 73 LYS A HB2  5  
ATOM 6875  H HB3  . LYS A 1 73 ? -2.750  7.656   -0.796  1.00 0.00 ? 73 LYS A HB3  5  
ATOM 6876  H HG2  . LYS A 1 73 ? -1.476  9.607   -0.814  1.00 0.00 ? 73 LYS A HG2  5  
ATOM 6877  H HG3  . LYS A 1 73 ? -0.477  9.078   -2.153  1.00 0.00 ? 73 LYS A HG3  5  
ATOM 6878  H HD2  . LYS A 1 73 ? -1.905  9.936   -3.736  1.00 0.00 ? 73 LYS A HD2  5  
ATOM 6879  H HD3  . LYS A 1 73 ? -3.340  9.432   -2.867  1.00 0.00 ? 73 LYS A HD3  5  
ATOM 6880  H HE2  . LYS A 1 73 ? -3.603  11.657  -2.404  1.00 0.00 ? 73 LYS A HE2  5  
ATOM 6881  H HE3  . LYS A 1 73 ? -2.382  11.393  -1.175  1.00 0.00 ? 73 LYS A HE3  5  
ATOM 6882  H HZ1  . LYS A 1 73 ? -1.743  12.143  -3.941  1.00 0.00 ? 73 LYS A HZ1  5  
ATOM 6883  H HZ2  . LYS A 1 73 ? -1.897  13.220  -2.723  1.00 0.00 ? 73 LYS A HZ2  5  
ATOM 6884  H HZ3  . LYS A 1 73 ? -0.714  12.095  -2.674  1.00 0.00 ? 73 LYS A HZ3  5  
ATOM 6885  N N    . ALA A 1 74 ? -1.899  4.527   -1.668  1.00 0.00 ? 74 ALA A N    5  
ATOM 6886  C CA   . ALA A 1 74 ? -2.387  3.220   -1.264  1.00 0.00 ? 74 ALA A CA   5  
ATOM 6887  C C    . ALA A 1 74 ? -1.305  2.506   -0.451  1.00 0.00 ? 74 ALA A C    5  
ATOM 6888  O O    . ALA A 1 74 ? -1.579  1.983   0.629   1.00 0.00 ? 74 ALA A O    5  
ATOM 6889  C CB   . ALA A 1 74 ? -2.804  2.425   -2.503  1.00 0.00 ? 74 ALA A CB   5  
ATOM 6890  H H    . ALA A 1 74 ? -1.998  4.733   -2.642  1.00 0.00 ? 74 ALA A H    5  
ATOM 6891  H HA   . ALA A 1 74 ? -3.263  3.372   -0.633  1.00 0.00 ? 74 ALA A HA   5  
ATOM 6892  H HB1  . ALA A 1 74 ? -3.407  1.569   -2.199  1.00 0.00 ? 74 ALA A HB1  5  
ATOM 6893  H HB2  . ALA A 1 74 ? -3.389  3.064   -3.165  1.00 0.00 ? 74 ALA A HB2  5  
ATOM 6894  H HB3  . ALA A 1 74 ? -1.915  2.076   -3.027  1.00 0.00 ? 74 ALA A HB3  5  
ATOM 6895  N N    . ALA A 1 75 ? -0.099  2.507   -1.000  1.00 0.00 ? 75 ALA A N    5  
ATOM 6896  C CA   . ALA A 1 75 ? 1.025   1.866   -0.339  1.00 0.00 ? 75 ALA A CA   5  
ATOM 6897  C C    . ALA A 1 75 ? 1.436   2.697   0.879   1.00 0.00 ? 75 ALA A C    5  
ATOM 6898  O O    . ALA A 1 75 ? 1.567   2.166   1.981   1.00 0.00 ? 75 ALA A O    5  
ATOM 6899  C CB   . ALA A 1 75 ? 2.170   1.688   -1.337  1.00 0.00 ? 75 ALA A CB   5  
ATOM 6900  H H    . ALA A 1 75 ? 0.115   2.935   -1.878  1.00 0.00 ? 75 ALA A H    5  
ATOM 6901  H HA   . ALA A 1 75 ? 0.695   0.883   -0.003  1.00 0.00 ? 75 ALA A HA   5  
ATOM 6902  H HB1  . ALA A 1 75 ? 2.966   2.396   -1.106  1.00 0.00 ? 75 ALA A HB1  5  
ATOM 6903  H HB2  . ALA A 1 75 ? 2.557   0.672   -1.268  1.00 0.00 ? 75 ALA A HB2  5  
ATOM 6904  H HB3  . ALA A 1 75 ? 1.804   1.870   -2.347  1.00 0.00 ? 75 ALA A HB3  5  
ATOM 6905  N N    . ARG A 1 76 ? 1.627   3.986   0.639   1.00 0.00 ? 76 ARG A N    5  
ATOM 6906  C CA   . ARG A 1 76 ? 2.021   4.895   1.702   1.00 0.00 ? 76 ARG A CA   5  
ATOM 6907  C C    . ARG A 1 76 ? 1.167   4.655   2.948   1.00 0.00 ? 76 ARG A C    5  
ATOM 6908  O O    . ARG A 1 76 ? 1.688   4.599   4.061   1.00 0.00 ? 76 ARG A O    5  
ATOM 6909  C CB   . ARG A 1 76 ? 1.872   6.353   1.263   1.00 0.00 ? 76 ARG A CB   5  
ATOM 6910  C CG   . ARG A 1 76 ? 2.340   7.307   2.364   1.00 0.00 ? 76 ARG A CG   5  
ATOM 6911  C CD   . ARG A 1 76 ? 1.252   8.327   2.704   1.00 0.00 ? 76 ARG A CD   5  
ATOM 6912  N NE   . ARG A 1 76 ? 1.869   9.620   3.076   1.00 0.00 ? 76 ARG A NE   5  
ATOM 6913  C CZ   . ARG A 1 76 ? 1.173   10.724  3.381   1.00 0.00 ? 76 ARG A CZ   5  
ATOM 6914  N NH1  . ARG A 1 76 ? -0.167  10.699  3.360   1.00 0.00 ? 76 ARG A NH1  5  
ATOM 6915  N NH2  . ARG A 1 76 ? 1.817   11.853  3.706   1.00 0.00 ? 76 ARG A NH2  5  
ATOM 6916  H H    . ARG A 1 76 ? 1.518   4.409   -0.261  1.00 0.00 ? 76 ARG A H    5  
ATOM 6917  H HA   . ARG A 1 76 ? 3.068   4.663   1.893   1.00 0.00 ? 76 ARG A HA   5  
ATOM 6918  H HB2  . ARG A 1 76 ? 2.452   6.525   0.357   1.00 0.00 ? 76 ARG A HB2  5  
ATOM 6919  H HB3  . ARG A 1 76 ? 0.830   6.558   1.018   1.00 0.00 ? 76 ARG A HB3  5  
ATOM 6920  H HG2  . ARG A 1 76 ? 2.602   6.738   3.256   1.00 0.00 ? 76 ARG A HG2  5  
ATOM 6921  H HG3  . ARG A 1 76 ? 3.242   7.827   2.040   1.00 0.00 ? 76 ARG A HG3  5  
ATOM 6922  H HD2  . ARG A 1 76 ? 0.589   8.463   1.850   1.00 0.00 ? 76 ARG A HD2  5  
ATOM 6923  H HD3  . ARG A 1 76 ? 0.640   7.957   3.527   1.00 0.00 ? 76 ARG A HD3  5  
ATOM 6924  H HE   . ARG A 1 76 ? 2.867   9.673   3.101   1.00 0.00 ? 76 ARG A HE   5  
ATOM 6925  H HH11 . ARG A 1 76 ? -0.647  9.857   3.118   1.00 0.00 ? 76 ARG A HH11 5  
ATOM 6926  H HH12 . ARG A 1 76 ? -0.686  11.523  3.588   1.00 0.00 ? 76 ARG A HH12 5  
ATOM 6927  H HH21 . ARG A 1 76 ? 2.817   11.872  3.722   1.00 0.00 ? 76 ARG A HH21 5  
ATOM 6928  H HH22 . ARG A 1 76 ? 1.298   12.677  3.934   1.00 0.00 ? 76 ARG A HH22 5  
ATOM 6929  N N    . ALA A 1 77 ? -0.131  4.518   2.720   1.00 0.00 ? 77 ALA A N    5  
ATOM 6930  C CA   . ALA A 1 77 ? -1.062  4.286   3.811   1.00 0.00 ? 77 ALA A CA   5  
ATOM 6931  C C    . ALA A 1 77 ? -0.735  2.949   4.479   1.00 0.00 ? 77 ALA A C    5  
ATOM 6932  O O    . ALA A 1 77 ? -0.513  2.893   5.688   1.00 0.00 ? 77 ALA A O    5  
ATOM 6933  C CB   . ALA A 1 77 ? -2.496  4.335   3.279   1.00 0.00 ? 77 ALA A CB   5  
ATOM 6934  H H    . ALA A 1 77 ? -0.547  4.565   1.812   1.00 0.00 ? 77 ALA A H    5  
ATOM 6935  H HA   . ALA A 1 77 ? -0.930  5.087   4.538   1.00 0.00 ? 77 ALA A HA   5  
ATOM 6936  H HB1  . ALA A 1 77 ? -3.095  3.573   3.777   1.00 0.00 ? 77 ALA A HB1  5  
ATOM 6937  H HB2  . ALA A 1 77 ? -2.922  5.319   3.475   1.00 0.00 ? 77 ALA A HB2  5  
ATOM 6938  H HB3  . ALA A 1 77 ? -2.491  4.149   2.205   1.00 0.00 ? 77 ALA A HB3  5  
ATOM 6939  N N    . THR A 1 78 ? -0.715  1.905   3.663   1.00 0.00 ? 78 THR A N    5  
ATOM 6940  C CA   . THR A 1 78 ? -0.418  0.572   4.160   1.00 0.00 ? 78 THR A CA   5  
ATOM 6941  C C    . THR A 1 78 ? 0.820   0.602   5.059   1.00 0.00 ? 78 THR A C    5  
ATOM 6942  O O    . THR A 1 78 ? 0.906   -0.151  6.028   1.00 0.00 ? 78 THR A O    5  
ATOM 6943  C CB   . THR A 1 78 ? -0.271  -0.360  2.956   1.00 0.00 ? 78 THR A CB   5  
ATOM 6944  O OG1  . THR A 1 78 ? -1.613  -0.612  2.547   1.00 0.00 ? 78 THR A OG1  5  
ATOM 6945  C CG2  . THR A 1 78 ? 0.266   -1.739  3.344   1.00 0.00 ? 78 THR A CG2  5  
ATOM 6946  H H    . THR A 1 78 ? -0.896  1.959   2.682   1.00 0.00 ? 78 THR A H    5  
ATOM 6947  H HA   . THR A 1 78 ? -1.253  0.241   4.777   1.00 0.00 ? 78 THR A HA   5  
ATOM 6948  H HB   . THR A 1 78 ? 0.348   0.097   2.184   1.00 0.00 ? 78 THR A HB   5  
ATOM 6949  H HG1  . THR A 1 78 ? -1.953  0.153   2.000   1.00 0.00 ? 78 THR A HG1  5  
ATOM 6950  H HG21 . THR A 1 78 ? 0.481   -2.312  2.442   1.00 0.00 ? 78 THR A HG21 5  
ATOM 6951  H HG22 . THR A 1 78 ? 1.179   -1.622  3.927   1.00 0.00 ? 78 THR A HG22 5  
ATOM 6952  H HG23 . THR A 1 78 ? -0.481  -2.265  3.939   1.00 0.00 ? 78 THR A HG23 5  
ATOM 6953  N N    . LEU A 1 79 ? 1.748   1.479   4.706   1.00 0.00 ? 79 LEU A N    5  
ATOM 6954  C CA   . LEU A 1 79 ? 2.977   1.617   5.469   1.00 0.00 ? 79 LEU A CA   5  
ATOM 6955  C C    . LEU A 1 79 ? 2.649   2.161   6.861   1.00 0.00 ? 79 LEU A C    5  
ATOM 6956  O O    . LEU A 1 79 ? 2.877   1.487   7.865   1.00 0.00 ? 79 LEU A O    5  
ATOM 6957  C CB   . LEU A 1 79 ? 3.993   2.464   4.701   1.00 0.00 ? 79 LEU A CB   5  
ATOM 6958  C CG   . LEU A 1 79 ? 4.851   1.718   3.678   1.00 0.00 ? 79 LEU A CG   5  
ATOM 6959  C CD1  . LEU A 1 79 ? 5.754   2.686   2.909   1.00 0.00 ? 79 LEU A CD1  5  
ATOM 6960  C CD2  . LEU A 1 79 ? 5.650   0.597   4.346   1.00 0.00 ? 79 LEU A CD2  5  
ATOM 6961  H H    . LEU A 1 79 ? 1.670   2.088   3.917   1.00 0.00 ? 79 LEU A H    5  
ATOM 6962  H HA   . LEU A 1 79 ? 3.406   0.621   5.580   1.00 0.00 ? 79 LEU A HA   5  
ATOM 6963  H HB2  . LEU A 1 79 ? 3.455   3.259   4.184   1.00 0.00 ? 79 LEU A HB2  5  
ATOM 6964  H HB3  . LEU A 1 79 ? 4.655   2.943   5.421   1.00 0.00 ? 79 LEU A HB3  5  
ATOM 6965  H HG   . LEU A 1 79 ? 4.187   1.251   2.950   1.00 0.00 ? 79 LEU A HG   5  
ATOM 6966  H HD11 . LEU A 1 79 ? 6.676   2.177   2.629   1.00 0.00 ? 79 LEU A HD11 5  
ATOM 6967  H HD12 . LEU A 1 79 ? 5.239   3.026   2.011   1.00 0.00 ? 79 LEU A HD12 5  
ATOM 6968  H HD13 . LEU A 1 79 ? 5.988   3.542   3.541   1.00 0.00 ? 79 LEU A HD13 5  
ATOM 6969  H HD21 . LEU A 1 79 ? 6.398   0.219   3.649   1.00 0.00 ? 79 LEU A HD21 5  
ATOM 6970  H HD22 . LEU A 1 79 ? 6.146   0.985   5.236   1.00 0.00 ? 79 LEU A HD22 5  
ATOM 6971  H HD23 . LEU A 1 79 ? 4.976   -0.211  4.629   1.00 0.00 ? 79 LEU A HD23 5  
ATOM 6972  N N    . GLU A 1 80 ? 2.121   3.376   6.877   1.00 0.00 ? 80 GLU A N    5  
ATOM 6973  C CA   . GLU A 1 80 ? 1.760   4.018   8.130   1.00 0.00 ? 80 GLU A CA   5  
ATOM 6974  C C    . GLU A 1 80 ? 1.030   3.030   9.042   1.00 0.00 ? 80 GLU A C    5  
ATOM 6975  O O    . GLU A 1 80 ? 1.356   2.912   10.222  1.00 0.00 ? 80 GLU A O    5  
ATOM 6976  C CB   . GLU A 1 80 ? 0.910   5.266   7.881   1.00 0.00 ? 80 GLU A CB   5  
ATOM 6977  C CG   . GLU A 1 80 ? 1.728   6.358   7.190   1.00 0.00 ? 80 GLU A CG   5  
ATOM 6978  C CD   . GLU A 1 80 ? 1.580   7.697   7.917   1.00 0.00 ? 80 GLU A CD   5  
ATOM 6979  O OE1  . GLU A 1 80 ? 0.435   8.004   8.312   1.00 0.00 ? 80 GLU A OE1  5  
ATOM 6980  O OE2  . GLU A 1 80 ? 2.615   8.382   8.060   1.00 0.00 ? 80 GLU A OE2  5  
ATOM 6981  H H    . GLU A 1 80 ? 1.939   3.917   6.057   1.00 0.00 ? 80 GLU A H    5  
ATOM 6982  H HA   . GLU A 1 80 ? 2.704   4.315   8.586   1.00 0.00 ? 80 GLU A HA   5  
ATOM 6983  H HB2  . GLU A 1 80 ? 0.049   5.007   7.264   1.00 0.00 ? 80 GLU A HB2  5  
ATOM 6984  H HB3  . GLU A 1 80 ? 0.522   5.641   8.828   1.00 0.00 ? 80 GLU A HB3  5  
ATOM 6985  H HG2  . GLU A 1 80 ? 2.779   6.069   7.164   1.00 0.00 ? 80 GLU A HG2  5  
ATOM 6986  H HG3  . GLU A 1 80 ? 1.401   6.464   6.156   1.00 0.00 ? 80 GLU A HG3  5  
ATOM 6987  N N    . ILE A 1 81 ? 0.056   2.346   8.461   1.00 0.00 ? 81 ILE A N    5  
ATOM 6988  C CA   . ILE A 1 81 ? -0.723  1.372   9.207   1.00 0.00 ? 81 ILE A CA   5  
ATOM 6989  C C    . ILE A 1 81 ? 0.223   0.461   9.990   1.00 0.00 ? 81 ILE A C    5  
ATOM 6990  O O    . ILE A 1 81 ? 0.081   0.306   11.202  1.00 0.00 ? 81 ILE A O    5  
ATOM 6991  C CB   . ILE A 1 81 ? -1.672  0.617   8.274   1.00 0.00 ? 81 ILE A CB   5  
ATOM 6992  C CG1  . ILE A 1 81 ? -2.829  1.513   7.827   1.00 0.00 ? 81 ILE A CG1  5  
ATOM 6993  C CG2  . ILE A 1 81 ? -2.167  -0.676  8.925   1.00 0.00 ? 81 ILE A CG2  5  
ATOM 6994  C CD1  . ILE A 1 81 ? -3.791  0.751   6.913   1.00 0.00 ? 81 ILE A CD1  5  
ATOM 6995  H H    . ILE A 1 81 ? -0.204  2.448   7.501   1.00 0.00 ? 81 ILE A H    5  
ATOM 6996  H HA   . ILE A 1 81 ? -1.340  1.923   9.918   1.00 0.00 ? 81 ILE A HA   5  
ATOM 6997  H HB   . ILE A 1 81 ? -1.119  0.336   7.379   1.00 0.00 ? 81 ILE A HB   5  
ATOM 6998  H HG12 . ILE A 1 81 ? -3.367  1.881   8.701   1.00 0.00 ? 81 ILE A HG12 5  
ATOM 6999  H HG13 . ILE A 1 81 ? -2.438  2.385   7.303   1.00 0.00 ? 81 ILE A HG13 5  
ATOM 7000  H HG21 . ILE A 1 81 ? -1.712  -1.531  8.426   1.00 0.00 ? 81 ILE A HG21 5  
ATOM 7001  H HG22 . ILE A 1 81 ? -1.890  -0.681  9.979   1.00 0.00 ? 81 ILE A HG22 5  
ATOM 7002  H HG23 . ILE A 1 81 ? -3.251  -0.737  8.834   1.00 0.00 ? 81 ILE A HG23 5  
ATOM 7003  H HD11 . ILE A 1 81 ? -4.809  0.858   7.286   1.00 0.00 ? 81 ILE A HD11 5  
ATOM 7004  H HD12 . ILE A 1 81 ? -3.730  1.157   5.903   1.00 0.00 ? 81 ILE A HD12 5  
ATOM 7005  H HD13 . ILE A 1 81 ? -3.518  -0.304  6.898   1.00 0.00 ? 81 ILE A HD13 5  
ATOM 7006  N N    . LEU A 1 82 ? 1.169   -0.119  9.266   1.00 0.00 ? 82 LEU A N    5  
ATOM 7007  C CA   . LEU A 1 82 ? 2.139   -1.011  9.878   1.00 0.00 ? 82 LEU A CA   5  
ATOM 7008  C C    . LEU A 1 82 ? 3.152   -0.187  10.676  1.00 0.00 ? 82 LEU A C    5  
ATOM 7009  O O    . LEU A 1 82 ? 3.203   -0.278  11.902  1.00 0.00 ? 82 LEU A O    5  
ATOM 7010  C CB   . LEU A 1 82 ? 2.779   -1.914  8.821   1.00 0.00 ? 82 LEU A CB   5  
ATOM 7011  C CG   . LEU A 1 82 ? 1.812   -2.616  7.865   1.00 0.00 ? 82 LEU A CG   5  
ATOM 7012  C CD1  . LEU A 1 82 ? 2.403   -2.706  6.456   1.00 0.00 ? 82 LEU A CD1  5  
ATOM 7013  C CD2  . LEU A 1 82 ? 1.406   -3.988  8.405   1.00 0.00 ? 82 LEU A CD2  5  
ATOM 7014  H H    . LEU A 1 82 ? 1.279   0.012   8.281   1.00 0.00 ? 82 LEU A H    5  
ATOM 7015  H HA   . LEU A 1 82 ? 1.598   -1.657  10.569  1.00 0.00 ? 82 LEU A HA   5  
ATOM 7016  H HB2  . LEU A 1 82 ? 3.471   -1.314  8.230   1.00 0.00 ? 82 LEU A HB2  5  
ATOM 7017  H HB3  . LEU A 1 82 ? 3.370   -2.674  9.331   1.00 0.00 ? 82 LEU A HB3  5  
ATOM 7018  H HG   . LEU A 1 82 ? 0.904   -2.016  7.795   1.00 0.00 ? 82 LEU A HG   5  
ATOM 7019  H HD11 . LEU A 1 82 ? 3.315   -2.112  6.406   1.00 0.00 ? 82 LEU A HD11 5  
ATOM 7020  H HD12 . LEU A 1 82 ? 2.633   -3.746  6.225   1.00 0.00 ? 82 LEU A HD12 5  
ATOM 7021  H HD13 . LEU A 1 82 ? 1.681   -2.324  5.734   1.00 0.00 ? 82 LEU A HD13 5  
ATOM 7022  H HD21 . LEU A 1 82 ? 1.907   -4.166  9.357   1.00 0.00 ? 82 LEU A HD21 5  
ATOM 7023  H HD22 . LEU A 1 82 ? 0.327   -4.016  8.552   1.00 0.00 ? 82 LEU A HD22 5  
ATOM 7024  H HD23 . LEU A 1 82 ? 1.697   -4.760  7.692   1.00 0.00 ? 82 LEU A HD23 5  
ATOM 7025  N N    . ILE A 1 83 ? 3.931   0.600   9.949   1.00 0.00 ? 83 ILE A N    5  
ATOM 7026  C CA   . ILE A 1 83 ? 4.939   1.440   10.574  1.00 0.00 ? 83 ILE A CA   5  
ATOM 7027  C C    . ILE A 1 83 ? 4.269   2.687   11.153  1.00 0.00 ? 83 ILE A C    5  
ATOM 7028  O O    . ILE A 1 83 ? 3.742   3.515   10.411  1.00 0.00 ? 83 ILE A O    5  
ATOM 7029  C CB   . ILE A 1 83 ? 6.065   1.750   9.586   1.00 0.00 ? 83 ILE A CB   5  
ATOM 7030  C CG1  . ILE A 1 83 ? 6.268   0.593   8.605   1.00 0.00 ? 83 ILE A CG1  5  
ATOM 7031  C CG2  . ILE A 1 83 ? 7.357   2.108   10.323  1.00 0.00 ? 83 ILE A CG2  5  
ATOM 7032  C CD1  . ILE A 1 83 ? 7.642   0.674   7.938   1.00 0.00 ? 83 ILE A CD1  5  
ATOM 7033  H H    . ILE A 1 83 ? 3.882   0.669   8.952   1.00 0.00 ? 83 ILE A H    5  
ATOM 7034  H HA   . ILE A 1 83 ? 5.376   0.870   11.394  1.00 0.00 ? 83 ILE A HA   5  
ATOM 7035  H HB   . ILE A 1 83 ? 5.776   2.622   9.001   1.00 0.00 ? 83 ILE A HB   5  
ATOM 7036  H HG12 . ILE A 1 83 ? 6.170   -0.356  9.131   1.00 0.00 ? 83 ILE A HG12 5  
ATOM 7037  H HG13 . ILE A 1 83 ? 5.488   0.618   7.843   1.00 0.00 ? 83 ILE A HG13 5  
ATOM 7038  H HG21 . ILE A 1 83 ? 8.073   1.292   10.221  1.00 0.00 ? 83 ILE A HG21 5  
ATOM 7039  H HG22 . ILE A 1 83 ? 7.779   3.018   9.895   1.00 0.00 ? 83 ILE A HG22 5  
ATOM 7040  H HG23 . ILE A 1 83 ? 7.140   2.271   11.379  1.00 0.00 ? 83 ILE A HG23 5  
ATOM 7041  H HD11 . ILE A 1 83 ? 7.600   0.195   6.960   1.00 0.00 ? 83 ILE A HD11 5  
ATOM 7042  H HD12 . ILE A 1 83 ? 7.927   1.720   7.819   1.00 0.00 ? 83 ILE A HD12 5  
ATOM 7043  H HD13 . ILE A 1 83 ? 8.379   0.166   8.560   1.00 0.00 ? 83 ILE A HD13 5  
ATOM 7044  N N    . PRO A 1 84 ? 4.312   2.786   12.509  1.00 0.00 ? 84 PRO A N    5  
ATOM 7045  C CA   . PRO A 1 84 ? 3.716   3.918   13.197  1.00 0.00 ? 84 PRO A CA   5  
ATOM 7046  C C    . PRO A 1 84 ? 4.581   5.170   13.044  1.00 0.00 ? 84 PRO A C    5  
ATOM 7047  O O    . PRO A 1 84 ? 4.061   6.280   12.936  1.00 0.00 ? 84 PRO A O    5  
ATOM 7048  C CB   . PRO A 1 84 ? 3.571   3.469   14.642  1.00 0.00 ? 84 PRO A CB   5  
ATOM 7049  C CG   . PRO A 1 84 ? 4.511   2.286   14.807  1.00 0.00 ? 84 PRO A CG   5  
ATOM 7050  C CD   . PRO A 1 84 ? 4.928   1.825   13.420  1.00 0.00 ? 84 PRO A CD   5  
ATOM 7051  H HA   . PRO A 1 84 ? 2.831   4.145   12.789  1.00 0.00 ? 84 PRO A HA   5  
ATOM 7052  H HB2  . PRO A 1 84 ? 3.831   4.274   15.329  1.00 0.00 ? 84 PRO A HB2  5  
ATOM 7053  H HB3  . PRO A 1 84 ? 2.542   3.184   14.861  1.00 0.00 ? 84 PRO A HB3  5  
ATOM 7054  H HG2  . PRO A 1 84 ? 5.384   2.572   15.393  1.00 0.00 ? 84 PRO A HG2  5  
ATOM 7055  H HG3  . PRO A 1 84 ? 4.016   1.478   15.345  1.00 0.00 ? 84 PRO A HG3  5  
ATOM 7056  H HD2  . PRO A 1 84 ? 6.013   1.818   13.314  1.00 0.00 ? 84 PRO A HD2  5  
ATOM 7057  H HD3  . PRO A 1 84 ? 4.582   0.811   13.219  1.00 0.00 ? 84 PRO A HD3  5  
ATOM 7058  N N    . ASP A 1 85 ? 5.888   4.951   13.039  1.00 0.00 ? 85 ASP A N    5  
ATOM 7059  C CA   . ASP A 1 85 ? 6.831   6.048   12.901  1.00 0.00 ? 85 ASP A CA   5  
ATOM 7060  C C    . ASP A 1 85 ? 7.746   5.780   11.705  1.00 0.00 ? 85 ASP A C    5  
ATOM 7061  O O    . ASP A 1 85 ? 8.890   5.361   11.876  1.00 0.00 ? 85 ASP A O    5  
ATOM 7062  C CB   . ASP A 1 85 ? 7.708   6.180   14.147  1.00 0.00 ? 85 ASP A CB   5  
ATOM 7063  C CG   . ASP A 1 85 ? 8.593   7.428   14.186  1.00 0.00 ? 85 ASP A CG   5  
ATOM 7064  O OD1  . ASP A 1 85 ? 8.018   8.527   14.338  1.00 0.00 ? 85 ASP A OD1  5  
ATOM 7065  O OD2  . ASP A 1 85 ? 9.824   7.254   14.061  1.00 0.00 ? 85 ASP A OD2  5  
ATOM 7066  H H    . ASP A 1 85 ? 6.303   4.045   13.127  1.00 0.00 ? 85 ASP A H    5  
ATOM 7067  H HA   . ASP A 1 85 ? 6.216   6.938   12.765  1.00 0.00 ? 85 ASP A HA   5  
ATOM 7068  H HB2  . ASP A 1 85 ? 7.064   6.183   15.027  1.00 0.00 ? 85 ASP A HB2  5  
ATOM 7069  H HB3  . ASP A 1 85 ? 8.345   5.299   14.221  1.00 0.00 ? 85 ASP A HB3  5  
ATOM 7070  N N    . PHE A 1 86 ? 7.209   6.032   10.520  1.00 0.00 ? 86 PHE A N    5  
ATOM 7071  C CA   . PHE A 1 86 ? 7.964   5.823   9.296   1.00 0.00 ? 86 PHE A CA   5  
ATOM 7072  C C    . PHE A 1 86 ? 8.589   7.132   8.808   1.00 0.00 ? 86 PHE A C    5  
ATOM 7073  O O    . PHE A 1 86 ? 9.765   7.166   8.450   1.00 0.00 ? 86 PHE A O    5  
ATOM 7074  C CB   . PHE A 1 86 ? 6.976   5.319   8.242   1.00 0.00 ? 86 PHE A CB   5  
ATOM 7075  C CG   . PHE A 1 86 ? 7.636   4.858   6.941   1.00 0.00 ? 86 PHE A CG   5  
ATOM 7076  C CD1  . PHE A 1 86 ? 8.712   4.028   6.982   1.00 0.00 ? 86 PHE A CD1  5  
ATOM 7077  C CD2  . PHE A 1 86 ? 7.146   5.279   5.744   1.00 0.00 ? 86 PHE A CD2  5  
ATOM 7078  C CE1  . PHE A 1 86 ? 9.325   3.601   5.774   1.00 0.00 ? 86 PHE A CE1  5  
ATOM 7079  C CE2  . PHE A 1 86 ? 7.758   4.851   4.537   1.00 0.00 ? 86 PHE A CE2  5  
ATOM 7080  C CZ   . PHE A 1 86 ? 8.835   4.021   4.577   1.00 0.00 ? 86 PHE A CZ   5  
ATOM 7081  H H    . PHE A 1 86 ? 6.278   6.372   10.390  1.00 0.00 ? 86 PHE A H    5  
ATOM 7082  H HA   . PHE A 1 86 ? 8.754   5.107   9.522   1.00 0.00 ? 86 PHE A HA   5  
ATOM 7083  H HB2  . PHE A 1 86 ? 6.405   4.491   8.661   1.00 0.00 ? 86 PHE A HB2  5  
ATOM 7084  H HB3  . PHE A 1 86 ? 6.265   6.114   8.016   1.00 0.00 ? 86 PHE A HB3  5  
ATOM 7085  H HD1  . PHE A 1 86 ? 9.105   3.691   7.941   1.00 0.00 ? 86 PHE A HD1  5  
ATOM 7086  H HD2  . PHE A 1 86 ? 6.283   5.944   5.712   1.00 0.00 ? 86 PHE A HD2  5  
ATOM 7087  H HE1  . PHE A 1 86 ? 10.188  2.935   5.806   1.00 0.00 ? 86 PHE A HE1  5  
ATOM 7088  H HE2  . PHE A 1 86 ? 7.366   5.188   3.577   1.00 0.00 ? 86 PHE A HE2  5  
ATOM 7089  H HZ   . PHE A 1 86 ? 9.305   3.693   3.650   1.00 0.00 ? 86 PHE A HZ   5  
ATOM 7090  N N    . VAL A 1 87 ? 7.773   8.176   8.808   1.00 0.00 ? 87 VAL A N    5  
ATOM 7091  C CA   . VAL A 1 87 ? 8.232   9.483   8.369   1.00 0.00 ? 87 VAL A CA   5  
ATOM 7092  C C    . VAL A 1 87 ? 8.491   10.365  9.592   1.00 0.00 ? 87 VAL A C    5  
ATOM 7093  O O    . VAL A 1 87 ? 7.931   10.129  10.662  1.00 0.00 ? 87 VAL A O    5  
ATOM 7094  C CB   . VAL A 1 87 ? 7.220   10.093  7.396   1.00 0.00 ? 87 VAL A CB   5  
ATOM 7095  C CG1  . VAL A 1 87 ? 7.613   11.524  7.022   1.00 0.00 ? 87 VAL A CG1  5  
ATOM 7096  C CG2  . VAL A 1 87 ? 7.067   9.222   6.148   1.00 0.00 ? 87 VAL A CG2  5  
ATOM 7097  H H    . VAL A 1 87 ? 6.818   8.140   9.100   1.00 0.00 ? 87 VAL A H    5  
ATOM 7098  H HA   . VAL A 1 87 ? 9.170   9.340   7.834   1.00 0.00 ? 87 VAL A HA   5  
ATOM 7099  H HB   . VAL A 1 87 ? 6.254   10.132  7.898   1.00 0.00 ? 87 VAL A HB   5  
ATOM 7100  H HG11 . VAL A 1 87 ? 6.868   11.939  6.343   1.00 0.00 ? 87 VAL A HG11 5  
ATOM 7101  H HG12 . VAL A 1 87 ? 7.664   12.134  7.923   1.00 0.00 ? 87 VAL A HG12 5  
ATOM 7102  H HG13 . VAL A 1 87 ? 8.587   11.516  6.532   1.00 0.00 ? 87 VAL A HG13 5  
ATOM 7103  H HG21 . VAL A 1 87 ? 6.079   8.761   6.146   1.00 0.00 ? 87 VAL A HG21 5  
ATOM 7104  H HG22 . VAL A 1 87 ? 7.182   9.840   5.257   1.00 0.00 ? 87 VAL A HG22 5  
ATOM 7105  H HG23 . VAL A 1 87 ? 7.830   8.444   6.151   1.00 0.00 ? 87 VAL A HG23 5  
ATOM 7106  N N    . LYS A 1 88 ? 9.339   11.363  9.394   1.00 0.00 ? 88 LYS A N    5  
ATOM 7107  C CA   . LYS A 1 88 ? 9.679   12.281  10.467  1.00 0.00 ? 88 LYS A CA   5  
ATOM 7108  C C    . LYS A 1 88 ? 8.456   13.134  10.810  1.00 0.00 ? 88 LYS A C    5  
ATOM 7109  O O    . LYS A 1 88 ? 7.968   13.101  11.938  1.00 0.00 ? 88 LYS A O    5  
ATOM 7110  C CB   . LYS A 1 88 ? 10.917  13.102  10.098  1.00 0.00 ? 88 LYS A CB   5  
ATOM 7111  C CG   . LYS A 1 88 ? 11.895  13.176  11.272  1.00 0.00 ? 88 LYS A CG   5  
ATOM 7112  C CD   . LYS A 1 88 ? 12.638  14.514  11.284  1.00 0.00 ? 88 LYS A CD   5  
ATOM 7113  C CE   . LYS A 1 88 ? 12.167  15.393  12.444  1.00 0.00 ? 88 LYS A CE   5  
ATOM 7114  N NZ   . LYS A 1 88 ? 13.283  15.663  13.377  1.00 0.00 ? 88 LYS A NZ   5  
ATOM 7115  H H    . LYS A 1 88 ? 9.790   11.548  8.520   1.00 0.00 ? 88 LYS A H    5  
ATOM 7116  H HA   . LYS A 1 88 ? 9.938   11.682  11.340  1.00 0.00 ? 88 LYS A HA   5  
ATOM 7117  H HB2  . LYS A 1 88 ? 11.412  12.654  9.236   1.00 0.00 ? 88 LYS A HB2  5  
ATOM 7118  H HB3  . LYS A 1 88 ? 10.617  14.108  9.806   1.00 0.00 ? 88 LYS A HB3  5  
ATOM 7119  H HG2  . LYS A 1 88 ? 11.354  13.049  12.210  1.00 0.00 ? 88 LYS A HG2  5  
ATOM 7120  H HG3  . LYS A 1 88 ? 12.613  12.358  11.205  1.00 0.00 ? 88 LYS A HG3  5  
ATOM 7121  H HD2  . LYS A 1 88 ? 13.710  14.338  11.368  1.00 0.00 ? 88 LYS A HD2  5  
ATOM 7122  H HD3  . LYS A 1 88 ? 12.474  15.033  10.339  1.00 0.00 ? 88 LYS A HD3  5  
ATOM 7123  H HE2  . LYS A 1 88 ? 11.772  16.333  12.058  1.00 0.00 ? 88 LYS A HE2  5  
ATOM 7124  H HE3  . LYS A 1 88 ? 11.353  14.899  12.974  1.00 0.00 ? 88 LYS A HE3  5  
ATOM 7125  H HZ1  . LYS A 1 88 ? 13.510  14.826  13.876  1.00 0.00 ? 88 LYS A HZ1  5  
ATOM 7126  H HZ2  . LYS A 1 88 ? 14.083  15.970  12.860  1.00 0.00 ? 88 LYS A HZ2  5  
ATOM 7127  H HZ3  . LYS A 1 88 ? 13.012  16.374  14.025  1.00 0.00 ? 88 LYS A HZ3  5  
ATOM 7128  N N    . GLN A 1 89 ? 7.996   13.878  9.815   1.00 0.00 ? 89 GLN A N    5  
ATOM 7129  C CA   . GLN A 1 89 ? 6.839   14.738  9.997   1.00 0.00 ? 89 GLN A CA   5  
ATOM 7130  C C    . GLN A 1 89 ? 5.557   13.989  9.628   1.00 0.00 ? 89 GLN A C    5  
ATOM 7131  O O    . GLN A 1 89 ? 4.957   14.254  8.587   1.00 0.00 ? 89 GLN A O    5  
ATOM 7132  C CB   . GLN A 1 89 ? 6.977   16.024  9.179   1.00 0.00 ? 89 GLN A CB   5  
ATOM 7133  C CG   . GLN A 1 89 ? 7.042   17.250  10.091  1.00 0.00 ? 89 GLN A CG   5  
ATOM 7134  C CD   . GLN A 1 89 ? 5.714   18.010  10.083  1.00 0.00 ? 89 GLN A CD   5  
ATOM 7135  O OE1  . GLN A 1 89 ? 4.640   17.437  10.167  1.00 0.00 ? 89 GLN A OE1  5  
ATOM 7136  N NE2  . GLN A 1 89 ? 5.847   19.330  9.977   1.00 0.00 ? 89 GLN A NE2  5  
ATOM 7137  H H    . GLN A 1 89 ? 8.399   13.900  8.900   1.00 0.00 ? 89 GLN A H    5  
ATOM 7138  H HA   . GLN A 1 89 ? 6.828   14.989  11.057  1.00 0.00 ? 89 GLN A HA   5  
ATOM 7139  H HB2  . GLN A 1 89 ? 7.877   15.974  8.566   1.00 0.00 ? 89 GLN A HB2  5  
ATOM 7140  H HB3  . GLN A 1 89 ? 6.132   16.118  8.497   1.00 0.00 ? 89 GLN A HB3  5  
ATOM 7141  H HG2  . GLN A 1 89 ? 7.281   16.939  11.108  1.00 0.00 ? 89 GLN A HG2  5  
ATOM 7142  H HG3  . GLN A 1 89 ? 7.845   17.910  9.763   1.00 0.00 ? 89 GLN A HG3  5  
ATOM 7143  H HE21 . GLN A 1 89 ? 6.758   19.737  9.912   1.00 0.00 ? 89 GLN A HE21 5  
ATOM 7144  H HE22 . GLN A 1 89 ? 5.035   19.914  9.963   1.00 0.00 ? 89 GLN A HE22 5  
ATOM 7145  N N    . THR A 1 90 ? 5.176   13.068  10.501  1.00 0.00 ? 90 THR A N    5  
ATOM 7146  C CA   . THR A 1 90 ? 3.976   12.279  10.280  1.00 0.00 ? 90 THR A CA   5  
ATOM 7147  C C    . THR A 1 90 ? 2.727   13.130  10.513  1.00 0.00 ? 90 THR A C    5  
ATOM 7148  O O    . THR A 1 90 ? 2.744   14.057  11.322  1.00 0.00 ? 90 THR A O    5  
ATOM 7149  C CB   . THR A 1 90 ? 4.049   11.046  11.183  1.00 0.00 ? 90 THR A CB   5  
ATOM 7150  O OG1  . THR A 1 90 ? 4.719   10.072  10.388  1.00 0.00 ? 90 THR A OG1  5  
ATOM 7151  C CG2  . THR A 1 90 ? 2.672   10.430  11.445  1.00 0.00 ? 90 THR A CG2  5  
ATOM 7152  H H    . THR A 1 90 ? 5.670   12.859  11.345  1.00 0.00 ? 90 THR A H    5  
ATOM 7153  H HA   . THR A 1 90 ? 3.959   11.965  9.236   1.00 0.00 ? 90 THR A HA   5  
ATOM 7154  H HB   . THR A 1 90 ? 4.556   11.278  12.119  1.00 0.00 ? 90 THR A HB   5  
ATOM 7155  H HG1  . THR A 1 90 ? 5.275   9.479   10.970  1.00 0.00 ? 90 THR A HG1  5  
ATOM 7156  H HG21 . THR A 1 90 ? 2.005   10.667  10.617  1.00 0.00 ? 90 THR A HG21 5  
ATOM 7157  H HG22 . THR A 1 90 ? 2.770   9.348   11.535  1.00 0.00 ? 90 THR A HG22 5  
ATOM 7158  H HG23 . THR A 1 90 ? 2.263   10.836  12.370  1.00 0.00 ? 90 THR A HG23 5  
ATOM 7159  N N    . SER A 1 91 ? 1.671   12.786  9.790   1.00 0.00 ? 91 SER A N    5  
ATOM 7160  C CA   . SER A 1 91 ? 0.415   13.507  9.908   1.00 0.00 ? 91 SER A CA   5  
ATOM 7161  C C    . SER A 1 91 ? -0.742  12.624  9.437   1.00 0.00 ? 91 SER A C    5  
ATOM 7162  O O    . SER A 1 91 ? -0.575  11.807  8.532   1.00 0.00 ? 91 SER A O    5  
ATOM 7163  C CB   . SER A 1 91 ? 0.450   14.809  9.105   1.00 0.00 ? 91 SER A CB   5  
ATOM 7164  O OG   . SER A 1 91 ? -0.784  15.517  9.181   1.00 0.00 ? 91 SER A OG   5  
ATOM 7165  H H    . SER A 1 91 ? 1.665   12.031  9.134   1.00 0.00 ? 91 SER A H    5  
ATOM 7166  H HA   . SER A 1 91 ? 0.314   13.738  10.968  1.00 0.00 ? 91 SER A HA   5  
ATOM 7167  H HB2  . SER A 1 91 ? 1.255   15.443  9.477   1.00 0.00 ? 91 SER A HB2  5  
ATOM 7168  H HB3  . SER A 1 91 ? 0.676   14.586  8.062   1.00 0.00 ? 91 SER A HB3  5  
ATOM 7169  H HG   . SER A 1 91 ? -1.156  15.655  8.263   1.00 0.00 ? 91 SER A HG   5  
ATOM 7170  N N    . GLU A 1 92 ? -1.888  12.818  10.071  1.00 0.00 ? 92 GLU A N    5  
ATOM 7171  C CA   . GLU A 1 92 ? -3.073  12.049  9.728   1.00 0.00 ? 92 GLU A CA   5  
ATOM 7172  C C    . GLU A 1 92 ? -4.308  12.646  10.406  1.00 0.00 ? 92 GLU A C    5  
ATOM 7173  O O    . GLU A 1 92 ? -4.192  13.341  11.415  1.00 0.00 ? 92 GLU A O    5  
ATOM 7174  C CB   . GLU A 1 92 ? -2.899  10.576  10.105  1.00 0.00 ? 92 GLU A CB   5  
ATOM 7175  C CG   . GLU A 1 92 ? -2.802  10.406  11.623  1.00 0.00 ? 92 GLU A CG   5  
ATOM 7176  C CD   . GLU A 1 92 ? -2.334  8.996   11.988  1.00 0.00 ? 92 GLU A CD   5  
ATOM 7177  O OE1  . GLU A 1 92 ? -1.315  8.568   11.404  1.00 0.00 ? 92 GLU A OE1  5  
ATOM 7178  O OE2  . GLU A 1 92 ? -3.005  8.379   12.843  1.00 0.00 ? 92 GLU A OE2  5  
ATOM 7179  H H    . GLU A 1 92 ? -2.015  13.484  10.806  1.00 0.00 ? 92 GLU A H    5  
ATOM 7180  H HA   . GLU A 1 92 ? -3.168  12.131  8.646   1.00 0.00 ? 92 GLU A HA   5  
ATOM 7181  H HB2  . GLU A 1 92 ? -3.740  9.998   9.724   1.00 0.00 ? 92 GLU A HB2  5  
ATOM 7182  H HB3  . GLU A 1 92 ? -1.999  10.180  9.634   1.00 0.00 ? 92 GLU A HB3  5  
ATOM 7183  H HG2  . GLU A 1 92 ? -2.108  11.141  12.031  1.00 0.00 ? 92 GLU A HG2  5  
ATOM 7184  H HG3  . GLU A 1 92 ? -3.774  10.599  12.076  1.00 0.00 ? 92 GLU A HG3  5  
ATOM 7185  N N    . SER A 1 93 ? -5.462  12.353  9.825   1.00 0.00 ? 93 SER A N    5  
ATOM 7186  C CA   . SER A 1 93 ? -6.717  12.852  10.360  1.00 0.00 ? 93 SER A CA   5  
ATOM 7187  C C    . SER A 1 93 ? -7.291  11.854  11.367  1.00 0.00 ? 93 SER A C    5  
ATOM 7188  O O    . SER A 1 93 ? -7.524  12.198  12.525  1.00 0.00 ? 93 SER A O    5  
ATOM 7189  C CB   . SER A 1 93 ? -7.727  13.117  9.241   1.00 0.00 ? 93 SER A CB   5  
ATOM 7190  O OG   . SER A 1 93 ? -7.834  12.013  8.347   1.00 0.00 ? 93 SER A OG   5  
ATOM 7191  H H    . SER A 1 93 ? -5.547  11.787  9.005   1.00 0.00 ? 93 SER A H    5  
ATOM 7192  H HA   . SER A 1 93 ? -6.467  13.792  10.853  1.00 0.00 ? 93 SER A HA   5  
ATOM 7193  H HB2  . SER A 1 93 ? -8.704  13.327  9.677   1.00 0.00 ? 93 SER A HB2  5  
ATOM 7194  H HB3  . SER A 1 93 ? -7.427  14.006  8.686   1.00 0.00 ? 93 SER A HB3  5  
ATOM 7195  H HG   . SER A 1 93 ? -8.793  11.856  8.111   1.00 0.00 ? 93 SER A HG   5  
ATOM 7196  N N    . GLY A 1 94 ? -7.501  10.636  10.890  1.00 0.00 ? 94 GLY A N    5  
ATOM 7197  C CA   . GLY A 1 94 ? -8.043  9.585   11.734  1.00 0.00 ? 94 GLY A CA   5  
ATOM 7198  C C    . GLY A 1 94 ? -8.257  8.296   10.937  1.00 0.00 ? 94 GLY A C    5  
ATOM 7199  O O    . GLY A 1 94 ? -8.387  8.333   9.714   1.00 0.00 ? 94 GLY A O    5  
ATOM 7200  H H    . GLY A 1 94 ? -7.309  10.363  9.947   1.00 0.00 ? 94 GLY A H    5  
ATOM 7201  H HA2  . GLY A 1 94 ? -7.364  9.394   12.565  1.00 0.00 ? 94 GLY A HA2  5  
ATOM 7202  H HA3  . GLY A 1 94 ? -8.990  9.911   12.165  1.00 0.00 ? 94 GLY A HA3  5  
ATOM 7203  N N    . PRO A 1 95 ? -8.286  7.158   11.681  1.00 0.00 ? 95 PRO A N    5  
ATOM 7204  C CA   . PRO A 1 95 ? -8.482  5.861   11.056  1.00 0.00 ? 95 PRO A CA   5  
ATOM 7205  C C    . PRO A 1 95 ? -9.941  5.667   10.639  1.00 0.00 ? 95 PRO A C    5  
ATOM 7206  O O    . PRO A 1 95 ? -10.790 6.509   10.928  1.00 0.00 ? 95 PRO A O    5  
ATOM 7207  C CB   . PRO A 1 95 ? -8.022  4.851   12.095  1.00 0.00 ? 95 PRO A CB   5  
ATOM 7208  C CG   . PRO A 1 95 ? -8.025  5.589   13.424  1.00 0.00 ? 95 PRO A CG   5  
ATOM 7209  C CD   . PRO A 1 95 ? -8.135  7.077   13.131  1.00 0.00 ? 95 PRO A CD   5  
ATOM 7210  H HA   . PRO A 1 95 ? -7.946  5.797   10.214  1.00 0.00 ? 95 PRO A HA   5  
ATOM 7211  H HB2  . PRO A 1 95 ? -8.690  3.990   12.125  1.00 0.00 ? 95 PRO A HB2  5  
ATOM 7212  H HB3  . PRO A 1 95 ? -7.027  4.474   11.860  1.00 0.00 ? 95 PRO A HB3  5  
ATOM 7213  H HG2  . PRO A 1 95 ? -8.860  5.259   14.042  1.00 0.00 ? 95 PRO A HG2  5  
ATOM 7214  H HG3  . PRO A 1 95 ? -7.113  5.377   13.981  1.00 0.00 ? 95 PRO A HG3  5  
ATOM 7215  H HD2  . PRO A 1 95 ? -8.989  7.519   13.643  1.00 0.00 ? 95 PRO A HD2  5  
ATOM 7216  H HD3  . PRO A 1 95 ? -7.248  7.613   13.467  1.00 0.00 ? 95 PRO A HD3  5  
ATOM 7217  N N    . SER A 1 96 ? -10.188 4.553   9.965   1.00 0.00 ? 96 SER A N    5  
ATOM 7218  C CA   . SER A 1 96 ? -11.529 4.239   9.505   1.00 0.00 ? 96 SER A CA   5  
ATOM 7219  C C    . SER A 1 96 ? -11.824 2.754   9.729   1.00 0.00 ? 96 SER A C    5  
ATOM 7220  O O    . SER A 1 96 ? -12.767 2.405   10.437  1.00 0.00 ? 96 SER A O    5  
ATOM 7221  C CB   . SER A 1 96 ? -11.704 4.598   8.028   1.00 0.00 ? 96 SER A CB   5  
ATOM 7222  O OG   . SER A 1 96 ? -11.792 6.006   7.829   1.00 0.00 ? 96 SER A OG   5  
ATOM 7223  H H    . SER A 1 96 ? -9.491  3.874   9.734   1.00 0.00 ? 96 SER A H    5  
ATOM 7224  H HA   . SER A 1 96 ? -12.194 4.856   10.110  1.00 0.00 ? 96 SER A HA   5  
ATOM 7225  H HB2  . SER A 1 96 ? -10.864 4.203   7.457   1.00 0.00 ? 96 SER A HB2  5  
ATOM 7226  H HB3  . SER A 1 96 ? -12.604 4.120   7.643   1.00 0.00 ? 96 SER A HB3  5  
ATOM 7227  H HG   . SER A 1 96 ? -11.074 6.471   8.347   1.00 0.00 ? 96 SER A HG   5  
ATOM 7228  N N    . SER A 1 97 ? -11.001 1.920   9.110   1.00 0.00 ? 97 SER A N    5  
ATOM 7229  C CA   . SER A 1 97 ? -11.162 0.481   9.233   1.00 0.00 ? 97 SER A CA   5  
ATOM 7230  C C    . SER A 1 97 ? -9.954  -0.121  9.953   1.00 0.00 ? 97 SER A C    5  
ATOM 7231  O O    . SER A 1 97 ? -10.103 -0.772  10.986  1.00 0.00 ? 97 SER A O    5  
ATOM 7232  C CB   . SER A 1 97 ? -11.341 -0.172  7.861   1.00 0.00 ? 97 SER A CB   5  
ATOM 7233  O OG   . SER A 1 97 ? -12.716 -0.360  7.535   1.00 0.00 ? 97 SER A OG   5  
ATOM 7234  H H    . SER A 1 97 ? -10.237 2.213   8.536   1.00 0.00 ? 97 SER A H    5  
ATOM 7235  H HA   . SER A 1 97 ? -12.068 0.341   9.822   1.00 0.00 ? 97 SER A HA   5  
ATOM 7236  H HB2  . SER A 1 97 ? -10.870 0.450   7.099   1.00 0.00 ? 97 SER A HB2  5  
ATOM 7237  H HB3  . SER A 1 97 ? -10.830 -1.134  7.848   1.00 0.00 ? 97 SER A HB3  5  
ATOM 7238  H HG   . SER A 1 97 ? -13.148 -0.959  8.209   1.00 0.00 ? 97 SER A HG   5  
ATOM 7239  N N    . GLY A 1 98 ? -8.783  0.118   9.380   1.00 0.00 ? 98 GLY A N    5  
ATOM 7240  C CA   . GLY A 1 98 ? -7.550  -0.393  9.954   1.00 0.00 ? 98 GLY A CA   5  
ATOM 7241  C C    . GLY A 1 98 ? -6.809  0.702   10.723  1.00 0.00 ? 98 GLY A C    5  
ATOM 7242  O O    . GLY A 1 98 ? -5.893  0.415   11.491  1.00 0.00 ? 98 GLY A O    5  
ATOM 7243  H H    . GLY A 1 98 ? -8.670  0.648   8.539   1.00 0.00 ? 98 GLY A H    5  
ATOM 7244  H HA2  . GLY A 1 98 ? -7.774  -1.224  10.623  1.00 0.00 ? 98 GLY A HA2  5  
ATOM 7245  H HA3  . GLY A 1 98 ? -6.911  -0.783  9.163   1.00 0.00 ? 98 GLY A HA3  5  
ATOM 7246  N N    . GLY A 1 1  ? -13.323 -6.343  1.072   1.00 0.00 ? 1  GLY A N    6  
ATOM 7247  C CA   . GLY A 1 1  ? -13.783 -6.892  -0.192  1.00 0.00 ? 1  GLY A CA   6  
ATOM 7248  C C    . GLY A 1 1  ? -12.787 -7.918  -0.739  1.00 0.00 ? 1  GLY A C    6  
ATOM 7249  O O    . GLY A 1 1  ? -11.924 -8.401  -0.008  1.00 0.00 ? 1  GLY A O    6  
ATOM 7250  H H1   . GLY A 1 1  ? -13.144 -5.360  1.065   1.00 0.00 ? 1  GLY A H1   6  
ATOM 7251  H HA2  . GLY A 1 1  ? -14.757 -7.362  -0.057  1.00 0.00 ? 1  GLY A HA2  6  
ATOM 7252  H HA3  . GLY A 1 1  ? -13.915 -6.088  -0.916  1.00 0.00 ? 1  GLY A HA3  6  
ATOM 7253  N N    . SER A 1 2  ? -12.941 -8.221  -2.019  1.00 0.00 ? 2  SER A N    6  
ATOM 7254  C CA   . SER A 1 2  ? -12.067 -9.180  -2.672  1.00 0.00 ? 2  SER A CA   6  
ATOM 7255  C C    . SER A 1 2  ? -12.424 -9.289  -4.156  1.00 0.00 ? 2  SER A C    6  
ATOM 7256  O O    . SER A 1 2  ? -13.512 -8.888  -4.567  1.00 0.00 ? 2  SER A O    6  
ATOM 7257  C CB   . SER A 1 2  ? -12.157 -10.552 -2.002  1.00 0.00 ? 2  SER A CB   6  
ATOM 7258  O OG   . SER A 1 2  ? -11.296 -11.505 -2.619  1.00 0.00 ? 2  SER A OG   6  
ATOM 7259  H H    . SER A 1 2  ? -13.646 -7.823  -2.607  1.00 0.00 ? 2  SER A H    6  
ATOM 7260  H HA   . SER A 1 2  ? -11.059 -8.782  -2.550  1.00 0.00 ? 2  SER A HA   6  
ATOM 7261  H HB2  . SER A 1 2  ? -11.898 -10.459 -0.947  1.00 0.00 ? 2  SER A HB2  6  
ATOM 7262  H HB3  . SER A 1 2  ? -13.185 -10.911 -2.047  1.00 0.00 ? 2  SER A HB3  6  
ATOM 7263  H HG   . SER A 1 2  ? -11.712 -12.414 -2.586  1.00 0.00 ? 2  SER A HG   6  
ATOM 7264  N N    . SER A 1 3  ? -11.488 -9.834  -4.919  1.00 0.00 ? 3  SER A N    6  
ATOM 7265  C CA   . SER A 1 3  ? -11.691 -10.002 -6.348  1.00 0.00 ? 3  SER A CA   6  
ATOM 7266  C C    . SER A 1 3  ? -11.286 -11.415 -6.772  1.00 0.00 ? 3  SER A C    6  
ATOM 7267  O O    . SER A 1 3  ? -10.384 -12.009 -6.183  1.00 0.00 ? 3  SER A O    6  
ATOM 7268  C CB   . SER A 1 3  ? -10.899 -8.961  -7.142  1.00 0.00 ? 3  SER A CB   6  
ATOM 7269  O OG   . SER A 1 3  ? -11.001 -9.171  -8.548  1.00 0.00 ? 3  SER A OG   6  
ATOM 7270  H H    . SER A 1 3  ? -10.606 -10.158 -4.576  1.00 0.00 ? 3  SER A H    6  
ATOM 7271  H HA   . SER A 1 3  ? -12.758 -9.845  -6.508  1.00 0.00 ? 3  SER A HA   6  
ATOM 7272  H HB2  . SER A 1 3  ? -11.263 -7.963  -6.897  1.00 0.00 ? 3  SER A HB2  6  
ATOM 7273  H HB3  . SER A 1 3  ? -9.851  -8.999  -6.845  1.00 0.00 ? 3  SER A HB3  6  
ATOM 7274  H HG   . SER A 1 3  ? -11.880 -9.594  -8.767  1.00 0.00 ? 3  SER A HG   6  
ATOM 7275  N N    . GLY A 1 4  ? -11.972 -11.912 -7.791  1.00 0.00 ? 4  GLY A N    6  
ATOM 7276  C CA   . GLY A 1 4  ? -11.695 -13.244 -8.300  1.00 0.00 ? 4  GLY A CA   6  
ATOM 7277  C C    . GLY A 1 4  ? -10.322 -13.299 -8.972  1.00 0.00 ? 4  GLY A C    6  
ATOM 7278  O O    . GLY A 1 4  ? -9.995  -12.446 -9.796  1.00 0.00 ? 4  GLY A O    6  
ATOM 7279  H H    . GLY A 1 4  ? -12.704 -11.422 -8.264  1.00 0.00 ? 4  GLY A H    6  
ATOM 7280  H HA2  . GLY A 1 4  ? -11.734 -13.965 -7.484  1.00 0.00 ? 4  GLY A HA2  6  
ATOM 7281  H HA3  . GLY A 1 4  ? -12.466 -13.531 -9.016  1.00 0.00 ? 4  GLY A HA3  6  
ATOM 7282  N N    . SER A 1 5  ? -9.554  -14.311 -8.595  1.00 0.00 ? 5  SER A N    6  
ATOM 7283  C CA   . SER A 1 5  ? -8.223  -14.489 -9.151  1.00 0.00 ? 5  SER A CA   6  
ATOM 7284  C C    . SER A 1 5  ? -7.360  -13.264 -8.842  1.00 0.00 ? 5  SER A C    6  
ATOM 7285  O O    . SER A 1 5  ? -7.869  -12.238 -8.395  1.00 0.00 ? 5  SER A O    6  
ATOM 7286  C CB   . SER A 1 5  ? -8.285  -14.729 -10.661 1.00 0.00 ? 5  SER A CB   6  
ATOM 7287  O OG   . SER A 1 5  ? -8.976  -15.932 -10.983 1.00 0.00 ? 5  SER A OG   6  
ATOM 7288  H H    . SER A 1 5  ? -9.828  -15.001 -7.925  1.00 0.00 ? 5  SER A H    6  
ATOM 7289  H HA   . SER A 1 5  ? -7.821  -15.375 -8.659  1.00 0.00 ? 5  SER A HA   6  
ATOM 7290  H HB2  . SER A 1 5  ? -8.781  -13.886 -11.142 1.00 0.00 ? 5  SER A HB2  6  
ATOM 7291  H HB3  . SER A 1 5  ? -7.272  -14.773 -11.062 1.00 0.00 ? 5  SER A HB3  6  
ATOM 7292  H HG   . SER A 1 5  ? -8.322  -16.645 -11.236 1.00 0.00 ? 5  SER A HG   6  
ATOM 7293  N N    . SER A 1 6  ? -6.067  -13.413 -9.094  1.00 0.00 ? 6  SER A N    6  
ATOM 7294  C CA   . SER A 1 6  ? -5.128  -12.332 -8.848  1.00 0.00 ? 6  SER A CA   6  
ATOM 7295  C C    . SER A 1 6  ? -4.833  -11.589 -10.153 1.00 0.00 ? 6  SER A C    6  
ATOM 7296  O O    . SER A 1 6  ? -5.202  -12.050 -11.231 1.00 0.00 ? 6  SER A O    6  
ATOM 7297  C CB   . SER A 1 6  ? -3.831  -12.859 -8.232  1.00 0.00 ? 6  SER A CB   6  
ATOM 7298  O OG   . SER A 1 6  ? -3.551  -12.250 -6.974  1.00 0.00 ? 6  SER A OG   6  
ATOM 7299  H H    . SER A 1 6  ? -5.661  -14.251 -9.457  1.00 0.00 ? 6  SER A H    6  
ATOM 7300  H HA   . SER A 1 6  ? -5.626  -11.673 -8.137  1.00 0.00 ? 6  SER A HA   6  
ATOM 7301  H HB2  . SER A 1 6  ? -3.902  -13.939 -8.104  1.00 0.00 ? 6  SER A HB2  6  
ATOM 7302  H HB3  . SER A 1 6  ? -3.003  -12.673 -8.916  1.00 0.00 ? 6  SER A HB3  6  
ATOM 7303  H HG   . SER A 1 6  ? -2.961  -12.846 -6.429  1.00 0.00 ? 6  SER A HG   6  
ATOM 7304  N N    . GLY A 1 7  ? -4.170  -10.451 -10.011 1.00 0.00 ? 7  GLY A N    6  
ATOM 7305  C CA   . GLY A 1 7  ? -3.821  -9.639  -11.165 1.00 0.00 ? 7  GLY A CA   6  
ATOM 7306  C C    . GLY A 1 7  ? -2.658  -8.699  -10.842 1.00 0.00 ? 7  GLY A C    6  
ATOM 7307  O O    . GLY A 1 7  ? -2.733  -7.915  -9.897  1.00 0.00 ? 7  GLY A O    6  
ATOM 7308  H H    . GLY A 1 7  ? -3.873  -10.082 -9.130  1.00 0.00 ? 7  GLY A H    6  
ATOM 7309  H HA2  . GLY A 1 7  ? -3.549  -10.286 -12.000 1.00 0.00 ? 7  GLY A HA2  6  
ATOM 7310  H HA3  . GLY A 1 7  ? -4.687  -9.058  -11.480 1.00 0.00 ? 7  GLY A HA3  6  
ATOM 7311  N N    . GLU A 1 8  ? -1.610  -8.807  -11.646 1.00 0.00 ? 8  GLU A N    6  
ATOM 7312  C CA   . GLU A 1 8  ? -0.434  -7.976  -11.457 1.00 0.00 ? 8  GLU A CA   6  
ATOM 7313  C C    . GLU A 1 8  ? 0.296   -7.780  -12.788 1.00 0.00 ? 8  GLU A C    6  
ATOM 7314  O O    . GLU A 1 8  ? 0.431   -8.719  -13.570 1.00 0.00 ? 8  GLU A O    6  
ATOM 7315  C CB   . GLU A 1 8  ? 0.499   -8.577  -10.404 1.00 0.00 ? 8  GLU A CB   6  
ATOM 7316  C CG   . GLU A 1 8  ? 1.396   -7.501  -9.788  1.00 0.00 ? 8  GLU A CG   6  
ATOM 7317  C CD   . GLU A 1 8  ? 1.147   -7.374  -8.284  1.00 0.00 ? 8  GLU A CD   6  
ATOM 7318  O OE1  . GLU A 1 8  ? 1.497   -8.337  -7.568  1.00 0.00 ? 8  GLU A OE1  6  
ATOM 7319  O OE2  . GLU A 1 8  ? 0.612   -6.318  -7.884  1.00 0.00 ? 8  GLU A OE2  6  
ATOM 7320  H H    . GLU A 1 8  ? -1.557  -9.447  -12.412 1.00 0.00 ? 8  GLU A H    6  
ATOM 7321  H HA   . GLU A 1 8  ? -0.810  -7.018  -11.097 1.00 0.00 ? 8  GLU A HA   6  
ATOM 7322  H HB2  . GLU A 1 8  ? -0.090  -9.055  -9.622  1.00 0.00 ? 8  GLU A HB2  6  
ATOM 7323  H HB3  . GLU A 1 8  ? 1.116   -9.352  -10.859 1.00 0.00 ? 8  GLU A HB3  6  
ATOM 7324  H HG2  . GLU A 1 8  ? 2.442   -7.748  -9.968  1.00 0.00 ? 8  GLU A HG2  6  
ATOM 7325  H HG3  . GLU A 1 8  ? 1.207   -6.543  -10.273 1.00 0.00 ? 8  GLU A HG3  6  
ATOM 7326  N N    . PHE A 1 9  ? 0.747   -6.553  -13.004 1.00 0.00 ? 9  PHE A N    6  
ATOM 7327  C CA   . PHE A 1 9  ? 1.459   -6.221  -14.226 1.00 0.00 ? 9  PHE A CA   6  
ATOM 7328  C C    . PHE A 1 9  ? 2.666   -5.328  -13.932 1.00 0.00 ? 9  PHE A C    6  
ATOM 7329  O O    . PHE A 1 9  ? 2.759   -4.737  -12.857 1.00 0.00 ? 9  PHE A O    6  
ATOM 7330  C CB   . PHE A 1 9  ? 0.481   -5.458  -15.121 1.00 0.00 ? 9  PHE A CB   6  
ATOM 7331  C CG   . PHE A 1 9  ? -0.443  -6.359  -15.943 1.00 0.00 ? 9  PHE A CG   6  
ATOM 7332  C CD1  . PHE A 1 9  ? 0.072   -7.148  -16.923 1.00 0.00 ? 9  PHE A CD1  6  
ATOM 7333  C CD2  . PHE A 1 9  ? -1.780  -6.371  -15.693 1.00 0.00 ? 9  PHE A CD2  6  
ATOM 7334  C CE1  . PHE A 1 9  ? -0.785  -7.985  -17.686 1.00 0.00 ? 9  PHE A CE1  6  
ATOM 7335  C CE2  . PHE A 1 9  ? -2.637  -7.207  -16.456 1.00 0.00 ? 9  PHE A CE2  6  
ATOM 7336  C CZ   . PHE A 1 9  ? -2.122  -7.996  -17.436 1.00 0.00 ? 9  PHE A CZ   6  
ATOM 7337  H H    . PHE A 1 9  ? 0.633   -5.794  -12.362 1.00 0.00 ? 9  PHE A H    6  
ATOM 7338  H HA   . PHE A 1 9  ? 1.802   -7.158  -14.665 1.00 0.00 ? 9  PHE A HA   6  
ATOM 7339  H HB2  . PHE A 1 9  ? -0.128  -4.801  -14.499 1.00 0.00 ? 9  PHE A HB2  6  
ATOM 7340  H HB3  . PHE A 1 9  ? 1.047   -4.820  -15.800 1.00 0.00 ? 9  PHE A HB3  6  
ATOM 7341  H HD1  . PHE A 1 9  ? 1.144   -7.139  -17.123 1.00 0.00 ? 9  PHE A HD1  6  
ATOM 7342  H HD2  . PHE A 1 9  ? -2.193  -5.739  -14.907 1.00 0.00 ? 9  PHE A HD2  6  
ATOM 7343  H HE1  . PHE A 1 9  ? -0.372  -8.617  -18.472 1.00 0.00 ? 9  PHE A HE1  6  
ATOM 7344  H HE2  . PHE A 1 9  ? -3.709  -7.217  -16.255 1.00 0.00 ? 9  PHE A HE2  6  
ATOM 7345  H HZ   . PHE A 1 9  ? -2.780  -8.639  -18.021 1.00 0.00 ? 9  PHE A HZ   6  
ATOM 7346  N N    . VAL A 1 10 ? 3.561   -5.257  -14.907 1.00 0.00 ? 10 VAL A N    6  
ATOM 7347  C CA   . VAL A 1 10 ? 4.758   -4.445  -14.766 1.00 0.00 ? 10 VAL A CA   6  
ATOM 7348  C C    . VAL A 1 10 ? 4.964   -3.624  -16.040 1.00 0.00 ? 10 VAL A C    6  
ATOM 7349  O O    . VAL A 1 10 ? 4.647   -4.082  -17.137 1.00 0.00 ? 10 VAL A O    6  
ATOM 7350  C CB   . VAL A 1 10 ? 5.956   -5.335  -14.428 1.00 0.00 ? 10 VAL A CB   6  
ATOM 7351  C CG1  . VAL A 1 10 ? 6.376   -6.173  -15.637 1.00 0.00 ? 10 VAL A CG1  6  
ATOM 7352  C CG2  . VAL A 1 10 ? 7.128   -4.501  -13.905 1.00 0.00 ? 10 VAL A CG2  6  
ATOM 7353  H H    . VAL A 1 10 ? 3.478   -5.740  -15.778 1.00 0.00 ? 10 VAL A H    6  
ATOM 7354  H HA   . VAL A 1 10 ? 4.597   -3.763  -13.931 1.00 0.00 ? 10 VAL A HA   6  
ATOM 7355  H HB   . VAL A 1 10 ? 5.652   -6.018  -13.635 1.00 0.00 ? 10 VAL A HB   6  
ATOM 7356  H HG11 . VAL A 1 10 ? 5.541   -6.799  -15.952 1.00 0.00 ? 10 VAL A HG11 6  
ATOM 7357  H HG12 . VAL A 1 10 ? 6.663   -5.513  -16.455 1.00 0.00 ? 10 VAL A HG12 6  
ATOM 7358  H HG13 . VAL A 1 10 ? 7.221   -6.805  -15.365 1.00 0.00 ? 10 VAL A HG13 6  
ATOM 7359  H HG21 . VAL A 1 10 ? 6.962   -3.450  -14.146 1.00 0.00 ? 10 VAL A HG21 6  
ATOM 7360  H HG22 . VAL A 1 10 ? 7.204   -4.618  -12.824 1.00 0.00 ? 10 VAL A HG22 6  
ATOM 7361  H HG23 . VAL A 1 10 ? 8.052   -4.839  -14.374 1.00 0.00 ? 10 VAL A HG23 6  
ATOM 7362  N N    . ILE A 1 11 ? 5.495   -2.424  -15.853 1.00 0.00 ? 11 ILE A N    6  
ATOM 7363  C CA   . ILE A 1 11 ? 5.748   -1.535  -16.974 1.00 0.00 ? 11 ILE A CA   6  
ATOM 7364  C C    . ILE A 1 11 ? 7.256   -1.449  -17.221 1.00 0.00 ? 11 ILE A C    6  
ATOM 7365  O O    . ILE A 1 11 ? 7.740   -1.861  -18.274 1.00 0.00 ? 11 ILE A O    6  
ATOM 7366  C CB   . ILE A 1 11 ? 5.085   -0.176  -16.740 1.00 0.00 ? 11 ILE A CB   6  
ATOM 7367  C CG1  . ILE A 1 11 ? 3.563   -0.315  -16.666 1.00 0.00 ? 11 ILE A CG1  6  
ATOM 7368  C CG2  . ILE A 1 11 ? 5.517   0.836   -17.803 1.00 0.00 ? 11 ILE A CG2  6  
ATOM 7369  C CD1  . ILE A 1 11 ? 3.041   0.092   -15.287 1.00 0.00 ? 11 ILE A CD1  6  
ATOM 7370  H H    . ILE A 1 11 ? 5.751   -2.059  -14.958 1.00 0.00 ? 11 ILE A H    6  
ATOM 7371  H HA   . ILE A 1 11 ? 5.279   -1.976  -17.853 1.00 0.00 ? 11 ILE A HA   6  
ATOM 7372  H HB   . ILE A 1 11 ? 5.420   0.206   -15.776 1.00 0.00 ? 11 ILE A HB   6  
ATOM 7373  H HG12 . ILE A 1 11 ? 3.100   0.308   -17.432 1.00 0.00 ? 11 ILE A HG12 6  
ATOM 7374  H HG13 . ILE A 1 11 ? 3.277   -1.345  -16.878 1.00 0.00 ? 11 ILE A HG13 6  
ATOM 7375  H HG21 . ILE A 1 11 ? 5.605   0.335   -18.767 1.00 0.00 ? 11 ILE A HG21 6  
ATOM 7376  H HG22 . ILE A 1 11 ? 4.774   1.630   -17.873 1.00 0.00 ? 11 ILE A HG22 6  
ATOM 7377  H HG23 . ILE A 1 11 ? 6.481   1.264   -17.526 1.00 0.00 ? 11 ILE A HG23 6  
ATOM 7378  H HD11 . ILE A 1 11 ? 3.071   1.177   -15.192 1.00 0.00 ? 11 ILE A HD11 6  
ATOM 7379  H HD12 . ILE A 1 11 ? 2.014   -0.255  -15.170 1.00 0.00 ? 11 ILE A HD12 6  
ATOM 7380  H HD13 . ILE A 1 11 ? 3.666   -0.358  -14.515 1.00 0.00 ? 11 ILE A HD13 6  
ATOM 7381  N N    . ASN A 1 12 ? 7.955   -0.910  -16.233 1.00 0.00 ? 12 ASN A N    6  
ATOM 7382  C CA   . ASN A 1 12 ? 9.398   -0.764  -16.331 1.00 0.00 ? 12 ASN A CA   6  
ATOM 7383  C C    . ASN A 1 12 ? 9.918   -0.045  -15.084 1.00 0.00 ? 12 ASN A C    6  
ATOM 7384  O O    . ASN A 1 12 ? 9.771   1.169   -14.957 1.00 0.00 ? 12 ASN A O    6  
ATOM 7385  C CB   . ASN A 1 12 ? 9.786   0.069   -17.554 1.00 0.00 ? 12 ASN A CB   6  
ATOM 7386  C CG   . ASN A 1 12 ? 10.966  -0.563  -18.295 1.00 0.00 ? 12 ASN A CG   6  
ATOM 7387  O OD1  . ASN A 1 12 ? 12.118  -0.220  -18.088 1.00 0.00 ? 12 ASN A OD1  6  
ATOM 7388  N ND2  . ASN A 1 12 ? 10.615  -1.502  -19.169 1.00 0.00 ? 12 ASN A ND2  6  
ATOM 7389  H H    . ASN A 1 12 ? 7.553   -0.577  -15.380 1.00 0.00 ? 12 ASN A H    6  
ATOM 7390  H HA   . ASN A 1 12 ? 9.783   -1.780  -16.418 1.00 0.00 ? 12 ASN A HA   6  
ATOM 7391  H HB2  . ASN A 1 12 ? 8.932   0.154   -18.226 1.00 0.00 ? 12 ASN A HB2  6  
ATOM 7392  H HB3  . ASN A 1 12 ? 10.047  1.080   -17.242 1.00 0.00 ? 12 ASN A HB3  6  
ATOM 7393  H HD21 . ASN A 1 12 ? 9.650   -1.736  -19.291 1.00 0.00 ? 12 ASN A HD21 6  
ATOM 7394  H HD22 . ASN A 1 12 ? 11.316  -1.975  -19.704 1.00 0.00 ? 12 ASN A HD22 6  
ATOM 7395  N N    . PRO A 1 13 ? 10.532  -0.846  -14.173 1.00 0.00 ? 13 PRO A N    6  
ATOM 7396  C CA   . PRO A 1 13 ? 11.075  -0.300  -12.941 1.00 0.00 ? 13 PRO A CA   6  
ATOM 7397  C C    . PRO A 1 13 ? 12.379  0.457   -13.205 1.00 0.00 ? 13 PRO A C    6  
ATOM 7398  O O    . PRO A 1 13 ? 13.029  0.243   -14.227 1.00 0.00 ? 13 PRO A O    6  
ATOM 7399  C CB   . PRO A 1 13 ? 11.260  -1.499  -12.026 1.00 0.00 ? 13 PRO A CB   6  
ATOM 7400  C CG   . PRO A 1 13 ? 11.253  -2.720  -12.932 1.00 0.00 ? 13 PRO A CG   6  
ATOM 7401  C CD   . PRO A 1 13 ? 10.724  -2.289  -14.290 1.00 0.00 ? 13 PRO A CD   6  
ATOM 7402  H HA   . PRO A 1 13 ? 10.444  0.371   -12.551 1.00 0.00 ? 13 PRO A HA   6  
ATOM 7403  H HB2  . PRO A 1 13 ? 12.196  -1.428  -11.473 1.00 0.00 ? 13 PRO A HB2  6  
ATOM 7404  H HB3  . PRO A 1 13 ? 10.458  -1.555  -11.289 1.00 0.00 ? 13 PRO A HB3  6  
ATOM 7405  H HG2  . PRO A 1 13 ? 12.258  -3.131  -13.026 1.00 0.00 ? 13 PRO A HG2  6  
ATOM 7406  H HG3  . PRO A 1 13 ? 10.626  -3.505  -12.509 1.00 0.00 ? 13 PRO A HG3  6  
ATOM 7407  H HD2  . PRO A 1 13 ? 11.430  -2.531  -15.085 1.00 0.00 ? 13 PRO A HD2  6  
ATOM 7408  H HD3  . PRO A 1 13 ? 9.789   -2.795  -14.530 1.00 0.00 ? 13 PRO A HD3  6  
ATOM 7409  N N    . ASN A 1 14 ? 12.722  1.326   -12.266 1.00 0.00 ? 14 ASN A N    6  
ATOM 7410  C CA   . ASN A 1 14 ? 13.936  2.115   -12.384 1.00 0.00 ? 14 ASN A CA   6  
ATOM 7411  C C    . ASN A 1 14 ? 14.471  2.432   -10.987 1.00 0.00 ? 14 ASN A C    6  
ATOM 7412  O O    . ASN A 1 14 ? 15.635  2.167   -10.689 1.00 0.00 ? 14 ASN A O    6  
ATOM 7413  C CB   . ASN A 1 14 ? 13.664  3.441   -13.098 1.00 0.00 ? 14 ASN A CB   6  
ATOM 7414  C CG   . ASN A 1 14 ? 14.107  3.378   -14.561 1.00 0.00 ? 14 ASN A CG   6  
ATOM 7415  O OD1  . ASN A 1 14 ? 13.729  2.495   -15.313 1.00 0.00 ? 14 ASN A OD1  6  
ATOM 7416  N ND2  . ASN A 1 14 ? 14.928  4.361   -14.920 1.00 0.00 ? 14 ASN A ND2  6  
ATOM 7417  H H    . ASN A 1 14 ? 12.187  1.494   -11.438 1.00 0.00 ? 14 ASN A H    6  
ATOM 7418  H HA   . ASN A 1 14 ? 14.623  1.499   -12.965 1.00 0.00 ? 14 ASN A HA   6  
ATOM 7419  H HB2  . ASN A 1 14 ? 12.600  3.674   -13.046 1.00 0.00 ? 14 ASN A HB2  6  
ATOM 7420  H HB3  . ASN A 1 14 ? 14.192  4.248   -12.589 1.00 0.00 ? 14 ASN A HB3  6  
ATOM 7421  H HD21 . ASN A 1 14 ? 15.200  5.054   -14.253 1.00 0.00 ? 14 ASN A HD21 6  
ATOM 7422  H HD22 . ASN A 1 14 ? 15.274  4.406   -15.857 1.00 0.00 ? 14 ASN A HD22 6  
ATOM 7423  N N    . GLY A 1 15 ? 13.597  2.995   -10.166 1.00 0.00 ? 15 GLY A N    6  
ATOM 7424  C CA   . GLY A 1 15 ? 13.967  3.350   -8.807  1.00 0.00 ? 15 GLY A CA   6  
ATOM 7425  C C    . GLY A 1 15 ? 13.033  2.687   -7.793  1.00 0.00 ? 15 GLY A C    6  
ATOM 7426  O O    . GLY A 1 15 ? 12.052  2.049   -8.171  1.00 0.00 ? 15 GLY A O    6  
ATOM 7427  H H    . GLY A 1 15 ? 12.652  3.207   -10.416 1.00 0.00 ? 15 GLY A H    6  
ATOM 7428  H HA2  . GLY A 1 15 ? 14.995  3.043   -8.614  1.00 0.00 ? 15 GLY A HA2  6  
ATOM 7429  H HA3  . GLY A 1 15 ? 13.930  4.433   -8.687  1.00 0.00 ? 15 GLY A HA3  6  
ATOM 7430  N N    . LYS A 1 16 ? 13.370  2.861   -6.523  1.00 0.00 ? 16 LYS A N    6  
ATOM 7431  C CA   . LYS A 1 16 ? 12.574  2.288   -5.452  1.00 0.00 ? 16 LYS A CA   6  
ATOM 7432  C C    . LYS A 1 16 ? 11.626  3.355   -4.899  1.00 0.00 ? 16 LYS A C    6  
ATOM 7433  O O    . LYS A 1 16 ? 12.072  4.357   -4.342  1.00 0.00 ? 16 LYS A O    6  
ATOM 7434  C CB   . LYS A 1 16 ? 13.477  1.659   -4.390  1.00 0.00 ? 16 LYS A CB   6  
ATOM 7435  C CG   . LYS A 1 16 ? 14.161  0.400   -4.928  1.00 0.00 ? 16 LYS A CG   6  
ATOM 7436  C CD   . LYS A 1 16 ? 15.679  0.585   -4.990  1.00 0.00 ? 16 LYS A CD   6  
ATOM 7437  C CE   . LYS A 1 16 ? 16.367  -0.137  -3.829  1.00 0.00 ? 16 LYS A CE   6  
ATOM 7438  N NZ   . LYS A 1 16 ? 17.495  -0.957  -4.324  1.00 0.00 ? 16 LYS A NZ   6  
ATOM 7439  H H    . LYS A 1 16 ? 14.170  3.382   -6.223  1.00 0.00 ? 16 LYS A H    6  
ATOM 7440  H HA   . LYS A 1 16 ? 11.976  1.485   -5.883  1.00 0.00 ? 16 LYS A HA   6  
ATOM 7441  H HB2  . LYS A 1 16 ? 14.231  2.380   -4.074  1.00 0.00 ? 16 LYS A HB2  6  
ATOM 7442  H HB3  . LYS A 1 16 ? 12.888  1.408   -3.508  1.00 0.00 ? 16 LYS A HB3  6  
ATOM 7443  H HG2  . LYS A 1 16 ? 13.920  -0.450  -4.289  1.00 0.00 ? 16 LYS A HG2  6  
ATOM 7444  H HG3  . LYS A 1 16 ? 13.778  0.170   -5.922  1.00 0.00 ? 16 LYS A HG3  6  
ATOM 7445  H HD2  . LYS A 1 16 ? 16.057  0.200   -5.937  1.00 0.00 ? 16 LYS A HD2  6  
ATOM 7446  H HD3  . LYS A 1 16 ? 15.921  1.647   -4.958  1.00 0.00 ? 16 LYS A HD3  6  
ATOM 7447  H HE2  . LYS A 1 16 ? 16.730  0.592   -3.104  1.00 0.00 ? 16 LYS A HE2  6  
ATOM 7448  H HE3  . LYS A 1 16 ? 15.648  -0.771  -3.310  1.00 0.00 ? 16 LYS A HE3  6  
ATOM 7449  H HZ1  . LYS A 1 16 ? 17.155  -1.852  -4.613  1.00 0.00 ? 16 LYS A HZ1  6  
ATOM 7450  H HZ2  . LYS A 1 16 ? 17.926  -0.497  -5.101  1.00 0.00 ? 16 LYS A HZ2  6  
ATOM 7451  H HZ3  . LYS A 1 16 ? 18.166  -1.076  -3.593  1.00 0.00 ? 16 LYS A HZ3  6  
ATOM 7452  N N    . SER A 1 17 ? 10.337  3.103   -5.073  1.00 0.00 ? 17 SER A N    6  
ATOM 7453  C CA   . SER A 1 17 ? 9.323   4.030   -4.598  1.00 0.00 ? 17 SER A CA   6  
ATOM 7454  C C    . SER A 1 17 ? 8.548   3.407   -3.436  1.00 0.00 ? 17 SER A C    6  
ATOM 7455  O O    . SER A 1 17 ? 8.833   2.283   -3.027  1.00 0.00 ? 17 SER A O    6  
ATOM 7456  C CB   . SER A 1 17 ? 8.366   4.423   -5.725  1.00 0.00 ? 17 SER A CB   6  
ATOM 7457  O OG   . SER A 1 17 ? 8.397   5.824   -5.988  1.00 0.00 ? 17 SER A OG   6  
ATOM 7458  H H    . SER A 1 17 ? 9.983   2.286   -5.527  1.00 0.00 ? 17 SER A H    6  
ATOM 7459  H HA   . SER A 1 17 ? 9.871   4.911   -4.264  1.00 0.00 ? 17 SER A HA   6  
ATOM 7460  H HB2  . SER A 1 17 ? 8.630   3.878   -6.632  1.00 0.00 ? 17 SER A HB2  6  
ATOM 7461  H HB3  . SER A 1 17 ? 7.352   4.127   -5.459  1.00 0.00 ? 17 SER A HB3  6  
ATOM 7462  H HG   . SER A 1 17 ? 7.848   6.311   -5.309  1.00 0.00 ? 17 SER A HG   6  
ATOM 7463  N N    . GLU A 1 18 ? 7.582   4.165   -2.937  1.00 0.00 ? 18 GLU A N    6  
ATOM 7464  C CA   . GLU A 1 18 ? 6.763   3.701   -1.830  1.00 0.00 ? 18 GLU A CA   6  
ATOM 7465  C C    . GLU A 1 18 ? 6.085   2.378   -2.190  1.00 0.00 ? 18 GLU A C    6  
ATOM 7466  O O    . GLU A 1 18 ? 5.989   1.479   -1.356  1.00 0.00 ? 18 GLU A O    6  
ATOM 7467  C CB   . GLU A 1 18 ? 5.730   4.757   -1.433  1.00 0.00 ? 18 GLU A CB   6  
ATOM 7468  C CG   . GLU A 1 18 ? 5.704   4.954   0.084   1.00 0.00 ? 18 GLU A CG   6  
ATOM 7469  C CD   . GLU A 1 18 ? 6.900   5.788   0.550   1.00 0.00 ? 18 GLU A CD   6  
ATOM 7470  O OE1  . GLU A 1 18 ? 6.747   7.028   0.589   1.00 0.00 ? 18 GLU A OE1  6  
ATOM 7471  O OE2  . GLU A 1 18 ? 7.940   5.166   0.856   1.00 0.00 ? 18 GLU A OE2  6  
ATOM 7472  H H    . GLU A 1 18 ? 7.357   5.078   -3.276  1.00 0.00 ? 18 GLU A H    6  
ATOM 7473  H HA   . GLU A 1 18 ? 7.455   3.549   -1.002  1.00 0.00 ? 18 GLU A HA   6  
ATOM 7474  H HB2  . GLU A 1 18 ? 5.964   5.702   -1.922  1.00 0.00 ? 18 GLU A HB2  6  
ATOM 7475  H HB3  . GLU A 1 18 ? 4.743   4.454   -1.781  1.00 0.00 ? 18 GLU A HB3  6  
ATOM 7476  H HG2  . GLU A 1 18 ? 4.777   5.449   0.374   1.00 0.00 ? 18 GLU A HG2  6  
ATOM 7477  H HG3  . GLU A 1 18 ? 5.716   3.984   0.581   1.00 0.00 ? 18 GLU A HG3  6  
ATOM 7478  N N    . VAL A 1 19 ? 5.632   2.301   -3.432  1.00 0.00 ? 19 VAL A N    6  
ATOM 7479  C CA   . VAL A 1 19 ? 4.965   1.102   -3.913  1.00 0.00 ? 19 VAL A CA   6  
ATOM 7480  C C    . VAL A 1 19 ? 5.934   -0.079  -3.840  1.00 0.00 ? 19 VAL A C    6  
ATOM 7481  O O    . VAL A 1 19 ? 5.521   -1.211  -3.592  1.00 0.00 ? 19 VAL A O    6  
ATOM 7482  C CB   . VAL A 1 19 ? 4.415   1.338   -5.321  1.00 0.00 ? 19 VAL A CB   6  
ATOM 7483  C CG1  . VAL A 1 19 ? 3.447   2.523   -5.340  1.00 0.00 ? 19 VAL A CG1  6  
ATOM 7484  C CG2  . VAL A 1 19 ? 5.550   1.541   -6.326  1.00 0.00 ? 19 VAL A CG2  6  
ATOM 7485  H H    . VAL A 1 19 ? 5.714   3.037   -4.104  1.00 0.00 ? 19 VAL A H    6  
ATOM 7486  H HA   . VAL A 1 19 ? 4.122   0.907   -3.249  1.00 0.00 ? 19 VAL A HA   6  
ATOM 7487  H HB   . VAL A 1 19 ? 3.860   0.448   -5.617  1.00 0.00 ? 19 VAL A HB   6  
ATOM 7488  H HG11 . VAL A 1 19 ? 2.892   2.554   -4.402  1.00 0.00 ? 19 VAL A HG11 6  
ATOM 7489  H HG12 . VAL A 1 19 ? 4.009   3.449   -5.461  1.00 0.00 ? 19 VAL A HG12 6  
ATOM 7490  H HG13 . VAL A 1 19 ? 2.750   2.410   -6.170  1.00 0.00 ? 19 VAL A HG13 6  
ATOM 7491  H HG21 . VAL A 1 19 ? 5.134   1.636   -7.329  1.00 0.00 ? 19 VAL A HG21 6  
ATOM 7492  H HG22 . VAL A 1 19 ? 6.100   2.448   -6.074  1.00 0.00 ? 19 VAL A HG22 6  
ATOM 7493  H HG23 . VAL A 1 19 ? 6.224   0.685   -6.291  1.00 0.00 ? 19 VAL A HG23 6  
ATOM 7494  N N    . CYS A 1 20 ? 7.205   0.224   -4.061  1.00 0.00 ? 20 CYS A N    6  
ATOM 7495  C CA   . CYS A 1 20 ? 8.236   -0.799  -4.023  1.00 0.00 ? 20 CYS A CA   6  
ATOM 7496  C C    . CYS A 1 20 ? 8.605   -1.056  -2.561  1.00 0.00 ? 20 CYS A C    6  
ATOM 7497  O O    . CYS A 1 20 ? 8.595   -2.199  -2.106  1.00 0.00 ? 20 CYS A O    6  
ATOM 7498  C CB   . CYS A 1 20 ? 9.456   -0.404  -4.858  1.00 0.00 ? 20 CYS A CB   6  
ATOM 7499  S SG   . CYS A 1 20 ? 9.000   -0.315  -6.628  1.00 0.00 ? 20 CYS A SG   6  
ATOM 7500  H H    . CYS A 1 20 ? 7.532   1.147   -4.262  1.00 0.00 ? 20 CYS A H    6  
ATOM 7501  H HA   . CYS A 1 20 ? 7.807   -1.692  -4.477  1.00 0.00 ? 20 CYS A HA   6  
ATOM 7502  H HB2  . CYS A 1 20 ? 9.838   0.561   -4.524  1.00 0.00 ? 20 CYS A HB2  6  
ATOM 7503  H HB3  . CYS A 1 20 ? 10.255  -1.130  -4.716  1.00 0.00 ? 20 CYS A HB3  6  
ATOM 7504  H HG   . CYS A 1 20 ? 8.990   -1.629  -6.835  1.00 0.00 ? 20 CYS A HG   6  
ATOM 7505  N N    . ILE A 1 21 ? 8.921   0.026   -1.864  1.00 0.00 ? 21 ILE A N    6  
ATOM 7506  C CA   . ILE A 1 21 ? 9.292   -0.068  -0.463  1.00 0.00 ? 21 ILE A CA   6  
ATOM 7507  C C    . ILE A 1 21 ? 8.248   -0.901  0.282   1.00 0.00 ? 21 ILE A C    6  
ATOM 7508  O O    . ILE A 1 21 ? 8.565   -1.956  0.829   1.00 0.00 ? 21 ILE A O    6  
ATOM 7509  C CB   . ILE A 1 21 ? 9.504   1.327   0.130   1.00 0.00 ? 21 ILE A CB   6  
ATOM 7510  C CG1  . ILE A 1 21 ? 10.762  1.982   -0.444  1.00 0.00 ? 21 ILE A CG1  6  
ATOM 7511  C CG2  . ILE A 1 21 ? 9.531   1.274   1.659   1.00 0.00 ? 21 ILE A CG2  6  
ATOM 7512  C CD1  . ILE A 1 21 ? 10.683  3.506   -0.338  1.00 0.00 ? 21 ILE A CD1  6  
ATOM 7513  H H    . ILE A 1 21 ? 8.927   0.952   -2.242  1.00 0.00 ? 21 ILE A H    6  
ATOM 7514  H HA   . ILE A 1 21 ? 10.249  -0.588  -0.412  1.00 0.00 ? 21 ILE A HA   6  
ATOM 7515  H HB   . ILE A 1 21 ? 8.657   1.951   -0.155  1.00 0.00 ? 21 ILE A HB   6  
ATOM 7516  H HG12 . ILE A 1 21 ? 11.640  1.621   0.092   1.00 0.00 ? 21 ILE A HG12 6  
ATOM 7517  H HG13 . ILE A 1 21 ? 10.883  1.692   -1.487  1.00 0.00 ? 21 ILE A HG13 6  
ATOM 7518  H HG21 . ILE A 1 21 ? 10.449  1.736   2.022   1.00 0.00 ? 21 ILE A HG21 6  
ATOM 7519  H HG22 . ILE A 1 21 ? 8.671   1.813   2.057   1.00 0.00 ? 21 ILE A HG22 6  
ATOM 7520  H HG23 . ILE A 1 21 ? 9.493   0.235   1.988   1.00 0.00 ? 21 ILE A HG23 6  
ATOM 7521  H HD11 . ILE A 1 21 ? 9.717   3.792   0.079   1.00 0.00 ? 21 ILE A HD11 6  
ATOM 7522  H HD12 . ILE A 1 21 ? 11.480  3.866   0.313   1.00 0.00 ? 21 ILE A HD12 6  
ATOM 7523  H HD13 . ILE A 1 21 ? 10.796  3.945   -1.329  1.00 0.00 ? 21 ILE A HD13 6  
ATOM 7524  N N    . LEU A 1 22 ? 7.023   -0.396  0.280   1.00 0.00 ? 22 LEU A N    6  
ATOM 7525  C CA   . LEU A 1 22 ? 5.929   -1.080  0.948   1.00 0.00 ? 22 LEU A CA   6  
ATOM 7526  C C    . LEU A 1 22 ? 6.042   -2.584  0.691   1.00 0.00 ? 22 LEU A C    6  
ATOM 7527  O O    . LEU A 1 22 ? 5.879   -3.388  1.608   1.00 0.00 ? 22 LEU A O    6  
ATOM 7528  C CB   . LEU A 1 22 ? 4.585   -0.483  0.527   1.00 0.00 ? 22 LEU A CB   6  
ATOM 7529  C CG   . LEU A 1 22 ? 3.345   -1.306  0.881   1.00 0.00 ? 22 LEU A CG   6  
ATOM 7530  C CD1  . LEU A 1 22 ? 3.195   -2.503  -0.060  1.00 0.00 ? 22 LEU A CD1  6  
ATOM 7531  C CD2  . LEU A 1 22 ? 3.370   -1.732  2.350   1.00 0.00 ? 22 LEU A CD2  6  
ATOM 7532  H H    . LEU A 1 22 ? 6.773   0.463   -0.168  1.00 0.00 ? 22 LEU A H    6  
ATOM 7533  H HA   . LEU A 1 22 ? 6.039   -0.904  2.018   1.00 0.00 ? 22 LEU A HA   6  
ATOM 7534  H HB2  . LEU A 1 22 ? 4.487   0.501   0.986   1.00 0.00 ? 22 LEU A HB2  6  
ATOM 7535  H HB3  . LEU A 1 22 ? 4.600   -0.331  -0.552  1.00 0.00 ? 22 LEU A HB3  6  
ATOM 7536  H HG   . LEU A 1 22 ? 2.466   -0.676  0.743   1.00 0.00 ? 22 LEU A HG   6  
ATOM 7537  H HD11 . LEU A 1 22 ? 2.211   -2.475  -0.530  1.00 0.00 ? 22 LEU A HD11 6  
ATOM 7538  H HD12 . LEU A 1 22 ? 3.966   -2.460  -0.829  1.00 0.00 ? 22 LEU A HD12 6  
ATOM 7539  H HD13 . LEU A 1 22 ? 3.299   -3.427  0.508   1.00 0.00 ? 22 LEU A HD13 6  
ATOM 7540  H HD21 . LEU A 1 22 ? 4.399   -1.924  2.655   1.00 0.00 ? 22 LEU A HD21 6  
ATOM 7541  H HD22 . LEU A 1 22 ? 2.951   -0.936  2.966   1.00 0.00 ? 22 LEU A HD22 6  
ATOM 7542  H HD23 . LEU A 1 22 ? 2.779   -2.638  2.476   1.00 0.00 ? 22 LEU A HD23 6  
ATOM 7543  N N    . HIS A 1 23 ? 6.319   -2.919  -0.560  1.00 0.00 ? 23 HIS A N    6  
ATOM 7544  C CA   . HIS A 1 23 ? 6.455   -4.313  -0.950  1.00 0.00 ? 23 HIS A CA   6  
ATOM 7545  C C    . HIS A 1 23 ? 7.618   -4.948  -0.185  1.00 0.00 ? 23 HIS A C    6  
ATOM 7546  O O    . HIS A 1 23 ? 7.423   -5.898  0.571   1.00 0.00 ? 23 HIS A O    6  
ATOM 7547  C CB   . HIS A 1 23 ? 6.602   -4.441  -2.467  1.00 0.00 ? 23 HIS A CB   6  
ATOM 7548  C CG   . HIS A 1 23 ? 6.497   -5.858  -2.977  1.00 0.00 ? 23 HIS A CG   6  
ATOM 7549  N ND1  . HIS A 1 23 ? 5.356   -6.355  -3.582  1.00 0.00 ? 23 HIS A ND1  6  
ATOM 7550  C CD2  . HIS A 1 23 ? 7.403   -6.878  -2.966  1.00 0.00 ? 23 HIS A CD2  6  
ATOM 7551  C CE1  . HIS A 1 23 ? 5.576   -7.618  -3.916  1.00 0.00 ? 23 HIS A CE1  6  
ATOM 7552  N NE2  . HIS A 1 23 ? 6.844   -7.941  -3.532  1.00 0.00 ? 23 HIS A NE2  6  
ATOM 7553  H H    . HIS A 1 23 ? 6.450   -2.259  -1.300  1.00 0.00 ? 23 HIS A H    6  
ATOM 7554  H HA   . HIS A 1 23 ? 5.528   -4.809  -0.663  1.00 0.00 ? 23 HIS A HA   6  
ATOM 7555  H HB2  . HIS A 1 23 ? 5.835   -3.835  -2.949  1.00 0.00 ? 23 HIS A HB2  6  
ATOM 7556  H HB3  . HIS A 1 23 ? 7.566   -4.029  -2.764  1.00 0.00 ? 23 HIS A HB3  6  
ATOM 7557  H HD1  . HIS A 1 23 ? 4.510   -5.846  -3.742  1.00 0.00 ? 23 HIS A HD1  6  
ATOM 7558  H HD2  . HIS A 1 23 ? 8.413   -6.829  -2.560  1.00 0.00 ? 23 HIS A HD2  6  
ATOM 7559  H HE1  . HIS A 1 23 ? 4.867   -8.283  -4.410  1.00 0.00 ? 23 HIS A HE1  6  
ATOM 7560  N N    . GLU A 1 24 ? 8.802   -4.398  -0.409  1.00 0.00 ? 24 GLU A N    6  
ATOM 7561  C CA   . GLU A 1 24 ? 9.996   -4.899  0.249   1.00 0.00 ? 24 GLU A CA   6  
ATOM 7562  C C    . GLU A 1 24 ? 9.691   -5.253  1.706   1.00 0.00 ? 24 GLU A C    6  
ATOM 7563  O O    . GLU A 1 24 ? 9.692   -6.426  2.076   1.00 0.00 ? 24 GLU A O    6  
ATOM 7564  C CB   . GLU A 1 24 ? 11.138  -3.885  0.160   1.00 0.00 ? 24 GLU A CB   6  
ATOM 7565  C CG   . GLU A 1 24 ? 12.219  -4.360  -0.813  1.00 0.00 ? 24 GLU A CG   6  
ATOM 7566  C CD   . GLU A 1 24 ? 13.499  -4.742  -0.067  1.00 0.00 ? 24 GLU A CD   6  
ATOM 7567  O OE1  . GLU A 1 24 ? 13.526  -5.868  0.475   1.00 0.00 ? 24 GLU A OE1  6  
ATOM 7568  O OE2  . GLU A 1 24 ? 14.422  -3.899  -0.055  1.00 0.00 ? 24 GLU A OE2  6  
ATOM 7569  H H    . GLU A 1 24 ? 8.952   -3.625  -1.026  1.00 0.00 ? 24 GLU A H    6  
ATOM 7570  H HA   . GLU A 1 24 ? 10.274  -5.799  -0.300  1.00 0.00 ? 24 GLU A HA   6  
ATOM 7571  H HB2  . GLU A 1 24 ? 10.748  -2.921  -0.167  1.00 0.00 ? 24 GLU A HB2  6  
ATOM 7572  H HB3  . GLU A 1 24 ? 11.574  -3.734  1.147   1.00 0.00 ? 24 GLU A HB3  6  
ATOM 7573  H HG2  . GLU A 1 24 ? 11.854  -5.218  -1.378  1.00 0.00 ? 24 GLU A HG2  6  
ATOM 7574  H HG3  . GLU A 1 24 ? 12.436  -3.572  -1.535  1.00 0.00 ? 24 GLU A HG3  6  
ATOM 7575  N N    . TYR A 1 25 ? 9.436   -4.218  2.492   1.00 0.00 ? 25 TYR A N    6  
ATOM 7576  C CA   . TYR A 1 25 ? 9.130   -4.406  3.900   1.00 0.00 ? 25 TYR A CA   6  
ATOM 7577  C C    . TYR A 1 25 ? 8.087   -5.509  4.092   1.00 0.00 ? 25 TYR A C    6  
ATOM 7578  O O    . TYR A 1 25 ? 8.224   -6.350  4.980   1.00 0.00 ? 25 TYR A O    6  
ATOM 7579  C CB   . TYR A 1 25 ? 8.544   -3.078  4.384   1.00 0.00 ? 25 TYR A CB   6  
ATOM 7580  C CG   . TYR A 1 25 ? 7.793   -3.177  5.714   1.00 0.00 ? 25 TYR A CG   6  
ATOM 7581  C CD1  . TYR A 1 25 ? 6.542   -3.757  5.758   1.00 0.00 ? 25 TYR A CD1  6  
ATOM 7582  C CD2  . TYR A 1 25 ? 8.367   -2.686  6.869   1.00 0.00 ? 25 TYR A CD2  6  
ATOM 7583  C CE1  . TYR A 1 25 ? 5.835   -3.850  7.009   1.00 0.00 ? 25 TYR A CE1  6  
ATOM 7584  C CE2  . TYR A 1 25 ? 7.661   -2.779  8.120   1.00 0.00 ? 25 TYR A CE2  6  
ATOM 7585  C CZ   . TYR A 1 25 ? 6.430   -3.357  8.129   1.00 0.00 ? 25 TYR A CZ   6  
ATOM 7586  O OH   . TYR A 1 25 ? 5.762   -3.445  9.310   1.00 0.00 ? 25 TYR A OH   6  
ATOM 7587  H H    . TYR A 1 25 ? 9.438   -3.267  2.183   1.00 0.00 ? 25 TYR A H    6  
ATOM 7588  H HA   . TYR A 1 25 ? 10.049  -4.692  4.409   1.00 0.00 ? 25 TYR A HA   6  
ATOM 7589  H HB2  . TYR A 1 25 ? 9.351   -2.353  4.488   1.00 0.00 ? 25 TYR A HB2  6  
ATOM 7590  H HB3  . TYR A 1 25 ? 7.865   -2.693  3.624   1.00 0.00 ? 25 TYR A HB3  6  
ATOM 7591  H HD1  . TYR A 1 25 ? 6.088   -4.145  4.846   1.00 0.00 ? 25 TYR A HD1  6  
ATOM 7592  H HD2  . TYR A 1 25 ? 9.356   -2.227  6.834   1.00 0.00 ? 25 TYR A HD2  6  
ATOM 7593  H HE1  . TYR A 1 25 ? 4.846   -4.306  7.058   1.00 0.00 ? 25 TYR A HE1  6  
ATOM 7594  H HE2  . TYR A 1 25 ? 8.103   -2.395  9.040   1.00 0.00 ? 25 TYR A HE2  6  
ATOM 7595  H HH   . TYR A 1 25 ? 5.848   -2.587  9.816   1.00 0.00 ? 25 TYR A HH   6  
ATOM 7596  N N    . MET A 1 26 ? 7.069   -5.471  3.245   1.00 0.00 ? 26 MET A N    6  
ATOM 7597  C CA   . MET A 1 26 ? 6.004   -6.457  3.310   1.00 0.00 ? 26 MET A CA   6  
ATOM 7598  C C    . MET A 1 26 ? 6.550   -7.869  3.088   1.00 0.00 ? 26 MET A C    6  
ATOM 7599  O O    . MET A 1 26 ? 6.429   -8.730  3.959   1.00 0.00 ? 26 MET A O    6  
ATOM 7600  C CB   . MET A 1 26 ? 4.951   -6.143  2.246   1.00 0.00 ? 26 MET A CB   6  
ATOM 7601  C CG   . MET A 1 26 ? 3.808   -5.313  2.833   1.00 0.00 ? 26 MET A CG   6  
ATOM 7602  S SD   . MET A 1 26 ? 2.256   -5.810  2.104   1.00 0.00 ? 26 MET A SD   6  
ATOM 7603  C CE   . MET A 1 26 ? 2.304   -7.563  2.436   1.00 0.00 ? 26 MET A CE   6  
ATOM 7604  H H    . MET A 1 26 ? 6.965   -4.784  2.526   1.00 0.00 ? 26 MET A H    6  
ATOM 7605  H HA   . MET A 1 26 ? 5.589   -6.374  4.315   1.00 0.00 ? 26 MET A HA   6  
ATOM 7606  H HB2  . MET A 1 26 ? 5.413   -5.600  1.421   1.00 0.00 ? 26 MET A HB2  6  
ATOM 7607  H HB3  . MET A 1 26 ? 4.557   -7.072  1.834   1.00 0.00 ? 26 MET A HB3  6  
ATOM 7608  H HG2  . MET A 1 26 ? 3.770   -5.446  3.914   1.00 0.00 ? 26 MET A HG2  6  
ATOM 7609  H HG3  . MET A 1 26 ? 3.984   -4.254  2.648   1.00 0.00 ? 26 MET A HG3  6  
ATOM 7610  H HE1  . MET A 1 26 ? 1.392   -7.860  2.954   1.00 0.00 ? 26 MET A HE1  6  
ATOM 7611  H HE2  . MET A 1 26 ? 2.383   -8.109  1.496   1.00 0.00 ? 26 MET A HE2  6  
ATOM 7612  H HE3  . MET A 1 26 ? 3.168   -7.791  3.061   1.00 0.00 ? 26 MET A HE3  6  
ATOM 7613  N N    . GLN A 1 27 ? 7.139   -8.064  1.917   1.00 0.00 ? 27 GLN A N    6  
ATOM 7614  C CA   . GLN A 1 27 ? 7.704   -9.356  1.569   1.00 0.00 ? 27 GLN A CA   6  
ATOM 7615  C C    . GLN A 1 27 ? 8.949   -9.636  2.413   1.00 0.00 ? 27 GLN A C    6  
ATOM 7616  O O    . GLN A 1 27 ? 9.515   -10.726 2.349   1.00 0.00 ? 27 GLN A O    6  
ATOM 7617  C CB   . GLN A 1 27 ? 8.026   -9.430  0.075   1.00 0.00 ? 27 GLN A CB   6  
ATOM 7618  C CG   . GLN A 1 27 ? 9.173   -10.407 -0.191  1.00 0.00 ? 27 GLN A CG   6  
ATOM 7619  C CD   . GLN A 1 27 ? 9.422   -10.564 -1.692  1.00 0.00 ? 27 GLN A CD   6  
ATOM 7620  O OE1  . GLN A 1 27 ? 9.627   -9.604  -2.417  1.00 0.00 ? 27 GLN A OE1  6  
ATOM 7621  N NE2  . GLN A 1 27 ? 9.394   -11.824 -2.116  1.00 0.00 ? 27 GLN A NE2  6  
ATOM 7622  H H    . GLN A 1 27 ? 7.233   -7.358  1.215   1.00 0.00 ? 27 GLN A H    6  
ATOM 7623  H HA   . GLN A 1 27 ? 6.927   -10.084 1.803   1.00 0.00 ? 27 GLN A HA   6  
ATOM 7624  H HB2  . GLN A 1 27 ? 7.140   -9.744  -0.476  1.00 0.00 ? 27 GLN A HB2  6  
ATOM 7625  H HB3  . GLN A 1 27 ? 8.295   -8.439  -0.291  1.00 0.00 ? 27 GLN A HB3  6  
ATOM 7626  H HG2  . GLN A 1 27 ? 10.080  -10.050 0.297   1.00 0.00 ? 27 GLN A HG2  6  
ATOM 7627  H HG3  . GLN A 1 27 ? 8.937   -11.377 0.246   1.00 0.00 ? 27 GLN A HG3  6  
ATOM 7628  H HE21 . GLN A 1 27 ? 9.221   -12.566 -1.468  1.00 0.00 ? 27 GLN A HE21 6  
ATOM 7629  H HE22 . GLN A 1 27 ? 9.546   -12.030 -3.083  1.00 0.00 ? 27 GLN A HE22 6  
ATOM 7630  N N    . ARG A 1 28 ? 9.339   -8.632  3.185   1.00 0.00 ? 28 ARG A N    6  
ATOM 7631  C CA   . ARG A 1 28 ? 10.507  -8.757  4.041   1.00 0.00 ? 28 ARG A CA   6  
ATOM 7632  C C    . ARG A 1 28 ? 10.096  -9.239  5.433   1.00 0.00 ? 28 ARG A C    6  
ATOM 7633  O O    . ARG A 1 28 ? 10.709  -10.152 5.984   1.00 0.00 ? 28 ARG A O    6  
ATOM 7634  C CB   . ARG A 1 28 ? 11.241  -7.420  4.168   1.00 0.00 ? 28 ARG A CB   6  
ATOM 7635  C CG   . ARG A 1 28 ? 12.246  -7.454  5.322   1.00 0.00 ? 28 ARG A CG   6  
ATOM 7636  C CD   . ARG A 1 28 ? 13.519  -6.686  4.963   1.00 0.00 ? 28 ARG A CD   6  
ATOM 7637  N NE   . ARG A 1 28 ? 13.573  -5.415  5.719   1.00 0.00 ? 28 ARG A NE   6  
ATOM 7638  C CZ   . ARG A 1 28 ? 13.744  -5.336  7.045   1.00 0.00 ? 28 ARG A CZ   6  
ATOM 7639  N NH1  . ARG A 1 28 ? 13.877  -6.455  7.771   1.00 0.00 ? 28 ARG A NH1  6  
ATOM 7640  N NH2  . ARG A 1 28 ? 13.780  -4.139  7.647   1.00 0.00 ? 28 ARG A NH2  6  
ATOM 7641  H H    . ARG A 1 28 ? 8.873   -7.749  3.232   1.00 0.00 ? 28 ARG A H    6  
ATOM 7642  H HA   . ARG A 1 28 ? 11.141  -9.490  3.543   1.00 0.00 ? 28 ARG A HA   6  
ATOM 7643  H HB2  . ARG A 1 28 ? 11.760  -7.196  3.236   1.00 0.00 ? 28 ARG A HB2  6  
ATOM 7644  H HB3  . ARG A 1 28 ? 10.521  -6.619  4.332   1.00 0.00 ? 28 ARG A HB3  6  
ATOM 7645  H HG2  . ARG A 1 28 ? 11.795  -7.021  6.214   1.00 0.00 ? 28 ARG A HG2  6  
ATOM 7646  H HG3  . ARG A 1 28 ? 12.496  -8.488  5.561   1.00 0.00 ? 28 ARG A HG3  6  
ATOM 7647  H HD2  . ARG A 1 28 ? 14.396  -7.292  5.191   1.00 0.00 ? 28 ARG A HD2  6  
ATOM 7648  H HD3  . ARG A 1 28 ? 13.542  -6.483  3.892   1.00 0.00 ? 28 ARG A HD3  6  
ATOM 7649  H HE   . ARG A 1 28 ? 13.477  -4.561  5.207   1.00 0.00 ? 28 ARG A HE   6  
ATOM 7650  H HH11 . ARG A 1 28 ? 13.850  -7.348  7.322   1.00 0.00 ? 28 ARG A HH11 6  
ATOM 7651  H HH12 . ARG A 1 28 ? 14.005  -6.396  8.761   1.00 0.00 ? 28 ARG A HH12 6  
ATOM 7652  H HH21 . ARG A 1 28 ? 13.681  -3.304  7.105   1.00 0.00 ? 28 ARG A HH21 6  
ATOM 7653  H HH22 . ARG A 1 28 ? 13.907  -4.081  8.637   1.00 0.00 ? 28 ARG A HH22 6  
ATOM 7654  N N    . VAL A 1 29 ? 9.060   -8.604  5.963   1.00 0.00 ? 29 VAL A N    6  
ATOM 7655  C CA   . VAL A 1 29 ? 8.560   -8.958  7.281   1.00 0.00 ? 29 VAL A CA   6  
ATOM 7656  C C    . VAL A 1 29 ? 7.393   -9.935  7.133   1.00 0.00 ? 29 VAL A C    6  
ATOM 7657  O O    . VAL A 1 29 ? 7.377   -10.990 7.766   1.00 0.00 ? 29 VAL A O    6  
ATOM 7658  C CB   . VAL A 1 29 ? 8.186   -7.692  8.055   1.00 0.00 ? 29 VAL A CB   6  
ATOM 7659  C CG1  . VAL A 1 29 ? 9.258   -6.613  7.892   1.00 0.00 ? 29 VAL A CG1  6  
ATOM 7660  C CG2  . VAL A 1 29 ? 6.814   -7.171  7.624   1.00 0.00 ? 29 VAL A CG2  6  
ATOM 7661  H H    . VAL A 1 29 ? 8.567   -7.863  5.509   1.00 0.00 ? 29 VAL A H    6  
ATOM 7662  H HA   . VAL A 1 29 ? 9.369   -9.455  7.817   1.00 0.00 ? 29 VAL A HA   6  
ATOM 7663  H HB   . VAL A 1 29 ? 8.129   -7.951  9.112   1.00 0.00 ? 29 VAL A HB   6  
ATOM 7664  H HG11 . VAL A 1 29 ? 9.053   -6.029  6.995   1.00 0.00 ? 29 VAL A HG11 6  
ATOM 7665  H HG12 . VAL A 1 29 ? 9.249   -5.957  8.763   1.00 0.00 ? 29 VAL A HG12 6  
ATOM 7666  H HG13 . VAL A 1 29 ? 10.237  -7.084  7.803   1.00 0.00 ? 29 VAL A HG13 6  
ATOM 7667  H HG21 . VAL A 1 29 ? 6.824   -6.962  6.554   1.00 0.00 ? 29 VAL A HG21 6  
ATOM 7668  H HG22 . VAL A 1 29 ? 6.055   -7.924  7.840   1.00 0.00 ? 29 VAL A HG22 6  
ATOM 7669  H HG23 . VAL A 1 29 ? 6.584   -6.257  8.171   1.00 0.00 ? 29 VAL A HG23 6  
ATOM 7670  N N    . LEU A 1 30 ? 6.443   -9.550  6.293   1.00 0.00 ? 30 LEU A N    6  
ATOM 7671  C CA   . LEU A 1 30 ? 5.274   -10.380 6.054   1.00 0.00 ? 30 LEU A CA   6  
ATOM 7672  C C    . LEU A 1 30 ? 5.663   -11.555 5.156   1.00 0.00 ? 30 LEU A C    6  
ATOM 7673  O O    . LEU A 1 30 ? 5.285   -12.695 5.421   1.00 0.00 ? 30 LEU A O    6  
ATOM 7674  C CB   . LEU A 1 30 ? 4.123   -9.537  5.501   1.00 0.00 ? 30 LEU A CB   6  
ATOM 7675  C CG   . LEU A 1 30 ? 3.761   -8.286  6.304   1.00 0.00 ? 30 LEU A CG   6  
ATOM 7676  C CD1  . LEU A 1 30 ? 2.591   -7.540  5.659   1.00 0.00 ? 30 LEU A CD1  6  
ATOM 7677  C CD2  . LEU A 1 30 ? 3.480   -8.636  7.767   1.00 0.00 ? 30 LEU A CD2  6  
ATOM 7678  H H    . LEU A 1 30 ? 6.463   -8.691  5.782   1.00 0.00 ? 30 LEU A H    6  
ATOM 7679  H HA   . LEU A 1 30 ? 4.950   -10.773 7.018   1.00 0.00 ? 30 LEU A HA   6  
ATOM 7680  H HB2  . LEU A 1 30 ? 4.378   -9.231  4.486   1.00 0.00 ? 30 LEU A HB2  6  
ATOM 7681  H HB3  . LEU A 1 30 ? 3.238   -10.169 5.430   1.00 0.00 ? 30 LEU A HB3  6  
ATOM 7682  H HG   . LEU A 1 30 ? 4.617   -7.613  6.293   1.00 0.00 ? 30 LEU A HG   6  
ATOM 7683  H HD11 . LEU A 1 30 ? 1.784   -7.434  6.384   1.00 0.00 ? 30 LEU A HD11 6  
ATOM 7684  H HD12 . LEU A 1 30 ? 2.923   -6.553  5.337   1.00 0.00 ? 30 LEU A HD12 6  
ATOM 7685  H HD13 . LEU A 1 30 ? 2.232   -8.103  4.797   1.00 0.00 ? 30 LEU A HD13 6  
ATOM 7686  H HD21 . LEU A 1 30 ? 2.534   -9.173  7.837   1.00 0.00 ? 30 LEU A HD21 6  
ATOM 7687  H HD22 . LEU A 1 30 ? 4.284   -9.265  8.150   1.00 0.00 ? 30 LEU A HD22 6  
ATOM 7688  H HD23 . LEU A 1 30 ? 3.424   -7.721  8.355   1.00 0.00 ? 30 LEU A HD23 6  
ATOM 7689  N N    . LYS A 1 31 ? 6.413   -11.237 4.111   1.00 0.00 ? 31 LYS A N    6  
ATOM 7690  C CA   . LYS A 1 31 ? 6.857   -12.253 3.172   1.00 0.00 ? 31 LYS A CA   6  
ATOM 7691  C C    . LYS A 1 31 ? 5.682   -12.673 2.287   1.00 0.00 ? 31 LYS A C    6  
ATOM 7692  O O    . LYS A 1 31 ? 5.484   -13.860 2.034   1.00 0.00 ? 31 LYS A O    6  
ATOM 7693  C CB   . LYS A 1 31 ? 7.515   -13.418 3.914   1.00 0.00 ? 31 LYS A CB   6  
ATOM 7694  C CG   . LYS A 1 31 ? 8.530   -12.911 4.941   1.00 0.00 ? 31 LYS A CG   6  
ATOM 7695  C CD   . LYS A 1 31 ? 9.833   -13.709 4.865   1.00 0.00 ? 31 LYS A CD   6  
ATOM 7696  C CE   . LYS A 1 31 ? 10.945  -12.881 4.218   1.00 0.00 ? 31 LYS A CE   6  
ATOM 7697  N NZ   . LYS A 1 31 ? 11.163  -13.311 2.819   1.00 0.00 ? 31 LYS A NZ   6  
ATOM 7698  H H    . LYS A 1 31 ? 6.716   -10.307 3.902   1.00 0.00 ? 31 LYS A H    6  
ATOM 7699  H HA   . LYS A 1 31 ? 7.621   -11.801 2.539   1.00 0.00 ? 31 LYS A HA   6  
ATOM 7700  H HB2  . LYS A 1 31 ? 6.752   -14.013 4.415   1.00 0.00 ? 31 LYS A HB2  6  
ATOM 7701  H HB3  . LYS A 1 31 ? 8.013   -14.074 3.200   1.00 0.00 ? 31 LYS A HB3  6  
ATOM 7702  H HG2  . LYS A 1 31 ? 8.735   -11.855 4.764   1.00 0.00 ? 31 LYS A HG2  6  
ATOM 7703  H HG3  . LYS A 1 31 ? 8.108   -12.990 5.943   1.00 0.00 ? 31 LYS A HG3  6  
ATOM 7704  H HD2  . LYS A 1 31 ? 10.136  -14.012 5.867   1.00 0.00 ? 31 LYS A HD2  6  
ATOM 7705  H HD3  . LYS A 1 31 ? 9.672   -14.621 4.291   1.00 0.00 ? 31 LYS A HD3  6  
ATOM 7706  H HE2  . LYS A 1 31 ? 10.682  -11.824 4.244   1.00 0.00 ? 31 LYS A HE2  6  
ATOM 7707  H HE3  . LYS A 1 31 ? 11.868  -12.994 4.787   1.00 0.00 ? 31 LYS A HE3  6  
ATOM 7708  H HZ1  . LYS A 1 31 ? 10.564  -12.788 2.212   1.00 0.00 ? 31 LYS A HZ1  6  
ATOM 7709  H HZ2  . LYS A 1 31 ? 12.117  -13.149 2.565   1.00 0.00 ? 31 LYS A HZ2  6  
ATOM 7710  H HZ3  . LYS A 1 31 ? 10.956  -14.285 2.733   1.00 0.00 ? 31 LYS A HZ3  6  
ATOM 7711  N N    . VAL A 1 32 ? 4.932   -11.675 1.842   1.00 0.00 ? 32 VAL A N    6  
ATOM 7712  C CA   . VAL A 1 32 ? 3.781   -11.926 0.991   1.00 0.00 ? 32 VAL A CA   6  
ATOM 7713  C C    . VAL A 1 32 ? 3.640   -10.785 -0.018  1.00 0.00 ? 32 VAL A C    6  
ATOM 7714  O O    . VAL A 1 32 ? 3.956   -9.637  0.290   1.00 0.00 ? 32 VAL A O    6  
ATOM 7715  C CB   . VAL A 1 32 ? 2.530   -12.125 1.849   1.00 0.00 ? 32 VAL A CB   6  
ATOM 7716  C CG1  . VAL A 1 32 ? 2.711   -13.291 2.823   1.00 0.00 ? 32 VAL A CG1  6  
ATOM 7717  C CG2  . VAL A 1 32 ? 2.167   -10.839 2.594   1.00 0.00 ? 32 VAL A CG2  6  
ATOM 7718  H H    . VAL A 1 32 ? 5.100   -10.712 2.053   1.00 0.00 ? 32 VAL A H    6  
ATOM 7719  H HA   . VAL A 1 32 ? 3.969   -12.853 0.449   1.00 0.00 ? 32 VAL A HA   6  
ATOM 7720  H HB   . VAL A 1 32 ? 1.702   -12.370 1.183   1.00 0.00 ? 32 VAL A HB   6  
ATOM 7721  H HG11 . VAL A 1 32 ? 1.737   -13.612 3.191   1.00 0.00 ? 32 VAL A HG11 6  
ATOM 7722  H HG12 . VAL A 1 32 ? 3.198   -14.120 2.309   1.00 0.00 ? 32 VAL A HG12 6  
ATOM 7723  H HG13 . VAL A 1 32 ? 3.329   -12.970 3.662   1.00 0.00 ? 32 VAL A HG13 6  
ATOM 7724  H HG21 . VAL A 1 32 ? 3.031   -10.491 3.160   1.00 0.00 ? 32 VAL A HG21 6  
ATOM 7725  H HG22 . VAL A 1 32 ? 1.870   -10.074 1.877   1.00 0.00 ? 32 VAL A HG22 6  
ATOM 7726  H HG23 . VAL A 1 32 ? 1.341   -11.036 3.278   1.00 0.00 ? 32 VAL A HG23 6  
ATOM 7727  N N    . ARG A 1 33 ? 3.163   -11.140 -1.202  1.00 0.00 ? 33 ARG A N    6  
ATOM 7728  C CA   . ARG A 1 33 ? 2.976   -10.160 -2.258  1.00 0.00 ? 33 ARG A CA   6  
ATOM 7729  C C    . ARG A 1 33 ? 1.624   -9.462  -2.101  1.00 0.00 ? 33 ARG A C    6  
ATOM 7730  O O    . ARG A 1 33 ? 0.577   -10.103 -2.182  1.00 0.00 ? 33 ARG A O    6  
ATOM 7731  C CB   . ARG A 1 33 ? 3.046   -10.817 -3.638  1.00 0.00 ? 33 ARG A CB   6  
ATOM 7732  C CG   . ARG A 1 33 ? 4.498   -11.027 -4.073  1.00 0.00 ? 33 ARG A CG   6  
ATOM 7733  C CD   . ARG A 1 33 ? 5.052   -12.340 -3.519  1.00 0.00 ? 33 ARG A CD   6  
ATOM 7734  N NE   . ARG A 1 33 ? 6.407   -12.586 -4.061  1.00 0.00 ? 33 ARG A NE   6  
ATOM 7735  C CZ   . ARG A 1 33 ? 6.651   -13.030 -5.301  1.00 0.00 ? 33 ARG A CZ   6  
ATOM 7736  N NH1  . ARG A 1 33 ? 5.633   -13.280 -6.136  1.00 0.00 ? 33 ARG A NH1  6  
ATOM 7737  N NH2  . ARG A 1 33 ? 7.913   -13.225 -5.707  1.00 0.00 ? 33 ARG A NH2  6  
ATOM 7738  H H    . ARG A 1 33 ? 2.908   -12.077 -1.444  1.00 0.00 ? 33 ARG A H    6  
ATOM 7739  H HA   . ARG A 1 33 ? 3.798   -9.455  -2.133  1.00 0.00 ? 33 ARG A HA   6  
ATOM 7740  H HB2  . ARG A 1 33 ? 2.527   -11.776 -3.615  1.00 0.00 ? 33 ARG A HB2  6  
ATOM 7741  H HB3  . ARG A 1 33 ? 2.530   -10.194 -4.368  1.00 0.00 ? 33 ARG A HB3  6  
ATOM 7742  H HG2  . ARG A 1 33 ? 4.558   -11.033 -5.162  1.00 0.00 ? 33 ARG A HG2  6  
ATOM 7743  H HG3  . ARG A 1 33 ? 5.109   -10.194 -3.725  1.00 0.00 ? 33 ARG A HG3  6  
ATOM 7744  H HD2  . ARG A 1 33 ? 5.089   -12.299 -2.431  1.00 0.00 ? 33 ARG A HD2  6  
ATOM 7745  H HD3  . ARG A 1 33 ? 4.390   -13.165 -3.785  1.00 0.00 ? 33 ARG A HD3  6  
ATOM 7746  H HE   . ARG A 1 33 ? 7.190   -12.411 -3.464  1.00 0.00 ? 33 ARG A HE   6  
ATOM 7747  H HH11 . ARG A 1 33 ? 4.691   -13.135 -5.833  1.00 0.00 ? 33 ARG A HH11 6  
ATOM 7748  H HH12 . ARG A 1 33 ? 5.815   -13.611 -7.062  1.00 0.00 ? 33 ARG A HH12 6  
ATOM 7749  H HH21 . ARG A 1 33 ? 8.673   -13.039 -5.084  1.00 0.00 ? 33 ARG A HH21 6  
ATOM 7750  H HH22 . ARG A 1 33 ? 8.095   -13.556 -6.633  1.00 0.00 ? 33 ARG A HH22 6  
ATOM 7751  N N    . PRO A 1 34 ? 1.691   -8.123  -1.873  1.00 0.00 ? 34 PRO A N    6  
ATOM 7752  C CA   . PRO A 1 34 ? 0.485   -7.331  -1.704  1.00 0.00 ? 34 PRO A CA   6  
ATOM 7753  C C    . PRO A 1 34 ? -0.214  -7.103  -3.045  1.00 0.00 ? 34 PRO A C    6  
ATOM 7754  O O    . PRO A 1 34 ? 0.436   -6.797  -4.044  1.00 0.00 ? 34 PRO A O    6  
ATOM 7755  C CB   . PRO A 1 34 ? 0.950   -6.041  -1.049  1.00 0.00 ? 34 PRO A CB   6  
ATOM 7756  C CG   . PRO A 1 34 ? 2.447   -5.963  -1.299  1.00 0.00 ? 34 PRO A CG   6  
ATOM 7757  C CD   . PRO A 1 34 ? 2.913   -7.331  -1.771  1.00 0.00 ? 34 PRO A CD   6  
ATOM 7758  H HA   . PRO A 1 34 ? -0.174  -7.821  -1.132  1.00 0.00 ? 34 PRO A HA   6  
ATOM 7759  H HB2  . PRO A 1 34 ? 0.437   -5.179  -1.476  1.00 0.00 ? 34 PRO A HB2  6  
ATOM 7760  H HB3  . PRO A 1 34 ? 0.732   -6.044  0.019   1.00 0.00 ? 34 PRO A HB3  6  
ATOM 7761  H HG2  . PRO A 1 34 ? 2.670   -5.204  -2.049  1.00 0.00 ? 34 PRO A HG2  6  
ATOM 7762  H HG3  . PRO A 1 34 ? 2.971   -5.674  -0.388  1.00 0.00 ? 34 PRO A HG3  6  
ATOM 7763  H HD2  . PRO A 1 34 ? 3.424   -7.265  -2.731  1.00 0.00 ? 34 PRO A HD2  6  
ATOM 7764  H HD3  . PRO A 1 34 ? 3.615   -7.775  -1.066  1.00 0.00 ? 34 PRO A HD3  6  
ATOM 7765  N N    . VAL A 1 35 ? -1.530  -7.261  -3.026  1.00 0.00 ? 35 VAL A N    6  
ATOM 7766  C CA   . VAL A 1 35 ? -2.324  -7.075  -4.228  1.00 0.00 ? 35 VAL A CA   6  
ATOM 7767  C C    . VAL A 1 35 ? -2.812  -5.627  -4.294  1.00 0.00 ? 35 VAL A C    6  
ATOM 7768  O O    . VAL A 1 35 ? -3.412  -5.127  -3.344  1.00 0.00 ? 35 VAL A O    6  
ATOM 7769  C CB   . VAL A 1 35 ? -3.466  -8.093  -4.264  1.00 0.00 ? 35 VAL A CB   6  
ATOM 7770  C CG1  . VAL A 1 35 ? -4.622  -7.590  -5.130  1.00 0.00 ? 35 VAL A CG1  6  
ATOM 7771  C CG2  . VAL A 1 35 ? -2.970  -9.457  -4.748  1.00 0.00 ? 35 VAL A CG2  6  
ATOM 7772  H H    . VAL A 1 35 ? -2.051  -7.510  -2.210  1.00 0.00 ? 35 VAL A H    6  
ATOM 7773  H HA   . VAL A 1 35 ? -1.675  -7.266  -5.083  1.00 0.00 ? 35 VAL A HA   6  
ATOM 7774  H HB   . VAL A 1 35 ? -3.838  -8.215  -3.246  1.00 0.00 ? 35 VAL A HB   6  
ATOM 7775  H HG11 . VAL A 1 35 ? -5.324  -7.033  -4.511  1.00 0.00 ? 35 VAL A HG11 6  
ATOM 7776  H HG12 . VAL A 1 35 ? -4.233  -6.940  -5.914  1.00 0.00 ? 35 VAL A HG12 6  
ATOM 7777  H HG13 . VAL A 1 35 ? -5.132  -8.440  -5.584  1.00 0.00 ? 35 VAL A HG13 6  
ATOM 7778  H HG21 . VAL A 1 35 ? -2.378  -9.327  -5.655  1.00 0.00 ? 35 VAL A HG21 6  
ATOM 7779  H HG22 . VAL A 1 35 ? -2.353  -9.915  -3.975  1.00 0.00 ? 35 VAL A HG22 6  
ATOM 7780  H HG23 . VAL A 1 35 ? -3.824  -10.100 -4.960  1.00 0.00 ? 35 VAL A HG23 6  
ATOM 7781  N N    . TYR A 1 36 ? -2.536  -4.993  -5.424  1.00 0.00 ? 36 TYR A N    6  
ATOM 7782  C CA   . TYR A 1 36 ? -2.939  -3.612  -5.626  1.00 0.00 ? 36 TYR A CA   6  
ATOM 7783  C C    . TYR A 1 36 ? -4.289  -3.534  -6.342  1.00 0.00 ? 36 TYR A C    6  
ATOM 7784  O O    . TYR A 1 36 ? -4.371  -3.768  -7.547  1.00 0.00 ? 36 TYR A O    6  
ATOM 7785  C CB   . TYR A 1 36 ? -1.866  -2.985  -6.518  1.00 0.00 ? 36 TYR A CB   6  
ATOM 7786  C CG   . TYR A 1 36 ? -0.621  -2.521  -5.760  1.00 0.00 ? 36 TYR A CG   6  
ATOM 7787  C CD1  . TYR A 1 36 ? 0.167   -3.440  -5.097  1.00 0.00 ? 36 TYR A CD1  6  
ATOM 7788  C CD2  . TYR A 1 36 ? -0.285  -1.182  -5.738  1.00 0.00 ? 36 TYR A CD2  6  
ATOM 7789  C CE1  . TYR A 1 36 ? 1.339   -3.003  -4.384  1.00 0.00 ? 36 TYR A CE1  6  
ATOM 7790  C CE2  . TYR A 1 36 ? 0.887   -0.745  -5.024  1.00 0.00 ? 36 TYR A CE2  6  
ATOM 7791  C CZ   . TYR A 1 36 ? 1.641   -1.677  -4.382  1.00 0.00 ? 36 TYR A CZ   6  
ATOM 7792  O OH   . TYR A 1 36 ? 2.748   -1.264  -3.708  1.00 0.00 ? 36 TYR A OH   6  
ATOM 7793  H H    . TYR A 1 36 ? -2.047  -5.407  -6.192  1.00 0.00 ? 36 TYR A H    6  
ATOM 7794  H HA   . TYR A 1 36 ? -3.028  -3.141  -4.647  1.00 0.00 ? 36 TYR A HA   6  
ATOM 7795  H HB2  . TYR A 1 36 ? -1.568  -3.710  -7.275  1.00 0.00 ? 36 TYR A HB2  6  
ATOM 7796  H HB3  . TYR A 1 36 ? -2.297  -2.134  -7.044  1.00 0.00 ? 36 TYR A HB3  6  
ATOM 7797  H HD1  . TYR A 1 36 ? -0.098  -4.498  -5.115  1.00 0.00 ? 36 TYR A HD1  6  
ATOM 7798  H HD2  . TYR A 1 36 ? -0.907  -0.456  -6.261  1.00 0.00 ? 36 TYR A HD2  6  
ATOM 7799  H HE1  . TYR A 1 36 ? 1.970   -3.719  -3.857  1.00 0.00 ? 36 TYR A HE1  6  
ATOM 7800  H HE2  . TYR A 1 36 ? 1.163   0.309   -4.999  1.00 0.00 ? 36 TYR A HE2  6  
ATOM 7801  H HH   . TYR A 1 36 ? 2.490   -0.921  -2.805  1.00 0.00 ? 36 TYR A HH   6  
ATOM 7802  N N    . ASN A 1 37 ? -5.315  -3.206  -5.570  1.00 0.00 ? 37 ASN A N    6  
ATOM 7803  C CA   . ASN A 1 37 ? -6.657  -3.094  -6.116  1.00 0.00 ? 37 ASN A CA   6  
ATOM 7804  C C    . ASN A 1 37 ? -6.916  -1.644  -6.529  1.00 0.00 ? 37 ASN A C    6  
ATOM 7805  O O    . ASN A 1 37 ? -6.444  -0.715  -5.875  1.00 0.00 ? 37 ASN A O    6  
ATOM 7806  C CB   . ASN A 1 37 ? -7.708  -3.485  -5.075  1.00 0.00 ? 37 ASN A CB   6  
ATOM 7807  C CG   . ASN A 1 37 ? -8.359  -4.824  -5.429  1.00 0.00 ? 37 ASN A CG   6  
ATOM 7808  O OD1  . ASN A 1 37 ? -9.341  -4.895  -6.149  1.00 0.00 ? 37 ASN A OD1  6  
ATOM 7809  N ND2  . ASN A 1 37 ? -7.759  -5.878  -4.883  1.00 0.00 ? 37 ASN A ND2  6  
ATOM 7810  H H    . ASN A 1 37 ? -5.239  -3.018  -4.591  1.00 0.00 ? 37 ASN A H    6  
ATOM 7811  H HA   . ASN A 1 37 ? -6.679  -3.780  -6.963  1.00 0.00 ? 37 ASN A HA   6  
ATOM 7812  H HB2  . ASN A 1 37 ? -7.244  -3.550  -4.091  1.00 0.00 ? 37 ASN A HB2  6  
ATOM 7813  H HB3  . ASN A 1 37 ? -8.472  -2.710  -5.016  1.00 0.00 ? 37 ASN A HB3  6  
ATOM 7814  H HD21 . ASN A 1 37 ? -6.956  -5.750  -4.301  1.00 0.00 ? 37 ASN A HD21 6  
ATOM 7815  H HD22 . ASN A 1 37 ? -8.110  -6.798  -5.055  1.00 0.00 ? 37 ASN A HD22 6  
ATOM 7816  N N    . PHE A 1 38 ? -7.666  -1.496  -7.611  1.00 0.00 ? 38 PHE A N    6  
ATOM 7817  C CA   . PHE A 1 38 ? -7.993  -0.174  -8.119  1.00 0.00 ? 38 PHE A CA   6  
ATOM 7818  C C    . PHE A 1 38 ? -9.502  -0.025  -8.325  1.00 0.00 ? 38 PHE A C    6  
ATOM 7819  O O    . PHE A 1 38 ? -10.188 -0.996  -8.639  1.00 0.00 ? 38 PHE A O    6  
ATOM 7820  C CB   . PHE A 1 38 ? -7.289  -0.027  -9.469  1.00 0.00 ? 38 PHE A CB   6  
ATOM 7821  C CG   . PHE A 1 38 ? -5.779  -0.266  -9.412  1.00 0.00 ? 38 PHE A CG   6  
ATOM 7822  C CD1  . PHE A 1 38 ? -4.937  0.764   -9.129  1.00 0.00 ? 38 PHE A CD1  6  
ATOM 7823  C CD2  . PHE A 1 38 ? -5.278  -1.509  -9.644  1.00 0.00 ? 38 PHE A CD2  6  
ATOM 7824  C CE1  . PHE A 1 38 ? -3.535  0.542   -9.076  1.00 0.00 ? 38 PHE A CE1  6  
ATOM 7825  C CE2  . PHE A 1 38 ? -3.876  -1.731  -9.591  1.00 0.00 ? 38 PHE A CE2  6  
ATOM 7826  C CZ   . PHE A 1 38 ? -3.035  -0.701  -9.308  1.00 0.00 ? 38 PHE A CZ   6  
ATOM 7827  H H    . PHE A 1 38 ? -8.046  -2.257  -8.136  1.00 0.00 ? 38 PHE A H    6  
ATOM 7828  H HA   . PHE A 1 38 ? -7.657  0.550   -7.377  1.00 0.00 ? 38 PHE A HA   6  
ATOM 7829  H HB2  . PHE A 1 38 ? -7.731  -0.728  -10.177 1.00 0.00 ? 38 PHE A HB2  6  
ATOM 7830  H HB3  . PHE A 1 38 ? -7.473  0.976   -9.855  1.00 0.00 ? 38 PHE A HB3  6  
ATOM 7831  H HD1  . PHE A 1 38 ? -5.338  1.761   -8.943  1.00 0.00 ? 38 PHE A HD1  6  
ATOM 7832  H HD2  . PHE A 1 38 ? -5.952  -2.335  -9.870  1.00 0.00 ? 38 PHE A HD2  6  
ATOM 7833  H HE1  . PHE A 1 38 ? -2.861  1.368   -8.850  1.00 0.00 ? 38 PHE A HE1  6  
ATOM 7834  H HE2  . PHE A 1 38 ? -3.475  -2.727  -9.777  1.00 0.00 ? 38 PHE A HE2  6  
ATOM 7835  H HZ   . PHE A 1 38 ? -1.959  -0.871  -9.268  1.00 0.00 ? 38 PHE A HZ   6  
ATOM 7836  N N    . PHE A 1 39 ? -9.974  1.199   -8.141  1.00 0.00 ? 39 PHE A N    6  
ATOM 7837  C CA   . PHE A 1 39 ? -11.389 1.488   -8.303  1.00 0.00 ? 39 PHE A CA   6  
ATOM 7838  C C    . PHE A 1 39 ? -11.613 2.968   -8.620  1.00 0.00 ? 39 PHE A C    6  
ATOM 7839  O O    . PHE A 1 39 ? -10.677 3.765   -8.578  1.00 0.00 ? 39 PHE A O    6  
ATOM 7840  C CB   . PHE A 1 39 ? -12.069 1.155   -6.974  1.00 0.00 ? 39 PHE A CB   6  
ATOM 7841  C CG   . PHE A 1 39 ? -11.391 1.781   -5.753  1.00 0.00 ? 39 PHE A CG   6  
ATOM 7842  C CD1  . PHE A 1 39 ? -11.381 3.133   -5.600  1.00 0.00 ? 39 PHE A CD1  6  
ATOM 7843  C CD2  . PHE A 1 39 ? -10.798 0.987   -4.822  1.00 0.00 ? 39 PHE A CD2  6  
ATOM 7844  C CE1  . PHE A 1 39 ? -10.752 3.714   -4.468  1.00 0.00 ? 39 PHE A CE1  6  
ATOM 7845  C CE2  . PHE A 1 39 ? -10.169 1.568   -3.690  1.00 0.00 ? 39 PHE A CE2  6  
ATOM 7846  C CZ   . PHE A 1 39 ? -10.159 2.920   -3.536  1.00 0.00 ? 39 PHE A CZ   6  
ATOM 7847  H H    . PHE A 1 39 ? -9.409  1.984   -7.885  1.00 0.00 ? 39 PHE A H    6  
ATOM 7848  H HA   . PHE A 1 39 ? -11.750 0.882   -9.134  1.00 0.00 ? 39 PHE A HA   6  
ATOM 7849  H HB2  . PHE A 1 39 ? -13.105 1.490   -7.013  1.00 0.00 ? 39 PHE A HB2  6  
ATOM 7850  H HB3  . PHE A 1 39 ? -12.089 0.072   -6.849  1.00 0.00 ? 39 PHE A HB3  6  
ATOM 7851  H HD1  . PHE A 1 39 ? -11.856 3.769   -6.347  1.00 0.00 ? 39 PHE A HD1  6  
ATOM 7852  H HD2  . PHE A 1 39 ? -10.806 -0.096  -4.945  1.00 0.00 ? 39 PHE A HD2  6  
ATOM 7853  H HE1  . PHE A 1 39 ? -10.744 4.797   -4.345  1.00 0.00 ? 39 PHE A HE1  6  
ATOM 7854  H HE2  . PHE A 1 39 ? -9.694  0.932   -2.943  1.00 0.00 ? 39 PHE A HE2  6  
ATOM 7855  H HZ   . PHE A 1 39 ? -9.676  3.366   -2.667  1.00 0.00 ? 39 PHE A HZ   6  
ATOM 7856  N N    . GLU A 1 40 ? -12.860 3.292   -8.930  1.00 0.00 ? 40 GLU A N    6  
ATOM 7857  C CA   . GLU A 1 40 ? -13.219 4.662   -9.253  1.00 0.00 ? 40 GLU A CA   6  
ATOM 7858  C C    . GLU A 1 40 ? -13.478 5.459   -7.973  1.00 0.00 ? 40 GLU A C    6  
ATOM 7859  O O    . GLU A 1 40 ? -13.667 4.881   -6.905  1.00 0.00 ? 40 GLU A O    6  
ATOM 7860  C CB   . GLU A 1 40 ? -14.435 4.705   -10.181 1.00 0.00 ? 40 GLU A CB   6  
ATOM 7861  C CG   . GLU A 1 40 ? -15.707 4.291   -9.439  1.00 0.00 ? 40 GLU A CG   6  
ATOM 7862  C CD   . GLU A 1 40 ? -16.939 4.446   -10.333 1.00 0.00 ? 40 GLU A CD   6  
ATOM 7863  O OE1  . GLU A 1 40 ? -16.840 4.039   -11.510 1.00 0.00 ? 40 GLU A OE1  6  
ATOM 7864  O OE2  . GLU A 1 40 ? -17.951 4.967   -9.818  1.00 0.00 ? 40 GLU A OE2  6  
ATOM 7865  H H    . GLU A 1 40 ? -13.616 2.638   -8.961  1.00 0.00 ? 40 GLU A H    6  
ATOM 7866  H HA   . GLU A 1 40 ? -12.356 5.072   -9.777  1.00 0.00 ? 40 GLU A HA   6  
ATOM 7867  H HB2  . GLU A 1 40 ? -14.555 5.712   -10.582 1.00 0.00 ? 40 GLU A HB2  6  
ATOM 7868  H HB3  . GLU A 1 40 ? -14.273 4.041   -11.030 1.00 0.00 ? 40 GLU A HB3  6  
ATOM 7869  H HG2  . GLU A 1 40 ? -15.619 3.255   -9.110  1.00 0.00 ? 40 GLU A HG2  6  
ATOM 7870  H HG3  . GLU A 1 40 ? -15.824 4.901   -8.543  1.00 0.00 ? 40 GLU A HG3  6  
ATOM 7871  N N    . CYS A 1 41 ? -13.477 6.776   -8.124  1.00 0.00 ? 41 CYS A N    6  
ATOM 7872  C CA   . CYS A 1 41 ? -13.709 7.658   -6.994  1.00 0.00 ? 41 CYS A CA   6  
ATOM 7873  C C    . CYS A 1 41 ? -15.029 8.397   -7.224  1.00 0.00 ? 41 CYS A C    6  
ATOM 7874  O O    . CYS A 1 41 ? -15.283 8.896   -8.319  1.00 0.00 ? 41 CYS A O    6  
ATOM 7875  C CB   . CYS A 1 41 ? -12.543 8.627   -6.783  1.00 0.00 ? 41 CYS A CB   6  
ATOM 7876  S SG   . CYS A 1 41 ? -12.256 8.881   -4.994  1.00 0.00 ? 41 CYS A SG   6  
ATOM 7877  H H    . CYS A 1 41 ? -13.322 7.239   -8.997  1.00 0.00 ? 41 CYS A H    6  
ATOM 7878  H HA   . CYS A 1 41 ? -13.769 7.025   -6.109  1.00 0.00 ? 41 CYS A HA   6  
ATOM 7879  H HB2  . CYS A 1 41 ? -11.642 8.231   -7.252  1.00 0.00 ? 41 CYS A HB2  6  
ATOM 7880  H HB3  . CYS A 1 41 ? -12.761 9.581   -7.264  1.00 0.00 ? 41 CYS A HB3  6  
ATOM 7881  H HG   . CYS A 1 41 ? -13.432 9.449   -4.743  1.00 0.00 ? 41 CYS A HG   6  
ATOM 7882  N N    . GLU A 1 42 ? -15.836 8.443   -6.173  1.00 0.00 ? 42 GLU A N    6  
ATOM 7883  C CA   . GLU A 1 42 ? -17.123 9.111   -6.247  1.00 0.00 ? 42 GLU A CA   6  
ATOM 7884  C C    . GLU A 1 42 ? -16.933 10.596  -6.563  1.00 0.00 ? 42 GLU A C    6  
ATOM 7885  O O    . GLU A 1 42 ? -17.735 11.189  -7.283  1.00 0.00 ? 42 GLU A O    6  
ATOM 7886  C CB   . GLU A 1 42 ? -17.914 8.923   -4.950  1.00 0.00 ? 42 GLU A CB   6  
ATOM 7887  C CG   . GLU A 1 42 ? -18.732 7.631   -4.989  1.00 0.00 ? 42 GLU A CG   6  
ATOM 7888  C CD   . GLU A 1 42 ? -18.777 6.969   -3.610  1.00 0.00 ? 42 GLU A CD   6  
ATOM 7889  O OE1  . GLU A 1 42 ? -19.575 7.448   -2.776  1.00 0.00 ? 42 GLU A OE1  6  
ATOM 7890  O OE2  . GLU A 1 42 ? -18.011 5.999   -3.421  1.00 0.00 ? 42 GLU A OE2  6  
ATOM 7891  H H    . GLU A 1 42 ? -15.622 8.034   -5.286  1.00 0.00 ? 42 GLU A H    6  
ATOM 7892  H HA   . GLU A 1 42 ? -17.656 8.625   -7.063  1.00 0.00 ? 42 GLU A HA   6  
ATOM 7893  H HB2  . GLU A 1 42 ? -17.229 8.899   -4.103  1.00 0.00 ? 42 GLU A HB2  6  
ATOM 7894  H HB3  . GLU A 1 42 ? -18.578 9.774   -4.798  1.00 0.00 ? 42 GLU A HB3  6  
ATOM 7895  H HG2  . GLU A 1 42 ? -19.746 7.848   -5.325  1.00 0.00 ? 42 GLU A HG2  6  
ATOM 7896  H HG3  . GLU A 1 42 ? -18.296 6.942   -5.713  1.00 0.00 ? 42 GLU A HG3  6  
ATOM 7897  N N    . ASN A 1 43 ? -15.867 11.155  -6.008  1.00 0.00 ? 43 ASN A N    6  
ATOM 7898  C CA   . ASN A 1 43 ? -15.562 12.559  -6.221  1.00 0.00 ? 43 ASN A CA   6  
ATOM 7899  C C    . ASN A 1 43 ? -14.816 12.718  -7.548  1.00 0.00 ? 43 ASN A C    6  
ATOM 7900  O O    . ASN A 1 43 ? -13.985 11.883  -7.901  1.00 0.00 ? 43 ASN A O    6  
ATOM 7901  C CB   . ASN A 1 43 ? -14.666 13.103  -5.107  1.00 0.00 ? 43 ASN A CB   6  
ATOM 7902  C CG   . ASN A 1 43 ? -15.174 14.457  -4.607  1.00 0.00 ? 43 ASN A CG   6  
ATOM 7903  O OD1  . ASN A 1 43 ? -16.357 14.756  -4.642  1.00 0.00 ? 43 ASN A OD1  6  
ATOM 7904  N ND2  . ASN A 1 43 ? -14.218 15.255  -4.140  1.00 0.00 ? 43 ASN A ND2  6  
ATOM 7905  H H    . ASN A 1 43 ? -15.220 10.665  -5.423  1.00 0.00 ? 43 ASN A H    6  
ATOM 7906  H HA   . ASN A 1 43 ? -16.527 13.065  -6.222  1.00 0.00 ? 43 ASN A HA   6  
ATOM 7907  H HB2  . ASN A 1 43 ? -14.636 12.394  -4.280  1.00 0.00 ? 43 ASN A HB2  6  
ATOM 7908  H HB3  . ASN A 1 43 ? -13.645 13.208  -5.474  1.00 0.00 ? 43 ASN A HB3  6  
ATOM 7909  H HD21 . ASN A 1 43 ? -13.267 14.948  -4.140  1.00 0.00 ? 43 ASN A HD21 6  
ATOM 7910  H HD22 . ASN A 1 43 ? -14.451 16.162  -3.790  1.00 0.00 ? 43 ASN A HD22 6  
ATOM 7911  N N    . PRO A 1 44 ? -15.148 13.825  -8.265  1.00 0.00 ? 44 PRO A N    6  
ATOM 7912  C CA   . PRO A 1 44 ? -14.519 14.104  -9.544  1.00 0.00 ? 44 PRO A CA   6  
ATOM 7913  C C    . PRO A 1 44 ? -13.089 14.615  -9.353  1.00 0.00 ? 44 PRO A C    6  
ATOM 7914  O O    . PRO A 1 44 ? -12.276 14.555  -10.274 1.00 0.00 ? 44 PRO A O    6  
ATOM 7915  C CB   . PRO A 1 44 ? -15.428 15.121  -10.216 1.00 0.00 ? 44 PRO A CB   6  
ATOM 7916  C CG   . PRO A 1 44 ? -16.276 15.720  -9.105  1.00 0.00 ? 44 PRO A CG   6  
ATOM 7917  C CD   . PRO A 1 44 ? -16.127 14.836  -7.878  1.00 0.00 ? 44 PRO A CD   6  
ATOM 7918  H HA   . PRO A 1 44 ? -14.440 13.265  -10.083 1.00 0.00 ? 44 PRO A HA   6  
ATOM 7919  H HB2  . PRO A 1 44 ? -14.846 15.891  -10.722 1.00 0.00 ? 44 PRO A HB2  6  
ATOM 7920  H HB3  . PRO A 1 44 ? -16.053 14.646  -10.972 1.00 0.00 ? 44 PRO A HB3  6  
ATOM 7921  H HG2  . PRO A 1 44 ? -15.952 16.737  -8.885  1.00 0.00 ? 44 PRO A HG2  6  
ATOM 7922  H HG3  . PRO A 1 44 ? -17.320 15.777  -9.411  1.00 0.00 ? 44 PRO A HG3  6  
ATOM 7923  H HD2  . PRO A 1 44 ? -15.785 15.409  -7.016  1.00 0.00 ? 44 PRO A HD2  6  
ATOM 7924  H HD3  . PRO A 1 44 ? -17.078 14.381  -7.601  1.00 0.00 ? 44 PRO A HD3  6  
ATOM 7925  N N    . SER A 1 45 ? -12.827 15.107  -8.151  1.00 0.00 ? 45 SER A N    6  
ATOM 7926  C CA   . SER A 1 45 ? -11.510 15.628  -7.827  1.00 0.00 ? 45 SER A CA   6  
ATOM 7927  C C    . SER A 1 45 ? -10.436 14.601  -8.192  1.00 0.00 ? 45 SER A C    6  
ATOM 7928  O O    . SER A 1 45 ? -9.605  14.849  -9.064  1.00 0.00 ? 45 SER A O    6  
ATOM 7929  C CB   . SER A 1 45 ? -11.412 15.994  -6.344  1.00 0.00 ? 45 SER A CB   6  
ATOM 7930  O OG   . SER A 1 45 ? -11.638 17.383  -6.121  1.00 0.00 ? 45 SER A OG   6  
ATOM 7931  H H    . SER A 1 45 ? -13.494 15.152  -7.407  1.00 0.00 ? 45 SER A H    6  
ATOM 7932  H HA   . SER A 1 45 ? -11.399 16.528  -8.431  1.00 0.00 ? 45 SER A HA   6  
ATOM 7933  H HB2  . SER A 1 45 ? -12.140 15.412  -5.778  1.00 0.00 ? 45 SER A HB2  6  
ATOM 7934  H HB3  . SER A 1 45 ? -10.426 15.722  -5.968  1.00 0.00 ? 45 SER A HB3  6  
ATOM 7935  H HG   . SER A 1 45 ? -12.456 17.510  -5.561  1.00 0.00 ? 45 SER A HG   6  
ATOM 7936  N N    . GLU A 1 46 ? -10.489 13.468  -7.506  1.00 0.00 ? 46 GLU A N    6  
ATOM 7937  C CA   . GLU A 1 46 ? -9.531  12.402  -7.748  1.00 0.00 ? 46 GLU A CA   6  
ATOM 7938  C C    . GLU A 1 46 ? -10.259 11.110  -8.123  1.00 0.00 ? 46 GLU A C    6  
ATOM 7939  O O    . GLU A 1 46 ? -10.636 10.329  -7.250  1.00 0.00 ? 46 GLU A O    6  
ATOM 7940  C CB   . GLU A 1 46 ? -8.629  12.190  -6.530  1.00 0.00 ? 46 GLU A CB   6  
ATOM 7941  C CG   . GLU A 1 46 ? -7.775  13.429  -6.258  1.00 0.00 ? 46 GLU A CG   6  
ATOM 7942  C CD   . GLU A 1 46 ? -7.517  13.599  -4.759  1.00 0.00 ? 46 GLU A CD   6  
ATOM 7943  O OE1  . GLU A 1 46 ? -8.517  13.600  -4.008  1.00 0.00 ? 46 GLU A OE1  6  
ATOM 7944  O OE2  . GLU A 1 46 ? -6.327  13.724  -4.399  1.00 0.00 ? 46 GLU A OE2  6  
ATOM 7945  H H    . GLU A 1 46 ? -11.168 13.274  -6.799  1.00 0.00 ? 46 GLU A H    6  
ATOM 7946  H HA   . GLU A 1 46 ? -8.925  12.742  -8.587  1.00 0.00 ? 46 GLU A HA   6  
ATOM 7947  H HB2  . GLU A 1 46 ? -9.240  11.965  -5.656  1.00 0.00 ? 46 GLU A HB2  6  
ATOM 7948  H HB3  . GLU A 1 46 ? -7.983  11.328  -6.698  1.00 0.00 ? 46 GLU A HB3  6  
ATOM 7949  H HG2  . GLU A 1 46 ? -6.826  13.345  -6.786  1.00 0.00 ? 46 GLU A HG2  6  
ATOM 7950  H HG3  . GLU A 1 46 ? -8.278  14.315  -6.646  1.00 0.00 ? 46 GLU A HG3  6  
ATOM 7951  N N    . PRO A 1 47 ? -10.440 10.919  -9.457  1.00 0.00 ? 47 PRO A N    6  
ATOM 7952  C CA   . PRO A 1 47 ? -11.116 9.734   -9.959  1.00 0.00 ? 47 PRO A CA   6  
ATOM 7953  C C    . PRO A 1 47 ? -10.208 8.506   -9.871  1.00 0.00 ? 47 PRO A C    6  
ATOM 7954  O O    . PRO A 1 47 ? -10.690 7.375   -9.830  1.00 0.00 ? 47 PRO A O    6  
ATOM 7955  C CB   . PRO A 1 47 ? -11.511 10.081  -11.385 1.00 0.00 ? 47 PRO A CB   6  
ATOM 7956  C CG   . PRO A 1 47 ? -10.640 11.261  -11.783 1.00 0.00 ? 47 PRO A CG   6  
ATOM 7957  C CD   . PRO A 1 47 ? -10.008 11.822  -10.520 1.00 0.00 ? 47 PRO A CD   6  
ATOM 7958  H HA   . PRO A 1 47 ? -11.915 9.525   -9.394  1.00 0.00 ? 47 PRO A HA   6  
ATOM 7959  H HB2  . PRO A 1 47 ? -11.350 9.234   -12.052 1.00 0.00 ? 47 PRO A HB2  6  
ATOM 7960  H HB3  . PRO A 1 47 ? -12.568 10.338  -11.446 1.00 0.00 ? 47 PRO A HB3  6  
ATOM 7961  H HG2  . PRO A 1 47 ? -9.870  10.946  -12.488 1.00 0.00 ? 47 PRO A HG2  6  
ATOM 7962  H HG3  . PRO A 1 47 ? -11.236 12.024  -12.283 1.00 0.00 ? 47 PRO A HG3  6  
ATOM 7963  H HD2  . PRO A 1 47 ? -8.921  11.849  -10.598 1.00 0.00 ? 47 PRO A HD2  6  
ATOM 7964  H HD3  . PRO A 1 47 ? -10.340 12.843  -10.331 1.00 0.00 ? 47 PRO A HD3  6  
ATOM 7965  N N    . PHE A 1 48 ? -8.910  8.770   -9.845  1.00 0.00 ? 48 PHE A N    6  
ATOM 7966  C CA   . PHE A 1 48 ? -7.930  7.701   -9.763  1.00 0.00 ? 48 PHE A CA   6  
ATOM 7967  C C    . PHE A 1 48 ? -7.741  7.240   -8.317  1.00 0.00 ? 48 PHE A C    6  
ATOM 7968  O O    . PHE A 1 48 ? -7.130  7.942   -7.513  1.00 0.00 ? 48 PHE A O    6  
ATOM 7969  C CB   . PHE A 1 48 ? -6.607  8.266   -10.283 1.00 0.00 ? 48 PHE A CB   6  
ATOM 7970  C CG   . PHE A 1 48 ? -6.660  8.736   -11.738 1.00 0.00 ? 48 PHE A CG   6  
ATOM 7971  C CD1  . PHE A 1 48 ? -7.136  9.975   -12.036 1.00 0.00 ? 48 PHE A CD1  6  
ATOM 7972  C CD2  . PHE A 1 48 ? -6.231  7.915   -12.734 1.00 0.00 ? 48 PHE A CD2  6  
ATOM 7973  C CE1  . PHE A 1 48 ? -7.185  10.411  -13.386 1.00 0.00 ? 48 PHE A CE1  6  
ATOM 7974  C CE2  . PHE A 1 48 ? -6.280  8.352   -14.085 1.00 0.00 ? 48 PHE A CE2  6  
ATOM 7975  C CZ   . PHE A 1 48 ? -6.756  9.590   -14.382 1.00 0.00 ? 48 PHE A CZ   6  
ATOM 7976  H H    . PHE A 1 48 ? -8.527  9.693   -9.879  1.00 0.00 ? 48 PHE A H    6  
ATOM 7977  H HA   . PHE A 1 48 ? -8.307  6.871   -10.361 1.00 0.00 ? 48 PHE A HA   6  
ATOM 7978  H HB2  . PHE A 1 48 ? -6.308  9.103   -9.652  1.00 0.00 ? 48 PHE A HB2  6  
ATOM 7979  H HB3  . PHE A 1 48 ? -5.835  7.502   -10.187 1.00 0.00 ? 48 PHE A HB3  6  
ATOM 7980  H HD1  . PHE A 1 48 ? -7.480  10.632  -11.237 1.00 0.00 ? 48 PHE A HD1  6  
ATOM 7981  H HD2  . PHE A 1 48 ? -5.849  6.923   -12.496 1.00 0.00 ? 48 PHE A HD2  6  
ATOM 7982  H HE1  . PHE A 1 48 ? -7.567  11.404  -13.624 1.00 0.00 ? 48 PHE A HE1  6  
ATOM 7983  H HE2  . PHE A 1 48 ? -5.936  7.694   -14.883 1.00 0.00 ? 48 PHE A HE2  6  
ATOM 7984  H HZ   . PHE A 1 48 ? -6.794  9.925   -15.419 1.00 0.00 ? 48 PHE A HZ   6  
ATOM 7985  N N    . GLY A 1 49 ? -8.277  6.063   -8.029  1.00 0.00 ? 49 GLY A N    6  
ATOM 7986  C CA   . GLY A 1 49 ? -8.175  5.500   -6.694  1.00 0.00 ? 49 GLY A CA   6  
ATOM 7987  C C    . GLY A 1 49 ? -7.534  4.111   -6.732  1.00 0.00 ? 49 GLY A C    6  
ATOM 7988  O O    . GLY A 1 49 ? -7.745  3.351   -7.676  1.00 0.00 ? 49 GLY A O    6  
ATOM 7989  H H    . GLY A 1 49 ? -8.773  5.498   -8.689  1.00 0.00 ? 49 GLY A H    6  
ATOM 7990  H HA2  . GLY A 1 49 ? -7.582  6.161   -6.061  1.00 0.00 ? 49 GLY A HA2  6  
ATOM 7991  H HA3  . GLY A 1 49 ? -9.167  5.435   -6.246  1.00 0.00 ? 49 GLY A HA3  6  
ATOM 7992  N N    . ALA A 1 50 ? -6.764  3.821   -5.693  1.00 0.00 ? 50 ALA A N    6  
ATOM 7993  C CA   . ALA A 1 50 ? -6.091  2.537   -5.596  1.00 0.00 ? 50 ALA A CA   6  
ATOM 7994  C C    . ALA A 1 50 ? -6.030  2.109   -4.128  1.00 0.00 ? 50 ALA A C    6  
ATOM 7995  O O    . ALA A 1 50 ? -5.952  2.950   -3.234  1.00 0.00 ? 50 ALA A O    6  
ATOM 7996  C CB   . ALA A 1 50 ? -4.703  2.638   -6.232  1.00 0.00 ? 50 ALA A CB   6  
ATOM 7997  H H    . ALA A 1 50 ? -6.597  4.445   -4.929  1.00 0.00 ? 50 ALA A H    6  
ATOM 7998  H HA   . ALA A 1 50 ? -6.681  1.810   -6.154  1.00 0.00 ? 50 ALA A HA   6  
ATOM 7999  H HB1  . ALA A 1 50 ? -4.594  1.863   -6.990  1.00 0.00 ? 50 ALA A HB1  6  
ATOM 8000  H HB2  . ALA A 1 50 ? -4.586  3.618   -6.695  1.00 0.00 ? 50 ALA A HB2  6  
ATOM 8001  H HB3  . ALA A 1 50 ? -3.941  2.506   -5.464  1.00 0.00 ? 50 ALA A HB3  6  
ATOM 8002  N N    . SER A 1 51 ? -6.068  0.800   -3.925  1.00 0.00 ? 51 SER A N    6  
ATOM 8003  C CA   . SER A 1 51 ? -6.018  0.249   -2.581  1.00 0.00 ? 51 SER A CA   6  
ATOM 8004  C C    . SER A 1 51 ? -4.958  -0.852  -2.506  1.00 0.00 ? 51 SER A C    6  
ATOM 8005  O O    . SER A 1 51 ? -4.611  -1.455  -3.521  1.00 0.00 ? 51 SER A O    6  
ATOM 8006  C CB   . SER A 1 51 ? -7.382  -0.299  -2.159  1.00 0.00 ? 51 SER A CB   6  
ATOM 8007  O OG   . SER A 1 51 ? -8.193  -0.635  -3.282  1.00 0.00 ? 51 SER A OG   6  
ATOM 8008  H H    . SER A 1 51 ? -6.131  0.122   -4.658  1.00 0.00 ? 51 SER A H    6  
ATOM 8009  H HA   . SER A 1 51 ? -5.747  1.085   -1.937  1.00 0.00 ? 51 SER A HA   6  
ATOM 8010  H HB2  . SER A 1 51 ? -7.242  -1.182  -1.536  1.00 0.00 ? 51 SER A HB2  6  
ATOM 8011  H HB3  . SER A 1 51 ? -7.898  0.443   -1.549  1.00 0.00 ? 51 SER A HB3  6  
ATOM 8012  H HG   . SER A 1 51 ? -7.619  -0.967  -4.031  1.00 0.00 ? 51 SER A HG   6  
ATOM 8013  N N    . VAL A 1 52 ? -4.472  -1.080  -1.295  1.00 0.00 ? 52 VAL A N    6  
ATOM 8014  C CA   . VAL A 1 52 ? -3.459  -2.097  -1.074  1.00 0.00 ? 52 VAL A CA   6  
ATOM 8015  C C    . VAL A 1 52 ? -4.061  -3.242  -0.258  1.00 0.00 ? 52 VAL A C    6  
ATOM 8016  O O    . VAL A 1 52 ? -4.227  -3.125  0.955   1.00 0.00 ? 52 VAL A O    6  
ATOM 8017  C CB   . VAL A 1 52 ? -2.228  -1.475  -0.412  1.00 0.00 ? 52 VAL A CB   6  
ATOM 8018  C CG1  . VAL A 1 52 ? -1.306  -2.555  0.158   1.00 0.00 ? 52 VAL A CG1  6  
ATOM 8019  C CG2  . VAL A 1 52 ? -1.475  -0.573  -1.392  1.00 0.00 ? 52 VAL A CG2  6  
ATOM 8020  H H    . VAL A 1 52 ? -4.759  -0.584  -0.475  1.00 0.00 ? 52 VAL A H    6  
ATOM 8021  H HA   . VAL A 1 52 ? -3.160  -2.481  -2.049  1.00 0.00 ? 52 VAL A HA   6  
ATOM 8022  H HB   . VAL A 1 52 ? -2.570  -0.855  0.417   1.00 0.00 ? 52 VAL A HB   6  
ATOM 8023  H HG11 . VAL A 1 52 ? -1.803  -3.056  0.988   1.00 0.00 ? 52 VAL A HG11 6  
ATOM 8024  H HG12 . VAL A 1 52 ? -1.076  -3.283  -0.620  1.00 0.00 ? 52 VAL A HG12 6  
ATOM 8025  H HG13 . VAL A 1 52 ? -0.383  -2.096  0.511   1.00 0.00 ? 52 VAL A HG13 6  
ATOM 8026  H HG21 . VAL A 1 52 ? -2.112  0.264   -1.678  1.00 0.00 ? 52 VAL A HG21 6  
ATOM 8027  H HG22 . VAL A 1 52 ? -0.570  -0.195  -0.917  1.00 0.00 ? 52 VAL A HG22 6  
ATOM 8028  H HG23 . VAL A 1 52 ? -1.207  -1.145  -2.280  1.00 0.00 ? 52 VAL A HG23 6  
ATOM 8029  N N    . THR A 1 53 ? -4.373  -4.324  -0.956  1.00 0.00 ? 53 THR A N    6  
ATOM 8030  C CA   . THR A 1 53 ? -4.954  -5.490  -0.312  1.00 0.00 ? 53 THR A CA   6  
ATOM 8031  C C    . THR A 1 53 ? -3.869  -6.524  -0.002  1.00 0.00 ? 53 THR A C    6  
ATOM 8032  O O    . THR A 1 53 ? -3.165  -6.978  -0.902  1.00 0.00 ? 53 THR A O    6  
ATOM 8033  C CB   . THR A 1 53 ? -6.064  -6.026  -1.217  1.00 0.00 ? 53 THR A CB   6  
ATOM 8034  O OG1  . THR A 1 53 ? -5.548  -5.861  -2.535  1.00 0.00 ? 53 THR A OG1  6  
ATOM 8035  C CG2  . THR A 1 53 ? -7.315  -5.146  -1.194  1.00 0.00 ? 53 THR A CG2  6  
ATOM 8036  H H    . THR A 1 53 ? -4.235  -4.412  -1.943  1.00 0.00 ? 53 THR A H    6  
ATOM 8037  H HA   . THR A 1 53 ? -5.380  -5.178  0.642   1.00 0.00 ? 53 THR A HA   6  
ATOM 8038  H HB   . THR A 1 53 ? -6.309  -7.058  -0.963  1.00 0.00 ? 53 THR A HB   6  
ATOM 8039  H HG1  . THR A 1 53 ? -4.748  -6.447  -2.665  1.00 0.00 ? 53 THR A HG1  6  
ATOM 8040  H HG21 . THR A 1 53 ? -8.195  -5.769  -1.036  1.00 0.00 ? 53 THR A HG21 6  
ATOM 8041  H HG22 . THR A 1 53 ? -7.234  -4.420  -0.385  1.00 0.00 ? 53 THR A HG22 6  
ATOM 8042  H HG23 . THR A 1 53 ? -7.408  -4.621  -2.145  1.00 0.00 ? 53 THR A HG23 6  
ATOM 8043  N N    . ILE A 1 54 ? -3.769  -6.864  1.274   1.00 0.00 ? 54 ILE A N    6  
ATOM 8044  C CA   . ILE A 1 54 ? -2.782  -7.836  1.714   1.00 0.00 ? 54 ILE A CA   6  
ATOM 8045  C C    . ILE A 1 54 ? -3.443  -9.211  1.831   1.00 0.00 ? 54 ILE A C    6  
ATOM 8046  O O    . ILE A 1 54 ? -4.171  -9.475  2.787   1.00 0.00 ? 54 ILE A O    6  
ATOM 8047  C CB   . ILE A 1 54 ? -2.106  -7.368  3.004   1.00 0.00 ? 54 ILE A CB   6  
ATOM 8048  C CG1  . ILE A 1 54 ? -1.192  -6.170  2.740   1.00 0.00 ? 54 ILE A CG1  6  
ATOM 8049  C CG2  . ILE A 1 54 ? -1.362  -8.519  3.682   1.00 0.00 ? 54 ILE A CG2  6  
ATOM 8050  C CD1  . ILE A 1 54 ? -0.722  -5.539  4.052   1.00 0.00 ? 54 ILE A CD1  6  
ATOM 8051  H H    . ILE A 1 54 ? -4.346  -6.490  2.000   1.00 0.00 ? 54 ILE A H    6  
ATOM 8052  H HA   . ILE A 1 54 ? -2.010  -7.888  0.946   1.00 0.00 ? 54 ILE A HA   6  
ATOM 8053  H HB   . ILE A 1 54 ? -2.882  -7.035  3.694   1.00 0.00 ? 54 ILE A HB   6  
ATOM 8054  H HG12 . ILE A 1 54 ? -0.328  -6.489  2.156   1.00 0.00 ? 54 ILE A HG12 6  
ATOM 8055  H HG13 . ILE A 1 54 ? -1.722  -5.427  2.145   1.00 0.00 ? 54 ILE A HG13 6  
ATOM 8056  H HG21 . ILE A 1 54 ? -1.350  -9.385  3.020   1.00 0.00 ? 54 ILE A HG21 6  
ATOM 8057  H HG22 . ILE A 1 54 ? -0.338  -8.213  3.898   1.00 0.00 ? 54 ILE A HG22 6  
ATOM 8058  H HG23 . ILE A 1 54 ? -1.866  -8.780  4.613   1.00 0.00 ? 54 ILE A HG23 6  
ATOM 8059  H HD11 . ILE A 1 54 ? 0.314   -5.217  3.951   1.00 0.00 ? 54 ILE A HD11 6  
ATOM 8060  H HD12 . ILE A 1 54 ? -1.348  -4.677  4.286   1.00 0.00 ? 54 ILE A HD12 6  
ATOM 8061  H HD13 . ILE A 1 54 ? -0.798  -6.271  4.856   1.00 0.00 ? 54 ILE A HD13 6  
ATOM 8062  N N    . ASP A 1 55 ? -3.167  -10.051 0.844   1.00 0.00 ? 55 ASP A N    6  
ATOM 8063  C CA   . ASP A 1 55 ? -3.726  -11.392 0.824   1.00 0.00 ? 55 ASP A CA   6  
ATOM 8064  C C    . ASP A 1 55 ? -5.250  -11.303 0.730   1.00 0.00 ? 55 ASP A C    6  
ATOM 8065  O O    . ASP A 1 55 ? -5.950  -12.279 0.995   1.00 0.00 ? 55 ASP A O    6  
ATOM 8066  C CB   . ASP A 1 55 ? -3.375  -12.154 2.103   1.00 0.00 ? 55 ASP A CB   6  
ATOM 8067  C CG   . ASP A 1 55 ? -3.767  -13.633 2.103   1.00 0.00 ? 55 ASP A CG   6  
ATOM 8068  O OD1  . ASP A 1 55 ? -3.681  -14.243 1.015   1.00 0.00 ? 55 ASP A OD1  6  
ATOM 8069  O OD2  . ASP A 1 55 ? -4.144  -14.120 3.190   1.00 0.00 ? 55 ASP A OD2  6  
ATOM 8070  H H    . ASP A 1 55 ? -2.574  -9.828  0.070   1.00 0.00 ? 55 ASP A H    6  
ATOM 8071  H HA   . ASP A 1 55 ? -3.282  -11.874 -0.047  1.00 0.00 ? 55 ASP A HA   6  
ATOM 8072  H HB2  . ASP A 1 55 ? -2.300  -12.079 2.270   1.00 0.00 ? 55 ASP A HB2  6  
ATOM 8073  H HB3  . ASP A 1 55 ? -3.863  -11.664 2.945   1.00 0.00 ? 55 ASP A HB3  6  
ATOM 8074  N N    . GLY A 1 56 ? -5.720  -10.124 0.351   1.00 0.00 ? 56 GLY A N    6  
ATOM 8075  C CA   . GLY A 1 56 ? -7.149  -9.894  0.218   1.00 0.00 ? 56 GLY A CA   6  
ATOM 8076  C C    . GLY A 1 56 ? -7.645  -8.901  1.271   1.00 0.00 ? 56 GLY A C    6  
ATOM 8077  O O    . GLY A 1 56 ? -8.658  -8.233  1.070   1.00 0.00 ? 56 GLY A O    6  
ATOM 8078  H H    . GLY A 1 56 ? -5.144  -9.335  0.136   1.00 0.00 ? 56 GLY A H    6  
ATOM 8079  H HA2  . GLY A 1 56 ? -7.369  -9.514  -0.779  1.00 0.00 ? 56 GLY A HA2  6  
ATOM 8080  H HA3  . GLY A 1 56 ? -7.684  -10.838 0.324   1.00 0.00 ? 56 GLY A HA3  6  
ATOM 8081  N N    . VAL A 1 57 ? -6.907  -8.834  2.369   1.00 0.00 ? 57 VAL A N    6  
ATOM 8082  C CA   . VAL A 1 57 ? -7.259  -7.933  3.453   1.00 0.00 ? 57 VAL A CA   6  
ATOM 8083  C C    . VAL A 1 57 ? -6.811  -6.514  3.098   1.00 0.00 ? 57 VAL A C    6  
ATOM 8084  O O    . VAL A 1 57 ? -5.633  -6.280  2.834   1.00 0.00 ? 57 VAL A O    6  
ATOM 8085  C CB   . VAL A 1 57 ? -6.661  -8.437  4.768   1.00 0.00 ? 57 VAL A CB   6  
ATOM 8086  C CG1  . VAL A 1 57 ? -6.601  -7.317  5.808   1.00 0.00 ? 57 VAL A CG1  6  
ATOM 8087  C CG2  . VAL A 1 57 ? -7.442  -9.639  5.301   1.00 0.00 ? 57 VAL A CG2  6  
ATOM 8088  H H    . VAL A 1 57 ? -6.084  -9.381  2.524   1.00 0.00 ? 57 VAL A H    6  
ATOM 8089  H HA   . VAL A 1 57 ? -8.345  -7.944  3.551   1.00 0.00 ? 57 VAL A HA   6  
ATOM 8090  H HB   . VAL A 1 57 ? -5.640  -8.763  4.568   1.00 0.00 ? 57 VAL A HB   6  
ATOM 8091  H HG11 . VAL A 1 57 ? -5.803  -6.621  5.547   1.00 0.00 ? 57 VAL A HG11 6  
ATOM 8092  H HG12 . VAL A 1 57 ? -7.553  -6.787  5.828   1.00 0.00 ? 57 VAL A HG12 6  
ATOM 8093  H HG13 . VAL A 1 57 ? -6.402  -7.744  6.791   1.00 0.00 ? 57 VAL A HG13 6  
ATOM 8094  H HG21 . VAL A 1 57 ? -7.296  -9.719  6.378   1.00 0.00 ? 57 VAL A HG21 6  
ATOM 8095  H HG22 . VAL A 1 57 ? -8.503  -9.506  5.088   1.00 0.00 ? 57 VAL A HG22 6  
ATOM 8096  H HG23 . VAL A 1 57 ? -7.086  -10.548 4.817   1.00 0.00 ? 57 VAL A HG23 6  
ATOM 8097  N N    . THR A 1 58 ? -7.774  -5.605  3.102   1.00 0.00 ? 58 THR A N    6  
ATOM 8098  C CA   . THR A 1 58 ? -7.493  -4.215  2.783   1.00 0.00 ? 58 THR A CA   6  
ATOM 8099  C C    . THR A 1 58 ? -6.792  -3.530  3.957   1.00 0.00 ? 58 THR A C    6  
ATOM 8100  O O    . THR A 1 58 ? -7.164  -3.734  5.111   1.00 0.00 ? 58 THR A O    6  
ATOM 8101  C CB   . THR A 1 58 ? -8.811  -3.546  2.386   1.00 0.00 ? 58 THR A CB   6  
ATOM 8102  O OG1  . THR A 1 58 ? -9.380  -4.436  1.430   1.00 0.00 ? 58 THR A OG1  6  
ATOM 8103  C CG2  . THR A 1 58 ? -8.596  -2.248  1.605   1.00 0.00 ? 58 THR A CG2  6  
ATOM 8104  H H    . THR A 1 58 ? -8.730  -5.804  3.317   1.00 0.00 ? 58 THR A H    6  
ATOM 8105  H HA   . THR A 1 58 ? -6.804  -4.189  1.939   1.00 0.00 ? 58 THR A HA   6  
ATOM 8106  H HB   . THR A 1 58 ? -9.439  -3.374  3.261   1.00 0.00 ? 58 THR A HB   6  
ATOM 8107  H HG1  . THR A 1 58 ? -10.164 -4.005  0.986   1.00 0.00 ? 58 THR A HG1  6  
ATOM 8108  H HG21 . THR A 1 58 ? -8.202  -2.480  0.616   1.00 0.00 ? 58 THR A HG21 6  
ATOM 8109  H HG22 . THR A 1 58 ? -9.546  -1.723  1.504   1.00 0.00 ? 58 THR A HG22 6  
ATOM 8110  H HG23 . THR A 1 58 ? -7.887  -1.615  2.139   1.00 0.00 ? 58 THR A HG23 6  
ATOM 8111  N N    . TYR A 1 59 ? -5.790  -2.730  3.621   1.00 0.00 ? 59 TYR A N    6  
ATOM 8112  C CA   . TYR A 1 59 ? -5.034  -2.013  4.633   1.00 0.00 ? 59 TYR A CA   6  
ATOM 8113  C C    . TYR A 1 59 ? -5.046  -0.508  4.363   1.00 0.00 ? 59 TYR A C    6  
ATOM 8114  O O    . TYR A 1 59 ? -5.866  0.220   4.919   1.00 0.00 ? 59 TYR A O    6  
ATOM 8115  C CB   . TYR A 1 59 ? -3.596  -2.527  4.528   1.00 0.00 ? 59 TYR A CB   6  
ATOM 8116  C CG   . TYR A 1 59 ? -3.300  -3.735  5.419   1.00 0.00 ? 59 TYR A CG   6  
ATOM 8117  C CD1  . TYR A 1 59 ? -3.709  -4.995  5.032   1.00 0.00 ? 59 TYR A CD1  6  
ATOM 8118  C CD2  . TYR A 1 59 ? -2.624  -3.564  6.611   1.00 0.00 ? 59 TYR A CD2  6  
ATOM 8119  C CE1  . TYR A 1 59 ? -3.431  -6.131  5.871   1.00 0.00 ? 59 TYR A CE1  6  
ATOM 8120  C CE2  . TYR A 1 59 ? -2.345  -4.701  7.449   1.00 0.00 ? 59 TYR A CE2  6  
ATOM 8121  C CZ   . TYR A 1 59 ? -2.762  -5.928  7.038   1.00 0.00 ? 59 TYR A CZ   6  
ATOM 8122  O OH   . TYR A 1 59 ? -2.499  -7.002  7.831   1.00 0.00 ? 59 TYR A OH   6  
ATOM 8123  H H    . TYR A 1 59 ? -5.494  -2.570  2.680   1.00 0.00 ? 59 TYR A H    6  
ATOM 8124  H HA   . TYR A 1 59 ? -5.499  -2.205  5.600   1.00 0.00 ? 59 TYR A HA   6  
ATOM 8125  H HB2  . TYR A 1 59 ? -3.392  -2.795  3.491   1.00 0.00 ? 59 TYR A HB2  6  
ATOM 8126  H HB3  . TYR A 1 59 ? -2.913  -1.719  4.789   1.00 0.00 ? 59 TYR A HB3  6  
ATOM 8127  H HD1  . TYR A 1 59 ? -4.243  -5.129  4.092   1.00 0.00 ? 59 TYR A HD1  6  
ATOM 8128  H HD2  . TYR A 1 59 ? -2.301  -2.569  6.916   1.00 0.00 ? 59 TYR A HD2  6  
ATOM 8129  H HE1  . TYR A 1 59 ? -3.748  -7.132  5.578   1.00 0.00 ? 59 TYR A HE1  6  
ATOM 8130  H HE2  . TYR A 1 59 ? -1.812  -4.580  8.392   1.00 0.00 ? 59 TYR A HE2  6  
ATOM 8131  H HH   . TYR A 1 59 ? -1.571  -7.332  7.662   1.00 0.00 ? 59 TYR A HH   6  
ATOM 8132  N N    . GLY A 1 60 ? -4.126  -0.085  3.508   1.00 0.00 ? 60 GLY A N    6  
ATOM 8133  C CA   . GLY A 1 60 ? -4.020  1.321   3.157   1.00 0.00 ? 60 GLY A CA   6  
ATOM 8134  C C    . GLY A 1 60 ? -4.533  1.572   1.737   1.00 0.00 ? 60 GLY A C    6  
ATOM 8135  O O    . GLY A 1 60 ? -4.122  0.894   0.796   1.00 0.00 ? 60 GLY A O    6  
ATOM 8136  H H    . GLY A 1 60 ? -3.462  -0.684  3.060   1.00 0.00 ? 60 GLY A H    6  
ATOM 8137  H HA2  . GLY A 1 60 ? -4.592  1.920   3.865   1.00 0.00 ? 60 GLY A HA2  6  
ATOM 8138  H HA3  . GLY A 1 60 ? -2.981  1.642   3.234   1.00 0.00 ? 60 GLY A HA3  6  
ATOM 8139  N N    . SER A 1 61 ? -5.423  2.547   1.628   1.00 0.00 ? 61 SER A N    6  
ATOM 8140  C CA   . SER A 1 61 ? -5.997  2.895   0.339   1.00 0.00 ? 61 SER A CA   6  
ATOM 8141  C C    . SER A 1 61 ? -6.202  4.409   0.250   1.00 0.00 ? 61 SER A C    6  
ATOM 8142  O O    . SER A 1 61 ? -6.394  5.074   1.266   1.00 0.00 ? 61 SER A O    6  
ATOM 8143  C CB   . SER A 1 61 ? -7.322  2.166   0.110   1.00 0.00 ? 61 SER A CB   6  
ATOM 8144  O OG   . SER A 1 61 ? -8.321  2.568   1.044   1.00 0.00 ? 61 SER A OG   6  
ATOM 8145  H H    . SER A 1 61 ? -5.752  3.093   2.398   1.00 0.00 ? 61 SER A H    6  
ATOM 8146  H HA   . SER A 1 61 ? -5.268  2.564   -0.400  1.00 0.00 ? 61 SER A HA   6  
ATOM 8147  H HB2  . SER A 1 61 ? -7.673  2.361   -0.903  1.00 0.00 ? 61 SER A HB2  6  
ATOM 8148  H HB3  . SER A 1 61 ? -7.162  1.090   0.191   1.00 0.00 ? 61 SER A HB3  6  
ATOM 8149  H HG   . SER A 1 61 ? -9.219  2.565   0.605   1.00 0.00 ? 61 SER A HG   6  
ATOM 8150  N N    . GLY A 1 62 ? -6.154  4.909   -0.976  1.00 0.00 ? 62 GLY A N    6  
ATOM 8151  C CA   . GLY A 1 62 ? -6.332  6.332   -1.212  1.00 0.00 ? 62 GLY A CA   6  
ATOM 8152  C C    . GLY A 1 62 ? -6.428  6.632   -2.709  1.00 0.00 ? 62 GLY A C    6  
ATOM 8153  O O    . GLY A 1 62 ? -6.209  5.750   -3.538  1.00 0.00 ? 62 GLY A O    6  
ATOM 8154  H H    . GLY A 1 62 ? -5.997  4.361   -1.798  1.00 0.00 ? 62 GLY A H    6  
ATOM 8155  H HA2  . GLY A 1 62 ? -7.236  6.676   -0.710  1.00 0.00 ? 62 GLY A HA2  6  
ATOM 8156  H HA3  . GLY A 1 62 ? -5.497  6.883   -0.779  1.00 0.00 ? 62 GLY A HA3  6  
ATOM 8157  N N    . THR A 1 63 ? -6.754  7.880   -3.010  1.00 0.00 ? 63 THR A N    6  
ATOM 8158  C CA   . THR A 1 63 ? -6.881  8.308   -4.393  1.00 0.00 ? 63 THR A CA   6  
ATOM 8159  C C    . THR A 1 63 ? -5.992  9.524   -4.659  1.00 0.00 ? 63 THR A C    6  
ATOM 8160  O O    . THR A 1 63 ? -5.358  10.046  -3.743  1.00 0.00 ? 63 THR A O    6  
ATOM 8161  C CB   . THR A 1 63 ? -8.363  8.565   -4.674  1.00 0.00 ? 63 THR A CB   6  
ATOM 8162  O OG1  . THR A 1 63 ? -8.677  9.698   -3.869  1.00 0.00 ? 63 THR A OG1  6  
ATOM 8163  C CG2  . THR A 1 63 ? -9.264  7.457   -4.126  1.00 0.00 ? 63 THR A CG2  6  
ATOM 8164  H H    . THR A 1 63 ? -6.931  8.591   -2.330  1.00 0.00 ? 63 THR A H    6  
ATOM 8165  H HA   . THR A 1 63 ? -6.524  7.503   -5.035  1.00 0.00 ? 63 THR A HA   6  
ATOM 8166  H HB   . THR A 1 63 ? -8.537  8.717   -5.739  1.00 0.00 ? 63 THR A HB   6  
ATOM 8167  H HG1  . THR A 1 63 ? -8.144  10.489  -4.169  1.00 0.00 ? 63 THR A HG1  6  
ATOM 8168  H HG21 . THR A 1 63 ? -9.753  7.804   -3.215  1.00 0.00 ? 63 THR A HG21 6  
ATOM 8169  H HG22 . THR A 1 63 ? -10.020 7.202   -4.869  1.00 0.00 ? 63 THR A HG22 6  
ATOM 8170  H HG23 . THR A 1 63 ? -8.662  6.576   -3.902  1.00 0.00 ? 63 THR A HG23 6  
ATOM 8171  N N    . ALA A 1 64 ? -5.974  9.940   -5.917  1.00 0.00 ? 64 ALA A N    6  
ATOM 8172  C CA   . ALA A 1 64 ? -5.173  11.085  -6.315  1.00 0.00 ? 64 ALA A CA   6  
ATOM 8173  C C    . ALA A 1 64 ? -5.580  11.521  -7.723  1.00 0.00 ? 64 ALA A C    6  
ATOM 8174  O O    . ALA A 1 64 ? -6.502  10.958  -8.310  1.00 0.00 ? 64 ALA A O    6  
ATOM 8175  C CB   . ALA A 1 64 ? -3.688  10.727  -6.221  1.00 0.00 ? 64 ALA A CB   6  
ATOM 8176  H H    . ALA A 1 64 ? -6.492  9.509   -6.656  1.00 0.00 ? 64 ALA A H    6  
ATOM 8177  H HA   . ALA A 1 64 ? -5.383  11.895  -5.617  1.00 0.00 ? 64 ALA A HA   6  
ATOM 8178  H HB1  . ALA A 1 64 ? -3.558  9.895   -5.529  1.00 0.00 ? 64 ALA A HB1  6  
ATOM 8179  H HB2  . ALA A 1 64 ? -3.321  10.440  -7.207  1.00 0.00 ? 64 ALA A HB2  6  
ATOM 8180  H HB3  . ALA A 1 64 ? -3.128  11.590  -5.862  1.00 0.00 ? 64 ALA A HB3  6  
ATOM 8181  N N    . SER A 1 65 ? -4.871  12.522  -8.226  1.00 0.00 ? 65 SER A N    6  
ATOM 8182  C CA   . SER A 1 65 ? -5.147  13.041  -9.555  1.00 0.00 ? 65 SER A CA   6  
ATOM 8183  C C    . SER A 1 65 ? -4.715  12.025  -10.614 1.00 0.00 ? 65 SER A C    6  
ATOM 8184  O O    . SER A 1 65 ? -5.411  11.824  -11.607 1.00 0.00 ? 65 SER A O    6  
ATOM 8185  C CB   . SER A 1 65 ? -4.440  14.378  -9.782  1.00 0.00 ? 65 SER A CB   6  
ATOM 8186  O OG   . SER A 1 65 ? -5.015  15.426  -9.006  1.00 0.00 ? 65 SER A OG   6  
ATOM 8187  H H    . SER A 1 65 ? -4.123  12.975  -7.742  1.00 0.00 ? 65 SER A H    6  
ATOM 8188  H HA   . SER A 1 65 ? -6.226  13.192  -9.587  1.00 0.00 ? 65 SER A HA   6  
ATOM 8189  H HB2  . SER A 1 65 ? -3.384  14.277  -9.528  1.00 0.00 ? 65 SER A HB2  6  
ATOM 8190  H HB3  . SER A 1 65 ? -4.490  14.640  -10.839 1.00 0.00 ? 65 SER A HB3  6  
ATOM 8191  H HG   . SER A 1 65 ? -4.761  15.319  -8.045  1.00 0.00 ? 65 SER A HG   6  
ATOM 8192  N N    . SER A 1 66 ? -3.567  11.411  -10.365 1.00 0.00 ? 66 SER A N    6  
ATOM 8193  C CA   . SER A 1 66 ? -3.033  10.421  -11.284 1.00 0.00 ? 66 SER A CA   6  
ATOM 8194  C C    . SER A 1 66 ? -3.109  9.028   -10.655 1.00 0.00 ? 66 SER A C    6  
ATOM 8195  O O    . SER A 1 66 ? -3.519  8.885   -9.504  1.00 0.00 ? 66 SER A O    6  
ATOM 8196  C CB   . SER A 1 66 ? -1.590  10.751  -11.672 1.00 0.00 ? 66 SER A CB   6  
ATOM 8197  O OG   . SER A 1 66 ? -1.347  10.530  -13.059 1.00 0.00 ? 66 SER A OG   6  
ATOM 8198  H H    . SER A 1 66 ? -3.007  11.581  -9.554  1.00 0.00 ? 66 SER A H    6  
ATOM 8199  H HA   . SER A 1 66 ? -3.668  10.476  -12.168 1.00 0.00 ? 66 SER A HA   6  
ATOM 8200  H HB2  . SER A 1 66 ? -1.378  11.791  -11.428 1.00 0.00 ? 66 SER A HB2  6  
ATOM 8201  H HB3  . SER A 1 66 ? -0.908  10.139  -11.082 1.00 0.00 ? 66 SER A HB3  6  
ATOM 8202  H HG   . SER A 1 66 ? -2.093  9.997   -13.457 1.00 0.00 ? 66 SER A HG   6  
ATOM 8203  N N    . LYS A 1 67 ? -2.707  8.038   -11.438 1.00 0.00 ? 67 LYS A N    6  
ATOM 8204  C CA   . LYS A 1 67 ? -2.724  6.662   -10.972 1.00 0.00 ? 67 LYS A CA   6  
ATOM 8205  C C    . LYS A 1 67 ? -1.598  6.458   -9.956  1.00 0.00 ? 67 LYS A C    6  
ATOM 8206  O O    . LYS A 1 67 ? -1.844  6.031   -8.829  1.00 0.00 ? 67 LYS A O    6  
ATOM 8207  C CB   . LYS A 1 67 ? -2.667  5.694   -12.156 1.00 0.00 ? 67 LYS A CB   6  
ATOM 8208  C CG   . LYS A 1 67 ? -3.860  4.736   -12.139 1.00 0.00 ? 67 LYS A CG   6  
ATOM 8209  C CD   . LYS A 1 67 ? -4.137  4.180   -13.538 1.00 0.00 ? 67 LYS A CD   6  
ATOM 8210  C CE   . LYS A 1 67 ? -4.817  2.812   -13.459 1.00 0.00 ? 67 LYS A CE   6  
ATOM 8211  N NZ   . LYS A 1 67 ? -6.271  2.969   -13.228 1.00 0.00 ? 67 LYS A NZ   6  
ATOM 8212  H H    . LYS A 1 67 ? -2.375  8.163   -12.373 1.00 0.00 ? 67 LYS A H    6  
ATOM 8213  H HA   . LYS A 1 67 ? -3.677  6.499   -10.469 1.00 0.00 ? 67 LYS A HA   6  
ATOM 8214  H HB2  . LYS A 1 67 ? -2.661  6.256   -13.090 1.00 0.00 ? 67 LYS A HB2  6  
ATOM 8215  H HB3  . LYS A 1 67 ? -1.738  5.125   -12.121 1.00 0.00 ? 67 LYS A HB3  6  
ATOM 8216  H HG2  . LYS A 1 67 ? -3.661  3.915   -11.450 1.00 0.00 ? 67 LYS A HG2  6  
ATOM 8217  H HG3  . LYS A 1 67 ? -4.743  5.256   -11.769 1.00 0.00 ? 67 LYS A HG3  6  
ATOM 8218  H HD2  . LYS A 1 67 ? -4.770  4.875   -14.090 1.00 0.00 ? 67 LYS A HD2  6  
ATOM 8219  H HD3  . LYS A 1 67 ? -3.201  4.094   -14.090 1.00 0.00 ? 67 LYS A HD3  6  
ATOM 8220  H HE2  . LYS A 1 67 ? -4.648  2.262   -14.385 1.00 0.00 ? 67 LYS A HE2  6  
ATOM 8221  H HE3  . LYS A 1 67 ? -4.376  2.226   -12.654 1.00 0.00 ? 67 LYS A HE3  6  
ATOM 8222  H HZ1  . LYS A 1 67 ? -6.683  3.440   -14.008 1.00 0.00 ? 67 LYS A HZ1  6  
ATOM 8223  H HZ2  . LYS A 1 67 ? -6.690  2.067   -13.122 1.00 0.00 ? 67 LYS A HZ2  6  
ATOM 8224  H HZ3  . LYS A 1 67 ? -6.420  3.506   -12.397 1.00 0.00 ? 67 LYS A HZ3  6  
ATOM 8225  N N    . LYS A 1 68 ? -0.387  6.771   -10.392 1.00 0.00 ? 68 LYS A N    6  
ATOM 8226  C CA   . LYS A 1 68 ? 0.777   6.628   -9.535  1.00 0.00 ? 68 LYS A CA   6  
ATOM 8227  C C    . LYS A 1 68 ? 0.458   7.193   -8.150  1.00 0.00 ? 68 LYS A C    6  
ATOM 8228  O O    . LYS A 1 68 ? 0.449   6.458   -7.163  1.00 0.00 ? 68 LYS A O    6  
ATOM 8229  C CB   . LYS A 1 68 ? 2.006   7.262   -10.190 1.00 0.00 ? 68 LYS A CB   6  
ATOM 8230  C CG   . LYS A 1 68 ? 2.502   6.414   -11.362 1.00 0.00 ? 68 LYS A CG   6  
ATOM 8231  C CD   . LYS A 1 68 ? 3.989   6.661   -11.628 1.00 0.00 ? 68 LYS A CD   6  
ATOM 8232  C CE   . LYS A 1 68 ? 4.505   5.753   -12.745 1.00 0.00 ? 68 LYS A CE   6  
ATOM 8233  N NZ   . LYS A 1 68 ? 5.833   5.202   -12.393 1.00 0.00 ? 68 LYS A NZ   6  
ATOM 8234  H H    . LYS A 1 68 ? -0.196  7.117   -11.311 1.00 0.00 ? 68 LYS A H    6  
ATOM 8235  H HA   . LYS A 1 68 ? 0.980   5.562   -9.435  1.00 0.00 ? 68 LYS A HA   6  
ATOM 8236  H HB2  . LYS A 1 68 ? 1.759   8.265   -10.541 1.00 0.00 ? 68 LYS A HB2  6  
ATOM 8237  H HB3  . LYS A 1 68 ? 2.801   7.370   -9.452  1.00 0.00 ? 68 LYS A HB3  6  
ATOM 8238  H HG2  . LYS A 1 68 ? 2.339   5.358   -11.146 1.00 0.00 ? 68 LYS A HG2  6  
ATOM 8239  H HG3  . LYS A 1 68 ? 1.925   6.650   -12.256 1.00 0.00 ? 68 LYS A HG3  6  
ATOM 8240  H HD2  . LYS A 1 68 ? 4.144   7.705   -11.902 1.00 0.00 ? 68 LYS A HD2  6  
ATOM 8241  H HD3  . LYS A 1 68 ? 4.559   6.483   -10.716 1.00 0.00 ? 68 LYS A HD3  6  
ATOM 8242  H HE2  . LYS A 1 68 ? 3.800   4.939   -12.915 1.00 0.00 ? 68 LYS A HE2  6  
ATOM 8243  H HE3  . LYS A 1 68 ? 4.573   6.315   -13.677 1.00 0.00 ? 68 LYS A HE3  6  
ATOM 8244  H HZ1  . LYS A 1 68 ? 5.718   4.432   -11.765 1.00 0.00 ? 68 LYS A HZ1  6  
ATOM 8245  H HZ2  . LYS A 1 68 ? 6.294   4.889   -13.224 1.00 0.00 ? 68 LYS A HZ2  6  
ATOM 8246  H HZ3  . LYS A 1 68 ? 6.382   5.912   -11.954 1.00 0.00 ? 68 LYS A HZ3  6  
ATOM 8247  N N    . LEU A 1 69 ? 0.203   8.493   -8.120  1.00 0.00 ? 69 LEU A N    6  
ATOM 8248  C CA   . LEU A 1 69 ? -0.115  9.165   -6.872  1.00 0.00 ? 69 LEU A CA   6  
ATOM 8249  C C    . LEU A 1 69 ? -1.023  8.265   -6.031  1.00 0.00 ? 69 LEU A C    6  
ATOM 8250  O O    . LEU A 1 69 ? -0.672  7.896   -4.911  1.00 0.00 ? 69 LEU A O    6  
ATOM 8251  C CB   . LEU A 1 69 ? -0.705  10.550  -7.144  1.00 0.00 ? 69 LEU A CB   6  
ATOM 8252  C CG   . LEU A 1 69 ? 0.291   11.631  -7.569  1.00 0.00 ? 69 LEU A CG   6  
ATOM 8253  C CD1  . LEU A 1 69 ? 0.813   12.403  -6.355  1.00 0.00 ? 69 LEU A CD1  6  
ATOM 8254  C CD2  . LEU A 1 69 ? 1.428   11.033  -8.400  1.00 0.00 ? 69 LEU A CD2  6  
ATOM 8255  H H    . LEU A 1 69 ? 0.213   9.083   -8.927  1.00 0.00 ? 69 LEU A H    6  
ATOM 8256  H HA   . LEU A 1 69 ? 0.820   9.313   -6.332  1.00 0.00 ? 69 LEU A HA   6  
ATOM 8257  H HB2  . LEU A 1 69 ? -1.461  10.454  -7.923  1.00 0.00 ? 69 LEU A HB2  6  
ATOM 8258  H HB3  . LEU A 1 69 ? -1.217  10.889  -6.243  1.00 0.00 ? 69 LEU A HB3  6  
ATOM 8259  H HG   . LEU A 1 69 ? -0.231  12.346  -8.205  1.00 0.00 ? 69 LEU A HG   6  
ATOM 8260  H HD11 . LEU A 1 69 ? -0.008  12.587  -5.662  1.00 0.00 ? 69 LEU A HD11 6  
ATOM 8261  H HD12 . LEU A 1 69 ? 1.586   11.818  -5.857  1.00 0.00 ? 69 LEU A HD12 6  
ATOM 8262  H HD13 . LEU A 1 69 ? 1.232   13.354  -6.683  1.00 0.00 ? 69 LEU A HD13 6  
ATOM 8263  H HD21 . LEU A 1 69 ? 1.806   10.137  -7.907  1.00 0.00 ? 69 LEU A HD21 6  
ATOM 8264  H HD22 . LEU A 1 69 ? 1.056   10.773  -9.391  1.00 0.00 ? 69 LEU A HD22 6  
ATOM 8265  H HD23 . LEU A 1 69 ? 2.232   11.763  -8.494  1.00 0.00 ? 69 LEU A HD23 6  
ATOM 8266  N N    . ALA A 1 70 ? -2.172  7.937   -6.602  1.00 0.00 ? 70 ALA A N    6  
ATOM 8267  C CA   . ALA A 1 70 ? -3.133  7.088   -5.919  1.00 0.00 ? 70 ALA A CA   6  
ATOM 8268  C C    . ALA A 1 70 ? -2.408  5.874   -5.335  1.00 0.00 ? 70 ALA A C    6  
ATOM 8269  O O    . ALA A 1 70 ? -2.487  5.618   -4.134  1.00 0.00 ? 70 ALA A O    6  
ATOM 8270  C CB   . ALA A 1 70 ? -4.245  6.690   -6.892  1.00 0.00 ? 70 ALA A CB   6  
ATOM 8271  H H    . ALA A 1 70 ? -2.450  8.242   -7.514  1.00 0.00 ? 70 ALA A H    6  
ATOM 8272  H HA   . ALA A 1 70 ? -3.569  7.667   -5.105  1.00 0.00 ? 70 ALA A HA   6  
ATOM 8273  H HB1  . ALA A 1 70 ? -3.901  5.870   -7.522  1.00 0.00 ? 70 ALA A HB1  6  
ATOM 8274  H HB2  . ALA A 1 70 ? -5.123  6.372   -6.329  1.00 0.00 ? 70 ALA A HB2  6  
ATOM 8275  H HB3  . ALA A 1 70 ? -4.504  7.545   -7.517  1.00 0.00 ? 70 ALA A HB3  6  
ATOM 8276  N N    . LYS A 1 71 ? -1.718  5.158   -6.211  1.00 0.00 ? 71 LYS A N    6  
ATOM 8277  C CA   . LYS A 1 71 ? -0.980  3.977   -5.796  1.00 0.00 ? 71 LYS A CA   6  
ATOM 8278  C C    . LYS A 1 71 ? -0.013  4.354   -4.672  1.00 0.00 ? 71 LYS A C    6  
ATOM 8279  O O    . LYS A 1 71 ? 0.031   3.689   -3.638  1.00 0.00 ? 71 LYS A O    6  
ATOM 8280  C CB   . LYS A 1 71 ? -0.299  3.321   -6.999  1.00 0.00 ? 71 LYS A CB   6  
ATOM 8281  C CG   . LYS A 1 71 ? -0.527  1.808   -7.001  1.00 0.00 ? 71 LYS A CG   6  
ATOM 8282  C CD   . LYS A 1 71 ? 0.150   1.153   -8.207  1.00 0.00 ? 71 LYS A CD   6  
ATOM 8283  C CE   . LYS A 1 71 ? 1.389   0.364   -7.778  1.00 0.00 ? 71 LYS A CE   6  
ATOM 8284  N NZ   . LYS A 1 71 ? 2.413   0.387   -8.846  1.00 0.00 ? 71 LYS A NZ   6  
ATOM 8285  H H    . LYS A 1 71 ? -1.659  5.373   -7.185  1.00 0.00 ? 71 LYS A H    6  
ATOM 8286  H HA   . LYS A 1 71 ? -1.703  3.261   -5.405  1.00 0.00 ? 71 LYS A HA   6  
ATOM 8287  H HB2  . LYS A 1 71 ? -0.688  3.752   -7.922  1.00 0.00 ? 71 LYS A HB2  6  
ATOM 8288  H HB3  . LYS A 1 71 ? 0.770   3.532   -6.976  1.00 0.00 ? 71 LYS A HB3  6  
ATOM 8289  H HG2  . LYS A 1 71 ? -0.134  1.377   -6.080  1.00 0.00 ? 71 LYS A HG2  6  
ATOM 8290  H HG3  . LYS A 1 71 ? -1.596  1.598   -7.021  1.00 0.00 ? 71 LYS A HG3  6  
ATOM 8291  H HD2  . LYS A 1 71 ? -0.554  0.489   -8.707  1.00 0.00 ? 71 LYS A HD2  6  
ATOM 8292  H HD3  . LYS A 1 71 ? 0.434   1.919   -8.929  1.00 0.00 ? 71 LYS A HD3  6  
ATOM 8293  H HE2  . LYS A 1 71 ? 1.800   0.789   -6.862  1.00 0.00 ? 71 LYS A HE2  6  
ATOM 8294  H HE3  . LYS A 1 71 ? 1.111   -0.666  -7.555  1.00 0.00 ? 71 LYS A HE3  6  
ATOM 8295  H HZ1  . LYS A 1 71 ? 2.807   -0.526  -8.950  1.00 0.00 ? 71 LYS A HZ1  6  
ATOM 8296  H HZ2  . LYS A 1 71 ? 1.991   0.668   -9.707  1.00 0.00 ? 71 LYS A HZ2  6  
ATOM 8297  H HZ3  . LYS A 1 71 ? 3.135   1.035   -8.602  1.00 0.00 ? 71 LYS A HZ3  6  
ATOM 8298  N N    . ASN A 1 72 ? 0.738   5.419   -4.913  1.00 0.00 ? 72 ASN A N    6  
ATOM 8299  C CA   . ASN A 1 72 ? 1.701   5.892   -3.933  1.00 0.00 ? 72 ASN A CA   6  
ATOM 8300  C C    . ASN A 1 72 ? 1.004   6.071   -2.584  1.00 0.00 ? 72 ASN A C    6  
ATOM 8301  O O    . ASN A 1 72 ? 1.584   5.784   -1.538  1.00 0.00 ? 72 ASN A O    6  
ATOM 8302  C CB   . ASN A 1 72 ? 2.287   7.243   -4.346  1.00 0.00 ? 72 ASN A CB   6  
ATOM 8303  C CG   . ASN A 1 72 ? 3.498   7.059   -5.262  1.00 0.00 ? 72 ASN A CG   6  
ATOM 8304  O OD1  . ASN A 1 72 ? 4.410   6.298   -4.984  1.00 0.00 ? 72 ASN A OD1  6  
ATOM 8305  N ND2  . ASN A 1 72 ? 3.457   7.796   -6.368  1.00 0.00 ? 72 ASN A ND2  6  
ATOM 8306  H H    . ASN A 1 72 ? 0.695   5.953   -5.757  1.00 0.00 ? 72 ASN A H    6  
ATOM 8307  H HA   . ASN A 1 72 ? 2.478   5.127   -3.903  1.00 0.00 ? 72 ASN A HA   6  
ATOM 8308  H HB2  . ASN A 1 72 ? 1.526   7.833   -4.857  1.00 0.00 ? 72 ASN A HB2  6  
ATOM 8309  H HB3  . ASN A 1 72 ? 2.581   7.803   -3.458  1.00 0.00 ? 72 ASN A HB3  6  
ATOM 8310  H HD21 . ASN A 1 72 ? 2.679   8.401   -6.537  1.00 0.00 ? 72 ASN A HD21 6  
ATOM 8311  H HD22 . ASN A 1 72 ? 4.204   7.746   -7.032  1.00 0.00 ? 72 ASN A HD22 6  
ATOM 8312  N N    . LYS A 1 73 ? -0.232  6.544   -2.650  1.00 0.00 ? 73 LYS A N    6  
ATOM 8313  C CA   . LYS A 1 73 ? -1.015  6.765   -1.446  1.00 0.00 ? 73 LYS A CA   6  
ATOM 8314  C C    . LYS A 1 73 ? -1.400  5.415   -0.838  1.00 0.00 ? 73 LYS A C    6  
ATOM 8315  O O    . LYS A 1 73 ? -1.174  5.177   0.347   1.00 0.00 ? 73 LYS A O    6  
ATOM 8316  C CB   . LYS A 1 73 ? -2.213  7.669   -1.744  1.00 0.00 ? 73 LYS A CB   6  
ATOM 8317  C CG   . LYS A 1 73 ? -1.786  9.136   -1.821  1.00 0.00 ? 73 LYS A CG   6  
ATOM 8318  C CD   . LYS A 1 73 ? -2.901  10.001  -2.414  1.00 0.00 ? 73 LYS A CD   6  
ATOM 8319  C CE   . LYS A 1 73 ? -2.862  11.417  -1.836  1.00 0.00 ? 73 LYS A CE   6  
ATOM 8320  N NZ   . LYS A 1 73 ? -3.283  12.404  -2.856  1.00 0.00 ? 73 LYS A NZ   6  
ATOM 8321  H H    . LYS A 1 73 ? -0.697  6.775   -3.505  1.00 0.00 ? 73 LYS A H    6  
ATOM 8322  H HA   . LYS A 1 73 ? -0.380  7.295   -0.736  1.00 0.00 ? 73 LYS A HA   6  
ATOM 8323  H HB2  . LYS A 1 73 ? -2.673  7.370   -2.686  1.00 0.00 ? 73 LYS A HB2  6  
ATOM 8324  H HB3  . LYS A 1 73 ? -2.968  7.546   -0.968  1.00 0.00 ? 73 LYS A HB3  6  
ATOM 8325  H HG2  . LYS A 1 73 ? -1.532  9.498   -0.825  1.00 0.00 ? 73 LYS A HG2  6  
ATOM 8326  H HG3  . LYS A 1 73 ? -0.888  9.226   -2.432  1.00 0.00 ? 73 LYS A HG3  6  
ATOM 8327  H HD2  . LYS A 1 73 ? -2.796  10.043  -3.498  1.00 0.00 ? 73 LYS A HD2  6  
ATOM 8328  H HD3  . LYS A 1 73 ? -3.869  9.545   -2.205  1.00 0.00 ? 73 LYS A HD3  6  
ATOM 8329  H HE2  . LYS A 1 73 ? -3.518  11.480  -0.968  1.00 0.00 ? 73 LYS A HE2  6  
ATOM 8330  H HE3  . LYS A 1 73 ? -1.854  11.648  -1.492  1.00 0.00 ? 73 LYS A HE3  6  
ATOM 8331  H HZ1  . LYS A 1 73 ? -3.639  11.924  -3.657  1.00 0.00 ? 73 LYS A HZ1  6  
ATOM 8332  H HZ2  . LYS A 1 73 ? -3.996  12.993  -2.475  1.00 0.00 ? 73 LYS A HZ2  6  
ATOM 8333  H HZ3  . LYS A 1 73 ? -2.498  12.962  -3.123  1.00 0.00 ? 73 LYS A HZ3  6  
ATOM 8334  N N    . ALA A 1 74 ? -1.973  4.566   -1.678  1.00 0.00 ? 74 ALA A N    6  
ATOM 8335  C CA   . ALA A 1 74 ? -2.392  3.245   -1.239  1.00 0.00 ? 74 ALA A CA   6  
ATOM 8336  C C    . ALA A 1 74 ? -1.243  2.577   -0.480  1.00 0.00 ? 74 ALA A C    6  
ATOM 8337  O O    . ALA A 1 74 ? -1.436  2.064   0.620   1.00 0.00 ? 74 ALA A O    6  
ATOM 8338  C CB   . ALA A 1 74 ? -2.848  2.425   -2.447  1.00 0.00 ? 74 ALA A CB   6  
ATOM 8339  H H    . ALA A 1 74 ? -2.153  4.767   -2.641  1.00 0.00 ? 74 ALA A H    6  
ATOM 8340  H HA   . ALA A 1 74 ? -3.237  3.373   -0.562  1.00 0.00 ? 74 ALA A HA   6  
ATOM 8341  H HB1  . ALA A 1 74 ? -3.339  3.080   -3.166  1.00 0.00 ? 74 ALA A HB1  6  
ATOM 8342  H HB2  . ALA A 1 74 ? -1.982  1.956   -2.915  1.00 0.00 ? 74 ALA A HB2  6  
ATOM 8343  H HB3  . ALA A 1 74 ? -3.546  1.655   -2.121  1.00 0.00 ? 74 ALA A HB3  6  
ATOM 8344  N N    . ALA A 1 75 ? -0.072  2.606   -1.100  1.00 0.00 ? 75 ALA A N    6  
ATOM 8345  C CA   . ALA A 1 75 ? 1.108   2.010   -0.497  1.00 0.00 ? 75 ALA A CA   6  
ATOM 8346  C C    . ALA A 1 75 ? 1.531   2.840   0.717   1.00 0.00 ? 75 ALA A C    6  
ATOM 8347  O O    . ALA A 1 75 ? 1.754   2.297   1.797   1.00 0.00 ? 75 ALA A O    6  
ATOM 8348  C CB   . ALA A 1 75 ? 2.218   1.903   -1.545  1.00 0.00 ? 75 ALA A CB   6  
ATOM 8349  H H    . ALA A 1 75 ? 0.077   3.026   -1.995  1.00 0.00 ? 75 ALA A H    6  
ATOM 8350  H HA   . ALA A 1 75 ? 0.841   1.007   -0.165  1.00 0.00 ? 75 ALA A HA   6  
ATOM 8351  H HB1  . ALA A 1 75 ? 2.654   0.904   -1.511  1.00 0.00 ? 75 ALA A HB1  6  
ATOM 8352  H HB2  . ALA A 1 75 ? 1.801   2.084   -2.535  1.00 0.00 ? 75 ALA A HB2  6  
ATOM 8353  H HB3  . ALA A 1 75 ? 2.989   2.643   -1.334  1.00 0.00 ? 75 ALA A HB3  6  
ATOM 8354  N N    . ARG A 1 76 ? 1.628   4.143   0.498   1.00 0.00 ? 76 ARG A N    6  
ATOM 8355  C CA   . ARG A 1 76 ? 2.019   5.054   1.560   1.00 0.00 ? 76 ARG A CA   6  
ATOM 8356  C C    . ARG A 1 76 ? 1.100   4.883   2.771   1.00 0.00 ? 76 ARG A C    6  
ATOM 8357  O O    . ARG A 1 76 ? 1.503   5.145   3.903   1.00 0.00 ? 76 ARG A O    6  
ATOM 8358  C CB   . ARG A 1 76 ? 1.965   6.508   1.087   1.00 0.00 ? 76 ARG A CB   6  
ATOM 8359  C CG   . ARG A 1 76 ? 2.396   7.463   2.202   1.00 0.00 ? 76 ARG A CG   6  
ATOM 8360  C CD   . ARG A 1 76 ? 2.366   8.916   1.721   1.00 0.00 ? 76 ARG A CD   6  
ATOM 8361  N NE   . ARG A 1 76 ? 2.436   9.834   2.880   1.00 0.00 ? 76 ARG A NE   6  
ATOM 8362  C CZ   . ARG A 1 76 ? 1.451   9.991   3.775   1.00 0.00 ? 76 ARG A CZ   6  
ATOM 8363  N NH1  . ARG A 1 76 ? 0.314   9.292   3.650   1.00 0.00 ? 76 ARG A NH1  6  
ATOM 8364  N NH2  . ARG A 1 76 ? 1.603   10.846  4.795   1.00 0.00 ? 76 ARG A NH2  6  
ATOM 8365  H H    . ARG A 1 76 ? 1.444   4.577   -0.385  1.00 0.00 ? 76 ARG A H    6  
ATOM 8366  H HA   . ARG A 1 76 ? 3.044   4.774   1.803   1.00 0.00 ? 76 ARG A HA   6  
ATOM 8367  H HB2  . ARG A 1 76 ? 2.614   6.637   0.221   1.00 0.00 ? 76 ARG A HB2  6  
ATOM 8368  H HB3  . ARG A 1 76 ? 0.952   6.752   0.766   1.00 0.00 ? 76 ARG A HB3  6  
ATOM 8369  H HG2  . ARG A 1 76 ? 1.736   7.347   3.061   1.00 0.00 ? 76 ARG A HG2  6  
ATOM 8370  H HG3  . ARG A 1 76 ? 3.402   7.208   2.535   1.00 0.00 ? 76 ARG A HG3  6  
ATOM 8371  H HD2  . ARG A 1 76 ? 3.202   9.102   1.048   1.00 0.00 ? 76 ARG A HD2  6  
ATOM 8372  H HD3  . ARG A 1 76 ? 1.453   9.101   1.155   1.00 0.00 ? 76 ARG A HD3  6  
ATOM 8373  H HE   . ARG A 1 76 ? 3.271   10.370  3.003   1.00 0.00 ? 76 ARG A HE   6  
ATOM 8374  H HH11 . ARG A 1 76 ? 0.201   8.653   2.888   1.00 0.00 ? 76 ARG A HH11 6  
ATOM 8375  H HH12 . ARG A 1 76 ? -0.421  9.409   4.318   1.00 0.00 ? 76 ARG A HH12 6  
ATOM 8376  H HH21 . ARG A 1 76 ? 2.451   11.368  4.888   1.00 0.00 ? 76 ARG A HH21 6  
ATOM 8377  H HH22 . ARG A 1 76 ? 0.867   10.964  5.462   1.00 0.00 ? 76 ARG A HH22 6  
ATOM 8378  N N    . ALA A 1 77 ? -0.119  4.446   2.491   1.00 0.00 ? 77 ALA A N    6  
ATOM 8379  C CA   . ALA A 1 77 ? -1.100  4.238   3.543   1.00 0.00 ? 77 ALA A CA   6  
ATOM 8380  C C    . ALA A 1 77 ? -0.737  2.977   4.330   1.00 0.00 ? 77 ALA A C    6  
ATOM 8381  O O    . ALA A 1 77 ? -0.483  3.043   5.532   1.00 0.00 ? 77 ALA A O    6  
ATOM 8382  C CB   . ALA A 1 77 ? -2.499  4.160   2.929   1.00 0.00 ? 77 ALA A CB   6  
ATOM 8383  H H    . ALA A 1 77 ? -0.440  4.236   1.567   1.00 0.00 ? 77 ALA A H    6  
ATOM 8384  H HA   . ALA A 1 77 ? -1.057  5.098   4.211   1.00 0.00 ? 77 ALA A HA   6  
ATOM 8385  H HB1  . ALA A 1 77 ? -3.235  4.019   3.720   1.00 0.00 ? 77 ALA A HB1  6  
ATOM 8386  H HB2  . ALA A 1 77 ? -2.713  5.085   2.395   1.00 0.00 ? 77 ALA A HB2  6  
ATOM 8387  H HB3  . ALA A 1 77 ? -2.545  3.320   2.236   1.00 0.00 ? 77 ALA A HB3  6  
ATOM 8388  N N    . THR A 1 78 ? -0.724  1.859   3.620   1.00 0.00 ? 78 THR A N    6  
ATOM 8389  C CA   . THR A 1 78 ? -0.397  0.584   4.237   1.00 0.00 ? 78 THR A CA   6  
ATOM 8390  C C    . THR A 1 78 ? 0.824   0.731   5.148   1.00 0.00 ? 78 THR A C    6  
ATOM 8391  O O    . THR A 1 78 ? 0.816   0.260   6.284   1.00 0.00 ? 78 THR A O    6  
ATOM 8392  C CB   . THR A 1 78 ? -0.203  -0.445  3.122   1.00 0.00 ? 78 THR A CB   6  
ATOM 8393  O OG1  . THR A 1 78 ? -1.519  -0.668  2.623   1.00 0.00 ? 78 THR A OG1  6  
ATOM 8394  C CG2  . THR A 1 78 ? 0.230   -1.812  3.656   1.00 0.00 ? 78 THR A CG2  6  
ATOM 8395  H H    . THR A 1 78 ? -0.932  1.814   2.643   1.00 0.00 ? 78 THR A H    6  
ATOM 8396  H HA   . THR A 1 78 ? -1.232  0.284   4.869   1.00 0.00 ? 78 THR A HA   6  
ATOM 8397  H HB   . THR A 1 78 ? 0.499   -0.079  2.373   1.00 0.00 ? 78 THR A HB   6  
ATOM 8398  H HG1  . THR A 1 78 ? -1.787  0.081   2.018   1.00 0.00 ? 78 THR A HG1  6  
ATOM 8399  H HG21 . THR A 1 78 ? 1.301   -1.799  3.861   1.00 0.00 ? 78 THR A HG21 6  
ATOM 8400  H HG22 . THR A 1 78 ? -0.313  -2.032  4.575   1.00 0.00 ? 78 THR A HG22 6  
ATOM 8401  H HG23 . THR A 1 78 ? 0.012   -2.578  2.912   1.00 0.00 ? 78 THR A HG23 6  
ATOM 8402  N N    . LEU A 1 79 ? 1.845   1.386   4.615   1.00 0.00 ? 79 LEU A N    6  
ATOM 8403  C CA   . LEU A 1 79 ? 3.070   1.601   5.365   1.00 0.00 ? 79 LEU A CA   6  
ATOM 8404  C C    . LEU A 1 79 ? 2.727   2.172   6.742   1.00 0.00 ? 79 LEU A C    6  
ATOM 8405  O O    . LEU A 1 79 ? 3.046   1.569   7.766   1.00 0.00 ? 79 LEU A O    6  
ATOM 8406  C CB   . LEU A 1 79 ? 4.044   2.469   4.565   1.00 0.00 ? 79 LEU A CB   6  
ATOM 8407  C CG   . LEU A 1 79 ? 4.995   1.721   3.629   1.00 0.00 ? 79 LEU A CG   6  
ATOM 8408  C CD1  . LEU A 1 79 ? 5.993   2.682   2.979   1.00 0.00 ? 79 LEU A CD1  6  
ATOM 8409  C CD2  . LEU A 1 79 ? 5.697   0.576   4.361   1.00 0.00 ? 79 LEU A CD2  6  
ATOM 8410  H H    . LEU A 1 79 ? 1.844   1.766   3.690   1.00 0.00 ? 79 LEU A H    6  
ATOM 8411  H HA   . LEU A 1 79 ? 3.544   0.629   5.502   1.00 0.00 ? 79 LEU A HA   6  
ATOM 8412  H HB2  . LEU A 1 79 ? 3.465   3.177   3.972   1.00 0.00 ? 79 LEU A HB2  6  
ATOM 8413  H HB3  . LEU A 1 79 ? 4.640   3.053   5.266   1.00 0.00 ? 79 LEU A HB3  6  
ATOM 8414  H HG   . LEU A 1 79 ? 4.406   1.277   2.826   1.00 0.00 ? 79 LEU A HG   6  
ATOM 8415  H HD11 . LEU A 1 79 ? 6.573   2.149   2.226   1.00 0.00 ? 79 LEU A HD11 6  
ATOM 8416  H HD12 . LEU A 1 79 ? 5.452   3.502   2.507   1.00 0.00 ? 79 LEU A HD12 6  
ATOM 8417  H HD13 . LEU A 1 79 ? 6.663   3.080   3.740   1.00 0.00 ? 79 LEU A HD13 6  
ATOM 8418  H HD21 . LEU A 1 79 ? 5.890   0.869   5.393   1.00 0.00 ? 79 LEU A HD21 6  
ATOM 8419  H HD22 . LEU A 1 79 ? 5.060   -0.309  4.348   1.00 0.00 ? 79 LEU A HD22 6  
ATOM 8420  H HD23 . LEU A 1 79 ? 6.641   0.351   3.865   1.00 0.00 ? 79 LEU A HD23 6  
ATOM 8421  N N    . GLU A 1 80 ? 2.080   3.328   6.724   1.00 0.00 ? 80 GLU A N    6  
ATOM 8422  C CA   . GLU A 1 80 ? 1.690   3.987   7.958   1.00 0.00 ? 80 GLU A CA   6  
ATOM 8423  C C    . GLU A 1 80 ? 1.078   2.976   8.930   1.00 0.00 ? 80 GLU A C    6  
ATOM 8424  O O    . GLU A 1 80 ? 1.522   2.859   10.071  1.00 0.00 ? 80 GLU A O    6  
ATOM 8425  C CB   . GLU A 1 80 ? 0.720   5.138   7.682   1.00 0.00 ? 80 GLU A CB   6  
ATOM 8426  C CG   . GLU A 1 80 ? 1.440   6.316   7.022   1.00 0.00 ? 80 GLU A CG   6  
ATOM 8427  C CD   . GLU A 1 80 ? 1.171   7.617   7.780   1.00 0.00 ? 80 GLU A CD   6  
ATOM 8428  O OE1  . GLU A 1 80 ? 1.467   7.640   8.994   1.00 0.00 ? 80 GLU A OE1  6  
ATOM 8429  O OE2  . GLU A 1 80 ? 0.674   8.561   7.128   1.00 0.00 ? 80 GLU A OE2  6  
ATOM 8430  H H    . GLU A 1 80 ? 1.824   3.812   5.887   1.00 0.00 ? 80 GLU A H    6  
ATOM 8431  H HA   . GLU A 1 80 ? 2.613   4.390   8.376   1.00 0.00 ? 80 GLU A HA   6  
ATOM 8432  H HB2  . GLU A 1 80 ? -0.086  4.792   7.036   1.00 0.00 ? 80 GLU A HB2  6  
ATOM 8433  H HB3  . GLU A 1 80 ? 0.262   5.464   8.616   1.00 0.00 ? 80 GLU A HB3  6  
ATOM 8434  H HG2  . GLU A 1 80 ? 2.512   6.122   6.995   1.00 0.00 ? 80 GLU A HG2  6  
ATOM 8435  H HG3  . GLU A 1 80 ? 1.108   6.416   5.989   1.00 0.00 ? 80 GLU A HG3  6  
ATOM 8436  N N    . ILE A 1 81 ? 0.069   2.270   8.441   1.00 0.00 ? 81 ILE A N    6  
ATOM 8437  C CA   . ILE A 1 81 ? -0.608  1.272   9.252   1.00 0.00 ? 81 ILE A CA   6  
ATOM 8438  C C    . ILE A 1 81 ? 0.433   0.432   9.993   1.00 0.00 ? 81 ILE A C    6  
ATOM 8439  O O    . ILE A 1 81 ? 0.361   0.281   11.212  1.00 0.00 ? 81 ILE A O    6  
ATOM 8440  C CB   . ILE A 1 81 ? -1.568  0.446   8.394   1.00 0.00 ? 81 ILE A CB   6  
ATOM 8441  C CG1  . ILE A 1 81 ? -2.784  1.275   7.977   1.00 0.00 ? 81 ILE A CG1  6  
ATOM 8442  C CG2  . ILE A 1 81 ? -1.972  -0.844  9.110   1.00 0.00 ? 81 ILE A CG2  6  
ATOM 8443  C CD1  . ILE A 1 81 ? -3.698  0.478   7.044   1.00 0.00 ? 81 ILE A CD1  6  
ATOM 8444  H H    . ILE A 1 81 ? -0.286  2.371   7.512   1.00 0.00 ? 81 ILE A H    6  
ATOM 8445  H HA   . ILE A 1 81 ? -1.211  1.804   9.988   1.00 0.00 ? 81 ILE A HA   6  
ATOM 8446  H HB   . ILE A 1 81 ? -1.047  0.157   7.480   1.00 0.00 ? 81 ILE A HB   6  
ATOM 8447  H HG12 . ILE A 1 81 ? -3.341  1.581   8.863   1.00 0.00 ? 81 ILE A HG12 6  
ATOM 8448  H HG13 . ILE A 1 81 ? -2.454  2.186   7.478   1.00 0.00 ? 81 ILE A HG13 6  
ATOM 8449  H HG21 . ILE A 1 81 ? -1.655  -0.796  10.152  1.00 0.00 ? 81 ILE A HG21 6  
ATOM 8450  H HG22 . ILE A 1 81 ? -3.054  -0.962  9.065   1.00 0.00 ? 81 ILE A HG22 6  
ATOM 8451  H HG23 . ILE A 1 81 ? -1.493  -1.695  8.624   1.00 0.00 ? 81 ILE A HG23 6  
ATOM 8452  H HD11 . ILE A 1 81 ? -4.739  0.670   7.303   1.00 0.00 ? 81 ILE A HD11 6  
ATOM 8453  H HD12 . ILE A 1 81 ? -3.519  0.783   6.013   1.00 0.00 ? 81 ILE A HD12 6  
ATOM 8454  H HD13 . ILE A 1 81 ? -3.486  -0.586  7.150   1.00 0.00 ? 81 ILE A HD13 6  
ATOM 8455  N N    . LEU A 1 82 ? 1.377   -0.094  9.227   1.00 0.00 ? 82 LEU A N    6  
ATOM 8456  C CA   . LEU A 1 82 ? 2.432   -0.915  9.796   1.00 0.00 ? 82 LEU A CA   6  
ATOM 8457  C C    . LEU A 1 82 ? 3.396   -0.026  10.584  1.00 0.00 ? 82 LEU A C    6  
ATOM 8458  O O    . LEU A 1 82 ? 3.415   -0.062  11.813  1.00 0.00 ? 82 LEU A O    6  
ATOM 8459  C CB   . LEU A 1 82 ? 3.113   -1.744  8.705   1.00 0.00 ? 82 LEU A CB   6  
ATOM 8460  C CG   . LEU A 1 82 ? 2.180   -2.481  7.742   1.00 0.00 ? 82 LEU A CG   6  
ATOM 8461  C CD1  . LEU A 1 82 ? 2.608   -2.263  6.289   1.00 0.00 ? 82 LEU A CD1  6  
ATOM 8462  C CD2  . LEU A 1 82 ? 2.090   -3.967  8.095   1.00 0.00 ? 82 LEU A CD2  6  
ATOM 8463  H H    . LEU A 1 82 ? 1.429   0.034   8.236   1.00 0.00 ? 82 LEU A H    6  
ATOM 8464  H HA   . LEU A 1 82 ? 1.964   -1.615  10.488  1.00 0.00 ? 82 LEU A HA   6  
ATOM 8465  H HB2  . LEU A 1 82 ? 3.756   -1.084  8.123   1.00 0.00 ? 82 LEU A HB2  6  
ATOM 8466  H HB3  . LEU A 1 82 ? 3.761   -2.478  9.185   1.00 0.00 ? 82 LEU A HB3  6  
ATOM 8467  H HG   . LEU A 1 82 ? 1.179   -2.063  7.849   1.00 0.00 ? 82 LEU A HG   6  
ATOM 8468  H HD11 . LEU A 1 82 ? 1.897   -1.598  5.798   1.00 0.00 ? 82 LEU A HD11 6  
ATOM 8469  H HD12 . LEU A 1 82 ? 3.601   -1.814  6.266   1.00 0.00 ? 82 LEU A HD12 6  
ATOM 8470  H HD13 . LEU A 1 82 ? 2.629   -3.220  5.769   1.00 0.00 ? 82 LEU A HD13 6  
ATOM 8471  H HD21 . LEU A 1 82 ? 1.043   -4.267  8.137   1.00 0.00 ? 82 LEU A HD21 6  
ATOM 8472  H HD22 . LEU A 1 82 ? 2.606   -4.554  7.335   1.00 0.00 ? 82 LEU A HD22 6  
ATOM 8473  H HD23 . LEU A 1 82 ? 2.556   -4.139  9.065   1.00 0.00 ? 82 LEU A HD23 6  
ATOM 8474  N N    . ILE A 1 83 ? 4.173   0.751   9.844   1.00 0.00 ? 83 ILE A N    6  
ATOM 8475  C CA   . ILE A 1 83 ? 5.137   1.648   10.458  1.00 0.00 ? 83 ILE A CA   6  
ATOM 8476  C C    . ILE A 1 83 ? 4.408   2.881   10.998  1.00 0.00 ? 83 ILE A C    6  
ATOM 8477  O O    . ILE A 1 83 ? 3.856   3.666   10.230  1.00 0.00 ? 83 ILE A O    6  
ATOM 8478  C CB   . ILE A 1 83 ? 6.262   1.981   9.476   1.00 0.00 ? 83 ILE A CB   6  
ATOM 8479  C CG1  . ILE A 1 83 ? 6.607   0.769   8.607   1.00 0.00 ? 83 ILE A CG1  6  
ATOM 8480  C CG2  . ILE A 1 83 ? 7.487   2.527   10.210  1.00 0.00 ? 83 ILE A CG2  6  
ATOM 8481  C CD1  . ILE A 1 83 ? 7.956   0.959   7.912   1.00 0.00 ? 83 ILE A CD1  6  
ATOM 8482  H H    . ILE A 1 83 ? 4.151   0.775   8.844   1.00 0.00 ? 83 ILE A H    6  
ATOM 8483  H HA   . ILE A 1 83 ? 5.588   1.118   11.297  1.00 0.00 ? 83 ILE A HA   6  
ATOM 8484  H HB   . ILE A 1 83 ? 5.910   2.766   8.807   1.00 0.00 ? 83 ILE A HB   6  
ATOM 8485  H HG12 . ILE A 1 83 ? 6.635   -0.129  9.225   1.00 0.00 ? 83 ILE A HG12 6  
ATOM 8486  H HG13 . ILE A 1 83 ? 5.827   0.618   7.861   1.00 0.00 ? 83 ILE A HG13 6  
ATOM 8487  H HG21 . ILE A 1 83 ? 8.113   3.082   9.510   1.00 0.00 ? 83 ILE A HG21 6  
ATOM 8488  H HG22 . ILE A 1 83 ? 7.164   3.191   11.012  1.00 0.00 ? 83 ILE A HG22 6  
ATOM 8489  H HG23 . ILE A 1 83 ? 8.059   1.700   10.630  1.00 0.00 ? 83 ILE A HG23 6  
ATOM 8490  H HD11 . ILE A 1 83 ? 8.747   0.535   8.531   1.00 0.00 ? 83 ILE A HD11 6  
ATOM 8491  H HD12 . ILE A 1 83 ? 7.942   0.455   6.946   1.00 0.00 ? 83 ILE A HD12 6  
ATOM 8492  H HD13 . ILE A 1 83 ? 8.142   2.023   7.765   1.00 0.00 ? 83 ILE A HD13 6  
ATOM 8493  N N    . PRO A 1 84 ? 4.431   3.014   12.352  1.00 0.00 ? 84 PRO A N    6  
ATOM 8494  C CA   . PRO A 1 84 ? 3.779   4.138   13.004  1.00 0.00 ? 84 PRO A CA   6  
ATOM 8495  C C    . PRO A 1 84 ? 4.594   5.421   12.829  1.00 0.00 ? 84 PRO A C    6  
ATOM 8496  O O    . PRO A 1 84 ? 4.031   6.511   12.746  1.00 0.00 ? 84 PRO A O    6  
ATOM 8497  C CB   . PRO A 1 84 ? 3.635   3.719   14.458  1.00 0.00 ? 84 PRO A CB   6  
ATOM 8498  C CG   . PRO A 1 84 ? 4.622   2.581   14.663  1.00 0.00 ? 84 PRO A CG   6  
ATOM 8499  C CD   . PRO A 1 84 ? 5.075   2.103   13.293  1.00 0.00 ? 84 PRO A CD   6  
ATOM 8500  H HA   . PRO A 1 84 ? 2.891   4.317   12.580  1.00 0.00 ? 84 PRO A HA   6  
ATOM 8501  H HB2  . PRO A 1 84 ? 3.854   4.551   15.127  1.00 0.00 ? 84 PRO A HB2  6  
ATOM 8502  H HB3  . PRO A 1 84 ? 2.617   3.396   14.672  1.00 0.00 ? 84 PRO A HB3  6  
ATOM 8503  H HG2  . PRO A 1 84 ? 5.475   2.917   15.252  1.00 0.00 ? 84 PRO A HG2  6  
ATOM 8504  H HG3  . PRO A 1 84 ? 4.155   1.766   15.217  1.00 0.00 ? 84 PRO A HG3  6  
ATOM 8505  H HD2  . PRO A 1 84 ? 6.160   2.139   13.200  1.00 0.00 ? 84 PRO A HD2  6  
ATOM 8506  H HD3  . PRO A 1 84 ? 4.774   1.071   13.114  1.00 0.00 ? 84 PRO A HD3  6  
ATOM 8507  N N    . ASP A 1 85 ? 5.906   5.248   12.778  1.00 0.00 ? 85 ASP A N    6  
ATOM 8508  C CA   . ASP A 1 85 ? 6.804   6.379   12.614  1.00 0.00 ? 85 ASP A CA   6  
ATOM 8509  C C    . ASP A 1 85 ? 7.691   6.148   11.389  1.00 0.00 ? 85 ASP A C    6  
ATOM 8510  O O    . ASP A 1 85 ? 8.873   5.835   11.524  1.00 0.00 ? 85 ASP A O    6  
ATOM 8511  C CB   . ASP A 1 85 ? 7.714   6.541   13.833  1.00 0.00 ? 85 ASP A CB   6  
ATOM 8512  C CG   . ASP A 1 85 ? 7.232   7.557   14.870  1.00 0.00 ? 85 ASP A CG   6  
ATOM 8513  O OD1  . ASP A 1 85 ? 6.095   7.376   15.356  1.00 0.00 ? 85 ASP A OD1  6  
ATOM 8514  O OD2  . ASP A 1 85 ? 8.011   8.493   15.153  1.00 0.00 ? 85 ASP A OD2  6  
ATOM 8515  H H    . ASP A 1 85 ? 6.356   4.358   12.846  1.00 0.00 ? 85 ASP A H    6  
ATOM 8516  H HA   . ASP A 1 85 ? 6.154   7.247   12.500  1.00 0.00 ? 85 ASP A HA   6  
ATOM 8517  H HB2  . ASP A 1 85 ? 7.821   5.571   14.319  1.00 0.00 ? 85 ASP A HB2  6  
ATOM 8518  H HB3  . ASP A 1 85 ? 8.706   6.836   13.491  1.00 0.00 ? 85 ASP A HB3  6  
ATOM 8519  N N    . PHE A 1 86 ? 7.087   6.311   10.221  1.00 0.00 ? 86 PHE A N    6  
ATOM 8520  C CA   . PHE A 1 86 ? 7.807   6.123   8.973   1.00 0.00 ? 86 PHE A CA   6  
ATOM 8521  C C    . PHE A 1 86 ? 8.416   7.440   8.489   1.00 0.00 ? 86 PHE A C    6  
ATOM 8522  O O    . PHE A 1 86 ? 9.613   7.512   8.216   1.00 0.00 ? 86 PHE A O    6  
ATOM 8523  C CB   . PHE A 1 86 ? 6.791   5.634   7.940   1.00 0.00 ? 86 PHE A CB   6  
ATOM 8524  C CG   . PHE A 1 86 ? 7.354   5.513   6.522   1.00 0.00 ? 86 PHE A CG   6  
ATOM 8525  C CD1  . PHE A 1 86 ? 8.366   4.641   6.264   1.00 0.00 ? 86 PHE A CD1  6  
ATOM 8526  C CD2  . PHE A 1 86 ? 6.844   6.278   5.520   1.00 0.00 ? 86 PHE A CD2  6  
ATOM 8527  C CE1  . PHE A 1 86 ? 8.888   4.529   4.949   1.00 0.00 ? 86 PHE A CE1  6  
ATOM 8528  C CE2  . PHE A 1 86 ? 7.367   6.166   4.205   1.00 0.00 ? 86 PHE A CE2  6  
ATOM 8529  C CZ   . PHE A 1 86 ? 8.378   5.294   3.947   1.00 0.00 ? 86 PHE A CZ   6  
ATOM 8530  H H    . PHE A 1 86 ? 6.125   6.565   10.120  1.00 0.00 ? 86 PHE A H    6  
ATOM 8531  H HA   . PHE A 1 86 ? 8.605   5.405   9.165   1.00 0.00 ? 86 PHE A HA   6  
ATOM 8532  H HB2  . PHE A 1 86 ? 6.410   4.661   8.252   1.00 0.00 ? 86 PHE A HB2  6  
ATOM 8533  H HB3  . PHE A 1 86 ? 5.943   6.319   7.926   1.00 0.00 ? 86 PHE A HB3  6  
ATOM 8534  H HD1  . PHE A 1 86 ? 8.775   4.028   7.067   1.00 0.00 ? 86 PHE A HD1  6  
ATOM 8535  H HD2  . PHE A 1 86 ? 6.033   6.977   5.727   1.00 0.00 ? 86 PHE A HD2  6  
ATOM 8536  H HE1  . PHE A 1 86 ? 9.699   3.830   4.742   1.00 0.00 ? 86 PHE A HE1  6  
ATOM 8537  H HE2  . PHE A 1 86 ? 6.957   6.780   3.402   1.00 0.00 ? 86 PHE A HE2  6  
ATOM 8538  H HZ   . PHE A 1 86 ? 8.779   5.209   2.937   1.00 0.00 ? 86 PHE A HZ   6  
ATOM 8539  N N    . VAL A 1 87 ? 7.563   8.451   8.396   1.00 0.00 ? 87 VAL A N    6  
ATOM 8540  C CA   . VAL A 1 87 ? 8.002   9.762   7.949   1.00 0.00 ? 87 VAL A CA   6  
ATOM 8541  C C    . VAL A 1 87 ? 8.997   10.334  8.961   1.00 0.00 ? 87 VAL A C    6  
ATOM 8542  O O    . VAL A 1 87 ? 8.986   9.954   10.131  1.00 0.00 ? 87 VAL A O    6  
ATOM 8543  C CB   . VAL A 1 87 ? 6.792   10.669  7.721   1.00 0.00 ? 87 VAL A CB   6  
ATOM 8544  C CG1  . VAL A 1 87 ? 7.219   12.015  7.133   1.00 0.00 ? 87 VAL A CG1  6  
ATOM 8545  C CG2  . VAL A 1 87 ? 5.754   9.985   6.829   1.00 0.00 ? 87 VAL A CG2  6  
ATOM 8546  H H    . VAL A 1 87 ? 6.591   8.384   8.620   1.00 0.00 ? 87 VAL A H    6  
ATOM 8547  H HA   . VAL A 1 87 ? 8.510   9.630   6.994   1.00 0.00 ? 87 VAL A HA   6  
ATOM 8548  H HB   . VAL A 1 87 ? 6.328   10.859  8.689   1.00 0.00 ? 87 VAL A HB   6  
ATOM 8549  H HG11 . VAL A 1 87 ? 6.336   12.628  6.948   1.00 0.00 ? 87 VAL A HG11 6  
ATOM 8550  H HG12 . VAL A 1 87 ? 7.876   12.527  7.836   1.00 0.00 ? 87 VAL A HG12 6  
ATOM 8551  H HG13 . VAL A 1 87 ? 7.749   11.850  6.195   1.00 0.00 ? 87 VAL A HG13 6  
ATOM 8552  H HG21 . VAL A 1 87 ? 4.957   9.574   7.449   1.00 0.00 ? 87 VAL A HG21 6  
ATOM 8553  H HG22 . VAL A 1 87 ? 5.336   10.714  6.134   1.00 0.00 ? 87 VAL A HG22 6  
ATOM 8554  H HG23 . VAL A 1 87 ? 6.230   9.181   6.269   1.00 0.00 ? 87 VAL A HG23 6  
ATOM 8555  N N    . LYS A 1 88 ? 9.833   11.239  8.474   1.00 0.00 ? 88 LYS A N    6  
ATOM 8556  C CA   . LYS A 1 88 ? 10.832  11.868  9.321   1.00 0.00 ? 88 LYS A CA   6  
ATOM 8557  C C    . LYS A 1 88 ? 11.062  13.306  8.850   1.00 0.00 ? 88 LYS A C    6  
ATOM 8558  O O    . LYS A 1 88 ? 11.903  13.553  7.988   1.00 0.00 ? 88 LYS A O    6  
ATOM 8559  C CB   . LYS A 1 88 ? 12.107  11.023  9.363   1.00 0.00 ? 88 LYS A CB   6  
ATOM 8560  C CG   . LYS A 1 88 ? 13.286  11.837  9.900   1.00 0.00 ? 88 LYS A CG   6  
ATOM 8561  C CD   . LYS A 1 88 ? 14.471  10.929  10.236  1.00 0.00 ? 88 LYS A CD   6  
ATOM 8562  C CE   . LYS A 1 88 ? 15.421  11.611  11.223  1.00 0.00 ? 88 LYS A CE   6  
ATOM 8563  N NZ   . LYS A 1 88 ? 16.074  10.606  12.092  1.00 0.00 ? 88 LYS A NZ   6  
ATOM 8564  H H    . LYS A 1 88 ? 9.835   11.543  7.521   1.00 0.00 ? 88 LYS A H    6  
ATOM 8565  H HA   . LYS A 1 88 ? 10.431  11.896  10.334  1.00 0.00 ? 88 LYS A HA   6  
ATOM 8566  H HB2  . LYS A 1 88 ? 11.948  10.148  9.993   1.00 0.00 ? 88 LYS A HB2  6  
ATOM 8567  H HB3  . LYS A 1 88 ? 12.339  10.658  8.363   1.00 0.00 ? 88 LYS A HB3  6  
ATOM 8568  H HG2  . LYS A 1 88 ? 13.589  12.577  9.160   1.00 0.00 ? 88 LYS A HG2  6  
ATOM 8569  H HG3  . LYS A 1 88 ? 12.979  12.385  10.791  1.00 0.00 ? 88 LYS A HG3  6  
ATOM 8570  H HD2  . LYS A 1 88 ? 14.108  9.994   10.663  1.00 0.00 ? 88 LYS A HD2  6  
ATOM 8571  H HD3  . LYS A 1 88 ? 15.010  10.675  9.323   1.00 0.00 ? 88 LYS A HD3  6  
ATOM 8572  H HE2  . LYS A 1 88 ? 16.178  12.175  10.678  1.00 0.00 ? 88 LYS A HE2  6  
ATOM 8573  H HE3  . LYS A 1 88 ? 14.869  12.325  11.834  1.00 0.00 ? 88 LYS A HE3  6  
ATOM 8574  H HZ1  . LYS A 1 88 ? 15.375  10.091  12.589  1.00 0.00 ? 88 LYS A HZ1  6  
ATOM 8575  H HZ2  . LYS A 1 88 ? 16.613  9.979   11.530  1.00 0.00 ? 88 LYS A HZ2  6  
ATOM 8576  H HZ3  . LYS A 1 88 ? 16.674  11.069  12.744  1.00 0.00 ? 88 LYS A HZ3  6  
ATOM 8577  N N    . GLN A 1 89 ? 10.299  14.216  9.437   1.00 0.00 ? 89 GLN A N    6  
ATOM 8578  C CA   . GLN A 1 89 ? 10.409  15.622  9.089   1.00 0.00 ? 89 GLN A CA   6  
ATOM 8579  C C    . GLN A 1 89 ? 9.760   15.884  7.728   1.00 0.00 ? 89 GLN A C    6  
ATOM 8580  O O    . GLN A 1 89 ? 10.338  15.569  6.689   1.00 0.00 ? 89 GLN A O    6  
ATOM 8581  C CB   . GLN A 1 89 ? 11.870  16.076  9.096   1.00 0.00 ? 89 GLN A CB   6  
ATOM 8582  C CG   . GLN A 1 89 ? 12.066  17.279  10.021  1.00 0.00 ? 89 GLN A CG   6  
ATOM 8583  C CD   . GLN A 1 89 ? 11.460  18.544  9.411   1.00 0.00 ? 89 GLN A CD   6  
ATOM 8584  O OE1  . GLN A 1 89 ? 10.854  18.525  8.352   1.00 0.00 ? 89 GLN A OE1  6  
ATOM 8585  N NE2  . GLN A 1 89 ? 11.657  19.642  10.136  1.00 0.00 ? 89 GLN A NE2  6  
ATOM 8586  H H    . GLN A 1 89 ? 9.617   14.006  10.138  1.00 0.00 ? 89 GLN A H    6  
ATOM 8587  H HA   . GLN A 1 89 ? 9.865   16.157  9.867   1.00 0.00 ? 89 GLN A HA   6  
ATOM 8588  H HB2  . GLN A 1 89 ? 12.508  15.255  9.421   1.00 0.00 ? 89 GLN A HB2  6  
ATOM 8589  H HB3  . GLN A 1 89 ? 12.178  16.338  8.083   1.00 0.00 ? 89 GLN A HB3  6  
ATOM 8590  H HG2  . GLN A 1 89 ? 11.602  17.078  10.987  1.00 0.00 ? 89 GLN A HG2  6  
ATOM 8591  H HG3  . GLN A 1 89 ? 13.130  17.432  10.204  1.00 0.00 ? 89 GLN A HG3  6  
ATOM 8592  H HE21 . GLN A 1 89 ? 12.164  19.589  10.996  1.00 0.00 ? 89 GLN A HE21 6  
ATOM 8593  H HE22 . GLN A 1 89 ? 11.299  20.521  9.820   1.00 0.00 ? 89 GLN A HE22 6  
ATOM 8594  N N    . THR A 1 90 ? 8.567   16.458  7.778   1.00 0.00 ? 90 THR A N    6  
ATOM 8595  C CA   . THR A 1 90 ? 7.833   16.766  6.563   1.00 0.00 ? 90 THR A CA   6  
ATOM 8596  C C    . THR A 1 90 ? 7.284   18.193  6.618   1.00 0.00 ? 90 THR A C    6  
ATOM 8597  O O    . THR A 1 90 ? 7.675   19.045  5.822   1.00 0.00 ? 90 THR A O    6  
ATOM 8598  C CB   . THR A 1 90 ? 6.747   15.704  6.384   1.00 0.00 ? 90 THR A CB   6  
ATOM 8599  O OG1  . THR A 1 90 ? 7.402   14.652  5.680   1.00 0.00 ? 90 THR A OG1  6  
ATOM 8600  C CG2  . THR A 1 90 ? 5.637   16.155  5.432   1.00 0.00 ? 90 THR A CG2  6  
ATOM 8601  H H    . THR A 1 90 ? 8.103   16.712  8.627   1.00 0.00 ? 90 THR A H    6  
ATOM 8602  H HA   . THR A 1 90 ? 8.526   16.723  5.723   1.00 0.00 ? 90 THR A HA   6  
ATOM 8603  H HB   . THR A 1 90 ? 6.335   15.402  7.347   1.00 0.00 ? 90 THR A HB   6  
ATOM 8604  H HG1  . THR A 1 90 ? 7.890   15.023  4.889   1.00 0.00 ? 90 THR A HG1  6  
ATOM 8605  H HG21 . THR A 1 90 ? 5.481   15.392  4.668   1.00 0.00 ? 90 THR A HG21 6  
ATOM 8606  H HG22 . THR A 1 90 ? 4.714   16.301  5.993   1.00 0.00 ? 90 THR A HG22 6  
ATOM 8607  H HG23 . THR A 1 90 ? 5.926   17.092  4.956   1.00 0.00 ? 90 THR A HG23 6  
ATOM 8608  N N    . SER A 1 91 ? 6.385   18.410  7.567   1.00 0.00 ? 91 SER A N    6  
ATOM 8609  C CA   . SER A 1 91 ? 5.778   19.720  7.737   1.00 0.00 ? 91 SER A CA   6  
ATOM 8610  C C    . SER A 1 91 ? 5.055   20.132  6.453   1.00 0.00 ? 91 SER A C    6  
ATOM 8611  O O    . SER A 1 91 ? 5.574   20.931  5.675   1.00 0.00 ? 91 SER A O    6  
ATOM 8612  C CB   . SER A 1 91 ? 6.826   20.768  8.117   1.00 0.00 ? 91 SER A CB   6  
ATOM 8613  O OG   . SER A 1 91 ? 6.266   21.826  8.890   1.00 0.00 ? 91 SER A OG   6  
ATOM 8614  H H    . SER A 1 91 ? 6.072   17.713  8.211   1.00 0.00 ? 91 SER A H    6  
ATOM 8615  H HA   . SER A 1 91 ? 5.067   19.604  8.556   1.00 0.00 ? 91 SER A HA   6  
ATOM 8616  H HB2  . SER A 1 91 ? 7.627   20.291  8.682   1.00 0.00 ? 91 SER A HB2  6  
ATOM 8617  H HB3  . SER A 1 91 ? 7.274   21.177  7.212   1.00 0.00 ? 91 SER A HB3  6  
ATOM 8618  H HG   . SER A 1 91 ? 5.767   22.456  8.295   1.00 0.00 ? 91 SER A HG   6  
ATOM 8619  N N    . GLU A 1 92 ? 3.870   19.569  6.272   1.00 0.00 ? 92 GLU A N    6  
ATOM 8620  C CA   . GLU A 1 92 ? 3.071   19.869  5.096   1.00 0.00 ? 92 GLU A CA   6  
ATOM 8621  C C    . GLU A 1 92 ? 1.807   20.634  5.493   1.00 0.00 ? 92 GLU A C    6  
ATOM 8622  O O    . GLU A 1 92 ? 0.944   20.097  6.186   1.00 0.00 ? 92 GLU A O    6  
ATOM 8623  C CB   . GLU A 1 92 ? 2.721   18.591  4.331   1.00 0.00 ? 92 GLU A CB   6  
ATOM 8624  C CG   . GLU A 1 92 ? 3.875   18.160  3.425   1.00 0.00 ? 92 GLU A CG   6  
ATOM 8625  C CD   . GLU A 1 92 ? 3.750   18.795  2.038   1.00 0.00 ? 92 GLU A CD   6  
ATOM 8626  O OE1  . GLU A 1 92 ? 3.203   19.917  1.975   1.00 0.00 ? 92 GLU A OE1  6  
ATOM 8627  O OE2  . GLU A 1 92 ? 4.205   18.145  1.073   1.00 0.00 ? 92 GLU A OE2  6  
ATOM 8628  H H    . GLU A 1 92 ? 3.455   18.921  6.910   1.00 0.00 ? 92 GLU A H    6  
ATOM 8629  H HA   . GLU A 1 92 ? 3.703   20.498  4.469   1.00 0.00 ? 92 GLU A HA   6  
ATOM 8630  H HB2  . GLU A 1 92 ? 2.490   17.792  5.036   1.00 0.00 ? 92 GLU A HB2  6  
ATOM 8631  H HB3  . GLU A 1 92 ? 1.825   18.755  3.732   1.00 0.00 ? 92 GLU A HB3  6  
ATOM 8632  H HG2  . GLU A 1 92 ? 4.824   18.448  3.877   1.00 0.00 ? 92 GLU A HG2  6  
ATOM 8633  H HG3  . GLU A 1 92 ? 3.883   17.074  3.331   1.00 0.00 ? 92 GLU A HG3  6  
ATOM 8634  N N    . SER A 1 93 ? 1.738   21.876  5.037   1.00 0.00 ? 93 SER A N    6  
ATOM 8635  C CA   . SER A 1 93 ? 0.594   22.721  5.336   1.00 0.00 ? 93 SER A CA   6  
ATOM 8636  C C    . SER A 1 93 ? -0.620  22.264  4.525   1.00 0.00 ? 93 SER A C    6  
ATOM 8637  O O    . SER A 1 93 ? -1.618  21.821  5.091   1.00 0.00 ? 93 SER A O    6  
ATOM 8638  C CB   . SER A 1 93 ? 0.904   24.191  5.046   1.00 0.00 ? 93 SER A CB   6  
ATOM 8639  O OG   . SER A 1 93 ? 1.526   24.364  3.775   1.00 0.00 ? 93 SER A OG   6  
ATOM 8640  H H    . SER A 1 93 ? 2.444   22.305  4.474   1.00 0.00 ? 93 SER A H    6  
ATOM 8641  H HA   . SER A 1 93 ? 0.412   22.592  6.403   1.00 0.00 ? 93 SER A HA   6  
ATOM 8642  H HB2  . SER A 1 93 ? -0.019  24.769  5.080   1.00 0.00 ? 93 SER A HB2  6  
ATOM 8643  H HB3  . SER A 1 93 ? 1.556   24.585  5.825   1.00 0.00 ? 93 SER A HB3  6  
ATOM 8644  H HG   . SER A 1 93 ? 2.513   24.225  3.856   1.00 0.00 ? 93 SER A HG   6  
ATOM 8645  N N    . GLY A 1 94 ? -0.495  22.387  3.212   1.00 0.00 ? 94 GLY A N    6  
ATOM 8646  C CA   . GLY A 1 94 ? -1.569  21.992  2.317   1.00 0.00 ? 94 GLY A CA   6  
ATOM 8647  C C    . GLY A 1 94 ? -2.242  20.706  2.802   1.00 0.00 ? 94 GLY A C    6  
ATOM 8648  O O    . GLY A 1 94 ? -3.254  20.755  3.499   1.00 0.00 ? 94 GLY A O    6  
ATOM 8649  H H    . GLY A 1 94 ? 0.321   22.749  2.759   1.00 0.00 ? 94 GLY A H    6  
ATOM 8650  H HA2  . GLY A 1 94 ? -2.308  22.792  2.255   1.00 0.00 ? 94 GLY A HA2  6  
ATOM 8651  H HA3  . GLY A 1 94 ? -1.175  21.845  1.312   1.00 0.00 ? 94 GLY A HA3  6  
ATOM 8652  N N    . PRO A 1 95 ? -1.635  19.556  2.403   1.00 0.00 ? 95 PRO A N    6  
ATOM 8653  C CA   . PRO A 1 95 ? -2.164  18.259  2.789   1.00 0.00 ? 95 PRO A CA   6  
ATOM 8654  C C    . PRO A 1 95 ? -1.854  17.955  4.256   1.00 0.00 ? 95 PRO A C    6  
ATOM 8655  O O    . PRO A 1 95 ? -0.792  17.420  4.572   1.00 0.00 ? 95 PRO A O    6  
ATOM 8656  C CB   . PRO A 1 95 ? -1.522  17.270  1.829   1.00 0.00 ? 95 PRO A CB   6  
ATOM 8657  C CG   . PRO A 1 95 ? -0.311  17.981  1.248   1.00 0.00 ? 95 PRO A CG   6  
ATOM 8658  C CD   . PRO A 1 95 ? -0.435  19.460  1.578   1.00 0.00 ? 95 PRO A CD   6  
ATOM 8659  H HA   . PRO A 1 95 ? -3.161  18.254  2.714   1.00 0.00 ? 95 PRO A HA   6  
ATOM 8660  H HB2  . PRO A 1 95 ? -1.228  16.358  2.347   1.00 0.00 ? 95 PRO A HB2  6  
ATOM 8661  H HB3  . PRO A 1 95 ? -2.219  16.980  1.043   1.00 0.00 ? 95 PRO A HB3  6  
ATOM 8662  H HG2  . PRO A 1 95 ? 0.609   17.573  1.667   1.00 0.00 ? 95 PRO A HG2  6  
ATOM 8663  H HG3  . PRO A 1 95 ? -0.263  17.833  0.169   1.00 0.00 ? 95 PRO A HG3  6  
ATOM 8664  H HD2  . PRO A 1 95 ? 0.443   19.822  2.112   1.00 0.00 ? 95 PRO A HD2  6  
ATOM 8665  H HD3  . PRO A 1 95 ? -0.527  20.061  0.673   1.00 0.00 ? 95 PRO A HD3  6  
ATOM 8666  N N    . SER A 1 96 ? -2.800  18.309  5.114   1.00 0.00 ? 96 SER A N    6  
ATOM 8667  C CA   . SER A 1 96 ? -2.641  18.080  6.540   1.00 0.00 ? 96 SER A CA   6  
ATOM 8668  C C    . SER A 1 96 ? -3.945  17.541  7.132   1.00 0.00 ? 96 SER A C    6  
ATOM 8669  O O    . SER A 1 96 ? -5.002  18.148  6.970   1.00 0.00 ? 96 SER A O    6  
ATOM 8670  C CB   . SER A 1 96 ? -2.223  19.364  7.260   1.00 0.00 ? 96 SER A CB   6  
ATOM 8671  O OG   . SER A 1 96 ? -3.046  20.470  6.901   1.00 0.00 ? 96 SER A OG   6  
ATOM 8672  H H    . SER A 1 96 ? -3.661  18.743  4.849   1.00 0.00 ? 96 SER A H    6  
ATOM 8673  H HA   . SER A 1 96 ? -1.846  17.340  6.627   1.00 0.00 ? 96 SER A HA   6  
ATOM 8674  H HB2  . SER A 1 96 ? -2.273  19.208  8.337   1.00 0.00 ? 96 SER A HB2  6  
ATOM 8675  H HB3  . SER A 1 96 ? -1.184  19.592  7.020   1.00 0.00 ? 96 SER A HB3  6  
ATOM 8676  H HG   . SER A 1 96 ? -2.589  21.327  7.137   1.00 0.00 ? 96 SER A HG   6  
ATOM 8677  N N    . SER A 1 97 ? -3.826  16.406  7.805   1.00 0.00 ? 97 SER A N    6  
ATOM 8678  C CA   . SER A 1 97 ? -4.982  15.777  8.422   1.00 0.00 ? 97 SER A CA   6  
ATOM 8679  C C    . SER A 1 97 ? -4.971  16.028  9.931   1.00 0.00 ? 97 SER A C    6  
ATOM 8680  O O    . SER A 1 97 ? -4.428  15.229  10.692  1.00 0.00 ? 97 SER A O    6  
ATOM 8681  C CB   . SER A 1 97 ? -5.012  14.275  8.133   1.00 0.00 ? 97 SER A CB   6  
ATOM 8682  O OG   . SER A 1 97 ? -5.980  13.941  7.143   1.00 0.00 ? 97 SER A OG   6  
ATOM 8683  H H    . SER A 1 97 ? -2.962  15.918  7.931   1.00 0.00 ? 97 SER A H    6  
ATOM 8684  H HA   . SER A 1 97 ? -5.849  16.252  7.962   1.00 0.00 ? 97 SER A HA   6  
ATOM 8685  H HB2  . SER A 1 97 ? -4.026  13.950  7.801   1.00 0.00 ? 97 SER A HB2  6  
ATOM 8686  H HB3  . SER A 1 97 ? -5.232  13.734  9.053   1.00 0.00 ? 97 SER A HB3  6  
ATOM 8687  H HG   . SER A 1 97 ? -6.023  12.948  7.029   1.00 0.00 ? 97 SER A HG   6  
ATOM 8688  N N    . GLY A 1 98 ? -5.576  17.141  10.318  1.00 0.00 ? 98 GLY A N    6  
ATOM 8689  C CA   . GLY A 1 98 ? -5.642  17.507  11.723  1.00 0.00 ? 98 GLY A CA   6  
ATOM 8690  C C    . GLY A 1 98 ? -5.921  16.282  12.596  1.00 0.00 ? 98 GLY A C    6  
ATOM 8691  O O    . GLY A 1 98 ? -5.263  16.078  13.615  1.00 0.00 ? 98 GLY A O    6  
ATOM 8692  H H    . GLY A 1 98 ? -6.015  17.786  9.692   1.00 0.00 ? 98 GLY A H    6  
ATOM 8693  H HA2  . GLY A 1 98 ? -4.702  17.968  12.027  1.00 0.00 ? 98 GLY A HA2  6  
ATOM 8694  H HA3  . GLY A 1 98 ? -6.425  18.251  11.872  1.00 0.00 ? 98 GLY A HA3  6  
ATOM 8695  N N    . GLY A 1 1  ? -17.367 8.377   -19.024 1.00 0.00 ? 1  GLY A N    7  
ATOM 8696  C CA   . GLY A 1 1  ? -16.193 7.985   -18.262 1.00 0.00 ? 1  GLY A CA   7  
ATOM 8697  C C    . GLY A 1 1  ? -14.915 8.522   -18.909 1.00 0.00 ? 1  GLY A C    7  
ATOM 8698  O O    . GLY A 1 1  ? -14.924 9.592   -19.515 1.00 0.00 ? 1  GLY A O    7  
ATOM 8699  H H1   . GLY A 1 1  ? -17.204 9.075   -19.722 1.00 0.00 ? 1  GLY A H1   7  
ATOM 8700  H HA2  . GLY A 1 1  ? -16.275 8.361   -17.242 1.00 0.00 ? 1  GLY A HA2  7  
ATOM 8701  H HA3  . GLY A 1 1  ? -16.144 6.898   -18.198 1.00 0.00 ? 1  GLY A HA3  7  
ATOM 8702  N N    . SER A 1 2  ? -13.846 7.753   -18.758 1.00 0.00 ? 2  SER A N    7  
ATOM 8703  C CA   . SER A 1 2  ? -12.562 8.138   -19.319 1.00 0.00 ? 2  SER A CA   7  
ATOM 8704  C C    . SER A 1 2  ? -12.169 7.171   -20.437 1.00 0.00 ? 2  SER A C    7  
ATOM 8705  O O    . SER A 1 2  ? -11.974 7.583   -21.580 1.00 0.00 ? 2  SER A O    7  
ATOM 8706  C CB   . SER A 1 2  ? -11.477 8.172   -18.241 1.00 0.00 ? 2  SER A CB   7  
ATOM 8707  O OG   . SER A 1 2  ? -10.211 8.556   -18.770 1.00 0.00 ? 2  SER A OG   7  
ATOM 8708  H H    . SER A 1 2  ? -13.847 6.884   -18.263 1.00 0.00 ? 2  SER A H    7  
ATOM 8709  H HA   . SER A 1 2  ? -12.711 9.142   -19.717 1.00 0.00 ? 2  SER A HA   7  
ATOM 8710  H HB2  . SER A 1 2  ? -11.769 8.870   -17.456 1.00 0.00 ? 2  SER A HB2  7  
ATOM 8711  H HB3  . SER A 1 2  ? -11.394 7.189   -17.779 1.00 0.00 ? 2  SER A HB3  7  
ATOM 8712  H HG   . SER A 1 2  ? -10.156 8.311   -19.738 1.00 0.00 ? 2  SER A HG   7  
ATOM 8713  N N    . SER A 1 3  ? -12.064 5.902   -20.069 1.00 0.00 ? 3  SER A N    7  
ATOM 8714  C CA   . SER A 1 3  ? -11.698 4.873   -21.027 1.00 0.00 ? 3  SER A CA   7  
ATOM 8715  C C    . SER A 1 3  ? -12.243 3.517   -20.573 1.00 0.00 ? 3  SER A C    7  
ATOM 8716  O O    . SER A 1 3  ? -13.022 2.887   -21.286 1.00 0.00 ? 3  SER A O    7  
ATOM 8717  C CB   . SER A 1 3  ? -10.180 4.802   -21.206 1.00 0.00 ? 3  SER A CB   7  
ATOM 8718  O OG   . SER A 1 3  ? -9.804  3.859   -22.205 1.00 0.00 ? 3  SER A OG   7  
ATOM 8719  H H    . SER A 1 3  ? -12.225 5.575   -19.138 1.00 0.00 ? 3  SER A H    7  
ATOM 8720  H HA   . SER A 1 3  ? -12.160 5.175   -21.967 1.00 0.00 ? 3  SER A HA   7  
ATOM 8721  H HB2  . SER A 1 3  ? -9.800  5.787   -21.476 1.00 0.00 ? 3  SER A HB2  7  
ATOM 8722  H HB3  . SER A 1 3  ? -9.716  4.530   -20.257 1.00 0.00 ? 3  SER A HB3  7  
ATOM 8723  H HG   . SER A 1 3  ? -10.613 3.548   -22.704 1.00 0.00 ? 3  SER A HG   7  
ATOM 8724  N N    . GLY A 1 4  ? -11.812 3.109   -19.389 1.00 0.00 ? 4  GLY A N    7  
ATOM 8725  C CA   . GLY A 1 4  ? -12.247 1.840   -18.831 1.00 0.00 ? 4  GLY A CA   7  
ATOM 8726  C C    . GLY A 1 4  ? -11.103 0.824   -18.823 1.00 0.00 ? 4  GLY A C    7  
ATOM 8727  O O    . GLY A 1 4  ? -10.262 0.837   -17.925 1.00 0.00 ? 4  GLY A O    7  
ATOM 8728  H H    . GLY A 1 4  ? -11.178 3.628   -18.815 1.00 0.00 ? 4  GLY A H    7  
ATOM 8729  H HA2  . GLY A 1 4  ? -12.611 1.991   -17.814 1.00 0.00 ? 4  GLY A HA2  7  
ATOM 8730  H HA3  . GLY A 1 4  ? -13.081 1.449   -19.413 1.00 0.00 ? 4  GLY A HA3  7  
ATOM 8731  N N    . SER A 1 5  ? -11.108 -0.033  -19.833 1.00 0.00 ? 5  SER A N    7  
ATOM 8732  C CA   . SER A 1 5  ? -10.081 -1.054  -19.954 1.00 0.00 ? 5  SER A CA   7  
ATOM 8733  C C    . SER A 1 5  ? -9.024  -0.616  -20.969 1.00 0.00 ? 5  SER A C    7  
ATOM 8734  O O    . SER A 1 5  ? -9.322  -0.454  -22.151 1.00 0.00 ? 5  SER A O    7  
ATOM 8735  C CB   . SER A 1 5  ? -10.686 -2.398  -20.365 1.00 0.00 ? 5  SER A CB   7  
ATOM 8736  O OG   . SER A 1 5  ? -9.693  -3.318  -20.807 1.00 0.00 ? 5  SER A OG   7  
ATOM 8737  H H    . SER A 1 5  ? -11.795 -0.037  -20.559 1.00 0.00 ? 5  SER A H    7  
ATOM 8738  H HA   . SER A 1 5  ? -9.644  -1.143  -18.959 1.00 0.00 ? 5  SER A HA   7  
ATOM 8739  H HB2  . SER A 1 5  ? -11.226 -2.826  -19.520 1.00 0.00 ? 5  SER A HB2  7  
ATOM 8740  H HB3  . SER A 1 5  ? -11.414 -2.240  -21.161 1.00 0.00 ? 5  SER A HB3  7  
ATOM 8741  H HG   . SER A 1 5  ? -10.025 -3.823  -21.604 1.00 0.00 ? 5  SER A HG   7  
ATOM 8742  N N    . SER A 1 6  ? -7.809  -0.436  -20.470 1.00 0.00 ? 6  SER A N    7  
ATOM 8743  C CA   . SER A 1 6  ? -6.706  -0.020  -21.319 1.00 0.00 ? 6  SER A CA   7  
ATOM 8744  C C    . SER A 1 6  ? -5.449  -0.820  -20.973 1.00 0.00 ? 6  SER A C    7  
ATOM 8745  O O    . SER A 1 6  ? -4.915  -1.539  -21.816 1.00 0.00 ? 6  SER A O    7  
ATOM 8746  C CB   . SER A 1 6  ? -6.437  1.480   -21.175 1.00 0.00 ? 6  SER A CB   7  
ATOM 8747  O OG   . SER A 1 6  ? -6.322  2.125   -22.441 1.00 0.00 ? 6  SER A OG   7  
ATOM 8748  H H    . SER A 1 6  ? -7.575  -0.570  -19.507 1.00 0.00 ? 6  SER A H    7  
ATOM 8749  H HA   . SER A 1 6  ? -7.028  -0.235  -22.337 1.00 0.00 ? 6  SER A HA   7  
ATOM 8750  H HB2  . SER A 1 6  ? -7.243  1.940   -20.605 1.00 0.00 ? 6  SER A HB2  7  
ATOM 8751  H HB3  . SER A 1 6  ? -5.519  1.630   -20.607 1.00 0.00 ? 6  SER A HB3  7  
ATOM 8752  H HG   . SER A 1 6  ? -7.108  2.725   -22.591 1.00 0.00 ? 6  SER A HG   7  
ATOM 8753  N N    . GLY A 1 7  ? -5.012  -0.669  -19.731 1.00 0.00 ? 7  GLY A N    7  
ATOM 8754  C CA   . GLY A 1 7  ? -3.828  -1.369  -19.264 1.00 0.00 ? 7  GLY A CA   7  
ATOM 8755  C C    . GLY A 1 7  ? -2.562  -0.786  -19.894 1.00 0.00 ? 7  GLY A C    7  
ATOM 8756  O O    . GLY A 1 7  ? -2.324  -0.955  -21.089 1.00 0.00 ? 7  GLY A O    7  
ATOM 8757  H H    . GLY A 1 7  ? -5.452  -0.082  -19.051 1.00 0.00 ? 7  GLY A H    7  
ATOM 8758  H HA2  . GLY A 1 7  ? -3.764  -1.298  -18.178 1.00 0.00 ? 7  GLY A HA2  7  
ATOM 8759  H HA3  . GLY A 1 7  ? -3.906  -2.428  -19.510 1.00 0.00 ? 7  GLY A HA3  7  
ATOM 8760  N N    . GLU A 1 8  ? -1.782  -0.111  -19.062 1.00 0.00 ? 8  GLU A N    7  
ATOM 8761  C CA   . GLU A 1 8  ? -0.546  0.499   -19.523 1.00 0.00 ? 8  GLU A CA   7  
ATOM 8762  C C    . GLU A 1 8  ? 0.595   0.180   -18.555 1.00 0.00 ? 8  GLU A C    7  
ATOM 8763  O O    . GLU A 1 8  ? 0.358   -0.110  -17.384 1.00 0.00 ? 8  GLU A O    7  
ATOM 8764  C CB   . GLU A 1 8  ? -0.712  2.010   -19.697 1.00 0.00 ? 8  GLU A CB   7  
ATOM 8765  C CG   . GLU A 1 8  ? -0.007  2.496   -20.965 1.00 0.00 ? 8  GLU A CG   7  
ATOM 8766  C CD   . GLU A 1 8  ? -0.721  3.713   -21.557 1.00 0.00 ? 8  GLU A CD   7  
ATOM 8767  O OE1  . GLU A 1 8  ? -0.963  4.662   -20.780 1.00 0.00 ? 8  GLU A OE1  7  
ATOM 8768  O OE2  . GLU A 1 8  ? -1.009  3.667   -22.772 1.00 0.00 ? 8  GLU A OE2  7  
ATOM 8769  H H    . GLU A 1 8  ? -1.983  0.022   -18.091 1.00 0.00 ? 8  GLU A H    7  
ATOM 8770  H HA   . GLU A 1 8  ? -0.345  0.047   -20.494 1.00 0.00 ? 8  GLU A HA   7  
ATOM 8771  H HB2  . GLU A 1 8  ? -1.771  2.260   -19.747 1.00 0.00 ? 8  GLU A HB2  7  
ATOM 8772  H HB3  . GLU A 1 8  ? -0.303  2.527   -18.829 1.00 0.00 ? 8  GLU A HB3  7  
ATOM 8773  H HG2  . GLU A 1 8  ? 1.027   2.752   -20.735 1.00 0.00 ? 8  GLU A HG2  7  
ATOM 8774  H HG3  . GLU A 1 8  ? 0.020   1.692   -21.701 1.00 0.00 ? 8  GLU A HG3  7  
ATOM 8775  N N    . PHE A 1 9  ? 1.810   0.245   -19.081 1.00 0.00 ? 9  PHE A N    7  
ATOM 8776  C CA   . PHE A 1 9  ? 2.989   -0.033  -18.279 1.00 0.00 ? 9  PHE A CA   7  
ATOM 8777  C C    . PHE A 1 9  ? 4.040   1.065   -18.451 1.00 0.00 ? 9  PHE A C    7  
ATOM 8778  O O    . PHE A 1 9  ? 4.483   1.337   -19.566 1.00 0.00 ? 9  PHE A O    7  
ATOM 8779  C CB   . PHE A 1 9  ? 3.567   -1.359  -18.778 1.00 0.00 ? 9  PHE A CB   7  
ATOM 8780  C CG   . PHE A 1 9  ? 3.018   -2.589  -18.054 1.00 0.00 ? 9  PHE A CG   7  
ATOM 8781  C CD1  . PHE A 1 9  ? 3.558   -2.978  -16.868 1.00 0.00 ? 9  PHE A CD1  7  
ATOM 8782  C CD2  . PHE A 1 9  ? 1.989   -3.294  -18.596 1.00 0.00 ? 9  PHE A CD2  7  
ATOM 8783  C CE1  . PHE A 1 9  ? 3.048   -4.120  -16.196 1.00 0.00 ? 9  PHE A CE1  7  
ATOM 8784  C CE2  . PHE A 1 9  ? 1.479   -4.437  -17.924 1.00 0.00 ? 9  PHE A CE2  7  
ATOM 8785  C CZ   . PHE A 1 9  ? 2.019   -4.826  -16.738 1.00 0.00 ? 9  PHE A CZ   7  
ATOM 8786  H H    . PHE A 1 9  ? 1.994   0.481   -20.035 1.00 0.00 ? 9  PHE A H    7  
ATOM 8787  H HA   . PHE A 1 9  ? 2.670   -0.069  -17.237 1.00 0.00 ? 9  PHE A HA   7  
ATOM 8788  H HB2  . PHE A 1 9  ? 3.361   -1.455  -19.844 1.00 0.00 ? 9  PHE A HB2  7  
ATOM 8789  H HB3  . PHE A 1 9  ? 4.651   -1.336  -18.664 1.00 0.00 ? 9  PHE A HB3  7  
ATOM 8790  H HD1  . PHE A 1 9  ? 4.383   -2.413  -16.434 1.00 0.00 ? 9  PHE A HD1  7  
ATOM 8791  H HD2  . PHE A 1 9  ? 1.556   -2.983  -19.547 1.00 0.00 ? 9  PHE A HD2  7  
ATOM 8792  H HE1  . PHE A 1 9  ? 3.481   -4.432  -15.246 1.00 0.00 ? 9  PHE A HE1  7  
ATOM 8793  H HE2  . PHE A 1 9  ? 0.654   -5.002  -18.359 1.00 0.00 ? 9  PHE A HE2  7  
ATOM 8794  H HZ   . PHE A 1 9  ? 1.628   -5.702  -16.222 1.00 0.00 ? 9  PHE A HZ   7  
ATOM 8795  N N    . VAL A 1 10 ? 4.409   1.667   -17.329 1.00 0.00 ? 10 VAL A N    7  
ATOM 8796  C CA   . VAL A 1 10 ? 5.400   2.730   -17.342 1.00 0.00 ? 10 VAL A CA   7  
ATOM 8797  C C    . VAL A 1 10 ? 6.576   2.335   -16.446 1.00 0.00 ? 10 VAL A C    7  
ATOM 8798  O O    . VAL A 1 10 ? 6.417   2.190   -15.235 1.00 0.00 ? 10 VAL A O    7  
ATOM 8799  C CB   . VAL A 1 10 ? 4.753   4.054   -16.930 1.00 0.00 ? 10 VAL A CB   7  
ATOM 8800  C CG1  . VAL A 1 10 ? 5.815   5.109   -16.617 1.00 0.00 ? 10 VAL A CG1  7  
ATOM 8801  C CG2  . VAL A 1 10 ? 3.787   4.550   -18.007 1.00 0.00 ? 10 VAL A CG2  7  
ATOM 8802  H H    . VAL A 1 10 ? 4.044   1.440   -16.427 1.00 0.00 ? 10 VAL A H    7  
ATOM 8803  H HA   . VAL A 1 10 ? 5.758   2.833   -18.366 1.00 0.00 ? 10 VAL A HA   7  
ATOM 8804  H HB   . VAL A 1 10 ? 4.178   3.877   -16.020 1.00 0.00 ? 10 VAL A HB   7  
ATOM 8805  H HG11 . VAL A 1 10 ? 6.325   5.395   -17.537 1.00 0.00 ? 10 VAL A HG11 7  
ATOM 8806  H HG12 . VAL A 1 10 ? 5.339   5.986   -16.178 1.00 0.00 ? 10 VAL A HG12 7  
ATOM 8807  H HG13 . VAL A 1 10 ? 6.539   4.699   -15.913 1.00 0.00 ? 10 VAL A HG13 7  
ATOM 8808  H HG21 . VAL A 1 10 ? 3.146   3.729   -18.327 1.00 0.00 ? 10 VAL A HG21 7  
ATOM 8809  H HG22 . VAL A 1 10 ? 3.172   5.354   -17.601 1.00 0.00 ? 10 VAL A HG22 7  
ATOM 8810  H HG23 . VAL A 1 10 ? 4.354   4.923   -18.860 1.00 0.00 ? 10 VAL A HG23 7  
ATOM 8811  N N    . ILE A 1 11 ? 7.730   2.172   -17.076 1.00 0.00 ? 11 ILE A N    7  
ATOM 8812  C CA   . ILE A 1 11 ? 8.932   1.797   -16.352 1.00 0.00 ? 11 ILE A CA   7  
ATOM 8813  C C    . ILE A 1 11 ? 9.241   2.863   -15.299 1.00 0.00 ? 11 ILE A C    7  
ATOM 8814  O O    . ILE A 1 11 ? 9.178   4.058   -15.583 1.00 0.00 ? 11 ILE A O    7  
ATOM 8815  C CB   . ILE A 1 11 ? 10.085  1.540   -17.324 1.00 0.00 ? 11 ILE A CB   7  
ATOM 8816  C CG1  . ILE A 1 11 ? 10.456  2.815   -18.085 1.00 0.00 ? 11 ILE A CG1  7  
ATOM 8817  C CG2  . ILE A 1 11 ? 9.758   0.383   -18.269 1.00 0.00 ? 11 ILE A CG2  7  
ATOM 8818  C CD1  . ILE A 1 11 ? 11.949  3.119   -17.950 1.00 0.00 ? 11 ILE A CD1  7  
ATOM 8819  H H    . ILE A 1 11 ? 7.851   2.292   -18.062 1.00 0.00 ? 11 ILE A H    7  
ATOM 8820  H HA   . ILE A 1 11 ? 8.726   0.856   -15.841 1.00 0.00 ? 11 ILE A HA   7  
ATOM 8821  H HB   . ILE A 1 11 ? 10.961  1.245   -16.745 1.00 0.00 ? 11 ILE A HB   7  
ATOM 8822  H HG12 . ILE A 1 11 ? 10.197  2.702   -19.137 1.00 0.00 ? 11 ILE A HG12 7  
ATOM 8823  H HG13 . ILE A 1 11 ? 9.874   3.653   -17.701 1.00 0.00 ? 11 ILE A HG13 7  
ATOM 8824  H HG21 . ILE A 1 11 ? 8.684   0.357   -18.454 1.00 0.00 ? 11 ILE A HG21 7  
ATOM 8825  H HG22 . ILE A 1 11 ? 10.286  0.524   -19.213 1.00 0.00 ? 11 ILE A HG22 7  
ATOM 8826  H HG23 . ILE A 1 11 ? 10.071  -0.557  -17.815 1.00 0.00 ? 11 ILE A HG23 7  
ATOM 8827  H HD11 . ILE A 1 11 ? 12.145  3.550   -16.968 1.00 0.00 ? 11 ILE A HD11 7  
ATOM 8828  H HD12 . ILE A 1 11 ? 12.519  2.197   -18.063 1.00 0.00 ? 11 ILE A HD12 7  
ATOM 8829  H HD13 . ILE A 1 11 ? 12.246  3.828   -18.724 1.00 0.00 ? 11 ILE A HD13 7  
ATOM 8830  N N    . ASN A 1 12 ? 9.569   2.392   -14.104 1.00 0.00 ? 12 ASN A N    7  
ATOM 8831  C CA   . ASN A 1 12 ? 9.888   3.290   -13.008 1.00 0.00 ? 12 ASN A CA   7  
ATOM 8832  C C    . ASN A 1 12 ? 11.044  4.203   -13.422 1.00 0.00 ? 12 ASN A C    7  
ATOM 8833  O O    . ASN A 1 12 ? 11.959  3.773   -14.121 1.00 0.00 ? 12 ASN A O    7  
ATOM 8834  C CB   . ASN A 1 12 ? 10.324  2.509   -11.766 1.00 0.00 ? 12 ASN A CB   7  
ATOM 8835  C CG   . ASN A 1 12 ? 11.531  1.621   -12.073 1.00 0.00 ? 12 ASN A CG   7  
ATOM 8836  O OD1  . ASN A 1 12 ? 11.466  0.692   -12.862 1.00 0.00 ? 12 ASN A OD1  7  
ATOM 8837  N ND2  . ASN A 1 12 ? 12.632  1.955   -11.406 1.00 0.00 ? 12 ASN A ND2  7  
ATOM 8838  H H    . ASN A 1 12 ? 9.618   1.418   -13.882 1.00 0.00 ? 12 ASN A H    7  
ATOM 8839  H HA   . ASN A 1 12 ? 8.969   3.842   -12.813 1.00 0.00 ? 12 ASN A HA   7  
ATOM 8840  H HB2  . ASN A 1 12 ? 10.574  3.204   -10.964 1.00 0.00 ? 12 ASN A HB2  7  
ATOM 8841  H HB3  . ASN A 1 12 ? 9.497   1.896   -11.409 1.00 0.00 ? 12 ASN A HB3  7  
ATOM 8842  H HD21 . ASN A 1 12 ? 12.618  2.728   -10.773 1.00 0.00 ? 12 ASN A HD21 7  
ATOM 8843  H HD22 . ASN A 1 12 ? 13.475  1.433   -11.539 1.00 0.00 ? 12 ASN A HD22 7  
ATOM 8844  N N    . PRO A 1 13 ? 10.961  5.480   -12.960 1.00 0.00 ? 13 PRO A N    7  
ATOM 8845  C CA   . PRO A 1 13 ? 11.989  6.457   -13.275 1.00 0.00 ? 13 PRO A CA   7  
ATOM 8846  C C    . PRO A 1 13 ? 13.255  6.206   -12.454 1.00 0.00 ? 13 PRO A C    7  
ATOM 8847  O O    . PRO A 1 13 ? 13.713  7.086   -11.728 1.00 0.00 ? 13 PRO A O    7  
ATOM 8848  C CB   . PRO A 1 13 ? 11.351  7.806   -12.984 1.00 0.00 ? 13 PRO A CB   7  
ATOM 8849  C CG   . PRO A 1 13 ? 10.161  7.519   -12.082 1.00 0.00 ? 13 PRO A CG   7  
ATOM 8850  C CD   . PRO A 1 13 ? 9.891   6.024   -12.129 1.00 0.00 ? 13 PRO A CD   7  
ATOM 8851  H HA   . PRO A 1 13 ? 12.263  6.376   -14.233 1.00 0.00 ? 13 PRO A HA   7  
ATOM 8852  H HB2  . PRO A 1 13 ? 12.059  8.476   -12.496 1.00 0.00 ? 13 PRO A HB2  7  
ATOM 8853  H HB3  . PRO A 1 13 ? 11.033  8.295   -13.906 1.00 0.00 ? 13 PRO A HB3  7  
ATOM 8854  H HG2  . PRO A 1 13 ? 10.371  7.837   -11.061 1.00 0.00 ? 13 PRO A HG2  7  
ATOM 8855  H HG3  . PRO A 1 13 ? 9.286   8.076   -12.416 1.00 0.00 ? 13 PRO A HG3  7  
ATOM 8856  H HD2  . PRO A 1 13 ? 9.905   5.588   -11.130 1.00 0.00 ? 13 PRO A HD2  7  
ATOM 8857  H HD3  . PRO A 1 13 ? 8.911   5.812   -12.556 1.00 0.00 ? 13 PRO A HD3  7  
ATOM 8858  N N    . ASN A 1 14 ? 13.784  5.000   -12.597 1.00 0.00 ? 14 ASN A N    7  
ATOM 8859  C CA   . ASN A 1 14 ? 14.989  4.621   -11.878 1.00 0.00 ? 14 ASN A CA   7  
ATOM 8860  C C    . ASN A 1 14 ? 14.723  4.694   -10.373 1.00 0.00 ? 14 ASN A C    7  
ATOM 8861  O O    . ASN A 1 14 ? 13.996  5.571   -9.908  1.00 0.00 ? 14 ASN A O    7  
ATOM 8862  C CB   . ASN A 1 14 ? 16.144  5.570   -12.200 1.00 0.00 ? 14 ASN A CB   7  
ATOM 8863  C CG   . ASN A 1 14 ? 16.699  5.303   -13.600 1.00 0.00 ? 14 ASN A CG   7  
ATOM 8864  O OD1  . ASN A 1 14 ? 16.004  4.854   -14.496 1.00 0.00 ? 14 ASN A OD1  7  
ATOM 8865  N ND2  . ASN A 1 14 ? 17.987  5.604   -13.738 1.00 0.00 ? 14 ASN A ND2  7  
ATOM 8866  H H    . ASN A 1 14 ? 13.405  4.289   -13.190 1.00 0.00 ? 14 ASN A H    7  
ATOM 8867  H HA   . ASN A 1 14 ? 15.216  3.609   -12.213 1.00 0.00 ? 14 ASN A HA   7  
ATOM 8868  H HB2  . ASN A 1 14 ? 15.801  6.603   -12.132 1.00 0.00 ? 14 ASN A HB2  7  
ATOM 8869  H HB3  . ASN A 1 14 ? 16.937  5.448   -11.461 1.00 0.00 ? 14 ASN A HB3  7  
ATOM 8870  H HD21 . ASN A 1 14 ? 18.501  5.970   -12.962 1.00 0.00 ? 14 ASN A HD21 7  
ATOM 8871  H HD22 . ASN A 1 14 ? 18.442  5.465   -14.618 1.00 0.00 ? 14 ASN A HD22 7  
ATOM 8872  N N    . GLY A 1 15 ? 15.326  3.759   -9.652  1.00 0.00 ? 15 GLY A N    7  
ATOM 8873  C CA   . GLY A 1 15 ? 15.163  3.706   -8.209  1.00 0.00 ? 15 GLY A CA   7  
ATOM 8874  C C    . GLY A 1 15 ? 13.868  2.985   -7.829  1.00 0.00 ? 15 GLY A C    7  
ATOM 8875  O O    . GLY A 1 15 ? 13.195  2.416   -8.688  1.00 0.00 ? 15 GLY A O    7  
ATOM 8876  H H    . GLY A 1 15 ? 15.915  3.049   -10.037 1.00 0.00 ? 15 GLY A H    7  
ATOM 8877  H HA2  . GLY A 1 15 ? 16.014  3.193   -7.762  1.00 0.00 ? 15 GLY A HA2  7  
ATOM 8878  H HA3  . GLY A 1 15 ? 15.152  4.718   -7.803  1.00 0.00 ? 15 GLY A HA3  7  
ATOM 8879  N N    . LYS A 1 16 ? 13.558  3.032   -6.542  1.00 0.00 ? 16 LYS A N    7  
ATOM 8880  C CA   . LYS A 1 16 ? 12.356  2.391   -6.038  1.00 0.00 ? 16 LYS A CA   7  
ATOM 8881  C C    . LYS A 1 16 ? 11.392  3.459   -5.517  1.00 0.00 ? 16 LYS A C    7  
ATOM 8882  O O    . LYS A 1 16 ? 11.809  4.569   -5.191  1.00 0.00 ? 16 LYS A O    7  
ATOM 8883  C CB   . LYS A 1 16 ? 12.712  1.325   -4.999  1.00 0.00 ? 16 LYS A CB   7  
ATOM 8884  C CG   . LYS A 1 16 ? 13.452  1.944   -3.811  1.00 0.00 ? 16 LYS A CG   7  
ATOM 8885  C CD   . LYS A 1 16 ? 14.920  1.513   -3.795  1.00 0.00 ? 16 LYS A CD   7  
ATOM 8886  C CE   . LYS A 1 16 ? 15.820  2.653   -3.315  1.00 0.00 ? 16 LYS A CE   7  
ATOM 8887  N NZ   . LYS A 1 16 ? 16.608  3.200   -4.442  1.00 0.00 ? 16 LYS A NZ   7  
ATOM 8888  H H    . LYS A 1 16 ? 14.110  3.497   -5.850  1.00 0.00 ? 16 LYS A H    7  
ATOM 8889  H HA   . LYS A 1 16 ? 11.883  1.878   -6.876  1.00 0.00 ? 16 LYS A HA   7  
ATOM 8890  H HB2  . LYS A 1 16 ? 11.804  0.833   -4.651  1.00 0.00 ? 16 LYS A HB2  7  
ATOM 8891  H HB3  . LYS A 1 16 ? 13.334  0.557   -5.459  1.00 0.00 ? 16 LYS A HB3  7  
ATOM 8892  H HG2  . LYS A 1 16 ? 13.388  3.031   -3.865  1.00 0.00 ? 16 LYS A HG2  7  
ATOM 8893  H HG3  . LYS A 1 16 ? 12.970  1.642   -2.881  1.00 0.00 ? 16 LYS A HG3  7  
ATOM 8894  H HD2  . LYS A 1 16 ? 15.042  0.649   -3.141  1.00 0.00 ? 16 LYS A HD2  7  
ATOM 8895  H HD3  . LYS A 1 16 ? 15.222  1.202   -4.794  1.00 0.00 ? 16 LYS A HD3  7  
ATOM 8896  H HE2  . LYS A 1 16 ? 15.213  3.442   -2.871  1.00 0.00 ? 16 LYS A HE2  7  
ATOM 8897  H HE3  . LYS A 1 16 ? 16.491  2.291   -2.536  1.00 0.00 ? 16 LYS A HE3  7  
ATOM 8898  H HZ1  . LYS A 1 16 ? 17.562  2.912   -4.353  1.00 0.00 ? 16 LYS A HZ1  7  
ATOM 8899  H HZ2  . LYS A 1 16 ? 16.236  2.860   -5.305  1.00 0.00 ? 16 LYS A HZ2  7  
ATOM 8900  H HZ3  . LYS A 1 16 ? 16.560  4.199   -4.428  1.00 0.00 ? 16 LYS A HZ3  7  
ATOM 8901  N N    . SER A 1 17 ? 10.122  3.086   -5.456  1.00 0.00 ? 17 SER A N    7  
ATOM 8902  C CA   . SER A 1 17 ? 9.096   3.999   -4.981  1.00 0.00 ? 17 SER A CA   7  
ATOM 8903  C C    . SER A 1 17 ? 8.416   3.420   -3.738  1.00 0.00 ? 17 SER A C    7  
ATOM 8904  O O    . SER A 1 17 ? 8.805   2.360   -3.251  1.00 0.00 ? 17 SER A O    7  
ATOM 8905  C CB   . SER A 1 17 ? 8.060   4.279   -6.071  1.00 0.00 ? 17 SER A CB   7  
ATOM 8906  O OG   . SER A 1 17 ? 7.643   5.641   -6.074  1.00 0.00 ? 17 SER A OG   7  
ATOM 8907  H H    . SER A 1 17 ? 9.792   2.181   -5.724  1.00 0.00 ? 17 SER A H    7  
ATOM 8908  H HA   . SER A 1 17 ? 9.622   4.921   -4.734  1.00 0.00 ? 17 SER A HA   7  
ATOM 8909  H HB2  . SER A 1 17 ? 8.481   4.027   -7.044  1.00 0.00 ? 17 SER A HB2  7  
ATOM 8910  H HB3  . SER A 1 17 ? 7.194   3.635   -5.922  1.00 0.00 ? 17 SER A HB3  7  
ATOM 8911  H HG   . SER A 1 17 ? 6.767   5.732   -5.600  1.00 0.00 ? 17 SER A HG   7  
ATOM 8912  N N    . GLU A 1 18 ? 7.413   4.142   -3.262  1.00 0.00 ? 18 GLU A N    7  
ATOM 8913  C CA   . GLU A 1 18 ? 6.675   3.714   -2.086  1.00 0.00 ? 18 GLU A CA   7  
ATOM 8914  C C    . GLU A 1 18 ? 5.976   2.379   -2.354  1.00 0.00 ? 18 GLU A C    7  
ATOM 8915  O O    . GLU A 1 18 ? 5.766   1.588   -1.436  1.00 0.00 ? 18 GLU A O    7  
ATOM 8916  C CB   . GLU A 1 18 ? 5.669   4.781   -1.650  1.00 0.00 ? 18 GLU A CB   7  
ATOM 8917  C CG   . GLU A 1 18 ? 5.794   5.074   -0.154  1.00 0.00 ? 18 GLU A CG   7  
ATOM 8918  C CD   . GLU A 1 18 ? 7.121   5.767   0.161   1.00 0.00 ? 18 GLU A CD   7  
ATOM 8919  O OE1  . GLU A 1 18 ? 8.121   5.033   0.316   1.00 0.00 ? 18 GLU A OE1  7  
ATOM 8920  O OE2  . GLU A 1 18 ? 7.105   7.014   0.240   1.00 0.00 ? 18 GLU A OE2  7  
ATOM 8921  H H    . GLU A 1 18 ? 7.103   5.003   -3.664  1.00 0.00 ? 18 GLU A H    7  
ATOM 8922  H HA   . GLU A 1 18 ? 7.424   3.588   -1.304  1.00 0.00 ? 18 GLU A HA   7  
ATOM 8923  H HB2  . GLU A 1 18 ? 5.836   5.696   -2.218  1.00 0.00 ? 18 GLU A HB2  7  
ATOM 8924  H HB3  . GLU A 1 18 ? 4.657   4.446   -1.876  1.00 0.00 ? 18 GLU A HB3  7  
ATOM 8925  H HG2  . GLU A 1 18 ? 4.965   5.705   0.167   1.00 0.00 ? 18 GLU A HG2  7  
ATOM 8926  H HG3  . GLU A 1 18 ? 5.723   4.143   0.410   1.00 0.00 ? 18 GLU A HG3  7  
ATOM 8927  N N    . VAL A 1 19 ? 5.635   2.170   -3.617  1.00 0.00 ? 19 VAL A N    7  
ATOM 8928  C CA   . VAL A 1 19 ? 4.964   0.945   -4.019  1.00 0.00 ? 19 VAL A CA   7  
ATOM 8929  C C    . VAL A 1 19 ? 5.953   -0.220  -3.947  1.00 0.00 ? 19 VAL A C    7  
ATOM 8930  O O    . VAL A 1 19 ? 5.565   -1.352  -3.666  1.00 0.00 ? 19 VAL A O    7  
ATOM 8931  C CB   . VAL A 1 19 ? 4.344   1.119   -5.406  1.00 0.00 ? 19 VAL A CB   7  
ATOM 8932  C CG1  . VAL A 1 19 ? 3.284   2.223   -5.399  1.00 0.00 ? 19 VAL A CG1  7  
ATOM 8933  C CG2  . VAL A 1 19 ? 5.420   1.398   -6.457  1.00 0.00 ? 19 VAL A CG2  7  
ATOM 8934  H H    . VAL A 1 19 ? 5.809   2.819   -4.358  1.00 0.00 ? 19 VAL A H    7  
ATOM 8935  H HA   . VAL A 1 19 ? 4.157   0.764   -3.308  1.00 0.00 ? 19 VAL A HA   7  
ATOM 8936  H HB   . VAL A 1 19 ? 3.851   0.183   -5.673  1.00 0.00 ? 19 VAL A HB   7  
ATOM 8937  H HG11 . VAL A 1 19 ? 2.757   2.214   -4.445  1.00 0.00 ? 19 VAL A HG11 7  
ATOM 8938  H HG12 . VAL A 1 19 ? 3.767   3.190   -5.540  1.00 0.00 ? 19 VAL A HG12 7  
ATOM 8939  H HG13 . VAL A 1 19 ? 2.574   2.050   -6.208  1.00 0.00 ? 19 VAL A HG13 7  
ATOM 8940  H HG21 . VAL A 1 19 ? 6.321   0.836   -6.212  1.00 0.00 ? 19 VAL A HG21 7  
ATOM 8941  H HG22 . VAL A 1 19 ? 5.057   1.094   -7.439  1.00 0.00 ? 19 VAL A HG22 7  
ATOM 8942  H HG23 . VAL A 1 19 ? 5.649   2.464   -6.468  1.00 0.00 ? 19 VAL A HG23 7  
ATOM 8943  N N    . CYS A 1 20 ? 7.213   0.099   -4.207  1.00 0.00 ? 20 CYS A N    7  
ATOM 8944  C CA   . CYS A 1 20 ? 8.261   -0.908  -4.175  1.00 0.00 ? 20 CYS A CA   7  
ATOM 8945  C C    . CYS A 1 20 ? 8.669   -1.131  -2.718  1.00 0.00 ? 20 CYS A C    7  
ATOM 8946  O O    . CYS A 1 20 ? 8.799   -2.270  -2.273  1.00 0.00 ? 20 CYS A O    7  
ATOM 8947  C CB   . CYS A 1 20 ? 9.453   -0.510  -5.048  1.00 0.00 ? 20 CYS A CB   7  
ATOM 8948  S SG   . CYS A 1 20 ? 8.970   -0.524  -6.813  1.00 0.00 ? 20 CYS A SG   7  
ATOM 8949  H H    . CYS A 1 20 ? 7.521   1.022   -4.435  1.00 0.00 ? 20 CYS A H    7  
ATOM 8950  H HA   . CYS A 1 20 ? 7.835   -1.816  -4.602  1.00 0.00 ? 20 CYS A HA   7  
ATOM 8951  H HB2  . CYS A 1 20 ? 9.805   0.483   -4.766  1.00 0.00 ? 20 CYS A HB2  7  
ATOM 8952  H HB3  . CYS A 1 20 ? 10.281  -1.200  -4.883  1.00 0.00 ? 20 CYS A HB3  7  
ATOM 8953  H HG   . CYS A 1 20 ? 7.910   -1.313  -6.660  1.00 0.00 ? 20 CYS A HG   7  
ATOM 8954  N N    . ILE A 1 21 ? 8.860   -0.025  -2.014  1.00 0.00 ? 21 ILE A N    7  
ATOM 8955  C CA   . ILE A 1 21 ? 9.251   -0.085  -0.616  1.00 0.00 ? 21 ILE A CA   7  
ATOM 8956  C C    . ILE A 1 21 ? 8.207   -0.886  0.167   1.00 0.00 ? 21 ILE A C    7  
ATOM 8957  O O    . ILE A 1 21 ? 8.534   -1.893  0.792   1.00 0.00 ? 21 ILE A O    7  
ATOM 8958  C CB   . ILE A 1 21 ? 9.487   1.322   -0.064  1.00 0.00 ? 21 ILE A CB   7  
ATOM 8959  C CG1  . ILE A 1 21 ? 10.788  1.914   -0.610  1.00 0.00 ? 21 ILE A CG1  7  
ATOM 8960  C CG2  . ILE A 1 21 ? 9.454   1.324   1.466   1.00 0.00 ? 21 ILE A CG2  7  
ATOM 8961  C CD1  . ILE A 1 21 ? 10.918  3.391   -0.235  1.00 0.00 ? 21 ILE A CD1  7  
ATOM 8962  H H    . ILE A 1 21 ? 8.752   0.898   -2.383  1.00 0.00 ? 21 ILE A H    7  
ATOM 8963  H HA   . ILE A 1 21 ? 10.202  -0.615  -0.565  1.00 0.00 ? 21 ILE A HA   7  
ATOM 8964  H HB   . ILE A 1 21 ? 8.673   1.963   -0.404  1.00 0.00 ? 21 ILE A HB   7  
ATOM 8965  H HG12 . ILE A 1 21 ? 11.638  1.358   -0.215  1.00 0.00 ? 21 ILE A HG12 7  
ATOM 8966  H HG13 . ILE A 1 21 ? 10.813  1.807   -1.695  1.00 0.00 ? 21 ILE A HG13 7  
ATOM 8967  H HG21 . ILE A 1 21 ? 10.322  1.861   1.847   1.00 0.00 ? 21 ILE A HG21 7  
ATOM 8968  H HG22 . ILE A 1 21 ? 8.544   1.815   1.809   1.00 0.00 ? 21 ILE A HG22 7  
ATOM 8969  H HG23 . ILE A 1 21 ? 9.473   0.297   1.831   1.00 0.00 ? 21 ILE A HG23 7  
ATOM 8970  H HD11 . ILE A 1 21 ? 10.054  3.693   0.358   1.00 0.00 ? 21 ILE A HD11 7  
ATOM 8971  H HD12 . ILE A 1 21 ? 11.828  3.540   0.347   1.00 0.00 ? 21 ILE A HD12 7  
ATOM 8972  H HD13 . ILE A 1 21 ? 10.965  3.994   -1.142  1.00 0.00 ? 21 ILE A HD13 7  
ATOM 8973  N N    . LEU A 1 22 ? 6.973   -0.407  0.106   1.00 0.00 ? 22 LEU A N    7  
ATOM 8974  C CA   . LEU A 1 22 ? 5.880   -1.065  0.801   1.00 0.00 ? 22 LEU A CA   7  
ATOM 8975  C C    . LEU A 1 22 ? 6.008   -2.579  0.626   1.00 0.00 ? 22 LEU A C    7  
ATOM 8976  O O    . LEU A 1 22 ? 5.932   -3.329  1.598   1.00 0.00 ? 22 LEU A O    7  
ATOM 8977  C CB   . LEU A 1 22 ? 4.535   -0.504  0.337   1.00 0.00 ? 22 LEU A CB   7  
ATOM 8978  C CG   . LEU A 1 22 ? 3.298   -1.310  0.738   1.00 0.00 ? 22 LEU A CG   7  
ATOM 8979  C CD1  . LEU A 1 22 ? 3.173   -2.579  -0.107  1.00 0.00 ? 22 LEU A CD1  7  
ATOM 8980  C CD2  . LEU A 1 22 ? 3.305   -1.616  2.237   1.00 0.00 ? 22 LEU A CD2  7  
ATOM 8981  H H    . LEU A 1 22 ? 6.716   0.414   -0.405  1.00 0.00 ? 22 LEU A H    7  
ATOM 8982  H HA   . LEU A 1 22 ? 5.979   -0.830  1.861   1.00 0.00 ? 22 LEU A HA   7  
ATOM 8983  H HB2  . LEU A 1 22 ? 4.429   0.507   0.731   1.00 0.00 ? 22 LEU A HB2  7  
ATOM 8984  H HB3  . LEU A 1 22 ? 4.554   -0.421  -0.750  1.00 0.00 ? 22 LEU A HB3  7  
ATOM 8985  H HG   . LEU A 1 22 ? 2.415   -0.702  0.538   1.00 0.00 ? 22 LEU A HG   7  
ATOM 8986  H HD11 . LEU A 1 22 ? 2.149   -2.678  -0.466  1.00 0.00 ? 22 LEU A HD11 7  
ATOM 8987  H HD12 . LEU A 1 22 ? 3.852   -2.518  -0.957  1.00 0.00 ? 22 LEU A HD12 7  
ATOM 8988  H HD13 . LEU A 1 22 ? 3.430   -3.447  0.502   1.00 0.00 ? 22 LEU A HD13 7  
ATOM 8989  H HD21 . LEU A 1 22 ? 2.666   -2.476  2.435   1.00 0.00 ? 22 LEU A HD21 7  
ATOM 8990  H HD22 . LEU A 1 22 ? 4.323   -1.839  2.557   1.00 0.00 ? 22 LEU A HD22 7  
ATOM 8991  H HD23 . LEU A 1 22 ? 2.932   -0.752  2.786   1.00 0.00 ? 22 LEU A HD23 7  
ATOM 8992  N N    . HIS A 1 23 ? 6.201   -2.984  -0.621  1.00 0.00 ? 23 HIS A N    7  
ATOM 8993  C CA   . HIS A 1 23 ? 6.341   -4.396  -0.936  1.00 0.00 ? 23 HIS A CA   7  
ATOM 8994  C C    . HIS A 1 23 ? 7.531   -4.977  -0.170  1.00 0.00 ? 23 HIS A C    7  
ATOM 8995  O O    . HIS A 1 23 ? 7.389   -5.966  0.547   1.00 0.00 ? 23 HIS A O    7  
ATOM 8996  C CB   . HIS A 1 23 ? 6.448   -4.607  -2.448  1.00 0.00 ? 23 HIS A CB   7  
ATOM 8997  C CG   . HIS A 1 23 ? 6.267   -6.042  -2.882  1.00 0.00 ? 23 HIS A CG   7  
ATOM 8998  N ND1  . HIS A 1 23 ? 6.054   -6.405  -4.200  1.00 0.00 ? 23 HIS A ND1  7  
ATOM 8999  C CD2  . HIS A 1 23 ? 6.270   -7.199  -2.159  1.00 0.00 ? 23 HIS A CD2  7  
ATOM 9000  C CE1  . HIS A 1 23 ? 5.935   -7.724  -4.257  1.00 0.00 ? 23 HIS A CE1  7  
ATOM 9001  N NE2  . HIS A 1 23 ? 6.068   -8.213  -2.991  1.00 0.00 ? 23 HIS A NE2  7  
ATOM 9002  H H    . HIS A 1 23 ? 6.263   -2.368  -1.406  1.00 0.00 ? 23 HIS A H    7  
ATOM 9003  H HA   . HIS A 1 23 ? 5.428   -4.884  -0.596  1.00 0.00 ? 23 HIS A HA   7  
ATOM 9004  H HB2  . HIS A 1 23 ? 5.699   -3.991  -2.944  1.00 0.00 ? 23 HIS A HB2  7  
ATOM 9005  H HB3  . HIS A 1 23 ? 7.424   -4.257  -2.785  1.00 0.00 ? 23 HIS A HB3  7  
ATOM 9006  H HD1  . HIS A 1 23 ? 5.999   -5.779  -4.978  1.00 0.00 ? 23 HIS A HD1  7  
ATOM 9007  H HD2  . HIS A 1 23 ? 6.414   -7.277  -1.081  1.00 0.00 ? 23 HIS A HD2  7  
ATOM 9008  H HE1  . HIS A 1 23 ? 5.761   -8.313  -5.157  1.00 0.00 ? 23 HIS A HE1  7  
ATOM 9009  N N    . GLU A 1 24 ? 8.678   -4.339  -0.349  1.00 0.00 ? 24 GLU A N    7  
ATOM 9010  C CA   . GLU A 1 24 ? 9.892   -4.780  0.316   1.00 0.00 ? 24 GLU A CA   7  
ATOM 9011  C C    . GLU A 1 24 ? 9.597   -5.142  1.773   1.00 0.00 ? 24 GLU A C    7  
ATOM 9012  O O    . GLU A 1 24 ? 9.619   -6.316  2.142   1.00 0.00 ? 24 GLU A O    7  
ATOM 9013  C CB   . GLU A 1 24 ? 10.985  -3.714  0.227   1.00 0.00 ? 24 GLU A CB   7  
ATOM 9014  C CG   . GLU A 1 24 ? 12.112  -4.160  -0.707  1.00 0.00 ? 24 GLU A CG   7  
ATOM 9015  C CD   . GLU A 1 24 ? 13.416  -4.368  0.066   1.00 0.00 ? 24 GLU A CD   7  
ATOM 9016  O OE1  . GLU A 1 24 ? 14.136  -3.361  0.245   1.00 0.00 ? 24 GLU A OE1  7  
ATOM 9017  O OE2  . GLU A 1 24 ? 13.663  -5.527  0.462   1.00 0.00 ? 24 GLU A OE2  7  
ATOM 9018  H H    . GLU A 1 24 ? 8.785   -3.535  -0.934  1.00 0.00 ? 24 GLU A H    7  
ATOM 9019  H HA   . GLU A 1 24 ? 10.214  -5.668  -0.228  1.00 0.00 ? 24 GLU A HA   7  
ATOM 9020  H HB2  . GLU A 1 24 ? 10.557  -2.779  -0.135  1.00 0.00 ? 24 GLU A HB2  7  
ATOM 9021  H HB3  . GLU A 1 24 ? 11.388  -3.516  1.220   1.00 0.00 ? 24 GLU A HB3  7  
ATOM 9022  H HG2  . GLU A 1 24 ? 11.829  -5.087  -1.206  1.00 0.00 ? 24 GLU A HG2  7  
ATOM 9023  H HG3  . GLU A 1 24 ? 12.262  -3.412  -1.486  1.00 0.00 ? 24 GLU A HG3  7  
ATOM 9024  N N    . TYR A 1 25 ? 9.329   -4.112  2.563   1.00 0.00 ? 25 TYR A N    7  
ATOM 9025  C CA   . TYR A 1 25 ? 9.031   -4.307  3.971   1.00 0.00 ? 25 TYR A CA   7  
ATOM 9026  C C    . TYR A 1 25 ? 8.036   -5.453  4.168   1.00 0.00 ? 25 TYR A C    7  
ATOM 9027  O O    . TYR A 1 25 ? 8.231   -6.310  5.028   1.00 0.00 ? 25 TYR A O    7  
ATOM 9028  C CB   . TYR A 1 25 ? 8.390   -3.004  4.451   1.00 0.00 ? 25 TYR A CB   7  
ATOM 9029  C CG   . TYR A 1 25 ? 7.696   -3.114  5.810   1.00 0.00 ? 25 TYR A CG   7  
ATOM 9030  C CD1  . TYR A 1 25 ? 6.483   -3.762  5.915   1.00 0.00 ? 25 TYR A CD1  7  
ATOM 9031  C CD2  . TYR A 1 25 ? 8.285   -2.566  6.932   1.00 0.00 ? 25 TYR A CD2  7  
ATOM 9032  C CE1  . TYR A 1 25 ? 5.830   -3.867  7.194   1.00 0.00 ? 25 TYR A CE1  7  
ATOM 9033  C CE2  . TYR A 1 25 ? 7.632   -2.670  8.211   1.00 0.00 ? 25 TYR A CE2  7  
ATOM 9034  C CZ   . TYR A 1 25 ? 6.437   -3.315  8.279   1.00 0.00 ? 25 TYR A CZ   7  
ATOM 9035  O OH   . TYR A 1 25 ? 5.820   -3.413  9.488   1.00 0.00 ? 25 TYR A OH   7  
ATOM 9036  H H    . TYR A 1 25 ? 9.314   -3.161  2.255   1.00 0.00 ? 25 TYR A H    7  
ATOM 9037  H HA   . TYR A 1 25 ? 9.962   -4.553  4.482   1.00 0.00 ? 25 TYR A HA   7  
ATOM 9038  H HB2  . TYR A 1 25 ? 9.158   -2.233  4.508   1.00 0.00 ? 25 TYR A HB2  7  
ATOM 9039  H HB3  . TYR A 1 25 ? 7.663   -2.674  3.709   1.00 0.00 ? 25 TYR A HB3  7  
ATOM 9040  H HD1  . TYR A 1 25 ? 6.018   -4.196  5.029   1.00 0.00 ? 25 TYR A HD1  7  
ATOM 9041  H HD2  . TYR A 1 25 ? 9.243   -2.053  6.849   1.00 0.00 ? 25 TYR A HD2  7  
ATOM 9042  H HE1  . TYR A 1 25 ? 4.871   -4.376  7.291   1.00 0.00 ? 25 TYR A HE1  7  
ATOM 9043  H HE2  . TYR A 1 25 ? 8.086   -2.241  9.105   1.00 0.00 ? 25 TYR A HE2  7  
ATOM 9044  H HH   . TYR A 1 25 ? 5.286   -4.258  9.531   1.00 0.00 ? 25 TYR A HH   7  
ATOM 9045  N N    . MET A 1 26 ? 6.989   -5.431  3.355   1.00 0.00 ? 26 MET A N    7  
ATOM 9046  C CA   . MET A 1 26 ? 5.963   -6.457  3.428   1.00 0.00 ? 26 MET A CA   7  
ATOM 9047  C C    . MET A 1 26 ? 6.570   -7.852  3.263   1.00 0.00 ? 26 MET A C    7  
ATOM 9048  O O    . MET A 1 26 ? 6.461   -8.690  4.157   1.00 0.00 ? 26 MET A O    7  
ATOM 9049  C CB   . MET A 1 26 ? 4.924   -6.220  2.331   1.00 0.00 ? 26 MET A CB   7  
ATOM 9050  C CG   . MET A 1 26 ? 3.799   -5.310  2.829   1.00 0.00 ? 26 MET A CG   7  
ATOM 9051  S SD   . MET A 1 26 ? 2.256   -5.770  2.058   1.00 0.00 ? 26 MET A SD   7  
ATOM 9052  C CE   . MET A 1 26 ? 2.202   -7.503  2.482   1.00 0.00 ? 26 MET A CE   7  
ATOM 9053  H H    . MET A 1 26 ? 6.838   -4.731  2.657   1.00 0.00 ? 26 MET A H    7  
ATOM 9054  H HA   . MET A 1 26 ? 5.522   -6.360  4.420   1.00 0.00 ? 26 MET A HA   7  
ATOM 9055  H HB2  . MET A 1 26 ? 5.404   -5.769  1.462   1.00 0.00 ? 26 MET A HB2  7  
ATOM 9056  H HB3  . MET A 1 26 ? 4.509   -7.174  2.006   1.00 0.00 ? 26 MET A HB3  7  
ATOM 9057  H HG2  . MET A 1 26 ? 3.711   -5.387  3.912   1.00 0.00 ? 26 MET A HG2  7  
ATOM 9058  H HG3  . MET A 1 26 ? 4.033   -4.270  2.601   1.00 0.00 ? 26 MET A HG3  7  
ATOM 9059  H HE1  . MET A 1 26 ? 3.001   -7.730  3.188   1.00 0.00 ? 26 MET A HE1  7  
ATOM 9060  H HE2  . MET A 1 26 ? 1.239   -7.737  2.934   1.00 0.00 ? 26 MET A HE2  7  
ATOM 9061  H HE3  . MET A 1 26 ? 2.335   -8.102  1.580   1.00 0.00 ? 26 MET A HE3  7  
ATOM 9062  N N    . GLN A 1 27 ? 7.197   -8.058  2.115   1.00 0.00 ? 27 GLN A N    7  
ATOM 9063  C CA   . GLN A 1 27 ? 7.821   -9.337  1.821   1.00 0.00 ? 27 GLN A CA   7  
ATOM 9064  C C    . GLN A 1 27 ? 9.013   -9.571  2.751   1.00 0.00 ? 27 GLN A C    7  
ATOM 9065  O O    . GLN A 1 27 ? 9.605   -10.650 2.749   1.00 0.00 ? 27 GLN A O    7  
ATOM 9066  C CB   . GLN A 1 27 ? 8.247   -9.416  0.354   1.00 0.00 ? 27 GLN A CB   7  
ATOM 9067  C CG   . GLN A 1 27 ? 9.451   -10.343 0.181   1.00 0.00 ? 27 GLN A CG   7  
ATOM 9068  C CD   . GLN A 1 27 ? 9.847   -10.460 -1.292  1.00 0.00 ? 27 GLN A CD   7  
ATOM 9069  O OE1  . GLN A 1 27 ? 9.125   -10.055 -2.189  1.00 0.00 ? 27 GLN A OE1  7  
ATOM 9070  N NE2  . GLN A 1 27 ? 11.030  -11.034 -1.491  1.00 0.00 ? 27 GLN A NE2  7  
ATOM 9071  H H    . GLN A 1 27 ? 7.282   -7.371  1.393   1.00 0.00 ? 27 GLN A H    7  
ATOM 9072  H HA   . GLN A 1 27 ? 7.052   -10.085 2.011   1.00 0.00 ? 27 GLN A HA   7  
ATOM 9073  H HB2  . GLN A 1 27 ? 7.415   -9.778  -0.251  1.00 0.00 ? 27 GLN A HB2  7  
ATOM 9074  H HB3  . GLN A 1 27 ? 8.495   -8.419  -0.011  1.00 0.00 ? 27 GLN A HB3  7  
ATOM 9075  H HG2  . GLN A 1 27 ? 10.294  -9.962  0.758   1.00 0.00 ? 27 GLN A HG2  7  
ATOM 9076  H HG3  . GLN A 1 27 ? 9.214   -11.331 0.577   1.00 0.00 ? 27 GLN A HG3  7  
ATOM 9077  H HE21 . GLN A 1 27 ? 11.573  -11.344 -0.711  1.00 0.00 ? 27 GLN A HE21 7  
ATOM 9078  H HE22 . GLN A 1 27 ? 11.377  -11.155 -2.421  1.00 0.00 ? 27 GLN A HE22 7  
ATOM 9079  N N    . ARG A 1 28 ? 9.331   -8.543  3.524   1.00 0.00 ? 28 ARG A N    7  
ATOM 9080  C CA   . ARG A 1 28 ? 10.442  -8.623  4.457   1.00 0.00 ? 28 ARG A CA   7  
ATOM 9081  C C    . ARG A 1 28 ? 9.951   -9.091  5.828   1.00 0.00 ? 28 ARG A C    7  
ATOM 9082  O O    . ARG A 1 28 ? 10.543  -9.983  6.433   1.00 0.00 ? 28 ARG A O    7  
ATOM 9083  C CB   . ARG A 1 28 ? 11.136  -7.268  4.606   1.00 0.00 ? 28 ARG A CB   7  
ATOM 9084  C CG   . ARG A 1 28 ? 12.059  -7.255  5.826   1.00 0.00 ? 28 ARG A CG   7  
ATOM 9085  C CD   . ARG A 1 28 ? 13.347  -6.485  5.531   1.00 0.00 ? 28 ARG A CD   7  
ATOM 9086  N NE   . ARG A 1 28 ? 13.355  -5.206  6.276   1.00 0.00 ? 28 ARG A NE   7  
ATOM 9087  C CZ   . ARG A 1 28 ? 14.362  -4.323  6.242   1.00 0.00 ? 28 ARG A CZ   7  
ATOM 9088  N NH1  . ARG A 1 28 ? 15.449  -4.574  5.500   1.00 0.00 ? 28 ARG A NH1  7  
ATOM 9089  N NH2  . ARG A 1 28 ? 14.282  -3.188  6.950   1.00 0.00 ? 28 ARG A NH2  7  
ATOM 9090  H H    . ARG A 1 28 ? 8.846   -7.669  3.520   1.00 0.00 ? 28 ARG A H    7  
ATOM 9091  H HA   . ARG A 1 28 ? 11.125  -9.351  4.016   1.00 0.00 ? 28 ARG A HA   7  
ATOM 9092  H HB2  . ARG A 1 28 ? 11.713  -7.050  3.707   1.00 0.00 ? 28 ARG A HB2  7  
ATOM 9093  H HB3  . ARG A 1 28 ? 10.388  -6.481  4.703   1.00 0.00 ? 28 ARG A HB3  7  
ATOM 9094  H HG2  . ARG A 1 28 ? 11.543  -6.798  6.671   1.00 0.00 ? 28 ARG A HG2  7  
ATOM 9095  H HG3  . ARG A 1 28 ? 12.300  -8.278  6.115   1.00 0.00 ? 28 ARG A HG3  7  
ATOM 9096  H HD2  . ARG A 1 28 ? 14.212  -7.085  5.814   1.00 0.00 ? 28 ARG A HD2  7  
ATOM 9097  H HD3  . ARG A 1 28 ? 13.429  -6.293  4.461   1.00 0.00 ? 28 ARG A HD3  7  
ATOM 9098  H HE   . ARG A 1 28 ? 12.558  -4.987  6.840   1.00 0.00 ? 28 ARG A HE   7  
ATOM 9099  H HH11 . ARG A 1 28 ? 15.509  -5.421  4.972   1.00 0.00 ? 28 ARG A HH11 7  
ATOM 9100  H HH12 . ARG A 1 28 ? 16.201  -3.915  5.475   1.00 0.00 ? 28 ARG A HH12 7  
ATOM 9101  H HH21 . ARG A 1 28 ? 13.471  -3.000  7.504   1.00 0.00 ? 28 ARG A HH21 7  
ATOM 9102  H HH22 . ARG A 1 28 ? 15.033  -2.529  6.925   1.00 0.00 ? 28 ARG A HH22 7  
ATOM 9103  N N    . VAL A 1 29 ? 8.873   -8.466  6.280   1.00 0.00 ? 29 VAL A N    7  
ATOM 9104  C CA   . VAL A 1 29 ? 8.296   -8.806  7.569   1.00 0.00 ? 29 VAL A CA   7  
ATOM 9105  C C    . VAL A 1 29 ? 7.158   -9.808  7.364   1.00 0.00 ? 29 VAL A C    7  
ATOM 9106  O O    . VAL A 1 29 ? 7.145   -10.873 7.981   1.00 0.00 ? 29 VAL A O    7  
ATOM 9107  C CB   . VAL A 1 29 ? 7.850   -7.535  8.295   1.00 0.00 ? 29 VAL A CB   7  
ATOM 9108  C CG1  . VAL A 1 29 ? 8.981   -6.506  8.343   1.00 0.00 ? 29 VAL A CG1  7  
ATOM 9109  C CG2  . VAL A 1 29 ? 6.598   -6.944  7.645   1.00 0.00 ? 29 VAL A CG2  7  
ATOM 9110  H H    . VAL A 1 29 ? 8.398   -7.741  5.782   1.00 0.00 ? 29 VAL A H    7  
ATOM 9111  H HA   . VAL A 1 29 ? 9.077   -9.279  8.165   1.00 0.00 ? 29 VAL A HA   7  
ATOM 9112  H HB   . VAL A 1 29 ? 7.599   -7.806  9.320   1.00 0.00 ? 29 VAL A HB   7  
ATOM 9113  H HG11 . VAL A 1 29 ? 8.976   -5.917  7.427   1.00 0.00 ? 29 VAL A HG11 7  
ATOM 9114  H HG12 . VAL A 1 29 ? 8.837   -5.848  9.200   1.00 0.00 ? 29 VAL A HG12 7  
ATOM 9115  H HG13 . VAL A 1 29 ? 9.937   -7.022  8.438   1.00 0.00 ? 29 VAL A HG13 7  
ATOM 9116  H HG21 . VAL A 1 29 ? 5.757   -7.621  7.794   1.00 0.00 ? 29 VAL A HG21 7  
ATOM 9117  H HG22 . VAL A 1 29 ? 6.373   -5.979  8.101   1.00 0.00 ? 29 VAL A HG22 7  
ATOM 9118  H HG23 . VAL A 1 29 ? 6.772   -6.809  6.577   1.00 0.00 ? 29 VAL A HG23 7  
ATOM 9119  N N    . LEU A 1 30 ? 6.230   -9.433  6.496   1.00 0.00 ? 30 LEU A N    7  
ATOM 9120  C CA   . LEU A 1 30 ? 5.091   -10.285 6.202   1.00 0.00 ? 30 LEU A CA   7  
ATOM 9121  C C    . LEU A 1 30 ? 5.555   -11.479 5.366   1.00 0.00 ? 30 LEU A C    7  
ATOM 9122  O O    . LEU A 1 30 ? 5.236   -12.624 5.682   1.00 0.00 ? 30 LEU A O    7  
ATOM 9123  C CB   . LEU A 1 30 ? 3.970   -9.475  5.549   1.00 0.00 ? 30 LEU A CB   7  
ATOM 9124  C CG   . LEU A 1 30 ? 3.235   -8.490  6.460   1.00 0.00 ? 30 LEU A CG   7  
ATOM 9125  C CD1  . LEU A 1 30 ? 2.363   -7.533  5.644   1.00 0.00 ? 30 LEU A CD1  7  
ATOM 9126  C CD2  . LEU A 1 30 ? 2.428   -9.230  7.529   1.00 0.00 ? 30 LEU A CD2  7  
ATOM 9127  H H    . LEU A 1 30 ? 6.248   -8.565  5.999   1.00 0.00 ? 30 LEU A H    7  
ATOM 9128  H HA   . LEU A 1 30 ? 4.708   -10.657 7.153   1.00 0.00 ? 30 LEU A HA   7  
ATOM 9129  H HB2  . LEU A 1 30 ? 4.391   -8.919  4.711   1.00 0.00 ? 30 LEU A HB2  7  
ATOM 9130  H HB3  . LEU A 1 30 ? 3.240   -10.170 5.134   1.00 0.00 ? 30 LEU A HB3  7  
ATOM 9131  H HG   . LEU A 1 30 ? 3.978   -7.885  6.979   1.00 0.00 ? 30 LEU A HG   7  
ATOM 9132  H HD11 . LEU A 1 30 ? 1.713   -6.972  6.315   1.00 0.00 ? 30 LEU A HD11 7  
ATOM 9133  H HD12 . LEU A 1 30 ? 3.001   -6.841  5.093   1.00 0.00 ? 30 LEU A HD12 7  
ATOM 9134  H HD13 . LEU A 1 30 ? 1.755   -8.104  4.942   1.00 0.00 ? 30 LEU A HD13 7  
ATOM 9135  H HD21 . LEU A 1 30 ? 2.506   -8.698  8.477   1.00 0.00 ? 30 LEU A HD21 7  
ATOM 9136  H HD22 . LEU A 1 30 ? 1.382   -9.279  7.226   1.00 0.00 ? 30 LEU A HD22 7  
ATOM 9137  H HD23 . LEU A 1 30 ? 2.820   -10.240 7.646   1.00 0.00 ? 30 LEU A HD23 7  
ATOM 9138  N N    . LYS A 1 31 ? 6.300   -11.171 4.314   1.00 0.00 ? 31 LYS A N    7  
ATOM 9139  C CA   . LYS A 1 31 ? 6.811   -12.204 3.430   1.00 0.00 ? 31 LYS A CA   7  
ATOM 9140  C C    . LYS A 1 31 ? 5.733   -12.574 2.409   1.00 0.00 ? 31 LYS A C    7  
ATOM 9141  O O    . LYS A 1 31 ? 5.560   -13.746 2.081   1.00 0.00 ? 31 LYS A O    7  
ATOM 9142  C CB   . LYS A 1 31 ? 7.325   -13.396 4.240   1.00 0.00 ? 31 LYS A CB   7  
ATOM 9143  C CG   . LYS A 1 31 ? 8.600   -13.971 3.619   1.00 0.00 ? 31 LYS A CG   7  
ATOM 9144  C CD   . LYS A 1 31 ? 9.752   -13.963 4.626   1.00 0.00 ? 31 LYS A CD   7  
ATOM 9145  C CE   . LYS A 1 31 ? 10.642  -15.195 4.452   1.00 0.00 ? 31 LYS A CE   7  
ATOM 9146  N NZ   . LYS A 1 31 ? 11.347  -15.508 5.715   1.00 0.00 ? 31 LYS A NZ   7  
ATOM 9147  H H    . LYS A 1 31 ? 6.554   -10.237 4.064   1.00 0.00 ? 31 LYS A H    7  
ATOM 9148  H HA   . LYS A 1 31 ? 7.664   -11.785 2.896   1.00 0.00 ? 31 LYS A HA   7  
ATOM 9149  H HB2  . LYS A 1 31 ? 7.524   -13.086 5.266   1.00 0.00 ? 31 LYS A HB2  7  
ATOM 9150  H HB3  . LYS A 1 31 ? 6.557   -14.168 4.284   1.00 0.00 ? 31 LYS A HB3  7  
ATOM 9151  H HG2  . LYS A 1 31 ? 8.415   -14.991 3.281   1.00 0.00 ? 31 LYS A HG2  7  
ATOM 9152  H HG3  . LYS A 1 31 ? 8.876   -13.389 2.741   1.00 0.00 ? 31 LYS A HG3  7  
ATOM 9153  H HD2  . LYS A 1 31 ? 10.346  -13.058 4.496   1.00 0.00 ? 31 LYS A HD2  7  
ATOM 9154  H HD3  . LYS A 1 31 ? 9.353   -13.938 5.640   1.00 0.00 ? 31 LYS A HD3  7  
ATOM 9155  H HE2  . LYS A 1 31 ? 10.037  -16.047 4.145   1.00 0.00 ? 31 LYS A HE2  7  
ATOM 9156  H HE3  . LYS A 1 31 ? 11.368  -15.017 3.658   1.00 0.00 ? 31 LYS A HE3  7  
ATOM 9157  H HZ1  . LYS A 1 31 ? 12.137  -16.089 5.520   1.00 0.00 ? 31 LYS A HZ1  7  
ATOM 9158  H HZ2  . LYS A 1 31 ? 11.655  -14.659 6.144   1.00 0.00 ? 31 LYS A HZ2  7  
ATOM 9159  H HZ3  . LYS A 1 31 ? 10.725  -15.988 6.333   1.00 0.00 ? 31 LYS A HZ3  7  
ATOM 9160  N N    . VAL A 1 32 ? 5.038   -11.551 1.934   1.00 0.00 ? 32 VAL A N    7  
ATOM 9161  C CA   . VAL A 1 32 ? 3.982   -11.753 0.956   1.00 0.00 ? 32 VAL A CA   7  
ATOM 9162  C C    . VAL A 1 32 ? 3.883   -10.520 0.056   1.00 0.00 ? 32 VAL A C    7  
ATOM 9163  O O    . VAL A 1 32 ? 4.098   -9.397  0.509   1.00 0.00 ? 32 VAL A O    7  
ATOM 9164  C CB   . VAL A 1 32 ? 2.667   -12.081 1.666   1.00 0.00 ? 32 VAL A CB   7  
ATOM 9165  C CG1  . VAL A 1 32 ? 2.804   -13.346 2.516   1.00 0.00 ? 32 VAL A CG1  7  
ATOM 9166  C CG2  . VAL A 1 32 ? 2.192   -10.900 2.514   1.00 0.00 ? 32 VAL A CG2  7  
ATOM 9167  H H    . VAL A 1 32 ? 5.185   -10.600 2.206   1.00 0.00 ? 32 VAL A H    7  
ATOM 9168  H HA   . VAL A 1 32 ? 4.259   -12.612 0.346   1.00 0.00 ? 32 VAL A HA   7  
ATOM 9169  H HB   . VAL A 1 32 ? 1.912   -12.271 0.903   1.00 0.00 ? 32 VAL A HB   7  
ATOM 9170  H HG11 . VAL A 1 32 ? 3.283   -14.129 1.928   1.00 0.00 ? 32 VAL A HG11 7  
ATOM 9171  H HG12 . VAL A 1 32 ? 3.410   -13.130 3.396   1.00 0.00 ? 32 VAL A HG12 7  
ATOM 9172  H HG13 . VAL A 1 32 ? 1.815   -13.682 2.830   1.00 0.00 ? 32 VAL A HG13 7  
ATOM 9173  H HG21 . VAL A 1 32 ? 2.894   -10.072 2.410   1.00 0.00 ? 32 VAL A HG21 7  
ATOM 9174  H HG22 . VAL A 1 32 ? 1.205   -10.584 2.177   1.00 0.00 ? 32 VAL A HG22 7  
ATOM 9175  H HG23 . VAL A 1 32 ? 2.139   -11.201 3.561   1.00 0.00 ? 32 VAL A HG23 7  
ATOM 9176  N N    . ARG A 1 33 ? 3.558   -10.772 -1.204  1.00 0.00 ? 33 ARG A N    7  
ATOM 9177  C CA   . ARG A 1 33 ? 3.429   -9.696  -2.172  1.00 0.00 ? 33 ARG A CA   7  
ATOM 9178  C C    . ARG A 1 33 ? 2.028   -9.084  -2.102  1.00 0.00 ? 33 ARG A C    7  
ATOM 9179  O O    . ARG A 1 33 ? 1.030   -9.792  -2.230  1.00 0.00 ? 33 ARG A O    7  
ATOM 9180  C CB   . ARG A 1 33 ? 3.687   -10.200 -3.594  1.00 0.00 ? 33 ARG A CB   7  
ATOM 9181  C CG   . ARG A 1 33 ? 3.181   -9.196  -4.632  1.00 0.00 ? 33 ARG A CG   7  
ATOM 9182  C CD   . ARG A 1 33 ? 3.649   -9.578  -6.037  1.00 0.00 ? 33 ARG A CD   7  
ATOM 9183  N NE   . ARG A 1 33 ? 2.590   -10.340 -6.735  1.00 0.00 ? 33 ARG A NE   7  
ATOM 9184  C CZ   . ARG A 1 33 ? 2.422   -11.665 -6.626  1.00 0.00 ? 33 ARG A CZ   7  
ATOM 9185  N NH1  . ARG A 1 33 ? 3.242   -12.383 -5.847  1.00 0.00 ? 33 ARG A NH1  7  
ATOM 9186  N NH2  . ARG A 1 33 ? 1.433   -12.272 -7.296  1.00 0.00 ? 33 ARG A NH2  7  
ATOM 9187  H H    . ARG A 1 33 ? 3.385   -11.688 -1.565  1.00 0.00 ? 33 ARG A H    7  
ATOM 9188  H HA   . ARG A 1 33 ? 4.189   -8.969  -1.885  1.00 0.00 ? 33 ARG A HA   7  
ATOM 9189  H HB2  . ARG A 1 33 ? 4.754   -10.369 -3.735  1.00 0.00 ? 33 ARG A HB2  7  
ATOM 9190  H HB3  . ARG A 1 33 ? 3.191   -11.160 -3.738  1.00 0.00 ? 33 ARG A HB3  7  
ATOM 9191  H HG2  . ARG A 1 33 ? 2.092   -9.159  -4.605  1.00 0.00 ? 33 ARG A HG2  7  
ATOM 9192  H HG3  . ARG A 1 33 ? 3.541   -8.198  -4.383  1.00 0.00 ? 33 ARG A HG3  7  
ATOM 9193  H HD2  . ARG A 1 33 ? 3.896   -8.680  -6.604  1.00 0.00 ? 33 ARG A HD2  7  
ATOM 9194  H HD3  . ARG A 1 33 ? 4.559   -10.176 -5.976  1.00 0.00 ? 33 ARG A HD3  7  
ATOM 9195  H HE   . ARG A 1 33 ? 1.960   -9.835  -7.324  1.00 0.00 ? 33 ARG A HE   7  
ATOM 9196  H HH11 . ARG A 1 33 ? 3.981   -11.930 -5.347  1.00 0.00 ? 33 ARG A HH11 7  
ATOM 9197  H HH12 . ARG A 1 33 ? 3.117   -13.372 -5.766  1.00 0.00 ? 33 ARG A HH12 7  
ATOM 9198  H HH21 . ARG A 1 33 ? 0.820   -11.737 -7.877  1.00 0.00 ? 33 ARG A HH21 7  
ATOM 9199  H HH22 . ARG A 1 33 ? 1.307   -13.261 -7.215  1.00 0.00 ? 33 ARG A HH22 7  
ATOM 9200  N N    . PRO A 1 34 ? 1.997   -7.741  -1.893  1.00 0.00 ? 34 PRO A N    7  
ATOM 9201  C CA   . PRO A 1 34 ? 0.736   -7.026  -1.804  1.00 0.00 ? 34 PRO A CA   7  
ATOM 9202  C C    . PRO A 1 34 ? 0.101   -6.860  -3.186  1.00 0.00 ? 34 PRO A C    7  
ATOM 9203  O O    . PRO A 1 34 ? 0.804   -6.808  -4.194  1.00 0.00 ? 34 PRO A O    7  
ATOM 9204  C CB   . PRO A 1 34 ? 1.081   -5.699  -1.146  1.00 0.00 ? 34 PRO A CB   7  
ATOM 9205  C CG   . PRO A 1 34 ? 2.582   -5.529  -1.314  1.00 0.00 ? 34 PRO A CG   7  
ATOM 9206  C CD   . PRO A 1 34 ? 3.159   -6.870  -1.736  1.00 0.00 ? 34 PRO A CD   7  
ATOM 9207  H HA   . PRO A 1 34 ? 0.078   -7.548  -1.262  1.00 0.00 ? 34 PRO A HA   7  
ATOM 9208  H HB2  . PRO A 1 34 ? 0.539   -4.878  -1.615  1.00 0.00 ? 34 PRO A HB2  7  
ATOM 9209  H HB3  . PRO A 1 34 ? 0.803   -5.703  -0.092  1.00 0.00 ? 34 PRO A HB3  7  
ATOM 9210  H HG2  . PRO A 1 34 ? 2.798   -4.767  -2.063  1.00 0.00 ? 34 PRO A HG2  7  
ATOM 9211  H HG3  . PRO A 1 34 ? 3.035   -5.195  -0.380  1.00 0.00 ? 34 PRO A HG3  7  
ATOM 9212  H HD2  . PRO A 1 34 ? 3.718   -6.784  -2.668  1.00 0.00 ? 34 PRO A HD2  7  
ATOM 9213  H HD3  . PRO A 1 34 ? 3.847   -7.259  -0.986  1.00 0.00 ? 34 PRO A HD3  7  
ATOM 9214  N N    . VAL A 1 35 ? -1.222  -6.781  -3.189  1.00 0.00 ? 35 VAL A N    7  
ATOM 9215  C CA   . VAL A 1 35 ? -1.960  -6.623  -4.430  1.00 0.00 ? 35 VAL A CA   7  
ATOM 9216  C C    . VAL A 1 35 ? -2.589  -5.229  -4.470  1.00 0.00 ? 35 VAL A C    7  
ATOM 9217  O O    . VAL A 1 35 ? -3.265  -4.822  -3.526  1.00 0.00 ? 35 VAL A O    7  
ATOM 9218  C CB   . VAL A 1 35 ? -2.987  -7.747  -4.576  1.00 0.00 ? 35 VAL A CB   7  
ATOM 9219  C CG1  . VAL A 1 35 ? -4.127  -7.330  -5.507  1.00 0.00 ? 35 VAL A CG1  7  
ATOM 9220  C CG2  . VAL A 1 35 ? -2.323  -9.036  -5.064  1.00 0.00 ? 35 VAL A CG2  7  
ATOM 9221  H H    . VAL A 1 35 ? -1.786  -6.824  -2.364  1.00 0.00 ? 35 VAL A H    7  
ATOM 9222  H HA   . VAL A 1 35 ? -1.246  -6.709  -5.250  1.00 0.00 ? 35 VAL A HA   7  
ATOM 9223  H HB   . VAL A 1 35 ? -3.413  -7.941  -3.591  1.00 0.00 ? 35 VAL A HB   7  
ATOM 9224  H HG11 . VAL A 1 35 ? -3.756  -6.611  -6.237  1.00 0.00 ? 35 VAL A HG11 7  
ATOM 9225  H HG12 . VAL A 1 35 ? -4.512  -8.209  -6.026  1.00 0.00 ? 35 VAL A HG12 7  
ATOM 9226  H HG13 . VAL A 1 35 ? -4.926  -6.875  -4.922  1.00 0.00 ? 35 VAL A HG13 7  
ATOM 9227  H HG21 . VAL A 1 35 ? -1.695  -8.817  -5.927  1.00 0.00 ? 35 VAL A HG21 7  
ATOM 9228  H HG22 . VAL A 1 35 ? -1.711  -9.454  -4.265  1.00 0.00 ? 35 VAL A HG22 7  
ATOM 9229  H HG23 . VAL A 1 35 ? -3.092  -9.756  -5.347  1.00 0.00 ? 35 VAL A HG23 7  
ATOM 9230  N N    . TYR A 1 36 ? -2.345  -4.535  -5.572  1.00 0.00 ? 36 TYR A N    7  
ATOM 9231  C CA   . TYR A 1 36 ? -2.879  -3.195  -5.747  1.00 0.00 ? 36 TYR A CA   7  
ATOM 9232  C C    . TYR A 1 36 ? -4.279  -3.239  -6.362  1.00 0.00 ? 36 TYR A C    7  
ATOM 9233  O O    . TYR A 1 36 ? -4.426  -3.447  -7.566  1.00 0.00 ? 36 TYR A O    7  
ATOM 9234  C CB   . TYR A 1 36 ? -1.931  -2.486  -6.715  1.00 0.00 ? 36 TYR A CB   7  
ATOM 9235  C CG   . TYR A 1 36 ? -0.522  -2.270  -6.161  1.00 0.00 ? 36 TYR A CG   7  
ATOM 9236  C CD1  . TYR A 1 36 ? -0.338  -1.530  -5.011  1.00 0.00 ? 36 TYR A CD1  7  
ATOM 9237  C CD2  . TYR A 1 36 ? 0.566   -2.817  -6.810  1.00 0.00 ? 36 TYR A CD2  7  
ATOM 9238  C CE1  . TYR A 1 36 ? 0.988   -1.327  -4.489  1.00 0.00 ? 36 TYR A CE1  7  
ATOM 9239  C CE2  . TYR A 1 36 ? 1.893   -2.614  -6.288  1.00 0.00 ? 36 TYR A CE2  7  
ATOM 9240  C CZ   . TYR A 1 36 ? 2.038   -1.879  -5.153  1.00 0.00 ? 36 TYR A CZ   7  
ATOM 9241  O OH   . TYR A 1 36 ? 3.291   -1.687  -4.660  1.00 0.00 ? 36 TYR A OH   7  
ATOM 9242  H H    . TYR A 1 36 ? -1.794  -4.873  -6.335  1.00 0.00 ? 36 TYR A H    7  
ATOM 9243  H HA   . TYR A 1 36 ? -2.937  -2.725  -4.765  1.00 0.00 ? 36 TYR A HA   7  
ATOM 9244  H HB2  . TYR A 1 36 ? -1.864  -3.069  -7.634  1.00 0.00 ? 36 TYR A HB2  7  
ATOM 9245  H HB3  . TYR A 1 36 ? -2.357  -1.519  -6.982  1.00 0.00 ? 36 TYR A HB3  7  
ATOM 9246  H HD1  . TYR A 1 36 ? -1.198  -1.098  -4.498  1.00 0.00 ? 36 TYR A HD1  7  
ATOM 9247  H HD2  . TYR A 1 36 ? 0.422   -3.402  -7.718  1.00 0.00 ? 36 TYR A HD2  7  
ATOM 9248  H HE1  . TYR A 1 36 ? 1.147   -0.744  -3.581  1.00 0.00 ? 36 TYR A HE1  7  
ATOM 9249  H HE2  . TYR A 1 36 ? 2.761   -3.040  -6.791  1.00 0.00 ? 36 TYR A HE2  7  
ATOM 9250  H HH   . TYR A 1 36 ? 3.270   -1.009  -3.926  1.00 0.00 ? 36 TYR A HH   7  
ATOM 9251  N N    . ASN A 1 37 ? -5.273  -3.041  -5.509  1.00 0.00 ? 37 ASN A N    7  
ATOM 9252  C CA   . ASN A 1 37 ? -6.656  -3.056  -5.954  1.00 0.00 ? 37 ASN A CA   7  
ATOM 9253  C C    . ASN A 1 37 ? -7.082  -1.635  -6.330  1.00 0.00 ? 37 ASN A C    7  
ATOM 9254  O O    . ASN A 1 37 ? -7.009  -0.723  -5.507  1.00 0.00 ? 37 ASN A O    7  
ATOM 9255  C CB   . ASN A 1 37 ? -7.587  -3.550  -4.845  1.00 0.00 ? 37 ASN A CB   7  
ATOM 9256  C CG   . ASN A 1 37 ? -8.301  -4.838  -5.262  1.00 0.00 ? 37 ASN A CG   7  
ATOM 9257  O OD1  . ASN A 1 37 ? -9.431  -4.831  -5.722  1.00 0.00 ? 37 ASN A OD1  7  
ATOM 9258  N ND2  . ASN A 1 37 ? -7.580  -5.940  -5.075  1.00 0.00 ? 37 ASN A ND2  7  
ATOM 9259  H H    . ASN A 1 37 ? -5.145  -2.873  -4.531  1.00 0.00 ? 37 ASN A H    7  
ATOM 9260  H HA   . ASN A 1 37 ? -6.676  -3.736  -6.806  1.00 0.00 ? 37 ASN A HA   7  
ATOM 9261  H HB2  . ASN A 1 37 ? -7.012  -3.727  -3.935  1.00 0.00 ? 37 ASN A HB2  7  
ATOM 9262  H HB3  . ASN A 1 37 ? -8.323  -2.781  -4.613  1.00 0.00 ? 37 ASN A HB3  7  
ATOM 9263  H HD21 . ASN A 1 37 ? -6.658  -5.877  -4.693  1.00 0.00 ? 37 ASN A HD21 7  
ATOM 9264  H HD22 . ASN A 1 37 ? -7.961  -6.833  -5.317  1.00 0.00 ? 37 ASN A HD22 7  
ATOM 9265  N N    . PHE A 1 38 ? -7.516  -1.491  -7.573  1.00 0.00 ? 38 PHE A N    7  
ATOM 9266  C CA   . PHE A 1 38 ? -7.953  -0.196  -8.068  1.00 0.00 ? 38 PHE A CA   7  
ATOM 9267  C C    . PHE A 1 38 ? -9.479  -0.126  -8.147  1.00 0.00 ? 38 PHE A C    7  
ATOM 9268  O O    . PHE A 1 38 ? -10.138 -1.134  -8.401  1.00 0.00 ? 38 PHE A O    7  
ATOM 9269  C CB   . PHE A 1 38 ? -7.373  -0.035  -9.474  1.00 0.00 ? 38 PHE A CB   7  
ATOM 9270  C CG   . PHE A 1 38 ? -5.867  -0.296  -9.560  1.00 0.00 ? 38 PHE A CG   7  
ATOM 9271  C CD1  . PHE A 1 38 ? -4.990  0.625   -9.077  1.00 0.00 ? 38 PHE A CD1  7  
ATOM 9272  C CD2  . PHE A 1 38 ? -5.407  -1.447  -10.119 1.00 0.00 ? 38 PHE A CD2  7  
ATOM 9273  C CE1  . PHE A 1 38 ? -3.593  0.384   -9.157  1.00 0.00 ? 38 PHE A CE1  7  
ATOM 9274  C CE2  . PHE A 1 38 ? -4.010  -1.688  -10.198 1.00 0.00 ? 38 PHE A CE2  7  
ATOM 9275  C CZ   . PHE A 1 38 ? -3.132  -0.768  -9.716  1.00 0.00 ? 38 PHE A CZ   7  
ATOM 9276  H H    . PHE A 1 38 ? -7.571  -2.237  -8.236  1.00 0.00 ? 38 PHE A H    7  
ATOM 9277  H HA   . PHE A 1 38 ? -7.593  0.557   -7.366  1.00 0.00 ? 38 PHE A HA   7  
ATOM 9278  H HB2  . PHE A 1 38 ? -7.888  -0.719  -10.149 1.00 0.00 ? 38 PHE A HB2  7  
ATOM 9279  H HB3  . PHE A 1 38 ? -7.577  0.975   -9.827  1.00 0.00 ? 38 PHE A HB3  7  
ATOM 9280  H HD1  . PHE A 1 38 ? -5.359  1.547   -8.630  1.00 0.00 ? 38 PHE A HD1  7  
ATOM 9281  H HD2  . PHE A 1 38 ? -6.110  -2.184  -10.506 1.00 0.00 ? 38 PHE A HD2  7  
ATOM 9282  H HE1  . PHE A 1 38 ? -2.889  1.121   -8.770  1.00 0.00 ? 38 PHE A HE1  7  
ATOM 9283  H HE2  . PHE A 1 38 ? -3.641  -2.611  -10.646 1.00 0.00 ? 38 PHE A HE2  7  
ATOM 9284  H HZ   . PHE A 1 38 ? -2.060  -0.953  -9.777  1.00 0.00 ? 38 PHE A HZ   7  
ATOM 9285  N N    . PHE A 1 39 ? -9.997  1.073   -7.926  1.00 0.00 ? 39 PHE A N    7  
ATOM 9286  C CA   . PHE A 1 39 ? -11.434 1.287   -7.970  1.00 0.00 ? 39 PHE A CA   7  
ATOM 9287  C C    . PHE A 1 39 ? -11.762 2.707   -8.437  1.00 0.00 ? 39 PHE A C    7  
ATOM 9288  O O    . PHE A 1 39 ? -10.862 3.494   -8.723  1.00 0.00 ? 39 PHE A O    7  
ATOM 9289  C CB   . PHE A 1 39 ? -11.958 1.097   -6.545  1.00 0.00 ? 39 PHE A CB   7  
ATOM 9290  C CG   . PHE A 1 39 ? -11.307 2.022   -5.514  1.00 0.00 ? 39 PHE A CG   7  
ATOM 9291  C CD1  . PHE A 1 39 ? -10.070 1.735   -5.028  1.00 0.00 ? 39 PHE A CD1  7  
ATOM 9292  C CD2  . PHE A 1 39 ? -11.966 3.132   -5.085  1.00 0.00 ? 39 PHE A CD2  7  
ATOM 9293  C CE1  . PHE A 1 39 ? -9.466  2.593   -4.071  1.00 0.00 ? 39 PHE A CE1  7  
ATOM 9294  C CE2  . PHE A 1 39 ? -11.362 3.990   -4.128  1.00 0.00 ? 39 PHE A CE2  7  
ATOM 9295  C CZ   . PHE A 1 39 ? -10.125 3.703   -3.642  1.00 0.00 ? 39 PHE A CZ   7  
ATOM 9296  H H    . PHE A 1 39 ? -9.454  1.887   -7.721  1.00 0.00 ? 39 PHE A H    7  
ATOM 9297  H HA   . PHE A 1 39 ? -11.846 0.569   -8.678  1.00 0.00 ? 39 PHE A HA   7  
ATOM 9298  H HB2  . PHE A 1 39 ? -13.035 1.265   -6.539  1.00 0.00 ? 39 PHE A HB2  7  
ATOM 9299  H HB3  . PHE A 1 39 ? -11.794 0.063   -6.243  1.00 0.00 ? 39 PHE A HB3  7  
ATOM 9300  H HD1  . PHE A 1 39 ? -9.542  0.846   -5.372  1.00 0.00 ? 39 PHE A HD1  7  
ATOM 9301  H HD2  . PHE A 1 39 ? -12.957 3.362   -5.475  1.00 0.00 ? 39 PHE A HD2  7  
ATOM 9302  H HE1  . PHE A 1 39 ? -8.475  2.363   -3.681  1.00 0.00 ? 39 PHE A HE1  7  
ATOM 9303  H HE2  . PHE A 1 39 ? -11.890 4.880   -3.784  1.00 0.00 ? 39 PHE A HE2  7  
ATOM 9304  H HZ   . PHE A 1 39 ? -9.661  4.362   -2.907  1.00 0.00 ? 39 PHE A HZ   7  
ATOM 9305  N N    . GLU A 1 40 ? -13.055 2.990   -8.499  1.00 0.00 ? 40 GLU A N    7  
ATOM 9306  C CA   . GLU A 1 40 ? -13.514 4.301   -8.926  1.00 0.00 ? 40 GLU A CA   7  
ATOM 9307  C C    . GLU A 1 40 ? -13.904 5.148   -7.713  1.00 0.00 ? 40 GLU A C    7  
ATOM 9308  O O    . GLU A 1 40 ? -14.489 4.640   -6.758  1.00 0.00 ? 40 GLU A O    7  
ATOM 9309  C CB   . GLU A 1 40 ? -14.681 4.180   -9.908  1.00 0.00 ? 40 GLU A CB   7  
ATOM 9310  C CG   . GLU A 1 40 ? -14.230 4.494   -11.336 1.00 0.00 ? 40 GLU A CG   7  
ATOM 9311  C CD   . GLU A 1 40 ? -15.251 5.380   -12.052 1.00 0.00 ? 40 GLU A CD   7  
ATOM 9312  O OE1  . GLU A 1 40 ? -16.436 4.980   -12.070 1.00 0.00 ? 40 GLU A OE1  7  
ATOM 9313  O OE2  . GLU A 1 40 ? -14.825 6.437   -12.565 1.00 0.00 ? 40 GLU A OE2  7  
ATOM 9314  H H    . GLU A 1 40 ? -13.781 2.344   -8.264  1.00 0.00 ? 40 GLU A H    7  
ATOM 9315  H HA   . GLU A 1 40 ? -12.663 4.754   -9.436  1.00 0.00 ? 40 GLU A HA   7  
ATOM 9316  H HB2  . GLU A 1 40 ? -15.093 3.172   -9.866  1.00 0.00 ? 40 GLU A HB2  7  
ATOM 9317  H HB3  . GLU A 1 40 ? -15.478 4.864   -9.617  1.00 0.00 ? 40 GLU A HB3  7  
ATOM 9318  H HG2  . GLU A 1 40 ? -13.261 4.994   -11.314 1.00 0.00 ? 40 GLU A HG2  7  
ATOM 9319  H HG3  . GLU A 1 40 ? -14.096 3.565   -11.891 1.00 0.00 ? 40 GLU A HG3  7  
ATOM 9320  N N    . CYS A 1 41 ? -13.564 6.427   -7.790  1.00 0.00 ? 41 CYS A N    7  
ATOM 9321  C CA   . CYS A 1 41 ? -13.871 7.349   -6.711  1.00 0.00 ? 41 CYS A CA   7  
ATOM 9322  C C    . CYS A 1 41 ? -15.215 8.014   -7.015  1.00 0.00 ? 41 CYS A C    7  
ATOM 9323  O O    . CYS A 1 41 ? -15.580 8.180   -8.177  1.00 0.00 ? 41 CYS A O    7  
ATOM 9324  C CB   . CYS A 1 41 ? -12.756 8.379   -6.512  1.00 0.00 ? 41 CYS A CB   7  
ATOM 9325  S SG   . CYS A 1 41 ? -12.939 9.192   -4.883  1.00 0.00 ? 41 CYS A SG   7  
ATOM 9326  H H    . CYS A 1 41 ? -13.088 6.832   -8.570  1.00 0.00 ? 41 CYS A H    7  
ATOM 9327  H HA   . CYS A 1 41 ? -13.930 6.755   -5.799  1.00 0.00 ? 41 CYS A HA   7  
ATOM 9328  H HB2  . CYS A 1 41 ? -11.784 7.892   -6.578  1.00 0.00 ? 41 CYS A HB2  7  
ATOM 9329  H HB3  . CYS A 1 41 ? -12.794 9.125   -7.306  1.00 0.00 ? 41 CYS A HB3  7  
ATOM 9330  H HG   . CYS A 1 41 ? -11.805 9.885   -4.946  1.00 0.00 ? 41 CYS A HG   7  
ATOM 9331  N N    . GLU A 1 42 ? -15.914 8.376   -5.949  1.00 0.00 ? 42 GLU A N    7  
ATOM 9332  C CA   . GLU A 1 42 ? -17.210 9.019   -6.087  1.00 0.00 ? 42 GLU A CA   7  
ATOM 9333  C C    . GLU A 1 42 ? -17.034 10.491  -6.468  1.00 0.00 ? 42 GLU A C    7  
ATOM 9334  O O    . GLU A 1 42 ? -17.786 11.017  -7.287  1.00 0.00 ? 42 GLU A O    7  
ATOM 9335  C CB   . GLU A 1 42 ? -18.031 8.879   -4.804  1.00 0.00 ? 42 GLU A CB   7  
ATOM 9336  C CG   . GLU A 1 42 ? -19.527 8.809   -5.115  1.00 0.00 ? 42 GLU A CG   7  
ATOM 9337  C CD   . GLU A 1 42 ? -20.007 10.094  -5.793  1.00 0.00 ? 42 GLU A CD   7  
ATOM 9338  O OE1  . GLU A 1 42 ? -20.288 11.057  -5.049  1.00 0.00 ? 42 GLU A OE1  7  
ATOM 9339  O OE2  . GLU A 1 42 ? -20.083 10.083  -7.041  1.00 0.00 ? 42 GLU A OE2  7  
ATOM 9340  H H    . GLU A 1 42 ? -15.609 8.237   -5.007  1.00 0.00 ? 42 GLU A H    7  
ATOM 9341  H HA   . GLU A 1 42 ? -17.713 8.486   -6.893  1.00 0.00 ? 42 GLU A HA   7  
ATOM 9342  H HB2  . GLU A 1 42 ? -17.724 7.981   -4.268  1.00 0.00 ? 42 GLU A HB2  7  
ATOM 9343  H HB3  . GLU A 1 42 ? -17.832 9.726   -4.147  1.00 0.00 ? 42 GLU A HB3  7  
ATOM 9344  H HG2  . GLU A 1 42 ? -19.727 7.955   -5.763  1.00 0.00 ? 42 GLU A HG2  7  
ATOM 9345  H HG3  . GLU A 1 42 ? -20.087 8.649   -4.194  1.00 0.00 ? 42 GLU A HG3  7  
ATOM 9346  N N    . ASN A 1 43 ? -16.037 11.112  -5.856  1.00 0.00 ? 43 ASN A N    7  
ATOM 9347  C CA   . ASN A 1 43 ? -15.753 12.513  -6.121  1.00 0.00 ? 43 ASN A CA   7  
ATOM 9348  C C    . ASN A 1 43 ? -15.039 12.638  -7.469  1.00 0.00 ? 43 ASN A C    7  
ATOM 9349  O O    . ASN A 1 43 ? -14.203 11.804  -7.812  1.00 0.00 ? 43 ASN A O    7  
ATOM 9350  C CB   . ASN A 1 43 ? -14.839 13.103  -5.045  1.00 0.00 ? 43 ASN A CB   7  
ATOM 9351  C CG   . ASN A 1 43 ? -15.504 14.295  -4.355  1.00 0.00 ? 43 ASN A CG   7  
ATOM 9352  O OD1  . ASN A 1 43 ? -16.518 14.174  -3.688  1.00 0.00 ? 43 ASN A OD1  7  
ATOM 9353  N ND2  . ASN A 1 43 ? -14.878 15.452  -4.552  1.00 0.00 ? 43 ASN A ND2  7  
ATOM 9354  H H    . ASN A 1 43 ? -15.430 10.677  -5.191  1.00 0.00 ? 43 ASN A H    7  
ATOM 9355  H HA   . ASN A 1 43 ? -16.724 13.008  -6.116  1.00 0.00 ? 43 ASN A HA   7  
ATOM 9356  H HB2  . ASN A 1 43 ? -14.600 12.337  -4.307  1.00 0.00 ? 43 ASN A HB2  7  
ATOM 9357  H HB3  . ASN A 1 43 ? -13.898 13.417  -5.495  1.00 0.00 ? 43 ASN A HB3  7  
ATOM 9358  H HD21 . ASN A 1 43 ? -14.049 15.483  -5.110  1.00 0.00 ? 43 ASN A HD21 7  
ATOM 9359  H HD22 . ASN A 1 43 ? -15.236 16.291  -4.141  1.00 0.00 ? 43 ASN A HD22 7  
ATOM 9360  N N    . PRO A 1 44 ? -15.405 13.714  -8.215  1.00 0.00 ? 44 PRO A N    7  
ATOM 9361  C CA   . PRO A 1 44 ? -14.809 13.959  -9.517  1.00 0.00 ? 44 PRO A CA   7  
ATOM 9362  C C    . PRO A 1 44 ? -13.384 14.498  -9.375  1.00 0.00 ? 44 PRO A C    7  
ATOM 9363  O O    . PRO A 1 44 ? -12.560 14.330  -10.273 1.00 0.00 ? 44 PRO A O    7  
ATOM 9364  C CB   . PRO A 1 44 ? -15.748 14.938  -10.202 1.00 0.00 ? 44 PRO A CB   7  
ATOM 9365  C CG   . PRO A 1 44 ? -16.581 15.561  -9.094  1.00 0.00 ? 44 PRO A CG   7  
ATOM 9366  C CD   . PRO A 1 44 ? -16.392 14.722  -7.841  1.00 0.00 ? 44 PRO A CD   7  
ATOM 9367  H HA   . PRO A 1 44 ? -14.727 13.103  -10.028 1.00 0.00 ? 44 PRO A HA   7  
ATOM 9368  H HB2  . PRO A 1 44 ? -15.190 15.699  -10.747 1.00 0.00 ? 44 PRO A HB2  7  
ATOM 9369  H HB3  . PRO A 1 44 ? -16.382 14.428  -10.928 1.00 0.00 ? 44 PRO A HB3  7  
ATOM 9370  H HG2  . PRO A 1 44 ? -16.270 16.590  -8.916  1.00 0.00 ? 44 PRO A HG2  7  
ATOM 9371  H HG3  . PRO A 1 44 ? -17.633 15.591  -9.378  1.00 0.00 ? 44 PRO A HG3  7  
ATOM 9372  H HD2  . PRO A 1 44 ? -16.041 15.330  -7.007  1.00 0.00 ? 44 PRO A HD2  7  
ATOM 9373  H HD3  . PRO A 1 44 ? -17.329 14.262  -7.527  1.00 0.00 ? 44 PRO A HD3  7  
ATOM 9374  N N    . SER A 1 45 ? -13.137 15.136  -8.240  1.00 0.00 ? 45 SER A N    7  
ATOM 9375  C CA   . SER A 1 45 ? -11.826 15.701  -7.969  1.00 0.00 ? 45 SER A CA   7  
ATOM 9376  C C    . SER A 1 45 ? -10.736 14.693  -8.336  1.00 0.00 ? 45 SER A C    7  
ATOM 9377  O O    . SER A 1 45 ? -9.916  14.953  -9.215  1.00 0.00 ? 45 SER A O    7  
ATOM 9378  C CB   . SER A 1 45 ? -11.697 16.112  -6.501  1.00 0.00 ? 45 SER A CB   7  
ATOM 9379  O OG   . SER A 1 45 ? -12.408 17.314  -6.218  1.00 0.00 ? 45 SER A OG   7  
ATOM 9380  H H    . SER A 1 45 ? -13.813 15.269  -7.515  1.00 0.00 ? 45 SER A H    7  
ATOM 9381  H HA   . SER A 1 45 ? -11.757 16.587  -8.601  1.00 0.00 ? 45 SER A HA   7  
ATOM 9382  H HB2  . SER A 1 45 ? -12.073 15.310  -5.866  1.00 0.00 ? 45 SER A HB2  7  
ATOM 9383  H HB3  . SER A 1 45 ? -10.644 16.247  -6.254  1.00 0.00 ? 45 SER A HB3  7  
ATOM 9384  H HG   . SER A 1 45 ? -12.477 17.873  -7.044  1.00 0.00 ? 45 SER A HG   7  
ATOM 9385  N N    . GLU A 1 46 ? -10.762 13.563  -7.645  1.00 0.00 ? 46 GLU A N    7  
ATOM 9386  C CA   . GLU A 1 46 ? -9.785  12.515  -7.887  1.00 0.00 ? 46 GLU A CA   7  
ATOM 9387  C C    . GLU A 1 46 ? -10.491 11.201  -8.227  1.00 0.00 ? 46 GLU A C    7  
ATOM 9388  O O    . GLU A 1 46 ? -10.832 10.426  -7.335  1.00 0.00 ? 46 GLU A O    7  
ATOM 9389  C CB   . GLU A 1 46 ? -8.856  12.342  -6.685  1.00 0.00 ? 46 GLU A CB   7  
ATOM 9390  C CG   . GLU A 1 46 ? -7.998  13.592  -6.471  1.00 0.00 ? 46 GLU A CG   7  
ATOM 9391  C CD   . GLU A 1 46 ? -8.273  14.218  -5.102  1.00 0.00 ? 46 GLU A CD   7  
ATOM 9392  O OE1  . GLU A 1 46 ? -9.386  14.763  -4.941  1.00 0.00 ? 46 GLU A OE1  7  
ATOM 9393  O OE2  . GLU A 1 46 ? -7.364  14.137  -4.248  1.00 0.00 ? 46 GLU A OE2  7  
ATOM 9394  H H    . GLU A 1 46 ? -11.432 13.359  -6.932  1.00 0.00 ? 46 GLU A H    7  
ATOM 9395  H HA   . GLU A 1 46 ? -9.202  12.854  -8.744  1.00 0.00 ? 46 GLU A HA   7  
ATOM 9396  H HB2  . GLU A 1 46 ? -9.446  12.145  -5.790  1.00 0.00 ? 46 GLU A HB2  7  
ATOM 9397  H HB3  . GLU A 1 46 ? -8.211  11.477  -6.839  1.00 0.00 ? 46 GLU A HB3  7  
ATOM 9398  H HG2  . GLU A 1 46 ? -6.943  13.331  -6.550  1.00 0.00 ? 46 GLU A HG2  7  
ATOM 9399  H HG3  . GLU A 1 46 ? -8.207  14.319  -7.256  1.00 0.00 ? 46 GLU A HG3  7  
ATOM 9400  N N    . PRO A 1 47 ? -10.695 10.984  -9.555  1.00 0.00 ? 47 PRO A N    7  
ATOM 9401  C CA   . PRO A 1 47 ? -11.354 9.777   -10.024 1.00 0.00 ? 47 PRO A CA   7  
ATOM 9402  C C    . PRO A 1 47 ? -10.416 8.571   -9.935  1.00 0.00 ? 47 PRO A C    7  
ATOM 9403  O O    . PRO A 1 47 ? -10.871 7.432   -9.846  1.00 0.00 ? 47 PRO A O    7  
ATOM 9404  C CB   . PRO A 1 47 ? -11.784 10.091  -11.447 1.00 0.00 ? 47 PRO A CB   7  
ATOM 9405  C CG   . PRO A 1 47 ? -10.948 11.284  -11.881 1.00 0.00 ? 47 PRO A CG   7  
ATOM 9406  C CD   . PRO A 1 47 ? -10.304 11.879  -10.640 1.00 0.00 ? 47 PRO A CD   7  
ATOM 9407  H HA   . PRO A 1 47 ? -12.135 9.559   -9.439  1.00 0.00 ? 47 PRO A HA   7  
ATOM 9408  H HB2  . PRO A 1 47 ? -11.617 9.237   -12.103 1.00 0.00 ? 47 PRO A HB2  7  
ATOM 9409  H HB3  . PRO A 1 47 ? -12.848 10.324  -11.491 1.00 0.00 ? 47 PRO A HB3  7  
ATOM 9410  H HG2  . PRO A 1 47 ? -10.185 10.975  -12.596 1.00 0.00 ? 47 PRO A HG2  7  
ATOM 9411  H HG3  . PRO A 1 47 ? -11.571 12.026  -12.381 1.00 0.00 ? 47 PRO A HG3  7  
ATOM 9412  H HD2  . PRO A 1 47 ? -9.220  11.929  -10.741 1.00 0.00 ? 47 PRO A HD2  7  
ATOM 9413  H HD3  . PRO A 1 47 ? -10.655 12.896  -10.460 1.00 0.00 ? 47 PRO A HD3  7  
ATOM 9414  N N    . PHE A 1 48 ? -9.124  8.863   -9.963  1.00 0.00 ? 48 PHE A N    7  
ATOM 9415  C CA   . PHE A 1 48 ? -8.119  7.816   -9.887  1.00 0.00 ? 48 PHE A CA   7  
ATOM 9416  C C    . PHE A 1 48 ? -7.881  7.389   -8.437  1.00 0.00 ? 48 PHE A C    7  
ATOM 9417  O O    . PHE A 1 48 ? -7.233  8.103   -7.674  1.00 0.00 ? 48 PHE A O    7  
ATOM 9418  C CB   . PHE A 1 48 ? -6.823  8.399   -10.454 1.00 0.00 ? 48 PHE A CB   7  
ATOM 9419  C CG   . PHE A 1 48 ? -6.932  8.863   -11.907 1.00 0.00 ? 48 PHE A CG   7  
ATOM 9420  C CD1  . PHE A 1 48 ? -7.424  10.099  -12.192 1.00 0.00 ? 48 PHE A CD1  7  
ATOM 9421  C CD2  . PHE A 1 48 ? -6.539  8.039   -12.915 1.00 0.00 ? 48 PHE A CD2  7  
ATOM 9422  C CE1  . PHE A 1 48 ? -7.526  10.529  -13.541 1.00 0.00 ? 48 PHE A CE1  7  
ATOM 9423  C CE2  . PHE A 1 48 ? -6.640  8.470   -14.265 1.00 0.00 ? 48 PHE A CE2  7  
ATOM 9424  C CZ   . PHE A 1 48 ? -7.132  9.705   -14.549 1.00 0.00 ? 48 PHE A CZ   7  
ATOM 9425  H H    . PHE A 1 48 ? -8.762  9.792   -10.035 1.00 0.00 ? 48 PHE A H    7  
ATOM 9426  H HA   . PHE A 1 48 ? -8.493  6.966   -10.458 1.00 0.00 ? 48 PHE A HA   7  
ATOM 9427  H HB2  . PHE A 1 48 ? -6.515  9.243   -9.836  1.00 0.00 ? 48 PHE A HB2  7  
ATOM 9428  H HB3  . PHE A 1 48 ? -6.036  7.648   -10.381 1.00 0.00 ? 48 PHE A HB3  7  
ATOM 9429  H HD1  . PHE A 1 48 ? -7.740  10.759  -11.384 1.00 0.00 ? 48 PHE A HD1  7  
ATOM 9430  H HD2  . PHE A 1 48 ? -6.145  7.049   -12.687 1.00 0.00 ? 48 PHE A HD2  7  
ATOM 9431  H HE1  . PHE A 1 48 ? -7.919  11.519  -13.769 1.00 0.00 ? 48 PHE A HE1  7  
ATOM 9432  H HE2  . PHE A 1 48 ? -6.325  7.809   -15.073 1.00 0.00 ? 48 PHE A HE2  7  
ATOM 9433  H HZ   . PHE A 1 48 ? -7.210  10.036  -15.585 1.00 0.00 ? 48 PHE A HZ   7  
ATOM 9434  N N    . GLY A 1 49 ? -8.418  6.225   -8.101  1.00 0.00 ? 49 GLY A N    7  
ATOM 9435  C CA   . GLY A 1 49 ? -8.272  5.694   -6.757  1.00 0.00 ? 49 GLY A CA   7  
ATOM 9436  C C    . GLY A 1 49 ? -7.644  4.299   -6.784  1.00 0.00 ? 49 GLY A C    7  
ATOM 9437  O O    . GLY A 1 49 ? -7.930  3.502   -7.676  1.00 0.00 ? 49 GLY A O    7  
ATOM 9438  H H    . GLY A 1 49 ? -8.943  5.650   -8.728  1.00 0.00 ? 49 GLY A H    7  
ATOM 9439  H HA2  . GLY A 1 49 ? -7.651  6.364   -6.162  1.00 0.00 ? 49 GLY A HA2  7  
ATOM 9440  H HA3  . GLY A 1 49 ? -9.247  5.648   -6.272  1.00 0.00 ? 49 GLY A HA3  7  
ATOM 9441  N N    . ALA A 1 50 ? -6.799  4.046   -5.795  1.00 0.00 ? 50 ALA A N    7  
ATOM 9442  C CA   . ALA A 1 50 ? -6.129  2.761   -5.693  1.00 0.00 ? 50 ALA A CA   7  
ATOM 9443  C C    . ALA A 1 50 ? -6.042  2.350   -4.222  1.00 0.00 ? 50 ALA A C    7  
ATOM 9444  O O    . ALA A 1 50 ? -5.935  3.202   -3.341  1.00 0.00 ? 50 ALA A O    7  
ATOM 9445  C CB   . ALA A 1 50 ? -4.752  2.849   -6.356  1.00 0.00 ? 50 ALA A CB   7  
ATOM 9446  H H    . ALA A 1 50 ? -6.572  4.699   -5.072  1.00 0.00 ? 50 ALA A H    7  
ATOM 9447  H HA   . ALA A 1 50 ? -6.731  2.029   -6.232  1.00 0.00 ? 50 ALA A HA   7  
ATOM 9448  H HB1  . ALA A 1 50 ? -4.524  1.904   -6.847  1.00 0.00 ? 50 ALA A HB1  7  
ATOM 9449  H HB2  . ALA A 1 50 ? -4.756  3.651   -7.095  1.00 0.00 ? 50 ALA A HB2  7  
ATOM 9450  H HB3  . ALA A 1 50 ? -3.997  3.058   -5.598  1.00 0.00 ? 50 ALA A HB3  7  
ATOM 9451  N N    . SER A 1 51 ? -6.091  1.044   -4.001  1.00 0.00 ? 51 SER A N    7  
ATOM 9452  C CA   . SER A 1 51 ? -6.020  0.510   -2.652  1.00 0.00 ? 51 SER A CA   7  
ATOM 9453  C C    . SER A 1 51 ? -4.980  -0.610  -2.587  1.00 0.00 ? 51 SER A C    7  
ATOM 9454  O O    . SER A 1 51 ? -4.605  -1.174  -3.614  1.00 0.00 ? 51 SER A O    7  
ATOM 9455  C CB   . SER A 1 51 ? -7.384  -0.005  -2.191  1.00 0.00 ? 51 SER A CB   7  
ATOM 9456  O OG   . SER A 1 51 ? -7.848  -1.084  -2.998  1.00 0.00 ? 51 SER A OG   7  
ATOM 9457  H H    . SER A 1 51 ? -6.178  0.358   -4.724  1.00 0.00 ? 51 SER A H    7  
ATOM 9458  H HA   . SER A 1 51 ? -5.718  1.349   -2.025  1.00 0.00 ? 51 SER A HA   7  
ATOM 9459  H HB2  . SER A 1 51 ? -7.316  -0.332  -1.153  1.00 0.00 ? 51 SER A HB2  7  
ATOM 9460  H HB3  . SER A 1 51 ? -8.109  0.809   -2.222  1.00 0.00 ? 51 SER A HB3  7  
ATOM 9461  H HG   . SER A 1 51 ? -8.750  -0.867  -3.373  1.00 0.00 ? 51 SER A HG   7  
ATOM 9462  N N    . VAL A 1 52 ? -4.543  -0.899  -1.370  1.00 0.00 ? 52 VAL A N    7  
ATOM 9463  C CA   . VAL A 1 52 ? -3.553  -1.941  -1.158  1.00 0.00 ? 52 VAL A CA   7  
ATOM 9464  C C    . VAL A 1 52 ? -4.201  -3.108  -0.409  1.00 0.00 ? 52 VAL A C    7  
ATOM 9465  O O    . VAL A 1 52 ? -4.619  -2.957  0.738   1.00 0.00 ? 52 VAL A O    7  
ATOM 9466  C CB   . VAL A 1 52 ? -2.335  -1.367  -0.432  1.00 0.00 ? 52 VAL A CB   7  
ATOM 9467  C CG1  . VAL A 1 52 ? -1.489  -2.482  0.186   1.00 0.00 ? 52 VAL A CG1  7  
ATOM 9468  C CG2  . VAL A 1 52 ? -1.496  -0.499  -1.372  1.00 0.00 ? 52 VAL A CG2  7  
ATOM 9469  H H    . VAL A 1 52 ? -4.853  -0.435  -0.540  1.00 0.00 ? 52 VAL A H    7  
ATOM 9470  H HA   . VAL A 1 52 ? -3.229  -2.291  -2.138  1.00 0.00 ? 52 VAL A HA   7  
ATOM 9471  H HB   . VAL A 1 52 ? -2.696  -0.732  0.377   1.00 0.00 ? 52 VAL A HB   7  
ATOM 9472  H HG11 . VAL A 1 52 ? -0.588  -2.053  0.625   1.00 0.00 ? 52 VAL A HG11 7  
ATOM 9473  H HG12 . VAL A 1 52 ? -2.065  -2.988  0.961   1.00 0.00 ? 52 VAL A HG12 7  
ATOM 9474  H HG13 . VAL A 1 52 ? -1.211  -3.198  -0.587  1.00 0.00 ? 52 VAL A HG13 7  
ATOM 9475  H HG21 . VAL A 1 52 ? -1.457  -0.963  -2.357  1.00 0.00 ? 52 VAL A HG21 7  
ATOM 9476  H HG22 . VAL A 1 52 ? -1.948  0.490   -1.454  1.00 0.00 ? 52 VAL A HG22 7  
ATOM 9477  H HG23 . VAL A 1 52 ? -0.486  -0.404  -0.974  1.00 0.00 ? 52 VAL A HG23 7  
ATOM 9478  N N    . THR A 1 53 ? -4.262  -4.244  -1.087  1.00 0.00 ? 53 THR A N    7  
ATOM 9479  C CA   . THR A 1 53 ? -4.851  -5.435  -0.500  1.00 0.00 ? 53 THR A CA   7  
ATOM 9480  C C    . THR A 1 53 ? -3.766  -6.468  -0.186  1.00 0.00 ? 53 THR A C    7  
ATOM 9481  O O    . THR A 1 53 ? -3.029  -6.889  -1.076  1.00 0.00 ? 53 THR A O    7  
ATOM 9482  C CB   . THR A 1 53 ? -5.924  -5.954  -1.459  1.00 0.00 ? 53 THR A CB   7  
ATOM 9483  O OG1  . THR A 1 53 ? -5.378  -5.716  -2.753  1.00 0.00 ? 53 THR A OG1  7  
ATOM 9484  C CG2  . THR A 1 53 ? -7.196  -5.104  -1.429  1.00 0.00 ? 53 THR A CG2  7  
ATOM 9485  H H    . THR A 1 53 ? -3.919  -4.358  -2.019  1.00 0.00 ? 53 THR A H    7  
ATOM 9486  H HA   . THR A 1 53 ? -5.313  -5.159  0.448   1.00 0.00 ? 53 THR A HA   7  
ATOM 9487  H HB   . THR A 1 53 ? -6.151  -7.001  -1.259  1.00 0.00 ? 53 THR A HB   7  
ATOM 9488  H HG1  . THR A 1 53 ? -5.520  -4.761  -3.014  1.00 0.00 ? 53 THR A HG1  7  
ATOM 9489  H HG21 . THR A 1 53 ? -6.959  -4.109  -1.054  1.00 0.00 ? 53 THR A HG21 7  
ATOM 9490  H HG22 . THR A 1 53 ? -7.604  -5.026  -2.437  1.00 0.00 ? 53 THR A HG22 7  
ATOM 9491  H HG23 . THR A 1 53 ? -7.932  -5.573  -0.776  1.00 0.00 ? 53 THR A HG23 7  
ATOM 9492  N N    . ILE A 1 54 ? -3.703  -6.846  1.082   1.00 0.00 ? 54 ILE A N    7  
ATOM 9493  C CA   . ILE A 1 54 ? -2.721  -7.821  1.525   1.00 0.00 ? 54 ILE A CA   7  
ATOM 9494  C C    . ILE A 1 54 ? -3.381  -9.197  1.618   1.00 0.00 ? 54 ILE A C    7  
ATOM 9495  O O    . ILE A 1 54 ? -4.141  -9.463  2.548   1.00 0.00 ? 54 ILE A O    7  
ATOM 9496  C CB   . ILE A 1 54 ? -2.062  -7.364  2.828   1.00 0.00 ? 54 ILE A CB   7  
ATOM 9497  C CG1  . ILE A 1 54 ? -1.143  -6.165  2.588   1.00 0.00 ? 54 ILE A CG1  7  
ATOM 9498  C CG2  . ILE A 1 54 ? -1.327  -8.523  3.506   1.00 0.00 ? 54 ILE A CG2  7  
ATOM 9499  C CD1  . ILE A 1 54 ? -0.664  -5.567  3.912   1.00 0.00 ? 54 ILE A CD1  7  
ATOM 9500  H H    . ILE A 1 54 ? -4.306  -6.498  1.800   1.00 0.00 ? 54 ILE A H    7  
ATOM 9501  H HA   . ILE A 1 54 ? -1.939  -7.863  0.766   1.00 0.00 ? 54 ILE A HA   7  
ATOM 9502  H HB   . ILE A 1 54 ? -2.847  -7.037  3.511   1.00 0.00 ? 54 ILE A HB   7  
ATOM 9503  H HG12 . ILE A 1 54 ? -0.284  -6.474  1.992   1.00 0.00 ? 54 ILE A HG12 7  
ATOM 9504  H HG13 . ILE A 1 54 ? -1.673  -5.406  2.013   1.00 0.00 ? 54 ILE A HG13 7  
ATOM 9505  H HG21 . ILE A 1 54 ? -1.972  -8.968  4.264   1.00 0.00 ? 54 ILE A HG21 7  
ATOM 9506  H HG22 . ILE A 1 54 ? -1.070  -9.275  2.761   1.00 0.00 ? 54 ILE A HG22 7  
ATOM 9507  H HG23 . ILE A 1 54 ? -0.417  -8.150  3.976   1.00 0.00 ? 54 ILE A HG23 7  
ATOM 9508  H HD11 . ILE A 1 54 ? -1.091  -4.572  4.038   1.00 0.00 ? 54 ILE A HD11 7  
ATOM 9509  H HD12 . ILE A 1 54 ? -0.983  -6.206  4.736   1.00 0.00 ? 54 ILE A HD12 7  
ATOM 9510  H HD13 . ILE A 1 54 ? 0.424   -5.498  3.907   1.00 0.00 ? 54 ILE A HD13 7  
ATOM 9511  N N    . ASP A 1 55 ? -3.067  -10.037 0.642   1.00 0.00 ? 55 ASP A N    7  
ATOM 9512  C CA   . ASP A 1 55 ? -3.621  -11.379 0.603   1.00 0.00 ? 55 ASP A CA   7  
ATOM 9513  C C    . ASP A 1 55 ? -5.142  -11.295 0.456   1.00 0.00 ? 55 ASP A C    7  
ATOM 9514  O O    . ASP A 1 55 ? -5.844  -12.285 0.657   1.00 0.00 ? 55 ASP A O    7  
ATOM 9515  C CB   . ASP A 1 55 ? -3.312  -12.141 1.894   1.00 0.00 ? 55 ASP A CB   7  
ATOM 9516  C CG   . ASP A 1 55 ? -3.746  -13.608 1.899   1.00 0.00 ? 55 ASP A CG   7  
ATOM 9517  O OD1  . ASP A 1 55 ? -3.627  -14.239 0.827   1.00 0.00 ? 55 ASP A OD1  7  
ATOM 9518  O OD2  . ASP A 1 55 ? -4.187  -14.065 2.976   1.00 0.00 ? 55 ASP A OD2  7  
ATOM 9519  H H    . ASP A 1 55 ? -2.448  -9.813  -0.110  1.00 0.00 ? 55 ASP A H    7  
ATOM 9520  H HA   . ASP A 1 55 ? -3.145  -11.861 -0.251  1.00 0.00 ? 55 ASP A HA   7  
ATOM 9521  H HB2  . ASP A 1 55 ? -2.238  -12.094 2.077   1.00 0.00 ? 55 ASP A HB2  7  
ATOM 9522  H HB3  . ASP A 1 55 ? -3.799  -11.630 2.725   1.00 0.00 ? 55 ASP A HB3  7  
ATOM 9523  N N    . GLY A 1 56 ? -5.605  -10.104 0.108   1.00 0.00 ? 56 GLY A N    7  
ATOM 9524  C CA   . GLY A 1 56 ? -7.030  -9.878  -0.068  1.00 0.00 ? 56 GLY A CA   7  
ATOM 9525  C C    . GLY A 1 56 ? -7.574  -8.943  1.013   1.00 0.00 ? 56 GLY A C    7  
ATOM 9526  O O    . GLY A 1 56 ? -8.689  -8.436  0.897   1.00 0.00 ? 56 GLY A O    7  
ATOM 9527  H H    . GLY A 1 56 ? -5.027  -9.304  -0.054  1.00 0.00 ? 56 GLY A H    7  
ATOM 9528  H HA2  . GLY A 1 56 ? -7.215  -9.448  -1.053  1.00 0.00 ? 56 GLY A HA2  7  
ATOM 9529  H HA3  . GLY A 1 56 ? -7.560  -10.830 -0.032  1.00 0.00 ? 56 GLY A HA3  7  
ATOM 9530  N N    . VAL A 1 57 ? -6.762  -8.742  2.041   1.00 0.00 ? 57 VAL A N    7  
ATOM 9531  C CA   . VAL A 1 57 ? -7.148  -7.877  3.142   1.00 0.00 ? 57 VAL A CA   7  
ATOM 9532  C C    . VAL A 1 57 ? -6.678  -6.450  2.853   1.00 0.00 ? 57 VAL A C    7  
ATOM 9533  O O    . VAL A 1 57 ? -5.482  -6.204  2.708   1.00 0.00 ? 57 VAL A O    7  
ATOM 9534  C CB   . VAL A 1 57 ? -6.602  -8.431  4.459   1.00 0.00 ? 57 VAL A CB   7  
ATOM 9535  C CG1  . VAL A 1 57 ? -6.635  -7.366  5.558   1.00 0.00 ? 57 VAL A CG1  7  
ATOM 9536  C CG2  . VAL A 1 57 ? -7.368  -9.684  4.887   1.00 0.00 ? 57 VAL A CG2  7  
ATOM 9537  H H    . VAL A 1 57 ? -5.857  -9.158  2.127   1.00 0.00 ? 57 VAL A H    7  
ATOM 9538  H HA   . VAL A 1 57 ? -8.237  -7.883  3.199   1.00 0.00 ? 57 VAL A HA   7  
ATOM 9539  H HB   . VAL A 1 57 ? -5.561  -8.713  4.298   1.00 0.00 ? 57 VAL A HB   7  
ATOM 9540  H HG11 . VAL A 1 57 ? -6.094  -6.481  5.222   1.00 0.00 ? 57 VAL A HG11 7  
ATOM 9541  H HG12 . VAL A 1 57 ? -7.670  -7.099  5.773   1.00 0.00 ? 57 VAL A HG12 7  
ATOM 9542  H HG13 . VAL A 1 57 ? -6.166  -7.759  6.459   1.00 0.00 ? 57 VAL A HG13 7  
ATOM 9543  H HG21 . VAL A 1 57 ? -6.954  -10.554 4.378   1.00 0.00 ? 57 VAL A HG21 7  
ATOM 9544  H HG22 . VAL A 1 57 ? -7.275  -9.816  5.965   1.00 0.00 ? 57 VAL A HG22 7  
ATOM 9545  H HG23 . VAL A 1 57 ? -8.420  -9.575  4.623   1.00 0.00 ? 57 VAL A HG23 7  
ATOM 9546  N N    . THR A 1 58 ? -7.644  -5.546  2.777   1.00 0.00 ? 58 THR A N    7  
ATOM 9547  C CA   . THR A 1 58 ? -7.344  -4.150  2.507   1.00 0.00 ? 58 THR A CA   7  
ATOM 9548  C C    . THR A 1 58 ? -6.698  -3.498  3.731   1.00 0.00 ? 58 THR A C    7  
ATOM 9549  O O    . THR A 1 58 ? -7.150  -3.699  4.858   1.00 0.00 ? 58 THR A O    7  
ATOM 9550  C CB   . THR A 1 58 ? -8.639  -3.465  2.066   1.00 0.00 ? 58 THR A CB   7  
ATOM 9551  O OG1  . THR A 1 58 ? -9.286  -4.438  1.251   1.00 0.00 ? 58 THR A OG1  7  
ATOM 9552  C CG2  . THR A 1 58 ? -8.386  -2.292  1.116   1.00 0.00 ? 58 THR A CG2  7  
ATOM 9553  H H    . THR A 1 58 ? -8.615  -5.754  2.896   1.00 0.00 ? 58 THR A H    7  
ATOM 9554  H HA   . THR A 1 58 ? -6.615  -4.106  1.699   1.00 0.00 ? 58 THR A HA   7  
ATOM 9555  H HB   . THR A 1 58 ? -9.225  -3.149  2.928   1.00 0.00 ? 58 THR A HB   7  
ATOM 9556  H HG1  . THR A 1 58 ? -10.262 -4.232  1.182   1.00 0.00 ? 58 THR A HG1  7  
ATOM 9557  H HG21 . THR A 1 58 ? -7.633  -1.632  1.546   1.00 0.00 ? 58 THR A HG21 7  
ATOM 9558  H HG22 . THR A 1 58 ? -8.033  -2.671  0.157   1.00 0.00 ? 58 THR A HG22 7  
ATOM 9559  H HG23 . THR A 1 58 ? -9.313  -1.738  0.968   1.00 0.00 ? 58 THR A HG23 7  
ATOM 9560  N N    . TYR A 1 59 ? -5.651  -2.729  3.469   1.00 0.00 ? 59 TYR A N    7  
ATOM 9561  C CA   . TYR A 1 59 ? -4.939  -2.046  4.535   1.00 0.00 ? 59 TYR A CA   7  
ATOM 9562  C C    . TYR A 1 59 ? -5.002  -0.528  4.352   1.00 0.00 ? 59 TYR A C    7  
ATOM 9563  O O    . TYR A 1 59 ? -5.848  0.138   4.947   1.00 0.00 ? 59 TYR A O    7  
ATOM 9564  C CB   . TYR A 1 59 ? -3.482  -2.500  4.427   1.00 0.00 ? 59 TYR A CB   7  
ATOM 9565  C CG   . TYR A 1 59 ? -3.162  -3.762  5.232   1.00 0.00 ? 59 TYR A CG   7  
ATOM 9566  C CD1  . TYR A 1 59 ? -3.905  -4.909  5.040   1.00 0.00 ? 59 TYR A CD1  7  
ATOM 9567  C CD2  . TYR A 1 59 ? -2.131  -3.752  6.149   1.00 0.00 ? 59 TYR A CD2  7  
ATOM 9568  C CE1  . TYR A 1 59 ? -3.604  -6.096  5.798   1.00 0.00 ? 59 TYR A CE1  7  
ATOM 9569  C CE2  . TYR A 1 59 ? -1.830  -4.939  6.906   1.00 0.00 ? 59 TYR A CE2  7  
ATOM 9570  C CZ   . TYR A 1 59 ? -2.582  -6.053  6.693   1.00 0.00 ? 59 TYR A CZ   7  
ATOM 9571  O OH   . TYR A 1 59 ? -2.297  -7.174  7.408   1.00 0.00 ? 59 TYR A OH   7  
ATOM 9572  H H    . TYR A 1 59 ? -5.290  -2.571  2.550   1.00 0.00 ? 59 TYR A H    7  
ATOM 9573  H HA   . TYR A 1 59 ? -5.413  -2.310  5.480   1.00 0.00 ? 59 TYR A HA   7  
ATOM 9574  H HB2  . TYR A 1 59 ? -3.245  -2.681  3.378   1.00 0.00 ? 59 TYR A HB2  7  
ATOM 9575  H HB3  . TYR A 1 59 ? -2.834  -1.692  4.765   1.00 0.00 ? 59 TYR A HB3  7  
ATOM 9576  H HD1  . TYR A 1 59 ? -4.720  -4.916  4.316   1.00 0.00 ? 59 TYR A HD1  7  
ATOM 9577  H HD2  . TYR A 1 59 ? -1.544  -2.846  6.300   1.00 0.00 ? 59 TYR A HD2  7  
ATOM 9578  H HE1  . TYR A 1 59 ? -4.183  -7.009  5.656   1.00 0.00 ? 59 TYR A HE1  7  
ATOM 9579  H HE2  . TYR A 1 59 ? -1.019  -4.946  7.634   1.00 0.00 ? 59 TYR A HE2  7  
ATOM 9580  H HH   . TYR A 1 59 ? -3.097  -7.452  7.941   1.00 0.00 ? 59 TYR A HH   7  
ATOM 9581  N N    . GLY A 1 60 ? -4.096  -0.026  3.526   1.00 0.00 ? 60 GLY A N    7  
ATOM 9582  C CA   . GLY A 1 60 ? -4.039  1.401   3.256   1.00 0.00 ? 60 GLY A CA   7  
ATOM 9583  C C    . GLY A 1 60 ? -4.428  1.702   1.808   1.00 0.00 ? 60 GLY A C    7  
ATOM 9584  O O    . GLY A 1 60 ? -3.878  1.113   0.878   1.00 0.00 ? 60 GLY A O    7  
ATOM 9585  H H    . GLY A 1 60 ? -3.412  -0.574  3.045   1.00 0.00 ? 60 GLY A H    7  
ATOM 9586  H HA2  . GLY A 1 60 ? -4.709  1.930   3.934   1.00 0.00 ? 60 GLY A HA2  7  
ATOM 9587  H HA3  . GLY A 1 60 ? -3.032  1.771   3.451   1.00 0.00 ? 60 GLY A HA3  7  
ATOM 9588  N N    . SER A 1 61 ? -5.373  2.619   1.660   1.00 0.00 ? 61 SER A N    7  
ATOM 9589  C CA   . SER A 1 61 ? -5.842  3.005   0.341   1.00 0.00 ? 61 SER A CA   7  
ATOM 9590  C C    . SER A 1 61 ? -5.991  4.525   0.263   1.00 0.00 ? 61 SER A C    7  
ATOM 9591  O O    . SER A 1 61 ? -6.101  5.195   1.288   1.00 0.00 ? 61 SER A O    7  
ATOM 9592  C CB   . SER A 1 61 ? -7.170  2.323   0.007   1.00 0.00 ? 61 SER A CB   7  
ATOM 9593  O OG   . SER A 1 61 ? -7.290  1.050   0.636   1.00 0.00 ? 61 SER A OG   7  
ATOM 9594  H H    . SER A 1 61 ? -5.815  3.093   2.422   1.00 0.00 ? 61 SER A H    7  
ATOM 9595  H HA   . SER A 1 61 ? -5.073  2.660   -0.351  1.00 0.00 ? 61 SER A HA   7  
ATOM 9596  H HB2  . SER A 1 61 ? -7.995  2.962   0.322   1.00 0.00 ? 61 SER A HB2  7  
ATOM 9597  H HB3  . SER A 1 61 ? -7.255  2.203   -1.073  1.00 0.00 ? 61 SER A HB3  7  
ATOM 9598  H HG   . SER A 1 61 ? -6.383  0.660   0.794   1.00 0.00 ? 61 SER A HG   7  
ATOM 9599  N N    . GLY A 1 62 ? -5.991  5.026   -0.964  1.00 0.00 ? 62 GLY A N    7  
ATOM 9600  C CA   . GLY A 1 62 ? -6.125  6.455   -1.189  1.00 0.00 ? 62 GLY A CA   7  
ATOM 9601  C C    . GLY A 1 62 ? -6.337  6.759   -2.674  1.00 0.00 ? 62 GLY A C    7  
ATOM 9602  O O    . GLY A 1 62 ? -6.219  5.870   -3.516  1.00 0.00 ? 62 GLY A O    7  
ATOM 9603  H H    . GLY A 1 62 ? -5.901  4.474   -1.793  1.00 0.00 ? 62 GLY A H    7  
ATOM 9604  H HA2  . GLY A 1 62 ? -6.965  6.841   -0.612  1.00 0.00 ? 62 GLY A HA2  7  
ATOM 9605  H HA3  . GLY A 1 62 ? -5.231  6.968   -0.834  1.00 0.00 ? 62 GLY A HA3  7  
ATOM 9606  N N    . THR A 1 63 ? -6.647  8.017   -2.949  1.00 0.00 ? 63 THR A N    7  
ATOM 9607  C CA   . THR A 1 63 ? -6.877  8.449   -4.317  1.00 0.00 ? 63 THR A CA   7  
ATOM 9608  C C    . THR A 1 63 ? -6.015  9.670   -4.643  1.00 0.00 ? 63 THR A C    7  
ATOM 9609  O O    . THR A 1 63 ? -5.377  10.238  -3.758  1.00 0.00 ? 63 THR A O    7  
ATOM 9610  C CB   . THR A 1 63 ? -8.376  8.701   -4.488  1.00 0.00 ? 63 THR A CB   7  
ATOM 9611  O OG1  . THR A 1 63 ? -8.644  9.801   -3.623  1.00 0.00 ? 63 THR A OG1  7  
ATOM 9612  C CG2  . THR A 1 63 ? -9.229  7.564   -3.921  1.00 0.00 ? 63 THR A CG2  7  
ATOM 9613  H H    . THR A 1 63 ? -6.741  8.734   -2.258  1.00 0.00 ? 63 THR A H    7  
ATOM 9614  H HA   . THR A 1 63 ? -6.563  7.649   -4.988  1.00 0.00 ? 63 THR A HA   7  
ATOM 9615  H HB   . THR A 1 63 ? -8.623  8.888   -5.533  1.00 0.00 ? 63 THR A HB   7  
ATOM 9616  H HG1  . THR A 1 63 ? -9.542  10.188  -3.831  1.00 0.00 ? 63 THR A HG1  7  
ATOM 9617  H HG21 . THR A 1 63 ? -10.273 7.724   -4.189  1.00 0.00 ? 63 THR A HG21 7  
ATOM 9618  H HG22 . THR A 1 63 ? -8.890  6.614   -4.334  1.00 0.00 ? 63 THR A HG22 7  
ATOM 9619  H HG23 . THR A 1 63 ? -9.131  7.543   -2.836  1.00 0.00 ? 63 THR A HG23 7  
ATOM 9620  N N    . ALA A 1 64 ? -6.024  10.039  -5.916  1.00 0.00 ? 64 ALA A N    7  
ATOM 9621  C CA   . ALA A 1 64 ? -5.251  11.183  -6.369  1.00 0.00 ? 64 ALA A CA   7  
ATOM 9622  C C    . ALA A 1 64 ? -5.683  11.554  -7.789  1.00 0.00 ? 64 ALA A C    7  
ATOM 9623  O O    . ALA A 1 64 ? -6.579  10.928  -8.353  1.00 0.00 ? 64 ALA A O    7  
ATOM 9624  C CB   . ALA A 1 64 ? -3.758  10.858  -6.280  1.00 0.00 ? 64 ALA A CB   7  
ATOM 9625  H H    . ALA A 1 64 ? -6.546  9.572   -6.629  1.00 0.00 ? 64 ALA A H    7  
ATOM 9626  H HA   . ALA A 1 64 ? -5.469  12.016  -5.702  1.00 0.00 ? 64 ALA A HA   7  
ATOM 9627  H HB1  . ALA A 1 64 ? -3.531  10.013  -6.929  1.00 0.00 ? 64 ALA A HB1  7  
ATOM 9628  H HB2  . ALA A 1 64 ? -3.178  11.725  -6.596  1.00 0.00 ? 64 ALA A HB2  7  
ATOM 9629  H HB3  . ALA A 1 64 ? -3.502  10.605  -5.251  1.00 0.00 ? 64 ALA A HB3  7  
ATOM 9630  N N    . SER A 1 65 ? -5.024  12.570  -8.327  1.00 0.00 ? 65 SER A N    7  
ATOM 9631  C CA   . SER A 1 65 ? -5.329  13.032  -9.670  1.00 0.00 ? 65 SER A CA   7  
ATOM 9632  C C    . SER A 1 65 ? -4.798  12.033  -10.700 1.00 0.00 ? 65 SER A C    7  
ATOM 9633  O O    . SER A 1 65 ? -5.337  11.925  -11.801 1.00 0.00 ? 65 SER A O    7  
ATOM 9634  C CB   . SER A 1 65 ? -4.737  14.420  -9.923  1.00 0.00 ? 65 SER A CB   7  
ATOM 9635  O OG   . SER A 1 65 ? -5.717  15.448  -9.804  1.00 0.00 ? 65 SER A OG   7  
ATOM 9636  H H    . SER A 1 65 ? -4.296  13.074  -7.862  1.00 0.00 ? 65 SER A H    7  
ATOM 9637  H HA   . SER A 1 65 ? -6.417  13.088  -9.717  1.00 0.00 ? 65 SER A HA   7  
ATOM 9638  H HB2  . SER A 1 65 ? -3.930  14.605  -9.213  1.00 0.00 ? 65 SER A HB2  7  
ATOM 9639  H HB3  . SER A 1 65 ? -4.298  14.451  -10.920 1.00 0.00 ? 65 SER A HB3  7  
ATOM 9640  H HG   . SER A 1 65 ? -5.312  16.335  -10.028 1.00 0.00 ? 65 SER A HG   7  
ATOM 9641  N N    . SER A 1 66 ? -3.748  11.329  -10.307 1.00 0.00 ? 66 SER A N    7  
ATOM 9642  C CA   . SER A 1 66 ? -3.138  10.342  -11.182 1.00 0.00 ? 66 SER A CA   7  
ATOM 9643  C C    . SER A 1 66 ? -3.264  8.947   -10.567 1.00 0.00 ? 66 SER A C    7  
ATOM 9644  O O    . SER A 1 66 ? -3.753  8.800   -9.448  1.00 0.00 ? 66 SER A O    7  
ATOM 9645  C CB   . SER A 1 66 ? -1.668  10.674  -11.447 1.00 0.00 ? 66 SER A CB   7  
ATOM 9646  O OG   . SER A 1 66 ? -1.428  10.982  -12.817 1.00 0.00 ? 66 SER A OG   7  
ATOM 9647  H H    . SER A 1 66 ? -3.315  11.423  -9.410  1.00 0.00 ? 66 SER A H    7  
ATOM 9648  H HA   . SER A 1 66 ? -3.696  10.401  -12.116 1.00 0.00 ? 66 SER A HA   7  
ATOM 9649  H HB2  . SER A 1 66 ? -1.370  11.521  -10.828 1.00 0.00 ? 66 SER A HB2  7  
ATOM 9650  H HB3  . SER A 1 66 ? -1.046  9.829   -11.150 1.00 0.00 ? 66 SER A HB3  7  
ATOM 9651  H HG   . SER A 1 66 ? -0.997  10.202  -13.272 1.00 0.00 ? 66 SER A HG   7  
ATOM 9652  N N    . LYS A 1 67 ? -2.815  7.958   -11.325 1.00 0.00 ? 67 LYS A N    7  
ATOM 9653  C CA   . LYS A 1 67 ? -2.872  6.580   -10.869 1.00 0.00 ? 67 LYS A CA   7  
ATOM 9654  C C    . LYS A 1 67 ? -1.715  6.319   -9.902  1.00 0.00 ? 67 LYS A C    7  
ATOM 9655  O O    . LYS A 1 67 ? -1.924  5.814   -8.800  1.00 0.00 ? 67 LYS A O    7  
ATOM 9656  C CB   . LYS A 1 67 ? -2.905  5.621   -12.061 1.00 0.00 ? 67 LYS A CB   7  
ATOM 9657  C CG   . LYS A 1 67 ? -3.948  4.521   -11.852 1.00 0.00 ? 67 LYS A CG   7  
ATOM 9658  C CD   . LYS A 1 67 ? -4.035  3.608   -13.076 1.00 0.00 ? 67 LYS A CD   7  
ATOM 9659  C CE   . LYS A 1 67 ? -4.921  2.393   -12.792 1.00 0.00 ? 67 LYS A CE   7  
ATOM 9660  N NZ   . LYS A 1 67 ? -4.202  1.141   -13.115 1.00 0.00 ? 67 LYS A NZ   7  
ATOM 9661  H H    . LYS A 1 67 ? -2.419  8.086   -12.235 1.00 0.00 ? 67 LYS A H    7  
ATOM 9662  H HA   . LYS A 1 67 ? -3.810  6.453   -10.328 1.00 0.00 ? 67 LYS A HA   7  
ATOM 9663  H HB2  . LYS A 1 67 ? -3.133  6.175   -12.972 1.00 0.00 ? 67 LYS A HB2  7  
ATOM 9664  H HB3  . LYS A 1 67 ? -1.921  5.173   -12.199 1.00 0.00 ? 67 LYS A HB3  7  
ATOM 9665  H HG2  . LYS A 1 67 ? -3.689  3.932   -10.972 1.00 0.00 ? 67 LYS A HG2  7  
ATOM 9666  H HG3  . LYS A 1 67 ? -4.922  4.971   -11.659 1.00 0.00 ? 67 LYS A HG3  7  
ATOM 9667  H HD2  . LYS A 1 67 ? -4.436  4.166   -13.922 1.00 0.00 ? 67 LYS A HD2  7  
ATOM 9668  H HD3  . LYS A 1 67 ? -3.036  3.276   -13.358 1.00 0.00 ? 67 LYS A HD3  7  
ATOM 9669  H HE2  . LYS A 1 67 ? -5.217  2.389   -11.743 1.00 0.00 ? 67 LYS A HE2  7  
ATOM 9670  H HE3  . LYS A 1 67 ? -5.836  2.457   -13.381 1.00 0.00 ? 67 LYS A HE3  7  
ATOM 9671  H HZ1  . LYS A 1 67 ? -4.459  0.836   -14.032 1.00 0.00 ? 67 LYS A HZ1  7  
ATOM 9672  H HZ2  . LYS A 1 67 ? -3.216  1.304   -13.083 1.00 0.00 ? 67 LYS A HZ2  7  
ATOM 9673  H HZ3  . LYS A 1 67 ? -4.445  0.436   -12.449 1.00 0.00 ? 67 LYS A HZ3  7  
ATOM 9674  N N    . LYS A 1 68 ? -0.520  6.676   -10.350 1.00 0.00 ? 68 LYS A N    7  
ATOM 9675  C CA   . LYS A 1 68 ? 0.670   6.487   -9.538  1.00 0.00 ? 68 LYS A CA   7  
ATOM 9676  C C    . LYS A 1 68 ? 0.408   7.015   -8.126  1.00 0.00 ? 68 LYS A C    7  
ATOM 9677  O O    . LYS A 1 68 ? 0.561   6.284   -7.148  1.00 0.00 ? 68 LYS A O    7  
ATOM 9678  C CB   . LYS A 1 68 ? 1.887   7.120   -10.215 1.00 0.00 ? 68 LYS A CB   7  
ATOM 9679  C CG   . LYS A 1 68 ? 3.078   6.160   -10.212 1.00 0.00 ? 68 LYS A CG   7  
ATOM 9680  C CD   . LYS A 1 68 ? 4.207   6.683   -11.102 1.00 0.00 ? 68 LYS A CD   7  
ATOM 9681  C CE   . LYS A 1 68 ? 5.308   7.336   -10.265 1.00 0.00 ? 68 LYS A CE   7  
ATOM 9682  N NZ   . LYS A 1 68 ? 6.360   7.900   -11.141 1.00 0.00 ? 68 LYS A NZ   7  
ATOM 9683  H H    . LYS A 1 68 ? -0.359  7.086   -11.247 1.00 0.00 ? 68 LYS A H    7  
ATOM 9684  H HA   . LYS A 1 68 ? 0.857   5.415   -9.477  1.00 0.00 ? 68 LYS A HA   7  
ATOM 9685  H HB2  . LYS A 1 68 ? 1.637   7.391   -11.241 1.00 0.00 ? 68 LYS A HB2  7  
ATOM 9686  H HB3  . LYS A 1 68 ? 2.156   8.042   -9.699  1.00 0.00 ? 68 LYS A HB3  7  
ATOM 9687  H HG2  . LYS A 1 68 ? 3.443   6.033   -9.193  1.00 0.00 ? 68 LYS A HG2  7  
ATOM 9688  H HG3  . LYS A 1 68 ? 2.759   5.178   -10.561 1.00 0.00 ? 68 LYS A HG3  7  
ATOM 9689  H HD2  . LYS A 1 68 ? 4.626   5.862   -11.684 1.00 0.00 ? 68 LYS A HD2  7  
ATOM 9690  H HD3  . LYS A 1 68 ? 3.808   7.407   -11.813 1.00 0.00 ? 68 LYS A HD3  7  
ATOM 9691  H HE2  . LYS A 1 68 ? 4.882   8.124   -9.644  1.00 0.00 ? 68 LYS A HE2  7  
ATOM 9692  H HE3  . LYS A 1 68 ? 5.745   6.600   -9.590  1.00 0.00 ? 68 LYS A HE3  7  
ATOM 9693  H HZ1  . LYS A 1 68 ? 5.942   8.513   -11.811 1.00 0.00 ? 68 LYS A HZ1  7  
ATOM 9694  H HZ2  . LYS A 1 68 ? 7.017   8.411   -10.586 1.00 0.00 ? 68 LYS A HZ2  7  
ATOM 9695  H HZ3  . LYS A 1 68 ? 6.831   7.157   -11.616 1.00 0.00 ? 68 LYS A HZ3  7  
ATOM 9696  N N    . LEU A 1 69 ? 0.018   8.279   -8.064  1.00 0.00 ? 69 LEU A N    7  
ATOM 9697  C CA   . LEU A 1 69 ? -0.266  8.914   -6.788  1.00 0.00 ? 69 LEU A CA   7  
ATOM 9698  C C    . LEU A 1 69 ? -1.106  7.966   -5.929  1.00 0.00 ? 69 LEU A C    7  
ATOM 9699  O O    . LEU A 1 69 ? -0.743  7.668   -4.792  1.00 0.00 ? 69 LEU A O    7  
ATOM 9700  C CB   . LEU A 1 69 ? -0.912  10.284  -7.003  1.00 0.00 ? 69 LEU A CB   7  
ATOM 9701  C CG   . LEU A 1 69 ? 0.024   11.401  -7.469  1.00 0.00 ? 69 LEU A CG   7  
ATOM 9702  C CD1  . LEU A 1 69 ? 0.574   12.188  -6.278  1.00 0.00 ? 69 LEU A CD1  7  
ATOM 9703  C CD2  . LEU A 1 69 ? 1.143   10.846  -8.354  1.00 0.00 ? 69 LEU A CD2  7  
ATOM 9704  H H    . LEU A 1 69 ? -0.104  8.867   -8.864  1.00 0.00 ? 69 LEU A H    7  
ATOM 9705  H HA   . LEU A 1 69 ? 0.687   9.081   -6.287  1.00 0.00 ? 69 LEU A HA   7  
ATOM 9706  H HB2  . LEU A 1 69 ? -1.710  10.176  -7.738  1.00 0.00 ? 69 LEU A HB2  7  
ATOM 9707  H HB3  . LEU A 1 69 ? -1.379  10.594  -6.068  1.00 0.00 ? 69 LEU A HB3  7  
ATOM 9708  H HG   . LEU A 1 69 ? -0.551  12.098  -8.078  1.00 0.00 ? 69 LEU A HG   7  
ATOM 9709  H HD11 . LEU A 1 69 ? -0.218  12.335  -5.543  1.00 0.00 ? 69 LEU A HD11 7  
ATOM 9710  H HD12 . LEU A 1 69 ? 1.394   11.633  -5.822  1.00 0.00 ? 69 LEU A HD12 7  
ATOM 9711  H HD13 . LEU A 1 69 ? 0.936   13.158  -6.619  1.00 0.00 ? 69 LEU A HD13 7  
ATOM 9712  H HD21 . LEU A 1 69 ? 0.732   10.561  -9.322  1.00 0.00 ? 69 LEU A HD21 7  
ATOM 9713  H HD22 . LEU A 1 69 ? 1.908   11.609  -8.494  1.00 0.00 ? 69 LEU A HD22 7  
ATOM 9714  H HD23 . LEU A 1 69 ? 1.584   9.972   -7.875  1.00 0.00 ? 69 LEU A HD23 7  
ATOM 9715  N N    . ALA A 1 70 ? -2.213  7.520   -6.505  1.00 0.00 ? 70 ALA A N    7  
ATOM 9716  C CA   . ALA A 1 70 ? -3.107  6.613   -5.806  1.00 0.00 ? 70 ALA A CA   7  
ATOM 9717  C C    . ALA A 1 70 ? -2.303  5.432   -5.258  1.00 0.00 ? 70 ALA A C    7  
ATOM 9718  O O    . ALA A 1 70 ? -2.324  5.166   -4.057  1.00 0.00 ? 70 ALA A O    7  
ATOM 9719  C CB   . ALA A 1 70 ? -4.225  6.168   -6.751  1.00 0.00 ? 70 ALA A CB   7  
ATOM 9720  H H    . ALA A 1 70 ? -2.501  7.768   -7.430  1.00 0.00 ? 70 ALA A H    7  
ATOM 9721  H HA   . ALA A 1 70 ? -3.549  7.159   -4.972  1.00 0.00 ? 70 ALA A HA   7  
ATOM 9722  H HB1  . ALA A 1 70 ? -4.570  7.023   -7.333  1.00 0.00 ? 70 ALA A HB1  7  
ATOM 9723  H HB2  . ALA A 1 70 ? -3.846  5.399   -7.425  1.00 0.00 ? 70 ALA A HB2  7  
ATOM 9724  H HB3  . ALA A 1 70 ? -5.054  5.766   -6.170  1.00 0.00 ? 70 ALA A HB3  7  
ATOM 9725  N N    . LYS A 1 71 ? -1.612  4.757   -6.165  1.00 0.00 ? 71 LYS A N    7  
ATOM 9726  C CA   . LYS A 1 71 ? -0.802  3.611   -5.787  1.00 0.00 ? 71 LYS A CA   7  
ATOM 9727  C C    . LYS A 1 71 ? 0.205   4.034   -4.716  1.00 0.00 ? 71 LYS A C    7  
ATOM 9728  O O    . LYS A 1 71 ? 0.460   3.290   -3.770  1.00 0.00 ? 71 LYS A O    7  
ATOM 9729  C CB   . LYS A 1 71 ? -0.157  2.980   -7.023  1.00 0.00 ? 71 LYS A CB   7  
ATOM 9730  C CG   . LYS A 1 71 ? -0.402  1.471   -7.060  1.00 0.00 ? 71 LYS A CG   7  
ATOM 9731  C CD   . LYS A 1 71 ? 0.167   0.854   -8.339  1.00 0.00 ? 71 LYS A CD   7  
ATOM 9732  C CE   . LYS A 1 71 ? 1.479   0.119   -8.057  1.00 0.00 ? 71 LYS A CE   7  
ATOM 9733  N NZ   . LYS A 1 71 ? 2.490   0.449   -9.086  1.00 0.00 ? 71 LYS A NZ   7  
ATOM 9734  H H    . LYS A 1 71 ? -1.600  4.980   -7.139  1.00 0.00 ? 71 LYS A H    7  
ATOM 9735  H HA   . LYS A 1 71 ? -1.471  2.865   -5.358  1.00 0.00 ? 71 LYS A HA   7  
ATOM 9736  H HB2  . LYS A 1 71 ? -0.561  3.441   -7.924  1.00 0.00 ? 71 LYS A HB2  7  
ATOM 9737  H HB3  . LYS A 1 71 ? 0.915   3.178   -7.019  1.00 0.00 ? 71 LYS A HB3  7  
ATOM 9738  H HG2  . LYS A 1 71 ? 0.058   1.002   -6.190  1.00 0.00 ? 71 LYS A HG2  7  
ATOM 9739  H HG3  . LYS A 1 71 ? -1.472  1.271   -7.001  1.00 0.00 ? 71 LYS A HG3  7  
ATOM 9740  H HD2  . LYS A 1 71 ? -0.557  0.161   -8.767  1.00 0.00 ? 71 LYS A HD2  7  
ATOM 9741  H HD3  . LYS A 1 71 ? 0.336   1.635   -9.080  1.00 0.00 ? 71 LYS A HD3  7  
ATOM 9742  H HE2  . LYS A 1 71 ? 1.853   0.396   -7.071  1.00 0.00 ? 71 LYS A HE2  7  
ATOM 9743  H HE3  . LYS A 1 71 ? 1.305   -0.956  -8.041  1.00 0.00 ? 71 LYS A HE3  7  
ATOM 9744  H HZ1  . LYS A 1 71 ? 3.169   1.073   -8.700  1.00 0.00 ? 71 LYS A HZ1  7  
ATOM 9745  H HZ2  . LYS A 1 71 ? 2.943   -0.390  -9.389  1.00 0.00 ? 71 LYS A HZ2  7  
ATOM 9746  H HZ3  . LYS A 1 71 ? 2.041   0.886   -9.866  1.00 0.00 ? 71 LYS A HZ3  7  
ATOM 9747  N N    . ASN A 1 72 ? 0.749   5.228   -4.899  1.00 0.00 ? 72 ASN A N    7  
ATOM 9748  C CA   . ASN A 1 72 ? 1.722   5.759   -3.960  1.00 0.00 ? 72 ASN A CA   7  
ATOM 9749  C C    . ASN A 1 72 ? 1.065   5.921   -2.588  1.00 0.00 ? 72 ASN A C    7  
ATOM 9750  O O    . ASN A 1 72 ? 1.586   5.436   -1.585  1.00 0.00 ? 72 ASN A O    7  
ATOM 9751  C CB   . ASN A 1 72 ? 2.228   7.132   -4.408  1.00 0.00 ? 72 ASN A CB   7  
ATOM 9752  C CG   . ASN A 1 72 ? 3.412   7.586   -3.552  1.00 0.00 ? 72 ASN A CG   7  
ATOM 9753  O OD1  . ASN A 1 72 ? 3.387   7.533   -2.333  1.00 0.00 ? 72 ASN A OD1  7  
ATOM 9754  N ND2  . ASN A 1 72 ? 4.447   8.035   -4.256  1.00 0.00 ? 72 ASN A ND2  7  
ATOM 9755  H H    . ASN A 1 72 ? 0.536   5.827   -5.671  1.00 0.00 ? 72 ASN A H    7  
ATOM 9756  H HA   . ASN A 1 72 ? 2.536   5.033   -3.950  1.00 0.00 ? 72 ASN A HA   7  
ATOM 9757  H HB2  . ASN A 1 72 ? 2.527   7.089   -5.455  1.00 0.00 ? 72 ASN A HB2  7  
ATOM 9758  H HB3  . ASN A 1 72 ? 1.421   7.861   -4.336  1.00 0.00 ? 72 ASN A HB3  7  
ATOM 9759  H HD21 . ASN A 1 72 ? 4.403   8.052   -5.255  1.00 0.00 ? 72 ASN A HD21 7  
ATOM 9760  H HD22 . ASN A 1 72 ? 5.270   8.355   -3.786  1.00 0.00 ? 72 ASN A HD22 7  
ATOM 9761  N N    . LYS A 1 73 ? -0.070  6.605   -2.589  1.00 0.00 ? 73 LYS A N    7  
ATOM 9762  C CA   . LYS A 1 73 ? -0.804  6.838   -1.357  1.00 0.00 ? 73 LYS A CA   7  
ATOM 9763  C C    . LYS A 1 73 ? -1.232  5.495   -0.762  1.00 0.00 ? 73 LYS A C    7  
ATOM 9764  O O    . LYS A 1 73 ? -1.045  5.252   0.430   1.00 0.00 ? 73 LYS A O    7  
ATOM 9765  C CB   . LYS A 1 73 ? -1.968  7.801   -1.600  1.00 0.00 ? 73 LYS A CB   7  
ATOM 9766  C CG   . LYS A 1 73 ? -1.458  9.209   -1.913  1.00 0.00 ? 73 LYS A CG   7  
ATOM 9767  C CD   . LYS A 1 73 ? -2.494  10.003  -2.710  1.00 0.00 ? 73 LYS A CD   7  
ATOM 9768  C CE   . LYS A 1 73 ? -3.180  11.049  -1.829  1.00 0.00 ? 73 LYS A CE   7  
ATOM 9769  N NZ   . LYS A 1 73 ? -3.981  10.393  -0.772  1.00 0.00 ? 73 LYS A NZ   7  
ATOM 9770  H H    . LYS A 1 73 ? -0.487  6.996   -3.409  1.00 0.00 ? 73 LYS A H    7  
ATOM 9771  H HA   . LYS A 1 73 ? -0.124  7.324   -0.658  1.00 0.00 ? 73 LYS A HA   7  
ATOM 9772  H HB2  . LYS A 1 73 ? -2.578  7.439   -2.428  1.00 0.00 ? 73 LYS A HB2  7  
ATOM 9773  H HB3  . LYS A 1 73 ? -2.611  7.830   -0.720  1.00 0.00 ? 73 LYS A HB3  7  
ATOM 9774  H HG2  . LYS A 1 73 ? -1.230  9.732   -0.984  1.00 0.00 ? 73 LYS A HG2  7  
ATOM 9775  H HG3  . LYS A 1 73 ? -0.529  9.146   -2.479  1.00 0.00 ? 73 LYS A HG3  7  
ATOM 9776  H HD2  . LYS A 1 73 ? -2.011  10.494  -3.555  1.00 0.00 ? 73 LYS A HD2  7  
ATOM 9777  H HD3  . LYS A 1 73 ? -3.241  9.323   -3.122  1.00 0.00 ? 73 LYS A HD3  7  
ATOM 9778  H HE2  . LYS A 1 73 ? -2.431  11.699  -1.376  1.00 0.00 ? 73 LYS A HE2  7  
ATOM 9779  H HE3  . LYS A 1 73 ? -3.823  11.683  -2.440  1.00 0.00 ? 73 LYS A HE3  7  
ATOM 9780  H HZ1  . LYS A 1 73 ? -3.729  9.426   -0.715  1.00 0.00 ? 73 LYS A HZ1  7  
ATOM 9781  H HZ2  . LYS A 1 73 ? -3.802  10.836  0.106   1.00 0.00 ? 73 LYS A HZ2  7  
ATOM 9782  H HZ3  . LYS A 1 73 ? -4.953  10.471  -0.994  1.00 0.00 ? 73 LYS A HZ3  7  
ATOM 9783  N N    . ALA A 1 74 ? -1.797  4.657   -1.619  1.00 0.00 ? 74 ALA A N    7  
ATOM 9784  C CA   . ALA A 1 74 ? -2.252  3.345   -1.193  1.00 0.00 ? 74 ALA A CA   7  
ATOM 9785  C C    . ALA A 1 74 ? -1.124  2.638   -0.438  1.00 0.00 ? 74 ALA A C    7  
ATOM 9786  O O    . ALA A 1 74 ? -1.327  2.148   0.672   1.00 0.00 ? 74 ALA A O    7  
ATOM 9787  C CB   . ALA A 1 74 ? -2.727  2.549   -2.410  1.00 0.00 ? 74 ALA A CB   7  
ATOM 9788  H H    . ALA A 1 74 ? -1.945  4.862   -2.586  1.00 0.00 ? 74 ALA A H    7  
ATOM 9789  H HA   . ALA A 1 74 ? -3.096  3.489   -0.517  1.00 0.00 ? 74 ALA A HA   7  
ATOM 9790  H HB1  . ALA A 1 74 ? -3.434  1.783   -2.090  1.00 0.00 ? 74 ALA A HB1  7  
ATOM 9791  H HB2  . ALA A 1 74 ? -3.214  3.221   -3.116  1.00 0.00 ? 74 ALA A HB2  7  
ATOM 9792  H HB3  . ALA A 1 74 ? -1.871  2.075   -2.890  1.00 0.00 ? 74 ALA A HB3  7  
ATOM 9793  N N    . ALA A 1 75 ? 0.040   2.609   -1.070  1.00 0.00 ? 75 ALA A N    7  
ATOM 9794  C CA   . ALA A 1 75 ? 1.200   1.970   -0.472  1.00 0.00 ? 75 ALA A CA   7  
ATOM 9795  C C    . ALA A 1 75 ? 1.644   2.774   0.752   1.00 0.00 ? 75 ALA A C    7  
ATOM 9796  O O    . ALA A 1 75 ? 1.906   2.205   1.811   1.00 0.00 ? 75 ALA A O    7  
ATOM 9797  C CB   . ALA A 1 75 ? 2.308   1.842   -1.519  1.00 0.00 ? 75 ALA A CB   7  
ATOM 9798  H H    . ALA A 1 75 ? 0.196   3.010   -1.973  1.00 0.00 ? 75 ALA A H    7  
ATOM 9799  H HA   . ALA A 1 75 ? 0.902   0.972   -0.152  1.00 0.00 ? 75 ALA A HA   7  
ATOM 9800  H HB1  . ALA A 1 75 ? 2.749   0.847   -1.461  1.00 0.00 ? 75 ALA A HB1  7  
ATOM 9801  H HB2  . ALA A 1 75 ? 1.889   1.996   -2.513  1.00 0.00 ? 75 ALA A HB2  7  
ATOM 9802  H HB3  . ALA A 1 75 ? 3.077   2.591   -1.328  1.00 0.00 ? 75 ALA A HB3  7  
ATOM 9803  N N    . ARG A 1 76 ? 1.716   4.084   0.566   1.00 0.00 ? 76 ARG A N    7  
ATOM 9804  C CA   . ARG A 1 76 ? 2.124   4.971   1.642   1.00 0.00 ? 76 ARG A CA   7  
ATOM 9805  C C    . ARG A 1 76 ? 1.226   4.770   2.865   1.00 0.00 ? 76 ARG A C    7  
ATOM 9806  O O    . ARG A 1 76 ? 1.685   4.882   4.001   1.00 0.00 ? 76 ARG A O    7  
ATOM 9807  C CB   . ARG A 1 76 ? 2.057   6.435   1.204   1.00 0.00 ? 76 ARG A CB   7  
ATOM 9808  C CG   . ARG A 1 76 ? 2.505   7.366   2.332   1.00 0.00 ? 76 ARG A CG   7  
ATOM 9809  C CD   . ARG A 1 76 ? 1.827   8.733   2.217   1.00 0.00 ? 76 ARG A CD   7  
ATOM 9810  N NE   . ARG A 1 76 ? 2.073   9.525   3.443   1.00 0.00 ? 76 ARG A NE   7  
ATOM 9811  C CZ   . ARG A 1 76 ? 1.448   10.674  3.733   1.00 0.00 ? 76 ARG A CZ   7  
ATOM 9812  N NH1  . ARG A 1 76 ? 0.537   11.174  2.887   1.00 0.00 ? 76 ARG A NH1  7  
ATOM 9813  N NH2  . ARG A 1 76 ? 1.735   11.325  4.868   1.00 0.00 ? 76 ARG A NH2  7  
ATOM 9814  H H    . ARG A 1 76 ? 1.501   4.539   -0.298  1.00 0.00 ? 76 ARG A H    7  
ATOM 9815  H HA   . ARG A 1 76 ? 3.154   4.688   1.861   1.00 0.00 ? 76 ARG A HA   7  
ATOM 9816  H HB2  . ARG A 1 76 ? 2.691   6.586   0.330   1.00 0.00 ? 76 ARG A HB2  7  
ATOM 9817  H HB3  . ARG A 1 76 ? 1.039   6.683   0.905   1.00 0.00 ? 76 ARG A HB3  7  
ATOM 9818  H HG2  . ARG A 1 76 ? 2.265   6.917   3.296   1.00 0.00 ? 76 ARG A HG2  7  
ATOM 9819  H HG3  . ARG A 1 76 ? 3.588   7.490   2.299   1.00 0.00 ? 76 ARG A HG3  7  
ATOM 9820  H HD2  . ARG A 1 76 ? 2.209   9.266   1.347   1.00 0.00 ? 76 ARG A HD2  7  
ATOM 9821  H HD3  . ARG A 1 76 ? 0.755   8.605   2.066   1.00 0.00 ? 76 ARG A HD3  7  
ATOM 9822  H HE   . ARG A 1 76 ? 2.747   9.181   4.096   1.00 0.00 ? 76 ARG A HE   7  
ATOM 9823  H HH11 . ARG A 1 76 ? 0.323   10.688  2.039   1.00 0.00 ? 76 ARG A HH11 7  
ATOM 9824  H HH12 . ARG A 1 76 ? 0.071   12.032  3.103   1.00 0.00 ? 76 ARG A HH12 7  
ATOM 9825  H HH21 . ARG A 1 76 ? 2.415   10.953  5.500   1.00 0.00 ? 76 ARG A HH21 7  
ATOM 9826  H HH22 . ARG A 1 76 ? 1.269   12.183  5.085   1.00 0.00 ? 76 ARG A HH22 7  
ATOM 9827  N N    . ALA A 1 77 ? -0.036  4.478   2.590   1.00 0.00 ? 77 ALA A N    7  
ATOM 9828  C CA   . ALA A 1 77 ? -1.002  4.260   3.654   1.00 0.00 ? 77 ALA A CA   7  
ATOM 9829  C C    . ALA A 1 77 ? -0.646  2.977   4.407   1.00 0.00 ? 77 ALA A C    7  
ATOM 9830  O O    . ALA A 1 77 ? -0.307  3.020   5.589   1.00 0.00 ? 77 ALA A O    7  
ATOM 9831  C CB   . ALA A 1 77 ? -2.412  4.216   3.062   1.00 0.00 ? 77 ALA A CB   7  
ATOM 9832  H H    . ALA A 1 77 ? -0.401  4.388   1.664   1.00 0.00 ? 77 ALA A H    7  
ATOM 9833  H HA   . ALA A 1 77 ? -0.936  5.105   4.340   1.00 0.00 ? 77 ALA A HA   7  
ATOM 9834  H HB1  . ALA A 1 77 ? -2.467  3.427   2.312   1.00 0.00 ? 77 ALA A HB1  7  
ATOM 9835  H HB2  . ALA A 1 77 ? -3.133  4.015   3.855   1.00 0.00 ? 77 ALA A HB2  7  
ATOM 9836  H HB3  . ALA A 1 77 ? -2.642  5.175   2.597   1.00 0.00 ? 77 ALA A HB3  7  
ATOM 9837  N N    . THR A 1 78 ? -0.734  1.865   3.692   1.00 0.00 ? 78 THR A N    7  
ATOM 9838  C CA   . THR A 1 78 ? -0.424  0.572   4.278   1.00 0.00 ? 78 THR A CA   7  
ATOM 9839  C C    . THR A 1 78 ? 0.831   0.667   5.147   1.00 0.00 ? 78 THR A C    7  
ATOM 9840  O O    . THR A 1 78 ? 0.834   0.212   6.290   1.00 0.00 ? 78 THR A O    7  
ATOM 9841  C CB   . THR A 1 78 ? -0.300  -0.444  3.141   1.00 0.00 ? 78 THR A CB   7  
ATOM 9842  O OG1  . THR A 1 78 ? -1.638  -0.617  2.682   1.00 0.00 ? 78 THR A OG1  7  
ATOM 9843  C CG2  . THR A 1 78 ? 0.106   -1.833  3.639   1.00 0.00 ? 78 THR A CG2  7  
ATOM 9844  H H    . THR A 1 78 ? -1.010  1.839   2.731   1.00 0.00 ? 78 THR A H    7  
ATOM 9845  H HA   . THR A 1 78 ? -1.247  0.286   4.933   1.00 0.00 ? 78 THR A HA   7  
ATOM 9846  H HB   . THR A 1 78 ? 0.389   -0.089  2.374   1.00 0.00 ? 78 THR A HB   7  
ATOM 9847  H HG1  . THR A 1 78 ? -1.872  0.104   2.030   1.00 0.00 ? 78 THR A HG1  7  
ATOM 9848  H HG21 . THR A 1 78 ? -0.310  -1.998  4.633   1.00 0.00 ? 78 THR A HG21 7  
ATOM 9849  H HG22 . THR A 1 78 ? -0.277  -2.590  2.955   1.00 0.00 ? 78 THR A HG22 7  
ATOM 9850  H HG23 . THR A 1 78 ? 1.193   -1.900  3.683   1.00 0.00 ? 78 THR A HG23 7  
ATOM 9851  N N    . LEU A 1 79 ? 1.866   1.262   4.573   1.00 0.00 ? 79 LEU A N    7  
ATOM 9852  C CA   . LEU A 1 79 ? 3.124   1.422   5.282   1.00 0.00 ? 79 LEU A CA   7  
ATOM 9853  C C    . LEU A 1 79 ? 2.852   2.001   6.672   1.00 0.00 ? 79 LEU A C    7  
ATOM 9854  O O    . LEU A 1 79 ? 3.325   1.468   7.674   1.00 0.00 ? 79 LEU A O    7  
ATOM 9855  C CB   . LEU A 1 79 ? 4.105   2.253   4.451   1.00 0.00 ? 79 LEU A CB   7  
ATOM 9856  C CG   . LEU A 1 79 ? 4.988   1.471   3.476   1.00 0.00 ? 79 LEU A CG   7  
ATOM 9857  C CD1  . LEU A 1 79 ? 5.990   2.395   2.782   1.00 0.00 ? 79 LEU A CD1  7  
ATOM 9858  C CD2  . LEU A 1 79 ? 5.679   0.301   4.180   1.00 0.00 ? 79 LEU A CD2  7  
ATOM 9859  H H    . LEU A 1 79 ? 1.855   1.629   3.643   1.00 0.00 ? 79 LEU A H    7  
ATOM 9860  H HA   . LEU A 1 79 ? 3.562   0.431   5.400   1.00 0.00 ? 79 LEU A HA   7  
ATOM 9861  H HB2  . LEU A 1 79 ? 3.537   2.990   3.885   1.00 0.00 ? 79 LEU A HB2  7  
ATOM 9862  H HB3  . LEU A 1 79 ? 4.752   2.804   5.134   1.00 0.00 ? 79 LEU A HB3  7  
ATOM 9863  H HG   . LEU A 1 79 ? 4.349   1.048   2.701   1.00 0.00 ? 79 LEU A HG   7  
ATOM 9864  H HD11 . LEU A 1 79 ? 5.816   3.423   3.099   1.00 0.00 ? 79 LEU A HD11 7  
ATOM 9865  H HD12 . LEU A 1 79 ? 7.004   2.099   3.050   1.00 0.00 ? 79 LEU A HD12 7  
ATOM 9866  H HD13 . LEU A 1 79 ? 5.864   2.322   1.702   1.00 0.00 ? 79 LEU A HD13 7  
ATOM 9867  H HD21 . LEU A 1 79 ? 6.659   0.135   3.732   1.00 0.00 ? 79 LEU A HD21 7  
ATOM 9868  H HD22 . LEU A 1 79 ? 5.798   0.533   5.238   1.00 0.00 ? 79 LEU A HD22 7  
ATOM 9869  H HD23 . LEU A 1 79 ? 5.073   -0.598  4.071   1.00 0.00 ? 79 LEU A HD23 7  
ATOM 9870  N N    . GLU A 1 80 ? 2.090   3.085   6.687   1.00 0.00 ? 80 GLU A N    7  
ATOM 9871  C CA   . GLU A 1 80 ? 1.748   3.742   7.937   1.00 0.00 ? 80 GLU A CA   7  
ATOM 9872  C C    . GLU A 1 80 ? 1.040   2.763   8.876   1.00 0.00 ? 80 GLU A C    7  
ATOM 9873  O O    . GLU A 1 80 ? 1.399   2.651   10.047  1.00 0.00 ? 80 GLU A O    7  
ATOM 9874  C CB   . GLU A 1 80 ? 0.887   4.982   7.688   1.00 0.00 ? 80 GLU A CB   7  
ATOM 9875  C CG   . GLU A 1 80 ? 1.704   6.093   7.024   1.00 0.00 ? 80 GLU A CG   7  
ATOM 9876  C CD   . GLU A 1 80 ? 1.546   7.415   7.778   1.00 0.00 ? 80 GLU A CD   7  
ATOM 9877  O OE1  . GLU A 1 80 ? 1.962   7.450   8.956   1.00 0.00 ? 80 GLU A OE1  7  
ATOM 9878  O OE2  . GLU A 1 80 ? 1.012   8.360   7.159   1.00 0.00 ? 80 GLU A OE2  7  
ATOM 9879  H H    . GLU A 1 80 ? 1.709   3.512   5.867   1.00 0.00 ? 80 GLU A H    7  
ATOM 9880  H HA   . GLU A 1 80 ? 2.699   4.050   8.372   1.00 0.00 ? 80 GLU A HA   7  
ATOM 9881  H HB2  . GLU A 1 80 ? 0.041   4.720   7.053   1.00 0.00 ? 80 GLU A HB2  7  
ATOM 9882  H HB3  . GLU A 1 80 ? 0.478   5.341   8.632   1.00 0.00 ? 80 GLU A HB3  7  
ATOM 9883  H HG2  . GLU A 1 80 ? 2.756   5.809   6.998   1.00 0.00 ? 80 GLU A HG2  7  
ATOM 9884  H HG3  . GLU A 1 80 ? 1.382   6.218   5.991   1.00 0.00 ? 80 GLU A HG3  7  
ATOM 9885  N N    . ILE A 1 81 ? 0.048   2.079   8.326   1.00 0.00 ? 81 ILE A N    7  
ATOM 9886  C CA   . ILE A 1 81 ? -0.713  1.112   9.099   1.00 0.00 ? 81 ILE A CA   7  
ATOM 9887  C C    . ILE A 1 81 ? 0.251   0.227   9.892   1.00 0.00 ? 81 ILE A C    7  
ATOM 9888  O O    . ILE A 1 81 ? 0.040   -0.017  11.079  1.00 0.00 ? 81 ILE A O    7  
ATOM 9889  C CB   . ILE A 1 81 ? -1.663  0.328   8.192   1.00 0.00 ? 81 ILE A CB   7  
ATOM 9890  C CG1  . ILE A 1 81 ? -2.800  1.219   7.688   1.00 0.00 ? 81 ILE A CG1  7  
ATOM 9891  C CG2  . ILE A 1 81 ? -2.185  -0.925  8.897   1.00 0.00 ? 81 ILE A CG2  7  
ATOM 9892  C CD1  . ILE A 1 81 ? -3.697  0.461   6.707   1.00 0.00 ? 81 ILE A CD1  7  
ATOM 9893  H H    . ILE A 1 81 ? -0.237  2.176   7.372   1.00 0.00 ? 81 ILE A H    7  
ATOM 9894  H HA   . ILE A 1 81 ? -1.329  1.671   9.804   1.00 0.00 ? 81 ILE A HA   7  
ATOM 9895  H HB   . ILE A 1 81 ? -1.103  -0.004  7.318   1.00 0.00 ? 81 ILE A HB   7  
ATOM 9896  H HG12 . ILE A 1 81 ? -3.393  1.570   8.532   1.00 0.00 ? 81 ILE A HG12 7  
ATOM 9897  H HG13 . ILE A 1 81 ? -2.387  2.102   7.200   1.00 0.00 ? 81 ILE A HG13 7  
ATOM 9898  H HG21 . ILE A 1 81 ? -1.802  -1.812  8.393   1.00 0.00 ? 81 ILE A HG21 7  
ATOM 9899  H HG22 . ILE A 1 81 ? -1.852  -0.924  9.935   1.00 0.00 ? 81 ILE A HG22 7  
ATOM 9900  H HG23 . ILE A 1 81 ? -3.275  -0.932  8.865   1.00 0.00 ? 81 ILE A HG23 7  
ATOM 9901  H HD11 . ILE A 1 81 ? -3.345  0.628   5.689   1.00 0.00 ? 81 ILE A HD11 7  
ATOM 9902  H HD12 . ILE A 1 81 ? -3.663  -0.605  6.933   1.00 0.00 ? 81 ILE A HD12 7  
ATOM 9903  H HD13 . ILE A 1 81 ? -4.722  0.819   6.801   1.00 0.00 ? 81 ILE A HD13 7  
ATOM 9904  N N    . LEU A 1 82 ? 1.287   -0.229  9.204   1.00 0.00 ? 82 LEU A N    7  
ATOM 9905  C CA   . LEU A 1 82 ? 2.284   -1.081  9.829   1.00 0.00 ? 82 LEU A CA   7  
ATOM 9906  C C    . LEU A 1 82 ? 3.255   -0.217  10.635  1.00 0.00 ? 82 LEU A C    7  
ATOM 9907  O O    . LEU A 1 82 ? 3.248   -0.249  11.865  1.00 0.00 ? 82 LEU A O    7  
ATOM 9908  C CB   . LEU A 1 82 ? 2.968   -1.962  8.782   1.00 0.00 ? 82 LEU A CB   7  
ATOM 9909  C CG   . LEU A 1 82 ? 2.041   -2.670  7.792   1.00 0.00 ? 82 LEU A CG   7  
ATOM 9910  C CD1  . LEU A 1 82 ? 2.500   -2.441  6.351   1.00 0.00 ? 82 LEU A CD1  7  
ATOM 9911  C CD2  . LEU A 1 82 ? 1.917   -4.159  8.124   1.00 0.00 ? 82 LEU A CD2  7  
ATOM 9912  H H    . LEU A 1 82 ? 1.451   -0.025  8.239   1.00 0.00 ? 82 LEU A H    7  
ATOM 9913  H HA   . LEU A 1 82 ? 1.760   -1.746  10.517  1.00 0.00 ? 82 LEU A HA   7  
ATOM 9914  H HB2  . LEU A 1 82 ? 3.667   -1.345  8.218   1.00 0.00 ? 82 LEU A HB2  7  
ATOM 9915  H HB3  . LEU A 1 82 ? 3.557   -2.718  9.301   1.00 0.00 ? 82 LEU A HB3  7  
ATOM 9916  H HG   . LEU A 1 82 ? 1.045   -2.236  7.886   1.00 0.00 ? 82 LEU A HG   7  
ATOM 9917  H HD11 . LEU A 1 82 ? 2.477   -3.386  5.808   1.00 0.00 ? 82 LEU A HD11 7  
ATOM 9918  H HD12 . LEU A 1 82 ? 1.833   -1.727  5.866   1.00 0.00 ? 82 LEU A HD12 7  
ATOM 9919  H HD13 . LEU A 1 82 ? 3.516   -2.046  6.352   1.00 0.00 ? 82 LEU A HD13 7  
ATOM 9920  H HD21 . LEU A 1 82 ? 1.812   -4.729  7.202   1.00 0.00 ? 82 LEU A HD21 7  
ATOM 9921  H HD22 . LEU A 1 82 ? 2.811   -4.488  8.655   1.00 0.00 ? 82 LEU A HD22 7  
ATOM 9922  H HD23 . LEU A 1 82 ? 1.041   -4.319  8.753   1.00 0.00 ? 82 LEU A HD23 7  
ATOM 9923  N N    . ILE A 1 83 ? 4.068   0.537   9.909   1.00 0.00 ? 83 ILE A N    7  
ATOM 9924  C CA   . ILE A 1 83 ? 5.044   1.409   10.541  1.00 0.00 ? 83 ILE A CA   7  
ATOM 9925  C C    . ILE A 1 83 ? 4.325   2.616   11.147  1.00 0.00 ? 83 ILE A C    7  
ATOM 9926  O O    . ILE A 1 83 ? 3.761   3.435   10.423  1.00 0.00 ? 83 ILE A O    7  
ATOM 9927  C CB   . ILE A 1 83 ? 6.148   1.784   9.551   1.00 0.00 ? 83 ILE A CB   7  
ATOM 9928  C CG1  . ILE A 1 83 ? 6.462   0.618   8.612   1.00 0.00 ? 83 ILE A CG1  7  
ATOM 9929  C CG2  . ILE A 1 83 ? 7.396   2.282   10.283  1.00 0.00 ? 83 ILE A CG2  7  
ATOM 9930  C CD1  . ILE A 1 83 ? 7.835   0.792   7.960   1.00 0.00 ? 83 ILE A CD1  7  
ATOM 9931  H H    . ILE A 1 83 ? 4.068   0.558   8.910   1.00 0.00 ? 83 ILE A H    7  
ATOM 9932  H HA   . ILE A 1 83 ? 5.512   0.845   11.348  1.00 0.00 ? 83 ILE A HA   7  
ATOM 9933  H HB   . ILE A 1 83 ? 5.788   2.607   8.933   1.00 0.00 ? 83 ILE A HB   7  
ATOM 9934  H HG12 . ILE A 1 83 ? 6.435   -0.319  9.168   1.00 0.00 ? 83 ILE A HG12 7  
ATOM 9935  H HG13 . ILE A 1 83 ? 5.695   0.551   7.840   1.00 0.00 ? 83 ILE A HG13 7  
ATOM 9936  H HG21 . ILE A 1 83 ? 8.009   2.869   9.599   1.00 0.00 ? 83 ILE A HG21 7  
ATOM 9937  H HG22 . ILE A 1 83 ? 7.097   2.903   11.128  1.00 0.00 ? 83 ILE A HG22 7  
ATOM 9938  H HG23 . ILE A 1 83 ? 7.969   1.428   10.644  1.00 0.00 ? 83 ILE A HG23 7  
ATOM 9939  H HD11 . ILE A 1 83 ? 7.913   0.133   7.096   1.00 0.00 ? 83 ILE A HD11 7  
ATOM 9940  H HD12 . ILE A 1 83 ? 7.957   1.827   7.641   1.00 0.00 ? 83 ILE A HD12 7  
ATOM 9941  H HD13 . ILE A 1 83 ? 8.613   0.540   8.681   1.00 0.00 ? 83 ILE A HD13 7  
ATOM 9942  N N    . PRO A 1 84 ? 4.370   2.690   12.505  1.00 0.00 ? 84 PRO A N    7  
ATOM 9943  C CA   . PRO A 1 84 ? 3.730   3.783   13.216  1.00 0.00 ? 84 PRO A CA   7  
ATOM 9944  C C    . PRO A 1 84 ? 4.543   5.073   13.085  1.00 0.00 ? 84 PRO A C    7  
ATOM 9945  O O    . PRO A 1 84 ? 4.003   6.168   13.230  1.00 0.00 ? 84 PRO A O    7  
ATOM 9946  C CB   . PRO A 1 84 ? 3.610   3.300   14.653  1.00 0.00 ? 84 PRO A CB   7  
ATOM 9947  C CG   . PRO A 1 84 ? 4.598   2.154   14.791  1.00 0.00 ? 84 PRO A CG   7  
ATOM 9948  C CD   . PRO A 1 84 ? 5.028   1.738   13.394  1.00 0.00 ? 84 PRO A CD   7  
ATOM 9949  H HA   . PRO A 1 84 ? 2.836   3.982   12.816  1.00 0.00 ? 84 PRO A HA   7  
ATOM 9950  H HB2  . PRO A 1 84 ? 3.840   4.102   15.355  1.00 0.00 ? 84 PRO A HB2  7  
ATOM 9951  H HB3  . PRO A 1 84 ? 2.594   2.969   14.869  1.00 0.00 ? 84 PRO A HB3  7  
ATOM 9952  H HG2  . PRO A 1 84 ? 5.462   2.464   15.380  1.00 0.00 ? 84 PRO A HG2  7  
ATOM 9953  H HG3  . PRO A 1 84 ? 4.139   1.316   15.315  1.00 0.00 ? 84 PRO A HG3  7  
ATOM 9954  H HD2  . PRO A 1 84 ? 6.112   1.778   13.285  1.00 0.00 ? 84 PRO A HD2  7  
ATOM 9955  H HD3  . PRO A 1 84 ? 4.723   0.714   13.175  1.00 0.00 ? 84 PRO A HD3  7  
ATOM 9956  N N    . ASP A 1 85 ? 5.828   4.899   12.812  1.00 0.00 ? 85 ASP A N    7  
ATOM 9957  C CA   . ASP A 1 85 ? 6.720   6.036   12.660  1.00 0.00 ? 85 ASP A CA   7  
ATOM 9958  C C    . ASP A 1 85 ? 7.619   5.813   11.442  1.00 0.00 ? 85 ASP A C    7  
ATOM 9959  O O    . ASP A 1 85 ? 8.782   5.439   11.585  1.00 0.00 ? 85 ASP A O    7  
ATOM 9960  C CB   . ASP A 1 85 ? 7.619   6.199   13.887  1.00 0.00 ? 85 ASP A CB   7  
ATOM 9961  C CG   . ASP A 1 85 ? 7.158   7.259   14.890  1.00 0.00 ? 85 ASP A CG   7  
ATOM 9962  O OD1  . ASP A 1 85 ? 5.929   7.475   14.963  1.00 0.00 ? 85 ASP A OD1  7  
ATOM 9963  O OD2  . ASP A 1 85 ? 8.045   7.829   15.560  1.00 0.00 ? 85 ASP A OD2  7  
ATOM 9964  H H    . ASP A 1 85 ? 6.259   4.005   12.696  1.00 0.00 ? 85 ASP A H    7  
ATOM 9965  H HA   . ASP A 1 85 ? 6.066   6.900   12.543  1.00 0.00 ? 85 ASP A HA   7  
ATOM 9966  H HB2  . ASP A 1 85 ? 7.685   5.240   14.400  1.00 0.00 ? 85 ASP A HB2  7  
ATOM 9967  H HB3  . ASP A 1 85 ? 8.625   6.451   13.551  1.00 0.00 ? 85 ASP A HB3  7  
ATOM 9968  N N    . PHE A 1 86 ? 7.046   6.052   10.272  1.00 0.00 ? 86 PHE A N    7  
ATOM 9969  C CA   . PHE A 1 86 ? 7.781   5.883   9.030   1.00 0.00 ? 86 PHE A CA   7  
ATOM 9970  C C    . PHE A 1 86 ? 8.374   7.212   8.557   1.00 0.00 ? 86 PHE A C    7  
ATOM 9971  O O    . PHE A 1 86 ? 9.534   7.269   8.152   1.00 0.00 ? 86 PHE A O    7  
ATOM 9972  C CB   . PHE A 1 86 ? 6.783   5.382   7.984   1.00 0.00 ? 86 PHE A CB   7  
ATOM 9973  C CG   . PHE A 1 86 ? 7.378   5.216   6.585   1.00 0.00 ? 86 PHE A CG   7  
ATOM 9974  C CD1  . PHE A 1 86 ? 8.409   4.351   6.383   1.00 0.00 ? 86 PHE A CD1  7  
ATOM 9975  C CD2  . PHE A 1 86 ? 6.877   5.932   5.542   1.00 0.00 ? 86 PHE A CD2  7  
ATOM 9976  C CE1  . PHE A 1 86 ? 8.962   4.197   5.084   1.00 0.00 ? 86 PHE A CE1  7  
ATOM 9977  C CE2  . PHE A 1 86 ? 7.430   5.777   4.244   1.00 0.00 ? 86 PHE A CE2  7  
ATOM 9978  C CZ   . PHE A 1 86 ? 8.461   4.913   4.042   1.00 0.00 ? 86 PHE A CZ   7  
ATOM 9979  H H    . PHE A 1 86 ? 6.099   6.356   10.164  1.00 0.00 ? 86 PHE A H    7  
ATOM 9980  H HA   . PHE A 1 86 ? 8.588   5.176   9.225   1.00 0.00 ? 86 PHE A HA   7  
ATOM 9981  H HB2  . PHE A 1 86 ? 6.378   4.425   8.312   1.00 0.00 ? 86 PHE A HB2  7  
ATOM 9982  H HB3  . PHE A 1 86 ? 5.947   6.080   7.931   1.00 0.00 ? 86 PHE A HB3  7  
ATOM 9983  H HD1  . PHE A 1 86 ? 8.811   3.778   7.218   1.00 0.00 ? 86 PHE A HD1  7  
ATOM 9984  H HD2  . PHE A 1 86 ? 6.051   6.624   5.704   1.00 0.00 ? 86 PHE A HD2  7  
ATOM 9985  H HE1  . PHE A 1 86 ? 9.788   3.504   4.922   1.00 0.00 ? 86 PHE A HE1  7  
ATOM 9986  H HE2  . PHE A 1 86 ? 7.029   6.351   3.408   1.00 0.00 ? 86 PHE A HE2  7  
ATOM 9987  H HZ   . PHE A 1 86 ? 8.886   4.794   3.045   1.00 0.00 ? 86 PHE A HZ   7  
ATOM 9988  N N    . VAL A 1 87 ? 7.550   8.247   8.625   1.00 0.00 ? 87 VAL A N    7  
ATOM 9989  C CA   . VAL A 1 87 ? 7.978   9.572   8.209   1.00 0.00 ? 87 VAL A CA   7  
ATOM 9990  C C    . VAL A 1 87 ? 7.582   10.591  9.279   1.00 0.00 ? 87 VAL A C    7  
ATOM 9991  O O    . VAL A 1 87 ? 6.985   10.231  10.293  1.00 0.00 ? 87 VAL A O    7  
ATOM 9992  C CB   . VAL A 1 87 ? 7.402   9.899   6.830   1.00 0.00 ? 87 VAL A CB   7  
ATOM 9993  C CG1  . VAL A 1 87 ? 7.954   8.949   5.765   1.00 0.00 ? 87 VAL A CG1  7  
ATOM 9994  C CG2  . VAL A 1 87 ? 5.872   9.867   6.853   1.00 0.00 ? 87 VAL A CG2  7  
ATOM 9995  H H    . VAL A 1 87 ? 6.608   8.192   8.955   1.00 0.00 ? 87 VAL A H    7  
ATOM 9996  H HA   . VAL A 1 87 ? 9.065   9.555   8.125   1.00 0.00 ? 87 VAL A HA   7  
ATOM 9997  H HB   . VAL A 1 87 ? 7.711   10.911  6.569   1.00 0.00 ? 87 VAL A HB   7  
ATOM 9998  H HG11 . VAL A 1 87 ? 8.270   8.019   6.237   1.00 0.00 ? 87 VAL A HG11 7  
ATOM 9999  H HG12 . VAL A 1 87 ? 7.178   8.738   5.029   1.00 0.00 ? 87 VAL A HG12 7  
ATOM 10000 H HG13 . VAL A 1 87 ? 8.807   9.414   5.271   1.00 0.00 ? 87 VAL A HG13 7  
ATOM 10001 H HG21 . VAL A 1 87 ? 5.533   9.361   7.757   1.00 0.00 ? 87 VAL A HG21 7  
ATOM 10002 H HG22 . VAL A 1 87 ? 5.487   10.887  6.842   1.00 0.00 ? 87 VAL A HG22 7  
ATOM 10003 H HG23 . VAL A 1 87 ? 5.506   9.332   5.977   1.00 0.00 ? 87 VAL A HG23 7  
ATOM 10004 N N    . LYS A 1 88 ? 7.931   11.842  9.018   1.00 0.00 ? 88 LYS A N    7  
ATOM 10005 C CA   . LYS A 1 88 ? 7.619   12.915  9.947   1.00 0.00 ? 88 LYS A CA   7  
ATOM 10006 C C    . LYS A 1 88 ? 6.441   13.727  9.404   1.00 0.00 ? 88 LYS A C    7  
ATOM 10007 O O    . LYS A 1 88 ? 6.636   14.760  8.765   1.00 0.00 ? 88 LYS A O    7  
ATOM 10008 C CB   . LYS A 1 88 ? 8.865   13.756  10.232  1.00 0.00 ? 88 LYS A CB   7  
ATOM 10009 C CG   . LYS A 1 88 ? 9.411   13.469  11.633  1.00 0.00 ? 88 LYS A CG   7  
ATOM 10010 C CD   . LYS A 1 88 ? 10.021  14.728  12.251  1.00 0.00 ? 88 LYS A CD   7  
ATOM 10011 C CE   . LYS A 1 88 ? 9.089   15.329  13.305  1.00 0.00 ? 88 LYS A CE   7  
ATOM 10012 N NZ   . LYS A 1 88 ? 9.478   16.724  13.607  1.00 0.00 ? 88 LYS A NZ   7  
ATOM 10013 H H    . LYS A 1 88 ? 8.416   12.126  8.191   1.00 0.00 ? 88 LYS A H    7  
ATOM 10014 H HA   . LYS A 1 88 ? 7.318   12.456  10.888  1.00 0.00 ? 88 LYS A HA   7  
ATOM 10015 H HB2  . LYS A 1 88 ? 9.632   13.540  9.488   1.00 0.00 ? 88 LYS A HB2  7  
ATOM 10016 H HB3  . LYS A 1 88 ? 8.623   14.814  10.142  1.00 0.00 ? 88 LYS A HB3  7  
ATOM 10017 H HG2  . LYS A 1 88 ? 8.608   13.099  12.270  1.00 0.00 ? 88 LYS A HG2  7  
ATOM 10018 H HG3  . LYS A 1 88 ? 10.164  12.683  11.580  1.00 0.00 ? 88 LYS A HG3  7  
ATOM 10019 H HD2  . LYS A 1 88 ? 10.982  14.485  12.706  1.00 0.00 ? 88 LYS A HD2  7  
ATOM 10020 H HD3  . LYS A 1 88 ? 10.215  15.464  11.471  1.00 0.00 ? 88 LYS A HD3  7  
ATOM 10021 H HE2  . LYS A 1 88 ? 8.060   15.301  12.948  1.00 0.00 ? 88 LYS A HE2  7  
ATOM 10022 H HE3  . LYS A 1 88 ? 9.126   14.730  14.216  1.00 0.00 ? 88 LYS A HE3  7  
ATOM 10023 H HZ1  . LYS A 1 88 ? 9.862   17.148  12.786  1.00 0.00 ? 88 LYS A HZ1  7  
ATOM 10024 H HZ2  . LYS A 1 88 ? 8.673   17.239  13.901  1.00 0.00 ? 88 LYS A HZ2  7  
ATOM 10025 H HZ3  . LYS A 1 88 ? 10.162  16.730  14.336  1.00 0.00 ? 88 LYS A HZ3  7  
ATOM 10026 N N    . GLN A 1 89 ? 5.244   13.230  9.679   1.00 0.00 ? 89 GLN A N    7  
ATOM 10027 C CA   . GLN A 1 89 ? 4.035   13.896  9.227   1.00 0.00 ? 89 GLN A CA   7  
ATOM 10028 C C    . GLN A 1 89 ? 2.798   13.146  9.724   1.00 0.00 ? 89 GLN A C    7  
ATOM 10029 O O    . GLN A 1 89 ? 2.351   12.190  9.091   1.00 0.00 ? 89 GLN A O    7  
ATOM 10030 C CB   . GLN A 1 89 ? 4.020   14.029  7.703   1.00 0.00 ? 89 GLN A CB   7  
ATOM 10031 C CG   . GLN A 1 89 ? 3.056   15.132  7.259   1.00 0.00 ? 89 GLN A CG   7  
ATOM 10032 C CD   . GLN A 1 89 ? 3.793   16.223  6.480   1.00 0.00 ? 89 GLN A CD   7  
ATOM 10033 O OE1  . GLN A 1 89 ? 4.899   16.618  6.809   1.00 0.00 ? 89 GLN A OE1  7  
ATOM 10034 N NE2  . GLN A 1 89 ? 3.120   16.686  5.430   1.00 0.00 ? 89 GLN A NE2  7  
ATOM 10035 H H    . GLN A 1 89 ? 5.094   12.389  10.200  1.00 0.00 ? 89 GLN A H    7  
ATOM 10036 H HA   . GLN A 1 89 ? 4.068   14.890  9.672   1.00 0.00 ? 89 GLN A HA   7  
ATOM 10037 H HB2  . GLN A 1 89 ? 5.024   14.253  7.344   1.00 0.00 ? 89 GLN A HB2  7  
ATOM 10038 H HB3  . GLN A 1 89 ? 3.724   13.081  7.254   1.00 0.00 ? 89 GLN A HB3  7  
ATOM 10039 H HG2  . GLN A 1 89 ? 2.270   14.704  6.637   1.00 0.00 ? 89 GLN A HG2  7  
ATOM 10040 H HG3  . GLN A 1 89 ? 2.570   15.568  8.131   1.00 0.00 ? 89 GLN A HG3  7  
ATOM 10041 H HE21 . GLN A 1 89 ? 2.216   16.319  5.214   1.00 0.00 ? 89 GLN A HE21 7  
ATOM 10042 H HE22 . GLN A 1 89 ? 3.519   17.402  4.857   1.00 0.00 ? 89 GLN A HE22 7  
ATOM 10043 N N    . THR A 1 90 ? 2.279   13.606  10.853  1.00 0.00 ? 90 THR A N    7  
ATOM 10044 C CA   . THR A 1 90 ? 1.103   12.990  11.443  1.00 0.00 ? 90 THR A CA   7  
ATOM 10045 C C    . THR A 1 90 ? -0.158  13.761  11.046  1.00 0.00 ? 90 THR A C    7  
ATOM 10046 O O    . THR A 1 90 ? -0.079  14.919  10.637  1.00 0.00 ? 90 THR A O    7  
ATOM 10047 C CB   . THR A 1 90 ? 1.317   12.913  12.956  1.00 0.00 ? 90 THR A CB   7  
ATOM 10048 O OG1  . THR A 1 90 ? 0.193   12.176  13.428  1.00 0.00 ? 90 THR A OG1  7  
ATOM 10049 C CG2  . THR A 1 90 ? 1.182   14.277  13.637  1.00 0.00 ? 90 THR A CG2  7  
ATOM 10050 H H    . THR A 1 90 ? 2.649   14.384  11.362  1.00 0.00 ? 90 THR A H    7  
ATOM 10051 H HA   . THR A 1 90 ? 1.003   11.984  11.038  1.00 0.00 ? 90 THR A HA   7  
ATOM 10052 H HB   . THR A 1 90 ? 2.278   12.455  13.190  1.00 0.00 ? 90 THR A HB   7  
ATOM 10053 H HG1  . THR A 1 90 ? 0.225   12.106  14.425  1.00 0.00 ? 90 THR A HG1  7  
ATOM 10054 H HG21 . THR A 1 90 ? 1.533   15.057  12.961  1.00 0.00 ? 90 THR A HG21 7  
ATOM 10055 H HG22 . THR A 1 90 ? 0.136   14.456  13.886  1.00 0.00 ? 90 THR A HG22 7  
ATOM 10056 H HG23 . THR A 1 90 ? 1.780   14.289  14.548  1.00 0.00 ? 90 THR A HG23 7  
ATOM 10057 N N    . SER A 1 91 ? -1.291  13.089  11.181  1.00 0.00 ? 91 SER A N    7  
ATOM 10058 C CA   . SER A 1 91 ? -2.567  13.696  10.842  1.00 0.00 ? 91 SER A CA   7  
ATOM 10059 C C    . SER A 1 91 ? -3.648  13.221  11.815  1.00 0.00 ? 91 SER A C    7  
ATOM 10060 O O    . SER A 1 91 ? -3.408  12.330  12.628  1.00 0.00 ? 91 SER A O    7  
ATOM 10061 C CB   . SER A 1 91 ? -2.968  13.368  9.403   1.00 0.00 ? 91 SER A CB   7  
ATOM 10062 O OG   . SER A 1 91 ? -3.049  14.538  8.592   1.00 0.00 ? 91 SER A OG   7  
ATOM 10063 H H    . SER A 1 91 ? -1.347  12.148  11.515  1.00 0.00 ? 91 SER A H    7  
ATOM 10064 H HA   . SER A 1 91 ? -2.410  14.770  10.940  1.00 0.00 ? 91 SER A HA   7  
ATOM 10065 H HB2  . SER A 1 91 ? -2.241  12.679  8.972   1.00 0.00 ? 91 SER A HB2  7  
ATOM 10066 H HB3  . SER A 1 91 ? -3.931  12.858  9.401   1.00 0.00 ? 91 SER A HB3  7  
ATOM 10067 H HG   . SER A 1 91 ? -2.206  15.069  8.672   1.00 0.00 ? 91 SER A HG   7  
ATOM 10068 N N    . GLU A 1 92 ? -4.815  13.837  11.700  1.00 0.00 ? 92 GLU A N    7  
ATOM 10069 C CA   . GLU A 1 92 ? -5.934  13.488  12.559  1.00 0.00 ? 92 GLU A CA   7  
ATOM 10070 C C    . GLU A 1 92 ? -7.258  13.757  11.842  1.00 0.00 ? 92 GLU A C    7  
ATOM 10071 O O    . GLU A 1 92 ? -7.270  14.282  10.729  1.00 0.00 ? 92 GLU A O    7  
ATOM 10072 C CB   . GLU A 1 92 ? -5.864  14.247  13.885  1.00 0.00 ? 92 GLU A CB   7  
ATOM 10073 C CG   . GLU A 1 92 ? -5.100  13.442  14.939  1.00 0.00 ? 92 GLU A CG   7  
ATOM 10074 C CD   . GLU A 1 92 ? -5.996  13.113  16.134  1.00 0.00 ? 92 GLU A CD   7  
ATOM 10075 O OE1  . GLU A 1 92 ? -7.165  12.746  15.884  1.00 0.00 ? 92 GLU A OE1  7  
ATOM 10076 O OE2  . GLU A 1 92 ? -5.493  13.237  17.272  1.00 0.00 ? 92 GLU A OE2  7  
ATOM 10077 H H    . GLU A 1 92 ? -5.002  14.561  11.036  1.00 0.00 ? 92 GLU A H    7  
ATOM 10078 H HA   . GLU A 1 92 ? -5.828  12.420  12.753  1.00 0.00 ? 92 GLU A HA   7  
ATOM 10079 H HB2  . GLU A 1 92 ? -5.375  15.209  13.733  1.00 0.00 ? 92 GLU A HB2  7  
ATOM 10080 H HB3  . GLU A 1 92 ? -6.872  14.455  14.243  1.00 0.00 ? 92 GLU A HB3  7  
ATOM 10081 H HG2  . GLU A 1 92 ? -4.726  12.519  14.495  1.00 0.00 ? 92 GLU A HG2  7  
ATOM 10082 H HG3  . GLU A 1 92 ? -4.232  14.008  15.275  1.00 0.00 ? 92 GLU A HG3  7  
ATOM 10083 N N    . SER A 1 93 ? -8.341  13.386  12.509  1.00 0.00 ? 93 SER A N    7  
ATOM 10084 C CA   . SER A 1 93 ? -9.668  13.582  11.949  1.00 0.00 ? 93 SER A CA   7  
ATOM 10085 C C    . SER A 1 93 ? -9.827  12.748  10.676  1.00 0.00 ? 93 SER A C    7  
ATOM 10086 O O    . SER A 1 93 ? -9.079  12.927  9.715   1.00 0.00 ? 93 SER A O    7  
ATOM 10087 C CB   . SER A 1 93 ? -9.928  15.060  11.652  1.00 0.00 ? 93 SER A CB   7  
ATOM 10088 O OG   . SER A 1 93 ? -10.025 15.835  12.843  1.00 0.00 ? 93 SER A OG   7  
ATOM 10089 H H    . SER A 1 93 ? -8.323  12.960  13.413  1.00 0.00 ? 93 SER A H    7  
ATOM 10090 H HA   . SER A 1 93 ? -10.359 13.239  12.719  1.00 0.00 ? 93 SER A HA   7  
ATOM 10091 H HB2  . SER A 1 93 ? -9.124  15.451  11.029  1.00 0.00 ? 93 SER A HB2  7  
ATOM 10092 H HB3  . SER A 1 93 ? -10.851 15.157  11.080  1.00 0.00 ? 93 SER A HB3  7  
ATOM 10093 H HG   . SER A 1 93 ? -10.971 15.847  13.168  1.00 0.00 ? 93 SER A HG   7  
ATOM 10094 N N    . GLY A 1 94 ? -10.805 11.855  10.709  1.00 0.00 ? 94 GLY A N    7  
ATOM 10095 C CA   . GLY A 1 94 ? -11.071 10.993  9.570   1.00 0.00 ? 94 GLY A CA   7  
ATOM 10096 C C    . GLY A 1 94 ? -11.021 9.519   9.975   1.00 0.00 ? 94 GLY A C    7  
ATOM 10097 O O    . GLY A 1 94 ? -10.019 8.842   9.746   1.00 0.00 ? 94 GLY A O    7  
ATOM 10098 H H    . GLY A 1 94 ? -11.408 11.716  11.495  1.00 0.00 ? 94 GLY A H    7  
ATOM 10099 H HA2  . GLY A 1 94 ? -12.051 11.227  9.154   1.00 0.00 ? 94 GLY A HA2  7  
ATOM 10100 H HA3  . GLY A 1 94 ? -10.338 11.184  8.786   1.00 0.00 ? 94 GLY A HA3  7  
ATOM 10101 N N    . PRO A 1 95 ? -12.144 9.051   10.584  1.00 0.00 ? 95 PRO A N    7  
ATOM 10102 C CA   . PRO A 1 95 ? -12.237 7.669   11.022  1.00 0.00 ? 95 PRO A CA   7  
ATOM 10103 C C    . PRO A 1 95 ? -12.450 6.730   9.833   1.00 0.00 ? 95 PRO A C    7  
ATOM 10104 O O    . PRO A 1 95 ? -13.417 5.971   9.802   1.00 0.00 ? 95 PRO A O    7  
ATOM 10105 C CB   . PRO A 1 95 ? -13.392 7.647   12.010  1.00 0.00 ? 95 PRO A CB   7  
ATOM 10106 C CG   . PRO A 1 95 ? -14.195 8.909   11.741  1.00 0.00 ? 95 PRO A CG   7  
ATOM 10107 C CD   . PRO A 1 95 ? -13.349 9.823   10.871  1.00 0.00 ? 95 PRO A CD   7  
ATOM 10108 H HA   . PRO A 1 95 ? -11.379 7.381   11.448  1.00 0.00 ? 95 PRO A HA   7  
ATOM 10109 H HB2  . PRO A 1 95 ? -14.005 6.756   11.874  1.00 0.00 ? 95 PRO A HB2  7  
ATOM 10110 H HB3  . PRO A 1 95 ? -13.026 7.629   13.037  1.00 0.00 ? 95 PRO A HB3  7  
ATOM 10111 H HG2  . PRO A 1 95 ? -15.132 8.665   11.240  1.00 0.00 ? 95 PRO A HG2  7  
ATOM 10112 H HG3  . PRO A 1 95 ? -14.454 9.404   12.677  1.00 0.00 ? 95 PRO A HG3  7  
ATOM 10113 H HD2  . PRO A 1 95 ? -13.873 10.095  9.954   1.00 0.00 ? 95 PRO A HD2  7  
ATOM 10114 H HD3  . PRO A 1 95 ? -13.110 10.753  11.388  1.00 0.00 ? 95 PRO A HD3  7  
ATOM 10115 N N    . SER A 1 96 ? -11.530 6.812   8.883   1.00 0.00 ? 96 SER A N    7  
ATOM 10116 C CA   . SER A 1 96 ? -11.605 5.979   7.695   1.00 0.00 ? 96 SER A CA   7  
ATOM 10117 C C    . SER A 1 96 ? -12.912 6.250   6.947   1.00 0.00 ? 96 SER A C    7  
ATOM 10118 O O    . SER A 1 96 ? -13.882 5.509   7.097   1.00 0.00 ? 96 SER A O    7  
ATOM 10119 C CB   . SER A 1 96 ? -11.496 4.496   8.054   1.00 0.00 ? 96 SER A CB   7  
ATOM 10120 O OG   . SER A 1 96 ? -10.142 4.084   8.219   1.00 0.00 ? 96 SER A OG   7  
ATOM 10121 H H    . SER A 1 96 ? -10.746 7.433   8.916   1.00 0.00 ? 96 SER A H    7  
ATOM 10122 H HA   . SER A 1 96 ? -10.748 6.268   7.085   1.00 0.00 ? 96 SER A HA   7  
ATOM 10123 H HB2  . SER A 1 96 ? -12.048 4.305   8.975   1.00 0.00 ? 96 SER A HB2  7  
ATOM 10124 H HB3  . SER A 1 96 ? -11.964 3.898   7.272   1.00 0.00 ? 96 SER A HB3  7  
ATOM 10125 H HG   . SER A 1 96 ? -10.098 3.287   8.821   1.00 0.00 ? 96 SER A HG   7  
ATOM 10126 N N    . SER A 1 97 ? -12.895 7.314   6.158   1.00 0.00 ? 97 SER A N    7  
ATOM 10127 C CA   . SER A 1 97 ? -14.067 7.692   5.387   1.00 0.00 ? 97 SER A CA   7  
ATOM 10128 C C    . SER A 1 97 ? -13.807 7.467   3.896   1.00 0.00 ? 97 SER A C    7  
ATOM 10129 O O    . SER A 1 97 ? -13.178 8.296   3.240   1.00 0.00 ? 97 SER A O    7  
ATOM 10130 C CB   . SER A 1 97 ? -14.450 9.151   5.645   1.00 0.00 ? 97 SER A CB   7  
ATOM 10131 O OG   . SER A 1 97 ? -15.841 9.299   5.914   1.00 0.00 ? 97 SER A OG   7  
ATOM 10132 H H    . SER A 1 97 ? -12.102 7.912   6.042   1.00 0.00 ? 97 SER A H    7  
ATOM 10133 H HA   . SER A 1 97 ? -14.867 7.040   5.738   1.00 0.00 ? 97 SER A HA   7  
ATOM 10134 H HB2  . SER A 1 97 ? -13.875 9.533   6.489   1.00 0.00 ? 97 SER A HB2  7  
ATOM 10135 H HB3  . SER A 1 97 ? -14.182 9.755   4.778   1.00 0.00 ? 97 SER A HB3  7  
ATOM 10136 H HG   . SER A 1 97 ? -15.999 9.308   6.901   1.00 0.00 ? 97 SER A HG   7  
ATOM 10137 N N    . GLY A 1 98 ? -14.305 6.342   3.404   1.00 0.00 ? 98 GLY A N    7  
ATOM 10138 C CA   . GLY A 1 98 ? -14.135 5.998   2.003   1.00 0.00 ? 98 GLY A CA   7  
ATOM 10139 C C    . GLY A 1 98 ? -13.099 4.885   1.834   1.00 0.00 ? 98 GLY A C    7  
ATOM 10140 O O    . GLY A 1 98 ? -12.839 4.127   2.767   1.00 0.00 ? 98 GLY A O    7  
ATOM 10141 H H    . GLY A 1 98 ? -14.816 5.674   3.945   1.00 0.00 ? 98 GLY A H    7  
ATOM 10142 H HA2  . GLY A 1 98 ? -15.089 5.678   1.585   1.00 0.00 ? 98 GLY A HA2  7  
ATOM 10143 H HA3  . GLY A 1 98 ? -13.821 6.879   1.444   1.00 0.00 ? 98 GLY A HA3  7  
ATOM 10144 N N    . GLY A 1 1  ? 8.291   30.869  -8.932  1.00 0.00 ? 1  GLY A N    8  
ATOM 10145 C CA   . GLY A 1 1  ? 9.128   30.153  -9.880  1.00 0.00 ? 1  GLY A CA   8  
ATOM 10146 C C    . GLY A 1 1  ? 8.389   28.948  -10.464 1.00 0.00 ? 1  GLY A C    8  
ATOM 10147 O O    . GLY A 1 1  ? 8.124   27.976  -9.758  1.00 0.00 ? 1  GLY A O    8  
ATOM 10148 H H1   . GLY A 1 1  ? 8.733   31.096  -8.065  1.00 0.00 ? 1  GLY A H1   8  
ATOM 10149 H HA2  . GLY A 1 1  ? 9.428   30.825  -10.685 1.00 0.00 ? 1  GLY A HA2  8  
ATOM 10150 H HA3  . GLY A 1 1  ? 10.040  29.820  -9.386  1.00 0.00 ? 1  GLY A HA3  8  
ATOM 10151 N N    . SER A 1 2  ? 8.076   29.050  -11.747 1.00 0.00 ? 2  SER A N    8  
ATOM 10152 C CA   . SER A 1 2  ? 7.372   27.980  -12.434 1.00 0.00 ? 2  SER A CA   8  
ATOM 10153 C C    . SER A 1 2  ? 7.206   28.329  -13.914 1.00 0.00 ? 2  SER A C    8  
ATOM 10154 O O    . SER A 1 2  ? 7.449   29.465  -14.319 1.00 0.00 ? 2  SER A O    8  
ATOM 10155 C CB   . SER A 1 2  ? 6.007   27.720  -11.794 1.00 0.00 ? 2  SER A CB   8  
ATOM 10156 O OG   . SER A 1 2  ? 5.727   26.327  -11.681 1.00 0.00 ? 2  SER A OG   8  
ATOM 10157 H H    . SER A 1 2  ? 8.294   29.844  -12.314 1.00 0.00 ? 2  SER A H    8  
ATOM 10158 H HA   . SER A 1 2  ? 8.002   27.099  -12.316 1.00 0.00 ? 2  SER A HA   8  
ATOM 10159 H HB2  . SER A 1 2  ? 5.977   28.177  -10.805 1.00 0.00 ? 2  SER A HB2  8  
ATOM 10160 H HB3  . SER A 1 2  ? 5.230   28.198  -12.390 1.00 0.00 ? 2  SER A HB3  8  
ATOM 10161 H HG   . SER A 1 2  ? 6.508   25.794  -12.007 1.00 0.00 ? 2  SER A HG   8  
ATOM 10162 N N    . SER A 1 3  ? 6.794   27.331  -14.682 1.00 0.00 ? 3  SER A N    8  
ATOM 10163 C CA   . SER A 1 3  ? 6.593   27.517  -16.109 1.00 0.00 ? 3  SER A CA   8  
ATOM 10164 C C    . SER A 1 3  ? 6.018   26.241  -16.727 1.00 0.00 ? 3  SER A C    8  
ATOM 10165 O O    . SER A 1 3  ? 6.739   25.265  -16.926 1.00 0.00 ? 3  SER A O    8  
ATOM 10166 C CB   . SER A 1 3  ? 7.901   27.902  -16.803 1.00 0.00 ? 3  SER A CB   8  
ATOM 10167 O OG   . SER A 1 3  ? 8.970   27.030  -16.448 1.00 0.00 ? 3  SER A OG   8  
ATOM 10168 H H    . SER A 1 3  ? 6.598   26.410  -14.344 1.00 0.00 ? 3  SER A H    8  
ATOM 10169 H HA   . SER A 1 3  ? 5.881   28.338  -16.195 1.00 0.00 ? 3  SER A HA   8  
ATOM 10170 H HB2  . SER A 1 3  ? 7.758   27.879  -17.884 1.00 0.00 ? 3  SER A HB2  8  
ATOM 10171 H HB3  . SER A 1 3  ? 8.164   28.926  -16.538 1.00 0.00 ? 3  SER A HB3  8  
ATOM 10172 H HG   . SER A 1 3  ? 8.698   26.079  -16.592 1.00 0.00 ? 3  SER A HG   8  
ATOM 10173 N N    . GLY A 1 4  ? 4.726   26.291  -17.015 1.00 0.00 ? 4  GLY A N    8  
ATOM 10174 C CA   . GLY A 1 4  ? 4.047   25.152  -17.607 1.00 0.00 ? 4  GLY A CA   8  
ATOM 10175 C C    . GLY A 1 4  ? 4.145   25.187  -19.134 1.00 0.00 ? 4  GLY A C    8  
ATOM 10176 O O    . GLY A 1 4  ? 3.901   26.222  -19.751 1.00 0.00 ? 4  GLY A O    8  
ATOM 10177 H H    . GLY A 1 4  ? 4.147   27.090  -16.851 1.00 0.00 ? 4  GLY A H    8  
ATOM 10178 H HA2  . GLY A 1 4  ? 4.486   24.227  -17.233 1.00 0.00 ? 4  GLY A HA2  8  
ATOM 10179 H HA3  . GLY A 1 4  ? 2.999   25.152  -17.307 1.00 0.00 ? 4  GLY A HA3  8  
ATOM 10180 N N    . SER A 1 5  ? 4.503   24.043  -19.699 1.00 0.00 ? 5  SER A N    8  
ATOM 10181 C CA   . SER A 1 5  ? 4.637   23.930  -21.141 1.00 0.00 ? 5  SER A CA   8  
ATOM 10182 C C    . SER A 1 5  ? 4.487   22.469  -21.568 1.00 0.00 ? 5  SER A C    8  
ATOM 10183 O O    . SER A 1 5  ? 5.471   21.734  -21.634 1.00 0.00 ? 5  SER A O    8  
ATOM 10184 C CB   . SER A 1 5  ? 5.982   24.486  -21.615 1.00 0.00 ? 5  SER A CB   8  
ATOM 10185 O OG   . SER A 1 5  ? 5.974   25.909  -21.692 1.00 0.00 ? 5  SER A OG   8  
ATOM 10186 H H    . SER A 1 5  ? 4.700   23.205  -19.189 1.00 0.00 ? 5  SER A H    8  
ATOM 10187 H HA   . SER A 1 5  ? 3.830   24.534  -21.554 1.00 0.00 ? 5  SER A HA   8  
ATOM 10188 H HB2  . SER A 1 5  ? 6.768   24.165  -20.931 1.00 0.00 ? 5  SER A HB2  8  
ATOM 10189 H HB3  . SER A 1 5  ? 6.221   24.071  -22.593 1.00 0.00 ? 5  SER A HB3  8  
ATOM 10190 H HG   . SER A 1 5  ? 5.966   26.199  -22.649 1.00 0.00 ? 5  SER A HG   8  
ATOM 10191 N N    . SER A 1 6  ? 3.248   22.091  -21.845 1.00 0.00 ? 6  SER A N    8  
ATOM 10192 C CA   . SER A 1 6  ? 2.957   20.730  -22.264 1.00 0.00 ? 6  SER A CA   8  
ATOM 10193 C C    . SER A 1 6  ? 3.284   19.753  -21.133 1.00 0.00 ? 6  SER A C    8  
ATOM 10194 O O    . SER A 1 6  ? 4.207   19.988  -20.353 1.00 0.00 ? 6  SER A O    8  
ATOM 10195 C CB   . SER A 1 6  ? 3.739   20.363  -23.526 1.00 0.00 ? 6  SER A CB   8  
ATOM 10196 O OG   . SER A 1 6  ? 2.953   20.514  -24.705 1.00 0.00 ? 6  SER A OG   8  
ATOM 10197 H H    . SER A 1 6  ? 2.453   22.695  -21.788 1.00 0.00 ? 6  SER A H    8  
ATOM 10198 H HA   . SER A 1 6  ? 1.889   20.718  -22.482 1.00 0.00 ? 6  SER A HA   8  
ATOM 10199 H HB2  . SER A 1 6  ? 4.626   20.992  -23.599 1.00 0.00 ? 6  SER A HB2  8  
ATOM 10200 H HB3  . SER A 1 6  ? 4.085   19.332  -23.451 1.00 0.00 ? 6  SER A HB3  8  
ATOM 10201 H HG   . SER A 1 6  ? 2.669   19.617  -25.044 1.00 0.00 ? 6  SER A HG   8  
ATOM 10202 N N    . GLY A 1 7  ? 2.511   18.679  -21.079 1.00 0.00 ? 7  GLY A N    8  
ATOM 10203 C CA   . GLY A 1 7  ? 2.707   17.666  -20.056 1.00 0.00 ? 7  GLY A CA   8  
ATOM 10204 C C    . GLY A 1 7  ? 3.910   16.780  -20.386 1.00 0.00 ? 7  GLY A C    8  
ATOM 10205 O O    . GLY A 1 7  ? 5.003   16.990  -19.862 1.00 0.00 ? 7  GLY A O    8  
ATOM 10206 H H    . GLY A 1 7  ? 1.763   18.496  -21.717 1.00 0.00 ? 7  GLY A H    8  
ATOM 10207 H HA2  . GLY A 1 7  ? 2.858   18.145  -19.089 1.00 0.00 ? 7  GLY A HA2  8  
ATOM 10208 H HA3  . GLY A 1 7  ? 1.811   17.051  -19.971 1.00 0.00 ? 7  GLY A HA3  8  
ATOM 10209 N N    . GLU A 1 8  ? 3.668   15.808  -21.254 1.00 0.00 ? 8  GLU A N    8  
ATOM 10210 C CA   . GLU A 1 8  ? 4.718   14.889  -21.660 1.00 0.00 ? 8  GLU A CA   8  
ATOM 10211 C C    . GLU A 1 8  ? 5.428   14.317  -20.431 1.00 0.00 ? 8  GLU A C    8  
ATOM 10212 O O    . GLU A 1 8  ? 6.302   14.965  -19.857 1.00 0.00 ? 8  GLU A O    8  
ATOM 10213 C CB   . GLU A 1 8  ? 5.714   15.574  -22.598 1.00 0.00 ? 8  GLU A CB   8  
ATOM 10214 C CG   . GLU A 1 8  ? 5.064   15.897  -23.945 1.00 0.00 ? 8  GLU A CG   8  
ATOM 10215 C CD   . GLU A 1 8  ? 6.019   16.693  -24.838 1.00 0.00 ? 8  GLU A CD   8  
ATOM 10216 O OE1  . GLU A 1 8  ? 6.612   17.661  -24.313 1.00 0.00 ? 8  GLU A OE1  8  
ATOM 10217 O OE2  . GLU A 1 8  ? 6.134   16.317  -26.024 1.00 0.00 ? 8  GLU A OE2  8  
ATOM 10218 H H    . GLU A 1 8  ? 2.777   15.644  -21.676 1.00 0.00 ? 8  GLU A H    8  
ATOM 10219 H HA   . GLU A 1 8  ? 4.211   14.089  -22.200 1.00 0.00 ? 8  GLU A HA   8  
ATOM 10220 H HB2  . GLU A 1 8  ? 6.081   16.492  -22.138 1.00 0.00 ? 8  GLU A HB2  8  
ATOM 10221 H HB3  . GLU A 1 8  ? 6.578   14.928  -22.753 1.00 0.00 ? 8  GLU A HB3  8  
ATOM 10222 H HG2  . GLU A 1 8  ? 4.779   14.972  -24.447 1.00 0.00 ? 8  GLU A HG2  8  
ATOM 10223 H HG3  . GLU A 1 8  ? 4.150   16.468  -23.785 1.00 0.00 ? 8  GLU A HG3  8  
ATOM 10224 N N    . PHE A 1 9  ? 5.026   13.109  -20.064 1.00 0.00 ? 9  PHE A N    8  
ATOM 10225 C CA   . PHE A 1 9  ? 5.612   12.443  -18.913 1.00 0.00 ? 9  PHE A CA   8  
ATOM 10226 C C    . PHE A 1 9  ? 7.017   11.930  -19.234 1.00 0.00 ? 9  PHE A C    8  
ATOM 10227 O O    . PHE A 1 9  ? 7.216   11.237  -20.231 1.00 0.00 ? 9  PHE A O    8  
ATOM 10228 C CB   . PHE A 1 9  ? 4.711   11.252  -18.579 1.00 0.00 ? 9  PHE A CB   8  
ATOM 10229 C CG   . PHE A 1 9  ? 3.712   11.525  -17.453 1.00 0.00 ? 9  PHE A CG   8  
ATOM 10230 C CD1  . PHE A 1 9  ? 4.146   11.633  -16.169 1.00 0.00 ? 9  PHE A CD1  8  
ATOM 10231 C CD2  . PHE A 1 9  ? 2.388   11.660  -17.737 1.00 0.00 ? 9  PHE A CD2  8  
ATOM 10232 C CE1  . PHE A 1 9  ? 3.219   11.886  -15.124 1.00 0.00 ? 9  PHE A CE1  8  
ATOM 10233 C CE2  . PHE A 1 9  ? 1.461   11.913  -16.692 1.00 0.00 ? 9  PHE A CE2  8  
ATOM 10234 C CZ   . PHE A 1 9  ? 1.895   12.021  -15.408 1.00 0.00 ? 9  PHE A CZ   8  
ATOM 10235 H H    . PHE A 1 9  ? 4.314   12.589  -20.536 1.00 0.00 ? 9  PHE A H    8  
ATOM 10236 H HA   . PHE A 1 9  ? 5.670   13.176  -18.109 1.00 0.00 ? 9  PHE A HA   8  
ATOM 10237 H HB2  . PHE A 1 9  ? 4.163   10.961  -19.475 1.00 0.00 ? 9  PHE A HB2  8  
ATOM 10238 H HB3  . PHE A 1 9  ? 5.336   10.404  -18.298 1.00 0.00 ? 9  PHE A HB3  8  
ATOM 10239 H HD1  . PHE A 1 9  ? 5.207   11.525  -15.942 1.00 0.00 ? 9  PHE A HD1  8  
ATOM 10240 H HD2  . PHE A 1 9  ? 2.040   11.574  -18.766 1.00 0.00 ? 9  PHE A HD2  8  
ATOM 10241 H HE1  . PHE A 1 9  ? 3.567   11.972  -14.095 1.00 0.00 ? 9  PHE A HE1  8  
ATOM 10242 H HE2  . PHE A 1 9  ? 0.400   12.021  -16.919 1.00 0.00 ? 9  PHE A HE2  8  
ATOM 10243 H HZ   . PHE A 1 9  ? 1.183   12.215  -14.606 1.00 0.00 ? 9  PHE A HZ   8  
ATOM 10244 N N    . VAL A 1 10 ? 7.956   12.290  -18.371 1.00 0.00 ? 10 VAL A N    8  
ATOM 10245 C CA   . VAL A 1 10 ? 9.337   11.875  -18.550 1.00 0.00 ? 10 VAL A CA   8  
ATOM 10246 C C    . VAL A 1 10 ? 9.634   10.694  -17.624 1.00 0.00 ? 10 VAL A C    8  
ATOM 10247 O O    . VAL A 1 10 ? 10.443  10.810  -16.705 1.00 0.00 ? 10 VAL A O    8  
ATOM 10248 C CB   . VAL A 1 10 ? 10.274  13.063  -18.324 1.00 0.00 ? 10 VAL A CB   8  
ATOM 10249 C CG1  . VAL A 1 10 ? 9.894   14.240  -19.225 1.00 0.00 ? 10 VAL A CG1  8  
ATOM 10250 C CG2  . VAL A 1 10 ? 10.285  13.480  -16.852 1.00 0.00 ? 10 VAL A CG2  8  
ATOM 10251 H H    . VAL A 1 10 ? 7.785   12.854  -17.563 1.00 0.00 ? 10 VAL A H    8  
ATOM 10252 H HA   . VAL A 1 10 ? 9.450   11.547  -19.584 1.00 0.00 ? 10 VAL A HA   8  
ATOM 10253 H HB   . VAL A 1 10 ? 11.283  12.749  -18.591 1.00 0.00 ? 10 VAL A HB   8  
ATOM 10254 H HG11 . VAL A 1 10 ? 9.883   15.158  -18.638 1.00 0.00 ? 10 VAL A HG11 8  
ATOM 10255 H HG12 . VAL A 1 10 ? 10.624  14.332  -20.030 1.00 0.00 ? 10 VAL A HG12 8  
ATOM 10256 H HG13 . VAL A 1 10 ? 8.905   14.068  -19.649 1.00 0.00 ? 10 VAL A HG13 8  
ATOM 10257 H HG21 . VAL A 1 10 ? 9.376   13.124  -16.367 1.00 0.00 ? 10 VAL A HG21 8  
ATOM 10258 H HG22 . VAL A 1 10 ? 11.155  13.046  -16.358 1.00 0.00 ? 10 VAL A HG22 8  
ATOM 10259 H HG23 . VAL A 1 10 ? 10.332  14.567  -16.783 1.00 0.00 ? 10 VAL A HG23 8  
ATOM 10260 N N    . ILE A 1 11 ? 8.963   9.584   -17.898 1.00 0.00 ? 11 ILE A N    8  
ATOM 10261 C CA   . ILE A 1 11 ? 9.146   8.384   -17.100 1.00 0.00 ? 11 ILE A CA   8  
ATOM 10262 C C    . ILE A 1 11 ? 10.631  8.018   -17.069 1.00 0.00 ? 11 ILE A C    8  
ATOM 10263 O O    . ILE A 1 11 ? 11.299  8.031   -18.102 1.00 0.00 ? 11 ILE A O    8  
ATOM 10264 C CB   . ILE A 1 11 ? 8.246   7.258   -17.614 1.00 0.00 ? 11 ILE A CB   8  
ATOM 10265 C CG1  . ILE A 1 11 ? 8.610   6.877   -19.051 1.00 0.00 ? 11 ILE A CG1  8  
ATOM 10266 C CG2  . ILE A 1 11 ? 6.768   7.631   -17.476 1.00 0.00 ? 11 ILE A CG2  8  
ATOM 10267 C CD1  . ILE A 1 11 ? 8.462   5.371   -19.273 1.00 0.00 ? 11 ILE A CD1  8  
ATOM 10268 H H    . ILE A 1 11 ? 8.307   9.499   -18.648 1.00 0.00 ? 11 ILE A H    8  
ATOM 10269 H HA   . ILE A 1 11 ? 8.825   8.614   -16.084 1.00 0.00 ? 11 ILE A HA   8  
ATOM 10270 H HB   . ILE A 1 11 ? 8.414   6.377   -16.995 1.00 0.00 ? 11 ILE A HB   8  
ATOM 10271 H HG12 . ILE A 1 11 ? 7.967   7.416   -19.747 1.00 0.00 ? 11 ILE A HG12 8  
ATOM 10272 H HG13 . ILE A 1 11 ? 9.635   7.181   -19.263 1.00 0.00 ? 11 ILE A HG13 8  
ATOM 10273 H HG21 . ILE A 1 11 ? 6.449   7.476   -16.445 1.00 0.00 ? 11 ILE A HG21 8  
ATOM 10274 H HG22 . ILE A 1 11 ? 6.631   8.678   -17.746 1.00 0.00 ? 11 ILE A HG22 8  
ATOM 10275 H HG23 . ILE A 1 11 ? 6.172   7.004   -18.139 1.00 0.00 ? 11 ILE A HG23 8  
ATOM 10276 H HD11 . ILE A 1 11 ? 9.392   4.970   -19.674 1.00 0.00 ? 11 ILE A HD11 8  
ATOM 10277 H HD12 . ILE A 1 11 ? 8.235   4.884   -18.324 1.00 0.00 ? 11 ILE A HD12 8  
ATOM 10278 H HD13 . ILE A 1 11 ? 7.652   5.185   -19.979 1.00 0.00 ? 11 ILE A HD13 8  
ATOM 10279 N N    . ASN A 1 12 ? 11.104  7.700   -15.873 1.00 0.00 ? 12 ASN A N    8  
ATOM 10280 C CA   . ASN A 1 12 ? 12.498  7.332   -15.694 1.00 0.00 ? 12 ASN A CA   8  
ATOM 10281 C C    . ASN A 1 12 ? 12.724  6.897   -14.244 1.00 0.00 ? 12 ASN A C    8  
ATOM 10282 O O    . ASN A 1 12 ? 12.396  7.632   -13.314 1.00 0.00 ? 12 ASN A O    8  
ATOM 10283 C CB   . ASN A 1 12 ? 13.423  8.516   -15.982 1.00 0.00 ? 12 ASN A CB   8  
ATOM 10284 C CG   . ASN A 1 12 ? 14.617  8.085   -16.835 1.00 0.00 ? 12 ASN A CG   8  
ATOM 10285 O OD1  . ASN A 1 12 ? 14.536  7.965   -18.047 1.00 0.00 ? 12 ASN A OD1  8  
ATOM 10286 N ND2  . ASN A 1 12 ? 15.727  7.860   -16.138 1.00 0.00 ? 12 ASN A ND2  8  
ATOM 10287 H H    . ASN A 1 12 ? 10.554  7.692   -15.038 1.00 0.00 ? 12 ASN A H    8  
ATOM 10288 H HA   . ASN A 1 12 ? 12.674  6.524   -16.404 1.00 0.00 ? 12 ASN A HA   8  
ATOM 10289 H HB2  . ASN A 1 12 ? 12.867  9.299   -16.497 1.00 0.00 ? 12 ASN A HB2  8  
ATOM 10290 H HB3  . ASN A 1 12 ? 13.777  8.942   -15.043 1.00 0.00 ? 12 ASN A HB3  8  
ATOM 10291 H HD21 . ASN A 1 12 ? 15.726  7.977   -15.145 1.00 0.00 ? 12 ASN A HD21 8  
ATOM 10292 H HD22 . ASN A 1 12 ? 16.562  7.573   -16.607 1.00 0.00 ? 12 ASN A HD22 8  
ATOM 10293 N N    . PRO A 1 13 ? 13.297  5.673   -14.094 1.00 0.00 ? 13 PRO A N    8  
ATOM 10294 C CA   . PRO A 1 13 ? 13.570  5.132   -12.773 1.00 0.00 ? 13 PRO A CA   8  
ATOM 10295 C C    . PRO A 1 13 ? 14.784  5.816   -12.141 1.00 0.00 ? 13 PRO A C    8  
ATOM 10296 O O    . PRO A 1 13 ? 15.461  6.611   -12.790 1.00 0.00 ? 13 PRO A O    8  
ATOM 10297 C CB   . PRO A 1 13 ? 13.776  3.642   -12.993 1.00 0.00 ? 13 PRO A CB   8  
ATOM 10298 C CG   . PRO A 1 13 ? 14.071  3.477   -14.475 1.00 0.00 ? 13 PRO A CG   8  
ATOM 10299 C CD   . PRO A 1 13 ? 13.698  4.775   -15.173 1.00 0.00 ? 13 PRO A CD   8  
ATOM 10300 H HA   . PRO A 1 13 ? 12.803  5.313   -12.158 1.00 0.00 ? 13 PRO A HA   8  
ATOM 10301 H HB2  . PRO A 1 13 ? 14.601  3.268   -12.387 1.00 0.00 ? 13 PRO A HB2  8  
ATOM 10302 H HB3  . PRO A 1 13 ? 12.888  3.079   -12.706 1.00 0.00 ? 13 PRO A HB3  8  
ATOM 10303 H HG2  . PRO A 1 13 ? 15.125  3.248   -14.632 1.00 0.00 ? 13 PRO A HG2  8  
ATOM 10304 H HG3  . PRO A 1 13 ? 13.500  2.645   -14.888 1.00 0.00 ? 13 PRO A HG3  8  
ATOM 10305 H HD2  . PRO A 1 13 ? 14.541  5.180   -15.732 1.00 0.00 ? 13 PRO A HD2  8  
ATOM 10306 H HD3  . PRO A 1 13 ? 12.887  4.624   -15.884 1.00 0.00 ? 13 PRO A HD3  8  
ATOM 10307 N N    . ASN A 1 14 ? 15.022  5.482   -10.881 1.00 0.00 ? 14 ASN A N    8  
ATOM 10308 C CA   . ASN A 1 14 ? 16.142  6.054   -10.153 1.00 0.00 ? 14 ASN A CA   8  
ATOM 10309 C C    . ASN A 1 14 ? 16.500  5.142   -8.978  1.00 0.00 ? 14 ASN A C    8  
ATOM 10310 O O    . ASN A 1 14 ? 17.635  4.679   -8.871  1.00 0.00 ? 14 ASN A O    8  
ATOM 10311 C CB   . ASN A 1 14 ? 15.787  7.432   -9.591  1.00 0.00 ? 14 ASN A CB   8  
ATOM 10312 C CG   . ASN A 1 14 ? 16.062  8.531   -10.620 1.00 0.00 ? 14 ASN A CG   8  
ATOM 10313 O OD1  . ASN A 1 14 ? 17.164  9.040   -10.743 1.00 0.00 ? 14 ASN A OD1  8  
ATOM 10314 N ND2  . ASN A 1 14 ? 15.001  8.867   -11.349 1.00 0.00 ? 14 ASN A ND2  8  
ATOM 10315 H H    . ASN A 1 14 ? 14.466  4.834   -10.360 1.00 0.00 ? 14 ASN A H    8  
ATOM 10316 H HA   . ASN A 1 14 ? 16.948  6.131   -10.883 1.00 0.00 ? 14 ASN A HA   8  
ATOM 10317 H HB2  . ASN A 1 14 ? 14.736  7.452   -9.304  1.00 0.00 ? 14 ASN A HB2  8  
ATOM 10318 H HB3  . ASN A 1 14 ? 16.368  7.621   -8.688  1.00 0.00 ? 14 ASN A HB3  8  
ATOM 10319 H HD21 . ASN A 1 14 ? 14.125  8.410   -11.197 1.00 0.00 ? 14 ASN A HD21 8  
ATOM 10320 H HD22 . ASN A 1 14 ? 15.080  9.577   -12.049 1.00 0.00 ? 14 ASN A HD22 8  
ATOM 10321 N N    . GLY A 1 15 ? 15.512  4.912   -8.127  1.00 0.00 ? 15 GLY A N    8  
ATOM 10322 C CA   . GLY A 1 15 ? 15.709  4.063   -6.963  1.00 0.00 ? 15 GLY A CA   8  
ATOM 10323 C C    . GLY A 1 15 ? 14.464  3.221   -6.682  1.00 0.00 ? 15 GLY A C    8  
ATOM 10324 O O    . GLY A 1 15 ? 13.943  2.557   -7.578  1.00 0.00 ? 15 GLY A O    8  
ATOM 10325 H H    . GLY A 1 15 ? 14.592  5.292   -8.221  1.00 0.00 ? 15 GLY A H    8  
ATOM 10326 H HA2  . GLY A 1 15 ? 16.566  3.409   -7.127  1.00 0.00 ? 15 GLY A HA2  8  
ATOM 10327 H HA3  . GLY A 1 15 ? 15.940  4.680   -6.094  1.00 0.00 ? 15 GLY A HA3  8  
ATOM 10328 N N    . LYS A 1 16 ? 14.022  3.274   -5.434  1.00 0.00 ? 16 LYS A N    8  
ATOM 10329 C CA   . LYS A 1 16 ? 12.847  2.524   -5.023  1.00 0.00 ? 16 LYS A CA   8  
ATOM 10330 C C    . LYS A 1 16 ? 11.776  3.495   -4.522  1.00 0.00 ? 16 LYS A C    8  
ATOM 10331 O O    . LYS A 1 16 ? 12.086  4.460   -3.826  1.00 0.00 ? 16 LYS A O    8  
ATOM 10332 C CB   . LYS A 1 16 ? 13.228  1.448   -4.003  1.00 0.00 ? 16 LYS A CB   8  
ATOM 10333 C CG   . LYS A 1 16 ? 13.939  2.064   -2.797  1.00 0.00 ? 16 LYS A CG   8  
ATOM 10334 C CD   . LYS A 1 16 ? 15.414  1.658   -2.765  1.00 0.00 ? 16 LYS A CD   8  
ATOM 10335 C CE   . LYS A 1 16 ? 16.114  2.234   -1.532  1.00 0.00 ? 16 LYS A CE   8  
ATOM 10336 N NZ   . LYS A 1 16 ? 16.140  1.239   -0.438  1.00 0.00 ? 16 LYS A NZ   8  
ATOM 10337 H H    . LYS A 1 16 ? 14.451  3.816   -4.711  1.00 0.00 ? 16 LYS A H    8  
ATOM 10338 H HA   . LYS A 1 16 ? 12.463  2.010   -5.905  1.00 0.00 ? 16 LYS A HA   8  
ATOM 10339 H HB2  . LYS A 1 16 ? 12.332  0.922   -3.672  1.00 0.00 ? 16 LYS A HB2  8  
ATOM 10340 H HB3  . LYS A 1 16 ? 13.875  0.709   -4.474  1.00 0.00 ? 16 LYS A HB3  8  
ATOM 10341 H HG2  . LYS A 1 16 ? 13.858  3.150   -2.838  1.00 0.00 ? 16 LYS A HG2  8  
ATOM 10342 H HG3  . LYS A 1 16 ? 13.450  1.742   -1.878  1.00 0.00 ? 16 LYS A HG3  8  
ATOM 10343 H HD2  . LYS A 1 16 ? 15.496  0.571   -2.759  1.00 0.00 ? 16 LYS A HD2  8  
ATOM 10344 H HD3  . LYS A 1 16 ? 15.912  2.010   -3.668  1.00 0.00 ? 16 LYS A HD3  8  
ATOM 10345 H HE2  . LYS A 1 16 ? 17.132  2.528   -1.789  1.00 0.00 ? 16 LYS A HE2  8  
ATOM 10346 H HE3  . LYS A 1 16 ? 15.597  3.135   -1.201  1.00 0.00 ? 16 LYS A HE3  8  
ATOM 10347 H HZ1  . LYS A 1 16 ? 16.108  1.711   0.443   1.00 0.00 ? 16 LYS A HZ1  8  
ATOM 10348 H HZ2  . LYS A 1 16 ? 15.349  0.632   -0.520  1.00 0.00 ? 16 LYS A HZ2  8  
ATOM 10349 H HZ3  . LYS A 1 16 ? 16.981  0.700   -0.497  1.00 0.00 ? 16 LYS A HZ3  8  
ATOM 10350 N N    . SER A 1 17 ? 10.539  3.206   -4.896  1.00 0.00 ? 17 SER A N    8  
ATOM 10351 C CA   . SER A 1 17 ? 9.421   4.041   -4.494  1.00 0.00 ? 17 SER A CA   8  
ATOM 10352 C C    . SER A 1 17 ? 8.635   3.360   -3.371  1.00 0.00 ? 17 SER A C    8  
ATOM 10353 O O    . SER A 1 17 ? 8.914   2.214   -3.021  1.00 0.00 ? 17 SER A O    8  
ATOM 10354 C CB   . SER A 1 17 ? 8.501   4.340   -5.679  1.00 0.00 ? 17 SER A CB   8  
ATOM 10355 O OG   . SER A 1 17 ? 9.214   4.891   -6.783  1.00 0.00 ? 17 SER A OG   8  
ATOM 10356 H H    . SER A 1 17 ? 10.295  2.418   -5.463  1.00 0.00 ? 17 SER A H    8  
ATOM 10357 H HA   . SER A 1 17 ? 9.867   4.970   -4.139  1.00 0.00 ? 17 SER A HA   8  
ATOM 10358 H HB2  . SER A 1 17 ? 8.002   3.422   -5.992  1.00 0.00 ? 17 SER A HB2  8  
ATOM 10359 H HB3  . SER A 1 17 ? 7.722   5.035   -5.368  1.00 0.00 ? 17 SER A HB3  8  
ATOM 10360 H HG   . SER A 1 17 ? 8.661   5.592   -7.232  1.00 0.00 ? 17 SER A HG   8  
ATOM 10361 N N    . GLU A 1 18 ? 7.669   4.093   -2.839  1.00 0.00 ? 18 GLU A N    8  
ATOM 10362 C CA   . GLU A 1 18 ? 6.841   3.573   -1.763  1.00 0.00 ? 18 GLU A CA   8  
ATOM 10363 C C    . GLU A 1 18 ? 6.239   2.224   -2.161  1.00 0.00 ? 18 GLU A C    8  
ATOM 10364 O O    . GLU A 1 18 ? 6.454   1.221   -1.483  1.00 0.00 ? 18 GLU A O    8  
ATOM 10365 C CB   . GLU A 1 18 ? 5.746   4.572   -1.383  1.00 0.00 ? 18 GLU A CB   8  
ATOM 10366 C CG   . GLU A 1 18 ? 5.665   4.746   0.135   1.00 0.00 ? 18 GLU A CG   8  
ATOM 10367 C CD   . GLU A 1 18 ? 6.933   5.407   0.679   1.00 0.00 ? 18 GLU A CD   8  
ATOM 10368 O OE1  . GLU A 1 18 ? 7.909   4.661   0.908   1.00 0.00 ? 18 GLU A OE1  8  
ATOM 10369 O OE2  . GLU A 1 18 ? 6.897   6.645   0.854   1.00 0.00 ? 18 GLU A OE2  8  
ATOM 10370 H H    . GLU A 1 18 ? 7.448   5.024   -3.129  1.00 0.00 ? 18 GLU A H    8  
ATOM 10371 H HA   . GLU A 1 18 ? 7.515   3.443   -0.917  1.00 0.00 ? 18 GLU A HA   8  
ATOM 10372 H HB2  . GLU A 1 18 ? 5.947   5.535   -1.853  1.00 0.00 ? 18 GLU A HB2  8  
ATOM 10373 H HB3  . GLU A 1 18 ? 4.785   4.226   -1.765  1.00 0.00 ? 18 GLU A HB3  8  
ATOM 10374 H HG2  . GLU A 1 18 ? 4.796   5.352   0.389   1.00 0.00 ? 18 GLU A HG2  8  
ATOM 10375 H HG3  . GLU A 1 18 ? 5.526   3.774   0.609   1.00 0.00 ? 18 GLU A HG3  8  
ATOM 10376 N N    . VAL A 1 19 ? 5.498   2.244   -3.259  1.00 0.00 ? 19 VAL A N    8  
ATOM 10377 C CA   . VAL A 1 19 ? 4.864   1.034   -3.755  1.00 0.00 ? 19 VAL A CA   8  
ATOM 10378 C C    . VAL A 1 19 ? 5.873   -0.115  -3.724  1.00 0.00 ? 19 VAL A C    8  
ATOM 10379 O O    . VAL A 1 19 ? 5.507   -1.260  -3.462  1.00 0.00 ? 19 VAL A O    8  
ATOM 10380 C CB   . VAL A 1 19 ? 4.283   1.282   -5.149  1.00 0.00 ? 19 VAL A CB   8  
ATOM 10381 C CG1  . VAL A 1 19 ? 3.284   2.441   -5.128  1.00 0.00 ? 19 VAL A CG1  8  
ATOM 10382 C CG2  . VAL A 1 19 ? 5.394   1.534   -6.170  1.00 0.00 ? 19 VAL A CG2  8  
ATOM 10383 H H    . VAL A 1 19 ? 5.329   3.064   -3.805  1.00 0.00 ? 19 VAL A H    8  
ATOM 10384 H HA   . VAL A 1 19 ? 4.039   0.796   -3.083  1.00 0.00 ? 19 VAL A HA   8  
ATOM 10385 H HB   . VAL A 1 19 ? 3.746   0.383   -5.453  1.00 0.00 ? 19 VAL A HB   8  
ATOM 10386 H HG11 . VAL A 1 19 ? 3.825   3.387   -5.167  1.00 0.00 ? 19 VAL A HG11 8  
ATOM 10387 H HG12 . VAL A 1 19 ? 2.622   2.366   -5.991  1.00 0.00 ? 19 VAL A HG12 8  
ATOM 10388 H HG13 . VAL A 1 19 ? 2.695   2.397   -4.212  1.00 0.00 ? 19 VAL A HG13 8  
ATOM 10389 H HG21 . VAL A 1 19 ? 6.098   2.263   -5.768  1.00 0.00 ? 19 VAL A HG21 8  
ATOM 10390 H HG22 . VAL A 1 19 ? 5.917   0.600   -6.375  1.00 0.00 ? 19 VAL A HG22 8  
ATOM 10391 H HG23 . VAL A 1 19 ? 4.960   1.918   -7.092  1.00 0.00 ? 19 VAL A HG23 8  
ATOM 10392 N N    . CYS A 1 20 ? 7.123   0.230   -3.995  1.00 0.00 ? 20 CYS A N    8  
ATOM 10393 C CA   . CYS A 1 20 ? 8.187   -0.759  -4.002  1.00 0.00 ? 20 CYS A CA   8  
ATOM 10394 C C    . CYS A 1 20 ? 8.573   -1.060  -2.552  1.00 0.00 ? 20 CYS A C    8  
ATOM 10395 O O    . CYS A 1 20 ? 8.490   -2.204  -2.108  1.00 0.00 ? 20 CYS A O    8  
ATOM 10396 C CB   . CYS A 1 20 ? 9.389   -0.292  -4.826  1.00 0.00 ? 20 CYS A CB   8  
ATOM 10397 S SG   . CYS A 1 20 ? 9.398   -1.134  -6.451  1.00 0.00 ? 20 CYS A SG   8  
ATOM 10398 H H    . CYS A 1 20 ? 7.412   1.163   -4.207  1.00 0.00 ? 20 CYS A H    8  
ATOM 10399 H HA   . CYS A 1 20 ? 7.786   -1.649  -4.488  1.00 0.00 ? 20 CYS A HA   8  
ATOM 10400 H HB2  . CYS A 1 20 ? 9.346   0.788   -4.967  1.00 0.00 ? 20 CYS A HB2  8  
ATOM 10401 H HB3  . CYS A 1 20 ? 10.313  -0.507  -4.291  1.00 0.00 ? 20 CYS A HB3  8  
ATOM 10402 H HG   . CYS A 1 20 ? 9.283   -2.369  -5.969  1.00 0.00 ? 20 CYS A HG   8  
ATOM 10403 N N    . ILE A 1 21 ? 8.986   -0.012  -1.854  1.00 0.00 ? 21 ILE A N    8  
ATOM 10404 C CA   . ILE A 1 21 ? 9.384   -0.149  -0.463  1.00 0.00 ? 21 ILE A CA   8  
ATOM 10405 C C    . ILE A 1 21 ? 8.341   -0.984  0.282   1.00 0.00 ? 21 ILE A C    8  
ATOM 10406 O O    . ILE A 1 21 ? 8.657   -2.046  0.817   1.00 0.00 ? 21 ILE A O    8  
ATOM 10407 C CB   . ILE A 1 21 ? 9.632   1.225   0.161   1.00 0.00 ? 21 ILE A CB   8  
ATOM 10408 C CG1  . ILE A 1 21 ? 10.904  1.862   -0.402  1.00 0.00 ? 21 ILE A CG1  8  
ATOM 10409 C CG2  . ILE A 1 21 ? 9.664   1.136   1.688   1.00 0.00 ? 21 ILE A CG2  8  
ATOM 10410 C CD1  . ILE A 1 21 ? 10.879  3.382   -0.229  1.00 0.00 ? 21 ILE A CD1  8  
ATOM 10411 H H    . ILE A 1 21 ? 9.051   0.915   -2.222  1.00 0.00 ? 21 ILE A H    8  
ATOM 10412 H HA   . ILE A 1 21 ? 10.333  -0.687  -0.446  1.00 0.00 ? 21 ILE A HA   8  
ATOM 10413 H HB   . ILE A 1 21 ? 8.800   1.877   -0.106  1.00 0.00 ? 21 ILE A HB   8  
ATOM 10414 H HG12 . ILE A 1 21 ? 11.777  1.449   0.104   1.00 0.00 ? 21 ILE A HG12 8  
ATOM 10415 H HG13 . ILE A 1 21 ? 11.001  1.615   -1.459  1.00 0.00 ? 21 ILE A HG13 8  
ATOM 10416 H HG21 . ILE A 1 21 ? 9.644   0.089   1.992   1.00 0.00 ? 21 ILE A HG21 8  
ATOM 10417 H HG22 . ILE A 1 21 ? 10.575  1.605   2.061   1.00 0.00 ? 21 ILE A HG22 8  
ATOM 10418 H HG23 . ILE A 1 21 ? 8.796   1.650   2.101   1.00 0.00 ? 21 ILE A HG23 8  
ATOM 10419 H HD11 . ILE A 1 21 ? 9.853   3.741   -0.313  1.00 0.00 ? 21 ILE A HD11 8  
ATOM 10420 H HD12 . ILE A 1 21 ? 11.275  3.643   0.752   1.00 0.00 ? 21 ILE A HD12 8  
ATOM 10421 H HD13 . ILE A 1 21 ? 11.490  3.846   -1.003  1.00 0.00 ? 21 ILE A HD13 8  
ATOM 10422 N N    . LEU A 1 22 ? 7.118   -0.473  0.292   1.00 0.00 ? 22 LEU A N    8  
ATOM 10423 C CA   . LEU A 1 22 ? 6.027   -1.158  0.963   1.00 0.00 ? 22 LEU A CA   8  
ATOM 10424 C C    . LEU A 1 22 ? 6.115   -2.658  0.671   1.00 0.00 ? 22 LEU A C    8  
ATOM 10425 O O    . LEU A 1 22 ? 5.978   -3.479  1.576   1.00 0.00 ? 22 LEU A O    8  
ATOM 10426 C CB   . LEU A 1 22 ? 4.684   -0.535  0.576   1.00 0.00 ? 22 LEU A CB   8  
ATOM 10427 C CG   . LEU A 1 22 ? 3.438   -1.339  0.951   1.00 0.00 ? 22 LEU A CG   8  
ATOM 10428 C CD1  . LEU A 1 22 ? 3.241   -2.520  -0.001  1.00 0.00 ? 22 LEU A CD1  8  
ATOM 10429 C CD2  . LEU A 1 22 ? 3.492   -1.784  2.413   1.00 0.00 ? 22 LEU A CD2  8  
ATOM 10430 H H    . LEU A 1 22 ? 6.870   0.391   -0.145  1.00 0.00 ? 22 LEU A H    8  
ATOM 10431 H HA   . LEU A 1 22 ? 6.155   -1.007  2.035   1.00 0.00 ? 22 LEU A HA   8  
ATOM 10432 H HB2  . LEU A 1 22 ? 4.614   0.447   1.044   1.00 0.00 ? 22 LEU A HB2  8  
ATOM 10433 H HB3  . LEU A 1 22 ? 4.678   -0.375  -0.503  1.00 0.00 ? 22 LEU A HB3  8  
ATOM 10434 H HG   . LEU A 1 22 ? 2.568   -0.691  0.844   1.00 0.00 ? 22 LEU A HG   8  
ATOM 10435 H HD11 . LEU A 1 22 ? 3.433   -3.452  0.531   1.00 0.00 ? 22 LEU A HD11 8  
ATOM 10436 H HD12 . LEU A 1 22 ? 2.216   -2.520  -0.374  1.00 0.00 ? 22 LEU A HD12 8  
ATOM 10437 H HD13 . LEU A 1 22 ? 3.932   -2.431  -0.839  1.00 0.00 ? 22 LEU A HD13 8  
ATOM 10438 H HD21 . LEU A 1 22 ? 2.736   -2.549  2.589   1.00 0.00 ? 22 LEU A HD21 8  
ATOM 10439 H HD22 . LEU A 1 22 ? 4.479   -2.192  2.632   1.00 0.00 ? 22 LEU A HD22 8  
ATOM 10440 H HD23 . LEU A 1 22 ? 3.301   -0.928  3.061   1.00 0.00 ? 22 LEU A HD23 8  
ATOM 10441 N N    . HIS A 1 23 ? 6.344   -2.969  -0.597  1.00 0.00 ? 23 HIS A N    8  
ATOM 10442 C CA   . HIS A 1 23 ? 6.453   -4.354  -1.019  1.00 0.00 ? 23 HIS A CA   8  
ATOM 10443 C C    . HIS A 1 23 ? 7.637   -5.016  -0.312  1.00 0.00 ? 23 HIS A C    8  
ATOM 10444 O O    . HIS A 1 23 ? 7.467   -6.004  0.400   1.00 0.00 ? 23 HIS A O    8  
ATOM 10445 C CB   . HIS A 1 23 ? 6.543   -4.452  -2.543  1.00 0.00 ? 23 HIS A CB   8  
ATOM 10446 C CG   . HIS A 1 23 ? 6.469   -5.864  -3.074  1.00 0.00 ? 23 HIS A CG   8  
ATOM 10447 N ND1  . HIS A 1 23 ? 5.390   -6.336  -3.801  1.00 0.00 ? 23 HIS A ND1  8  
ATOM 10448 C CD2  . HIS A 1 23 ? 7.350   -6.901  -2.975  1.00 0.00 ? 23 HIS A CD2  8  
ATOM 10449 C CE1  . HIS A 1 23 ? 5.622   -7.601  -4.120  1.00 0.00 ? 23 HIS A CE1  8  
ATOM 10450 N NE2  . HIS A 1 23 ? 6.837   -7.949  -3.607  1.00 0.00 ? 23 HIS A NE2  8  
ATOM 10451 H H    . HIS A 1 23 ? 6.454   -2.294  -1.327  1.00 0.00 ? 23 HIS A H    8  
ATOM 10452 H HA   . HIS A 1 23 ? 5.532   -4.849  -0.708  1.00 0.00 ? 23 HIS A HA   8  
ATOM 10453 H HB2  . HIS A 1 23 ? 5.735   -3.867  -2.983  1.00 0.00 ? 23 HIS A HB2  8  
ATOM 10454 H HB3  . HIS A 1 23 ? 7.479   -4.000  -2.871  1.00 0.00 ? 23 HIS A HB3  8  
ATOM 10455 H HD1  . HIS A 1 23 ? 4.574   -5.812  -4.045  1.00 0.00 ? 23 HIS A HD1  8  
ATOM 10456 H HD2  . HIS A 1 23 ? 8.312   -6.872  -2.464  1.00 0.00 ? 23 HIS A HD2  8  
ATOM 10457 H HE1  . HIS A 1 23 ? 4.959   -8.249  -4.693  1.00 0.00 ? 23 HIS A HE1  8  
ATOM 10458 N N    . GLU A 1 24 ? 8.811   -4.443  -0.532  1.00 0.00 ? 24 GLU A N    8  
ATOM 10459 C CA   . GLU A 1 24 ? 10.024  -4.964  0.076   1.00 0.00 ? 24 GLU A CA   8  
ATOM 10460 C C    . GLU A 1 24 ? 9.766   -5.341  1.536   1.00 0.00 ? 24 GLU A C    8  
ATOM 10461 O O    . GLU A 1 24 ? 9.767   -6.520  1.886   1.00 0.00 ? 24 GLU A O    8  
ATOM 10462 C CB   . GLU A 1 24 ? 11.170  -3.957  -0.036  1.00 0.00 ? 24 GLU A CB   8  
ATOM 10463 C CG   . GLU A 1 24 ? 12.415  -4.608  -0.642  1.00 0.00 ? 24 GLU A CG   8  
ATOM 10464 C CD   . GLU A 1 24 ? 13.631  -4.417  0.268   1.00 0.00 ? 24 GLU A CD   8  
ATOM 10465 O OE1  . GLU A 1 24 ? 14.134  -3.274  0.310   1.00 0.00 ? 24 GLU A OE1  8  
ATOM 10466 O OE2  . GLU A 1 24 ? 14.029  -5.419  0.900   1.00 0.00 ? 24 GLU A OE2  8  
ATOM 10467 H H    . GLU A 1 24 ? 8.941   -3.639  -1.112  1.00 0.00 ? 24 GLU A H    8  
ATOM 10468 H HA   . GLU A 1 24 ? 10.275  -5.856  -0.498  1.00 0.00 ? 24 GLU A HA   8  
ATOM 10469 H HB2  . GLU A 1 24 ? 10.859  -3.114  -0.654  1.00 0.00 ? 24 GLU A HB2  8  
ATOM 10470 H HB3  . GLU A 1 24 ? 11.407  -3.558  0.950   1.00 0.00 ? 24 GLU A HB3  8  
ATOM 10471 H HG2  . GLU A 1 24 ? 12.235  -5.672  -0.796  1.00 0.00 ? 24 GLU A HG2  8  
ATOM 10472 H HG3  . GLU A 1 24 ? 12.617  -4.173  -1.621  1.00 0.00 ? 24 GLU A HG3  8  
ATOM 10473 N N    . TYR A 1 25 ? 9.552   -4.317  2.349   1.00 0.00 ? 25 TYR A N    8  
ATOM 10474 C CA   . TYR A 1 25 ? 9.293   -4.526  3.764   1.00 0.00 ? 25 TYR A CA   8  
ATOM 10475 C C    . TYR A 1 25 ? 8.256   -5.631  3.974   1.00 0.00 ? 25 TYR A C    8  
ATOM 10476 O O    . TYR A 1 25 ? 8.432   -6.499  4.828   1.00 0.00 ? 25 TYR A O    8  
ATOM 10477 C CB   . TYR A 1 25 ? 8.727   -3.205  4.289   1.00 0.00 ? 25 TYR A CB   8  
ATOM 10478 C CG   . TYR A 1 25 ? 8.028   -3.323  5.645   1.00 0.00 ? 25 TYR A CG   8  
ATOM 10479 C CD1  . TYR A 1 25 ? 6.775   -3.895  5.727   1.00 0.00 ? 25 TYR A CD1  8  
ATOM 10480 C CD2  . TYR A 1 25 ? 8.650   -2.857  6.785   1.00 0.00 ? 25 TYR A CD2  8  
ATOM 10481 C CE1  . TYR A 1 25 ? 6.116   -4.006  7.003   1.00 0.00 ? 25 TYR A CE1  8  
ATOM 10482 C CE2  . TYR A 1 25 ? 7.992   -2.968  8.061   1.00 0.00 ? 25 TYR A CE2  8  
ATOM 10483 C CZ   . TYR A 1 25 ? 6.758   -3.537  8.107   1.00 0.00 ? 25 TYR A CZ   8  
ATOM 10484 O OH   . TYR A 1 25 ? 6.136   -3.642  9.312   1.00 0.00 ? 25 TYR A OH   8  
ATOM 10485 H H    . TYR A 1 25 ? 9.553   -3.361  2.057   1.00 0.00 ? 25 TYR A H    8  
ATOM 10486 H HA   . TYR A 1 25 ? 10.229  -4.823  4.237   1.00 0.00 ? 25 TYR A HA   8  
ATOM 10487 H HB2  . TYR A 1 25 ? 9.538   -2.482  4.372   1.00 0.00 ? 25 TYR A HB2  8  
ATOM 10488 H HB3  . TYR A 1 25 ? 8.020   -2.809  3.560   1.00 0.00 ? 25 TYR A HB3  8  
ATOM 10489 H HD1  . TYR A 1 25 ? 6.283   -4.263  4.826   1.00 0.00 ? 25 TYR A HD1  8  
ATOM 10490 H HD2  . TYR A 1 25 ? 9.640   -2.405  6.720   1.00 0.00 ? 25 TYR A HD2  8  
ATOM 10491 H HE1  . TYR A 1 25 ? 5.127   -4.455  7.082   1.00 0.00 ? 25 TYR A HE1  8  
ATOM 10492 H HE2  . TYR A 1 25 ? 8.472   -2.604  8.969   1.00 0.00 ? 25 TYR A HE2  8  
ATOM 10493 H HH   . TYR A 1 25 ? 5.327   -3.055  9.331   1.00 0.00 ? 25 TYR A HH   8  
ATOM 10494 N N    . MET A 1 26 ? 7.196   -5.563  3.181   1.00 0.00 ? 26 MET A N    8  
ATOM 10495 C CA   . MET A 1 26 ? 6.131   -6.546  3.269   1.00 0.00 ? 26 MET A CA   8  
ATOM 10496 C C    . MET A 1 26 ? 6.669   -7.960  3.042   1.00 0.00 ? 26 MET A C    8  
ATOM 10497 O O    . MET A 1 26 ? 6.581   -8.812  3.925   1.00 0.00 ? 26 MET A O    8  
ATOM 10498 C CB   . MET A 1 26 ? 5.059   -6.234  2.223   1.00 0.00 ? 26 MET A CB   8  
ATOM 10499 C CG   . MET A 1 26 ? 3.942   -5.376  2.821   1.00 0.00 ? 26 MET A CG   8  
ATOM 10500 S SD   . MET A 1 26 ? 2.376   -5.813  2.086   1.00 0.00 ? 26 MET A SD   8  
ATOM 10501 C CE   . MET A 1 26 ? 2.383   -7.576  2.366   1.00 0.00 ? 26 MET A CE   8  
ATOM 10502 H H    . MET A 1 26 ? 7.061   -4.854  2.489   1.00 0.00 ? 26 MET A H    8  
ATOM 10503 H HA   . MET A 1 26 ? 5.735   -6.459  4.281   1.00 0.00 ? 26 MET A HA   8  
ATOM 10504 H HB2  . MET A 1 26 ? 5.511   -5.712  1.379   1.00 0.00 ? 26 MET A HB2  8  
ATOM 10505 H HB3  . MET A 1 26 ? 4.641   -7.163  1.836   1.00 0.00 ? 26 MET A HB3  8  
ATOM 10506 H HG2  . MET A 1 26 ? 3.900   -5.521  3.900   1.00 0.00 ? 26 MET A HG2  8  
ATOM 10507 H HG3  . MET A 1 26 ? 4.152   -4.320  2.650   1.00 0.00 ? 26 MET A HG3  8  
ATOM 10508 H HE1  . MET A 1 26 ? 1.434   -7.878  2.808   1.00 0.00 ? 26 MET A HE1  8  
ATOM 10509 H HE2  . MET A 1 26 ? 2.523   -8.094  1.417   1.00 0.00 ? 26 MET A HE2  8  
ATOM 10510 H HE3  . MET A 1 26 ? 3.198   -7.833  3.043   1.00 0.00 ? 26 MET A HE3  8  
ATOM 10511 N N    . GLN A 1 27 ? 7.216   -8.167  1.853   1.00 0.00 ? 27 GLN A N    8  
ATOM 10512 C CA   . GLN A 1 27 ? 7.769   -9.463  1.498   1.00 0.00 ? 27 GLN A CA   8  
ATOM 10513 C C    . GLN A 1 27 ? 9.012   -9.758  2.340   1.00 0.00 ? 27 GLN A C    8  
ATOM 10514 O O    . GLN A 1 27 ? 9.563   -10.856 2.276   1.00 0.00 ? 27 GLN A O    8  
ATOM 10515 C CB   . GLN A 1 27 ? 8.089   -9.532  0.004   1.00 0.00 ? 27 GLN A CB   8  
ATOM 10516 C CG   . GLN A 1 27 ? 9.239   -10.505 -0.266  1.00 0.00 ? 27 GLN A CG   8  
ATOM 10517 C CD   . GLN A 1 27 ? 9.493   -10.652 -1.767  1.00 0.00 ? 27 GLN A CD   8  
ATOM 10518 O OE1  . GLN A 1 27 ? 8.580   -10.770 -2.568  1.00 0.00 ? 27 GLN A OE1  8  
ATOM 10519 N NE2  . GLN A 1 27 ? 10.779  -10.639 -2.103  1.00 0.00 ? 27 GLN A NE2  8  
ATOM 10520 H H    . GLN A 1 27 ? 7.284   -7.469  1.140   1.00 0.00 ? 27 GLN A H    8  
ATOM 10521 H HA   . GLN A 1 27 ? 6.985   -10.185 1.729   1.00 0.00 ? 27 GLN A HA   8  
ATOM 10522 H HB2  . GLN A 1 27 ? 7.204   -9.848  -0.548  1.00 0.00 ? 27 GLN A HB2  8  
ATOM 10523 H HB3  . GLN A 1 27 ? 8.355   -8.540  -0.361  1.00 0.00 ? 27 GLN A HB3  8  
ATOM 10524 H HG2  . GLN A 1 27 ? 10.145  -10.148 0.226   1.00 0.00 ? 27 GLN A HG2  8  
ATOM 10525 H HG3  . GLN A 1 27 ? 9.005   -11.478 0.164   1.00 0.00 ? 27 GLN A HG3  8  
ATOM 10526 H HE21 . GLN A 1 27 ? 11.480  -10.539 -1.396  1.00 0.00 ? 27 GLN A HE21 8  
ATOM 10527 H HE22 . GLN A 1 27 ? 11.047  -10.729 -3.062  1.00 0.00 ? 27 GLN A HE22 8  
ATOM 10528 N N    . ARG A 1 28 ? 9.416   -8.759  3.111   1.00 0.00 ? 28 ARG A N    8  
ATOM 10529 C CA   . ARG A 1 28 ? 10.584  -8.898  3.964   1.00 0.00 ? 28 ARG A CA   8  
ATOM 10530 C C    . ARG A 1 28 ? 10.164  -9.325  5.372   1.00 0.00 ? 28 ARG A C    8  
ATOM 10531 O O    . ARG A 1 28 ? 10.756  -10.234 5.952   1.00 0.00 ? 28 ARG A O    8  
ATOM 10532 C CB   . ARG A 1 28 ? 11.364  -7.584  4.048   1.00 0.00 ? 28 ARG A CB   8  
ATOM 10533 C CG   . ARG A 1 28 ? 12.375  -7.620  5.196   1.00 0.00 ? 28 ARG A CG   8  
ATOM 10534 C CD   . ARG A 1 28 ? 13.667  -6.897  4.810   1.00 0.00 ? 28 ARG A CD   8  
ATOM 10535 N NE   . ARG A 1 28 ? 14.398  -6.481  6.029   1.00 0.00 ? 28 ARG A NE   8  
ATOM 10536 C CZ   . ARG A 1 28 ? 15.675  -6.077  6.038   1.00 0.00 ? 28 ARG A CZ   8  
ATOM 10537 N NH1  . ARG A 1 28 ? 16.372  -6.032  4.894   1.00 0.00 ? 28 ARG A NH1  8  
ATOM 10538 N NH2  . ARG A 1 28 ? 16.256  -5.718  7.191   1.00 0.00 ? 28 ARG A NH2  8  
ATOM 10539 H H    . ARG A 1 28 ? 8.962   -7.870  3.157   1.00 0.00 ? 28 ARG A H    8  
ATOM 10540 H HA   . ARG A 1 28 ? 11.189  -9.667  3.485   1.00 0.00 ? 28 ARG A HA   8  
ATOM 10541 H HB2  . ARG A 1 28 ? 11.883  -7.405  3.107   1.00 0.00 ? 28 ARG A HB2  8  
ATOM 10542 H HB3  . ARG A 1 28 ? 10.672  -6.755  4.194   1.00 0.00 ? 28 ARG A HB3  8  
ATOM 10543 H HG2  . ARG A 1 28 ? 11.943  -7.152  6.081   1.00 0.00 ? 28 ARG A HG2  8  
ATOM 10544 H HG3  . ARG A 1 28 ? 12.597  -8.654  5.458   1.00 0.00 ? 28 ARG A HG3  8  
ATOM 10545 H HD2  . ARG A 1 28 ? 14.295  -7.553  4.207   1.00 0.00 ? 28 ARG A HD2  8  
ATOM 10546 H HD3  . ARG A 1 28 ? 13.437  -6.025  4.199   1.00 0.00 ? 28 ARG A HD3  8  
ATOM 10547 H HE   . ARG A 1 28 ? 13.907  -6.503  6.900   1.00 0.00 ? 28 ARG A HE   8  
ATOM 10548 H HH11 . ARG A 1 28 ? 15.938  -6.300  4.034   1.00 0.00 ? 28 ARG A HH11 8  
ATOM 10549 H HH12 . ARG A 1 28 ? 17.325  -5.731  4.901   1.00 0.00 ? 28 ARG A HH12 8  
ATOM 10550 H HH21 . ARG A 1 28 ? 15.736  -5.752  8.044   1.00 0.00 ? 28 ARG A HH21 8  
ATOM 10551 H HH22 . ARG A 1 28 ? 17.210  -5.417  7.198   1.00 0.00 ? 28 ARG A HH22 8  
ATOM 10552 N N    . VAL A 1 29 ? 9.146   -8.648  5.882   1.00 0.00 ? 29 VAL A N    8  
ATOM 10553 C CA   . VAL A 1 29 ? 8.640   -8.946  7.212   1.00 0.00 ? 29 VAL A CA   8  
ATOM 10554 C C    . VAL A 1 29 ? 7.475   -9.932  7.100   1.00 0.00 ? 29 VAL A C    8  
ATOM 10555 O O    . VAL A 1 29 ? 7.468   -10.967 7.764   1.00 0.00 ? 29 VAL A O    8  
ATOM 10556 C CB   . VAL A 1 29 ? 8.259   -7.649  7.929   1.00 0.00 ? 29 VAL A CB   8  
ATOM 10557 C CG1  . VAL A 1 29 ? 9.348   -6.588  7.758   1.00 0.00 ? 29 VAL A CG1  8  
ATOM 10558 C CG2  . VAL A 1 29 ? 6.905   -7.130  7.441   1.00 0.00 ? 29 VAL A CG2  8  
ATOM 10559 H H    . VAL A 1 29 ? 8.669   -7.910  5.405   1.00 0.00 ? 29 VAL A H    8  
ATOM 10560 H HA   . VAL A 1 29 ? 9.447   -9.418  7.772   1.00 0.00 ? 29 VAL A HA   8  
ATOM 10561 H HB   . VAL A 1 29 ? 8.170   -7.869  8.993   1.00 0.00 ? 29 VAL A HB   8  
ATOM 10562 H HG11 . VAL A 1 29 ? 10.322  -7.073  7.696   1.00 0.00 ? 29 VAL A HG11 8  
ATOM 10563 H HG12 . VAL A 1 29 ? 9.164   -6.024  6.844   1.00 0.00 ? 29 VAL A HG12 8  
ATOM 10564 H HG13 . VAL A 1 29 ? 9.333   -5.911  8.612   1.00 0.00 ? 29 VAL A HG13 8  
ATOM 10565 H HG21 . VAL A 1 29 ? 6.941   -6.982  6.362   1.00 0.00 ? 29 VAL A HG21 8  
ATOM 10566 H HG22 . VAL A 1 29 ? 6.129   -7.856  7.683   1.00 0.00 ? 29 VAL A HG22 8  
ATOM 10567 H HG23 . VAL A 1 29 ? 6.682   -6.182  7.931   1.00 0.00 ? 29 VAL A HG23 8  
ATOM 10568 N N    . LEU A 1 30 ? 6.519   -9.575  6.256   1.00 0.00 ? 30 LEU A N    8  
ATOM 10569 C CA   . LEU A 1 30 ? 5.352   -10.416 6.049   1.00 0.00 ? 30 LEU A CA   8  
ATOM 10570 C C    . LEU A 1 30 ? 5.739   -11.614 5.180   1.00 0.00 ? 30 LEU A C    8  
ATOM 10571 O O    . LEU A 1 30 ? 5.452   -12.758 5.530   1.00 0.00 ? 30 LEU A O    8  
ATOM 10572 C CB   . LEU A 1 30 ? 4.193   -9.594  5.482   1.00 0.00 ? 30 LEU A CB   8  
ATOM 10573 C CG   . LEU A 1 30 ? 3.537   -8.604  6.447   1.00 0.00 ? 30 LEU A CG   8  
ATOM 10574 C CD1  . LEU A 1 30 ? 2.638   -7.619  5.695   1.00 0.00 ? 30 LEU A CD1  8  
ATOM 10575 C CD2  . LEU A 1 30 ? 2.781   -9.338  7.556   1.00 0.00 ? 30 LEU A CD2  8  
ATOM 10576 H H    . LEU A 1 30 ? 6.532   -8.732  5.720   1.00 0.00 ? 30 LEU A H    8  
ATOM 10577 H HA   . LEU A 1 30 ? 5.037   -10.784 7.026   1.00 0.00 ? 30 LEU A HA   8  
ATOM 10578 H HB2  . LEU A 1 30 ? 4.556   -9.040  4.616   1.00 0.00 ? 30 LEU A HB2  8  
ATOM 10579 H HB3  . LEU A 1 30 ? 3.427   -10.281 5.122   1.00 0.00 ? 30 LEU A HB3  8  
ATOM 10580 H HG   . LEU A 1 30 ? 4.324   -8.021  6.925   1.00 0.00 ? 30 LEU A HG   8  
ATOM 10581 H HD11 . LEU A 1 30 ? 1.912   -7.191  6.386   1.00 0.00 ? 30 LEU A HD11 8  
ATOM 10582 H HD12 . LEU A 1 30 ? 3.249   -6.823  5.269   1.00 0.00 ? 30 LEU A HD12 8  
ATOM 10583 H HD13 . LEU A 1 30 ? 2.114   -8.143  4.896   1.00 0.00 ? 30 LEU A HD13 8  
ATOM 10584 H HD21 . LEU A 1 30 ? 2.844   -8.764  8.480   1.00 0.00 ? 30 LEU A HD21 8  
ATOM 10585 H HD22 . LEU A 1 30 ? 1.735   -9.451  7.269   1.00 0.00 ? 30 LEU A HD22 8  
ATOM 10586 H HD23 . LEU A 1 30 ? 3.225   -10.322 7.708   1.00 0.00 ? 30 LEU A HD23 8  
ATOM 10587 N N    . LYS A 1 31 ? 6.384   -11.311 4.064   1.00 0.00 ? 31 LYS A N    8  
ATOM 10588 C CA   . LYS A 1 31 ? 6.814   -12.349 3.142   1.00 0.00 ? 31 LYS A CA   8  
ATOM 10589 C C    . LYS A 1 31 ? 5.635   -12.757 2.255   1.00 0.00 ? 31 LYS A C    8  
ATOM 10590 O O    . LYS A 1 31 ? 5.390   -13.945 2.052   1.00 0.00 ? 31 LYS A O    8  
ATOM 10591 C CB   . LYS A 1 31 ? 7.443   -13.516 3.905   1.00 0.00 ? 31 LYS A CB   8  
ATOM 10592 C CG   . LYS A 1 31 ? 8.789   -13.910 3.293   1.00 0.00 ? 31 LYS A CG   8  
ATOM 10593 C CD   . LYS A 1 31 ? 9.843   -14.127 4.380   1.00 0.00 ? 31 LYS A CD   8  
ATOM 10594 C CE   . LYS A 1 31 ? 11.064  -14.861 3.821   1.00 0.00 ? 31 LYS A CE   8  
ATOM 10595 N NZ   . LYS A 1 31 ? 11.058  -16.278 4.249   1.00 0.00 ? 31 LYS A NZ   8  
ATOM 10596 H H    . LYS A 1 31 ? 6.614   -10.378 3.786   1.00 0.00 ? 31 LYS A H    8  
ATOM 10597 H HA   . LYS A 1 31 ? 7.591   -11.922 2.508   1.00 0.00 ? 31 LYS A HA   8  
ATOM 10598 H HB2  . LYS A 1 31 ? 7.582   -13.240 4.950   1.00 0.00 ? 31 LYS A HB2  8  
ATOM 10599 H HB3  . LYS A 1 31 ? 6.767   -14.372 3.889   1.00 0.00 ? 31 LYS A HB3  8  
ATOM 10600 H HG2  . LYS A 1 31 ? 8.672   -14.821 2.706   1.00 0.00 ? 31 LYS A HG2  8  
ATOM 10601 H HG3  . LYS A 1 31 ? 9.122   -13.131 2.608   1.00 0.00 ? 31 LYS A HG3  8  
ATOM 10602 H HD2  . LYS A 1 31 ? 10.149  -13.166 4.792   1.00 0.00 ? 31 LYS A HD2  8  
ATOM 10603 H HD3  . LYS A 1 31 ? 9.412   -14.702 5.199   1.00 0.00 ? 31 LYS A HD3  8  
ATOM 10604 H HE2  . LYS A 1 31 ? 11.063  -14.804 2.732   1.00 0.00 ? 31 LYS A HE2  8  
ATOM 10605 H HE3  . LYS A 1 31 ? 11.977  -14.375 4.165   1.00 0.00 ? 31 LYS A HE3  8  
ATOM 10606 H HZ1  . LYS A 1 31 ? 10.115  -16.605 4.306   1.00 0.00 ? 31 LYS A HZ1  8  
ATOM 10607 H HZ2  . LYS A 1 31 ? 11.562  -16.829 3.584   1.00 0.00 ? 31 LYS A HZ2  8  
ATOM 10608 H HZ3  . LYS A 1 31 ? 11.493  -16.356 5.146   1.00 0.00 ? 31 LYS A HZ3  8  
ATOM 10609 N N    . VAL A 1 32 ? 4.938   -11.749 1.752   1.00 0.00 ? 32 VAL A N    8  
ATOM 10610 C CA   . VAL A 1 32 ? 3.791   -11.988 0.892   1.00 0.00 ? 32 VAL A CA   8  
ATOM 10611 C C    . VAL A 1 32 ? 3.672   -10.848 -0.121  1.00 0.00 ? 32 VAL A C    8  
ATOM 10612 O O    . VAL A 1 32 ? 4.022   -9.708  0.179   1.00 0.00 ? 32 VAL A O    8  
ATOM 10613 C CB   . VAL A 1 32 ? 2.531   -12.170 1.739   1.00 0.00 ? 32 VAL A CB   8  
ATOM 10614 C CG1  . VAL A 1 32 ? 2.713   -13.295 2.760   1.00 0.00 ? 32 VAL A CG1  8  
ATOM 10615 C CG2  . VAL A 1 32 ? 2.141   -10.861 2.430   1.00 0.00 ? 32 VAL A CG2  8  
ATOM 10616 H H    . VAL A 1 32 ? 5.145   -10.786 1.922   1.00 0.00 ? 32 VAL A H    8  
ATOM 10617 H HA   . VAL A 1 32 ? 3.973   -12.919 0.353   1.00 0.00 ? 32 VAL A HA   8  
ATOM 10618 H HB   . VAL A 1 32 ? 1.716   -12.451 1.072   1.00 0.00 ? 32 VAL A HB   8  
ATOM 10619 H HG11 . VAL A 1 32 ? 3.113   -14.177 2.260   1.00 0.00 ? 32 VAL A HG11 8  
ATOM 10620 H HG12 . VAL A 1 32 ? 3.405   -12.973 3.537   1.00 0.00 ? 32 VAL A HG12 8  
ATOM 10621 H HG13 . VAL A 1 32 ? 1.750   -13.538 3.209   1.00 0.00 ? 32 VAL A HG13 8  
ATOM 10622 H HG21 . VAL A 1 32 ? 1.111   -10.927 2.779   1.00 0.00 ? 32 VAL A HG21 8  
ATOM 10623 H HG22 . VAL A 1 32 ? 2.803   -10.688 3.280   1.00 0.00 ? 32 VAL A HG22 8  
ATOM 10624 H HG23 . VAL A 1 32 ? 2.234   -10.036 1.724   1.00 0.00 ? 32 VAL A HG23 8  
ATOM 10625 N N    . ARG A 1 33 ? 3.177   -11.195 -1.300  1.00 0.00 ? 33 ARG A N    8  
ATOM 10626 C CA   . ARG A 1 33 ? 3.007   -10.215 -2.358  1.00 0.00 ? 33 ARG A CA   8  
ATOM 10627 C C    . ARG A 1 33 ? 1.675   -9.481  -2.194  1.00 0.00 ? 33 ARG A C    8  
ATOM 10628 O O    . ARG A 1 33 ? 0.611   -10.089 -2.293  1.00 0.00 ? 33 ARG A O    8  
ATOM 10629 C CB   . ARG A 1 33 ? 3.049   -10.879 -3.736  1.00 0.00 ? 33 ARG A CB   8  
ATOM 10630 C CG   . ARG A 1 33 ? 4.490   -11.056 -4.217  1.00 0.00 ? 33 ARG A CG   8  
ATOM 10631 C CD   . ARG A 1 33 ? 4.533   -11.414 -5.704  1.00 0.00 ? 33 ARG A CD   8  
ATOM 10632 N NE   . ARG A 1 33 ? 5.740   -12.218 -5.997  1.00 0.00 ? 33 ARG A NE   8  
ATOM 10633 C CZ   . ARG A 1 33 ? 6.980   -11.714 -6.066  1.00 0.00 ? 33 ARG A CZ   8  
ATOM 10634 N NH1  . ARG A 1 33 ? 7.183   -10.405 -5.865  1.00 0.00 ? 33 ARG A NH1  8  
ATOM 10635 N NH2  . ARG A 1 33 ? 8.016   -12.519 -6.338  1.00 0.00 ? 33 ARG A NH2  8  
ATOM 10636 H H    . ARG A 1 33 ? 2.895   -12.125 -1.535  1.00 0.00 ? 33 ARG A H    8  
ATOM 10637 H HA   . ARG A 1 33 ? 3.849   -9.532  -2.243  1.00 0.00 ? 33 ARG A HA   8  
ATOM 10638 H HB2  . ARG A 1 33 ? 2.555   -11.850 -3.691  1.00 0.00 ? 33 ARG A HB2  8  
ATOM 10639 H HB3  . ARG A 1 33 ? 2.494   -10.274 -4.453  1.00 0.00 ? 33 ARG A HB3  8  
ATOM 10640 H HG2  . ARG A 1 33 ? 5.050   -10.137 -4.044  1.00 0.00 ? 33 ARG A HG2  8  
ATOM 10641 H HG3  . ARG A 1 33 ? 4.977   -11.840 -3.636  1.00 0.00 ? 33 ARG A HG3  8  
ATOM 10642 H HD2  . ARG A 1 33 ? 3.638   -11.973 -5.977  1.00 0.00 ? 33 ARG A HD2  8  
ATOM 10643 H HD3  . ARG A 1 33 ? 4.537   -10.504 -6.305  1.00 0.00 ? 33 ARG A HD3  8  
ATOM 10644 H HE   . ARG A 1 33 ? 5.624   -13.199 -6.152  1.00 0.00 ? 33 ARG A HE   8  
ATOM 10645 H HH11 . ARG A 1 33 ? 6.410   -9.804  -5.663  1.00 0.00 ? 33 ARG A HH11 8  
ATOM 10646 H HH12 . ARG A 1 33 ? 8.108   -10.029 -5.917  1.00 0.00 ? 33 ARG A HH12 8  
ATOM 10647 H HH21 . ARG A 1 33 ? 7.864   -13.496 -6.488  1.00 0.00 ? 33 ARG A HH21 8  
ATOM 10648 H HH22 . ARG A 1 33 ? 8.941   -12.143 -6.390  1.00 0.00 ? 33 ARG A HH22 8  
ATOM 10649 N N    . PRO A 1 34 ? 1.780   -8.149  -1.938  1.00 0.00 ? 34 PRO A N    8  
ATOM 10650 C CA   . PRO A 1 34 ? 0.597   -7.326  -1.759  1.00 0.00 ? 34 PRO A CA   8  
ATOM 10651 C C    . PRO A 1 34 ? -0.088  -7.050  -3.099  1.00 0.00 ? 34 PRO A C    8  
ATOM 10652 O O    . PRO A 1 34 ? 0.574   -6.718  -4.081  1.00 0.00 ? 34 PRO A O    8  
ATOM 10653 C CB   . PRO A 1 34 ? 1.096   -6.063  -1.076  1.00 0.00 ? 34 PRO A CB   8  
ATOM 10654 C CG   . PRO A 1 34 ? 2.596   -6.024  -1.317  1.00 0.00 ? 34 PRO A CG   8  
ATOM 10655 C CD   . PRO A 1 34 ? 3.024   -7.395  -1.814  1.00 0.00 ? 34 PRO A CD   8  
ATOM 10656 H HA   . PRO A 1 34 ? -0.079  -7.807  -1.201  1.00 0.00 ? 34 PRO A HA   8  
ATOM 10657 H HB2  . PRO A 1 34 ? 0.611   -5.178  -1.488  1.00 0.00 ? 34 PRO A HB2  8  
ATOM 10658 H HB3  . PRO A 1 34 ? 0.872   -6.081  -0.009  1.00 0.00 ? 34 PRO A HB3  8  
ATOM 10659 H HG2  . PRO A 1 34 ? 2.845   -5.257  -2.050  1.00 0.00 ? 34 PRO A HG2  8  
ATOM 10660 H HG3  . PRO A 1 34 ? 3.124   -5.770  -0.398  1.00 0.00 ? 34 PRO A HG3  8  
ATOM 10661 H HD2  . PRO A 1 34 ? 3.542   -7.325  -2.771  1.00 0.00 ? 34 PRO A HD2  8  
ATOM 10662 H HD3  . PRO A 1 34 ? 3.709   -7.874  -1.115  1.00 0.00 ? 34 PRO A HD3  8  
ATOM 10663 N N    . VAL A 1 35 ? -1.405  -7.198  -3.096  1.00 0.00 ? 35 VAL A N    8  
ATOM 10664 C CA   . VAL A 1 35 ? -2.186  -6.969  -4.300  1.00 0.00 ? 35 VAL A CA   8  
ATOM 10665 C C    . VAL A 1 35 ? -2.796  -5.567  -4.247  1.00 0.00 ? 35 VAL A C    8  
ATOM 10666 O O    . VAL A 1 35 ? -3.413  -5.191  -3.251  1.00 0.00 ? 35 VAL A O    8  
ATOM 10667 C CB   . VAL A 1 35 ? -3.234  -8.072  -4.461  1.00 0.00 ? 35 VAL A CB   8  
ATOM 10668 C CG1  . VAL A 1 35 ? -4.385  -7.608  -5.356  1.00 0.00 ? 35 VAL A CG1  8  
ATOM 10669 C CG2  . VAL A 1 35 ? -2.601  -9.355  -5.002  1.00 0.00 ? 35 VAL A CG2  8  
ATOM 10670 H H    . VAL A 1 35 ? -1.935  -7.468  -2.293  1.00 0.00 ? 35 VAL A H    8  
ATOM 10671 H HA   . VAL A 1 35 ? -1.505  -7.023  -5.149  1.00 0.00 ? 35 VAL A HA   8  
ATOM 10672 H HB   . VAL A 1 35 ? -3.644  -8.291  -3.475  1.00 0.00 ? 35 VAL A HB   8  
ATOM 10673 H HG11 . VAL A 1 35 ? -5.216  -7.274  -4.736  1.00 0.00 ? 35 VAL A HG11 8  
ATOM 10674 H HG12 . VAL A 1 35 ? -4.046  -6.784  -5.985  1.00 0.00 ? 35 VAL A HG12 8  
ATOM 10675 H HG13 . VAL A 1 35 ? -4.711  -8.435  -5.986  1.00 0.00 ? 35 VAL A HG13 8  
ATOM 10676 H HG21 . VAL A 1 35 ? -2.006  -9.825  -4.219  1.00 0.00 ? 35 VAL A HG21 8  
ATOM 10677 H HG22 . VAL A 1 35 ? -3.386  -10.040 -5.323  1.00 0.00 ? 35 VAL A HG22 8  
ATOM 10678 H HG23 . VAL A 1 35 ? -1.960  -9.114  -5.850  1.00 0.00 ? 35 VAL A HG23 8  
ATOM 10679 N N    . TYR A 1 36 ? -2.604  -4.831  -5.332  1.00 0.00 ? 36 TYR A N    8  
ATOM 10680 C CA   . TYR A 1 36 ? -3.128  -3.479  -5.422  1.00 0.00 ? 36 TYR A CA   8  
ATOM 10681 C C    . TYR A 1 36 ? -4.503  -3.467  -6.093  1.00 0.00 ? 36 TYR A C    8  
ATOM 10682 O O    . TYR A 1 36 ? -4.631  -3.830  -7.261  1.00 0.00 ? 36 TYR A O    8  
ATOM 10683 C CB   . TYR A 1 36 ? -2.141  -2.701  -6.295  1.00 0.00 ? 36 TYR A CB   8  
ATOM 10684 C CG   . TYR A 1 36 ? -0.828  -2.354  -5.592  1.00 0.00 ? 36 TYR A CG   8  
ATOM 10685 C CD1  . TYR A 1 36 ? 0.023   -3.361  -5.183  1.00 0.00 ? 36 TYR A CD1  8  
ATOM 10686 C CD2  . TYR A 1 36 ? -0.494  -1.034  -5.366  1.00 0.00 ? 36 TYR A CD2  8  
ATOM 10687 C CE1  . TYR A 1 36 ? 1.260   -3.034  -4.521  1.00 0.00 ? 36 TYR A CE1  8  
ATOM 10688 C CE2  . TYR A 1 36 ? 0.743   -0.707  -4.704  1.00 0.00 ? 36 TYR A CE2  8  
ATOM 10689 C CZ   . TYR A 1 36 ? 1.558   -1.723  -4.314  1.00 0.00 ? 36 TYR A CZ   8  
ATOM 10690 O OH   . TYR A 1 36 ? 2.726   -1.415  -3.689  1.00 0.00 ? 36 TYR A OH   8  
ATOM 10691 H H    . TYR A 1 36 ? -2.102  -5.144  -6.138  1.00 0.00 ? 36 TYR A H    8  
ATOM 10692 H HA   . TYR A 1 36 ? -3.223  -3.087  -4.409  1.00 0.00 ? 36 TYR A HA   8  
ATOM 10693 H HB2  . TYR A 1 36 ? -1.920  -3.288  -7.187  1.00 0.00 ? 36 TYR A HB2  8  
ATOM 10694 H HB3  . TYR A 1 36 ? -2.617  -1.780  -6.631  1.00 0.00 ? 36 TYR A HB3  8  
ATOM 10695 H HD1  . TYR A 1 36 ? -0.240  -4.403  -5.361  1.00 0.00 ? 36 TYR A HD1  8  
ATOM 10696 H HD2  . TYR A 1 36 ? -1.166  -0.239  -5.689  1.00 0.00 ? 36 TYR A HD2  8  
ATOM 10697 H HE1  . TYR A 1 36 ? 1.941   -3.819  -4.193  1.00 0.00 ? 36 TYR A HE1  8  
ATOM 10698 H HE2  . TYR A 1 36 ? 1.018   0.331   -4.520  1.00 0.00 ? 36 TYR A HE2  8  
ATOM 10699 H HH   . TYR A 1 36 ? 2.943   -2.112  -3.006  1.00 0.00 ? 36 TYR A HH   8  
ATOM 10700 N N    . ASN A 1 37 ? -5.497  -3.047  -5.325  1.00 0.00 ? 37 ASN A N    8  
ATOM 10701 C CA   . ASN A 1 37 ? -6.858  -2.983  -5.830  1.00 0.00 ? 37 ASN A CA   8  
ATOM 10702 C C    . ASN A 1 37 ? -7.131  -1.579  -6.373  1.00 0.00 ? 37 ASN A C    8  
ATOM 10703 O O    . ASN A 1 37 ? -6.979  -0.591  -5.654  1.00 0.00 ? 37 ASN A O    8  
ATOM 10704 C CB   . ASN A 1 37 ? -7.872  -3.266  -4.720  1.00 0.00 ? 37 ASN A CB   8  
ATOM 10705 C CG   . ASN A 1 37 ? -8.616  -4.577  -4.978  1.00 0.00 ? 37 ASN A CG   8  
ATOM 10706 O OD1  . ASN A 1 37 ? -9.795  -4.601  -5.291  1.00 0.00 ? 37 ASN A OD1  8  
ATOM 10707 N ND2  . ASN A 1 37 ? -7.864  -5.664  -4.829  1.00 0.00 ? 37 ASN A ND2  8  
ATOM 10708 H H    . ASN A 1 37 ? -5.385  -2.753  -4.375  1.00 0.00 ? 37 ASN A H    8  
ATOM 10709 H HA   . ASN A 1 37 ? -6.912  -3.747  -6.605  1.00 0.00 ? 37 ASN A HA   8  
ATOM 10710 H HB2  . ASN A 1 37 ? -7.359  -3.317  -3.759  1.00 0.00 ? 37 ASN A HB2  8  
ATOM 10711 H HB3  . ASN A 1 37 ? -8.586  -2.445  -4.656  1.00 0.00 ? 37 ASN A HB3  8  
ATOM 10712 H HD21 . ASN A 1 37 ? -6.903  -5.575  -4.569  1.00 0.00 ? 37 ASN A HD21 8  
ATOM 10713 H HD22 . ASN A 1 37 ? -8.261  -6.571  -4.976  1.00 0.00 ? 37 ASN A HD22 8  
ATOM 10714 N N    . PHE A 1 38 ? -7.529  -1.534  -7.636  1.00 0.00 ? 38 PHE A N    8  
ATOM 10715 C CA   . PHE A 1 38 ? -7.824  -0.267  -8.283  1.00 0.00 ? 38 PHE A CA   8  
ATOM 10716 C C    . PHE A 1 38 ? -9.320  -0.135  -8.574  1.00 0.00 ? 38 PHE A C    8  
ATOM 10717 O O    . PHE A 1 38 ? -9.981  -1.119  -8.905  1.00 0.00 ? 38 PHE A O    8  
ATOM 10718 C CB   . PHE A 1 38 ? -7.056  -0.250  -9.606  1.00 0.00 ? 38 PHE A CB   8  
ATOM 10719 C CG   . PHE A 1 38 ? -5.552  -0.492  -9.455  1.00 0.00 ? 38 PHE A CG   8  
ATOM 10720 C CD1  . PHE A 1 38 ? -4.727  0.539   -9.132  1.00 0.00 ? 38 PHE A CD1  8  
ATOM 10721 C CD2  . PHE A 1 38 ? -5.041  -1.738  -9.645  1.00 0.00 ? 38 PHE A CD2  8  
ATOM 10722 C CE1  . PHE A 1 38 ? -3.332  0.315   -8.992  1.00 0.00 ? 38 PHE A CE1  8  
ATOM 10723 C CE2  . PHE A 1 38 ? -3.646  -1.962  -9.506  1.00 0.00 ? 38 PHE A CE2  8  
ATOM 10724 C CZ   . PHE A 1 38 ? -2.821  -0.931  -9.182  1.00 0.00 ? 38 PHE A CZ   8  
ATOM 10725 H H    . PHE A 1 38 ? -7.649  -2.341  -8.213  1.00 0.00 ? 38 PHE A H    8  
ATOM 10726 H HA   . PHE A 1 38 ? -7.518  0.525   -7.599  1.00 0.00 ? 38 PHE A HA   8  
ATOM 10727 H HB2  . PHE A 1 38 ? -7.471  -1.012  -10.265 1.00 0.00 ? 38 PHE A HB2  8  
ATOM 10728 H HB3  . PHE A 1 38 ? -7.211  0.712   -10.093 1.00 0.00 ? 38 PHE A HB3  8  
ATOM 10729 H HD1  . PHE A 1 38 ? -5.136  1.538   -8.980  1.00 0.00 ? 38 PHE A HD1  8  
ATOM 10730 H HD2  . PHE A 1 38 ? -5.703  -2.565  -9.905  1.00 0.00 ? 38 PHE A HD2  8  
ATOM 10731 H HE1  . PHE A 1 38 ? -2.670  1.141   -8.733  1.00 0.00 ? 38 PHE A HE1  8  
ATOM 10732 H HE2  . PHE A 1 38 ? -3.237  -2.961  -9.658  1.00 0.00 ? 38 PHE A HE2  8  
ATOM 10733 H HZ   . PHE A 1 38 ? -1.750  -1.103  -9.075  1.00 0.00 ? 38 PHE A HZ   8  
ATOM 10734 N N    . PHE A 1 39 ? -9.811  1.088   -8.440  1.00 0.00 ? 39 PHE A N    8  
ATOM 10735 C CA   . PHE A 1 39 ? -11.217 1.361   -8.685  1.00 0.00 ? 39 PHE A CA   8  
ATOM 10736 C C    . PHE A 1 39 ? -11.455 2.855   -8.908  1.00 0.00 ? 39 PHE A C    8  
ATOM 10737 O O    . PHE A 1 39 ? -10.515 3.648   -8.884  1.00 0.00 ? 39 PHE A O    8  
ATOM 10738 C CB   . PHE A 1 39 ? -11.983 0.915   -7.437  1.00 0.00 ? 39 PHE A CB   8  
ATOM 10739 C CG   . PHE A 1 39 ? -11.292 1.276   -6.121  1.00 0.00 ? 39 PHE A CG   8  
ATOM 10740 C CD1  . PHE A 1 39 ? -11.549 2.470   -5.522  1.00 0.00 ? 39 PHE A CD1  8  
ATOM 10741 C CD2  . PHE A 1 39 ? -10.420 0.403   -5.549  1.00 0.00 ? 39 PHE A CD2  8  
ATOM 10742 C CE1  . PHE A 1 39 ? -10.908 2.805   -4.301  1.00 0.00 ? 39 PHE A CE1  8  
ATOM 10743 C CE2  . PHE A 1 39 ? -9.778  0.738   -4.327  1.00 0.00 ? 39 PHE A CE2  8  
ATOM 10744 C CZ   . PHE A 1 39 ? -10.036 1.932   -3.729  1.00 0.00 ? 39 PHE A CZ   8  
ATOM 10745 H H    . PHE A 1 39 ? -9.267  1.882   -8.170  1.00 0.00 ? 39 PHE A H    8  
ATOM 10746 H HA   . PHE A 1 39 ? -11.502 0.811   -9.582  1.00 0.00 ? 39 PHE A HA   8  
ATOM 10747 H HB2  . PHE A 1 39 ? -12.975 1.367   -7.451  1.00 0.00 ? 39 PHE A HB2  8  
ATOM 10748 H HB3  . PHE A 1 39 ? -12.125 -0.165  -7.477  1.00 0.00 ? 39 PHE A HB3  8  
ATOM 10749 H HD1  . PHE A 1 39 ? -12.248 3.170   -5.981  1.00 0.00 ? 39 PHE A HD1  8  
ATOM 10750 H HD2  . PHE A 1 39 ? -10.213 -0.554  -6.028  1.00 0.00 ? 39 PHE A HD2  8  
ATOM 10751 H HE1  . PHE A 1 39 ? -11.115 3.762   -3.821  1.00 0.00 ? 39 PHE A HE1  8  
ATOM 10752 H HE2  . PHE A 1 39 ? -9.079  0.039   -3.869  1.00 0.00 ? 39 PHE A HE2  8  
ATOM 10753 H HZ   . PHE A 1 39 ? -9.544  2.189   -2.791  1.00 0.00 ? 39 PHE A HZ   8  
ATOM 10754 N N    . GLU A 1 40 ? -12.718 3.196   -9.120  1.00 0.00 ? 40 GLU A N    8  
ATOM 10755 C CA   . GLU A 1 40 ? -13.091 4.582   -9.347  1.00 0.00 ? 40 GLU A CA   8  
ATOM 10756 C C    . GLU A 1 40 ? -13.494 5.246   -8.029  1.00 0.00 ? 40 GLU A C    8  
ATOM 10757 O O    . GLU A 1 40 ? -13.876 4.565   -7.078  1.00 0.00 ? 40 GLU A O    8  
ATOM 10758 C CB   . GLU A 1 40 ? -14.216 4.684   -10.379 1.00 0.00 ? 40 GLU A CB   8  
ATOM 10759 C CG   . GLU A 1 40 ? -13.651 4.846   -11.792 1.00 0.00 ? 40 GLU A CG   8  
ATOM 10760 C CD   . GLU A 1 40 ? -14.720 5.371   -12.753 1.00 0.00 ? 40 GLU A CD   8  
ATOM 10761 O OE1  . GLU A 1 40 ? -15.456 6.292   -12.335 1.00 0.00 ? 40 GLU A OE1  8  
ATOM 10762 O OE2  . GLU A 1 40 ? -14.778 4.840   -13.882 1.00 0.00 ? 40 GLU A OE2  8  
ATOM 10763 H H    . GLU A 1 40 ? -13.477 2.545   -9.138  1.00 0.00 ? 40 GLU A H    8  
ATOM 10764 H HA   . GLU A 1 40 ? -12.197 5.061   -9.745  1.00 0.00 ? 40 GLU A HA   8  
ATOM 10765 H HB2  . GLU A 1 40 ? -14.839 3.791   -10.333 1.00 0.00 ? 40 GLU A HB2  8  
ATOM 10766 H HB3  . GLU A 1 40 ? -14.858 5.533   -10.140 1.00 0.00 ? 40 GLU A HB3  8  
ATOM 10767 H HG2  . GLU A 1 40 ? -12.806 5.534   -11.772 1.00 0.00 ? 40 GLU A HG2  8  
ATOM 10768 H HG3  . GLU A 1 40 ? -13.275 3.888   -12.149 1.00 0.00 ? 40 GLU A HG3  8  
ATOM 10769 N N    . CYS A 1 41 ? -13.396 6.567   -8.015  1.00 0.00 ? 41 CYS A N    8  
ATOM 10770 C CA   . CYS A 1 41 ? -13.745 7.331   -6.829  1.00 0.00 ? 41 CYS A CA   8  
ATOM 10771 C C    . CYS A 1 41 ? -15.141 7.923   -7.033  1.00 0.00 ? 41 CYS A C    8  
ATOM 10772 O O    . CYS A 1 41 ? -15.589 8.089   -8.166  1.00 0.00 ? 41 CYS A O    8  
ATOM 10773 C CB   . CYS A 1 41 ? -12.705 8.411   -6.526  1.00 0.00 ? 41 CYS A CB   8  
ATOM 10774 S SG   . CYS A 1 41 ? -12.741 8.831   -4.745  1.00 0.00 ? 41 CYS A SG   8  
ATOM 10775 H H    . CYS A 1 41 ? -13.085 7.113   -8.792  1.00 0.00 ? 41 CYS A H    8  
ATOM 10776 H HA   . CYS A 1 41 ? -13.740 6.631   -5.993  1.00 0.00 ? 41 CYS A HA   8  
ATOM 10777 H HB2  . CYS A 1 41 ? -11.712 8.061   -6.805  1.00 0.00 ? 41 CYS A HB2  8  
ATOM 10778 H HB3  . CYS A 1 41 ? -12.909 9.301   -7.121  1.00 0.00 ? 41 CYS A HB3  8  
ATOM 10779 H HG   . CYS A 1 41 ? -11.694 9.652   -4.775  1.00 0.00 ? 41 CYS A HG   8  
ATOM 10780 N N    . GLU A 1 42 ? -15.789 8.226   -5.918  1.00 0.00 ? 42 GLU A N    8  
ATOM 10781 C CA   . GLU A 1 42 ? -17.125 8.796   -5.960  1.00 0.00 ? 42 GLU A CA   8  
ATOM 10782 C C    . GLU A 1 42 ? -17.059 10.273  -6.353  1.00 0.00 ? 42 GLU A C    8  
ATOM 10783 O O    . GLU A 1 42 ? -17.936 10.771  -7.058  1.00 0.00 ? 42 GLU A O    8  
ATOM 10784 C CB   . GLU A 1 42 ? -17.840 8.617   -4.619  1.00 0.00 ? 42 GLU A CB   8  
ATOM 10785 C CG   . GLU A 1 42 ? -19.313 8.256   -4.827  1.00 0.00 ? 42 GLU A CG   8  
ATOM 10786 C CD   . GLU A 1 42 ? -20.063 8.223   -3.494  1.00 0.00 ? 42 GLU A CD   8  
ATOM 10787 O OE1  . GLU A 1 42 ? -19.680 9.017   -2.608  1.00 0.00 ? 42 GLU A OE1  8  
ATOM 10788 O OE2  . GLU A 1 42 ? -21.001 7.404   -3.391  1.00 0.00 ? 42 GLU A OE2  8  
ATOM 10789 H H    . GLU A 1 42 ? -15.417 8.088   -5.000  1.00 0.00 ? 42 GLU A H    8  
ATOM 10790 H HA   . GLU A 1 42 ? -17.657 8.232   -6.727  1.00 0.00 ? 42 GLU A HA   8  
ATOM 10791 H HB2  . GLU A 1 42 ? -17.349 7.833   -4.043  1.00 0.00 ? 42 GLU A HB2  8  
ATOM 10792 H HB3  . GLU A 1 42 ? -17.766 9.535   -4.038  1.00 0.00 ? 42 GLU A HB3  8  
ATOM 10793 H HG2  . GLU A 1 42 ? -19.778 8.984   -5.492  1.00 0.00 ? 42 GLU A HG2  8  
ATOM 10794 H HG3  . GLU A 1 42 ? -19.387 7.285   -5.315  1.00 0.00 ? 42 GLU A HG3  8  
ATOM 10795 N N    . ASN A 1 43 ? -16.012 10.933  -5.880  1.00 0.00 ? 43 ASN A N    8  
ATOM 10796 C CA   . ASN A 1 43 ? -15.821 12.343  -6.174  1.00 0.00 ? 43 ASN A CA   8  
ATOM 10797 C C    . ASN A 1 43 ? -15.074 12.486  -7.502  1.00 0.00 ? 43 ASN A C    8  
ATOM 10798 O O    . ASN A 1 43 ? -14.193 11.686  -7.812  1.00 0.00 ? 43 ASN A O    8  
ATOM 10799 C CB   . ASN A 1 43 ? -14.987 13.023  -5.087  1.00 0.00 ? 43 ASN A CB   8  
ATOM 10800 C CG   . ASN A 1 43 ? -15.858 13.413  -3.891  1.00 0.00 ? 43 ASN A CG   8  
ATOM 10801 O OD1  . ASN A 1 43 ? -16.378 14.513  -3.801  1.00 0.00 ? 43 ASN A OD1  8  
ATOM 10802 N ND2  . ASN A 1 43 ? -15.988 12.453  -2.980  1.00 0.00 ? 43 ASN A ND2  8  
ATOM 10803 H H    . ASN A 1 43 ? -15.304 10.520  -5.308  1.00 0.00 ? 43 ASN A H    8  
ATOM 10804 H HA   . ASN A 1 43 ? -16.824 12.766  -6.212  1.00 0.00 ? 43 ASN A HA   8  
ATOM 10805 H HB2  . ASN A 1 43 ? -14.192 12.352  -4.759  1.00 0.00 ? 43 ASN A HB2  8  
ATOM 10806 H HB3  . ASN A 1 43 ? -14.505 13.912  -5.495  1.00 0.00 ? 43 ASN A HB3  8  
ATOM 10807 H HD21 . ASN A 1 43 ? -15.534 11.572  -3.114  1.00 0.00 ? 43 ASN A HD21 8  
ATOM 10808 H HD22 . ASN A 1 43 ? -16.539 12.612  -2.161  1.00 0.00 ? 43 ASN A HD22 8  
ATOM 10809 N N    . PRO A 1 44 ? -15.463 13.539  -8.269  1.00 0.00 ? 44 PRO A N    8  
ATOM 10810 C CA   . PRO A 1 44 ? -14.841 13.798  -9.556  1.00 0.00 ? 44 PRO A CA   8  
ATOM 10811 C C    . PRO A 1 44 ? -13.445 14.399  -9.379  1.00 0.00 ? 44 PRO A C    8  
ATOM 10812 O O    . PRO A 1 44 ? -12.629 14.363  -10.299 1.00 0.00 ? 44 PRO A O    8  
ATOM 10813 C CB   . PRO A 1 44 ? -15.801 14.729  -10.278 1.00 0.00 ? 44 PRO A CB   8  
ATOM 10814 C CG   . PRO A 1 44 ? -16.691 15.326  -9.200  1.00 0.00 ? 44 PRO A CG   8  
ATOM 10815 C CD   . PRO A 1 44 ? -16.503 14.508  -7.933  1.00 0.00 ? 44 PRO A CD   8  
ATOM 10816 H HA   . PRO A 1 44 ? -14.708 12.942  -10.056 1.00 0.00 ? 44 PRO A HA   8  
ATOM 10817 H HB2  . PRO A 1 44 ? -15.260 15.509  -10.814 1.00 0.00 ? 44 PRO A HB2  8  
ATOM 10818 H HB3  . PRO A 1 44 ? -16.392 14.186  -11.016 1.00 0.00 ? 44 PRO A HB3  8  
ATOM 10819 H HG2  . PRO A 1 44 ? -16.429 16.369  -9.023  1.00 0.00 ? 44 PRO A HG2  8  
ATOM 10820 H HG3  . PRO A 1 44 ? -17.735 15.309  -9.514  1.00 0.00 ? 44 PRO A HG3  8  
ATOM 10821 H HD2  . PRO A 1 44 ? -16.202 15.137  -7.096  1.00 0.00 ? 44 PRO A HD2  8  
ATOM 10822 H HD3  . PRO A 1 44 ? -17.428 14.011  -7.642  1.00 0.00 ? 44 PRO A HD3  8  
ATOM 10823 N N    . SER A 1 45 ? -13.213 14.937  -8.191  1.00 0.00 ? 45 SER A N    8  
ATOM 10824 C CA   . SER A 1 45 ? -11.930 15.544  -7.881  1.00 0.00 ? 45 SER A CA   8  
ATOM 10825 C C    . SER A 1 45 ? -10.797 14.576  -8.223  1.00 0.00 ? 45 SER A C    8  
ATOM 10826 O O    . SER A 1 45 ? -9.859  14.938  -8.931  1.00 0.00 ? 45 SER A O    8  
ATOM 10827 C CB   . SER A 1 45 ? -11.855 15.952  -6.409  1.00 0.00 ? 45 SER A CB   8  
ATOM 10828 O OG   . SER A 1 45 ? -11.235 14.949  -5.608  1.00 0.00 ? 45 SER A OG   8  
ATOM 10829 H H    . SER A 1 45 ? -13.883 14.962  -7.448  1.00 0.00 ? 45 SER A H    8  
ATOM 10830 H HA   . SER A 1 45 ? -11.874 16.435  -8.507  1.00 0.00 ? 45 SER A HA   8  
ATOM 10831 H HB2  . SER A 1 45 ? -11.296 16.884  -6.318  1.00 0.00 ? 45 SER A HB2  8  
ATOM 10832 H HB3  . SER A 1 45 ? -12.860 16.146  -6.034  1.00 0.00 ? 45 SER A HB3  8  
ATOM 10833 H HG   . SER A 1 45 ? -11.596 14.984  -4.676  1.00 0.00 ? 45 SER A HG   8  
ATOM 10834 N N    . GLU A 1 46 ? -10.920 13.363  -7.703  1.00 0.00 ? 46 GLU A N    8  
ATOM 10835 C CA   . GLU A 1 46 ? -9.918  12.340  -7.944  1.00 0.00 ? 46 GLU A CA   8  
ATOM 10836 C C    . GLU A 1 46 ? -10.589 11.010  -8.292  1.00 0.00 ? 46 GLU A C    8  
ATOM 10837 O O    . GLU A 1 46 ? -10.916 10.225  -7.404  1.00 0.00 ? 46 GLU A O    8  
ATOM 10838 C CB   . GLU A 1 46 ? -8.990  12.186  -6.737  1.00 0.00 ? 46 GLU A CB   8  
ATOM 10839 C CG   . GLU A 1 46 ? -8.246  13.492  -6.447  1.00 0.00 ? 46 GLU A CG   8  
ATOM 10840 C CD   . GLU A 1 46 ? -8.090  13.711  -4.941  1.00 0.00 ? 46 GLU A CD   8  
ATOM 10841 O OE1  . GLU A 1 46 ? -9.128  13.645  -4.247  1.00 0.00 ? 46 GLU A OE1  8  
ATOM 10842 O OE2  . GLU A 1 46 ? -6.937  13.940  -4.518  1.00 0.00 ? 46 GLU A OE2  8  
ATOM 10843 H H    . GLU A 1 46 ? -11.686 13.077  -7.128  1.00 0.00 ? 46 GLU A H    8  
ATOM 10844 H HA   . GLU A 1 46 ? -9.339  12.696  -8.796  1.00 0.00 ? 46 GLU A HA   8  
ATOM 10845 H HB2  . GLU A 1 46 ? -9.570  11.892  -5.863  1.00 0.00 ? 46 GLU A HB2  8  
ATOM 10846 H HB3  . GLU A 1 46 ? -8.271  11.388  -6.925  1.00 0.00 ? 46 GLU A HB3  8  
ATOM 10847 H HG2  . GLU A 1 46 ? -7.264  13.467  -6.919  1.00 0.00 ? 46 GLU A HG2  8  
ATOM 10848 H HG3  . GLU A 1 46 ? -8.790  14.329  -6.886  1.00 0.00 ? 46 GLU A HG3  8  
ATOM 10849 N N    . PRO A 1 47 ? -10.780 10.793  -9.621  1.00 0.00 ? 47 PRO A N    8  
ATOM 10850 C CA   . PRO A 1 47 ? -11.407 9.571   -10.097 1.00 0.00 ? 47 PRO A CA   8  
ATOM 10851 C C    . PRO A 1 47 ? -10.441 8.388   -10.007 1.00 0.00 ? 47 PRO A C    8  
ATOM 10852 O O    . PRO A 1 47 ? -10.867 7.234   -10.001 1.00 0.00 ? 47 PRO A O    8  
ATOM 10853 C CB   . PRO A 1 47 ? -11.837 9.880   -11.522 1.00 0.00 ? 47 PRO A CB   8  
ATOM 10854 C CG   . PRO A 1 47 ? -11.028 11.094  -11.948 1.00 0.00 ? 47 PRO A CG   8  
ATOM 10855 C CD   . PRO A 1 47 ? -10.405 11.701  -10.701 1.00 0.00 ? 47 PRO A CD   8  
ATOM 10856 H HA   . PRO A 1 47 ? -12.186 9.333   -9.518  1.00 0.00 ? 47 PRO A HA   8  
ATOM 10857 H HB2  . PRO A 1 47 ? -11.646 9.032   -12.180 1.00 0.00 ? 47 PRO A HB2  8  
ATOM 10858 H HB3  . PRO A 1 47 ? -12.906 10.087  -11.571 1.00 0.00 ? 47 PRO A HB3  8  
ATOM 10859 H HG2  . PRO A 1 47 ? -10.254 10.806  -12.660 1.00 0.00 ? 47 PRO A HG2  8  
ATOM 10860 H HG3  . PRO A 1 47 ? -11.666 11.822  -12.449 1.00 0.00 ? 47 PRO A HG3  8  
ATOM 10861 H HD2  . PRO A 1 47 ? -9.322  11.777  -10.796 1.00 0.00 ? 47 PRO A HD2  8  
ATOM 10862 H HD3  . PRO A 1 47 ? -10.782 12.707  -10.520 1.00 0.00 ? 47 PRO A HD3  8  
ATOM 10863 N N    . PHE A 1 48 ? -9.159  8.716   -9.939  1.00 0.00 ? 48 PHE A N    8  
ATOM 10864 C CA   . PHE A 1 48 ? -8.130  7.694   -9.849  1.00 0.00 ? 48 PHE A CA   8  
ATOM 10865 C C    . PHE A 1 48 ? -7.917  7.256   -8.399  1.00 0.00 ? 48 PHE A C    8  
ATOM 10866 O O    . PHE A 1 48 ? -7.329  7.989   -7.605  1.00 0.00 ? 48 PHE A O    8  
ATOM 10867 C CB   . PHE A 1 48 ? -6.835  8.317   -10.377 1.00 0.00 ? 48 PHE A CB   8  
ATOM 10868 C CG   . PHE A 1 48 ? -6.890  8.709   -11.855 1.00 0.00 ? 48 PHE A CG   8  
ATOM 10869 C CD1  . PHE A 1 48 ? -7.484  9.874   -12.227 1.00 0.00 ? 48 PHE A CD1  8  
ATOM 10870 C CD2  . PHE A 1 48 ? -6.345  7.892   -12.795 1.00 0.00 ? 48 PHE A CD2  8  
ATOM 10871 C CE1  . PHE A 1 48 ? -7.535  10.238  -13.599 1.00 0.00 ? 48 PHE A CE1  8  
ATOM 10872 C CE2  . PHE A 1 48 ? -6.396  8.256   -14.167 1.00 0.00 ? 48 PHE A CE2  8  
ATOM 10873 C CZ   . PHE A 1 48 ? -6.990  9.421   -14.540 1.00 0.00 ? 48 PHE A CZ   8  
ATOM 10874 H H    . PHE A 1 48 ? -8.821  9.657   -9.944  1.00 0.00 ? 48 PHE A H    8  
ATOM 10875 H HA   . PHE A 1 48 ? -8.467  6.842   -10.439 1.00 0.00 ? 48 PHE A HA   8  
ATOM 10876 H HB2  . PHE A 1 48 ? -6.602  9.202   -9.785  1.00 0.00 ? 48 PHE A HB2  8  
ATOM 10877 H HB3  . PHE A 1 48 ? -6.018  7.611   -10.229 1.00 0.00 ? 48 PHE A HB3  8  
ATOM 10878 H HD1  . PHE A 1 48 ? -7.921  10.529  -11.473 1.00 0.00 ? 48 PHE A HD1  8  
ATOM 10879 H HD2  . PHE A 1 48 ? -5.869  6.958   -12.497 1.00 0.00 ? 48 PHE A HD2  8  
ATOM 10880 H HE1  . PHE A 1 48 ? -8.011  11.172  -13.898 1.00 0.00 ? 48 PHE A HE1  8  
ATOM 10881 H HE2  . PHE A 1 48 ? -5.959  7.601   -14.921 1.00 0.00 ? 48 PHE A HE2  8  
ATOM 10882 H HZ   . PHE A 1 48 ? -7.029  9.700   -15.593 1.00 0.00 ? 48 PHE A HZ   8  
ATOM 10883 N N    . GLY A 1 49 ? -8.406  6.062   -8.097  1.00 0.00 ? 49 GLY A N    8  
ATOM 10884 C CA   . GLY A 1 49 ? -8.277  5.518   -6.756  1.00 0.00 ? 49 GLY A CA   8  
ATOM 10885 C C    . GLY A 1 49 ? -7.601  4.145   -6.785  1.00 0.00 ? 49 GLY A C    8  
ATOM 10886 O O    . GLY A 1 49 ? -7.770  3.386   -7.737  1.00 0.00 ? 49 GLY A O    8  
ATOM 10887 H H    . GLY A 1 49 ? -8.883  5.473   -8.749  1.00 0.00 ? 49 GLY A H    8  
ATOM 10888 H HA2  . GLY A 1 49 ? -7.696  6.201   -6.137  1.00 0.00 ? 49 GLY A HA2  8  
ATOM 10889 H HA3  . GLY A 1 49 ? -9.263  5.432   -6.298  1.00 0.00 ? 49 GLY A HA3  8  
ATOM 10890 N N    . ALA A 1 50 ? -6.849  3.870   -5.729  1.00 0.00 ? 50 ALA A N    8  
ATOM 10891 C CA   . ALA A 1 50 ? -6.147  2.602   -5.622  1.00 0.00 ? 50 ALA A CA   8  
ATOM 10892 C C    . ALA A 1 50 ? -6.038  2.208   -4.147  1.00 0.00 ? 50 ALA A C    8  
ATOM 10893 O O    . ALA A 1 50 ? -6.010  3.071   -3.271  1.00 0.00 ? 50 ALA A O    8  
ATOM 10894 C CB   . ALA A 1 50 ? -4.778  2.718   -6.296  1.00 0.00 ? 50 ALA A CB   8  
ATOM 10895 H H    . ALA A 1 50 ? -6.717  4.493   -4.959  1.00 0.00 ? 50 ALA A H    8  
ATOM 10896 H HA   . ALA A 1 50 ? -6.735  1.851   -6.148  1.00 0.00 ? 50 ALA A HA   8  
ATOM 10897 H HB1  . ALA A 1 50 ? -4.694  3.690   -6.782  1.00 0.00 ? 50 ALA A HB1  8  
ATOM 10898 H HB2  . ALA A 1 50 ? -3.994  2.617   -5.546  1.00 0.00 ? 50 ALA A HB2  8  
ATOM 10899 H HB3  . ALA A 1 50 ? -4.673  1.929   -7.041  1.00 0.00 ? 50 ALA A HB3  8  
ATOM 10900 N N    . SER A 1 51 ? -5.981  0.904   -3.919  1.00 0.00 ? 51 SER A N    8  
ATOM 10901 C CA   . SER A 1 51 ? -5.877  0.385   -2.566  1.00 0.00 ? 51 SER A CA   8  
ATOM 10902 C C    . SER A 1 51 ? -4.805  -0.705  -2.505  1.00 0.00 ? 51 SER A C    8  
ATOM 10903 O O    . SER A 1 51 ? -4.388  -1.229  -3.537  1.00 0.00 ? 51 SER A O    8  
ATOM 10904 C CB   . SER A 1 51 ? -7.220  -0.164  -2.081  1.00 0.00 ? 51 SER A CB   8  
ATOM 10905 O OG   . SER A 1 51 ? -7.610  -1.331  -2.800  1.00 0.00 ? 51 SER A OG   8  
ATOM 10906 H H    . SER A 1 51 ? -6.005  0.209   -4.638  1.00 0.00 ? 51 SER A H    8  
ATOM 10907 H HA   . SER A 1 51 ? -5.590  1.238   -1.951  1.00 0.00 ? 51 SER A HA   8  
ATOM 10908 H HB2  . SER A 1 51 ? -7.154  -0.398  -1.019  1.00 0.00 ? 51 SER A HB2  8  
ATOM 10909 H HB3  . SER A 1 51 ? -7.986  0.603   -2.192  1.00 0.00 ? 51 SER A HB3  8  
ATOM 10910 H HG   . SER A 1 51 ? -8.035  -1.989  -2.179  1.00 0.00 ? 51 SER A HG   8  
ATOM 10911 N N    . VAL A 1 52 ? -4.389  -1.014  -1.285  1.00 0.00 ? 52 VAL A N    8  
ATOM 10912 C CA   . VAL A 1 52 ? -3.374  -2.032  -1.076  1.00 0.00 ? 52 VAL A CA   8  
ATOM 10913 C C    . VAL A 1 52 ? -3.960  -3.165  -0.232  1.00 0.00 ? 52 VAL A C    8  
ATOM 10914 O O    . VAL A 1 52 ? -4.074  -3.042  0.987   1.00 0.00 ? 52 VAL A O    8  
ATOM 10915 C CB   . VAL A 1 52 ? -2.126  -1.406  -0.451  1.00 0.00 ? 52 VAL A CB   8  
ATOM 10916 C CG1  . VAL A 1 52 ? -1.193  -2.482  0.108   1.00 0.00 ? 52 VAL A CG1  8  
ATOM 10917 C CG2  . VAL A 1 52 ? -1.395  -0.517  -1.460  1.00 0.00 ? 52 VAL A CG2  8  
ATOM 10918 H H    . VAL A 1 52 ? -4.733  -0.583  -0.451  1.00 0.00 ? 52 VAL A H    8  
ATOM 10919 H HA   . VAL A 1 52 ? -3.099  -2.428  -2.054  1.00 0.00 ? 52 VAL A HA   8  
ATOM 10920 H HB   . VAL A 1 52 ? -2.446  -0.776  0.379   1.00 0.00 ? 52 VAL A HB   8  
ATOM 10921 H HG11 . VAL A 1 52 ? -1.717  -3.053  0.875   1.00 0.00 ? 52 VAL A HG11 8  
ATOM 10922 H HG12 . VAL A 1 52 ? -0.886  -3.150  -0.697  1.00 0.00 ? 52 VAL A HG12 8  
ATOM 10923 H HG13 . VAL A 1 52 ? -0.313  -2.010  0.544   1.00 0.00 ? 52 VAL A HG13 8  
ATOM 10924 H HG21 . VAL A 1 52 ? -1.264  -1.061  -2.395  1.00 0.00 ? 52 VAL A HG21 8  
ATOM 10925 H HG22 . VAL A 1 52 ? -1.981  0.384   -1.643  1.00 0.00 ? 52 VAL A HG22 8  
ATOM 10926 H HG23 . VAL A 1 52 ? -0.419  -0.241  -1.061  1.00 0.00 ? 52 VAL A HG23 8  
ATOM 10927 N N    . THR A 1 53 ? -4.318  -4.244  -0.913  1.00 0.00 ? 53 THR A N    8  
ATOM 10928 C CA   . THR A 1 53 ? -4.889  -5.398  -0.241  1.00 0.00 ? 53 THR A CA   8  
ATOM 10929 C C    . THR A 1 53 ? -3.811  -6.451  0.021   1.00 0.00 ? 53 THR A C    8  
ATOM 10930 O O    . THR A 1 53 ? -3.138  -6.900  -0.905  1.00 0.00 ? 53 THR A O    8  
ATOM 10931 C CB   . THR A 1 53 ? -6.049  -5.916  -1.095  1.00 0.00 ? 53 THR A CB   8  
ATOM 10932 O OG1  . THR A 1 53 ? -5.607  -5.721  -2.436  1.00 0.00 ? 53 THR A OG1  8  
ATOM 10933 C CG2  . THR A 1 53 ? -7.297  -5.038  -0.982  1.00 0.00 ? 53 THR A CG2  8  
ATOM 10934 H H    . THR A 1 53 ? -4.222  -4.336  -1.904  1.00 0.00 ? 53 THR A H    8  
ATOM 10935 H HA   . THR A 1 53 ? -5.267  -5.078  0.730   1.00 0.00 ? 53 THR A HA   8  
ATOM 10936 H HB   . THR A 1 53 ? -6.279  -6.953  -0.851  1.00 0.00 ? 53 THR A HB   8  
ATOM 10937 H HG1  . THR A 1 53 ? -5.833  -6.521  -2.990  1.00 0.00 ? 53 THR A HG1  8  
ATOM 10938 H HG21 . THR A 1 53 ? -7.174  -4.337  -0.156  1.00 0.00 ? 53 THR A HG21 8  
ATOM 10939 H HG22 . THR A 1 53 ? -7.437  -4.485  -1.911  1.00 0.00 ? 53 THR A HG22 8  
ATOM 10940 H HG23 . THR A 1 53 ? -8.168  -5.667  -0.799  1.00 0.00 ? 53 THR A HG23 8  
ATOM 10941 N N    . ILE A 1 54 ? -3.680  -6.814  1.289   1.00 0.00 ? 54 ILE A N    8  
ATOM 10942 C CA   . ILE A 1 54 ? -2.694  -7.805  1.685   1.00 0.00 ? 54 ILE A CA   8  
ATOM 10943 C C    . ILE A 1 54 ? -3.374  -9.170  1.816   1.00 0.00 ? 54 ILE A C    8  
ATOM 10944 O O    . ILE A 1 54 ? -4.104  -9.414  2.776   1.00 0.00 ? 54 ILE A O    8  
ATOM 10945 C CB   . ILE A 1 54 ? -1.964  -7.358  2.953   1.00 0.00 ? 54 ILE A CB   8  
ATOM 10946 C CG1  . ILE A 1 54 ? -1.039  -6.174  2.665   1.00 0.00 ? 54 ILE A CG1  8  
ATOM 10947 C CG2  . ILE A 1 54 ? -1.216  -8.527  3.597   1.00 0.00 ? 54 ILE A CG2  8  
ATOM 10948 C CD1  . ILE A 1 54 ? -0.558  -5.524  3.964   1.00 0.00 ? 54 ILE A CD1  8  
ATOM 10949 H H    . ILE A 1 54 ? -4.231  -6.444  2.037   1.00 0.00 ? 54 ILE A H    8  
ATOM 10950 H HA   . ILE A 1 54 ? -1.952  -7.864  0.890   1.00 0.00 ? 54 ILE A HA   8  
ATOM 10951 H HB   . ILE A 1 54 ? -2.708  -7.017  3.673   1.00 0.00 ? 54 ILE A HB   8  
ATOM 10952 H HG12 . ILE A 1 54 ? -0.181  -6.513  2.084   1.00 0.00 ? 54 ILE A HG12 8  
ATOM 10953 H HG13 . ILE A 1 54 ? -1.564  -5.437  2.057   1.00 0.00 ? 54 ILE A HG13 8  
ATOM 10954 H HG21 . ILE A 1 54 ? -1.759  -8.865  4.479   1.00 0.00 ? 54 ILE A HG21 8  
ATOM 10955 H HG22 . ILE A 1 54 ? -1.139  -9.347  2.882   1.00 0.00 ? 54 ILE A HG22 8  
ATOM 10956 H HG23 . ILE A 1 54 ? -0.217  -8.203  3.887   1.00 0.00 ? 54 ILE A HG23 8  
ATOM 10957 H HD11 . ILE A 1 54 ? 0.263   -4.841  3.746   1.00 0.00 ? 54 ILE A HD11 8  
ATOM 10958 H HD12 . ILE A 1 54 ? -1.380  -4.972  4.419   1.00 0.00 ? 54 ILE A HD12 8  
ATOM 10959 H HD13 . ILE A 1 54 ? -0.215  -6.297  4.651   1.00 0.00 ? 54 ILE A HD13 8  
ATOM 10960 N N    . ASP A 1 55 ? -3.110  -10.023 0.837   1.00 0.00 ? 55 ASP A N    8  
ATOM 10961 C CA   . ASP A 1 55 ? -3.688  -11.356 0.831   1.00 0.00 ? 55 ASP A CA   8  
ATOM 10962 C C    . ASP A 1 55 ? -5.208  -11.248 0.704   1.00 0.00 ? 55 ASP A C    8  
ATOM 10963 O O    . ASP A 1 55 ? -5.925  -12.221 0.936   1.00 0.00 ? 55 ASP A O    8  
ATOM 10964 C CB   . ASP A 1 55 ? -3.373  -12.099 2.131   1.00 0.00 ? 55 ASP A CB   8  
ATOM 10965 C CG   . ASP A 1 55 ? -3.770  -13.576 2.144   1.00 0.00 ? 55 ASP A CG   8  
ATOM 10966 O OD1  . ASP A 1 55 ? -3.812  -14.163 1.041   1.00 0.00 ? 55 ASP A OD1  8  
ATOM 10967 O OD2  . ASP A 1 55 ? -4.024  -14.086 3.257   1.00 0.00 ? 55 ASP A OD2  8  
ATOM 10968 H H    . ASP A 1 55 ? -2.516  -9.816  0.060   1.00 0.00 ? 55 ASP A H    8  
ATOM 10969 H HA   . ASP A 1 55 ? -3.233  -11.861 -0.021  1.00 0.00 ? 55 ASP A HA   8  
ATOM 10970 H HB2  . ASP A 1 55 ? -2.303  -12.025 2.324   1.00 0.00 ? 55 ASP A HB2  8  
ATOM 10971 H HB3  . ASP A 1 55 ? -3.881  -11.594 2.953   1.00 0.00 ? 55 ASP A HB3  8  
ATOM 10972 N N    . GLY A 1 56 ? -5.657  -10.057 0.338   1.00 0.00 ? 56 GLY A N    8  
ATOM 10973 C CA   . GLY A 1 56 ? -7.079  -9.809  0.178   1.00 0.00 ? 56 GLY A CA   8  
ATOM 10974 C C    . GLY A 1 56 ? -7.570  -8.761  1.179   1.00 0.00 ? 56 GLY A C    8  
ATOM 10975 O O    . GLY A 1 56 ? -8.475  -7.985  0.878   1.00 0.00 ? 56 GLY A O    8  
ATOM 10976 H H    . GLY A 1 56 ? -5.067  -9.271  0.152   1.00 0.00 ? 56 GLY A H    8  
ATOM 10977 H HA2  . GLY A 1 56 ? -7.281  -9.469  -0.838  1.00 0.00 ? 56 GLY A HA2  8  
ATOM 10978 H HA3  . GLY A 1 56 ? -7.632  -10.738 0.319   1.00 0.00 ? 56 GLY A HA3  8  
ATOM 10979 N N    . VAL A 1 57 ? -6.949  -8.772  2.350   1.00 0.00 ? 57 VAL A N    8  
ATOM 10980 C CA   . VAL A 1 57 ? -7.311  -7.832  3.397   1.00 0.00 ? 57 VAL A CA   8  
ATOM 10981 C C    . VAL A 1 57 ? -6.847  -6.429  3.000   1.00 0.00 ? 57 VAL A C    8  
ATOM 10982 O O    . VAL A 1 57 ? -5.680  -6.229  2.664   1.00 0.00 ? 57 VAL A O    8  
ATOM 10983 C CB   . VAL A 1 57 ? -6.736  -8.295  4.737   1.00 0.00 ? 57 VAL A CB   8  
ATOM 10984 C CG1  . VAL A 1 57 ? -6.858  -7.197  5.795   1.00 0.00 ? 57 VAL A CG1  8  
ATOM 10985 C CG2  . VAL A 1 57 ? -7.409  -9.586  5.206   1.00 0.00 ? 57 VAL A CG2  8  
ATOM 10986 H H    . VAL A 1 57 ? -6.213  -9.406  2.587   1.00 0.00 ? 57 VAL A H    8  
ATOM 10987 H HA   . VAL A 1 57 ? -8.398  -7.832  3.478   1.00 0.00 ? 57 VAL A HA   8  
ATOM 10988 H HB   . VAL A 1 57 ? -5.676  -8.504  4.593   1.00 0.00 ? 57 VAL A HB   8  
ATOM 10989 H HG11 . VAL A 1 57 ? -6.227  -7.443  6.649   1.00 0.00 ? 57 VAL A HG11 8  
ATOM 10990 H HG12 . VAL A 1 57 ? -6.539  -6.245  5.370   1.00 0.00 ? 57 VAL A HG12 8  
ATOM 10991 H HG13 . VAL A 1 57 ? -7.896  -7.120  6.121   1.00 0.00 ? 57 VAL A HG13 8  
ATOM 10992 H HG21 . VAL A 1 57 ? -7.268  -9.700  6.281   1.00 0.00 ? 57 VAL A HG21 8  
ATOM 10993 H HG22 . VAL A 1 57 ? -8.475  -9.542  4.983   1.00 0.00 ? 57 VAL A HG22 8  
ATOM 10994 H HG23 . VAL A 1 57 ? -6.965  -10.437 4.689   1.00 0.00 ? 57 VAL A HG23 8  
ATOM 10995 N N    . THR A 1 58 ? -7.784  -5.494  3.052   1.00 0.00 ? 58 THR A N    8  
ATOM 10996 C CA   . THR A 1 58 ? -7.485  -4.116  2.702   1.00 0.00 ? 58 THR A CA   8  
ATOM 10997 C C    . THR A 1 58 ? -6.841  -3.392  3.886   1.00 0.00 ? 58 THR A C    8  
ATOM 10998 O O    . THR A 1 58 ? -7.309  -3.507  5.018   1.00 0.00 ? 58 THR A O    8  
ATOM 10999 C CB   . THR A 1 58 ? -8.781  -3.459  2.221   1.00 0.00 ? 58 THR A CB   8  
ATOM 11000 O OG1  . THR A 1 58 ? -9.267  -4.345  1.217   1.00 0.00 ? 58 THR A OG1  8  
ATOM 11001 C CG2  . THR A 1 58 ? -8.530  -2.149  1.472   1.00 0.00 ? 58 THR A CG2  8  
ATOM 11002 H H    . THR A 1 58 ? -8.730  -5.665  3.327   1.00 0.00 ? 58 THR A H    8  
ATOM 11003 H HA   . THR A 1 58 ? -6.755  -4.117  1.893   1.00 0.00 ? 58 THR A HA   8  
ATOM 11004 H HB   . THR A 1 58 ? -9.471  -3.307  3.050   1.00 0.00 ? 58 THR A HB   8  
ATOM 11005 H HG1  . THR A 1 58 ? -9.654  -5.164  1.641   1.00 0.00 ? 58 THR A HG1  8  
ATOM 11006 H HG21 . THR A 1 58 ? -8.198  -2.368  0.457   1.00 0.00 ? 58 THR A HG21 8  
ATOM 11007 H HG22 . THR A 1 58 ? -9.452  -1.569  1.435   1.00 0.00 ? 58 THR A HG22 8  
ATOM 11008 H HG23 . THR A 1 58 ? -7.760  -1.576  1.989   1.00 0.00 ? 58 THR A HG23 8  
ATOM 11009 N N    . TYR A 1 59 ? -5.776  -2.663  3.585   1.00 0.00 ? 59 TYR A N    8  
ATOM 11010 C CA   . TYR A 1 59 ? -5.063  -1.921  4.610   1.00 0.00 ? 59 TYR A CA   8  
ATOM 11011 C C    . TYR A 1 59 ? -5.120  -0.416  4.338   1.00 0.00 ? 59 TYR A C    8  
ATOM 11012 O O    . TYR A 1 59 ? -5.974  0.284   4.879   1.00 0.00 ? 59 TYR A O    8  
ATOM 11013 C CB   . TYR A 1 59 ? -3.608  -2.387  4.532   1.00 0.00 ? 59 TYR A CB   8  
ATOM 11014 C CG   . TYR A 1 59 ? -3.309  -3.637  5.362   1.00 0.00 ? 59 TYR A CG   8  
ATOM 11015 C CD1  . TYR A 1 59 ? -3.735  -4.874  4.923   1.00 0.00 ? 59 TYR A CD1  8  
ATOM 11016 C CD2  . TYR A 1 59 ? -2.615  -3.527  6.550   1.00 0.00 ? 59 TYR A CD2  8  
ATOM 11017 C CE1  . TYR A 1 59 ? -3.454  -6.051  5.704   1.00 0.00 ? 59 TYR A CE1  8  
ATOM 11018 C CE2  . TYR A 1 59 ? -2.334  -4.704  7.331   1.00 0.00 ? 59 TYR A CE2  8  
ATOM 11019 C CZ   . TYR A 1 59 ? -2.767  -5.908  6.869   1.00 0.00 ? 59 TYR A CZ   8  
ATOM 11020 O OH   . TYR A 1 59 ? -2.502  -7.019  7.607   1.00 0.00 ? 59 TYR A OH   8  
ATOM 11021 H H    . TYR A 1 59 ? -5.402  -2.575  2.662   1.00 0.00 ? 59 TYR A H    8  
ATOM 11022 H HA   . TYR A 1 59 ? -5.540  -2.127  5.568   1.00 0.00 ? 59 TYR A HA   8  
ATOM 11023 H HB2  . TYR A 1 59 ? -3.356  -2.586  3.491   1.00 0.00 ? 59 TYR A HB2  8  
ATOM 11024 H HB3  . TYR A 1 59 ? -2.959  -1.577  4.868   1.00 0.00 ? 59 TYR A HB3  8  
ATOM 11025 H HD1  . TYR A 1 59 ? -4.283  -4.961  3.985   1.00 0.00 ? 59 TYR A HD1  8  
ATOM 11026 H HD2  . TYR A 1 59 ? -2.279  -2.550  6.896   1.00 0.00 ? 59 TYR A HD2  8  
ATOM 11027 H HE1  . TYR A 1 59 ? -3.784  -7.034  5.369   1.00 0.00 ? 59 TYR A HE1  8  
ATOM 11028 H HE2  . TYR A 1 59 ? -1.786  -4.632  8.270   1.00 0.00 ? 59 TYR A HE2  8  
ATOM 11029 H HH   . TYR A 1 59 ? -1.769  -6.829  8.260   1.00 0.00 ? 59 TYR A HH   8  
ATOM 11030 N N    . GLY A 1 60 ? -4.199  0.036   3.499   1.00 0.00 ? 60 GLY A N    8  
ATOM 11031 C CA   . GLY A 1 60 ? -4.134  1.445   3.148   1.00 0.00 ? 60 GLY A CA   8  
ATOM 11032 C C    . GLY A 1 60 ? -4.647  1.680   1.726   1.00 0.00 ? 60 GLY A C    8  
ATOM 11033 O O    . GLY A 1 60 ? -4.296  0.943   0.806   1.00 0.00 ? 60 GLY A O    8  
ATOM 11034 H H    . GLY A 1 60 ? -3.508  -0.541  3.063   1.00 0.00 ? 60 GLY A H    8  
ATOM 11035 H HA2  . GLY A 1 60 ? -4.726  2.027   3.854   1.00 0.00 ? 60 GLY A HA2  8  
ATOM 11036 H HA3  . GLY A 1 60 ? -3.105  1.796   3.230   1.00 0.00 ? 60 GLY A HA3  8  
ATOM 11037 N N    . SER A 1 61 ? -5.470  2.709   1.591   1.00 0.00 ? 61 SER A N    8  
ATOM 11038 C CA   . SER A 1 61 ? -6.036  3.051   0.297   1.00 0.00 ? 61 SER A CA   8  
ATOM 11039 C C    . SER A 1 61 ? -6.232  4.565   0.195   1.00 0.00 ? 61 SER A C    8  
ATOM 11040 O O    . SER A 1 61 ? -6.398  5.242   1.208   1.00 0.00 ? 61 SER A O    8  
ATOM 11041 C CB   . SER A 1 61 ? -7.364  2.327   0.068   1.00 0.00 ? 61 SER A CB   8  
ATOM 11042 O OG   . SER A 1 61 ? -8.474  3.087   0.536   1.00 0.00 ? 61 SER A OG   8  
ATOM 11043 H H    . SER A 1 61 ? -5.751  3.303   2.345   1.00 0.00 ? 61 SER A H    8  
ATOM 11044 H HA   . SER A 1 61 ? -5.305  2.709   -0.436  1.00 0.00 ? 61 SER A HA   8  
ATOM 11045 H HB2  . SER A 1 61 ? -7.486  2.123   -0.996  1.00 0.00 ? 61 SER A HB2  8  
ATOM 11046 H HB3  . SER A 1 61 ? -7.344  1.363   0.576   1.00 0.00 ? 61 SER A HB3  8  
ATOM 11047 H HG   . SER A 1 61 ? -9.318  2.756   0.113   1.00 0.00 ? 61 SER A HG   8  
ATOM 11048 N N    . GLY A 1 62 ? -6.207  5.051   -1.037  1.00 0.00 ? 62 GLY A N    8  
ATOM 11049 C CA   . GLY A 1 62 ? -6.380  6.472   -1.285  1.00 0.00 ? 62 GLY A CA   8  
ATOM 11050 C C    . GLY A 1 62 ? -6.517  6.755   -2.782  1.00 0.00 ? 62 GLY A C    8  
ATOM 11051 O O    . GLY A 1 62 ? -6.306  5.867   -3.607  1.00 0.00 ? 62 GLY A O    8  
ATOM 11052 H H    . GLY A 1 62 ? -6.072  4.493   -1.856  1.00 0.00 ? 62 GLY A H    8  
ATOM 11053 H HA2  . GLY A 1 62 ? -7.267  6.830   -0.761  1.00 0.00 ? 62 GLY A HA2  8  
ATOM 11054 H HA3  . GLY A 1 62 ? -5.529  7.021   -0.883  1.00 0.00 ? 62 GLY A HA3  8  
ATOM 11055 N N    . THR A 1 63 ? -6.868  7.996   -3.088  1.00 0.00 ? 63 THR A N    8  
ATOM 11056 C CA   . THR A 1 63 ? -7.035  8.407   -4.471  1.00 0.00 ? 63 THR A CA   8  
ATOM 11057 C C    . THR A 1 63 ? -6.156  9.621   -4.776  1.00 0.00 ? 63 THR A C    8  
ATOM 11058 O O    . THR A 1 63 ? -5.515  10.169  -3.881  1.00 0.00 ? 63 THR A O    8  
ATOM 11059 C CB   . THR A 1 63 ? -8.524  8.659   -4.714  1.00 0.00 ? 63 THR A CB   8  
ATOM 11060 O OG1  . THR A 1 63 ? -8.858  9.686   -3.784  1.00 0.00 ? 63 THR A OG1  8  
ATOM 11061 C CG2  . THR A 1 63 ? -9.395  7.474   -4.289  1.00 0.00 ? 63 THR A CG2  8  
ATOM 11062 H H    . THR A 1 63 ? -7.037  8.712   -2.411  1.00 0.00 ? 63 THR A H    8  
ATOM 11063 H HA   . THR A 1 63 ? -6.694  7.596   -5.114  1.00 0.00 ? 63 THR A HA   8  
ATOM 11064 H HB   . THR A 1 63 ? -8.710  8.925   -5.754  1.00 0.00 ? 63 THR A HB   8  
ATOM 11065 H HG1  . THR A 1 63 ? -8.837  9.323   -2.852  1.00 0.00 ? 63 THR A HG1  8  
ATOM 11066 H HG21 . THR A 1 63 ? -10.206 7.829   -3.654  1.00 0.00 ? 63 THR A HG21 8  
ATOM 11067 H HG22 . THR A 1 63 ? -9.811  6.993   -5.175  1.00 0.00 ? 63 THR A HG22 8  
ATOM 11068 H HG23 . THR A 1 63 ? -8.788  6.756   -3.737  1.00 0.00 ? 63 THR A HG23 8  
ATOM 11069 N N    . ALA A 1 64 ? -6.154  10.007  -6.044  1.00 0.00 ? 64 ALA A N    8  
ATOM 11070 C CA   . ALA A 1 64 ? -5.364  11.146  -6.478  1.00 0.00 ? 64 ALA A CA   8  
ATOM 11071 C C    . ALA A 1 64 ? -5.783  11.541  -7.896  1.00 0.00 ? 64 ALA A C    8  
ATOM 11072 O O    . ALA A 1 64 ? -6.705  10.955  -8.460  1.00 0.00 ? 64 ALA A O    8  
ATOM 11073 C CB   . ALA A 1 64 ? -3.876  10.802  -6.385  1.00 0.00 ? 64 ALA A CB   8  
ATOM 11074 H H    . ALA A 1 64 ? -6.678  9.556   -6.766  1.00 0.00 ? 64 ALA A H    8  
ATOM 11075 H HA   . ALA A 1 64 ? -5.576  11.974  -5.802  1.00 0.00 ? 64 ALA A HA   8  
ATOM 11076 H HB1  . ALA A 1 64 ? -3.297  11.540  -6.940  1.00 0.00 ? 64 ALA A HB1  8  
ATOM 11077 H HB2  . ALA A 1 64 ? -3.567  10.808  -5.340  1.00 0.00 ? 64 ALA A HB2  8  
ATOM 11078 H HB3  . ALA A 1 64 ? -3.705  9.813   -6.809  1.00 0.00 ? 64 ALA A HB3  8  
ATOM 11079 N N    . SER A 1 65 ? -5.086  12.534  -8.430  1.00 0.00 ? 65 SER A N    8  
ATOM 11080 C CA   . SER A 1 65 ? -5.375  13.014  -9.770  1.00 0.00 ? 65 SER A CA   8  
ATOM 11081 C C    . SER A 1 65 ? -4.904  11.990  -10.806 1.00 0.00 ? 65 SER A C    8  
ATOM 11082 O O    . SER A 1 65 ? -5.476  11.891  -11.890 1.00 0.00 ? 65 SER A O    8  
ATOM 11083 C CB   . SER A 1 65 ? -4.711  14.369  -10.025 1.00 0.00 ? 65 SER A CB   8  
ATOM 11084 O OG   . SER A 1 65 ? -5.194  14.985  -11.216 1.00 0.00 ? 65 SER A OG   8  
ATOM 11085 H H    . SER A 1 65 ? -4.338  13.006  -7.964  1.00 0.00 ? 65 SER A H    8  
ATOM 11086 H HA   . SER A 1 65 ? -6.458  13.127  -9.810  1.00 0.00 ? 65 SER A HA   8  
ATOM 11087 H HB2  . SER A 1 65 ? -4.896  15.028  -9.176  1.00 0.00 ? 65 SER A HB2  8  
ATOM 11088 H HB3  . SER A 1 65 ? -3.632  14.237  -10.096 1.00 0.00 ? 65 SER A HB3  8  
ATOM 11089 H HG   . SER A 1 65 ? -5.612  14.298  -11.810 1.00 0.00 ? 65 SER A HG   8  
ATOM 11090 N N    . SER A 1 66 ? -3.866  11.255  -10.434 1.00 0.00 ? 66 SER A N    8  
ATOM 11091 C CA   . SER A 1 66 ? -3.313  10.243  -11.317 1.00 0.00 ? 66 SER A CA   8  
ATOM 11092 C C    . SER A 1 66 ? -3.413  8.864   -10.661 1.00 0.00 ? 66 SER A C    8  
ATOM 11093 O O    . SER A 1 66 ? -3.963  8.731   -9.569  1.00 0.00 ? 66 SER A O    8  
ATOM 11094 C CB   . SER A 1 66 ? -1.858  10.557  -11.672 1.00 0.00 ? 66 SER A CB   8  
ATOM 11095 O OG   . SER A 1 66 ? -1.578  10.309  -13.047 1.00 0.00 ? 66 SER A OG   8  
ATOM 11096 H H    . SER A 1 66 ? -3.407  11.342  -9.551  1.00 0.00 ? 66 SER A H    8  
ATOM 11097 H HA   . SER A 1 66 ? -3.922  10.282  -12.220 1.00 0.00 ? 66 SER A HA   8  
ATOM 11098 H HB2  . SER A 1 66 ? -1.646  11.601  -11.442 1.00 0.00 ? 66 SER A HB2  8  
ATOM 11099 H HB3  . SER A 1 66 ? -1.195  9.953   -11.052 1.00 0.00 ? 66 SER A HB3  8  
ATOM 11100 H HG   . SER A 1 66 ? -2.427  10.119  -13.540 1.00 0.00 ? 66 SER A HG   8  
ATOM 11101 N N    . LYS A 1 67 ? -2.873  7.873   -11.354 1.00 0.00 ? 67 LYS A N    8  
ATOM 11102 C CA   . LYS A 1 67 ? -2.894  6.510   -10.852 1.00 0.00 ? 67 LYS A CA   8  
ATOM 11103 C C    . LYS A 1 67 ? -1.728  6.309   -9.883  1.00 0.00 ? 67 LYS A C    8  
ATOM 11104 O O    . LYS A 1 67 ? -1.899  5.727   -8.812  1.00 0.00 ? 67 LYS A O    8  
ATOM 11105 C CB   . LYS A 1 67 ? -2.908  5.512   -12.012 1.00 0.00 ? 67 LYS A CB   8  
ATOM 11106 C CG   . LYS A 1 67 ? -4.047  4.502   -11.854 1.00 0.00 ? 67 LYS A CG   8  
ATOM 11107 C CD   . LYS A 1 67 ? -4.254  3.702   -13.141 1.00 0.00 ? 67 LYS A CD   8  
ATOM 11108 C CE   . LYS A 1 67 ? -4.995  2.394   -12.861 1.00 0.00 ? 67 LYS A CE   8  
ATOM 11109 N NZ   . LYS A 1 67 ? -4.057  1.363   -12.362 1.00 0.00 ? 67 LYS A NZ   8  
ATOM 11110 H H    . LYS A 1 67 ? -2.427  7.989   -12.242 1.00 0.00 ? 67 LYS A H    8  
ATOM 11111 H HA   . LYS A 1 67 ? -3.827  6.378   -10.303 1.00 0.00 ? 67 LYS A HA   8  
ATOM 11112 H HB2  . LYS A 1 67 ? -3.020  6.046   -12.956 1.00 0.00 ? 67 LYS A HB2  8  
ATOM 11113 H HB3  . LYS A 1 67 ? -1.954  4.986   -12.056 1.00 0.00 ? 67 LYS A HB3  8  
ATOM 11114 H HG2  . LYS A 1 67 ? -3.823  3.823   -11.031 1.00 0.00 ? 67 LYS A HG2  8  
ATOM 11115 H HG3  . LYS A 1 67 ? -4.967  5.025   -11.594 1.00 0.00 ? 67 LYS A HG3  8  
ATOM 11116 H HD2  . LYS A 1 67 ? -4.820  4.299   -13.857 1.00 0.00 ? 67 LYS A HD2  8  
ATOM 11117 H HD3  . LYS A 1 67 ? -3.288  3.487   -13.599 1.00 0.00 ? 67 LYS A HD3  8  
ATOM 11118 H HE2  . LYS A 1 67 ? -5.781  2.564   -12.125 1.00 0.00 ? 67 LYS A HE2  8  
ATOM 11119 H HE3  . LYS A 1 67 ? -5.480  2.041   -13.771 1.00 0.00 ? 67 LYS A HE3  8  
ATOM 11120 H HZ1  . LYS A 1 67 ? -3.619  1.689   -11.523 1.00 0.00 ? 67 LYS A HZ1  8  
ATOM 11121 H HZ2  . LYS A 1 67 ? -4.559  0.520   -12.170 1.00 0.00 ? 67 LYS A HZ2  8  
ATOM 11122 H HZ3  . LYS A 1 67 ? -3.358  1.185   -13.055 1.00 0.00 ? 67 LYS A HZ3  8  
ATOM 11123 N N    . LYS A 1 68 ? -0.568  6.802   -10.292 1.00 0.00 ? 68 LYS A N    8  
ATOM 11124 C CA   . LYS A 1 68 ? 0.626   6.685   -9.472  1.00 0.00 ? 68 LYS A CA   8  
ATOM 11125 C C    . LYS A 1 68 ? 0.327   7.206   -8.065  1.00 0.00 ? 68 LYS A C    8  
ATOM 11126 O O    . LYS A 1 68 ? 0.425   6.463   -7.090  1.00 0.00 ? 68 LYS A O    8  
ATOM 11127 C CB   . LYS A 1 68 ? 1.809   7.380   -10.147 1.00 0.00 ? 68 LYS A CB   8  
ATOM 11128 C CG   . LYS A 1 68 ? 2.471   6.462   -11.177 1.00 0.00 ? 68 LYS A CG   8  
ATOM 11129 C CD   . LYS A 1 68 ? 3.969   6.754   -11.289 1.00 0.00 ? 68 LYS A CD   8  
ATOM 11130 C CE   . LYS A 1 68 ? 4.796   5.618   -10.684 1.00 0.00 ? 68 LYS A CE   8  
ATOM 11131 N NZ   . LYS A 1 68 ? 5.646   4.987   -11.718 1.00 0.00 ? 68 LYS A NZ   8  
ATOM 11132 H H    . LYS A 1 68 ? -0.438  7.274   -11.164 1.00 0.00 ? 68 LYS A H    8  
ATOM 11133 H HA   . LYS A 1 68 ? 0.871   5.625   -9.403  1.00 0.00 ? 68 LYS A HA   8  
ATOM 11134 H HB2  . LYS A 1 68 ? 1.470   8.294   -10.635 1.00 0.00 ? 68 LYS A HB2  8  
ATOM 11135 H HB3  . LYS A 1 68 ? 2.540   7.675   -9.394  1.00 0.00 ? 68 LYS A HB3  8  
ATOM 11136 H HG2  . LYS A 1 68 ? 2.320   5.421   -10.890 1.00 0.00 ? 68 LYS A HG2  8  
ATOM 11137 H HG3  . LYS A 1 68 ? 1.996   6.597   -12.148 1.00 0.00 ? 68 LYS A HG3  8  
ATOM 11138 H HD2  . LYS A 1 68 ? 4.239   6.886   -12.337 1.00 0.00 ? 68 LYS A HD2  8  
ATOM 11139 H HD3  . LYS A 1 68 ? 4.200   7.689   -10.780 1.00 0.00 ? 68 LYS A HD3  8  
ATOM 11140 H HE2  . LYS A 1 68 ? 5.420   6.004   -9.878  1.00 0.00 ? 68 LYS A HE2  8  
ATOM 11141 H HE3  . LYS A 1 68 ? 4.133   4.872   -10.244 1.00 0.00 ? 68 LYS A HE3  8  
ATOM 11142 H HZ1  . LYS A 1 68 ? 5.273   5.188   -12.624 1.00 0.00 ? 68 LYS A HZ1  8  
ATOM 11143 H HZ2  . LYS A 1 68 ? 6.575   5.349   -11.652 1.00 0.00 ? 68 LYS A HZ2  8  
ATOM 11144 H HZ3  . LYS A 1 68 ? 5.662   3.997   -11.577 1.00 0.00 ? 68 LYS A HZ3  8  
ATOM 11145 N N    . LEU A 1 69 ? -0.032  8.480   -8.005  1.00 0.00 ? 69 LEU A N    8  
ATOM 11146 C CA   . LEU A 1 69 ? -0.345  9.110   -6.733  1.00 0.00 ? 69 LEU A CA   8  
ATOM 11147 C C    . LEU A 1 69 ? -1.180  8.148   -5.885  1.00 0.00 ? 69 LEU A C    8  
ATOM 11148 O O    . LEU A 1 69 ? -0.810  7.829   -4.756  1.00 0.00 ? 69 LEU A O    8  
ATOM 11149 C CB   . LEU A 1 69 ? -1.012  10.468  -6.958  1.00 0.00 ? 69 LEU A CB   8  
ATOM 11150 C CG   . LEU A 1 69 ? -0.086  11.605  -7.398  1.00 0.00 ? 69 LEU A CG   8  
ATOM 11151 C CD1  . LEU A 1 69 ? 0.426   12.393  -6.191  1.00 0.00 ? 69 LEU A CD1  8  
ATOM 11152 C CD2  . LEU A 1 69 ? 1.058   11.076  -8.265  1.00 0.00 ? 69 LEU A CD2  8  
ATOM 11153 H H    . LEU A 1 69 ? -0.109  9.078   -8.803  1.00 0.00 ? 69 LEU A H    8  
ATOM 11154 H HA   . LEU A 1 69 ? 0.598   9.294   -6.219  1.00 0.00 ? 69 LEU A HA   8  
ATOM 11155 H HB2  . LEU A 1 69 ? -1.791  10.349  -7.711  1.00 0.00 ? 69 LEU A HB2  8  
ATOM 11156 H HB3  . LEU A 1 69 ? -1.505  10.766  -6.033  1.00 0.00 ? 69 LEU A HB3  8  
ATOM 11157 H HG   . LEU A 1 69 ? -0.663  12.296  -8.012  1.00 0.00 ? 69 LEU A HG   8  
ATOM 11158 H HD11 . LEU A 1 69 ? 1.285   11.878  -5.759  1.00 0.00 ? 69 LEU A HD11 8  
ATOM 11159 H HD12 . LEU A 1 69 ? 0.724   13.392  -6.509  1.00 0.00 ? 69 LEU A HD12 8  
ATOM 11160 H HD13 . LEU A 1 69 ? -0.364  12.469  -5.444  1.00 0.00 ? 69 LEU A HD13 8  
ATOM 11161 H HD21 . LEU A 1 69 ? 0.673   10.801  -9.247  1.00 0.00 ? 69 LEU A HD21 8  
ATOM 11162 H HD22 . LEU A 1 69 ? 1.817   11.850  -8.376  1.00 0.00 ? 69 LEU A HD22 8  
ATOM 11163 H HD23 . LEU A 1 69 ? 1.499   10.199  -7.789  1.00 0.00 ? 69 LEU A HD23 8  
ATOM 11164 N N    . ALA A 1 70 ? -2.291  7.713   -6.462  1.00 0.00 ? 70 ALA A N    8  
ATOM 11165 C CA   . ALA A 1 70 ? -3.181  6.794   -5.773  1.00 0.00 ? 70 ALA A CA   8  
ATOM 11166 C C    . ALA A 1 70 ? -2.366  5.633   -5.201  1.00 0.00 ? 70 ALA A C    8  
ATOM 11167 O O    . ALA A 1 70 ? -2.414  5.367   -4.001  1.00 0.00 ? 70 ALA A O    8  
ATOM 11168 C CB   . ALA A 1 70 ? -4.272  6.322   -6.736  1.00 0.00 ? 70 ALA A CB   8  
ATOM 11169 H H    . ALA A 1 70 ? -2.584  7.977   -7.380  1.00 0.00 ? 70 ALA A H    8  
ATOM 11170 H HA   . ALA A 1 70 ? -3.649  7.338   -4.952  1.00 0.00 ? 70 ALA A HA   8  
ATOM 11171 H HB1  . ALA A 1 70 ? -4.585  7.154   -7.367  1.00 0.00 ? 70 ALA A HB1  8  
ATOM 11172 H HB2  . ALA A 1 70 ? -3.882  5.519   -7.362  1.00 0.00 ? 70 ALA A HB2  8  
ATOM 11173 H HB3  . ALA A 1 70 ? -5.127  5.957   -6.166  1.00 0.00 ? 70 ALA A HB3  8  
ATOM 11174 N N    . LYS A 1 71 ? -1.636  4.971   -6.088  1.00 0.00 ? 71 LYS A N    8  
ATOM 11175 C CA   . LYS A 1 71 ? -0.811  3.845   -5.686  1.00 0.00 ? 71 LYS A CA   8  
ATOM 11176 C C    . LYS A 1 71 ? 0.165   4.295   -4.597  1.00 0.00 ? 71 LYS A C    8  
ATOM 11177 O O    . LYS A 1 71 ? 0.304   3.631   -3.570  1.00 0.00 ? 71 LYS A O    8  
ATOM 11178 C CB   . LYS A 1 71 ? -0.127  3.220   -6.904  1.00 0.00 ? 71 LYS A CB   8  
ATOM 11179 C CG   . LYS A 1 71 ? -0.330  1.704   -6.930  1.00 0.00 ? 71 LYS A CG   8  
ATOM 11180 C CD   . LYS A 1 71 ? 0.303   1.087   -8.179  1.00 0.00 ? 71 LYS A CD   8  
ATOM 11181 C CE   . LYS A 1 71 ? 1.625   0.395   -7.838  1.00 0.00 ? 71 LYS A CE   8  
ATOM 11182 N NZ   . LYS A 1 71 ? 2.667   0.754   -8.826  1.00 0.00 ? 71 LYS A NZ   8  
ATOM 11183 H H    . LYS A 1 71 ? -1.602  5.194   -7.062  1.00 0.00 ? 71 LYS A H    8  
ATOM 11184 H HA   . LYS A 1 71 ? -1.473  3.088   -5.266  1.00 0.00 ? 71 LYS A HA   8  
ATOM 11185 H HB2  . LYS A 1 71 ? -0.529  3.660   -7.817  1.00 0.00 ? 71 LYS A HB2  8  
ATOM 11186 H HB3  . LYS A 1 71 ? 0.939   3.448   -6.884  1.00 0.00 ? 71 LYS A HB3  8  
ATOM 11187 H HG2  . LYS A 1 71 ? 0.110   1.260   -6.037  1.00 0.00 ? 71 LYS A HG2  8  
ATOM 11188 H HG3  . LYS A 1 71 ? -1.395  1.476   -6.907  1.00 0.00 ? 71 LYS A HG3  8  
ATOM 11189 H HD2  . LYS A 1 71 ? -0.385  0.367   -8.622  1.00 0.00 ? 71 LYS A HD2  8  
ATOM 11190 H HD3  . LYS A 1 71 ? 0.476   1.863   -8.924  1.00 0.00 ? 71 LYS A HD3  8  
ATOM 11191 H HE2  . LYS A 1 71 ? 1.948   0.686   -6.839  1.00 0.00 ? 71 LYS A HE2  8  
ATOM 11192 H HE3  . LYS A 1 71 ? 1.484   -0.685  -7.826  1.00 0.00 ? 71 LYS A HE3  8  
ATOM 11193 H HZ1  . LYS A 1 71 ? 2.868   -0.038  -9.401  1.00 0.00 ? 71 LYS A HZ1  8  
ATOM 11194 H HZ2  . LYS A 1 71 ? 2.340   1.507   -9.398  1.00 0.00 ? 71 LYS A HZ2  8  
ATOM 11195 H HZ3  . LYS A 1 71 ? 3.498   1.038   -8.346  1.00 0.00 ? 71 LYS A HZ3  8  
ATOM 11196 N N    . ASN A 1 72 ? 0.815   5.419   -4.857  1.00 0.00 ? 72 ASN A N    8  
ATOM 11197 C CA   . ASN A 1 72 ? 1.773   5.965   -3.911  1.00 0.00 ? 72 ASN A CA   8  
ATOM 11198 C C    . ASN A 1 72 ? 1.107   6.109   -2.542  1.00 0.00 ? 72 ASN A C    8  
ATOM 11199 O O    . ASN A 1 72 ? 1.704   5.779   -1.519  1.00 0.00 ? 72 ASN A O    8  
ATOM 11200 C CB   . ASN A 1 72 ? 2.253   7.350   -4.351  1.00 0.00 ? 72 ASN A CB   8  
ATOM 11201 C CG   . ASN A 1 72 ? 3.081   7.262   -5.635  1.00 0.00 ? 72 ASN A CG   8  
ATOM 11202 O OD1  . ASN A 1 72 ? 3.527   6.203   -6.045  1.00 0.00 ? 72 ASN A OD1  8  
ATOM 11203 N ND2  . ASN A 1 72 ? 3.261   8.430   -6.244  1.00 0.00 ? 72 ASN A ND2  8  
ATOM 11204 H H    . ASN A 1 72 ? 0.696   5.953   -5.694  1.00 0.00 ? 72 ASN A H    8  
ATOM 11205 H HA   . ASN A 1 72 ? 2.601   5.256   -3.900  1.00 0.00 ? 72 ASN A HA   8  
ATOM 11206 H HB2  . ASN A 1 72 ? 1.394   8.002   -4.512  1.00 0.00 ? 72 ASN A HB2  8  
ATOM 11207 H HB3  . ASN A 1 72 ? 2.851   7.801   -3.559  1.00 0.00 ? 72 ASN A HB3  8  
ATOM 11208 H HD21 . ASN A 1 72 ? 2.868   9.263   -5.854  1.00 0.00 ? 72 ASN A HD21 8  
ATOM 11209 H HD22 . ASN A 1 72 ? 3.790   8.476   -7.091  1.00 0.00 ? 72 ASN A HD22 8  
ATOM 11210 N N    . LYS A 1 73 ? -0.123  6.602   -2.566  1.00 0.00 ? 73 LYS A N    8  
ATOM 11211 C CA   . LYS A 1 73 ? -0.877  6.793   -1.339  1.00 0.00 ? 73 LYS A CA   8  
ATOM 11212 C C    . LYS A 1 73 ? -1.309  5.431   -0.793  1.00 0.00 ? 73 LYS A C    8  
ATOM 11213 O O    . LYS A 1 73 ? -1.172  5.164   0.400   1.00 0.00 ? 73 LYS A O    8  
ATOM 11214 C CB   . LYS A 1 73 ? -2.040  7.760   -1.570  1.00 0.00 ? 73 LYS A CB   8  
ATOM 11215 C CG   . LYS A 1 73 ? -1.539  9.200   -1.701  1.00 0.00 ? 73 LYS A CG   8  
ATOM 11216 C CD   . LYS A 1 73 ? -2.584  10.084  -2.386  1.00 0.00 ? 73 LYS A CD   8  
ATOM 11217 C CE   . LYS A 1 73 ? -2.576  11.496  -1.798  1.00 0.00 ? 73 LYS A CE   8  
ATOM 11218 N NZ   . LYS A 1 73 ? -2.866  12.497  -2.850  1.00 0.00 ? 73 LYS A NZ   8  
ATOM 11219 H H    . LYS A 1 73 ? -0.602  6.869   -3.403  1.00 0.00 ? 73 LYS A H    8  
ATOM 11220 H HA   . LYS A 1 73 ? -0.209  7.260   -0.615  1.00 0.00 ? 73 LYS A HA   8  
ATOM 11221 H HB2  . LYS A 1 73 ? -2.581  7.476   -2.473  1.00 0.00 ? 73 LYS A HB2  8  
ATOM 11222 H HB3  . LYS A 1 73 ? -2.746  7.690   -0.742  1.00 0.00 ? 73 LYS A HB3  8  
ATOM 11223 H HG2  . LYS A 1 73 ? -1.310  9.600   -0.713  1.00 0.00 ? 73 LYS A HG2  8  
ATOM 11224 H HG3  . LYS A 1 73 ? -0.612  9.216   -2.274  1.00 0.00 ? 73 LYS A HG3  8  
ATOM 11225 H HD2  . LYS A 1 73 ? -2.381  10.130  -3.456  1.00 0.00 ? 73 LYS A HD2  8  
ATOM 11226 H HD3  . LYS A 1 73 ? -3.573  9.642   -2.267  1.00 0.00 ? 73 LYS A HD3  8  
ATOM 11227 H HE2  . LYS A 1 73 ? -3.318  11.570  -1.004  1.00 0.00 ? 73 LYS A HE2  8  
ATOM 11228 H HE3  . LYS A 1 73 ? -1.605  11.704  -1.348  1.00 0.00 ? 73 LYS A HE3  8  
ATOM 11229 H HZ1  . LYS A 1 73 ? -3.323  12.049  -3.619  1.00 0.00 ? 73 LYS A HZ1  8  
ATOM 11230 H HZ2  . LYS A 1 73 ? -3.461  13.209  -2.478  1.00 0.00 ? 73 LYS A HZ2  8  
ATOM 11231 H HZ3  . LYS A 1 73 ? -2.010  12.907  -3.164  1.00 0.00 ? 73 LYS A HZ3  8  
ATOM 11232 N N    . ALA A 1 74 ? -1.822  4.604   -1.693  1.00 0.00 ? 74 ALA A N    8  
ATOM 11233 C CA   . ALA A 1 74 ? -2.274  3.276   -1.316  1.00 0.00 ? 74 ALA A CA   8  
ATOM 11234 C C    . ALA A 1 74 ? -1.179  2.579   -0.507  1.00 0.00 ? 74 ALA A C    8  
ATOM 11235 O O    . ALA A 1 74 ? -1.449  2.014   0.552   1.00 0.00 ? 74 ALA A O    8  
ATOM 11236 C CB   . ALA A 1 74 ? -2.659  2.492   -2.573  1.00 0.00 ? 74 ALA A CB   8  
ATOM 11237 H H    . ALA A 1 74 ? -1.930  4.829   -2.661  1.00 0.00 ? 74 ALA A H    8  
ATOM 11238 H HA   . ALA A 1 74 ? -3.159  3.392   -0.691  1.00 0.00 ? 74 ALA A HA   8  
ATOM 11239 H HB1  . ALA A 1 74 ? -1.763  2.064   -3.023  1.00 0.00 ? 74 ALA A HB1  8  
ATOM 11240 H HB2  . ALA A 1 74 ? -3.348  1.692   -2.305  1.00 0.00 ? 74 ALA A HB2  8  
ATOM 11241 H HB3  . ALA A 1 74 ? -3.139  3.162   -3.286  1.00 0.00 ? 74 ALA A HB3  8  
ATOM 11242 N N    . ALA A 1 75 ? 0.034   2.642   -1.036  1.00 0.00 ? 75 ALA A N    8  
ATOM 11243 C CA   . ALA A 1 75 ? 1.171   2.024   -0.376  1.00 0.00 ? 75 ALA A CA   8  
ATOM 11244 C C    . ALA A 1 75 ? 1.552   2.850   0.855   1.00 0.00 ? 75 ALA A C    8  
ATOM 11245 O O    . ALA A 1 75 ? 1.630   2.320   1.963   1.00 0.00 ? 75 ALA A O    8  
ATOM 11246 C CB   . ALA A 1 75 ? 2.328   1.891   -1.368  1.00 0.00 ? 75 ALA A CB   8  
ATOM 11247 H H    . ALA A 1 75 ? 0.245   3.104   -1.897  1.00 0.00 ? 75 ALA A H    8  
ATOM 11248 H HA   . ALA A 1 75 ? 0.868   1.028   -0.055  1.00 0.00 ? 75 ALA A HA   8  
ATOM 11249 H HB1  . ALA A 1 75 ? 3.104   2.615   -1.121  1.00 0.00 ? 75 ALA A HB1  8  
ATOM 11250 H HB2  . ALA A 1 75 ? 2.740   0.883   -1.314  1.00 0.00 ? 75 ALA A HB2  8  
ATOM 11251 H HB3  . ALA A 1 75 ? 1.964   2.080   -2.378  1.00 0.00 ? 75 ALA A HB3  8  
ATOM 11252 N N    . ARG A 1 76 ? 1.778   4.134   0.620   1.00 0.00 ? 76 ARG A N    8  
ATOM 11253 C CA   . ARG A 1 76 ? 2.148   5.038   1.696   1.00 0.00 ? 76 ARG A CA   8  
ATOM 11254 C C    . ARG A 1 76 ? 1.250   4.810   2.913   1.00 0.00 ? 76 ARG A C    8  
ATOM 11255 O O    . ARG A 1 76 ? 1.710   4.890   4.052   1.00 0.00 ? 76 ARG A O    8  
ATOM 11256 C CB   . ARG A 1 76 ? 2.033   6.498   1.252   1.00 0.00 ? 76 ARG A CB   8  
ATOM 11257 C CG   . ARG A 1 76 ? 2.390   7.448   2.397   1.00 0.00 ? 76 ARG A CG   8  
ATOM 11258 C CD   . ARG A 1 76 ? 1.339   8.551   2.542   1.00 0.00 ? 76 ARG A CD   8  
ATOM 11259 N NE   . ARG A 1 76 ? 2.002   9.864   2.703   1.00 0.00 ? 76 ARG A NE   8  
ATOM 11260 C CZ   . ARG A 1 76 ? 2.717   10.467  1.743   1.00 0.00 ? 76 ARG A CZ   8  
ATOM 11261 N NH1  . ARG A 1 76 ? 2.865   9.879   0.548   1.00 0.00 ? 76 ARG A NH1  8  
ATOM 11262 N NH2  . ARG A 1 76 ? 3.284   11.658  1.978   1.00 0.00 ? 76 ARG A NH2  8  
ATOM 11263 H H    . ARG A 1 76 ? 1.712   4.557   -0.284  1.00 0.00 ? 76 ARG A H    8  
ATOM 11264 H HA   . ARG A 1 76 ? 3.186   4.792   1.922   1.00 0.00 ? 76 ARG A HA   8  
ATOM 11265 H HB2  . ARG A 1 76 ? 2.696   6.678   0.406   1.00 0.00 ? 76 ARG A HB2  8  
ATOM 11266 H HB3  . ARG A 1 76 ? 1.018   6.699   0.911   1.00 0.00 ? 76 ARG A HB3  8  
ATOM 11267 H HG2  . ARG A 1 76 ? 2.465   6.888   3.330   1.00 0.00 ? 76 ARG A HG2  8  
ATOM 11268 H HG3  . ARG A 1 76 ? 3.367   7.894   2.214   1.00 0.00 ? 76 ARG A HG3  8  
ATOM 11269 H HD2  . ARG A 1 76 ? 0.693   8.566   1.664   1.00 0.00 ? 76 ARG A HD2  8  
ATOM 11270 H HD3  . ARG A 1 76 ? 0.702   8.348   3.403   1.00 0.00 ? 76 ARG A HD3  8  
ATOM 11271 H HE   . ARG A 1 76 ? 1.911   10.330  3.583   1.00 0.00 ? 76 ARG A HE   8  
ATOM 11272 H HH11 . ARG A 1 76 ? 2.443   8.990   0.373   1.00 0.00 ? 76 ARG A HH11 8  
ATOM 11273 H HH12 . ARG A 1 76 ? 3.399   10.329  -0.168  1.00 0.00 ? 76 ARG A HH12 8  
ATOM 11274 H HH21 . ARG A 1 76 ? 3.173   12.097  2.870   1.00 0.00 ? 76 ARG A HH21 8  
ATOM 11275 H HH22 . ARG A 1 76 ? 3.817   12.109  1.262   1.00 0.00 ? 76 ARG A HH22 8  
ATOM 11276 N N    . ALA A 1 77 ? -0.014  4.530   2.632   1.00 0.00 ? 77 ALA A N    8  
ATOM 11277 C CA   . ALA A 1 77 ? -0.980  4.289   3.690   1.00 0.00 ? 77 ALA A CA   8  
ATOM 11278 C C    . ALA A 1 77 ? -0.625  2.988   4.414   1.00 0.00 ? 77 ALA A C    8  
ATOM 11279 O O    . ALA A 1 77 ? -0.253  3.007   5.586   1.00 0.00 ? 77 ALA A O    8  
ATOM 11280 C CB   . ALA A 1 77 ? -2.390  4.261   3.098   1.00 0.00 ? 77 ALA A CB   8  
ATOM 11281 H H    . ALA A 1 77 ? -0.379  4.466   1.704   1.00 0.00 ? 77 ALA A H    8  
ATOM 11282 H HA   . ALA A 1 77 ? -0.913  5.117   4.396   1.00 0.00 ? 77 ALA A HA   8  
ATOM 11283 H HB1  . ALA A 1 77 ? -3.113  4.061   3.889   1.00 0.00 ? 77 ALA A HB1  8  
ATOM 11284 H HB2  . ALA A 1 77 ? -2.611  5.224   2.638   1.00 0.00 ? 77 ALA A HB2  8  
ATOM 11285 H HB3  . ALA A 1 77 ? -2.451  3.476   2.343   1.00 0.00 ? 77 ALA A HB3  8  
ATOM 11286 N N    . THR A 1 78 ? -0.753  1.890   3.684   1.00 0.00 ? 78 THR A N    8  
ATOM 11287 C CA   . THR A 1 78 ? -0.450  0.582   4.241   1.00 0.00 ? 78 THR A CA   8  
ATOM 11288 C C    . THR A 1 78 ? 0.778   0.661   5.150   1.00 0.00 ? 78 THR A C    8  
ATOM 11289 O O    . THR A 1 78 ? 0.783   0.100   6.245   1.00 0.00 ? 78 THR A O    8  
ATOM 11290 C CB   . THR A 1 78 ? -0.284  -0.400  3.080   1.00 0.00 ? 78 THR A CB   8  
ATOM 11291 O OG1  . THR A 1 78 ? -1.614  -0.617  2.617   1.00 0.00 ? 78 THR A OG1  8  
ATOM 11292 C CG2  . THR A 1 78 ? 0.179   -1.782  3.544   1.00 0.00 ? 78 THR A CG2  8  
ATOM 11293 H H    . THR A 1 78 ? -1.056  1.883   2.731   1.00 0.00 ? 78 THR A H    8  
ATOM 11294 H HA   . THR A 1 78 ? -1.289  0.272   4.864   1.00 0.00 ? 78 THR A HA   8  
ATOM 11295 H HB   . THR A 1 78 ? 0.388   0.003   2.323   1.00 0.00 ? 78 THR A HB   8  
ATOM 11296 H HG1  . THR A 1 78 ? -1.952  0.200   2.150   1.00 0.00 ? 78 THR A HG1  8  
ATOM 11297 H HG21 . THR A 1 78 ? 1.242   -1.748  3.783   1.00 0.00 ? 78 THR A HG21 8  
ATOM 11298 H HG22 . THR A 1 78 ? -0.383  -2.075  4.431   1.00 0.00 ? 78 THR A HG22 8  
ATOM 11299 H HG23 . THR A 1 78 ? 0.009   -2.508  2.749   1.00 0.00 ? 78 THR A HG23 8  
ATOM 11300 N N    . LEU A 1 79 ? 1.791   1.363   4.663   1.00 0.00 ? 79 LEU A N    8  
ATOM 11301 C CA   . LEU A 1 79 ? 3.023   1.523   5.417   1.00 0.00 ? 79 LEU A CA   8  
ATOM 11302 C C    . LEU A 1 79 ? 2.701   2.111   6.792   1.00 0.00 ? 79 LEU A C    8  
ATOM 11303 O O    . LEU A 1 79 ? 2.955   1.480   7.817   1.00 0.00 ? 79 LEU A O    8  
ATOM 11304 C CB   . LEU A 1 79 ? 4.037   2.344   4.619   1.00 0.00 ? 79 LEU A CB   8  
ATOM 11305 C CG   . LEU A 1 79 ? 5.008   1.546   3.746   1.00 0.00 ? 79 LEU A CG   8  
ATOM 11306 C CD1  . LEU A 1 79 ? 6.068   2.460   3.129   1.00 0.00 ? 79 LEU A CD1  8  
ATOM 11307 C CD2  . LEU A 1 79 ? 5.634   0.393   4.535   1.00 0.00 ? 79 LEU A CD2  8  
ATOM 11308 H H    . LEU A 1 79 ? 1.780   1.816   3.772   1.00 0.00 ? 79 LEU A H    8  
ATOM 11309 H HA   . LEU A 1 79 ? 3.451   0.530   5.558   1.00 0.00 ? 79 LEU A HA   8  
ATOM 11310 H HB2  . LEU A 1 79 ? 3.491   3.038   3.980   1.00 0.00 ? 79 LEU A HB2  8  
ATOM 11311 H HB3  . LEU A 1 79 ? 4.619   2.945   5.318   1.00 0.00 ? 79 LEU A HB3  8  
ATOM 11312 H HG   . LEU A 1 79 ? 4.445   1.105   2.924   1.00 0.00 ? 79 LEU A HG   8  
ATOM 11313 H HD11 . LEU A 1 79 ? 6.721   1.874   2.482   1.00 0.00 ? 79 LEU A HD11 8  
ATOM 11314 H HD12 . LEU A 1 79 ? 5.580   3.238   2.543   1.00 0.00 ? 79 LEU A HD12 8  
ATOM 11315 H HD13 . LEU A 1 79 ? 6.659   2.919   3.922   1.00 0.00 ? 79 LEU A HD13 8  
ATOM 11316 H HD21 . LEU A 1 79 ? 5.747   0.686   5.578   1.00 0.00 ? 79 LEU A HD21 8  
ATOM 11317 H HD22 . LEU A 1 79 ? 4.988   -0.483  4.472   1.00 0.00 ? 79 LEU A HD22 8  
ATOM 11318 H HD23 . LEU A 1 79 ? 6.611   0.155   4.115   1.00 0.00 ? 79 LEU A HD23 8  
ATOM 11319 N N    . GLU A 1 80 ? 2.146   3.314   6.770   1.00 0.00 ? 80 GLU A N    8  
ATOM 11320 C CA   . GLU A 1 80 ? 1.786   3.995   8.003   1.00 0.00 ? 80 GLU A CA   8  
ATOM 11321 C C    . GLU A 1 80 ? 1.067   3.033   8.950   1.00 0.00 ? 80 GLU A C    8  
ATOM 11322 O O    . GLU A 1 80 ? 1.441   2.908   10.115  1.00 0.00 ? 80 GLU A O    8  
ATOM 11323 C CB   . GLU A 1 80 ? 0.927   5.228   7.717   1.00 0.00 ? 80 GLU A CB   8  
ATOM 11324 C CG   . GLU A 1 80 ? 1.735   6.302   6.986   1.00 0.00 ? 80 GLU A CG   8  
ATOM 11325 C CD   . GLU A 1 80 ? 1.660   7.641   7.723   1.00 0.00 ? 80 GLU A CD   8  
ATOM 11326 O OE1  . GLU A 1 80 ? 1.680   7.603   8.972   1.00 0.00 ? 80 GLU A OE1  8  
ATOM 11327 O OE2  . GLU A 1 80 ? 1.583   8.672   7.020   1.00 0.00 ? 80 GLU A OE2  8  
ATOM 11328 H H    . GLU A 1 80 ? 1.942   3.821   5.933   1.00 0.00 ? 80 GLU A H    8  
ATOM 11329 H HA   . GLU A 1 80 ? 2.731   4.312   8.445   1.00 0.00 ? 80 GLU A HA   8  
ATOM 11330 H HB2  . GLU A 1 80 ? 0.064   4.943   7.114   1.00 0.00 ? 80 GLU A HB2  8  
ATOM 11331 H HB3  . GLU A 1 80 ? 0.541   5.632   8.653   1.00 0.00 ? 80 GLU A HB3  8  
ATOM 11332 H HG2  . GLU A 1 80 ? 2.775   5.987   6.903   1.00 0.00 ? 80 GLU A HG2  8  
ATOM 11333 H HG3  . GLU A 1 80 ? 1.355   6.420   5.971   1.00 0.00 ? 80 GLU A HG3  8  
ATOM 11334 N N    . ILE A 1 81 ? 0.047   2.377   8.415   1.00 0.00 ? 81 ILE A N    8  
ATOM 11335 C CA   . ILE A 1 81 ? -0.728  1.430   9.198   1.00 0.00 ? 81 ILE A CA   8  
ATOM 11336 C C    . ILE A 1 81 ? 0.223   0.547   10.008  1.00 0.00 ? 81 ILE A C    8  
ATOM 11337 O O    . ILE A 1 81 ? 0.083   0.430   11.225  1.00 0.00 ? 81 ILE A O    8  
ATOM 11338 C CB   . ILE A 1 81 ? -1.682  0.643   8.297   1.00 0.00 ? 81 ILE A CB   8  
ATOM 11339 C CG1  . ILE A 1 81 ? -2.824  1.531   7.800   1.00 0.00 ? 81 ILE A CG1  8  
ATOM 11340 C CG2  . ILE A 1 81 ? -2.197  -0.611  9.007   1.00 0.00 ? 81 ILE A CG2  8  
ATOM 11341 C CD1  . ILE A 1 81 ? -3.754  0.756   6.864   1.00 0.00 ? 81 ILE A CD1  8  
ATOM 11342 H H    . ILE A 1 81 ? -0.251  2.485   7.466   1.00 0.00 ? 81 ILE A H    8  
ATOM 11343 H HA   . ILE A 1 81 ? -1.341  2.005   9.892   1.00 0.00 ? 81 ILE A HA   8  
ATOM 11344 H HB   . ILE A 1 81 ? -1.126  0.312   7.420   1.00 0.00 ? 81 ILE A HB   8  
ATOM 11345 H HG12 . ILE A 1 81 ? -3.392  1.909   8.651   1.00 0.00 ? 81 ILE A HG12 8  
ATOM 11346 H HG13 . ILE A 1 81 ? -2.416  2.397   7.279   1.00 0.00 ? 81 ILE A HG13 8  
ATOM 11347 H HG21 . ILE A 1 81 ? -1.891  -0.587  10.053  1.00 0.00 ? 81 ILE A HG21 8  
ATOM 11348 H HG22 . ILE A 1 81 ? -3.285  -0.641  8.946   1.00 0.00 ? 81 ILE A HG22 8  
ATOM 11349 H HG23 . ILE A 1 81 ? -1.781  -1.496  8.526   1.00 0.00 ? 81 ILE A HG23 8  
ATOM 11350 H HD11 . ILE A 1 81 ? -3.588  -0.314  6.992   1.00 0.00 ? 81 ILE A HD11 8  
ATOM 11351 H HD12 . ILE A 1 81 ? -4.790  0.993   7.103   1.00 0.00 ? 81 ILE A HD12 8  
ATOM 11352 H HD13 . ILE A 1 81 ? -3.545  1.035   5.831   1.00 0.00 ? 81 ILE A HD13 8  
ATOM 11353 N N    . LEU A 1 82 ? 1.169   -0.053  9.301   1.00 0.00 ? 82 LEU A N    8  
ATOM 11354 C CA   . LEU A 1 82 ? 2.142   -0.923  9.939   1.00 0.00 ? 82 LEU A CA   8  
ATOM 11355 C C    . LEU A 1 82 ? 3.127   -0.074  10.745  1.00 0.00 ? 82 LEU A C    8  
ATOM 11356 O O    . LEU A 1 82 ? 3.111   -0.097  11.975  1.00 0.00 ? 82 LEU A O    8  
ATOM 11357 C CB   . LEU A 1 82 ? 2.813   -1.827  8.903   1.00 0.00 ? 82 LEU A CB   8  
ATOM 11358 C CG   . LEU A 1 82 ? 1.878   -2.513  7.906   1.00 0.00 ? 82 LEU A CG   8  
ATOM 11359 C CD1  . LEU A 1 82 ? 2.421   -2.402  6.479   1.00 0.00 ? 82 LEU A CD1  8  
ATOM 11360 C CD2  . LEU A 1 82 ? 1.618   -3.967  8.308   1.00 0.00 ? 82 LEU A CD2  8  
ATOM 11361 H H    . LEU A 1 82 ? 1.276   0.046   8.312   1.00 0.00 ? 82 LEU A H    8  
ATOM 11362 H HA   . LEU A 1 82 ? 1.600   -1.570  10.628  1.00 0.00 ? 82 LEU A HA   8  
ATOM 11363 H HB2  . LEU A 1 82 ? 3.535   -1.232  8.344   1.00 0.00 ? 82 LEU A HB2  8  
ATOM 11364 H HB3  . LEU A 1 82 ? 3.376   -2.596  9.432   1.00 0.00 ? 82 LEU A HB3  8  
ATOM 11365 H HG   . LEU A 1 82 ? 0.919   -1.997  7.926   1.00 0.00 ? 82 LEU A HG   8  
ATOM 11366 H HD11 . LEU A 1 82 ? 3.355   -1.840  6.489   1.00 0.00 ? 82 LEU A HD11 8  
ATOM 11367 H HD12 . LEU A 1 82 ? 2.601   -3.400  6.080   1.00 0.00 ? 82 LEU A HD12 8  
ATOM 11368 H HD13 . LEU A 1 82 ? 1.693   -1.886  5.853   1.00 0.00 ? 82 LEU A HD13 8  
ATOM 11369 H HD21 . LEU A 1 82 ? 0.551   -4.113  8.471   1.00 0.00 ? 82 LEU A HD21 8  
ATOM 11370 H HD22 . LEU A 1 82 ? 1.958   -4.630  7.513   1.00 0.00 ? 82 LEU A HD22 8  
ATOM 11371 H HD23 . LEU A 1 82 ? 2.161   -4.192  9.226   1.00 0.00 ? 82 LEU A HD23 8  
ATOM 11372 N N    . ILE A 1 83 ? 3.963   0.655   10.019  1.00 0.00 ? 83 ILE A N    8  
ATOM 11373 C CA   . ILE A 1 83 ? 4.953   1.509   10.651  1.00 0.00 ? 83 ILE A CA   8  
ATOM 11374 C C    . ILE A 1 83 ? 4.267   2.766   11.191  1.00 0.00 ? 83 ILE A C    8  
ATOM 11375 O O    . ILE A 1 83 ? 3.756   3.578   10.421  1.00 0.00 ? 83 ILE A O    8  
ATOM 11376 C CB   . ILE A 1 83 ? 6.102   1.804   9.684   1.00 0.00 ? 83 ILE A CB   8  
ATOM 11377 C CG1  . ILE A 1 83 ? 6.403   0.589   8.804   1.00 0.00 ? 83 ILE A CG1  8  
ATOM 11378 C CG2  . ILE A 1 83 ? 7.343   2.287   10.438  1.00 0.00 ? 83 ILE A CG2  8  
ATOM 11379 C CD1  . ILE A 1 83 ? 7.797   0.694   8.183   1.00 0.00 ? 83 ILE A CD1  8  
ATOM 11380 H H    . ILE A 1 83 ? 3.970   0.667   9.019   1.00 0.00 ? 83 ILE A H    8  
ATOM 11381 H HA   . ILE A 1 83 ? 5.373   0.957   11.492  1.00 0.00 ? 83 ILE A HA   8  
ATOM 11382 H HB   . ILE A 1 83 ? 5.792   2.612   9.022   1.00 0.00 ? 83 ILE A HB   8  
ATOM 11383 H HG12 . ILE A 1 83 ? 6.333   -0.322  9.399   1.00 0.00 ? 83 ILE A HG12 8  
ATOM 11384 H HG13 . ILE A 1 83 ? 5.654   0.513   8.015   1.00 0.00 ? 83 ILE A HG13 8  
ATOM 11385 H HG21 . ILE A 1 83 ? 7.039   2.934   11.260  1.00 0.00 ? 83 ILE A HG21 8  
ATOM 11386 H HG22 . ILE A 1 83 ? 7.885   1.428   10.833  1.00 0.00 ? 83 ILE A HG22 8  
ATOM 11387 H HG23 . ILE A 1 83 ? 7.987   2.843   9.757   1.00 0.00 ? 83 ILE A HG23 8  
ATOM 11388 H HD11 . ILE A 1 83 ? 8.024   1.739   7.973   1.00 0.00 ? 83 ILE A HD11 8  
ATOM 11389 H HD12 . ILE A 1 83 ? 8.535   0.294   8.879   1.00 0.00 ? 83 ILE A HD12 8  
ATOM 11390 H HD13 . ILE A 1 83 ? 7.826   0.122   7.255   1.00 0.00 ? 83 ILE A HD13 8  
ATOM 11391 N N    . PRO A 1 84 ? 4.276   2.889   12.545  1.00 0.00 ? 84 PRO A N    8  
ATOM 11392 C CA   . PRO A 1 84 ? 3.661   4.032   13.197  1.00 0.00 ? 84 PRO A CA   8  
ATOM 11393 C C    . PRO A 1 84 ? 4.527   5.284   13.042  1.00 0.00 ? 84 PRO A C    8  
ATOM 11394 O O    . PRO A 1 84 ? 4.010   6.398   12.985  1.00 0.00 ? 84 PRO A O    8  
ATOM 11395 C CB   . PRO A 1 84 ? 3.481   3.610   14.646  1.00 0.00 ? 84 PRO A CB   8  
ATOM 11396 C CG   . PRO A 1 84 ? 4.419   2.432   14.856  1.00 0.00 ? 84 PRO A CG   8  
ATOM 11397 C CD   . PRO A 1 84 ? 4.871   1.947   13.488  1.00 0.00 ? 84 PRO A CD   8  
ATOM 11398 H HA   . PRO A 1 84 ? 2.786   4.250   12.763  1.00 0.00 ? 84 PRO A HA   8  
ATOM 11399 H HB2  . PRO A 1 84 ? 3.723   4.428   15.324  1.00 0.00 ? 84 PRO A HB2  8  
ATOM 11400 H HB3  . PRO A 1 84 ? 2.448   3.326   14.845  1.00 0.00 ? 84 PRO A HB3  8  
ATOM 11401 H HG2  . PRO A 1 84 ? 5.278   2.731   15.458  1.00 0.00 ? 84 PRO A HG2  8  
ATOM 11402 H HG3  . PRO A 1 84 ? 3.913   1.633   15.397  1.00 0.00 ? 84 PRO A HG3  8  
ATOM 11403 H HD2  . PRO A 1 84 ? 5.958   1.941   13.409  1.00 0.00 ? 84 PRO A HD2  8  
ATOM 11404 H HD3  . PRO A 1 84 ? 4.532   0.929   13.298  1.00 0.00 ? 84 PRO A HD3  8  
ATOM 11405 N N    . ASP A 1 85 ? 5.831   5.058   12.979  1.00 0.00 ? 85 ASP A N    8  
ATOM 11406 C CA   . ASP A 1 85 ? 6.774   6.153   12.832  1.00 0.00 ? 85 ASP A CA   8  
ATOM 11407 C C    . ASP A 1 85 ? 7.730   5.846   11.677  1.00 0.00 ? 85 ASP A C    8  
ATOM 11408 O O    . ASP A 1 85 ? 8.881   5.473   11.902  1.00 0.00 ? 85 ASP A O    8  
ATOM 11409 C CB   . ASP A 1 85 ? 7.609   6.335   14.101  1.00 0.00 ? 85 ASP A CB   8  
ATOM 11410 C CG   . ASP A 1 85 ? 7.054   7.354   15.099  1.00 0.00 ? 85 ASP A CG   8  
ATOM 11411 O OD1  . ASP A 1 85 ? 6.267   8.216   14.652  1.00 0.00 ? 85 ASP A OD1  8  
ATOM 11412 O OD2  . ASP A 1 85 ? 7.430   7.248   16.286  1.00 0.00 ? 85 ASP A OD2  8  
ATOM 11413 H H    . ASP A 1 85 ? 6.244   4.148   13.026  1.00 0.00 ? 85 ASP A H    8  
ATOM 11414 H HA   . ASP A 1 85 ? 6.162   7.035   12.643  1.00 0.00 ? 85 ASP A HA   8  
ATOM 11415 H HB2  . ASP A 1 85 ? 7.698   5.371   14.601  1.00 0.00 ? 85 ASP A HB2  8  
ATOM 11416 H HB3  . ASP A 1 85 ? 8.616   6.640   13.815  1.00 0.00 ? 85 ASP A HB3  8  
ATOM 11417 N N    . PHE A 1 86 ? 7.219   6.013   10.467  1.00 0.00 ? 86 PHE A N    8  
ATOM 11418 C CA   . PHE A 1 86 ? 8.013   5.758   9.277   1.00 0.00 ? 86 PHE A CA   8  
ATOM 11419 C C    . PHE A 1 86 ? 8.714   7.033   8.802   1.00 0.00 ? 86 PHE A C    8  
ATOM 11420 O O    . PHE A 1 86 ? 9.846   6.981   8.323   1.00 0.00 ? 86 PHE A O    8  
ATOM 11421 C CB   . PHE A 1 86 ? 7.047   5.286   8.188   1.00 0.00 ? 86 PHE A CB   8  
ATOM 11422 C CG   . PHE A 1 86 ? 7.733   4.886   6.879   1.00 0.00 ? 86 PHE A CG   8  
ATOM 11423 C CD1  . PHE A 1 86 ? 8.738   3.971   6.891   1.00 0.00 ? 86 PHE A CD1  8  
ATOM 11424 C CD2  . PHE A 1 86 ? 7.336   5.447   5.705   1.00 0.00 ? 86 PHE A CD2  8  
ATOM 11425 C CE1  . PHE A 1 86 ? 9.374   3.600   5.676   1.00 0.00 ? 86 PHE A CE1  8  
ATOM 11426 C CE2  . PHE A 1 86 ? 7.973   5.076   4.491   1.00 0.00 ? 86 PHE A CE2  8  
ATOM 11427 C CZ   . PHE A 1 86 ? 8.978   4.161   4.502   1.00 0.00 ? 86 PHE A CZ   8  
ATOM 11428 H H    . PHE A 1 86 ? 6.282   6.317   10.293  1.00 0.00 ? 86 PHE A H    8  
ATOM 11429 H HA   . PHE A 1 86 ? 8.761   5.011   9.541   1.00 0.00 ? 86 PHE A HA   8  
ATOM 11430 H HB2  . PHE A 1 86 ? 6.480   4.434   8.564   1.00 0.00 ? 86 PHE A HB2  8  
ATOM 11431 H HB3  . PHE A 1 86 ? 6.330   6.081   7.982   1.00 0.00 ? 86 PHE A HB3  8  
ATOM 11432 H HD1  . PHE A 1 86 ? 9.056   3.521   7.831   1.00 0.00 ? 86 PHE A HD1  8  
ATOM 11433 H HD2  . PHE A 1 86 ? 6.531   6.181   5.697   1.00 0.00 ? 86 PHE A HD2  8  
ATOM 11434 H HE1  . PHE A 1 86 ? 10.180  2.866   5.685   1.00 0.00 ? 86 PHE A HE1  8  
ATOM 11435 H HE2  . PHE A 1 86 ? 7.655   5.526   3.550   1.00 0.00 ? 86 PHE A HE2  8  
ATOM 11436 H HZ   . PHE A 1 86 ? 9.466   3.876   3.570   1.00 0.00 ? 86 PHE A HZ   8  
ATOM 11437 N N    . VAL A 1 87 ? 8.013   8.147   8.952   1.00 0.00 ? 87 VAL A N    8  
ATOM 11438 C CA   . VAL A 1 87 ? 8.554   9.432   8.545   1.00 0.00 ? 87 VAL A CA   8  
ATOM 11439 C C    . VAL A 1 87 ? 8.162   10.495  9.573   1.00 0.00 ? 87 VAL A C    8  
ATOM 11440 O O    . VAL A 1 87 ? 6.984   10.820  9.717   1.00 0.00 ? 87 VAL A O    8  
ATOM 11441 C CB   . VAL A 1 87 ? 8.088   9.771   7.127   1.00 0.00 ? 87 VAL A CB   8  
ATOM 11442 C CG1  . VAL A 1 87 ? 8.812   8.909   6.091   1.00 0.00 ? 87 VAL A CG1  8  
ATOM 11443 C CG2  . VAL A 1 87 ? 6.570   9.623   6.999   1.00 0.00 ? 87 VAL A CG2  8  
ATOM 11444 H H    . VAL A 1 87 ? 7.093   8.180   9.343   1.00 0.00 ? 87 VAL A H    8  
ATOM 11445 H HA   . VAL A 1 87 ? 9.640   9.342   8.530   1.00 0.00 ? 87 VAL A HA   8  
ATOM 11446 H HB   . VAL A 1 87 ? 8.340   10.813  6.932   1.00 0.00 ? 87 VAL A HB   8  
ATOM 11447 H HG11 . VAL A 1 87 ? 9.063   9.519   5.223   1.00 0.00 ? 87 VAL A HG11 8  
ATOM 11448 H HG12 . VAL A 1 87 ? 9.726   8.506   6.529   1.00 0.00 ? 87 VAL A HG12 8  
ATOM 11449 H HG13 . VAL A 1 87 ? 8.164   8.089   5.784   1.00 0.00 ? 87 VAL A HG13 8  
ATOM 11450 H HG21 . VAL A 1 87 ? 6.299   9.559   5.946   1.00 0.00 ? 87 VAL A HG21 8  
ATOM 11451 H HG22 . VAL A 1 87 ? 6.249   8.717   7.513   1.00 0.00 ? 87 VAL A HG22 8  
ATOM 11452 H HG23 . VAL A 1 87 ? 6.082   10.488  7.448   1.00 0.00 ? 87 VAL A HG23 8  
ATOM 11453 N N    . LYS A 1 88 ? 9.171   11.007  10.262  1.00 0.00 ? 88 LYS A N    8  
ATOM 11454 C CA   . LYS A 1 88 ? 8.946   12.026  11.273  1.00 0.00 ? 88 LYS A CA   8  
ATOM 11455 C C    . LYS A 1 88 ? 7.938   13.048  10.745  1.00 0.00 ? 88 LYS A C    8  
ATOM 11456 O O    . LYS A 1 88 ? 6.850   13.196  11.299  1.00 0.00 ? 88 LYS A O    8  
ATOM 11457 C CB   . LYS A 1 88 ? 10.274  12.644  11.715  1.00 0.00 ? 88 LYS A CB   8  
ATOM 11458 C CG   . LYS A 1 88 ? 10.270  12.936  13.217  1.00 0.00 ? 88 LYS A CG   8  
ATOM 11459 C CD   . LYS A 1 88 ? 11.214  14.092  13.554  1.00 0.00 ? 88 LYS A CD   8  
ATOM 11460 C CE   . LYS A 1 88 ? 12.591  13.572  13.971  1.00 0.00 ? 88 LYS A CE   8  
ATOM 11461 N NZ   . LYS A 1 88 ? 13.456  13.385  12.785  1.00 0.00 ? 88 LYS A NZ   8  
ATOM 11462 H H    . LYS A 1 88 ? 10.126  10.737  10.139  1.00 0.00 ? 88 LYS A H    8  
ATOM 11463 H HA   . LYS A 1 88 ? 8.515   11.533  12.144  1.00 0.00 ? 88 LYS A HA   8  
ATOM 11464 H HB2  . LYS A 1 88 ? 11.093  11.966  11.475  1.00 0.00 ? 88 LYS A HB2  8  
ATOM 11465 H HB3  . LYS A 1 88 ? 10.453  13.566  11.162  1.00 0.00 ? 88 LYS A HB3  8  
ATOM 11466 H HG2  . LYS A 1 88 ? 9.258   13.182  13.540  1.00 0.00 ? 88 LYS A HG2  8  
ATOM 11467 H HG3  . LYS A 1 88 ? 10.572  12.044  13.766  1.00 0.00 ? 88 LYS A HG3  8  
ATOM 11468 H HD2  . LYS A 1 88 ? 11.316  14.747  12.688  1.00 0.00 ? 88 LYS A HD2  8  
ATOM 11469 H HD3  . LYS A 1 88 ? 10.788  14.692  14.358  1.00 0.00 ? 88 LYS A HD3  8  
ATOM 11470 H HE2  . LYS A 1 88 ? 13.057  14.275  14.662  1.00 0.00 ? 88 LYS A HE2  8  
ATOM 11471 H HE3  . LYS A 1 88 ? 12.483  12.627  14.503  1.00 0.00 ? 88 LYS A HE3  8  
ATOM 11472 H HZ1  . LYS A 1 88 ? 14.363  13.762  12.971  1.00 0.00 ? 88 LYS A HZ1  8  
ATOM 11473 H HZ2  . LYS A 1 88 ? 13.536  12.409  12.582  1.00 0.00 ? 88 LYS A HZ2  8  
ATOM 11474 H HZ3  . LYS A 1 88 ? 13.053  13.857  12.001  1.00 0.00 ? 88 LYS A HZ3  8  
ATOM 11475 N N    . GLN A 1 89 ? 8.336   13.728  9.679   1.00 0.00 ? 89 GLN A N    8  
ATOM 11476 C CA   . GLN A 1 89 ? 7.480   14.732  9.070   1.00 0.00 ? 89 GLN A CA   8  
ATOM 11477 C C    . GLN A 1 89 ? 7.065   15.776  10.109  1.00 0.00 ? 89 GLN A C    8  
ATOM 11478 O O    . GLN A 1 89 ? 6.233   15.501  10.972  1.00 0.00 ? 89 GLN A O    8  
ATOM 11479 C CB   . GLN A 1 89 ? 6.255   14.088  8.420   1.00 0.00 ? 89 GLN A CB   8  
ATOM 11480 C CG   . GLN A 1 89 ? 6.120   14.516  6.958   1.00 0.00 ? 89 GLN A CG   8  
ATOM 11481 C CD   . GLN A 1 89 ? 4.707   15.021  6.662   1.00 0.00 ? 89 GLN A CD   8  
ATOM 11482 O OE1  . GLN A 1 89 ? 3.758   14.261  6.553   1.00 0.00 ? 89 GLN A OE1  8  
ATOM 11483 N NE2  . GLN A 1 89 ? 4.619   16.342  6.538   1.00 0.00 ? 89 GLN A NE2  8  
ATOM 11484 H H    . GLN A 1 89 ? 9.222   13.602  9.234   1.00 0.00 ? 89 GLN A H    8  
ATOM 11485 H HA   . GLN A 1 89 ? 8.089   15.201  8.297   1.00 0.00 ? 89 GLN A HA   8  
ATOM 11486 H HB2  . GLN A 1 89 ? 6.336   13.002  8.479   1.00 0.00 ? 89 GLN A HB2  8  
ATOM 11487 H HB3  . GLN A 1 89 ? 5.356   14.370  8.969   1.00 0.00 ? 89 GLN A HB3  8  
ATOM 11488 H HG2  . GLN A 1 89 ? 6.844   15.300  6.737   1.00 0.00 ? 89 GLN A HG2  8  
ATOM 11489 H HG3  . GLN A 1 89 ? 6.354   13.674  6.305   1.00 0.00 ? 89 GLN A HG3  8  
ATOM 11490 H HE21 . GLN A 1 89 ? 5.437   16.909  6.639   1.00 0.00 ? 89 GLN A HE21 8  
ATOM 11491 H HE22 . GLN A 1 89 ? 3.736   16.769  6.344   1.00 0.00 ? 89 GLN A HE22 8  
ATOM 11492 N N    . THR A 1 90 ? 7.663   16.953  9.990   1.00 0.00 ? 90 THR A N    8  
ATOM 11493 C CA   . THR A 1 90 ? 7.365   18.039  10.908  1.00 0.00 ? 90 THR A CA   8  
ATOM 11494 C C    . THR A 1 90 ? 5.878   18.392  10.852  1.00 0.00 ? 90 THR A C    8  
ATOM 11495 O O    . THR A 1 90 ? 5.212   18.135  9.850   1.00 0.00 ? 90 THR A O    8  
ATOM 11496 C CB   . THR A 1 90 ? 8.282   19.214  10.563  1.00 0.00 ? 90 THR A CB   8  
ATOM 11497 O OG1  . THR A 1 90 ? 8.030   20.166  11.593  1.00 0.00 ? 90 THR A OG1  8  
ATOM 11498 C CG2  . THR A 1 90 ? 7.857   19.932  9.280   1.00 0.00 ? 90 THR A CG2  8  
ATOM 11499 H H    . THR A 1 90 ? 8.338   17.168  9.285   1.00 0.00 ? 90 THR A H    8  
ATOM 11500 H HA   . THR A 1 90 ? 7.575   17.700  11.922  1.00 0.00 ? 90 THR A HA   8  
ATOM 11501 H HB   . THR A 1 90 ? 9.322   18.892  10.502  1.00 0.00 ? 90 THR A HB   8  
ATOM 11502 H HG1  . THR A 1 90 ? 7.077   20.465  11.556  1.00 0.00 ? 90 THR A HG1  8  
ATOM 11503 H HG21 . THR A 1 90 ? 6.770   19.910  9.195   1.00 0.00 ? 90 THR A HG21 8  
ATOM 11504 H HG22 . THR A 1 90 ? 8.198   20.967  9.313   1.00 0.00 ? 90 THR A HG22 8  
ATOM 11505 H HG23 . THR A 1 90 ? 8.299   19.431  8.420   1.00 0.00 ? 90 THR A HG23 8  
ATOM 11506 N N    . SER A 1 91 ? 5.400   18.977  11.941  1.00 0.00 ? 91 SER A N    8  
ATOM 11507 C CA   . SER A 1 91 ? 4.003   19.368  12.028  1.00 0.00 ? 91 SER A CA   8  
ATOM 11508 C C    . SER A 1 91 ? 3.837   20.490  13.056  1.00 0.00 ? 91 SER A C    8  
ATOM 11509 O O    . SER A 1 91 ? 4.713   20.705  13.892  1.00 0.00 ? 91 SER A O    8  
ATOM 11510 C CB   . SER A 1 91 ? 3.119   18.176  12.397  1.00 0.00 ? 91 SER A CB   8  
ATOM 11511 O OG   . SER A 1 91 ? 3.415   17.673  13.697  1.00 0.00 ? 91 SER A OG   8  
ATOM 11512 H H    . SER A 1 91 ? 5.948   19.184  12.751  1.00 0.00 ? 91 SER A H    8  
ATOM 11513 H HA   . SER A 1 91 ? 3.739   19.721  11.031  1.00 0.00 ? 91 SER A HA   8  
ATOM 11514 H HB2  . SER A 1 91 ? 2.071   18.474  12.353  1.00 0.00 ? 91 SER A HB2  8  
ATOM 11515 H HB3  . SER A 1 91 ? 3.255   17.382  11.662  1.00 0.00 ? 91 SER A HB3  8  
ATOM 11516 H HG   . SER A 1 91 ? 3.547   16.683  13.659  1.00 0.00 ? 91 SER A HG   8  
ATOM 11517 N N    . GLU A 1 92 ? 2.707   21.175  12.960  1.00 0.00 ? 92 GLU A N    8  
ATOM 11518 C CA   . GLU A 1 92 ? 2.415   22.268  13.870  1.00 0.00 ? 92 GLU A CA   8  
ATOM 11519 C C    . GLU A 1 92 ? 0.933   22.643  13.792  1.00 0.00 ? 92 GLU A C    8  
ATOM 11520 O O    . GLU A 1 92 ? 0.592   23.770  13.437  1.00 0.00 ? 92 GLU A O    8  
ATOM 11521 C CB   . GLU A 1 92 ? 3.303   23.479  13.576  1.00 0.00 ? 92 GLU A CB   8  
ATOM 11522 C CG   . GLU A 1 92 ? 3.015   24.044  12.183  1.00 0.00 ? 92 GLU A CG   8  
ATOM 11523 C CD   . GLU A 1 92 ? 4.277   24.654  11.568  1.00 0.00 ? 92 GLU A CD   8  
ATOM 11524 O OE1  . GLU A 1 92 ? 5.294   23.928  11.523  1.00 0.00 ? 92 GLU A OE1  8  
ATOM 11525 O OE2  . GLU A 1 92 ? 4.195   25.831  11.156  1.00 0.00 ? 92 GLU A OE2  8  
ATOM 11526 H H    . GLU A 1 92 ? 1.999   20.993  12.277  1.00 0.00 ? 92 GLU A H    8  
ATOM 11527 H HA   . GLU A 1 92 ? 2.648   21.888  14.865  1.00 0.00 ? 92 GLU A HA   8  
ATOM 11528 H HB2  . GLU A 1 92 ? 3.133   24.250  14.327  1.00 0.00 ? 92 GLU A HB2  8  
ATOM 11529 H HB3  . GLU A 1 92 ? 4.352   23.191  13.646  1.00 0.00 ? 92 GLU A HB3  8  
ATOM 11530 H HG2  . GLU A 1 92 ? 2.637   23.252  11.537  1.00 0.00 ? 92 GLU A HG2  8  
ATOM 11531 H HG3  . GLU A 1 92 ? 2.235   24.802  12.248  1.00 0.00 ? 92 GLU A HG3  8  
ATOM 11532 N N    . SER A 1 93 ? 0.093   21.676  14.130  1.00 0.00 ? 93 SER A N    8  
ATOM 11533 C CA   . SER A 1 93 ? -1.344  21.890  14.102  1.00 0.00 ? 93 SER A CA   8  
ATOM 11534 C C    . SER A 1 93 ? -1.745  22.586  12.800  1.00 0.00 ? 93 SER A C    8  
ATOM 11535 O O    . SER A 1 93 ? -1.696  23.811  12.706  1.00 0.00 ? 93 SER A O    8  
ATOM 11536 C CB   . SER A 1 93 ? -1.801  22.715  15.307  1.00 0.00 ? 93 SER A CB   8  
ATOM 11537 O OG   . SER A 1 93 ? -2.095  21.895  16.435  1.00 0.00 ? 93 SER A OG   8  
ATOM 11538 H H    . SER A 1 93 ? 0.379   20.762  14.417  1.00 0.00 ? 93 SER A H    8  
ATOM 11539 H HA   . SER A 1 93 ? -1.785  20.895  14.156  1.00 0.00 ? 93 SER A HA   8  
ATOM 11540 H HB2  . SER A 1 93 ? -1.023  23.431  15.572  1.00 0.00 ? 93 SER A HB2  8  
ATOM 11541 H HB3  . SER A 1 93 ? -2.686  23.291  15.037  1.00 0.00 ? 93 SER A HB3  8  
ATOM 11542 H HG   . SER A 1 93 ? -1.997  20.930  16.192  1.00 0.00 ? 93 SER A HG   8  
ATOM 11543 N N    . GLY A 1 94 ? -2.132  21.773  11.828  1.00 0.00 ? 94 GLY A N    8  
ATOM 11544 C CA   . GLY A 1 94 ? -2.541  22.295  10.535  1.00 0.00 ? 94 GLY A CA   8  
ATOM 11545 C C    . GLY A 1 94 ? -4.065  22.305  10.405  1.00 0.00 ? 94 GLY A C    8  
ATOM 11546 O O    . GLY A 1 94 ? -4.768  21.755  11.252  1.00 0.00 ? 94 GLY A O    8  
ATOM 11547 H H    . GLY A 1 94 ? -2.169  20.778  11.912  1.00 0.00 ? 94 GLY A H    8  
ATOM 11548 H HA2  . GLY A 1 94 ? -2.155  23.307  10.409  1.00 0.00 ? 94 GLY A HA2  8  
ATOM 11549 H HA3  . GLY A 1 94 ? -2.108  21.688  9.740   1.00 0.00 ? 94 GLY A HA3  8  
ATOM 11550 N N    . PRO A 1 95 ? -4.545  22.953  9.309   1.00 0.00 ? 95 PRO A N    8  
ATOM 11551 C CA   . PRO A 1 95 ? -5.973  23.042  9.057   1.00 0.00 ? 95 PRO A CA   8  
ATOM 11552 C C    . PRO A 1 95 ? -6.524  21.707  8.552   1.00 0.00 ? 95 PRO A C    8  
ATOM 11553 O O    . PRO A 1 95 ? -7.616  21.295  8.940   1.00 0.00 ? 95 PRO A O    8  
ATOM 11554 C CB   . PRO A 1 95 ? -6.125  24.168  8.048   1.00 0.00 ? 95 PRO A CB   8  
ATOM 11555 C CG   . PRO A 1 95 ? -4.752  24.356  7.423   1.00 0.00 ? 95 PRO A CG   8  
ATOM 11556 C CD   . PRO A 1 95 ? -3.742  23.616  8.285   1.00 0.00 ? 95 PRO A CD   8  
ATOM 11557 H HA   . PRO A 1 95 ? -6.464  23.236  9.906   1.00 0.00 ? 95 PRO A HA   8  
ATOM 11558 H HB2  . PRO A 1 95 ? -6.868  23.916  7.290   1.00 0.00 ? 95 PRO A HB2  8  
ATOM 11559 H HB3  . PRO A 1 95 ? -6.463  25.084  8.532   1.00 0.00 ? 95 PRO A HB3  8  
ATOM 11560 H HG2  . PRO A 1 95 ? -4.740  23.970  6.404   1.00 0.00 ? 95 PRO A HG2  8  
ATOM 11561 H HG3  . PRO A 1 95 ? -4.501  25.415  7.365   1.00 0.00 ? 95 PRO A HG3  8  
ATOM 11562 H HD2  . PRO A 1 95 ? -3.174  22.894  7.698   1.00 0.00 ? 95 PRO A HD2  8  
ATOM 11563 H HD3  . PRO A 1 95 ? -3.022  24.303  8.729   1.00 0.00 ? 95 PRO A HD3  8  
ATOM 11564 N N    . SER A 1 96 ? -5.744  21.068  7.693   1.00 0.00 ? 96 SER A N    8  
ATOM 11565 C CA   . SER A 1 96 ? -6.140  19.788  7.131   1.00 0.00 ? 96 SER A CA   8  
ATOM 11566 C C    . SER A 1 96 ? -5.014  19.228  6.259   1.00 0.00 ? 96 SER A C    8  
ATOM 11567 O O    . SER A 1 96 ? -4.519  18.130  6.508   1.00 0.00 ? 96 SER A O    8  
ATOM 11568 C CB   . SER A 1 96 ? -7.428  19.920  6.314   1.00 0.00 ? 96 SER A CB   8  
ATOM 11569 O OG   . SER A 1 96 ? -7.353  20.983  5.368   1.00 0.00 ? 96 SER A OG   8  
ATOM 11570 H H    . SER A 1 96 ? -4.857  21.409  7.382   1.00 0.00 ? 96 SER A H    8  
ATOM 11571 H HA   . SER A 1 96 ? -6.319  19.139  7.988   1.00 0.00 ? 96 SER A HA   8  
ATOM 11572 H HB2  . SER A 1 96 ? -7.624  18.984  5.793   1.00 0.00 ? 96 SER A HB2  8  
ATOM 11573 H HB3  . SER A 1 96 ? -8.268  20.092  6.988   1.00 0.00 ? 96 SER A HB3  8  
ATOM 11574 H HG   . SER A 1 96 ? -6.989  21.806  5.806   1.00 0.00 ? 96 SER A HG   8  
ATOM 11575 N N    . SER A 1 97 ? -4.643  20.009  5.255   1.00 0.00 ? 97 SER A N    8  
ATOM 11576 C CA   . SER A 1 97 ? -3.585  19.605  4.345   1.00 0.00 ? 97 SER A CA   8  
ATOM 11577 C C    . SER A 1 97 ? -3.953  18.283  3.668   1.00 0.00 ? 97 SER A C    8  
ATOM 11578 O O    . SER A 1 97 ? -3.755  17.212  4.241   1.00 0.00 ? 97 SER A O    8  
ATOM 11579 C CB   . SER A 1 97 ? -2.248  19.472  5.078   1.00 0.00 ? 97 SER A CB   8  
ATOM 11580 O OG   . SER A 1 97 ? -1.522  20.698  5.090   1.00 0.00 ? 97 SER A OG   8  
ATOM 11581 H H    . SER A 1 97 ? -5.051  20.901  5.059   1.00 0.00 ? 97 SER A H    8  
ATOM 11582 H HA   . SER A 1 97 ? -3.516  20.405  3.608   1.00 0.00 ? 97 SER A HA   8  
ATOM 11583 H HB2  . SER A 1 97 ? -2.428  19.147  6.103   1.00 0.00 ? 97 SER A HB2  8  
ATOM 11584 H HB3  . SER A 1 97 ? -1.647  18.699  4.599   1.00 0.00 ? 97 SER A HB3  8  
ATOM 11585 H HG   . SER A 1 97 ? -0.708  20.607  5.664   1.00 0.00 ? 97 SER A HG   8  
ATOM 11586 N N    . GLY A 1 98 ? -4.482  18.400  2.459   1.00 0.00 ? 98 GLY A N    8  
ATOM 11587 C CA   . GLY A 1 98 ? -4.879  17.228  1.699   1.00 0.00 ? 98 GLY A CA   8  
ATOM 11588 C C    . GLY A 1 98 ? -6.295  16.786  2.072   1.00 0.00 ? 98 GLY A C    8  
ATOM 11589 O O    . GLY A 1 98 ? -7.118  16.522  1.197   1.00 0.00 ? 98 GLY A O    8  
ATOM 11590 H H    . GLY A 1 98 ? -4.639  19.275  2.000   1.00 0.00 ? 98 GLY A H    8  
ATOM 11591 H HA2  . GLY A 1 98 ? -4.832  17.448  0.632   1.00 0.00 ? 98 GLY A HA2  8  
ATOM 11592 H HA3  . GLY A 1 98 ? -4.179  16.414  1.887   1.00 0.00 ? 98 GLY A HA3  8  
ATOM 11593 N N    . GLY A 1 1  ? -15.091 -20.552 -5.568  1.00 0.00 ? 1  GLY A N    9  
ATOM 11594 C CA   . GLY A 1 1  ? -15.187 -19.607 -4.468  1.00 0.00 ? 1  GLY A CA   9  
ATOM 11595 C C    . GLY A 1 1  ? -15.811 -18.289 -4.930  1.00 0.00 ? 1  GLY A C    9  
ATOM 11596 O O    . GLY A 1 1  ? -17.029 -18.126 -4.887  1.00 0.00 ? 1  GLY A O    9  
ATOM 11597 H H1   . GLY A 1 1  ? -14.249 -20.492 -6.104  1.00 0.00 ? 1  GLY A H1   9  
ATOM 11598 H HA2  . GLY A 1 1  ? -15.789 -20.037 -3.667  1.00 0.00 ? 1  GLY A HA2  9  
ATOM 11599 H HA3  . GLY A 1 1  ? -14.195 -19.420 -4.056  1.00 0.00 ? 1  GLY A HA3  9  
ATOM 11600 N N    . SER A 1 2  ? -14.947 -17.382 -5.363  1.00 0.00 ? 2  SER A N    9  
ATOM 11601 C CA   . SER A 1 2  ? -15.398 -16.084 -5.833  1.00 0.00 ? 2  SER A CA   9  
ATOM 11602 C C    . SER A 1 2  ? -14.272 -15.384 -6.597  1.00 0.00 ? 2  SER A C    9  
ATOM 11603 O O    . SER A 1 2  ? -13.106 -15.756 -6.470  1.00 0.00 ? 2  SER A O    9  
ATOM 11604 C CB   . SER A 1 2  ? -15.872 -15.211 -4.670  1.00 0.00 ? 2  SER A CB   9  
ATOM 11605 O OG   . SER A 1 2  ? -14.807 -14.874 -3.786  1.00 0.00 ? 2  SER A OG   9  
ATOM 11606 H H    . SER A 1 2  ? -13.957 -17.523 -5.395  1.00 0.00 ? 2  SER A H    9  
ATOM 11607 H HA   . SER A 1 2  ? -16.237 -16.292 -6.496  1.00 0.00 ? 2  SER A HA   9  
ATOM 11608 H HB2  . SER A 1 2  ? -16.321 -14.298 -5.061  1.00 0.00 ? 2  SER A HB2  9  
ATOM 11609 H HB3  . SER A 1 2  ? -16.650 -15.736 -4.116  1.00 0.00 ? 2  SER A HB3  9  
ATOM 11610 H HG   . SER A 1 2  ? -14.655 -15.617 -3.134  1.00 0.00 ? 2  SER A HG   9  
ATOM 11611 N N    . SER A 1 3  ? -14.659 -14.382 -7.373  1.00 0.00 ? 3  SER A N    9  
ATOM 11612 C CA   . SER A 1 3  ? -13.697 -13.627 -8.157  1.00 0.00 ? 3  SER A CA   9  
ATOM 11613 C C    . SER A 1 3  ? -14.409 -12.517 -8.932  1.00 0.00 ? 3  SER A C    9  
ATOM 11614 O O    . SER A 1 3  ? -15.632 -12.537 -9.070  1.00 0.00 ? 3  SER A O    9  
ATOM 11615 C CB   . SER A 1 3  ? -12.933 -14.539 -9.118  1.00 0.00 ? 3  SER A CB   9  
ATOM 11616 O OG   . SER A 1 3  ? -13.697 -14.849 -10.281 1.00 0.00 ? 3  SER A OG   9  
ATOM 11617 H H    . SER A 1 3  ? -15.609 -14.086 -7.470  1.00 0.00 ? 3  SER A H    9  
ATOM 11618 H HA   . SER A 1 3  ? -13.003 -13.203 -7.431  1.00 0.00 ? 3  SER A HA   9  
ATOM 11619 H HB2  . SER A 1 3  ? -12.002 -14.055 -9.415  1.00 0.00 ? 3  SER A HB2  9  
ATOM 11620 H HB3  . SER A 1 3  ? -12.663 -15.462 -8.605  1.00 0.00 ? 3  SER A HB3  9  
ATOM 11621 H HG   . SER A 1 3  ? -13.949 -15.817 -10.277 1.00 0.00 ? 3  SER A HG   9  
ATOM 11622 N N    . GLY A 1 4  ? -13.615 -11.574 -9.417  1.00 0.00 ? 4  GLY A N    9  
ATOM 11623 C CA   . GLY A 1 4  ? -14.154 -10.457 -10.174 1.00 0.00 ? 4  GLY A CA   9  
ATOM 11624 C C    . GLY A 1 4  ? -13.109 -9.892  -11.138 1.00 0.00 ? 4  GLY A C    9  
ATOM 11625 O O    . GLY A 1 4  ? -12.873 -10.458 -12.205 1.00 0.00 ? 4  GLY A O    9  
ATOM 11626 H H    . GLY A 1 4  ? -12.622 -11.565 -9.300  1.00 0.00 ? 4  GLY A H    9  
ATOM 11627 H HA2  . GLY A 1 4  ? -15.032 -10.783 -10.733 1.00 0.00 ? 4  GLY A HA2  9  
ATOM 11628 H HA3  . GLY A 1 4  ? -14.484 -9.675  -9.490  1.00 0.00 ? 4  GLY A HA3  9  
ATOM 11629 N N    . SER A 1 5  ? -12.510 -8.784  -10.728 1.00 0.00 ? 5  SER A N    9  
ATOM 11630 C CA   . SER A 1 5  ? -11.496 -8.136  -11.541 1.00 0.00 ? 5  SER A CA   9  
ATOM 11631 C C    . SER A 1 5  ? -10.224 -8.986  -11.566 1.00 0.00 ? 5  SER A C    9  
ATOM 11632 O O    . SER A 1 5  ? -9.781  -9.478  -10.529 1.00 0.00 ? 5  SER A O    9  
ATOM 11633 C CB   . SER A 1 5  ? -11.185 -6.732  -11.020 1.00 0.00 ? 5  SER A CB   9  
ATOM 11634 O OG   . SER A 1 5  ? -10.296 -6.760  -9.907  1.00 0.00 ? 5  SER A OG   9  
ATOM 11635 H H    . SER A 1 5  ? -12.708 -8.330  -9.858  1.00 0.00 ? 5  SER A H    9  
ATOM 11636 H HA   . SER A 1 5  ? -11.928 -8.065  -12.539 1.00 0.00 ? 5  SER A HA   9  
ATOM 11637 H HB2  . SER A 1 5  ? -10.745 -6.137  -11.820 1.00 0.00 ? 5  SER A HB2  9  
ATOM 11638 H HB3  . SER A 1 5  ? -12.113 -6.239  -10.730 1.00 0.00 ? 5  SER A HB3  9  
ATOM 11639 H HG   . SER A 1 5  ? -9.376  -6.498  -10.197 1.00 0.00 ? 5  SER A HG   9  
ATOM 11640 N N    . SER A 1 6  ? -9.671  -9.133  -12.761 1.00 0.00 ? 6  SER A N    9  
ATOM 11641 C CA   . SER A 1 6  ? -8.459  -9.915  -12.935 1.00 0.00 ? 6  SER A CA   9  
ATOM 11642 C C    . SER A 1 6  ? -7.485  -9.174  -13.852 1.00 0.00 ? 6  SER A C    9  
ATOM 11643 O O    . SER A 1 6  ? -7.903  -8.396  -14.709 1.00 0.00 ? 6  SER A O    9  
ATOM 11644 C CB   . SER A 1 6  ? -8.774  -11.300 -13.504 1.00 0.00 ? 6  SER A CB   9  
ATOM 11645 O OG   . SER A 1 6  ? -9.836  -11.938 -12.799 1.00 0.00 ? 6  SER A OG   9  
ATOM 11646 H H    . SER A 1 6  ? -10.038 -8.730  -13.600 1.00 0.00 ? 6  SER A H    9  
ATOM 11647 H HA   . SER A 1 6  ? -8.038  -10.021 -11.935 1.00 0.00 ? 6  SER A HA   9  
ATOM 11648 H HB2  . SER A 1 6  ? -9.041  -11.207 -14.556 1.00 0.00 ? 6  SER A HB2  9  
ATOM 11649 H HB3  . SER A 1 6  ? -7.881  -11.923 -13.455 1.00 0.00 ? 6  SER A HB3  9  
ATOM 11650 H HG   . SER A 1 6  ? -9.984  -11.485 -11.920 1.00 0.00 ? 6  SER A HG   9  
ATOM 11651 N N    . GLY A 1 7  ? -6.204  -9.440  -13.641 1.00 0.00 ? 7  GLY A N    9  
ATOM 11652 C CA   . GLY A 1 7  ? -5.167  -8.808  -14.438 1.00 0.00 ? 7  GLY A CA   9  
ATOM 11653 C C    . GLY A 1 7  ? -4.416  -7.753  -13.624 1.00 0.00 ? 7  GLY A C    9  
ATOM 11654 O O    . GLY A 1 7  ? -4.974  -6.710  -13.286 1.00 0.00 ? 7  GLY A O    9  
ATOM 11655 H H    . GLY A 1 7  ? -5.873  -10.074 -12.942 1.00 0.00 ? 7  GLY A H    9  
ATOM 11656 H HA2  . GLY A 1 7  ? -4.467  -9.563  -14.796 1.00 0.00 ? 7  GLY A HA2  9  
ATOM 11657 H HA3  . GLY A 1 7  ? -5.612  -8.344  -15.318 1.00 0.00 ? 7  GLY A HA3  9  
ATOM 11658 N N    . GLU A 1 8  ? -3.161  -8.060  -13.331 1.00 0.00 ? 8  GLU A N    9  
ATOM 11659 C CA   . GLU A 1 8  ? -2.327  -7.152  -12.562 1.00 0.00 ? 8  GLU A CA   9  
ATOM 11660 C C    . GLU A 1 8  ? -0.851  -7.374  -12.897 1.00 0.00 ? 8  GLU A C    9  
ATOM 11661 O O    . GLU A 1 8  ? -0.260  -8.371  -12.484 1.00 0.00 ? 8  GLU A O    9  
ATOM 11662 C CB   . GLU A 1 8  ? -2.580  -7.313  -11.062 1.00 0.00 ? 8  GLU A CB   9  
ATOM 11663 C CG   . GLU A 1 8  ? -3.877  -6.617  -10.646 1.00 0.00 ? 8  GLU A CG   9  
ATOM 11664 C CD   . GLU A 1 8  ? -3.939  -6.434  -9.128  1.00 0.00 ? 8  GLU A CD   9  
ATOM 11665 O OE1  . GLU A 1 8  ? -2.956  -5.887  -8.582  1.00 0.00 ? 8  GLU A OE1  9  
ATOM 11666 O OE2  . GLU A 1 8  ? -4.967  -6.845  -8.548  1.00 0.00 ? 8  GLU A OE2  9  
ATOM 11667 H H    . GLU A 1 8  ? -2.714  -8.911  -13.609 1.00 0.00 ? 8  GLU A H    9  
ATOM 11668 H HA   . GLU A 1 8  ? -2.630  -6.151  -12.869 1.00 0.00 ? 8  GLU A HA   9  
ATOM 11669 H HB2  . GLU A 1 8  ? -2.635  -8.372  -10.810 1.00 0.00 ? 8  GLU A HB2  9  
ATOM 11670 H HB3  . GLU A 1 8  ? -1.743  -6.896  -10.501 1.00 0.00 ? 8  GLU A HB3  9  
ATOM 11671 H HG2  . GLU A 1 8  ? -3.946  -5.645  -11.136 1.00 0.00 ? 8  GLU A HG2  9  
ATOM 11672 H HG3  . GLU A 1 8  ? -4.732  -7.204  -10.980 1.00 0.00 ? 8  GLU A HG3  9  
ATOM 11673 N N    . PHE A 1 9  ? -0.297  -6.429  -13.642 1.00 0.00 ? 9  PHE A N    9  
ATOM 11674 C CA   . PHE A 1 9  ? 1.099   -6.509  -14.037 1.00 0.00 ? 9  PHE A CA   9  
ATOM 11675 C C    . PHE A 1 9  ? 1.741   -5.120  -14.066 1.00 0.00 ? 9  PHE A C    9  
ATOM 11676 O O    . PHE A 1 9  ? 1.183   -4.187  -14.642 1.00 0.00 ? 9  PHE A O    9  
ATOM 11677 C CB   . PHE A 1 9  ? 1.132   -7.103  -15.446 1.00 0.00 ? 9  PHE A CB   9  
ATOM 11678 C CG   . PHE A 1 9  ? 2.330   -8.017  -15.708 1.00 0.00 ? 9  PHE A CG   9  
ATOM 11679 C CD1  . PHE A 1 9  ? 2.512   -9.134  -14.954 1.00 0.00 ? 9  PHE A CD1  9  
ATOM 11680 C CD2  . PHE A 1 9  ? 3.215   -7.712  -16.695 1.00 0.00 ? 9  PHE A CD2  9  
ATOM 11681 C CE1  . PHE A 1 9  ? 3.624   -9.982  -15.197 1.00 0.00 ? 9  PHE A CE1  9  
ATOM 11682 C CE2  . PHE A 1 9  ? 4.327   -8.560  -16.938 1.00 0.00 ? 9  PHE A CE2  9  
ATOM 11683 C CZ   . PHE A 1 9  ? 4.509   -9.678  -16.184 1.00 0.00 ? 9  PHE A CZ   9  
ATOM 11684 H H    . PHE A 1 9  ? -0.785  -5.621  -13.973 1.00 0.00 ? 9  PHE A H    9  
ATOM 11685 H HA   . PHE A 1 9  ? 1.609   -7.127  -13.298 1.00 0.00 ? 9  PHE A HA   9  
ATOM 11686 H HB2  . PHE A 1 9  ? 0.214   -7.668  -15.613 1.00 0.00 ? 9  PHE A HB2  9  
ATOM 11687 H HB3  . PHE A 1 9  ? 1.142   -6.290  -16.172 1.00 0.00 ? 9  PHE A HB3  9  
ATOM 11688 H HD1  . PHE A 1 9  ? 1.803   -9.378  -14.162 1.00 0.00 ? 9  PHE A HD1  9  
ATOM 11689 H HD2  . PHE A 1 9  ? 3.070   -6.817  -17.300 1.00 0.00 ? 9  PHE A HD2  9  
ATOM 11690 H HE1  . PHE A 1 9  ? 3.770   -10.877 -14.592 1.00 0.00 ? 9  PHE A HE1  9  
ATOM 11691 H HE2  . PHE A 1 9  ? 5.036   -8.316  -17.730 1.00 0.00 ? 9  PHE A HE2  9  
ATOM 11692 H HZ   . PHE A 1 9  ? 5.363   -10.328 -16.371 1.00 0.00 ? 9  PHE A HZ   9  
ATOM 11693 N N    . VAL A 1 10 ? 2.904   -5.027  -13.439 1.00 0.00 ? 10 VAL A N    9  
ATOM 11694 C CA   . VAL A 1 10 ? 3.627   -3.769  -13.386 1.00 0.00 ? 10 VAL A CA   9  
ATOM 11695 C C    . VAL A 1 10 ? 4.985   -3.993  -12.716 1.00 0.00 ? 10 VAL A C    9  
ATOM 11696 O O    . VAL A 1 10 ? 5.094   -4.778  -11.776 1.00 0.00 ? 10 VAL A O    9  
ATOM 11697 C CB   . VAL A 1 10 ? 2.781   -2.707  -12.681 1.00 0.00 ? 10 VAL A CB   9  
ATOM 11698 C CG1  . VAL A 1 10 ? 2.526   -3.090  -11.222 1.00 0.00 ? 10 VAL A CG1  9  
ATOM 11699 C CG2  . VAL A 1 10 ? 3.436   -1.328  -12.780 1.00 0.00 ? 10 VAL A CG2  9  
ATOM 11700 H H    . VAL A 1 10 ? 3.350   -5.791  -12.973 1.00 0.00 ? 10 VAL A H    9  
ATOM 11701 H HA   . VAL A 1 10 ? 3.793   -3.441  -14.413 1.00 0.00 ? 10 VAL A HA   9  
ATOM 11702 H HB   . VAL A 1 10 ? 1.816   -2.657  -13.187 1.00 0.00 ? 10 VAL A HB   9  
ATOM 11703 H HG11 . VAL A 1 10 ? 3.339   -2.712  -10.600 1.00 0.00 ? 10 VAL A HG11 9  
ATOM 11704 H HG12 . VAL A 1 10 ? 1.583   -2.655  -10.891 1.00 0.00 ? 10 VAL A HG12 9  
ATOM 11705 H HG13 . VAL A 1 10 ? 2.477   -4.175  -11.134 1.00 0.00 ? 10 VAL A HG13 9  
ATOM 11706 H HG21 . VAL A 1 10 ? 3.473   -0.872  -11.791 1.00 0.00 ? 10 VAL A HG21 9  
ATOM 11707 H HG22 . VAL A 1 10 ? 4.448   -1.434  -13.170 1.00 0.00 ? 10 VAL A HG22 9  
ATOM 11708 H HG23 . VAL A 1 10 ? 2.852   -0.696  -13.450 1.00 0.00 ? 10 VAL A HG23 9  
ATOM 11709 N N    . ILE A 1 11 ? 5.984   -3.289  -13.227 1.00 0.00 ? 11 ILE A N    9  
ATOM 11710 C CA   . ILE A 1 11 ? 7.330   -3.401  -12.690 1.00 0.00 ? 11 ILE A CA   9  
ATOM 11711 C C    . ILE A 1 11 ? 8.005   -2.029  -12.727 1.00 0.00 ? 11 ILE A C    9  
ATOM 11712 O O    . ILE A 1 11 ? 8.353   -1.475  -11.685 1.00 0.00 ? 11 ILE A O    9  
ATOM 11713 C CB   . ILE A 1 11 ? 8.111   -4.492  -13.425 1.00 0.00 ? 11 ILE A CB   9  
ATOM 11714 C CG1  . ILE A 1 11 ? 7.449   -5.859  -13.241 1.00 0.00 ? 11 ILE A CG1  9  
ATOM 11715 C CG2  . ILE A 1 11 ? 9.578   -4.502  -12.992 1.00 0.00 ? 11 ILE A CG2  9  
ATOM 11716 C CD1  . ILE A 1 11 ? 7.507   -6.303  -11.778 1.00 0.00 ? 11 ILE A CD1  9  
ATOM 11717 H H    . ILE A 1 11 ? 5.886   -2.652  -13.992 1.00 0.00 ? 11 ILE A H    9  
ATOM 11718 H HA   . ILE A 1 11 ? 7.241   -3.714  -11.649 1.00 0.00 ? 11 ILE A HA   9  
ATOM 11719 H HB   . ILE A 1 11 ? 8.091   -4.266  -14.491 1.00 0.00 ? 11 ILE A HB   9  
ATOM 11720 H HG12 . ILE A 1 11 ? 6.411   -5.812  -13.569 1.00 0.00 ? 11 ILE A HG12 9  
ATOM 11721 H HG13 . ILE A 1 11 ? 7.949   -6.597  -13.868 1.00 0.00 ? 11 ILE A HG13 9  
ATOM 11722 H HG21 . ILE A 1 11 ? 9.678   -5.059  -12.061 1.00 0.00 ? 11 ILE A HG21 9  
ATOM 11723 H HG22 . ILE A 1 11 ? 10.182  -4.976  -13.766 1.00 0.00 ? 11 ILE A HG22 9  
ATOM 11724 H HG23 . ILE A 1 11 ? 9.919   -3.478  -12.841 1.00 0.00 ? 11 ILE A HG23 9  
ATOM 11725 H HD11 . ILE A 1 11 ? 7.953   -5.512  -11.175 1.00 0.00 ? 11 ILE A HD11 9  
ATOM 11726 H HD12 . ILE A 1 11 ? 6.498   -6.508  -11.420 1.00 0.00 ? 11 ILE A HD12 9  
ATOM 11727 H HD13 . ILE A 1 11 ? 8.111   -7.207  -11.696 1.00 0.00 ? 11 ILE A HD13 9  
ATOM 11728 N N    . ASN A 1 12 ? 8.172   -1.520  -13.939 1.00 0.00 ? 12 ASN A N    9  
ATOM 11729 C CA   . ASN A 1 12 ? 8.800   -0.223  -14.126 1.00 0.00 ? 12 ASN A CA   9  
ATOM 11730 C C    . ASN A 1 12 ? 10.115  -0.181  -13.346 1.00 0.00 ? 12 ASN A C    9  
ATOM 11731 O O    . ASN A 1 12 ? 10.126  0.144   -12.159 1.00 0.00 ? 12 ASN A O    9  
ATOM 11732 C CB   . ASN A 1 12 ? 7.904   0.903   -13.605 1.00 0.00 ? 12 ASN A CB   9  
ATOM 11733 C CG   . ASN A 1 12 ? 8.402   2.267   -14.088 1.00 0.00 ? 12 ASN A CG   9  
ATOM 11734 O OD1  . ASN A 1 12 ? 7.874   2.856   -15.016 1.00 0.00 ? 12 ASN A OD1  9  
ATOM 11735 N ND2  . ASN A 1 12 ? 9.445   2.734   -13.407 1.00 0.00 ? 12 ASN A ND2  9  
ATOM 11736 H H    . ASN A 1 12 ? 7.886   -1.977  -14.782 1.00 0.00 ? 12 ASN A H    9  
ATOM 11737 H HA   . ASN A 1 12 ? 8.950   -0.130  -15.202 1.00 0.00 ? 12 ASN A HA   9  
ATOM 11738 H HB2  . ASN A 1 12 ? 6.881   0.745   -13.945 1.00 0.00 ? 12 ASN A HB2  9  
ATOM 11739 H HB3  . ASN A 1 12 ? 7.886   0.883   -12.516 1.00 0.00 ? 12 ASN A HB3  9  
ATOM 11740 H HD21 . ASN A 1 12 ? 9.831   2.199   -12.655 1.00 0.00 ? 12 ASN A HD21 9  
ATOM 11741 H HD22 . ASN A 1 12 ? 9.843   3.619   -13.648 1.00 0.00 ? 12 ASN A HD22 9  
ATOM 11742 N N    . PRO A 1 13 ? 11.219  -0.523  -14.061 1.00 0.00 ? 13 PRO A N    9  
ATOM 11743 C CA   . PRO A 1 13 ? 12.537  -0.527  -13.448 1.00 0.00 ? 13 PRO A CA   9  
ATOM 11744 C C    . PRO A 1 13 ? 13.058  0.899   -13.260 1.00 0.00 ? 13 PRO A C    9  
ATOM 11745 O O    . PRO A 1 13 ? 13.419  1.565   -14.229 1.00 0.00 ? 13 PRO A O    9  
ATOM 11746 C CB   . PRO A 1 13 ? 13.402  -1.357  -14.382 1.00 0.00 ? 13 PRO A CB   9  
ATOM 11747 C CG   . PRO A 1 13 ? 12.664  -1.397  -15.710 1.00 0.00 ? 13 PRO A CG   9  
ATOM 11748 C CD   . PRO A 1 13 ? 11.243  -0.913  -15.468 1.00 0.00 ? 13 PRO A CD   9  
ATOM 11749 H HA   . PRO A 1 13 ? 12.492  -0.925  -12.532 1.00 0.00 ? 13 PRO A HA   9  
ATOM 11750 H HB2  . PRO A 1 13 ? 14.390  -0.912  -14.498 1.00 0.00 ? 13 PRO A HB2  9  
ATOM 11751 H HB3  . PRO A 1 13 ? 13.550  -2.362  -13.987 1.00 0.00 ? 13 PRO A HB3  9  
ATOM 11752 H HG2  . PRO A 1 13 ? 13.163  -0.765  -16.444 1.00 0.00 ? 13 PRO A HG2  9  
ATOM 11753 H HG3  . PRO A 1 13 ? 12.659  -2.410  -16.113 1.00 0.00 ? 13 PRO A HG3  9  
ATOM 11754 H HD2  . PRO A 1 13 ? 10.996  -0.073  -16.116 1.00 0.00 ? 13 PRO A HD2  9  
ATOM 11755 H HD3  . PRO A 1 13 ? 10.517  -1.699  -15.673 1.00 0.00 ? 13 PRO A HD3  9  
ATOM 11756 N N    . ASN A 1 14 ? 13.081  1.325   -12.005 1.00 0.00 ? 14 ASN A N    9  
ATOM 11757 C CA   . ASN A 1 14 ? 13.552  2.660   -11.677 1.00 0.00 ? 14 ASN A CA   9  
ATOM 11758 C C    . ASN A 1 14 ? 13.563  2.833   -10.157 1.00 0.00 ? 14 ASN A C    9  
ATOM 11759 O O    . ASN A 1 14 ? 12.548  3.190   -9.562  1.00 0.00 ? 14 ASN A O    9  
ATOM 11760 C CB   . ASN A 1 14 ? 12.632  3.730   -12.268 1.00 0.00 ? 14 ASN A CB   9  
ATOM 11761 C CG   . ASN A 1 14 ? 13.260  5.120   -12.149 1.00 0.00 ? 14 ASN A CG   9  
ATOM 11762 O OD1  . ASN A 1 14 ? 14.236  5.331   -11.448 1.00 0.00 ? 14 ASN A OD1  9  
ATOM 11763 N ND2  . ASN A 1 14 ? 12.647  6.054   -12.871 1.00 0.00 ? 14 ASN A ND2  9  
ATOM 11764 H H    . ASN A 1 14 ? 12.785  0.777   -11.223 1.00 0.00 ? 14 ASN A H    9  
ATOM 11765 H HA   . ASN A 1 14 ? 14.549  2.727   -12.112 1.00 0.00 ? 14 ASN A HA   9  
ATOM 11766 H HB2  . ASN A 1 14 ? 12.432  3.505   -13.316 1.00 0.00 ? 14 ASN A HB2  9  
ATOM 11767 H HB3  . ASN A 1 14 ? 11.672  3.715   -11.751 1.00 0.00 ? 14 ASN A HB3  9  
ATOM 11768 H HD21 . ASN A 1 14 ? 11.850  5.815   -13.425 1.00 0.00 ? 14 ASN A HD21 9  
ATOM 11769 H HD22 . ASN A 1 14 ? 12.983  6.996   -12.859 1.00 0.00 ? 14 ASN A HD22 9  
ATOM 11770 N N    . GLY A 1 15 ? 14.723  2.571   -9.572  1.00 0.00 ? 15 GLY A N    9  
ATOM 11771 C CA   . GLY A 1 15 ? 14.880  2.693   -8.133  1.00 0.00 ? 15 GLY A CA   9  
ATOM 11772 C C    . GLY A 1 15 ? 13.735  1.995   -7.396  1.00 0.00 ? 15 GLY A C    9  
ATOM 11773 O O    . GLY A 1 15 ? 12.988  1.221   -7.992  1.00 0.00 ? 15 GLY A O    9  
ATOM 11774 H H    . GLY A 1 15 ? 15.544  2.281   -10.064 1.00 0.00 ? 15 GLY A H    9  
ATOM 11775 H HA2  . GLY A 1 15 ? 15.832  2.258   -7.829  1.00 0.00 ? 15 GLY A HA2  9  
ATOM 11776 H HA3  . GLY A 1 15 ? 14.907  3.747   -7.854  1.00 0.00 ? 15 GLY A HA3  9  
ATOM 11777 N N    . LYS A 1 16 ? 13.633  2.294   -6.109  1.00 0.00 ? 16 LYS A N    9  
ATOM 11778 C CA   . LYS A 1 16 ? 12.593  1.705   -5.284  1.00 0.00 ? 16 LYS A CA   9  
ATOM 11779 C C    . LYS A 1 16 ? 11.682  2.813   -4.751  1.00 0.00 ? 16 LYS A C    9  
ATOM 11780 O O    . LYS A 1 16 ? 12.129  3.685   -4.008  1.00 0.00 ? 16 LYS A O    9  
ATOM 11781 C CB   . LYS A 1 16 ? 13.207  0.833   -4.187  1.00 0.00 ? 16 LYS A CB   9  
ATOM 11782 C CG   . LYS A 1 16 ? 13.401  -0.605  -4.673  1.00 0.00 ? 16 LYS A CG   9  
ATOM 11783 C CD   . LYS A 1 16 ? 14.626  -1.245  -4.016  1.00 0.00 ? 16 LYS A CD   9  
ATOM 11784 C CE   . LYS A 1 16 ? 15.732  -1.494  -5.045  1.00 0.00 ? 16 LYS A CE   9  
ATOM 11785 N NZ   . LYS A 1 16 ? 16.825  -0.510  -4.879  1.00 0.00 ? 16 LYS A NZ   9  
ATOM 11786 H H    . LYS A 1 16 ? 14.245  2.924   -5.631  1.00 0.00 ? 16 LYS A H    9  
ATOM 11787 H HA   . LYS A 1 16 ? 12.001  1.049   -5.923  1.00 0.00 ? 16 LYS A HA   9  
ATOM 11788 H HB2  . LYS A 1 16 ? 14.167  1.250   -3.881  1.00 0.00 ? 16 LYS A HB2  9  
ATOM 11789 H HB3  . LYS A 1 16 ? 12.563  0.840   -3.308  1.00 0.00 ? 16 LYS A HB3  9  
ATOM 11790 H HG2  . LYS A 1 16 ? 12.513  -1.193  -4.443  1.00 0.00 ? 16 LYS A HG2  9  
ATOM 11791 H HG3  . LYS A 1 16 ? 13.518  -0.613  -5.756  1.00 0.00 ? 16 LYS A HG3  9  
ATOM 11792 H HD2  . LYS A 1 16 ? 15.000  -0.595  -3.225  1.00 0.00 ? 16 LYS A HD2  9  
ATOM 11793 H HD3  . LYS A 1 16 ? 14.342  -2.187  -3.548  1.00 0.00 ? 16 LYS A HD3  9  
ATOM 11794 H HE2  . LYS A 1 16 ? 16.123  -2.504  -4.929  1.00 0.00 ? 16 LYS A HE2  9  
ATOM 11795 H HE3  . LYS A 1 16 ? 15.322  -1.424  -6.052  1.00 0.00 ? 16 LYS A HE3  9  
ATOM 11796 H HZ1  . LYS A 1 16 ? 17.387  -0.493  -5.706  1.00 0.00 ? 16 LYS A HZ1  9  
ATOM 11797 H HZ2  . LYS A 1 16 ? 16.436  0.398   -4.722  1.00 0.00 ? 16 LYS A HZ2  9  
ATOM 11798 H HZ3  . LYS A 1 16 ? 17.391  -0.769  -4.096  1.00 0.00 ? 16 LYS A HZ3  9  
ATOM 11799 N N    . SER A 1 17 ? 10.421  2.741   -5.151  1.00 0.00 ? 17 SER A N    9  
ATOM 11800 C CA   . SER A 1 17 ? 9.443   3.727   -4.723  1.00 0.00 ? 17 SER A CA   9  
ATOM 11801 C C    . SER A 1 17 ? 8.606   3.168   -3.570  1.00 0.00 ? 17 SER A C    9  
ATOM 11802 O O    . SER A 1 17 ? 8.749   2.003   -3.202  1.00 0.00 ? 17 SER A O    9  
ATOM 11803 C CB   . SER A 1 17 ? 8.537   4.145   -5.883  1.00 0.00 ? 17 SER A CB   9  
ATOM 11804 O OG   . SER A 1 17 ? 9.183   5.063   -6.761  1.00 0.00 ? 17 SER A OG   9  
ATOM 11805 H H    . SER A 1 17 ? 10.065  2.028   -5.755  1.00 0.00 ? 17 SER A H    9  
ATOM 11806 H HA   . SER A 1 17 ? 10.026  4.586   -4.391  1.00 0.00 ? 17 SER A HA   9  
ATOM 11807 H HB2  . SER A 1 17 ? 8.234   3.260   -6.443  1.00 0.00 ? 17 SER A HB2  9  
ATOM 11808 H HB3  . SER A 1 17 ? 7.628   4.599   -5.488  1.00 0.00 ? 17 SER A HB3  9  
ATOM 11809 H HG   . SER A 1 17 ? 9.513   5.854   -6.246  1.00 0.00 ? 17 SER A HG   9  
ATOM 11810 N N    . GLU A 1 18 ? 7.750   4.025   -3.033  1.00 0.00 ? 18 GLU A N    9  
ATOM 11811 C CA   . GLU A 1 18 ? 6.890   3.632   -1.930  1.00 0.00 ? 18 GLU A CA   9  
ATOM 11812 C C    . GLU A 1 18 ? 6.239   2.278   -2.221  1.00 0.00 ? 18 GLU A C    9  
ATOM 11813 O O    . GLU A 1 18 ? 6.403   1.329   -1.457  1.00 0.00 ? 18 GLU A O    9  
ATOM 11814 C CB   . GLU A 1 18 ? 5.832   4.701   -1.651  1.00 0.00 ? 18 GLU A CB   9  
ATOM 11815 C CG   . GLU A 1 18 ? 5.847   5.117   -0.179  1.00 0.00 ? 18 GLU A CG   9  
ATOM 11816 C CD   . GLU A 1 18 ? 7.193   5.739   0.201   1.00 0.00 ? 18 GLU A CD   9  
ATOM 11817 O OE1  . GLU A 1 18 ? 7.617   6.662   -0.527  1.00 0.00 ? 18 GLU A OE1  9  
ATOM 11818 O OE2  . GLU A 1 18 ? 7.766   5.276   1.211   1.0