data_1X4B
# 
_entry.id   1X4B 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1X4B         
RCSB  RCSB024361   
WWPDB D_1000024361 
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          hss001003384.2 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1X4B 
_pdbx_database_status.recvd_initial_deposition_date   2005-05-14 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'He, F.'                                                 1 
'Muto, Y.'                                               2 
'Inoue, M.'                                              3 
'Kigawa, T.'                                             4 
'Shirouzu, M.'                                           5 
'Terada, T.'                                             6 
'Yokoyama, S.'                                           7 
'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 8 
# 
_citation.id                        primary 
_citation.title                     'Solution structure of RRM domain in Heterogeneous nuclear ribonucleaoproteins A2/B1' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'He, F.'       1 
primary 'Muto, Y.'     2 
primary 'Inoue, M.'    3 
primary 'Kigawa, T.'   4 
primary 'Shirouzu, M.' 5 
primary 'Terada, T.'   6 
primary 'Yokoyama, S.' 7 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Heterogeneous nuclear ribonucleoproteins A2/B1' 
_entity.formula_weight             12801.366 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'RRM domain' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'hnRNP A2 / hnRNP B1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSSGSSGMEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMA
EVDAAMAARPHSIDGRVVEPKRAVAREESGSGPSSG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSSGSSGMEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMA
EVDAAMAARPHSIDGRVVEPKRAVAREESGSGPSSG
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         hss001003384.2 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   SER n 
1 4   GLY n 
1 5   SER n 
1 6   SER n 
1 7   GLY n 
1 8   MET n 
1 9   GLU n 
1 10  LYS n 
1 11  THR n 
1 12  LEU n 
1 13  GLU n 
1 14  THR n 
1 15  VAL n 
1 16  PRO n 
1 17  LEU n 
1 18  GLU n 
1 19  ARG n 
1 20  LYS n 
1 21  LYS n 
1 22  ARG n 
1 23  GLU n 
1 24  LYS n 
1 25  GLU n 
1 26  GLN n 
1 27  PHE n 
1 28  ARG n 
1 29  LYS n 
1 30  LEU n 
1 31  PHE n 
1 32  ILE n 
1 33  GLY n 
1 34  GLY n 
1 35  LEU n 
1 36  SER n 
1 37  PHE n 
1 38  GLU n 
1 39  THR n 
1 40  THR n 
1 41  GLU n 
1 42  GLU n 
1 43  SER n 
1 44  LEU n 
1 45  ARG n 
1 46  ASN n 
1 47  TYR n 
1 48  TYR n 
1 49  GLU n 
1 50  GLN n 
1 51  TRP n 
1 52  GLY n 
1 53  LYS n 
1 54  LEU n 
1 55  THR n 
1 56  ASP n 
1 57  CYS n 
1 58  VAL n 
1 59  VAL n 
1 60  MET n 
1 61  ARG n 
1 62  ASP n 
1 63  PRO n 
1 64  ALA n 
1 65  SER n 
1 66  LYS n 
1 67  ARG n 
1 68  SER n 
1 69  ARG n 
1 70  GLY n 
1 71  PHE n 
1 72  GLY n 
1 73  PHE n 
1 74  VAL n 
1 75  THR n 
1 76  PHE n 
1 77  SER n 
1 78  SER n 
1 79  MET n 
1 80  ALA n 
1 81  GLU n 
1 82  VAL n 
1 83  ASP n 
1 84  ALA n 
1 85  ALA n 
1 86  MET n 
1 87  ALA n 
1 88  ALA n 
1 89  ARG n 
1 90  PRO n 
1 91  HIS n 
1 92  SER n 
1 93  ILE n 
1 94  ASP n 
1 95  GLY n 
1 96  ARG n 
1 97  VAL n 
1 98  VAL n 
1 99  GLU n 
1 100 PRO n 
1 101 LYS n 
1 102 ARG n 
1 103 ALA n 
1 104 VAL n 
1 105 ALA n 
1 106 ARG n 
1 107 GLU n 
1 108 GLU n 
1 109 SER n 
1 110 GLY n 
1 111 SER n 
1 112 GLY n 
1 113 PRO n 
1 114 SER n 
1 115 SER n 
1 116 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 HNRPA2B1 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       P040510-06 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'Cell free protein synthesis' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ROA2_HUMAN 
_struct_ref.pdbx_db_accession          P22626 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMA
ARPHSIDGRVVEPKRAVAREESG
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1X4B 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 8 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 110 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P22626 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  103 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       8 
_struct_ref_seq.pdbx_auth_seq_align_end       110 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1X4B GLY A 1   ? UNP P22626 ? ? 'CLONING ARTIFACT' 1   1  
1 1X4B SER A 2   ? UNP P22626 ? ? 'CLONING ARTIFACT' 2   2  
1 1X4B SER A 3   ? UNP P22626 ? ? 'CLONING ARTIFACT' 3   3  
1 1X4B GLY A 4   ? UNP P22626 ? ? 'CLONING ARTIFACT' 4   4  
1 1X4B SER A 5   ? UNP P22626 ? ? 'CLONING ARTIFACT' 5   5  
1 1X4B SER A 6   ? UNP P22626 ? ? 'CLONING ARTIFACT' 6   6  
1 1X4B GLY A 7   ? UNP P22626 ? ? 'CLONING ARTIFACT' 7   7  
1 1X4B SER A 111 ? UNP P22626 ? ? 'CLONING ARTIFACT' 111 8  
1 1X4B GLY A 112 ? UNP P22626 ? ? 'CLONING ARTIFACT' 112 9  
1 1X4B PRO A 113 ? UNP P22626 ? ? 'CLONING ARTIFACT' 113 10 
1 1X4B SER A 114 ? UNP P22626 ? ? 'CLONING ARTIFACT' 114 11 
1 1X4B SER A 115 ? UNP P22626 ? ? 'CLONING ARTIFACT' 115 12 
1 1X4B GLY A 116 ? UNP P22626 ? ? 'CLONING ARTIFACT' 116 13 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 3D_15N-separated_NOESY 1 
2 1 3D_13C-separated_NOESY 1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      120mM 
_pdbx_nmr_exptl_sample_conditions.pressure_units      . 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         '0.8mM U-15,13C; 20mM phosphate buffer NA; 100mM NaCl; 1mM d-DTT; 0.02% NaN3' 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.model             Avance 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.field_strength    800 
_pdbx_nmr_spectrometer.type              ? 
# 
_pdbx_nmr_refine.entry_id           1X4B 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      1X4B 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'target function, structures with the lowest energy' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             1X4B 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
collection           XWINNMR 2.6      Bruker       1 
processing           NMRPipe 20031121 Delaglio,F.  2 
'data analysis'      NMRView 5.0.4    Johnson,B.A. 3 
'data analysis'      Kujira  0.863    Kobayashi,N. 4 
'structure solution' CYANA   1.0.8    Guntert,P.   5 
refinement           CYANA   1.0.8    Guntert,P.   6 
# 
_exptl.entry_id          1X4B 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  1X4B 
_struct.title                     'Solution structure of RRM domain in Heterogeneous nuclear ribonucleaoproteins A2/B1' 
_struct.pdbx_descriptor           'Heterogeneous nuclear ribonucleoproteins A2/B1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1X4B 
_struct_keywords.pdbx_keywords   'RNA BINDING PROTEIN' 
_struct_keywords.text            
;structure genomics, RRM domain, heterogeneous nuclear ribonucleoproteins A2/B1, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN
;
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLU A 23 ? PHE A 27 ? GLU A 23 PHE A 27 1 ? 5 
HELX_P HELX_P2 2 GLU A 41 ? TYR A 48 ? GLU A 41 TYR A 48 1 ? 8 
HELX_P HELX_P3 3 MET A 79 ? MET A 86 ? MET A 79 MET A 86 1 ? 8 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  ARG 89 A . ? ARG 89 A PRO 90 A ? PRO 90 A 1  0.02  
2  ARG 89 A . ? ARG 89 A PRO 90 A ? PRO 90 A 2  -0.03 
3  ARG 89 A . ? ARG 89 A PRO 90 A ? PRO 90 A 3  0.04  
4  ARG 89 A . ? ARG 89 A PRO 90 A ? PRO 90 A 4  -0.01 
5  ARG 89 A . ? ARG 89 A PRO 90 A ? PRO 90 A 5  -0.05 
6  ARG 89 A . ? ARG 89 A PRO 90 A ? PRO 90 A 6  0.03  
7  ARG 89 A . ? ARG 89 A PRO 90 A ? PRO 90 A 7  0.01  
8  ARG 89 A . ? ARG 89 A PRO 90 A ? PRO 90 A 8  0.03  
9  ARG 89 A . ? ARG 89 A PRO 90 A ? PRO 90 A 9  -0.06 
10 ARG 89 A . ? ARG 89 A PRO 90 A ? PRO 90 A 10 0.02  
11 ARG 89 A . ? ARG 89 A PRO 90 A ? PRO 90 A 11 0.02  
12 ARG 89 A . ? ARG 89 A PRO 90 A ? PRO 90 A 12 -0.04 
13 ARG 89 A . ? ARG 89 A PRO 90 A ? PRO 90 A 13 0.05  
14 ARG 89 A . ? ARG 89 A PRO 90 A ? PRO 90 A 14 -0.03 
15 ARG 89 A . ? ARG 89 A PRO 90 A ? PRO 90 A 15 0.01  
16 ARG 89 A . ? ARG 89 A PRO 90 A ? PRO 90 A 16 -0.01 
17 ARG 89 A . ? ARG 89 A PRO 90 A ? PRO 90 A 17 0.02  
18 ARG 89 A . ? ARG 89 A PRO 90 A ? PRO 90 A 18 0.01  
19 ARG 89 A . ? ARG 89 A PRO 90 A ? PRO 90 A 19 0.03  
20 ARG 89 A . ? ARG 89 A PRO 90 A ? PRO 90 A 20 0.05  
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   5 
_struct_sheet.details          ? 
# 
_struct_sheet_order.sheet_id     A 
_struct_sheet_order.range_id_1   2 
_struct_sheet_order.range_id_2   3 
_struct_sheet_order.offset       ? 
_struct_sheet_order.sense        anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LYS A 29 ? GLY A 33  ? LYS A 29 GLY A 33  
A 2 ASP A 56 ? MET A 60  ? ASP A 56 MET A 60  
A 3 PHE A 71 ? THR A 75  ? PHE A 71 THR A 75  
A 4 HIS A 91 ? ILE A 93  ? HIS A 91 ILE A 93  
A 5 ARG A 96 ? LYS A 101 ? ARG A 96 LYS A 101 
# 
_database_PDB_matrix.entry_id          1X4B 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1X4B 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . GLY A 1 1   ? -21.170 -29.474 5.882  1.00 0.00 ? 1   GLY A N    1  
ATOM 2     C CA   . GLY A 1 1   ? -21.810 -28.523 6.774  1.00 0.00 ? 1   GLY A CA   1  
ATOM 3     C C    . GLY A 1 1   ? -20.798 -27.918 7.749  1.00 0.00 ? 1   GLY A C    1  
ATOM 4     O O    . GLY A 1 1   ? -20.582 -28.453 8.836  1.00 0.00 ? 1   GLY A O    1  
ATOM 5     H H1   . GLY A 1 1   ? -20.363 -29.128 5.404  1.00 0.00 ? 1   GLY A H1   1  
ATOM 6     H HA2  . GLY A 1 1   ? -22.277 -27.729 6.190  1.00 0.00 ? 1   GLY A HA2  1  
ATOM 7     H HA3  . GLY A 1 1   ? -22.605 -29.019 7.330  1.00 0.00 ? 1   GLY A HA3  1  
ATOM 8     N N    . SER A 1 2   ? -20.205 -26.812 7.326  1.00 0.00 ? 2   SER A N    1  
ATOM 9     C CA   . SER A 1 2   ? -19.220 -26.129 8.149  1.00 0.00 ? 2   SER A CA   1  
ATOM 10    C C    . SER A 1 2   ? -19.736 -24.743 8.540  1.00 0.00 ? 2   SER A C    1  
ATOM 11    O O    . SER A 1 2   ? -20.618 -24.196 7.880  1.00 0.00 ? 2   SER A O    1  
ATOM 12    C CB   . SER A 1 2   ? -17.880 -26.010 7.420  1.00 0.00 ? 2   SER A CB   1  
ATOM 13    O OG   . SER A 1 2   ? -17.374 -27.282 7.023  1.00 0.00 ? 2   SER A OG   1  
ATOM 14    H H    . SER A 1 2   ? -20.386 -26.383 6.441  1.00 0.00 ? 2   SER A H    1  
ATOM 15    H HA   . SER A 1 2   ? -19.098 -26.755 9.032  1.00 0.00 ? 2   SER A HA   1  
ATOM 16    H HB2  . SER A 1 2   ? -18.001 -25.378 6.540  1.00 0.00 ? 2   SER A HB2  1  
ATOM 17    H HB3  . SER A 1 2   ? -17.157 -25.518 8.069  1.00 0.00 ? 2   SER A HB3  1  
ATOM 18    H HG   . SER A 1 2   ? -17.644 -27.479 6.081  1.00 0.00 ? 2   SER A HG   1  
ATOM 19    N N    . SER A 1 3   ? -19.164 -24.214 9.612  1.00 0.00 ? 3   SER A N    1  
ATOM 20    C CA   . SER A 1 3   ? -19.556 -22.902 10.099 1.00 0.00 ? 3   SER A CA   1  
ATOM 21    C C    . SER A 1 3   ? -18.770 -22.559 11.366 1.00 0.00 ? 3   SER A C    1  
ATOM 22    O O    . SER A 1 3   ? -18.209 -23.443 12.011 1.00 0.00 ? 3   SER A O    1  
ATOM 23    C CB   . SER A 1 3   ? -21.059 -22.843 10.374 1.00 0.00 ? 3   SER A CB   1  
ATOM 24    O OG   . SER A 1 3   ? -21.658 -21.676 9.817  1.00 0.00 ? 3   SER A OG   1  
ATOM 25    H H    . SER A 1 3   ? -18.448 -24.666 10.143 1.00 0.00 ? 3   SER A H    1  
ATOM 26    H HA   . SER A 1 3   ? -19.306 -22.210 9.295  1.00 0.00 ? 3   SER A HA   1  
ATOM 27    H HB2  . SER A 1 3   ? -21.539 -23.730 9.959  1.00 0.00 ? 3   SER A HB2  1  
ATOM 28    H HB3  . SER A 1 3   ? -21.232 -22.861 11.450 1.00 0.00 ? 3   SER A HB3  1  
ATOM 29    H HG   . SER A 1 3   ? -22.392 -21.934 9.189  1.00 0.00 ? 3   SER A HG   1  
ATOM 30    N N    . GLY A 1 4   ? -18.756 -21.273 11.684 1.00 0.00 ? 4   GLY A N    1  
ATOM 31    C CA   . GLY A 1 4   ? -18.048 -20.802 12.863 1.00 0.00 ? 4   GLY A CA   1  
ATOM 32    C C    . GLY A 1 4   ? -17.599 -19.349 12.689 1.00 0.00 ? 4   GLY A C    1  
ATOM 33    O O    . GLY A 1 4   ? -17.232 -18.937 11.590 1.00 0.00 ? 4   GLY A O    1  
ATOM 34    H H    . GLY A 1 4   ? -19.215 -20.560 11.154 1.00 0.00 ? 4   GLY A H    1  
ATOM 35    H HA2  . GLY A 1 4   ? -18.695 -20.884 13.737 1.00 0.00 ? 4   GLY A HA2  1  
ATOM 36    H HA3  . GLY A 1 4   ? -17.180 -21.435 13.048 1.00 0.00 ? 4   GLY A HA3  1  
ATOM 37    N N    . SER A 1 5   ? -17.644 -18.614 13.790 1.00 0.00 ? 5   SER A N    1  
ATOM 38    C CA   . SER A 1 5   ? -17.247 -17.216 13.773 1.00 0.00 ? 5   SER A CA   1  
ATOM 39    C C    . SER A 1 5   ? -17.323 -16.634 15.186 1.00 0.00 ? 5   SER A C    1  
ATOM 40    O O    . SER A 1 5   ? -17.782 -17.300 16.112 1.00 0.00 ? 5   SER A O    1  
ATOM 41    C CB   . SER A 1 5   ? -18.124 -16.406 12.817 1.00 0.00 ? 5   SER A CB   1  
ATOM 42    O OG   . SER A 1 5   ? -17.349 -15.571 11.960 1.00 0.00 ? 5   SER A OG   1  
ATOM 43    H H    . SER A 1 5   ? -17.944 -18.957 14.680 1.00 0.00 ? 5   SER A H    1  
ATOM 44    H HA   . SER A 1 5   ? -16.218 -17.213 13.413 1.00 0.00 ? 5   SER A HA   1  
ATOM 45    H HB2  . SER A 1 5   ? -18.726 -17.085 12.214 1.00 0.00 ? 5   SER A HB2  1  
ATOM 46    H HB3  . SER A 1 5   ? -18.817 -15.792 13.392 1.00 0.00 ? 5   SER A HB3  1  
ATOM 47    H HG   . SER A 1 5   ? -16.695 -16.124 11.444 1.00 0.00 ? 5   SER A HG   1  
ATOM 48    N N    . SER A 1 6   ? -16.867 -15.396 15.306 1.00 0.00 ? 6   SER A N    1  
ATOM 49    C CA   . SER A 1 6   ? -16.878 -14.716 16.590 1.00 0.00 ? 6   SER A CA   1  
ATOM 50    C C    . SER A 1 6   ? -16.223 -13.339 16.459 1.00 0.00 ? 6   SER A C    1  
ATOM 51    O O    . SER A 1 6   ? -15.488 -13.086 15.506 1.00 0.00 ? 6   SER A O    1  
ATOM 52    C CB   . SER A 1 6   ? -16.163 -15.545 17.659 1.00 0.00 ? 6   SER A CB   1  
ATOM 53    O OG   . SER A 1 6   ? -14.846 -15.911 17.257 1.00 0.00 ? 6   SER A OG   1  
ATOM 54    H H    . SER A 1 6   ? -16.496 -14.860 14.548 1.00 0.00 ? 6   SER A H    1  
ATOM 55    H HA   . SER A 1 6   ? -17.931 -14.614 16.854 1.00 0.00 ? 6   SER A HA   1  
ATOM 56    H HB2  . SER A 1 6   ? -16.113 -14.975 18.587 1.00 0.00 ? 6   SER A HB2  1  
ATOM 57    H HB3  . SER A 1 6   ? -16.742 -16.444 17.868 1.00 0.00 ? 6   SER A HB3  1  
ATOM 58    H HG   . SER A 1 6   ? -14.558 -16.738 17.741 1.00 0.00 ? 6   SER A HG   1  
ATOM 59    N N    . GLY A 1 7   ? -16.512 -12.486 17.431 1.00 0.00 ? 7   GLY A N    1  
ATOM 60    C CA   . GLY A 1 7   ? -15.960 -11.142 17.436 1.00 0.00 ? 7   GLY A CA   1  
ATOM 61    C C    . GLY A 1 7   ? -16.410 -10.369 18.677 1.00 0.00 ? 7   GLY A C    1  
ATOM 62    O O    . GLY A 1 7   ? -17.174 -10.886 19.491 1.00 0.00 ? 7   GLY A O    1  
ATOM 63    H H    . GLY A 1 7   ? -17.111 -12.700 18.202 1.00 0.00 ? 7   GLY A H    1  
ATOM 64    H HA2  . GLY A 1 7   ? -14.872 -11.192 17.409 1.00 0.00 ? 7   GLY A HA2  1  
ATOM 65    H HA3  . GLY A 1 7   ? -16.277 -10.612 16.538 1.00 0.00 ? 7   GLY A HA3  1  
ATOM 66    N N    . MET A 1 8   ? -15.917 -9.144  18.783 1.00 0.00 ? 8   MET A N    1  
ATOM 67    C CA   . MET A 1 8   ? -16.258 -8.295  19.912 1.00 0.00 ? 8   MET A CA   1  
ATOM 68    C C    . MET A 1 8   ? -15.702 -6.882  19.723 1.00 0.00 ? 8   MET A C    1  
ATOM 69    O O    . MET A 1 8   ? -14.533 -6.629  20.007 1.00 0.00 ? 8   MET A O    1  
ATOM 70    C CB   . MET A 1 8   ? -15.690 -8.900  21.197 1.00 0.00 ? 8   MET A CB   1  
ATOM 71    C CG   . MET A 1 8   ? -16.800 -9.513  22.053 1.00 0.00 ? 8   MET A CG   1  
ATOM 72    S SD   . MET A 1 8   ? -16.432 -11.225 22.396 1.00 0.00 ? 8   MET A SD   1  
ATOM 73    C CE   . MET A 1 8   ? -16.743 -11.263 24.153 1.00 0.00 ? 8   MET A CE   1  
ATOM 74    H H    . MET A 1 8   ? -15.296 -8.732  18.117 1.00 0.00 ? 8   MET A H    1  
ATOM 75    H HA   . MET A 1 8   ? -17.348 -8.264  19.936 1.00 0.00 ? 8   MET A HA   1  
ATOM 76    H HB2  . MET A 1 8   ? -14.953 -9.665  20.948 1.00 0.00 ? 8   MET A HB2  1  
ATOM 77    H HB3  . MET A 1 8   ? -15.169 -8.130  21.767 1.00 0.00 ? 8   MET A HB3  1  
ATOM 78    H HG2  . MET A 1 8   ? -16.899 -8.959  22.986 1.00 0.00 ? 8   MET A HG2  1  
ATOM 79    H HG3  . MET A 1 8   ? -17.755 -9.435  21.534 1.00 0.00 ? 8   MET A HG3  1  
ATOM 80    H HE1  . MET A 1 8   ? -15.801 -11.164 24.692 1.00 0.00 ? 8   MET A HE1  1  
ATOM 81    H HE2  . MET A 1 8   ? -17.404 -10.439 24.423 1.00 0.00 ? 8   MET A HE2  1  
ATOM 82    H HE3  . MET A 1 8   ? -17.216 -12.209 24.418 1.00 0.00 ? 8   MET A HE3  1  
ATOM 83    N N    . GLU A 1 9   ? -16.567 -5.999  19.245 1.00 0.00 ? 9   GLU A N    1  
ATOM 84    C CA   . GLU A 1 9   ? -16.177 -4.619  19.015 1.00 0.00 ? 9   GLU A CA   1  
ATOM 85    C C    . GLU A 1 9   ? -16.991 -3.681  19.910 1.00 0.00 ? 9   GLU A C    1  
ATOM 86    O O    . GLU A 1 9   ? -18.219 -3.664  19.842 1.00 0.00 ? 9   GLU A O    1  
ATOM 87    C CB   . GLU A 1 9   ? -16.335 -4.243  17.541 1.00 0.00 ? 9   GLU A CB   1  
ATOM 88    C CG   . GLU A 1 9   ? -15.194 -3.333  17.082 1.00 0.00 ? 9   GLU A CG   1  
ATOM 89    C CD   . GLU A 1 9   ? -14.353 -4.011  15.998 1.00 0.00 ? 9   GLU A CD   1  
ATOM 90    O OE1  . GLU A 1 9   ? -14.966 -4.482  15.016 1.00 0.00 ? 9   GLU A OE1  1  
ATOM 91    O OE2  . GLU A 1 9   ? -13.116 -4.042  16.176 1.00 0.00 ? 9   GLU A OE2  1  
ATOM 92    H H    . GLU A 1 9   ? -17.517 -6.214  19.017 1.00 0.00 ? 9   GLU A H    1  
ATOM 93    H HA   . GLU A 1 9   ? -15.123 -4.567  19.286 1.00 0.00 ? 9   GLU A HA   1  
ATOM 94    H HB2  . GLU A 1 9   ? -16.351 -5.147  16.931 1.00 0.00 ? 9   GLU A HB2  1  
ATOM 95    H HB3  . GLU A 1 9   ? -17.290 -3.739  17.390 1.00 0.00 ? 9   GLU A HB3  1  
ATOM 96    H HG2  . GLU A 1 9   ? -15.602 -2.397  16.699 1.00 0.00 ? 9   GLU A HG2  1  
ATOM 97    H HG3  . GLU A 1 9   ? -14.561 -3.080  17.933 1.00 0.00 ? 9   GLU A HG3  1  
ATOM 98    N N    . LYS A 1 10  ? -16.273 -2.925  20.727 1.00 0.00 ? 10  LYS A N    1  
ATOM 99    C CA   . LYS A 1 10  ? -16.913 -1.987  21.634 1.00 0.00 ? 10  LYS A CA   1  
ATOM 100   C C    . LYS A 1 10  ? -17.651 -0.922  20.822 1.00 0.00 ? 10  LYS A C    1  
ATOM 101   O O    . LYS A 1 10  ? -17.569 -0.904  19.595 1.00 0.00 ? 10  LYS A O    1  
ATOM 102   C CB   . LYS A 1 10  ? -15.892 -1.413  22.619 1.00 0.00 ? 10  LYS A CB   1  
ATOM 103   C CG   . LYS A 1 10  ? -15.839 -2.245  23.902 1.00 0.00 ? 10  LYS A CG   1  
ATOM 104   C CD   . LYS A 1 10  ? -14.477 -2.923  24.059 1.00 0.00 ? 10  LYS A CD   1  
ATOM 105   C CE   . LYS A 1 10  ? -14.640 -4.406  24.398 1.00 0.00 ? 10  LYS A CE   1  
ATOM 106   N NZ   . LYS A 1 10  ? -14.364 -4.643  25.833 1.00 0.00 ? 10  LYS A NZ   1  
ATOM 107   H H    . LYS A 1 10  ? -15.274 -2.945  20.776 1.00 0.00 ? 10  LYS A H    1  
ATOM 108   H HA   . LYS A 1 10  ? -17.645 -2.545  22.218 1.00 0.00 ? 10  LYS A HA   1  
ATOM 109   H HB2  . LYS A 1 10  ? -14.906 -1.390  22.155 1.00 0.00 ? 10  LYS A HB2  1  
ATOM 110   H HB3  . LYS A 1 10  ? -16.154 -0.382  22.860 1.00 0.00 ? 10  LYS A HB3  1  
ATOM 111   H HG2  . LYS A 1 10  ? -16.032 -1.604  24.763 1.00 0.00 ? 10  LYS A HG2  1  
ATOM 112   H HG3  . LYS A 1 10  ? -16.626 -2.999  23.883 1.00 0.00 ? 10  LYS A HG3  1  
ATOM 113   H HD2  . LYS A 1 10  ? -13.906 -2.818  23.137 1.00 0.00 ? 10  LYS A HD2  1  
ATOM 114   H HD3  . LYS A 1 10  ? -13.908 -2.427  24.845 1.00 0.00 ? 10  LYS A HD3  1  
ATOM 115   H HE2  . LYS A 1 10  ? -15.652 -4.732  24.157 1.00 0.00 ? 10  LYS A HE2  1  
ATOM 116   H HE3  . LYS A 1 10  ? -13.960 -5.002  23.788 1.00 0.00 ? 10  LYS A HE3  1  
ATOM 117   H HZ1  . LYS A 1 10  ? -13.407 -4.908  25.950 1.00 0.00 ? 10  LYS A HZ1  1  
ATOM 118   H HZ2  . LYS A 1 10  ? -14.544 -3.806  26.349 1.00 0.00 ? 10  LYS A HZ2  1  
ATOM 119   H HZ3  . LYS A 1 10  ? -14.956 -5.376  26.170 1.00 0.00 ? 10  LYS A HZ3  1  
ATOM 120   N N    . THR A 1 11  ? -18.356 -0.059  21.539 1.00 0.00 ? 11  THR A N    1  
ATOM 121   C CA   . THR A 1 11  ? -19.108 1.008   20.900 1.00 0.00 ? 11  THR A CA   1  
ATOM 122   C C    . THR A 1 11  ? -18.683 2.368   21.458 1.00 0.00 ? 11  THR A C    1  
ATOM 123   O O    . THR A 1 11  ? -18.510 3.325   20.704 1.00 0.00 ? 11  THR A O    1  
ATOM 124   C CB   . THR A 1 11  ? -20.597 0.713   21.087 1.00 0.00 ? 11  THR A CB   1  
ATOM 125   O OG1  . THR A 1 11  ? -21.251 1.762   20.378 1.00 0.00 ? 11  THR A OG1  1  
ATOM 126   C CG2  . THR A 1 11  ? -21.055 0.900   22.535 1.00 0.00 ? 11  THR A CG2  1  
ATOM 127   H H    . THR A 1 11  ? -18.417 -0.080  22.537 1.00 0.00 ? 11  THR A H    1  
ATOM 128   H HA   . THR A 1 11  ? -18.867 1.008   19.837 1.00 0.00 ? 11  THR A HA   1  
ATOM 129   H HB   . THR A 1 11  ? -20.845 -0.286  20.726 1.00 0.00 ? 11  THR A HB   1  
ATOM 130   H HG1  . THR A 1 11  ? -21.043 2.643   20.803 1.00 0.00 ? 11  THR A HG1  1  
ATOM 131   H HG21 . THR A 1 11  ? -20.531 0.192   23.176 1.00 0.00 ? 11  THR A HG21 1  
ATOM 132   H HG22 . THR A 1 11  ? -20.831 1.917   22.857 1.00 0.00 ? 11  THR A HG22 1  
ATOM 133   H HG23 . THR A 1 11  ? -22.129 0.725   22.602 1.00 0.00 ? 11  THR A HG23 1  
ATOM 134   N N    . LEU A 1 12  ? -18.528 2.410   22.773 1.00 0.00 ? 12  LEU A N    1  
ATOM 135   C CA   . LEU A 1 12  ? -18.127 3.637   23.440 1.00 0.00 ? 12  LEU A CA   1  
ATOM 136   C C    . LEU A 1 12  ? -19.238 4.679   23.293 1.00 0.00 ? 12  LEU A C    1  
ATOM 137   O O    . LEU A 1 12  ? -20.201 4.465   22.558 1.00 0.00 ? 12  LEU A O    1  
ATOM 138   C CB   . LEU A 1 12  ? -16.768 4.111   22.919 1.00 0.00 ? 12  LEU A CB   1  
ATOM 139   C CG   . LEU A 1 12  ? -15.548 3.669   23.731 1.00 0.00 ? 12  LEU A CG   1  
ATOM 140   C CD1  . LEU A 1 12  ? -14.388 3.283   22.811 1.00 0.00 ? 12  LEU A CD1  1  
ATOM 141   C CD2  . LEU A 1 12  ? -15.144 4.744   24.742 1.00 0.00 ? 12  LEU A CD2  1  
ATOM 142   H H    . LEU A 1 12  ? -18.670 1.627   23.378 1.00 0.00 ? 12  LEU A H    1  
ATOM 143   H HA   . LEU A 1 12  ? -18.005 3.409   24.498 1.00 0.00 ? 12  LEU A HA   1  
ATOM 144   H HB2  . LEU A 1 12  ? -16.648 3.753   21.897 1.00 0.00 ? 12  LEU A HB2  1  
ATOM 145   H HB3  . LEU A 1 12  ? -16.777 5.200   22.877 1.00 0.00 ? 12  LEU A HB3  1  
ATOM 146   H HG   . LEU A 1 12  ? -15.819 2.779   24.299 1.00 0.00 ? 12  LEU A HG   1  
ATOM 147   H HD11 . LEU A 1 12  ? -13.443 3.487   23.313 1.00 0.00 ? 12  LEU A HD11 1  
ATOM 148   H HD12 . LEU A 1 12  ? -14.451 2.221   22.573 1.00 0.00 ? 12  LEU A HD12 1  
ATOM 149   H HD13 . LEU A 1 12  ? -14.444 3.865   21.891 1.00 0.00 ? 12  LEU A HD13 1  
ATOM 150   H HD21 . LEU A 1 12  ? -15.889 5.540   24.743 1.00 0.00 ? 12  LEU A HD21 1  
ATOM 151   H HD22 . LEU A 1 12  ? -15.083 4.303   25.736 1.00 0.00 ? 12  LEU A HD22 1  
ATOM 152   H HD23 . LEU A 1 12  ? -14.173 5.156   24.466 1.00 0.00 ? 12  LEU A HD23 1  
ATOM 153   N N    . GLU A 1 13  ? -19.068 5.783   24.005 1.00 0.00 ? 13  GLU A N    1  
ATOM 154   C CA   . GLU A 1 13  ? -20.044 6.858   23.964 1.00 0.00 ? 13  GLU A CA   1  
ATOM 155   C C    . GLU A 1 13  ? -19.405 8.173   24.415 1.00 0.00 ? 13  GLU A C    1  
ATOM 156   O O    . GLU A 1 13  ? -18.517 8.176   25.265 1.00 0.00 ? 13  GLU A O    1  
ATOM 157   C CB   . GLU A 1 13  ? -21.267 6.521   24.820 1.00 0.00 ? 13  GLU A CB   1  
ATOM 158   C CG   . GLU A 1 13  ? -20.900 6.468   26.304 1.00 0.00 ? 13  GLU A CG   1  
ATOM 159   C CD   . GLU A 1 13  ? -21.894 7.273   27.144 1.00 0.00 ? 13  GLU A CD   1  
ATOM 160   O OE1  . GLU A 1 13  ? -22.946 6.692   27.489 1.00 0.00 ? 13  GLU A OE1  1  
ATOM 161   O OE2  . GLU A 1 13  ? -21.581 8.450   27.421 1.00 0.00 ? 13  GLU A OE2  1  
ATOM 162   H H    . GLU A 1 13  ? -18.282 5.949   24.601 1.00 0.00 ? 13  GLU A H    1  
ATOM 163   H HA   . GLU A 1 13  ? -20.348 6.933   22.920 1.00 0.00 ? 13  GLU A HA   1  
ATOM 164   H HB2  . GLU A 1 13  ? -22.044 7.268   24.660 1.00 0.00 ? 13  GLU A HB2  1  
ATOM 165   H HB3  . GLU A 1 13  ? -21.680 5.561   24.509 1.00 0.00 ? 13  GLU A HB3  1  
ATOM 166   H HG2  . GLU A 1 13  ? -20.888 5.432   26.642 1.00 0.00 ? 13  GLU A HG2  1  
ATOM 167   H HG3  . GLU A 1 13  ? -19.894 6.863   26.448 1.00 0.00 ? 13  GLU A HG3  1  
ATOM 168   N N    . THR A 1 14  ? -19.883 9.259   23.825 1.00 0.00 ? 14  THR A N    1  
ATOM 169   C CA   . THR A 1 14  ? -19.369 10.577  24.155 1.00 0.00 ? 14  THR A CA   1  
ATOM 170   C C    . THR A 1 14  ? -17.855 10.629  23.942 1.00 0.00 ? 14  THR A C    1  
ATOM 171   O O    . THR A 1 14  ? -17.093 10.104  24.752 1.00 0.00 ? 14  THR A O    1  
ATOM 172   C CB   . THR A 1 14  ? -19.793 10.905  25.588 1.00 0.00 ? 14  THR A CB   1  
ATOM 173   O OG1  . THR A 1 14  ? -21.194 11.146  25.489 1.00 0.00 ? 14  THR A OG1  1  
ATOM 174   C CG2  . THR A 1 14  ? -19.219 12.235  26.079 1.00 0.00 ? 14  THR A CG2  1  
ATOM 175   H H    . THR A 1 14  ? -20.606 9.248   23.134 1.00 0.00 ? 14  THR A H    1  
ATOM 176   H HA   . THR A 1 14  ? -19.813 11.300  23.470 1.00 0.00 ? 14  THR A HA   1  
ATOM 177   H HB   . THR A 1 14  ? -19.530 10.093  26.266 1.00 0.00 ? 14  THR A HB   1  
ATOM 178   H HG1  . THR A 1 14  ? -21.675 10.679  26.231 1.00 0.00 ? 14  THR A HG1  1  
ATOM 179   H HG21 . THR A 1 14  ? -19.259 12.968  25.273 1.00 0.00 ? 14  THR A HG21 1  
ATOM 180   H HG22 . THR A 1 14  ? -19.806 12.594  26.925 1.00 0.00 ? 14  THR A HG22 1  
ATOM 181   H HG23 . THR A 1 14  ? -18.184 12.092  26.389 1.00 0.00 ? 14  THR A HG23 1  
ATOM 182   N N    . VAL A 1 15  ? -17.464 11.266  22.848 1.00 0.00 ? 15  VAL A N    1  
ATOM 183   C CA   . VAL A 1 15  ? -16.055 11.393  22.519 1.00 0.00 ? 15  VAL A CA   1  
ATOM 184   C C    . VAL A 1 15  ? -15.604 12.832  22.772 1.00 0.00 ? 15  VAL A C    1  
ATOM 185   O O    . VAL A 1 15  ? -16.313 13.778  22.431 1.00 0.00 ? 15  VAL A O    1  
ATOM 186   C CB   . VAL A 1 15  ? -15.810 10.934  21.080 1.00 0.00 ? 15  VAL A CB   1  
ATOM 187   C CG1  . VAL A 1 15  ? -16.050 9.429   20.936 1.00 0.00 ? 15  VAL A CG1  1  
ATOM 188   C CG2  . VAL A 1 15  ? -16.678 11.723  20.098 1.00 0.00 ? 15  VAL A CG2  1  
ATOM 189   H H    . VAL A 1 15  ? -18.091 11.690  22.194 1.00 0.00 ? 15  VAL A H    1  
ATOM 190   H HA   . VAL A 1 15  ? -15.501 10.729  23.183 1.00 0.00 ? 15  VAL A HA   1  
ATOM 191   H HB   . VAL A 1 15  ? -14.766 11.132  20.838 1.00 0.00 ? 15  VAL A HB   1  
ATOM 192   H HG11 . VAL A 1 15  ? -16.977 9.260   20.389 1.00 0.00 ? 15  VAL A HG11 1  
ATOM 193   H HG12 . VAL A 1 15  ? -15.219 8.980   20.392 1.00 0.00 ? 15  VAL A HG12 1  
ATOM 194   H HG13 . VAL A 1 15  ? -16.123 8.977   21.925 1.00 0.00 ? 15  VAL A HG13 1  
ATOM 195   H HG21 . VAL A 1 15  ? -17.705 11.362  20.149 1.00 0.00 ? 15  VAL A HG21 1  
ATOM 196   H HG22 . VAL A 1 15  ? -16.652 12.781  20.359 1.00 0.00 ? 15  VAL A HG22 1  
ATOM 197   H HG23 . VAL A 1 15  ? -16.296 11.589  19.086 1.00 0.00 ? 15  VAL A HG23 1  
ATOM 198   N N    . PRO A 1 16  ? -14.396 12.957  23.384 1.00 0.00 ? 16  PRO A N    1  
ATOM 199   C CA   . PRO A 1 16  ? -13.842 14.266  23.686 1.00 0.00 ? 16  PRO A CA   1  
ATOM 200   C C    . PRO A 1 16  ? -13.310 14.942  22.421 1.00 0.00 ? 16  PRO A C    1  
ATOM 201   O O    . PRO A 1 16  ? -12.725 14.285  21.561 1.00 0.00 ? 16  PRO A O    1  
ATOM 202   C CB   . PRO A 1 16  ? -12.758 14.005  24.720 1.00 0.00 ? 16  PRO A CB   1  
ATOM 203   C CG   . PRO A 1 16  ? -12.430 12.525  24.615 1.00 0.00 ? 16  PRO A CG   1  
ATOM 204   C CD   . PRO A 1 16  ? -13.528 11.860  23.802 1.00 0.00 ? 16  PRO A CD   1  
ATOM 205   H HA   . PRO A 1 16  ? -14.554 14.871  24.041 1.00 0.00 ? 16  PRO A HA   1  
ATOM 206   H HB2  . PRO A 1 16  ? -11.877 14.616  24.525 1.00 0.00 ? 16  PRO A HB2  1  
ATOM 207   H HB3  . PRO A 1 16  ? -13.106 14.258  25.722 1.00 0.00 ? 16  PRO A HB3  1  
ATOM 208   H HG2  . PRO A 1 16  ? -11.461 12.382  24.137 1.00 0.00 ? 16  PRO A HG2  1  
ATOM 209   H HG3  . PRO A 1 16  ? -12.365 12.077  25.607 1.00 0.00 ? 16  PRO A HG3  1  
ATOM 210   H HD2  . PRO A 1 16  ? -13.119 11.329  22.942 1.00 0.00 ? 16  PRO A HD2  1  
ATOM 211   H HD3  . PRO A 1 16  ? -14.074 11.128  24.397 1.00 0.00 ? 16  PRO A HD3  1  
ATOM 212   N N    . LEU A 1 17  ? -13.531 16.246  22.348 1.00 0.00 ? 17  LEU A N    1  
ATOM 213   C CA   . LEU A 1 17  ? -13.082 17.019  21.202 1.00 0.00 ? 17  LEU A CA   1  
ATOM 214   C C    . LEU A 1 17  ? -11.823 17.801  21.582 1.00 0.00 ? 17  LEU A C    1  
ATOM 215   O O    . LEU A 1 17  ? -11.725 18.325  22.691 1.00 0.00 ? 17  LEU A O    1  
ATOM 216   C CB   . LEU A 1 17  ? -14.215 17.898  20.671 1.00 0.00 ? 17  LEU A CB   1  
ATOM 217   C CG   . LEU A 1 17  ? -14.422 19.233  21.390 1.00 0.00 ? 17  LEU A CG   1  
ATOM 218   C CD1  . LEU A 1 17  ? -14.325 20.404  20.410 1.00 0.00 ? 17  LEU A CD1  1  
ATOM 219   C CD2  . LEU A 1 17  ? -15.742 19.241  22.163 1.00 0.00 ? 17  LEU A CD2  1  
ATOM 220   H H    . LEU A 1 17  ? -14.007 16.773  23.052 1.00 0.00 ? 17  LEU A H    1  
ATOM 221   H HA   . LEU A 1 17  ? -12.824 16.313  20.413 1.00 0.00 ? 17  LEU A HA   1  
ATOM 222   H HB2  . LEU A 1 17  ? -14.027 18.101  19.617 1.00 0.00 ? 17  LEU A HB2  1  
ATOM 223   H HB3  . LEU A 1 17  ? -15.144 17.331  20.726 1.00 0.00 ? 17  LEU A HB3  1  
ATOM 224   H HG   . LEU A 1 17  ? -13.621 19.356  22.118 1.00 0.00 ? 17  LEU A HG   1  
ATOM 225   H HD11 . LEU A 1 17  ? -15.044 20.263  19.603 1.00 0.00 ? 17  LEU A HD11 1  
ATOM 226   H HD12 . LEU A 1 17  ? -14.544 21.335  20.933 1.00 0.00 ? 17  LEU A HD12 1  
ATOM 227   H HD13 . LEU A 1 17  ? -13.318 20.449  19.995 1.00 0.00 ? 17  LEU A HD13 1  
ATOM 228   H HD21 . LEU A 1 17  ? -16.451 19.903  21.665 1.00 0.00 ? 17  LEU A HD21 1  
ATOM 229   H HD22 . LEU A 1 17  ? -16.149 18.231  22.197 1.00 0.00 ? 17  LEU A HD22 1  
ATOM 230   H HD23 . LEU A 1 17  ? -15.565 19.596  23.179 1.00 0.00 ? 17  LEU A HD23 1  
ATOM 231   N N    . GLU A 1 18  ? -10.892 17.855  20.642 1.00 0.00 ? 18  GLU A N    1  
ATOM 232   C CA   . GLU A 1 18  ? -9.643  18.564  20.864 1.00 0.00 ? 18  GLU A CA   1  
ATOM 233   C C    . GLU A 1 18  ? -9.251  19.354  19.613 1.00 0.00 ? 18  GLU A C    1  
ATOM 234   O O    . GLU A 1 18  ? -9.752  19.084  18.523 1.00 0.00 ? 18  GLU A O    1  
ATOM 235   C CB   . GLU A 1 18  ? -8.529  17.599  21.274 1.00 0.00 ? 18  GLU A CB   1  
ATOM 236   C CG   . GLU A 1 18  ? -8.066  17.873  22.706 1.00 0.00 ? 18  GLU A CG   1  
ATOM 237   C CD   . GLU A 1 18  ? -6.845  17.020  23.060 1.00 0.00 ? 18  GLU A CD   1  
ATOM 238   O OE1  . GLU A 1 18  ? -7.034  15.794  23.211 1.00 0.00 ? 18  GLU A OE1  1  
ATOM 239   O OE2  . GLU A 1 18  ? -5.751  17.615  23.171 1.00 0.00 ? 18  GLU A OE2  1  
ATOM 240   H H    . GLU A 1 18  ? -10.979 17.425  19.743 1.00 0.00 ? 18  GLU A H    1  
ATOM 241   H HA   . GLU A 1 18  ? -9.842  19.250  21.687 1.00 0.00 ? 18  GLU A HA   1  
ATOM 242   H HB2  . GLU A 1 18  ? -8.886  16.572  21.194 1.00 0.00 ? 18  GLU A HB2  1  
ATOM 243   H HB3  . GLU A 1 18  ? -7.687  17.698  20.590 1.00 0.00 ? 18  GLU A HB3  1  
ATOM 244   H HG2  . GLU A 1 18  ? -7.821  18.929  22.817 1.00 0.00 ? 18  GLU A HG2  1  
ATOM 245   H HG3  . GLU A 1 18  ? -8.877  17.659  23.402 1.00 0.00 ? 18  GLU A HG3  1  
ATOM 246   N N    . ARG A 1 19  ? -8.360  20.313  19.814 1.00 0.00 ? 19  ARG A N    1  
ATOM 247   C CA   . ARG A 1 19  ? -7.895  21.144  18.716 1.00 0.00 ? 19  ARG A CA   1  
ATOM 248   C C    . ARG A 1 19  ? -7.494  20.273  17.524 1.00 0.00 ? 19  ARG A C    1  
ATOM 249   O O    . ARG A 1 19  ? -7.580  20.707  16.376 1.00 0.00 ? 19  ARG A O    1  
ATOM 250   C CB   . ARG A 1 19  ? -6.699  21.998  19.140 1.00 0.00 ? 19  ARG A CB   1  
ATOM 251   C CG   . ARG A 1 19  ? -5.706  21.180  19.967 1.00 0.00 ? 19  ARG A CG   1  
ATOM 252   C CD   . ARG A 1 19  ? -5.518  21.790  21.358 1.00 0.00 ? 19  ARG A CD   1  
ATOM 253   N NE   . ARG A 1 19  ? -4.692  20.892  22.196 1.00 0.00 ? 19  ARG A NE   1  
ATOM 254   C CZ   . ARG A 1 19  ? -3.377  20.700  22.022 1.00 0.00 ? 19  ARG A CZ   1  
ATOM 255   N NH1  . ARG A 1 19  ? -2.731  21.341  21.038 1.00 0.00 ? 19  ARG A NH1  1  
ATOM 256   N NH2  . ARG A 1 19  ? -2.709  19.867  22.831 1.00 0.00 ? 19  ARG A NH2  1  
ATOM 257   H H    . ARG A 1 19  ? -7.958  20.526  20.704 1.00 0.00 ? 19  ARG A H    1  
ATOM 258   H HA   . ARG A 1 19  ? -8.745  21.780  18.468 1.00 0.00 ? 19  ARG A HA   1  
ATOM 259   H HB2  . ARG A 1 19  ? -6.200  22.396  18.256 1.00 0.00 ? 19  ARG A HB2  1  
ATOM 260   H HB3  . ARG A 1 19  ? -7.045  22.853  19.721 1.00 0.00 ? 19  ARG A HB3  1  
ATOM 261   H HG2  . ARG A 1 19  ? -6.064  20.155  20.061 1.00 0.00 ? 19  ARG A HG2  1  
ATOM 262   H HG3  . ARG A 1 19  ? -4.747  21.136  19.452 1.00 0.00 ? 19  ARG A HG3  1  
ATOM 263   H HD2  . ARG A 1 19  ? -5.039  22.765  21.274 1.00 0.00 ? 19  ARG A HD2  1  
ATOM 264   H HD3  . ARG A 1 19  ? -6.488  21.950  21.828 1.00 0.00 ? 19  ARG A HD3  1  
ATOM 265   H HE   . ARG A 1 19  ? -5.143  20.398  22.940 1.00 0.00 ? 19  ARG A HE   1  
ATOM 266   H HH11 . ARG A 1 19  ? -3.230  21.963  20.434 1.00 0.00 ? 19  ARG A HH11 1  
ATOM 267   H HH12 . ARG A 1 19  ? -1.750  21.198  20.908 1.00 0.00 ? 19  ARG A HH12 1  
ATOM 268   H HH21 . ARG A 1 19  ? -3.191  19.389  23.565 1.00 0.00 ? 19  ARG A HH21 1  
ATOM 269   H HH22 . ARG A 1 19  ? -1.728  19.724  22.701 1.00 0.00 ? 19  ARG A HH22 1  
ATOM 270   N N    . LYS A 1 20  ? -7.064  19.059  17.837 1.00 0.00 ? 20  LYS A N    1  
ATOM 271   C CA   . LYS A 1 20  ? -6.650  18.123  16.806 1.00 0.00 ? 20  LYS A CA   1  
ATOM 272   C C    . LYS A 1 20  ? -5.356  18.623  16.160 1.00 0.00 ? 20  LYS A C    1  
ATOM 273   O O    . LYS A 1 20  ? -4.262  18.268  16.597 1.00 0.00 ? 20  LYS A O    1  
ATOM 274   C CB   . LYS A 1 20  ? -7.785  17.888  15.807 1.00 0.00 ? 20  LYS A CB   1  
ATOM 275   C CG   . LYS A 1 20  ? -8.399  16.499  15.991 1.00 0.00 ? 20  LYS A CG   1  
ATOM 276   C CD   . LYS A 1 20  ? -7.485  15.415  15.416 1.00 0.00 ? 20  LYS A CD   1  
ATOM 277   C CE   . LYS A 1 20  ? -6.814  14.614  16.533 1.00 0.00 ? 20  LYS A CE   1  
ATOM 278   N NZ   . LYS A 1 20  ? -6.960  13.161  16.288 1.00 0.00 ? 20  LYS A NZ   1  
ATOM 279   H H    . LYS A 1 20  ? -6.997  18.714  18.773 1.00 0.00 ? 20  LYS A H    1  
ATOM 280   H HA   . LYS A 1 20  ? -6.447  17.169  17.293 1.00 0.00 ? 20  LYS A HA   1  
ATOM 281   H HB2  . LYS A 1 20  ? -8.553  18.650  15.938 1.00 0.00 ? 20  LYS A HB2  1  
ATOM 282   H HB3  . LYS A 1 20  ? -7.406  17.991  14.790 1.00 0.00 ? 20  LYS A HB3  1  
ATOM 283   H HG2  . LYS A 1 20  ? -8.570  16.311  17.051 1.00 0.00 ? 20  LYS A HG2  1  
ATOM 284   H HG3  . LYS A 1 20  ? -9.371  16.459  15.500 1.00 0.00 ? 20  LYS A HG3  1  
ATOM 285   H HD2  . LYS A 1 20  ? -8.065  14.745  14.781 1.00 0.00 ? 20  LYS A HD2  1  
ATOM 286   H HD3  . LYS A 1 20  ? -6.724  15.873  14.785 1.00 0.00 ? 20  LYS A HD3  1  
ATOM 287   H HE2  . LYS A 1 20  ? -5.758  14.874  16.592 1.00 0.00 ? 20  LYS A HE2  1  
ATOM 288   H HE3  . LYS A 1 20  ? -7.260  14.873  17.493 1.00 0.00 ? 20  LYS A HE3  1  
ATOM 289   H HZ1  . LYS A 1 20  ? -7.844  12.851  16.639 1.00 0.00 ? 20  LYS A HZ1  1  
ATOM 290   H HZ2  . LYS A 1 20  ? -6.910  12.982  15.306 1.00 0.00 ? 20  LYS A HZ2  1  
ATOM 291   H HZ3  . LYS A 1 20  ? -6.225  12.669  16.755 1.00 0.00 ? 20  LYS A HZ3  1  
ATOM 292   N N    . LYS A 1 21  ? -5.523  19.439  15.130 1.00 0.00 ? 21  LYS A N    1  
ATOM 293   C CA   . LYS A 1 21  ? -4.382  19.991  14.419 1.00 0.00 ? 21  LYS A CA   1  
ATOM 294   C C    . LYS A 1 21  ? -3.925  18.999  13.347 1.00 0.00 ? 21  LYS A C    1  
ATOM 295   O O    . LYS A 1 21  ? -4.207  17.805  13.441 1.00 0.00 ? 21  LYS A O    1  
ATOM 296   C CB   . LYS A 1 21  ? -3.278  20.385  15.402 1.00 0.00 ? 21  LYS A CB   1  
ATOM 297   C CG   . LYS A 1 21  ? -2.606  21.692  14.977 1.00 0.00 ? 21  LYS A CG   1  
ATOM 298   C CD   . LYS A 1 21  ? -2.502  22.663  16.154 1.00 0.00 ? 21  LYS A CD   1  
ATOM 299   C CE   . LYS A 1 21  ? -3.645  23.680  16.130 1.00 0.00 ? 21  LYS A CE   1  
ATOM 300   N NZ   . LYS A 1 21  ? -3.373  24.789  17.072 1.00 0.00 ? 21  LYS A NZ   1  
ATOM 301   H H    . LYS A 1 21  ? -6.416  19.722  14.780 1.00 0.00 ? 21  LYS A H    1  
ATOM 302   H HA   . LYS A 1 21  ? -4.715  20.903  13.925 1.00 0.00 ? 21  LYS A HA   1  
ATOM 303   H HB2  . LYS A 1 21  ? -3.699  20.497  16.402 1.00 0.00 ? 21  LYS A HB2  1  
ATOM 304   H HB3  . LYS A 1 21  ? -2.534  19.590  15.457 1.00 0.00 ? 21  LYS A HB3  1  
ATOM 305   H HG2  . LYS A 1 21  ? -1.611  21.482  14.584 1.00 0.00 ? 21  LYS A HG2  1  
ATOM 306   H HG3  . LYS A 1 21  ? -3.177  22.153  14.170 1.00 0.00 ? 21  LYS A HG3  1  
ATOM 307   H HD2  . LYS A 1 21  ? -2.524  22.108  17.092 1.00 0.00 ? 21  LYS A HD2  1  
ATOM 308   H HD3  . LYS A 1 21  ? -1.545  23.185  16.116 1.00 0.00 ? 21  LYS A HD3  1  
ATOM 309   H HE2  . LYS A 1 21  ? -3.767  24.074  15.121 1.00 0.00 ? 21  LYS A HE2  1  
ATOM 310   H HE3  . LYS A 1 21  ? -4.581  23.190  16.396 1.00 0.00 ? 21  LYS A HE3  1  
ATOM 311   H HZ1  . LYS A 1 21  ? -2.392  24.984  17.083 1.00 0.00 ? 21  LYS A HZ1  1  
ATOM 312   H HZ2  . LYS A 1 21  ? -3.872  25.604  16.779 1.00 0.00 ? 21  LYS A HZ2  1  
ATOM 313   H HZ3  . LYS A 1 21  ? -3.671  24.527  17.990 1.00 0.00 ? 21  LYS A HZ3  1  
ATOM 314   N N    . ARG A 1 22  ? -3.228  19.529  12.354 1.00 0.00 ? 22  ARG A N    1  
ATOM 315   C CA   . ARG A 1 22  ? -2.730  18.705  11.266 1.00 0.00 ? 22  ARG A CA   1  
ATOM 316   C C    . ARG A 1 22  ? -3.848  17.815  10.719 1.00 0.00 ? 22  ARG A C    1  
ATOM 317   O O    . ARG A 1 22  ? -3.947  16.644  11.083 1.00 0.00 ? 22  ARG A O    1  
ATOM 318   C CB   . ARG A 1 22  ? -1.567  17.826  11.729 1.00 0.00 ? 22  ARG A CB   1  
ATOM 319   C CG   . ARG A 1 22  ? -0.223  18.494  11.434 1.00 0.00 ? 22  ARG A CG   1  
ATOM 320   C CD   . ARG A 1 22  ? 0.395   19.070  12.709 1.00 0.00 ? 22  ARG A CD   1  
ATOM 321   N NE   . ARG A 1 22  ? 1.447   20.052  12.363 1.00 0.00 ? 22  ARG A NE   1  
ATOM 322   C CZ   . ARG A 1 22  ? 2.124   20.777  13.265 1.00 0.00 ? 22  ARG A CZ   1  
ATOM 323   N NH1  . ARG A 1 22  ? 1.864   20.634  14.571 1.00 0.00 ? 22  ARG A NH1  1  
ATOM 324   N NH2  . ARG A 1 22  ? 3.062   21.644  12.859 1.00 0.00 ? 22  ARG A NH2  1  
ATOM 325   H H    . ARG A 1 22  ? -3.003  20.501  12.285 1.00 0.00 ? 22  ARG A H    1  
ATOM 326   H HA   . ARG A 1 22  ? -2.390  19.415  10.512 1.00 0.00 ? 22  ARG A HA   1  
ATOM 327   H HB2  . ARG A 1 22  ? -1.655  17.634  12.798 1.00 0.00 ? 22  ARG A HB2  1  
ATOM 328   H HB3  . ARG A 1 22  ? -1.615  16.859  11.227 1.00 0.00 ? 22  ARG A HB3  1  
ATOM 329   H HG2  . ARG A 1 22  ? 0.459   17.768  10.991 1.00 0.00 ? 22  ARG A HG2  1  
ATOM 330   H HG3  . ARG A 1 22  ? -0.361  19.289  10.701 1.00 0.00 ? 22  ARG A HG3  1  
ATOM 331   H HD2  . ARG A 1 22  ? -0.376  19.549  13.312 1.00 0.00 ? 22  ARG A HD2  1  
ATOM 332   H HD3  . ARG A 1 22  ? 0.819   18.268  13.313 1.00 0.00 ? 22  ARG A HD3  1  
ATOM 333   H HE   . ARG A 1 22  ? 1.666   20.184  11.396 1.00 0.00 ? 22  ARG A HE   1  
ATOM 334   H HH11 . ARG A 1 22  ? 1.164   19.986  14.874 1.00 0.00 ? 22  ARG A HH11 1  
ATOM 335   H HH12 . ARG A 1 22  ? 2.370   21.174  15.244 1.00 0.00 ? 22  ARG A HH12 1  
ATOM 336   H HH21 . ARG A 1 22  ? 3.256   21.751  11.884 1.00 0.00 ? 22  ARG A HH21 1  
ATOM 337   H HH22 . ARG A 1 22  ? 3.568   22.184  13.532 1.00 0.00 ? 22  ARG A HH22 1  
ATOM 338   N N    . GLU A 1 23  ? -4.661  18.404  9.855  1.00 0.00 ? 23  GLU A N    1  
ATOM 339   C CA   . GLU A 1 23  ? -5.767  17.679  9.254  1.00 0.00 ? 23  GLU A CA   1  
ATOM 340   C C    . GLU A 1 23  ? -5.300  16.943  7.997  1.00 0.00 ? 23  GLU A C    1  
ATOM 341   O O    . GLU A 1 23  ? -5.680  15.795  7.768  1.00 0.00 ? 23  GLU A O    1  
ATOM 342   C CB   . GLU A 1 23  ? -6.932  18.619  8.938  1.00 0.00 ? 23  GLU A CB   1  
ATOM 343   C CG   . GLU A 1 23  ? -7.456  19.290  10.209 1.00 0.00 ? 23  GLU A CG   1  
ATOM 344   C CD   . GLU A 1 23  ? -8.924  18.931  10.453 1.00 0.00 ? 23  GLU A CD   1  
ATOM 345   O OE1  . GLU A 1 23  ? -9.158  17.805  10.942 1.00 0.00 ? 23  GLU A OE1  1  
ATOM 346   O OE2  . GLU A 1 23  ? -9.777  19.790  10.145 1.00 0.00 ? 23  GLU A OE2  1  
ATOM 347   H H    . GLU A 1 23  ? -4.573  19.357  9.564  1.00 0.00 ? 23  GLU A H    1  
ATOM 348   H HA   . GLU A 1 23  ? -6.085  16.959  10.008 1.00 0.00 ? 23  GLU A HA   1  
ATOM 349   H HB2  . GLU A 1 23  ? -6.607  19.380  8.229  1.00 0.00 ? 23  GLU A HB2  1  
ATOM 350   H HB3  . GLU A 1 23  ? -7.736  18.060  8.459  1.00 0.00 ? 23  GLU A HB3  1  
ATOM 351   H HG2  . GLU A 1 23  ? -6.855  18.978  11.063 1.00 0.00 ? 23  GLU A HG2  1  
ATOM 352   H HG3  . GLU A 1 23  ? -7.352  20.371  10.124 1.00 0.00 ? 23  GLU A HG3  1  
ATOM 353   N N    . LYS A 1 24  ? -4.483  17.633  7.215  1.00 0.00 ? 24  LYS A N    1  
ATOM 354   C CA   . LYS A 1 24  ? -3.959  17.059  5.987  1.00 0.00 ? 24  LYS A CA   1  
ATOM 355   C C    . LYS A 1 24  ? -3.248  15.742  6.307  1.00 0.00 ? 24  LYS A C    1  
ATOM 356   O O    . LYS A 1 24  ? -3.208  14.837  5.476  1.00 0.00 ? 24  LYS A O    1  
ATOM 357   C CB   . LYS A 1 24  ? -3.077  18.072  5.256  1.00 0.00 ? 24  LYS A CB   1  
ATOM 358   C CG   . LYS A 1 24  ? -3.537  18.255  3.808  1.00 0.00 ? 24  LYS A CG   1  
ATOM 359   C CD   . LYS A 1 24  ? -4.268  19.587  3.628  1.00 0.00 ? 24  LYS A CD   1  
ATOM 360   C CE   . LYS A 1 24  ? -3.557  20.468  2.600  1.00 0.00 ? 24  LYS A CE   1  
ATOM 361   N NZ   . LYS A 1 24  ? -4.152  20.281  1.257  1.00 0.00 ? 24  LYS A NZ   1  
ATOM 362   H H    . LYS A 1 24  ? -4.179  18.565  7.409  1.00 0.00 ? 24  LYS A H    1  
ATOM 363   H HA   . LYS A 1 24  ? -4.809  16.844  5.339  1.00 0.00 ? 24  LYS A HA   1  
ATOM 364   H HB2  . LYS A 1 24  ? -3.109  19.030  5.775  1.00 0.00 ? 24  LYS A HB2  1  
ATOM 365   H HB3  . LYS A 1 24  ? -2.040  17.736  5.272  1.00 0.00 ? 24  LYS A HB3  1  
ATOM 366   H HG2  . LYS A 1 24  ? -2.675  18.216  3.141  1.00 0.00 ? 24  LYS A HG2  1  
ATOM 367   H HG3  . LYS A 1 24  ? -4.195  17.434  3.525  1.00 0.00 ? 24  LYS A HG3  1  
ATOM 368   H HD2  . LYS A 1 24  ? -5.293  19.403  3.308  1.00 0.00 ? 24  LYS A HD2  1  
ATOM 369   H HD3  . LYS A 1 24  ? -4.321  20.108  4.584  1.00 0.00 ? 24  LYS A HD3  1  
ATOM 370   H HE2  . LYS A 1 24  ? -3.632  21.515  2.895  1.00 0.00 ? 24  LYS A HE2  1  
ATOM 371   H HE3  . LYS A 1 24  ? -2.496  20.221  2.571  1.00 0.00 ? 24  LYS A HE3  1  
ATOM 372   H HZ1  . LYS A 1 24  ? -4.223  21.167  0.798  1.00 0.00 ? 24  LYS A HZ1  1  
ATOM 373   H HZ2  . LYS A 1 24  ? -3.571  19.672  0.718  1.00 0.00 ? 24  LYS A HZ2  1  
ATOM 374   H HZ3  . LYS A 1 24  ? -5.063  19.879  1.350  1.00 0.00 ? 24  LYS A HZ3  1  
ATOM 375   N N    . GLU A 1 25  ? -2.706  15.678  7.514  1.00 0.00 ? 25  GLU A N    1  
ATOM 376   C CA   . GLU A 1 25  ? -1.999  14.487  7.954  1.00 0.00 ? 25  GLU A CA   1  
ATOM 377   C C    . GLU A 1 25  ? -2.976  13.322  8.124  1.00 0.00 ? 25  GLU A C    1  
ATOM 378   O O    . GLU A 1 25  ? -2.892  12.327  7.406  1.00 0.00 ? 25  GLU A O    1  
ATOM 379   C CB   . GLU A 1 25  ? -1.231  14.753  9.250  1.00 0.00 ? 25  GLU A CB   1  
ATOM 380   C CG   . GLU A 1 25  ? -0.069  13.771  9.411  1.00 0.00 ? 25  GLU A CG   1  
ATOM 381   C CD   . GLU A 1 25  ? 0.790   14.131  10.624 1.00 0.00 ? 25  GLU A CD   1  
ATOM 382   O OE1  . GLU A 1 25  ? 0.246   14.057  11.747 1.00 0.00 ? 25  GLU A OE1  1  
ATOM 383   O OE2  . GLU A 1 25  ? 1.972   14.473  10.402 1.00 0.00 ? 25  GLU A OE2  1  
ATOM 384   H H    . GLU A 1 25  ? -2.743  16.419  8.184  1.00 0.00 ? 25  GLU A H    1  
ATOM 385   H HA   . GLU A 1 25  ? -1.289  14.261  7.158  1.00 0.00 ? 25  GLU A HA   1  
ATOM 386   H HB2  . GLU A 1 25  ? -0.851  15.775  9.249  1.00 0.00 ? 25  GLU A HB2  1  
ATOM 387   H HB3  . GLU A 1 25  ? -1.906  14.665  10.102 1.00 0.00 ? 25  GLU A HB3  1  
ATOM 388   H HG2  . GLU A 1 25  ? -0.456  12.758  9.523  1.00 0.00 ? 25  GLU A HG2  1  
ATOM 389   H HG3  . GLU A 1 25  ? 0.546   13.779  8.510  1.00 0.00 ? 25  GLU A HG3  1  
ATOM 390   N N    . GLN A 1 26  ? -3.879  13.484  9.079  1.00 0.00 ? 26  GLN A N    1  
ATOM 391   C CA   . GLN A 1 26  ? -4.871  12.458  9.353  1.00 0.00 ? 26  GLN A CA   1  
ATOM 392   C C    . GLN A 1 26  ? -5.696  12.169  8.098  1.00 0.00 ? 26  GLN A C    1  
ATOM 393   O O    . GLN A 1 26  ? -6.173  11.051  7.908  1.00 0.00 ? 26  GLN A O    1  
ATOM 394   C CB   . GLN A 1 26  ? -5.773  12.865  10.520 1.00 0.00 ? 26  GLN A CB   1  
ATOM 395   C CG   . GLN A 1 26  ? -6.647  14.063  10.146 1.00 0.00 ? 26  GLN A CG   1  
ATOM 396   C CD   . GLN A 1 26  ? -7.743  14.290  11.189 1.00 0.00 ? 26  GLN A CD   1  
ATOM 397   O OE1  . GLN A 1 26  ? -7.528  14.881  12.234 1.00 0.00 ? 26  GLN A OE1  1  
ATOM 398   N NE2  . GLN A 1 26  ? -8.927  13.788  10.849 1.00 0.00 ? 26  GLN A NE2  1  
ATOM 399   H H    . GLN A 1 26  ? -3.940  14.296  9.660  1.00 0.00 ? 26  GLN A H    1  
ATOM 400   H HA   . GLN A 1 26  ? -4.301  11.572  9.634  1.00 0.00 ? 26  GLN A HA   1  
ATOM 401   H HB2  . GLN A 1 26  ? -6.405  12.024  10.806 1.00 0.00 ? 26  GLN A HB2  1  
ATOM 402   H HB3  . GLN A 1 26  ? -5.161  13.114  11.388 1.00 0.00 ? 26  GLN A HB3  1  
ATOM 403   H HG2  . GLN A 1 26  ? -6.029  14.957  10.062 1.00 0.00 ? 26  GLN A HG2  1  
ATOM 404   H HG3  . GLN A 1 26  ? -7.100  13.896  9.168  1.00 0.00 ? 26  GLN A HG3  1  
ATOM 405   H HE21 . GLN A 1 26  ? -9.036  13.314  9.975  1.00 0.00 ? 26  GLN A HE21 1  
ATOM 406   H HE22 . GLN A 1 26  ? -9.707  13.886  11.466 1.00 0.00 ? 26  GLN A HE22 1  
ATOM 407   N N    . PHE A 1 27  ? -5.839  13.196  7.273  1.00 0.00 ? 27  PHE A N    1  
ATOM 408   C CA   . PHE A 1 27  ? -6.599  13.066  6.041  1.00 0.00 ? 27  PHE A CA   1  
ATOM 409   C C    . PHE A 1 27  ? -5.971  12.019  5.118  1.00 0.00 ? 27  PHE A C    1  
ATOM 410   O O    . PHE A 1 27  ? -6.666  11.145  4.602  1.00 0.00 ? 27  PHE A O    1  
ATOM 411   C CB   . PHE A 1 27  ? -6.561  14.429  5.346  1.00 0.00 ? 27  PHE A CB   1  
ATOM 412   C CG   . PHE A 1 27  ? -7.803  15.287  5.594  1.00 0.00 ? 27  PHE A CG   1  
ATOM 413   C CD1  . PHE A 1 27  ? -8.498  15.160  6.756  1.00 0.00 ? 27  PHE A CD1  1  
ATOM 414   C CD2  . PHE A 1 27  ? -8.212  16.179  4.651  1.00 0.00 ? 27  PHE A CD2  1  
ATOM 415   C CE1  . PHE A 1 27  ? -9.650  15.957  6.986  1.00 0.00 ? 27  PHE A CE1  1  
ATOM 416   C CE2  . PHE A 1 27  ? -9.365  16.976  4.881  1.00 0.00 ? 27  PHE A CE2  1  
ATOM 417   C CZ   . PHE A 1 27  ? -10.059 16.848  6.043  1.00 0.00 ? 27  PHE A CZ   1  
ATOM 418   H H    . PHE A 1 27  ? -5.449  14.102  7.435  1.00 0.00 ? 27  PHE A H    1  
ATOM 419   H HA   . PHE A 1 27  ? -7.606  12.750  6.313  1.00 0.00 ? 27  PHE A HA   1  
ATOM 420   H HB2  . PHE A 1 27  ? -5.681  14.974  5.687  1.00 0.00 ? 27  PHE A HB2  1  
ATOM 421   H HB3  . PHE A 1 27  ? -6.446  14.275  4.274  1.00 0.00 ? 27  PHE A HB3  1  
ATOM 422   H HD1  . PHE A 1 27  ? -8.170  14.446  7.511  1.00 0.00 ? 27  PHE A HD1  1  
ATOM 423   H HD2  . PHE A 1 27  ? -7.655  16.281  3.720  1.00 0.00 ? 27  PHE A HD2  1  
ATOM 424   H HE1  . PHE A 1 27  ? -10.207 15.855  7.917  1.00 0.00 ? 27  PHE A HE1  1  
ATOM 425   H HE2  . PHE A 1 27  ? -9.693  17.690  4.126  1.00 0.00 ? 27  PHE A HE2  1  
ATOM 426   H HZ   . PHE A 1 27  ? -10.944 17.460  6.219  1.00 0.00 ? 27  PHE A HZ   1  
ATOM 427   N N    . ARG A 1 28  ? -4.664  12.142  4.938  1.00 0.00 ? 28  ARG A N    1  
ATOM 428   C CA   . ARG A 1 28  ? -3.935  11.218  4.087  1.00 0.00 ? 28  ARG A CA   1  
ATOM 429   C C    . ARG A 1 28  ? -3.006  10.341  4.929  1.00 0.00 ? 28  ARG A C    1  
ATOM 430   O O    . ARG A 1 28  ? -1.854  10.118  4.559  1.00 0.00 ? 28  ARG A O    1  
ATOM 431   C CB   . ARG A 1 28  ? -3.109  11.968  3.040  1.00 0.00 ? 28  ARG A CB   1  
ATOM 432   C CG   . ARG A 1 28  ? -4.013  12.747  2.083  1.00 0.00 ? 28  ARG A CG   1  
ATOM 433   C CD   . ARG A 1 28  ? -3.888  14.254  2.315  1.00 0.00 ? 28  ARG A CD   1  
ATOM 434   N NE   . ARG A 1 28  ? -3.712  14.952  1.022  1.00 0.00 ? 28  ARG A NE   1  
ATOM 435   C CZ   . ARG A 1 28  ? -2.549  15.024  0.359  1.00 0.00 ? 28  ARG A CZ   1  
ATOM 436   N NH1  . ARG A 1 28  ? -1.453  14.441  0.863  1.00 0.00 ? 28  ARG A NH1  1  
ATOM 437   N NH2  . ARG A 1 28  ? -2.483  15.679  -0.808 1.00 0.00 ? 28  ARG A NH2  1  
ATOM 438   H H    . ARG A 1 28  ? -4.107  12.856  5.362  1.00 0.00 ? 28  ARG A H    1  
ATOM 439   H HA   . ARG A 1 28  ? -4.706  10.619  3.602  1.00 0.00 ? 28  ARG A HA   1  
ATOM 440   H HB2  . ARG A 1 28  ? -2.422  12.653  3.537  1.00 0.00 ? 28  ARG A HB2  1  
ATOM 441   H HB3  . ARG A 1 28  ? -2.500  11.260  2.477  1.00 0.00 ? 28  ARG A HB3  1  
ATOM 442   H HG2  . ARG A 1 28  ? -3.747  12.511  1.053  1.00 0.00 ? 28  ARG A HG2  1  
ATOM 443   H HG3  . ARG A 1 28  ? -5.049  12.439  2.224  1.00 0.00 ? 28  ARG A HG3  1  
ATOM 444   H HD2  . ARG A 1 28  ? -4.778  14.628  2.821  1.00 0.00 ? 28  ARG A HD2  1  
ATOM 445   H HD3  . ARG A 1 28  ? -3.039  14.461  2.968  1.00 0.00 ? 28  ARG A HD3  1  
ATOM 446   H HE   . ARG A 1 28  ? -4.510  15.399  0.618  1.00 0.00 ? 28  ARG A HE   1  
ATOM 447   H HH11 . ARG A 1 28  ? -1.503  13.952  1.734  1.00 0.00 ? 28  ARG A HH11 1  
ATOM 448   H HH12 . ARG A 1 28  ? -0.586  14.494  0.369  1.00 0.00 ? 28  ARG A HH12 1  
ATOM 449   H HH21 . ARG A 1 28  ? -3.301  16.115  -1.184 1.00 0.00 ? 28  ARG A HH21 1  
ATOM 450   H HH22 . ARG A 1 28  ? -1.615  15.733  -1.303 1.00 0.00 ? 28  ARG A HH22 1  
ATOM 451   N N    . LYS A 1 29  ? -3.541  9.868   6.044  1.00 0.00 ? 29  LYS A N    1  
ATOM 452   C CA   . LYS A 1 29  ? -2.774  9.021   6.942  1.00 0.00 ? 29  LYS A CA   1  
ATOM 453   C C    . LYS A 1 29  ? -3.618  7.808   7.337  1.00 0.00 ? 29  LYS A C    1  
ATOM 454   O O    . LYS A 1 29  ? -4.627  7.947   8.027  1.00 0.00 ? 29  LYS A O    1  
ATOM 455   C CB   . LYS A 1 29  ? -2.262  9.829   8.135  1.00 0.00 ? 29  LYS A CB   1  
ATOM 456   C CG   . LYS A 1 29  ? -1.588  8.920   9.165  1.00 0.00 ? 29  LYS A CG   1  
ATOM 457   C CD   . LYS A 1 29  ? -2.185  9.133   10.558 1.00 0.00 ? 29  LYS A CD   1  
ATOM 458   C CE   . LYS A 1 29  ? -1.191  9.842   11.479 1.00 0.00 ? 29  LYS A CE   1  
ATOM 459   N NZ   . LYS A 1 29  ? -1.784  10.052  12.818 1.00 0.00 ? 29  LYS A NZ   1  
ATOM 460   H H    . LYS A 1 29  ? -4.479  10.054  6.338  1.00 0.00 ? 29  LYS A H    1  
ATOM 461   H HA   . LYS A 1 29  ? -1.900  8.670   6.392  1.00 0.00 ? 29  LYS A HA   1  
ATOM 462   H HB2  . LYS A 1 29  ? -1.553  10.583  7.792  1.00 0.00 ? 29  LYS A HB2  1  
ATOM 463   H HB3  . LYS A 1 29  ? -3.091  10.361  8.602  1.00 0.00 ? 29  LYS A HB3  1  
ATOM 464   H HG2  . LYS A 1 29  ? -1.708  7.878   8.869  1.00 0.00 ? 29  LYS A HG2  1  
ATOM 465   H HG3  . LYS A 1 29  ? -0.518  9.123   9.190  1.00 0.00 ? 29  LYS A HG3  1  
ATOM 466   H HD2  . LYS A 1 29  ? -3.099  9.723   10.480 1.00 0.00 ? 29  LYS A HD2  1  
ATOM 467   H HD3  . LYS A 1 29  ? -2.463  8.171   10.989 1.00 0.00 ? 29  LYS A HD3  1  
ATOM 468   H HE2  . LYS A 1 29  ? -0.280  9.249   11.566 1.00 0.00 ? 29  LYS A HE2  1  
ATOM 469   H HE3  . LYS A 1 29  ? -0.906  10.801  11.046 1.00 0.00 ? 29  LYS A HE3  1  
ATOM 470   H HZ1  . LYS A 1 29  ? -1.661  11.007  13.091 1.00 0.00 ? 29  LYS A HZ1  1  
ATOM 471   H HZ2  . LYS A 1 29  ? -2.760  9.837   12.789 1.00 0.00 ? 29  LYS A HZ2  1  
ATOM 472   H HZ3  . LYS A 1 29  ? -1.330  9.456   13.481 1.00 0.00 ? 29  LYS A HZ3  1  
ATOM 473   N N    . LEU A 1 30  ? -3.174  6.645   6.884  1.00 0.00 ? 30  LEU A N    1  
ATOM 474   C CA   . LEU A 1 30  ? -3.876  5.408   7.181  1.00 0.00 ? 30  LEU A CA   1  
ATOM 475   C C    . LEU A 1 30  ? -3.083  4.614   8.222  1.00 0.00 ? 30  LEU A C    1  
ATOM 476   O O    . LEU A 1 30  ? -1.857  4.543   8.152  1.00 0.00 ? 30  LEU A O    1  
ATOM 477   C CB   . LEU A 1 30  ? -4.156  4.628   5.895  1.00 0.00 ? 30  LEU A CB   1  
ATOM 478   C CG   . LEU A 1 30  ? -5.502  4.905   5.222  1.00 0.00 ? 30  LEU A CG   1  
ATOM 479   C CD1  . LEU A 1 30  ? -5.639  6.386   4.861  1.00 0.00 ? 30  LEU A CD1  1  
ATOM 480   C CD2  . LEU A 1 30  ? -5.705  3.998   4.008  1.00 0.00 ? 30  LEU A CD2  1  
ATOM 481   H H    . LEU A 1 30  ? -2.353  6.540   6.323  1.00 0.00 ? 30  LEU A H    1  
ATOM 482   H HA   . LEU A 1 30  ? -4.841  5.676   7.613  1.00 0.00 ? 30  LEU A HA   1  
ATOM 483   H HB2  . LEU A 1 30  ? -3.363  4.847   5.181  1.00 0.00 ? 30  LEU A HB2  1  
ATOM 484   H HB3  . LEU A 1 30  ? -4.098  3.563   6.120  1.00 0.00 ? 30  LEU A HB3  1  
ATOM 485   H HG   . LEU A 1 30  ? -6.294  4.673   5.934  1.00 0.00 ? 30  LEU A HG   1  
ATOM 486   H HD11 . LEU A 1 30  ? -6.584  6.547   4.341  1.00 0.00 ? 30  LEU A HD11 1  
ATOM 487   H HD12 . LEU A 1 30  ? -5.618  6.985   5.771  1.00 0.00 ? 30  LEU A HD12 1  
ATOM 488   H HD13 . LEU A 1 30  ? -4.814  6.680   4.213  1.00 0.00 ? 30  LEU A HD13 1  
ATOM 489   H HD21 . LEU A 1 30  ? -6.018  4.598   3.153  1.00 0.00 ? 30  LEU A HD21 1  
ATOM 490   H HD22 . LEU A 1 30  ? -4.769  3.491   3.772  1.00 0.00 ? 30  LEU A HD22 1  
ATOM 491   H HD23 . LEU A 1 30  ? -6.473  3.257   4.232  1.00 0.00 ? 30  LEU A HD23 1  
ATOM 492   N N    . PHE A 1 31  ? -3.816  4.037   9.163  1.00 0.00 ? 31  PHE A N    1  
ATOM 493   C CA   . PHE A 1 31  ? -3.196  3.251   10.217 1.00 0.00 ? 31  PHE A CA   1  
ATOM 494   C C    . PHE A 1 31  ? -3.224  1.760   9.876  1.00 0.00 ? 31  PHE A C    1  
ATOM 495   O O    . PHE A 1 31  ? -4.290  1.148   9.837  1.00 0.00 ? 31  PHE A O    1  
ATOM 496   C CB   . PHE A 1 31  ? -4.013  3.487   11.489 1.00 0.00 ? 31  PHE A CB   1  
ATOM 497   C CG   . PHE A 1 31  ? -3.516  2.698   12.702 1.00 0.00 ? 31  PHE A CG   1  
ATOM 498   C CD1  . PHE A 1 31  ? -3.773  1.366   12.799 1.00 0.00 ? 31  PHE A CD1  1  
ATOM 499   C CD2  . PHE A 1 31  ? -2.816  3.328   13.684 1.00 0.00 ? 31  PHE A CD2  1  
ATOM 500   C CE1  . PHE A 1 31  ? -3.312  0.633   13.924 1.00 0.00 ? 31  PHE A CE1  1  
ATOM 501   C CE2  . PHE A 1 31  ? -2.355  2.596   14.809 1.00 0.00 ? 31  PHE A CE2  1  
ATOM 502   C CZ   . PHE A 1 31  ? -2.613  1.264   14.906 1.00 0.00 ? 31  PHE A CZ   1  
ATOM 503   H H    . PHE A 1 31  ? -4.813  4.100   9.213  1.00 0.00 ? 31  PHE A H    1  
ATOM 504   H HA   . PHE A 1 31  ? -2.162  3.584   10.302 1.00 0.00 ? 31  PHE A HA   1  
ATOM 505   H HB2  . PHE A 1 31  ? -3.995  4.550   11.728 1.00 0.00 ? 31  PHE A HB2  1  
ATOM 506   H HB3  . PHE A 1 31  ? -5.052  3.221   11.297 1.00 0.00 ? 31  PHE A HB3  1  
ATOM 507   H HD1  . PHE A 1 31  ? -4.334  0.861   12.012 1.00 0.00 ? 31  PHE A HD1  1  
ATOM 508   H HD2  . PHE A 1 31  ? -2.610  4.396   13.606 1.00 0.00 ? 31  PHE A HD2  1  
ATOM 509   H HE1  . PHE A 1 31  ? -3.519  -0.434  14.002 1.00 0.00 ? 31  PHE A HE1  1  
ATOM 510   H HE2  . PHE A 1 31  ? -1.795  3.101   15.596 1.00 0.00 ? 31  PHE A HE2  1  
ATOM 511   H HZ   . PHE A 1 31  ? -2.259  0.701   15.770 1.00 0.00 ? 31  PHE A HZ   1  
ATOM 512   N N    . ILE A 1 32  ? -2.038  1.218   9.639  1.00 0.00 ? 32  ILE A N    1  
ATOM 513   C CA   . ILE A 1 32  ? -1.913  -0.190  9.303  1.00 0.00 ? 32  ILE A CA   1  
ATOM 514   C C    . ILE A 1 32  ? -1.877  -1.016  10.591 1.00 0.00 ? 32  ILE A C    1  
ATOM 515   O O    . ILE A 1 32  ? -1.085  -0.736  11.490 1.00 0.00 ? 32  ILE A O    1  
ATOM 516   C CB   . ILE A 1 32  ? -0.705  -0.418  8.393  1.00 0.00 ? 32  ILE A CB   1  
ATOM 517   C CG1  . ILE A 1 32  ? -0.590  0.691   7.346  1.00 0.00 ? 32  ILE A CG1  1  
ATOM 518   C CG2  . ILE A 1 32  ? -0.755  -1.807  7.753  1.00 0.00 ? 32  ILE A CG2  1  
ATOM 519   C CD1  . ILE A 1 32  ? -1.785  0.668   6.390  1.00 0.00 ? 32  ILE A CD1  1  
ATOM 520   H H    . ILE A 1 32  ? -1.176  1.723   9.673  1.00 0.00 ? 32  ILE A H    1  
ATOM 521   H HA   . ILE A 1 32  ? -2.801  -0.471  8.737  1.00 0.00 ? 32  ILE A HA   1  
ATOM 522   H HB   . ILE A 1 32  ? 0.197   -0.378  9.005  1.00 0.00 ? 32  ILE A HB   1  
ATOM 523   H HG12 . ILE A 1 32  ? -0.535  1.660   7.842  1.00 0.00 ? 32  ILE A HG12 1  
ATOM 524   H HG13 . ILE A 1 32  ? 0.334   0.569   6.781  1.00 0.00 ? 32  ILE A HG13 1  
ATOM 525   H HG21 . ILE A 1 32  ? -1.255  -1.745  6.787  1.00 0.00 ? 32  ILE A HG21 1  
ATOM 526   H HG22 . ILE A 1 32  ? 0.260   -2.180  7.614  1.00 0.00 ? 32  ILE A HG22 1  
ATOM 527   H HG23 . ILE A 1 32  ? -1.305  -2.487  8.404  1.00 0.00 ? 32  ILE A HG23 1  
ATOM 528   H HD11 . ILE A 1 32  ? -1.437  0.459   5.378  1.00 0.00 ? 32  ILE A HD11 1  
ATOM 529   H HD12 . ILE A 1 32  ? -2.484  -0.107  6.701  1.00 0.00 ? 32  ILE A HD12 1  
ATOM 530   H HD13 . ILE A 1 32  ? -2.284  1.637   6.409  1.00 0.00 ? 32  ILE A HD13 1  
ATOM 531   N N    . GLY A 1 33  ? -2.744  -2.016  10.639 1.00 0.00 ? 33  GLY A N    1  
ATOM 532   C CA   . GLY A 1 33  ? -2.821  -2.884  11.802 1.00 0.00 ? 33  GLY A CA   1  
ATOM 533   C C    . GLY A 1 33  ? -2.480  -4.329  11.431 1.00 0.00 ? 33  GLY A C    1  
ATOM 534   O O    . GLY A 1 33  ? -2.967  -4.848  10.428 1.00 0.00 ? 33  GLY A O    1  
ATOM 535   H H    . GLY A 1 33  ? -3.384  -2.237  9.904  1.00 0.00 ? 33  GLY A H    1  
ATOM 536   H HA2  . GLY A 1 33  ? -2.135  -2.531  12.571 1.00 0.00 ? 33  GLY A HA2  1  
ATOM 537   H HA3  . GLY A 1 33  ? -3.824  -2.841  12.226 1.00 0.00 ? 33  GLY A HA3  1  
ATOM 538   N N    . GLY A 1 34  ? -1.646  -4.938  12.261 1.00 0.00 ? 34  GLY A N    1  
ATOM 539   C CA   . GLY A 1 34  ? -1.234  -6.313  12.033 1.00 0.00 ? 34  GLY A CA   1  
ATOM 540   C C    . GLY A 1 34  ? -0.128  -6.386  10.978 1.00 0.00 ? 34  GLY A C    1  
ATOM 541   O O    . GLY A 1 34  ? -0.374  -6.793  9.844  1.00 0.00 ? 34  GLY A O    1  
ATOM 542   H H    . GLY A 1 34  ? -1.254  -4.509  13.075 1.00 0.00 ? 34  GLY A H    1  
ATOM 543   H HA2  . GLY A 1 34  ? -0.880  -6.749  12.967 1.00 0.00 ? 34  GLY A HA2  1  
ATOM 544   H HA3  . GLY A 1 34  ? -2.090  -6.904  11.709 1.00 0.00 ? 34  GLY A HA3  1  
ATOM 545   N N    . LEU A 1 35  ? 1.066   -5.985  11.390 1.00 0.00 ? 35  LEU A N    1  
ATOM 546   C CA   . LEU A 1 35  ? 2.210   -6.000  10.494 1.00 0.00 ? 35  LEU A CA   1  
ATOM 547   C C    . LEU A 1 35  ? 3.000   -7.293  10.705 1.00 0.00 ? 35  LEU A C    1  
ATOM 548   O O    . LEU A 1 35  ? 3.963   -7.560  9.988  1.00 0.00 ? 35  LEU A O    1  
ATOM 549   C CB   . LEU A 1 35  ? 3.047   -4.732  10.673 1.00 0.00 ? 35  LEU A CB   1  
ATOM 550   C CG   . LEU A 1 35  ? 2.298   -3.407  10.517 1.00 0.00 ? 35  LEU A CG   1  
ATOM 551   C CD1  . LEU A 1 35  ? 3.253   -2.282  10.113 1.00 0.00 ? 35  LEU A CD1  1  
ATOM 552   C CD2  . LEU A 1 35  ? 1.131   -3.548  9.538  1.00 0.00 ? 35  LEU A CD2  1  
ATOM 553   H H    . LEU A 1 35  ? 1.257   -5.656  12.314 1.00 0.00 ? 35  LEU A H    1  
ATOM 554   H HA   . LEU A 1 35  ? 1.826   -5.992  9.474  1.00 0.00 ? 35  LEU A HA   1  
ATOM 555   H HB2  . LEU A 1 35  ? 3.500   -4.756  11.664 1.00 0.00 ? 35  LEU A HB2  1  
ATOM 556   H HB3  . LEU A 1 35  ? 3.862   -4.753  9.949  1.00 0.00 ? 35  LEU A HB3  1  
ATOM 557   H HG   . LEU A 1 35  ? 1.876   -3.138  11.485 1.00 0.00 ? 35  LEU A HG   1  
ATOM 558   H HD11 . LEU A 1 35  ? 3.908   -2.042  10.950 1.00 0.00 ? 35  LEU A HD11 1  
ATOM 559   H HD12 . LEU A 1 35  ? 3.854   -2.604  9.262  1.00 0.00 ? 35  LEU A HD12 1  
ATOM 560   H HD13 . LEU A 1 35  ? 2.677   -1.398  9.837  1.00 0.00 ? 35  LEU A HD13 1  
ATOM 561   H HD21 . LEU A 1 35  ? 0.494   -2.666  9.603  1.00 0.00 ? 35  LEU A HD21 1  
ATOM 562   H HD22 . LEU A 1 35  ? 1.518   -3.643  8.523  1.00 0.00 ? 35  LEU A HD22 1  
ATOM 563   H HD23 . LEU A 1 35  ? 0.551   -4.436  9.790  1.00 0.00 ? 35  LEU A HD23 1  
ATOM 564   N N    . SER A 1 36  ? 2.563   -8.062  11.691 1.00 0.00 ? 36  SER A N    1  
ATOM 565   C CA   . SER A 1 36  ? 3.217   -9.321  12.005 1.00 0.00 ? 36  SER A CA   1  
ATOM 566   C C    . SER A 1 36  ? 4.459   -9.066  12.862 1.00 0.00 ? 36  SER A C    1  
ATOM 567   O O    . SER A 1 36  ? 5.080   -10.005 13.357 1.00 0.00 ? 36  SER A O    1  
ATOM 568   C CB   . SER A 1 36  ? 3.598   -10.077 10.731 1.00 0.00 ? 36  SER A CB   1  
ATOM 569   O OG   . SER A 1 36  ? 5.010   -10.175 10.570 1.00 0.00 ? 36  SER A OG   1  
ATOM 570   H H    . SER A 1 36  ? 1.779   -7.838  12.270 1.00 0.00 ? 36  SER A H    1  
ATOM 571   H HA   . SER A 1 36  ? 2.480   -9.898  12.563 1.00 0.00 ? 36  SER A HA   1  
ATOM 572   H HB2  . SER A 1 36  ? 3.166   -11.077 10.760 1.00 0.00 ? 36  SER A HB2  1  
ATOM 573   H HB3  . SER A 1 36  ? 3.169   -9.570  9.867  1.00 0.00 ? 36  SER A HB3  1  
ATOM 574   H HG   . SER A 1 36  ? 5.334   -11.053 10.923 1.00 0.00 ? 36  SER A HG   1  
ATOM 575   N N    . PHE A 1 37  ? 4.785   -7.790  13.010 1.00 0.00 ? 37  PHE A N    1  
ATOM 576   C CA   . PHE A 1 37  ? 5.941   -7.399  13.798 1.00 0.00 ? 37  PHE A CA   1  
ATOM 577   C C    . PHE A 1 37  ? 7.241   -7.674  13.038 1.00 0.00 ? 37  PHE A C    1  
ATOM 578   O O    . PHE A 1 37  ? 8.327   -7.370  13.528 1.00 0.00 ? 37  PHE A O    1  
ATOM 579   C CB   . PHE A 1 37  ? 5.921   -8.246  15.072 1.00 0.00 ? 37  PHE A CB   1  
ATOM 580   C CG   . PHE A 1 37  ? 4.516   -8.545  15.599 1.00 0.00 ? 37  PHE A CG   1  
ATOM 581   C CD1  . PHE A 1 37  ? 3.495   -7.684  15.339 1.00 0.00 ? 37  PHE A CD1  1  
ATOM 582   C CD2  . PHE A 1 37  ? 4.288   -9.670  16.327 1.00 0.00 ? 37  PHE A CD2  1  
ATOM 583   C CE1  . PHE A 1 37  ? 2.191   -7.961  15.827 1.00 0.00 ? 37  PHE A CE1  1  
ATOM 584   C CE2  . PHE A 1 37  ? 2.984   -9.947  16.815 1.00 0.00 ? 37  PHE A CE2  1  
ATOM 585   C CZ   . PHE A 1 37  ? 1.963   -9.087  16.556 1.00 0.00 ? 37  PHE A CZ   1  
ATOM 586   H H    . PHE A 1 37  ? 4.275   -7.032  12.604 1.00 0.00 ? 37  PHE A H    1  
ATOM 587   H HA   . PHE A 1 37  ? 5.855   -6.330  13.991 1.00 0.00 ? 37  PHE A HA   1  
ATOM 588   H HB2  . PHE A 1 37  ? 6.433   -9.188  14.878 1.00 0.00 ? 37  PHE A HB2  1  
ATOM 589   H HB3  . PHE A 1 37  ? 6.487   -7.730  15.848 1.00 0.00 ? 37  PHE A HB3  1  
ATOM 590   H HD1  . PHE A 1 37  ? 3.678   -6.782  14.755 1.00 0.00 ? 37  PHE A HD1  1  
ATOM 591   H HD2  . PHE A 1 37  ? 5.106   -10.360 16.535 1.00 0.00 ? 37  PHE A HD2  1  
ATOM 592   H HE1  . PHE A 1 37  ? 1.373   -7.272  15.619 1.00 0.00 ? 37  PHE A HE1  1  
ATOM 593   H HE2  . PHE A 1 37  ? 2.801   -10.850 17.399 1.00 0.00 ? 37  PHE A HE2  1  
ATOM 594   H HZ   . PHE A 1 37  ? 0.962   -9.300  16.931 1.00 0.00 ? 37  PHE A HZ   1  
ATOM 595   N N    . GLU A 1 38  ? 7.086   -8.245  11.852 1.00 0.00 ? 38  GLU A N    1  
ATOM 596   C CA   . GLU A 1 38  ? 8.233   -8.564  11.020 1.00 0.00 ? 38  GLU A CA   1  
ATOM 597   C C    . GLU A 1 38  ? 8.254   -7.669  9.779  1.00 0.00 ? 38  GLU A C    1  
ATOM 598   O O    . GLU A 1 38  ? 9.106   -7.831  8.907  1.00 0.00 ? 38  GLU A O    1  
ATOM 599   C CB   . GLU A 1 38  ? 8.232   -10.043 10.628 1.00 0.00 ? 38  GLU A CB   1  
ATOM 600   C CG   . GLU A 1 38  ? 9.159   -10.852 11.539 1.00 0.00 ? 38  GLU A CG   1  
ATOM 601   C CD   . GLU A 1 38  ? 10.463  -11.205 10.820 1.00 0.00 ? 38  GLU A CD   1  
ATOM 602   O OE1  . GLU A 1 38  ? 10.470  -12.254 10.140 1.00 0.00 ? 38  GLU A OE1  1  
ATOM 603   O OE2  . GLU A 1 38  ? 11.423  -10.419 10.968 1.00 0.00 ? 38  GLU A OE2  1  
ATOM 604   H H    . GLU A 1 38  ? 6.199   -8.490  11.461 1.00 0.00 ? 38  GLU A H    1  
ATOM 605   H HA   . GLU A 1 38  ? 9.106   -8.359  11.639 1.00 0.00 ? 38  GLU A HA   1  
ATOM 606   H HB2  . GLU A 1 38  ? 7.219   -10.439 10.691 1.00 0.00 ? 38  GLU A HB2  1  
ATOM 607   H HB3  . GLU A 1 38  ? 8.553   -10.149 9.592  1.00 0.00 ? 38  GLU A HB3  1  
ATOM 608   H HG2  . GLU A 1 38  ? 9.379   -10.279 12.440 1.00 0.00 ? 38  GLU A HG2  1  
ATOM 609   H HG3  . GLU A 1 38  ? 8.656   -11.765 11.857 1.00 0.00 ? 38  GLU A HG3  1  
ATOM 610   N N    . THR A 1 39  ? 7.306   -6.744  9.741  1.00 0.00 ? 39  THR A N    1  
ATOM 611   C CA   . THR A 1 39  ? 7.205   -5.822  8.622  1.00 0.00 ? 39  THR A CA   1  
ATOM 612   C C    . THR A 1 39  ? 7.686   -4.429  9.033  1.00 0.00 ? 39  THR A C    1  
ATOM 613   O O    . THR A 1 39  ? 7.023   -3.745  9.811  1.00 0.00 ? 39  THR A O    1  
ATOM 614   C CB   . THR A 1 39  ? 5.760   -5.843  8.121  1.00 0.00 ? 39  THR A CB   1  
ATOM 615   O OG1  . THR A 1 39  ? 5.742   -6.892  7.156  1.00 0.00 ? 39  THR A OG1  1  
ATOM 616   C CG2  . THR A 1 39  ? 5.400   -4.592  7.318  1.00 0.00 ? 39  THR A CG2  1  
ATOM 617   H H    . THR A 1 39  ? 6.618   -6.619  10.455 1.00 0.00 ? 39  THR A H    1  
ATOM 618   H HA   . THR A 1 39  ? 7.870   -6.169  7.830  1.00 0.00 ? 39  THR A HA   1  
ATOM 619   H HB   . THR A 1 39  ? 5.064   -5.989  8.947  1.00 0.00 ? 39  THR A HB   1  
ATOM 620   H HG1  . THR A 1 39  ? 6.174   -7.711  7.533  1.00 0.00 ? 39  THR A HG1  1  
ATOM 621   H HG21 . THR A 1 39  ? 5.545   -3.708  7.938  1.00 0.00 ? 39  THR A HG21 1  
ATOM 622   H HG22 . THR A 1 39  ? 6.041   -4.528  6.438  1.00 0.00 ? 39  THR A HG22 1  
ATOM 623   H HG23 . THR A 1 39  ? 4.357   -4.649  7.004  1.00 0.00 ? 39  THR A HG23 1  
ATOM 624   N N    . THR A 1 40  ? 8.835   -4.051  8.492  1.00 0.00 ? 40  THR A N    1  
ATOM 625   C CA   . THR A 1 40  ? 9.411   -2.752  8.793  1.00 0.00 ? 40  THR A CA   1  
ATOM 626   C C    . THR A 1 40  ? 8.765   -1.668  7.928  1.00 0.00 ? 40  THR A C    1  
ATOM 627   O O    . THR A 1 40  ? 7.903   -1.961  7.100  1.00 0.00 ? 40  THR A O    1  
ATOM 628   C CB   . THR A 1 40  ? 10.927  -2.853  8.608  1.00 0.00 ? 40  THR A CB   1  
ATOM 629   O OG1  . THR A 1 40  ? 11.081  -3.445  7.321  1.00 0.00 ? 40  THR A OG1  1  
ATOM 630   C CG2  . THR A 1 40  ? 11.567  -3.864  9.563  1.00 0.00 ? 40  THR A CG2  1  
ATOM 631   H H    . THR A 1 40  ? 9.367   -4.614  7.860  1.00 0.00 ? 40  THR A H    1  
ATOM 632   H HA   . THR A 1 40  ? 9.187   -2.508  9.831  1.00 0.00 ? 40  THR A HA   1  
ATOM 633   H HB   . THR A 1 40  ? 11.397  -1.874  8.705  1.00 0.00 ? 40  THR A HB   1  
ATOM 634   H HG1  . THR A 1 40  ? 11.683  -2.882  6.756  1.00 0.00 ? 40  THR A HG1  1  
ATOM 635   H HG21 . THR A 1 40  ? 11.064  -3.820  10.529 1.00 0.00 ? 40  THR A HG21 1  
ATOM 636   H HG22 . THR A 1 40  ? 11.470  -4.867  9.147  1.00 0.00 ? 40  THR A HG22 1  
ATOM 637   H HG23 . THR A 1 40  ? 12.622  -3.624  9.691  1.00 0.00 ? 40  THR A HG23 1  
ATOM 638   N N    . GLU A 1 41  ? 9.206   -0.438  8.149  1.00 0.00 ? 41  GLU A N    1  
ATOM 639   C CA   . GLU A 1 41  ? 8.681   0.691   7.400  1.00 0.00 ? 41  GLU A CA   1  
ATOM 640   C C    . GLU A 1 41  ? 8.796   0.430   5.896  1.00 0.00 ? 41  GLU A C    1  
ATOM 641   O O    . GLU A 1 41  ? 7.811   0.540   5.167  1.00 0.00 ? 41  GLU A O    1  
ATOM 642   C CB   . GLU A 1 41  ? 9.397   1.986   7.787  1.00 0.00 ? 41  GLU A CB   1  
ATOM 643   C CG   . GLU A 1 41  ? 9.269   2.256   9.288  1.00 0.00 ? 41  GLU A CG   1  
ATOM 644   C CD   . GLU A 1 41  ? 9.956   3.569   9.669  1.00 0.00 ? 41  GLU A CD   1  
ATOM 645   O OE1  . GLU A 1 41  ? 10.902  3.945   8.945  1.00 0.00 ? 41  GLU A OE1  1  
ATOM 646   O OE2  . GLU A 1 41  ? 9.519   4.166   10.677 1.00 0.00 ? 41  GLU A OE2  1  
ATOM 647   H H    . GLU A 1 41  ? 9.907   -0.208  8.824  1.00 0.00 ? 41  GLU A H    1  
ATOM 648   H HA   . GLU A 1 41  ? 7.631   0.764   7.684  1.00 0.00 ? 41  GLU A HA   1  
ATOM 649   H HB2  . GLU A 1 41  ? 10.451  1.919   7.515  1.00 0.00 ? 41  GLU A HB2  1  
ATOM 650   H HB3  . GLU A 1 41  ? 8.976   2.821   7.227  1.00 0.00 ? 41  GLU A HB3  1  
ATOM 651   H HG2  . GLU A 1 41  ? 8.215   2.299   9.564  1.00 0.00 ? 41  GLU A HG2  1  
ATOM 652   H HG3  . GLU A 1 41  ? 9.712   1.433   9.848  1.00 0.00 ? 41  GLU A HG3  1  
ATOM 653   N N    . GLU A 1 42  ? 10.005  0.088   5.478  1.00 0.00 ? 42  GLU A N    1  
ATOM 654   C CA   . GLU A 1 42  ? 10.261  -0.190  4.075  1.00 0.00 ? 42  GLU A CA   1  
ATOM 655   C C    . GLU A 1 42  ? 9.437   -1.393  3.613  1.00 0.00 ? 42  GLU A C    1  
ATOM 656   O O    . GLU A 1 42  ? 8.567   -1.262  2.754  1.00 0.00 ? 42  GLU A O    1  
ATOM 657   C CB   . GLU A 1 42  ? 11.753  -0.419  3.824  1.00 0.00 ? 42  GLU A CB   1  
ATOM 658   C CG   . GLU A 1 42  ? 12.312  0.626   2.856  1.00 0.00 ? 42  GLU A CG   1  
ATOM 659   C CD   . GLU A 1 42  ? 13.635  0.156   2.247  1.00 0.00 ? 42  GLU A CD   1  
ATOM 660   O OE1  . GLU A 1 42  ? 14.572  -0.082  3.040  1.00 0.00 ? 42  GLU A OE1  1  
ATOM 661   O OE2  . GLU A 1 42  ? 13.680  0.046   1.003  1.00 0.00 ? 42  GLU A OE2  1  
ATOM 662   H H    . GLU A 1 42  ? 10.800  0.000   6.078  1.00 0.00 ? 42  GLU A H    1  
ATOM 663   H HA   . GLU A 1 42  ? 9.942   0.704   3.540  1.00 0.00 ? 42  GLU A HA   1  
ATOM 664   H HB2  . GLU A 1 42  ? 12.295  -0.372  4.768  1.00 0.00 ? 42  GLU A HB2  1  
ATOM 665   H HB3  . GLU A 1 42  ? 11.908  -1.417  3.416  1.00 0.00 ? 42  GLU A HB3  1  
ATOM 666   H HG2  . GLU A 1 42  ? 11.590  0.816   2.062  1.00 0.00 ? 42  GLU A HG2  1  
ATOM 667   H HG3  . GLU A 1 42  ? 12.464  1.569   3.381  1.00 0.00 ? 42  GLU A HG3  1  
ATOM 668   N N    . SER A 1 43  ? 9.740   -2.540  4.205  1.00 0.00 ? 43  SER A N    1  
ATOM 669   C CA   . SER A 1 43  ? 9.038   -3.766  3.865  1.00 0.00 ? 43  SER A CA   1  
ATOM 670   C C    . SER A 1 43  ? 7.548   -3.479  3.669  1.00 0.00 ? 43  SER A C    1  
ATOM 671   O O    . SER A 1 43  ? 6.909   -4.062  2.795  1.00 0.00 ? 43  SER A O    1  
ATOM 672   C CB   . SER A 1 43  ? 9.236   -4.831  4.945  1.00 0.00 ? 43  SER A CB   1  
ATOM 673   O OG   . SER A 1 43  ? 10.445  -5.561  4.760  1.00 0.00 ? 43  SER A OG   1  
ATOM 674   H H    . SER A 1 43  ? 10.449  -2.638  4.903  1.00 0.00 ? 43  SER A H    1  
ATOM 675   H HA   . SER A 1 43  ? 9.487   -4.107  2.932  1.00 0.00 ? 43  SER A HA   1  
ATOM 676   H HB2  . SER A 1 43  ? 9.246   -4.356  5.926  1.00 0.00 ? 43  SER A HB2  1  
ATOM 677   H HB3  . SER A 1 43  ? 8.391   -5.520  4.934  1.00 0.00 ? 43  SER A HB3  1  
ATOM 678   H HG   . SER A 1 43  ? 11.014  -5.112  4.071  1.00 0.00 ? 43  SER A HG   1  
ATOM 679   N N    . LEU A 1 44  ? 7.037   -2.580  4.498  1.00 0.00 ? 44  LEU A N    1  
ATOM 680   C CA   . LEU A 1 44  ? 5.634   -2.208  4.427  1.00 0.00 ? 44  LEU A CA   1  
ATOM 681   C C    . LEU A 1 44  ? 5.400   -1.352  3.181  1.00 0.00 ? 44  LEU A C    1  
ATOM 682   O O    . LEU A 1 44  ? 4.587   -1.701  2.328  1.00 0.00 ? 44  LEU A O    1  
ATOM 683   C CB   . LEU A 1 44  ? 5.192   -1.535  5.728  1.00 0.00 ? 44  LEU A CB   1  
ATOM 684   C CG   . LEU A 1 44  ? 3.822   -0.855  5.699  1.00 0.00 ? 44  LEU A CG   1  
ATOM 685   C CD1  . LEU A 1 44  ? 2.749   -1.755  6.315  1.00 0.00 ? 44  LEU A CD1  1  
ATOM 686   C CD2  . LEU A 1 44  ? 3.877   0.517   6.375  1.00 0.00 ? 44  LEU A CD2  1  
ATOM 687   H H    . LEU A 1 44  ? 7.564   -2.110  5.207  1.00 0.00 ? 44  LEU A H    1  
ATOM 688   H HA   . LEU A 1 44  ? 5.058   -3.128  4.328  1.00 0.00 ? 44  LEU A HA   1  
ATOM 689   H HB2  . LEU A 1 44  ? 5.186   -2.286  6.519  1.00 0.00 ? 44  LEU A HB2  1  
ATOM 690   H HB3  . LEU A 1 44  ? 5.940   -0.791  6.001  1.00 0.00 ? 44  LEU A HB3  1  
ATOM 691   H HG   . LEU A 1 44  ? 3.544   -0.690  4.658  1.00 0.00 ? 44  LEU A HG   1  
ATOM 692   H HD11 . LEU A 1 44  ? 2.754   -2.722  5.813  1.00 0.00 ? 44  LEU A HD11 1  
ATOM 693   H HD12 . LEU A 1 44  ? 2.959   -1.896  7.376  1.00 0.00 ? 44  LEU A HD12 1  
ATOM 694   H HD13 . LEU A 1 44  ? 1.771   -1.288  6.197  1.00 0.00 ? 44  LEU A HD13 1  
ATOM 695   H HD21 . LEU A 1 44  ? 4.366   1.230   5.711  1.00 0.00 ? 44  LEU A HD21 1  
ATOM 696   H HD22 . LEU A 1 44  ? 2.863   0.857   6.589  1.00 0.00 ? 44  LEU A HD22 1  
ATOM 697   H HD23 . LEU A 1 44  ? 4.439   0.441   7.305  1.00 0.00 ? 44  LEU A HD23 1  
ATOM 698   N N    . ARG A 1 45  ? 6.129   -0.247  3.117  1.00 0.00 ? 45  ARG A N    1  
ATOM 699   C CA   . ARG A 1 45  ? 6.010   0.663   1.990  1.00 0.00 ? 45  ARG A CA   1  
ATOM 700   C C    . ARG A 1 45  ? 6.097   -0.111  0.672  1.00 0.00 ? 45  ARG A C    1  
ATOM 701   O O    . ARG A 1 45  ? 5.324   0.140   -0.251 1.00 0.00 ? 45  ARG A O    1  
ATOM 702   C CB   . ARG A 1 45  ? 7.111   1.726   2.022  1.00 0.00 ? 45  ARG A CB   1  
ATOM 703   C CG   . ARG A 1 45  ? 6.548   3.085   2.442  1.00 0.00 ? 45  ARG A CG   1  
ATOM 704   C CD   . ARG A 1 45  ? 7.626   4.168   2.381  1.00 0.00 ? 45  ARG A CD   1  
ATOM 705   N NE   . ARG A 1 45  ? 7.768   4.663   0.993  1.00 0.00 ? 45  ARG A NE   1  
ATOM 706   C CZ   . ARG A 1 45  ? 8.814   5.374   0.552  1.00 0.00 ? 45  ARG A CZ   1  
ATOM 707   N NH1  . ARG A 1 45  ? 9.817   5.679   1.387  1.00 0.00 ? 45  ARG A NH1  1  
ATOM 708   N NH2  . ARG A 1 45  ? 8.858   5.781   -0.724 1.00 0.00 ? 45  ARG A NH2  1  
ATOM 709   H H    . ARG A 1 45  ? 6.788   0.030   3.816  1.00 0.00 ? 45  ARG A H    1  
ATOM 710   H HA   . ARG A 1 45  ? 5.032   1.128   2.108  1.00 0.00 ? 45  ARG A HA   1  
ATOM 711   H HB2  . ARG A 1 45  ? 7.894   1.422   2.716  1.00 0.00 ? 45  ARG A HB2  1  
ATOM 712   H HB3  . ARG A 1 45  ? 7.571   1.808   1.037  1.00 0.00 ? 45  ARG A HB3  1  
ATOM 713   H HG2  . ARG A 1 45  ? 5.717   3.356   1.791  1.00 0.00 ? 45  ARG A HG2  1  
ATOM 714   H HG3  . ARG A 1 45  ? 6.150   3.020   3.455  1.00 0.00 ? 45  ARG A HG3  1  
ATOM 715   H HD2  . ARG A 1 45  ? 7.365   4.992   3.044  1.00 0.00 ? 45  ARG A HD2  1  
ATOM 716   H HD3  . ARG A 1 45  ? 8.577   3.766   2.731  1.00 0.00 ? 45  ARG A HD3  1  
ATOM 717   H HE   . ARG A 1 45  ? 7.037   4.453   0.344  1.00 0.00 ? 45  ARG A HE   1  
ATOM 718   H HH11 . ARG A 1 45  ? 9.784   5.375   2.339  1.00 0.00 ? 45  ARG A HH11 1  
ATOM 719   H HH12 . ARG A 1 45  ? 10.598  6.210   1.058  1.00 0.00 ? 45  ARG A HH12 1  
ATOM 720   H HH21 . ARG A 1 45  ? 8.109   5.554   -1.347 1.00 0.00 ? 45  ARG A HH21 1  
ATOM 721   H HH22 . ARG A 1 45  ? 9.639   6.312   -1.053 1.00 0.00 ? 45  ARG A HH22 1  
ATOM 722   N N    . ASN A 1 46  ? 7.044   -1.037  0.628  1.00 0.00 ? 46  ASN A N    1  
ATOM 723   C CA   . ASN A 1 46  ? 7.241   -1.849  -0.561 1.00 0.00 ? 46  ASN A CA   1  
ATOM 724   C C    . ASN A 1 46  ? 5.890   -2.392  -1.032 1.00 0.00 ? 46  ASN A C    1  
ATOM 725   O O    . ASN A 1 46  ? 5.719   -2.705  -2.210 1.00 0.00 ? 46  ASN A O    1  
ATOM 726   C CB   . ASN A 1 46  ? 8.154   -3.041  -0.269 1.00 0.00 ? 46  ASN A CB   1  
ATOM 727   C CG   . ASN A 1 46  ? 8.328   -3.916  -1.511 1.00 0.00 ? 46  ASN A CG   1  
ATOM 728   O OD1  . ASN A 1 46  ? 8.984   -3.552  -2.472 1.00 0.00 ? 46  ASN A OD1  1  
ATOM 729   N ND2  . ASN A 1 46  ? 7.704   -5.089  -1.439 1.00 0.00 ? 46  ASN A ND2  1  
ATOM 730   H H    . ASN A 1 46  ? 7.668   -1.235  1.383  1.00 0.00 ? 46  ASN A H    1  
ATOM 731   H HA   . ASN A 1 46  ? 7.699   -1.181  -1.291 1.00 0.00 ? 46  ASN A HA   1  
ATOM 732   H HB2  . ASN A 1 46  ? 9.127   -2.684  0.068  1.00 0.00 ? 46  ASN A HB2  1  
ATOM 733   H HB3  . ASN A 1 46  ? 7.734   -3.635  0.543  1.00 0.00 ? 46  ASN A HB3  1  
ATOM 734   H HD21 . ASN A 1 46  ? 7.181   -5.327  -0.620 1.00 0.00 ? 46  ASN A HD21 1  
ATOM 735   H HD22 . ASN A 1 46  ? 7.758   -5.732  -2.202 1.00 0.00 ? 46  ASN A HD22 1  
ATOM 736   N N    . TYR A 1 47  ? 4.965   -2.487  -0.089 1.00 0.00 ? 47  TYR A N    1  
ATOM 737   C CA   . TYR A 1 47  ? 3.635   -2.987  -0.392 1.00 0.00 ? 47  TYR A CA   1  
ATOM 738   C C    . TYR A 1 47  ? 2.682   -1.839  -0.730 1.00 0.00 ? 47  TYR A C    1  
ATOM 739   O O    . TYR A 1 47  ? 1.958   -1.900  -1.722 1.00 0.00 ? 47  TYR A O    1  
ATOM 740   C CB   . TYR A 1 47  ? 3.146   -3.684  0.879  1.00 0.00 ? 47  TYR A CB   1  
ATOM 741   C CG   . TYR A 1 47  ? 1.923   -4.579  0.667  1.00 0.00 ? 47  TYR A CG   1  
ATOM 742   C CD1  . TYR A 1 47  ? 2.041   -5.748  -0.057 1.00 0.00 ? 47  TYR A CD1  1  
ATOM 743   C CD2  . TYR A 1 47  ? 0.703   -4.218  1.199  1.00 0.00 ? 47  TYR A CD2  1  
ATOM 744   C CE1  . TYR A 1 47  ? 0.891   -6.591  -0.257 1.00 0.00 ? 47  TYR A CE1  1  
ATOM 745   C CE2  . TYR A 1 47  ? -0.448  -5.060  1.000  1.00 0.00 ? 47  TYR A CE2  1  
ATOM 746   C CZ   . TYR A 1 47  ? -0.297  -6.205  0.281  1.00 0.00 ? 47  TYR A CZ   1  
ATOM 747   O OH   . TYR A 1 47  ? -1.384  -7.001  0.093  1.00 0.00 ? 47  TYR A OH   1  
ATOM 748   H H    . TYR A 1 47  ? 5.112   -2.231  0.867  1.00 0.00 ? 47  TYR A H    1  
ATOM 749   H HA   . TYR A 1 47  ? 3.713   -3.650  -1.254 1.00 0.00 ? 47  TYR A HA   1  
ATOM 750   H HB2  . TYR A 1 47  ? 3.958   -4.286  1.286  1.00 0.00 ? 47  TYR A HB2  1  
ATOM 751   H HB3  . TYR A 1 47  ? 2.904   -2.928  1.626  1.00 0.00 ? 47  TYR A HB3  1  
ATOM 752   H HD1  . TYR A 1 47  ? 3.006   -6.034  -0.478 1.00 0.00 ? 47  TYR A HD1  1  
ATOM 753   H HD2  . TYR A 1 47  ? 0.609   -3.294  1.771  1.00 0.00 ? 47  TYR A HD2  1  
ATOM 754   H HE1  . TYR A 1 47  ? 0.970   -7.516  -0.827 1.00 0.00 ? 47  TYR A HE1  1  
ATOM 755   H HE2  . TYR A 1 47  ? -1.418  -4.787  1.415  1.00 0.00 ? 47  TYR A HE2  1  
ATOM 756   H HH   . TYR A 1 47  ? -2.192  -6.578  0.502  1.00 0.00 ? 47  TYR A HH   1  
ATOM 757   N N    . TYR A 1 48  ? 2.712   -0.820  0.116  1.00 0.00 ? 48  TYR A N    1  
ATOM 758   C CA   . TYR A 1 48  ? 1.859   0.341   -0.080 1.00 0.00 ? 48  TYR A CA   1  
ATOM 759   C C    . TYR A 1 48  ? 2.551   1.388   -0.954 1.00 0.00 ? 48  TYR A C    1  
ATOM 760   O O    . TYR A 1 48  ? 2.230   2.573   -0.881 1.00 0.00 ? 48  TYR A O    1  
ATOM 761   C CB   . TYR A 1 48  ? 1.624   0.931   1.312  1.00 0.00 ? 48  TYR A CB   1  
ATOM 762   C CG   . TYR A 1 48  ? 0.576   0.180   2.137  1.00 0.00 ? 48  TYR A CG   1  
ATOM 763   C CD1  . TYR A 1 48  ? 0.957   -0.874  2.942  1.00 0.00 ? 48  TYR A CD1  1  
ATOM 764   C CD2  . TYR A 1 48  ? -0.750  0.557   2.076  1.00 0.00 ? 48  TYR A CD2  1  
ATOM 765   C CE1  . TYR A 1 48  ? -0.029  -1.580  3.718  1.00 0.00 ? 48  TYR A CE1  1  
ATOM 766   C CE2  . TYR A 1 48  ? -1.736  -0.149  2.852  1.00 0.00 ? 48  TYR A CE2  1  
ATOM 767   C CZ   . TYR A 1 48  ? -1.327  -1.183  3.635  1.00 0.00 ? 48  TYR A CZ   1  
ATOM 768   O OH   . TYR A 1 48  ? -2.258  -1.850  4.368  1.00 0.00 ? 48  TYR A OH   1  
ATOM 769   H H    . TYR A 1 48  ? 3.303   -0.778  0.921  1.00 0.00 ? 48  TYR A H    1  
ATOM 770   H HA   . TYR A 1 48  ? 0.948   0.008   -0.576 1.00 0.00 ? 48  TYR A HA   1  
ATOM 771   H HB2  . TYR A 1 48  ? 2.567   0.934   1.858  1.00 0.00 ? 48  TYR A HB2  1  
ATOM 772   H HB3  . TYR A 1 48  ? 1.312   1.970   1.207  1.00 0.00 ? 48  TYR A HB3  1  
ATOM 773   H HD1  . TYR A 1 48  ? 2.005   -1.172  2.990  1.00 0.00 ? 48  TYR A HD1  1  
ATOM 774   H HD2  . TYR A 1 48  ? -1.051  1.390   1.440  1.00 0.00 ? 48  TYR A HD2  1  
ATOM 775   H HE1  . TYR A 1 48  ? 0.259   -2.414  4.358  1.00 0.00 ? 48  TYR A HE1  1  
ATOM 776   H HE2  . TYR A 1 48  ? -2.787  0.138   2.813  1.00 0.00 ? 48  TYR A HE2  1  
ATOM 777   H HH   . TYR A 1 48  ? -1.816  -2.558  4.919  1.00 0.00 ? 48  TYR A HH   1  
ATOM 778   N N    . GLU A 1 49  ? 3.488   0.913   -1.762 1.00 0.00 ? 49  GLU A N    1  
ATOM 779   C CA   . GLU A 1 49  ? 4.228   1.794   -2.649 1.00 0.00 ? 49  GLU A CA   1  
ATOM 780   C C    . GLU A 1 49  ? 3.641   1.741   -4.061 1.00 0.00 ? 49  GLU A C    1  
ATOM 781   O O    . GLU A 1 49  ? 3.881   2.634   -4.872 1.00 0.00 ? 49  GLU A O    1  
ATOM 782   C CB   . GLU A 1 49  ? 5.716   1.437   -2.661 1.00 0.00 ? 49  GLU A CB   1  
ATOM 783   C CG   . GLU A 1 49  ? 6.503   2.338   -1.707 1.00 0.00 ? 49  GLU A CG   1  
ATOM 784   C CD   . GLU A 1 49  ? 7.872   2.691   -2.292 1.00 0.00 ? 49  GLU A CD   1  
ATOM 785   O OE1  . GLU A 1 49  ? 8.717   1.771   -2.354 1.00 0.00 ? 49  GLU A OE1  1  
ATOM 786   O OE2  . GLU A 1 49  ? 8.044   3.872   -2.662 1.00 0.00 ? 49  GLU A OE2  1  
ATOM 787   H H    . GLU A 1 49  ? 3.743   -0.052  -1.815 1.00 0.00 ? 49  GLU A H    1  
ATOM 788   H HA   . GLU A 1 49  ? 4.104   2.794   -2.234 1.00 0.00 ? 49  GLU A HA   1  
ATOM 789   H HB2  . GLU A 1 49  ? 5.845   0.394   -2.371 1.00 0.00 ? 49  GLU A HB2  1  
ATOM 790   H HB3  . GLU A 1 49  ? 6.110   1.539   -3.672 1.00 0.00 ? 49  GLU A HB3  1  
ATOM 791   H HG2  . GLU A 1 49  ? 5.939   3.251   -1.515 1.00 0.00 ? 49  GLU A HG2  1  
ATOM 792   H HG3  . GLU A 1 49  ? 6.631   1.835   -0.749 1.00 0.00 ? 49  GLU A HG3  1  
ATOM 793   N N    . GLN A 1 50  ? 2.881   0.684   -4.312 1.00 0.00 ? 50  GLN A N    1  
ATOM 794   C CA   . GLN A 1 50  ? 2.257   0.503   -5.611 1.00 0.00 ? 50  GLN A CA   1  
ATOM 795   C C    . GLN A 1 50  ? 1.099   1.487   -5.786 1.00 0.00 ? 50  GLN A C    1  
ATOM 796   O O    . GLN A 1 50  ? 1.121   2.324   -6.687 1.00 0.00 ? 50  GLN A O    1  
ATOM 797   C CB   . GLN A 1 50  ? 1.783   -0.940  -5.796 1.00 0.00 ? 50  GLN A CB   1  
ATOM 798   C CG   . GLN A 1 50  ? 2.919   -1.929  -5.524 1.00 0.00 ? 50  GLN A CG   1  
ATOM 799   C CD   . GLN A 1 50  ? 2.386   -3.359  -5.413 1.00 0.00 ? 50  GLN A CD   1  
ATOM 800   O OE1  . GLN A 1 50  ? 2.771   -4.251  -6.151 1.00 0.00 ? 50  GLN A OE1  1  
ATOM 801   N NE2  . GLN A 1 50  ? 1.481   -3.526  -4.453 1.00 0.00 ? 50  GLN A NE2  1  
ATOM 802   H H    . GLN A 1 50  ? 2.690   -0.038  -3.647 1.00 0.00 ? 50  GLN A H    1  
ATOM 803   H HA   . GLN A 1 50  ? 3.039   0.718   -6.340 1.00 0.00 ? 50  GLN A HA   1  
ATOM 804   H HB2  . GLN A 1 50  ? 0.951   -1.143  -5.121 1.00 0.00 ? 50  GLN A HB2  1  
ATOM 805   H HB3  . GLN A 1 50  ? 1.411   -1.078  -6.811 1.00 0.00 ? 50  GLN A HB3  1  
ATOM 806   H HG2  . GLN A 1 50  ? 3.655   -1.872  -6.326 1.00 0.00 ? 50  GLN A HG2  1  
ATOM 807   H HG3  . GLN A 1 50  ? 3.431   -1.656  -4.602 1.00 0.00 ? 50  GLN A HG3  1  
ATOM 808   H HE21 . GLN A 1 50  ? 1.209   -2.752  -3.882 1.00 0.00 ? 50  GLN A HE21 1  
ATOM 809   H HE22 . GLN A 1 50  ? 1.073   -4.427  -4.302 1.00 0.00 ? 50  GLN A HE22 1  
ATOM 810   N N    . TRP A 1 51  ? 0.114   1.353   -4.910 1.00 0.00 ? 51  TRP A N    1  
ATOM 811   C CA   . TRP A 1 51  ? -1.051  2.220   -4.956 1.00 0.00 ? 51  TRP A CA   1  
ATOM 812   C C    . TRP A 1 51  ? -0.561  3.668   -5.028 1.00 0.00 ? 51  TRP A C    1  
ATOM 813   O O    . TRP A 1 51  ? -1.116  4.479   -5.768 1.00 0.00 ? 51  TRP A O    1  
ATOM 814   C CB   . TRP A 1 51  ? -1.976  1.961   -3.765 1.00 0.00 ? 51  TRP A CB   1  
ATOM 815   C CG   . TRP A 1 51  ? -2.629  0.577   -3.774 1.00 0.00 ? 51  TRP A CG   1  
ATOM 816   C CD1  . TRP A 1 51  ? -3.567  0.113   -4.610 1.00 0.00 ? 51  TRP A CD1  1  
ATOM 817   C CD2  . TRP A 1 51  ? -2.352  -0.510  -2.867 1.00 0.00 ? 51  TRP A CD2  1  
ATOM 818   N NE1  . TRP A 1 51  ? -3.915  -1.188  -4.309 1.00 0.00 ? 51  TRP A NE1  1  
ATOM 819   C CE2  . TRP A 1 51  ? -3.151  -1.579  -3.215 1.00 0.00 ? 51  TRP A CE2  1  
ATOM 820   C CE3  . TRP A 1 51  ? -1.455  -0.588  -1.787 1.00 0.00 ? 51  TRP A CE3  1  
ATOM 821   C CZ2  . TRP A 1 51  ? -3.135  -2.803  -2.536 1.00 0.00 ? 51  TRP A CZ2  1  
ATOM 822   C CZ3  . TRP A 1 51  ? -1.450  -1.818  -1.117 1.00 0.00 ? 51  TRP A CZ3  1  
ATOM 823   C CH2  . TRP A 1 51  ? -2.249  -2.904  -1.456 1.00 0.00 ? 51  TRP A CH2  1  
ATOM 824   H H    . TRP A 1 51  ? 0.103   0.670   -4.180 1.00 0.00 ? 51  TRP A H    1  
ATOM 825   H HA   . TRP A 1 51  ? -1.615  1.973   -5.856 1.00 0.00 ? 51  TRP A HA   1  
ATOM 826   H HB2  . TRP A 1 51  ? -1.405  2.076   -2.844 1.00 0.00 ? 51  TRP A HB2  1  
ATOM 827   H HB3  . TRP A 1 51  ? -2.758  2.720   -3.753 1.00 0.00 ? 51  TRP A HB3  1  
ATOM 828   H HD1  . TRP A 1 51  ? -4.002  0.691   -5.426 1.00 0.00 ? 51  TRP A HD1  1  
ATOM 829   H HE1  . TRP A 1 51  ? -4.651  -1.797  -4.833 1.00 0.00 ? 51  TRP A HE1  1  
ATOM 830   H HE3  . TRP A 1 51  ? -0.813  0.242   -1.491 1.00 0.00 ? 51  TRP A HE3  1  
ATOM 831   H HZ2  . TRP A 1 51  ? -3.777  -3.633  -2.831 1.00 0.00 ? 51  TRP A HZ2  1  
ATOM 832   H HZ3  . TRP A 1 51  ? -0.772  -1.932  -0.272 1.00 0.00 ? 51  TRP A HZ3  1  
ATOM 833   H HH2  . TRP A 1 51  ? -2.186  -3.829  -0.884 1.00 0.00 ? 51  TRP A HH2  1  
ATOM 834   N N    . GLY A 1 52  ? 0.474   3.948   -4.250 1.00 0.00 ? 52  GLY A N    1  
ATOM 835   C CA   . GLY A 1 52  ? 1.045   5.284   -4.216 1.00 0.00 ? 52  GLY A CA   1  
ATOM 836   C C    . GLY A 1 52  ? 2.291   5.324   -3.330 1.00 0.00 ? 52  GLY A C    1  
ATOM 837   O O    . GLY A 1 52  ? 2.494   4.443   -2.496 1.00 0.00 ? 52  GLY A O    1  
ATOM 838   H H    . GLY A 1 52  ? 0.919   3.283   -3.651 1.00 0.00 ? 52  GLY A H    1  
ATOM 839   H HA2  . GLY A 1 52  ? 1.302   5.599   -5.227 1.00 0.00 ? 52  GLY A HA2  1  
ATOM 840   H HA3  . GLY A 1 52  ? 0.304   5.990   -3.841 1.00 0.00 ? 52  GLY A HA3  1  
ATOM 841   N N    . LYS A 1 53  ? 3.094   6.357   -3.540 1.00 0.00 ? 53  LYS A N    1  
ATOM 842   C CA   . LYS A 1 53  ? 4.315   6.525   -2.771 1.00 0.00 ? 53  LYS A CA   1  
ATOM 843   C C    . LYS A 1 53  ? 3.983   7.185   -1.431 1.00 0.00 ? 53  LYS A C    1  
ATOM 844   O O    . LYS A 1 53  ? 3.383   8.258   -1.396 1.00 0.00 ? 53  LYS A O    1  
ATOM 845   C CB   . LYS A 1 53  ? 5.363   7.284   -3.587 1.00 0.00 ? 53  LYS A CB   1  
ATOM 846   C CG   . LYS A 1 53  ? 6.197   6.324   -4.438 1.00 0.00 ? 53  LYS A CG   1  
ATOM 847   C CD   . LYS A 1 53  ? 6.319   6.830   -5.877 1.00 0.00 ? 53  LYS A CD   1  
ATOM 848   C CE   . LYS A 1 53  ? 5.066   6.489   -6.686 1.00 0.00 ? 53  LYS A CE   1  
ATOM 849   N NZ   . LYS A 1 53  ? 5.437   5.955   -8.015 1.00 0.00 ? 53  LYS A NZ   1  
ATOM 850   H H    . LYS A 1 53  ? 2.922   7.070   -4.220 1.00 0.00 ? 53  LYS A H    1  
ATOM 851   H HA   . LYS A 1 53  ? 4.717   5.530   -2.576 1.00 0.00 ? 53  LYS A HA   1  
ATOM 852   H HB2  . LYS A 1 53  ? 4.870   8.012   -4.232 1.00 0.00 ? 53  LYS A HB2  1  
ATOM 853   H HB3  . LYS A 1 53  ? 6.017   7.843   -2.918 1.00 0.00 ? 53  LYS A HB3  1  
ATOM 854   H HG2  . LYS A 1 53  ? 7.190   6.214   -4.002 1.00 0.00 ? 53  LYS A HG2  1  
ATOM 855   H HG3  . LYS A 1 53  ? 5.736   5.336   -4.434 1.00 0.00 ? 53  LYS A HG3  1  
ATOM 856   H HD2  . LYS A 1 53  ? 6.472   7.909   -5.874 1.00 0.00 ? 53  LYS A HD2  1  
ATOM 857   H HD3  . LYS A 1 53  ? 7.194   6.385   -6.350 1.00 0.00 ? 53  LYS A HD3  1  
ATOM 858   H HE2  . LYS A 1 53  ? 4.466   5.756   -6.147 1.00 0.00 ? 53  LYS A HE2  1  
ATOM 859   H HE3  . LYS A 1 53  ? 4.449   7.380   -6.805 1.00 0.00 ? 53  LYS A HE3  1  
ATOM 860   H HZ1  . LYS A 1 53  ? 4.733   6.199   -8.682 1.00 0.00 ? 53  LYS A HZ1  1  
ATOM 861   H HZ2  . LYS A 1 53  ? 6.314   6.344   -8.298 1.00 0.00 ? 53  LYS A HZ2  1  
ATOM 862   H HZ3  . LYS A 1 53  ? 5.516   4.959   -7.964 1.00 0.00 ? 53  LYS A HZ3  1  
ATOM 863   N N    . LEU A 1 54  ? 4.388   6.516   -0.362 1.00 0.00 ? 54  LEU A N    1  
ATOM 864   C CA   . LEU A 1 54  ? 4.141   7.025   0.977  1.00 0.00 ? 54  LEU A CA   1  
ATOM 865   C C    . LEU A 1 54  ? 5.169   8.110   1.304  1.00 0.00 ? 54  LEU A C    1  
ATOM 866   O O    . LEU A 1 54  ? 6.368   7.841   1.346  1.00 0.00 ? 54  LEU A O    1  
ATOM 867   C CB   . LEU A 1 54  ? 4.114   5.878   1.989  1.00 0.00 ? 54  LEU A CB   1  
ATOM 868   C CG   . LEU A 1 54  ? 3.305   4.644   1.584  1.00 0.00 ? 54  LEU A CG   1  
ATOM 869   C CD1  . LEU A 1 54  ? 3.470   3.519   2.608  1.00 0.00 ? 54  LEU A CD1  1  
ATOM 870   C CD2  . LEU A 1 54  ? 1.835   5.002   1.358  1.00 0.00 ? 54  LEU A CD2  1  
ATOM 871   H H    . LEU A 1 54  ? 4.876   5.644   -0.399 1.00 0.00 ? 54  LEU A H    1  
ATOM 872   H HA   . LEU A 1 54  ? 3.149   7.477   0.976  1.00 0.00 ? 54  LEU A HA   1  
ATOM 873   H HB2  . LEU A 1 54  ? 5.140   5.567   2.184  1.00 0.00 ? 54  LEU A HB2  1  
ATOM 874   H HB3  . LEU A 1 54  ? 3.713   6.258   2.929  1.00 0.00 ? 54  LEU A HB3  1  
ATOM 875   H HG   . LEU A 1 54  ? 3.696   4.276   0.635  1.00 0.00 ? 54  LEU A HG   1  
ATOM 876   H HD11 . LEU A 1 54  ? 4.300   3.754   3.274  1.00 0.00 ? 54  LEU A HD11 1  
ATOM 877   H HD12 . LEU A 1 54  ? 2.554   3.420   3.190  1.00 0.00 ? 54  LEU A HD12 1  
ATOM 878   H HD13 . LEU A 1 54  ? 3.674   2.582   2.089  1.00 0.00 ? 54  LEU A HD13 1  
ATOM 879   H HD21 . LEU A 1 54  ? 1.608   4.953   0.293  1.00 0.00 ? 54  LEU A HD21 1  
ATOM 880   H HD22 . LEU A 1 54  ? 1.202   4.296   1.897  1.00 0.00 ? 54  LEU A HD22 1  
ATOM 881   H HD23 . LEU A 1 54  ? 1.646   6.011   1.724  1.00 0.00 ? 54  LEU A HD23 1  
ATOM 882   N N    . THR A 1 55  ? 4.661   9.313   1.527  1.00 0.00 ? 55  THR A N    1  
ATOM 883   C CA   . THR A 1 55  ? 5.520   10.440  1.848  1.00 0.00 ? 55  THR A CA   1  
ATOM 884   C C    . THR A 1 55  ? 6.076   10.299  3.267  1.00 0.00 ? 55  THR A C    1  
ATOM 885   O O    . THR A 1 55  ? 7.062   10.945  3.618  1.00 0.00 ? 55  THR A O    1  
ATOM 886   C CB   . THR A 1 55  ? 4.716   11.723  1.636  1.00 0.00 ? 55  THR A CB   1  
ATOM 887   O OG1  . THR A 1 55  ? 3.496   11.488  2.333  1.00 0.00 ? 55  THR A OG1  1  
ATOM 888   C CG2  . THR A 1 55  ? 4.283   11.909  0.180  1.00 0.00 ? 55  THR A CG2  1  
ATOM 889   H H    . THR A 1 55  ? 3.684   9.523   1.490  1.00 0.00 ? 55  THR A H    1  
ATOM 890   H HA   . THR A 1 55  ? 6.372   10.427  1.168  1.00 0.00 ? 55  THR A HA   1  
ATOM 891   H HB   . THR A 1 55  ? 5.269   12.593  1.992  1.00 0.00 ? 55  THR A HB   1  
ATOM 892   H HG1  . THR A 1 55  ? 2.976   12.339  2.410  1.00 0.00 ? 55  THR A HG1  1  
ATOM 893   H HG21 . THR A 1 55  ? 5.165   11.940  -0.460 1.00 0.00 ? 55  THR A HG21 1  
ATOM 894   H HG22 . THR A 1 55  ? 3.646   11.077  -0.118 1.00 0.00 ? 55  THR A HG22 1  
ATOM 895   H HG23 . THR A 1 55  ? 3.730   12.844  0.082  1.00 0.00 ? 55  THR A HG23 1  
ATOM 896   N N    . ASP A 1 56  ? 5.419   9.449   4.044  1.00 0.00 ? 56  ASP A N    1  
ATOM 897   C CA   . ASP A 1 56  ? 5.835   9.215   5.416  1.00 0.00 ? 56  ASP A CA   1  
ATOM 898   C C    . ASP A 1 56  ? 5.250   7.888   5.902  1.00 0.00 ? 56  ASP A C    1  
ATOM 899   O O    . ASP A 1 56  ? 4.036   7.695   5.879  1.00 0.00 ? 56  ASP A O    1  
ATOM 900   C CB   . ASP A 1 56  ? 5.329   10.323  6.342  1.00 0.00 ? 56  ASP A CB   1  
ATOM 901   C CG   . ASP A 1 56  ? 6.414   11.039  7.148  1.00 0.00 ? 56  ASP A CG   1  
ATOM 902   O OD1  . ASP A 1 56  ? 7.591   10.650  6.986  1.00 0.00 ? 56  ASP A OD1  1  
ATOM 903   O OD2  . ASP A 1 56  ? 6.043   11.959  7.908  1.00 0.00 ? 56  ASP A OD2  1  
ATOM 904   H H    . ASP A 1 56  ? 4.618   8.928   3.750  1.00 0.00 ? 56  ASP A H    1  
ATOM 905   H HA   . ASP A 1 56  ? 6.925   9.205   5.387  1.00 0.00 ? 56  ASP A HA   1  
ATOM 906   H HB2  . ASP A 1 56  ? 4.796   11.061  5.743  1.00 0.00 ? 56  ASP A HB2  1  
ATOM 907   H HB3  . ASP A 1 56  ? 4.606   9.893   7.036  1.00 0.00 ? 56  ASP A HB3  1  
ATOM 908   N N    . CYS A 1 57  ? 6.142   7.007   6.331  1.00 0.00 ? 57  CYS A N    1  
ATOM 909   C CA   . CYS A 1 57  ? 5.729   5.703   6.822  1.00 0.00 ? 57  CYS A CA   1  
ATOM 910   C C    . CYS A 1 57  ? 6.361   5.486   8.198  1.00 0.00 ? 57  CYS A C    1  
ATOM 911   O O    . CYS A 1 57  ? 7.584   5.473   8.329  1.00 0.00 ? 57  CYS A O    1  
ATOM 912   C CB   . CYS A 1 57  ? 6.097   4.587   5.842  1.00 0.00 ? 57  CYS A CB   1  
ATOM 913   S SG   . CYS A 1 57  ? 7.904   4.579   5.553  1.00 0.00 ? 57  CYS A SG   1  
ATOM 914   H H    . CYS A 1 57  ? 7.128   7.171   6.346  1.00 0.00 ? 57  CYS A H    1  
ATOM 915   H HA   . CYS A 1 57  ? 4.642   5.725   6.895  1.00 0.00 ? 57  CYS A HA   1  
ATOM 916   H HB2  . CYS A 1 57  ? 5.780   3.623   6.241  1.00 0.00 ? 57  CYS A HB2  1  
ATOM 917   H HB3  . CYS A 1 57  ? 5.570   4.731   4.899  1.00 0.00 ? 57  CYS A HB3  1  
ATOM 918   H HG   . CYS A 1 57  ? 7.921   3.476   4.810  1.00 0.00 ? 57  CYS A HG   1  
ATOM 919   N N    . VAL A 1 58  ? 5.499   5.320   9.191  1.00 0.00 ? 58  VAL A N    1  
ATOM 920   C CA   . VAL A 1 58  ? 5.958   5.104   10.552 1.00 0.00 ? 58  VAL A CA   1  
ATOM 921   C C    . VAL A 1 58  ? 5.425   3.762   11.058 1.00 0.00 ? 58  VAL A C    1  
ATOM 922   O O    . VAL A 1 58  ? 4.273   3.412   10.806 1.00 0.00 ? 58  VAL A O    1  
ATOM 923   C CB   . VAL A 1 58  ? 5.545   6.283   11.436 1.00 0.00 ? 58  VAL A CB   1  
ATOM 924   C CG1  . VAL A 1 58  ? 5.520   5.878   12.912 1.00 0.00 ? 58  VAL A CG1  1  
ATOM 925   C CG2  . VAL A 1 58  ? 6.465   7.484   11.213 1.00 0.00 ? 58  VAL A CG2  1  
ATOM 926   H H    . VAL A 1 58  ? 4.506   5.332   9.076  1.00 0.00 ? 58  VAL A H    1  
ATOM 927   H HA   . VAL A 1 58  ? 7.047   5.063   10.530 1.00 0.00 ? 58  VAL A HA   1  
ATOM 928   H HB   . VAL A 1 58  ? 4.535   6.577   11.153 1.00 0.00 ? 58  VAL A HB   1  
ATOM 929   H HG11 . VAL A 1 58  ? 4.491   5.693   13.220 1.00 0.00 ? 58  VAL A HG11 1  
ATOM 930   H HG12 . VAL A 1 58  ? 6.110   4.972   13.051 1.00 0.00 ? 58  VAL A HG12 1  
ATOM 931   H HG13 . VAL A 1 58  ? 5.941   6.682   13.516 1.00 0.00 ? 58  VAL A HG13 1  
ATOM 932   H HG21 . VAL A 1 58  ? 6.476   8.105   12.108 1.00 0.00 ? 58  VAL A HG21 1  
ATOM 933   H HG22 . VAL A 1 58  ? 7.476   7.134   11.001 1.00 0.00 ? 58  VAL A HG22 1  
ATOM 934   H HG23 . VAL A 1 58  ? 6.100   8.070   10.369 1.00 0.00 ? 58  VAL A HG23 1  
ATOM 935   N N    . VAL A 1 59  ? 6.289   3.047   11.764 1.00 0.00 ? 59  VAL A N    1  
ATOM 936   C CA   . VAL A 1 59  ? 5.920   1.751   12.308 1.00 0.00 ? 59  VAL A CA   1  
ATOM 937   C C    . VAL A 1 59  ? 6.156   1.751   13.819 1.00 0.00 ? 59  VAL A C    1  
ATOM 938   O O    . VAL A 1 59  ? 7.297   1.834   14.273 1.00 0.00 ? 59  VAL A O    1  
ATOM 939   C CB   . VAL A 1 59  ? 6.685   0.642   11.583 1.00 0.00 ? 59  VAL A CB   1  
ATOM 940   C CG1  . VAL A 1 59  ? 8.189   0.752   11.845 1.00 0.00 ? 59  VAL A CG1  1  
ATOM 941   C CG2  . VAL A 1 59  ? 6.158   -0.738  11.980 1.00 0.00 ? 59  VAL A CG2  1  
ATOM 942   H H    . VAL A 1 59  ? 7.224   3.338   11.965 1.00 0.00 ? 59  VAL A H    1  
ATOM 943   H HA   . VAL A 1 59  ? 4.856   1.606   12.119 1.00 0.00 ? 59  VAL A HA   1  
ATOM 944   H HB   . VAL A 1 59  ? 6.522   0.767   10.512 1.00 0.00 ? 59  VAL A HB   1  
ATOM 945   H HG11 . VAL A 1 59  ? 8.487   1.800   11.817 1.00 0.00 ? 59  VAL A HG11 1  
ATOM 946   H HG12 . VAL A 1 59  ? 8.418   0.335   12.826 1.00 0.00 ? 59  VAL A HG12 1  
ATOM 947   H HG13 . VAL A 1 59  ? 8.732   0.199   11.079 1.00 0.00 ? 59  VAL A HG13 1  
ATOM 948   H HG21 . VAL A 1 59  ? 6.752   -1.129  12.807 1.00 0.00 ? 59  VAL A HG21 1  
ATOM 949   H HG22 . VAL A 1 59  ? 5.116   -0.654  12.290 1.00 0.00 ? 59  VAL A HG22 1  
ATOM 950   H HG23 . VAL A 1 59  ? 6.231   -1.415  11.129 1.00 0.00 ? 59  VAL A HG23 1  
ATOM 951   N N    . MET A 1 60  ? 5.060   1.657   14.557 1.00 0.00 ? 60  MET A N    1  
ATOM 952   C CA   . MET A 1 60  ? 5.134   1.645   16.008 1.00 0.00 ? 60  MET A CA   1  
ATOM 953   C C    . MET A 1 60  ? 5.803   0.364   16.513 1.00 0.00 ? 60  MET A C    1  
ATOM 954   O O    . MET A 1 60  ? 5.586   -0.713  15.961 1.00 0.00 ? 60  MET A O    1  
ATOM 955   C CB   . MET A 1 60  ? 3.724   1.748   16.592 1.00 0.00 ? 60  MET A CB   1  
ATOM 956   C CG   . MET A 1 60  ? 3.182   3.174   16.469 1.00 0.00 ? 60  MET A CG   1  
ATOM 957   S SD   . MET A 1 60  ? 4.240   4.307   17.356 1.00 0.00 ? 60  MET A SD   1  
ATOM 958   C CE   . MET A 1 60  ? 5.199   4.960   16.000 1.00 0.00 ? 60  MET A CE   1  
ATOM 959   H H    . MET A 1 60  ? 4.136   1.589   14.181 1.00 0.00 ? 60  MET A H    1  
ATOM 960   H HA   . MET A 1 60  ? 5.740   2.510   16.278 1.00 0.00 ? 60  MET A HA   1  
ATOM 961   H HB2  . MET A 1 60  ? 3.060   1.057   16.073 1.00 0.00 ? 60  MET A HB2  1  
ATOM 962   H HB3  . MET A 1 60  ? 3.737   1.450   17.641 1.00 0.00 ? 60  MET A HB3  1  
ATOM 963   H HG2  . MET A 1 60  ? 3.127   3.461   15.420 1.00 0.00 ? 60  MET A HG2  1  
ATOM 964   H HG3  . MET A 1 60  ? 2.169   3.222   16.867 1.00 0.00 ? 60  MET A HG3  1  
ATOM 965   H HE1  . MET A 1 60  ? 6.167   5.298   16.369 1.00 0.00 ? 60  MET A HE1  1  
ATOM 966   H HE2  . MET A 1 60  ? 5.347   4.182   15.251 1.00 0.00 ? 60  MET A HE2  1  
ATOM 967   H HE3  . MET A 1 60  ? 4.669   5.800   15.551 1.00 0.00 ? 60  MET A HE3  1  
ATOM 968   N N    . ARG A 1 61  ? 6.604   0.525   17.556 1.00 0.00 ? 61  ARG A N    1  
ATOM 969   C CA   . ARG A 1 61  ? 7.306   -0.605  18.141 1.00 0.00 ? 61  ARG A CA   1  
ATOM 970   C C    . ARG A 1 61  ? 6.898   -0.783  19.605 1.00 0.00 ? 61  ARG A C    1  
ATOM 971   O O    . ARG A 1 61  ? 6.674   0.197   20.314 1.00 0.00 ? 61  ARG A O    1  
ATOM 972   C CB   . ARG A 1 61  ? 8.822   -0.413  18.061 1.00 0.00 ? 61  ARG A CB   1  
ATOM 973   C CG   . ARG A 1 61  ? 9.301   -0.437  16.608 1.00 0.00 ? 61  ARG A CG   1  
ATOM 974   C CD   . ARG A 1 61  ? 10.829  -0.393  16.534 1.00 0.00 ? 61  ARG A CD   1  
ATOM 975   N NE   . ARG A 1 61  ? 11.270  0.894   15.951 1.00 0.00 ? 61  ARG A NE   1  
ATOM 976   C CZ   . ARG A 1 61  ? 11.454  2.016   16.659 1.00 0.00 ? 61  ARG A CZ   1  
ATOM 977   N NH1  . ARG A 1 61  ? 11.236  2.017   17.981 1.00 0.00 ? 61  ARG A NH1  1  
ATOM 978   N NH2  . ARG A 1 61  ? 11.856  3.138   16.046 1.00 0.00 ? 61  ARG A NH2  1  
ATOM 979   H H    . ARG A 1 61  ? 6.775   1.405   18.000 1.00 0.00 ? 61  ARG A H    1  
ATOM 980   H HA   . ARG A 1 61  ? 7.001   -1.463  17.542 1.00 0.00 ? 61  ARG A HA   1  
ATOM 981   H HB2  . ARG A 1 61  ? 9.097   0.536   18.523 1.00 0.00 ? 61  ARG A HB2  1  
ATOM 982   H HB3  . ARG A 1 61  ? 9.322   -1.199  18.626 1.00 0.00 ? 61  ARG A HB3  1  
ATOM 983   H HG2  . ARG A 1 61  ? 8.935   -1.338  16.116 1.00 0.00 ? 61  ARG A HG2  1  
ATOM 984   H HG3  . ARG A 1 61  ? 8.882   0.413   16.069 1.00 0.00 ? 61  ARG A HG3  1  
ATOM 985   H HD2  . ARG A 1 61  ? 11.253  -0.514  17.530 1.00 0.00 ? 61  ARG A HD2  1  
ATOM 986   H HD3  . ARG A 1 61  ? 11.196  -1.221  15.928 1.00 0.00 ? 61  ARG A HD3  1  
ATOM 987   H HE   . ARG A 1 61  ? 11.441  0.928   14.966 1.00 0.00 ? 61  ARG A HE   1  
ATOM 988   H HH11 . ARG A 1 61  ? 10.936  1.180   18.439 1.00 0.00 ? 61  ARG A HH11 1  
ATOM 989   H HH12 . ARG A 1 61  ? 11.373  2.855   18.510 1.00 0.00 ? 61  ARG A HH12 1  
ATOM 990   H HH21 . ARG A 1 61  ? 12.018  3.137   15.059 1.00 0.00 ? 61  ARG A HH21 1  
ATOM 991   H HH22 . ARG A 1 61  ? 11.993  3.975   16.575 1.00 0.00 ? 61  ARG A HH22 1  
ATOM 992   N N    . ASP A 1 62  ? 6.815   -2.040  20.015 1.00 0.00 ? 62  ASP A N    1  
ATOM 993   C CA   . ASP A 1 62  ? 6.438   -2.359  21.381 1.00 0.00 ? 62  ASP A CA   1  
ATOM 994   C C    . ASP A 1 62  ? 7.152   -1.402  22.339 1.00 0.00 ? 62  ASP A C    1  
ATOM 995   O O    . ASP A 1 62  ? 8.375   -1.277  22.300 1.00 0.00 ? 62  ASP A O    1  
ATOM 996   C CB   . ASP A 1 62  ? 6.848   -3.787  21.747 1.00 0.00 ? 62  ASP A CB   1  
ATOM 997   C CG   . ASP A 1 62  ? 6.357   -4.867  20.782 1.00 0.00 ? 62  ASP A CG   1  
ATOM 998   O OD1  . ASP A 1 62  ? 5.121   -5.040  20.704 1.00 0.00 ? 62  ASP A OD1  1  
ATOM 999   O OD2  . ASP A 1 62  ? 7.228   -5.497  20.144 1.00 0.00 ? 62  ASP A OD2  1  
ATOM 1000  H H    . ASP A 1 62  ? 6.999   -2.831  19.432 1.00 0.00 ? 62  ASP A H    1  
ATOM 1001  H HA   . ASP A 1 62  ? 5.354   -2.248  21.413 1.00 0.00 ? 62  ASP A HA   1  
ATOM 1002  H HB2  . ASP A 1 62  ? 7.936   -3.834  21.799 1.00 0.00 ? 62  ASP A HB2  1  
ATOM 1003  H HB3  . ASP A 1 62  ? 6.471   -4.013  22.744 1.00 0.00 ? 62  ASP A HB3  1  
ATOM 1004  N N    . PRO A 1 63  ? 6.337   -0.734  23.198 1.00 0.00 ? 63  PRO A N    1  
ATOM 1005  C CA   . PRO A 1 63  ? 6.877   0.207   24.164 1.00 0.00 ? 63  PRO A CA   1  
ATOM 1006  C C    . PRO A 1 63  ? 7.556   -0.526  25.323 1.00 0.00 ? 63  PRO A C    1  
ATOM 1007  O O    . PRO A 1 63  ? 8.235   0.093   26.141 1.00 0.00 ? 63  PRO A O    1  
ATOM 1008  C CB   . PRO A 1 63  ? 5.688   1.044   24.606 1.00 0.00 ? 63  PRO A CB   1  
ATOM 1009  C CG   . PRO A 1 63  ? 4.452   0.245   24.227 1.00 0.00 ? 63  PRO A CG   1  
ATOM 1010  C CD   . PRO A 1 63  ? 4.884   -0.857  23.273 1.00 0.00 ? 63  PRO A CD   1  
ATOM 1011  H HA   . PRO A 1 63  ? 7.589   0.768   23.741 1.00 0.00 ? 63  PRO A HA   1  
ATOM 1012  H HB2  . PRO A 1 63  ? 5.719   1.230   25.679 1.00 0.00 ? 63  PRO A HB2  1  
ATOM 1013  H HB3  . PRO A 1 63  ? 5.691   2.017   24.114 1.00 0.00 ? 63  PRO A HB3  1  
ATOM 1014  H HG2  . PRO A 1 63  ? 3.985   -0.180  25.115 1.00 0.00 ? 63  PRO A HG2  1  
ATOM 1015  H HG3  . PRO A 1 63  ? 3.711   0.889   23.754 1.00 0.00 ? 63  PRO A HG3  1  
ATOM 1016  H HD2  . PRO A 1 63  ? 4.588   -1.839  23.642 1.00 0.00 ? 63  PRO A HD2  1  
ATOM 1017  H HD3  . PRO A 1 63  ? 4.425   -0.734  22.292 1.00 0.00 ? 63  PRO A HD3  1  
ATOM 1018  N N    . ALA A 1 64  ? 7.350   -1.834  25.356 1.00 0.00 ? 64  ALA A N    1  
ATOM 1019  C CA   . ALA A 1 64  ? 7.933   -2.658  26.401 1.00 0.00 ? 64  ALA A CA   1  
ATOM 1020  C C    . ALA A 1 64  ? 9.014   -3.555  25.794 1.00 0.00 ? 64  ALA A C    1  
ATOM 1021  O O    . ALA A 1 64  ? 10.082  -3.729  26.378 1.00 0.00 ? 64  ALA A O    1  
ATOM 1022  C CB   . ALA A 1 64  ? 6.831   -3.461  27.094 1.00 0.00 ? 64  ALA A CB   1  
ATOM 1023  H H    . ALA A 1 64  ? 6.797   -2.330  24.686 1.00 0.00 ? 64  ALA A H    1  
ATOM 1024  H HA   . ALA A 1 64  ? 8.394   -1.992  27.130 1.00 0.00 ? 64  ALA A HA   1  
ATOM 1025  H HB1  . ALA A 1 64  ? 7.047   -3.530  28.160 1.00 0.00 ? 64  ALA A HB1  1  
ATOM 1026  H HB2  . ALA A 1 64  ? 5.872   -2.962  26.949 1.00 0.00 ? 64  ALA A HB2  1  
ATOM 1027  H HB3  . ALA A 1 64  ? 6.787   -4.462  26.667 1.00 0.00 ? 64  ALA A HB3  1  
ATOM 1028  N N    . SER A 1 65  ? 8.698   -4.101  24.629 1.00 0.00 ? 65  SER A N    1  
ATOM 1029  C CA   . SER A 1 65  ? 9.629   -4.976  23.936 1.00 0.00 ? 65  SER A CA   1  
ATOM 1030  C C    . SER A 1 65  ? 10.657  -4.144  23.168 1.00 0.00 ? 65  SER A C    1  
ATOM 1031  O O    . SER A 1 65  ? 11.822  -4.527  23.069 1.00 0.00 ? 65  SER A O    1  
ATOM 1032  C CB   . SER A 1 65  ? 8.892   -5.920  22.983 1.00 0.00 ? 65  SER A CB   1  
ATOM 1033  O OG   . SER A 1 65  ? 8.977   -7.278  23.405 1.00 0.00 ? 65  SER A OG   1  
ATOM 1034  H H    . SER A 1 65  ? 7.827   -3.955  24.160 1.00 0.00 ? 65  SER A H    1  
ATOM 1035  H HA   . SER A 1 65  ? 10.115  -5.558  24.719 1.00 0.00 ? 65  SER A HA   1  
ATOM 1036  H HB2  . SER A 1 65  ? 7.844   -5.625  22.918 1.00 0.00 ? 65  SER A HB2  1  
ATOM 1037  H HB3  . SER A 1 65  ? 9.312   -5.825  21.982 1.00 0.00 ? 65  SER A HB3  1  
ATOM 1038  H HG   . SER A 1 65  ? 8.750   -7.349  24.376 1.00 0.00 ? 65  SER A HG   1  
ATOM 1039  N N    . LYS A 1 66  ? 10.190  -3.020  22.644 1.00 0.00 ? 66  LYS A N    1  
ATOM 1040  C CA   . LYS A 1 66  ? 11.055  -2.130  21.889 1.00 0.00 ? 66  LYS A CA   1  
ATOM 1041  C C    . LYS A 1 66  ? 11.506  -2.832  20.606 1.00 0.00 ? 66  LYS A C    1  
ATOM 1042  O O    . LYS A 1 66  ? 12.672  -2.746  20.224 1.00 0.00 ? 66  LYS A O    1  
ATOM 1043  C CB   . LYS A 1 66  ? 12.212  -1.639  22.761 1.00 0.00 ? 66  LYS A CB   1  
ATOM 1044  C CG   . LYS A 1 66  ? 11.953  -0.219  23.268 1.00 0.00 ? 66  LYS A CG   1  
ATOM 1045  C CD   . LYS A 1 66  ? 12.296  0.817   22.196 1.00 0.00 ? 66  LYS A CD   1  
ATOM 1046  C CE   . LYS A 1 66  ? 13.351  1.802   22.705 1.00 0.00 ? 66  LYS A CE   1  
ATOM 1047  N NZ   . LYS A 1 66  ? 14.711  1.253   22.509 1.00 0.00 ? 66  LYS A NZ   1  
ATOM 1048  H H    . LYS A 1 66  ? 9.241   -2.716  22.729 1.00 0.00 ? 66  LYS A H    1  
ATOM 1049  H HA   . LYS A 1 66  ? 10.464  -1.256  21.615 1.00 0.00 ? 66  LYS A HA   1  
ATOM 1050  H HB2  . LYS A 1 66  ? 12.346  -2.313  23.607 1.00 0.00 ? 66  LYS A HB2  1  
ATOM 1051  H HB3  . LYS A 1 66  ? 13.139  -1.661  22.188 1.00 0.00 ? 66  LYS A HB3  1  
ATOM 1052  H HG2  . LYS A 1 66  ? 10.906  -0.117  23.555 1.00 0.00 ? 66  LYS A HG2  1  
ATOM 1053  H HG3  . LYS A 1 66  ? 12.548  -0.034  24.162 1.00 0.00 ? 66  LYS A HG3  1  
ATOM 1054  H HD2  . LYS A 1 66  ? 12.665  0.313   21.303 1.00 0.00 ? 66  LYS A HD2  1  
ATOM 1055  H HD3  . LYS A 1 66  ? 11.396  1.359   21.907 1.00 0.00 ? 66  LYS A HD3  1  
ATOM 1056  H HE2  . LYS A 1 66  ? 13.256  2.751   22.176 1.00 0.00 ? 66  LYS A HE2  1  
ATOM 1057  H HE3  . LYS A 1 66  ? 13.184  2.009   23.762 1.00 0.00 ? 66  LYS A HE3  1  
ATOM 1058  H HZ1  . LYS A 1 66  ? 15.380  1.857   22.942 1.00 0.00 ? 66  LYS A HZ1  1  
ATOM 1059  H HZ2  . LYS A 1 66  ? 14.766  0.344   22.923 1.00 0.00 ? 66  LYS A HZ2  1  
ATOM 1060  H HZ3  . LYS A 1 66  ? 14.906  1.186   21.531 1.00 0.00 ? 66  LYS A HZ3  1  
ATOM 1061  N N    . ARG A 1 67  ? 10.558  -3.511  19.976 1.00 0.00 ? 67  ARG A N    1  
ATOM 1062  C CA   . ARG A 1 67  ? 10.843  -4.227  18.745 1.00 0.00 ? 67  ARG A CA   1  
ATOM 1063  C C    . ARG A 1 67  ? 9.862   -3.809  17.648 1.00 0.00 ? 67  ARG A C    1  
ATOM 1064  O O    . ARG A 1 67  ? 10.210  -3.029  16.763 1.00 0.00 ? 67  ARG A O    1  
ATOM 1065  C CB   . ARG A 1 67  ? 10.751  -5.740  18.953 1.00 0.00 ? 67  ARG A CB   1  
ATOM 1066  C CG   . ARG A 1 67  ? 11.868  -6.236  19.873 1.00 0.00 ? 67  ARG A CG   1  
ATOM 1067  C CD   . ARG A 1 67  ? 13.072  -6.719  19.062 1.00 0.00 ? 67  ARG A CD   1  
ATOM 1068  N NE   . ARG A 1 67  ? 14.295  -6.670  19.893 1.00 0.00 ? 67  ARG A NE   1  
ATOM 1069  C CZ   . ARG A 1 67  ? 14.542  -7.501  20.915 1.00 0.00 ? 67  ARG A CZ   1  
ATOM 1070  N NH1  . ARG A 1 67  ? 13.652  -8.449  21.238 1.00 0.00 ? 67  ARG A NH1  1  
ATOM 1071  N NH2  . ARG A 1 67  ? 15.679  -7.383  21.615 1.00 0.00 ? 67  ARG A NH2  1  
ATOM 1072  H H    . ARG A 1 67  ? 9.612   -3.576  20.293 1.00 0.00 ? 67  ARG A H    1  
ATOM 1073  H HA   . ARG A 1 67  ? 11.864  -3.943  18.487 1.00 0.00 ? 67  ARG A HA   1  
ATOM 1074  H HB2  . ARG A 1 67  ? 9.781   -5.992  19.383 1.00 0.00 ? 67  ARG A HB2  1  
ATOM 1075  H HB3  . ARG A 1 67  ? 10.814  -6.248  17.991 1.00 0.00 ? 67  ARG A HB3  1  
ATOM 1076  H HG2  . ARG A 1 67  ? 12.175  -5.434  20.544 1.00 0.00 ? 67  ARG A HG2  1  
ATOM 1077  H HG3  . ARG A 1 67  ? 11.496  -7.049  20.497 1.00 0.00 ? 67  ARG A HG3  1  
ATOM 1078  H HD2  . ARG A 1 67  ? 12.900  -7.737  18.712 1.00 0.00 ? 67  ARG A HD2  1  
ATOM 1079  H HD3  . ARG A 1 67  ? 13.199  -6.096  18.177 1.00 0.00 ? 67  ARG A HD3  1  
ATOM 1080  H HE   . ARG A 1 67  ? 14.980  -5.974  19.679 1.00 0.00 ? 67  ARG A HE   1  
ATOM 1081  H HH11 . ARG A 1 67  ? 12.804  -8.537  20.717 1.00 0.00 ? 67  ARG A HH11 1  
ATOM 1082  H HH12 . ARG A 1 67  ? 13.837  -9.069  22.001 1.00 0.00 ? 67  ARG A HH12 1  
ATOM 1083  H HH21 . ARG A 1 67  ? 16.343  -6.675  21.374 1.00 0.00 ? 67  ARG A HH21 1  
ATOM 1084  H HH22 . ARG A 1 67  ? 15.863  -8.003  22.378 1.00 0.00 ? 67  ARG A HH22 1  
ATOM 1085  N N    . SER A 1 68  ? 8.654   -4.346  17.743 1.00 0.00 ? 68  SER A N    1  
ATOM 1086  C CA   . SER A 1 68  ? 7.620   -4.039  16.770 1.00 0.00 ? 68  SER A CA   1  
ATOM 1087  C C    . SER A 1 68  ? 6.238   -4.260  17.387 1.00 0.00 ? 68  SER A C    1  
ATOM 1088  O O    . SER A 1 68  ? 5.994   -5.286  18.020 1.00 0.00 ? 68  SER A O    1  
ATOM 1089  C CB   . SER A 1 68  ? 7.780   -4.890  15.508 1.00 0.00 ? 68  SER A CB   1  
ATOM 1090  O OG   . SER A 1 68  ? 8.835   -4.417  14.675 1.00 0.00 ? 68  SER A OG   1  
ATOM 1091  H H    . SER A 1 68  ? 8.379   -4.980  18.466 1.00 0.00 ? 68  SER A H    1  
ATOM 1092  H HA   . SER A 1 68  ? 7.763   -2.988  16.519 1.00 0.00 ? 68  SER A HA   1  
ATOM 1093  H HB2  . SER A 1 68  ? 7.978   -5.924  15.791 1.00 0.00 ? 68  SER A HB2  1  
ATOM 1094  H HB3  . SER A 1 68  ? 6.845   -4.886  14.947 1.00 0.00 ? 68  SER A HB3  1  
ATOM 1095  H HG   . SER A 1 68  ? 8.814   -3.418  14.631 1.00 0.00 ? 68  SER A HG   1  
ATOM 1096  N N    . ARG A 1 69  ? 5.370   -3.280  17.182 1.00 0.00 ? 69  ARG A N    1  
ATOM 1097  C CA   . ARG A 1 69  ? 4.018   -3.355  17.711 1.00 0.00 ? 69  ARG A CA   1  
ATOM 1098  C C    . ARG A 1 69  ? 3.119   -4.148  16.760 1.00 0.00 ? 69  ARG A C    1  
ATOM 1099  O O    . ARG A 1 69  ? 2.232   -4.877  17.201 1.00 0.00 ? 69  ARG A O    1  
ATOM 1100  C CB   . ARG A 1 69  ? 3.428   -1.958  17.914 1.00 0.00 ? 69  ARG A CB   1  
ATOM 1101  C CG   . ARG A 1 69  ? 3.188   -1.675  19.398 1.00 0.00 ? 69  ARG A CG   1  
ATOM 1102  C CD   . ARG A 1 69  ? 1.723   -1.908  19.771 1.00 0.00 ? 69  ARG A CD   1  
ATOM 1103  N NE   . ARG A 1 69  ? 1.555   -3.262  20.343 1.00 0.00 ? 69  ARG A NE   1  
ATOM 1104  C CZ   . ARG A 1 69  ? 0.385   -3.758  20.770 1.00 0.00 ? 69  ARG A CZ   1  
ATOM 1105  N NH1  . ARG A 1 69  ? -0.726  -3.013  20.693 1.00 0.00 ? 69  ARG A NH1  1  
ATOM 1106  N NH2  . ARG A 1 69  ? 0.327   -4.998  21.275 1.00 0.00 ? 69  ARG A NH2  1  
ATOM 1107  H H    . ARG A 1 69  ? 5.576   -2.449  16.666 1.00 0.00 ? 69  ARG A H    1  
ATOM 1108  H HA   . ARG A 1 69  ? 4.122   -3.865  18.669 1.00 0.00 ? 69  ARG A HA   1  
ATOM 1109  H HB2  . ARG A 1 69  ? 4.106   -1.210  17.502 1.00 0.00 ? 69  ARG A HB2  1  
ATOM 1110  H HB3  . ARG A 1 69  ? 2.489   -1.873  17.367 1.00 0.00 ? 69  ARG A HB3  1  
ATOM 1111  H HG2  . ARG A 1 69  ? 3.827   -2.318  20.003 1.00 0.00 ? 69  ARG A HG2  1  
ATOM 1112  H HG3  . ARG A 1 69  ? 3.466   -0.646  19.625 1.00 0.00 ? 69  ARG A HG3  1  
ATOM 1113  H HD2  . ARG A 1 69  ? 1.398   -1.157  20.491 1.00 0.00 ? 69  ARG A HD2  1  
ATOM 1114  H HD3  . ARG A 1 69  ? 1.092   -1.796  18.888 1.00 0.00 ? 69  ARG A HD3  1  
ATOM 1115  H HE   . ARG A 1 69  ? 2.365   -3.844  20.415 1.00 0.00 ? 69  ARG A HE   1  
ATOM 1116  H HH11 . ARG A 1 69  ? -0.683  -2.088  20.316 1.00 0.00 ? 69  ARG A HH11 1  
ATOM 1117  H HH12 . ARG A 1 69  ? -1.599  -3.383  21.012 1.00 0.00 ? 69  ARG A HH12 1  
ATOM 1118  H HH21 . ARG A 1 69  ? 1.157   -5.553  21.333 1.00 0.00 ? 69  ARG A HH21 1  
ATOM 1119  H HH22 . ARG A 1 69  ? -0.545  -5.367  21.594 1.00 0.00 ? 69  ARG A HH22 1  
ATOM 1120  N N    . GLY A 1 70  ? 3.379   -3.978  15.472 1.00 0.00 ? 70  GLY A N    1  
ATOM 1121  C CA   . GLY A 1 70  ? 2.604   -4.668  14.455 1.00 0.00 ? 70  GLY A CA   1  
ATOM 1122  C C    . GLY A 1 70  ? 1.600   -3.722  13.794 1.00 0.00 ? 70  GLY A C    1  
ATOM 1123  O O    . GLY A 1 70  ? 0.632   -4.168  13.180 1.00 0.00 ? 70  GLY A O    1  
ATOM 1124  H H    . GLY A 1 70  ? 4.102   -3.383  15.121 1.00 0.00 ? 70  GLY A H    1  
ATOM 1125  H HA2  . GLY A 1 70  ? 3.274   -5.079  13.699 1.00 0.00 ? 70  GLY A HA2  1  
ATOM 1126  H HA3  . GLY A 1 70  ? 2.076   -5.509  14.903 1.00 0.00 ? 70  GLY A HA3  1  
ATOM 1127  N N    . PHE A 1 71  ? 1.864   -2.432  13.943 1.00 0.00 ? 71  PHE A N    1  
ATOM 1128  C CA   . PHE A 1 71  ? 0.995   -1.419  13.368 1.00 0.00 ? 71  PHE A CA   1  
ATOM 1129  C C    . PHE A 1 71  ? 1.725   -0.080  13.238 1.00 0.00 ? 71  PHE A C    1  
ATOM 1130  O O    . PHE A 1 71  ? 2.594   0.239   14.049 1.00 0.00 ? 71  PHE A O    1  
ATOM 1131  C CB   . PHE A 1 71  ? -0.188  -1.250  14.324 1.00 0.00 ? 71  PHE A CB   1  
ATOM 1132  C CG   . PHE A 1 71  ? 0.033   -0.193  15.407 1.00 0.00 ? 71  PHE A CG   1  
ATOM 1133  C CD1  . PHE A 1 71  ? 0.073   1.125   15.073 1.00 0.00 ? 71  PHE A CD1  1  
ATOM 1134  C CD2  . PHE A 1 71  ? 0.189   -0.570  16.704 1.00 0.00 ? 71  PHE A CD2  1  
ATOM 1135  C CE1  . PHE A 1 71  ? 0.278   2.107   16.078 1.00 0.00 ? 71  PHE A CE1  1  
ATOM 1136  C CE2  . PHE A 1 71  ? 0.394   0.411   17.710 1.00 0.00 ? 71  PHE A CE2  1  
ATOM 1137  C CZ   . PHE A 1 71  ? 0.434   1.729   17.376 1.00 0.00 ? 71  PHE A CZ   1  
ATOM 1138  H H    . PHE A 1 71  ? 2.654   -2.077  14.444 1.00 0.00 ? 71  PHE A H    1  
ATOM 1139  H HA   . PHE A 1 71  ? 0.701   -1.768  12.379 1.00 0.00 ? 71  PHE A HA   1  
ATOM 1140  H HB2  . PHE A 1 71  ? -1.073  -0.985  13.746 1.00 0.00 ? 71  PHE A HB2  1  
ATOM 1141  H HB3  . PHE A 1 71  ? -0.395  -2.208  14.802 1.00 0.00 ? 71  PHE A HB3  1  
ATOM 1142  H HD1  . PHE A 1 71  ? -0.052  1.428   14.033 1.00 0.00 ? 71  PHE A HD1  1  
ATOM 1143  H HD2  . PHE A 1 71  ? 0.157   -1.626  16.972 1.00 0.00 ? 71  PHE A HD2  1  
ATOM 1144  H HE1  . PHE A 1 71  ? 0.310   3.163   15.811 1.00 0.00 ? 71  PHE A HE1  1  
ATOM 1145  H HE2  . PHE A 1 71  ? 0.519   0.109   18.749 1.00 0.00 ? 71  PHE A HE2  1  
ATOM 1146  H HZ   . PHE A 1 71  ? 0.591   2.483   18.147 1.00 0.00 ? 71  PHE A HZ   1  
ATOM 1147  N N    . GLY A 1 72  ? 1.346   0.667   12.212 1.00 0.00 ? 72  GLY A N    1  
ATOM 1148  C CA   . GLY A 1 72  ? 1.953   1.963   11.965 1.00 0.00 ? 72  GLY A CA   1  
ATOM 1149  C C    . GLY A 1 72  ? 1.024   2.856   11.141 1.00 0.00 ? 72  GLY A C    1  
ATOM 1150  O O    . GLY A 1 72  ? -0.188  2.646   11.121 1.00 0.00 ? 72  GLY A O    1  
ATOM 1151  H H    . GLY A 1 72  ? 0.639   0.400   11.557 1.00 0.00 ? 72  GLY A H    1  
ATOM 1152  H HA2  . GLY A 1 72  ? 2.182   2.448   12.914 1.00 0.00 ? 72  GLY A HA2  1  
ATOM 1153  H HA3  . GLY A 1 72  ? 2.899   1.832   11.439 1.00 0.00 ? 72  GLY A HA3  1  
ATOM 1154  N N    . PHE A 1 73  ? 1.627   3.834   10.481 1.00 0.00 ? 73  PHE A N    1  
ATOM 1155  C CA   . PHE A 1 73  ? 0.869   4.760   9.657  1.00 0.00 ? 73  PHE A CA   1  
ATOM 1156  C C    . PHE A 1 73  ? 1.519   4.930   8.283  1.00 0.00 ? 73  PHE A C    1  
ATOM 1157  O O    . PHE A 1 73  ? 2.744   4.930   8.167  1.00 0.00 ? 73  PHE A O    1  
ATOM 1158  C CB   . PHE A 1 73  ? 0.872   6.108   10.380 1.00 0.00 ? 73  PHE A CB   1  
ATOM 1159  C CG   . PHE A 1 73  ? 0.675   6.003   11.893 1.00 0.00 ? 73  PHE A CG   1  
ATOM 1160  C CD1  . PHE A 1 73  ? 1.740   5.752   12.702 1.00 0.00 ? 73  PHE A CD1  1  
ATOM 1161  C CD2  . PHE A 1 73  ? -0.564  6.161   12.431 1.00 0.00 ? 73  PHE A CD2  1  
ATOM 1162  C CE1  . PHE A 1 73  ? 1.557   5.654   14.107 1.00 0.00 ? 73  PHE A CE1  1  
ATOM 1163  C CE2  . PHE A 1 73  ? -0.747  6.064   13.835 1.00 0.00 ? 73  PHE A CE2  1  
ATOM 1164  C CZ   . PHE A 1 73  ? 0.318   5.813   14.644 1.00 0.00 ? 73  PHE A CZ   1  
ATOM 1165  H H    . PHE A 1 73  ? 2.613   3.998   10.503 1.00 0.00 ? 73  PHE A H    1  
ATOM 1166  H HA   . PHE A 1 73  ? -0.130  4.341   9.535  1.00 0.00 ? 73  PHE A HA   1  
ATOM 1167  H HB2  . PHE A 1 73  ? 1.818   6.613   10.181 1.00 0.00 ? 73  PHE A HB2  1  
ATOM 1168  H HB3  . PHE A 1 73  ? 0.083   6.734   9.964  1.00 0.00 ? 73  PHE A HB3  1  
ATOM 1169  H HD1  . PHE A 1 73  ? 2.733   5.625   12.271 1.00 0.00 ? 73  PHE A HD1  1  
ATOM 1170  H HD2  . PHE A 1 73  ? -1.417  6.363   11.783 1.00 0.00 ? 73  PHE A HD2  1  
ATOM 1171  H HE1  . PHE A 1 73  ? 2.410   5.453   14.755 1.00 0.00 ? 73  PHE A HE1  1  
ATOM 1172  H HE2  . PHE A 1 73  ? -1.740  6.191   14.266 1.00 0.00 ? 73  PHE A HE2  1  
ATOM 1173  H HZ   . PHE A 1 73  ? 0.177   5.738   15.722 1.00 0.00 ? 73  PHE A HZ   1  
ATOM 1174  N N    . VAL A 1 74  ? 0.671   5.071   7.275  1.00 0.00 ? 74  VAL A N    1  
ATOM 1175  C CA   . VAL A 1 74  ? 1.147   5.241   5.913  1.00 0.00 ? 74  VAL A CA   1  
ATOM 1176  C C    . VAL A 1 74  ? 0.548   6.520   5.324  1.00 0.00 ? 74  VAL A C    1  
ATOM 1177  O O    . VAL A 1 74  ? -0.666  6.618   5.151  1.00 0.00 ? 74  VAL A O    1  
ATOM 1178  C CB   . VAL A 1 74  ? 0.827   3.994   5.086  1.00 0.00 ? 74  VAL A CB   1  
ATOM 1179  C CG1  . VAL A 1 74  ? 1.797   2.857   5.412  1.00 0.00 ? 74  VAL A CG1  1  
ATOM 1180  C CG2  . VAL A 1 74  ? -0.624  3.555   5.296  1.00 0.00 ? 74  VAL A CG2  1  
ATOM 1181  H H    . VAL A 1 74  ? -0.324  5.070   7.377  1.00 0.00 ? 74  VAL A H    1  
ATOM 1182  H HA   . VAL A 1 74  ? 2.231   5.349   5.955  1.00 0.00 ? 74  VAL A HA   1  
ATOM 1183  H HB   . VAL A 1 74  ? 0.951   4.249   4.034  1.00 0.00 ? 74  VAL A HB   1  
ATOM 1184  H HG11 . VAL A 1 74  ? 2.821   3.229   5.368  1.00 0.00 ? 74  VAL A HG11 1  
ATOM 1185  H HG12 . VAL A 1 74  ? 1.591   2.478   6.413  1.00 0.00 ? 74  VAL A HG12 1  
ATOM 1186  H HG13 . VAL A 1 74  ? 1.671   2.053   4.687  1.00 0.00 ? 74  VAL A HG13 1  
ATOM 1187  H HG21 . VAL A 1 74  ? -0.660  2.770   6.052  1.00 0.00 ? 74  VAL A HG21 1  
ATOM 1188  H HG22 . VAL A 1 74  ? -1.216  4.407   5.629  1.00 0.00 ? 74  VAL A HG22 1  
ATOM 1189  H HG23 . VAL A 1 74  ? -1.028  3.176   4.358  1.00 0.00 ? 74  VAL A HG23 1  
ATOM 1190  N N    . THR A 1 75  ? 1.426   7.467   5.031  1.00 0.00 ? 75  THR A N    1  
ATOM 1191  C CA   . THR A 1 75  ? 0.999   8.735   4.465  1.00 0.00 ? 75  THR A CA   1  
ATOM 1192  C C    . THR A 1 75  ? 1.267   8.764   2.959  1.00 0.00 ? 75  THR A C    1  
ATOM 1193  O O    . THR A 1 75  ? 2.411   8.915   2.532  1.00 0.00 ? 75  THR A O    1  
ATOM 1194  C CB   . THR A 1 75  ? 1.705   9.857   5.230  1.00 0.00 ? 75  THR A CB   1  
ATOM 1195  O OG1  . THR A 1 75  ? 1.707   9.407   6.582  1.00 0.00 ? 75  THR A OG1  1  
ATOM 1196  C CG2  . THR A 1 75  ? 0.883   11.147  5.268  1.00 0.00 ? 75  THR A CG2  1  
ATOM 1197  H H    . THR A 1 75  ? 2.412   7.380   5.175  1.00 0.00 ? 75  THR A H    1  
ATOM 1198  H HA   . THR A 1 75  ? -0.079  8.826   4.599  1.00 0.00 ? 75  THR A HA   1  
ATOM 1199  H HB   . THR A 1 75  ? 2.699   10.040  4.822  1.00 0.00 ? 75  THR A HB   1  
ATOM 1200  H HG1  . THR A 1 75  ? 2.303   9.988   7.135  1.00 0.00 ? 75  THR A HG1  1  
ATOM 1201  H HG21 . THR A 1 75  ? 0.140   11.081  6.063  1.00 0.00 ? 75  THR A HG21 1  
ATOM 1202  H HG22 . THR A 1 75  ? 1.544   11.993  5.457  1.00 0.00 ? 75  THR A HG22 1  
ATOM 1203  H HG23 . THR A 1 75  ? 0.379   11.285  4.311  1.00 0.00 ? 75  THR A HG23 1  
ATOM 1204  N N    . PHE A 1 76  ? 0.194   8.617   2.196  1.00 0.00 ? 76  PHE A N    1  
ATOM 1205  C CA   . PHE A 1 76  ? 0.300   8.625   0.747  1.00 0.00 ? 76  PHE A CA   1  
ATOM 1206  C C    . PHE A 1 76  ? 0.633   10.025  0.229  1.00 0.00 ? 76  PHE A C    1  
ATOM 1207  O O    . PHE A 1 76  ? 0.614   10.993  0.988  1.00 0.00 ? 76  PHE A O    1  
ATOM 1208  C CB   . PHE A 1 76  ? -1.064  8.201   0.197  1.00 0.00 ? 76  PHE A CB   1  
ATOM 1209  C CG   . PHE A 1 76  ? -1.224  6.689   0.028  1.00 0.00 ? 76  PHE A CG   1  
ATOM 1210  C CD1  . PHE A 1 76  ? -0.729  6.073   -1.079 1.00 0.00 ? 76  PHE A CD1  1  
ATOM 1211  C CD2  . PHE A 1 76  ? -1.861  5.961   0.984  1.00 0.00 ? 76  PHE A CD2  1  
ATOM 1212  C CE1  . PHE A 1 76  ? -0.878  4.669   -1.237 1.00 0.00 ? 76  PHE A CE1  1  
ATOM 1213  C CE2  . PHE A 1 76  ? -2.010  4.558   0.827  1.00 0.00 ? 76  PHE A CE2  1  
ATOM 1214  C CZ   . PHE A 1 76  ? -1.515  3.942   -0.280 1.00 0.00 ? 76  PHE A CZ   1  
ATOM 1215  H H    . PHE A 1 76  ? -0.732  8.495   2.552  1.00 0.00 ? 76  PHE A H    1  
ATOM 1216  H HA   . PHE A 1 76  ? 1.103   7.939   0.478  1.00 0.00 ? 76  PHE A HA   1  
ATOM 1217  H HB2  . PHE A 1 76  ? -1.843  8.566   0.866  1.00 0.00 ? 76  PHE A HB2  1  
ATOM 1218  H HB3  . PHE A 1 76  ? -1.220  8.683   -0.768 1.00 0.00 ? 76  PHE A HB3  1  
ATOM 1219  H HD1  . PHE A 1 76  ? -0.219  6.656   -1.846 1.00 0.00 ? 76  PHE A HD1  1  
ATOM 1220  H HD2  . PHE A 1 76  ? -2.257  6.455   1.871  1.00 0.00 ? 76  PHE A HD2  1  
ATOM 1221  H HE1  . PHE A 1 76  ? -0.482  4.175   -2.124 1.00 0.00 ? 76  PHE A HE1  1  
ATOM 1222  H HE2  . PHE A 1 76  ? -2.520  3.975   1.593  1.00 0.00 ? 76  PHE A HE2  1  
ATOM 1223  H HZ   . PHE A 1 76  ? -1.629  2.864   -0.401 1.00 0.00 ? 76  PHE A HZ   1  
ATOM 1224  N N    . SER A 1 77  ? 0.931   10.089  -1.061 1.00 0.00 ? 77  SER A N    1  
ATOM 1225  C CA   . SER A 1 77  ? 1.267   11.355  -1.690 1.00 0.00 ? 77  SER A CA   1  
ATOM 1226  C C    . SER A 1 77  ? -0.009  12.086  -2.109 1.00 0.00 ? 77  SER A C    1  
ATOM 1227  O O    . SER A 1 77  ? -0.106  13.305  -1.968 1.00 0.00 ? 77  SER A O    1  
ATOM 1228  C CB   . SER A 1 77  ? 2.180   11.144  -2.899 1.00 0.00 ? 77  SER A CB   1  
ATOM 1229  O OG   . SER A 1 77  ? 3.037   12.260  -3.123 1.00 0.00 ? 77  SER A OG   1  
ATOM 1230  H H    . SER A 1 77  ? 0.944   9.297   -1.671 1.00 0.00 ? 77  SER A H    1  
ATOM 1231  H HA   . SER A 1 77  ? 1.801   11.923  -0.927 1.00 0.00 ? 77  SER A HA   1  
ATOM 1232  H HB2  . SER A 1 77  ? 2.784   10.249  -2.746 1.00 0.00 ? 77  SER A HB2  1  
ATOM 1233  H HB3  . SER A 1 77  ? 1.572   10.970  -3.786 1.00 0.00 ? 77  SER A HB3  1  
ATOM 1234  H HG   . SER A 1 77  ? 3.908   11.952  -3.504 1.00 0.00 ? 77  SER A HG   1  
ATOM 1235  N N    . SER A 1 78  ? -0.957  11.313  -2.618 1.00 0.00 ? 78  SER A N    1  
ATOM 1236  C CA   . SER A 1 78  ? -2.223  11.872  -3.059 1.00 0.00 ? 78  SER A CA   1  
ATOM 1237  C C    . SER A 1 78  ? -3.381  11.177  -2.340 1.00 0.00 ? 78  SER A C    1  
ATOM 1238  O O    . SER A 1 78  ? -3.201  10.113  -1.750 1.00 0.00 ? 78  SER A O    1  
ATOM 1239  C CB   . SER A 1 78  ? -2.384  11.741  -4.575 1.00 0.00 ? 78  SER A CB   1  
ATOM 1240  O OG   . SER A 1 78  ? -2.876  12.941  -5.165 1.00 0.00 ? 78  SER A OG   1  
ATOM 1241  H H    . SER A 1 78  ? -0.870  10.323  -2.730 1.00 0.00 ? 78  SER A H    1  
ATOM 1242  H HA   . SER A 1 78  ? -2.182  12.927  -2.789 1.00 0.00 ? 78  SER A HA   1  
ATOM 1243  H HB2  . SER A 1 78  ? -1.423  11.485  -5.021 1.00 0.00 ? 78  SER A HB2  1  
ATOM 1244  H HB3  . SER A 1 78  ? -3.067  10.921  -4.797 1.00 0.00 ? 78  SER A HB3  1  
ATOM 1245  H HG   . SER A 1 78  ? -3.240  13.546  -4.457 1.00 0.00 ? 78  SER A HG   1  
ATOM 1246  N N    . MET A 1 79  ? -4.544  11.807  -2.413 1.00 0.00 ? 79  MET A N    1  
ATOM 1247  C CA   . MET A 1 79  ? -5.731  11.263  -1.776 1.00 0.00 ? 79  MET A CA   1  
ATOM 1248  C C    . MET A 1 79  ? -6.361  10.167  -2.637 1.00 0.00 ? 79  MET A C    1  
ATOM 1249  O O    . MET A 1 79  ? -7.208  9.410   -2.164 1.00 0.00 ? 79  MET A O    1  
ATOM 1250  C CB   . MET A 1 79  ? -6.749  12.383  -1.550 1.00 0.00 ? 79  MET A CB   1  
ATOM 1251  C CG   . MET A 1 79  ? -7.785  11.979  -0.500 1.00 0.00 ? 79  MET A CG   1  
ATOM 1252  S SD   . MET A 1 79  ? -7.817  13.180  0.820  1.00 0.00 ? 79  MET A SD   1  
ATOM 1253  C CE   . MET A 1 79  ? -7.964  12.090  2.227  1.00 0.00 ? 79  MET A CE   1  
ATOM 1254  H H    . MET A 1 79  ? -4.682  12.673  -2.895 1.00 0.00 ? 79  MET A H    1  
ATOM 1255  H HA   . MET A 1 79  ? -5.389  10.841  -0.831 1.00 0.00 ? 79  MET A HA   1  
ATOM 1256  H HB2  . MET A 1 79  ? -6.233  13.288  -1.228 1.00 0.00 ? 79  MET A HB2  1  
ATOM 1257  H HB3  . MET A 1 79  ? -7.250  12.619  -2.489 1.00 0.00 ? 79  MET A HB3  1  
ATOM 1258  H HG2  . MET A 1 79  ? -8.771  11.906  -0.959 1.00 0.00 ? 79  MET A HG2  1  
ATOM 1259  H HG3  . MET A 1 79  ? -7.545  10.994  -0.101 1.00 0.00 ? 79  MET A HG3  1  
ATOM 1260  H HE1  . MET A 1 79  ? -7.520  11.125  1.986  1.00 0.00 ? 79  MET A HE1  1  
ATOM 1261  H HE2  . MET A 1 79  ? -7.446  12.527  3.080  1.00 0.00 ? 79  MET A HE2  1  
ATOM 1262  H HE3  . MET A 1 79  ? -9.018  11.955  2.472  1.00 0.00 ? 79  MET A HE3  1  
ATOM 1263  N N    . ALA A 1 80  ? -5.925  10.116  -3.887 1.00 0.00 ? 80  ALA A N    1  
ATOM 1264  C CA   . ALA A 1 80  ? -6.436  9.125   -4.819 1.00 0.00 ? 80  ALA A CA   1  
ATOM 1265  C C    . ALA A 1 80  ? -5.810  7.765   -4.503 1.00 0.00 ? 80  ALA A C    1  
ATOM 1266  O O    . ALA A 1 80  ? -6.521  6.799   -4.231 1.00 0.00 ? 80  ALA A O    1  
ATOM 1267  C CB   . ALA A 1 80  ? -6.153  9.578   -6.252 1.00 0.00 ? 80  ALA A CB   1  
ATOM 1268  H H    . ALA A 1 80  ? -5.236  10.735  -4.264 1.00 0.00 ? 80  ALA A H    1  
ATOM 1269  H HA   . ALA A 1 80  ? -7.514  9.061   -4.677 1.00 0.00 ? 80  ALA A HA   1  
ATOM 1270  H HB1  . ALA A 1 80  ? -6.498  10.604  -6.384 1.00 0.00 ? 80  ALA A HB1  1  
ATOM 1271  H HB2  . ALA A 1 80  ? -5.082  9.527   -6.445 1.00 0.00 ? 80  ALA A HB2  1  
ATOM 1272  H HB3  . ALA A 1 80  ? -6.679  8.926   -6.950 1.00 0.00 ? 80  ALA A HB3  1  
ATOM 1273  N N    . GLU A 1 81  ? -4.486  7.733   -4.551 1.00 0.00 ? 81  GLU A N    1  
ATOM 1274  C CA   . GLU A 1 81  ? -3.757  6.507   -4.274 1.00 0.00 ? 81  GLU A CA   1  
ATOM 1275  C C    . GLU A 1 81  ? -4.273  5.862   -2.986 1.00 0.00 ? 81  GLU A C    1  
ATOM 1276  O O    . GLU A 1 81  ? -4.713  4.714   -2.996 1.00 0.00 ? 81  GLU A O    1  
ATOM 1277  C CB   . GLU A 1 81  ? -2.252  6.772   -4.190 1.00 0.00 ? 81  GLU A CB   1  
ATOM 1278  C CG   . GLU A 1 81  ? -1.734  7.408   -5.481 1.00 0.00 ? 81  GLU A CG   1  
ATOM 1279  C CD   . GLU A 1 81  ? -1.531  8.915   -5.306 1.00 0.00 ? 81  GLU A CD   1  
ATOM 1280  O OE1  . GLU A 1 81  ? -1.057  9.300   -4.216 1.00 0.00 ? 81  GLU A OE1  1  
ATOM 1281  O OE2  . GLU A 1 81  ? -1.853  9.646   -6.267 1.00 0.00 ? 81  GLU A OE2  1  
ATOM 1282  H H    . GLU A 1 81  ? -3.915  8.523   -4.774 1.00 0.00 ? 81  GLU A H    1  
ATOM 1283  H HA   . GLU A 1 81  ? -3.957  5.852   -5.122 1.00 0.00 ? 81  GLU A HA   1  
ATOM 1284  H HB2  . GLU A 1 81  ? -2.041  7.429   -3.346 1.00 0.00 ? 81  GLU A HB2  1  
ATOM 1285  H HB3  . GLU A 1 81  ? -1.724  5.836   -4.005 1.00 0.00 ? 81  GLU A HB3  1  
ATOM 1286  H HG2  . GLU A 1 81  ? -0.793  6.941   -5.769 1.00 0.00 ? 81  GLU A HG2  1  
ATOM 1287  H HG3  . GLU A 1 81  ? -2.442  7.225   -6.290 1.00 0.00 ? 81  GLU A HG3  1  
ATOM 1288  N N    . VAL A 1 82  ? -4.200  6.629   -1.908 1.00 0.00 ? 82  VAL A N    1  
ATOM 1289  C CA   . VAL A 1 82  ? -4.655  6.146   -0.615 1.00 0.00 ? 82  VAL A CA   1  
ATOM 1290  C C    . VAL A 1 82  ? -6.060  5.559   -0.759 1.00 0.00 ? 82  VAL A C    1  
ATOM 1291  O O    . VAL A 1 82  ? -6.340  4.477   -0.246 1.00 0.00 ? 82  VAL A O    1  
ATOM 1292  C CB   . VAL A 1 82  ? -4.581  7.272   0.419  1.00 0.00 ? 82  VAL A CB   1  
ATOM 1293  C CG1  . VAL A 1 82  ? -5.387  8.489   -0.037 1.00 0.00 ? 82  VAL A CG1  1  
ATOM 1294  C CG2  . VAL A 1 82  ? -5.050  6.786   1.792  1.00 0.00 ? 82  VAL A CG2  1  
ATOM 1295  H H    . VAL A 1 82  ? -3.841  7.562   -1.908 1.00 0.00 ? 82  VAL A H    1  
ATOM 1296  H HA   . VAL A 1 82  ? -3.974  5.355   -0.301 1.00 0.00 ? 82  VAL A HA   1  
ATOM 1297  H HB   . VAL A 1 82  ? -3.538  7.575   0.510  1.00 0.00 ? 82  VAL A HB   1  
ATOM 1298  H HG11 . VAL A 1 82  ? -5.029  9.378   0.483  1.00 0.00 ? 82  VAL A HG11 1  
ATOM 1299  H HG12 . VAL A 1 82  ? -5.266  8.623   -1.112 1.00 0.00 ? 82  VAL A HG12 1  
ATOM 1300  H HG13 . VAL A 1 82  ? -6.441  8.334   0.193  1.00 0.00 ? 82  VAL A HG13 1  
ATOM 1301  H HG21 . VAL A 1 82  ? -4.206  6.359   2.334  1.00 0.00 ? 82  VAL A HG21 1  
ATOM 1302  H HG22 . VAL A 1 82  ? -5.455  7.627   2.356  1.00 0.00 ? 82  VAL A HG22 1  
ATOM 1303  H HG23 . VAL A 1 82  ? -5.822  6.027   1.665  1.00 0.00 ? 82  VAL A HG23 1  
ATOM 1304  N N    . ASP A 1 83  ? -6.907  6.298   -1.461 1.00 0.00 ? 83  ASP A N    1  
ATOM 1305  C CA   . ASP A 1 83  ? -8.276  5.864   -1.679 1.00 0.00 ? 83  ASP A CA   1  
ATOM 1306  C C    . ASP A 1 83  ? -8.270  4.473   -2.316 1.00 0.00 ? 83  ASP A C    1  
ATOM 1307  O O    . ASP A 1 83  ? -9.105  3.632   -1.986 1.00 0.00 ? 83  ASP A O    1  
ATOM 1308  C CB   . ASP A 1 83  ? -9.010  6.815   -2.627 1.00 0.00 ? 83  ASP A CB   1  
ATOM 1309  C CG   . ASP A 1 83  ? -10.289 7.434   -2.059 1.00 0.00 ? 83  ASP A CG   1  
ATOM 1310  O OD1  . ASP A 1 83  ? -11.344 6.777   -2.188 1.00 0.00 ? 83  ASP A OD1  1  
ATOM 1311  O OD2  . ASP A 1 83  ? -10.182 8.552   -1.509 1.00 0.00 ? 83  ASP A OD2  1  
ATOM 1312  H H    . ASP A 1 83  ? -6.671  7.178   -1.875 1.00 0.00 ? 83  ASP A H    1  
ATOM 1313  H HA   . ASP A 1 83  ? -8.739  5.870   -0.693 1.00 0.00 ? 83  ASP A HA   1  
ATOM 1314  H HB2  . ASP A 1 83  ? -8.330  7.618   -2.911 1.00 0.00 ? 83  ASP A HB2  1  
ATOM 1315  H HB3  . ASP A 1 83  ? -9.261  6.273   -3.539 1.00 0.00 ? 83  ASP A HB3  1  
ATOM 1316  N N    . ALA A 1 84  ? -7.319  4.274   -3.217 1.00 0.00 ? 84  ALA A N    1  
ATOM 1317  C CA   . ALA A 1 84  ? -7.194  2.999   -3.903 1.00 0.00 ? 84  ALA A CA   1  
ATOM 1318  C C    . ALA A 1 84  ? -6.772  1.924   -2.899 1.00 0.00 ? 84  ALA A C    1  
ATOM 1319  O O    . ALA A 1 84  ? -7.262  0.797   -2.949 1.00 0.00 ? 84  ALA A O    1  
ATOM 1320  C CB   . ALA A 1 84  ? -6.202  3.137   -5.060 1.00 0.00 ? 84  ALA A CB   1  
ATOM 1321  H H    . ALA A 1 84  ? -6.644  4.963   -3.480 1.00 0.00 ? 84  ALA A H    1  
ATOM 1322  H HA   . ALA A 1 84  ? -8.173  2.742   -4.308 1.00 0.00 ? 84  ALA A HA   1  
ATOM 1323  H HB1  . ALA A 1 84  ? -5.211  3.359   -4.664 1.00 0.00 ? 84  ALA A HB1  1  
ATOM 1324  H HB2  . ALA A 1 84  ? -6.168  2.204   -5.622 1.00 0.00 ? 84  ALA A HB2  1  
ATOM 1325  H HB3  . ALA A 1 84  ? -6.521  3.946   -5.717 1.00 0.00 ? 84  ALA A HB3  1  
ATOM 1326  N N    . ALA A 1 85  ? -5.869  2.311   -2.010 1.00 0.00 ? 85  ALA A N    1  
ATOM 1327  C CA   . ALA A 1 85  ? -5.376  1.395   -0.996 1.00 0.00 ? 85  ALA A CA   1  
ATOM 1328  C C    . ALA A 1 85  ? -6.537  0.962   -0.099 1.00 0.00 ? 85  ALA A C    1  
ATOM 1329  O O    . ALA A 1 85  ? -6.576  -0.176  0.367  1.00 0.00 ? 85  ALA A O    1  
ATOM 1330  C CB   . ALA A 1 85  ? -4.248  2.064   -0.208 1.00 0.00 ? 85  ALA A CB   1  
ATOM 1331  H H    . ALA A 1 85  ? -5.476  3.230   -1.976 1.00 0.00 ? 85  ALA A H    1  
ATOM 1332  H HA   . ALA A 1 85  ? -4.976  0.519   -1.506 1.00 0.00 ? 85  ALA A HA   1  
ATOM 1333  H HB1  . ALA A 1 85  ? -4.510  2.090   0.850  1.00 0.00 ? 85  ALA A HB1  1  
ATOM 1334  H HB2  . ALA A 1 85  ? -3.327  1.497   -0.340 1.00 0.00 ? 85  ALA A HB2  1  
ATOM 1335  H HB3  . ALA A 1 85  ? -4.105  3.081   -0.572 1.00 0.00 ? 85  ALA A HB3  1  
ATOM 1336  N N    . MET A 1 86  ? -7.456  1.892   0.117  1.00 0.00 ? 86  MET A N    1  
ATOM 1337  C CA   . MET A 1 86  ? -8.615  1.621   0.950  1.00 0.00 ? 86  MET A CA   1  
ATOM 1338  C C    . MET A 1 86  ? -9.480  0.515   0.343  1.00 0.00 ? 86  MET A C    1  
ATOM 1339  O O    . MET A 1 86  ? -9.968  -0.359  1.057  1.00 0.00 ? 86  MET A O    1  
ATOM 1340  C CB   . MET A 1 86  ? -9.446  2.896   1.099  1.00 0.00 ? 86  MET A CB   1  
ATOM 1341  C CG   . MET A 1 86  ? -8.617  4.023   1.719  1.00 0.00 ? 86  MET A CG   1  
ATOM 1342  S SD   . MET A 1 86  ? -9.447  4.670   3.160  1.00 0.00 ? 86  MET A SD   1  
ATOM 1343  C CE   . MET A 1 86  ? -9.431  3.222   4.204  1.00 0.00 ? 86  MET A CE   1  
ATOM 1344  H H    . MET A 1 86  ? -7.417  2.815   -0.266 1.00 0.00 ? 86  MET A H    1  
ATOM 1345  H HA   . MET A 1 86  ? -8.215  1.293   1.910  1.00 0.00 ? 86  MET A HA   1  
ATOM 1346  H HB2  . MET A 1 86  ? -9.818  3.208   0.123  1.00 0.00 ? 86  MET A HB2  1  
ATOM 1347  H HB3  . MET A 1 86  ? -10.318 2.696   1.723  1.00 0.00 ? 86  MET A HB3  1  
ATOM 1348  H HG2  . MET A 1 86  ? -7.630  3.650   1.994  1.00 0.00 ? 86  MET A HG2  1  
ATOM 1349  H HG3  . MET A 1 86  ? -8.465  4.818   0.989  1.00 0.00 ? 86  MET A HG3  1  
ATOM 1350  H HE1  . MET A 1 86  ? -10.372 3.157   4.750  1.00 0.00 ? 86  MET A HE1  1  
ATOM 1351  H HE2  . MET A 1 86  ? -9.306  2.331   3.588  1.00 0.00 ? 86  MET A HE2  1  
ATOM 1352  H HE3  . MET A 1 86  ? -8.605  3.293   4.911  1.00 0.00 ? 86  MET A HE3  1  
ATOM 1353  N N    . ALA A 1 87  ? -9.643  0.589   -0.970 1.00 0.00 ? 87  ALA A N    1  
ATOM 1354  C CA   . ALA A 1 87  ? -10.441 -0.395  -1.682 1.00 0.00 ? 87  ALA A CA   1  
ATOM 1355  C C    . ALA A 1 87  ? -9.515  -1.439  -2.309 1.00 0.00 ? 87  ALA A C    1  
ATOM 1356  O O    . ALA A 1 87  ? -9.631  -1.745  -3.495 1.00 0.00 ? 87  ALA A O    1  
ATOM 1357  C CB   . ALA A 1 87  ? -11.313 0.310   -2.722 1.00 0.00 ? 87  ALA A CB   1  
ATOM 1358  H H    . ALA A 1 87  ? -9.242  1.303   -1.544 1.00 0.00 ? 87  ALA A H    1  
ATOM 1359  H HA   . ALA A 1 87  ? -11.088 -0.886  -0.955 1.00 0.00 ? 87  ALA A HA   1  
ATOM 1360  H HB1  . ALA A 1 87  ? -12.146 -0.337  -2.997 1.00 0.00 ? 87  ALA A HB1  1  
ATOM 1361  H HB2  . ALA A 1 87  ? -11.699 1.240   -2.302 1.00 0.00 ? 87  ALA A HB2  1  
ATOM 1362  H HB3  . ALA A 1 87  ? -10.717 0.531   -3.607 1.00 0.00 ? 87  ALA A HB3  1  
ATOM 1363  N N    . ALA A 1 88  ? -8.615  -1.957  -1.486 1.00 0.00 ? 88  ALA A N    1  
ATOM 1364  C CA   . ALA A 1 88  ? -7.669  -2.960  -1.945 1.00 0.00 ? 88  ALA A CA   1  
ATOM 1365  C C    . ALA A 1 88  ? -7.464  -4.003  -0.845 1.00 0.00 ? 88  ALA A C    1  
ATOM 1366  O O    . ALA A 1 88  ? -6.332  -4.295  -0.465 1.00 0.00 ? 88  ALA A O    1  
ATOM 1367  C CB   . ALA A 1 88  ? -6.362  -2.279  -2.354 1.00 0.00 ? 88  ALA A CB   1  
ATOM 1368  H H    . ALA A 1 88  ? -8.527  -1.702  -0.523 1.00 0.00 ? 88  ALA A H    1  
ATOM 1369  H HA   . ALA A 1 88  ? -8.100  -3.446  -2.820 1.00 0.00 ? 88  ALA A HA   1  
ATOM 1370  H HB1  . ALA A 1 88  ? -6.472  -1.198  -2.268 1.00 0.00 ? 88  ALA A HB1  1  
ATOM 1371  H HB2  . ALA A 1 88  ? -5.557  -2.615  -1.700 1.00 0.00 ? 88  ALA A HB2  1  
ATOM 1372  H HB3  . ALA A 1 88  ? -6.124  -2.539  -3.386 1.00 0.00 ? 88  ALA A HB3  1  
ATOM 1373  N N    . ARG A 1 89  ? -8.578  -4.537  -0.365 1.00 0.00 ? 89  ARG A N    1  
ATOM 1374  C CA   . ARG A 1 89  ? -8.535  -5.542  0.683  1.00 0.00 ? 89  ARG A CA   1  
ATOM 1375  C C    . ARG A 1 89  ? -8.937  -6.908  0.126  1.00 0.00 ? 89  ARG A C    1  
ATOM 1376  O O    . ARG A 1 89  ? -9.602  -6.991  -0.906 1.00 0.00 ? 89  ARG A O    1  
ATOM 1377  C CB   . ARG A 1 89  ? -9.470  -5.174  1.837  1.00 0.00 ? 89  ARG A CB   1  
ATOM 1378  C CG   . ARG A 1 89  ? -8.759  -4.280  2.856  1.00 0.00 ? 89  ARG A CG   1  
ATOM 1379  C CD   . ARG A 1 89  ? -9.566  -4.175  4.151  1.00 0.00 ? 89  ARG A CD   1  
ATOM 1380  N NE   . ARG A 1 89  ? -10.606 -3.130  4.015  1.00 0.00 ? 89  ARG A NE   1  
ATOM 1381  C CZ   . ARG A 1 89  ? -11.817 -3.340  3.480  1.00 0.00 ? 89  ARG A CZ   1  
ATOM 1382  N NH1  . ARG A 1 89  ? -12.147 -4.558  3.028  1.00 0.00 ? 89  ARG A NH1  1  
ATOM 1383  N NH2  . ARG A 1 89  ? -12.697 -2.333  3.398  1.00 0.00 ? 89  ARG A NH2  1  
ATOM 1384  H H    . ARG A 1 89  ? -9.496  -4.294  -0.680 1.00 0.00 ? 89  ARG A H    1  
ATOM 1385  H HA   . ARG A 1 89  ? -7.499  -5.546  1.023  1.00 0.00 ? 89  ARG A HA   1  
ATOM 1386  H HB2  . ARG A 1 89  ? -10.349 -4.660  1.448  1.00 0.00 ? 89  ARG A HB2  1  
ATOM 1387  H HB3  . ARG A 1 89  ? -9.822  -6.081  2.328  1.00 0.00 ? 89  ARG A HB3  1  
ATOM 1388  H HG2  . ARG A 1 89  ? -7.770  -4.685  3.072  1.00 0.00 ? 89  ARG A HG2  1  
ATOM 1389  H HG3  . ARG A 1 89  ? -8.611  -3.287  2.433  1.00 0.00 ? 89  ARG A HG3  1  
ATOM 1390  H HD2  . ARG A 1 89  ? -10.030 -5.134  4.379  1.00 0.00 ? 89  ARG A HD2  1  
ATOM 1391  H HD3  . ARG A 1 89  ? -8.905  -3.935  4.983  1.00 0.00 ? 89  ARG A HD3  1  
ATOM 1392  H HE   . ARG A 1 89  ? -10.392 -2.210  4.343  1.00 0.00 ? 89  ARG A HE   1  
ATOM 1393  H HH11 . ARG A 1 89  ? -11.490 -5.309  3.089  1.00 0.00 ? 89  ARG A HH11 1  
ATOM 1394  H HH12 . ARG A 1 89  ? -13.050 -4.714  2.628  1.00 0.00 ? 89  ARG A HH12 1  
ATOM 1395  H HH21 . ARG A 1 89  ? -12.450 -1.425  3.736  1.00 0.00 ? 89  ARG A HH21 1  
ATOM 1396  H HH22 . ARG A 1 89  ? -13.600 -2.490  2.999  1.00 0.00 ? 89  ARG A HH22 1  
ATOM 1397  N N    . PRO A 1 90  ? -8.506  -7.975  0.852  1.00 0.00 ? 90  PRO A N    1  
ATOM 1398  C CA   . PRO A 1 90  ? -7.724  -7.789  2.062  1.00 0.00 ? 90  PRO A CA   1  
ATOM 1399  C C    . PRO A 1 90  ? -6.285  -7.391  1.728  1.00 0.00 ? 90  PRO A C    1  
ATOM 1400  O O    . PRO A 1 90  ? -5.961  -7.130  0.571  1.00 0.00 ? 90  PRO A O    1  
ATOM 1401  C CB   . PRO A 1 90  ? -7.817  -9.116  2.798  1.00 0.00 ? 90  PRO A CB   1  
ATOM 1402  C CG   . PRO A 1 90  ? -8.256  -10.138 1.762  1.00 0.00 ? 90  PRO A CG   1  
ATOM 1403  C CD   . PRO A 1 90  ? -8.752  -9.380  0.541  1.00 0.00 ? 90  PRO A CD   1  
ATOM 1404  H HA   . PRO A 1 90  ? -8.097  -7.037  2.605  1.00 0.00 ? 90  PRO A HA   1  
ATOM 1405  H HB2  . PRO A 1 90  ? -6.856  -9.389  3.234  1.00 0.00 ? 90  PRO A HB2  1  
ATOM 1406  H HB3  . PRO A 1 90  ? -8.534  -9.058  3.617  1.00 0.00 ? 90  PRO A HB3  1  
ATOM 1407  H HG2  . PRO A 1 90  ? -7.425  -10.791 1.494  1.00 0.00 ? 90  PRO A HG2  1  
ATOM 1408  H HG3  . PRO A 1 90  ? -9.045  -10.773 2.163  1.00 0.00 ? 90  PRO A HG3  1  
ATOM 1409  H HD2  . PRO A 1 90  ? -8.218  -9.685  -0.359 1.00 0.00 ? 90  PRO A HD2  1  
ATOM 1410  H HD3  . PRO A 1 90  ? -9.811  -9.567  0.362  1.00 0.00 ? 90  PRO A HD3  1  
ATOM 1411  N N    . HIS A 1 91  ? -5.459  -7.356  2.764  1.00 0.00 ? 91  HIS A N    1  
ATOM 1412  C CA   . HIS A 1 91  ? -4.062  -6.993  2.596  1.00 0.00 ? 91  HIS A CA   1  
ATOM 1413  C C    . HIS A 1 91  ? -3.173  -8.088  3.188  1.00 0.00 ? 91  HIS A C    1  
ATOM 1414  O O    . HIS A 1 91  ? -3.311  -8.439  4.359  1.00 0.00 ? 91  HIS A O    1  
ATOM 1415  C CB   . HIS A 1 91  ? -3.783  -5.614  3.195  1.00 0.00 ? 91  HIS A CB   1  
ATOM 1416  C CG   . HIS A 1 91  ? -3.868  -4.483  2.198  1.00 0.00 ? 91  HIS A CG   1  
ATOM 1417  N ND1  . HIS A 1 91  ? -3.661  -3.159  2.546  1.00 0.00 ? 91  HIS A ND1  1  
ATOM 1418  C CD2  . HIS A 1 91  ? -4.138  -4.491  0.861  1.00 0.00 ? 91  HIS A CD2  1  
ATOM 1419  C CE1  . HIS A 1 91  ? -3.803  -2.414  1.460  1.00 0.00 ? 91  HIS A CE1  1  
ATOM 1420  N NE2  . HIS A 1 91  ? -4.100  -3.241  0.417  1.00 0.00 ? 91  HIS A NE2  1  
ATOM 1421  H H    . HIS A 1 91  ? -5.730  -7.569  3.703  1.00 0.00 ? 91  HIS A H    1  
ATOM 1422  H HA   . HIS A 1 91  ? -3.882  -6.932  1.522  1.00 0.00 ? 91  HIS A HA   1  
ATOM 1423  H HB2  . HIS A 1 91  ? -4.493  -5.428  4.001  1.00 0.00 ? 91  HIS A HB2  1  
ATOM 1424  H HB3  . HIS A 1 91  ? -2.788  -5.617  3.641  1.00 0.00 ? 91  HIS A HB3  1  
ATOM 1425  H HD1  . HIS A 1 91  ? -3.441  -2.823  3.462  1.00 0.00 ? 91  HIS A HD1  1  
ATOM 1426  H HD2  . HIS A 1 91  ? -4.350  -5.375  0.259  1.00 0.00 ? 91  HIS A HD2  1  
ATOM 1427  H HE1  . HIS A 1 91  ? -3.702  -1.330  1.409  1.00 0.00 ? 91  HIS A HE1  1  
ATOM 1428  N N    . SER A 1 92  ? -2.280  -8.598  2.353  1.00 0.00 ? 92  SER A N    1  
ATOM 1429  C CA   . SER A 1 92  ? -1.368  -9.645  2.779  1.00 0.00 ? 92  SER A CA   1  
ATOM 1430  C C    . SER A 1 92  ? 0.078   -9.156  2.675  1.00 0.00 ? 92  SER A C    1  
ATOM 1431  O O    . SER A 1 92  ? 0.555   -8.847  1.584  1.00 0.00 ? 92  SER A O    1  
ATOM 1432  C CB   . SER A 1 92  ? -1.560  -10.915 1.947  1.00 0.00 ? 92  SER A CB   1  
ATOM 1433  O OG   . SER A 1 92  ? -1.611  -10.635 0.551  1.00 0.00 ? 92  SER A OG   1  
ATOM 1434  H H    . SER A 1 92  ? -2.174  -8.307  1.402  1.00 0.00 ? 92  SER A H    1  
ATOM 1435  H HA   . SER A 1 92  ? -1.629  -9.850  3.818  1.00 0.00 ? 92  SER A HA   1  
ATOM 1436  H HB2  . SER A 1 92  ? -0.742  -11.607 2.149  1.00 0.00 ? 92  SER A HB2  1  
ATOM 1437  H HB3  . SER A 1 92  ? -2.481  -11.412 2.251  1.00 0.00 ? 92  SER A HB3  1  
ATOM 1438  H HG   . SER A 1 92  ? -2.334  -11.175 0.120  1.00 0.00 ? 92  SER A HG   1  
ATOM 1439  N N    . ILE A 1 93  ? 0.734   -9.099  3.824  1.00 0.00 ? 93  ILE A N    1  
ATOM 1440  C CA   . ILE A 1 93  ? 2.116   -8.652  3.876  1.00 0.00 ? 93  ILE A CA   1  
ATOM 1441  C C    . ILE A 1 93  ? 2.909   -9.568  4.811  1.00 0.00 ? 93  ILE A C    1  
ATOM 1442  O O    . ILE A 1 93  ? 2.380   -10.045 5.813  1.00 0.00 ? 93  ILE A O    1  
ATOM 1443  C CB   . ILE A 1 93  ? 2.186   -7.173  4.258  1.00 0.00 ? 93  ILE A CB   1  
ATOM 1444  C CG1  . ILE A 1 93  ? 1.140   -6.358  3.494  1.00 0.00 ? 93  ILE A CG1  1  
ATOM 1445  C CG2  . ILE A 1 93  ? 3.600   -6.621  4.059  1.00 0.00 ? 93  ILE A CG2  1  
ATOM 1446  C CD1  . ILE A 1 93  ? 1.103   -4.911  3.990  1.00 0.00 ? 93  ILE A CD1  1  
ATOM 1447  H H    . ILE A 1 93  ? 0.339   -9.352  4.707  1.00 0.00 ? 93  ILE A H    1  
ATOM 1448  H HA   . ILE A 1 93  ? 2.527   -8.745  2.871  1.00 0.00 ? 93  ILE A HA   1  
ATOM 1449  H HB   . ILE A 1 93  ? 1.952   -7.083  5.319  1.00 0.00 ? 93  ILE A HB   1  
ATOM 1450  H HG12 . ILE A 1 93  ? 1.369   -6.376  2.428  1.00 0.00 ? 93  ILE A HG12 1  
ATOM 1451  H HG13 . ILE A 1 93  ? 0.158   -6.815  3.617  1.00 0.00 ? 93  ILE A HG13 1  
ATOM 1452  H HG21 . ILE A 1 93  ? 4.186   -6.789  4.963  1.00 0.00 ? 93  ILE A HG21 1  
ATOM 1453  H HG22 . ILE A 1 93  ? 4.073   -7.130  3.219  1.00 0.00 ? 93  ILE A HG22 1  
ATOM 1454  H HG23 . ILE A 1 93  ? 3.547   -5.552  3.853  1.00 0.00 ? 93  ILE A HG23 1  
ATOM 1455  H HD11 . ILE A 1 93  ? 0.108   -4.497  3.826  1.00 0.00 ? 93  ILE A HD11 1  
ATOM 1456  H HD12 . ILE A 1 93  ? 1.336   -4.886  5.054  1.00 0.00 ? 93  ILE A HD12 1  
ATOM 1457  H HD13 . ILE A 1 93  ? 1.837   -4.320  3.442  1.00 0.00 ? 93  ILE A HD13 1  
ATOM 1458  N N    . ASP A 1 94  ? 4.165   -9.785  4.449  1.00 0.00 ? 94  ASP A N    1  
ATOM 1459  C CA   . ASP A 1 94  ? 5.036   -10.634 5.243  1.00 0.00 ? 94  ASP A CA   1  
ATOM 1460  C C    . ASP A 1 94  ? 4.480   -12.059 5.254  1.00 0.00 ? 94  ASP A C    1  
ATOM 1461  O O    . ASP A 1 94  ? 4.908   -12.890 6.053  1.00 0.00 ? 94  ASP A O    1  
ATOM 1462  C CB   . ASP A 1 94  ? 5.112   -10.145 6.691  1.00 0.00 ? 94  ASP A CB   1  
ATOM 1463  C CG   . ASP A 1 94  ? 6.464   -10.355 7.375  1.00 0.00 ? 94  ASP A CG   1  
ATOM 1464  O OD1  . ASP A 1 94  ? 7.468   -10.439 6.634  1.00 0.00 ? 94  ASP A OD1  1  
ATOM 1465  O OD2  . ASP A 1 94  ? 6.465   -10.427 8.623  1.00 0.00 ? 94  ASP A OD2  1  
ATOM 1466  H H    . ASP A 1 94  ? 4.587   -9.392  3.632  1.00 0.00 ? 94  ASP A H    1  
ATOM 1467  H HA   . ASP A 1 94  ? 6.013   -10.571 4.763  1.00 0.00 ? 94  ASP A HA   1  
ATOM 1468  H HB2  . ASP A 1 94  ? 4.872   -9.082  6.713  1.00 0.00 ? 94  ASP A HB2  1  
ATOM 1469  H HB3  . ASP A 1 94  ? 4.345   -10.657 7.272  1.00 0.00 ? 94  ASP A HB3  1  
ATOM 1470  N N    . GLY A 1 95  ? 3.535   -12.298 4.357  1.00 0.00 ? 95  GLY A N    1  
ATOM 1471  C CA   . GLY A 1 95  ? 2.916   -13.609 4.253  1.00 0.00 ? 95  GLY A CA   1  
ATOM 1472  C C    . GLY A 1 95  ? 1.808   -13.776 5.295  1.00 0.00 ? 95  GLY A C    1  
ATOM 1473  O O    . GLY A 1 95  ? 1.387   -14.895 5.585  1.00 0.00 ? 95  GLY A O    1  
ATOM 1474  H H    . GLY A 1 95  ? 3.193   -11.617 3.710  1.00 0.00 ? 95  GLY A H    1  
ATOM 1475  H HA2  . GLY A 1 95  ? 2.503   -13.742 3.253  1.00 0.00 ? 95  GLY A HA2  1  
ATOM 1476  H HA3  . GLY A 1 95  ? 3.670   -14.383 4.392  1.00 0.00 ? 95  GLY A HA3  1  
ATOM 1477  N N    . ARG A 1 96  ? 1.366   -12.646 5.829  1.00 0.00 ? 96  ARG A N    1  
ATOM 1478  C CA   . ARG A 1 96  ? 0.315   -12.654 6.832  1.00 0.00 ? 96  ARG A CA   1  
ATOM 1479  C C    . ARG A 1 96  ? -0.838  -11.747 6.398  1.00 0.00 ? 96  ARG A C    1  
ATOM 1480  O O    . ARG A 1 96  ? -0.667  -10.889 5.534  1.00 0.00 ? 96  ARG A O    1  
ATOM 1481  C CB   . ARG A 1 96  ? 0.844   -12.181 8.188  1.00 0.00 ? 96  ARG A CB   1  
ATOM 1482  C CG   . ARG A 1 96  ? 0.962   -10.657 8.229  1.00 0.00 ? 96  ARG A CG   1  
ATOM 1483  C CD   . ARG A 1 96  ? -0.008  -10.059 9.250  1.00 0.00 ? 96  ARG A CD   1  
ATOM 1484  N NE   . ARG A 1 96  ? 0.081   -10.802 10.527 1.00 0.00 ? 96  ARG A NE   1  
ATOM 1485  C CZ   . ARG A 1 96  ? -0.810  -10.693 11.523 1.00 0.00 ? 96  ARG A CZ   1  
ATOM 1486  N NH1  . ARG A 1 96  ? -1.861  -9.873  11.395 1.00 0.00 ? 96  ARG A NH1  1  
ATOM 1487  N NH2  . ARG A 1 96  ? -0.649  -11.406 12.646 1.00 0.00 ? 96  ARG A NH2  1  
ATOM 1488  H H    . ARG A 1 96  ? 1.714   -11.740 5.587  1.00 0.00 ? 96  ARG A H    1  
ATOM 1489  H HA   . ARG A 1 96  ? -0.005  -13.694 6.893  1.00 0.00 ? 96  ARG A HA   1  
ATOM 1490  H HB2  . ARG A 1 96  ? 0.177   -12.520 8.980  1.00 0.00 ? 96  ARG A HB2  1  
ATOM 1491  H HB3  . ARG A 1 96  ? 1.819   -12.630 8.378  1.00 0.00 ? 96  ARG A HB3  1  
ATOM 1492  H HG2  . ARG A 1 96  ? 1.984   -10.374 8.484  1.00 0.00 ? 96  ARG A HG2  1  
ATOM 1493  H HG3  . ARG A 1 96  ? 0.755   -10.245 7.241  1.00 0.00 ? 96  ARG A HG3  1  
ATOM 1494  H HD2  . ARG A 1 96  ? 0.226   -9.007  9.414  1.00 0.00 ? 96  ARG A HD2  1  
ATOM 1495  H HD3  . ARG A 1 96  ? -1.027  -10.103 8.865  1.00 0.00 ? 96  ARG A HD3  1  
ATOM 1496  H HE   . ARG A 1 96  ? 0.854   -11.423 10.656 1.00 0.00 ? 96  ARG A HE   1  
ATOM 1497  H HH11 . ARG A 1 96  ? -1.981  -9.341  10.556 1.00 0.00 ? 96  ARG A HH11 1  
ATOM 1498  H HH12 . ARG A 1 96  ? -2.526  -9.792  12.138 1.00 0.00 ? 96  ARG A HH12 1  
ATOM 1499  H HH21 . ARG A 1 96  ? 0.136   -12.018 12.742 1.00 0.00 ? 96  ARG A HH21 1  
ATOM 1500  H HH22 . ARG A 1 96  ? -1.313  -11.325 13.389 1.00 0.00 ? 96  ARG A HH22 1  
ATOM 1501  N N    . VAL A 1 97  ? -1.988  -11.968 7.019  1.00 0.00 ? 97  VAL A N    1  
ATOM 1502  C CA   . VAL A 1 97  ? -3.170  -11.182 6.708  1.00 0.00 ? 97  VAL A CA   1  
ATOM 1503  C C    . VAL A 1 97  ? -3.233  -9.972  7.643  1.00 0.00 ? 97  VAL A C    1  
ATOM 1504  O O    . VAL A 1 97  ? -3.445  -10.123 8.845  1.00 0.00 ? 97  VAL A O    1  
ATOM 1505  C CB   . VAL A 1 97  ? -4.419  -12.062 6.784  1.00 0.00 ? 97  VAL A CB   1  
ATOM 1506  C CG1  . VAL A 1 97  ? -5.675  -11.262 6.434  1.00 0.00 ? 97  VAL A CG1  1  
ATOM 1507  C CG2  . VAL A 1 97  ? -4.281  -13.289 5.880  1.00 0.00 ? 97  VAL A CG2  1  
ATOM 1508  H H    . VAL A 1 97  ? -2.119  -12.669 7.720  1.00 0.00 ? 97  VAL A H    1  
ATOM 1509  H HA   . VAL A 1 97  ? -3.068  -10.828 5.682  1.00 0.00 ? 97  VAL A HA   1  
ATOM 1510  H HB   . VAL A 1 97  ? -4.520  -12.413 7.811  1.00 0.00 ? 97  VAL A HB   1  
ATOM 1511  H HG11 . VAL A 1 97  ? -6.543  -11.725 6.904  1.00 0.00 ? 97  VAL A HG11 1  
ATOM 1512  H HG12 . VAL A 1 97  ? -5.568  -10.240 6.797  1.00 0.00 ? 97  VAL A HG12 1  
ATOM 1513  H HG13 . VAL A 1 97  ? -5.810  -11.251 5.353  1.00 0.00 ? 97  VAL A HG13 1  
ATOM 1514  H HG21 . VAL A 1 97  ? -3.760  -14.080 6.418  1.00 0.00 ? 97  VAL A HG21 1  
ATOM 1515  H HG22 . VAL A 1 97  ? -5.272  -13.639 5.589  1.00 0.00 ? 97  VAL A HG22 1  
ATOM 1516  H HG23 . VAL A 1 97  ? -3.714  -13.021 4.988  1.00 0.00 ? 97  VAL A HG23 1  
ATOM 1517  N N    . VAL A 1 98  ? -3.044  -8.800  7.055  1.00 0.00 ? 98  VAL A N    1  
ATOM 1518  C CA   . VAL A 1 98  ? -3.077  -7.566  7.821  1.00 0.00 ? 98  VAL A CA   1  
ATOM 1519  C C    . VAL A 1 98  ? -4.449  -6.907  7.660  1.00 0.00 ? 98  VAL A C    1  
ATOM 1520  O O    . VAL A 1 98  ? -5.358  -7.493  7.074  1.00 0.00 ? 98  VAL A O    1  
ATOM 1521  C CB   . VAL A 1 98  ? -1.924  -6.655  7.395  1.00 0.00 ? 98  VAL A CB   1  
ATOM 1522  C CG1  . VAL A 1 98  ? -0.684  -7.474  7.029  1.00 0.00 ? 98  VAL A CG1  1  
ATOM 1523  C CG2  . VAL A 1 98  ? -2.341  -5.746  6.237  1.00 0.00 ? 98  VAL A CG2  1  
ATOM 1524  H H    . VAL A 1 98  ? -2.872  -8.686  6.077  1.00 0.00 ? 98  VAL A H    1  
ATOM 1525  H HA   . VAL A 1 98  ? -2.933  -7.825  8.869  1.00 0.00 ? 98  VAL A HA   1  
ATOM 1526  H HB   . VAL A 1 98  ? -1.667  -6.020  8.243  1.00 0.00 ? 98  VAL A HB   1  
ATOM 1527  H HG11 . VAL A 1 98  ? 0.203   -6.846  7.107  1.00 0.00 ? 98  VAL A HG11 1  
ATOM 1528  H HG12 . VAL A 1 98  ? -0.593  -8.319  7.711  1.00 0.00 ? 98  VAL A HG12 1  
ATOM 1529  H HG13 . VAL A 1 98  ? -0.780  -7.841  6.007  1.00 0.00 ? 98  VAL A HG13 1  
ATOM 1530  H HG21 . VAL A 1 98  ? -1.471  -5.518  5.622  1.00 0.00 ? 98  VAL A HG21 1  
ATOM 1531  H HG22 . VAL A 1 98  ? -3.092  -6.252  5.630  1.00 0.00 ? 98  VAL A HG22 1  
ATOM 1532  H HG23 . VAL A 1 98  ? -2.758  -4.820  6.634  1.00 0.00 ? 98  VAL A HG23 1  
ATOM 1533  N N    . GLU A 1 99  ? -4.555  -5.698  8.191  1.00 0.00 ? 99  GLU A N    1  
ATOM 1534  C CA   . GLU A 1 99  ? -5.801  -4.954  8.114  1.00 0.00 ? 99  GLU A CA   1  
ATOM 1535  C C    . GLU A 1 99  ? -5.537  -3.458  8.296  1.00 0.00 ? 99  GLU A C    1  
ATOM 1536  O O    . GLU A 1 99  ? -5.208  -3.010  9.393  1.00 0.00 ? 99  GLU A O    1  
ATOM 1537  C CB   . GLU A 1 99  ? -6.808  -5.462  9.148  1.00 0.00 ? 99  GLU A CB   1  
ATOM 1538  C CG   . GLU A 1 99  ? -6.124  -5.741  10.488 1.00 0.00 ? 99  GLU A CG   1  
ATOM 1539  C CD   . GLU A 1 99  ? -6.301  -7.205  10.899 1.00 0.00 ? 99  GLU A CD   1  
ATOM 1540  O OE1  . GLU A 1 99  ? -7.463  -7.587  11.154 1.00 0.00 ? 99  GLU A OE1  1  
ATOM 1541  O OE2  . GLU A 1 99  ? -5.269  -7.908  10.949 1.00 0.00 ? 99  GLU A OE2  1  
ATOM 1542  H H    . GLU A 1 99  ? -3.811  -5.228  8.666  1.00 0.00 ? 99  GLU A H    1  
ATOM 1543  H HA   . GLU A 1 99  ? -6.190  -5.143  7.114  1.00 0.00 ? 99  GLU A HA   1  
ATOM 1544  H HB2  . GLU A 1 99  ? -7.598  -4.724  9.285  1.00 0.00 ? 99  GLU A HB2  1  
ATOM 1545  H HB3  . GLU A 1 99  ? -7.283  -6.373  8.782  1.00 0.00 ? 99  GLU A HB3  1  
ATOM 1546  H HG2  . GLU A 1 99  ? -5.063  -5.506  10.415 1.00 0.00 ? 99  GLU A HG2  1  
ATOM 1547  H HG3  . GLU A 1 99  ? -6.543  -5.091  11.256 1.00 0.00 ? 99  GLU A HG3  1  
ATOM 1548  N N    . PRO A 1 100 ? -5.697  -2.706  7.173  1.00 0.00 ? 100 PRO A N    1  
ATOM 1549  C CA   . PRO A 1 100 ? -5.480  -1.270  7.198  1.00 0.00 ? 100 PRO A CA   1  
ATOM 1550  C C    . PRO A 1 100 ? -6.642  -0.551  7.886  1.00 0.00 ? 100 PRO A C    1  
ATOM 1551  O O    . PRO A 1 100 ? -7.728  -1.112  8.027  1.00 0.00 ? 100 PRO A O    1  
ATOM 1552  C CB   . PRO A 1 100 ? -5.315  -0.872  5.740  1.00 0.00 ? 100 PRO A CB   1  
ATOM 1553  C CG   . PRO A 1 100 ? -5.905  -2.013  4.927  1.00 0.00 ? 100 PRO A CG   1  
ATOM 1554  C CD   . PRO A 1 100 ? -6.086  -3.202  5.857  1.00 0.00 ? 100 PRO A CD   1  
ATOM 1555  H HA   . PRO A 1 100 ? -4.666  -1.051  7.736  1.00 0.00 ? 100 PRO A HA   1  
ATOM 1556  H HB2  . PRO A 1 100 ? -5.831  0.065   5.530  1.00 0.00 ? 100 PRO A HB2  1  
ATOM 1557  H HB3  . PRO A 1 100 ? -4.265  -0.719  5.493  1.00 0.00 ? 100 PRO A HB3  1  
ATOM 1558  H HG2  . PRO A 1 100 ? -6.861  -1.718  4.494  1.00 0.00 ? 100 PRO A HG2  1  
ATOM 1559  H HG3  . PRO A 1 100 ? -5.246  -2.272  4.099  1.00 0.00 ? 100 PRO A HG3  1  
ATOM 1560  H HD2  . PRO A 1 100 ? -7.119  -3.552  5.855  1.00 0.00 ? 100 PRO A HD2  1  
ATOM 1561  H HD3  . PRO A 1 100 ? -5.464  -4.043  5.550  1.00 0.00 ? 100 PRO A HD3  1  
ATOM 1562  N N    . LYS A 1 101 ? -6.375  0.680   8.297  1.00 0.00 ? 101 LYS A N    1  
ATOM 1563  C CA   . LYS A 1 101 ? -7.385  1.481   8.967  1.00 0.00 ? 101 LYS A CA   1  
ATOM 1564  C C    . LYS A 1 101 ? -7.263  2.936   8.509  1.00 0.00 ? 101 LYS A C    1  
ATOM 1565  O O    . LYS A 1 101 ? -6.196  3.365   8.073  1.00 0.00 ? 101 LYS A O    1  
ATOM 1566  C CB   . LYS A 1 101 ? -7.290  1.304   10.483 1.00 0.00 ? 101 LYS A CB   1  
ATOM 1567  C CG   . LYS A 1 101 ? -6.824  -0.109  10.842 1.00 0.00 ? 101 LYS A CG   1  
ATOM 1568  C CD   . LYS A 1 101 ? -6.741  -0.290  12.359 1.00 0.00 ? 101 LYS A CD   1  
ATOM 1569  C CE   . LYS A 1 101 ? -7.965  -1.037  12.891 1.00 0.00 ? 101 LYS A CE   1  
ATOM 1570  N NZ   . LYS A 1 101 ? -8.860  -0.112  13.621 1.00 0.00 ? 101 LYS A NZ   1  
ATOM 1571  H H    . LYS A 1 101 ? -5.489  1.129   8.178  1.00 0.00 ? 101 LYS A H    1  
ATOM 1572  H HA   . LYS A 1 101 ? -8.360  1.103   8.658  1.00 0.00 ? 101 LYS A HA   1  
ATOM 1573  H HB2  . LYS A 1 101 ? -6.596  2.036   10.897 1.00 0.00 ? 101 LYS A HB2  1  
ATOM 1574  H HB3  . LYS A 1 101 ? -8.263  1.496   10.937 1.00 0.00 ? 101 LYS A HB3  1  
ATOM 1575  H HG2  . LYS A 1 101 ? -7.514  -0.841  10.423 1.00 0.00 ? 101 LYS A HG2  1  
ATOM 1576  H HG3  . LYS A 1 101 ? -5.848  -0.298  10.396 1.00 0.00 ? 101 LYS A HG3  1  
ATOM 1577  H HD2  . LYS A 1 101 ? -5.835  -0.840  12.614 1.00 0.00 ? 101 LYS A HD2  1  
ATOM 1578  H HD3  . LYS A 1 101 ? -6.667  0.685   12.842 1.00 0.00 ? 101 LYS A HD3  1  
ATOM 1579  H HE2  . LYS A 1 101 ? -8.505  -1.497  12.063 1.00 0.00 ? 101 LYS A HE2  1  
ATOM 1580  H HE3  . LYS A 1 101 ? -7.648  -1.843  13.552 1.00 0.00 ? 101 LYS A HE3  1  
ATOM 1581  H HZ1  . LYS A 1 101 ? -8.356  0.716   13.867 1.00 0.00 ? 101 LYS A HZ1  1  
ATOM 1582  H HZ2  . LYS A 1 101 ? -9.636  0.132   13.038 1.00 0.00 ? 101 LYS A HZ2  1  
ATOM 1583  H HZ3  . LYS A 1 101 ? -9.195  -0.557  14.451 1.00 0.00 ? 101 LYS A HZ3  1  
ATOM 1584  N N    . ARG A 1 102 ? -8.370  3.654   8.623  1.00 0.00 ? 102 ARG A N    1  
ATOM 1585  C CA   . ARG A 1 102 ? -8.401  5.051   8.226  1.00 0.00 ? 102 ARG A CA   1  
ATOM 1586  C C    . ARG A 1 102 ? -7.437  5.869   9.088  1.00 0.00 ? 102 ARG A C    1  
ATOM 1587  O O    . ARG A 1 102 ? -6.888  6.871   8.632  1.00 0.00 ? 102 ARG A O    1  
ATOM 1588  C CB   . ARG A 1 102 ? -9.810  5.631   8.358  1.00 0.00 ? 102 ARG A CB   1  
ATOM 1589  C CG   . ARG A 1 102 ? -10.646 5.332   7.112  1.00 0.00 ? 102 ARG A CG   1  
ATOM 1590  C CD   . ARG A 1 102 ? -11.590 4.153   7.355  1.00 0.00 ? 102 ARG A CD   1  
ATOM 1591  N NE   . ARG A 1 102 ? -10.878 2.878   7.119  1.00 0.00 ? 102 ARG A NE   1  
ATOM 1592  C CZ   . ARG A 1 102 ? -11.344 1.677   7.490  1.00 0.00 ? 102 ARG A CZ   1  
ATOM 1593  N NH1  . ARG A 1 102 ? -12.525 1.582   8.116  1.00 0.00 ? 102 ARG A NH1  1  
ATOM 1594  N NH2  . ARG A 1 102 ? -10.630 0.573   7.235  1.00 0.00 ? 102 ARG A NH2  1  
ATOM 1595  H H    . ARG A 1 102 ? -9.234  3.297   8.978  1.00 0.00 ? 102 ARG A H    1  
ATOM 1596  H HA   . ARG A 1 102 ? -8.089  5.051   7.181  1.00 0.00 ? 102 ARG A HA   1  
ATOM 1597  H HB2  . ARG A 1 102 ? -10.299 5.211   9.237  1.00 0.00 ? 102 ARG A HB2  1  
ATOM 1598  H HB3  . ARG A 1 102 ? -9.751  6.709   8.511  1.00 0.00 ? 102 ARG A HB3  1  
ATOM 1599  H HG2  . ARG A 1 102 ? -11.223 6.215   6.837  1.00 0.00 ? 102 ARG A HG2  1  
ATOM 1600  H HG3  . ARG A 1 102 ? -9.987  5.108   6.273  1.00 0.00 ? 102 ARG A HG3  1  
ATOM 1601  H HD2  . ARG A 1 102 ? -11.969 4.185   8.376  1.00 0.00 ? 102 ARG A HD2  1  
ATOM 1602  H HD3  . ARG A 1 102 ? -12.453 4.226   6.692  1.00 0.00 ? 102 ARG A HD3  1  
ATOM 1603  H HE   . ARG A 1 102 ? -9.993  2.913   6.654  1.00 0.00 ? 102 ARG A HE   1  
ATOM 1604  H HH11 . ARG A 1 102 ? -13.059 2.406   8.306  1.00 0.00 ? 102 ARG A HH11 1  
ATOM 1605  H HH12 . ARG A 1 102 ? -12.873 0.686   8.393  1.00 0.00 ? 102 ARG A HH12 1  
ATOM 1606  H HH21 . ARG A 1 102 ? -9.748  0.644   6.768  1.00 0.00 ? 102 ARG A HH21 1  
ATOM 1607  H HH22 . ARG A 1 102 ? -10.978 -0.323  7.512  1.00 0.00 ? 102 ARG A HH22 1  
ATOM 1608  N N    . ALA A 1 103 ? -7.260  5.411   10.319 1.00 0.00 ? 103 ALA A N    1  
ATOM 1609  C CA   . ALA A 1 103 ? -6.372  6.087   11.249 1.00 0.00 ? 103 ALA A CA   1  
ATOM 1610  C C    . ALA A 1 103 ? -7.132  7.220   11.940 1.00 0.00 ? 103 ALA A C    1  
ATOM 1611  O O    . ALA A 1 103 ? -7.106  7.334   13.165 1.00 0.00 ? 103 ALA A O    1  
ATOM 1612  C CB   . ALA A 1 103 ? -5.134  6.587   10.501 1.00 0.00 ? 103 ALA A CB   1  
ATOM 1613  H H    . ALA A 1 103 ? -7.710  4.595   10.681 1.00 0.00 ? 103 ALA A H    1  
ATOM 1614  H HA   . ALA A 1 103 ? -6.060  5.360   11.998 1.00 0.00 ? 103 ALA A HA   1  
ATOM 1615  H HB1  . ALA A 1 103 ? -5.246  7.648   10.282 1.00 0.00 ? 103 ALA A HB1  1  
ATOM 1616  H HB2  . ALA A 1 103 ? -4.250  6.435   11.120 1.00 0.00 ? 103 ALA A HB2  1  
ATOM 1617  H HB3  . ALA A 1 103 ? -5.024  6.033   9.569  1.00 0.00 ? 103 ALA A HB3  1  
ATOM 1618  N N    . VAL A 1 104 ? -7.792  8.030   11.126 1.00 0.00 ? 104 VAL A N    1  
ATOM 1619  C CA   . VAL A 1 104 ? -8.559  9.151   11.644 1.00 0.00 ? 104 VAL A CA   1  
ATOM 1620  C C    . VAL A 1 104 ? -9.340  8.701   12.880 1.00 0.00 ? 104 VAL A C    1  
ATOM 1621  O O    . VAL A 1 104 ? -9.802  7.562   12.946 1.00 0.00 ? 104 VAL A O    1  
ATOM 1622  C CB   . VAL A 1 104 ? -9.457  9.724   10.545 1.00 0.00 ? 104 VAL A CB   1  
ATOM 1623  C CG1  . VAL A 1 104 ? -8.622  10.297  9.399  1.00 0.00 ? 104 VAL A CG1  1  
ATOM 1624  C CG2  . VAL A 1 104 ? -10.439 8.668   10.034 1.00 0.00 ? 104 VAL A CG2  1  
ATOM 1625  H H    . VAL A 1 104 ? -7.809  7.931   10.131 1.00 0.00 ? 104 VAL A H    1  
ATOM 1626  H HA   . VAL A 1 104 ? -7.851  9.925   11.939 1.00 0.00 ? 104 VAL A HA   1  
ATOM 1627  H HB   . VAL A 1 104 ? -10.036 10.539  10.978 1.00 0.00 ? 104 VAL A HB   1  
ATOM 1628  H HG11 . VAL A 1 104 ? -7.744  9.671   9.240  1.00 0.00 ? 104 VAL A HG11 1  
ATOM 1629  H HG12 . VAL A 1 104 ? -9.221  10.319  8.488  1.00 0.00 ? 104 VAL A HG12 1  
ATOM 1630  H HG13 . VAL A 1 104 ? -8.306  11.309  9.650  1.00 0.00 ? 104 VAL A HG13 1  
ATOM 1631  H HG21 . VAL A 1 104 ? -10.456 8.685   8.944  1.00 0.00 ? 104 VAL A HG21 1  
ATOM 1632  H HG22 . VAL A 1 104 ? -10.124 7.682   10.378 1.00 0.00 ? 104 VAL A HG22 1  
ATOM 1633  H HG23 . VAL A 1 104 ? -11.436 8.884   10.417 1.00 0.00 ? 104 VAL A HG23 1  
ATOM 1634  N N    . ALA A 1 105 ? -9.464  9.617   13.829 1.00 0.00 ? 105 ALA A N    1  
ATOM 1635  C CA   . ALA A 1 105 ? -10.181 9.329   15.059 1.00 0.00 ? 105 ALA A CA   1  
ATOM 1636  C C    . ALA A 1 105 ? -9.808  7.927   15.545 1.00 0.00 ? 105 ALA A C    1  
ATOM 1637  O O    . ALA A 1 105 ? -10.450 6.946   15.174 1.00 0.00 ? 105 ALA A O    1  
ATOM 1638  C CB   . ALA A 1 105 ? -11.684 9.482   14.822 1.00 0.00 ? 105 ALA A CB   1  
ATOM 1639  H H    . ALA A 1 105 ? -9.085  10.540  13.767 1.00 0.00 ? 105 ALA A H    1  
ATOM 1640  H HA   . ALA A 1 105 ? -9.867  10.058  15.806 1.00 0.00 ? 105 ALA A HA   1  
ATOM 1641  H HB1  . ALA A 1 105 ? -12.141 9.968   15.684 1.00 0.00 ? 105 ALA A HB1  1  
ATOM 1642  H HB2  . ALA A 1 105 ? -11.852 10.090  13.932 1.00 0.00 ? 105 ALA A HB2  1  
ATOM 1643  H HB3  . ALA A 1 105 ? -12.132 8.499   14.680 1.00 0.00 ? 105 ALA A HB3  1  
ATOM 1644  N N    . ARG A 1 106 ? -8.770  7.877   16.368 1.00 0.00 ? 106 ARG A N    1  
ATOM 1645  C CA   . ARG A 1 106 ? -8.304  6.611   16.909 1.00 0.00 ? 106 ARG A CA   1  
ATOM 1646  C C    . ARG A 1 106 ? -8.318  6.650   18.438 1.00 0.00 ? 106 ARG A C    1  
ATOM 1647  O O    . ARG A 1 106 ? -8.141  7.710   19.037 1.00 0.00 ? 106 ARG A O    1  
ATOM 1648  C CB   . ARG A 1 106 ? -6.887  6.295   16.426 1.00 0.00 ? 106 ARG A CB   1  
ATOM 1649  C CG   . ARG A 1 106 ? -6.638  4.785   16.408 1.00 0.00 ? 106 ARG A CG   1  
ATOM 1650  C CD   . ARG A 1 106 ? -5.692  4.372   17.537 1.00 0.00 ? 106 ARG A CD   1  
ATOM 1651  N NE   . ARG A 1 106 ? -6.002  2.995   17.980 1.00 0.00 ? 106 ARG A NE   1  
ATOM 1652  C CZ   . ARG A 1 106 ? -5.611  2.476   19.152 1.00 0.00 ? 106 ARG A CZ   1  
ATOM 1653  N NH1  . ARG A 1 106 ? -4.893  3.217   20.006 1.00 0.00 ? 106 ARG A NH1  1  
ATOM 1654  N NH2  . ARG A 1 106 ? -5.939  1.216   19.470 1.00 0.00 ? 106 ARG A NH2  1  
ATOM 1655  H H    . ARG A 1 106 ? -8.253  8.679   16.665 1.00 0.00 ? 106 ARG A H    1  
ATOM 1656  H HA   . ARG A 1 106 ? -9.007  5.870   16.529 1.00 0.00 ? 106 ARG A HA   1  
ATOM 1657  H HB2  . ARG A 1 106 ? -6.740  6.703   15.426 1.00 0.00 ? 106 ARG A HB2  1  
ATOM 1658  H HB3  . ARG A 1 106 ? -6.160  6.779   17.078 1.00 0.00 ? 106 ARG A HB3  1  
ATOM 1659  H HG2  . ARG A 1 106 ? -7.585  4.256   16.511 1.00 0.00 ? 106 ARG A HG2  1  
ATOM 1660  H HG3  . ARG A 1 106 ? -6.213  4.494   15.448 1.00 0.00 ? 106 ARG A HG3  1  
ATOM 1661  H HD2  . ARG A 1 106 ? -4.658  4.429   17.196 1.00 0.00 ? 106 ARG A HD2  1  
ATOM 1662  H HD3  . ARG A 1 106 ? -5.789  5.063   18.375 1.00 0.00 ? 106 ARG A HD3  1  
ATOM 1663  H HE   . ARG A 1 106 ? -6.537  2.414   17.365 1.00 0.00 ? 106 ARG A HE   1  
ATOM 1664  H HH11 . ARG A 1 106 ? -4.649  4.158   19.769 1.00 0.00 ? 106 ARG A HH11 1  
ATOM 1665  H HH12 . ARG A 1 106 ? -4.602  2.830   20.881 1.00 0.00 ? 106 ARG A HH12 1  
ATOM 1666  H HH21 . ARG A 1 106 ? -6.475  0.663   18.832 1.00 0.00 ? 106 ARG A HH21 1  
ATOM 1667  H HH22 . ARG A 1 106 ? -5.647  0.829   20.344 1.00 0.00 ? 106 ARG A HH22 1  
ATOM 1668  N N    . GLU A 1 107 ? -8.529  5.482   19.026 1.00 0.00 ? 107 GLU A N    1  
ATOM 1669  C CA   . GLU A 1 107 ? -8.568  5.369   20.474 1.00 0.00 ? 107 GLU A CA   1  
ATOM 1670  C C    . GLU A 1 107 ? -7.370  6.089   21.095 1.00 0.00 ? 107 GLU A C    1  
ATOM 1671  O O    . GLU A 1 107 ? -6.222  5.773   20.785 1.00 0.00 ? 107 GLU A O    1  
ATOM 1672  C CB   . GLU A 1 107 ? -8.613  3.903   20.909 1.00 0.00 ? 107 GLU A CB   1  
ATOM 1673  C CG   . GLU A 1 107 ? -9.807  3.639   21.828 1.00 0.00 ? 107 GLU A CG   1  
ATOM 1674  C CD   . GLU A 1 107 ? -9.365  3.546   23.290 1.00 0.00 ? 107 GLU A CD   1  
ATOM 1675  O OE1  . GLU A 1 107 ? -8.996  2.425   23.701 1.00 0.00 ? 107 GLU A OE1  1  
ATOM 1676  O OE2  . GLU A 1 107 ? -9.405  4.599   23.963 1.00 0.00 ? 107 GLU A OE2  1  
ATOM 1677  H H    . GLU A 1 107 ? -8.672  4.625   18.532 1.00 0.00 ? 107 GLU A H    1  
ATOM 1678  H HA   . GLU A 1 107 ? -9.493  5.860   20.778 1.00 0.00 ? 107 GLU A HA   1  
ATOM 1679  H HB2  . GLU A 1 107 ? -8.677  3.261   20.030 1.00 0.00 ? 107 GLU A HB2  1  
ATOM 1680  H HB3  . GLU A 1 107 ? -7.688  3.645   21.425 1.00 0.00 ? 107 GLU A HB3  1  
ATOM 1681  H HG2  . GLU A 1 107 ? -10.540 4.438   21.716 1.00 0.00 ? 107 GLU A HG2  1  
ATOM 1682  H HG3  . GLU A 1 107 ? -10.299 2.712   21.534 1.00 0.00 ? 107 GLU A HG3  1  
ATOM 1683  N N    . GLU A 1 108 ? -7.677  7.044   21.961 1.00 0.00 ? 108 GLU A N    1  
ATOM 1684  C CA   . GLU A 1 108 ? -6.639  7.811   22.628 1.00 0.00 ? 108 GLU A CA   1  
ATOM 1685  C C    . GLU A 1 108 ? -6.982  7.993   24.108 1.00 0.00 ? 108 GLU A C    1  
ATOM 1686  O O    . GLU A 1 108 ? -7.660  8.951   24.478 1.00 0.00 ? 108 GLU A O    1  
ATOM 1687  C CB   . GLU A 1 108 ? -6.430  9.163   21.943 1.00 0.00 ? 108 GLU A CB   1  
ATOM 1688  C CG   . GLU A 1 108 ? -4.958  9.375   21.586 1.00 0.00 ? 108 GLU A CG   1  
ATOM 1689  C CD   . GLU A 1 108 ? -4.748  10.731  20.908 1.00 0.00 ? 108 GLU A CD   1  
ATOM 1690  O OE1  . GLU A 1 108 ? -5.455  11.681  21.307 1.00 0.00 ? 108 GLU A OE1  1  
ATOM 1691  O OE2  . GLU A 1 108 ? -3.886  10.786  20.004 1.00 0.00 ? 108 GLU A OE2  1  
ATOM 1692  H H    . GLU A 1 108 ? -8.613  7.295   22.208 1.00 0.00 ? 108 GLU A H    1  
ATOM 1693  H HA   . GLU A 1 108 ? -5.731  7.217   22.530 1.00 0.00 ? 108 GLU A HA   1  
ATOM 1694  H HB2  . GLU A 1 108 ? -7.038  9.215   21.040 1.00 0.00 ? 108 GLU A HB2  1  
ATOM 1695  H HB3  . GLU A 1 108 ? -6.768  9.964   22.601 1.00 0.00 ? 108 GLU A HB3  1  
ATOM 1696  H HG2  . GLU A 1 108 ? -4.349  9.319   22.489 1.00 0.00 ? 108 GLU A HG2  1  
ATOM 1697  H HG3  . GLU A 1 108 ? -4.622  8.577   20.924 1.00 0.00 ? 108 GLU A HG3  1  
ATOM 1698  N N    . SER A 1 109 ? -6.498  7.060   24.915 1.00 0.00 ? 109 SER A N    1  
ATOM 1699  C CA   . SER A 1 109 ? -6.745  7.106   26.346 1.00 0.00 ? 109 SER A CA   1  
ATOM 1700  C C    . SER A 1 109 ? -6.386  8.488   26.895 1.00 0.00 ? 109 SER A C    1  
ATOM 1701  O O    . SER A 1 109 ? -5.445  9.123   26.421 1.00 0.00 ? 109 SER A O    1  
ATOM 1702  C CB   . SER A 1 109 ? -5.951  6.022   27.077 1.00 0.00 ? 109 SER A CB   1  
ATOM 1703  O OG   . SER A 1 109 ? -6.713  5.410   28.114 1.00 0.00 ? 109 SER A OG   1  
ATOM 1704  H H    . SER A 1 109 ? -5.947  6.285   24.605 1.00 0.00 ? 109 SER A H    1  
ATOM 1705  H HA   . SER A 1 109 ? -7.812  6.914   26.461 1.00 0.00 ? 109 SER A HA   1  
ATOM 1706  H HB2  . SER A 1 109 ? -5.633  5.262   26.363 1.00 0.00 ? 109 SER A HB2  1  
ATOM 1707  H HB3  . SER A 1 109 ? -5.047  6.458   27.501 1.00 0.00 ? 109 SER A HB3  1  
ATOM 1708  H HG   . SER A 1 109 ? -6.542  4.424   28.127 1.00 0.00 ? 109 SER A HG   1  
ATOM 1709  N N    . GLY A 1 110 ? -7.155  8.914   27.886 1.00 0.00 ? 110 GLY A N    1  
ATOM 1710  C CA   . GLY A 1 110 ? -6.929  10.209  28.505 1.00 0.00 ? 110 GLY A CA   1  
ATOM 1711  C C    . GLY A 1 110 ? -7.372  10.202  29.970 1.00 0.00 ? 110 GLY A C    1  
ATOM 1712  O O    . GLY A 1 110 ? -7.519  9.140   30.572 1.00 0.00 ? 110 GLY A O    1  
ATOM 1713  H H    . GLY A 1 110 ? -7.918  8.391   28.266 1.00 0.00 ? 110 GLY A H    1  
ATOM 1714  H HA2  . GLY A 1 110 ? -5.872  10.467  28.442 1.00 0.00 ? 110 GLY A HA2  1  
ATOM 1715  H HA3  . GLY A 1 110 ? -7.478  10.977  27.959 1.00 0.00 ? 110 GLY A HA3  1  
ATOM 1716  N N    . SER A 1 111 ? -7.571  11.400  30.500 1.00 0.00 ? 111 SER A N    1  
ATOM 1717  C CA   . SER A 1 111 ? -7.994  11.544  31.883 1.00 0.00 ? 111 SER A CA   1  
ATOM 1718  C C    . SER A 1 111 ? -8.293  13.014  32.187 1.00 0.00 ? 111 SER A C    1  
ATOM 1719  O O    . SER A 1 111 ? -7.705  13.909  31.582 1.00 0.00 ? 111 SER A O    1  
ATOM 1720  C CB   . SER A 1 111 ? -6.930  11.009  32.843 1.00 0.00 ? 111 SER A CB   1  
ATOM 1721  O OG   . SER A 1 111 ? -5.647  11.573  32.586 1.00 0.00 ? 111 SER A OG   1  
ATOM 1722  H H    . SER A 1 111 ? -7.449  12.259  30.003 1.00 0.00 ? 111 SER A H    1  
ATOM 1723  H HA   . SER A 1 111 ? -8.899  10.944  31.972 1.00 0.00 ? 111 SER A HA   1  
ATOM 1724  H HB2  . SER A 1 111 ? -7.224  11.230  33.869 1.00 0.00 ? 111 SER A HB2  1  
ATOM 1725  H HB3  . SER A 1 111 ? -6.874  9.924   32.754 1.00 0.00 ? 111 SER A HB3  1  
ATOM 1726  H HG   . SER A 1 111 ? -4.931  10.957  32.914 1.00 0.00 ? 111 SER A HG   1  
ATOM 1727  N N    . GLY A 1 112 ? -9.207  13.217  33.125 1.00 0.00 ? 112 GLY A N    1  
ATOM 1728  C CA   . GLY A 1 112 ? -9.591  14.562  33.517 1.00 0.00 ? 112 GLY A CA   1  
ATOM 1729  C C    . GLY A 1 112 ? -10.426 15.234  32.425 1.00 0.00 ? 112 GLY A C    1  
ATOM 1730  O O    . GLY A 1 112 ? -9.932  15.484  31.326 1.00 0.00 ? 112 GLY A O    1  
ATOM 1731  H H    . GLY A 1 112 ? -9.681  12.483  33.612 1.00 0.00 ? 112 GLY A H    1  
ATOM 1732  H HA2  . GLY A 1 112 ? -10.162 14.525  34.445 1.00 0.00 ? 112 GLY A HA2  1  
ATOM 1733  H HA3  . GLY A 1 112 ? -8.698  15.156  33.715 1.00 0.00 ? 112 GLY A HA3  1  
ATOM 1734  N N    . PRO A 1 113 ? -11.710 15.516  32.774 1.00 0.00 ? 113 PRO A N    1  
ATOM 1735  C CA   . PRO A 1 113 ? -12.617 16.154  31.836 1.00 0.00 ? 113 PRO A CA   1  
ATOM 1736  C C    . PRO A 1 113 ? -12.295 17.642  31.688 1.00 0.00 ? 113 PRO A C    1  
ATOM 1737  O O    . PRO A 1 113 ? -12.112 18.343  32.682 1.00 0.00 ? 113 PRO A O    1  
ATOM 1738  C CB   . PRO A 1 113 ? -14.007 15.900  32.399 1.00 0.00 ? 113 PRO A CB   1  
ATOM 1739  C CG   . PRO A 1 113 ? -13.804 15.536  33.861 1.00 0.00 ? 113 PRO A CG   1  
ATOM 1740  C CD   . PRO A 1 113 ? -12.329 15.234  34.066 1.00 0.00 ? 113 PRO A CD   1  
ATOM 1741  H HA   . PRO A 1 113 ? -12.509 15.759  30.924 1.00 0.00 ? 113 PRO A HA   1  
ATOM 1742  H HB2  . PRO A 1 113 ? -14.636 16.785  32.300 1.00 0.00 ? 113 PRO A HB2  1  
ATOM 1743  H HB3  . PRO A 1 113 ? -14.504 15.093  31.861 1.00 0.00 ? 113 PRO A HB3  1  
ATOM 1744  H HG2  . PRO A 1 113 ? -14.119 16.357  34.505 1.00 0.00 ? 113 PRO A HG2  1  
ATOM 1745  H HG3  . PRO A 1 113 ? -14.412 14.671  34.126 1.00 0.00 ? 113 PRO A HG3  1  
ATOM 1746  H HD2  . PRO A 1 113 ? -11.903 15.857  34.853 1.00 0.00 ? 113 PRO A HD2  1  
ATOM 1747  H HD3  . PRO A 1 113 ? -12.174 14.197  34.361 1.00 0.00 ? 113 PRO A HD3  1  
ATOM 1748  N N    . SER A 1 114 ? -12.236 18.081  30.439 1.00 0.00 ? 114 SER A N    1  
ATOM 1749  C CA   . SER A 1 114 ? -11.939 19.473  30.148 1.00 0.00 ? 114 SER A CA   1  
ATOM 1750  C C    . SER A 1 114 ? -13.100 20.105  29.377 1.00 0.00 ? 114 SER A C    1  
ATOM 1751  O O    . SER A 1 114 ? -13.317 19.790  28.208 1.00 0.00 ? 114 SER A O    1  
ATOM 1752  C CB   . SER A 1 114 ? -10.639 19.604  29.353 1.00 0.00 ? 114 SER A CB   1  
ATOM 1753  O OG   . SER A 1 114 ? -9.620  20.262  30.101 1.00 0.00 ? 114 SER A OG   1  
ATOM 1754  H H    . SER A 1 114 ? -12.387 17.504  29.636 1.00 0.00 ? 114 SER A H    1  
ATOM 1755  H HA   . SER A 1 114 ? -11.820 19.952  31.120 1.00 0.00 ? 114 SER A HA   1  
ATOM 1756  H HB2  . SER A 1 114 ? -10.292 18.614  29.060 1.00 0.00 ? 114 SER A HB2  1  
ATOM 1757  H HB3  . SER A 1 114 ? -10.830 20.159  28.434 1.00 0.00 ? 114 SER A HB3  1  
ATOM 1758  H HG   . SER A 1 114 ? -9.980  21.103  30.504 1.00 0.00 ? 114 SER A HG   1  
ATOM 1759  N N    . SER A 1 115 ? -13.814 20.986  30.062 1.00 0.00 ? 115 SER A N    1  
ATOM 1760  C CA   . SER A 1 115 ? -14.946 21.665  29.456 1.00 0.00 ? 115 SER A CA   1  
ATOM 1761  C C    . SER A 1 115 ? -15.593 22.611  30.469 1.00 0.00 ? 115 SER A C    1  
ATOM 1762  O O    . SER A 1 115 ? -15.665 22.299  31.657 1.00 0.00 ? 115 SER A O    1  
ATOM 1763  C CB   . SER A 1 115 ? -15.976 20.661  28.934 1.00 0.00 ? 115 SER A CB   1  
ATOM 1764  O OG   . SER A 1 115 ? -16.480 21.030  27.653 1.00 0.00 ? 115 SER A OG   1  
ATOM 1765  H H    . SER A 1 115 ? -13.630 21.237  31.012 1.00 0.00 ? 115 SER A H    1  
ATOM 1766  H HA   . SER A 1 115 ? -14.531 22.227  28.619 1.00 0.00 ? 115 SER A HA   1  
ATOM 1767  H HB2  . SER A 1 115 ? -15.520 19.673  28.873 1.00 0.00 ? 115 SER A HB2  1  
ATOM 1768  H HB3  . SER A 1 115 ? -16.802 20.588  29.641 1.00 0.00 ? 115 SER A HB3  1  
ATOM 1769  H HG   . SER A 1 115 ? -16.427 20.252  27.028 1.00 0.00 ? 115 SER A HG   1  
ATOM 1770  N N    . GLY A 1 116 ? -16.048 23.748  29.964 1.00 0.00 ? 116 GLY A N    1  
ATOM 1771  C CA   . GLY A 1 116 ? -16.687 24.741  30.810 1.00 0.00 ? 116 GLY A CA   1  
ATOM 1772  C C    . GLY A 1 116 ? -15.964 24.864  32.153 1.00 0.00 ? 116 GLY A C    1  
ATOM 1773  O O    . GLY A 1 116 ? -16.571 25.230  33.158 1.00 0.00 ? 116 GLY A O    1  
ATOM 1774  H H    . GLY A 1 116 ? -15.986 23.994  28.996 1.00 0.00 ? 116 GLY A H    1  
ATOM 1775  H HA2  . GLY A 1 116 ? -16.690 25.707  30.305 1.00 0.00 ? 116 GLY A HA2  1  
ATOM 1776  H HA3  . GLY A 1 116 ? -17.728 24.466  30.978 1.00 0.00 ? 116 GLY A HA3  1  
ATOM 1777  N N    . GLY A 1 1   ? -9.075  -30.016 17.895 1.00 0.00 ? 1   GLY A N    2  
ATOM 1778  C CA   . GLY A 1 1   ? -9.797  -28.929 18.536 1.00 0.00 ? 1   GLY A CA   2  
ATOM 1779  C C    . GLY A 1 1   ? -8.969  -27.643 18.532 1.00 0.00 ? 1   GLY A C    2  
ATOM 1780  O O    . GLY A 1 1   ? -7.751  -27.685 18.363 1.00 0.00 ? 1   GLY A O    2  
ATOM 1781  H H1   . GLY A 1 1   ? -8.125  -29.811 17.661 1.00 0.00 ? 1   GLY A H1   2  
ATOM 1782  H HA2  . GLY A 1 1   ? -10.741 -28.760 18.017 1.00 0.00 ? 1   GLY A HA2  2  
ATOM 1783  H HA3  . GLY A 1 1   ? -10.042 -29.206 19.561 1.00 0.00 ? 1   GLY A HA3  2  
ATOM 1784  N N    . SER A 1 2   ? -9.663  -26.530 18.720 1.00 0.00 ? 2   SER A N    2  
ATOM 1785  C CA   . SER A 1 2   ? -9.007  -25.234 18.741 1.00 0.00 ? 2   SER A CA   2  
ATOM 1786  C C    . SER A 1 2   ? -9.900  -24.206 19.440 1.00 0.00 ? 2   SER A C    2  
ATOM 1787  O O    . SER A 1 2   ? -11.061 -24.485 19.733 1.00 0.00 ? 2   SER A O    2  
ATOM 1788  C CB   . SER A 1 2   ? -8.668  -24.765 17.324 1.00 0.00 ? 2   SER A CB   2  
ATOM 1789  O OG   . SER A 1 2   ? -8.042  -25.791 16.558 1.00 0.00 ? 2   SER A OG   2  
ATOM 1790  H H    . SER A 1 2   ? -10.653 -26.505 18.857 1.00 0.00 ? 2   SER A H    2  
ATOM 1791  H HA   . SER A 1 2   ? -8.085  -25.385 19.303 1.00 0.00 ? 2   SER A HA   2  
ATOM 1792  H HB2  . SER A 1 2   ? -9.580  -24.443 16.821 1.00 0.00 ? 2   SER A HB2  2  
ATOM 1793  H HB3  . SER A 1 2   ? -8.009  -23.899 17.377 1.00 0.00 ? 2   SER A HB3  2  
ATOM 1794  H HG   . SER A 1 2   ? -7.081  -25.562 16.401 1.00 0.00 ? 2   SER A HG   2  
ATOM 1795  N N    . SER A 1 3   ? -9.323  -23.039 19.687 1.00 0.00 ? 3   SER A N    2  
ATOM 1796  C CA   . SER A 1 3   ? -10.052 -21.969 20.346 1.00 0.00 ? 3   SER A CA   2  
ATOM 1797  C C    . SER A 1 3   ? -9.290  -20.650 20.200 1.00 0.00 ? 3   SER A C    2  
ATOM 1798  O O    . SER A 1 3   ? -8.146  -20.637 19.748 1.00 0.00 ? 3   SER A O    2  
ATOM 1799  C CB   . SER A 1 3   ? -10.282 -22.289 21.825 1.00 0.00 ? 3   SER A CB   2  
ATOM 1800  O OG   . SER A 1 3   ? -9.076  -22.665 22.483 1.00 0.00 ? 3   SER A OG   2  
ATOM 1801  H H    . SER A 1 3   ? -8.378  -22.821 19.445 1.00 0.00 ? 3   SER A H    2  
ATOM 1802  H HA   . SER A 1 3   ? -11.012 -21.915 19.833 1.00 0.00 ? 3   SER A HA   2  
ATOM 1803  H HB2  . SER A 1 3   ? -10.710 -21.418 22.321 1.00 0.00 ? 3   SER A HB2  2  
ATOM 1804  H HB3  . SER A 1 3   ? -11.010 -23.095 21.912 1.00 0.00 ? 3   SER A HB3  2  
ATOM 1805  H HG   . SER A 1 3   ? -8.706  -23.497 22.070 1.00 0.00 ? 3   SER A HG   2  
ATOM 1806  N N    . GLY A 1 4   ? -9.955  -19.573 20.592 1.00 0.00 ? 4   GLY A N    2  
ATOM 1807  C CA   . GLY A 1 4   ? -9.355  -18.253 20.511 1.00 0.00 ? 4   GLY A CA   2  
ATOM 1808  C C    . GLY A 1 4   ? -10.422 -17.159 20.596 1.00 0.00 ? 4   GLY A C    2  
ATOM 1809  O O    . GLY A 1 4   ? -11.530 -17.327 20.088 1.00 0.00 ? 4   GLY A O    2  
ATOM 1810  H H    . GLY A 1 4   ? -10.885 -19.593 20.959 1.00 0.00 ? 4   GLY A H    2  
ATOM 1811  H HA2  . GLY A 1 4   ? -8.634  -18.126 21.318 1.00 0.00 ? 4   GLY A HA2  2  
ATOM 1812  H HA3  . GLY A 1 4   ? -8.805  -18.156 19.575 1.00 0.00 ? 4   GLY A HA3  2  
ATOM 1813  N N    . SER A 1 5   ? -10.051 -16.064 21.243 1.00 0.00 ? 5   SER A N    2  
ATOM 1814  C CA   . SER A 1 5   ? -10.962 -14.944 21.402 1.00 0.00 ? 5   SER A CA   2  
ATOM 1815  C C    . SER A 1 5   ? -10.218 -13.743 21.990 1.00 0.00 ? 5   SER A C    2  
ATOM 1816  O O    . SER A 1 5   ? -9.197  -13.907 22.656 1.00 0.00 ? 5   SER A O    2  
ATOM 1817  C CB   . SER A 1 5   ? -12.149 -15.321 22.291 1.00 0.00 ? 5   SER A CB   2  
ATOM 1818  O OG   . SER A 1 5   ? -12.882 -14.175 22.717 1.00 0.00 ? 5   SER A OG   2  
ATOM 1819  H H    . SER A 1 5   ? -9.148  -15.936 21.653 1.00 0.00 ? 5   SER A H    2  
ATOM 1820  H HA   . SER A 1 5   ? -11.320 -14.718 20.397 1.00 0.00 ? 5   SER A HA   2  
ATOM 1821  H HB2  . SER A 1 5   ? -12.811 -15.993 21.746 1.00 0.00 ? 5   SER A HB2  2  
ATOM 1822  H HB3  . SER A 1 5   ? -11.789 -15.866 23.164 1.00 0.00 ? 5   SER A HB3  2  
ATOM 1823  H HG   . SER A 1 5   ? -12.859 -14.105 23.714 1.00 0.00 ? 5   SER A HG   2  
ATOM 1824  N N    . SER A 1 6   ? -10.759 -12.564 21.723 1.00 0.00 ? 6   SER A N    2  
ATOM 1825  C CA   . SER A 1 6   ? -10.159 -11.336 22.218 1.00 0.00 ? 6   SER A CA   2  
ATOM 1826  C C    . SER A 1 6   ? -10.957 -10.128 21.724 1.00 0.00 ? 6   SER A C    2  
ATOM 1827  O O    . SER A 1 6   ? -11.666 -10.215 20.722 1.00 0.00 ? 6   SER A O    2  
ATOM 1828  C CB   . SER A 1 6   ? -8.698  -11.222 21.781 1.00 0.00 ? 6   SER A CB   2  
ATOM 1829  O OG   . SER A 1 6   ? -7.808  -11.192 22.893 1.00 0.00 ? 6   SER A OG   2  
ATOM 1830  H H    . SER A 1 6   ? -11.590 -12.439 21.181 1.00 0.00 ? 6   SER A H    2  
ATOM 1831  H HA   . SER A 1 6   ? -10.208 -11.408 23.304 1.00 0.00 ? 6   SER A HA   2  
ATOM 1832  H HB2  . SER A 1 6   ? -8.445  -12.065 21.137 1.00 0.00 ? 6   SER A HB2  2  
ATOM 1833  H HB3  . SER A 1 6   ? -8.566  -10.318 21.187 1.00 0.00 ? 6   SER A HB3  2  
ATOM 1834  H HG   . SER A 1 6   ? -7.724  -12.107 23.289 1.00 0.00 ? 6   SER A HG   2  
ATOM 1835  N N    . GLY A 1 7   ? -10.814 -9.028  22.449 1.00 0.00 ? 7   GLY A N    2  
ATOM 1836  C CA   . GLY A 1 7   ? -11.513 -7.803  22.097 1.00 0.00 ? 7   GLY A CA   2  
ATOM 1837  C C    . GLY A 1 7   ? -12.298 -7.257  23.291 1.00 0.00 ? 7   GLY A C    2  
ATOM 1838  O O    . GLY A 1 7   ? -13.175 -7.935  23.824 1.00 0.00 ? 7   GLY A O    2  
ATOM 1839  H H    . GLY A 1 7   ? -10.235 -8.965  23.262 1.00 0.00 ? 7   GLY A H    2  
ATOM 1840  H HA2  . GLY A 1 7   ? -10.795 -7.056  21.756 1.00 0.00 ? 7   GLY A HA2  2  
ATOM 1841  H HA3  . GLY A 1 7   ? -12.192 -7.994  21.266 1.00 0.00 ? 7   GLY A HA3  2  
ATOM 1842  N N    . MET A 1 8   ? -11.955 -6.037  23.676 1.00 0.00 ? 8   MET A N    2  
ATOM 1843  C CA   . MET A 1 8   ? -12.617 -5.392  24.797 1.00 0.00 ? 8   MET A CA   2  
ATOM 1844  C C    . MET A 1 8   ? -12.138 -3.948  24.960 1.00 0.00 ? 8   MET A C    2  
ATOM 1845  O O    . MET A 1 8   ? -11.176 -3.687  25.680 1.00 0.00 ? 8   MET A O    2  
ATOM 1846  C CB   . MET A 1 8   ? -12.328 -6.174  26.079 1.00 0.00 ? 8   MET A CB   2  
ATOM 1847  C CG   . MET A 1 8   ? -13.618 -6.459  26.850 1.00 0.00 ? 8   MET A CG   2  
ATOM 1848  S SD   . MET A 1 8   ? -13.353 -7.787  28.014 1.00 0.00 ? 8   MET A SD   2  
ATOM 1849  C CE   . MET A 1 8   ? -13.061 -6.842  29.500 1.00 0.00 ? 8   MET A CE   2  
ATOM 1850  H H    . MET A 1 8   ? -11.241 -5.492  23.236 1.00 0.00 ? 8   MET A H    2  
ATOM 1851  H HA   . MET A 1 8   ? -13.680 -5.404  24.555 1.00 0.00 ? 8   MET A HA   2  
ATOM 1852  H HB2  . MET A 1 8   ? -11.832 -7.113  25.833 1.00 0.00 ? 8   MET A HB2  2  
ATOM 1853  H HB3  . MET A 1 8   ? -11.642 -5.607  26.709 1.00 0.00 ? 8   MET A HB3  2  
ATOM 1854  H HG2  . MET A 1 8   ? -13.943 -5.562  27.377 1.00 0.00 ? 8   MET A HG2  2  
ATOM 1855  H HG3  . MET A 1 8   ? -14.415 -6.727  26.156 1.00 0.00 ? 8   MET A HG3  2  
ATOM 1856  H HE1  . MET A 1 8   ? -12.661 -5.863  29.236 1.00 0.00 ? 8   MET A HE1  2  
ATOM 1857  H HE2  . MET A 1 8   ? -13.998 -6.717  30.042 1.00 0.00 ? 8   MET A HE2  2  
ATOM 1858  H HE3  . MET A 1 8   ? -12.344 -7.369  30.130 1.00 0.00 ? 8   MET A HE3  2  
ATOM 1859  N N    . GLU A 1 9   ? -12.832 -3.048  24.279 1.00 0.00 ? 9   GLU A N    2  
ATOM 1860  C CA   . GLU A 1 9   ? -12.489 -1.637  24.340 1.00 0.00 ? 9   GLU A CA   2  
ATOM 1861  C C    . GLU A 1 9   ? -13.759 -0.783  24.376 1.00 0.00 ? 9   GLU A C    2  
ATOM 1862  O O    . GLU A 1 9   ? -14.860 -1.293  24.174 1.00 0.00 ? 9   GLU A O    2  
ATOM 1863  C CB   . GLU A 1 9   ? -11.594 -1.239  23.164 1.00 0.00 ? 9   GLU A CB   2  
ATOM 1864  C CG   . GLU A 1 9   ? -10.134 -1.605  23.438 1.00 0.00 ? 9   GLU A CG   2  
ATOM 1865  C CD   . GLU A 1 9   ? -9.282  -0.349  23.632 1.00 0.00 ? 9   GLU A CD   2  
ATOM 1866  O OE1  . GLU A 1 9   ? -8.905  0.245   22.599 1.00 0.00 ? 9   GLU A OE1  2  
ATOM 1867  O OE2  . GLU A 1 9   ? -9.026  -0.013  24.808 1.00 0.00 ? 9   GLU A OE2  2  
ATOM 1868  H H    . GLU A 1 9   ? -13.614 -3.268  23.696 1.00 0.00 ? 9   GLU A H    2  
ATOM 1869  H HA   . GLU A 1 9   ? -11.934 -1.513  25.269 1.00 0.00 ? 9   GLU A HA   2  
ATOM 1870  H HB2  . GLU A 1 9   ? -11.935 -1.740  22.258 1.00 0.00 ? 9   GLU A HB2  2  
ATOM 1871  H HB3  . GLU A 1 9   ? -11.677 -0.167  22.986 1.00 0.00 ? 9   GLU A HB3  2  
ATOM 1872  H HG2  . GLU A 1 9   ? -10.074 -2.231  24.329 1.00 0.00 ? 9   GLU A HG2  2  
ATOM 1873  H HG3  . GLU A 1 9   ? -9.741  -2.192  22.609 1.00 0.00 ? 9   GLU A HG3  2  
ATOM 1874  N N    . LYS A 1 10  ? -13.563 0.501   24.635 1.00 0.00 ? 10  LYS A N    2  
ATOM 1875  C CA   . LYS A 1 10  ? -14.678 1.430   24.700 1.00 0.00 ? 10  LYS A CA   2  
ATOM 1876  C C    . LYS A 1 10  ? -14.468 2.546   23.674 1.00 0.00 ? 10  LYS A C    2  
ATOM 1877  O O    . LYS A 1 10  ? -13.453 2.571   22.979 1.00 0.00 ? 10  LYS A O    2  
ATOM 1878  C CB   . LYS A 1 10  ? -14.869 1.938   26.131 1.00 0.00 ? 10  LYS A CB   2  
ATOM 1879  C CG   . LYS A 1 10  ? -13.676 2.787   26.575 1.00 0.00 ? 10  LYS A CG   2  
ATOM 1880  C CD   . LYS A 1 10  ? -12.601 1.919   27.232 1.00 0.00 ? 10  LYS A CD   2  
ATOM 1881  C CE   . LYS A 1 10  ? -11.852 2.699   28.315 1.00 0.00 ? 10  LYS A CE   2  
ATOM 1882  N NZ   . LYS A 1 10  ? -10.551 2.059   28.609 1.00 0.00 ? 10  LYS A NZ   2  
ATOM 1883  H H    . LYS A 1 10  ? -12.664 0.908   24.798 1.00 0.00 ? 10  LYS A H    2  
ATOM 1884  H HA   . LYS A 1 10  ? -15.579 0.879   24.431 1.00 0.00 ? 10  LYS A HA   2  
ATOM 1885  H HB2  . LYS A 1 10  ? -15.783 2.529   26.192 1.00 0.00 ? 10  LYS A HB2  2  
ATOM 1886  H HB3  . LYS A 1 10  ? -14.991 1.093   26.807 1.00 0.00 ? 10  LYS A HB3  2  
ATOM 1887  H HG2  . LYS A 1 10  ? -13.254 3.306   25.715 1.00 0.00 ? 10  LYS A HG2  2  
ATOM 1888  H HG3  . LYS A 1 10  ? -14.010 3.551   27.276 1.00 0.00 ? 10  LYS A HG3  2  
ATOM 1889  H HD2  . LYS A 1 10  ? -13.061 1.033   27.671 1.00 0.00 ? 10  LYS A HD2  2  
ATOM 1890  H HD3  . LYS A 1 10  ? -11.897 1.571   26.477 1.00 0.00 ? 10  LYS A HD3  2  
ATOM 1891  H HE2  . LYS A 1 10  ? -11.692 3.726   27.986 1.00 0.00 ? 10  LYS A HE2  2  
ATOM 1892  H HE3  . LYS A 1 10  ? -12.455 2.745   29.221 1.00 0.00 ? 10  LYS A HE3  2  
ATOM 1893  H HZ1  . LYS A 1 10  ? -10.532 1.767   29.566 1.00 0.00 ? 10  LYS A HZ1  2  
ATOM 1894  H HZ2  . LYS A 1 10  ? -10.429 1.263   28.016 1.00 0.00 ? 10  LYS A HZ2  2  
ATOM 1895  H HZ3  . LYS A 1 10  ? -9.813  2.713   28.445 1.00 0.00 ? 10  LYS A HZ3  2  
ATOM 1896  N N    . THR A 1 11  ? -15.443 3.441   23.613 1.00 0.00 ? 11  THR A N    2  
ATOM 1897  C CA   . THR A 1 11  ? -15.377 4.556   22.683 1.00 0.00 ? 11  THR A CA   2  
ATOM 1898  C C    . THR A 1 11  ? -16.071 5.784   23.275 1.00 0.00 ? 11  THR A C    2  
ATOM 1899  O O    . THR A 1 11  ? -16.985 5.654   24.088 1.00 0.00 ? 11  THR A O    2  
ATOM 1900  C CB   . THR A 1 11  ? -15.979 4.099   21.353 1.00 0.00 ? 11  THR A CB   2  
ATOM 1901  O OG1  . THR A 1 11  ? -15.755 5.199   20.475 1.00 0.00 ? 11  THR A OG1  2  
ATOM 1902  C CG2  . THR A 1 11  ? -17.502 3.973   21.412 1.00 0.00 ? 11  THR A CG2  2  
ATOM 1903  H H    . THR A 1 11  ? -16.264 3.413   24.182 1.00 0.00 ? 11  THR A H    2  
ATOM 1904  H HA   . THR A 1 11  ? -14.330 4.820   22.537 1.00 0.00 ? 11  THR A HA   2  
ATOM 1905  H HB   . THR A 1 11  ? -15.524 3.166   21.020 1.00 0.00 ? 11  THR A HB   2  
ATOM 1906  H HG1  . THR A 1 11  ? -15.138 4.927   19.736 1.00 0.00 ? 11  THR A HG1  2  
ATOM 1907  H HG21 . THR A 1 11  ? -17.957 4.816   20.892 1.00 0.00 ? 11  THR A HG21 2  
ATOM 1908  H HG22 . THR A 1 11  ? -17.809 3.042   20.935 1.00 0.00 ? 11  THR A HG22 2  
ATOM 1909  H HG23 . THR A 1 11  ? -17.827 3.971   22.453 1.00 0.00 ? 11  THR A HG23 2  
ATOM 1910  N N    . LEU A 1 12  ? -15.611 6.949   22.843 1.00 0.00 ? 12  LEU A N    2  
ATOM 1911  C CA   . LEU A 1 12  ? -16.177 8.200   23.319 1.00 0.00 ? 12  LEU A CA   2  
ATOM 1912  C C    . LEU A 1 12  ? -16.979 8.854   22.193 1.00 0.00 ? 12  LEU A C    2  
ATOM 1913  O O    . LEU A 1 12  ? -17.008 8.348   21.072 1.00 0.00 ? 12  LEU A O    2  
ATOM 1914  C CB   . LEU A 1 12  ? -15.081 9.099   23.895 1.00 0.00 ? 12  LEU A CB   2  
ATOM 1915  C CG   . LEU A 1 12  ? -13.924 9.434   22.952 1.00 0.00 ? 12  LEU A CG   2  
ATOM 1916  C CD1  . LEU A 1 12  ? -13.555 10.916  23.042 1.00 0.00 ? 12  LEU A CD1  2  
ATOM 1917  C CD2  . LEU A 1 12  ? -12.720 8.527   23.218 1.00 0.00 ? 12  LEU A CD2  2  
ATOM 1918  H H    . LEU A 1 12  ? -14.868 7.047   22.182 1.00 0.00 ? 12  LEU A H    2  
ATOM 1919  H HA   . LEU A 1 12  ? -16.859 7.960   24.135 1.00 0.00 ? 12  LEU A HA   2  
ATOM 1920  H HB2  . LEU A 1 12  ? -15.539 10.033  24.222 1.00 0.00 ? 12  LEU A HB2  2  
ATOM 1921  H HB3  . LEU A 1 12  ? -14.672 8.616   24.783 1.00 0.00 ? 12  LEU A HB3  2  
ATOM 1922  H HG   . LEU A 1 12  ? -14.250 9.244   21.930 1.00 0.00 ? 12  LEU A HG   2  
ATOM 1923  H HD11 . LEU A 1 12  ? -13.737 11.275  24.055 1.00 0.00 ? 12  LEU A HD11 2  
ATOM 1924  H HD12 . LEU A 1 12  ? -12.501 11.044  22.794 1.00 0.00 ? 12  LEU A HD12 2  
ATOM 1925  H HD13 . LEU A 1 12  ? -14.165 11.485  22.340 1.00 0.00 ? 12  LEU A HD13 2  
ATOM 1926  H HD21 . LEU A 1 12  ? -12.241 8.274   22.272 1.00 0.00 ? 12  LEU A HD21 2  
ATOM 1927  H HD22 . LEU A 1 12  ? -12.008 9.046   23.859 1.00 0.00 ? 12  LEU A HD22 2  
ATOM 1928  H HD23 . LEU A 1 12  ? -13.055 7.614   23.711 1.00 0.00 ? 12  LEU A HD23 2  
ATOM 1929  N N    . GLU A 1 13  ? -17.611 9.969   22.529 1.00 0.00 ? 13  GLU A N    2  
ATOM 1930  C CA   . GLU A 1 13  ? -18.412 10.697  21.559 1.00 0.00 ? 13  GLU A CA   2  
ATOM 1931  C C    . GLU A 1 13  ? -17.726 12.014  21.187 1.00 0.00 ? 13  GLU A C    2  
ATOM 1932  O O    . GLU A 1 13  ? -17.076 12.637  22.024 1.00 0.00 ? 13  GLU A O    2  
ATOM 1933  C CB   . GLU A 1 13  ? -19.825 10.946  22.091 1.00 0.00 ? 13  GLU A CB   2  
ATOM 1934  C CG   . GLU A 1 13  ? -20.879 10.510  21.071 1.00 0.00 ? 13  GLU A CG   2  
ATOM 1935  C CD   . GLU A 1 13  ? -22.129 9.972   21.770 1.00 0.00 ? 13  GLU A CD   2  
ATOM 1936  O OE1  . GLU A 1 13  ? -22.078 8.800   22.201 1.00 0.00 ? 13  GLU A OE1  2  
ATOM 1937  O OE2  . GLU A 1 13  ? -23.107 10.746  21.857 1.00 0.00 ? 13  GLU A OE2  2  
ATOM 1938  H H    . GLU A 1 13  ? -17.582 10.374  23.443 1.00 0.00 ? 13  GLU A H    2  
ATOM 1939  H HA   . GLU A 1 13  ? -18.468 10.049  20.685 1.00 0.00 ? 13  GLU A HA   2  
ATOM 1940  H HB2  . GLU A 1 13  ? -19.968 10.399  23.023 1.00 0.00 ? 13  GLU A HB2  2  
ATOM 1941  H HB3  . GLU A 1 13  ? -19.950 12.004  22.319 1.00 0.00 ? 13  GLU A HB3  2  
ATOM 1942  H HG2  . GLU A 1 13  ? -21.147 11.354  20.436 1.00 0.00 ? 13  GLU A HG2  2  
ATOM 1943  H HG3  . GLU A 1 13  ? -20.463 9.741   20.419 1.00 0.00 ? 13  GLU A HG3  2  
ATOM 1944  N N    . THR A 1 14  ? -17.897 12.398  19.930 1.00 0.00 ? 14  THR A N    2  
ATOM 1945  C CA   . THR A 1 14  ? -17.303 13.629  19.437 1.00 0.00 ? 14  THR A CA   2  
ATOM 1946  C C    . THR A 1 14  ? -17.779 13.917  18.012 1.00 0.00 ? 14  THR A C    2  
ATOM 1947  O O    . THR A 1 14  ? -18.217 13.010  17.305 1.00 0.00 ? 14  THR A O    2  
ATOM 1948  C CB   . THR A 1 14  ? -15.783 13.501  19.556 1.00 0.00 ? 14  THR A CB   2  
ATOM 1949  O OG1  . THR A 1 14  ? -15.298 14.796  19.213 1.00 0.00 ? 14  THR A OG1  2  
ATOM 1950  C CG2  . THR A 1 14  ? -15.187 12.585  18.485 1.00 0.00 ? 14  THR A CG2  2  
ATOM 1951  H H    . THR A 1 14  ? -18.428 11.885  19.256 1.00 0.00 ? 14  THR A H    2  
ATOM 1952  H HA   . THR A 1 14  ? -17.649 14.452  20.062 1.00 0.00 ? 14  THR A HA   2  
ATOM 1953  H HB   . THR A 1 14  ? -15.497 13.171  20.554 1.00 0.00 ? 14  THR A HB   2  
ATOM 1954  H HG1  . THR A 1 14  ? -15.453 14.974  18.241 1.00 0.00 ? 14  THR A HG1  2  
ATOM 1955  H HG21 . THR A 1 14  ? -14.950 11.616  18.926 1.00 0.00 ? 14  THR A HG21 2  
ATOM 1956  H HG22 . THR A 1 14  ? -15.908 12.450  17.679 1.00 0.00 ? 14  THR A HG22 2  
ATOM 1957  H HG23 . THR A 1 14  ? -14.277 13.035  18.087 1.00 0.00 ? 14  THR A HG23 2  
ATOM 1958  N N    . VAL A 1 15  ? -17.677 15.182  17.633 1.00 0.00 ? 15  VAL A N    2  
ATOM 1959  C CA   . VAL A 1 15  ? -18.092 15.601  16.304 1.00 0.00 ? 15  VAL A CA   2  
ATOM 1960  C C    . VAL A 1 15  ? -16.959 15.331  15.312 1.00 0.00 ? 15  VAL A C    2  
ATOM 1961  O O    . VAL A 1 15  ? -15.784 15.397  15.672 1.00 0.00 ? 15  VAL A O    2  
ATOM 1962  C CB   . VAL A 1 15  ? -18.527 17.067  16.330 1.00 0.00 ? 15  VAL A CB   2  
ATOM 1963  C CG1  . VAL A 1 15  ? -19.348 17.373  17.585 1.00 0.00 ? 15  VAL A CG1  2  
ATOM 1964  C CG2  . VAL A 1 15  ? -17.319 18.000  16.225 1.00 0.00 ? 15  VAL A CG2  2  
ATOM 1965  H H    . VAL A 1 15  ? -17.319 15.913  18.214 1.00 0.00 ? 15  VAL A H    2  
ATOM 1966  H HA   . VAL A 1 15  ? -18.955 14.997  16.024 1.00 0.00 ? 15  VAL A HA   2  
ATOM 1967  H HB   . VAL A 1 15  ? -19.162 17.244  15.463 1.00 0.00 ? 15  VAL A HB   2  
ATOM 1968  H HG11 . VAL A 1 15  ? -19.758 18.381  17.514 1.00 0.00 ? 15  VAL A HG11 2  
ATOM 1969  H HG12 . VAL A 1 15  ? -20.164 16.655  17.669 1.00 0.00 ? 15  VAL A HG12 2  
ATOM 1970  H HG13 . VAL A 1 15  ? -18.709 17.302  18.464 1.00 0.00 ? 15  VAL A HG13 2  
ATOM 1971  H HG21 . VAL A 1 15  ? -16.938 17.988  15.204 1.00 0.00 ? 15  VAL A HG21 2  
ATOM 1972  H HG22 . VAL A 1 15  ? -17.618 19.014  16.489 1.00 0.00 ? 15  VAL A HG22 2  
ATOM 1973  H HG23 . VAL A 1 15  ? -16.538 17.662  16.908 1.00 0.00 ? 15  VAL A HG23 2  
ATOM 1974  N N    . PRO A 1 16  ? -17.361 15.024  14.050 1.00 0.00 ? 16  PRO A N    2  
ATOM 1975  C CA   . PRO A 1 16  ? -16.393 14.744  13.003 1.00 0.00 ? 16  PRO A CA   2  
ATOM 1976  C C    . PRO A 1 16  ? -15.726 16.031  12.515 1.00 0.00 ? 16  PRO A C    2  
ATOM 1977  O O    . PRO A 1 16  ? -15.962 16.469  11.390 1.00 0.00 ? 16  PRO A O    2  
ATOM 1978  C CB   . PRO A 1 16  ? -17.184 14.035  11.916 1.00 0.00 ? 16  PRO A CB   2  
ATOM 1979  C CG   . PRO A 1 16  ? -18.645 14.357  12.186 1.00 0.00 ? 16  PRO A CG   2  
ATOM 1980  C CD   . PRO A 1 16  ? -18.743 14.936  13.587 1.00 0.00 ? 16  PRO A CD   2  
ATOM 1981  H HA   . PRO A 1 16  ? -15.654 14.171  13.358 1.00 0.00 ? 16  PRO A HA   2  
ATOM 1982  H HB2  . PRO A 1 16  ? -16.884 14.381  10.926 1.00 0.00 ? 16  PRO A HB2  2  
ATOM 1983  H HB3  . PRO A 1 16  ? -17.009 12.960  11.943 1.00 0.00 ? 16  PRO A HB3  2  
ATOM 1984  H HG2  . PRO A 1 16  ? -19.021 15.069  11.451 1.00 0.00 ? 16  PRO A HG2  2  
ATOM 1985  H HG3  . PRO A 1 16  ? -19.255 13.458  12.100 1.00 0.00 ? 16  PRO A HG3  2  
ATOM 1986  H HD2  . PRO A 1 16  ? -19.221 15.916  13.578 1.00 0.00 ? 16  PRO A HD2  2  
ATOM 1987  H HD3  . PRO A 1 16  ? -19.339 14.297  14.239 1.00 0.00 ? 16  PRO A HD3  2  
ATOM 1988  N N    . LEU A 1 17  ? -14.905 16.601  13.385 1.00 0.00 ? 17  LEU A N    2  
ATOM 1989  C CA   . LEU A 1 17  ? -14.202 17.830  13.056 1.00 0.00 ? 17  LEU A CA   2  
ATOM 1990  C C    . LEU A 1 17  ? -13.239 18.181  14.192 1.00 0.00 ? 17  LEU A C    2  
ATOM 1991  O O    . LEU A 1 17  ? -13.669 18.574  15.276 1.00 0.00 ? 17  LEU A O    2  
ATOM 1992  C CB   . LEU A 1 17  ? -15.196 18.945  12.727 1.00 0.00 ? 17  LEU A CB   2  
ATOM 1993  C CG   . LEU A 1 17  ? -14.807 19.870  11.572 1.00 0.00 ? 17  LEU A CG   2  
ATOM 1994  C CD1  . LEU A 1 17  ? -13.401 20.437  11.774 1.00 0.00 ? 17  LEU A CD1  2  
ATOM 1995  C CD2  . LEU A 1 17  ? -14.951 19.157  10.226 1.00 0.00 ? 17  LEU A CD2  2  
ATOM 1996  H H    . LEU A 1 17  ? -14.719 16.239  14.298 1.00 0.00 ? 17  LEU A H    2  
ATOM 1997  H HA   . LEU A 1 17  ? -13.619 17.641  12.155 1.00 0.00 ? 17  LEU A HA   2  
ATOM 1998  H HB2  . LEU A 1 17  ? -16.158 18.489  12.493 1.00 0.00 ? 17  LEU A HB2  2  
ATOM 1999  H HB3  . LEU A 1 17  ? -15.340 19.552  13.620 1.00 0.00 ? 17  LEU A HB3  2  
ATOM 2000  H HG   . LEU A 1 17  ? -15.497 20.715  11.564 1.00 0.00 ? 17  LEU A HG   2  
ATOM 2001  H HD11 . LEU A 1 17  ? -12.683 19.832  11.220 1.00 0.00 ? 17  LEU A HD11 2  
ATOM 2002  H HD12 . LEU A 1 17  ? -13.367 21.464  11.410 1.00 0.00 ? 17  LEU A HD12 2  
ATOM 2003  H HD13 . LEU A 1 17  ? -13.150 20.419  12.834 1.00 0.00 ? 17  LEU A HD13 2  
ATOM 2004  H HD21 . LEU A 1 17  ? -15.968 19.284  9.854  1.00 0.00 ? 17  LEU A HD21 2  
ATOM 2005  H HD22 . LEU A 1 17  ? -14.247 19.585  9.512  1.00 0.00 ? 17  LEU A HD22 2  
ATOM 2006  H HD23 . LEU A 1 17  ? -14.740 18.096  10.353 1.00 0.00 ? 17  LEU A HD23 2  
ATOM 2007  N N    . GLU A 1 18  ? -11.955 18.025  13.906 1.00 0.00 ? 18  GLU A N    2  
ATOM 2008  C CA   . GLU A 1 18  ? -10.928 18.321  14.891 1.00 0.00 ? 18  GLU A CA   2  
ATOM 2009  C C    . GLU A 1 18  ? -9.538  18.092  14.293 1.00 0.00 ? 18  GLU A C    2  
ATOM 2010  O O    . GLU A 1 18  ? -9.242  17.006  13.797 1.00 0.00 ? 18  GLU A O    2  
ATOM 2011  C CB   . GLU A 1 18  ? -11.124 17.484  16.156 1.00 0.00 ? 18  GLU A CB   2  
ATOM 2012  C CG   . GLU A 1 18  ? -10.106 17.868  17.231 1.00 0.00 ? 18  GLU A CG   2  
ATOM 2013  C CD   . GLU A 1 18  ? -8.759  17.188  16.979 1.00 0.00 ? 18  GLU A CD   2  
ATOM 2014  O OE1  . GLU A 1 18  ? -8.783  15.977  16.673 1.00 0.00 ? 18  GLU A OE1  2  
ATOM 2015  O OE2  . GLU A 1 18  ? -7.735  17.895  17.098 1.00 0.00 ? 18  GLU A OE2  2  
ATOM 2016  H H    . GLU A 1 18  ? -11.614 17.704  13.023 1.00 0.00 ? 18  GLU A H    2  
ATOM 2017  H HA   . GLU A 1 18  ? -11.056 19.375  15.136 1.00 0.00 ? 18  GLU A HA   2  
ATOM 2018  H HB2  . GLU A 1 18  ? -12.134 17.628  16.539 1.00 0.00 ? 18  GLU A HB2  2  
ATOM 2019  H HB3  . GLU A 1 18  ? -11.022 16.425  15.916 1.00 0.00 ? 18  GLU A HB3  2  
ATOM 2020  H HG2  . GLU A 1 18  ? -9.975  18.950  17.243 1.00 0.00 ? 18  GLU A HG2  2  
ATOM 2021  H HG3  . GLU A 1 18  ? -10.483 17.583  18.213 1.00 0.00 ? 18  GLU A HG3  2  
ATOM 2022  N N    . ARG A 1 19  ? -8.722  19.134  14.359 1.00 0.00 ? 19  ARG A N    2  
ATOM 2023  C CA   . ARG A 1 19  ? -7.370  19.060  13.830 1.00 0.00 ? 19  ARG A CA   2  
ATOM 2024  C C    . ARG A 1 19  ? -6.350  19.287  14.948 1.00 0.00 ? 19  ARG A C    2  
ATOM 2025  O O    . ARG A 1 19  ? -6.676  19.866  15.983 1.00 0.00 ? 19  ARG A O    2  
ATOM 2026  C CB   . ARG A 1 19  ? -7.152  20.102  12.731 1.00 0.00 ? 19  ARG A CB   2  
ATOM 2027  C CG   . ARG A 1 19  ? -7.723  21.461  13.142 1.00 0.00 ? 19  ARG A CG   2  
ATOM 2028  C CD   . ARG A 1 19  ? -6.855  22.603  12.611 1.00 0.00 ? 19  ARG A CD   2  
ATOM 2029  N NE   . ARG A 1 19  ? -6.796  23.698  13.604 1.00 0.00 ? 19  ARG A NE   2  
ATOM 2030  C CZ   . ARG A 1 19  ? -6.336  24.929  13.340 1.00 0.00 ? 19  ARG A CZ   2  
ATOM 2031  N NH1  . ARG A 1 19  ? -5.893  25.229  12.111 1.00 0.00 ? 19  ARG A NH1  2  
ATOM 2032  N NH2  . ARG A 1 19  ? -6.320  25.860  14.304 1.00 0.00 ? 19  ARG A NH2  2  
ATOM 2033  H H    . ARG A 1 19  ? -8.970  20.014  14.764 1.00 0.00 ? 19  ARG A H    2  
ATOM 2034  H HA   . ARG A 1 19  ? -7.286  18.054  13.420 1.00 0.00 ? 19  ARG A HA   2  
ATOM 2035  H HB2  . ARG A 1 19  ? -6.086  20.199  12.524 1.00 0.00 ? 19  ARG A HB2  2  
ATOM 2036  H HB3  . ARG A 1 19  ? -7.627  19.768  11.809 1.00 0.00 ? 19  ARG A HB3  2  
ATOM 2037  H HG2  . ARG A 1 19  ? -8.738  21.563  12.760 1.00 0.00 ? 19  ARG A HG2  2  
ATOM 2038  H HG3  . ARG A 1 19  ? -7.783  21.520  14.228 1.00 0.00 ? 19  ARG A HG3  2  
ATOM 2039  H HD2  . ARG A 1 19  ? -5.849  22.239  12.399 1.00 0.00 ? 19  ARG A HD2  2  
ATOM 2040  H HD3  . ARG A 1 19  ? -7.264  22.975  11.671 1.00 0.00 ? 19  ARG A HD3  2  
ATOM 2041  H HE   . ARG A 1 19  ? -7.119  23.508  14.531 1.00 0.00 ? 19  ARG A HE   2  
ATOM 2042  H HH11 . ARG A 1 19  ? -5.905  24.535  11.392 1.00 0.00 ? 19  ARG A HH11 2  
ATOM 2043  H HH12 . ARG A 1 19  ? -5.550  26.148  11.914 1.00 0.00 ? 19  ARG A HH12 2  
ATOM 2044  H HH21 . ARG A 1 19  ? -6.651  25.636  15.220 1.00 0.00 ? 19  ARG A HH21 2  
ATOM 2045  H HH22 . ARG A 1 19  ? -5.977  26.778  14.106 1.00 0.00 ? 19  ARG A HH22 2  
ATOM 2046  N N    . LYS A 1 20  ? -5.136  18.818  14.700 1.00 0.00 ? 20  LYS A N    2  
ATOM 2047  C CA   . LYS A 1 20  ? -4.066  18.962  15.673 1.00 0.00 ? 20  LYS A CA   2  
ATOM 2048  C C    . LYS A 1 20  ? -2.764  19.305  14.946 1.00 0.00 ? 20  LYS A C    2  
ATOM 2049  O O    . LYS A 1 20  ? -2.237  20.406  15.095 1.00 0.00 ? 20  LYS A O    2  
ATOM 2050  C CB   . LYS A 1 20  ? -3.969  17.713  16.551 1.00 0.00 ? 20  LYS A CB   2  
ATOM 2051  C CG   . LYS A 1 20  ? -2.973  17.923  17.694 1.00 0.00 ? 20  LYS A CG   2  
ATOM 2052  C CD   . LYS A 1 20  ? -1.903  16.829  17.697 1.00 0.00 ? 20  LYS A CD   2  
ATOM 2053  C CE   . LYS A 1 20  ? -0.622  17.318  18.374 1.00 0.00 ? 20  LYS A CE   2  
ATOM 2054  N NZ   . LYS A 1 20  ? -0.392  16.587  19.640 1.00 0.00 ? 20  LYS A NZ   2  
ATOM 2055  H H    . LYS A 1 20  ? -4.879  18.348  13.856 1.00 0.00 ? 20  LYS A H    2  
ATOM 2056  H HA   . LYS A 1 20  ? -4.327  19.795  16.325 1.00 0.00 ? 20  LYS A HA   2  
ATOM 2057  H HB2  . LYS A 1 20  ? -4.951  17.473  16.959 1.00 0.00 ? 20  LYS A HB2  2  
ATOM 2058  H HB3  . LYS A 1 20  ? -3.659  16.861  15.946 1.00 0.00 ? 20  LYS A HB3  2  
ATOM 2059  H HG2  . LYS A 1 20  ? -2.500  18.900  17.595 1.00 0.00 ? 20  LYS A HG2  2  
ATOM 2060  H HG3  . LYS A 1 20  ? -3.503  17.921  18.647 1.00 0.00 ? 20  LYS A HG3  2  
ATOM 2061  H HD2  . LYS A 1 20  ? -2.280  15.948  18.217 1.00 0.00 ? 20  LYS A HD2  2  
ATOM 2062  H HD3  . LYS A 1 20  ? -1.685  16.526  16.673 1.00 0.00 ? 20  LYS A HD3  2  
ATOM 2063  H HE2  . LYS A 1 20  ? 0.227   17.175  17.706 1.00 0.00 ? 20  LYS A HE2  2  
ATOM 2064  H HE3  . LYS A 1 20  ? -0.694  18.388  18.574 1.00 0.00 ? 20  LYS A HE3  2  
ATOM 2065  H HZ1  . LYS A 1 20  ? -0.198  15.626  19.440 1.00 0.00 ? 20  LYS A HZ1  2  
ATOM 2066  H HZ2  . LYS A 1 20  ? 0.385   16.991  20.123 1.00 0.00 ? 20  LYS A HZ2  2  
ATOM 2067  H HZ3  . LYS A 1 20  ? -1.210  16.648  20.214 1.00 0.00 ? 20  LYS A HZ3  2  
ATOM 2068  N N    . LYS A 1 21  ? -2.283  18.341  14.174 1.00 0.00 ? 21  LYS A N    2  
ATOM 2069  C CA   . LYS A 1 21  ? -1.053  18.527  13.423 1.00 0.00 ? 21  LYS A CA   2  
ATOM 2070  C C    . LYS A 1 21  ? -1.387  19.072  12.033 1.00 0.00 ? 21  LYS A C    2  
ATOM 2071  O O    . LYS A 1 21  ? -0.671  19.924  11.508 1.00 0.00 ? 21  LYS A O    2  
ATOM 2072  C CB   . LYS A 1 21  ? -0.240  17.231  13.397 1.00 0.00 ? 21  LYS A CB   2  
ATOM 2073  C CG   . LYS A 1 21  ? -0.768  16.275  12.325 1.00 0.00 ? 21  LYS A CG   2  
ATOM 2074  C CD   . LYS A 1 21  ? -0.377  14.829  12.640 1.00 0.00 ? 21  LYS A CD   2  
ATOM 2075  C CE   . LYS A 1 21  ? -1.228  14.267  13.781 1.00 0.00 ? 21  LYS A CE   2  
ATOM 2076  N NZ   . LYS A 1 21  ? -2.609  14.007  13.317 1.00 0.00 ? 21  LYS A NZ   2  
ATOM 2077  H H    . LYS A 1 21  ? -2.718  17.448  14.058 1.00 0.00 ? 21  LYS A H    2  
ATOM 2078  H HA   . LYS A 1 21  ? -0.457  19.271  13.952 1.00 0.00 ? 21  LYS A HA   2  
ATOM 2079  H HB2  . LYS A 1 21  ? 0.808   17.458  13.202 1.00 0.00 ? 21  LYS A HB2  2  
ATOM 2080  H HB3  . LYS A 1 21  ? -0.285  16.749  14.373 1.00 0.00 ? 21  LYS A HB3  2  
ATOM 2081  H HG2  . LYS A 1 21  ? -1.853  16.356  12.262 1.00 0.00 ? 21  LYS A HG2  2  
ATOM 2082  H HG3  . LYS A 1 21  ? -0.370  16.559  11.351 1.00 0.00 ? 21  LYS A HG3  2  
ATOM 2083  H HD2  . LYS A 1 21  ? -0.503  14.213  11.750 1.00 0.00 ? 21  LYS A HD2  2  
ATOM 2084  H HD3  . LYS A 1 21  ? 0.677   14.785  12.912 1.00 0.00 ? 21  LYS A HD3  2  
ATOM 2085  H HE2  . LYS A 1 21  ? -0.783  13.345  14.154 1.00 0.00 ? 21  LYS A HE2  2  
ATOM 2086  H HE3  . LYS A 1 21  ? -1.244  14.972  14.612 1.00 0.00 ? 21  LYS A HE3  2  
ATOM 2087  H HZ1  . LYS A 1 21  ? -2.887  14.723  12.677 1.00 0.00 ? 21  LYS A HZ1  2  
ATOM 2088  H HZ2  . LYS A 1 21  ? -2.645  13.118  12.859 1.00 0.00 ? 21  LYS A HZ2  2  
ATOM 2089  H HZ3  . LYS A 1 21  ? -3.229  14.003  14.102 1.00 0.00 ? 21  LYS A HZ3  2  
ATOM 2090  N N    . ARG A 1 22  ? -2.474  18.559  11.476 1.00 0.00 ? 22  ARG A N    2  
ATOM 2091  C CA   . ARG A 1 22  ? -2.911  18.984  10.157 1.00 0.00 ? 22  ARG A CA   2  
ATOM 2092  C C    . ARG A 1 22  ? -4.099  18.138  9.694  1.00 0.00 ? 22  ARG A C    2  
ATOM 2093  O O    . ARG A 1 22  ? -4.131  16.929  9.919  1.00 0.00 ? 22  ARG A O    2  
ATOM 2094  C CB   . ARG A 1 22  ? -1.778  18.862  9.136  1.00 0.00 ? 22  ARG A CB   2  
ATOM 2095  C CG   . ARG A 1 22  ? -1.570  20.181  8.389  1.00 0.00 ? 22  ARG A CG   2  
ATOM 2096  C CD   . ARG A 1 22  ? -0.226  20.190  7.657  1.00 0.00 ? 22  ARG A CD   2  
ATOM 2097  N NE   . ARG A 1 22  ? -0.389  20.775  6.308  1.00 0.00 ? 22  ARG A NE   2  
ATOM 2098  C CZ   . ARG A 1 22  ? -0.698  22.059  6.078  1.00 0.00 ? 22  ARG A CZ   2  
ATOM 2099  N NH1  . ARG A 1 22  ? -0.880  22.898  7.106  1.00 0.00 ? 22  ARG A NH1  2  
ATOM 2100  N NH2  . ARG A 1 22  ? -0.826  22.502  4.820  1.00 0.00 ? 22  ARG A NH2  2  
ATOM 2101  H H    . ARG A 1 22  ? -3.051  17.867  11.910 1.00 0.00 ? 22  ARG A H    2  
ATOM 2102  H HA   . ARG A 1 22  ? -3.198  20.028  10.282 1.00 0.00 ? 22  ARG A HA   2  
ATOM 2103  H HB2  . ARG A 1 22  ? -0.856  18.577  9.643  1.00 0.00 ? 22  ARG A HB2  2  
ATOM 2104  H HB3  . ARG A 1 22  ? -2.009  18.070  8.424  1.00 0.00 ? 22  ARG A HB3  2  
ATOM 2105  H HG2  . ARG A 1 22  ? -2.379  20.330  7.674  1.00 0.00 ? 22  ARG A HG2  2  
ATOM 2106  H HG3  . ARG A 1 22  ? -1.609  21.012  9.094  1.00 0.00 ? 22  ARG A HG3  2  
ATOM 2107  H HD2  . ARG A 1 22  ? 0.504   20.765  8.227  1.00 0.00 ? 22  ARG A HD2  2  
ATOM 2108  H HD3  . ARG A 1 22  ? 0.161   19.174  7.578  1.00 0.00 ? 22  ARG A HD3  2  
ATOM 2109  H HE   . ARG A 1 22  ? -0.260  20.175  5.518  1.00 0.00 ? 22  ARG A HE   2  
ATOM 2110  H HH11 . ARG A 1 22  ? -0.785  22.568  8.045  1.00 0.00 ? 22  ARG A HH11 2  
ATOM 2111  H HH12 . ARG A 1 22  ? -1.111  23.856  6.934  1.00 0.00 ? 22  ARG A HH12 2  
ATOM 2112  H HH21 . ARG A 1 22  ? -0.690  21.875  4.052  1.00 0.00 ? 22  ARG A HH21 2  
ATOM 2113  H HH22 . ARG A 1 22  ? -1.057  23.460  4.648  1.00 0.00 ? 22  ARG A HH22 2  
ATOM 2114  N N    . GLU A 1 23  ? -5.048  18.808  9.055  1.00 0.00 ? 23  GLU A N    2  
ATOM 2115  C CA   . GLU A 1 23  ? -6.235  18.133  8.559  1.00 0.00 ? 23  GLU A CA   2  
ATOM 2116  C C    . GLU A 1 23  ? -5.970  17.546  7.171  1.00 0.00 ? 23  GLU A C    2  
ATOM 2117  O O    . GLU A 1 23  ? -6.793  16.801  6.640  1.00 0.00 ? 23  GLU A O    2  
ATOM 2118  C CB   . GLU A 1 23  ? -7.434  19.082  8.532  1.00 0.00 ? 23  GLU A CB   2  
ATOM 2119  C CG   . GLU A 1 23  ? -7.173  20.271  7.605  1.00 0.00 ? 23  GLU A CG   2  
ATOM 2120  C CD   . GLU A 1 23  ? -8.342  20.482  6.642  1.00 0.00 ? 23  GLU A CD   2  
ATOM 2121  O OE1  . GLU A 1 23  ? -8.562  19.577  5.809  1.00 0.00 ? 23  GLU A OE1  2  
ATOM 2122  O OE2  . GLU A 1 23  ? -8.990  21.545  6.760  1.00 0.00 ? 23  GLU A OE2  2  
ATOM 2123  H H    . GLU A 1 23  ? -5.014  19.791  8.876  1.00 0.00 ? 23  GLU A H    2  
ATOM 2124  H HA   . GLU A 1 23  ? -6.430  17.330  9.269  1.00 0.00 ? 23  GLU A HA   2  
ATOM 2125  H HB2  . GLU A 1 23  ? -8.321  18.544  8.198  1.00 0.00 ? 23  GLU A HB2  2  
ATOM 2126  H HB3  . GLU A 1 23  ? -7.641  19.441  9.541  1.00 0.00 ? 23  GLU A HB3  2  
ATOM 2127  H HG2  . GLU A 1 23  ? -7.018  21.172  8.199  1.00 0.00 ? 23  GLU A HG2  2  
ATOM 2128  H HG3  . GLU A 1 23  ? -6.257  20.101  7.040  1.00 0.00 ? 23  GLU A HG3  2  
ATOM 2129  N N    . LYS A 1 24  ? -4.818  17.903  6.622  1.00 0.00 ? 24  LYS A N    2  
ATOM 2130  C CA   . LYS A 1 24  ? -4.434  17.420  5.307  1.00 0.00 ? 24  LYS A CA   2  
ATOM 2131  C C    . LYS A 1 24  ? -3.650  16.115  5.455  1.00 0.00 ? 24  LYS A C    2  
ATOM 2132  O O    . LYS A 1 24  ? -3.541  15.341  4.505  1.00 0.00 ? 24  LYS A O    2  
ATOM 2133  C CB   . LYS A 1 24  ? -3.679  18.506  4.537  1.00 0.00 ? 24  LYS A CB   2  
ATOM 2134  C CG   . LYS A 1 24  ? -4.334  18.772  3.180  1.00 0.00 ? 24  LYS A CG   2  
ATOM 2135  C CD   . LYS A 1 24  ? -3.644  17.972  2.073  1.00 0.00 ? 24  LYS A CD   2  
ATOM 2136  C CE   . LYS A 1 24  ? -2.641  18.842  1.312  1.00 0.00 ? 24  LYS A CE   2  
ATOM 2137  N NZ   . LYS A 1 24  ? -2.861  18.731  -0.148 1.00 0.00 ? 24  LYS A NZ   2  
ATOM 2138  H H    . LYS A 1 24  ? -4.154  18.508  7.061  1.00 0.00 ? 24  LYS A H    2  
ATOM 2139  H HA   . LYS A 1 24  ? -5.351  17.212  4.755  1.00 0.00 ? 24  LYS A HA   2  
ATOM 2140  H HB2  . LYS A 1 24  ? -3.660  19.426  5.122  1.00 0.00 ? 24  LYS A HB2  2  
ATOM 2141  H HB3  . LYS A 1 24  ? -2.643  18.200  4.392  1.00 0.00 ? 24  LYS A HB3  2  
ATOM 2142  H HG2  . LYS A 1 24  ? -5.389  18.504  3.223  1.00 0.00 ? 24  LYS A HG2  2  
ATOM 2143  H HG3  . LYS A 1 24  ? -4.284  19.836  2.950  1.00 0.00 ? 24  LYS A HG3  2  
ATOM 2144  H HD2  . LYS A 1 24  ? -3.131  17.113  2.505  1.00 0.00 ? 24  LYS A HD2  2  
ATOM 2145  H HD3  . LYS A 1 24  ? -4.391  17.583  1.381  1.00 0.00 ? 24  LYS A HD3  2  
ATOM 2146  H HE2  . LYS A 1 24  ? -2.743  19.882  1.623  1.00 0.00 ? 24  LYS A HE2  2  
ATOM 2147  H HE3  . LYS A 1 24  ? -1.624  18.534  1.557  1.00 0.00 ? 24  LYS A HE3  2  
ATOM 2148  H HZ1  . LYS A 1 24  ? -3.798  18.428  -0.321 1.00 0.00 ? 24  LYS A HZ1  2  
ATOM 2149  H HZ2  . LYS A 1 24  ? -2.714  19.623  -0.576 1.00 0.00 ? 24  LYS A HZ2  2  
ATOM 2150  H HZ3  . LYS A 1 24  ? -2.219  18.067  -0.532 1.00 0.00 ? 24  LYS A HZ3  2  
ATOM 2151  N N    . GLU A 1 25  ? -3.126  15.910  6.654  1.00 0.00 ? 25  GLU A N    2  
ATOM 2152  C CA   . GLU A 1 25  ? -2.355  14.711  6.940  1.00 0.00 ? 25  GLU A CA   2  
ATOM 2153  C C    . GLU A 1 25  ? -3.291  13.536  7.232  1.00 0.00 ? 25  GLU A C    2  
ATOM 2154  O O    . GLU A 1 25  ? -3.272  12.532  6.522  1.00 0.00 ? 25  GLU A O    2  
ATOM 2155  C CB   . GLU A 1 25  ? -1.388  14.944  8.102  1.00 0.00 ? 25  GLU A CB   2  
ATOM 2156  C CG   . GLU A 1 25  ? -0.014  14.345  7.800  1.00 0.00 ? 25  GLU A CG   2  
ATOM 2157  C CD   . GLU A 1 25  ? 1.018   14.786  8.841  1.00 0.00 ? 25  GLU A CD   2  
ATOM 2158  O OE1  . GLU A 1 25  ? 1.126   16.014  9.048  1.00 0.00 ? 25  GLU A OE1  2  
ATOM 2159  O OE2  . GLU A 1 25  ? 1.674   13.885  9.406  1.00 0.00 ? 25  GLU A OE2  2  
ATOM 2160  H H    . GLU A 1 25  ? -3.219  16.544  7.422  1.00 0.00 ? 25  GLU A H    2  
ATOM 2161  H HA   . GLU A 1 25  ? -1.783  14.512  6.033  1.00 0.00 ? 25  GLU A HA   2  
ATOM 2162  H HB2  . GLU A 1 25  ? -1.290  16.014  8.289  1.00 0.00 ? 25  GLU A HB2  2  
ATOM 2163  H HB3  . GLU A 1 25  ? -1.792  14.498  9.011  1.00 0.00 ? 25  GLU A HB3  2  
ATOM 2164  H HG2  . GLU A 1 25  ? -0.082  13.257  7.789  1.00 0.00 ? 25  GLU A HG2  2  
ATOM 2165  H HG3  . GLU A 1 25  ? 0.312   14.654  6.807  1.00 0.00 ? 25  GLU A HG3  2  
ATOM 2166  N N    . GLN A 1 26  ? -4.087  13.701  8.278  1.00 0.00 ? 26  GLN A N    2  
ATOM 2167  C CA   . GLN A 1 26  ? -5.028  12.667  8.673  1.00 0.00 ? 26  GLN A CA   2  
ATOM 2168  C C    . GLN A 1 26  ? -5.831  12.190  7.462  1.00 0.00 ? 26  GLN A C    2  
ATOM 2169  O O    . GLN A 1 26  ? -6.183  11.015  7.370  1.00 0.00 ? 26  GLN A O    2  
ATOM 2170  C CB   . GLN A 1 26  ? -5.954  13.164  9.785  1.00 0.00 ? 26  GLN A CB   2  
ATOM 2171  C CG   . GLN A 1 26  ? -6.644  14.468  9.381  1.00 0.00 ? 26  GLN A CG   2  
ATOM 2172  C CD   . GLN A 1 26  ? -6.860  15.373  10.596 1.00 0.00 ? 26  GLN A CD   2  
ATOM 2173  O OE1  . GLN A 1 26  ? -5.951  15.664  11.356 1.00 0.00 ? 26  GLN A OE1  2  
ATOM 2174  N NE2  . GLN A 1 26  ? -8.112  15.799  10.737 1.00 0.00 ? 26  GLN A NE2  2  
ATOM 2175  H H    . GLN A 1 26  ? -4.096  14.521  8.850  1.00 0.00 ? 26  GLN A H    2  
ATOM 2176  H HA   . GLN A 1 26  ? -4.416  11.850  9.057  1.00 0.00 ? 26  GLN A HA   2  
ATOM 2177  H HB2  . GLN A 1 26  ? -6.705  12.404  10.004 1.00 0.00 ? 26  GLN A HB2  2  
ATOM 2178  H HB3  . GLN A 1 26  ? -5.381  13.318  10.699 1.00 0.00 ? 26  GLN A HB3  2  
ATOM 2179  H HG2  . GLN A 1 26  ? -6.039  14.989  8.639  1.00 0.00 ? 26  GLN A HG2  2  
ATOM 2180  H HG3  . GLN A 1 26  ? -7.603  14.248  8.912  1.00 0.00 ? 26  GLN A HG3  2  
ATOM 2181  H HE21 . GLN A 1 26  ? -8.811  15.523  10.078 1.00 0.00 ? 26  GLN A HE21 2  
ATOM 2182  H HE22 . GLN A 1 26  ? -8.354  16.396  11.502 1.00 0.00 ? 26  GLN A HE22 2  
ATOM 2183  N N    . PHE A 1 27  ? -6.098  13.126  6.563  1.00 0.00 ? 27  PHE A N    2  
ATOM 2184  C CA   . PHE A 1 27  ? -6.854  12.815  5.361  1.00 0.00 ? 27  PHE A CA   2  
ATOM 2185  C C    . PHE A 1 27  ? -6.153  11.733  4.537  1.00 0.00 ? 27  PHE A C    2  
ATOM 2186  O O    . PHE A 1 27  ? -6.788  10.778  4.092  1.00 0.00 ? 27  PHE A O    2  
ATOM 2187  C CB   . PHE A 1 27  ? -6.928  14.101  4.535  1.00 0.00 ? 27  PHE A CB   2  
ATOM 2188  C CG   . PHE A 1 27  ? -8.272  14.826  4.630  1.00 0.00 ? 27  PHE A CG   2  
ATOM 2189  C CD1  . PHE A 1 27  ? -9.039  14.692  5.746  1.00 0.00 ? 27  PHE A CD1  2  
ATOM 2190  C CD2  . PHE A 1 27  ? -8.700  15.604  3.600  1.00 0.00 ? 27  PHE A CD2  2  
ATOM 2191  C CE1  . PHE A 1 27  ? -10.286 15.364  5.834  1.00 0.00 ? 27  PHE A CE1  2  
ATOM 2192  C CE2  . PHE A 1 27  ? -9.947  16.276  3.689  1.00 0.00 ? 27  PHE A CE2  2  
ATOM 2193  C CZ   . PHE A 1 27  ? -10.714 16.142  4.804  1.00 0.00 ? 27  PHE A CZ   2  
ATOM 2194  H H    . PHE A 1 27  ? -5.808  14.079  6.645  1.00 0.00 ? 27  PHE A H    2  
ATOM 2195  H HA   . PHE A 1 27  ? -7.831  12.452  5.678  1.00 0.00 ? 27  PHE A HA   2  
ATOM 2196  H HB2  . PHE A 1 27  ? -6.138  14.777  4.862  1.00 0.00 ? 27  PHE A HB2  2  
ATOM 2197  H HB3  . PHE A 1 27  ? -6.729  13.861  3.490  1.00 0.00 ? 27  PHE A HB3  2  
ATOM 2198  H HD1  . PHE A 1 27  ? -8.696  14.068  6.571  1.00 0.00 ? 27  PHE A HD1  2  
ATOM 2199  H HD2  . PHE A 1 27  ? -8.085  15.711  2.706  1.00 0.00 ? 27  PHE A HD2  2  
ATOM 2200  H HE1  . PHE A 1 27  ? -10.901 15.257  6.728  1.00 0.00 ? 27  PHE A HE1  2  
ATOM 2201  H HE2  . PHE A 1 27  ? -10.290 16.900  2.863  1.00 0.00 ? 27  PHE A HE2  2  
ATOM 2202  H HZ   . PHE A 1 27  ? -11.672 16.659  4.872  1.00 0.00 ? 27  PHE A HZ   2  
ATOM 2203  N N    . ARG A 1 28  ? -4.853  11.919  4.358  1.00 0.00 ? 28  ARG A N    2  
ATOM 2204  C CA   . ARG A 1 28  ? -4.060  10.971  3.596  1.00 0.00 ? 28  ARG A CA   2  
ATOM 2205  C C    . ARG A 1 28  ? -3.162  10.157  4.530  1.00 0.00 ? 28  ARG A C    2  
ATOM 2206  O O    . ARG A 1 28  ? -1.984  9.951   4.241  1.00 0.00 ? 28  ARG A O    2  
ATOM 2207  C CB   . ARG A 1 28  ? -3.191  11.687  2.560  1.00 0.00 ? 28  ARG A CB   2  
ATOM 2208  C CG   . ARG A 1 28  ? -4.005  12.046  1.315  1.00 0.00 ? 28  ARG A CG   2  
ATOM 2209  C CD   . ARG A 1 28  ? -4.160  13.562  1.180  1.00 0.00 ? 28  ARG A CD   2  
ATOM 2210  N NE   . ARG A 1 28  ? -3.295  14.064  0.089  1.00 0.00 ? 28  ARG A NE   2  
ATOM 2211  C CZ   . ARG A 1 28  ? -3.511  15.208  -0.575 1.00 0.00 ? 28  ARG A CZ   2  
ATOM 2212  N NH1  . ARG A 1 28  ? -4.564  15.975  -0.263 1.00 0.00 ? 28  ARG A NH1  2  
ATOM 2213  N NH2  . ARG A 1 28  ? -2.673  15.585  -1.550 1.00 0.00 ? 28  ARG A NH2  2  
ATOM 2214  H H    . ARG A 1 28  ? -4.344  12.699  4.724  1.00 0.00 ? 28  ARG A H    2  
ATOM 2215  H HA   . ARG A 1 28  ? -4.790  10.332  3.099  1.00 0.00 ? 28  ARG A HA   2  
ATOM 2216  H HB2  . ARG A 1 28  ? -2.770  12.592  2.997  1.00 0.00 ? 28  ARG A HB2  2  
ATOM 2217  H HB3  . ARG A 1 28  ? -2.352  11.049  2.280  1.00 0.00 ? 28  ARG A HB3  2  
ATOM 2218  H HG2  . ARG A 1 28  ? -3.514  11.646  0.428  1.00 0.00 ? 28  ARG A HG2  2  
ATOM 2219  H HG3  . ARG A 1 28  ? -4.988  11.579  1.372  1.00 0.00 ? 28  ARG A HG3  2  
ATOM 2220  H HD2  . ARG A 1 28  ? -5.201  13.812  0.974  1.00 0.00 ? 28  ARG A HD2  2  
ATOM 2221  H HD3  . ARG A 1 28  ? -3.895  14.048  2.119  1.00 0.00 ? 28  ARG A HD3  2  
ATOM 2222  H HE   . ARG A 1 28  ? -2.500  13.515  -0.169 1.00 0.00 ? 28  ARG A HE   2  
ATOM 2223  H HH11 . ARG A 1 28  ? -5.190  15.694  0.465  1.00 0.00 ? 28  ARG A HH11 2  
ATOM 2224  H HH12 . ARG A 1 28  ? -4.725  16.828  -0.759 1.00 0.00 ? 28  ARG A HH12 2  
ATOM 2225  H HH21 . ARG A 1 28  ? -1.886  15.012  -1.783 1.00 0.00 ? 28  ARG A HH21 2  
ATOM 2226  H HH22 . ARG A 1 28  ? -2.834  16.438  -2.046 1.00 0.00 ? 28  ARG A HH22 2  
ATOM 2227  N N    . LYS A 1 29  ? -3.752  9.718   5.632  1.00 0.00 ? 29  LYS A N    2  
ATOM 2228  C CA   . LYS A 1 29  ? -3.020  8.932   6.610  1.00 0.00 ? 29  LYS A CA   2  
ATOM 2229  C C    . LYS A 1 29  ? -3.928  7.825   7.151  1.00 0.00 ? 29  LYS A C    2  
ATOM 2230  O O    . LYS A 1 29  ? -4.972  8.104   7.738  1.00 0.00 ? 29  LYS A O    2  
ATOM 2231  C CB   . LYS A 1 29  ? -2.439  9.837   7.699  1.00 0.00 ? 29  LYS A CB   2  
ATOM 2232  C CG   . LYS A 1 29  ? -1.640  9.024   8.719  1.00 0.00 ? 29  LYS A CG   2  
ATOM 2233  C CD   . LYS A 1 29  ? -2.073  9.360   10.148 1.00 0.00 ? 29  LYS A CD   2  
ATOM 2234  C CE   . LYS A 1 29  ? -0.934  10.023  10.924 1.00 0.00 ? 29  LYS A CE   2  
ATOM 2235  N NZ   . LYS A 1 29  ? -1.444  10.640  12.169 1.00 0.00 ? 29  LYS A NZ   2  
ATOM 2236  H H    . LYS A 1 29  ? -4.710  9.890   5.859  1.00 0.00 ? 29  LYS A H    2  
ATOM 2237  H HA   . LYS A 1 29  ? -2.179  8.468   6.094  1.00 0.00 ? 29  LYS A HA   2  
ATOM 2238  H HB2  . LYS A 1 29  ? -1.796  10.591  7.245  1.00 0.00 ? 29  LYS A HB2  2  
ATOM 2239  H HB3  . LYS A 1 29  ? -3.246  10.369  8.203  1.00 0.00 ? 29  LYS A HB3  2  
ATOM 2240  H HG2  . LYS A 1 29  ? -1.783  7.960   8.533  1.00 0.00 ? 29  LYS A HG2  2  
ATOM 2241  H HG3  . LYS A 1 29  ? -0.577  9.229   8.600  1.00 0.00 ? 29  LYS A HG3  2  
ATOM 2242  H HD2  . LYS A 1 29  ? -2.936  10.026  10.123 1.00 0.00 ? 29  LYS A HD2  2  
ATOM 2243  H HD3  . LYS A 1 29  ? -2.386  8.451   10.660 1.00 0.00 ? 29  LYS A HD3  2  
ATOM 2244  H HE2  . LYS A 1 29  ? -0.171  9.283   11.165 1.00 0.00 ? 29  LYS A HE2  2  
ATOM 2245  H HE3  . LYS A 1 29  ? -0.456  10.782  10.304 1.00 0.00 ? 29  LYS A HE3  2  
ATOM 2246  H HZ1  . LYS A 1 29  ? -0.718  10.656  12.856 1.00 0.00 ? 29  LYS A HZ1  2  
ATOM 2247  H HZ2  . LYS A 1 29  ? -1.744  11.575  11.979 1.00 0.00 ? 29  LYS A HZ2  2  
ATOM 2248  H HZ3  . LYS A 1 29  ? -2.217  10.106  12.513 1.00 0.00 ? 29  LYS A HZ3  2  
ATOM 2249  N N    . LEU A 1 30  ? -3.496  6.591   6.933  1.00 0.00 ? 30  LEU A N    2  
ATOM 2250  C CA   . LEU A 1 30  ? -4.256  5.441   7.391  1.00 0.00 ? 30  LEU A CA   2  
ATOM 2251  C C    . LEU A 1 30  ? -3.436  4.673   8.429  1.00 0.00 ? 30  LEU A C    2  
ATOM 2252  O O    . LEU A 1 30  ? -2.208  4.649   8.361  1.00 0.00 ? 30  LEU A O    2  
ATOM 2253  C CB   . LEU A 1 30  ? -4.701  4.585   6.203  1.00 0.00 ? 30  LEU A CB   2  
ATOM 2254  C CG   . LEU A 1 30  ? -4.870  5.321   4.873  1.00 0.00 ? 30  LEU A CG   2  
ATOM 2255  C CD1  . LEU A 1 30  ? -5.495  6.701   5.085  1.00 0.00 ? 30  LEU A CD1  2  
ATOM 2256  C CD2  . LEU A 1 30  ? -3.541  5.404   4.119  1.00 0.00 ? 30  LEU A CD2  2  
ATOM 2257  H H    . LEU A 1 30  ? -2.645  6.372   6.455  1.00 0.00 ? 30  LEU A H    2  
ATOM 2258  H HA   . LEU A 1 30  ? -5.159  5.817   7.873  1.00 0.00 ? 30  LEU A HA   2  
ATOM 2259  H HB2  . LEU A 1 30  ? -3.973  3.786   6.064  1.00 0.00 ? 30  LEU A HB2  2  
ATOM 2260  H HB3  . LEU A 1 30  ? -5.650  4.112   6.457  1.00 0.00 ? 30  LEU A HB3  2  
ATOM 2261  H HG   . LEU A 1 30  ? -5.558  4.749   4.250  1.00 0.00 ? 30  LEU A HG   2  
ATOM 2262  H HD11 . LEU A 1 30  ? -5.879  6.774   6.102  1.00 0.00 ? 30  LEU A HD11 2  
ATOM 2263  H HD12 . LEU A 1 30  ? -4.740  7.471   4.926  1.00 0.00 ? 30  LEU A HD12 2  
ATOM 2264  H HD13 . LEU A 1 30  ? -6.312  6.843   4.377  1.00 0.00 ? 30  LEU A HD13 2  
ATOM 2265  H HD21 . LEU A 1 30  ? -3.725  5.327   3.048  1.00 0.00 ? 30  LEU A HD21 2  
ATOM 2266  H HD22 . LEU A 1 30  ? -3.058  6.356   4.337  1.00 0.00 ? 30  LEU A HD22 2  
ATOM 2267  H HD23 . LEU A 1 30  ? -2.893  4.587   4.436  1.00 0.00 ? 30  LEU A HD23 2  
ATOM 2268  N N    . PHE A 1 31  ? -4.147  4.063   9.366  1.00 0.00 ? 31  PHE A N    2  
ATOM 2269  C CA   . PHE A 1 31  ? -3.500  3.296   10.417 1.00 0.00 ? 31  PHE A CA   2  
ATOM 2270  C C    . PHE A 1 31  ? -3.473  1.806   10.070 1.00 0.00 ? 31  PHE A C    2  
ATOM 2271  O O    . PHE A 1 31  ? -4.495  1.127   10.154 1.00 0.00 ? 31  PHE A O    2  
ATOM 2272  C CB   . PHE A 1 31  ? -4.325  3.497   11.690 1.00 0.00 ? 31  PHE A CB   2  
ATOM 2273  C CG   . PHE A 1 31  ? -3.712  2.855   12.936 1.00 0.00 ? 31  PHE A CG   2  
ATOM 2274  C CD1  . PHE A 1 31  ? -3.732  1.503   13.084 1.00 0.00 ? 31  PHE A CD1  2  
ATOM 2275  C CD2  . PHE A 1 31  ? -3.146  3.636   13.895 1.00 0.00 ? 31  PHE A CD2  2  
ATOM 2276  C CE1  . PHE A 1 31  ? -3.164  0.907   14.241 1.00 0.00 ? 31  PHE A CE1  2  
ATOM 2277  C CE2  . PHE A 1 31  ? -2.578  3.040   15.051 1.00 0.00 ? 31  PHE A CE2  2  
ATOM 2278  C CZ   . PHE A 1 31  ? -2.598  1.688   15.200 1.00 0.00 ? 31  PHE A CZ   2  
ATOM 2279  H H    . PHE A 1 31  ? -5.146  4.087   9.414  1.00 0.00 ? 31  PHE A H    2  
ATOM 2280  H HA   . PHE A 1 31  ? -2.478  3.665   10.504 1.00 0.00 ? 31  PHE A HA   2  
ATOM 2281  H HB2  . PHE A 1 31  ? -4.447  4.565   11.867 1.00 0.00 ? 31  PHE A HB2  2  
ATOM 2282  H HB3  . PHE A 1 31  ? -5.321  3.084   11.534 1.00 0.00 ? 31  PHE A HB3  2  
ATOM 2283  H HD1  . PHE A 1 31  ? -4.185  0.877   12.316 1.00 0.00 ? 31  PHE A HD1  2  
ATOM 2284  H HD2  . PHE A 1 31  ? -3.130  4.719   13.776 1.00 0.00 ? 31  PHE A HD2  2  
ATOM 2285  H HE1  . PHE A 1 31  ? -3.180  -0.176  14.360 1.00 0.00 ? 31  PHE A HE1  2  
ATOM 2286  H HE2  . PHE A 1 31  ? -2.124  3.666   15.820 1.00 0.00 ? 31  PHE A HE2  2  
ATOM 2287  H HZ   . PHE A 1 31  ? -2.161  1.231   16.088 1.00 0.00 ? 31  PHE A HZ   2  
ATOM 2288  N N    . ILE A 1 32  ? -2.292  1.341   9.689  1.00 0.00 ? 32  ILE A N    2  
ATOM 2289  C CA   . ILE A 1 32  ? -2.119  -0.056  9.330  1.00 0.00 ? 32  ILE A CA   2  
ATOM 2290  C C    . ILE A 1 32  ? -2.003  -0.895  10.604 1.00 0.00 ? 32  ILE A C    2  
ATOM 2291  O O    . ILE A 1 32  ? -1.239  -0.558  11.507 1.00 0.00 ? 32  ILE A O    2  
ATOM 2292  C CB   . ILE A 1 32  ? -0.934  -0.221  8.376  1.00 0.00 ? 32  ILE A CB   2  
ATOM 2293  C CG1  . ILE A 1 32  ? -0.891  0.916   7.353  1.00 0.00 ? 32  ILE A CG1  2  
ATOM 2294  C CG2  . ILE A 1 32  ? -0.958  -1.595  7.704  1.00 0.00 ? 32  ILE A CG2  2  
ATOM 2295  C CD1  . ILE A 1 32  ? -2.223  1.036   6.610  1.00 0.00 ? 32  ILE A CD1  2  
ATOM 2296  H H    . ILE A 1 32  ? -1.466  1.900   9.624  1.00 0.00 ? 32  ILE A H    2  
ATOM 2297  H HA   . ILE A 1 32  ? -3.013  -0.368  8.790  1.00 0.00 ? 32  ILE A HA   2  
ATOM 2298  H HB   . ILE A 1 32  ? -0.015  -0.164  8.960  1.00 0.00 ? 32  ILE A HB   2  
ATOM 2299  H HG12 . ILE A 1 32  ? -0.666  1.856   7.858  1.00 0.00 ? 32  ILE A HG12 2  
ATOM 2300  H HG13 . ILE A 1 32  ? -0.087  0.738   6.639  1.00 0.00 ? 32  ILE A HG13 2  
ATOM 2301  H HG21 . ILE A 1 32  ? 0.061   -1.900  7.465  1.00 0.00 ? 32  ILE A HG21 2  
ATOM 2302  H HG22 . ILE A 1 32  ? -1.405  -2.323  8.381  1.00 0.00 ? 32  ILE A HG22 2  
ATOM 2303  H HG23 . ILE A 1 32  ? -1.545  -1.542  6.788  1.00 0.00 ? 32  ILE A HG23 2  
ATOM 2304  H HD11 . ILE A 1 32  ? -2.814  0.135   6.776  1.00 0.00 ? 32  ILE A HD11 2  
ATOM 2305  H HD12 . ILE A 1 32  ? -2.771  1.902   6.983  1.00 0.00 ? 32  ILE A HD12 2  
ATOM 2306  H HD13 . ILE A 1 32  ? -2.035  1.157   5.544  1.00 0.00 ? 32  ILE A HD13 2  
ATOM 2307  N N    . GLY A 1 33  ? -2.774  -1.972  10.637 1.00 0.00 ? 33  GLY A N    2  
ATOM 2308  C CA   . GLY A 1 33  ? -2.768  -2.862  11.785 1.00 0.00 ? 33  GLY A CA   2  
ATOM 2309  C C    . GLY A 1 33  ? -2.495  -4.306  11.359 1.00 0.00 ? 33  GLY A C    2  
ATOM 2310  O O    . GLY A 1 33  ? -3.045  -4.778  10.365 1.00 0.00 ? 33  GLY A O    2  
ATOM 2311  H H    . GLY A 1 33  ? -3.394  -2.239  9.898  1.00 0.00 ? 33  GLY A H    2  
ATOM 2312  H HA2  . GLY A 1 33  ? -2.008  -2.539  12.496 1.00 0.00 ? 33  GLY A HA2  2  
ATOM 2313  H HA3  . GLY A 1 33  ? -3.729  -2.807  12.298 1.00 0.00 ? 33  GLY A HA3  2  
ATOM 2314  N N    . GLY A 1 34  ? -1.645  -4.967  12.132 1.00 0.00 ? 34  GLY A N    2  
ATOM 2315  C CA   . GLY A 1 34  ? -1.292  -6.347  11.846 1.00 0.00 ? 34  GLY A CA   2  
ATOM 2316  C C    . GLY A 1 34  ? -0.170  -6.422  10.808 1.00 0.00 ? 34  GLY A C    2  
ATOM 2317  O O    . GLY A 1 34  ? -0.391  -6.866  9.682  1.00 0.00 ? 34  GLY A O    2  
ATOM 2318  H H    . GLY A 1 34  ? -1.202  -4.575  12.938 1.00 0.00 ? 34  GLY A H    2  
ATOM 2319  H HA2  . GLY A 1 34  ? -0.976  -6.842  12.764 1.00 0.00 ? 34  GLY A HA2  2  
ATOM 2320  H HA3  . GLY A 1 34  ? -2.168  -6.882  11.480 1.00 0.00 ? 34  GLY A HA3  2  
ATOM 2321  N N    . LEU A 1 35  ? 1.008   -5.982  11.223 1.00 0.00 ? 35  LEU A N    2  
ATOM 2322  C CA   . LEU A 1 35  ? 2.164   -5.994  10.343 1.00 0.00 ? 35  LEU A CA   2  
ATOM 2323  C C    . LEU A 1 35  ? 2.978   -7.265  10.595 1.00 0.00 ? 35  LEU A C    2  
ATOM 2324  O O    . LEU A 1 35  ? 3.989   -7.500  9.934  1.00 0.00 ? 35  LEU A O    2  
ATOM 2325  C CB   . LEU A 1 35  ? 2.972   -4.705  10.502 1.00 0.00 ? 35  LEU A CB   2  
ATOM 2326  C CG   . LEU A 1 35  ? 2.178   -3.400  10.406 1.00 0.00 ? 35  LEU A CG   2  
ATOM 2327  C CD1  . LEU A 1 35  ? 3.073   -2.246  9.950  1.00 0.00 ? 35  LEU A CD1  2  
ATOM 2328  C CD2  . LEU A 1 35  ? 0.954   -3.568  9.504  1.00 0.00 ? 35  LEU A CD2  2  
ATOM 2329  H H    . LEU A 1 35  ? 1.179   -5.623  12.141 1.00 0.00 ? 35  LEU A H    2  
ATOM 2330  H HA   . LEU A 1 35  ? 1.794   -6.019  9.318  1.00 0.00 ? 35  LEU A HA   2  
ATOM 2331  H HB2  . LEU A 1 35  ? 3.475   -4.731  11.469 1.00 0.00 ? 35  LEU A HB2  2  
ATOM 2332  H HB3  . LEU A 1 35  ? 3.750   -4.690  9.738  1.00 0.00 ? 35  LEU A HB3  2  
ATOM 2333  H HG   . LEU A 1 35  ? 1.813   -3.149  11.402 1.00 0.00 ? 35  LEU A HG   2  
ATOM 2334  H HD11 . LEU A 1 35  ? 2.464   -1.484  9.465  1.00 0.00 ? 35  LEU A HD11 2  
ATOM 2335  H HD12 . LEU A 1 35  ? 3.578   -1.813  10.814 1.00 0.00 ? 35  LEU A HD12 2  
ATOM 2336  H HD13 . LEU A 1 35  ? 3.816   -2.620  9.245  1.00 0.00 ? 35  LEU A HD13 2  
ATOM 2337  H HD21 . LEU A 1 35  ? 0.224   -4.209  9.998  1.00 0.00 ? 35  LEU A HD21 2  
ATOM 2338  H HD22 . LEU A 1 35  ? 0.509   -2.592  9.312  1.00 0.00 ? 35  LEU A HD22 2  
ATOM 2339  H HD23 . LEU A 1 35  ? 1.258   -4.021  8.561  1.00 0.00 ? 35  LEU A HD23 2  
ATOM 2340  N N    . SER A 1 36  ? 2.508   -8.051  11.552 1.00 0.00 ? 36  SER A N    2  
ATOM 2341  C CA   . SER A 1 36  ? 3.179   -9.292  11.900 1.00 0.00 ? 36  SER A CA   2  
ATOM 2342  C C    . SER A 1 36  ? 4.379   -9.002  12.804 1.00 0.00 ? 36  SER A C    2  
ATOM 2343  O O    . SER A 1 36  ? 5.072   -9.922  13.236 1.00 0.00 ? 36  SER A O    2  
ATOM 2344  C CB   . SER A 1 36  ? 3.629   -10.044 10.646 1.00 0.00 ? 36  SER A CB   2  
ATOM 2345  O OG   . SER A 1 36  ? 5.049   -10.112 10.545 1.00 0.00 ? 36  SER A OG   2  
ATOM 2346  H H    . SER A 1 36  ? 1.685   -7.852  12.085 1.00 0.00 ? 36  SER A H    2  
ATOM 2347  H HA   . SER A 1 36  ? 2.434   -9.884  12.431 1.00 0.00 ? 36  SER A HA   2  
ATOM 2348  H HB2  . SER A 1 36  ? 3.218   -11.054 10.662 1.00 0.00 ? 36  SER A HB2  2  
ATOM 2349  H HB3  . SER A 1 36  ? 3.226   -9.550  9.762  1.00 0.00 ? 36  SER A HB3  2  
ATOM 2350  H HG   . SER A 1 36  ? 5.372   -9.488  9.833  1.00 0.00 ? 36  SER A HG   2  
ATOM 2351  N N    . PHE A 1 37  ? 4.587   -7.719  13.064 1.00 0.00 ? 37  PHE A N    2  
ATOM 2352  C CA   . PHE A 1 37  ? 5.691   -7.297  13.909 1.00 0.00 ? 37  PHE A CA   2  
ATOM 2353  C C    . PHE A 1 37  ? 7.021   -7.381  13.157 1.00 0.00 ? 37  PHE A C    2  
ATOM 2354  O O    . PHE A 1 37  ? 8.067   -7.023  13.696 1.00 0.00 ? 37  PHE A O    2  
ATOM 2355  C CB   . PHE A 1 37  ? 5.733   -8.253  15.102 1.00 0.00 ? 37  PHE A CB   2  
ATOM 2356  C CG   . PHE A 1 37  ? 4.354   -8.720  15.574 1.00 0.00 ? 37  PHE A CG   2  
ATOM 2357  C CD1  . PHE A 1 37  ? 3.382   -7.807  15.841 1.00 0.00 ? 37  PHE A CD1  2  
ATOM 2358  C CD2  . PHE A 1 37  ? 4.101   -10.047 15.726 1.00 0.00 ? 37  PHE A CD2  2  
ATOM 2359  C CE1  . PHE A 1 37  ? 2.102   -8.240  16.279 1.00 0.00 ? 37  PHE A CE1  2  
ATOM 2360  C CE2  . PHE A 1 37  ? 2.821   -10.480 16.164 1.00 0.00 ? 37  PHE A CE2  2  
ATOM 2361  C CZ   . PHE A 1 37  ? 1.849   -9.567  16.431 1.00 0.00 ? 37  PHE A CZ   2  
ATOM 2362  H H    . PHE A 1 37  ? 4.019   -6.977  12.708 1.00 0.00 ? 37  PHE A H    2  
ATOM 2363  H HA   . PHE A 1 37  ? 5.502   -6.262  14.194 1.00 0.00 ? 37  PHE A HA   2  
ATOM 2364  H HB2  . PHE A 1 37  ? 6.328   -9.126  14.835 1.00 0.00 ? 37  PHE A HB2  2  
ATOM 2365  H HB3  . PHE A 1 37  ? 6.242   -7.762  15.931 1.00 0.00 ? 37  PHE A HB3  2  
ATOM 2366  H HD1  . PHE A 1 37  ? 3.585   -6.743  15.719 1.00 0.00 ? 37  PHE A HD1  2  
ATOM 2367  H HD2  . PHE A 1 37  ? 4.880   -10.779 15.512 1.00 0.00 ? 37  PHE A HD2  2  
ATOM 2368  H HE1  . PHE A 1 37  ? 1.323   -7.508  16.493 1.00 0.00 ? 37  PHE A HE1  2  
ATOM 2369  H HE2  . PHE A 1 37  ? 2.618   -11.544 16.286 1.00 0.00 ? 37  PHE A HE2  2  
ATOM 2370  H HZ   . PHE A 1 37  ? 0.867   -9.899  16.767 1.00 0.00 ? 37  PHE A HZ   2  
ATOM 2371  N N    . GLU A 1 38  ? 6.937   -7.857  11.923 1.00 0.00 ? 38  GLU A N    2  
ATOM 2372  C CA   . GLU A 1 38  ? 8.121   -7.992  11.091 1.00 0.00 ? 38  GLU A CA   2  
ATOM 2373  C C    . GLU A 1 38  ? 8.151   -6.893  10.027 1.00 0.00 ? 38  GLU A C    2  
ATOM 2374  O O    . GLU A 1 38  ? 9.063   -6.069  10.007 1.00 0.00 ? 38  GLU A O    2  
ATOM 2375  C CB   . GLU A 1 38  ? 8.184   -9.379  10.449 1.00 0.00 ? 38  GLU A CB   2  
ATOM 2376  C CG   . GLU A 1 38  ? 9.518   -10.065 10.752 1.00 0.00 ? 38  GLU A CG   2  
ATOM 2377  C CD   . GLU A 1 38  ? 10.138  -10.645 9.480  1.00 0.00 ? 38  GLU A CD   2  
ATOM 2378  O OE1  . GLU A 1 38  ? 10.808  -9.867  8.768  1.00 0.00 ? 38  GLU A OE1  2  
ATOM 2379  O OE2  . GLU A 1 38  ? 9.927   -11.855 9.247  1.00 0.00 ? 38  GLU A OE2  2  
ATOM 2380  H H    . GLU A 1 38  ? 6.083   -8.146  11.492 1.00 0.00 ? 38  GLU A H    2  
ATOM 2381  H HA   . GLU A 1 38  ? 8.966   -7.874  11.769 1.00 0.00 ? 38  GLU A HA   2  
ATOM 2382  H HB2  . GLU A 1 38  ? 7.363   -9.993  10.819 1.00 0.00 ? 38  GLU A HB2  2  
ATOM 2383  H HB3  . GLU A 1 38  ? 8.053   -9.291  9.370  1.00 0.00 ? 38  GLU A HB3  2  
ATOM 2384  H HG2  . GLU A 1 38  ? 10.205  -9.348  11.201 1.00 0.00 ? 38  GLU A HG2  2  
ATOM 2385  H HG3  . GLU A 1 38  ? 9.364   -10.859 11.482 1.00 0.00 ? 38  GLU A HG3  2  
ATOM 2386  N N    . THR A 1 39  ? 7.142   -6.917  9.169  1.00 0.00 ? 39  THR A N    2  
ATOM 2387  C CA   . THR A 1 39  ? 7.041   -5.933  8.104  1.00 0.00 ? 39  THR A CA   2  
ATOM 2388  C C    . THR A 1 39  ? 7.471   -4.555  8.610  1.00 0.00 ? 39  THR A C    2  
ATOM 2389  O O    . THR A 1 39  ? 6.680   -3.838  9.221  1.00 0.00 ? 39  THR A O    2  
ATOM 2390  C CB   . THR A 1 39  ? 5.609   -5.963  7.567  1.00 0.00 ? 39  THR A CB   2  
ATOM 2391  O OG1  . THR A 1 39  ? 5.691   -6.787  6.407  1.00 0.00 ? 39  THR A OG1  2  
ATOM 2392  C CG2  . THR A 1 39  ? 5.158   -4.604  7.027  1.00 0.00 ? 39  THR A CG2  2  
ATOM 2393  H H    . THR A 1 39  ? 6.404   -7.591  9.192  1.00 0.00 ? 39  THR A H    2  
ATOM 2394  H HA   . THR A 1 39  ? 7.734   -6.213  7.311  1.00 0.00 ? 39  THR A HA   2  
ATOM 2395  H HB   . THR A 1 39  ? 4.917   -6.331  8.324  1.00 0.00 ? 39  THR A HB   2  
ATOM 2396  H HG1  . THR A 1 39  ? 6.029   -7.695  6.656  1.00 0.00 ? 39  THR A HG1  2  
ATOM 2397  H HG21 . THR A 1 39  ? 6.021   -4.060  6.645  1.00 0.00 ? 39  THR A HG21 2  
ATOM 2398  H HG22 . THR A 1 39  ? 4.437   -4.754  6.223  1.00 0.00 ? 39  THR A HG22 2  
ATOM 2399  H HG23 . THR A 1 39  ? 4.693   -4.031  7.829  1.00 0.00 ? 39  THR A HG23 2  
ATOM 2400  N N    . THR A 1 40  ? 8.725   -4.225  8.337  1.00 0.00 ? 40  THR A N    2  
ATOM 2401  C CA   . THR A 1 40  ? 9.271   -2.945  8.757  1.00 0.00 ? 40  THR A CA   2  
ATOM 2402  C C    . THR A 1 40  ? 8.715   -1.817  7.885  1.00 0.00 ? 40  THR A C    2  
ATOM 2403  O O    . THR A 1 40  ? 7.835   -2.044  7.056  1.00 0.00 ? 40  THR A O    2  
ATOM 2404  C CB   . THR A 1 40  ? 10.797  -3.046  8.720  1.00 0.00 ? 40  THR A CB   2  
ATOM 2405  O OG1  . THR A 1 40  ? 11.097  -3.267  7.344  1.00 0.00 ? 40  THR A OG1  2  
ATOM 2406  C CG2  . THR A 1 40  ? 11.317  -4.302  9.421  1.00 0.00 ? 40  THR A CG2  2  
ATOM 2407  H H    . THR A 1 40  ? 9.363   -4.813  7.840  1.00 0.00 ? 40  THR A H    2  
ATOM 2408  H HA   . THR A 1 40  ? 8.943   -2.750  9.778  1.00 0.00 ? 40  THR A HA   2  
ATOM 2409  H HB   . THR A 1 40  ? 11.256  -2.150  9.135  1.00 0.00 ? 40  THR A HB   2  
ATOM 2410  H HG1  . THR A 1 40  ? 12.087  -3.291  7.210  1.00 0.00 ? 40  THR A HG1  2  
ATOM 2411  H HG21 . THR A 1 40  ? 11.054  -5.182  8.834  1.00 0.00 ? 40  THR A HG21 2  
ATOM 2412  H HG22 . THR A 1 40  ? 12.401  -4.242  9.518  1.00 0.00 ? 40  THR A HG22 2  
ATOM 2413  H HG23 . THR A 1 40  ? 10.868  -4.379  10.411 1.00 0.00 ? 40  THR A HG23 2  
ATOM 2414  N N    . GLU A 1 41  ? 9.253   -0.626  8.102  1.00 0.00 ? 41  GLU A N    2  
ATOM 2415  C CA   . GLU A 1 41  ? 8.822   0.538   7.346  1.00 0.00 ? 41  GLU A CA   2  
ATOM 2416  C C    . GLU A 1 41  ? 8.911   0.259   5.844  1.00 0.00 ? 41  GLU A C    2  
ATOM 2417  O O    . GLU A 1 41  ? 7.928   0.414   5.121  1.00 0.00 ? 41  GLU A O    2  
ATOM 2418  C CB   . GLU A 1 41  ? 9.644   1.772   7.724  1.00 0.00 ? 41  GLU A CB   2  
ATOM 2419  C CG   . GLU A 1 41  ? 9.497   2.094   9.212  1.00 0.00 ? 41  GLU A CG   2  
ATOM 2420  C CD   . GLU A 1 41  ? 10.113  3.455   9.542  1.00 0.00 ? 41  GLU A CD   2  
ATOM 2421  O OE1  . GLU A 1 41  ? 9.786   4.418   8.816  1.00 0.00 ? 41  GLU A OE1  2  
ATOM 2422  O OE2  . GLU A 1 41  ? 10.898  3.502   10.514 1.00 0.00 ? 41  GLU A OE2  2  
ATOM 2423  H H    . GLU A 1 41  ? 9.968   -0.449  8.778  1.00 0.00 ? 41  GLU A H    2  
ATOM 2424  H HA   . GLU A 1 41  ? 7.782   0.701   7.631  1.00 0.00 ? 41  GLU A HA   2  
ATOM 2425  H HB2  . GLU A 1 41  ? 10.694  1.601   7.487  1.00 0.00 ? 41  GLU A HB2  2  
ATOM 2426  H HB3  . GLU A 1 41  ? 9.318   2.626   7.130  1.00 0.00 ? 41  GLU A HB3  2  
ATOM 2427  H HG2  . GLU A 1 41  ? 8.441   2.093   9.486  1.00 0.00 ? 41  GLU A HG2  2  
ATOM 2428  H HG3  . GLU A 1 41  ? 9.980   1.318   9.805  1.00 0.00 ? 41  GLU A HG3  2  
ATOM 2429  N N    . GLU A 1 42  ? 10.098  -0.148  5.420  1.00 0.00 ? 42  GLU A N    2  
ATOM 2430  C CA   . GLU A 1 42  ? 10.328  -0.450  4.017  1.00 0.00 ? 42  GLU A CA   2  
ATOM 2431  C C    . GLU A 1 42  ? 9.426   -1.601  3.568  1.00 0.00 ? 42  GLU A C    2  
ATOM 2432  O O    . GLU A 1 42  ? 8.568   -1.421  2.704  1.00 0.00 ? 42  GLU A O    2  
ATOM 2433  C CB   . GLU A 1 42  ? 11.801  -0.776  3.761  1.00 0.00 ? 42  GLU A CB   2  
ATOM 2434  C CG   . GLU A 1 42  ? 12.292  -0.116  2.472  1.00 0.00 ? 42  GLU A CG   2  
ATOM 2435  C CD   . GLU A 1 42  ? 13.737  -0.517  2.166  1.00 0.00 ? 42  GLU A CD   2  
ATOM 2436  O OE1  . GLU A 1 42  ? 14.494  -0.701  3.143  1.00 0.00 ? 42  GLU A OE1  2  
ATOM 2437  O OE2  . GLU A 1 42  ? 14.051  -0.632  0.961  1.00 0.00 ? 42  GLU A OE2  2  
ATOM 2438  H H    . GLU A 1 42  ? 10.892  -0.272  6.015  1.00 0.00 ? 42  GLU A H    2  
ATOM 2439  H HA   . GLU A 1 42  ? 10.064  0.459   3.478  1.00 0.00 ? 42  GLU A HA   2  
ATOM 2440  H HB2  . GLU A 1 42  ? 12.404  -0.434  4.602  1.00 0.00 ? 42  GLU A HB2  2  
ATOM 2441  H HB3  . GLU A 1 42  ? 11.932  -1.856  3.694  1.00 0.00 ? 42  GLU A HB3  2  
ATOM 2442  H HG2  . GLU A 1 42  ? 11.647  -0.405  1.642  1.00 0.00 ? 42  GLU A HG2  2  
ATOM 2443  H HG3  . GLU A 1 42  ? 12.224  0.968   2.565  1.00 0.00 ? 42  GLU A HG3  2  
ATOM 2444  N N    . SER A 1 43  ? 9.650   -2.758  4.173  1.00 0.00 ? 43  SER A N    2  
ATOM 2445  C CA   . SER A 1 43  ? 8.868   -3.938  3.846  1.00 0.00 ? 43  SER A CA   2  
ATOM 2446  C C    . SER A 1 43  ? 7.389   -3.568  3.722  1.00 0.00 ? 43  SER A C    2  
ATOM 2447  O O    . SER A 1 43  ? 6.656   -4.175  2.942  1.00 0.00 ? 43  SER A O    2  
ATOM 2448  C CB   . SER A 1 43  ? 9.055   -5.033  4.898  1.00 0.00 ? 43  SER A CB   2  
ATOM 2449  O OG   . SER A 1 43  ? 10.235  -5.799  4.668  1.00 0.00 ? 43  SER A OG   2  
ATOM 2450  H H    . SER A 1 43  ? 10.350  -2.896  4.874  1.00 0.00 ? 43  SER A H    2  
ATOM 2451  H HA   . SER A 1 43  ? 9.257   -4.285  2.888  1.00 0.00 ? 43  SER A HA   2  
ATOM 2452  H HB2  . SER A 1 43  ? 9.105   -4.579  5.888  1.00 0.00 ? 43  SER A HB2  2  
ATOM 2453  H HB3  . SER A 1 43  ? 8.188   -5.692  4.894  1.00 0.00 ? 43  SER A HB3  2  
ATOM 2454  H HG   . SER A 1 43  ? 9.998   -6.762  4.545  1.00 0.00 ? 43  SER A HG   2  
ATOM 2455  N N    . LEU A 1 44  ? 6.993   -2.574  4.504  1.00 0.00 ? 44  LEU A N    2  
ATOM 2456  C CA   . LEU A 1 44  ? 5.615   -2.115  4.492  1.00 0.00 ? 44  LEU A CA   2  
ATOM 2457  C C    . LEU A 1 44  ? 5.396   -1.201  3.285  1.00 0.00 ? 44  LEU A C    2  
ATOM 2458  O O    . LEU A 1 44  ? 4.387   -1.315  2.590  1.00 0.00 ? 44  LEU A O    2  
ATOM 2459  C CB   . LEU A 1 44  ? 5.255   -1.465  5.829  1.00 0.00 ? 44  LEU A CB   2  
ATOM 2460  C CG   . LEU A 1 44  ? 3.976   -0.625  5.844  1.00 0.00 ? 44  LEU A CG   2  
ATOM 2461  C CD1  . LEU A 1 44  ? 2.803   -1.421  6.420  1.00 0.00 ? 44  LEU A CD1  2  
ATOM 2462  C CD2  . LEU A 1 44  ? 4.194   0.694   6.588  1.00 0.00 ? 44  LEU A CD2  2  
ATOM 2463  H H    . LEU A 1 44  ? 7.595   -2.085  5.135  1.00 0.00 ? 44  LEU A H    2  
ATOM 2464  H HA   . LEU A 1 44  ? 4.979   -2.994  4.379  1.00 0.00 ? 44  LEU A HA   2  
ATOM 2465  H HB2  . LEU A 1 44  ? 5.158   -2.251  6.578  1.00 0.00 ? 44  LEU A HB2  2  
ATOM 2466  H HB3  . LEU A 1 44  ? 6.086   -0.831  6.137  1.00 0.00 ? 44  LEU A HB3  2  
ATOM 2467  H HG   . LEU A 1 44  ? 3.720   -0.375  4.814  1.00 0.00 ? 44  LEU A HG   2  
ATOM 2468  H HD11 . LEU A 1 44  ? 2.910   -2.472  6.150  1.00 0.00 ? 44  LEU A HD11 2  
ATOM 2469  H HD12 . LEU A 1 44  ? 2.797   -1.324  7.506  1.00 0.00 ? 44  LEU A HD12 2  
ATOM 2470  H HD13 . LEU A 1 44  ? 1.868   -1.035  6.015  1.00 0.00 ? 44  LEU A HD13 2  
ATOM 2471  H HD21 . LEU A 1 44  ? 3.232   1.172   6.770  1.00 0.00 ? 44  LEU A HD21 2  
ATOM 2472  H HD22 . LEU A 1 44  ? 4.687   0.496   7.540  1.00 0.00 ? 44  LEU A HD22 2  
ATOM 2473  H HD23 . LEU A 1 44  ? 4.819   1.352   5.985  1.00 0.00 ? 44  LEU A HD23 2  
ATOM 2474  N N    . ARG A 1 45  ? 6.358   -0.315  3.072  1.00 0.00 ? 45  ARG A N    2  
ATOM 2475  C CA   . ARG A 1 45  ? 6.283   0.618   1.960  1.00 0.00 ? 45  ARG A CA   2  
ATOM 2476  C C    . ARG A 1 45  ? 6.296   -0.138  0.631  1.00 0.00 ? 45  ARG A C    2  
ATOM 2477  O O    . ARG A 1 45  ? 5.471   0.123   -0.244 1.00 0.00 ? 45  ARG A O    2  
ATOM 2478  C CB   . ARG A 1 45  ? 7.453   1.604   1.990  1.00 0.00 ? 45  ARG A CB   2  
ATOM 2479  C CG   . ARG A 1 45  ? 7.116   2.830   2.841  1.00 0.00 ? 45  ARG A CG   2  
ATOM 2480  C CD   . ARG A 1 45  ? 8.040   4.002   2.503  1.00 0.00 ? 45  ARG A CD   2  
ATOM 2481  N NE   . ARG A 1 45  ? 9.452   3.561   2.540  1.00 0.00 ? 45  ARG A NE   2  
ATOM 2482  C CZ   . ARG A 1 45  ? 10.480  4.293   2.090  1.00 0.00 ? 45  ARG A CZ   2  
ATOM 2483  N NH1  . ARG A 1 45  ? 10.259  5.507   1.566  1.00 0.00 ? 45  ARG A NH1  2  
ATOM 2484  N NH2  . ARG A 1 45  ? 11.728  3.812   2.164  1.00 0.00 ? 45  ARG A NH2  2  
ATOM 2485  H H    . ARG A 1 45  ? 7.175   -0.230  3.641  1.00 0.00 ? 45  ARG A H    2  
ATOM 2486  H HA   . ARG A 1 45  ? 5.341   1.146   2.103  1.00 0.00 ? 45  ARG A HA   2  
ATOM 2487  H HB2  . ARG A 1 45  ? 8.339   1.111   2.390  1.00 0.00 ? 45  ARG A HB2  2  
ATOM 2488  H HB3  . ARG A 1 45  ? 7.695   1.917   0.974  1.00 0.00 ? 45  ARG A HB3  2  
ATOM 2489  H HG2  . ARG A 1 45  ? 6.079   3.119   2.673  1.00 0.00 ? 45  ARG A HG2  2  
ATOM 2490  H HG3  . ARG A 1 45  ? 7.211   2.580   3.897  1.00 0.00 ? 45  ARG A HG3  2  
ATOM 2491  H HD2  . ARG A 1 45  ? 7.798   4.393   1.515  1.00 0.00 ? 45  ARG A HD2  2  
ATOM 2492  H HD3  . ARG A 1 45  ? 7.885   4.814   3.214  1.00 0.00 ? 45  ARG A HD3  2  
ATOM 2493  H HE   . ARG A 1 45  ? 9.652   2.660   2.925  1.00 0.00 ? 45  ARG A HE   2  
ATOM 2494  H HH11 . ARG A 1 45  ? 9.327   5.866   1.511  1.00 0.00 ? 45  ARG A HH11 2  
ATOM 2495  H HH12 . ARG A 1 45  ? 11.026  6.053   1.230  1.00 0.00 ? 45  ARG A HH12 2  
ATOM 2496  H HH21 . ARG A 1 45  ? 11.893  2.907   2.555  1.00 0.00 ? 45  ARG A HH21 2  
ATOM 2497  H HH22 . ARG A 1 45  ? 12.495  4.359   1.828  1.00 0.00 ? 45  ARG A HH22 2  
ATOM 2498  N N    . ASN A 1 46  ? 7.240   -1.061  0.519  1.00 0.00 ? 46  ASN A N    2  
ATOM 2499  C CA   . ASN A 1 46  ? 7.370   -1.857  -0.689 1.00 0.00 ? 46  ASN A CA   2  
ATOM 2500  C C    . ASN A 1 46  ? 5.996   -2.398  -1.089 1.00 0.00 ? 46  ASN A C    2  
ATOM 2501  O O    . ASN A 1 46  ? 5.760   -2.699  -2.258 1.00 0.00 ? 46  ASN A O    2  
ATOM 2502  C CB   . ASN A 1 46  ? 8.301   -3.050  -0.465 1.00 0.00 ? 46  ASN A CB   2  
ATOM 2503  C CG   . ASN A 1 46  ? 8.380   -3.926  -1.717 1.00 0.00 ? 46  ASN A CG   2  
ATOM 2504  O OD1  . ASN A 1 46  ? 8.936   -3.550  -2.735 1.00 0.00 ? 46  ASN A OD1  2  
ATOM 2505  N ND2  . ASN A 1 46  ? 7.795   -5.113  -1.584 1.00 0.00 ? 46  ASN A ND2  2  
ATOM 2506  H H    . ASN A 1 46  ? 7.907   -1.267  1.235  1.00 0.00 ? 46  ASN A H    2  
ATOM 2507  H HA   . ASN A 1 46  ? 7.785   -1.179  -1.435 1.00 0.00 ? 46  ASN A HA   2  
ATOM 2508  H HB2  . ASN A 1 46  ? 9.297   -2.695  -0.202 1.00 0.00 ? 46  ASN A HB2  2  
ATOM 2509  H HB3  . ASN A 1 46  ? 7.942   -3.643  0.376  1.00 0.00 ? 46  ASN A HB3  2  
ATOM 2510  H HD21 . ASN A 1 46  ? 7.356   -5.361  -0.720 1.00 0.00 ? 46  ASN A HD21 2  
ATOM 2511  H HD22 . ASN A 1 46  ? 7.794   -5.758  -2.348 1.00 0.00 ? 46  ASN A HD22 2  
ATOM 2512  N N    . TYR A 1 47  ? 5.126   -2.504  -0.096 1.00 0.00 ? 47  TYR A N    2  
ATOM 2513  C CA   . TYR A 1 47  ? 3.781   -3.004  -0.330 1.00 0.00 ? 47  TYR A CA   2  
ATOM 2514  C C    . TYR A 1 47  ? 2.833   -1.866  -0.713 1.00 0.00 ? 47  TYR A C    2  
ATOM 2515  O O    . TYR A 1 47  ? 2.149   -1.940  -1.733 1.00 0.00 ? 47  TYR A O    2  
ATOM 2516  C CB   . TYR A 1 47  ? 3.320   -3.611  0.997  1.00 0.00 ? 47  TYR A CB   2  
ATOM 2517  C CG   . TYR A 1 47  ? 2.125   -4.556  0.866  1.00 0.00 ? 47  TYR A CG   2  
ATOM 2518  C CD1  . TYR A 1 47  ? 2.302   -5.827  0.358  1.00 0.00 ? 47  TYR A CD1  2  
ATOM 2519  C CD2  . TYR A 1 47  ? 0.868   -4.138  1.256  1.00 0.00 ? 47  TYR A CD2  2  
ATOM 2520  C CE1  . TYR A 1 47  ? 1.176   -6.717  0.235  1.00 0.00 ? 47  TYR A CE1  2  
ATOM 2521  C CE2  . TYR A 1 47  ? -0.257  -5.027  1.133  1.00 0.00 ? 47  TYR A CE2  2  
ATOM 2522  C CZ   . TYR A 1 47  ? -0.048  -6.273  0.629  1.00 0.00 ? 47  TYR A CZ   2  
ATOM 2523  O OH   . TYR A 1 47  ? -1.111  -7.113  0.513  1.00 0.00 ? 47  TYR A OH   2  
ATOM 2524  H H    . TYR A 1 47  ? 5.326   -2.257  0.852  1.00 0.00 ? 47  TYR A H    2  
ATOM 2525  H HA   . TYR A 1 47  ? 3.827   -3.721  -1.150 1.00 0.00 ? 47  TYR A HA   2  
ATOM 2526  H HB2  . TYR A 1 47  ? 4.153   -4.154  1.444  1.00 0.00 ? 47  TYR A HB2  2  
ATOM 2527  H HB3  . TYR A 1 47  ? 3.060   -2.805  1.683  1.00 0.00 ? 47  TYR A HB3  2  
ATOM 2528  H HD1  . TYR A 1 47  ? 3.294   -6.157  0.050  1.00 0.00 ? 47  TYR A HD1  2  
ATOM 2529  H HD2  . TYR A 1 47  ? 0.729   -3.134  1.657  1.00 0.00 ? 47  TYR A HD2  2  
ATOM 2530  H HE1  . TYR A 1 47  ? 1.302   -7.723  -0.164 1.00 0.00 ? 47  TYR A HE1  2  
ATOM 2531  H HE2  . TYR A 1 47  ? -1.254  -4.710  1.438  1.00 0.00 ? 47  TYR A HE2  2  
ATOM 2532  H HH   . TYR A 1 47  ? -1.317  -7.273  -0.453 1.00 0.00 ? 47  TYR A HH   2  
ATOM 2533  N N    . TYR A 1 48  ? 2.822   -0.840  0.125  1.00 0.00 ? 48  TYR A N    2  
ATOM 2534  C CA   . TYR A 1 48  ? 1.969   0.312   -0.113 1.00 0.00 ? 48  TYR A CA   2  
ATOM 2535  C C    . TYR A 1 48  ? 2.686   1.358   -0.968 1.00 0.00 ? 48  TYR A C    2  
ATOM 2536  O O    . TYR A 1 48  ? 2.401   2.551   -0.866 1.00 0.00 ? 48  TYR A O    2  
ATOM 2537  C CB   . TYR A 1 48  ? 1.675   0.911   1.264  1.00 0.00 ? 48  TYR A CB   2  
ATOM 2538  C CG   . TYR A 1 48  ? 0.613   0.150   2.060  1.00 0.00 ? 48  TYR A CG   2  
ATOM 2539  C CD1  . TYR A 1 48  ? -0.727  0.390   1.829  1.00 0.00 ? 48  TYR A CD1  2  
ATOM 2540  C CD2  . TYR A 1 48  ? 0.994   -0.778  3.008  1.00 0.00 ? 48  TYR A CD2  2  
ATOM 2541  C CE1  . TYR A 1 48  ? -1.727  -0.327  2.578  1.00 0.00 ? 48  TYR A CE1  2  
ATOM 2542  C CE2  . TYR A 1 48  ? -0.006  -1.494  3.757  1.00 0.00 ? 48  TYR A CE2  2  
ATOM 2543  C CZ   . TYR A 1 48  ? -1.317  -1.233  3.505  1.00 0.00 ? 48  TYR A CZ   2  
ATOM 2544  O OH   . TYR A 1 48  ? -2.261  -1.910  4.212  1.00 0.00 ? 48  TYR A OH   2  
ATOM 2545  H H    . TYR A 1 48  ? 3.381   -0.788  0.953  1.00 0.00 ? 48  TYR A H    2  
ATOM 2546  H HA   . TYR A 1 48  ? 1.080   -0.031  -0.642 1.00 0.00 ? 48  TYR A HA   2  
ATOM 2547  H HB2  . TYR A 1 48  ? 2.598   0.937   1.842  1.00 0.00 ? 48  TYR A HB2  2  
ATOM 2548  H HB3  . TYR A 1 48  ? 1.349   1.943   1.138  1.00 0.00 ? 48  TYR A HB3  2  
ATOM 2549  H HD1  . TYR A 1 48  ? -1.028  1.122   1.080  1.00 0.00 ? 48  TYR A HD1  2  
ATOM 2550  H HD2  . TYR A 1 48  ? 2.051   -0.968  3.190  1.00 0.00 ? 48  TYR A HD2  2  
ATOM 2551  H HE1  . TYR A 1 48  ? -2.788  -0.146  2.405  1.00 0.00 ? 48  TYR A HE1  2  
ATOM 2552  H HE2  . TYR A 1 48  ? 0.281   -2.229  4.509  1.00 0.00 ? 48  TYR A HE2  2  
ATOM 2553  H HH   . TYR A 1 48  ? -1.859  -2.729  4.622  1.00 0.00 ? 48  TYR A HH   2  
ATOM 2554  N N    . GLU A 1 49  ? 3.604   0.874   -1.793 1.00 0.00 ? 49  GLU A N    2  
ATOM 2555  C CA   . GLU A 1 49  ? 4.364   1.753   -2.665 1.00 0.00 ? 49  GLU A CA   2  
ATOM 2556  C C    . GLU A 1 49  ? 3.772   1.742   -4.076 1.00 0.00 ? 49  GLU A C    2  
ATOM 2557  O O    . GLU A 1 49  ? 4.016   2.656   -4.862 1.00 0.00 ? 49  GLU A O    2  
ATOM 2558  C CB   . GLU A 1 49  ? 5.842   1.358   -2.688 1.00 0.00 ? 49  GLU A CB   2  
ATOM 2559  C CG   . GLU A 1 49  ? 6.666   2.264   -1.771 1.00 0.00 ? 49  GLU A CG   2  
ATOM 2560  C CD   . GLU A 1 49  ? 8.037   2.560   -2.381 1.00 0.00 ? 49  GLU A CD   2  
ATOM 2561  O OE1  . GLU A 1 49  ? 8.096   3.477   -3.228 1.00 0.00 ? 49  GLU A OE1  2  
ATOM 2562  O OE2  . GLU A 1 49  ? 8.996   1.862   -1.986 1.00 0.00 ? 49  GLU A OE2  2  
ATOM 2563  H H    . GLU A 1 49  ? 3.829   -0.097  -1.870 1.00 0.00 ? 49  GLU A H    2  
ATOM 2564  H HA   . GLU A 1 49  ? 4.267   2.748   -2.231 1.00 0.00 ? 49  GLU A HA   2  
ATOM 2565  H HB2  . GLU A 1 49  ? 5.950   0.320   -2.372 1.00 0.00 ? 49  GLU A HB2  2  
ATOM 2566  H HB3  . GLU A 1 49  ? 6.223   1.422   -3.707 1.00 0.00 ? 49  GLU A HB3  2  
ATOM 2567  H HG2  . GLU A 1 49  ? 6.130   3.199   -1.601 1.00 0.00 ? 49  GLU A HG2  2  
ATOM 2568  H HG3  . GLU A 1 49  ? 6.791   1.787   -0.799 1.00 0.00 ? 49  GLU A HG3  2  
ATOM 2569  N N    . GLN A 1 50  ? 3.005   0.698   -4.353 1.00 0.00 ? 50  GLN A N    2  
ATOM 2570  C CA   . GLN A 1 50  ? 2.376   0.556   -5.656 1.00 0.00 ? 50  GLN A CA   2  
ATOM 2571  C C    . GLN A 1 50  ? 1.239   1.568   -5.809 1.00 0.00 ? 50  GLN A C    2  
ATOM 2572  O O    . GLN A 1 50  ? 1.276   2.420   -6.695 1.00 0.00 ? 50  GLN A O    2  
ATOM 2573  C CB   . GLN A 1 50  ? 1.871   -0.872  -5.868 1.00 0.00 ? 50  GLN A CB   2  
ATOM 2574  C CG   . GLN A 1 50  ? 2.972   -1.893  -5.573 1.00 0.00 ? 50  GLN A CG   2  
ATOM 2575  C CD   . GLN A 1 50  ? 2.392   -3.302  -5.441 1.00 0.00 ? 50  GLN A CD   2  
ATOM 2576  O OE1  . GLN A 1 50  ? 2.691   -4.199  -6.212 1.00 0.00 ? 50  GLN A OE1  2  
ATOM 2577  N NE2  . GLN A 1 50  ? 1.549   -3.447  -4.422 1.00 0.00 ? 50  GLN A NE2  2  
ATOM 2578  H H    . GLN A 1 50  ? 2.811   -0.041  -3.708 1.00 0.00 ? 50  GLN A H    2  
ATOM 2579  H HA   . GLN A 1 50  ? 3.161   0.769   -6.381 1.00 0.00 ? 50  GLN A HA   2  
ATOM 2580  H HB2  . GLN A 1 50  ? 1.014   -1.059  -5.221 1.00 0.00 ? 50  GLN A HB2  2  
ATOM 2581  H HB3  . GLN A 1 50  ? 1.526   -0.991  -6.895 1.00 0.00 ? 50  GLN A HB3  2  
ATOM 2582  H HG2  . GLN A 1 50  ? 3.714   -1.874  -6.372 1.00 0.00 ? 50  GLN A HG2  2  
ATOM 2583  H HG3  . GLN A 1 50  ? 3.489   -1.620  -4.653 1.00 0.00 ? 50  GLN A HG3  2  
ATOM 2584  H HE21 . GLN A 1 50  ? 1.347   -2.670  -3.826 1.00 0.00 ? 50  GLN A HE21 2  
ATOM 2585  H HE22 . GLN A 1 50  ? 1.117   -4.333  -4.253 1.00 0.00 ? 50  GLN A HE22 2  
ATOM 2586  N N    . TRP A 1 51  ? 0.254   1.441   -4.931 1.00 0.00 ? 51  TRP A N    2  
ATOM 2587  C CA   . TRP A 1 51  ? -0.892  2.334   -4.958 1.00 0.00 ? 51  TRP A CA   2  
ATOM 2588  C C    . TRP A 1 51  ? -0.370  3.771   -5.004 1.00 0.00 ? 51  TRP A C    2  
ATOM 2589  O O    . TRP A 1 51  ? -0.883  4.598   -5.758 1.00 0.00 ? 51  TRP A O    2  
ATOM 2590  C CB   . TRP A 1 51  ? -1.819  2.072   -3.769 1.00 0.00 ? 51  TRP A CB   2  
ATOM 2591  C CG   . TRP A 1 51  ? -2.434  0.671   -3.757 1.00 0.00 ? 51  TRP A CG   2  
ATOM 2592  C CD1  . TRP A 1 51  ? -3.327  0.154   -4.612 1.00 0.00 ? 51  TRP A CD1  2  
ATOM 2593  C CD2  . TRP A 1 51  ? -2.164  -0.378  -2.803 1.00 0.00 ? 51  TRP A CD2  2  
ATOM 2594  N NE1  . TRP A 1 51  ? -3.651  -1.146  -4.281 1.00 0.00 ? 51  TRP A NE1  2  
ATOM 2595  C CE2  . TRP A 1 51  ? -2.921  -1.480  -3.146 1.00 0.00 ? 51  TRP A CE2  2  
ATOM 2596  C CE3  . TRP A 1 51  ? -1.308  -0.396  -1.688 1.00 0.00 ? 51  TRP A CE3  2  
ATOM 2597  C CZ2  . TRP A 1 51  ? -2.898  -2.680  -2.425 1.00 0.00 ? 51  TRP A CZ2  2  
ATOM 2598  C CZ3  . TRP A 1 51  ? -1.297  -1.602  -0.978 1.00 0.00 ? 51  TRP A CZ3  2  
ATOM 2599  C CH2  . TRP A 1 51  ? -2.053  -2.720  -1.310 1.00 0.00 ? 51  TRP A CH2  2  
ATOM 2600  H H    . TRP A 1 51  ? 0.231   0.745   -4.214 1.00 0.00 ? 51  TRP A H    2  
ATOM 2601  H HA   . TRP A 1 51  ? -1.464  2.116   -5.860 1.00 0.00 ? 51  TRP A HA   2  
ATOM 2602  H HB2  . TRP A 1 51  ? -1.259  2.220   -2.846 1.00 0.00 ? 51  TRP A HB2  2  
ATOM 2603  H HB3  . TRP A 1 51  ? -2.621  2.810   -3.778 1.00 0.00 ? 51  TRP A HB3  2  
ATOM 2604  H HD1  . TRP A 1 51  ? -3.745  0.693   -5.463 1.00 0.00 ? 51  TRP A HD1  2  
ATOM 2605  H HE1  . TRP A 1 51  ? -4.350  -1.792  -4.812 1.00 0.00 ? 51  TRP A HE1  2  
ATOM 2606  H HE3  . TRP A 1 51  ? -0.701  0.461   -1.396 1.00 0.00 ? 51  TRP A HE3  2  
ATOM 2607  H HZ2  . TRP A 1 51  ? -3.506  -3.536  -2.717 1.00 0.00 ? 51  TRP A HZ2  2  
ATOM 2608  H HZ3  . TRP A 1 51  ? -0.650  -1.670  -0.103 1.00 0.00 ? 51  TRP A HZ3  2  
ATOM 2609  H HH2  . TRP A 1 51  ? -1.988  -3.625  -0.705 1.00 0.00 ? 51  TRP A HH2  2  
ATOM 2610  N N    . GLY A 1 52  ? 0.642   4.026   -4.188 1.00 0.00 ? 52  GLY A N    2  
ATOM 2611  C CA   . GLY A 1 52  ? 1.239   5.349   -4.126 1.00 0.00 ? 52  GLY A CA   2  
ATOM 2612  C C    . GLY A 1 52  ? 2.467   5.355   -3.214 1.00 0.00 ? 52  GLY A C    2  
ATOM 2613  O O    . GLY A 1 52  ? 2.606   4.491   -2.349 1.00 0.00 ? 52  GLY A O    2  
ATOM 2614  H H    . GLY A 1 52  ? 1.053   3.348   -3.578 1.00 0.00 ? 52  GLY A H    2  
ATOM 2615  H HA2  . GLY A 1 52  ? 1.524   5.671   -5.128 1.00 0.00 ? 52  GLY A HA2  2  
ATOM 2616  H HA3  . GLY A 1 52  ? 0.504   6.066   -3.758 1.00 0.00 ? 52  GLY A HA3  2  
ATOM 2617  N N    . LYS A 1 53  ? 3.326   6.339   -3.438 1.00 0.00 ? 53  LYS A N    2  
ATOM 2618  C CA   . LYS A 1 53  ? 4.538   6.468   -2.647 1.00 0.00 ? 53  LYS A CA   2  
ATOM 2619  C C    . LYS A 1 53  ? 4.195   7.102   -1.297 1.00 0.00 ? 53  LYS A C    2  
ATOM 2620  O O    . LYS A 1 53  ? 3.656   8.206   -1.245 1.00 0.00 ? 53  LYS A O    2  
ATOM 2621  C CB   . LYS A 1 53  ? 5.610   7.229   -3.429 1.00 0.00 ? 53  LYS A CB   2  
ATOM 2622  C CG   . LYS A 1 53  ? 6.459   6.273   -4.269 1.00 0.00 ? 53  LYS A CG   2  
ATOM 2623  C CD   . LYS A 1 53  ? 6.422   6.662   -5.748 1.00 0.00 ? 53  LYS A CD   2  
ATOM 2624  C CE   . LYS A 1 53  ? 5.222   6.027   -6.453 1.00 0.00 ? 53  LYS A CE   2  
ATOM 2625  N NZ   . LYS A 1 53  ? 5.657   5.307   -7.670 1.00 0.00 ? 53  LYS A NZ   2  
ATOM 2626  H H    . LYS A 1 53  ? 3.205   7.037   -4.143 1.00 0.00 ? 53  LYS A H    2  
ATOM 2627  H HA   . LYS A 1 53  ? 4.921   5.463   -2.469 1.00 0.00 ? 53  LYS A HA   2  
ATOM 2628  H HB2  . LYS A 1 53  ? 5.137   7.967   -4.078 1.00 0.00 ? 53  LYS A HB2  2  
ATOM 2629  H HB3  . LYS A 1 53  ? 6.250   7.777   -2.738 1.00 0.00 ? 53  LYS A HB3  2  
ATOM 2630  H HG2  . LYS A 1 53  ? 7.488   6.285   -3.911 1.00 0.00 ? 53  LYS A HG2  2  
ATOM 2631  H HG3  . LYS A 1 53  ? 6.091   5.253   -4.149 1.00 0.00 ? 53  LYS A HG3  2  
ATOM 2632  H HD2  . LYS A 1 53  ? 6.371   7.747   -5.841 1.00 0.00 ? 53  LYS A HD2  2  
ATOM 2633  H HD3  . LYS A 1 53  ? 7.344   6.344   -6.235 1.00 0.00 ? 53  LYS A HD3  2  
ATOM 2634  H HE2  . LYS A 1 53  ? 4.718   5.338   -5.776 1.00 0.00 ? 53  LYS A HE2  2  
ATOM 2635  H HE3  . LYS A 1 53  ? 4.499   6.799   -6.719 1.00 0.00 ? 53  LYS A HE3  2  
ATOM 2636  H HZ1  . LYS A 1 53  ? 5.286   5.763   -8.479 1.00 0.00 ? 53  LYS A HZ1  2  
ATOM 2637  H HZ2  . LYS A 1 53  ? 6.656   5.306   -7.718 1.00 0.00 ? 53  LYS A HZ2  2  
ATOM 2638  H HZ3  . LYS A 1 53  ? 5.324   4.364   -7.637 1.00 0.00 ? 53  LYS A HZ3  2  
ATOM 2639  N N    . LEU A 1 54  ? 4.522   6.376   -0.238 1.00 0.00 ? 54  LEU A N    2  
ATOM 2640  C CA   . LEU A 1 54  ? 4.256   6.853   1.108  1.00 0.00 ? 54  LEU A CA   2  
ATOM 2641  C C    . LEU A 1 54  ? 5.248   7.965   1.456  1.00 0.00 ? 54  LEU A C    2  
ATOM 2642  O O    . LEU A 1 54  ? 6.436   7.705   1.645  1.00 0.00 ? 54  LEU A O    2  
ATOM 2643  C CB   . LEU A 1 54  ? 4.264   5.689   2.101  1.00 0.00 ? 54  LEU A CB   2  
ATOM 2644  C CG   . LEU A 1 54  ? 3.427   4.469   1.710  1.00 0.00 ? 54  LEU A CG   2  
ATOM 2645  C CD1  . LEU A 1 54  ? 3.565   3.355   2.749  1.00 0.00 ? 54  LEU A CD1  2  
ATOM 2646  C CD2  . LEU A 1 54  ? 1.966   4.858   1.477  1.00 0.00 ? 54  LEU A CD2  2  
ATOM 2647  H H    . LEU A 1 54  ? 4.961   5.478   -0.289 1.00 0.00 ? 54  LEU A H    2  
ATOM 2648  H HA   . LEU A 1 54  ? 3.251   7.274   1.113  1.00 0.00 ? 54  LEU A HA   2  
ATOM 2649  H HB2  . LEU A 1 54  ? 5.295   5.367   2.245  1.00 0.00 ? 54  LEU A HB2  2  
ATOM 2650  H HB3  . LEU A 1 54  ? 3.907   6.056   3.063  1.00 0.00 ? 54  LEU A HB3  2  
ATOM 2651  H HG   . LEU A 1 54  ? 3.811   4.079   0.768  1.00 0.00 ? 54  LEU A HG   2  
ATOM 2652  H HD11 . LEU A 1 54  ? 2.611   3.211   3.257  1.00 0.00 ? 54  LEU A HD11 2  
ATOM 2653  H HD12 . LEU A 1 54  ? 3.855   2.429   2.253  1.00 0.00 ? 54  LEU A HD12 2  
ATOM 2654  H HD13 . LEU A 1 54  ? 4.327   3.630   3.479  1.00 0.00 ? 54  LEU A HD13 2  
ATOM 2655  H HD21 . LEU A 1 54  ? 1.314   4.106   1.921  1.00 0.00 ? 54  LEU A HD21 2  
ATOM 2656  H HD22 . LEU A 1 54  ? 1.770   5.826   1.937  1.00 0.00 ? 54  LEU A HD22 2  
ATOM 2657  H HD23 . LEU A 1 54  ? 1.773   4.919   0.406  1.00 0.00 ? 54  LEU A HD23 2  
ATOM 2658  N N    . THR A 1 55  ? 4.725   9.180   1.530  1.00 0.00 ? 55  THR A N    2  
ATOM 2659  C CA   . THR A 1 55  ? 5.550   10.332  1.852  1.00 0.00 ? 55  THR A CA   2  
ATOM 2660  C C    . THR A 1 55  ? 5.958   10.300  3.326  1.00 0.00 ? 55  THR A C    2  
ATOM 2661  O O    . THR A 1 55  ? 6.870   11.016  3.737  1.00 0.00 ? 55  THR A O    2  
ATOM 2662  C CB   . THR A 1 55  ? 4.775   11.592  1.462  1.00 0.00 ? 55  THR A CB   2  
ATOM 2663  O OG1  . THR A 1 55  ? 3.789   11.722  2.482  1.00 0.00 ? 55  THR A OG1  2  
ATOM 2664  C CG2  . THR A 1 55  ? 3.963   11.406  0.179  1.00 0.00 ? 55  THR A CG2  2  
ATOM 2665  H H    . THR A 1 55  ? 3.758   9.382   1.375  1.00 0.00 ? 55  THR A H    2  
ATOM 2666  H HA   . THR A 1 55  ? 6.467   10.272  1.265  1.00 0.00 ? 55  THR A HA   2  
ATOM 2667  H HB   . THR A 1 55  ? 5.443   12.449  1.380  1.00 0.00 ? 55  THR A HB   2  
ATOM 2668  H HG1  . THR A 1 55  ? 3.158   10.947  2.448  1.00 0.00 ? 55  THR A HG1  2  
ATOM 2669  H HG21 . THR A 1 55  ? 4.345   10.547  -0.372 1.00 0.00 ? 55  THR A HG21 2  
ATOM 2670  H HG22 . THR A 1 55  ? 2.916   11.240  0.432  1.00 0.00 ? 55  THR A HG22 2  
ATOM 2671  H HG23 . THR A 1 55  ? 4.049   12.301  -0.438 1.00 0.00 ? 55  THR A HG23 2  
ATOM 2672  N N    . ASP A 1 56  ? 5.261   9.464   4.082  1.00 0.00 ? 56  ASP A N    2  
ATOM 2673  C CA   . ASP A 1 56  ? 5.539   9.331   5.502  1.00 0.00 ? 56  ASP A CA   2  
ATOM 2674  C C    . ASP A 1 56  ? 4.995   7.990   6.000  1.00 0.00 ? 56  ASP A C    2  
ATOM 2675  O O    . ASP A 1 56  ? 3.782   7.793   6.060  1.00 0.00 ? 56  ASP A O    2  
ATOM 2676  C CB   . ASP A 1 56  ? 4.861   10.444  6.303  1.00 0.00 ? 56  ASP A CB   2  
ATOM 2677  C CG   . ASP A 1 56  ? 5.771   11.614  6.682  1.00 0.00 ? 56  ASP A CG   2  
ATOM 2678  O OD1  . ASP A 1 56  ? 6.979   11.516  6.376  1.00 0.00 ? 56  ASP A OD1  2  
ATOM 2679  O OD2  . ASP A 1 56  ? 5.237   12.580  7.268  1.00 0.00 ? 56  ASP A OD2  2  
ATOM 2680  H H    . ASP A 1 56  ? 4.521   8.886   3.740  1.00 0.00 ? 56  ASP A H    2  
ATOM 2681  H HA   . ASP A 1 56  ? 6.624   9.398   5.589  1.00 0.00 ? 56  ASP A HA   2  
ATOM 2682  H HB2  . ASP A 1 56  ? 4.021   10.828  5.724  1.00 0.00 ? 56  ASP A HB2  2  
ATOM 2683  H HB3  . ASP A 1 56  ? 4.448   10.014  7.216  1.00 0.00 ? 56  ASP A HB3  2  
ATOM 2684  N N    . CYS A 1 57  ? 5.917   7.104   6.344  1.00 0.00 ? 57  CYS A N    2  
ATOM 2685  C CA   . CYS A 1 57  ? 5.545   5.788   6.835  1.00 0.00 ? 57  CYS A CA   2  
ATOM 2686  C C    . CYS A 1 57  ? 6.279   5.542   8.154  1.00 0.00 ? 57  CYS A C    2  
ATOM 2687  O O    . CYS A 1 57  ? 7.503   5.648   8.217  1.00 0.00 ? 57  CYS A O    2  
ATOM 2688  C CB   . CYS A 1 57  ? 5.839   4.696   5.805  1.00 0.00 ? 57  CYS A CB   2  
ATOM 2689  S SG   . CYS A 1 57  ? 7.636   4.349   5.758  1.00 0.00 ? 57  CYS A SG   2  
ATOM 2690  H H    . CYS A 1 57  ? 6.901   7.273   6.292  1.00 0.00 ? 57  CYS A H    2  
ATOM 2691  H HA   . CYS A 1 57  ? 4.466   5.806   6.990  1.00 0.00 ? 57  CYS A HA   2  
ATOM 2692  H HB2  . CYS A 1 57  ? 5.292   3.788   6.058  1.00 0.00 ? 57  CYS A HB2  2  
ATOM 2693  H HB3  . CYS A 1 57  ? 5.495   5.011   4.820  1.00 0.00 ? 57  CYS A HB3  2  
ATOM 2694  H HG   . CYS A 1 57  ? 7.696   3.768   6.953  1.00 0.00 ? 57  CYS A HG   2  
ATOM 2695  N N    . VAL A 1 58  ? 5.501   5.216   9.176  1.00 0.00 ? 58  VAL A N    2  
ATOM 2696  C CA   . VAL A 1 58  ? 6.062   4.954   10.490 1.00 0.00 ? 58  VAL A CA   2  
ATOM 2697  C C    . VAL A 1 58  ? 5.498   3.637   11.028 1.00 0.00 ? 58  VAL A C    2  
ATOM 2698  O O    . VAL A 1 58  ? 4.322   3.336   10.831 1.00 0.00 ? 58  VAL A O    2  
ATOM 2699  C CB   . VAL A 1 58  ? 5.798   6.141   11.419 1.00 0.00 ? 58  VAL A CB   2  
ATOM 2700  C CG1  . VAL A 1 58  ? 5.896   5.721   12.887 1.00 0.00 ? 58  VAL A CG1  2  
ATOM 2701  C CG2  . VAL A 1 58  ? 6.752   7.298   11.115 1.00 0.00 ? 58  VAL A CG2  2  
ATOM 2702  H H    . VAL A 1 58  ? 4.506   5.132   9.117  1.00 0.00 ? 58  VAL A H    2  
ATOM 2703  H HA   . VAL A 1 58  ? 7.141   4.851   10.373 1.00 0.00 ? 58  VAL A HA   2  
ATOM 2704  H HB   . VAL A 1 58  ? 4.781   6.489   11.237 1.00 0.00 ? 58  VAL A HB   2  
ATOM 2705  H HG11 . VAL A 1 58  ? 6.241   6.565   13.484 1.00 0.00 ? 58  VAL A HG11 2  
ATOM 2706  H HG12 . VAL A 1 58  ? 4.915   5.404   13.240 1.00 0.00 ? 58  VAL A HG12 2  
ATOM 2707  H HG13 . VAL A 1 58  ? 6.601   4.896   12.982 1.00 0.00 ? 58  VAL A HG13 2  
ATOM 2708  H HG21 . VAL A 1 58  ? 7.719   6.900   10.807 1.00 0.00 ? 58  VAL A HG21 2  
ATOM 2709  H HG22 . VAL A 1 58  ? 6.338   7.909   10.312 1.00 0.00 ? 58  VAL A HG22 2  
ATOM 2710  H HG23 . VAL A 1 58  ? 6.878   7.909   12.008 1.00 0.00 ? 58  VAL A HG23 2  
ATOM 2711  N N    . VAL A 1 59  ? 6.363   2.888   11.695 1.00 0.00 ? 59  VAL A N    2  
ATOM 2712  C CA   . VAL A 1 59  ? 5.965   1.611   12.262 1.00 0.00 ? 59  VAL A CA   2  
ATOM 2713  C C    . VAL A 1 59  ? 6.167   1.646   13.778 1.00 0.00 ? 59  VAL A C    2  
ATOM 2714  O O    . VAL A 1 59  ? 7.297   1.736   14.256 1.00 0.00 ? 59  VAL A O    2  
ATOM 2715  C CB   . VAL A 1 59  ? 6.733   0.475   11.583 1.00 0.00 ? 59  VAL A CB   2  
ATOM 2716  C CG1  . VAL A 1 59  ? 8.231   0.572   11.880 1.00 0.00 ? 59  VAL A CG1  2  
ATOM 2717  C CG2  . VAL A 1 59  ? 6.178   -0.888  12.000 1.00 0.00 ? 59  VAL A CG2  2  
ATOM 2718  H H    . VAL A 1 59  ? 7.318   3.141   11.851 1.00 0.00 ? 59  VAL A H    2  
ATOM 2719  H HA   . VAL A 1 59  ? 4.904   1.474   12.053 1.00 0.00 ? 59  VAL A HA   2  
ATOM 2720  H HB   . VAL A 1 59  ? 6.598   0.576   10.506 1.00 0.00 ? 59  VAL A HB   2  
ATOM 2721  H HG11 . VAL A 1 59  ? 8.476   -0.071  12.725 1.00 0.00 ? 59  VAL A HG11 2  
ATOM 2722  H HG12 . VAL A 1 59  ? 8.796   0.252   11.004 1.00 0.00 ? 59  VAL A HG12 2  
ATOM 2723  H HG13 . VAL A 1 59  ? 8.488   1.603   12.121 1.00 0.00 ? 59  VAL A HG13 2  
ATOM 2724  H HG21 . VAL A 1 59  ? 6.286   -1.010  13.078 1.00 0.00 ? 59  VAL A HG21 2  
ATOM 2725  H HG22 . VAL A 1 59  ? 5.123   -0.949  11.731 1.00 0.00 ? 59  VAL A HG22 2  
ATOM 2726  H HG23 . VAL A 1 59  ? 6.729   -1.677  11.489 1.00 0.00 ? 59  VAL A HG23 2  
ATOM 2727  N N    . MET A 1 60  ? 5.054   1.572   14.493 1.00 0.00 ? 60  MET A N    2  
ATOM 2728  C CA   . MET A 1 60  ? 5.095   1.594   15.946 1.00 0.00 ? 60  MET A CA   2  
ATOM 2729  C C    . MET A 1 60  ? 5.716   0.309   16.496 1.00 0.00 ? 60  MET A C    2  
ATOM 2730  O O    . MET A 1 60  ? 5.553   -0.762  15.915 1.00 0.00 ? 60  MET A O    2  
ATOM 2731  C CB   . MET A 1 60  ? 3.675   1.751   16.494 1.00 0.00 ? 60  MET A CB   2  
ATOM 2732  C CG   . MET A 1 60  ? 3.171   3.184   16.310 1.00 0.00 ? 60  MET A CG   2  
ATOM 2733  S SD   . MET A 1 60  ? 4.231   4.321   17.188 1.00 0.00 ? 60  MET A SD   2  
ATOM 2734  C CE   . MET A 1 60  ? 5.273   4.872   15.847 1.00 0.00 ? 60  MET A CE   2  
ATOM 2735  H H    . MET A 1 60  ? 4.139   1.499   14.097 1.00 0.00 ? 60  MET A H    2  
ATOM 2736  H HA   . MET A 1 60  ? 5.718   2.449   16.208 1.00 0.00 ? 60  MET A HA   2  
ATOM 2737  H HB2  . MET A 1 60  ? 3.006   1.059   15.984 1.00 0.00 ? 60  MET A HB2  2  
ATOM 2738  H HB3  . MET A 1 60  ? 3.659   1.490   17.552 1.00 0.00 ? 60  MET A HB3  2  
ATOM 2739  H HG2  . MET A 1 60  ? 3.151   3.438   15.250 1.00 0.00 ? 60  MET A HG2  2  
ATOM 2740  H HG3  . MET A 1 60  ? 2.149   3.270   16.678 1.00 0.00 ? 60  MET A HG3  2  
ATOM 2741  H HE1  . MET A 1 60  ? 5.118   4.231   14.980 1.00 0.00 ? 60  MET A HE1  2  
ATOM 2742  H HE2  . MET A 1 60  ? 5.021   5.900   15.590 1.00 0.00 ? 60  MET A HE2  2  
ATOM 2743  H HE3  . MET A 1 60  ? 6.318   4.821   16.155 1.00 0.00 ? 60  MET A HE3  2  
ATOM 2744  N N    . ARG A 1 61  ? 6.415   0.459   17.612 1.00 0.00 ? 61  ARG A N    2  
ATOM 2745  C CA   . ARG A 1 61  ? 7.061   -0.677  18.248 1.00 0.00 ? 61  ARG A CA   2  
ATOM 2746  C C    . ARG A 1 61  ? 6.678   -0.745  19.728 1.00 0.00 ? 61  ARG A C    2  
ATOM 2747  O O    . ARG A 1 61  ? 6.687   0.270   20.422 1.00 0.00 ? 61  ARG A O    2  
ATOM 2748  C CB   . ARG A 1 61  ? 8.583   -0.584  18.125 1.00 0.00 ? 61  ARG A CB   2  
ATOM 2749  C CG   . ARG A 1 61  ? 9.005   -0.387  16.668 1.00 0.00 ? 61  ARG A CG   2  
ATOM 2750  C CD   . ARG A 1 61  ? 10.401  0.232   16.580 1.00 0.00 ? 61  ARG A CD   2  
ATOM 2751  N NE   . ARG A 1 61  ? 10.941  0.072   15.212 1.00 0.00 ? 61  ARG A NE   2  
ATOM 2752  C CZ   . ARG A 1 61  ? 12.153  0.497   14.827 1.00 0.00 ? 61  ARG A CZ   2  
ATOM 2753  N NH1  . ARG A 1 61  ? 12.957  1.111   15.706 1.00 0.00 ? 61  ARG A NH1  2  
ATOM 2754  N NH2  . ARG A 1 61  ? 12.559  0.308   13.565 1.00 0.00 ? 61  ARG A NH2  2  
ATOM 2755  H H    . ARG A 1 61  ? 6.542   1.334   18.079 1.00 0.00 ? 61  ARG A H    2  
ATOM 2756  H HA   . ARG A 1 61  ? 6.691   -1.548  17.706 1.00 0.00 ? 61  ARG A HA   2  
ATOM 2757  H HB2  . ARG A 1 61  ? 8.950   0.246   18.729 1.00 0.00 ? 61  ARG A HB2  2  
ATOM 2758  H HB3  . ARG A 1 61  ? 9.040   -1.492  18.521 1.00 0.00 ? 61  ARG A HB3  2  
ATOM 2759  H HG2  . ARG A 1 61  ? 8.996   -1.346  16.150 1.00 0.00 ? 61  ARG A HG2  2  
ATOM 2760  H HG3  . ARG A 1 61  ? 8.286   0.256   16.161 1.00 0.00 ? 61  ARG A HG3  2  
ATOM 2761  H HD2  . ARG A 1 61  ? 10.356  1.290   16.840 1.00 0.00 ? 61  ARG A HD2  2  
ATOM 2762  H HD3  . ARG A 1 61  ? 11.066  -0.245  17.301 1.00 0.00 ? 61  ARG A HD3  2  
ATOM 2763  H HE   . ARG A 1 61  ? 10.366  -0.383  14.531 1.00 0.00 ? 61  ARG A HE   2  
ATOM 2764  H HH11 . ARG A 1 61  ? 12.653  1.252   16.648 1.00 0.00 ? 61  ARG A HH11 2  
ATOM 2765  H HH12 . ARG A 1 61  ? 13.861  1.429   15.419 1.00 0.00 ? 61  ARG A HH12 2  
ATOM 2766  H HH21 . ARG A 1 61  ? 11.959  -0.150  12.909 1.00 0.00 ? 61  ARG A HH21 2  
ATOM 2767  H HH22 . ARG A 1 61  ? 13.463  0.625   13.278 1.00 0.00 ? 61  ARG A HH22 2  
ATOM 2768  N N    . ASP A 1 62  ? 6.351   -1.952  20.166 1.00 0.00 ? 62  ASP A N    2  
ATOM 2769  C CA   . ASP A 1 62  ? 5.966   -2.166  21.551 1.00 0.00 ? 62  ASP A CA   2  
ATOM 2770  C C    . ASP A 1 62  ? 6.874   -1.337  22.462 1.00 0.00 ? 62  ASP A C    2  
ATOM 2771  O O    . ASP A 1 62  ? 8.096   -1.373  22.326 1.00 0.00 ? 62  ASP A O    2  
ATOM 2772  C CB   . ASP A 1 62  ? 6.118   -3.637  21.944 1.00 0.00 ? 62  ASP A CB   2  
ATOM 2773  C CG   . ASP A 1 62  ? 5.274   -4.615  21.125 1.00 0.00 ? 62  ASP A CG   2  
ATOM 2774  O OD1  . ASP A 1 62  ? 4.123   -4.862  21.547 1.00 0.00 ? 62  ASP A OD1  2  
ATOM 2775  O OD2  . ASP A 1 62  ? 5.798   -5.095  20.097 1.00 0.00 ? 62  ASP A OD2  2  
ATOM 2776  H H    . ASP A 1 62  ? 6.346   -2.772  19.595 1.00 0.00 ? 62  ASP A H    2  
ATOM 2777  H HA   . ASP A 1 62  ? 4.923   -1.857  21.609 1.00 0.00 ? 62  ASP A HA   2  
ATOM 2778  H HB2  . ASP A 1 62  ? 7.167   -3.917  21.847 1.00 0.00 ? 62  ASP A HB2  2  
ATOM 2779  H HB3  . ASP A 1 62  ? 5.855   -3.745  22.996 1.00 0.00 ? 62  ASP A HB3  2  
ATOM 2780  N N    . PRO A 1 63  ? 6.224   -0.590  23.395 1.00 0.00 ? 63  PRO A N    2  
ATOM 2781  C CA   . PRO A 1 63  ? 6.960   0.246   24.328 1.00 0.00 ? 63  PRO A CA   2  
ATOM 2782  C C    . PRO A 1 63  ? 7.623   -0.599  25.417 1.00 0.00 ? 63  PRO A C    2  
ATOM 2783  O O    . PRO A 1 63  ? 8.414   -0.089  26.209 1.00 0.00 ? 63  PRO A O    2  
ATOM 2784  C CB   . PRO A 1 63  ? 5.931   1.221   24.877 1.00 0.00 ? 63  PRO A CB   2  
ATOM 2785  C CG   . PRO A 1 63  ? 4.573   0.602   24.587 1.00 0.00 ? 63  PRO A CG   2  
ATOM 2786  C CD   . PRO A 1 63  ? 4.779   -0.522  23.585 1.00 0.00 ? 63  PRO A CD   2  
ATOM 2787  H HA   . PRO A 1 63  ? 7.705   0.720   23.858 1.00 0.00 ? 63  PRO A HA   2  
ATOM 2788  H HB2  . PRO A 1 63  ? 6.070   1.374   25.948 1.00 0.00 ? 63  PRO A HB2  2  
ATOM 2789  H HB3  . PRO A 1 63  ? 6.025   2.197   24.402 1.00 0.00 ? 63  PRO A HB3  2  
ATOM 2790  H HG2  . PRO A 1 63  ? 4.125   0.219   25.504 1.00 0.00 ? 63  PRO A HG2  2  
ATOM 2791  H HG3  . PRO A 1 63  ? 3.890   1.351   24.186 1.00 0.00 ? 63  PRO A HG3  2  
ATOM 2792  H HD2  . PRO A 1 63  ? 4.384   -1.466  23.962 1.00 0.00 ? 63  PRO A HD2  2  
ATOM 2793  H HD3  . PRO A 1 63  ? 4.265   -0.315  22.646 1.00 0.00 ? 63  PRO A HD3  2  
ATOM 2794  N N    . ALA A 1 64  ? 7.277   -1.878  25.422 1.00 0.00 ? 64  ALA A N    2  
ATOM 2795  C CA   . ALA A 1 64  ? 7.829   -2.799  26.400 1.00 0.00 ? 64  ALA A CA   2  
ATOM 2796  C C    . ALA A 1 64  ? 8.722   -3.817  25.689 1.00 0.00 ? 64  ALA A C    2  
ATOM 2797  O O    . ALA A 1 64  ? 9.787   -4.172  26.192 1.00 0.00 ? 64  ALA A O    2  
ATOM 2798  C CB   . ALA A 1 64  ? 6.689   -3.465  27.175 1.00 0.00 ? 64  ALA A CB   2  
ATOM 2799  H H    . ALA A 1 64  ? 6.633   -2.285  24.774 1.00 0.00 ? 64  ALA A H    2  
ATOM 2800  H HA   . ALA A 1 64  ? 8.435   -2.220  27.097 1.00 0.00 ? 64  ALA A HA   2  
ATOM 2801  H HB1  . ALA A 1 64  ? 6.941   -3.497  28.235 1.00 0.00 ? 64  ALA A HB1  2  
ATOM 2802  H HB2  . ALA A 1 64  ? 5.773   -2.891  27.037 1.00 0.00 ? 64  ALA A HB2  2  
ATOM 2803  H HB3  . ALA A 1 64  ? 6.543   -4.479  26.805 1.00 0.00 ? 64  ALA A HB3  2  
ATOM 2804  N N    . SER A 1 65  ? 8.256   -4.258  24.530 1.00 0.00 ? 65  SER A N    2  
ATOM 2805  C CA   . SER A 1 65  ? 8.999   -5.229  23.744 1.00 0.00 ? 65  SER A CA   2  
ATOM 2806  C C    . SER A 1 65  ? 10.021  -4.512  22.859 1.00 0.00 ? 65  SER A C    2  
ATOM 2807  O O    . SER A 1 65  ? 11.127  -5.010  22.654 1.00 0.00 ? 65  SER A O    2  
ATOM 2808  C CB   . SER A 1 65  ? 8.060   -6.080  22.888 1.00 0.00 ? 65  SER A CB   2  
ATOM 2809  O OG   . SER A 1 65  ? 7.973   -7.421  23.363 1.00 0.00 ? 65  SER A OG   2  
ATOM 2810  H H    . SER A 1 65  ? 7.388   -3.965  24.128 1.00 0.00 ? 65  SER A H    2  
ATOM 2811  H HA   . SER A 1 65  ? 9.503   -5.864  24.472 1.00 0.00 ? 65  SER A HA   2  
ATOM 2812  H HB2  . SER A 1 65  ? 7.066   -5.632  22.885 1.00 0.00 ? 65  SER A HB2  2  
ATOM 2813  H HB3  . SER A 1 65  ? 8.411   -6.083  21.857 1.00 0.00 ? 65  SER A HB3  2  
ATOM 2814  H HG   . SER A 1 65  ? 8.373   -8.047  22.694 1.00 0.00 ? 65  SER A HG   2  
ATOM 2815  N N    . LYS A 1 66  ? 9.614   -3.355  22.357 1.00 0.00 ? 66  LYS A N    2  
ATOM 2816  C CA   . LYS A 1 66  ? 10.480  -2.566  21.499 1.00 0.00 ? 66  LYS A CA   2  
ATOM 2817  C C    . LYS A 1 66  ? 10.866  -3.393  20.271 1.00 0.00 ? 66  LYS A C    2  
ATOM 2818  O O    . LYS A 1 66  ? 11.921  -3.176  19.679 1.00 0.00 ? 66  LYS A O    2  
ATOM 2819  C CB   . LYS A 1 66  ? 11.680  -2.039  22.288 1.00 0.00 ? 66  LYS A CB   2  
ATOM 2820  C CG   . LYS A 1 66  ? 11.663  -0.511  22.357 1.00 0.00 ? 66  LYS A CG   2  
ATOM 2821  C CD   . LYS A 1 66  ? 10.871  -0.026  23.573 1.00 0.00 ? 66  LYS A CD   2  
ATOM 2822  C CE   . LYS A 1 66  ? 11.527  1.207   24.198 1.00 0.00 ? 66  LYS A CE   2  
ATOM 2823  N NZ   . LYS A 1 66  ? 11.864  0.952   25.616 1.00 0.00 ? 66  LYS A NZ   2  
ATOM 2824  H H    . LYS A 1 66  ? 8.712   -2.958  22.529 1.00 0.00 ? 66  LYS A H    2  
ATOM 2825  H HA   . LYS A 1 66  ? 9.908   -1.700  21.166 1.00 0.00 ? 66  LYS A HA   2  
ATOM 2826  H HB2  . LYS A 1 66  ? 11.668  -2.452  23.296 1.00 0.00 ? 66  LYS A HB2  2  
ATOM 2827  H HB3  . LYS A 1 66  ? 12.605  -2.375  21.817 1.00 0.00 ? 66  LYS A HB3  2  
ATOM 2828  H HG2  . LYS A 1 66  ? 12.685  -0.134  22.410 1.00 0.00 ? 66  LYS A HG2  2  
ATOM 2829  H HG3  . LYS A 1 66  ? 11.221  -0.107  21.446 1.00 0.00 ? 66  LYS A HG3  2  
ATOM 2830  H HD2  . LYS A 1 66  ? 9.850   0.212   23.275 1.00 0.00 ? 66  LYS A HD2  2  
ATOM 2831  H HD3  . LYS A 1 66  ? 10.809  -0.824  24.313 1.00 0.00 ? 66  LYS A HD3  2  
ATOM 2832  H HE2  . LYS A 1 66  ? 12.429  1.467   23.644 1.00 0.00 ? 66  LYS A HE2  2  
ATOM 2833  H HE3  . LYS A 1 66  ? 10.852  2.060   24.127 1.00 0.00 ? 66  LYS A HE3  2  
ATOM 2834  H HZ1  . LYS A 1 66  ? 11.990  1.823   26.091 1.00 0.00 ? 66  LYS A HZ1  2  
ATOM 2835  H HZ2  . LYS A 1 66  ? 11.122  0.440   26.049 1.00 0.00 ? 66  LYS A HZ2  2  
ATOM 2836  H HZ3  . LYS A 1 66  ? 12.710  0.420   25.667 1.00 0.00 ? 66  LYS A HZ3  2  
ATOM 2837  N N    . ARG A 1 67  ? 9.989   -4.325  19.926 1.00 0.00 ? 67  ARG A N    2  
ATOM 2838  C CA   . ARG A 1 67  ? 10.225  -5.186  18.780 1.00 0.00 ? 67  ARG A CA   2  
ATOM 2839  C C    . ARG A 1 67  ? 9.013   -5.170  17.845 1.00 0.00 ? 67  ARG A C    2  
ATOM 2840  O O    . ARG A 1 67  ? 8.387   -6.204  17.617 1.00 0.00 ? 67  ARG A O    2  
ATOM 2841  C CB   . ARG A 1 67  ? 10.502  -6.625  19.220 1.00 0.00 ? 67  ARG A CB   2  
ATOM 2842  C CG   . ARG A 1 67  ? 11.604  -6.672  20.279 1.00 0.00 ? 67  ARG A CG   2  
ATOM 2843  C CD   . ARG A 1 67  ? 12.520  -7.879  20.065 1.00 0.00 ? 67  ARG A CD   2  
ATOM 2844  N NE   . ARG A 1 67  ? 13.480  -7.992  21.186 1.00 0.00 ? 67  ARG A NE   2  
ATOM 2845  C CZ   . ARG A 1 67  ? 14.403  -8.957  21.290 1.00 0.00 ? 67  ARG A CZ   2  
ATOM 2846  N NH1  . ARG A 1 67  ? 14.498  -9.899  20.341 1.00 0.00 ? 67  ARG A NH1  2  
ATOM 2847  N NH2  . ARG A 1 67  ? 15.232  -8.981  22.342 1.00 0.00 ? 67  ARG A NH2  2  
ATOM 2848  H H    . ARG A 1 67  ? 9.133   -4.495  20.413 1.00 0.00 ? 67  ARG A H    2  
ATOM 2849  H HA   . ARG A 1 67  ? 11.103  -4.765  18.291 1.00 0.00 ? 67  ARG A HA   2  
ATOM 2850  H HB2  . ARG A 1 67  ? 9.589   -7.069  19.619 1.00 0.00 ? 67  ARG A HB2  2  
ATOM 2851  H HB3  . ARG A 1 67  ? 10.796  -7.223  18.357 1.00 0.00 ? 67  ARG A HB3  2  
ATOM 2852  H HG2  . ARG A 1 67  ? 12.191  -5.755  20.240 1.00 0.00 ? 67  ARG A HG2  2  
ATOM 2853  H HG3  . ARG A 1 67  ? 11.157  -6.722  21.272 1.00 0.00 ? 67  ARG A HG3  2  
ATOM 2854  H HD2  . ARG A 1 67  ? 11.924  -8.789  19.992 1.00 0.00 ? 67  ARG A HD2  2  
ATOM 2855  H HD3  . ARG A 1 67  ? 13.058  -7.775  19.123 1.00 0.00 ? 67  ARG A HD3  2  
ATOM 2856  H HE   . ARG A 1 67  ? 13.436  -7.305  21.911 1.00 0.00 ? 67  ARG A HE   2  
ATOM 2857  H HH11 . ARG A 1 67  ? 13.879  -9.882  19.556 1.00 0.00 ? 67  ARG A HH11 2  
ATOM 2858  H HH12 . ARG A 1 67  ? 15.187  -10.620 20.419 1.00 0.00 ? 67  ARG A HH12 2  
ATOM 2859  H HH21 . ARG A 1 67  ? 15.162  -8.278  23.050 1.00 0.00 ? 67  ARG A HH21 2  
ATOM 2860  H HH22 . ARG A 1 67  ? 15.921  -9.701  22.420 1.00 0.00 ? 67  ARG A HH22 2  
ATOM 2861  N N    . SER A 1 68  ? 8.720   -3.985  17.330 1.00 0.00 ? 68  SER A N    2  
ATOM 2862  C CA   . SER A 1 68  ? 7.595   -3.821  16.425 1.00 0.00 ? 68  SER A CA   2  
ATOM 2863  C C    . SER A 1 68  ? 6.292   -4.192  17.137 1.00 0.00 ? 68  SER A C    2  
ATOM 2864  O O    . SER A 1 68  ? 6.195   -5.256  17.746 1.00 0.00 ? 68  SER A O    2  
ATOM 2865  C CB   . SER A 1 68  ? 7.772   -4.670  15.166 1.00 0.00 ? 68  SER A CB   2  
ATOM 2866  O OG   . SER A 1 68  ? 9.038   -4.453  14.549 1.00 0.00 ? 68  SER A OG   2  
ATOM 2867  H H    . SER A 1 68  ? 9.235   -3.149  17.521 1.00 0.00 ? 68  SER A H    2  
ATOM 2868  H HA   . SER A 1 68  ? 7.595   -2.765  16.154 1.00 0.00 ? 68  SER A HA   2  
ATOM 2869  H HB2  . SER A 1 68  ? 7.670   -5.725  15.422 1.00 0.00 ? 68  SER A HB2  2  
ATOM 2870  H HB3  . SER A 1 68  ? 6.978   -4.436  14.456 1.00 0.00 ? 68  SER A HB3  2  
ATOM 2871  H HG   . SER A 1 68  ? 9.215   -5.167  13.871 1.00 0.00 ? 68  SER A HG   2  
ATOM 2872  N N    . ARG A 1 69  ? 5.323   -3.294  17.037 1.00 0.00 ? 69  ARG A N    2  
ATOM 2873  C CA   . ARG A 1 69  ? 4.031   -3.514  17.664 1.00 0.00 ? 69  ARG A CA   2  
ATOM 2874  C C    . ARG A 1 69  ? 3.122   -4.321  16.736 1.00 0.00 ? 69  ARG A C    2  
ATOM 2875  O O    . ARG A 1 69  ? 2.342   -5.155  17.195 1.00 0.00 ? 69  ARG A O    2  
ATOM 2876  C CB   . ARG A 1 69  ? 3.351   -2.187  18.005 1.00 0.00 ? 69  ARG A CB   2  
ATOM 2877  C CG   . ARG A 1 69  ? 3.044   -2.097  19.501 1.00 0.00 ? 69  ARG A CG   2  
ATOM 2878  C CD   . ARG A 1 69  ? 1.546   -2.265  19.764 1.00 0.00 ? 69  ARG A CD   2  
ATOM 2879  N NE   . ARG A 1 69  ? 1.136   -3.659  19.483 1.00 0.00 ? 69  ARG A NE   2  
ATOM 2880  C CZ   . ARG A 1 69  ? -0.135  -4.082  19.480 1.00 0.00 ? 69  ARG A CZ   2  
ATOM 2881  N NH1  . ARG A 1 69  ? -1.129  -3.222  19.743 1.00 0.00 ? 69  ARG A NH1  2  
ATOM 2882  N NH2  . ARG A 1 69  ? -0.414  -5.366  19.214 1.00 0.00 ? 69  ARG A NH2  2  
ATOM 2883  H H    . ARG A 1 69  ? 5.410   -2.431  16.540 1.00 0.00 ? 69  ARG A H    2  
ATOM 2884  H HA   . ARG A 1 69  ? 4.254   -4.070  18.575 1.00 0.00 ? 69  ARG A HA   2  
ATOM 2885  H HB2  . ARG A 1 69  ? 3.996   -1.358  17.713 1.00 0.00 ? 69  ARG A HB2  2  
ATOM 2886  H HB3  . ARG A 1 69  ? 2.428   -2.089  17.434 1.00 0.00 ? 69  ARG A HB3  2  
ATOM 2887  H HG2  . ARG A 1 69  ? 3.599   -2.866  20.037 1.00 0.00 ? 69  ARG A HG2  2  
ATOM 2888  H HG3  . ARG A 1 69  ? 3.378   -1.134  19.888 1.00 0.00 ? 69  ARG A HG3  2  
ATOM 2889  H HD2  . ARG A 1 69  ? 1.319   -2.012  20.800 1.00 0.00 ? 69  ARG A HD2  2  
ATOM 2890  H HD3  . ARG A 1 69  ? 0.979   -1.577  19.137 1.00 0.00 ? 69  ARG A HD3  2  
ATOM 2891  H HE   . ARG A 1 69  ? 1.853   -4.327  19.283 1.00 0.00 ? 69  ARG A HE   2  
ATOM 2892  H HH11 . ARG A 1 69  ? -0.921  -2.264  19.942 1.00 0.00 ? 69  ARG A HH11 2  
ATOM 2893  H HH12 . ARG A 1 69  ? -2.077  -3.538  19.741 1.00 0.00 ? 69  ARG A HH12 2  
ATOM 2894  H HH21 . ARG A 1 69  ? 0.327   -6.008  19.018 1.00 0.00 ? 69  ARG A HH21 2  
ATOM 2895  H HH22 . ARG A 1 69  ? -1.362  -5.682  19.212 1.00 0.00 ? 69  ARG A HH22 2  
ATOM 2896  N N    . GLY A 1 70  ? 3.251   -4.046  15.446 1.00 0.00 ? 70  GLY A N    2  
ATOM 2897  C CA   . GLY A 1 70  ? 2.451   -4.736  14.449 1.00 0.00 ? 70  GLY A CA   2  
ATOM 2898  C C    . GLY A 1 70  ? 1.481   -3.772  13.762 1.00 0.00 ? 70  GLY A C    2  
ATOM 2899  O O    . GLY A 1 70  ? 0.516   -4.202  13.131 1.00 0.00 ? 70  GLY A O    2  
ATOM 2900  H H    . GLY A 1 70  ? 3.888   -3.366  15.081 1.00 0.00 ? 70  GLY A H    2  
ATOM 2901  H HA2  . GLY A 1 70  ? 3.104   -5.192  13.705 1.00 0.00 ? 70  GLY A HA2  2  
ATOM 2902  H HA3  . GLY A 1 70  ? 1.892   -5.544  14.922 1.00 0.00 ? 70  GLY A HA3  2  
ATOM 2903  N N    . PHE A 1 71  ? 1.771   -2.488  13.907 1.00 0.00 ? 71  PHE A N    2  
ATOM 2904  C CA   . PHE A 1 71  ? 0.936   -1.460  13.309 1.00 0.00 ? 71  PHE A CA   2  
ATOM 2905  C C    . PHE A 1 71  ? 1.704   -0.144  13.167 1.00 0.00 ? 71  PHE A C    2  
ATOM 2906  O O    . PHE A 1 71  ? 2.575   0.161   13.980 1.00 0.00 ? 71  PHE A O    2  
ATOM 2907  C CB   . PHE A 1 71  ? -0.252  -1.245  14.248 1.00 0.00 ? 71  PHE A CB   2  
ATOM 2908  C CG   . PHE A 1 71  ? -0.029  -0.150  15.293 1.00 0.00 ? 71  PHE A CG   2  
ATOM 2909  C CD1  . PHE A 1 71  ? 0.028   1.154   14.910 1.00 0.00 ? 71  PHE A CD1  2  
ATOM 2910  C CD2  . PHE A 1 71  ? 0.112   -0.481  16.605 1.00 0.00 ? 71  PHE A CD2  2  
ATOM 2911  C CE1  . PHE A 1 71  ? 0.235   2.170   15.880 1.00 0.00 ? 71  PHE A CE1  2  
ATOM 2912  C CE2  . PHE A 1 71  ? 0.319   0.536   17.575 1.00 0.00 ? 71  PHE A CE2  2  
ATOM 2913  C CZ   . PHE A 1 71  ? 0.376   1.839   17.192 1.00 0.00 ? 71  PHE A CZ   2  
ATOM 2914  H H    . PHE A 1 71  ? 2.557   -2.147  14.422 1.00 0.00 ? 71  PHE A H    2  
ATOM 2915  H HA   . PHE A 1 71  ? 0.644   -1.816  12.321 1.00 0.00 ? 71  PHE A HA   2  
ATOM 2916  H HB2  . PHE A 1 71  ? -1.131  -0.993  13.654 1.00 0.00 ? 71  PHE A HB2  2  
ATOM 2917  H HB3  . PHE A 1 71  ? -0.472  -2.182  14.760 1.00 0.00 ? 71  PHE A HB3  2  
ATOM 2918  H HD1  . PHE A 1 71  ? -0.084  1.419   13.859 1.00 0.00 ? 71  PHE A HD1  2  
ATOM 2919  H HD2  . PHE A 1 71  ? 0.065   -1.526  16.911 1.00 0.00 ? 71  PHE A HD2  2  
ATOM 2920  H HE1  . PHE A 1 71  ? 0.282   3.215   15.574 1.00 0.00 ? 71  PHE A HE1  2  
ATOM 2921  H HE2  . PHE A 1 71  ? 0.431   0.271   18.626 1.00 0.00 ? 71  PHE A HE2  2  
ATOM 2922  H HZ   . PHE A 1 71  ? 0.535   2.619   17.937 1.00 0.00 ? 71  PHE A HZ   2  
ATOM 2923  N N    . GLY A 1 72  ? 1.353   0.600   12.129 1.00 0.00 ? 72  GLY A N    2  
ATOM 2924  C CA   . GLY A 1 72  ? 1.998   1.876   11.870 1.00 0.00 ? 72  GLY A CA   2  
ATOM 2925  C C    . GLY A 1 72  ? 1.089   2.794   11.051 1.00 0.00 ? 72  GLY A C    2  
ATOM 2926  O O    . GLY A 1 72  ? -0.115  2.559   10.957 1.00 0.00 ? 72  GLY A O    2  
ATOM 2927  H H    . GLY A 1 72  ? 0.643   0.345   11.472 1.00 0.00 ? 72  GLY A H    2  
ATOM 2928  H HA2  . GLY A 1 72  ? 2.250   2.358   12.815 1.00 0.00 ? 72  GLY A HA2  2  
ATOM 2929  H HA3  . GLY A 1 72  ? 2.934   1.713   11.336 1.00 0.00 ? 72  GLY A HA3  2  
ATOM 2930  N N    . PHE A 1 73  ? 1.700   3.821   10.477 1.00 0.00 ? 73  PHE A N    2  
ATOM 2931  C CA   . PHE A 1 73  ? 0.961   4.775   9.668  1.00 0.00 ? 73  PHE A CA   2  
ATOM 2932  C C    . PHE A 1 73  ? 1.577   4.906   8.274  1.00 0.00 ? 73  PHE A C    2  
ATOM 2933  O O    . PHE A 1 73  ? 2.793   4.804   8.117  1.00 0.00 ? 73  PHE A O    2  
ATOM 2934  C CB   . PHE A 1 73  ? 1.047   6.126   10.380 1.00 0.00 ? 73  PHE A CB   2  
ATOM 2935  C CG   . PHE A 1 73  ? 0.811   6.050   11.890 1.00 0.00 ? 73  PHE A CG   2  
ATOM 2936  C CD1  . PHE A 1 73  ? 1.854   5.814   12.730 1.00 0.00 ? 73  PHE A CD1  2  
ATOM 2937  C CD2  . PHE A 1 73  ? -0.441  6.220   12.392 1.00 0.00 ? 73  PHE A CD2  2  
ATOM 2938  C CE1  . PHE A 1 73  ? 1.635   5.743   14.131 1.00 0.00 ? 73  PHE A CE1  2  
ATOM 2939  C CE2  . PHE A 1 73  ? -0.660  6.150   13.793 1.00 0.00 ? 73  PHE A CE2  2  
ATOM 2940  C CZ   . PHE A 1 73  ? 0.383   5.913   14.634 1.00 0.00 ? 73  PHE A CZ   2  
ATOM 2941  H H    . PHE A 1 73  ? 2.679   4.004   10.558 1.00 0.00 ? 73  PHE A H    2  
ATOM 2942  H HA   . PHE A 1 73  ? -0.059  4.401   9.579  1.00 0.00 ? 73  PHE A HA   2  
ATOM 2943  H HB2  . PHE A 1 73  ? 2.030   6.560   10.198 1.00 0.00 ? 73  PHE A HB2  2  
ATOM 2944  H HB3  . PHE A 1 73  ? 0.314   6.804   9.942  1.00 0.00 ? 73  PHE A HB3  2  
ATOM 2945  H HD1  . PHE A 1 73  ? 2.858   5.678   12.328 1.00 0.00 ? 73  PHE A HD1  2  
ATOM 2946  H HD2  . PHE A 1 73  ? -1.277  6.410   11.719 1.00 0.00 ? 73  PHE A HD2  2  
ATOM 2947  H HE1  . PHE A 1 73  ? 2.471   5.553   14.805 1.00 0.00 ? 73  PHE A HE1  2  
ATOM 2948  H HE2  . PHE A 1 73  ? -1.664  6.286   14.196 1.00 0.00 ? 73  PHE A HE2  2  
ATOM 2949  H HZ   . PHE A 1 73  ? 0.215   5.859   15.709 1.00 0.00 ? 73  PHE A HZ   2  
ATOM 2950  N N    . VAL A 1 74  ? 0.711   5.129   7.297  1.00 0.00 ? 74  VAL A N    2  
ATOM 2951  C CA   . VAL A 1 74  ? 1.155   5.275   5.922  1.00 0.00 ? 74  VAL A CA   2  
ATOM 2952  C C    . VAL A 1 74  ? 0.509   6.521   5.311  1.00 0.00 ? 74  VAL A C    2  
ATOM 2953  O O    . VAL A 1 74  ? -0.715  6.621   5.246  1.00 0.00 ? 74  VAL A O    2  
ATOM 2954  C CB   . VAL A 1 74  ? 0.852   3.998   5.136  1.00 0.00 ? 74  VAL A CB   2  
ATOM 2955  C CG1  . VAL A 1 74  ? 1.715   2.834   5.626  1.00 0.00 ? 74  VAL A CG1  2  
ATOM 2956  C CG2  . VAL A 1 74  ? -0.636  3.648   5.212  1.00 0.00 ? 74  VAL A CG2  2  
ATOM 2957  H H    . VAL A 1 74  ? -0.277  5.211   7.433  1.00 0.00 ? 74  VAL A H    2  
ATOM 2958  H HA   . VAL A 1 74  ? 2.236   5.413   5.938  1.00 0.00 ? 74  VAL A HA   2  
ATOM 2959  H HB   . VAL A 1 74  ? 1.099   4.182   4.090  1.00 0.00 ? 74  VAL A HB   2  
ATOM 2960  H HG11 . VAL A 1 74  ? 2.660   3.219   6.010  1.00 0.00 ? 74  VAL A HG11 2  
ATOM 2961  H HG12 . VAL A 1 74  ? 1.191   2.302   6.420  1.00 0.00 ? 74  VAL A HG12 2  
ATOM 2962  H HG13 . VAL A 1 74  ? 1.910   2.152   4.798  1.00 0.00 ? 74  VAL A HG13 2  
ATOM 2963  H HG21 . VAL A 1 74  ? -1.191  4.503   5.596  1.00 0.00 ? 74  VAL A HG21 2  
ATOM 2964  H HG22 . VAL A 1 74  ? -1.001  3.395   4.216  1.00 0.00 ? 74  VAL A HG22 2  
ATOM 2965  H HG23 . VAL A 1 74  ? -0.775  2.795   5.877  1.00 0.00 ? 74  VAL A HG23 2  
ATOM 2966  N N    . THR A 1 75  ? 1.361   7.439   4.879  1.00 0.00 ? 75  THR A N    2  
ATOM 2967  C CA   . THR A 1 75  ? 0.889   8.674   4.276  1.00 0.00 ? 75  THR A CA   2  
ATOM 2968  C C    . THR A 1 75  ? 1.257   8.717   2.792  1.00 0.00 ? 75  THR A C    2  
ATOM 2969  O O    . THR A 1 75  ? 2.432   8.822   2.442  1.00 0.00 ? 75  THR A O    2  
ATOM 2970  C CB   . THR A 1 75  ? 1.464   9.842   5.079  1.00 0.00 ? 75  THR A CB   2  
ATOM 2971  O OG1  . THR A 1 75  ? 1.454   9.376   6.426  1.00 0.00 ? 75  THR A OG1  2  
ATOM 2972  C CG2  . THR A 1 75  ? 0.533   11.055  5.097  1.00 0.00 ? 75  THR A CG2  2  
ATOM 2973  H H    . THR A 1 75  ? 2.356   7.349   4.936  1.00 0.00 ? 75  THR A H    2  
ATOM 2974  H HA   . THR A 1 75  ? -0.199  8.691   4.337  1.00 0.00 ? 75  THR A HA   2  
ATOM 2975  H HB   . THR A 1 75  ? 2.454   10.116  4.713  1.00 0.00 ? 75  THR A HB   2  
ATOM 2976  H HG1  . THR A 1 75  ? 0.534   9.077   6.677  1.00 0.00 ? 75  THR A HG1  2  
ATOM 2977  H HG21 . THR A 1 75  ? -0.254  10.899  5.835  1.00 0.00 ? 75  THR A HG21 2  
ATOM 2978  H HG22 . THR A 1 75  ? 1.103   11.947  5.357  1.00 0.00 ? 75  THR A HG22 2  
ATOM 2979  H HG23 . THR A 1 75  ? 0.085   11.184  4.111  1.00 0.00 ? 75  THR A HG23 2  
ATOM 2980  N N    . PHE A 1 76  ? 0.231   8.634   1.958  1.00 0.00 ? 76  PHE A N    2  
ATOM 2981  C CA   . PHE A 1 76  ? 0.431   8.662   0.519  1.00 0.00 ? 76  PHE A CA   2  
ATOM 2982  C C    . PHE A 1 76  ? 0.665   10.091  0.026  1.00 0.00 ? 76  PHE A C    2  
ATOM 2983  O O    . PHE A 1 76  ? 0.537   11.045  0.793  1.00 0.00 ? 76  PHE A O    2  
ATOM 2984  C CB   . PHE A 1 76  ? -0.847  8.117   -0.121 1.00 0.00 ? 76  PHE A CB   2  
ATOM 2985  C CG   . PHE A 1 76  ? -0.942  6.590   -0.117 1.00 0.00 ? 76  PHE A CG   2  
ATOM 2986  C CD1  . PHE A 1 76  ? -0.223  5.861   -1.012 1.00 0.00 ? 76  PHE A CD1  2  
ATOM 2987  C CD2  . PHE A 1 76  ? -1.747  5.961   0.782  1.00 0.00 ? 76  PHE A CD2  2  
ATOM 2988  C CE1  . PHE A 1 76  ? -0.312  4.444   -1.009 1.00 0.00 ? 76  PHE A CE1  2  
ATOM 2989  C CE2  . PHE A 1 76  ? -1.835  4.544   0.785  1.00 0.00 ? 76  PHE A CE2  2  
ATOM 2990  C CZ   . PHE A 1 76  ? -1.116  3.815   -0.110 1.00 0.00 ? 76  PHE A CZ   2  
ATOM 2991  H H    . PHE A 1 76  ? -0.722  8.549   2.250  1.00 0.00 ? 76  PHE A H    2  
ATOM 2992  H HA   . PHE A 1 76  ? 1.311   8.057   0.303  1.00 0.00 ? 76  PHE A HA   2  
ATOM 2993  H HB2  . PHE A 1 76  ? -1.709  8.526   0.406  1.00 0.00 ? 76  PHE A HB2  2  
ATOM 2994  H HB3  . PHE A 1 76  ? -0.905  8.472   -1.150 1.00 0.00 ? 76  PHE A HB3  2  
ATOM 2995  H HD1  . PHE A 1 76  ? 0.421   6.365   -1.733 1.00 0.00 ? 76  PHE A HD1  2  
ATOM 2996  H HD2  . PHE A 1 76  ? -2.323  6.545   1.499  1.00 0.00 ? 76  PHE A HD2  2  
ATOM 2997  H HE1  . PHE A 1 76  ? 0.265   3.860   -1.726 1.00 0.00 ? 76  PHE A HE1  2  
ATOM 2998  H HE2  . PHE A 1 76  ? -2.480  4.040   1.506  1.00 0.00 ? 76  PHE A HE2  2  
ATOM 2999  H HZ   . PHE A 1 76  ? -1.184  2.727   -0.107 1.00 0.00 ? 76  PHE A HZ   2  
ATOM 3000  N N    . SER A 1 77  ? 1.002   10.195  -1.251 1.00 0.00 ? 77  SER A N    2  
ATOM 3001  C CA   . SER A 1 77  ? 1.255   11.492  -1.855 1.00 0.00 ? 77  SER A CA   2  
ATOM 3002  C C    . SER A 1 77  ? -0.064  12.127  -2.302 1.00 0.00 ? 77  SER A C    2  
ATOM 3003  O O    . SER A 1 77  ? -0.309  13.304  -2.044 1.00 0.00 ? 77  SER A O    2  
ATOM 3004  C CB   . SER A 1 77  ? 2.214   11.370  -3.041 1.00 0.00 ? 77  SER A CB   2  
ATOM 3005  O OG   . SER A 1 77  ? 1.785   12.146  -4.156 1.00 0.00 ? 77  SER A OG   2  
ATOM 3006  H H    . SER A 1 77  ? 1.104   9.415   -1.868 1.00 0.00 ? 77  SER A H    2  
ATOM 3007  H HA   . SER A 1 77  ? 1.721   12.090  -1.072 1.00 0.00 ? 77  SER A HA   2  
ATOM 3008  H HB2  . SER A 1 77  ? 3.210   11.692  -2.736 1.00 0.00 ? 77  SER A HB2  2  
ATOM 3009  H HB3  . SER A 1 77  ? 2.294   10.324  -3.336 1.00 0.00 ? 77  SER A HB3  2  
ATOM 3010  H HG   . SER A 1 77  ? 1.555   13.073  -3.860 1.00 0.00 ? 77  SER A HG   2  
ATOM 3011  N N    . SER A 1 78  ? -0.878  11.319  -2.965 1.00 0.00 ? 78  SER A N    2  
ATOM 3012  C CA   . SER A 1 78  ? -2.165  11.787  -3.450 1.00 0.00 ? 78  SER A CA   2  
ATOM 3013  C C    . SER A 1 78  ? -3.295  11.106  -2.675 1.00 0.00 ? 78  SER A C    2  
ATOM 3014  O O    . SER A 1 78  ? -3.112  10.018  -2.131 1.00 0.00 ? 78  SER A O    2  
ATOM 3015  C CB   . SER A 1 78  ? -2.317  11.525  -4.950 1.00 0.00 ? 78  SER A CB   2  
ATOM 3016  O OG   . SER A 1 78  ? -1.116  11.804  -5.664 1.00 0.00 ? 78  SER A OG   2  
ATOM 3017  H H    . SER A 1 78  ? -0.671  10.362  -3.170 1.00 0.00 ? 78  SER A H    2  
ATOM 3018  H HA   . SER A 1 78  ? -2.169  12.861  -3.267 1.00 0.00 ? 78  SER A HA   2  
ATOM 3019  H HB2  . SER A 1 78  ? -2.600  10.484  -5.109 1.00 0.00 ? 78  SER A HB2  2  
ATOM 3020  H HB3  . SER A 1 78  ? -3.126  12.139  -5.345 1.00 0.00 ? 78  SER A HB3  2  
ATOM 3021  H HG   . SER A 1 78  ? -1.168  12.714  -6.077 1.00 0.00 ? 78  SER A HG   2  
ATOM 3022  N N    . MET A 1 79  ? -4.439  11.774  -2.650 1.00 0.00 ? 79  MET A N    2  
ATOM 3023  C CA   . MET A 1 79  ? -5.599  11.247  -1.951 1.00 0.00 ? 79  MET A CA   2  
ATOM 3024  C C    . MET A 1 79  ? -6.304  10.178  -2.788 1.00 0.00 ? 79  MET A C    2  
ATOM 3025  O O    . MET A 1 79  ? -7.173  9.466   -2.287 1.00 0.00 ? 79  MET A O    2  
ATOM 3026  C CB   . MET A 1 79  ? -6.575  12.387  -1.650 1.00 0.00 ? 79  MET A CB   2  
ATOM 3027  C CG   . MET A 1 79  ? -7.951  11.842  -1.264 1.00 0.00 ? 79  MET A CG   2  
ATOM 3028  S SD   . MET A 1 79  ? -7.809  10.779  0.163  1.00 0.00 ? 79  MET A SD   2  
ATOM 3029  C CE   . MET A 1 79  ? -7.710  12.007  1.455  1.00 0.00 ? 79  MET A CE   2  
ATOM 3030  H H    . MET A 1 79  ? -4.579  12.659  -3.095 1.00 0.00 ? 79  MET A H    2  
ATOM 3031  H HA   . MET A 1 79  ? -5.211  10.804  -1.034 1.00 0.00 ? 79  MET A HA   2  
ATOM 3032  H HB2  . MET A 1 79  ? -6.183  13.002  -0.840 1.00 0.00 ? 79  MET A HB2  2  
ATOM 3033  H HB3  . MET A 1 79  ? -6.667  13.032  -2.524 1.00 0.00 ? 79  MET A HB3  2  
ATOM 3034  H HG2  . MET A 1 79  ? -8.630  12.666  -1.047 1.00 0.00 ? 79  MET A HG2  2  
ATOM 3035  H HG3  . MET A 1 79  ? -8.379  11.287  -2.099 1.00 0.00 ? 79  MET A HG3  2  
ATOM 3036  H HE1  . MET A 1 79  ? -8.613  11.968  2.063  1.00 0.00 ? 79  MET A HE1  2  
ATOM 3037  H HE2  . MET A 1 79  ? -6.841  11.806  2.082  1.00 0.00 ? 79  MET A HE2  2  
ATOM 3038  H HE3  . MET A 1 79  ? -7.614  12.997  1.009  1.00 0.00 ? 79  MET A HE3  2  
ATOM 3039  N N    . ALA A 1 80  ? -5.904  10.100  -4.048 1.00 0.00 ? 80  ALA A N    2  
ATOM 3040  C CA   . ALA A 1 80  ? -6.487  9.129   -4.959 1.00 0.00 ? 80  ALA A CA   2  
ATOM 3041  C C    . ALA A 1 80  ? -5.921  7.742   -4.650 1.00 0.00 ? 80  ALA A C    2  
ATOM 3042  O O    . ALA A 1 80  ? -6.675  6.788   -4.463 1.00 0.00 ? 80  ALA A O    2  
ATOM 3043  C CB   . ALA A 1 80  ? -6.219  9.559   -6.403 1.00 0.00 ? 80  ALA A CB   2  
ATOM 3044  H H    . ALA A 1 80  ? -5.196  10.683  -4.448 1.00 0.00 ? 80  ALA A H    2  
ATOM 3045  H HA   . ALA A 1 80  ? -7.563  9.120   -4.790 1.00 0.00 ? 80  ALA A HA   2  
ATOM 3046  H HB1  . ALA A 1 80  ? -5.151  9.494   -6.609 1.00 0.00 ? 80  ALA A HB1  2  
ATOM 3047  H HB2  . ALA A 1 80  ? -6.761  8.903   -7.084 1.00 0.00 ? 80  ALA A HB2  2  
ATOM 3048  H HB3  . ALA A 1 80  ? -6.554  10.587  -6.544 1.00 0.00 ? 80  ALA A HB3  2  
ATOM 3049  N N    . GLU A 1 81  ? -4.599  7.673   -4.605 1.00 0.00 ? 81  GLU A N    2  
ATOM 3050  C CA   . GLU A 1 81  ? -3.924  6.418   -4.321 1.00 0.00 ? 81  GLU A CA   2  
ATOM 3051  C C    . GLU A 1 81  ? -4.410  5.844   -2.989 1.00 0.00 ? 81  GLU A C    2  
ATOM 3052  O O    . GLU A 1 81  ? -4.885  4.710   -2.934 1.00 0.00 ? 81  GLU A O    2  
ATOM 3053  C CB   . GLU A 1 81  ? -2.405  6.601   -4.318 1.00 0.00 ? 81  GLU A CB   2  
ATOM 3054  C CG   . GLU A 1 81  ? -1.919  7.169   -5.653 1.00 0.00 ? 81  GLU A CG   2  
ATOM 3055  C CD   . GLU A 1 81  ? -2.776  6.657   -6.812 1.00 0.00 ? 81  GLU A CD   2  
ATOM 3056  O OE1  . GLU A 1 81  ? -2.619  5.465   -7.151 1.00 0.00 ? 81  GLU A OE1  2  
ATOM 3057  O OE2  . GLU A 1 81  ? -3.570  7.471   -7.332 1.00 0.00 ? 81  GLU A OE2  2  
ATOM 3058  H H    . GLU A 1 81  ? -3.993  8.454   -4.758 1.00 0.00 ? 81  GLU A H    2  
ATOM 3059  H HA   . GLU A 1 81  ? -4.202  5.749   -5.136 1.00 0.00 ? 81  GLU A HA   2  
ATOM 3060  H HB2  . GLU A 1 81  ? -2.117  7.270   -3.507 1.00 0.00 ? 81  GLU A HB2  2  
ATOM 3061  H HB3  . GLU A 1 81  ? -1.920  5.643   -4.128 1.00 0.00 ? 81  GLU A HB3  2  
ATOM 3062  H HG2  . GLU A 1 81  ? -1.954  8.258   -5.623 1.00 0.00 ? 81  GLU A HG2  2  
ATOM 3063  H HG3  . GLU A 1 81  ? -0.878  6.888   -5.814 1.00 0.00 ? 81  GLU A HG3  2  
ATOM 3064  N N    . VAL A 1 82  ? -4.274  6.652   -1.948 1.00 0.00 ? 82  VAL A N    2  
ATOM 3065  C CA   . VAL A 1 82  ? -4.693  6.238   -0.619 1.00 0.00 ? 82  VAL A CA   2  
ATOM 3066  C C    . VAL A 1 82  ? -6.103  5.650   -0.694 1.00 0.00 ? 82  VAL A C    2  
ATOM 3067  O O    . VAL A 1 82  ? -6.360  4.574   -0.157 1.00 0.00 ? 82  VAL A O    2  
ATOM 3068  C CB   . VAL A 1 82  ? -4.587  7.414   0.353  1.00 0.00 ? 82  VAL A CB   2  
ATOM 3069  C CG1  . VAL A 1 82  ? -5.425  8.600   -0.127 1.00 0.00 ? 82  VAL A CG1  2  
ATOM 3070  C CG2  . VAL A 1 82  ? -4.990  6.994   1.768  1.00 0.00 ? 82  VAL A CG2  2  
ATOM 3071  H H    . VAL A 1 82  ? -3.887  7.572   -2.001 1.00 0.00 ? 82  VAL A H    2  
ATOM 3072  H HA   . VAL A 1 82  ? -4.006  5.460   -0.285 1.00 0.00 ? 82  VAL A HA   2  
ATOM 3073  H HB   . VAL A 1 82  ? -3.544  7.732   0.383  1.00 0.00 ? 82  VAL A HB   2  
ATOM 3074  H HG11 . VAL A 1 82  ? -6.484  8.363   -0.020 1.00 0.00 ? 82  VAL A HG11 2  
ATOM 3075  H HG12 . VAL A 1 82  ? -5.188  9.480   0.471  1.00 0.00 ? 82  VAL A HG12 2  
ATOM 3076  H HG13 . VAL A 1 82  ? -5.202  8.802   -1.175 1.00 0.00 ? 82  VAL A HG13 2  
ATOM 3077  H HG21 . VAL A 1 82  ? -5.200  5.925   1.783  1.00 0.00 ? 82  VAL A HG21 2  
ATOM 3078  H HG22 . VAL A 1 82  ? -4.176  7.215   2.459  1.00 0.00 ? 82  VAL A HG22 2  
ATOM 3079  H HG23 . VAL A 1 82  ? -5.882  7.544   2.070  1.00 0.00 ? 82  VAL A HG23 2  
ATOM 3080  N N    . ASP A 1 83  ? -6.980  6.382   -1.365 1.00 0.00 ? 83  ASP A N    2  
ATOM 3081  C CA   . ASP A 1 83  ? -8.358  5.947   -1.517 1.00 0.00 ? 83  ASP A CA   2  
ATOM 3082  C C    . ASP A 1 83  ? -8.382  4.563   -2.169 1.00 0.00 ? 83  ASP A C    2  
ATOM 3083  O O    . ASP A 1 83  ? -9.315  3.789   -1.957 1.00 0.00 ? 83  ASP A O    2  
ATOM 3084  C CB   . ASP A 1 83  ? -9.143  6.905   -2.415 1.00 0.00 ? 83  ASP A CB   2  
ATOM 3085  C CG   . ASP A 1 83  ? -10.453 7.425   -1.818 1.00 0.00 ? 83  ASP A CG   2  
ATOM 3086  O OD1  . ASP A 1 83  ? -11.467 6.708   -1.965 1.00 0.00 ? 83  ASP A OD1  2  
ATOM 3087  O OD2  . ASP A 1 83  ? -10.410 8.526   -1.228 1.00 0.00 ? 83  ASP A OD2  2  
ATOM 3088  H H    . ASP A 1 83  ? -6.763  7.257   -1.799 1.00 0.00 ? 83  ASP A H    2  
ATOM 3089  H HA   . ASP A 1 83  ? -8.769  5.940   -0.508 1.00 0.00 ? 83  ASP A HA   2  
ATOM 3090  H HB2  . ASP A 1 83  ? -8.507  7.758   -2.654 1.00 0.00 ? 83  ASP A HB2  2  
ATOM 3091  H HB3  . ASP A 1 83  ? -9.365  6.400   -3.355 1.00 0.00 ? 83  ASP A HB3  2  
ATOM 3092  N N    . ALA A 1 84  ? -7.345  4.293   -2.948 1.00 0.00 ? 84  ALA A N    2  
ATOM 3093  C CA   . ALA A 1 84  ? -7.235  3.015   -3.632 1.00 0.00 ? 84  ALA A CA   2  
ATOM 3094  C C    . ALA A 1 84  ? -6.793  1.943   -2.633 1.00 0.00 ? 84  ALA A C    2  
ATOM 3095  O O    . ALA A 1 84  ? -7.490  0.949   -2.436 1.00 0.00 ? 84  ALA A O    2  
ATOM 3096  C CB   . ALA A 1 84  ? -6.269  3.148   -4.810 1.00 0.00 ? 84  ALA A CB   2  
ATOM 3097  H H    . ALA A 1 84  ? -6.591  4.927   -3.115 1.00 0.00 ? 84  ALA A H    2  
ATOM 3098  H HA   . ALA A 1 84  ? -8.223  2.758   -4.015 1.00 0.00 ? 84  ALA A HA   2  
ATOM 3099  H HB1  . ALA A 1 84  ? -5.245  3.019   -4.457 1.00 0.00 ? 84  ALA A HB1  2  
ATOM 3100  H HB2  . ALA A 1 84  ? -6.495  2.384   -5.554 1.00 0.00 ? 84  ALA A HB2  2  
ATOM 3101  H HB3  . ALA A 1 84  ? -6.377  4.136   -5.259 1.00 0.00 ? 84  ALA A HB3  2  
ATOM 3102  N N    . ALA A 1 85  ? -5.638  2.182   -2.030 1.00 0.00 ? 85  ALA A N    2  
ATOM 3103  C CA   . ALA A 1 85  ? -5.095  1.250   -1.057 1.00 0.00 ? 85  ALA A CA   2  
ATOM 3104  C C    . ALA A 1 85  ? -6.162  0.938   -0.006 1.00 0.00 ? 85  ALA A C    2  
ATOM 3105  O O    . ALA A 1 85  ? -6.324  -0.213  0.397  1.00 0.00 ? 85  ALA A O    2  
ATOM 3106  C CB   . ALA A 1 85  ? -3.824  1.837   -0.441 1.00 0.00 ? 85  ALA A CB   2  
ATOM 3107  H H    . ALA A 1 85  ? -5.078  2.994   -2.197 1.00 0.00 ? 85  ALA A H    2  
ATOM 3108  H HA   . ALA A 1 85  ? -4.838  0.332   -1.585 1.00 0.00 ? 85  ALA A HA   2  
ATOM 3109  H HB1  . ALA A 1 85  ? -3.262  1.046   0.055  1.00 0.00 ? 85  ALA A HB1  2  
ATOM 3110  H HB2  . ALA A 1 85  ? -3.211  2.280   -1.227 1.00 0.00 ? 85  ALA A HB2  2  
ATOM 3111  H HB3  . ALA A 1 85  ? -4.092  2.604   0.286  1.00 0.00 ? 85  ALA A HB3  2  
ATOM 3112  N N    . MET A 1 86  ? -6.861  1.984   0.410  1.00 0.00 ? 86  MET A N    2  
ATOM 3113  C CA   . MET A 1 86  ? -7.908  1.836   1.406  1.00 0.00 ? 86  MET A CA   2  
ATOM 3114  C C    . MET A 1 86  ? -8.924  0.774   0.981  1.00 0.00 ? 86  MET A C    2  
ATOM 3115  O O    . MET A 1 86  ? -9.276  -0.104  1.767  1.00 0.00 ? 86  MET A O    2  
ATOM 3116  C CB   . MET A 1 86  ? -8.621  3.176   1.602  1.00 0.00 ? 86  MET A CB   2  
ATOM 3117  C CG   . MET A 1 86  ? -7.682  4.210   2.226  1.00 0.00 ? 86  MET A CG   2  
ATOM 3118  S SD   . MET A 1 86  ? -8.279  4.679   3.841  1.00 0.00 ? 86  MET A SD   2  
ATOM 3119  C CE   . MET A 1 86  ? -7.995  3.158   4.731  1.00 0.00 ? 86  MET A CE   2  
ATOM 3120  H H    . MET A 1 86  ? -6.723  2.917   0.077  1.00 0.00 ? 86  MET A H    2  
ATOM 3121  H HA   . MET A 1 86  ? -7.401  1.519   2.318  1.00 0.00 ? 86  MET A HA   2  
ATOM 3122  H HB2  . MET A 1 86  ? -8.984  3.542   0.641  1.00 0.00 ? 86  MET A HB2  2  
ATOM 3123  H HB3  . MET A 1 86  ? -9.493  3.038   2.241  1.00 0.00 ? 86  MET A HB3  2  
ATOM 3124  H HG2  . MET A 1 86  ? -6.676  3.798   2.307  1.00 0.00 ? 86  MET A HG2  2  
ATOM 3125  H HG3  . MET A 1 86  ? -7.616  5.088   1.584  1.00 0.00 ? 86  MET A HG3  2  
ATOM 3126  H HE1  . MET A 1 86  ? -8.651  3.119   5.602  1.00 0.00 ? 86  MET A HE1  2  
ATOM 3127  H HE2  . MET A 1 86  ? -8.206  2.311   4.079  1.00 0.00 ? 86  MET A HE2  2  
ATOM 3128  H HE3  . MET A 1 86  ? -6.956  3.117   5.057  1.00 0.00 ? 86  MET A HE3  2  
ATOM 3129  N N    . ALA A 1 87  ? -9.368  0.890   -0.262 1.00 0.00 ? 87  ALA A N    2  
ATOM 3130  C CA   . ALA A 1 87  ? -10.337 -0.049  -0.801 1.00 0.00 ? 87  ALA A CA   2  
ATOM 3131  C C    . ALA A 1 87  ? -9.615  -1.067  -1.687 1.00 0.00 ? 87  ALA A C    2  
ATOM 3132  O O    . ALA A 1 87  ? -10.039 -1.326  -2.813 1.00 0.00 ? 87  ALA A O    2  
ATOM 3133  C CB   . ALA A 1 87  ? -11.423 0.717   -1.558 1.00 0.00 ? 87  ALA A CB   2  
ATOM 3134  H H    . ALA A 1 87  ? -9.077  1.607   -0.895 1.00 0.00 ? 87  ALA A H    2  
ATOM 3135  H HA   . ALA A 1 87  ? -10.796 -0.572  0.038  1.00 0.00 ? 87  ALA A HA   2  
ATOM 3136  H HB1  . ALA A 1 87  ? -12.102 0.009   -2.035 1.00 0.00 ? 87  ALA A HB1  2  
ATOM 3137  H HB2  . ALA A 1 87  ? -11.981 1.341   -0.861 1.00 0.00 ? 87  ALA A HB2  2  
ATOM 3138  H HB3  . ALA A 1 87  ? -10.961 1.345   -2.320 1.00 0.00 ? 87  ALA A HB3  2  
ATOM 3139  N N    . ALA A 1 88  ? -8.538  -1.617  -1.146 1.00 0.00 ? 88  ALA A N    2  
ATOM 3140  C CA   . ALA A 1 88  ? -7.754  -2.600  -1.874 1.00 0.00 ? 88  ALA A CA   2  
ATOM 3141  C C    . ALA A 1 88  ? -7.512  -3.817  -0.978 1.00 0.00 ? 88  ALA A C    2  
ATOM 3142  O O    . ALA A 1 88  ? -6.414  -4.371  -0.962 1.00 0.00 ? 88  ALA A O    2  
ATOM 3143  C CB   . ALA A 1 88  ? -6.450  -1.960  -2.353 1.00 0.00 ? 88  ALA A CB   2  
ATOM 3144  H H    . ALA A 1 88  ? -8.200  -1.400  -0.230 1.00 0.00 ? 88  ALA A H    2  
ATOM 3145  H HA   . ALA A 1 88  ? -8.334  -2.910  -2.743 1.00 0.00 ? 88  ALA A HA   2  
ATOM 3146  H HB1  . ALA A 1 88  ? -6.347  -0.970  -1.910 1.00 0.00 ? 88  ALA A HB1  2  
ATOM 3147  H HB2  . ALA A 1 88  ? -5.608  -2.583  -2.052 1.00 0.00 ? 88  ALA A HB2  2  
ATOM 3148  H HB3  . ALA A 1 88  ? -6.467  -1.872  -3.440 1.00 0.00 ? 88  ALA A HB3  2  
ATOM 3149  N N    . ARG A 1 89  ? -8.555  -4.196  -0.254 1.00 0.00 ? 89  ARG A N    2  
ATOM 3150  C CA   . ARG A 1 89  ? -8.469  -5.336  0.643  1.00 0.00 ? 89  ARG A CA   2  
ATOM 3151  C C    . ARG A 1 89  ? -8.891  -6.615  -0.084 1.00 0.00 ? 89  ARG A C    2  
ATOM 3152  O O    . ARG A 1 89  ? -9.554  -6.555  -1.118 1.00 0.00 ? 89  ARG A O    2  
ATOM 3153  C CB   . ARG A 1 89  ? -9.358  -5.138  1.872  1.00 0.00 ? 89  ARG A CB   2  
ATOM 3154  C CG   . ARG A 1 89  ? -8.557  -4.560  3.040  1.00 0.00 ? 89  ARG A CG   2  
ATOM 3155  C CD   . ARG A 1 89  ? -9.162  -4.980  4.381  1.00 0.00 ? 89  ARG A CD   2  
ATOM 3156  N NE   . ARG A 1 89  ? -10.201 -4.010  4.794  1.00 0.00 ? 89  ARG A NE   2  
ATOM 3157  C CZ   . ARG A 1 89  ? -10.636 -3.866  6.053  1.00 0.00 ? 89  ARG A CZ   2  
ATOM 3158  N NH1  . ARG A 1 89  ? -10.125 -4.628  7.030  1.00 0.00 ? 89  ARG A NH1  2  
ATOM 3159  N NH2  . ARG A 1 89  ? -11.583 -2.961  6.336  1.00 0.00 ? 89  ARG A NH2  2  
ATOM 3160  H H    . ARG A 1 89  ? -9.444  -3.739  -0.272 1.00 0.00 ? 89  ARG A H    2  
ATOM 3161  H HA   . ARG A 1 89  ? -7.420  -5.380  0.937  1.00 0.00 ? 89  ARG A HA   2  
ATOM 3162  H HB2  . ARG A 1 89  ? -10.183 -4.470  1.625  1.00 0.00 ? 89  ARG A HB2  2  
ATOM 3163  H HB3  . ARG A 1 89  ? -9.797  -6.092  2.165  1.00 0.00 ? 89  ARG A HB3  2  
ATOM 3164  H HG2  . ARG A 1 89  ? -7.523  -4.900  2.981  1.00 0.00 ? 89  ARG A HG2  2  
ATOM 3165  H HG3  . ARG A 1 89  ? -8.540  -3.472  2.970  1.00 0.00 ? 89  ARG A HG3  2  
ATOM 3166  H HD2  . ARG A 1 89  ? -9.596  -5.977  4.298  1.00 0.00 ? 89  ARG A HD2  2  
ATOM 3167  H HD3  . ARG A 1 89  ? -8.382  -5.035  5.140  1.00 0.00 ? 89  ARG A HD3  2  
ATOM 3168  H HE   . ARG A 1 89  ? -10.604 -3.426  4.089  1.00 0.00 ? 89  ARG A HE   2  
ATOM 3169  H HH11 . ARG A 1 89  ? -9.419  -5.304  6.819  1.00 0.00 ? 89  ARG A HH11 2  
ATOM 3170  H HH12 . ARG A 1 89  ? -10.450 -4.520  7.970  1.00 0.00 ? 89  ARG A HH12 2  
ATOM 3171  H HH21 . ARG A 1 89  ? -11.964 -2.392  5.606  1.00 0.00 ? 89  ARG A HH21 2  
ATOM 3172  H HH22 . ARG A 1 89  ? -11.908 -2.853  7.275  1.00 0.00 ? 89  ARG A HH22 2  
ATOM 3173  N N    . PRO A 1 90  ? -8.480  -7.771  0.502  1.00 0.00 ? 90  PRO A N    2  
ATOM 3174  C CA   . PRO A 1 90  ? -7.699  -7.753  1.727  1.00 0.00 ? 90  PRO A CA   2  
ATOM 3175  C C    . PRO A 1 90  ? -6.252  -7.339  1.449  1.00 0.00 ? 90  PRO A C    2  
ATOM 3176  O O    . PRO A 1 90  ? -5.883  -7.095  0.301  1.00 0.00 ? 90  PRO A O    2  
ATOM 3177  C CB   . PRO A 1 90  ? -7.816  -9.160  2.290  1.00 0.00 ? 90  PRO A CB   2  
ATOM 3178  C CG   . PRO A 1 90  ? -8.267  -10.035 1.132  1.00 0.00 ? 90  PRO A CG   2  
ATOM 3179  C CD   . PRO A 1 90  ? -8.747  -9.122  0.016  1.00 0.00 ? 90  PRO A CD   2  
ATOM 3180  H HA   . PRO A 1 90  ? -8.061  -7.069  2.360  1.00 0.00 ? 90  PRO A HA   2  
ATOM 3181  H HB2  . PRO A 1 90  ? -6.861  -9.502  2.689  1.00 0.00 ? 90  PRO A HB2  2  
ATOM 3182  H HB3  . PRO A 1 90  ? -8.534  -9.194  3.109  1.00 0.00 ? 90  PRO A HB3  2  
ATOM 3183  H HG2  . PRO A 1 90  ? -7.447  -10.663 0.785  1.00 0.00 ? 90  PRO A HG2  2  
ATOM 3184  H HG3  . PRO A 1 90  ? -9.068  -10.704 1.449  1.00 0.00 ? 90  PRO A HG3  2  
ATOM 3185  H HD2  . PRO A 1 90  ? -8.215  -9.320  -0.914 1.00 0.00 ? 90  PRO A HD2  2  
ATOM 3186  H HD3  . PRO A 1 90  ? -9.808  -9.267  -0.186 1.00 0.00 ? 90  PRO A HD3  2  
ATOM 3187  N N    . HIS A 1 91  ? -5.473  -7.273  2.518  1.00 0.00 ? 91  HIS A N    2  
ATOM 3188  C CA   . HIS A 1 91  ? -4.075  -6.892  2.403  1.00 0.00 ? 91  HIS A CA   2  
ATOM 3189  C C    . HIS A 1 91  ? -3.201  -7.934  3.104  1.00 0.00 ? 91  HIS A C    2  
ATOM 3190  O O    . HIS A 1 91  ? -3.344  -8.165  4.303  1.00 0.00 ? 91  HIS A O    2  
ATOM 3191  C CB   . HIS A 1 91  ? -3.852  -5.476  2.936  1.00 0.00 ? 91  HIS A CB   2  
ATOM 3192  C CG   . HIS A 1 91  ? -3.990  -4.397  1.889  1.00 0.00 ? 91  HIS A CG   2  
ATOM 3193  N ND1  . HIS A 1 91  ? -3.860  -3.050  2.179  1.00 0.00 ? 91  HIS A ND1  2  
ATOM 3194  C CD2  . HIS A 1 91  ? -4.248  -4.480  0.552  1.00 0.00 ? 91  HIS A CD2  2  
ATOM 3195  C CE1  . HIS A 1 91  ? -4.034  -2.362  1.060  1.00 0.00 ? 91  HIS A CE1  2  
ATOM 3196  N NE2  . HIS A 1 91  ? -4.275  -3.250  0.053  1.00 0.00 ? 91  HIS A NE2  2  
ATOM 3197  H H    . HIS A 1 91  ? -5.781  -7.473  3.448  1.00 0.00 ? 91  HIS A H    2  
ATOM 3198  H HA   . HIS A 1 91  ? -3.839  -6.888  1.339  1.00 0.00 ? 91  HIS A HA   2  
ATOM 3199  H HB2  . HIS A 1 91  ? -4.565  -5.284  3.738  1.00 0.00 ? 91  HIS A HB2  2  
ATOM 3200  H HB3  . HIS A 1 91  ? -2.856  -5.416  3.375  1.00 0.00 ? 91  HIS A HB3  2  
ATOM 3201  H HD1  . HIS A 1 91  ? -3.667  -2.661  3.080  1.00 0.00 ? 91  HIS A HD1  2  
ATOM 3202  H HD2  . HIS A 1 91  ? -4.405  -5.400  -0.010 1.00 0.00 ? 91  HIS A HD2  2  
ATOM 3203  H HE1  . HIS A 1 91  ? -3.992  -1.278  0.961  1.00 0.00 ? 91  HIS A HE1  2  
ATOM 3204  N N    . SER A 1 92  ? -2.314  -8.536  2.325  1.00 0.00 ? 92  SER A N    2  
ATOM 3205  C CA   . SER A 1 92  ? -1.416  -9.547  2.856  1.00 0.00 ? 92  SER A CA   2  
ATOM 3206  C C    . SER A 1 92  ? 0.032   -9.059  2.771  1.00 0.00 ? 92  SER A C    2  
ATOM 3207  O O    . SER A 1 92  ? 0.537   -8.791  1.682  1.00 0.00 ? 92  SER A O    2  
ATOM 3208  C CB   . SER A 1 92  ? -1.574  -10.872 2.106  1.00 0.00 ? 92  SER A CB   2  
ATOM 3209  O OG   . SER A 1 92  ? -1.542  -10.692 0.693  1.00 0.00 ? 92  SER A OG   2  
ATOM 3210  H H    . SER A 1 92  ? -2.203  -8.342  1.350  1.00 0.00 ? 92  SER A H    2  
ATOM 3211  H HA   . SER A 1 92  ? -1.714  -9.681  3.895  1.00 0.00 ? 92  SER A HA   2  
ATOM 3212  H HB2  . SER A 1 92  ? -0.777  -11.554 2.403  1.00 0.00 ? 92  SER A HB2  2  
ATOM 3213  H HB3  . SER A 1 92  ? -2.516  -11.339 2.391  1.00 0.00 ? 92  SER A HB3  2  
ATOM 3214  H HG   . SER A 1 92  ? -1.012  -9.876  0.463  1.00 0.00 ? 92  SER A HG   2  
ATOM 3215  N N    . ILE A 1 93  ? 0.657   -8.959  3.934  1.00 0.00 ? 93  ILE A N    2  
ATOM 3216  C CA   . ILE A 1 93  ? 2.037   -8.507  4.005  1.00 0.00 ? 93  ILE A CA   2  
ATOM 3217  C C    . ILE A 1 93  ? 2.818   -9.416  4.956  1.00 0.00 ? 93  ILE A C    2  
ATOM 3218  O O    . ILE A 1 93  ? 2.263   -9.930  5.926  1.00 0.00 ? 93  ILE A O    2  
ATOM 3219  C CB   . ILE A 1 93  ? 2.097   -7.026  4.383  1.00 0.00 ? 93  ILE A CB   2  
ATOM 3220  C CG1  . ILE A 1 93  ? 1.076   -6.214  3.584  1.00 0.00 ? 93  ILE A CG1  2  
ATOM 3221  C CG2  . ILE A 1 93  ? 3.516   -6.477  4.224  1.00 0.00 ? 93  ILE A CG2  2  
ATOM 3222  C CD1  . ILE A 1 93  ? 0.928   -4.803  4.155  1.00 0.00 ? 93  ILE A CD1  2  
ATOM 3223  H H    . ILE A 1 93  ? 0.239   -9.179  4.815  1.00 0.00 ? 93  ILE A H    2  
ATOM 3224  H HA   . ILE A 1 93  ? 2.464   -8.603  3.007  1.00 0.00 ? 93  ILE A HA   2  
ATOM 3225  H HB   . ILE A 1 93  ? 1.831   -6.931  5.436  1.00 0.00 ? 93  ILE A HB   2  
ATOM 3226  H HG12 . ILE A 1 93  ? 1.387   -6.157  2.541  1.00 0.00 ? 93  ILE A HG12 2  
ATOM 3227  H HG13 . ILE A 1 93  ? 0.110   -6.720  3.601  1.00 0.00 ? 93  ILE A HG13 2  
ATOM 3228  H HG21 . ILE A 1 93  ? 3.805   -6.515  3.174  1.00 0.00 ? 93  ILE A HG21 2  
ATOM 3229  H HG22 . ILE A 1 93  ? 3.548   -5.444  4.573  1.00 0.00 ? 93  ILE A HG22 2  
ATOM 3230  H HG23 . ILE A 1 93  ? 4.207   -7.080  4.813  1.00 0.00 ? 93  ILE A HG23 2  
ATOM 3231  H HD11 . ILE A 1 93  ? 0.046   -4.327  3.727  1.00 0.00 ? 93  ILE A HD11 2  
ATOM 3232  H HD12 . ILE A 1 93  ? 0.821   -4.859  5.239  1.00 0.00 ? 93  ILE A HD12 2  
ATOM 3233  H HD13 . ILE A 1 93  ? 1.813   -4.216  3.908  1.00 0.00 ? 93  ILE A HD13 2  
ATOM 3234  N N    . ASP A 1 94  ? 4.095   -9.587  4.645  1.00 0.00 ? 94  ASP A N    2  
ATOM 3235  C CA   . ASP A 1 94  ? 4.958   -10.426 5.459  1.00 0.00 ? 94  ASP A CA   2  
ATOM 3236  C C    . ASP A 1 94  ? 4.439   -11.865 5.430  1.00 0.00 ? 94  ASP A C    2  
ATOM 3237  O O    . ASP A 1 94  ? 4.848   -12.693 6.243  1.00 0.00 ? 94  ASP A O    2  
ATOM 3238  C CB   . ASP A 1 94  ? 4.967   -9.956  6.915  1.00 0.00 ? 94  ASP A CB   2  
ATOM 3239  C CG   . ASP A 1 94  ? 6.350   -9.897  7.567  1.00 0.00 ? 94  ASP A CG   2  
ATOM 3240  O OD1  . ASP A 1 94  ? 6.778   -10.950 8.086  1.00 0.00 ? 94  ASP A OD1  2  
ATOM 3241  O OD2  . ASP A 1 94  ? 6.947   -8.800  7.532  1.00 0.00 ? 94  ASP A OD2  2  
ATOM 3242  H H    . ASP A 1 94  ? 4.539   -9.166  3.854  1.00 0.00 ? 94  ASP A H    2  
ATOM 3243  H HA   . ASP A 1 94  ? 5.949   -10.331 5.017  1.00 0.00 ? 94  ASP A HA   2  
ATOM 3244  H HB2  . ASP A 1 94  ? 4.516   -8.965  6.965  1.00 0.00 ? 94  ASP A HB2  2  
ATOM 3245  H HB3  . ASP A 1 94  ? 4.334   -10.624 7.501  1.00 0.00 ? 94  ASP A HB3  2  
ATOM 3246  N N    . GLY A 1 95  ? 3.547   -12.119 4.484  1.00 0.00 ? 95  GLY A N    2  
ATOM 3247  C CA   . GLY A 1 95  ? 2.968   -13.444 4.338  1.00 0.00 ? 95  GLY A CA   2  
ATOM 3248  C C    . GLY A 1 95  ? 1.722   -13.598 5.213  1.00 0.00 ? 95  GLY A C    2  
ATOM 3249  O O    . GLY A 1 95  ? 1.043   -14.621 5.157  1.00 0.00 ? 95  GLY A O    2  
ATOM 3250  H H    . GLY A 1 95  ? 3.220   -11.440 3.827  1.00 0.00 ? 95  GLY A H    2  
ATOM 3251  H HA2  . GLY A 1 95  ? 2.707   -13.618 3.294  1.00 0.00 ? 95  GLY A HA2  2  
ATOM 3252  H HA3  . GLY A 1 95  ? 3.705   -14.199 4.612  1.00 0.00 ? 95  GLY A HA3  2  
ATOM 3253  N N    . ARG A 1 96  ? 1.461   -12.565 6.001  1.00 0.00 ? 96  ARG A N    2  
ATOM 3254  C CA   . ARG A 1 96  ? 0.309   -12.573 6.887  1.00 0.00 ? 96  ARG A CA   2  
ATOM 3255  C C    . ARG A 1 96  ? -0.791  -11.663 6.335  1.00 0.00 ? 96  ARG A C    2  
ATOM 3256  O O    . ARG A 1 96  ? -0.556  -10.893 5.405  1.00 0.00 ? 96  ARG A O    2  
ATOM 3257  C CB   . ARG A 1 96  ? 0.692   -12.104 8.292  1.00 0.00 ? 96  ARG A CB   2  
ATOM 3258  C CG   . ARG A 1 96  ? 1.111   -10.633 8.284  1.00 0.00 ? 96  ARG A CG   2  
ATOM 3259  C CD   . ARG A 1 96  ? 0.755   -9.954  9.608  1.00 0.00 ? 96  ARG A CD   2  
ATOM 3260  N NE   . ARG A 1 96  ? -0.701  -9.699  9.671  1.00 0.00 ? 96  ARG A NE   2  
ATOM 3261  C CZ   . ARG A 1 96  ? -1.372  -9.449  10.804 1.00 0.00 ? 96  ARG A CZ   2  
ATOM 3262  N NH1  . ARG A 1 96  ? -0.721  -9.419  11.975 1.00 0.00 ? 96  ARG A NH1  2  
ATOM 3263  N NH2  . ARG A 1 96  ? -2.693  -9.229  10.766 1.00 0.00 ? 96  ARG A NH2  2  
ATOM 3264  H H    . ARG A 1 96  ? 2.019   -11.736 6.041  1.00 0.00 ? 96  ARG A H    2  
ATOM 3265  H HA   . ARG A 1 96  ? -0.017  -13.613 6.911  1.00 0.00 ? 96  ARG A HA   2  
ATOM 3266  H HB2  . ARG A 1 96  ? -0.153  -12.241 8.968  1.00 0.00 ? 96  ARG A HB2  2  
ATOM 3267  H HB3  . ARG A 1 96  ? 1.508   -12.716 8.674  1.00 0.00 ? 96  ARG A HB3  2  
ATOM 3268  H HG2  . ARG A 1 96  ? 2.184   -10.558 8.110  1.00 0.00 ? 96  ARG A HG2  2  
ATOM 3269  H HG3  . ARG A 1 96  ? 0.618   -10.115 7.462  1.00 0.00 ? 96  ARG A HG3  2  
ATOM 3270  H HD2  . ARG A 1 96  ? 1.059   -10.585 10.443 1.00 0.00 ? 96  ARG A HD2  2  
ATOM 3271  H HD3  . ARG A 1 96  ? 1.302   -9.015  9.704  1.00 0.00 ? 96  ARG A HD3  2  
ATOM 3272  H HE   . ARG A 1 96  ? -1.217  -9.714  8.815  1.00 0.00 ? 96  ARG A HE   2  
ATOM 3273  H HH11 . ARG A 1 96  ? 0.265   -9.583  12.004 1.00 0.00 ? 96  ARG A HH11 2  
ATOM 3274  H HH12 . ARG A 1 96  ? -1.222  -9.233  12.821 1.00 0.00 ? 96  ARG A HH12 2  
ATOM 3275  H HH21 . ARG A 1 96  ? -3.179  -9.251  9.892  1.00 0.00 ? 96  ARG A HH21 2  
ATOM 3276  H HH22 . ARG A 1 96  ? -3.194  -9.042  11.611 1.00 0.00 ? 96  ARG A HH22 2  
ATOM 3277  N N    . VAL A 1 97  ? -1.968  -11.783 6.932  1.00 0.00 ? 97  VAL A N    2  
ATOM 3278  C CA   . VAL A 1 97  ? -3.104  -10.981 6.512  1.00 0.00 ? 97  VAL A CA   2  
ATOM 3279  C C    . VAL A 1 97  ? -3.236  -9.767  7.435  1.00 0.00 ? 97  VAL A C    2  
ATOM 3280  O O    . VAL A 1 97  ? -3.690  -9.893  8.571  1.00 0.00 ? 97  VAL A O    2  
ATOM 3281  C CB   . VAL A 1 97  ? -4.368  -11.843 6.475  1.00 0.00 ? 97  VAL A CB   2  
ATOM 3282  C CG1  . VAL A 1 97  ? -5.574  -11.028 6.005  1.00 0.00 ? 97  VAL A CG1  2  
ATOM 3283  C CG2  . VAL A 1 97  ? -4.163  -13.077 5.594  1.00 0.00 ? 97  VAL A CG2  2  
ATOM 3284  H H    . VAL A 1 97  ? -2.150  -12.411 7.688  1.00 0.00 ? 97  VAL A H    2  
ATOM 3285  H HA   . VAL A 1 97  ? -2.904  -10.632 5.499  1.00 0.00 ? 97  VAL A HA   2  
ATOM 3286  H HB   . VAL A 1 97  ? -4.570  -12.186 7.490  1.00 0.00 ? 97  VAL A HB   2  
ATOM 3287  H HG11 . VAL A 1 97  ? -5.566  -10.960 4.917  1.00 0.00 ? 97  VAL A HG11 2  
ATOM 3288  H HG12 . VAL A 1 97  ? -6.492  -11.517 6.331  1.00 0.00 ? 97  VAL A HG12 2  
ATOM 3289  H HG13 . VAL A 1 97  ? -5.524  -10.026 6.432  1.00 0.00 ? 97  VAL A HG13 2  
ATOM 3290  H HG21 . VAL A 1 97  ? -3.284  -12.933 4.965  1.00 0.00 ? 97  VAL A HG21 2  
ATOM 3291  H HG22 . VAL A 1 97  ? -4.019  -13.954 6.225  1.00 0.00 ? 97  VAL A HG22 2  
ATOM 3292  H HG23 . VAL A 1 97  ? -5.041  -13.224 4.964  1.00 0.00 ? 97  VAL A HG23 2  
ATOM 3293  N N    . VAL A 1 98  ? -2.830  -8.620  6.912  1.00 0.00 ? 98  VAL A N    2  
ATOM 3294  C CA   . VAL A 1 98  ? -2.897  -7.385  7.674  1.00 0.00 ? 98  VAL A CA   2  
ATOM 3295  C C    . VAL A 1 98  ? -4.291  -6.772  7.524  1.00 0.00 ? 98  VAL A C    2  
ATOM 3296  O O    . VAL A 1 98  ? -5.173  -7.372  6.911  1.00 0.00 ? 98  VAL A O    2  
ATOM 3297  C CB   . VAL A 1 98  ? -1.777  -6.438  7.236  1.00 0.00 ? 98  VAL A CB   2  
ATOM 3298  C CG1  . VAL A 1 98  ? -0.509  -7.216  6.881  1.00 0.00 ? 98  VAL A CG1  2  
ATOM 3299  C CG2  . VAL A 1 98  ? -2.228  -5.561  6.066  1.00 0.00 ? 98  VAL A CG2  2  
ATOM 3300  H H    . VAL A 1 98  ? -2.462  -8.526  5.987  1.00 0.00 ? 98  VAL A H    2  
ATOM 3301  H HA   . VAL A 1 98  ? -2.735  -7.636  8.722  1.00 0.00 ? 98  VAL A HA   2  
ATOM 3302  H HB   . VAL A 1 98  ? -1.545  -5.783  8.075  1.00 0.00 ? 98  VAL A HB   2  
ATOM 3303  H HG11 . VAL A 1 98  ? -0.598  -7.617  5.871  1.00 0.00 ? 98  VAL A HG11 2  
ATOM 3304  H HG12 . VAL A 1 98  ? 0.353   -6.550  6.933  1.00 0.00 ? 98  VAL A HG12 2  
ATOM 3305  H HG13 . VAL A 1 98  ? -0.376  -8.037  7.587  1.00 0.00 ? 98  VAL A HG13 2  
ATOM 3306  H HG21 . VAL A 1 98  ? -2.831  -6.154  5.379  1.00 0.00 ? 98  VAL A HG21 2  
ATOM 3307  H HG22 . VAL A 1 98  ? -2.820  -4.727  6.444  1.00 0.00 ? 98  VAL A HG22 2  
ATOM 3308  H HG23 . VAL A 1 98  ? -1.352  -5.177  5.542  1.00 0.00 ? 98  VAL A HG23 2  
ATOM 3309  N N    . GLU A 1 99  ? -4.445  -5.586  8.093  1.00 0.00 ? 99  GLU A N    2  
ATOM 3310  C CA   . GLU A 1 99  ? -5.717  -4.886  8.030  1.00 0.00 ? 99  GLU A CA   2  
ATOM 3311  C C    . GLU A 1 99  ? -5.511  -3.389  8.271  1.00 0.00 ? 99  GLU A C    2  
ATOM 3312  O O    . GLU A 1 99  ? -5.198  -2.974  9.386  1.00 0.00 ? 99  GLU A O    2  
ATOM 3313  C CB   . GLU A 1 99  ? -6.715  -5.471  9.031  1.00 0.00 ? 99  GLU A CB   2  
ATOM 3314  C CG   . GLU A 1 99  ? -6.037  -5.775  10.368 1.00 0.00 ? 99  GLU A CG   2  
ATOM 3315  C CD   . GLU A 1 99  ? -5.479  -7.199  10.389 1.00 0.00 ? 99  GLU A CD   2  
ATOM 3316  O OE1  . GLU A 1 99  ? -6.306  -8.131  10.497 1.00 0.00 ? 99  GLU A OE1  2  
ATOM 3317  O OE2  . GLU A 1 99  ? -4.239  -7.325  10.295 1.00 0.00 ? 99  GLU A OE2  2  
ATOM 3318  H H    . GLU A 1 99  ? -3.723  -5.105  8.589  1.00 0.00 ? 99  GLU A H    2  
ATOM 3319  H HA   . GLU A 1 99  ? -6.088  -5.050  7.018  1.00 0.00 ? 99  GLU A HA   2  
ATOM 3320  H HB2  . GLU A 1 99  ? -7.534  -4.768  9.186  1.00 0.00 ? 99  GLU A HB2  2  
ATOM 3321  H HB3  . GLU A 1 99  ? -7.151  -6.383  8.624  1.00 0.00 ? 99  GLU A HB3  2  
ATOM 3322  H HG2  . GLU A 1 99  ? -5.230  -5.062  10.541 1.00 0.00 ? 99  GLU A HG2  2  
ATOM 3323  H HG3  . GLU A 1 99  ? -6.753  -5.649  11.180 1.00 0.00 ? 99  GLU A HG3  2  
ATOM 3324  N N    . PRO A 1 100 ? -5.701  -2.599  7.181  1.00 0.00 ? 100 PRO A N    2  
ATOM 3325  C CA   . PRO A 1 100 ? -5.539  -1.158  7.263  1.00 0.00 ? 100 PRO A CA   2  
ATOM 3326  C C    . PRO A 1 100 ? -6.728  -0.513  7.979  1.00 0.00 ? 100 PRO A C    2  
ATOM 3327  O O    . PRO A 1 100 ? -7.805  -1.102  8.055  1.00 0.00 ? 100 PRO A O    2  
ATOM 3328  C CB   . PRO A 1 100 ? -5.391  -0.695  5.823  1.00 0.00 ? 100 PRO A CB   2  
ATOM 3329  C CG   . PRO A 1 100 ? -5.937  -1.824  4.964  1.00 0.00 ? 100 PRO A CG   2  
ATOM 3330  C CD   . PRO A 1 100 ? -6.072  -3.056  5.844  1.00 0.00 ? 100 PRO A CD   2  
ATOM 3331  H HA   . PRO A 1 100 ? -4.734  -0.929  7.811  1.00 0.00 ? 100 PRO A HA   2  
ATOM 3332  H HB2  . PRO A 1 100 ? -5.943  0.229   5.651  1.00 0.00 ? 100 PRO A HB2  2  
ATOM 3333  H HB3  . PRO A 1 100 ? -4.348  -0.492  5.583  1.00 0.00 ? 100 PRO A HB3  2  
ATOM 3334  H HG2  . PRO A 1 100 ? -6.904  -1.549  4.542  1.00 0.00 ? 100 PRO A HG2  2  
ATOM 3335  H HG3  . PRO A 1 100 ? -5.269  -2.024  4.127  1.00 0.00 ? 100 PRO A HG3  2  
ATOM 3336  H HD2  . PRO A 1 100 ? -7.090  -3.446  5.828  1.00 0.00 ? 100 PRO A HD2  2  
ATOM 3337  H HD3  . PRO A 1 100 ? -5.418  -3.859  5.505  1.00 0.00 ? 100 PRO A HD3  2  
ATOM 3338  N N    . LYS A 1 101 ? -6.492  0.688   8.486  1.00 0.00 ? 101 LYS A N    2  
ATOM 3339  C CA   . LYS A 1 101 ? -7.530  1.419   9.193  1.00 0.00 ? 101 LYS A CA   2  
ATOM 3340  C C    . LYS A 1 101 ? -7.401  2.911   8.879  1.00 0.00 ? 101 LYS A C    2  
ATOM 3341  O O    . LYS A 1 101 ? -6.405  3.344   8.301  1.00 0.00 ? 101 LYS A O    2  
ATOM 3342  C CB   . LYS A 1 101 ? -7.487  1.099   10.688 1.00 0.00 ? 101 LYS A CB   2  
ATOM 3343  C CG   . LYS A 1 101 ? -7.268  -0.397  10.922 1.00 0.00 ? 101 LYS A CG   2  
ATOM 3344  C CD   . LYS A 1 101 ? -8.514  -1.200  10.543 1.00 0.00 ? 101 LYS A CD   2  
ATOM 3345  C CE   . LYS A 1 101 ? -9.337  -1.553  11.783 1.00 0.00 ? 101 LYS A CE   2  
ATOM 3346  N NZ   . LYS A 1 101 ? -10.368 -0.521  12.032 1.00 0.00 ? 101 LYS A NZ   2  
ATOM 3347  H H    . LYS A 1 101 ? -5.613  1.160   8.420  1.00 0.00 ? 101 LYS A H    2  
ATOM 3348  H HA   . LYS A 1 101 ? -8.491  1.069   8.816  1.00 0.00 ? 101 LYS A HA   2  
ATOM 3349  H HB2  . LYS A 1 101 ? -6.687  1.666   11.163 1.00 0.00 ? 101 LYS A HB2  2  
ATOM 3350  H HB3  . LYS A 1 101 ? -8.420  1.411   11.158 1.00 0.00 ? 101 LYS A HB3  2  
ATOM 3351  H HG2  . LYS A 1 101 ? -6.417  -0.740  10.334 1.00 0.00 ? 101 LYS A HG2  2  
ATOM 3352  H HG3  . LYS A 1 101 ? -7.023  -0.573  11.970 1.00 0.00 ? 101 LYS A HG3  2  
ATOM 3353  H HD2  . LYS A 1 101 ? -9.125  -0.623  9.849  1.00 0.00 ? 101 LYS A HD2  2  
ATOM 3354  H HD3  . LYS A 1 101 ? -8.219  -2.113  10.026 1.00 0.00 ? 101 LYS A HD3  2  
ATOM 3355  H HE2  . LYS A 1 101 ? -9.812  -2.525  11.647 1.00 0.00 ? 101 LYS A HE2  2  
ATOM 3356  H HE3  . LYS A 1 101 ? -8.682  -1.637  12.650 1.00 0.00 ? 101 LYS A HE3  2  
ATOM 3357  H HZ1  . LYS A 1 101 ? -10.785 -0.250  11.164 1.00 0.00 ? 101 LYS A HZ1  2  
ATOM 3358  H HZ2  . LYS A 1 101 ? -11.071 -0.892  12.638 1.00 0.00 ? 101 LYS A HZ2  2  
ATOM 3359  H HZ3  . LYS A 1 101 ? -9.944  0.277   12.462 1.00 0.00 ? 101 LYS A HZ3  2  
ATOM 3360  N N    . ARG A 1 102 ? -8.422  3.657   9.275  1.00 0.00 ? 102 ARG A N    2  
ATOM 3361  C CA   . ARG A 1 102 ? -8.434  5.092   9.044  1.00 0.00 ? 102 ARG A CA   2  
ATOM 3362  C C    . ARG A 1 102 ? -7.849  5.829   10.250 1.00 0.00 ? 102 ARG A C    2  
ATOM 3363  O O    . ARG A 1 102 ? -8.283  5.619   11.381 1.00 0.00 ? 102 ARG A O    2  
ATOM 3364  C CB   . ARG A 1 102 ? -9.856  5.595   8.788  1.00 0.00 ? 102 ARG A CB   2  
ATOM 3365  C CG   . ARG A 1 102 ? -10.154 5.658   7.289  1.00 0.00 ? 102 ARG A CG   2  
ATOM 3366  C CD   . ARG A 1 102 ? -11.657 5.545   7.023  1.00 0.00 ? 102 ARG A CD   2  
ATOM 3367  N NE   . ARG A 1 102 ? -12.151 6.783   6.381  1.00 0.00 ? 102 ARG A NE   2  
ATOM 3368  C CZ   . ARG A 1 102 ? -13.446 7.117   6.289  1.00 0.00 ? 102 ARG A CZ   2  
ATOM 3369  N NH1  . ARG A 1 102 ? -14.384 6.306   6.797  1.00 0.00 ? 102 ARG A NH1  2  
ATOM 3370  N NH2  . ARG A 1 102 ? -13.803 8.260   5.688  1.00 0.00 ? 102 ARG A NH2  2  
ATOM 3371  H H    . ARG A 1 102 ? -9.228  3.298   9.745  1.00 0.00 ? 102 ARG A H    2  
ATOM 3372  H HA   . ARG A 1 102 ? -7.817  5.236   8.158  1.00 0.00 ? 102 ARG A HA   2  
ATOM 3373  H HB2  . ARG A 1 102 ? -10.573 4.936   9.278  1.00 0.00 ? 102 ARG A HB2  2  
ATOM 3374  H HB3  . ARG A 1 102 ? -9.980  6.585   9.229  1.00 0.00 ? 102 ARG A HB3  2  
ATOM 3375  H HG2  . ARG A 1 102 ? -9.778  6.595   6.878  1.00 0.00 ? 102 ARG A HG2  2  
ATOM 3376  H HG3  . ARG A 1 102 ? -9.630  4.851   6.776  1.00 0.00 ? 102 ARG A HG3  2  
ATOM 3377  H HD2  . ARG A 1 102 ? -11.858 4.687   6.382  1.00 0.00 ? 102 ARG A HD2  2  
ATOM 3378  H HD3  . ARG A 1 102 ? -12.188 5.375   7.959  1.00 0.00 ? 102 ARG A HD3  2  
ATOM 3379  H HE   . ARG A 1 102 ? -11.477 7.411   5.991  1.00 0.00 ? 102 ARG A HE   2  
ATOM 3380  H HH11 . ARG A 1 102 ? -14.118 5.453   7.245  1.00 0.00 ? 102 ARG A HH11 2  
ATOM 3381  H HH12 . ARG A 1 102 ? -15.350 6.555   6.729  1.00 0.00 ? 102 ARG A HH12 2  
ATOM 3382  H HH21 . ARG A 1 102 ? -13.102 8.865   5.309  1.00 0.00 ? 102 ARG A HH21 2  
ATOM 3383  H HH22 . ARG A 1 102 ? -14.769 8.509   5.619  1.00 0.00 ? 102 ARG A HH22 2  
ATOM 3384  N N    . ALA A 1 103 ? -6.871  6.677   9.967  1.00 0.00 ? 103 ALA A N    2  
ATOM 3385  C CA   . ALA A 1 103 ? -6.221  7.447   11.014 1.00 0.00 ? 103 ALA A CA   2  
ATOM 3386  C C    . ALA A 1 103 ? -6.900  8.813   11.133 1.00 0.00 ? 103 ALA A C    2  
ATOM 3387  O O    . ALA A 1 103 ? -6.241  9.847   11.040 1.00 0.00 ? 103 ALA A O    2  
ATOM 3388  C CB   . ALA A 1 103 ? -4.726  7.563   10.710 1.00 0.00 ? 103 ALA A CB   2  
ATOM 3389  H H    . ALA A 1 103 ? -6.523  6.842   9.044  1.00 0.00 ? 103 ALA A H    2  
ATOM 3390  H HA   . ALA A 1 103 ? -6.348  6.905   11.951 1.00 0.00 ? 103 ALA A HA   2  
ATOM 3391  H HB1  . ALA A 1 103 ? -4.534  7.212   9.696  1.00 0.00 ? 103 ALA A HB1  2  
ATOM 3392  H HB2  . ALA A 1 103 ? -4.418  8.604   10.799 1.00 0.00 ? 103 ALA A HB2  2  
ATOM 3393  H HB3  . ALA A 1 103 ? -4.163  6.955   11.418 1.00 0.00 ? 103 ALA A HB3  2  
ATOM 3394  N N    . VAL A 1 104 ? -8.209  8.772   11.337 1.00 0.00 ? 104 VAL A N    2  
ATOM 3395  C CA   . VAL A 1 104 ? -8.984  9.994   11.469 1.00 0.00 ? 104 VAL A CA   2  
ATOM 3396  C C    . VAL A 1 104 ? -9.843  9.913   12.732 1.00 0.00 ? 104 VAL A C    2  
ATOM 3397  O O    . VAL A 1 104 ? -10.194 8.822   13.180 1.00 0.00 ? 104 VAL A O    2  
ATOM 3398  C CB   . VAL A 1 104 ? -9.805  10.233  10.201 1.00 0.00 ? 104 VAL A CB   2  
ATOM 3399  C CG1  . VAL A 1 104 ? -8.895  10.444  8.990  1.00 0.00 ? 104 VAL A CG1  2  
ATOM 3400  C CG2  . VAL A 1 104 ? -10.784 9.082   9.958  1.00 0.00 ? 104 VAL A CG2  2  
ATOM 3401  H H    . VAL A 1 104 ? -8.737  7.926   11.412 1.00 0.00 ? 104 VAL A H    2  
ATOM 3402  H HA   . VAL A 1 104 ? -8.280  10.820  11.576 1.00 0.00 ? 104 VAL A HA   2  
ATOM 3403  H HB   . VAL A 1 104 ? -10.387 11.143  10.345 1.00 0.00 ? 104 VAL A HB   2  
ATOM 3404  H HG11 . VAL A 1 104 ? -8.454  11.439  9.036  1.00 0.00 ? 104 VAL A HG11 2  
ATOM 3405  H HG12 . VAL A 1 104 ? -8.103  9.695   8.996  1.00 0.00 ? 104 VAL A HG12 2  
ATOM 3406  H HG13 . VAL A 1 104 ? -9.479  10.347  8.075  1.00 0.00 ? 104 VAL A HG13 2  
ATOM 3407  H HG21 . VAL A 1 104 ? -10.382 8.165   10.388 1.00 0.00 ? 104 VAL A HG21 2  
ATOM 3408  H HG22 . VAL A 1 104 ? -11.741 9.314   10.426 1.00 0.00 ? 104 VAL A HG22 2  
ATOM 3409  H HG23 . VAL A 1 104 ? -10.928 8.948   8.885  1.00 0.00 ? 104 VAL A HG23 2  
ATOM 3410  N N    . ALA A 1 105 ? -10.158 11.082  13.271 1.00 0.00 ? 105 ALA A N    2  
ATOM 3411  C CA   . ALA A 1 105 ? -10.970 11.157  14.474 1.00 0.00 ? 105 ALA A CA   2  
ATOM 3412  C C    . ALA A 1 105 ? -10.132 10.724  15.678 1.00 0.00 ? 105 ALA A C    2  
ATOM 3413  O O    . ALA A 1 105 ? -9.712  11.559  16.479 1.00 0.00 ? 105 ALA A O    2  
ATOM 3414  C CB   . ALA A 1 105 ? -12.224 10.298  14.298 1.00 0.00 ? 105 ALA A CB   2  
ATOM 3415  H H    . ALA A 1 105 ? -9.869  11.964  12.901 1.00 0.00 ? 105 ALA A H    2  
ATOM 3416  H HA   . ALA A 1 105 ? -11.272 12.196  14.606 1.00 0.00 ? 105 ALA A HA   2  
ATOM 3417  H HB1  . ALA A 1 105 ? -12.235 9.511   15.053 1.00 0.00 ? 105 ALA A HB1  2  
ATOM 3418  H HB2  . ALA A 1 105 ? -13.111 10.922  14.411 1.00 0.00 ? 105 ALA A HB2  2  
ATOM 3419  H HB3  . ALA A 1 105 ? -12.220 9.848   13.305 1.00 0.00 ? 105 ALA A HB3  2  
ATOM 3420  N N    . ARG A 1 106 ? -9.912  9.421   15.769 1.00 0.00 ? 106 ARG A N    2  
ATOM 3421  C CA   . ARG A 1 106 ? -9.131  8.868   16.862 1.00 0.00 ? 106 ARG A CA   2  
ATOM 3422  C C    . ARG A 1 106 ? -7.951  9.785   17.188 1.00 0.00 ? 106 ARG A C    2  
ATOM 3423  O O    . ARG A 1 106 ? -7.441  10.481  16.312 1.00 0.00 ? 106 ARG A O    2  
ATOM 3424  C CB   . ARG A 1 106 ? -8.605  7.474   16.513 1.00 0.00 ? 106 ARG A CB   2  
ATOM 3425  C CG   . ARG A 1 106 ? -9.271  6.403   17.379 1.00 0.00 ? 106 ARG A CG   2  
ATOM 3426  C CD   . ARG A 1 106 ? -8.713  5.015   17.059 1.00 0.00 ? 106 ARG A CD   2  
ATOM 3427  N NE   . ARG A 1 106 ? -9.793  4.005   17.137 1.00 0.00 ? 106 ARG A NE   2  
ATOM 3428  C CZ   . ARG A 1 106 ? -10.236 3.466   18.281 1.00 0.00 ? 106 ARG A CZ   2  
ATOM 3429  N NH1  . ARG A 1 106 ? -9.695  3.836   19.450 1.00 0.00 ? 106 ARG A NH1  2  
ATOM 3430  N NH2  . ARG A 1 106 ? -11.220 2.557   18.256 1.00 0.00 ? 106 ARG A NH2  2  
ATOM 3431  H H    . ARG A 1 106 ? -10.257 8.749   15.114 1.00 0.00 ? 106 ARG A H    2  
ATOM 3432  H HA   . ARG A 1 106 ? -9.827  8.810   17.700 1.00 0.00 ? 106 ARG A HA   2  
ATOM 3433  H HB2  . ARG A 1 106 ? -8.792  7.264   15.460 1.00 0.00 ? 106 ARG A HB2  2  
ATOM 3434  H HB3  . ARG A 1 106 ? -7.525  7.443   16.657 1.00 0.00 ? 106 ARG A HB3  2  
ATOM 3435  H HG2  . ARG A 1 106 ? -9.110  6.630   18.432 1.00 0.00 ? 106 ARG A HG2  2  
ATOM 3436  H HG3  . ARG A 1 106 ? -10.348 6.413   17.211 1.00 0.00 ? 106 ARG A HG3  2  
ATOM 3437  H HD2  . ARG A 1 106 ? -8.272  5.011   16.062 1.00 0.00 ? 106 ARG A HD2  2  
ATOM 3438  H HD3  . ARG A 1 106 ? -7.918  4.763   17.760 1.00 0.00 ? 106 ARG A HD3  2  
ATOM 3439  H HE   . ARG A 1 106 ? -10.218 3.707   16.282 1.00 0.00 ? 106 ARG A HE   2  
ATOM 3440  H HH11 . ARG A 1 106 ? -8.961  4.515   19.468 1.00 0.00 ? 106 ARG A HH11 2  
ATOM 3441  H HH12 . ARG A 1 106 ? -10.026 3.434   20.303 1.00 0.00 ? 106 ARG A HH12 2  
ATOM 3442  H HH21 . ARG A 1 106 ? -11.624 2.281   17.384 1.00 0.00 ? 106 ARG A HH21 2  
ATOM 3443  H HH22 . ARG A 1 106 ? -11.551 2.154   19.110 1.00 0.00 ? 106 ARG A HH22 2  
ATOM 3444  N N    . GLU A 1 107 ? -7.551  9.755   18.451 1.00 0.00 ? 107 GLU A N    2  
ATOM 3445  C CA   . GLU A 1 107 ? -6.440  10.575  18.904 1.00 0.00 ? 107 GLU A CA   2  
ATOM 3446  C C    . GLU A 1 107 ? -6.803  12.059  18.810 1.00 0.00 ? 107 GLU A C    2  
ATOM 3447  O O    . GLU A 1 107 ? -6.404  12.740  17.867 1.00 0.00 ? 107 GLU A O    2  
ATOM 3448  C CB   . GLU A 1 107 ? -5.172  10.269  18.106 1.00 0.00 ? 107 GLU A CB   2  
ATOM 3449  C CG   . GLU A 1 107 ? -4.702  8.834   18.352 1.00 0.00 ? 107 GLU A CG   2  
ATOM 3450  C CD   . GLU A 1 107 ? -3.432  8.528   17.556 1.00 0.00 ? 107 GLU A CD   2  
ATOM 3451  O OE1  . GLU A 1 107 ? -2.513  9.374   17.607 1.00 0.00 ? 107 GLU A OE1  2  
ATOM 3452  O OE2  . GLU A 1 107 ? -3.409  7.456   16.914 1.00 0.00 ? 107 GLU A OE2  2  
ATOM 3453  H H    . GLU A 1 107 ? -7.972  9.186   19.158 1.00 0.00 ? 107 GLU A H    2  
ATOM 3454  H HA   . GLU A 1 107 ? -6.282  10.298  19.946 1.00 0.00 ? 107 GLU A HA   2  
ATOM 3455  H HB2  . GLU A 1 107 ? -5.363  10.415  17.043 1.00 0.00 ? 107 GLU A HB2  2  
ATOM 3456  H HB3  . GLU A 1 107 ? -4.383  10.967  18.387 1.00 0.00 ? 107 GLU A HB3  2  
ATOM 3457  H HG2  . GLU A 1 107 ? -4.513  8.687   19.416 1.00 0.00 ? 107 GLU A HG2  2  
ATOM 3458  H HG3  . GLU A 1 107 ? -5.490  8.136   18.069 1.00 0.00 ? 107 GLU A HG3  2  
ATOM 3459  N N    . GLU A 1 108 ? -7.555  12.515  19.800 1.00 0.00 ? 108 GLU A N    2  
ATOM 3460  C CA   . GLU A 1 108 ? -7.975  13.906  19.841 1.00 0.00 ? 108 GLU A CA   2  
ATOM 3461  C C    . GLU A 1 108 ? -6.977  14.739  20.648 1.00 0.00 ? 108 GLU A C    2  
ATOM 3462  O O    . GLU A 1 108 ? -6.393  15.688  20.128 1.00 0.00 ? 108 GLU A O    2  
ATOM 3463  C CB   . GLU A 1 108 ? -9.388  14.035  20.415 1.00 0.00 ? 108 GLU A CB   2  
ATOM 3464  C CG   . GLU A 1 108 ? -10.275 14.883  19.502 1.00 0.00 ? 108 GLU A CG   2  
ATOM 3465  C CD   . GLU A 1 108 ? -11.339 15.629  20.311 1.00 0.00 ? 108 GLU A CD   2  
ATOM 3466  O OE1  . GLU A 1 108 ? -11.826 15.032  21.295 1.00 0.00 ? 108 GLU A OE1  2  
ATOM 3467  O OE2  . GLU A 1 108 ? -11.641 16.779  19.926 1.00 0.00 ? 108 GLU A OE2  2  
ATOM 3468  H H    . GLU A 1 108 ? -7.875  11.954  20.564 1.00 0.00 ? 108 GLU A H    2  
ATOM 3469  H HA   . GLU A 1 108 ? -7.980  14.237  18.803 1.00 0.00 ? 108 GLU A HA   2  
ATOM 3470  H HB2  . GLU A 1 108 ? -9.827  13.044  20.537 1.00 0.00 ? 108 GLU A HB2  2  
ATOM 3471  H HB3  . GLU A 1 108 ? -9.342  14.487  21.406 1.00 0.00 ? 108 GLU A HB3  2  
ATOM 3472  H HG2  . GLU A 1 108 ? -9.661  15.599  18.955 1.00 0.00 ? 108 GLU A HG2  2  
ATOM 3473  H HG3  . GLU A 1 108 ? -10.757 14.245  18.762 1.00 0.00 ? 108 GLU A HG3  2  
ATOM 3474  N N    . SER A 1 109 ? -6.813  14.353  21.905 1.00 0.00 ? 109 SER A N    2  
ATOM 3475  C CA   . SER A 1 109 ? -5.896  15.053  22.788 1.00 0.00 ? 109 SER A CA   2  
ATOM 3476  C C    . SER A 1 109 ? -6.282  16.530  22.879 1.00 0.00 ? 109 SER A C    2  
ATOM 3477  O O    . SER A 1 109 ? -6.048  17.295  21.945 1.00 0.00 ? 109 SER A O    2  
ATOM 3478  C CB   . SER A 1 109 ? -4.451  14.910  22.307 1.00 0.00 ? 109 SER A CB   2  
ATOM 3479  O OG   . SER A 1 109 ? -3.587  14.448  23.341 1.00 0.00 ? 109 SER A OG   2  
ATOM 3480  H H    . SER A 1 109 ? -7.293  13.580  22.320 1.00 0.00 ? 109 SER A H    2  
ATOM 3481  H HA   . SER A 1 109 ? -6.004  14.568  23.759 1.00 0.00 ? 109 SER A HA   2  
ATOM 3482  H HB2  . SER A 1 109 ? -4.415  14.216  21.467 1.00 0.00 ? 109 SER A HB2  2  
ATOM 3483  H HB3  . SER A 1 109 ? -4.094  15.873  21.940 1.00 0.00 ? 109 SER A HB3  2  
ATOM 3484  H HG   . SER A 1 109 ? -2.639  14.449  23.021 1.00 0.00 ? 109 SER A HG   2  
ATOM 3485  N N    . GLY A 1 110 ? -6.866  16.888  24.014 1.00 0.00 ? 110 GLY A N    2  
ATOM 3486  C CA   . GLY A 1 110 ? -7.286  18.260  24.239 1.00 0.00 ? 110 GLY A CA   2  
ATOM 3487  C C    . GLY A 1 110 ? -6.252  19.020  25.073 1.00 0.00 ? 110 GLY A C    2  
ATOM 3488  O O    . GLY A 1 110 ? -5.397  19.715  24.525 1.00 0.00 ? 110 GLY A O    2  
ATOM 3489  H H    . GLY A 1 110 ? -7.052  16.260  24.769 1.00 0.00 ? 110 GLY A H    2  
ATOM 3490  H HA2  . GLY A 1 110 ? -7.427  18.763  23.282 1.00 0.00 ? 110 GLY A HA2  2  
ATOM 3491  H HA3  . GLY A 1 110 ? -8.249  18.270  24.750 1.00 0.00 ? 110 GLY A HA3  2  
ATOM 3492  N N    . SER A 1 111 ? -6.365  18.863  26.383 1.00 0.00 ? 111 SER A N    2  
ATOM 3493  C CA   . SER A 1 111 ? -5.451  19.526  27.298 1.00 0.00 ? 111 SER A CA   2  
ATOM 3494  C C    . SER A 1 111 ? -5.211  20.968  26.845 1.00 0.00 ? 111 SER A C    2  
ATOM 3495  O O    . SER A 1 111 ? -4.283  21.237  26.084 1.00 0.00 ? 111 SER A O    2  
ATOM 3496  C CB   . SER A 1 111 ? -4.123  18.772  27.393 1.00 0.00 ? 111 SER A CB   2  
ATOM 3497  O OG   . SER A 1 111 ? -3.602  18.773  28.719 1.00 0.00 ? 111 SER A OG   2  
ATOM 3498  H H    . SER A 1 111 ? -7.063  18.296  26.820 1.00 0.00 ? 111 SER A H    2  
ATOM 3499  H HA   . SER A 1 111 ? -5.949  19.507  28.267 1.00 0.00 ? 111 SER A HA   2  
ATOM 3500  H HB2  . SER A 1 111 ? -4.266  17.744  27.060 1.00 0.00 ? 111 SER A HB2  2  
ATOM 3501  H HB3  . SER A 1 111 ? -3.398  19.227  26.718 1.00 0.00 ? 111 SER A HB3  2  
ATOM 3502  H HG   . SER A 1 111 ? -2.673  19.141  28.721 1.00 0.00 ? 111 SER A HG   2  
ATOM 3503  N N    . GLY A 1 112 ? -6.064  21.857  27.332 1.00 0.00 ? 112 GLY A N    2  
ATOM 3504  C CA   . GLY A 1 112 ? -5.957  23.264  26.987 1.00 0.00 ? 112 GLY A CA   2  
ATOM 3505  C C    . GLY A 1 112 ? -6.014  24.141  28.239 1.00 0.00 ? 112 GLY A C    2  
ATOM 3506  O O    . GLY A 1 112 ? -7.068  24.278  28.859 1.00 0.00 ? 112 GLY A O    2  
ATOM 3507  H H    . GLY A 1 112 ? -6.817  21.629  27.951 1.00 0.00 ? 112 GLY A H    2  
ATOM 3508  H HA2  . GLY A 1 112 ? -5.022  23.442  26.456 1.00 0.00 ? 112 GLY A HA2  2  
ATOM 3509  H HA3  . GLY A 1 112 ? -6.765  23.539  26.309 1.00 0.00 ? 112 GLY A HA3  2  
ATOM 3510  N N    . PRO A 1 113 ? -4.836  24.728  28.584 1.00 0.00 ? 113 PRO A N    2  
ATOM 3511  C CA   . PRO A 1 113 ? -4.742  25.589  29.751 1.00 0.00 ? 113 PRO A CA   2  
ATOM 3512  C C    . PRO A 1 113 ? -5.382  26.952  29.480 1.00 0.00 ? 113 PRO A C    2  
ATOM 3513  O O    . PRO A 1 113 ? -4.699  27.894  29.080 1.00 0.00 ? 113 PRO A O    2  
ATOM 3514  C CB   . PRO A 1 113 ? -3.255  25.680  30.053 1.00 0.00 ? 113 PRO A CB   2  
ATOM 3515  C CG   . PRO A 1 113 ? -2.544  25.253  28.779 1.00 0.00 ? 113 PRO A CG   2  
ATOM 3516  C CD   . PRO A 1 113 ? -3.568  24.589  27.874 1.00 0.00 ? 113 PRO A CD   2  
ATOM 3517  H HA   . PRO A 1 113 ? -5.252  25.194  30.515 1.00 0.00 ? 113 PRO A HA   2  
ATOM 3518  H HB2  . PRO A 1 113 ? -2.976  26.695  30.334 1.00 0.00 ? 113 PRO A HB2  2  
ATOM 3519  H HB3  . PRO A 1 113 ? -2.985  25.032  30.887 1.00 0.00 ? 113 PRO A HB3  2  
ATOM 3520  H HG2  . PRO A 1 113 ? -2.098  26.115  28.283 1.00 0.00 ? 113 PRO A HG2  2  
ATOM 3521  H HG3  . PRO A 1 113 ? -1.732  24.562  29.009 1.00 0.00 ? 113 PRO A HG3  2  
ATOM 3522  H HD2  . PRO A 1 113 ? -3.606  25.072  26.897 1.00 0.00 ? 113 PRO A HD2  2  
ATOM 3523  H HD3  . PRO A 1 113 ? -3.324  23.541  27.701 1.00 0.00 ? 113 PRO A HD3  2  
ATOM 3524  N N    . SER A 1 114 ? -6.686  27.014  29.709 1.00 0.00 ? 114 SER A N    2  
ATOM 3525  C CA   . SER A 1 114 ? -7.425  28.246  29.495 1.00 0.00 ? 114 SER A CA   2  
ATOM 3526  C C    . SER A 1 114 ? -8.889  28.054  29.896 1.00 0.00 ? 114 SER A C    2  
ATOM 3527  O O    . SER A 1 114 ? -9.430  26.956  29.777 1.00 0.00 ? 114 SER A O    2  
ATOM 3528  C CB   . SER A 1 114 ? -7.330  28.699  28.037 1.00 0.00 ? 114 SER A CB   2  
ATOM 3529  O OG   . SER A 1 114 ? -6.798  30.016  27.921 1.00 0.00 ? 114 SER A OG   2  
ATOM 3530  H H    . SER A 1 114 ? -7.233  26.243  30.034 1.00 0.00 ? 114 SER A H    2  
ATOM 3531  H HA   . SER A 1 114 ? -6.946  28.985  30.137 1.00 0.00 ? 114 SER A HA   2  
ATOM 3532  H HB2  . SER A 1 114 ? -6.700  28.004  27.481 1.00 0.00 ? 114 SER A HB2  2  
ATOM 3533  H HB3  . SER A 1 114 ? -8.319  28.666  27.581 1.00 0.00 ? 114 SER A HB3  2  
ATOM 3534  H HG   . SER A 1 114 ? -7.541  30.685  27.907 1.00 0.00 ? 114 SER A HG   2  
ATOM 3535  N N    . SER A 1 115 ? -9.489  29.139  30.363 1.00 0.00 ? 115 SER A N    2  
ATOM 3536  C CA   . SER A 1 115 ? -10.879 29.104  30.783 1.00 0.00 ? 115 SER A CA   2  
ATOM 3537  C C    . SER A 1 115 ? -11.301 30.476  31.313 1.00 0.00 ? 115 SER A C    2  
ATOM 3538  O O    . SER A 1 115 ? -11.068 30.793  32.478 1.00 0.00 ? 115 SER A O    2  
ATOM 3539  C CB   . SER A 1 115 ? -11.106 28.030  31.849 1.00 0.00 ? 115 SER A CB   2  
ATOM 3540  O OG   . SER A 1 115 ? -12.014 27.024  31.409 1.00 0.00 ? 115 SER A OG   2  
ATOM 3541  H H    . SER A 1 115 ? -9.041  30.029  30.457 1.00 0.00 ? 115 SER A H    2  
ATOM 3542  H HA   . SER A 1 115 ? -11.445 28.850  29.887 1.00 0.00 ? 115 SER A HA   2  
ATOM 3543  H HB2  . SER A 1 115 ? -10.152 27.570  32.109 1.00 0.00 ? 115 SER A HB2  2  
ATOM 3544  H HB3  . SER A 1 115 ? -11.492 28.496  32.756 1.00 0.00 ? 115 SER A HB3  2  
ATOM 3545  H HG   . SER A 1 115 ? -12.000 26.963  30.411 1.00 0.00 ? 115 SER A HG   2  
ATOM 3546  N N    . GLY A 1 116 ? -11.914 31.252  30.432 1.00 0.00 ? 116 GLY A N    2  
ATOM 3547  C CA   . GLY A 1 116 ? -12.371 32.583  30.797 1.00 0.00 ? 116 GLY A CA   2  
ATOM 3548  C C    . GLY A 1 116 ? -13.269 33.172  29.707 1.00 0.00 ? 116 GLY A C    2  
ATOM 3549  O O    . GLY A 1 116 ? -14.433 33.479  29.957 1.00 0.00 ? 116 GLY A O    2  
ATOM 3550  H H    . GLY A 1 116 ? -12.100 30.986  29.486 1.00 0.00 ? 116 GLY A H    2  
ATOM 3551  H HA2  . GLY A 1 116 ? -12.917 32.538  31.739 1.00 0.00 ? 116 GLY A HA2  2  
ATOM 3552  H HA3  . GLY A 1 116 ? -11.512 33.234  30.957 1.00 0.00 ? 116 GLY A HA3  2  
ATOM 3553  N N    . GLY A 1 1   ? -43.239 -17.524 18.563 1.00 0.00 ? 1   GLY A N    3  
ATOM 3554  C CA   . GLY A 1 1   ? -42.015 -17.176 17.861 1.00 0.00 ? 1   GLY A CA   3  
ATOM 3555  C C    . GLY A 1 1   ? -40.944 -16.686 18.837 1.00 0.00 ? 1   GLY A C    3  
ATOM 3556  O O    . GLY A 1 1   ? -39.960 -17.381 19.085 1.00 0.00 ? 1   GLY A O    3  
ATOM 3557  H H1   . GLY A 1 1   ? -43.334 -17.120 19.472 1.00 0.00 ? 1   GLY A H1   3  
ATOM 3558  H HA2  . GLY A 1 1   ? -41.645 -18.043 17.315 1.00 0.00 ? 1   GLY A HA2  3  
ATOM 3559  H HA3  . GLY A 1 1   ? -42.223 -16.400 17.124 1.00 0.00 ? 1   GLY A HA3  3  
ATOM 3560  N N    . SER A 1 2   ? -41.171 -15.492 19.365 1.00 0.00 ? 2   SER A N    3  
ATOM 3561  C CA   . SER A 1 2   ? -40.237 -14.901 20.308 1.00 0.00 ? 2   SER A CA   3  
ATOM 3562  C C    . SER A 1 2   ? -38.856 -14.767 19.664 1.00 0.00 ? 2   SER A C    3  
ATOM 3563  O O    . SER A 1 2   ? -38.199 -15.768 19.382 1.00 0.00 ? 2   SER A O    3  
ATOM 3564  C CB   . SER A 1 2   ? -40.147 -15.734 21.589 1.00 0.00 ? 2   SER A CB   3  
ATOM 3565  O OG   . SER A 1 2   ? -39.229 -16.815 21.459 1.00 0.00 ? 2   SER A OG   3  
ATOM 3566  H H    . SER A 1 2   ? -41.974 -14.933 19.158 1.00 0.00 ? 2   SER A H    3  
ATOM 3567  H HA   . SER A 1 2   ? -40.647 -13.918 20.543 1.00 0.00 ? 2   SER A HA   3  
ATOM 3568  H HB2  . SER A 1 2   ? -39.839 -15.094 22.416 1.00 0.00 ? 2   SER A HB2  3  
ATOM 3569  H HB3  . SER A 1 2   ? -41.134 -16.124 21.838 1.00 0.00 ? 2   SER A HB3  3  
ATOM 3570  H HG   . SER A 1 2   ? -38.308 -16.514 21.707 1.00 0.00 ? 2   SER A HG   3  
ATOM 3571  N N    . SER A 1 3   ? -38.457 -13.522 19.450 1.00 0.00 ? 3   SER A N    3  
ATOM 3572  C CA   . SER A 1 3   ? -37.166 -13.245 18.844 1.00 0.00 ? 3   SER A CA   3  
ATOM 3573  C C    . SER A 1 3   ? -36.699 -11.839 19.227 1.00 0.00 ? 3   SER A C    3  
ATOM 3574  O O    . SER A 1 3   ? -37.511 -10.989 19.591 1.00 0.00 ? 3   SER A O    3  
ATOM 3575  C CB   . SER A 1 3   ? -37.230 -13.386 17.321 1.00 0.00 ? 3   SER A CB   3  
ATOM 3576  O OG   . SER A 1 3   ? -37.878 -14.591 16.924 1.00 0.00 ? 3   SER A OG   3  
ATOM 3577  H H    . SER A 1 3   ? -38.997 -12.714 19.682 1.00 0.00 ? 3   SER A H    3  
ATOM 3578  H HA   . SER A 1 3   ? -36.489 -13.996 19.249 1.00 0.00 ? 3   SER A HA   3  
ATOM 3579  H HB2  . SER A 1 3   ? -37.761 -12.532 16.900 1.00 0.00 ? 3   SER A HB2  3  
ATOM 3580  H HB3  . SER A 1 3   ? -36.219 -13.366 16.912 1.00 0.00 ? 3   SER A HB3  3  
ATOM 3581  H HG   . SER A 1 3   ? -37.242 -15.170 16.414 1.00 0.00 ? 3   SER A HG   3  
ATOM 3582  N N    . GLY A 1 4   ? -35.393 -11.637 19.132 1.00 0.00 ? 4   GLY A N    3  
ATOM 3583  C CA   . GLY A 1 4   ? -34.809 -10.349 19.464 1.00 0.00 ? 4   GLY A CA   3  
ATOM 3584  C C    . GLY A 1 4   ? -34.189 -9.693  18.229 1.00 0.00 ? 4   GLY A C    3  
ATOM 3585  O O    . GLY A 1 4   ? -33.843 -10.376 17.266 1.00 0.00 ? 4   GLY A O    3  
ATOM 3586  H H    . GLY A 1 4   ? -34.739 -12.333 18.835 1.00 0.00 ? 4   GLY A H    3  
ATOM 3587  H HA2  . GLY A 1 4   ? -35.574 -9.695  19.882 1.00 0.00 ? 4   GLY A HA2  3  
ATOM 3588  H HA3  . GLY A 1 4   ? -34.046 -10.479 20.232 1.00 0.00 ? 4   GLY A HA3  3  
ATOM 3589  N N    . SER A 1 5   ? -34.069 -8.375  18.296 1.00 0.00 ? 5   SER A N    3  
ATOM 3590  C CA   . SER A 1 5   ? -33.497 -7.619  17.195 1.00 0.00 ? 5   SER A CA   3  
ATOM 3591  C C    . SER A 1 5   ? -33.099 -6.220  17.671 1.00 0.00 ? 5   SER A C    3  
ATOM 3592  O O    . SER A 1 5   ? -33.742 -5.655  18.553 1.00 0.00 ? 5   SER A O    3  
ATOM 3593  C CB   . SER A 1 5   ? -34.479 -7.521  16.025 1.00 0.00 ? 5   SER A CB   3  
ATOM 3594  O OG   . SER A 1 5   ? -34.310 -8.589  15.096 1.00 0.00 ? 5   SER A OG   3  
ATOM 3595  H H    . SER A 1 5   ? -34.353 -7.827  19.082 1.00 0.00 ? 5   SER A H    3  
ATOM 3596  H HA   . SER A 1 5   ? -32.617 -8.182  16.883 1.00 0.00 ? 5   SER A HA   3  
ATOM 3597  H HB2  . SER A 1 5   ? -35.500 -7.531  16.407 1.00 0.00 ? 5   SER A HB2  3  
ATOM 3598  H HB3  . SER A 1 5   ? -34.340 -6.569  15.513 1.00 0.00 ? 5   SER A HB3  3  
ATOM 3599  H HG   . SER A 1 5   ? -34.453 -8.256  14.164 1.00 0.00 ? 5   SER A HG   3  
ATOM 3600  N N    . SER A 1 6   ? -32.040 -5.703  17.066 1.00 0.00 ? 6   SER A N    3  
ATOM 3601  C CA   . SER A 1 6   ? -31.548 -4.382  17.417 1.00 0.00 ? 6   SER A CA   3  
ATOM 3602  C C    . SER A 1 6   ? -31.566 -3.472  16.187 1.00 0.00 ? 6   SER A C    3  
ATOM 3603  O O    . SER A 1 6   ? -31.161 -3.883  15.101 1.00 0.00 ? 6   SER A O    3  
ATOM 3604  C CB   . SER A 1 6   ? -30.135 -4.457  18.000 1.00 0.00 ? 6   SER A CB   3  
ATOM 3605  O OG   . SER A 1 6   ? -29.857 -3.361  18.867 1.00 0.00 ? 6   SER A OG   3  
ATOM 3606  H H    . SER A 1 6   ? -31.522 -6.170  16.349 1.00 0.00 ? 6   SER A H    3  
ATOM 3607  H HA   . SER A 1 6   ? -32.235 -4.011  18.177 1.00 0.00 ? 6   SER A HA   3  
ATOM 3608  H HB2  . SER A 1 6   ? -30.019 -5.391  18.549 1.00 0.00 ? 6   SER A HB2  3  
ATOM 3609  H HB3  . SER A 1 6   ? -29.408 -4.472  17.188 1.00 0.00 ? 6   SER A HB3  3  
ATOM 3610  H HG   . SER A 1 6   ? -29.279 -3.662  19.625 1.00 0.00 ? 6   SER A HG   3  
ATOM 3611  N N    . GLY A 1 7   ? -32.041 -2.254  16.399 1.00 0.00 ? 7   GLY A N    3  
ATOM 3612  C CA   . GLY A 1 7   ? -32.118 -1.283  15.320 1.00 0.00 ? 7   GLY A CA   3  
ATOM 3613  C C    . GLY A 1 7   ? -31.722 0.112   15.809 1.00 0.00 ? 7   GLY A C    3  
ATOM 3614  O O    . GLY A 1 7   ? -32.528 0.811   16.422 1.00 0.00 ? 7   GLY A O    3  
ATOM 3615  H H    . GLY A 1 7   ? -32.369 -1.927  17.285 1.00 0.00 ? 7   GLY A H    3  
ATOM 3616  H HA2  . GLY A 1 7   ? -31.461 -1.586  14.505 1.00 0.00 ? 7   GLY A HA2  3  
ATOM 3617  H HA3  . GLY A 1 7   ? -33.131 -1.257  14.920 1.00 0.00 ? 7   GLY A HA3  3  
ATOM 3618  N N    . MET A 1 8   ? -30.481 0.475   15.521 1.00 0.00 ? 8   MET A N    3  
ATOM 3619  C CA   . MET A 1 8   ? -29.968 1.774   15.923 1.00 0.00 ? 8   MET A CA   3  
ATOM 3620  C C    . MET A 1 8   ? -29.827 2.705   14.718 1.00 0.00 ? 8   MET A C    3  
ATOM 3621  O O    . MET A 1 8   ? -28.906 2.554   13.916 1.00 0.00 ? 8   MET A O    3  
ATOM 3622  C CB   . MET A 1 8   ? -28.605 1.599   16.596 1.00 0.00 ? 8   MET A CB   3  
ATOM 3623  C CG   . MET A 1 8   ? -28.753 0.946   17.972 1.00 0.00 ? 8   MET A CG   3  
ATOM 3624  S SD   . MET A 1 8   ? -28.700 -0.831  17.813 1.00 0.00 ? 8   MET A SD   3  
ATOM 3625  C CE   . MET A 1 8   ? -27.376 -1.205  18.950 1.00 0.00 ? 8   MET A CE   3  
ATOM 3626  H H    . MET A 1 8   ? -29.832 -0.099  15.022 1.00 0.00 ? 8   MET A H    3  
ATOM 3627  H HA   . MET A 1 8   ? -30.705 2.177   16.618 1.00 0.00 ? 8   MET A HA   3  
ATOM 3628  H HB2  . MET A 1 8   ? -27.961 0.986   15.966 1.00 0.00 ? 8   MET A HB2  3  
ATOM 3629  H HB3  . MET A 1 8   ? -28.120 2.569   16.701 1.00 0.00 ? 8   MET A HB3  3  
ATOM 3630  H HG2  . MET A 1 8   ? -27.955 1.284   18.632 1.00 0.00 ? 8   MET A HG2  3  
ATOM 3631  H HG3  . MET A 1 8   ? -29.695 1.250   18.429 1.00 0.00 ? 8   MET A HG3  3  
ATOM 3632  H HE1  . MET A 1 8   ? -26.456 -0.731  18.606 1.00 0.00 ? 8   MET A HE1  3  
ATOM 3633  H HE2  . MET A 1 8   ? -27.630 -0.827  19.941 1.00 0.00 ? 8   MET A HE2  3  
ATOM 3634  H HE3  . MET A 1 8   ? -27.232 -2.284  18.999 1.00 0.00 ? 8   MET A HE3  3  
ATOM 3635  N N    . GLU A 1 9   ? -30.753 3.648   14.627 1.00 0.00 ? 9   GLU A N    3  
ATOM 3636  C CA   . GLU A 1 9   ? -30.743 4.604   13.533 1.00 0.00 ? 9   GLU A CA   3  
ATOM 3637  C C    . GLU A 1 9   ? -31.852 5.640   13.723 1.00 0.00 ? 9   GLU A C    3  
ATOM 3638  O O    . GLU A 1 9   ? -33.012 5.283   13.925 1.00 0.00 ? 9   GLU A O    3  
ATOM 3639  C CB   . GLU A 1 9   ? -30.880 3.895   12.184 1.00 0.00 ? 9   GLU A CB   3  
ATOM 3640  C CG   . GLU A 1 9   ? -31.945 2.799   12.247 1.00 0.00 ? 9   GLU A CG   3  
ATOM 3641  C CD   . GLU A 1 9   ? -32.979 2.974   11.132 1.00 0.00 ? 9   GLU A CD   3  
ATOM 3642  O OE1  . GLU A 1 9   ? -33.912 3.778   11.345 1.00 0.00 ? 9   GLU A OE1  3  
ATOM 3643  O OE2  . GLU A 1 9   ? -32.813 2.300   10.093 1.00 0.00 ? 9   GLU A OE2  3  
ATOM 3644  H H    . GLU A 1 9   ? -31.499 3.765   15.283 1.00 0.00 ? 9   GLU A H    3  
ATOM 3645  H HA   . GLU A 1 9   ? -29.769 5.091   13.582 1.00 0.00 ? 9   GLU A HA   3  
ATOM 3646  H HB2  . GLU A 1 9   ? -31.144 4.619   11.413 1.00 0.00 ? 9   GLU A HB2  3  
ATOM 3647  H HB3  . GLU A 1 9   ? -29.922 3.460   11.898 1.00 0.00 ? 9   GLU A HB3  3  
ATOM 3648  H HG2  . GLU A 1 9   ? -31.472 1.821   12.158 1.00 0.00 ? 9   GLU A HG2  3  
ATOM 3649  H HG3  . GLU A 1 9   ? -32.442 2.825   13.216 1.00 0.00 ? 9   GLU A HG3  3  
ATOM 3650  N N    . LYS A 1 10  ? -31.457 6.903   13.651 1.00 0.00 ? 10  LYS A N    3  
ATOM 3651  C CA   . LYS A 1 10  ? -32.404 7.994   13.812 1.00 0.00 ? 10  LYS A CA   3  
ATOM 3652  C C    . LYS A 1 10  ? -31.683 9.325   13.594 1.00 0.00 ? 10  LYS A C    3  
ATOM 3653  O O    . LYS A 1 10  ? -32.143 10.165  12.821 1.00 0.00 ? 10  LYS A O    3  
ATOM 3654  C CB   . LYS A 1 10  ? -33.113 7.892   15.165 1.00 0.00 ? 10  LYS A CB   3  
ATOM 3655  C CG   . LYS A 1 10  ? -32.103 7.720   16.301 1.00 0.00 ? 10  LYS A CG   3  
ATOM 3656  C CD   . LYS A 1 10  ? -32.614 6.723   17.343 1.00 0.00 ? 10  LYS A CD   3  
ATOM 3657  C CE   . LYS A 1 10  ? -32.449 7.276   18.759 1.00 0.00 ? 10  LYS A CE   3  
ATOM 3658  N NZ   . LYS A 1 10  ? -31.147 6.862   19.329 1.00 0.00 ? 10  LYS A NZ   3  
ATOM 3659  H H    . LYS A 1 10  ? -30.512 7.185   13.485 1.00 0.00 ? 10  LYS A H    3  
ATOM 3660  H HA   . LYS A 1 10  ? -33.166 7.882   13.040 1.00 0.00 ? 10  LYS A HA   3  
ATOM 3661  H HB2  . LYS A 1 10  ? -33.708 8.789   15.336 1.00 0.00 ? 10  LYS A HB2  3  
ATOM 3662  H HB3  . LYS A 1 10  ? -33.802 7.048   15.155 1.00 0.00 ? 10  LYS A HB3  3  
ATOM 3663  H HG2  . LYS A 1 10  ? -31.151 7.373   15.897 1.00 0.00 ? 10  LYS A HG2  3  
ATOM 3664  H HG3  . LYS A 1 10  ? -31.916 8.683   16.775 1.00 0.00 ? 10  LYS A HG3  3  
ATOM 3665  H HD2  . LYS A 1 10  ? -33.665 6.502   17.155 1.00 0.00 ? 10  LYS A HD2  3  
ATOM 3666  H HD3  . LYS A 1 10  ? -32.070 5.783   17.250 1.00 0.00 ? 10  LYS A HD3  3  
ATOM 3667  H HE2  . LYS A 1 10  ? -32.515 8.364   18.741 1.00 0.00 ? 10  LYS A HE2  3  
ATOM 3668  H HE3  . LYS A 1 10  ? -33.260 6.918   19.393 1.00 0.00 ? 10  LYS A HE3  3  
ATOM 3669  H HZ1  . LYS A 1 10  ? -31.284 6.521   20.259 1.00 0.00 ? 10  LYS A HZ1  3  
ATOM 3670  H HZ2  . LYS A 1 10  ? -30.751 6.138   18.763 1.00 0.00 ? 10  LYS A HZ2  3  
ATOM 3671  H HZ3  . LYS A 1 10  ? -30.527 7.646   19.349 1.00 0.00 ? 10  LYS A HZ3  3  
ATOM 3672  N N    . THR A 1 11  ? -30.565 9.477   14.288 1.00 0.00 ? 11  THR A N    3  
ATOM 3673  C CA   . THR A 1 11  ? -29.777 10.693  14.180 1.00 0.00 ? 11  THR A CA   3  
ATOM 3674  C C    . THR A 1 11  ? -28.626 10.496  13.192 1.00 0.00 ? 11  THR A C    3  
ATOM 3675  O O    . THR A 1 11  ? -28.154 9.376   12.998 1.00 0.00 ? 11  THR A O    3  
ATOM 3676  C CB   . THR A 1 11  ? -29.311 11.081  15.585 1.00 0.00 ? 11  THR A CB   3  
ATOM 3677  O OG1  . THR A 1 11  ? -30.491 11.569  16.219 1.00 0.00 ? 11  THR A OG1  3  
ATOM 3678  C CG2  . THR A 1 11  ? -28.367 12.285  15.577 1.00 0.00 ? 11  THR A CG2  3  
ATOM 3679  H H    . THR A 1 11  ? -30.198 8.790   14.915 1.00 0.00 ? 11  THR A H    3  
ATOM 3680  H HA   . THR A 1 11  ? -30.413 11.481  13.777 1.00 0.00 ? 11  THR A HA   3  
ATOM 3681  H HB   . THR A 1 11  ? -28.855 10.232  16.092 1.00 0.00 ? 11  THR A HB   3  
ATOM 3682  H HG1  . THR A 1 11  ? -31.076 10.804  16.488 1.00 0.00 ? 11  THR A HG1  3  
ATOM 3683  H HG21 . THR A 1 11  ? -27.556 12.106  14.871 1.00 0.00 ? 11  THR A HG21 3  
ATOM 3684  H HG22 . THR A 1 11  ? -28.918 13.177  15.279 1.00 0.00 ? 11  THR A HG22 3  
ATOM 3685  H HG23 . THR A 1 11  ? -27.954 12.430  16.576 1.00 0.00 ? 11  THR A HG23 3  
ATOM 3686  N N    . LEU A 1 12  ? -28.206 11.601  12.593 1.00 0.00 ? 12  LEU A N    3  
ATOM 3687  C CA   . LEU A 1 12  ? -27.119 11.563  11.630 1.00 0.00 ? 12  LEU A CA   3  
ATOM 3688  C C    . LEU A 1 12  ? -26.725 12.994  11.256 1.00 0.00 ? 12  LEU A C    3  
ATOM 3689  O O    . LEU A 1 12  ? -27.127 13.498  10.208 1.00 0.00 ? 12  LEU A O    3  
ATOM 3690  C CB   . LEU A 1 12  ? -27.498 10.696  10.427 1.00 0.00 ? 12  LEU A CB   3  
ATOM 3691  C CG   . LEU A 1 12  ? -26.338 10.011  9.702  1.00 0.00 ? 12  LEU A CG   3  
ATOM 3692  C CD1  . LEU A 1 12  ? -25.249 11.020  9.335  1.00 0.00 ? 12  LEU A CD1  3  
ATOM 3693  C CD2  . LEU A 1 12  ? -25.787 8.847   10.528 1.00 0.00 ? 12  LEU A CD2  3  
ATOM 3694  H H    . LEU A 1 12  ? -28.595 12.507  12.757 1.00 0.00 ? 12  LEU A H    3  
ATOM 3695  H HA   . LEU A 1 12  ? -26.268 11.086  12.115 1.00 0.00 ? 12  LEU A HA   3  
ATOM 3696  H HB2  . LEU A 1 12  ? -28.195 9.928   10.764 1.00 0.00 ? 12  LEU A HB2  3  
ATOM 3697  H HB3  . LEU A 1 12  ? -28.033 11.318  9.710  1.00 0.00 ? 12  LEU A HB3  3  
ATOM 3698  H HG   . LEU A 1 12  ? -26.718 9.592   8.770  1.00 0.00 ? 12  LEU A HG   3  
ATOM 3699  H HD11 . LEU A 1 12  ? -24.528 11.090  10.150 1.00 0.00 ? 12  LEU A HD11 3  
ATOM 3700  H HD12 . LEU A 1 12  ? -24.741 10.692  8.428  1.00 0.00 ? 12  LEU A HD12 3  
ATOM 3701  H HD13 . LEU A 1 12  ? -25.701 11.997  9.164  1.00 0.00 ? 12  LEU A HD13 3  
ATOM 3702  H HD21 . LEU A 1 12  ? -24.708 8.958   10.638 1.00 0.00 ? 12  LEU A HD21 3  
ATOM 3703  H HD22 . LEU A 1 12  ? -26.254 8.846   11.513 1.00 0.00 ? 12  LEU A HD22 3  
ATOM 3704  H HD23 . LEU A 1 12  ? -26.005 7.906   10.022 1.00 0.00 ? 12  LEU A HD23 3  
ATOM 3705  N N    . GLU A 1 13  ? -25.944 13.606  12.133 1.00 0.00 ? 13  GLU A N    3  
ATOM 3706  C CA   . GLU A 1 13  ? -25.491 14.969  11.908 1.00 0.00 ? 13  GLU A CA   3  
ATOM 3707  C C    . GLU A 1 13  ? -24.081 15.159  12.471 1.00 0.00 ? 13  GLU A C    3  
ATOM 3708  O O    . GLU A 1 13  ? -23.859 14.988  13.669 1.00 0.00 ? 13  GLU A O    3  
ATOM 3709  C CB   . GLU A 1 13  ? -26.466 15.978  12.518 1.00 0.00 ? 13  GLU A CB   3  
ATOM 3710  C CG   . GLU A 1 13  ? -26.219 17.383  11.963 1.00 0.00 ? 13  GLU A CG   3  
ATOM 3711  C CD   . GLU A 1 13  ? -25.442 18.239  12.965 1.00 0.00 ? 13  GLU A CD   3  
ATOM 3712  O OE1  . GLU A 1 13  ? -24.277 17.876  13.237 1.00 0.00 ? 13  GLU A OE1  3  
ATOM 3713  O OE2  . GLU A 1 13  ? -26.030 19.236  13.435 1.00 0.00 ? 13  GLU A OE2  3  
ATOM 3714  H H    . GLU A 1 13  ? -25.622 13.189  12.983 1.00 0.00 ? 13  GLU A H    3  
ATOM 3715  H HA   . GLU A 1 13  ? -25.477 15.095  10.826 1.00 0.00 ? 13  GLU A HA   3  
ATOM 3716  H HB2  . GLU A 1 13  ? -27.491 15.674  12.304 1.00 0.00 ? 13  GLU A HB2  3  
ATOM 3717  H HB3  . GLU A 1 13  ? -26.355 15.987  13.602 1.00 0.00 ? 13  GLU A HB3  3  
ATOM 3718  H HG2  . GLU A 1 13  ? -25.663 17.316  11.028 1.00 0.00 ? 13  GLU A HG2  3  
ATOM 3719  H HG3  . GLU A 1 13  ? -27.172 17.860  11.734 1.00 0.00 ? 13  GLU A HG3  3  
ATOM 3720  N N    . THR A 1 14  ? -23.165 15.511  11.581 1.00 0.00 ? 14  THR A N    3  
ATOM 3721  C CA   . THR A 1 14  ? -21.783 15.726  11.974 1.00 0.00 ? 14  THR A CA   3  
ATOM 3722  C C    . THR A 1 14  ? -21.277 17.064  11.431 1.00 0.00 ? 14  THR A C    3  
ATOM 3723  O O    . THR A 1 14  ? -21.661 17.480  10.339 1.00 0.00 ? 14  THR A O    3  
ATOM 3724  C CB   . THR A 1 14  ? -20.963 14.527  11.495 1.00 0.00 ? 14  THR A CB   3  
ATOM 3725  O OG1  . THR A 1 14  ? -19.613 14.976  11.572 1.00 0.00 ? 14  THR A OG1  3  
ATOM 3726  C CG2  . THR A 1 14  ? -21.173 14.229  10.009 1.00 0.00 ? 14  THR A CG2  3  
ATOM 3727  H H    . THR A 1 14  ? -23.354 15.647  10.608 1.00 0.00 ? 14  THR A H    3  
ATOM 3728  H HA   . THR A 1 14  ? -21.741 15.786  13.061 1.00 0.00 ? 14  THR A HA   3  
ATOM 3729  H HB   . THR A 1 14  ? -21.172 13.645  12.102 1.00 0.00 ? 14  THR A HB   3  
ATOM 3730  H HG1  . THR A 1 14  ? -19.307 14.979  12.524 1.00 0.00 ? 14  THR A HG1  3  
ATOM 3731  H HG21 . THR A 1 14  ? -20.703 13.278  9.759  1.00 0.00 ? 14  THR A HG21 3  
ATOM 3732  H HG22 . THR A 1 14  ? -22.241 14.173  9.797  1.00 0.00 ? 14  THR A HG22 3  
ATOM 3733  H HG23 . THR A 1 14  ? -20.725 15.024  9.413  1.00 0.00 ? 14  THR A HG23 3  
ATOM 3734  N N    . VAL A 1 15  ? -20.422 17.700  12.219 1.00 0.00 ? 15  VAL A N    3  
ATOM 3735  C CA   . VAL A 1 15  ? -19.860 18.983  11.831 1.00 0.00 ? 15  VAL A CA   3  
ATOM 3736  C C    . VAL A 1 15  ? -18.423 19.081  12.348 1.00 0.00 ? 15  VAL A C    3  
ATOM 3737  O O    . VAL A 1 15  ? -18.075 18.455  13.348 1.00 0.00 ? 15  VAL A O    3  
ATOM 3738  C CB   . VAL A 1 15  ? -20.754 20.119  12.330 1.00 0.00 ? 15  VAL A CB   3  
ATOM 3739  C CG1  . VAL A 1 15  ? -22.128 20.070  11.659 1.00 0.00 ? 15  VAL A CG1  3  
ATOM 3740  C CG2  . VAL A 1 15  ? -20.886 20.085  13.854 1.00 0.00 ? 15  VAL A CG2  3  
ATOM 3741  H H    . VAL A 1 15  ? -20.115 17.355  13.106 1.00 0.00 ? 15  VAL A H    3  
ATOM 3742  H HA   . VAL A 1 15  ? -19.844 19.019  10.742 1.00 0.00 ? 15  VAL A HA   3  
ATOM 3743  H HB   . VAL A 1 15  ? -20.281 21.062  12.056 1.00 0.00 ? 15  VAL A HB   3  
ATOM 3744  H HG11 . VAL A 1 15  ? -22.009 19.820  10.605 1.00 0.00 ? 15  VAL A HG11 3  
ATOM 3745  H HG12 . VAL A 1 15  ? -22.743 19.312  12.145 1.00 0.00 ? 15  VAL A HG12 3  
ATOM 3746  H HG13 . VAL A 1 15  ? -22.612 21.043  11.750 1.00 0.00 ? 15  VAL A HG13 3  
ATOM 3747  H HG21 . VAL A 1 15  ? -19.898 20.180  14.306 1.00 0.00 ? 15  VAL A HG21 3  
ATOM 3748  H HG22 . VAL A 1 15  ? -21.517 20.910  14.183 1.00 0.00 ? 15  VAL A HG22 3  
ATOM 3749  H HG23 . VAL A 1 15  ? -21.335 19.140  14.158 1.00 0.00 ? 15  VAL A HG23 3  
ATOM 3750  N N    . PRO A 1 16  ? -17.606 19.894  11.625 1.00 0.00 ? 16  PRO A N    3  
ATOM 3751  C CA   . PRO A 1 16  ? -16.215 20.082  12.000 1.00 0.00 ? 16  PRO A CA   3  
ATOM 3752  C C    . PRO A 1 16  ? -16.096 20.994  13.223 1.00 0.00 ? 16  PRO A C    3  
ATOM 3753  O O    . PRO A 1 16  ? -17.099 21.504  13.721 1.00 0.00 ? 16  PRO A O    3  
ATOM 3754  C CB   . PRO A 1 16  ? -15.549 20.660  10.762 1.00 0.00 ? 16  PRO A CB   3  
ATOM 3755  C CG   . PRO A 1 16  ? -16.674 21.205  9.899  1.00 0.00 ? 16  PRO A CG   3  
ATOM 3756  C CD   . PRO A 1 16  ? -17.984 20.651  10.435 1.00 0.00 ? 16  PRO A CD   3  
ATOM 3757  H HA   . PRO A 1 16  ? -15.807 19.210  12.269 1.00 0.00 ? 16  PRO A HA   3  
ATOM 3758  H HB2  . PRO A 1 16  ? -14.844 21.447  11.029 1.00 0.00 ? 16  PRO A HB2  3  
ATOM 3759  H HB3  . PRO A 1 16  ? -14.984 19.894  10.230 1.00 0.00 ? 16  PRO A HB3  3  
ATOM 3760  H HG2  . PRO A 1 16  ? -16.682 22.295  9.925  1.00 0.00 ? 16  PRO A HG2  3  
ATOM 3761  H HG3  . PRO A 1 16  ? -16.534 20.912  8.858  1.00 0.00 ? 16  PRO A HG3  3  
ATOM 3762  H HD2  . PRO A 1 16  ? -18.682 21.451  10.681 1.00 0.00 ? 16  PRO A HD2  3  
ATOM 3763  H HD3  . PRO A 1 16  ? -18.475 20.014  9.700  1.00 0.00 ? 16  PRO A HD3  3  
ATOM 3764  N N    . LEU A 1 17  ? -14.862 21.171  13.672 1.00 0.00 ? 17  LEU A N    3  
ATOM 3765  C CA   . LEU A 1 17  ? -14.599 22.012  14.827 1.00 0.00 ? 17  LEU A CA   3  
ATOM 3766  C C    . LEU A 1 17  ? -14.071 23.368  14.356 1.00 0.00 ? 17  LEU A C    3  
ATOM 3767  O O    . LEU A 1 17  ? -14.718 24.395  14.557 1.00 0.00 ? 17  LEU A O    3  
ATOM 3768  C CB   . LEU A 1 17  ? -13.669 21.297  15.810 1.00 0.00 ? 17  LEU A CB   3  
ATOM 3769  C CG   . LEU A 1 17  ? -14.311 20.204  16.666 1.00 0.00 ? 17  LEU A CG   3  
ATOM 3770  C CD1  . LEU A 1 17  ? -14.520 18.924  15.855 1.00 0.00 ? 17  LEU A CD1  3  
ATOM 3771  C CD2  . LEU A 1 17  ? -13.494 19.952  17.935 1.00 0.00 ? 17  LEU A CD2  3  
ATOM 3772  H H    . LEU A 1 17  ? -14.053 20.752  13.261 1.00 0.00 ? 17  LEU A H    3  
ATOM 3773  H HA   . LEU A 1 17  ? -15.549 22.170  15.339 1.00 0.00 ? 17  LEU A HA   3  
ATOM 3774  H HB2  . LEU A 1 17  ? -12.849 20.854  15.246 1.00 0.00 ? 17  LEU A HB2  3  
ATOM 3775  H HB3  . LEU A 1 17  ? -13.233 22.043  16.474 1.00 0.00 ? 17  LEU A HB3  3  
ATOM 3776  H HG   . LEU A 1 17  ? -15.296 20.550  16.981 1.00 0.00 ? 17  LEU A HG   3  
ATOM 3777  H HD11 . LEU A 1 17  ? -15.398 19.036  15.219 1.00 0.00 ? 17  LEU A HD11 3  
ATOM 3778  H HD12 . LEU A 1 17  ? -13.643 18.739  15.235 1.00 0.00 ? 17  LEU A HD12 3  
ATOM 3779  H HD13 . LEU A 1 17  ? -14.669 18.084  16.534 1.00 0.00 ? 17  LEU A HD13 3  
ATOM 3780  H HD21 . LEU A 1 17  ? -13.152 18.917  17.947 1.00 0.00 ? 17  LEU A HD21 3  
ATOM 3781  H HD22 . LEU A 1 17  ? -12.633 20.619  17.952 1.00 0.00 ? 17  LEU A HD22 3  
ATOM 3782  H HD23 . LEU A 1 17  ? -14.116 20.138  18.811 1.00 0.00 ? 17  LEU A HD23 3  
ATOM 3783  N N    . GLU A 1 18  ? -12.900 23.328  13.737 1.00 0.00 ? 18  GLU A N    3  
ATOM 3784  C CA   . GLU A 1 18  ? -12.277 24.541  13.235 1.00 0.00 ? 18  GLU A CA   3  
ATOM 3785  C C    . GLU A 1 18  ? -10.957 24.210  12.536 1.00 0.00 ? 18  GLU A C    3  
ATOM 3786  O O    . GLU A 1 18  ? -10.851 24.325  11.316 1.00 0.00 ? 18  GLU A O    3  
ATOM 3787  C CB   . GLU A 1 18  ? -12.062 25.554  14.362 1.00 0.00 ? 18  GLU A CB   3  
ATOM 3788  C CG   . GLU A 1 18  ? -12.470 26.960  13.920 1.00 0.00 ? 18  GLU A CG   3  
ATOM 3789  C CD   . GLU A 1 18  ? -11.277 27.918  13.967 1.00 0.00 ? 18  GLU A CD   3  
ATOM 3790  O OE1  . GLU A 1 18  ? -10.494 27.801  14.934 1.00 0.00 ? 18  GLU A OE1  3  
ATOM 3791  O OE2  . GLU A 1 18  ? -11.176 28.744  13.035 1.00 0.00 ? 18  GLU A OE2  3  
ATOM 3792  H H    . GLU A 1 18  ? -12.380 22.489  13.577 1.00 0.00 ? 18  GLU A H    3  
ATOM 3793  H HA   . GLU A 1 18  ? -12.984 24.953  12.515 1.00 0.00 ? 18  GLU A HA   3  
ATOM 3794  H HB2  . GLU A 1 18  ? -12.644 25.260  15.235 1.00 0.00 ? 18  GLU A HB2  3  
ATOM 3795  H HB3  . GLU A 1 18  ? -11.014 25.552  14.661 1.00 0.00 ? 18  GLU A HB3  3  
ATOM 3796  H HG2  . GLU A 1 18  ? -12.873 26.925  12.908 1.00 0.00 ? 18  GLU A HG2  3  
ATOM 3797  H HG3  . GLU A 1 18  ? -13.265 27.332  14.566 1.00 0.00 ? 18  GLU A HG3  3  
ATOM 3798  N N    . ARG A 1 19  ? -9.984  23.805  13.339 1.00 0.00 ? 19  ARG A N    3  
ATOM 3799  C CA   . ARG A 1 19  ? -8.676  23.456  12.812 1.00 0.00 ? 19  ARG A CA   3  
ATOM 3800  C C    . ARG A 1 19  ? -7.883  22.657  13.848 1.00 0.00 ? 19  ARG A C    3  
ATOM 3801  O O    . ARG A 1 19  ? -7.662  23.126  14.964 1.00 0.00 ? 19  ARG A O    3  
ATOM 3802  C CB   . ARG A 1 19  ? -7.885  24.708  12.430 1.00 0.00 ? 19  ARG A CB   3  
ATOM 3803  C CG   . ARG A 1 19  ? -7.410  24.634  10.977 1.00 0.00 ? 19  ARG A CG   3  
ATOM 3804  C CD   . ARG A 1 19  ? -7.026  26.020  10.454 1.00 0.00 ? 19  ARG A CD   3  
ATOM 3805  N NE   . ARG A 1 19  ? -5.638  26.000  9.939  1.00 0.00 ? 19  ARG A NE   3  
ATOM 3806  C CZ   . ARG A 1 19  ? -4.965  27.091  9.551  1.00 0.00 ? 19  ARG A CZ   3  
ATOM 3807  N NH1  . ARG A 1 19  ? -5.548  28.296  9.616  1.00 0.00 ? 19  ARG A NH1  3  
ATOM 3808  N NH2  . ARG A 1 19  ? -3.710  26.978  9.096  1.00 0.00 ? 19  ARG A NH2  3  
ATOM 3809  H H    . ARG A 1 19  ? -10.079 23.713  14.330 1.00 0.00 ? 19  ARG A H    3  
ATOM 3810  H HA   . ARG A 1 19  ? -8.883  22.854  11.927 1.00 0.00 ? 19  ARG A HA   3  
ATOM 3811  H HB2  . ARG A 1 19  ? -8.507  25.592  12.568 1.00 0.00 ? 19  ARG A HB2  3  
ATOM 3812  H HB3  . ARG A 1 19  ? -7.025  24.816  13.092 1.00 0.00 ? 19  ARG A HB3  3  
ATOM 3813  H HG2  . ARG A 1 19  ? -6.554  23.964  10.904 1.00 0.00 ? 19  ARG A HG2  3  
ATOM 3814  H HG3  . ARG A 1 19  ? -8.199  24.213  10.354 1.00 0.00 ? 19  ARG A HG3  3  
ATOM 3815  H HD2  . ARG A 1 19  ? -7.712  26.322  9.663  1.00 0.00 ? 19  ARG A HD2  3  
ATOM 3816  H HD3  . ARG A 1 19  ? -7.115  26.756  11.253 1.00 0.00 ? 19  ARG A HD3  3  
ATOM 3817  H HE   . ARG A 1 19  ? -5.174  25.116  9.877  1.00 0.00 ? 19  ARG A HE   3  
ATOM 3818  H HH11 . ARG A 1 19  ? -6.485  28.381  9.955  1.00 0.00 ? 19  ARG A HH11 3  
ATOM 3819  H HH12 . ARG A 1 19  ? -5.045  29.111  9.326  1.00 0.00 ? 19  ARG A HH12 3  
ATOM 3820  H HH21 . ARG A 1 19  ? -3.275  26.079  9.048  1.00 0.00 ? 19  ARG A HH21 3  
ATOM 3821  H HH22 . ARG A 1 19  ? -3.207  27.792  8.807  1.00 0.00 ? 19  ARG A HH22 3  
ATOM 3822  N N    . LYS A 1 20  ? -7.476  21.463  13.443 1.00 0.00 ? 20  LYS A N    3  
ATOM 3823  C CA   . LYS A 1 20  ? -6.713  20.594  14.322 1.00 0.00 ? 20  LYS A CA   3  
ATOM 3824  C C    . LYS A 1 20  ? -5.284  20.465  13.790 1.00 0.00 ? 20  LYS A C    3  
ATOM 3825  O O    . LYS A 1 20  ? -5.057  20.551  12.584 1.00 0.00 ? 20  LYS A O    3  
ATOM 3826  C CB   . LYS A 1 20  ? -7.426  19.252  14.501 1.00 0.00 ? 20  LYS A CB   3  
ATOM 3827  C CG   . LYS A 1 20  ? -8.690  19.411  15.347 1.00 0.00 ? 20  LYS A CG   3  
ATOM 3828  C CD   . LYS A 1 20  ? -9.355  18.056  15.601 1.00 0.00 ? 20  LYS A CD   3  
ATOM 3829  C CE   . LYS A 1 20  ? -10.689 17.953  14.859 1.00 0.00 ? 20  LYS A CE   3  
ATOM 3830  N NZ   . LYS A 1 20  ? -10.463 17.679  13.422 1.00 0.00 ? 20  LYS A NZ   3  
ATOM 3831  H H    . LYS A 1 20  ? -7.660  21.088  12.534 1.00 0.00 ? 20  LYS A H    3  
ATOM 3832  H HA   . LYS A 1 20  ? -6.675  21.071  15.301 1.00 0.00 ? 20  LYS A HA   3  
ATOM 3833  H HB2  . LYS A 1 20  ? -7.686  18.841  13.526 1.00 0.00 ? 20  LYS A HB2  3  
ATOM 3834  H HB3  . LYS A 1 20  ? -6.752  18.539  14.977 1.00 0.00 ? 20  LYS A HB3  3  
ATOM 3835  H HG2  . LYS A 1 20  ? -8.439  19.880  16.298 1.00 0.00 ? 20  LYS A HG2  3  
ATOM 3836  H HG3  . LYS A 1 20  ? -9.390  20.075  14.840 1.00 0.00 ? 20  LYS A HG3  3  
ATOM 3837  H HD2  . LYS A 1 20  ? -8.691  17.255  15.276 1.00 0.00 ? 20  LYS A HD2  3  
ATOM 3838  H HD3  . LYS A 1 20  ? -9.518  17.922  16.670 1.00 0.00 ? 20  LYS A HD3  3  
ATOM 3839  H HE2  . LYS A 1 20  ? -11.294 17.159  15.296 1.00 0.00 ? 20  LYS A HE2  3  
ATOM 3840  H HE3  . LYS A 1 20  ? -11.249 18.881  14.974 1.00 0.00 ? 20  LYS A HE3  3  
ATOM 3841  H HZ1  . LYS A 1 20  ? -10.762 16.749  13.209 1.00 0.00 ? 20  LYS A HZ1  3  
ATOM 3842  H HZ2  . LYS A 1 20  ? -10.984 18.331  12.872 1.00 0.00 ? 20  LYS A HZ2  3  
ATOM 3843  H HZ3  . LYS A 1 20  ? -9.489  17.771  13.214 1.00 0.00 ? 20  LYS A HZ3  3  
ATOM 3844  N N    . LYS A 1 21  ? -4.358  20.262  14.715 1.00 0.00 ? 21  LYS A N    3  
ATOM 3845  C CA   . LYS A 1 21  ? -2.957  20.120  14.354 1.00 0.00 ? 21  LYS A CA   3  
ATOM 3846  C C    . LYS A 1 21  ? -2.807  18.977  13.349 1.00 0.00 ? 21  LYS A C    3  
ATOM 3847  O O    . LYS A 1 21  ? -3.457  17.941  13.480 1.00 0.00 ? 21  LYS A O    3  
ATOM 3848  C CB   . LYS A 1 21  ? -2.095  19.955  15.607 1.00 0.00 ? 21  LYS A CB   3  
ATOM 3849  C CG   . LYS A 1 21  ? -1.750  21.314  16.219 1.00 0.00 ? 21  LYS A CG   3  
ATOM 3850  C CD   . LYS A 1 21  ? -2.497  21.528  17.537 1.00 0.00 ? 21  LYS A CD   3  
ATOM 3851  C CE   . LYS A 1 21  ? -3.363  22.787  17.478 1.00 0.00 ? 21  LYS A CE   3  
ATOM 3852  N NZ   . LYS A 1 21  ? -4.640  22.572  18.195 1.00 0.00 ? 21  LYS A NZ   3  
ATOM 3853  H H    . LYS A 1 21  ? -4.551  20.193  15.694 1.00 0.00 ? 21  LYS A H    3  
ATOM 3854  H HA   . LYS A 1 21  ? -2.650  21.048  13.871 1.00 0.00 ? 21  LYS A HA   3  
ATOM 3855  H HB2  . LYS A 1 21  ? -2.625  19.346  16.340 1.00 0.00 ? 21  LYS A HB2  3  
ATOM 3856  H HB3  . LYS A 1 21  ? -1.178  19.422  15.354 1.00 0.00 ? 21  LYS A HB3  3  
ATOM 3857  H HG2  . LYS A 1 21  ? -0.675  21.377  16.391 1.00 0.00 ? 21  LYS A HG2  3  
ATOM 3858  H HG3  . LYS A 1 21  ? -2.007  22.108  15.518 1.00 0.00 ? 21  LYS A HG3  3  
ATOM 3859  H HD2  . LYS A 1 21  ? -3.122  20.661  17.749 1.00 0.00 ? 21  LYS A HD2  3  
ATOM 3860  H HD3  . LYS A 1 21  ? -1.781  21.613  18.355 1.00 0.00 ? 21  LYS A HD3  3  
ATOM 3861  H HE2  . LYS A 1 21  ? -2.827  23.626  17.921 1.00 0.00 ? 21  LYS A HE2  3  
ATOM 3862  H HE3  . LYS A 1 21  ? -3.563  23.050  16.439 1.00 0.00 ? 21  LYS A HE3  3  
ATOM 3863  H HZ1  . LYS A 1 21  ? -4.452  22.233  19.116 1.00 0.00 ? 21  LYS A HZ1  3  
ATOM 3864  H HZ2  . LYS A 1 21  ? -5.140  23.436  18.253 1.00 0.00 ? 21  LYS A HZ2  3  
ATOM 3865  H HZ3  . LYS A 1 21  ? -5.192  21.901  17.699 1.00 0.00 ? 21  LYS A HZ3  3  
ATOM 3866  N N    . ARG A 1 22  ? -1.947  19.204  12.367 1.00 0.00 ? 22  ARG A N    3  
ATOM 3867  C CA   . ARG A 1 22  ? -1.703  18.206  11.340 1.00 0.00 ? 22  ARG A CA   3  
ATOM 3868  C C    . ARG A 1 22  ? -3.028  17.632  10.832 1.00 0.00 ? 22  ARG A C    3  
ATOM 3869  O O    . ARG A 1 22  ? -3.377  16.495  11.144 1.00 0.00 ? 22  ARG A O    3  
ATOM 3870  C CB   . ARG A 1 22  ? -0.834  17.066  11.875 1.00 0.00 ? 22  ARG A CB   3  
ATOM 3871  C CG   . ARG A 1 22  ? 0.595   17.168  11.338 1.00 0.00 ? 22  ARG A CG   3  
ATOM 3872  C CD   . ARG A 1 22  ? 1.614   17.128  12.479 1.00 0.00 ? 22  ARG A CD   3  
ATOM 3873  N NE   . ARG A 1 22  ? 2.633   18.183  12.283 1.00 0.00 ? 22  ARG A NE   3  
ATOM 3874  C CZ   . ARG A 1 22  ? 2.440   19.478  12.569 1.00 0.00 ? 22  ARG A CZ   3  
ATOM 3875  N NH1  . ARG A 1 22  ? 1.264   19.885  13.066 1.00 0.00 ? 22  ARG A NH1  3  
ATOM 3876  N NH2  . ARG A 1 22  ? 3.422   20.364  12.359 1.00 0.00 ? 22  ARG A NH2  3  
ATOM 3877  H H    . ARG A 1 22  ? -1.422  20.049  12.268 1.00 0.00 ? 22  ARG A H    3  
ATOM 3878  H HA   . ARG A 1 22  ? -1.179  18.742  10.549 1.00 0.00 ? 22  ARG A HA   3  
ATOM 3879  H HB2  . ARG A 1 22  ? -0.820  17.095  12.964 1.00 0.00 ? 22  ARG A HB2  3  
ATOM 3880  H HB3  . ARG A 1 22  ? -1.267  16.108  11.587 1.00 0.00 ? 22  ARG A HB3  3  
ATOM 3881  H HG2  . ARG A 1 22  ? 0.787   16.347  10.646 1.00 0.00 ? 22  ARG A HG2  3  
ATOM 3882  H HG3  . ARG A 1 22  ? 0.710   18.093  10.774 1.00 0.00 ? 22  ARG A HG3  3  
ATOM 3883  H HD2  . ARG A 1 22  ? 1.108   17.272  13.433 1.00 0.00 ? 22  ARG A HD2  3  
ATOM 3884  H HD3  . ARG A 1 22  ? 2.093   16.150  12.516 1.00 0.00 ? 22  ARG A HD3  3  
ATOM 3885  H HE   . ARG A 1 22  ? 3.523   17.912  11.914 1.00 0.00 ? 22  ARG A HE   3  
ATOM 3886  H HH11 . ARG A 1 22  ? 0.531   19.224  13.222 1.00 0.00 ? 22  ARG A HH11 3  
ATOM 3887  H HH12 . ARG A 1 22  ? 1.120   20.852  13.279 1.00 0.00 ? 22  ARG A HH12 3  
ATOM 3888  H HH21 . ARG A 1 22  ? 4.300   20.060  11.989 1.00 0.00 ? 22  ARG A HH21 3  
ATOM 3889  H HH22 . ARG A 1 22  ? 3.278   21.330  12.573 1.00 0.00 ? 22  ARG A HH22 3  
ATOM 3890  N N    . GLU A 1 23  ? -3.730  18.447  10.058 1.00 0.00 ? 23  GLU A N    3  
ATOM 3891  C CA   . GLU A 1 23  ? -5.009  18.035  9.504  1.00 0.00 ? 23  GLU A CA   3  
ATOM 3892  C C    . GLU A 1 23  ? -4.812  17.412  8.120  1.00 0.00 ? 23  GLU A C    3  
ATOM 3893  O O    . GLU A 1 23  ? -5.673  16.679  7.637  1.00 0.00 ? 23  GLU A O    3  
ATOM 3894  C CB   . GLU A 1 23  ? -5.984  19.212  9.441  1.00 0.00 ? 23  GLU A CB   3  
ATOM 3895  C CG   . GLU A 1 23  ? -5.524  20.251  8.417  1.00 0.00 ? 23  GLU A CG   3  
ATOM 3896  C CD   . GLU A 1 23  ? -6.713  21.037  7.861  1.00 0.00 ? 23  GLU A CD   3  
ATOM 3897  O OE1  . GLU A 1 23  ? -7.514  20.414  7.131  1.00 0.00 ? 23  GLU A OE1  3  
ATOM 3898  O OE2  . GLU A 1 23  ? -6.795  22.243  8.179  1.00 0.00 ? 23  GLU A OE2  3  
ATOM 3899  H H    . GLU A 1 23  ? -3.439  19.370  9.809  1.00 0.00 ? 23  GLU A H    3  
ATOM 3900  H HA   . GLU A 1 23  ? -5.396  17.286  10.194 1.00 0.00 ? 23  GLU A HA   3  
ATOM 3901  H HB2  . GLU A 1 23  ? -6.978  18.852  9.177  1.00 0.00 ? 23  GLU A HB2  3  
ATOM 3902  H HB3  . GLU A 1 23  ? -6.064  19.676  10.424 1.00 0.00 ? 23  GLU A HB3  3  
ATOM 3903  H HG2  . GLU A 1 23  ? -4.816  20.937  8.882  1.00 0.00 ? 23  GLU A HG2  3  
ATOM 3904  H HG3  . GLU A 1 23  ? -4.998  19.755  7.601  1.00 0.00 ? 23  GLU A HG3  3  
ATOM 3905  N N    . LYS A 1 24  ? -3.673  17.727  7.521  1.00 0.00 ? 24  LYS A N    3  
ATOM 3906  C CA   . LYS A 1 24  ? -3.351  17.208  6.202  1.00 0.00 ? 24  LYS A CA   3  
ATOM 3907  C C    . LYS A 1 24  ? -2.713  15.825  6.346  1.00 0.00 ? 24  LYS A C    3  
ATOM 3908  O O    . LYS A 1 24  ? -2.435  15.159  5.349  1.00 0.00 ? 24  LYS A O    3  
ATOM 3909  C CB   . LYS A 1 24  ? -2.488  18.206  5.429  1.00 0.00 ? 24  LYS A CB   3  
ATOM 3910  C CG   . LYS A 1 24  ? -2.993  18.371  3.994  1.00 0.00 ? 24  LYS A CG   3  
ATOM 3911  C CD   . LYS A 1 24  ? -3.576  19.768  3.774  1.00 0.00 ? 24  LYS A CD   3  
ATOM 3912  C CE   . LYS A 1 24  ? -2.781  20.534  2.715  1.00 0.00 ? 24  LYS A CE   3  
ATOM 3913  N NZ   . LYS A 1 24  ? -1.628  21.226  3.333  1.00 0.00 ? 24  LYS A NZ   3  
ATOM 3914  H H    . LYS A 1 24  ? -2.977  18.325  7.921  1.00 0.00 ? 24  LYS A H    3  
ATOM 3915  H HA   . LYS A 1 24  ? -4.289  17.101  5.656  1.00 0.00 ? 24  LYS A HA   3  
ATOM 3916  H HB2  . LYS A 1 24  ? -2.500  19.172  5.935  1.00 0.00 ? 24  LYS A HB2  3  
ATOM 3917  H HB3  . LYS A 1 24  ? -1.453  17.866  5.417  1.00 0.00 ? 24  LYS A HB3  3  
ATOM 3918  H HG2  . LYS A 1 24  ? -2.174  18.201  3.295  1.00 0.00 ? 24  LYS A HG2  3  
ATOM 3919  H HG3  . LYS A 1 24  ? -3.753  17.619  3.783  1.00 0.00 ? 24  LYS A HG3  3  
ATOM 3920  H HD2  . LYS A 1 24  ? -4.618  19.687  3.464  1.00 0.00 ? 24  LYS A HD2  3  
ATOM 3921  H HD3  . LYS A 1 24  ? -3.566  20.322  4.713  1.00 0.00 ? 24  LYS A HD3  3  
ATOM 3922  H HE2  . LYS A 1 24  ? -2.431  19.846  1.946  1.00 0.00 ? 24  LYS A HE2  3  
ATOM 3923  H HE3  . LYS A 1 24  ? -3.427  21.261  2.222  1.00 0.00 ? 24  LYS A HE3  3  
ATOM 3924  H HZ1  . LYS A 1 24  ? -1.814  22.207  3.381  1.00 0.00 ? 24  LYS A HZ1  3  
ATOM 3925  H HZ2  . LYS A 1 24  ? -1.480  20.869  4.255  1.00 0.00 ? 24  LYS A HZ2  3  
ATOM 3926  H HZ3  . LYS A 1 24  ? -0.810  21.069  2.779  1.00 0.00 ? 24  LYS A HZ3  3  
ATOM 3927  N N    . GLU A 1 25  ? -2.499  15.433  7.593  1.00 0.00 ? 25  GLU A N    3  
ATOM 3928  C CA   . GLU A 1 25  ? -1.899  14.141  7.879  1.00 0.00 ? 25  GLU A CA   3  
ATOM 3929  C C    . GLU A 1 25  ? -2.986  13.098  8.146  1.00 0.00 ? 25  GLU A C    3  
ATOM 3930  O O    . GLU A 1 25  ? -3.136  12.144  7.384  1.00 0.00 ? 25  GLU A O    3  
ATOM 3931  C CB   . GLU A 1 25  ? -0.929  14.237  9.059  1.00 0.00 ? 25  GLU A CB   3  
ATOM 3932  C CG   . GLU A 1 25  ? 0.520   14.087  8.591  1.00 0.00 ? 25  GLU A CG   3  
ATOM 3933  C CD   . GLU A 1 25  ? 0.952   15.292  7.752  1.00 0.00 ? 25  GLU A CD   3  
ATOM 3934  O OE1  . GLU A 1 25  ? 0.541   16.414  8.117  1.00 0.00 ? 25  GLU A OE1  3  
ATOM 3935  O OE2  . GLU A 1 25  ? 1.683   15.063  6.765  1.00 0.00 ? 25  GLU A OE2  3  
ATOM 3936  H H    . GLU A 1 25  ? -2.728  15.980  8.398  1.00 0.00 ? 25  GLU A H    3  
ATOM 3937  H HA   . GLU A 1 25  ? -1.343  13.875  6.980  1.00 0.00 ? 25  GLU A HA   3  
ATOM 3938  H HB2  . GLU A 1 25  ? -1.056  15.195  9.562  1.00 0.00 ? 25  GLU A HB2  3  
ATOM 3939  H HB3  . GLU A 1 25  ? -1.161  13.461  9.789  1.00 0.00 ? 25  GLU A HB3  3  
ATOM 3940  H HG2  . GLU A 1 25  ? 1.176   13.987  9.455  1.00 0.00 ? 25  GLU A HG2  3  
ATOM 3941  H HG3  . GLU A 1 25  ? 0.624   13.175  8.004  1.00 0.00 ? 25  GLU A HG3  3  
ATOM 3942  N N    . GLN A 1 26  ? -3.716  13.315  9.230  1.00 0.00 ? 26  GLN A N    3  
ATOM 3943  C CA   . GLN A 1 26  ? -4.784  12.405  9.607  1.00 0.00 ? 26  GLN A CA   3  
ATOM 3944  C C    . GLN A 1 26  ? -5.748  12.205  8.435  1.00 0.00 ? 26  GLN A C    3  
ATOM 3945  O O    . GLN A 1 26  ? -6.494  11.227  8.401  1.00 0.00 ? 26  GLN A O    3  
ATOM 3946  C CB   . GLN A 1 26  ? -5.525  12.912  10.846 1.00 0.00 ? 26  GLN A CB   3  
ATOM 3947  C CG   . GLN A 1 26  ? -6.410  14.112  10.503 1.00 0.00 ? 26  GLN A CG   3  
ATOM 3948  C CD   . GLN A 1 26  ? -7.887  13.787  10.733 1.00 0.00 ? 26  GLN A CD   3  
ATOM 3949  O OE1  . GLN A 1 26  ? -8.605  13.373  9.838  1.00 0.00 ? 26  GLN A OE1  3  
ATOM 3950  N NE2  . GLN A 1 26  ? -8.300  13.999  11.980 1.00 0.00 ? 26  GLN A NE2  3  
ATOM 3951  H H    . GLN A 1 26  ? -3.587  14.093  9.845  1.00 0.00 ? 26  GLN A H    3  
ATOM 3952  H HA   . GLN A 1 26  ? -4.292  11.462  9.846  1.00 0.00 ? 26  GLN A HA   3  
ATOM 3953  H HB2  . GLN A 1 26  ? -6.137  12.111  11.261 1.00 0.00 ? 26  GLN A HB2  3  
ATOM 3954  H HB3  . GLN A 1 26  ? -4.805  13.195  11.614 1.00 0.00 ? 26  GLN A HB3  3  
ATOM 3955  H HG2  . GLN A 1 26  ? -6.122  14.967  11.114 1.00 0.00 ? 26  GLN A HG2  3  
ATOM 3956  H HG3  . GLN A 1 26  ? -6.255  14.397  9.462  1.00 0.00 ? 26  GLN A HG3  3  
ATOM 3957  H HE21 . GLN A 1 26  ? -7.659  14.340  12.667 1.00 0.00 ? 26  GLN A HE21 3  
ATOM 3958  H HE22 . GLN A 1 26  ? -9.251  13.816  12.229 1.00 0.00 ? 26  GLN A HE22 3  
ATOM 3959  N N    . PHE A 1 27  ? -5.702  13.147  7.505  1.00 0.00 ? 27  PHE A N    3  
ATOM 3960  C CA   . PHE A 1 27  ? -6.562  13.086  6.335  1.00 0.00 ? 27  PHE A CA   3  
ATOM 3961  C C    . PHE A 1 27  ? -6.030  12.077  5.315  1.00 0.00 ? 27  PHE A C    3  
ATOM 3962  O O    . PHE A 1 27  ? -6.799  11.313  4.733  1.00 0.00 ? 27  PHE A O    3  
ATOM 3963  C CB   . PHE A 1 27  ? -6.559  14.480  5.705  1.00 0.00 ? 27  PHE A CB   3  
ATOM 3964  C CG   . PHE A 1 27  ? -7.810  15.304  6.012  1.00 0.00 ? 27  PHE A CG   3  
ATOM 3965  C CD1  . PHE A 1 27  ? -8.508  15.081  7.157  1.00 0.00 ? 27  PHE A CD1  3  
ATOM 3966  C CD2  . PHE A 1 27  ? -8.225  16.261  5.139  1.00 0.00 ? 27  PHE A CD2  3  
ATOM 3967  C CE1  . PHE A 1 27  ? -9.669  15.846  7.442  1.00 0.00 ? 27  PHE A CE1  3  
ATOM 3968  C CE2  . PHE A 1 27  ? -9.387  17.027  5.424  1.00 0.00 ? 27  PHE A CE2  3  
ATOM 3969  C CZ   . PHE A 1 27  ? -10.084 16.803  6.569  1.00 0.00 ? 27  PHE A CZ   3  
ATOM 3970  H H    . PHE A 1 27  ? -5.093  13.939  7.541  1.00 0.00 ? 27  PHE A H    3  
ATOM 3971  H HA   . PHE A 1 27  ? -7.548  12.771  6.675  1.00 0.00 ? 27  PHE A HA   3  
ATOM 3972  H HB2  . PHE A 1 27  ? -5.682  15.024  6.056  1.00 0.00 ? 27  PHE A HB2  3  
ATOM 3973  H HB3  . PHE A 1 27  ? -6.459  14.378  4.624  1.00 0.00 ? 27  PHE A HB3  3  
ATOM 3974  H HD1  . PHE A 1 27  ? -8.175  14.314  7.857  1.00 0.00 ? 27  PHE A HD1  3  
ATOM 3975  H HD2  . PHE A 1 27  ? -7.666  16.441  4.220  1.00 0.00 ? 27  PHE A HD2  3  
ATOM 3976  H HE1  . PHE A 1 27  ? -10.229 15.667  8.361  1.00 0.00 ? 27  PHE A HE1  3  
ATOM 3977  H HE2  . PHE A 1 27  ? -9.719  17.794  4.724  1.00 0.00 ? 27  PHE A HE2  3  
ATOM 3978  H HZ   . PHE A 1 27  ? -10.976 17.391  6.788  1.00 0.00 ? 27  PHE A HZ   3  
ATOM 3979  N N    . ARG A 1 28  ? -4.718  12.106  5.131  1.00 0.00 ? 28  ARG A N    3  
ATOM 3980  C CA   . ARG A 1 28  ? -4.075  11.203  4.191  1.00 0.00 ? 28  ARG A CA   3  
ATOM 3981  C C    . ARG A 1 28  ? -3.178  10.212  4.937  1.00 0.00 ? 28  ARG A C    3  
ATOM 3982  O O    . ARG A 1 28  ? -2.218  9.692   4.371  1.00 0.00 ? 28  ARG A O    3  
ATOM 3983  C CB   . ARG A 1 28  ? -3.233  11.975  3.173  1.00 0.00 ? 28  ARG A CB   3  
ATOM 3984  C CG   . ARG A 1 28  ? -4.125  12.753  2.203  1.00 0.00 ? 28  ARG A CG   3  
ATOM 3985  C CD   . ARG A 1 28  ? -3.642  14.197  2.053  1.00 0.00 ? 28  ARG A CD   3  
ATOM 3986  N NE   . ARG A 1 28  ? -3.293  14.470  0.641  1.00 0.00 ? 28  ARG A NE   3  
ATOM 3987  C CZ   . ARG A 1 28  ? -3.106  15.697  0.137  1.00 0.00 ? 28  ARG A CZ   3  
ATOM 3988  N NH1  . ARG A 1 28  ? -3.234  16.773  0.927  1.00 0.00 ? 28  ARG A NH1  3  
ATOM 3989  N NH2  . ARG A 1 28  ? -2.791  15.850  -1.156 1.00 0.00 ? 28  ARG A NH2  3  
ATOM 3990  H H    . ARG A 1 28  ? -4.100  12.730  5.609  1.00 0.00 ? 28  ARG A H    3  
ATOM 3991  H HA   . ARG A 1 28  ? -4.896  10.689  3.692  1.00 0.00 ? 28  ARG A HA   3  
ATOM 3992  H HB2  . ARG A 1 28  ? -2.568  12.664  3.694  1.00 0.00 ? 28  ARG A HB2  3  
ATOM 3993  H HB3  . ARG A 1 28  ? -2.602  11.282  2.617  1.00 0.00 ? 28  ARG A HB3  3  
ATOM 3994  H HG2  . ARG A 1 28  ? -4.124  12.263  1.230  1.00 0.00 ? 28  ARG A HG2  3  
ATOM 3995  H HG3  . ARG A 1 28  ? -5.154  12.745  2.563  1.00 0.00 ? 28  ARG A HG3  3  
ATOM 3996  H HD2  . ARG A 1 28  ? -4.420  14.886  2.383  1.00 0.00 ? 28  ARG A HD2  3  
ATOM 3997  H HD3  . ARG A 1 28  ? -2.775  14.368  2.691  1.00 0.00 ? 28  ARG A HD3  3  
ATOM 3998  H HE   . ARG A 1 28  ? -3.189  13.690  0.025  1.00 0.00 ? 28  ARG A HE   3  
ATOM 3999  H HH11 . ARG A 1 28  ? -3.469  16.659  1.892  1.00 0.00 ? 28  ARG A HH11 3  
ATOM 4000  H HH12 . ARG A 1 28  ? -3.094  17.689  0.550  1.00 0.00 ? 28  ARG A HH12 3  
ATOM 4001  H HH21 . ARG A 1 28  ? -2.695  15.047  -1.746 1.00 0.00 ? 28  ARG A HH21 3  
ATOM 4002  H HH22 . ARG A 1 28  ? -2.651  16.766  -1.533 1.00 0.00 ? 28  ARG A HH22 3  
ATOM 4003  N N    . LYS A 1 29  ? -3.524  9.981   6.195  1.00 0.00 ? 29  LYS A N    3  
ATOM 4004  C CA   . LYS A 1 29  ? -2.762  9.062   7.024  1.00 0.00 ? 29  LYS A CA   3  
ATOM 4005  C C    . LYS A 1 29  ? -3.608  7.821   7.312  1.00 0.00 ? 29  LYS A C    3  
ATOM 4006  O O    . LYS A 1 29  ? -4.669  7.917   7.928  1.00 0.00 ? 29  LYS A O    3  
ATOM 4007  C CB   . LYS A 1 29  ? -2.258  9.769   8.284  1.00 0.00 ? 29  LYS A CB   3  
ATOM 4008  C CG   . LYS A 1 29  ? -1.786  8.756   9.329  1.00 0.00 ? 29  LYS A CG   3  
ATOM 4009  C CD   . LYS A 1 29  ? -2.653  8.822   10.588 1.00 0.00 ? 29  LYS A CD   3  
ATOM 4010  C CE   . LYS A 1 29  ? -1.954  9.615   11.694 1.00 0.00 ? 29  LYS A CE   3  
ATOM 4011  N NZ   . LYS A 1 29  ? -2.879  10.607  12.285 1.00 0.00 ? 29  LYS A NZ   3  
ATOM 4012  H H    . LYS A 1 29  ? -4.306  10.409  6.648  1.00 0.00 ? 29  LYS A H    3  
ATOM 4013  H HA   . LYS A 1 29  ? -1.885  8.758   6.453  1.00 0.00 ? 29  LYS A HA   3  
ATOM 4014  H HB2  . LYS A 1 29  ? -1.439  10.440  8.026  1.00 0.00 ? 29  LYS A HB2  3  
ATOM 4015  H HB3  . LYS A 1 29  ? -3.054  10.385  8.703  1.00 0.00 ? 29  LYS A HB3  3  
ATOM 4016  H HG2  . LYS A 1 29  ? -1.824  7.751   8.909  1.00 0.00 ? 29  LYS A HG2  3  
ATOM 4017  H HG3  . LYS A 1 29  ? -0.746  8.954   9.588  1.00 0.00 ? 29  LYS A HG3  3  
ATOM 4018  H HD2  . LYS A 1 29  ? -3.609  9.288   10.351 1.00 0.00 ? 29  LYS A HD2  3  
ATOM 4019  H HD3  . LYS A 1 29  ? -2.868  7.813   10.939 1.00 0.00 ? 29  LYS A HD3  3  
ATOM 4020  H HE2  . LYS A 1 29  ? -1.598  8.934   12.468 1.00 0.00 ? 29  LYS A HE2  3  
ATOM 4021  H HE3  . LYS A 1 29  ? -1.078  10.121  11.289 1.00 0.00 ? 29  LYS A HE3  3  
ATOM 4022  H HZ1  . LYS A 1 29  ? -2.779  10.604  13.280 1.00 0.00 ? 29  LYS A HZ1  3  
ATOM 4023  H HZ2  . LYS A 1 29  ? -2.662  11.517  11.931 1.00 0.00 ? 29  LYS A HZ2  3  
ATOM 4024  H HZ3  . LYS A 1 29  ? -3.820  10.371  12.043 1.00 0.00 ? 29  LYS A HZ3  3  
ATOM 4025  N N    . LEU A 1 30  ? -3.108  6.683   6.852  1.00 0.00 ? 30  LEU A N    3  
ATOM 4026  C CA   . LEU A 1 30  ? -3.805  5.424   7.053  1.00 0.00 ? 30  LEU A CA   3  
ATOM 4027  C C    . LEU A 1 30  ? -3.056  4.592   8.096  1.00 0.00 ? 30  LEU A C    3  
ATOM 4028  O O    . LEU A 1 30  ? -1.868  4.316   7.938  1.00 0.00 ? 30  LEU A O    3  
ATOM 4029  C CB   . LEU A 1 30  ? -4.004  4.703   5.718  1.00 0.00 ? 30  LEU A CB   3  
ATOM 4030  C CG   . LEU A 1 30  ? -5.336  4.960   5.009  1.00 0.00 ? 30  LEU A CG   3  
ATOM 4031  C CD1  . LEU A 1 30  ? -5.511  6.447   4.695  1.00 0.00 ? 30  LEU A CD1  3  
ATOM 4032  C CD2  . LEU A 1 30  ? -5.467  4.091   3.757  1.00 0.00 ? 30  LEU A CD2  3  
ATOM 4033  H H    . LEU A 1 30  ? -2.245  6.613   6.352  1.00 0.00 ? 30  LEU A H    3  
ATOM 4034  H HA   . LEU A 1 30  ? -4.796  5.658   7.444  1.00 0.00 ? 30  LEU A HA   3  
ATOM 4035  H HB2  . LEU A 1 30  ? -3.196  4.994   5.047  1.00 0.00 ? 30  LEU A HB2  3  
ATOM 4036  H HB3  . LEU A 1 30  ? -3.908  3.631   5.889  1.00 0.00 ? 30  LEU A HB3  3  
ATOM 4037  H HG   . LEU A 1 30  ? -6.143  4.677   5.684  1.00 0.00 ? 30  LEU A HG   3  
ATOM 4038  H HD11 . LEU A 1 30  ? -5.821  6.975   5.596  1.00 0.00 ? 30  LEU A HD11 3  
ATOM 4039  H HD12 . LEU A 1 30  ? -4.566  6.858   4.340  1.00 0.00 ? 30  LEU A HD12 3  
ATOM 4040  H HD13 . LEU A 1 30  ? -6.272  6.568   3.923  1.00 0.00 ? 30  LEU A HD13 3  
ATOM 4041  H HD21 . LEU A 1 30  ? -6.273  4.474   3.131  1.00 0.00 ? 30  LEU A HD21 3  
ATOM 4042  H HD22 . LEU A 1 30  ? -4.531  4.114   3.199  1.00 0.00 ? 30  LEU A HD22 3  
ATOM 4043  H HD23 . LEU A 1 30  ? -5.690  3.064   4.050  1.00 0.00 ? 30  LEU A HD23 3  
ATOM 4044  N N    . PHE A 1 31  ? -3.782  4.215   9.138  1.00 0.00 ? 31  PHE A N    3  
ATOM 4045  C CA   . PHE A 1 31  ? -3.201  3.420   10.206 1.00 0.00 ? 31  PHE A CA   3  
ATOM 4046  C C    . PHE A 1 31  ? -3.281  1.927   9.884  1.00 0.00 ? 31  PHE A C    3  
ATOM 4047  O O    . PHE A 1 31  ? -4.364  1.343   9.891  1.00 0.00 ? 31  PHE A O    3  
ATOM 4048  C CB   . PHE A 1 31  ? -4.019  3.702   11.469 1.00 0.00 ? 31  PHE A CB   3  
ATOM 4049  C CG   . PHE A 1 31  ? -3.487  3.004   12.722 1.00 0.00 ? 31  PHE A CG   3  
ATOM 4050  C CD1  . PHE A 1 31  ? -3.594  1.654   12.847 1.00 0.00 ? 31  PHE A CD1  3  
ATOM 4051  C CD2  . PHE A 1 31  ? -2.908  3.735   13.713 1.00 0.00 ? 31  PHE A CD2  3  
ATOM 4052  C CE1  . PHE A 1 31  ? -3.101  1.007   14.011 1.00 0.00 ? 31  PHE A CE1  3  
ATOM 4053  C CE2  . PHE A 1 31  ? -2.415  3.087   14.877 1.00 0.00 ? 31  PHE A CE2  3  
ATOM 4054  C CZ   . PHE A 1 31  ? -2.522  1.737   15.001 1.00 0.00 ? 31  PHE A CZ   3  
ATOM 4055  H H    . PHE A 1 31  ? -4.748  4.444   9.259  1.00 0.00 ? 31  PHE A H    3  
ATOM 4056  H HA   . PHE A 1 31  ? -2.156  3.715   10.297 1.00 0.00 ? 31  PHE A HA   3  
ATOM 4057  H HB2  . PHE A 1 31  ? -4.039  4.777   11.644 1.00 0.00 ? 31  PHE A HB2  3  
ATOM 4058  H HB3  . PHE A 1 31  ? -5.049  3.387   11.300 1.00 0.00 ? 31  PHE A HB3  3  
ATOM 4059  H HD1  . PHE A 1 31  ? -4.059  1.069   12.053 1.00 0.00 ? 31  PHE A HD1  3  
ATOM 4060  H HD2  . PHE A 1 31  ? -2.822  4.817   13.613 1.00 0.00 ? 31  PHE A HD2  3  
ATOM 4061  H HE1  . PHE A 1 31  ? -3.187  -0.075  14.110 1.00 0.00 ? 31  PHE A HE1  3  
ATOM 4062  H HE2  . PHE A 1 31  ? -1.950  3.673   15.670 1.00 0.00 ? 31  PHE A HE2  3  
ATOM 4063  H HZ   . PHE A 1 31  ? -2.143  1.241   15.894 1.00 0.00 ? 31  PHE A HZ   3  
ATOM 4064  N N    . ILE A 1 32  ? -2.120  1.350   9.609  1.00 0.00 ? 32  ILE A N    3  
ATOM 4065  C CA   . ILE A 1 32  ? -2.045  -0.064  9.285  1.00 0.00 ? 32  ILE A CA   3  
ATOM 4066  C C    . ILE A 1 32  ? -1.981  -0.877  10.579 1.00 0.00 ? 32  ILE A C    3  
ATOM 4067  O O    . ILE A 1 32  ? -1.220  -0.545  11.488 1.00 0.00 ? 32  ILE A O    3  
ATOM 4068  C CB   . ILE A 1 32  ? -0.879  -0.333  8.331  1.00 0.00 ? 32  ILE A CB   3  
ATOM 4069  C CG1  . ILE A 1 32  ? -0.733  0.797   7.311  1.00 0.00 ? 32  ILE A CG1  3  
ATOM 4070  C CG2  . ILE A 1 32  ? -1.027  -1.699  7.656  1.00 0.00 ? 32  ILE A CG2  3  
ATOM 4071  C CD1  . ILE A 1 32  ? -2.009  0.958   6.483  1.00 0.00 ? 32  ILE A CD1  3  
ATOM 4072  H H    . ILE A 1 32  ? -1.244  1.832   9.606  1.00 0.00 ? 32  ILE A H    3  
ATOM 4073  H HA   . ILE A 1 32  ? -2.961  -0.327  8.756  1.00 0.00 ? 32  ILE A HA   3  
ATOM 4074  H HB   . ILE A 1 32  ? 0.041   -0.361  8.915  1.00 0.00 ? 32  ILE A HB   3  
ATOM 4075  H HG12 . ILE A 1 32  ? -0.510  1.731   7.827  1.00 0.00 ? 32  ILE A HG12 3  
ATOM 4076  H HG13 . ILE A 1 32  ? 0.109   0.590   6.650  1.00 0.00 ? 32  ILE A HG13 3  
ATOM 4077  H HG21 . ILE A 1 32  ? -1.308  -2.443  8.401  1.00 0.00 ? 32  ILE A HG21 3  
ATOM 4078  H HG22 . ILE A 1 32  ? -1.800  -1.643  6.889  1.00 0.00 ? 32  ILE A HG22 3  
ATOM 4079  H HG23 . ILE A 1 32  ? -0.080  -1.982  7.197  1.00 0.00 ? 32  ILE A HG23 3  
ATOM 4080  H HD11 . ILE A 1 32  ? -1.768  0.879   5.423  1.00 0.00 ? 32  ILE A HD11 3  
ATOM 4081  H HD12 . ILE A 1 32  ? -2.718  0.175   6.753  1.00 0.00 ? 32  ILE A HD12 3  
ATOM 4082  H HD13 . ILE A 1 32  ? -2.452  1.934   6.683  1.00 0.00 ? 32  ILE A HD13 3  
ATOM 4083  N N    . GLY A 1 33  ? -2.789  -1.926  10.622 1.00 0.00 ? 33  GLY A N    3  
ATOM 4084  C CA   . GLY A 1 33  ? -2.834  -2.789  11.790 1.00 0.00 ? 33  GLY A CA   3  
ATOM 4085  C C    . GLY A 1 33  ? -2.495  -4.234  11.418 1.00 0.00 ? 33  GLY A C    3  
ATOM 4086  O O    . GLY A 1 33  ? -2.994  -4.755  10.422 1.00 0.00 ? 33  GLY A O    3  
ATOM 4087  H H    . GLY A 1 33  ? -3.404  -2.189  9.879  1.00 0.00 ? 33  GLY A H    3  
ATOM 4088  H HA2  . GLY A 1 33  ? -2.130  -2.428  12.540 1.00 0.00 ? 33  GLY A HA2  3  
ATOM 4089  H HA3  . GLY A 1 33  ? -3.826  -2.748  12.239 1.00 0.00 ? 33  GLY A HA3  3  
ATOM 4090  N N    . GLY A 1 34  ? -1.648  -4.839  12.237 1.00 0.00 ? 34  GLY A N    3  
ATOM 4091  C CA   . GLY A 1 34  ? -1.237  -6.214  12.007 1.00 0.00 ? 34  GLY A CA   3  
ATOM 4092  C C    . GLY A 1 34  ? -0.155  -6.288  10.927 1.00 0.00 ? 34  GLY A C    3  
ATOM 4093  O O    . GLY A 1 34  ? -0.432  -6.671  9.791  1.00 0.00 ? 34  GLY A O    3  
ATOM 4094  H H    . GLY A 1 34  ? -1.246  -4.408  13.045 1.00 0.00 ? 34  GLY A H    3  
ATOM 4095  H HA2  . GLY A 1 34  ? -0.860  -6.645  12.934 1.00 0.00 ? 34  GLY A HA2  3  
ATOM 4096  H HA3  . GLY A 1 34  ? -2.098  -6.809  11.705 1.00 0.00 ? 34  GLY A HA3  3  
ATOM 4097  N N    . LEU A 1 35  ? 1.055   -5.917  11.320 1.00 0.00 ? 35  LEU A N    3  
ATOM 4098  C CA   . LEU A 1 35  ? 2.179   -5.937  10.400 1.00 0.00 ? 35  LEU A CA   3  
ATOM 4099  C C    . LEU A 1 35  ? 2.986   -7.219  10.616 1.00 0.00 ? 35  LEU A C    3  
ATOM 4100  O O    . LEU A 1 35  ? 4.012   -7.427  9.971  1.00 0.00 ? 35  LEU A O    3  
ATOM 4101  C CB   . LEU A 1 35  ? 3.008   -4.658  10.539 1.00 0.00 ? 35  LEU A CB   3  
ATOM 4102  C CG   . LEU A 1 35  ? 2.256   -3.345  10.318 1.00 0.00 ? 35  LEU A CG   3  
ATOM 4103  C CD1  . LEU A 1 35  ? 3.182   -2.273  9.740  1.00 0.00 ? 35  LEU A CD1  3  
ATOM 4104  C CD2  . LEU A 1 35  ? 1.017   -3.562  9.446  1.00 0.00 ? 35  LEU A CD2  3  
ATOM 4105  H H    . LEU A 1 35  ? 1.271   -5.608  12.246 1.00 0.00 ? 35  LEU A H    3  
ATOM 4106  H HA   . LEU A 1 35  ? 1.774   -5.950  9.389  1.00 0.00 ? 35  LEU A HA   3  
ATOM 4107  H HB2  . LEU A 1 35  ? 3.446   -4.639  11.537 1.00 0.00 ? 35  LEU A HB2  3  
ATOM 4108  H HB3  . LEU A 1 35  ? 3.834   -4.706  9.830  1.00 0.00 ? 35  LEU A HB3  3  
ATOM 4109  H HG   . LEU A 1 35  ? 1.909   -2.982  11.285 1.00 0.00 ? 35  LEU A HG   3  
ATOM 4110  H HD11 . LEU A 1 35  ? 2.652   -1.711  8.971  1.00 0.00 ? 35  LEU A HD11 3  
ATOM 4111  H HD12 . LEU A 1 35  ? 3.496   -1.596  10.535 1.00 0.00 ? 35  LEU A HD12 3  
ATOM 4112  H HD13 . LEU A 1 35  ? 4.060   -2.749  9.301  1.00 0.00 ? 35  LEU A HD13 3  
ATOM 4113  H HD21 . LEU A 1 35  ? 0.272   -4.126  10.008 1.00 0.00 ? 35  LEU A HD21 3  
ATOM 4114  H HD22 . LEU A 1 35  ? 0.601   -2.596  9.158  1.00 0.00 ? 35  LEU A HD22 3  
ATOM 4115  H HD23 . LEU A 1 35  ? 1.296   -4.119  8.552  1.00 0.00 ? 35  LEU A HD23 3  
ATOM 4116  N N    . SER A 1 36  ? 2.492   -8.046  11.526 1.00 0.00 ? 36  SER A N    3  
ATOM 4117  C CA   . SER A 1 36  ? 3.154   -9.301  11.835 1.00 0.00 ? 36  SER A CA   3  
ATOM 4118  C C    . SER A 1 36  ? 4.360   -9.048  12.741 1.00 0.00 ? 36  SER A C    3  
ATOM 4119  O O    . SER A 1 36  ? 5.066   -9.983  13.117 1.00 0.00 ? 36  SER A O    3  
ATOM 4120  C CB   . SER A 1 36  ? 3.591   -10.022 10.558 1.00 0.00 ? 36  SER A CB   3  
ATOM 4121  O OG   . SER A 1 36  ? 5.009   -10.140 10.470 1.00 0.00 ? 36  SER A OG   3  
ATOM 4122  H H    . SER A 1 36  ? 1.657   -7.869  12.047 1.00 0.00 ? 36  SER A H    3  
ATOM 4123  H HA   . SER A 1 36  ? 2.406   -9.902  12.353 1.00 0.00 ? 36  SER A HA   3  
ATOM 4124  H HB2  . SER A 1 36  ? 3.143   -11.015 10.531 1.00 0.00 ? 36  SER A HB2  3  
ATOM 4125  H HB3  . SER A 1 36  ? 3.218   -9.480  9.690  1.00 0.00 ? 36  SER A HB3  3  
ATOM 4126  H HG   . SER A 1 36  ? 5.274   -11.103 10.498 1.00 0.00 ? 36  SER A HG   3  
ATOM 4127  N N    . PHE A 1 37  ? 4.560   -7.779  13.066 1.00 0.00 ? 37  PHE A N    3  
ATOM 4128  C CA   . PHE A 1 37  ? 5.669   -7.391  13.921 1.00 0.00 ? 37  PHE A CA   3  
ATOM 4129  C C    . PHE A 1 37  ? 6.992   -7.424  13.152 1.00 0.00 ? 37  PHE A C    3  
ATOM 4130  O O    . PHE A 1 37  ? 8.040   -7.086  13.699 1.00 0.00 ? 37  PHE A O    3  
ATOM 4131  C CB   . PHE A 1 37  ? 5.731   -8.407  15.062 1.00 0.00 ? 37  PHE A CB   3  
ATOM 4132  C CG   . PHE A 1 37  ? 4.361   -8.909  15.524 1.00 0.00 ? 37  PHE A CG   3  
ATOM 4133  C CD1  . PHE A 1 37  ? 3.365   -8.021  15.789 1.00 0.00 ? 37  PHE A CD1  3  
ATOM 4134  C CD2  . PHE A 1 37  ? 4.138   -10.243 15.667 1.00 0.00 ? 37  PHE A CD2  3  
ATOM 4135  C CE1  . PHE A 1 37  ? 2.094   -8.486  16.217 1.00 0.00 ? 37  PHE A CE1  3  
ATOM 4136  C CE2  . PHE A 1 37  ? 2.867   -10.708 16.095 1.00 0.00 ? 37  PHE A CE2  3  
ATOM 4137  C CZ   . PHE A 1 37  ? 1.871   -9.820  16.361 1.00 0.00 ? 37  PHE A CZ   3  
ATOM 4138  H H    . PHE A 1 37  ? 3.982   -7.025  12.756 1.00 0.00 ? 37  PHE A H    3  
ATOM 4139  H HA   . PHE A 1 37  ? 5.475   -6.374  14.261 1.00 0.00 ? 37  PHE A HA   3  
ATOM 4140  H HB2  . PHE A 1 37  ? 6.330   -9.260  14.744 1.00 0.00 ? 37  PHE A HB2  3  
ATOM 4141  H HB3  . PHE A 1 37  ? 6.245   -7.955  15.911 1.00 0.00 ? 37  PHE A HB3  3  
ATOM 4142  H HD1  . PHE A 1 37  ? 3.544   -6.952  15.674 1.00 0.00 ? 37  PHE A HD1  3  
ATOM 4143  H HD2  . PHE A 1 37  ? 4.936   -10.955 15.454 1.00 0.00 ? 37  PHE A HD2  3  
ATOM 4144  H HE1  . PHE A 1 37  ? 1.296   -7.775  16.430 1.00 0.00 ? 37  PHE A HE1  3  
ATOM 4145  H HE2  . PHE A 1 37  ? 2.688   -11.777 16.211 1.00 0.00 ? 37  PHE A HE2  3  
ATOM 4146  H HZ   . PHE A 1 37  ? 0.895   -10.178 16.689 1.00 0.00 ? 37  PHE A HZ   3  
ATOM 4147  N N    . GLU A 1 38  ? 6.899   -7.836  11.896 1.00 0.00 ? 38  GLU A N    3  
ATOM 4148  C CA   . GLU A 1 38  ? 8.075   -7.918  11.047 1.00 0.00 ? 38  GLU A CA   3  
ATOM 4149  C C    . GLU A 1 38  ? 8.073   -6.780  10.025 1.00 0.00 ? 38  GLU A C    3  
ATOM 4150  O O    . GLU A 1 38  ? 8.943   -5.911  10.055 1.00 0.00 ? 38  GLU A O    3  
ATOM 4151  C CB   . GLU A 1 38  ? 8.156   -9.279  10.352 1.00 0.00 ? 38  GLU A CB   3  
ATOM 4152  C CG   . GLU A 1 38  ? 9.522   -9.930  10.579 1.00 0.00 ? 38  GLU A CG   3  
ATOM 4153  C CD   . GLU A 1 38  ? 10.395  -9.823  9.328  1.00 0.00 ? 38  GLU A CD   3  
ATOM 4154  O OE1  . GLU A 1 38  ? 9.901   -10.229 8.254  1.00 0.00 ? 38  GLU A OE1  3  
ATOM 4155  O OE2  . GLU A 1 38  ? 11.538  -9.336  9.473  1.00 0.00 ? 38  GLU A OE2  3  
ATOM 4156  H H    . GLU A 1 38  ? 6.043   -8.110  11.459 1.00 0.00 ? 38  GLU A H    3  
ATOM 4157  H HA   . GLU A 1 38  ? 8.926   -7.810  11.719 1.00 0.00 ? 38  GLU A HA   3  
ATOM 4158  H HB2  . GLU A 1 38  ? 7.370   -9.932  10.731 1.00 0.00 ? 38  GLU A HB2  3  
ATOM 4159  H HB3  . GLU A 1 38  ? 7.981   -9.157  9.283  1.00 0.00 ? 38  GLU A HB3  3  
ATOM 4160  H HG2  . GLU A 1 38  ? 10.023  -9.450  11.419 1.00 0.00 ? 38  GLU A HG2  3  
ATOM 4161  H HG3  . GLU A 1 38  ? 9.389   -10.979 10.845 1.00 0.00 ? 38  GLU A HG3  3  
ATOM 4162  N N    . THR A 1 39  ? 7.084   -6.821  9.143  1.00 0.00 ? 39  THR A N    3  
ATOM 4163  C CA   . THR A 1 39  ? 6.957   -5.804  8.114  1.00 0.00 ? 39  THR A CA   3  
ATOM 4164  C C    . THR A 1 39  ? 7.340   -4.431  8.670  1.00 0.00 ? 39  THR A C    3  
ATOM 4165  O O    . THR A 1 39  ? 6.536   -3.781  9.336  1.00 0.00 ? 39  THR A O    3  
ATOM 4166  C CB   . THR A 1 39  ? 5.529   -5.861  7.567  1.00 0.00 ? 39  THR A CB   3  
ATOM 4167  O OG1  . THR A 1 39  ? 5.631   -6.696  6.416  1.00 0.00 ? 39  THR A OG1  3  
ATOM 4168  C CG2  . THR A 1 39  ? 5.061   -4.515  7.010  1.00 0.00 ? 39  THR A CG2  3  
ATOM 4169  H H    . THR A 1 39  ? 6.380   -7.531  9.125  1.00 0.00 ? 39  THR A H    3  
ATOM 4170  H HA   . THR A 1 39  ? 7.662   -6.033  7.315  1.00 0.00 ? 39  THR A HA   3  
ATOM 4171  H HB   . THR A 1 39  ? 4.837   -6.232  8.323  1.00 0.00 ? 39  THR A HB   3  
ATOM 4172  H HG1  . THR A 1 39  ? 6.197   -6.253  5.721  1.00 0.00 ? 39  THR A HG1  3  
ATOM 4173  H HG21 . THR A 1 39  ? 4.523   -3.969  7.785  1.00 0.00 ? 39  THR A HG21 3  
ATOM 4174  H HG22 . THR A 1 39  ? 5.926   -3.934  6.689  1.00 0.00 ? 39  THR A HG22 3  
ATOM 4175  H HG23 . THR A 1 39  ? 4.401   -4.683  6.159  1.00 0.00 ? 39  THR A HG23 3  
ATOM 4176  N N    . THR A 1 40  ? 8.568   -4.031  8.376  1.00 0.00 ? 40  THR A N    3  
ATOM 4177  C CA   . THR A 1 40  ? 9.067   -2.747  8.838  1.00 0.00 ? 40  THR A CA   3  
ATOM 4178  C C    . THR A 1 40  ? 8.499   -1.614  7.982  1.00 0.00 ? 40  THR A C    3  
ATOM 4179  O O    . THR A 1 40  ? 7.534   -1.811  7.245  1.00 0.00 ? 40  THR A O    3  
ATOM 4180  C CB   . THR A 1 40  ? 10.596  -2.804  8.832  1.00 0.00 ? 40  THR A CB   3  
ATOM 4181  O OG1  . THR A 1 40  ? 10.931  -3.009  7.462  1.00 0.00 ? 40  THR A OG1  3  
ATOM 4182  C CG2  . THR A 1 40  ? 11.138  -4.049  9.538  1.00 0.00 ? 40  THR A CG2  3  
ATOM 4183  H H    . THR A 1 40  ? 9.216   -4.565  7.833  1.00 0.00 ? 40  THR A H    3  
ATOM 4184  H HA   . THR A 1 40  ? 8.713   -2.587  9.856  1.00 0.00 ? 40  THR A HA   3  
ATOM 4185  H HB   . THR A 1 40  ? 11.022  -1.897  9.262  1.00 0.00 ? 40  THR A HB   3  
ATOM 4186  H HG1  . THR A 1 40  ? 11.914  -2.884  7.328  1.00 0.00 ? 40  THR A HG1  3  
ATOM 4187  H HG21 . THR A 1 40  ? 12.227  -4.053  9.482  1.00 0.00 ? 40  THR A HG21 3  
ATOM 4188  H HG22 . THR A 1 40  ? 10.828  -4.039  10.583 1.00 0.00 ? 40  THR A HG22 3  
ATOM 4189  H HG23 . THR A 1 40  ? 10.746  -4.942  9.051  1.00 0.00 ? 40  THR A HG23 3  
ATOM 4190  N N    . GLU A 1 41  ? 9.121   -0.451  8.107  1.00 0.00 ? 41  GLU A N    3  
ATOM 4191  C CA   . GLU A 1 41  ? 8.689   0.714   7.354  1.00 0.00 ? 41  GLU A CA   3  
ATOM 4192  C C    . GLU A 1 41  ? 8.807   0.449   5.852  1.00 0.00 ? 41  GLU A C    3  
ATOM 4193  O O    . GLU A 1 41  ? 7.837   0.605   5.112  1.00 0.00 ? 41  GLU A O    3  
ATOM 4194  C CB   . GLU A 1 41  ? 9.490   1.955   7.756  1.00 0.00 ? 41  GLU A CB   3  
ATOM 4195  C CG   . GLU A 1 41  ? 9.329   2.251   9.248  1.00 0.00 ? 41  GLU A CG   3  
ATOM 4196  C CD   . GLU A 1 41  ? 9.828   3.658   9.585  1.00 0.00 ? 41  GLU A CD   3  
ATOM 4197  O OE1  . GLU A 1 41  ? 10.809  4.082   8.937  1.00 0.00 ? 41  GLU A OE1  3  
ATOM 4198  O OE2  . GLU A 1 41  ? 9.218   4.277   10.483 1.00 0.00 ? 41  GLU A OE2  3  
ATOM 4199  H H    . GLU A 1 41  ? 9.906   -0.298  8.709  1.00 0.00 ? 41  GLU A H    3  
ATOM 4200  H HA   . GLU A 1 41  ? 7.643   0.862   7.623  1.00 0.00 ? 41  GLU A HA   3  
ATOM 4201  H HB2  . GLU A 1 41  ? 10.544  1.803   7.523  1.00 0.00 ? 41  GLU A HB2  3  
ATOM 4202  H HB3  . GLU A 1 41  ? 9.155   2.813   7.173  1.00 0.00 ? 41  GLU A HB3  3  
ATOM 4203  H HG2  . GLU A 1 41  ? 8.280   2.156   9.531  1.00 0.00 ? 41  GLU A HG2  3  
ATOM 4204  H HG3  . GLU A 1 41  ? 9.883   1.515   9.831  1.00 0.00 ? 41  GLU A HG3  3  
ATOM 4205  N N    . GLU A 1 42  ? 10.004  0.052   5.446  1.00 0.00 ? 42  GLU A N    3  
ATOM 4206  C CA   . GLU A 1 42  ? 10.262  -0.237  4.045  1.00 0.00 ? 42  GLU A CA   3  
ATOM 4207  C C    . GLU A 1 42  ? 9.340   -1.356  3.556  1.00 0.00 ? 42  GLU A C    3  
ATOM 4208  O O    . GLU A 1 42  ? 8.473   -1.127  2.713  1.00 0.00 ? 42  GLU A O    3  
ATOM 4209  C CB   . GLU A 1 42  ? 11.731  -0.599  3.821  1.00 0.00 ? 42  GLU A CB   3  
ATOM 4210  C CG   . GLU A 1 42  ? 12.489  0.560   3.171  1.00 0.00 ? 42  GLU A CG   3  
ATOM 4211  C CD   . GLU A 1 42  ? 13.879  0.117   2.710  1.00 0.00 ? 42  GLU A CD   3  
ATOM 4212  O OE1  . GLU A 1 42  ? 14.591  -0.480  3.546  1.00 0.00 ? 42  GLU A OE1  3  
ATOM 4213  O OE2  . GLU A 1 42  ? 14.198  0.384   1.531  1.00 0.00 ? 42  GLU A OE2  3  
ATOM 4214  H H    . GLU A 1 42  ? 10.788  -0.073  6.054  1.00 0.00 ? 42  GLU A H    3  
ATOM 4215  H HA   . GLU A 1 42  ? 10.037  0.687   3.513  1.00 0.00 ? 42  GLU A HA   3  
ATOM 4216  H HB2  . GLU A 1 42  ? 12.196  -0.854  4.773  1.00 0.00 ? 42  GLU A HB2  3  
ATOM 4217  H HB3  . GLU A 1 42  ? 11.799  -1.483  3.187  1.00 0.00 ? 42  GLU A HB3  3  
ATOM 4218  H HG2  . GLU A 1 42  ? 11.923  0.938   2.320  1.00 0.00 ? 42  GLU A HG2  3  
ATOM 4219  H HG3  . GLU A 1 42  ? 12.583  1.381   3.882  1.00 0.00 ? 42  GLU A HG3  3  
ATOM 4220  N N    . SER A 1 43  ? 9.559   -2.542  4.104  1.00 0.00 ? 43  SER A N    3  
ATOM 4221  C CA   . SER A 1 43  ? 8.759   -3.697  3.734  1.00 0.00 ? 43  SER A CA   3  
ATOM 4222  C C    . SER A 1 43  ? 7.292   -3.289  3.577  1.00 0.00 ? 43  SER A C    3  
ATOM 4223  O O    . SER A 1 43  ? 6.577   -3.841  2.743  1.00 0.00 ? 43  SER A O    3  
ATOM 4224  C CB   . SER A 1 43  ? 8.891   -4.814  4.771  1.00 0.00 ? 43  SER A CB   3  
ATOM 4225  O OG   . SER A 1 43  ? 10.080  -5.577  4.586  1.00 0.00 ? 43  SER A OG   3  
ATOM 4226  H H    . SER A 1 43  ? 10.266  -2.719  4.789  1.00 0.00 ? 43  SER A H    3  
ATOM 4227  H HA   . SER A 1 43  ? 9.165   -4.036  2.782  1.00 0.00 ? 43  SER A HA   3  
ATOM 4228  H HB2  . SER A 1 43  ? 8.891   -4.381  5.772  1.00 0.00 ? 43  SER A HB2  3  
ATOM 4229  H HB3  . SER A 1 43  ? 8.024   -5.471  4.708  1.00 0.00 ? 43  SER A HB3  3  
ATOM 4230  H HG   . SER A 1 43  ? 9.920   -6.529  4.847  1.00 0.00 ? 43  SER A HG   3  
ATOM 4231  N N    . LEU A 1 44  ? 6.889   -2.325  4.392  1.00 0.00 ? 44  LEU A N    3  
ATOM 4232  C CA   . LEU A 1 44  ? 5.521   -1.837  4.354  1.00 0.00 ? 44  LEU A CA   3  
ATOM 4233  C C    . LEU A 1 44  ? 5.305   -1.038  3.068  1.00 0.00 ? 44  LEU A C    3  
ATOM 4234  O O    . LEU A 1 44  ? 4.350   -1.285  2.332  1.00 0.00 ? 44  LEU A O    3  
ATOM 4235  C CB   . LEU A 1 44  ? 5.196   -1.053  5.628  1.00 0.00 ? 44  LEU A CB   3  
ATOM 4236  C CG   . LEU A 1 44  ? 3.816   -0.394  5.676  1.00 0.00 ? 44  LEU A CG   3  
ATOM 4237  C CD1  . LEU A 1 44  ? 2.755   -1.379  6.170  1.00 0.00 ? 44  LEU A CD1  3  
ATOM 4238  C CD2  . LEU A 1 44  ? 3.848   0.883   6.517  1.00 0.00 ? 44  LEU A CD2  3  
ATOM 4239  H H    . LEU A 1 44  ? 7.477   -1.881  5.068  1.00 0.00 ? 44  LEU A H    3  
ATOM 4240  H HA   . LEU A 1 44  ? 4.864   -2.707  4.335  1.00 0.00 ? 44  LEU A HA   3  
ATOM 4241  H HB2  . LEU A 1 44  ? 5.284   -1.728  6.479  1.00 0.00 ? 44  LEU A HB2  3  
ATOM 4242  H HB3  . LEU A 1 44  ? 5.952   -0.278  5.756  1.00 0.00 ? 44  LEU A HB3  3  
ATOM 4243  H HG   . LEU A 1 44  ? 3.540   -0.105  4.662  1.00 0.00 ? 44  LEU A HG   3  
ATOM 4244  H HD11 . LEU A 1 44  ? 1.851   -0.834  6.441  1.00 0.00 ? 44  LEU A HD11 3  
ATOM 4245  H HD12 . LEU A 1 44  ? 2.525   -2.093  5.378  1.00 0.00 ? 44  LEU A HD12 3  
ATOM 4246  H HD13 . LEU A 1 44  ? 3.133   -1.913  7.042  1.00 0.00 ? 44  LEU A HD13 3  
ATOM 4247  H HD21 . LEU A 1 44  ? 2.862   1.060   6.947  1.00 0.00 ? 44  LEU A HD21 3  
ATOM 4248  H HD22 . LEU A 1 44  ? 4.579   0.773   7.318  1.00 0.00 ? 44  LEU A HD22 3  
ATOM 4249  H HD23 . LEU A 1 44  ? 4.125   1.727   5.886  1.00 0.00 ? 44  LEU A HD23 3  
ATOM 4250  N N    . ARG A 1 45  ? 6.206   -0.095  2.836  1.00 0.00 ? 45  ARG A N    3  
ATOM 4251  C CA   . ARG A 1 45  ? 6.126   0.742   1.651  1.00 0.00 ? 45  ARG A CA   3  
ATOM 4252  C C    . ARG A 1 45  ? 6.159   -0.121  0.388  1.00 0.00 ? 45  ARG A C    3  
ATOM 4253  O O    . ARG A 1 45  ? 5.290   0.000   -0.473 1.00 0.00 ? 45  ARG A O    3  
ATOM 4254  C CB   . ARG A 1 45  ? 7.282   1.744   1.606  1.00 0.00 ? 45  ARG A CB   3  
ATOM 4255  C CG   . ARG A 1 45  ? 7.355   2.555   2.901  1.00 0.00 ? 45  ARG A CG   3  
ATOM 4256  C CD   . ARG A 1 45  ? 7.700   4.017   2.613  1.00 0.00 ? 45  ARG A CD   3  
ATOM 4257  N NE   . ARG A 1 45  ? 9.152   4.240   2.794  1.00 0.00 ? 45  ARG A NE   3  
ATOM 4258  C CZ   . ARG A 1 45  ? 10.064  4.070   1.827  1.00 0.00 ? 45  ARG A CZ   3  
ATOM 4259  N NH1  . ARG A 1 45  ? 9.680   3.675   0.605  1.00 0.00 ? 45  ARG A NH1  3  
ATOM 4260  N NH2  . ARG A 1 45  ? 11.361  4.295   2.081  1.00 0.00 ? 45  ARG A NH2  3  
ATOM 4261  H H    . ARG A 1 45  ? 6.980   0.099   3.440  1.00 0.00 ? 45  ARG A H    3  
ATOM 4262  H HA   . ARG A 1 45  ? 5.175   1.265   1.744  1.00 0.00 ? 45  ARG A HA   3  
ATOM 4263  H HB2  . ARG A 1 45  ? 8.221   1.214   1.450  1.00 0.00 ? 45  ARG A HB2  3  
ATOM 4264  H HB3  . ARG A 1 45  ? 7.151   2.417   0.758  1.00 0.00 ? 45  ARG A HB3  3  
ATOM 4265  H HG2  . ARG A 1 45  ? 6.400   2.499   3.424  1.00 0.00 ? 45  ARG A HG2  3  
ATOM 4266  H HG3  . ARG A 1 45  ? 8.106   2.123   3.562  1.00 0.00 ? 45  ARG A HG3  3  
ATOM 4267  H HD2  . ARG A 1 45  ? 7.408   4.275   1.595  1.00 0.00 ? 45  ARG A HD2  3  
ATOM 4268  H HD3  . ARG A 1 45  ? 7.138   4.671   3.281  1.00 0.00 ? 45  ARG A HD3  3  
ATOM 4269  H HE   . ARG A 1 45  ? 9.473   4.535   3.694  1.00 0.00 ? 45  ARG A HE   3  
ATOM 4270  H HH11 . ARG A 1 45  ? 8.713   3.507   0.415  1.00 0.00 ? 45  ARG A HH11 3  
ATOM 4271  H HH12 . ARG A 1 45  ? 10.360  3.549   -0.116 1.00 0.00 ? 45  ARG A HH12 3  
ATOM 4272  H HH21 . ARG A 1 45  ? 11.647  4.589   2.993  1.00 0.00 ? 45  ARG A HH21 3  
ATOM 4273  H HH22 . ARG A 1 45  ? 12.041  4.168   1.359  1.00 0.00 ? 45  ARG A HH22 3  
ATOM 4274  N N    . ASN A 1 46  ? 7.171   -0.974  0.319  1.00 0.00 ? 46  ASN A N    3  
ATOM 4275  C CA   . ASN A 1 46  ? 7.328   -1.857  -0.825 1.00 0.00 ? 46  ASN A CA   3  
ATOM 4276  C C    . ASN A 1 46  ? 5.966   -2.443  -1.202 1.00 0.00 ? 46  ASN A C    3  
ATOM 4277  O O    . ASN A 1 46  ? 5.732   -2.782  -2.361 1.00 0.00 ? 46  ASN A O    3  
ATOM 4278  C CB   . ASN A 1 46  ? 8.269   -3.018  -0.498 1.00 0.00 ? 46  ASN A CB   3  
ATOM 4279  C CG   . ASN A 1 46  ? 8.418   -3.957  -1.697 1.00 0.00 ? 46  ASN A CG   3  
ATOM 4280  O OD1  . ASN A 1 46  ? 9.186   -3.717  -2.614 1.00 0.00 ? 46  ASN A OD1  3  
ATOM 4281  N ND2  . ASN A 1 46  ? 7.642   -5.035  -1.639 1.00 0.00 ? 46  ASN A ND2  3  
ATOM 4282  H H    . ASN A 1 46  ? 7.874   -1.066  1.024  1.00 0.00 ? 46  ASN A H    3  
ATOM 4283  H HA   . ASN A 1 46  ? 7.746   -1.232  -1.614 1.00 0.00 ? 46  ASN A HA   3  
ATOM 4284  H HB2  . ASN A 1 46  ? 9.247   -2.629  -0.213 1.00 0.00 ? 46  ASN A HB2  3  
ATOM 4285  H HB3  . ASN A 1 46  ? 7.885   -3.573  0.357  1.00 0.00 ? 46  ASN A HB3  3  
ATOM 4286  H HD21 . ASN A 1 46  ? 7.033   -5.172  -0.858 1.00 0.00 ? 46  ASN A HD21 3  
ATOM 4287  H HD22 . ASN A 1 46  ? 7.668   -5.710  -2.377 1.00 0.00 ? 46  ASN A HD22 3  
ATOM 4288  N N    . TYR A 1 47  ? 5.104   -2.546  -0.201 1.00 0.00 ? 47  TYR A N    3  
ATOM 4289  C CA   . TYR A 1 47  ? 3.772   -3.085  -0.413 1.00 0.00 ? 47  TYR A CA   3  
ATOM 4290  C C    . TYR A 1 47  ? 2.769   -1.969  -0.714 1.00 0.00 ? 47  TYR A C    3  
ATOM 4291  O O    . TYR A 1 47  ? 1.975   -2.079  -1.646 1.00 0.00 ? 47  TYR A O    3  
ATOM 4292  C CB   . TYR A 1 47  ? 3.379   -3.767  0.899  1.00 0.00 ? 47  TYR A CB   3  
ATOM 4293  C CG   . TYR A 1 47  ? 2.163   -4.688  0.783  1.00 0.00 ? 47  TYR A CG   3  
ATOM 4294  C CD1  . TYR A 1 47  ? 2.298   -5.942  0.222  1.00 0.00 ? 47  TYR A CD1  3  
ATOM 4295  C CD2  . TYR A 1 47  ? 0.931   -4.265  1.239  1.00 0.00 ? 47  TYR A CD2  3  
ATOM 4296  C CE1  . TYR A 1 47  ? 1.154   -6.808  0.112  1.00 0.00 ? 47  TYR A CE1  3  
ATOM 4297  C CE2  . TYR A 1 47  ? -0.213  -5.132  1.129  1.00 0.00 ? 47  TYR A CE2  3  
ATOM 4298  C CZ   . TYR A 1 47  ? -0.046  -6.361  0.571  1.00 0.00 ? 47  TYR A CZ   3  
ATOM 4299  O OH   . TYR A 1 47  ? -1.127  -7.179  0.467  1.00 0.00 ? 47  TYR A OH   3  
ATOM 4300  H H    . TYR A 1 47  ? 5.303   -2.268  0.739  1.00 0.00 ? 47  TYR A H    3  
ATOM 4301  H HA   . TYR A 1 47  ? 3.816   -3.764  -1.265 1.00 0.00 ? 47  TYR A HA   3  
ATOM 4302  H HB2  . TYR A 1 47  ? 4.228   -4.347  1.264  1.00 0.00 ? 47  TYR A HB2  3  
ATOM 4303  H HB3  . TYR A 1 47  ? 3.172   -3.001  1.647  1.00 0.00 ? 47  TYR A HB3  3  
ATOM 4304  H HD1  . TYR A 1 47  ? 3.271   -6.275  -0.139 1.00 0.00 ? 47  TYR A HD1  3  
ATOM 4305  H HD2  . TYR A 1 47  ? 0.825   -3.275  1.682  1.00 0.00 ? 47  TYR A HD2  3  
ATOM 4306  H HE1  . TYR A 1 47  ? 1.246   -7.801  -0.330 1.00 0.00 ? 47  TYR A HE1  3  
ATOM 4307  H HE2  . TYR A 1 47  ? -1.192  -4.811  1.485  1.00 0.00 ? 47  TYR A HE2  3  
ATOM 4308  H HH   . TYR A 1 47  ? -0.894  -7.986  -0.077 1.00 0.00 ? 47  TYR A HH   3  
ATOM 4309  N N    . TYR A 1 48  ? 2.840   -0.921  0.094  1.00 0.00 ? 48  TYR A N    3  
ATOM 4310  C CA   . TYR A 1 48  ? 1.948   0.214   -0.074 1.00 0.00 ? 48  TYR A CA   3  
ATOM 4311  C C    . TYR A 1 48  ? 2.542   1.239   -1.043 1.00 0.00 ? 48  TYR A C    3  
ATOM 4312  O O    . TYR A 1 48  ? 2.193   2.417   -0.996 1.00 0.00 ? 48  TYR A O    3  
ATOM 4313  C CB   . TYR A 1 48  ? 1.816   0.854   1.309  1.00 0.00 ? 48  TYR A CB   3  
ATOM 4314  C CG   . TYR A 1 48  ? 0.733   0.222   2.186  1.00 0.00 ? 48  TYR A CG   3  
ATOM 4315  C CD1  . TYR A 1 48  ? -0.577  0.641   2.075  1.00 0.00 ? 48  TYR A CD1  3  
ATOM 4316  C CD2  . TYR A 1 48  ? 1.067   -0.766  3.089  1.00 0.00 ? 48  TYR A CD2  3  
ATOM 4317  C CE1  . TYR A 1 48  ? -1.596  0.047   2.900  1.00 0.00 ? 48  TYR A CE1  3  
ATOM 4318  C CE2  . TYR A 1 48  ? 0.048   -1.361  3.915  1.00 0.00 ? 48  TYR A CE2  3  
ATOM 4319  C CZ   . TYR A 1 48  ? -1.233  -0.925  3.780  1.00 0.00 ? 48  TYR A CZ   3  
ATOM 4320  O OH   . TYR A 1 48  ? -2.195  -1.487  4.560  1.00 0.00 ? 48  TYR A OH   3  
ATOM 4321  H H    . TYR A 1 48  ? 3.489   -0.840  0.850  1.00 0.00 ? 48  TYR A H    3  
ATOM 4322  H HA   . TYR A 1 48  ? 1.006   -0.155  -0.480 1.00 0.00 ? 48  TYR A HA   3  
ATOM 4323  H HB2  . TYR A 1 48  ? 2.774   0.783   1.824  1.00 0.00 ? 48  TYR A HB2  3  
ATOM 4324  H HB3  . TYR A 1 48  ? 1.597   1.915   1.187  1.00 0.00 ? 48  TYR A HB3  3  
ATOM 4325  H HD1  . TYR A 1 48  ? -0.841  1.422   1.361  1.00 0.00 ? 48  TYR A HD1  3  
ATOM 4326  H HD2  . TYR A 1 48  ? 2.102   -1.097  3.177  1.00 0.00 ? 48  TYR A HD2  3  
ATOM 4327  H HE1  . TYR A 1 48  ? -2.635  0.368   2.822  1.00 0.00 ? 48  TYR A HE1  3  
ATOM 4328  H HE2  . TYR A 1 48  ? 0.298   -2.143  4.632  1.00 0.00 ? 48  TYR A HE2  3  
ATOM 4329  H HH   . TYR A 1 48  ? -1.918  -2.407  4.836  1.00 0.00 ? 48  TYR A HH   3  
ATOM 4330  N N    . GLU A 1 49  ? 3.428   0.752   -1.899 1.00 0.00 ? 49  GLU A N    3  
ATOM 4331  C CA   . GLU A 1 49  ? 4.073   1.611   -2.877 1.00 0.00 ? 49  GLU A CA   3  
ATOM 4332  C C    . GLU A 1 49  ? 3.391   1.470   -4.239 1.00 0.00 ? 49  GLU A C    3  
ATOM 4333  O O    . GLU A 1 49  ? 3.398   2.403   -5.041 1.00 0.00 ? 49  GLU A O    3  
ATOM 4334  C CB   . GLU A 1 49  ? 5.568   1.300   -2.978 1.00 0.00 ? 49  GLU A CB   3  
ATOM 4335  C CG   . GLU A 1 49  ? 6.388   2.263   -2.117 1.00 0.00 ? 49  GLU A CG   3  
ATOM 4336  C CD   . GLU A 1 49  ? 7.718   2.605   -2.792 1.00 0.00 ? 49  GLU A CD   3  
ATOM 4337  O OE1  . GLU A 1 49  ? 8.421   1.647   -3.179 1.00 0.00 ? 49  GLU A OE1  3  
ATOM 4338  O OE2  . GLU A 1 49  ? 8.001   3.818   -2.905 1.00 0.00 ? 49  GLU A OE2  3  
ATOM 4339  H H    . GLU A 1 49  ? 3.706   -0.208  -1.931 1.00 0.00 ? 49  GLU A H    3  
ATOM 4340  H HA   . GLU A 1 49  ? 3.944   2.626   -2.502 1.00 0.00 ? 49  GLU A HA   3  
ATOM 4341  H HB2  . GLU A 1 49  ? 5.753   0.274   -2.659 1.00 0.00 ? 49  GLU A HB2  3  
ATOM 4342  H HB3  . GLU A 1 49  ? 5.889   1.373   -4.018 1.00 0.00 ? 49  GLU A HB3  3  
ATOM 4343  H HG2  . GLU A 1 49  ? 5.818   3.176   -1.944 1.00 0.00 ? 49  GLU A HG2  3  
ATOM 4344  H HG3  . GLU A 1 49  ? 6.575   1.815   -1.142 1.00 0.00 ? 49  GLU A HG3  3  
ATOM 4345  N N    . GLN A 1 50  ? 2.818   0.296   -4.460 1.00 0.00 ? 50  GLN A N    3  
ATOM 4346  C CA   . GLN A 1 50  ? 2.133   0.021   -5.711 1.00 0.00 ? 50  GLN A CA   3  
ATOM 4347  C C    . GLN A 1 50  ? 0.828   0.817   -5.788 1.00 0.00 ? 50  GLN A C    3  
ATOM 4348  O O    . GLN A 1 50  ? 0.231   0.935   -6.857 1.00 0.00 ? 50  GLN A O    3  
ATOM 4349  C CB   . GLN A 1 50  ? 1.871   -1.478  -5.875 1.00 0.00 ? 50  GLN A CB   3  
ATOM 4350  C CG   . GLN A 1 50  ? 0.819   -1.963  -4.875 1.00 0.00 ? 50  GLN A CG   3  
ATOM 4351  C CD   . GLN A 1 50  ? 1.386   -3.062  -3.973 1.00 0.00 ? 50  GLN A CD   3  
ATOM 4352  O OE1  . GLN A 1 50  ? 2.586   -3.255  -3.866 1.00 0.00 ? 50  GLN A OE1  3  
ATOM 4353  N NE2  . GLN A 1 50  ? 0.459   -3.769  -3.334 1.00 0.00 ? 50  GLN A NE2  3  
ATOM 4354  H H    . GLN A 1 50  ? 2.817   -0.458  -3.803 1.00 0.00 ? 50  GLN A H    3  
ATOM 4355  H HA   . GLN A 1 50  ? 2.815   0.351   -6.494 1.00 0.00 ? 50  GLN A HA   3  
ATOM 4356  H HB2  . GLN A 1 50  ? 1.533   -1.683  -6.891 1.00 0.00 ? 50  GLN A HB2  3  
ATOM 4357  H HB3  . GLN A 1 50  ? 2.798   -2.031  -5.730 1.00 0.00 ? 50  GLN A HB3  3  
ATOM 4358  H HG2  . GLN A 1 50  ? 0.479   -1.127  -4.265 1.00 0.00 ? 50  GLN A HG2  3  
ATOM 4359  H HG3  . GLN A 1 50  ? -0.051  -2.341  -5.411 1.00 0.00 ? 50  GLN A HG3  3  
ATOM 4360  H HE21 . GLN A 1 50  ? -0.510  -3.559  -3.467 1.00 0.00 ? 50  GLN A HE21 3  
ATOM 4361  H HE22 . GLN A 1 50  ? 0.730   -4.511  -2.721 1.00 0.00 ? 50  GLN A HE22 3  
ATOM 4362  N N    . TRP A 1 51  ? 0.425   1.343   -4.641 1.00 0.00 ? 51  TRP A N    3  
ATOM 4363  C CA   . TRP A 1 51  ? -0.797  2.125   -4.565 1.00 0.00 ? 51  TRP A CA   3  
ATOM 4364  C C    . TRP A 1 51  ? -0.416  3.605   -4.624 1.00 0.00 ? 51  TRP A C    3  
ATOM 4365  O O    . TRP A 1 51  ? -1.139  4.414   -5.204 1.00 0.00 ? 51  TRP A O    3  
ATOM 4366  C CB   . TRP A 1 51  ? -1.602  1.764   -3.315 1.00 0.00 ? 51  TRP A CB   3  
ATOM 4367  C CG   . TRP A 1 51  ? -2.174  0.345   -3.331 1.00 0.00 ? 51  TRP A CG   3  
ATOM 4368  C CD1  . TRP A 1 51  ? -2.875  -0.251  -4.305 1.00 0.00 ? 51  TRP A CD1  3  
ATOM 4369  C CD2  . TRP A 1 51  ? -2.065  -0.638  -2.280 1.00 0.00 ? 51  TRP A CD2  3  
ATOM 4370  N NE1  . TRP A 1 51  ? -3.224  -1.541  -3.961 1.00 0.00 ? 51  TRP A NE1  3  
ATOM 4371  C CE2  . TRP A 1 51  ? -2.716  -1.783  -2.690 1.00 0.00 ? 51  TRP A CE2  3  
ATOM 4372  C CE3  . TRP A 1 51  ? -1.437  -0.561  -1.024 1.00 0.00 ? 51  TRP A CE3  3  
ATOM 4373  C CZ2  . TRP A 1 51  ? -2.802  -2.939  -1.904 1.00 0.00 ? 51  TRP A CZ2  3  
ATOM 4374  C CZ3  . TRP A 1 51  ? -1.532  -1.725  -0.251 1.00 0.00 ? 51  TRP A CZ3  3  
ATOM 4375  C CH2  . TRP A 1 51  ? -2.184  -2.886  -0.649 1.00 0.00 ? 51  TRP A CH2  3  
ATOM 4376  H H    . TRP A 1 51  ? 0.917   1.243   -3.776 1.00 0.00 ? 51  TRP A H    3  
ATOM 4377  H HA   . TRP A 1 51  ? -1.414  1.864   -5.425 1.00 0.00 ? 51  TRP A HA   3  
ATOM 4378  H HB2  . TRP A 1 51  ? -0.963  1.877   -2.439 1.00 0.00 ? 51  TRP A HB2  3  
ATOM 4379  H HB3  . TRP A 1 51  ? -2.422  2.474   -3.205 1.00 0.00 ? 51  TRP A HB3  3  
ATOM 4380  H HD1  . TRP A 1 51  ? -3.136  0.224   -5.251 1.00 0.00 ? 51  TRP A HD1  3  
ATOM 4381  H HE1  . TRP A 1 51  ? -3.794  -2.240  -4.572 1.00 0.00 ? 51  TRP A HE1  3  
ATOM 4382  H HE3  . TRP A 1 51  ? -0.917  0.332   -0.677 1.00 0.00 ? 51  TRP A HE3  3  
ATOM 4383  H HZ2  . TRP A 1 51  ? -3.322  -3.832  -2.251 1.00 0.00 ? 51  TRP A HZ2  3  
ATOM 4384  H HZ3  . TRP A 1 51  ? -1.062  -1.719  0.732  1.00 0.00 ? 51  TRP A HZ3  3  
ATOM 4385  H HH2  . TRP A 1 51  ? -2.213  -3.752  0.013  1.00 0.00 ? 51  TRP A HH2  3  
ATOM 4386  N N    . GLY A 1 52  ? 0.719   3.916   -4.016 1.00 0.00 ? 52  GLY A N    3  
ATOM 4387  C CA   . GLY A 1 52  ? 1.205   5.285   -3.992 1.00 0.00 ? 52  GLY A CA   3  
ATOM 4388  C C    . GLY A 1 52  ? 2.464   5.405   -3.130 1.00 0.00 ? 52  GLY A C    3  
ATOM 4389  O O    . GLY A 1 52  ? 2.754   4.524   -2.323 1.00 0.00 ? 52  GLY A O    3  
ATOM 4390  H H    . GLY A 1 52  ? 1.302   3.253   -3.546 1.00 0.00 ? 52  GLY A H    3  
ATOM 4391  H HA2  . GLY A 1 52  ? 1.422   5.615   -5.008 1.00 0.00 ? 52  GLY A HA2  3  
ATOM 4392  H HA3  . GLY A 1 52  ? 0.429   5.944   -3.602 1.00 0.00 ? 52  GLY A HA3  3  
ATOM 4393  N N    . LYS A 1 53  ? 3.178   6.503   -3.332 1.00 0.00 ? 53  LYS A N    3  
ATOM 4394  C CA   . LYS A 1 53  ? 4.399   6.750   -2.584 1.00 0.00 ? 53  LYS A CA   3  
ATOM 4395  C C    . LYS A 1 53  ? 4.043   7.310   -1.206 1.00 0.00 ? 53  LYS A C    3  
ATOM 4396  O O    . LYS A 1 53  ? 3.346   8.319   -1.103 1.00 0.00 ? 53  LYS A O    3  
ATOM 4397  C CB   . LYS A 1 53  ? 5.347   7.644   -3.386 1.00 0.00 ? 53  LYS A CB   3  
ATOM 4398  C CG   . LYS A 1 53  ? 6.236   6.810   -4.311 1.00 0.00 ? 53  LYS A CG   3  
ATOM 4399  C CD   . LYS A 1 53  ? 6.295   7.421   -5.712 1.00 0.00 ? 53  LYS A CD   3  
ATOM 4400  C CE   . LYS A 1 53  ? 5.239   6.797   -6.627 1.00 0.00 ? 53  LYS A CE   3  
ATOM 4401  N NZ   . LYS A 1 53  ? 5.856   5.791   -7.520 1.00 0.00 ? 53  LYS A NZ   3  
ATOM 4402  H H    . LYS A 1 53  ? 2.935   7.215   -3.991 1.00 0.00 ? 53  LYS A H    3  
ATOM 4403  H HA   . LYS A 1 53  ? 4.898   5.790   -2.448 1.00 0.00 ? 53  LYS A HA   3  
ATOM 4404  H HB2  . LYS A 1 53  ? 4.770   8.356   -3.975 1.00 0.00 ? 53  LYS A HB2  3  
ATOM 4405  H HB3  . LYS A 1 53  ? 5.968   8.224   -2.704 1.00 0.00 ? 53  LYS A HB3  3  
ATOM 4406  H HG2  . LYS A 1 53  ? 7.242   6.748   -3.895 1.00 0.00 ? 53  LYS A HG2  3  
ATOM 4407  H HG3  . LYS A 1 53  ? 5.852   5.792   -4.369 1.00 0.00 ? 53  LYS A HG3  3  
ATOM 4408  H HD2  . LYS A 1 53  ? 6.136   8.498   -5.650 1.00 0.00 ? 53  LYS A HD2  3  
ATOM 4409  H HD3  . LYS A 1 53  ? 7.286   7.268   -6.138 1.00 0.00 ? 53  LYS A HD3  3  
ATOM 4410  H HE2  . LYS A 1 53  ? 4.460   6.328   -6.026 1.00 0.00 ? 53  LYS A HE2  3  
ATOM 4411  H HE3  . LYS A 1 53  ? 4.759   7.574   -7.221 1.00 0.00 ? 53  LYS A HE3  3  
ATOM 4412  H HZ1  . LYS A 1 53  ? 6.844   5.943   -7.560 1.00 0.00 ? 53  LYS A HZ1  3  
ATOM 4413  H HZ2  . LYS A 1 53  ? 5.674   4.874   -7.165 1.00 0.00 ? 53  LYS A HZ2  3  
ATOM 4414  H HZ3  . LYS A 1 53  ? 5.468   5.877   -8.437 1.00 0.00 ? 53  LYS A HZ3  3  
ATOM 4415  N N    . LEU A 1 54  ? 4.537   6.632   -0.181 1.00 0.00 ? 54  LEU A N    3  
ATOM 4416  C CA   . LEU A 1 54  ? 4.280   7.050   1.187  1.00 0.00 ? 54  LEU A CA   3  
ATOM 4417  C C    . LEU A 1 54  ? 5.267   8.153   1.573  1.00 0.00 ? 54  LEU A C    3  
ATOM 4418  O O    . LEU A 1 54  ? 6.460   7.896   1.732  1.00 0.00 ? 54  LEU A O    3  
ATOM 4419  C CB   . LEU A 1 54  ? 4.305   5.845   2.129  1.00 0.00 ? 54  LEU A CB   3  
ATOM 4420  C CG   . LEU A 1 54  ? 3.521   4.615   1.666  1.00 0.00 ? 54  LEU A CG   3  
ATOM 4421  C CD1  . LEU A 1 54  ? 3.701   3.451   2.642  1.00 0.00 ? 54  LEU A CD1  3  
ATOM 4422  C CD2  . LEU A 1 54  ? 2.046   4.956   1.447  1.00 0.00 ? 54  LEU A CD2  3  
ATOM 4423  H H    . LEU A 1 54  ? 5.103   5.813   -0.273 1.00 0.00 ? 54  LEU A H    3  
ATOM 4424  H HA   . LEU A 1 54  ? 3.271   7.463   1.218  1.00 0.00 ? 54  LEU A HA   3  
ATOM 4425  H HB2  . LEU A 1 54  ? 5.343   5.552   2.285  1.00 0.00 ? 54  LEU A HB2  3  
ATOM 4426  H HB3  . LEU A 1 54  ? 3.913   6.158   3.097  1.00 0.00 ? 54  LEU A HB3  3  
ATOM 4427  H HG   . LEU A 1 54  ? 3.924   4.295   0.705  1.00 0.00 ? 54  LEU A HG   3  
ATOM 4428  H HD11 . LEU A 1 54  ? 4.703   3.036   2.531  1.00 0.00 ? 54  LEU A HD11 3  
ATOM 4429  H HD12 . LEU A 1 54  ? 3.567   3.808   3.663  1.00 0.00 ? 54  LEU A HD12 3  
ATOM 4430  H HD13 . LEU A 1 54  ? 2.962   2.679   2.427  1.00 0.00 ? 54  LEU A HD13 3  
ATOM 4431  H HD21 . LEU A 1 54  ? 1.424   4.259   2.009  1.00 0.00 ? 54  LEU A HD21 3  
ATOM 4432  H HD22 . LEU A 1 54  ? 1.853   5.973   1.789  1.00 0.00 ? 54  LEU A HD22 3  
ATOM 4433  H HD23 . LEU A 1 54  ? 1.809   4.879   0.386  1.00 0.00 ? 54  LEU A HD23 3  
ATOM 4434  N N    . THR A 1 55  ? 4.735   9.358   1.712  1.00 0.00 ? 55  THR A N    3  
ATOM 4435  C CA   . THR A 1 55  ? 5.554   10.501  2.077  1.00 0.00 ? 55  THR A CA   3  
ATOM 4436  C C    . THR A 1 55  ? 5.922   10.442  3.560  1.00 0.00 ? 55  THR A C    3  
ATOM 4437  O O    . THR A 1 55  ? 6.750   11.222  4.030  1.00 0.00 ? 55  THR A O    3  
ATOM 4438  C CB   . THR A 1 55  ? 4.794   11.771  1.689  1.00 0.00 ? 55  THR A CB   3  
ATOM 4439  O OG1  . THR A 1 55  ? 3.770   11.877  2.675  1.00 0.00 ? 55  THR A OG1  3  
ATOM 4440  C CG2  . THR A 1 55  ? 4.029   11.617  0.373  1.00 0.00 ? 55  THR A CG2  3  
ATOM 4441  H H    . THR A 1 55  ? 3.764   9.559   1.581  1.00 0.00 ? 55  THR A H    3  
ATOM 4442  H HA   . THR A 1 55  ? 6.486   10.449  1.514  1.00 0.00 ? 55  THR A HA   3  
ATOM 4443  H HB   . THR A 1 55  ? 5.464   12.630  1.653  1.00 0.00 ? 55  THR A HB   3  
ATOM 4444  H HG1  . THR A 1 55  ? 3.133   11.111  2.590  1.00 0.00 ? 55  THR A HG1  3  
ATOM 4445  H HG21 . THR A 1 55  ? 4.355   10.708  -0.133 1.00 0.00 ? 55  THR A HG21 3  
ATOM 4446  H HG22 . THR A 1 55  ? 2.961   11.555  0.578  1.00 0.00 ? 55  THR A HG22 3  
ATOM 4447  H HG23 . THR A 1 55  ? 4.227   12.479  -0.265 1.00 0.00 ? 55  THR A HG23 3  
ATOM 4448  N N    . ASP A 1 56  ? 5.290   9.510   4.258  1.00 0.00 ? 56  ASP A N    3  
ATOM 4449  C CA   . ASP A 1 56  ? 5.540   9.339   5.679  1.00 0.00 ? 56  ASP A CA   3  
ATOM 4450  C C    . ASP A 1 56  ? 5.080   7.945   6.109  1.00 0.00 ? 56  ASP A C    3  
ATOM 4451  O O    . ASP A 1 56  ? 3.886   7.651   6.099  1.00 0.00 ? 56  ASP A O    3  
ATOM 4452  C CB   . ASP A 1 56  ? 4.764   10.368  6.503  1.00 0.00 ? 56  ASP A CB   3  
ATOM 4453  C CG   . ASP A 1 56  ? 5.610   11.178  7.488  1.00 0.00 ? 56  ASP A CG   3  
ATOM 4454  O OD1  . ASP A 1 56  ? 6.240   10.536  8.355  1.00 0.00 ? 56  ASP A OD1  3  
ATOM 4455  O OD2  . ASP A 1 56  ? 5.606   12.420  7.352  1.00 0.00 ? 56  ASP A OD2  3  
ATOM 4456  H H    . ASP A 1 56  ? 4.618   8.879   3.868  1.00 0.00 ? 56  ASP A H    3  
ATOM 4457  H HA   . ASP A 1 56  ? 6.615   9.479   5.799  1.00 0.00 ? 56  ASP A HA   3  
ATOM 4458  H HB2  . ASP A 1 56  ? 4.268   11.058  5.820  1.00 0.00 ? 56  ASP A HB2  3  
ATOM 4459  H HB3  . ASP A 1 56  ? 3.981   9.851   7.058  1.00 0.00 ? 56  ASP A HB3  3  
ATOM 4460  N N    . CYS A 1 57  ? 6.052   7.123   6.477  1.00 0.00 ? 57  CYS A N    3  
ATOM 4461  C CA   . CYS A 1 57  ? 5.762   5.766   6.910  1.00 0.00 ? 57  CYS A CA   3  
ATOM 4462  C C    . CYS A 1 57  ? 6.410   5.550   8.279  1.00 0.00 ? 57  CYS A C    3  
ATOM 4463  O O    . CYS A 1 57  ? 7.629   5.646   8.414  1.00 0.00 ? 57  CYS A O    3  
ATOM 4464  C CB   . CYS A 1 57  ? 6.233   4.732   5.885  1.00 0.00 ? 57  CYS A CB   3  
ATOM 4465  S SG   . CYS A 1 57  ? 8.061   4.722   5.802  1.00 0.00 ? 57  CYS A SG   3  
ATOM 4466  H H    . CYS A 1 57  ? 7.021   7.370   6.482  1.00 0.00 ? 57  CYS A H    3  
ATOM 4467  H HA   . CYS A 1 57  ? 4.677   5.685   6.978  1.00 0.00 ? 57  CYS A HA   3  
ATOM 4468  H HB2  . CYS A 1 57  ? 5.868   3.743   6.160  1.00 0.00 ? 57  CYS A HB2  3  
ATOM 4469  H HB3  . CYS A 1 57  ? 5.818   4.964   4.905  1.00 0.00 ? 57  CYS A HB3  3  
ATOM 4470  H HG   . CYS A 1 57  ? 8.166   5.714   4.923  1.00 0.00 ? 57  CYS A HG   3  
ATOM 4471  N N    . VAL A 1 58  ? 5.566   5.262   9.259  1.00 0.00 ? 58  VAL A N    3  
ATOM 4472  C CA   . VAL A 1 58  ? 6.042   5.032   10.612 1.00 0.00 ? 58  VAL A CA   3  
ATOM 4473  C C    . VAL A 1 58  ? 5.476   3.707   11.128 1.00 0.00 ? 58  VAL A C    3  
ATOM 4474  O O    . VAL A 1 58  ? 4.314   3.387   10.885 1.00 0.00 ? 58  VAL A O    3  
ATOM 4475  C CB   . VAL A 1 58  ? 5.682   6.222   11.503 1.00 0.00 ? 58  VAL A CB   3  
ATOM 4476  C CG1  . VAL A 1 58  ? 5.678   5.820   12.979 1.00 0.00 ? 58  VAL A CG1  3  
ATOM 4477  C CG2  . VAL A 1 58  ? 6.631   7.397   11.257 1.00 0.00 ? 58  VAL A CG2  3  
ATOM 4478  H H    . VAL A 1 58  ? 4.576   5.186   9.140  1.00 0.00 ? 58  VAL A H    3  
ATOM 4479  H HA   . VAL A 1 58  ? 7.128   4.957   10.571 1.00 0.00 ? 58  VAL A HA   3  
ATOM 4480  H HB   . VAL A 1 58  ? 4.674   6.545   11.241 1.00 0.00 ? 58  VAL A HB   3  
ATOM 4481  H HG11 . VAL A 1 58  ? 4.672   5.518   13.271 1.00 0.00 ? 58  VAL A HG11 3  
ATOM 4482  H HG12 . VAL A 1 58  ? 6.365   4.989   13.132 1.00 0.00 ? 58  VAL A HG12 3  
ATOM 4483  H HG13 . VAL A 1 58  ? 5.993   6.668   13.588 1.00 0.00 ? 58  VAL A HG13 3  
ATOM 4484  H HG21 . VAL A 1 58  ? 6.751   7.966   12.179 1.00 0.00 ? 58  VAL A HG21 3  
ATOM 4485  H HG22 . VAL A 1 58  ? 7.601   7.020   10.934 1.00 0.00 ? 58  VAL A HG22 3  
ATOM 4486  H HG23 . VAL A 1 58  ? 6.216   8.043   10.483 1.00 0.00 ? 58  VAL A HG23 3  
ATOM 4487  N N    . VAL A 1 59  ? 6.326   2.971   11.830 1.00 0.00 ? 59  VAL A N    3  
ATOM 4488  C CA   . VAL A 1 59  ? 5.925   1.688   12.381 1.00 0.00 ? 59  VAL A CA   3  
ATOM 4489  C C    . VAL A 1 59  ? 6.173   1.687   13.891 1.00 0.00 ? 59  VAL A C    3  
ATOM 4490  O O    . VAL A 1 59  ? 7.317   1.761   14.337 1.00 0.00 ? 59  VAL A O    3  
ATOM 4491  C CB   . VAL A 1 59  ? 6.655   0.555   11.656 1.00 0.00 ? 59  VAL A CB   3  
ATOM 4492  C CG1  . VAL A 1 59  ? 8.165   0.637   11.890 1.00 0.00 ? 59  VAL A CG1  3  
ATOM 4493  C CG2  . VAL A 1 59  ? 6.107   -0.809  12.079 1.00 0.00 ? 59  VAL A CG2  3  
ATOM 4494  H H    . VAL A 1 59  ? 7.270   3.238   12.022 1.00 0.00 ? 59  VAL A H    3  
ATOM 4495  H HA   . VAL A 1 59  ? 4.857   1.571   12.201 1.00 0.00 ? 59  VAL A HA   3  
ATOM 4496  H HB   . VAL A 1 59  ? 6.475   0.672   10.587 1.00 0.00 ? 59  VAL A HB   3  
ATOM 4497  H HG11 . VAL A 1 59  ? 8.453   -0.082  12.658 1.00 0.00 ? 59  VAL A HG11 3  
ATOM 4498  H HG12 . VAL A 1 59  ? 8.690   0.408   10.963 1.00 0.00 ? 59  VAL A HG12 3  
ATOM 4499  H HG13 . VAL A 1 59  ? 8.428   1.643   12.218 1.00 0.00 ? 59  VAL A HG13 3  
ATOM 4500  H HG21 . VAL A 1 59  ? 6.149   -1.495  11.233 1.00 0.00 ? 59  VAL A HG21 3  
ATOM 4501  H HG22 . VAL A 1 59  ? 6.710   -1.205  12.897 1.00 0.00 ? 59  VAL A HG22 3  
ATOM 4502  H HG23 . VAL A 1 59  ? 5.074   -0.700  12.408 1.00 0.00 ? 59  VAL A HG23 3  
ATOM 4503  N N    . MET A 1 60  ? 5.081   1.604   14.638 1.00 0.00 ? 60  MET A N    3  
ATOM 4504  C CA   . MET A 1 60  ? 5.165   1.593   16.088 1.00 0.00 ? 60  MET A CA   3  
ATOM 4505  C C    . MET A 1 60  ? 5.836   0.312   16.589 1.00 0.00 ? 60  MET A C    3  
ATOM 4506  O O    . MET A 1 60  ? 5.694   -0.746  15.978 1.00 0.00 ? 60  MET A O    3  
ATOM 4507  C CB   . MET A 1 60  ? 3.759   1.699   16.682 1.00 0.00 ? 60  MET A CB   3  
ATOM 4508  C CG   . MET A 1 60  ? 3.210   3.120   16.540 1.00 0.00 ? 60  MET A CG   3  
ATOM 4509  S SD   . MET A 1 60  ? 4.257   4.270   17.416 1.00 0.00 ? 60  MET A SD   3  
ATOM 4510  C CE   . MET A 1 60  ? 5.132   5.001   16.043 1.00 0.00 ? 60  MET A CE   3  
ATOM 4511  H H    . MET A 1 60  ? 4.154   1.545   14.267 1.00 0.00 ? 60  MET A H    3  
ATOM 4512  H HA   . MET A 1 60  ? 5.774   2.458   16.352 1.00 0.00 ? 60  MET A HA   3  
ATOM 4513  H HB2  . MET A 1 60  ? 3.094   0.997   16.179 1.00 0.00 ? 60  MET A HB2  3  
ATOM 4514  H HB3  . MET A 1 60  ? 3.783   1.418   17.735 1.00 0.00 ? 60  MET A HB3  3  
ATOM 4515  H HG2  . MET A 1 60  ? 3.156   3.395   15.486 1.00 0.00 ? 60  MET A HG2  3  
ATOM 4516  H HG3  . MET A 1 60  ? 2.194   3.168   16.933 1.00 0.00 ? 60  MET A HG3  3  
ATOM 4517  H HE1  . MET A 1 60  ? 4.440   5.166   15.218 1.00 0.00 ? 60  MET A HE1  3  
ATOM 4518  H HE2  . MET A 1 60  ? 5.564   5.953   16.353 1.00 0.00 ? 60  MET A HE2  3  
ATOM 4519  H HE3  . MET A 1 60  ? 5.928   4.329   15.721 1.00 0.00 ? 60  MET A HE3  3  
ATOM 4520  N N    . ARG A 1 61  ? 6.551   0.451   17.695 1.00 0.00 ? 61  ARG A N    3  
ATOM 4521  C CA   . ARG A 1 61  ? 7.244   -0.682  18.285 1.00 0.00 ? 61  ARG A CA   3  
ATOM 4522  C C    . ARG A 1 61  ? 6.855   -0.834  19.757 1.00 0.00 ? 61  ARG A C    3  
ATOM 4523  O O    . ARG A 1 61  ? 6.676   0.159   20.461 1.00 0.00 ? 61  ARG A O    3  
ATOM 4524  C CB   . ARG A 1 61  ? 8.761   -0.516  18.180 1.00 0.00 ? 61  ARG A CB   3  
ATOM 4525  C CG   . ARG A 1 61  ? 9.202   -0.426  16.718 1.00 0.00 ? 61  ARG A CG   3  
ATOM 4526  C CD   . ARG A 1 61  ? 10.719  -0.249  16.612 1.00 0.00 ? 61  ARG A CD   3  
ATOM 4527  N NE   . ARG A 1 61  ? 11.228  -0.954  15.415 1.00 0.00 ? 61  ARG A NE   3  
ATOM 4528  C CZ   . ARG A 1 61  ? 12.497  -0.889  14.989 1.00 0.00 ? 61  ARG A CZ   3  
ATOM 4529  N NH1  . ARG A 1 61  ? 13.393  -0.153  15.660 1.00 0.00 ? 61  ARG A NH1  3  
ATOM 4530  N NH2  . ARG A 1 61  ? 12.870  -1.562  13.891 1.00 0.00 ? 61  ARG A NH2  3  
ATOM 4531  H H    . ARG A 1 61  ? 6.661   1.315   18.186 1.00 0.00 ? 61  ARG A H    3  
ATOM 4532  H HA   . ARG A 1 61  ? 6.917   -1.543  17.702 1.00 0.00 ? 61  ARG A HA   3  
ATOM 4533  H HB2  . ARG A 1 61  ? 9.070   0.384   18.712 1.00 0.00 ? 61  ARG A HB2  3  
ATOM 4534  H HB3  . ARG A 1 61  ? 9.257   -1.358  18.662 1.00 0.00 ? 61  ARG A HB3  3  
ATOM 4535  H HG2  . ARG A 1 61  ? 8.900   -1.329  16.187 1.00 0.00 ? 61  ARG A HG2  3  
ATOM 4536  H HG3  . ARG A 1 61  ? 8.701   0.411   16.233 1.00 0.00 ? 61  ARG A HG3  3  
ATOM 4537  H HD2  . ARG A 1 61  ? 10.966  0.810   16.554 1.00 0.00 ? 61  ARG A HD2  3  
ATOM 4538  H HD3  . ARG A 1 61  ? 11.202  -0.641  17.508 1.00 0.00 ? 61  ARG A HD3  3  
ATOM 4539  H HE   . ARG A 1 61  ? 10.586  -1.513  14.890 1.00 0.00 ? 61  ARG A HE   3  
ATOM 4540  H HH11 . ARG A 1 61  ? 13.114  0.349   16.479 1.00 0.00 ? 61  ARG A HH11 3  
ATOM 4541  H HH12 . ARG A 1 61  ? 14.340  -0.105  15.342 1.00 0.00 ? 61  ARG A HH12 3  
ATOM 4542  H HH21 . ARG A 1 61  ? 12.202  -2.112  13.390 1.00 0.00 ? 61  ARG A HH21 3  
ATOM 4543  H HH22 . ARG A 1 61  ? 13.817  -1.514  13.573 1.00 0.00 ? 61  ARG A HH22 3  
ATOM 4544  N N    . ASP A 1 62  ? 6.737   -2.084  20.179 1.00 0.00 ? 62  ASP A N    3  
ATOM 4545  C CA   . ASP A 1 62  ? 6.373   -2.379  21.555 1.00 0.00 ? 62  ASP A CA   3  
ATOM 4546  C C    . ASP A 1 62  ? 7.266   -1.571  22.498 1.00 0.00 ? 62  ASP A C    3  
ATOM 4547  O O    . ASP A 1 62  ? 8.490   -1.594  22.373 1.00 0.00 ? 62  ASP A O    3  
ATOM 4548  C CB   . ASP A 1 62  ? 6.572   -3.863  21.871 1.00 0.00 ? 62  ASP A CB   3  
ATOM 4549  C CG   . ASP A 1 62  ? 5.610   -4.436  22.913 1.00 0.00 ? 62  ASP A CG   3  
ATOM 4550  O OD1  . ASP A 1 62  ? 5.698   -3.986  24.076 1.00 0.00 ? 62  ASP A OD1  3  
ATOM 4551  O OD2  . ASP A 1 62  ? 4.807   -5.312  22.523 1.00 0.00 ? 62  ASP A OD2  3  
ATOM 4552  H H    . ASP A 1 62  ? 6.885   -2.886  19.600 1.00 0.00 ? 62  ASP A H    3  
ATOM 4553  H HA   . ASP A 1 62  ? 5.322   -2.104  21.638 1.00 0.00 ? 62  ASP A HA   3  
ATOM 4554  H HB2  . ASP A 1 62  ? 6.467   -4.433  20.949 1.00 0.00 ? 62  ASP A HB2  3  
ATOM 4555  H HB3  . ASP A 1 62  ? 7.594   -4.010  22.222 1.00 0.00 ? 62  ASP A HB3  3  
ATOM 4556  N N    . PRO A 1 63  ? 6.603   -0.856  23.446 1.00 0.00 ? 63  PRO A N    3  
ATOM 4557  C CA   . PRO A 1 63  ? 7.323   -0.042  24.410 1.00 0.00 ? 63  PRO A CA   3  
ATOM 4558  C C    . PRO A 1 63  ? 7.983   -0.914  25.480 1.00 0.00 ? 63  PRO A C    3  
ATOM 4559  O O    . PRO A 1 63  ? 8.834   -0.442  26.232 1.00 0.00 ? 63  PRO A O    3  
ATOM 4560  C CB   . PRO A 1 63  ? 6.282   0.909   24.978 1.00 0.00 ? 63  PRO A CB   3  
ATOM 4561  C CG   . PRO A 1 63  ? 4.932   0.289   24.657 1.00 0.00 ? 63  PRO A CG   3  
ATOM 4562  C CD   . PRO A 1 63  ? 5.155   -0.804  23.624 1.00 0.00 ? 63  PRO A CD   3  
ATOM 4563  H HA   . PRO A 1 63  ? 8.068   0.450   23.961 1.00 0.00 ? 63  PRO A HA   3  
ATOM 4564  H HB2  . PRO A 1 63  ? 6.409   1.032   26.053 1.00 0.00 ? 63  PRO A HB2  3  
ATOM 4565  H HB3  . PRO A 1 63  ? 6.373   1.900   24.531 1.00 0.00 ? 63  PRO A HB3  3  
ATOM 4566  H HG2  . PRO A 1 63  ? 4.477   -0.124  25.557 1.00 0.00 ? 63  PRO A HG2  3  
ATOM 4567  H HG3  . PRO A 1 63  ? 4.247   1.044   24.271 1.00 0.00 ? 63  PRO A HG3  3  
ATOM 4568  H HD2  . PRO A 1 63  ? 4.764   -1.761  23.970 1.00 0.00 ? 63  PRO A HD2  3  
ATOM 4569  H HD3  . PRO A 1 63  ? 4.648   -0.573  22.687 1.00 0.00 ? 63  PRO A HD3  3  
ATOM 4570  N N    . ALA A 1 64  ? 7.564   -2.170  25.515 1.00 0.00 ? 64  ALA A N    3  
ATOM 4571  C CA   . ALA A 1 64  ? 8.103   -3.113  26.480 1.00 0.00 ? 64  ALA A CA   3  
ATOM 4572  C C    . ALA A 1 64  ? 9.064   -4.069  25.771 1.00 0.00 ? 64  ALA A C    3  
ATOM 4573  O O    . ALA A 1 64  ? 10.117  -4.409  26.309 1.00 0.00 ? 64  ALA A O    3  
ATOM 4574  C CB   . ALA A 1 64  ? 6.955   -3.848  27.173 1.00 0.00 ? 64  ALA A CB   3  
ATOM 4575  H H    . ALA A 1 64  ? 6.871   -2.546  24.899 1.00 0.00 ? 64  ALA A H    3  
ATOM 4576  H HA   . ALA A 1 64  ? 8.656   -2.543  27.227 1.00 0.00 ? 64  ALA A HA   3  
ATOM 4577  H HB1  . ALA A 1 64  ? 6.393   -4.421  26.435 1.00 0.00 ? 64  ALA A HB1  3  
ATOM 4578  H HB2  . ALA A 1 64  ? 7.358   -4.524  27.927 1.00 0.00 ? 64  ALA A HB2  3  
ATOM 4579  H HB3  . ALA A 1 64  ? 6.294   -3.124  27.650 1.00 0.00 ? 64  ALA A HB3  3  
ATOM 4580  N N    . SER A 1 65  ? 8.668   -4.476  24.574 1.00 0.00 ? 65  SER A N    3  
ATOM 4581  C CA   . SER A 1 65  ? 9.481   -5.386  23.786 1.00 0.00 ? 65  SER A CA   3  
ATOM 4582  C C    . SER A 1 65  ? 10.562  -4.606  23.035 1.00 0.00 ? 65  SER A C    3  
ATOM 4583  O O    . SER A 1 65  ? 11.673  -5.101  22.849 1.00 0.00 ? 65  SER A O    3  
ATOM 4584  C CB   . SER A 1 65  ? 8.620   -6.181  22.801 1.00 0.00 ? 65  SER A CB   3  
ATOM 4585  O OG   . SER A 1 65  ? 8.775   -7.587  22.972 1.00 0.00 ? 65  SER A OG   3  
ATOM 4586  H H    . SER A 1 65  ? 7.810   -4.195  24.144 1.00 0.00 ? 65  SER A H    3  
ATOM 4587  H HA   . SER A 1 65  ? 9.931   -6.068  24.506 1.00 0.00 ? 65  SER A HA   3  
ATOM 4588  H HB2  . SER A 1 65  ? 7.572   -5.913  22.937 1.00 0.00 ? 65  SER A HB2  3  
ATOM 4589  H HB3  . SER A 1 65  ? 8.890   -5.908  21.781 1.00 0.00 ? 65  SER A HB3  3  
ATOM 4590  H HG   . SER A 1 65  ? 9.537   -7.775  23.591 1.00 0.00 ? 65  SER A HG   3  
ATOM 4591  N N    . LYS A 1 66  ? 10.199  -3.400  22.625 1.00 0.00 ? 66  LYS A N    3  
ATOM 4592  C CA   . LYS A 1 66  ? 11.125  -2.546  21.899 1.00 0.00 ? 66  LYS A CA   3  
ATOM 4593  C C    . LYS A 1 66  ? 11.534  -3.237  20.597 1.00 0.00 ? 66  LYS A C    3  
ATOM 4594  O O    . LYS A 1 66  ? 12.696  -3.182  20.199 1.00 0.00 ? 66  LYS A O    3  
ATOM 4595  C CB   . LYS A 1 66  ? 12.308  -2.161  22.789 1.00 0.00 ? 66  LYS A CB   3  
ATOM 4596  C CG   . LYS A 1 66  ? 12.490  -0.642  22.833 1.00 0.00 ? 66  LYS A CG   3  
ATOM 4597  C CD   . LYS A 1 66  ? 12.001  -0.070  24.165 1.00 0.00 ? 66  LYS A CD   3  
ATOM 4598  C CE   . LYS A 1 66  ? 13.160  0.534   24.961 1.00 0.00 ? 66  LYS A CE   3  
ATOM 4599  N NZ   . LYS A 1 66  ? 13.048  2.010   24.998 1.00 0.00 ? 66  LYS A NZ   3  
ATOM 4600  H H    . LYS A 1 66  ? 9.294   -3.005  22.781 1.00 0.00 ? 66  LYS A H    3  
ATOM 4601  H HA   . LYS A 1 66  ? 10.595  -1.626  21.651 1.00 0.00 ? 66  LYS A HA   3  
ATOM 4602  H HB2  . LYS A 1 66  ? 12.149  -2.541  23.798 1.00 0.00 ? 66  LYS A HB2  3  
ATOM 4603  H HB3  . LYS A 1 66  ? 13.218  -2.629  22.413 1.00 0.00 ? 66  LYS A HB3  3  
ATOM 4604  H HG2  . LYS A 1 66  ? 13.541  -0.394  22.690 1.00 0.00 ? 66  LYS A HG2  3  
ATOM 4605  H HG3  . LYS A 1 66  ? 11.939  -0.183  22.012 1.00 0.00 ? 66  LYS A HG3  3  
ATOM 4606  H HD2  . LYS A 1 66  ? 11.244  0.692   23.982 1.00 0.00 ? 66  LYS A HD2  3  
ATOM 4607  H HD3  . LYS A 1 66  ? 11.525  -0.857  24.751 1.00 0.00 ? 66  LYS A HD3  3  
ATOM 4608  H HE2  . LYS A 1 66  ? 13.158  0.137   25.976 1.00 0.00 ? 66  LYS A HE2  3  
ATOM 4609  H HE3  . LYS A 1 66  ? 14.108  0.247   24.507 1.00 0.00 ? 66  LYS A HE3  3  
ATOM 4610  H HZ1  . LYS A 1 66  ? 12.366  2.310   24.331 1.00 0.00 ? 66  LYS A HZ1  3  
ATOM 4611  H HZ2  . LYS A 1 66  ? 12.769  2.299   25.914 1.00 0.00 ? 66  LYS A HZ2  3  
ATOM 4612  H HZ3  . LYS A 1 66  ? 13.934  2.417   24.776 1.00 0.00 ? 66  LYS A HZ3  3  
ATOM 4613  N N    . ARG A 1 67  ? 10.555  -3.871  19.968 1.00 0.00 ? 67  ARG A N    3  
ATOM 4614  C CA   . ARG A 1 67  ? 10.798  -4.571  18.718 1.00 0.00 ? 67  ARG A CA   3  
ATOM 4615  C C    . ARG A 1 67  ? 9.839   -4.073  17.635 1.00 0.00 ? 67  ARG A C    3  
ATOM 4616  O O    . ARG A 1 67  ? 10.240  -3.330  16.741 1.00 0.00 ? 67  ARG A O    3  
ATOM 4617  C CB   . ARG A 1 67  ? 10.623  -6.082  18.890 1.00 0.00 ? 67  ARG A CB   3  
ATOM 4618  C CG   . ARG A 1 67  ? 11.646  -6.643  19.880 1.00 0.00 ? 67  ARG A CG   3  
ATOM 4619  C CD   . ARG A 1 67  ? 12.640  -7.568  19.175 1.00 0.00 ? 67  ARG A CD   3  
ATOM 4620  N NE   . ARG A 1 67  ? 13.862  -7.718  19.997 1.00 0.00 ? 67  ARG A NE   3  
ATOM 4621  C CZ   . ARG A 1 67  ? 14.942  -8.414  19.616 1.00 0.00 ? 67  ARG A CZ   3  
ATOM 4622  N NH1  . ARG A 1 67  ? 14.959  -9.027  18.425 1.00 0.00 ? 67  ARG A NH1  3  
ATOM 4623  N NH2  . ARG A 1 67  ? 16.006  -8.496  20.427 1.00 0.00 ? 67  ARG A NH2  3  
ATOM 4624  H H    . ARG A 1 67  ? 9.612   -3.911  20.298 1.00 0.00 ? 67  ARG A H    3  
ATOM 4625  H HA   . ARG A 1 67  ? 11.832  -4.337  18.465 1.00 0.00 ? 67  ARG A HA   3  
ATOM 4626  H HB2  . ARG A 1 67  ? 9.614   -6.296  19.243 1.00 0.00 ? 67  ARG A HB2  3  
ATOM 4627  H HB3  . ARG A 1 67  ? 10.735  -6.576  17.925 1.00 0.00 ? 67  ARG A HB3  3  
ATOM 4628  H HG2  . ARG A 1 67  ? 12.182  -5.824  20.358 1.00 0.00 ? 67  ARG A HG2  3  
ATOM 4629  H HG3  . ARG A 1 67  ? 11.130  -7.191  20.669 1.00 0.00 ? 67  ARG A HG3  3  
ATOM 4630  H HD2  . ARG A 1 67  ? 12.184  -8.544  19.005 1.00 0.00 ? 67  ARG A HD2  3  
ATOM 4631  H HD3  . ARG A 1 67  ? 12.897  -7.162  18.197 1.00 0.00 ? 67  ARG A HD3  3  
ATOM 4632  H HE   . ARG A 1 67  ? 13.882  -7.273  20.892 1.00 0.00 ? 67  ARG A HE   3  
ATOM 4633  H HH11 . ARG A 1 67  ? 14.165  -8.966  17.820 1.00 0.00 ? 67  ARG A HH11 3  
ATOM 4634  H HH12 . ARG A 1 67  ? 15.765  -9.546  18.142 1.00 0.00 ? 67  ARG A HH12 3  
ATOM 4635  H HH21 . ARG A 1 67  ? 15.993  -8.038  21.316 1.00 0.00 ? 67  ARG A HH21 3  
ATOM 4636  H HH22 . ARG A 1 67  ? 16.812  -9.015  20.144 1.00 0.00 ? 67  ARG A HH22 3  
ATOM 4637  N N    . SER A 1 68  ? 8.592   -4.504  17.751 1.00 0.00 ? 68  SER A N    3  
ATOM 4638  C CA   . SER A 1 68  ? 7.572   -4.111  16.793 1.00 0.00 ? 68  SER A CA   3  
ATOM 4639  C C    . SER A 1 68  ? 6.182   -4.413  17.354 1.00 0.00 ? 68  SER A C    3  
ATOM 4640  O O    . SER A 1 68  ? 5.939   -5.505  17.867 1.00 0.00 ? 68  SER A O    3  
ATOM 4641  C CB   . SER A 1 68  ? 7.771   -4.824  15.454 1.00 0.00 ? 68  SER A CB   3  
ATOM 4642  O OG   . SER A 1 68  ? 6.696   -4.576  14.552 1.00 0.00 ? 68  SER A OG   3  
ATOM 4643  H H    . SER A 1 68  ? 8.274   -5.108  18.481 1.00 0.00 ? 68  SER A H    3  
ATOM 4644  H HA   . SER A 1 68  ? 7.704   -3.038  16.655 1.00 0.00 ? 68  SER A HA   3  
ATOM 4645  H HB2  . SER A 1 68  ? 8.707   -4.494  15.003 1.00 0.00 ? 68  SER A HB2  3  
ATOM 4646  H HB3  . SER A 1 68  ? 7.861   -5.897  15.625 1.00 0.00 ? 68  SER A HB3  3  
ATOM 4647  H HG   . SER A 1 68  ? 6.049   -3.932  14.960 1.00 0.00 ? 68  SER A HG   3  
ATOM 4648  N N    . ARG A 1 69  ? 5.304   -3.427  17.239 1.00 0.00 ? 69  ARG A N    3  
ATOM 4649  C CA   . ARG A 1 69  ? 3.944   -3.574  17.728 1.00 0.00 ? 69  ARG A CA   3  
ATOM 4650  C C    . ARG A 1 69  ? 3.104   -4.372  16.729 1.00 0.00 ? 69  ARG A C    3  
ATOM 4651  O O    . ARG A 1 69  ? 2.343   -5.256  17.120 1.00 0.00 ? 69  ARG A O    3  
ATOM 4652  C CB   . ARG A 1 69  ? 3.291   -2.210  17.959 1.00 0.00 ? 69  ARG A CB   3  
ATOM 4653  C CG   . ARG A 1 69  ? 3.357   -1.813  19.435 1.00 0.00 ? 69  ARG A CG   3  
ATOM 4654  C CD   . ARG A 1 69  ? 1.954   -1.707  20.037 1.00 0.00 ? 69  ARG A CD   3  
ATOM 4655  N NE   . ARG A 1 69  ? 1.821   -0.441  20.791 1.00 0.00 ? 69  ARG A NE   3  
ATOM 4656  C CZ   . ARG A 1 69  ? 0.750   -0.113  21.526 1.00 0.00 ? 69  ARG A CZ   3  
ATOM 4657  N NH1  . ARG A 1 69  ? -0.288  -0.956  21.610 1.00 0.00 ? 69  ARG A NH1  3  
ATOM 4658  N NH2  . ARG A 1 69  ? 0.716   1.058   22.176 1.00 0.00 ? 69  ARG A NH2  3  
ATOM 4659  H H    . ARG A 1 69  ? 5.510   -2.542  16.820 1.00 0.00 ? 69  ARG A H    3  
ATOM 4660  H HA   . ARG A 1 69  ? 4.045   -4.110  18.673 1.00 0.00 ? 69  ARG A HA   3  
ATOM 4661  H HB2  . ARG A 1 69  ? 3.793   -1.455  17.353 1.00 0.00 ? 69  ARG A HB2  3  
ATOM 4662  H HB3  . ARG A 1 69  ? 2.252   -2.240  17.633 1.00 0.00 ? 69  ARG A HB3  3  
ATOM 4663  H HG2  . ARG A 1 69  ? 3.940   -2.550  19.988 1.00 0.00 ? 69  ARG A HG2  3  
ATOM 4664  H HG3  . ARG A 1 69  ? 3.873   -0.858  19.536 1.00 0.00 ? 69  ARG A HG3  3  
ATOM 4665  H HD2  . ARG A 1 69  ? 1.206   -1.750  19.246 1.00 0.00 ? 69  ARG A HD2  3  
ATOM 4666  H HD3  . ARG A 1 69  ? 1.768   -2.554  20.698 1.00 0.00 ? 69  ARG A HD3  3  
ATOM 4667  H HE   . ARG A 1 69  ? 2.578   0.212   20.749 1.00 0.00 ? 69  ARG A HE   3  
ATOM 4668  H HH11 . ARG A 1 69  ? -0.263  -1.830  21.125 1.00 0.00 ? 69  ARG A HH11 3  
ATOM 4669  H HH12 . ARG A 1 69  ? -1.088  -0.711  22.159 1.00 0.00 ? 69  ARG A HH12 3  
ATOM 4670  H HH21 . ARG A 1 69  ? 1.491   1.688   22.113 1.00 0.00 ? 69  ARG A HH21 3  
ATOM 4671  H HH22 . ARG A 1 69  ? -0.083  1.303   22.725 1.00 0.00 ? 69  ARG A HH22 3  
ATOM 4672  N N    . GLY A 1 70  ? 3.270   -4.031  15.460 1.00 0.00 ? 70  GLY A N    3  
ATOM 4673  C CA   . GLY A 1 70  ? 2.536   -4.705  14.402 1.00 0.00 ? 70  GLY A CA   3  
ATOM 4674  C C    . GLY A 1 70  ? 1.557   -3.747  13.718 1.00 0.00 ? 70  GLY A C    3  
ATOM 4675  O O    . GLY A 1 70  ? 0.614   -4.184  13.061 1.00 0.00 ? 70  GLY A O    3  
ATOM 4676  H H    . GLY A 1 70  ? 3.891   -3.311  15.151 1.00 0.00 ? 70  GLY A H    3  
ATOM 4677  H HA2  . GLY A 1 70  ? 3.235   -5.103  13.667 1.00 0.00 ? 70  GLY A HA2  3  
ATOM 4678  H HA3  . GLY A 1 70  ? 1.991   -5.553  14.816 1.00 0.00 ? 70  GLY A HA3  3  
ATOM 4679  N N    . PHE A 1 71  ? 1.816   -2.460  13.897 1.00 0.00 ? 71  PHE A N    3  
ATOM 4680  C CA   . PHE A 1 71  ? 0.971   -1.438  13.305 1.00 0.00 ? 71  PHE A CA   3  
ATOM 4681  C C    . PHE A 1 71  ? 1.722   -0.111  13.176 1.00 0.00 ? 71  PHE A C    3  
ATOM 4682  O O    . PHE A 1 71  ? 2.582   0.202   13.998 1.00 0.00 ? 71  PHE A O    3  
ATOM 4683  C CB   . PHE A 1 71  ? -0.222  -1.245  14.244 1.00 0.00 ? 71  PHE A CB   3  
ATOM 4684  C CG   . PHE A 1 71  ? 0.015   -0.212  15.347 1.00 0.00 ? 71  PHE A CG   3  
ATOM 4685  C CD1  . PHE A 1 71  ? 0.103   1.109   15.035 1.00 0.00 ? 71  PHE A CD1  3  
ATOM 4686  C CD2  . PHE A 1 71  ? 0.138   -0.614  16.641 1.00 0.00 ? 71  PHE A CD2  3  
ATOM 4687  C CE1  . PHE A 1 71  ? 0.323   2.067   16.059 1.00 0.00 ? 71  PHE A CE1  3  
ATOM 4688  C CE2  . PHE A 1 71  ? 0.359   0.345   17.665 1.00 0.00 ? 71  PHE A CE2  3  
ATOM 4689  C CZ   . PHE A 1 71  ? 0.447   1.665   17.352 1.00 0.00 ? 71  PHE A CZ   3  
ATOM 4690  H H    . PHE A 1 71  ? 2.586   -2.114  14.433 1.00 0.00 ? 71  PHE A H    3  
ATOM 4691  H HA   . PHE A 1 71  ? 0.684   -1.789  12.314 1.00 0.00 ? 71  PHE A HA   3  
ATOM 4692  H HB2  . PHE A 1 71  ? -1.089  -0.942  13.657 1.00 0.00 ? 71  PHE A HB2  3  
ATOM 4693  H HB3  . PHE A 1 71  ? -0.467  -2.203  14.704 1.00 0.00 ? 71  PHE A HB3  3  
ATOM 4694  H HD1  . PHE A 1 71  ? 0.005   1.431   13.998 1.00 0.00 ? 71  PHE A HD1  3  
ATOM 4695  H HD2  . PHE A 1 71  ? 0.068   -1.673  16.891 1.00 0.00 ? 71  PHE A HD2  3  
ATOM 4696  H HE1  . PHE A 1 71  ? 0.394   3.126   15.808 1.00 0.00 ? 71  PHE A HE1  3  
ATOM 4697  H HE2  . PHE A 1 71  ? 0.457   0.022   18.701 1.00 0.00 ? 71  PHE A HE2  3  
ATOM 4698  H HZ   . PHE A 1 71  ? 0.616   2.401   18.138 1.00 0.00 ? 71  PHE A HZ   3  
ATOM 4699  N N    . GLY A 1 72  ? 1.371   0.633   12.138 1.00 0.00 ? 72  GLY A N    3  
ATOM 4700  C CA   . GLY A 1 72  ? 2.002   1.918   11.891 1.00 0.00 ? 72  GLY A CA   3  
ATOM 4701  C C    . GLY A 1 72  ? 1.086   2.830   11.071 1.00 0.00 ? 72  GLY A C    3  
ATOM 4702  O O    . GLY A 1 72  ? -0.127  2.629   11.038 1.00 0.00 ? 72  GLY A O    3  
ATOM 4703  H H    . GLY A 1 72  ? 0.671   0.371   11.473 1.00 0.00 ? 72  GLY A H    3  
ATOM 4704  H HA2  . GLY A 1 72  ? 2.243   2.397   12.839 1.00 0.00 ? 72  GLY A HA2  3  
ATOM 4705  H HA3  . GLY A 1 72  ? 2.942   1.770   11.360 1.00 0.00 ? 72  GLY A HA3  3  
ATOM 4706  N N    . PHE A 1 73  ? 1.702   3.812   10.430 1.00 0.00 ? 73  PHE A N    3  
ATOM 4707  C CA   . PHE A 1 73  ? 0.957   4.755   9.613  1.00 0.00 ? 73  PHE A CA   3  
ATOM 4708  C C    . PHE A 1 73  ? 1.611   4.926   8.240  1.00 0.00 ? 73  PHE A C    3  
ATOM 4709  O O    . PHE A 1 73  ? 2.834   4.884   8.121  1.00 0.00 ? 73  PHE A O    3  
ATOM 4710  C CB   . PHE A 1 73  ? 0.980   6.097   10.346 1.00 0.00 ? 73  PHE A CB   3  
ATOM 4711  C CG   . PHE A 1 73  ? 0.760   5.985   11.856 1.00 0.00 ? 73  PHE A CG   3  
ATOM 4712  C CD1  . PHE A 1 73  ? 1.788   5.622   12.668 1.00 0.00 ? 73  PHE A CD1  3  
ATOM 4713  C CD2  . PHE A 1 73  ? -0.465  6.249   12.386 1.00 0.00 ? 73  PHE A CD2  3  
ATOM 4714  C CE1  . PHE A 1 73  ? 1.584   5.518   14.070 1.00 0.00 ? 73  PHE A CE1  3  
ATOM 4715  C CE2  . PHE A 1 73  ? -0.669  6.144   13.788 1.00 0.00 ? 73  PHE A CE2  3  
ATOM 4716  C CZ   . PHE A 1 73  ? 0.360   5.781   14.600 1.00 0.00 ? 73  PHE A CZ   3  
ATOM 4717  H H    . PHE A 1 73  ? 2.689   3.968   10.462 1.00 0.00 ? 73  PHE A H    3  
ATOM 4718  H HA   . PHE A 1 73  ? -0.047  4.351   9.487  1.00 0.00 ? 73  PHE A HA   3  
ATOM 4719  H HB2  . PHE A 1 73  ? 1.938   6.583   10.164 1.00 0.00 ? 73  PHE A HB2  3  
ATOM 4720  H HB3  . PHE A 1 73  ? 0.210   6.743   9.924  1.00 0.00 ? 73  PHE A HB3  3  
ATOM 4721  H HD1  . PHE A 1 73  ? 2.770   5.411   12.243 1.00 0.00 ? 73  PHE A HD1  3  
ATOM 4722  H HD2  . PHE A 1 73  ? -1.289  6.539   11.735 1.00 0.00 ? 73  PHE A HD2  3  
ATOM 4723  H HE1  . PHE A 1 73  ? 2.408   5.227   14.720 1.00 0.00 ? 73  PHE A HE1  3  
ATOM 4724  H HE2  . PHE A 1 73  ? -1.651  6.356   14.212 1.00 0.00 ? 73  PHE A HE2  3  
ATOM 4725  H HZ   . PHE A 1 73  ? 0.203   5.701   15.675 1.00 0.00 ? 73  PHE A HZ   3  
ATOM 4726  N N    . VAL A 1 74  ? 0.765   5.116   7.237  1.00 0.00 ? 74  VAL A N    3  
ATOM 4727  C CA   . VAL A 1 74  ? 1.245   5.294   5.877  1.00 0.00 ? 74  VAL A CA   3  
ATOM 4728  C C    . VAL A 1 74  ? 0.566   6.516   5.257  1.00 0.00 ? 74  VAL A C    3  
ATOM 4729  O O    . VAL A 1 74  ? -0.638  6.501   5.007  1.00 0.00 ? 74  VAL A O    3  
ATOM 4730  C CB   . VAL A 1 74  ? 1.021   4.012   5.072  1.00 0.00 ? 74  VAL A CB   3  
ATOM 4731  C CG1  . VAL A 1 74  ? 1.935   2.888   5.565  1.00 0.00 ? 74  VAL A CG1  3  
ATOM 4732  C CG2  . VAL A 1 74  ? -0.447  3.586   5.117  1.00 0.00 ? 74  VAL A CG2  3  
ATOM 4733  H H    . VAL A 1 74  ? -0.228  5.149   7.342  1.00 0.00 ? 74  VAL A H    3  
ATOM 4734  H HA   . VAL A 1 74  ? 2.318   5.477   5.929  1.00 0.00 ? 74  VAL A HA   3  
ATOM 4735  H HB   . VAL A 1 74  ? 1.278   4.221   4.033  1.00 0.00 ? 74  VAL A HB   3  
ATOM 4736  H HG11 . VAL A 1 74  ? 1.476   2.398   6.424  1.00 0.00 ? 74  VAL A HG11 3  
ATOM 4737  H HG12 . VAL A 1 74  ? 2.079   2.161   4.766  1.00 0.00 ? 74  VAL A HG12 3  
ATOM 4738  H HG13 . VAL A 1 74  ? 2.899   3.304   5.856  1.00 0.00 ? 74  VAL A HG13 3  
ATOM 4739  H HG21 . VAL A 1 74  ? -0.785  3.339   4.110  1.00 0.00 ? 74  VAL A HG21 3  
ATOM 4740  H HG22 . VAL A 1 74  ? -0.552  2.711   5.760  1.00 0.00 ? 74  VAL A HG22 3  
ATOM 4741  H HG23 . VAL A 1 74  ? -1.051  4.402   5.513  1.00 0.00 ? 74  VAL A HG23 3  
ATOM 4742  N N    . THR A 1 75  ? 1.367   7.546   5.027  1.00 0.00 ? 75  THR A N    3  
ATOM 4743  C CA   . THR A 1 75  ? 0.858   8.774   4.441  1.00 0.00 ? 75  THR A CA   3  
ATOM 4744  C C    . THR A 1 75  ? 1.191   8.830   2.948  1.00 0.00 ? 75  THR A C    3  
ATOM 4745  O O    . THR A 1 75  ? 2.355   8.957   2.573  1.00 0.00 ? 75  THR A O    3  
ATOM 4746  C CB   . THR A 1 75  ? 1.430   9.949   5.236  1.00 0.00 ? 75  THR A CB   3  
ATOM 4747  O OG1  . THR A 1 75  ? 1.352   9.522   6.593  1.00 0.00 ? 75  THR A OG1  3  
ATOM 4748  C CG2  . THR A 1 75  ? 0.531   11.186  5.182  1.00 0.00 ? 75  THR A CG2  3  
ATOM 4749  H H    . THR A 1 75  ? 2.346   7.550   5.234  1.00 0.00 ? 75  THR A H    3  
ATOM 4750  H HA   . THR A 1 75  ? -0.228  8.771   4.526  1.00 0.00 ? 75  THR A HA   3  
ATOM 4751  H HB   . THR A 1 75  ? 2.441   10.188  4.904  1.00 0.00 ? 75  THR A HB   3  
ATOM 4752  H HG1  . THR A 1 75  ? 2.086   8.873   6.790  1.00 0.00 ? 75  THR A HG1  3  
ATOM 4753  H HG21 . THR A 1 75  ? -0.492  10.902  5.429  1.00 0.00 ? 75  THR A HG21 3  
ATOM 4754  H HG22 . THR A 1 75  ? 0.886   11.925  5.899  1.00 0.00 ? 75  THR A HG22 3  
ATOM 4755  H HG23 . THR A 1 75  ? 0.557   11.611  4.178  1.00 0.00 ? 75  THR A HG23 3  
ATOM 4756  N N    . PHE A 1 76  ? 0.147   8.733   2.138  1.00 0.00 ? 76  PHE A N    3  
ATOM 4757  C CA   . PHE A 1 76  ? 0.313   8.771   0.695  1.00 0.00 ? 76  PHE A CA   3  
ATOM 4758  C C    . PHE A 1 76  ? 0.539   10.204  0.207  1.00 0.00 ? 76  PHE A C    3  
ATOM 4759  O O    . PHE A 1 76  ? 0.383   11.155  0.971  1.00 0.00 ? 76  PHE A O    3  
ATOM 4760  C CB   . PHE A 1 76  ? -0.981  8.234   0.081  1.00 0.00 ? 76  PHE A CB   3  
ATOM 4761  C CG   . PHE A 1 76  ? -1.071  6.707   0.058  1.00 0.00 ? 76  PHE A CG   3  
ATOM 4762  C CD1  . PHE A 1 76  ? -0.446  6.004   -0.925 1.00 0.00 ? 76  PHE A CD1  3  
ATOM 4763  C CD2  . PHE A 1 76  ? -1.777  6.053   1.018  1.00 0.00 ? 76  PHE A CD2  3  
ATOM 4764  C CE1  . PHE A 1 76  ? -0.530  4.587   -0.947 1.00 0.00 ? 76  PHE A CE1  3  
ATOM 4765  C CE2  . PHE A 1 76  ? -1.861  4.635   0.996  1.00 0.00 ? 76  PHE A CE2  3  
ATOM 4766  C CZ   . PHE A 1 76  ? -1.236  3.932   0.014  1.00 0.00 ? 76  PHE A CZ   3  
ATOM 4767  H H    . PHE A 1 76  ? -0.797  8.630   2.452  1.00 0.00 ? 76  PHE A H    3  
ATOM 4768  H HA   . PHE A 1 76  ? 1.187   8.165   0.454  1.00 0.00 ? 76  PHE A HA   3  
ATOM 4769  H HB2  . PHE A 1 76  ? -1.828  8.629   0.642  1.00 0.00 ? 76  PHE A HB2  3  
ATOM 4770  H HB3  . PHE A 1 76  ? -1.070  8.609   -0.938 1.00 0.00 ? 76  PHE A HB3  3  
ATOM 4771  H HD1  . PHE A 1 76  ? 0.119   6.528   -1.695 1.00 0.00 ? 76  PHE A HD1  3  
ATOM 4772  H HD2  . PHE A 1 76  ? -2.278  6.616   1.806  1.00 0.00 ? 76  PHE A HD2  3  
ATOM 4773  H HE1  . PHE A 1 76  ? -0.030  4.023   -1.734 1.00 0.00 ? 76  PHE A HE1  3  
ATOM 4774  H HE2  . PHE A 1 76  ? -2.427  4.111   1.767  1.00 0.00 ? 76  PHE A HE2  3  
ATOM 4775  H HZ   . PHE A 1 76  ? -1.301  2.844   -0.003 1.00 0.00 ? 76  PHE A HZ   3  
ATOM 4776  N N    . SER A 1 77  ? 0.904   10.312  -1.062 1.00 0.00 ? 77  SER A N    3  
ATOM 4777  C CA   . SER A 1 77  ? 1.153   11.612  -1.661 1.00 0.00 ? 77  SER A CA   3  
ATOM 4778  C C    . SER A 1 77  ? -0.171  12.262  -2.070 1.00 0.00 ? 77  SER A C    3  
ATOM 4779  O O    . SER A 1 77  ? -0.400  13.438  -1.794 1.00 0.00 ? 77  SER A O    3  
ATOM 4780  C CB   . SER A 1 77  ? 2.082   11.492  -2.871 1.00 0.00 ? 77  SER A CB   3  
ATOM 4781  O OG   . SER A 1 77  ? 1.822   12.499  -3.845 1.00 0.00 ? 77  SER A OG   3  
ATOM 4782  H H    . SER A 1 77  ? 1.028   9.533   -1.676 1.00 0.00 ? 77  SER A H    3  
ATOM 4783  H HA   . SER A 1 77  ? 1.643   12.199  -0.884 1.00 0.00 ? 77  SER A HA   3  
ATOM 4784  H HB2  . SER A 1 77  ? 3.118   11.566  -2.540 1.00 0.00 ? 77  SER A HB2  3  
ATOM 4785  H HB3  . SER A 1 77  ? 1.961   10.509  -3.325 1.00 0.00 ? 77  SER A HB3  3  
ATOM 4786  H HG   . SER A 1 77  ? 1.789   13.398  -3.407 1.00 0.00 ? 77  SER A HG   3  
ATOM 4787  N N    . SER A 1 78  ? -1.007  11.467  -2.722 1.00 0.00 ? 78  SER A N    3  
ATOM 4788  C CA   . SER A 1 78  ? -2.301  11.950  -3.172 1.00 0.00 ? 78  SER A CA   3  
ATOM 4789  C C    . SER A 1 78  ? -3.421  11.197  -2.450 1.00 0.00 ? 78  SER A C    3  
ATOM 4790  O O    . SER A 1 78  ? -3.212  10.088  -1.961 1.00 0.00 ? 78  SER A O    3  
ATOM 4791  C CB   . SER A 1 78  ? -2.450  11.797  -4.687 1.00 0.00 ? 78  SER A CB   3  
ATOM 4792  O OG   . SER A 1 78  ? -2.600  13.055  -5.338 1.00 0.00 ? 78  SER A OG   3  
ATOM 4793  H H    . SER A 1 78  ? -0.812  10.511  -2.942 1.00 0.00 ? 78  SER A H    3  
ATOM 4794  H HA   . SER A 1 78  ? -2.321  13.008  -2.910 1.00 0.00 ? 78  SER A HA   3  
ATOM 4795  H HB2  . SER A 1 78  ? -1.575  11.283  -5.087 1.00 0.00 ? 78  SER A HB2  3  
ATOM 4796  H HB3  . SER A 1 78  ? -3.314  11.170  -4.905 1.00 0.00 ? 78  SER A HB3  3  
ATOM 4797  H HG   . SER A 1 78  ? -2.246  13.001  -6.272 1.00 0.00 ? 78  SER A HG   3  
ATOM 4798  N N    . MET A 1 79  ? -4.584  11.830  -2.406 1.00 0.00 ? 79  MET A N    3  
ATOM 4799  C CA   . MET A 1 79  ? -5.736  11.234  -1.753 1.00 0.00 ? 79  MET A CA   3  
ATOM 4800  C C    . MET A 1 79  ? -6.320  10.099  -2.597 1.00 0.00 ? 79  MET A C    3  
ATOM 4801  O O    . MET A 1 79  ? -7.087  9.279   -2.096 1.00 0.00 ? 79  MET A O    3  
ATOM 4802  C CB   . MET A 1 79  ? -6.806  12.305  -1.527 1.00 0.00 ? 79  MET A CB   3  
ATOM 4803  C CG   . MET A 1 79  ? -7.656  11.979  -0.297 1.00 0.00 ? 79  MET A CG   3  
ATOM 4804  S SD   . MET A 1 79  ? -7.426  13.233  0.953  1.00 0.00 ? 79  MET A SD   3  
ATOM 4805  C CE   . MET A 1 79  ? -7.819  12.288  2.415  1.00 0.00 ? 79  MET A CE   3  
ATOM 4806  H H    . MET A 1 79  ? -4.745  12.732  -2.807 1.00 0.00 ? 79  MET A H    3  
ATOM 4807  H HA   . MET A 1 79  ? -5.364  10.839  -0.807 1.00 0.00 ? 79  MET A HA   3  
ATOM 4808  H HB2  . MET A 1 79  ? -6.330  13.277  -1.398 1.00 0.00 ? 79  MET A HB2  3  
ATOM 4809  H HB3  . MET A 1 79  ? -7.445  12.376  -2.407 1.00 0.00 ? 79  MET A HB3  3  
ATOM 4810  H HG2  . MET A 1 79  ? -8.708  11.922  -0.577 1.00 0.00 ? 79  MET A HG2  3  
ATOM 4811  H HG3  . MET A 1 79  ? -7.378  11.003  0.100  1.00 0.00 ? 79  MET A HG3  3  
ATOM 4812  H HE1  . MET A 1 79  ? -7.297  11.332  2.382  1.00 0.00 ? 79  MET A HE1  3  
ATOM 4813  H HE2  . MET A 1 79  ? -7.507  12.842  3.301  1.00 0.00 ? 79  MET A HE2  3  
ATOM 4814  H HE3  . MET A 1 79  ? -8.894  12.113  2.456  1.00 0.00 ? 79  MET A HE3  3  
ATOM 4815  N N    . ALA A 1 80  ? -5.933  10.089  -3.865 1.00 0.00 ? 80  ALA A N    3  
ATOM 4816  C CA   . ALA A 1 80  ? -6.408  9.069   -4.783 1.00 0.00 ? 80  ALA A CA   3  
ATOM 4817  C C    . ALA A 1 80  ? -5.750  7.731   -4.438 1.00 0.00 ? 80  ALA A C    3  
ATOM 4818  O O    . ALA A 1 80  ? -6.438  6.754   -4.144 1.00 0.00 ? 80  ALA A O    3  
ATOM 4819  C CB   . ALA A 1 80  ? -6.123  9.504   -6.222 1.00 0.00 ? 80  ALA A CB   3  
ATOM 4820  H H    . ALA A 1 80  ? -5.309  10.760  -4.264 1.00 0.00 ? 80  ALA A H    3  
ATOM 4821  H HA   . ALA A 1 80  ? -7.486  8.979   -4.651 1.00 0.00 ? 80  ALA A HA   3  
ATOM 4822  H HB1  . ALA A 1 80  ? -6.482  10.523  -6.371 1.00 0.00 ? 80  ALA A HB1  3  
ATOM 4823  H HB2  . ALA A 1 80  ? -5.050  9.467   -6.407 1.00 0.00 ? 80  ALA A HB2  3  
ATOM 4824  H HB3  . ALA A 1 80  ? -6.635  8.834   -6.913 1.00 0.00 ? 80  ALA A HB3  3  
ATOM 4825  N N    . GLU A 1 81  ? -4.426  7.730   -4.484 1.00 0.00 ? 81  GLU A N    3  
ATOM 4826  C CA   . GLU A 1 81  ? -3.668  6.529   -4.180 1.00 0.00 ? 81  GLU A CA   3  
ATOM 4827  C C    . GLU A 1 81  ? -4.192  5.880   -2.897 1.00 0.00 ? 81  GLU A C    3  
ATOM 4828  O O    . GLU A 1 81  ? -4.630  4.731   -2.913 1.00 0.00 ? 81  GLU A O    3  
ATOM 4829  C CB   . GLU A 1 81  ? -2.174  6.837   -4.067 1.00 0.00 ? 81  GLU A CB   3  
ATOM 4830  C CG   . GLU A 1 81  ? -1.583  7.198   -5.432 1.00 0.00 ? 81  GLU A CG   3  
ATOM 4831  C CD   . GLU A 1 81  ? -1.241  8.688   -5.505 1.00 0.00 ? 81  GLU A CD   3  
ATOM 4832  O OE1  . GLU A 1 81  ? -0.253  9.076   -4.845 1.00 0.00 ? 81  GLU A OE1  3  
ATOM 4833  O OE2  . GLU A 1 81  ? -1.976  9.404   -6.219 1.00 0.00 ? 81  GLU A OE2  3  
ATOM 4834  H H    . GLU A 1 81  ? -3.874  8.529   -4.724 1.00 0.00 ? 81  GLU A H    3  
ATOM 4835  H HA   . GLU A 1 81  ? -3.831  5.861   -5.026 1.00 0.00 ? 81  GLU A HA   3  
ATOM 4836  H HB2  . GLU A 1 81  ? -2.021  7.662   -3.371 1.00 0.00 ? 81  GLU A HB2  3  
ATOM 4837  H HB3  . GLU A 1 81  ? -1.650  5.974   -3.657 1.00 0.00 ? 81  GLU A HB3  3  
ATOM 4838  H HG2  . GLU A 1 81  ? -0.686  6.606   -5.612 1.00 0.00 ? 81  GLU A HG2  3  
ATOM 4839  H HG3  . GLU A 1 81  ? -2.295  6.946   -6.218 1.00 0.00 ? 81  GLU A HG3  3  
ATOM 4840  N N    . VAL A 1 82  ? -4.131  6.646   -1.817 1.00 0.00 ? 82  VAL A N    3  
ATOM 4841  C CA   . VAL A 1 82  ? -4.594  6.160   -0.529 1.00 0.00 ? 82  VAL A CA   3  
ATOM 4842  C C    . VAL A 1 82  ? -5.970  5.513   -0.697 1.00 0.00 ? 82  VAL A C    3  
ATOM 4843  O O    . VAL A 1 82  ? -6.198  4.400   -0.225 1.00 0.00 ? 82  VAL A O    3  
ATOM 4844  C CB   . VAL A 1 82  ? -4.591  7.300   0.492  1.00 0.00 ? 82  VAL A CB   3  
ATOM 4845  C CG1  . VAL A 1 82  ? -5.424  8.483   -0.005 1.00 0.00 ? 82  VAL A CG1  3  
ATOM 4846  C CG2  . VAL A 1 82  ? -5.084  6.816   1.856  1.00 0.00 ? 82  VAL A CG2  3  
ATOM 4847  H H    . VAL A 1 82  ? -3.773  7.580   -1.814 1.00 0.00 ? 82  VAL A H    3  
ATOM 4848  H HA   . VAL A 1 82  ? -3.888  5.402   -0.190 1.00 0.00 ? 82  VAL A HA   3  
ATOM 4849  H HB   . VAL A 1 82  ? -3.562  7.642   0.610  1.00 0.00 ? 82  VAL A HB   3  
ATOM 4850  H HG11 . VAL A 1 82  ? -6.481  8.217   0.016  1.00 0.00 ? 82  VAL A HG11 3  
ATOM 4851  H HG12 . VAL A 1 82  ? -5.254  9.344   0.641  1.00 0.00 ? 82  VAL A HG12 3  
ATOM 4852  H HG13 . VAL A 1 82  ? -5.132  8.731   -1.025 1.00 0.00 ? 82  VAL A HG13 3  
ATOM 4853  H HG21 . VAL A 1 82  ? -5.841  6.044   1.716  1.00 0.00 ? 82  VAL A HG21 3  
ATOM 4854  H HG22 . VAL A 1 82  ? -4.247  6.405   2.421  1.00 0.00 ? 82  VAL A HG22 3  
ATOM 4855  H HG23 . VAL A 1 82  ? -5.516  7.653   2.405  1.00 0.00 ? 82  VAL A HG23 3  
ATOM 4856  N N    . ASP A 1 83  ? -6.851  6.237   -1.372 1.00 0.00 ? 83  ASP A N    3  
ATOM 4857  C CA   . ASP A 1 83  ? -8.198  5.747   -1.609 1.00 0.00 ? 83  ASP A CA   3  
ATOM 4858  C C    . ASP A 1 83  ? -8.126  4.359   -2.249 1.00 0.00 ? 83  ASP A C    3  
ATOM 4859  O O    . ASP A 1 83  ? -8.972  3.505   -1.986 1.00 0.00 ? 83  ASP A O    3  
ATOM 4860  C CB   . ASP A 1 83  ? -8.960  6.668   -2.563 1.00 0.00 ? 83  ASP A CB   3  
ATOM 4861  C CG   . ASP A 1 83  ? -10.445 6.846   -2.242 1.00 0.00 ? 83  ASP A CG   3  
ATOM 4862  O OD1  . ASP A 1 83  ? -11.195 5.871   -2.466 1.00 0.00 ? 83  ASP A OD1  3  
ATOM 4863  O OD2  . ASP A 1 83  ? -10.797 7.953   -1.780 1.00 0.00 ? 83  ASP A OD2  3  
ATOM 4864  H H    . ASP A 1 83  ? -6.657  7.141   -1.753 1.00 0.00 ? 83  ASP A H    3  
ATOM 4865  H HA   . ASP A 1 83  ? -8.673  5.729   -0.628 1.00 0.00 ? 83  ASP A HA   3  
ATOM 4866  H HB2  . ASP A 1 83  ? -8.482  7.648   -2.556 1.00 0.00 ? 83  ASP A HB2  3  
ATOM 4867  H HB3  . ASP A 1 83  ? -8.867  6.276   -3.575 1.00 0.00 ? 83  ASP A HB3  3  
ATOM 4868  N N    . ALA A 1 84  ? -7.108  4.176   -3.078 1.00 0.00 ? 84  ALA A N    3  
ATOM 4869  C CA   . ALA A 1 84  ? -6.915  2.907   -3.757 1.00 0.00 ? 84  ALA A CA   3  
ATOM 4870  C C    . ALA A 1 84  ? -6.674  1.809   -2.719 1.00 0.00 ? 84  ALA A C    3  
ATOM 4871  O O    . ALA A 1 84  ? -7.450  0.859   -2.624 1.00 0.00 ? 84  ALA A O    3  
ATOM 4872  C CB   . ALA A 1 84  ? -5.760  3.031   -4.753 1.00 0.00 ? 84  ALA A CB   3  
ATOM 4873  H H    . ALA A 1 84  ? -6.425  4.876   -3.286 1.00 0.00 ? 84  ALA A H    3  
ATOM 4874  H HA   . ALA A 1 84  ? -7.829  2.682   -4.306 1.00 0.00 ? 84  ALA A HA   3  
ATOM 4875  H HB1  . ALA A 1 84  ? -4.812  2.957   -4.221 1.00 0.00 ? 84  ALA A HB1  3  
ATOM 4876  H HB2  . ALA A 1 84  ? -5.827  2.230   -5.489 1.00 0.00 ? 84  ALA A HB2  3  
ATOM 4877  H HB3  . ALA A 1 84  ? -5.818  3.995   -5.258 1.00 0.00 ? 84  ALA A HB3  3  
ATOM 4878  N N    . ALA A 1 85  ? -5.596  1.976   -1.967 1.00 0.00 ? 85  ALA A N    3  
ATOM 4879  C CA   . ALA A 1 85  ? -5.243  1.011   -0.940 1.00 0.00 ? 85  ALA A CA   3  
ATOM 4880  C C    . ALA A 1 85  ? -6.500  0.621   -0.160 1.00 0.00 ? 85  ALA A C    3  
ATOM 4881  O O    . ALA A 1 85  ? -6.704  -0.552  0.150  1.00 0.00 ? 85  ALA A O    3  
ATOM 4882  C CB   . ALA A 1 85  ? -4.156  1.599   -0.038 1.00 0.00 ? 85  ALA A CB   3  
ATOM 4883  H H    . ALA A 1 85  ? -4.970  2.752   -2.051 1.00 0.00 ? 85  ALA A H    3  
ATOM 4884  H HA   . ALA A 1 85  ? -4.846  0.127   -1.438 1.00 0.00 ? 85  ALA A HA   3  
ATOM 4885  H HB1  . ALA A 1 85  ? -4.190  2.688   -0.092 1.00 0.00 ? 85  ALA A HB1  3  
ATOM 4886  H HB2  . ALA A 1 85  ? -4.325  1.280   0.990  1.00 0.00 ? 85  ALA A HB2  3  
ATOM 4887  H HB3  . ALA A 1 85  ? -3.179  1.249   -0.372 1.00 0.00 ? 85  ALA A HB3  3  
ATOM 4888  N N    . MET A 1 86  ? -7.310  1.627   0.137  1.00 0.00 ? 86  MET A N    3  
ATOM 4889  C CA   . MET A 1 86  ? -8.541  1.404   0.875  1.00 0.00 ? 86  MET A CA   3  
ATOM 4890  C C    . MET A 1 86  ? -9.438  0.396   0.154  1.00 0.00 ? 86  MET A C    3  
ATOM 4891  O O    . MET A 1 86  ? -10.050 -0.461  0.789  1.00 0.00 ? 86  MET A O    3  
ATOM 4892  C CB   . MET A 1 86  ? -9.288  2.730   1.035  1.00 0.00 ? 86  MET A CB   3  
ATOM 4893  C CG   . MET A 1 86  ? -8.382  3.799   1.649  1.00 0.00 ? 86  MET A CG   3  
ATOM 4894  S SD   . MET A 1 86  ? -9.186  4.546   3.056  1.00 0.00 ? 86  MET A SD   3  
ATOM 4895  C CE   . MET A 1 86  ? -9.148  3.174   4.198  1.00 0.00 ? 86  MET A CE   3  
ATOM 4896  H H    . MET A 1 86  ? -7.136  2.578   -0.118 1.00 0.00 ? 86  MET A H    3  
ATOM 4897  H HA   . MET A 1 86  ? -8.235  1.003   1.841  1.00 0.00 ? 86  MET A HA   3  
ATOM 4898  H HB2  . MET A 1 86  ? -9.649  3.068   0.063  1.00 0.00 ? 86  MET A HB2  3  
ATOM 4899  H HB3  . MET A 1 86  ? -10.164 2.584   1.667  1.00 0.00 ? 86  MET A HB3  3  
ATOM 4900  H HG2  . MET A 1 86  ? -7.435  3.354   1.954  1.00 0.00 ? 86  MET A HG2  3  
ATOM 4901  H HG3  . MET A 1 86  ? -8.151  4.562   0.905  1.00 0.00 ? 86  MET A HG3  3  
ATOM 4902  H HE1  . MET A 1 86  ? -10.014 3.227   4.858  1.00 0.00 ? 86  MET A HE1  3  
ATOM 4903  H HE2  . MET A 1 86  ? -9.172  2.237   3.642  1.00 0.00 ? 86  MET A HE2  3  
ATOM 4904  H HE3  . MET A 1 86  ? -8.235  3.221   4.792  1.00 0.00 ? 86  MET A HE3  3  
ATOM 4905  N N    . ALA A 1 87  ? -9.488  0.533   -1.163 1.00 0.00 ? 87  ALA A N    3  
ATOM 4906  C CA   . ALA A 1 87  ? -10.300 -0.356  -1.977 1.00 0.00 ? 87  ALA A CA   3  
ATOM 4907  C C    . ALA A 1 87  ? -9.397  -1.390  -2.651 1.00 0.00 ? 87  ALA A C    3  
ATOM 4908  O O    . ALA A 1 87  ? -9.520  -1.641  -3.849 1.00 0.00 ? 87  ALA A O    3  
ATOM 4909  C CB   . ALA A 1 87  ? -11.099 0.468   -2.989 1.00 0.00 ? 87  ALA A CB   3  
ATOM 4910  H H    . ALA A 1 87  ? -8.987  1.233   -1.672 1.00 0.00 ? 87  ALA A H    3  
ATOM 4911  H HA   . ALA A 1 87  ? -10.996 -0.870  -1.314 1.00 0.00 ? 87  ALA A HA   3  
ATOM 4912  H HB1  . ALA A 1 87  ? -10.415 0.957   -3.682 1.00 0.00 ? 87  ALA A HB1  3  
ATOM 4913  H HB2  . ALA A 1 87  ? -11.770 -0.189  -3.543 1.00 0.00 ? 87  ALA A HB2  3  
ATOM 4914  H HB3  . ALA A 1 87  ? -11.684 1.222   -2.462 1.00 0.00 ? 87  ALA A HB3  3  
ATOM 4915  N N    . ALA A 1 88  ? -8.508  -1.963  -1.852 1.00 0.00 ? 88  ALA A N    3  
ATOM 4916  C CA   . ALA A 1 88  ? -7.585  -2.965  -2.357 1.00 0.00 ? 88  ALA A CA   3  
ATOM 4917  C C    . ALA A 1 88  ? -7.378  -4.044  -1.292 1.00 0.00 ? 88  ALA A C    3  
ATOM 4918  O O    . ALA A 1 88  ? -6.259  -4.510  -1.084 1.00 0.00 ? 88  ALA A O    3  
ATOM 4919  C CB   . ALA A 1 88  ? -6.274  -2.292  -2.766 1.00 0.00 ? 88  ALA A CB   3  
ATOM 4920  H H    . ALA A 1 88  ? -8.414  -1.754  -0.879 1.00 0.00 ? 88  ALA A H    3  
ATOM 4921  H HA   . ALA A 1 88  ? -8.037  -3.419  -3.239 1.00 0.00 ? 88  ALA A HA   3  
ATOM 4922  H HB1  . ALA A 1 88  ? -6.324  -1.228  -2.533 1.00 0.00 ? 88  ALA A HB1  3  
ATOM 4923  H HB2  . ALA A 1 88  ? -5.446  -2.745  -2.220 1.00 0.00 ? 88  ALA A HB2  3  
ATOM 4924  H HB3  . ALA A 1 88  ? -6.117  -2.422  -3.837 1.00 0.00 ? 88  ALA A HB3  3  
ATOM 4925  N N    . ARG A 1 89  ? -8.476  -4.411  -0.645 1.00 0.00 ? 89  ARG A N    3  
ATOM 4926  C CA   . ARG A 1 89  ? -8.429  -5.426  0.393  1.00 0.00 ? 89  ARG A CA   3  
ATOM 4927  C C    . ARG A 1 89  ? -8.798  -6.794  -0.185 1.00 0.00 ? 89  ARG A C    3  
ATOM 4928  O O    . ARG A 1 89  ? -9.406  -6.877  -1.251 1.00 0.00 ? 89  ARG A O    3  
ATOM 4929  C CB   . ARG A 1 89  ? -9.386  -5.088  1.537  1.00 0.00 ? 89  ARG A CB   3  
ATOM 4930  C CG   . ARG A 1 89  ? -8.642  -4.421  2.695  1.00 0.00 ? 89  ARG A CG   3  
ATOM 4931  C CD   . ARG A 1 89  ? -9.463  -4.487  3.985  1.00 0.00 ? 89  ARG A CD   3  
ATOM 4932  N NE   . ARG A 1 89  ? -10.827 -3.966  3.745  1.00 0.00 ? 89  ARG A NE   3  
ATOM 4933  C CZ   . ARG A 1 89  ? -11.863 -4.163  4.572  1.00 0.00 ? 89  ARG A CZ   3  
ATOM 4934  N NH1  . ARG A 1 89  ? -11.696 -4.870  5.698  1.00 0.00 ? 89  ARG A NH1  3  
ATOM 4935  N NH2  . ARG A 1 89  ? -13.065 -3.653  4.273  1.00 0.00 ? 89  ARG A NH2  3  
ATOM 4936  H H    . ARG A 1 89  ? -9.382  -4.027  -0.821 1.00 0.00 ? 89  ARG A H    3  
ATOM 4937  H HA   . ARG A 1 89  ? -7.398  -5.416  0.747  1.00 0.00 ? 89  ARG A HA   3  
ATOM 4938  H HB2  . ARG A 1 89  ? -10.172 -4.426  1.175  1.00 0.00 ? 89  ARG A HB2  3  
ATOM 4939  H HB3  . ARG A 1 89  ? -9.873  -5.998  1.889  1.00 0.00 ? 89  ARG A HB3  3  
ATOM 4940  H HG2  . ARG A 1 89  ? -7.681  -4.911  2.846  1.00 0.00 ? 89  ARG A HG2  3  
ATOM 4941  H HG3  . ARG A 1 89  ? -8.433  -3.380  2.447  1.00 0.00 ? 89  ARG A HG3  3  
ATOM 4942  H HD2  . ARG A 1 89  ? -9.515  -5.516  4.340  1.00 0.00 ? 89  ARG A HD2  3  
ATOM 4943  H HD3  . ARG A 1 89  ? -8.975  -3.905  4.767  1.00 0.00 ? 89  ARG A HD3  3  
ATOM 4944  H HE   . ARG A 1 89  ? -10.986 -3.435  2.913  1.00 0.00 ? 89  ARG A HE   3  
ATOM 4945  H HH11 . ARG A 1 89  ? -10.799 -5.251  5.921  1.00 0.00 ? 89  ARG A HH11 3  
ATOM 4946  H HH12 . ARG A 1 89  ? -12.469 -5.017  6.315  1.00 0.00 ? 89  ARG A HH12 3  
ATOM 4947  H HH21 . ARG A 1 89  ? -13.190 -3.125  3.432  1.00 0.00 ? 89  ARG A HH21 3  
ATOM 4948  H HH22 . ARG A 1 89  ? -13.838 -3.800  4.890  1.00 0.00 ? 89  ARG A HH22 3  
ATOM 4949  N N    . PRO A 1 90  ? -8.405  -7.859  0.563  1.00 0.00 ? 90  PRO A N    3  
ATOM 4950  C CA   . PRO A 1 90  ? -7.690  -7.672  1.814  1.00 0.00 ? 90  PRO A CA   3  
ATOM 4951  C C    . PRO A 1 90  ? -6.235  -7.272  1.558  1.00 0.00 ? 90  PRO A C    3  
ATOM 4952  O O    . PRO A 1 90  ? -5.847  -7.025  0.418  1.00 0.00 ? 90  PRO A O    3  
ATOM 4953  C CB   . PRO A 1 90  ? -7.821  -8.999  2.544  1.00 0.00 ? 90  PRO A CB   3  
ATOM 4954  C CG   . PRO A 1 90  ? -8.201  -10.022 1.486  1.00 0.00 ? 90  PRO A CG   3  
ATOM 4955  C CD   . PRO A 1 90  ? -8.632  -9.265  0.240  1.00 0.00 ? 90  PRO A CD   3  
ATOM 4956  H HA   . PRO A 1 90  ? -8.093  -6.920  2.335  1.00 0.00 ? 90  PRO A HA   3  
ATOM 4957  H HB2  . PRO A 1 90  ? -6.884  -9.271  3.031  1.00 0.00 ? 90  PRO A HB2  3  
ATOM 4958  H HB3  . PRO A 1 90  ? -8.581  -8.942  3.323  1.00 0.00 ? 90  PRO A HB3  3  
ATOM 4959  H HG2  . PRO A 1 90  ? -7.356  -10.674 1.264  1.00 0.00 ? 90  PRO A HG2  3  
ATOM 4960  H HG3  . PRO A 1 90  ? -9.010  -10.659 1.844  1.00 0.00 ? 90  PRO A HG3  3  
ATOM 4961  H HD2  . PRO A 1 90  ? -8.049  -9.570  -0.630 1.00 0.00 ? 90  PRO A HD2  3  
ATOM 4962  H HD3  . PRO A 1 90  ? -9.679  -9.453  0.004  1.00 0.00 ? 90  PRO A HD3  3  
ATOM 4963  N N    . HIS A 1 91  ? -5.471  -7.219  2.639  1.00 0.00 ? 91  HIS A N    3  
ATOM 4964  C CA   . HIS A 1 91  ? -4.068  -6.852  2.547  1.00 0.00 ? 91  HIS A CA   3  
ATOM 4965  C C    . HIS A 1 91  ? -3.207  -7.958  3.161  1.00 0.00 ? 91  HIS A C    3  
ATOM 4966  O O    . HIS A 1 91  ? -3.391  -8.320  4.322  1.00 0.00 ? 91  HIS A O    3  
ATOM 4967  C CB   . HIS A 1 91  ? -3.821  -5.484  3.186  1.00 0.00 ? 91  HIS A CB   3  
ATOM 4968  C CG   . HIS A 1 91  ? -4.061  -4.320  2.255  1.00 0.00 ? 91  HIS A CG   3  
ATOM 4969  N ND1  . HIS A 1 91  ? -3.886  -3.003  2.642  1.00 0.00 ? 91  HIS A ND1  3  
ATOM 4970  C CD2  . HIS A 1 91  ? -4.464  -4.288  0.953  1.00 0.00 ? 91  HIS A CD2  3  
ATOM 4971  C CE1  . HIS A 1 91  ? -4.174  -2.222  1.611  1.00 0.00 ? 91  HIS A CE1  3  
ATOM 4972  N NE2  . HIS A 1 91  ? -4.533  -3.020  0.565  1.00 0.00 ? 91  HIS A NE2  3  
ATOM 4973  H H    . HIS A 1 91  ? -5.795  -7.421  3.564  1.00 0.00 ? 91  HIS A H    3  
ATOM 4974  H HA   . HIS A 1 91  ? -3.836  -6.770  1.485  1.00 0.00 ? 91  HIS A HA   3  
ATOM 4975  H HB2  . HIS A 1 91  ? -4.467  -5.380  4.057  1.00 0.00 ? 91  HIS A HB2  3  
ATOM 4976  H HB3  . HIS A 1 91  ? -2.792  -5.443  3.545  1.00 0.00 ? 91  HIS A HB3  3  
ATOM 4977  H HD1  . HIS A 1 91  ? -3.592  -2.693  3.547  1.00 0.00 ? 91  HIS A HD1  3  
ATOM 4978  H HD2  . HIS A 1 91  ? -4.691  -5.157  0.335  1.00 0.00 ? 91  HIS A HD2  3  
ATOM 4979  H HE1  . HIS A 1 91  ? -4.132  -1.133  1.601  1.00 0.00 ? 91  HIS A HE1  3  
ATOM 4980  N N    . SER A 1 92  ? -2.286  -8.464  2.354  1.00 0.00 ? 92  SER A N    3  
ATOM 4981  C CA   . SER A 1 92  ? -1.396  -9.520  2.804  1.00 0.00 ? 92  SER A CA   3  
ATOM 4982  C C    . SER A 1 92  ? 0.058   -9.049  2.727  1.00 0.00 ? 92  SER A C    3  
ATOM 4983  O O    . SER A 1 92  ? 0.563   -8.757  1.644  1.00 0.00 ? 92  SER A O    3  
ATOM 4984  C CB   . SER A 1 92  ? -1.586  -10.791 1.973  1.00 0.00 ? 92  SER A CB   3  
ATOM 4985  O OG   . SER A 1 92  ? -1.676  -10.509 0.579  1.00 0.00 ? 92  SER A OG   3  
ATOM 4986  H H    . SER A 1 92  ? -2.143  -8.163  1.411  1.00 0.00 ? 92  SER A H    3  
ATOM 4987  H HA   . SER A 1 92  ? -1.680  -9.717  3.837  1.00 0.00 ? 92  SER A HA   3  
ATOM 4988  H HB2  . SER A 1 92  ? -0.752  -11.470 2.152  1.00 0.00 ? 92  SER A HB2  3  
ATOM 4989  H HB3  . SER A 1 92  ? -2.490  -11.305 2.298  1.00 0.00 ? 92  SER A HB3  3  
ATOM 4990  H HG   . SER A 1 92  ? -2.586  -10.747 0.240  1.00 0.00 ? 92  SER A HG   3  
ATOM 4991  N N    . ILE A 1 93  ? 0.689   -8.989  3.891  1.00 0.00 ? 93  ILE A N    3  
ATOM 4992  C CA   . ILE A 1 93  ? 2.074   -8.558  3.969  1.00 0.00 ? 93  ILE A CA   3  
ATOM 4993  C C    . ILE A 1 93  ? 2.835   -9.471  4.933  1.00 0.00 ? 93  ILE A C    3  
ATOM 4994  O O    . ILE A 1 93  ? 2.273   -9.943  5.920  1.00 0.00 ? 93  ILE A O    3  
ATOM 4995  C CB   . ILE A 1 93  ? 2.154   -7.075  4.336  1.00 0.00 ? 93  ILE A CB   3  
ATOM 4996  C CG1  . ILE A 1 93  ? 1.137   -6.257  3.537  1.00 0.00 ? 93  ILE A CG1  3  
ATOM 4997  C CG2  . ILE A 1 93  ? 3.578   -6.543  4.164  1.00 0.00 ? 93  ILE A CG2  3  
ATOM 4998  C CD1  . ILE A 1 93  ? 1.080   -4.812  4.037  1.00 0.00 ? 93  ILE A CD1  3  
ATOM 4999  H H    . ILE A 1 93  ? 0.271   -9.229  4.767  1.00 0.00 ? 93  ILE A H    3  
ATOM 5000  H HA   . ILE A 1 93  ? 2.507   -8.668  2.975  1.00 0.00 ? 93  ILE A HA   3  
ATOM 5001  H HB   . ILE A 1 93  ? 1.896   -6.969  5.389  1.00 0.00 ? 93  ILE A HB   3  
ATOM 5002  H HG12 . ILE A 1 93  ? 1.404   -6.270  2.480  1.00 0.00 ? 93  ILE A HG12 3  
ATOM 5003  H HG13 . ILE A 1 93  ? 0.151   -6.714  3.622  1.00 0.00 ? 93  ILE A HG13 3  
ATOM 5004  H HG21 . ILE A 1 93  ? 4.268   -7.158  4.742  1.00 0.00 ? 93  ILE A HG21 3  
ATOM 5005  H HG22 . ILE A 1 93  ? 3.855   -6.579  3.110  1.00 0.00 ? 93  ILE A HG22 3  
ATOM 5006  H HG23 . ILE A 1 93  ? 3.627   -5.513  4.517  1.00 0.00 ? 93  ILE A HG23 3  
ATOM 5007  H HD11 . ILE A 1 93  ? 1.094   -4.804  5.127  1.00 0.00 ? 93  ILE A HD11 3  
ATOM 5008  H HD12 . ILE A 1 93  ? 1.942   -4.263  3.659  1.00 0.00 ? 93  ILE A HD12 3  
ATOM 5009  H HD13 . ILE A 1 93  ? 0.164   -4.340  3.682  1.00 0.00 ? 93  ILE A HD13 3  
ATOM 5010  N N    . ASP A 1 94  ? 4.101   -9.693  4.612  1.00 0.00 ? 94  ASP A N    3  
ATOM 5011  C CA   . ASP A 1 94  ? 4.944   -10.541 5.437  1.00 0.00 ? 94  ASP A CA   3  
ATOM 5012  C C    . ASP A 1 94  ? 4.401   -11.972 5.412  1.00 0.00 ? 94  ASP A C    3  
ATOM 5013  O O    . ASP A 1 94  ? 4.813   -12.810 6.213  1.00 0.00 ? 94  ASP A O    3  
ATOM 5014  C CB   . ASP A 1 94  ? 4.951   -10.064 6.891  1.00 0.00 ? 94  ASP A CB   3  
ATOM 5015  C CG   . ASP A 1 94  ? 6.322   -10.076 7.569  1.00 0.00 ? 94  ASP A CG   3  
ATOM 5016  O OD1  . ASP A 1 94  ? 7.147   -9.214  7.197  1.00 0.00 ? 94  ASP A OD1  3  
ATOM 5017  O OD2  . ASP A 1 94  ? 6.515   -10.948 8.445  1.00 0.00 ? 94  ASP A OD2  3  
ATOM 5018  H H    . ASP A 1 94  ? 4.550   -9.305  3.808  1.00 0.00 ? 94  ASP A H    3  
ATOM 5019  H HA   . ASP A 1 94  ? 5.940   -10.466 5.002  1.00 0.00 ? 94  ASP A HA   3  
ATOM 5020  H HB2  . ASP A 1 94  ? 4.554   -9.050  6.926  1.00 0.00 ? 94  ASP A HB2  3  
ATOM 5021  H HB3  . ASP A 1 94  ? 4.272   -10.692 7.467  1.00 0.00 ? 94  ASP A HB3  3  
ATOM 5022  N N    . GLY A 1 95  ? 3.485   -12.206 4.484  1.00 0.00 ? 95  GLY A N    3  
ATOM 5023  C CA   . GLY A 1 95  ? 2.882   -13.521 4.344  1.00 0.00 ? 95  GLY A CA   3  
ATOM 5024  C C    . GLY A 1 95  ? 1.753   -13.717 5.357  1.00 0.00 ? 95  GLY A C    3  
ATOM 5025  O O    . GLY A 1 95  ? 1.366   -14.847 5.651  1.00 0.00 ? 95  GLY A O    3  
ATOM 5026  H H    . GLY A 1 95  ? 3.156   -11.519 3.836  1.00 0.00 ? 95  GLY A H    3  
ATOM 5027  H HA2  . GLY A 1 95  ? 2.493   -13.640 3.333  1.00 0.00 ? 95  GLY A HA2  3  
ATOM 5028  H HA3  . GLY A 1 95  ? 3.641   -14.290 4.486  1.00 0.00 ? 95  GLY A HA3  3  
ATOM 5029  N N    . ARG A 1 96  ? 1.255   -12.598 5.864  1.00 0.00 ? 96  ARG A N    3  
ATOM 5030  C CA   . ARG A 1 96  ? 0.178   -12.632 6.839  1.00 0.00 ? 96  ARG A CA   3  
ATOM 5031  C C    . ARG A 1 96  ? -0.943  -11.677 6.425  1.00 0.00 ? 96  ARG A C    3  
ATOM 5032  O O    . ARG A 1 96  ? -0.713  -10.735 5.668  1.00 0.00 ? 96  ARG A O    3  
ATOM 5033  C CB   . ARG A 1 96  ? 0.681   -12.244 8.230  1.00 0.00 ? 96  ARG A CB   3  
ATOM 5034  C CG   . ARG A 1 96  ? 0.885   -10.731 8.337  1.00 0.00 ? 96  ARG A CG   3  
ATOM 5035  C CD   . ARG A 1 96  ? -0.033  -10.129 9.403  1.00 0.00 ? 96  ARG A CD   3  
ATOM 5036  N NE   . ARG A 1 96  ? 0.157   -10.831 10.691 1.00 0.00 ? 96  ARG A NE   3  
ATOM 5037  C CZ   . ARG A 1 96  ? -0.659  -11.788 11.153 1.00 0.00 ? 96  ARG A CZ   3  
ATOM 5038  N NH1  . ARG A 1 96  ? -1.727  -12.162 10.435 1.00 0.00 ? 96  ARG A NH1  3  
ATOM 5039  N NH2  . ARG A 1 96  ? -0.408  -12.371 12.333 1.00 0.00 ? 96  ARG A NH2  3  
ATOM 5040  H H    . ARG A 1 96  ? 1.575   -11.683 5.620  1.00 0.00 ? 96  ARG A H    3  
ATOM 5041  H HA   . ARG A 1 96  ? -0.167  -13.666 6.837  1.00 0.00 ? 96  ARG A HA   3  
ATOM 5042  H HB2  . ARG A 1 96  ? -0.034  -12.573 8.984  1.00 0.00 ? 96  ARG A HB2  3  
ATOM 5043  H HB3  . ARG A 1 96  ? 1.621   -12.757 8.437  1.00 0.00 ? 96  ARG A HB3  3  
ATOM 5044  H HG2  . ARG A 1 96  ? 1.925   -10.517 8.585  1.00 0.00 ? 96  ARG A HG2  3  
ATOM 5045  H HG3  . ARG A 1 96  ? 0.684   -10.265 7.373  1.00 0.00 ? 96  ARG A HG3  3  
ATOM 5046  H HD2  . ARG A 1 96  ? 0.183   -9.067  9.522  1.00 0.00 ? 96  ARG A HD2  3  
ATOM 5047  H HD3  . ARG A 1 96  ? -1.073  -10.208 9.086  1.00 0.00 ? 96  ARG A HD3  3  
ATOM 5048  H HE   . ARG A 1 96  ? 0.945   -10.576 11.253 1.00 0.00 ? 96  ARG A HE   3  
ATOM 5049  H HH11 . ARG A 1 96  ? -1.914  -11.728 9.554  1.00 0.00 ? 96  ARG A HH11 3  
ATOM 5050  H HH12 . ARG A 1 96  ? -2.336  -12.877 10.779 1.00 0.00 ? 96  ARG A HH12 3  
ATOM 5051  H HH21 . ARG A 1 96  ? 0.388   -12.092 12.870 1.00 0.00 ? 96  ARG A HH21 3  
ATOM 5052  H HH22 . ARG A 1 96  ? -1.018  -13.085 12.678 1.00 0.00 ? 96  ARG A HH22 3  
ATOM 5053  N N    . VAL A 1 97  ? -2.133  -11.953 6.939  1.00 0.00 ? 97  VAL A N    3  
ATOM 5054  C CA   . VAL A 1 97  ? -3.290  -11.130 6.632  1.00 0.00 ? 97  VAL A CA   3  
ATOM 5055  C C    . VAL A 1 97  ? -3.333  -9.940  7.593  1.00 0.00 ? 97  VAL A C    3  
ATOM 5056  O O    . VAL A 1 97  ? -3.539  -10.113 8.793  1.00 0.00 ? 97  VAL A O    3  
ATOM 5057  C CB   . VAL A 1 97  ? -4.562  -11.979 6.675  1.00 0.00 ? 97  VAL A CB   3  
ATOM 5058  C CG1  . VAL A 1 97  ? -5.781  -11.163 6.240  1.00 0.00 ? 97  VAL A CG1  3  
ATOM 5059  C CG2  . VAL A 1 97  ? -4.411  -13.237 5.818  1.00 0.00 ? 97  VAL A CG2  3  
ATOM 5060  H H    . VAL A 1 97  ? -2.311  -12.721 7.554  1.00 0.00 ? 97  VAL A H    3  
ATOM 5061  H HA   . VAL A 1 97  ? -3.168  -10.756 5.616  1.00 0.00 ? 97  VAL A HA   3  
ATOM 5062  H HB   . VAL A 1 97  ? -4.720  -12.294 7.706  1.00 0.00 ? 97  VAL A HB   3  
ATOM 5063  H HG11 . VAL A 1 97  ? -5.823  -11.125 5.151  1.00 0.00 ? 97  VAL A HG11 3  
ATOM 5064  H HG12 . VAL A 1 97  ? -6.688  -11.631 6.623  1.00 0.00 ? 97  VAL A HG12 3  
ATOM 5065  H HG13 . VAL A 1 97  ? -5.700  -10.150 6.636  1.00 0.00 ? 97  VAL A HG13 3  
ATOM 5066  H HG21 . VAL A 1 97  ? -3.508  -13.772 6.114  1.00 0.00 ? 97  VAL A HG21 3  
ATOM 5067  H HG22 . VAL A 1 97  ? -5.278  -13.881 5.961  1.00 0.00 ? 97  VAL A HG22 3  
ATOM 5068  H HG23 . VAL A 1 97  ? -4.338  -12.955 4.767  1.00 0.00 ? 97  VAL A HG23 3  
ATOM 5069  N N    . VAL A 1 98  ? -3.136  -8.757  7.029  1.00 0.00 ? 98  VAL A N    3  
ATOM 5070  C CA   . VAL A 1 98  ? -3.149  -7.539  7.820  1.00 0.00 ? 98  VAL A CA   3  
ATOM 5071  C C    . VAL A 1 98  ? -4.529  -6.886  7.719  1.00 0.00 ? 98  VAL A C    3  
ATOM 5072  O O    . VAL A 1 98  ? -5.455  -7.466  7.153  1.00 0.00 ? 98  VAL A O    3  
ATOM 5073  C CB   . VAL A 1 98  ? -2.016  -6.613  7.375  1.00 0.00 ? 98  VAL A CB   3  
ATOM 5074  C CG1  . VAL A 1 98  ? -0.759  -7.413  7.027  1.00 0.00 ? 98  VAL A CG1  3  
ATOM 5075  C CG2  . VAL A 1 98  ? -2.452  -5.739  6.197  1.00 0.00 ? 98  VAL A CG2  3  
ATOM 5076  H H    . VAL A 1 98  ? -2.969  -8.625  6.051  1.00 0.00 ? 98  VAL A H    3  
ATOM 5077  H HA   . VAL A 1 98  ? -2.969  -7.819  8.858  1.00 0.00 ? 98  VAL A HA   3  
ATOM 5078  H HB   . VAL A 1 98  ? -1.774  -5.954  8.209  1.00 0.00 ? 98  VAL A HB   3  
ATOM 5079  H HG11 . VAL A 1 98  ? -0.973  -8.083  6.195  1.00 0.00 ? 98  VAL A HG11 3  
ATOM 5080  H HG12 . VAL A 1 98  ? 0.042   -6.728  6.746  1.00 0.00 ? 98  VAL A HG12 3  
ATOM 5081  H HG13 . VAL A 1 98  ? -0.449  -7.998  7.894  1.00 0.00 ? 98  VAL A HG13 3  
ATOM 5082  H HG21 . VAL A 1 98  ? -2.975  -4.859  6.572  1.00 0.00 ? 98  VAL A HG21 3  
ATOM 5083  H HG22 . VAL A 1 98  ? -1.574  -5.426  5.632  1.00 0.00 ? 98  VAL A HG22 3  
ATOM 5084  H HG23 . VAL A 1 98  ? -3.118  -6.308  5.549  1.00 0.00 ? 98  VAL A HG23 3  
ATOM 5085  N N    . GLU A 1 99  ? -4.624  -5.688  8.276  1.00 0.00 ? 99  GLU A N    3  
ATOM 5086  C CA   . GLU A 1 99  ? -5.875  -4.950  8.256  1.00 0.00 ? 99  GLU A CA   3  
ATOM 5087  C C    . GLU A 1 99  ? -5.609  -3.450  8.397  1.00 0.00 ? 99  GLU A C    3  
ATOM 5088  O O    . GLU A 1 99  ? -5.226  -2.981  9.468  1.00 0.00 ? 99  GLU A O    3  
ATOM 5089  C CB   . GLU A 1 99  ? -6.821  -5.444  9.352  1.00 0.00 ? 99  GLU A CB   3  
ATOM 5090  C CG   . GLU A 1 99  ? -6.038  -5.998  10.544 1.00 0.00 ? 99  GLU A CG   3  
ATOM 5091  C CD   . GLU A 1 99  ? -5.958  -7.525  10.486 1.00 0.00 ? 99  GLU A CD   3  
ATOM 5092  O OE1  . GLU A 1 99  ? -6.900  -8.121  9.921  1.00 0.00 ? 99  GLU A OE1  3  
ATOM 5093  O OE2  . GLU A 1 99  ? -4.957  -8.061  11.008 1.00 0.00 ? 99  GLU A OE2  3  
ATOM 5094  H H    . GLU A 1 99  ? -3.867  -5.223  8.735  1.00 0.00 ? 99  GLU A H    3  
ATOM 5095  H HA   . GLU A 1 99  ? -6.318  -5.157  7.282  1.00 0.00 ? 99  GLU A HA   3  
ATOM 5096  H HB2  . GLU A 1 99  ? -7.461  -4.625  9.682  1.00 0.00 ? 99  GLU A HB2  3  
ATOM 5097  H HB3  . GLU A 1 99  ? -7.476  -6.218  8.951  1.00 0.00 ? 99  GLU A HB3  3  
ATOM 5098  H HG2  . GLU A 1 99  ? -5.032  -5.577  10.550 1.00 0.00 ? 99  GLU A HG2  3  
ATOM 5099  H HG3  . GLU A 1 99  ? -6.517  -5.691  11.474 1.00 0.00 ? 99  GLU A HG3  3  
ATOM 5100  N N    . PRO A 1 100 ? -5.828  -2.719  7.271  1.00 0.00 ? 100 PRO A N    3  
ATOM 5101  C CA   . PRO A 1 100 ? -5.616  -1.281  7.259  1.00 0.00 ? 100 PRO A CA   3  
ATOM 5102  C C    . PRO A 1 100 ? -6.745  -0.554  7.992  1.00 0.00 ? 100 PRO A C    3  
ATOM 5103  O O    . PRO A 1 100 ? -7.833  -1.103  8.164  1.00 0.00 ? 100 PRO A O    3  
ATOM 5104  C CB   . PRO A 1 100 ? -5.527  -0.909  5.788  1.00 0.00 ? 100 PRO A CB   3  
ATOM 5105  C CG   . PRO A 1 100 ? -6.153  -2.067  5.027  1.00 0.00 ? 100 PRO A CG   3  
ATOM 5106  C CD   . PRO A 1 100 ? -6.282  -3.239  5.985  1.00 0.00 ? 100 PRO A CD   3  
ATOM 5107  H HA   . PRO A 1 100 ? -4.777  -1.050  7.752  1.00 0.00 ? 100 PRO A HA   3  
ATOM 5108  H HB2  . PRO A 1 100 ? -6.057  0.022   5.588  1.00 0.00 ? 100 PRO A HB2  3  
ATOM 5109  H HB3  . PRO A 1 100 ? -4.491  -0.758  5.486  1.00 0.00 ? 100 PRO A HB3  3  
ATOM 5110  H HG2  . PRO A 1 100 ? -7.130  -1.783  4.637  1.00 0.00 ? 100 PRO A HG2  3  
ATOM 5111  H HG3  . PRO A 1 100 ? -5.535  -2.339  4.171  1.00 0.00 ? 100 PRO A HG3  3  
ATOM 5112  H HD2  . PRO A 1 100 ? -7.311  -3.593  6.042  1.00 0.00 ? 100 PRO A HD2  3  
ATOM 5113  H HD3  . PRO A 1 100 ? -5.672  -4.083  5.662  1.00 0.00 ? 100 PRO A HD3  3  
ATOM 5114  N N    . LYS A 1 101 ? -6.448  0.669   8.405  1.00 0.00 ? 101 LYS A N    3  
ATOM 5115  C CA   . LYS A 1 101 ? -7.425  1.477   9.115  1.00 0.00 ? 101 LYS A CA   3  
ATOM 5116  C C    . LYS A 1 101 ? -7.356  2.918   8.606  1.00 0.00 ? 101 LYS A C    3  
ATOM 5117  O O    . LYS A 1 101 ? -6.269  3.455   8.397  1.00 0.00 ? 101 LYS A O    3  
ATOM 5118  C CB   . LYS A 1 101 ? -7.227  1.350   10.627 1.00 0.00 ? 101 LYS A CB   3  
ATOM 5119  C CG   . LYS A 1 101 ? -7.053  -0.115  11.036 1.00 0.00 ? 101 LYS A CG   3  
ATOM 5120  C CD   . LYS A 1 101 ? -8.381  -0.869  10.954 1.00 0.00 ? 101 LYS A CD   3  
ATOM 5121  C CE   . LYS A 1 101 ? -8.852  -1.302  12.343 1.00 0.00 ? 101 LYS A CE   3  
ATOM 5122  N NZ   . LYS A 1 101 ? -9.808  -0.317  12.897 1.00 0.00 ? 101 LYS A NZ   3  
ATOM 5123  H H    . LYS A 1 101 ? -5.561  1.108   8.261  1.00 0.00 ? 101 LYS A H    3  
ATOM 5124  H HA   . LYS A 1 101 ? -8.411  1.076   8.884  1.00 0.00 ? 101 LYS A HA   3  
ATOM 5125  H HB2  . LYS A 1 101 ? -6.352  1.923   10.934 1.00 0.00 ? 101 LYS A HB2  3  
ATOM 5126  H HB3  . LYS A 1 101 ? -8.085  1.776   11.147 1.00 0.00 ? 101 LYS A HB3  3  
ATOM 5127  H HG2  . LYS A 1 101 ? -6.319  -0.592  10.387 1.00 0.00 ? 101 LYS A HG2  3  
ATOM 5128  H HG3  . LYS A 1 101 ? -6.662  -0.168  12.052 1.00 0.00 ? 101 LYS A HG3  3  
ATOM 5129  H HD2  . LYS A 1 101 ? -9.137  -0.233  10.492 1.00 0.00 ? 101 LYS A HD2  3  
ATOM 5130  H HD3  . LYS A 1 101 ? -8.268  -1.744  10.315 1.00 0.00 ? 101 LYS A HD3  3  
ATOM 5131  H HE2  . LYS A 1 101 ? -9.325  -2.283  12.284 1.00 0.00 ? 101 LYS A HE2  3  
ATOM 5132  H HE3  . LYS A 1 101 ? -7.996  -1.402  13.010 1.00 0.00 ? 101 LYS A HE3  3  
ATOM 5133  H HZ1  . LYS A 1 101 ? -10.457 -0.046  12.187 1.00 0.00 ? 101 LYS A HZ1  3  
ATOM 5134  H HZ2  . LYS A 1 101 ? -10.304 -0.728  13.662 1.00 0.00 ? 101 LYS A HZ2  3  
ATOM 5135  H HZ3  . LYS A 1 101 ? -9.308  0.488   13.218 1.00 0.00 ? 101 LYS A HZ3  3  
ATOM 5136  N N    . ARG A 1 102 ? -8.530  3.503   8.421  1.00 0.00 ? 102 ARG A N    3  
ATOM 5137  C CA   . ARG A 1 102 ? -8.617  4.871   7.940  1.00 0.00 ? 102 ARG A CA   3  
ATOM 5138  C C    . ARG A 1 102 ? -7.845  5.811   8.868  1.00 0.00 ? 102 ARG A C    3  
ATOM 5139  O O    . ARG A 1 102 ? -7.525  6.937   8.491  1.00 0.00 ? 102 ARG A O    3  
ATOM 5140  C CB   . ARG A 1 102 ? -10.073 5.334   7.853  1.00 0.00 ? 102 ARG A CB   3  
ATOM 5141  C CG   . ARG A 1 102 ? -10.297 6.214   6.623  1.00 0.00 ? 102 ARG A CG   3  
ATOM 5142  C CD   . ARG A 1 102 ? -11.768 6.613   6.494  1.00 0.00 ? 102 ARG A CD   3  
ATOM 5143  N NE   . ARG A 1 102 ? -11.876 7.975   5.925  1.00 0.00 ? 102 ARG A NE   3  
ATOM 5144  C CZ   . ARG A 1 102 ? -13.036 8.578   5.632  1.00 0.00 ? 102 ARG A CZ   3  
ATOM 5145  N NH1  . ARG A 1 102 ? -14.195 7.943   5.853  1.00 0.00 ? 102 ARG A NH1  3  
ATOM 5146  N NH2  . ARG A 1 102 ? -13.038 9.815   5.118  1.00 0.00 ? 102 ARG A NH2  3  
ATOM 5147  H H    . ARG A 1 102 ? -9.410  3.059   8.593  1.00 0.00 ? 102 ARG A H    3  
ATOM 5148  H HA   . ARG A 1 102 ? -8.169  4.847   6.946  1.00 0.00 ? 102 ARG A HA   3  
ATOM 5149  H HB2  . ARG A 1 102 ? -10.732 4.466   7.809  1.00 0.00 ? 102 ARG A HB2  3  
ATOM 5150  H HB3  . ARG A 1 102 ? -10.336 5.888   8.754  1.00 0.00 ? 102 ARG A HB3  3  
ATOM 5151  H HG2  . ARG A 1 102 ? -9.679  7.109   6.694  1.00 0.00 ? 102 ARG A HG2  3  
ATOM 5152  H HG3  . ARG A 1 102 ? -9.982  5.680   5.726  1.00 0.00 ? 102 ARG A HG3  3  
ATOM 5153  H HD2  . ARG A 1 102 ? -12.292 5.901   5.856  1.00 0.00 ? 102 ARG A HD2  3  
ATOM 5154  H HD3  . ARG A 1 102 ? -12.250 6.580   7.471  1.00 0.00 ? 102 ARG A HD3  3  
ATOM 5155  H HE   . ARG A 1 102 ? -11.029 8.477   5.747  1.00 0.00 ? 102 ARG A HE   3  
ATOM 5156  H HH11 . ARG A 1 102 ? -14.194 7.019   6.236  1.00 0.00 ? 102 ARG A HH11 3  
ATOM 5157  H HH12 . ARG A 1 102 ? -15.061 8.392   5.634  1.00 0.00 ? 102 ARG A HH12 3  
ATOM 5158  H HH21 . ARG A 1 102 ? -12.173 10.289  4.953  1.00 0.00 ? 102 ARG A HH21 3  
ATOM 5159  H HH22 . ARG A 1 102 ? -13.904 10.265  4.899  1.00 0.00 ? 102 ARG A HH22 3  
ATOM 5160  N N    . ALA A 1 103 ? -7.569  5.313   10.065 1.00 0.00 ? 103 ALA A N    3  
ATOM 5161  C CA   . ALA A 1 103 ? -6.840  6.093   11.050 1.00 0.00 ? 103 ALA A CA   3  
ATOM 5162  C C    . ALA A 1 103 ? -7.813  7.022   11.779 1.00 0.00 ? 103 ALA A C    3  
ATOM 5163  O O    . ALA A 1 103 ? -7.861  7.035   13.008 1.00 0.00 ? 103 ALA A O    3  
ATOM 5164  C CB   . ALA A 1 103 ? -5.709  6.859   10.361 1.00 0.00 ? 103 ALA A CB   3  
ATOM 5165  H H    . ALA A 1 103 ? -7.833  4.396   10.363 1.00 0.00 ? 103 ALA A H    3  
ATOM 5166  H HA   . ALA A 1 103 ? -6.406  5.399   11.769 1.00 0.00 ? 103 ALA A HA   3  
ATOM 5167  H HB1  . ALA A 1 103 ? -4.898  7.025   11.069 1.00 0.00 ? 103 ALA A HB1  3  
ATOM 5168  H HB2  . ALA A 1 103 ? -5.340  6.279   9.515  1.00 0.00 ? 103 ALA A HB2  3  
ATOM 5169  H HB3  . ALA A 1 103 ? -6.084  7.819   10.006 1.00 0.00 ? 103 ALA A HB3  3  
ATOM 5170  N N    . VAL A 1 104 ? -8.565  7.776   10.991 1.00 0.00 ? 104 VAL A N    3  
ATOM 5171  C CA   . VAL A 1 104 ? -9.534  8.705   11.546 1.00 0.00 ? 104 VAL A CA   3  
ATOM 5172  C C    . VAL A 1 104 ? -10.941 8.290   11.110 1.00 0.00 ? 104 VAL A C    3  
ATOM 5173  O O    . VAL A 1 104 ? -11.106 7.619   10.092 1.00 0.00 ? 104 VAL A O    3  
ATOM 5174  C CB   . VAL A 1 104 ? -9.180  10.137  11.138 1.00 0.00 ? 104 VAL A CB   3  
ATOM 5175  C CG1  . VAL A 1 104 ? -10.370 11.076  11.344 1.00 0.00 ? 104 VAL A CG1  3  
ATOM 5176  C CG2  . VAL A 1 104 ? -7.950  10.635  11.899 1.00 0.00 ? 104 VAL A CG2  3  
ATOM 5177  H H    . VAL A 1 104 ? -8.520  7.759   9.992  1.00 0.00 ? 104 VAL A H    3  
ATOM 5178  H HA   . VAL A 1 104 ? -9.470  8.638   12.632 1.00 0.00 ? 104 VAL A HA   3  
ATOM 5179  H HB   . VAL A 1 104 ? -8.937  10.132  10.075 1.00 0.00 ? 104 VAL A HB   3  
ATOM 5180  H HG11 . VAL A 1 104 ? -10.809 10.897  12.325 1.00 0.00 ? 104 VAL A HG11 3  
ATOM 5181  H HG12 . VAL A 1 104 ? -10.032 12.110  11.280 1.00 0.00 ? 104 VAL A HG12 3  
ATOM 5182  H HG13 . VAL A 1 104 ? -11.118 10.890  10.572 1.00 0.00 ? 104 VAL A HG13 3  
ATOM 5183  H HG21 . VAL A 1 104 ? -7.956  10.224  12.909 1.00 0.00 ? 104 VAL A HG21 3  
ATOM 5184  H HG22 . VAL A 1 104 ? -7.047  10.312  11.381 1.00 0.00 ? 104 VAL A HG22 3  
ATOM 5185  H HG23 . VAL A 1 104 ? -7.971  11.724  11.949 1.00 0.00 ? 104 VAL A HG23 3  
ATOM 5186  N N    . ALA A 1 105 ? -11.918 8.706   11.902 1.00 0.00 ? 105 ALA A N    3  
ATOM 5187  C CA   . ALA A 1 105 ? -13.305 8.385   11.610 1.00 0.00 ? 105 ALA A CA   3  
ATOM 5188  C C    . ALA A 1 105 ? -13.599 6.954   12.062 1.00 0.00 ? 105 ALA A C    3  
ATOM 5189  O O    . ALA A 1 105 ? -13.018 6.003   11.542 1.00 0.00 ? 105 ALA A O    3  
ATOM 5190  C CB   . ALA A 1 105 ? -13.574 8.592   10.118 1.00 0.00 ? 105 ALA A CB   3  
ATOM 5191  H H    . ALA A 1 105 ? -11.775 9.251   12.728 1.00 0.00 ? 105 ALA A H    3  
ATOM 5192  H HA   . ALA A 1 105 ? -13.931 9.073   12.179 1.00 0.00 ? 105 ALA A HA   3  
ATOM 5193  H HB1  . ALA A 1 105 ? -13.398 7.658   9.584  1.00 0.00 ? 105 ALA A HB1  3  
ATOM 5194  H HB2  . ALA A 1 105 ? -14.609 8.903   9.976  1.00 0.00 ? 105 ALA A HB2  3  
ATOM 5195  H HB3  . ALA A 1 105 ? -12.907 9.363   9.732  1.00 0.00 ? 105 ALA A HB3  3  
ATOM 5196  N N    . ARG A 1 106 ? -14.502 6.845   13.027 1.00 0.00 ? 106 ARG A N    3  
ATOM 5197  C CA   . ARG A 1 106 ? -14.880 5.545   13.555 1.00 0.00 ? 106 ARG A CA   3  
ATOM 5198  C C    . ARG A 1 106 ? -13.687 4.889   14.253 1.00 0.00 ? 106 ARG A C    3  
ATOM 5199  O O    . ARG A 1 106 ? -13.257 3.803   13.865 1.00 0.00 ? 106 ARG A O    3  
ATOM 5200  C CB   . ARG A 1 106 ? -15.382 4.623   12.442 1.00 0.00 ? 106 ARG A CB   3  
ATOM 5201  C CG   . ARG A 1 106 ? -16.537 3.749   12.933 1.00 0.00 ? 106 ARG A CG   3  
ATOM 5202  C CD   . ARG A 1 106 ? -16.828 2.619   11.944 1.00 0.00 ? 106 ARG A CD   3  
ATOM 5203  N NE   . ARG A 1 106 ? -18.280 2.334   11.915 1.00 0.00 ? 106 ARG A NE   3  
ATOM 5204  C CZ   . ARG A 1 106 ? -18.933 1.657   12.870 1.00 0.00 ? 106 ARG A CZ   3  
ATOM 5205  N NH1  . ARG A 1 106 ? -18.267 1.192   13.935 1.00 0.00 ? 106 ARG A NH1  3  
ATOM 5206  N NH2  . ARG A 1 106 ? -20.252 1.446   12.759 1.00 0.00 ? 106 ARG A NH2  3  
ATOM 5207  H H    . ARG A 1 106 ? -14.970 7.624   13.444 1.00 0.00 ? 106 ARG A H    3  
ATOM 5208  H HA   . ARG A 1 106 ? -15.682 5.755   14.262 1.00 0.00 ? 106 ARG A HA   3  
ATOM 5209  H HB2  . ARG A 1 106 ? -15.709 5.220   11.590 1.00 0.00 ? 106 ARG A HB2  3  
ATOM 5210  H HB3  . ARG A 1 106 ? -14.565 3.991   12.093 1.00 0.00 ? 106 ARG A HB3  3  
ATOM 5211  H HG2  . ARG A 1 106 ? -16.291 3.329   13.909 1.00 0.00 ? 106 ARG A HG2  3  
ATOM 5212  H HG3  . ARG A 1 106 ? -17.430 4.360   13.066 1.00 0.00 ? 106 ARG A HG3  3  
ATOM 5213  H HD2  . ARG A 1 106 ? -16.484 2.898   10.948 1.00 0.00 ? 106 ARG A HD2  3  
ATOM 5214  H HD3  . ARG A 1 106 ? -16.279 1.722   12.232 1.00 0.00 ? 106 ARG A HD3  3  
ATOM 5215  H HE   . ARG A 1 106 ? -18.808 2.667   11.133 1.00 0.00 ? 106 ARG A HE   3  
ATOM 5216  H HH11 . ARG A 1 106 ? -17.283 1.349   14.018 1.00 0.00 ? 106 ARG A HH11 3  
ATOM 5217  H HH12 . ARG A 1 106 ? -18.754 0.687   14.648 1.00 0.00 ? 106 ARG A HH12 3  
ATOM 5218  H HH21 . ARG A 1 106 ? -20.749 1.793   11.964 1.00 0.00 ? 106 ARG A HH21 3  
ATOM 5219  H HH22 . ARG A 1 106 ? -20.739 0.941   13.472 1.00 0.00 ? 106 ARG A HH22 3  
ATOM 5220  N N    . GLU A 1 107 ? -13.187 5.574   15.270 1.00 0.00 ? 107 GLU A N    3  
ATOM 5221  C CA   . GLU A 1 107 ? -12.053 5.071   16.026 1.00 0.00 ? 107 GLU A CA   3  
ATOM 5222  C C    . GLU A 1 107 ? -12.041 5.675   17.432 1.00 0.00 ? 107 GLU A C    3  
ATOM 5223  O O    . GLU A 1 107 ? -12.870 6.526   17.752 1.00 0.00 ? 107 GLU A O    3  
ATOM 5224  C CB   . GLU A 1 107 ? -10.738 5.355   15.296 1.00 0.00 ? 107 GLU A CB   3  
ATOM 5225  C CG   . GLU A 1 107 ? -10.482 6.860   15.194 1.00 0.00 ? 107 GLU A CG   3  
ATOM 5226  C CD   . GLU A 1 107 ? -9.270  7.267   16.034 1.00 0.00 ? 107 GLU A CD   3  
ATOM 5227  O OE1  . GLU A 1 107 ? -8.145  6.919   15.614 1.00 0.00 ? 107 GLU A OE1  3  
ATOM 5228  O OE2  . GLU A 1 107 ? -9.495  7.918   17.077 1.00 0.00 ? 107 GLU A OE2  3  
ATOM 5229  H H    . GLU A 1 107 ? -13.543 6.456   15.579 1.00 0.00 ? 107 GLU A H    3  
ATOM 5230  H HA   . GLU A 1 107 ? -12.201 3.993   16.088 1.00 0.00 ? 107 GLU A HA   3  
ATOM 5231  H HB2  . GLU A 1 107 ? -9.914  4.877   15.825 1.00 0.00 ? 107 GLU A HB2  3  
ATOM 5232  H HB3  . GLU A 1 107 ? -10.771 4.919   14.298 1.00 0.00 ? 107 GLU A HB3  3  
ATOM 5233  H HG2  . GLU A 1 107 ? -10.315 7.134   14.152 1.00 0.00 ? 107 GLU A HG2  3  
ATOM 5234  H HG3  . GLU A 1 107 ? -11.363 7.406   15.531 1.00 0.00 ? 107 GLU A HG3  3  
ATOM 5235  N N    . GLU A 1 108 ? -11.092 5.212   18.232 1.00 0.00 ? 108 GLU A N    3  
ATOM 5236  C CA   . GLU A 1 108 ? -10.962 5.697   19.596 1.00 0.00 ? 108 GLU A CA   3  
ATOM 5237  C C    . GLU A 1 108 ? -9.537  5.470   20.106 1.00 0.00 ? 108 GLU A C    3  
ATOM 5238  O O    . GLU A 1 108 ? -9.041  4.345   20.092 1.00 0.00 ? 108 GLU A O    3  
ATOM 5239  C CB   . GLU A 1 108 ? -11.986 5.028   20.516 1.00 0.00 ? 108 GLU A CB   3  
ATOM 5240  C CG   . GLU A 1 108 ? -13.003 6.046   21.035 1.00 0.00 ? 108 GLU A CG   3  
ATOM 5241  C CD   . GLU A 1 108 ? -13.316 5.804   22.513 1.00 0.00 ? 108 GLU A CD   3  
ATOM 5242  O OE1  . GLU A 1 108 ? -12.527 6.297   23.348 1.00 0.00 ? 108 GLU A OE1  3  
ATOM 5243  O OE2  . GLU A 1 108 ? -14.336 5.131   22.774 1.00 0.00 ? 108 GLU A OE2  3  
ATOM 5244  H H    . GLU A 1 108 ? -10.422 4.520   17.964 1.00 0.00 ? 108 GLU A H    3  
ATOM 5245  H HA   . GLU A 1 108 ? -11.171 6.765   19.545 1.00 0.00 ? 108 GLU A HA   3  
ATOM 5246  H HB2  . GLU A 1 108 ? -12.503 4.236   19.975 1.00 0.00 ? 108 GLU A HB2  3  
ATOM 5247  H HB3  . GLU A 1 108 ? -11.474 4.559   21.356 1.00 0.00 ? 108 GLU A HB3  3  
ATOM 5248  H HG2  . GLU A 1 108 ? -12.613 7.055   20.903 1.00 0.00 ? 108 GLU A HG2  3  
ATOM 5249  H HG3  . GLU A 1 108 ? -13.920 5.980   20.450 1.00 0.00 ? 108 GLU A HG3  3  
ATOM 5250  N N    . SER A 1 109 ? -8.920  6.557   20.544 1.00 0.00 ? 109 SER A N    3  
ATOM 5251  C CA   . SER A 1 109 ? -7.562  6.491   21.058 1.00 0.00 ? 109 SER A CA   3  
ATOM 5252  C C    . SER A 1 109 ? -7.091  7.886   21.473 1.00 0.00 ? 109 SER A C    3  
ATOM 5253  O O    . SER A 1 109 ? -7.400  8.874   20.807 1.00 0.00 ? 109 SER A O    3  
ATOM 5254  C CB   . SER A 1 109 ? -6.609  5.897   20.019 1.00 0.00 ? 109 SER A CB   3  
ATOM 5255  O OG   . SER A 1 109 ? -6.723  6.547   18.756 1.00 0.00 ? 109 SER A OG   3  
ATOM 5256  H H    . SER A 1 109 ? -9.331  7.469   20.553 1.00 0.00 ? 109 SER A H    3  
ATOM 5257  H HA   . SER A 1 109 ? -7.613  5.831   21.923 1.00 0.00 ? 109 SER A HA   3  
ATOM 5258  H HB2  . SER A 1 109 ? -5.583  5.981   20.378 1.00 0.00 ? 109 SER A HB2  3  
ATOM 5259  H HB3  . SER A 1 109 ? -6.819  4.834   19.900 1.00 0.00 ? 109 SER A HB3  3  
ATOM 5260  H HG   . SER A 1 109 ? -5.853  6.974   18.511 1.00 0.00 ? 109 SER A HG   3  
ATOM 5261  N N    . GLY A 1 110 ? -6.352  7.924   22.572 1.00 0.00 ? 110 GLY A N    3  
ATOM 5262  C CA   . GLY A 1 110 ? -5.836  9.182   23.084 1.00 0.00 ? 110 GLY A CA   3  
ATOM 5263  C C    . GLY A 1 110 ? -6.812  9.810   24.080 1.00 0.00 ? 110 GLY A C    3  
ATOM 5264  O O    . GLY A 1 110 ? -7.965  9.392   24.172 1.00 0.00 ? 110 GLY A O    3  
ATOM 5265  H H    . GLY A 1 110 ? -6.105  7.116   23.108 1.00 0.00 ? 110 GLY A H    3  
ATOM 5266  H HA2  . GLY A 1 110 ? -4.874  9.014   23.569 1.00 0.00 ? 110 GLY A HA2  3  
ATOM 5267  H HA3  . GLY A 1 110 ? -5.660  9.871   22.257 1.00 0.00 ? 110 GLY A HA3  3  
ATOM 5268  N N    . SER A 1 111 ? -6.314  10.804  24.801 1.00 0.00 ? 111 SER A N    3  
ATOM 5269  C CA   . SER A 1 111 ? -7.128  11.495  25.787 1.00 0.00 ? 111 SER A CA   3  
ATOM 5270  C C    . SER A 1 111 ? -6.373  12.708  26.332 1.00 0.00 ? 111 SER A C    3  
ATOM 5271  O O    . SER A 1 111 ? -5.186  12.618  26.642 1.00 0.00 ? 111 SER A O    3  
ATOM 5272  C CB   . SER A 1 111 ? -7.521  10.557  26.930 1.00 0.00 ? 111 SER A CB   3  
ATOM 5273  O OG   . SER A 1 111 ? -6.382  10.000  27.580 1.00 0.00 ? 111 SER A OG   3  
ATOM 5274  H H    . SER A 1 111 ? -5.375  11.138  24.720 1.00 0.00 ? 111 SER A H    3  
ATOM 5275  H HA   . SER A 1 111 ? -8.024  11.810  25.252 1.00 0.00 ? 111 SER A HA   3  
ATOM 5276  H HB2  . SER A 1 111 ? -8.122  11.104  27.658 1.00 0.00 ? 111 SER A HB2  3  
ATOM 5277  H HB3  . SER A 1 111 ? -8.146  9.753   26.542 1.00 0.00 ? 111 SER A HB3  3  
ATOM 5278  H HG   . SER A 1 111 ? -5.553  10.472  27.280 1.00 0.00 ? 111 SER A HG   3  
ATOM 5279  N N    . GLY A 1 112 ? -7.092  13.817  26.431 1.00 0.00 ? 112 GLY A N    3  
ATOM 5280  C CA   . GLY A 1 112 ? -6.505  15.047  26.933 1.00 0.00 ? 112 GLY A CA   3  
ATOM 5281  C C    . GLY A 1 112 ? -7.290  15.580  28.134 1.00 0.00 ? 112 GLY A C    3  
ATOM 5282  O O    . GLY A 1 112 ? -7.465  14.877  29.127 1.00 0.00 ? 112 GLY A O    3  
ATOM 5283  H H    . GLY A 1 112 ? -8.057  13.882  26.177 1.00 0.00 ? 112 GLY A H    3  
ATOM 5284  H HA2  . GLY A 1 112 ? -5.469  14.869  27.222 1.00 0.00 ? 112 GLY A HA2  3  
ATOM 5285  H HA3  . GLY A 1 112 ? -6.490  15.797  26.142 1.00 0.00 ? 112 GLY A HA3  3  
ATOM 5286  N N    . PRO A 1 113 ? -7.754  16.851  27.998 1.00 0.00 ? 113 PRO A N    3  
ATOM 5287  C CA   . PRO A 1 113 ? -8.516  17.487  29.060 1.00 0.00 ? 113 PRO A CA   3  
ATOM 5288  C C    . PRO A 1 113 ? -9.943  16.935  29.116 1.00 0.00 ? 113 PRO A C    3  
ATOM 5289  O O    . PRO A 1 113 ? -10.476 16.479  28.105 1.00 0.00 ? 113 PRO A O    3  
ATOM 5290  C CB   . PRO A 1 113 ? -8.466  18.973  28.745 1.00 0.00 ? 113 PRO A CB   3  
ATOM 5291  C CG   . PRO A 1 113 ? -8.078  19.075  27.279 1.00 0.00 ? 113 PRO A CG   3  
ATOM 5292  C CD   . PRO A 1 113 ? -7.566  17.714  26.836 1.00 0.00 ? 113 PRO A CD   3  
ATOM 5293  H HA   . PRO A 1 113 ? -8.109  17.282  29.950 1.00 0.00 ? 113 PRO A HA   3  
ATOM 5294  H HB2  . PRO A 1 113 ? -9.432  19.443  28.927 1.00 0.00 ? 113 PRO A HB2  3  
ATOM 5295  H HB3  . PRO A 1 113 ? -7.740  19.482  29.378 1.00 0.00 ? 113 PRO A HB3  3  
ATOM 5296  H HG2  . PRO A 1 113 ? -8.935  19.375  26.677 1.00 0.00 ? 113 PRO A HG2  3  
ATOM 5297  H HG3  . PRO A 1 113 ? -7.309  19.836  27.140 1.00 0.00 ? 113 PRO A HG3  3  
ATOM 5298  H HD2  . PRO A 1 113 ? -8.120  17.344  25.974 1.00 0.00 ? 113 PRO A HD2  3  
ATOM 5299  H HD3  . PRO A 1 113 ? -6.517  17.762  26.544 1.00 0.00 ? 113 PRO A HD3  3  
ATOM 5300  N N    . SER A 1 114 ? -10.519 16.995  30.307 1.00 0.00 ? 114 SER A N    3  
ATOM 5301  C CA   . SER A 1 114 ? -11.873 16.507  30.508 1.00 0.00 ? 114 SER A CA   3  
ATOM 5302  C C    . SER A 1 114 ? -12.818 17.680  30.777 1.00 0.00 ? 114 SER A C    3  
ATOM 5303  O O    . SER A 1 114 ? -13.782 17.886  30.041 1.00 0.00 ? 114 SER A O    3  
ATOM 5304  C CB   . SER A 1 114 ? -11.932 15.504  31.662 1.00 0.00 ? 114 SER A CB   3  
ATOM 5305  O OG   . SER A 1 114 ? -13.196 14.851  31.738 1.00 0.00 ? 114 SER A OG   3  
ATOM 5306  H H    . SER A 1 114 ? -10.079 17.367  31.124 1.00 0.00 ? 114 SER A H    3  
ATOM 5307  H HA   . SER A 1 114 ? -12.141 16.006  29.578 1.00 0.00 ? 114 SER A HA   3  
ATOM 5308  H HB2  . SER A 1 114 ? -11.146 14.759  31.535 1.00 0.00 ? 114 SER A HB2  3  
ATOM 5309  H HB3  . SER A 1 114 ? -11.733 16.020  32.601 1.00 0.00 ? 114 SER A HB3  3  
ATOM 5310  H HG   . SER A 1 114 ? -13.654 15.091  32.594 1.00 0.00 ? 114 SER A HG   3  
ATOM 5311  N N    . SER A 1 115 ? -12.507 18.419  31.832 1.00 0.00 ? 115 SER A N    3  
ATOM 5312  C CA   . SER A 1 115 ? -13.317 19.566  32.207 1.00 0.00 ? 115 SER A CA   3  
ATOM 5313  C C    . SER A 1 115 ? -12.745 20.837  31.576 1.00 0.00 ? 115 SER A C    3  
ATOM 5314  O O    . SER A 1 115 ? -12.046 21.603  32.238 1.00 0.00 ? 115 SER A O    3  
ATOM 5315  C CB   . SER A 1 115 ? -13.390 19.715  33.728 1.00 0.00 ? 115 SER A CB   3  
ATOM 5316  O OG   . SER A 1 115 ? -13.984 18.577  34.348 1.00 0.00 ? 115 SER A OG   3  
ATOM 5317  H H    . SER A 1 115 ? -11.721 18.244  32.425 1.00 0.00 ? 115 SER A H    3  
ATOM 5318  H HA   . SER A 1 115 ? -14.312 19.358  31.814 1.00 0.00 ? 115 SER A HA   3  
ATOM 5319  H HB2  . SER A 1 115 ? -12.386 19.862  34.127 1.00 0.00 ? 115 SER A HB2  3  
ATOM 5320  H HB3  . SER A 1 115 ? -13.966 20.606  33.978 1.00 0.00 ? 115 SER A HB3  3  
ATOM 5321  H HG   . SER A 1 115 ? -13.751 17.749  33.838 1.00 0.00 ? 115 SER A HG   3  
ATOM 5322  N N    . GLY A 1 116 ? -13.065 21.024  30.304 1.00 0.00 ? 116 GLY A N    3  
ATOM 5323  C CA   . GLY A 1 116 ? -12.593 22.189  29.576 1.00 0.00 ? 116 GLY A CA   3  
ATOM 5324  C C    . GLY A 1 116 ? -13.492 22.487  28.375 1.00 0.00 ? 116 GLY A C    3  
ATOM 5325  O O    . GLY A 1 116 ? -13.046 23.078  27.393 1.00 0.00 ? 116 GLY A O    3  
ATOM 5326  H H    . GLY A 1 116 ? -13.635 20.396  29.773 1.00 0.00 ? 116 GLY A H    3  
ATOM 5327  H HA2  . GLY A 1 116 ? -12.570 23.053  30.241 1.00 0.00 ? 116 GLY A HA2  3  
ATOM 5328  H HA3  . GLY A 1 116 ? -11.571 22.021  29.237 1.00 0.00 ? 116 GLY A HA3  3  
ATOM 5329  N N    . GLY A 1 1   ? -38.924 -11.839 18.375 1.00 0.00 ? 1   GLY A N    4  
ATOM 5330  C CA   . GLY A 1 1   ? -38.250 -10.592 18.054 1.00 0.00 ? 1   GLY A CA   4  
ATOM 5331  C C    . GLY A 1 1   ? -38.955 -9.403  18.710 1.00 0.00 ? 1   GLY A C    4  
ATOM 5332  O O    . GLY A 1 1   ? -40.120 -9.502  19.093 1.00 0.00 ? 1   GLY A O    4  
ATOM 5333  H H1   . GLY A 1 1   ? -39.633 -12.114 17.726 1.00 0.00 ? 1   GLY A H1   4  
ATOM 5334  H HA2  . GLY A 1 1   ? -37.215 -10.637 18.392 1.00 0.00 ? 1   GLY A HA2  4  
ATOM 5335  H HA3  . GLY A 1 1   ? -38.227 -10.454 16.973 1.00 0.00 ? 1   GLY A HA3  4  
ATOM 5336  N N    . SER A 1 2   ? -38.220 -8.306  18.819 1.00 0.00 ? 2   SER A N    4  
ATOM 5337  C CA   . SER A 1 2   ? -38.760 -7.100  19.421 1.00 0.00 ? 2   SER A CA   4  
ATOM 5338  C C    . SER A 1 2   ? -37.787 -5.935  19.223 1.00 0.00 ? 2   SER A C    4  
ATOM 5339  O O    . SER A 1 2   ? -36.578 -6.141  19.128 1.00 0.00 ? 2   SER A O    4  
ATOM 5340  C CB   . SER A 1 2   ? -39.043 -7.307  20.911 1.00 0.00 ? 2   SER A CB   4  
ATOM 5341  O OG   . SER A 1 2   ? -40.198 -6.590  21.339 1.00 0.00 ? 2   SER A OG   4  
ATOM 5342  H H    . SER A 1 2   ? -37.273 -8.234  18.504 1.00 0.00 ? 2   SER A H    4  
ATOM 5343  H HA   . SER A 1 2   ? -39.696 -6.909  18.897 1.00 0.00 ? 2   SER A HA   4  
ATOM 5344  H HB2  . SER A 1 2   ? -39.181 -8.370  21.109 1.00 0.00 ? 2   SER A HB2  4  
ATOM 5345  H HB3  . SER A 1 2   ? -38.179 -6.985  21.492 1.00 0.00 ? 2   SER A HB3  4  
ATOM 5346  H HG   . SER A 1 2   ? -40.192 -5.669  20.951 1.00 0.00 ? 2   SER A HG   4  
ATOM 5347  N N    . SER A 1 3   ? -38.351 -4.738  19.167 1.00 0.00 ? 3   SER A N    4  
ATOM 5348  C CA   . SER A 1 3   ? -37.549 -3.540  18.982 1.00 0.00 ? 3   SER A CA   4  
ATOM 5349  C C    . SER A 1 3   ? -36.889 -3.561  17.602 1.00 0.00 ? 3   SER A C    4  
ATOM 5350  O O    . SER A 1 3   ? -36.635 -4.629  17.047 1.00 0.00 ? 3   SER A O    4  
ATOM 5351  C CB   . SER A 1 3   ? -36.488 -3.414  20.076 1.00 0.00 ? 3   SER A CB   4  
ATOM 5352  O OG   . SER A 1 3   ? -35.874 -2.128  20.079 1.00 0.00 ? 3   SER A OG   4  
ATOM 5353  H H    . SER A 1 3   ? -39.336 -4.579  19.245 1.00 0.00 ? 3   SER A H    4  
ATOM 5354  H HA   . SER A 1 3   ? -38.250 -2.709  19.058 1.00 0.00 ? 3   SER A HA   4  
ATOM 5355  H HB2  . SER A 1 3   ? -36.945 -3.600  21.048 1.00 0.00 ? 3   SER A HB2  4  
ATOM 5356  H HB3  . SER A 1 3   ? -35.725 -4.179  19.931 1.00 0.00 ? 3   SER A HB3  4  
ATOM 5357  H HG   . SER A 1 3   ? -34.894 -2.216  19.900 1.00 0.00 ? 3   SER A HG   4  
ATOM 5358  N N    . GLY A 1 4   ? -36.631 -2.368  17.087 1.00 0.00 ? 4   GLY A N    4  
ATOM 5359  C CA   . GLY A 1 4   ? -36.005 -2.236  15.782 1.00 0.00 ? 4   GLY A CA   4  
ATOM 5360  C C    . GLY A 1 4   ? -35.462 -0.820  15.575 1.00 0.00 ? 4   GLY A C    4  
ATOM 5361  O O    . GLY A 1 4   ? -35.864 0.111   16.271 1.00 0.00 ? 4   GLY A O    4  
ATOM 5362  H H    . GLY A 1 4   ? -36.841 -1.504  17.544 1.00 0.00 ? 4   GLY A H    4  
ATOM 5363  H HA2  . GLY A 1 4   ? -35.194 -2.958  15.688 1.00 0.00 ? 4   GLY A HA2  4  
ATOM 5364  H HA3  . GLY A 1 4   ? -36.730 -2.468  15.002 1.00 0.00 ? 4   GLY A HA3  4  
ATOM 5365  N N    . SER A 1 5   ? -34.556 -0.703  14.616 1.00 0.00 ? 5   SER A N    4  
ATOM 5366  C CA   . SER A 1 5   ? -33.953 0.583   14.309 1.00 0.00 ? 5   SER A CA   4  
ATOM 5367  C C    . SER A 1 5   ? -33.083 0.468   13.056 1.00 0.00 ? 5   SER A C    4  
ATOM 5368  O O    . SER A 1 5   ? -32.770 -0.636  12.613 1.00 0.00 ? 5   SER A O    4  
ATOM 5369  C CB   . SER A 1 5   ? -33.122 1.097   15.487 1.00 0.00 ? 5   SER A CB   4  
ATOM 5370  O OG   . SER A 1 5   ? -33.807 2.107   16.223 1.00 0.00 ? 5   SER A OG   4  
ATOM 5371  H H    . SER A 1 5   ? -34.234 -1.465  14.054 1.00 0.00 ? 5   SER A H    4  
ATOM 5372  H HA   . SER A 1 5   ? -34.790 1.259   14.133 1.00 0.00 ? 5   SER A HA   4  
ATOM 5373  H HB2  . SER A 1 5   ? -32.880 0.266   16.149 1.00 0.00 ? 5   SER A HB2  4  
ATOM 5374  H HB3  . SER A 1 5   ? -32.178 1.496   15.117 1.00 0.00 ? 5   SER A HB3  4  
ATOM 5375  H HG   . SER A 1 5   ? -33.889 1.834   17.182 1.00 0.00 ? 5   SER A HG   4  
ATOM 5376  N N    . SER A 1 6   ? -32.717 1.623   12.520 1.00 0.00 ? 6   SER A N    4  
ATOM 5377  C CA   . SER A 1 6   ? -31.889 1.665   11.327 1.00 0.00 ? 6   SER A CA   4  
ATOM 5378  C C    . SER A 1 6   ? -30.696 2.597   11.550 1.00 0.00 ? 6   SER A C    4  
ATOM 5379  O O    . SER A 1 6   ? -29.546 2.170   11.463 1.00 0.00 ? 6   SER A O    4  
ATOM 5380  C CB   . SER A 1 6   ? -32.698 2.120   10.110 1.00 0.00 ? 6   SER A CB   4  
ATOM 5381  O OG   . SER A 1 6   ? -32.761 1.114   9.104  1.00 0.00 ? 6   SER A OG   4  
ATOM 5382  H H    . SER A 1 6   ? -32.976 2.516   12.886 1.00 0.00 ? 6   SER A H    4  
ATOM 5383  H HA   . SER A 1 6   ? -31.550 0.640   11.174 1.00 0.00 ? 6   SER A HA   4  
ATOM 5384  H HB2  . SER A 1 6   ? -33.709 2.382   10.425 1.00 0.00 ? 6   SER A HB2  4  
ATOM 5385  H HB3  . SER A 1 6   ? -32.250 3.022   9.694  1.00 0.00 ? 6   SER A HB3  4  
ATOM 5386  H HG   . SER A 1 6   ? -33.505 0.476   9.304  1.00 0.00 ? 6   SER A HG   4  
ATOM 5387  N N    . GLY A 1 7   ? -31.012 3.852   11.833 1.00 0.00 ? 7   GLY A N    4  
ATOM 5388  C CA   . GLY A 1 7   ? -29.981 4.848   12.069 1.00 0.00 ? 7   GLY A CA   4  
ATOM 5389  C C    . GLY A 1 7   ? -29.120 5.053   10.821 1.00 0.00 ? 7   GLY A C    4  
ATOM 5390  O O    . GLY A 1 7   ? -28.404 4.146   10.400 1.00 0.00 ? 7   GLY A O    4  
ATOM 5391  H H    . GLY A 1 7   ? -31.951 4.191   11.902 1.00 0.00 ? 7   GLY A H    4  
ATOM 5392  H HA2  . GLY A 1 7   ? -30.442 5.793   12.357 1.00 0.00 ? 7   GLY A HA2  4  
ATOM 5393  H HA3  . GLY A 1 7   ? -29.351 4.534   12.902 1.00 0.00 ? 7   GLY A HA3  4  
ATOM 5394  N N    . MET A 1 8   ? -29.219 6.251   10.264 1.00 0.00 ? 8   MET A N    4  
ATOM 5395  C CA   . MET A 1 8   ? -28.458 6.587   9.072  1.00 0.00 ? 8   MET A CA   4  
ATOM 5396  C C    . MET A 1 8   ? -27.183 7.353   9.433  1.00 0.00 ? 8   MET A C    4  
ATOM 5397  O O    . MET A 1 8   ? -27.009 7.772   10.576 1.00 0.00 ? 8   MET A O    4  
ATOM 5398  C CB   . MET A 1 8   ? -29.320 7.440   8.140  1.00 0.00 ? 8   MET A CB   4  
ATOM 5399  C CG   . MET A 1 8   ? -30.274 6.567   7.322  1.00 0.00 ? 8   MET A CG   4  
ATOM 5400  S SD   . MET A 1 8   ? -31.893 7.317   7.267  1.00 0.00 ? 8   MET A SD   4  
ATOM 5401  C CE   . MET A 1 8   ? -32.348 7.200   8.989  1.00 0.00 ? 8   MET A CE   4  
ATOM 5402  H H    . MET A 1 8   ? -29.803 6.984   10.612 1.00 0.00 ? 8   MET A H    4  
ATOM 5403  H HA   . MET A 1 8   ? -28.200 5.633   8.611  1.00 0.00 ? 8   MET A HA   4  
ATOM 5404  H HB2  . MET A 1 8   ? -29.892 8.160   8.725  1.00 0.00 ? 8   MET A HB2  4  
ATOM 5405  H HB3  . MET A 1 8   ? -28.680 8.012   7.468  1.00 0.00 ? 8   MET A HB3  4  
ATOM 5406  H HG2  . MET A 1 8   ? -29.888 6.440   6.311  1.00 0.00 ? 8   MET A HG2  4  
ATOM 5407  H HG3  . MET A 1 8   ? -30.340 5.573   7.765  1.00 0.00 ? 8   MET A HG3  4  
ATOM 5408  H HE1  . MET A 1 8   ? -33.183 6.508   9.098  1.00 0.00 ? 8   MET A HE1  4  
ATOM 5409  H HE2  . MET A 1 8   ? -31.497 6.836   9.566  1.00 0.00 ? 8   MET A HE2  4  
ATOM 5410  H HE3  . MET A 1 8   ? -32.641 8.184   9.356  1.00 0.00 ? 8   MET A HE3  4  
ATOM 5411  N N    . GLU A 1 9   ? -26.325 7.512   8.436  1.00 0.00 ? 9   GLU A N    4  
ATOM 5412  C CA   . GLU A 1 9   ? -25.072 8.220   8.634  1.00 0.00 ? 9   GLU A CA   4  
ATOM 5413  C C    . GLU A 1 9   ? -24.863 9.250   7.522  1.00 0.00 ? 9   GLU A C    4  
ATOM 5414  O O    . GLU A 1 9   ? -24.323 8.928   6.465  1.00 0.00 ? 9   GLU A O    4  
ATOM 5415  C CB   . GLU A 1 9   ? -23.896 7.244   8.704  1.00 0.00 ? 9   GLU A CB   4  
ATOM 5416  C CG   . GLU A 1 9   ? -23.383 7.105   10.139 1.00 0.00 ? 9   GLU A CG   4  
ATOM 5417  C CD   . GLU A 1 9   ? -24.368 6.311   10.999 1.00 0.00 ? 9   GLU A CD   4  
ATOM 5418  O OE1  . GLU A 1 9   ? -24.764 5.216   10.543 1.00 0.00 ? 9   GLU A OE1  4  
ATOM 5419  O OE2  . GLU A 1 9   ? -24.703 6.816   12.092 1.00 0.00 ? 9   GLU A OE2  4  
ATOM 5420  H H    . GLU A 1 9   ? -26.475 7.168   7.509  1.00 0.00 ? 9   GLU A H    4  
ATOM 5421  H HA   . GLU A 1 9   ? -25.174 8.726   9.594  1.00 0.00 ? 9   GLU A HA   4  
ATOM 5422  H HB2  . GLU A 1 9   ? -24.205 6.268   8.329  1.00 0.00 ? 9   GLU A HB2  4  
ATOM 5423  H HB3  . GLU A 1 9   ? -23.090 7.592   8.058  1.00 0.00 ? 9   GLU A HB3  4  
ATOM 5424  H HG2  . GLU A 1 9   ? -22.414 6.607   10.136 1.00 0.00 ? 9   GLU A HG2  4  
ATOM 5425  H HG3  . GLU A 1 9   ? -23.233 8.094   10.572 1.00 0.00 ? 9   GLU A HG3  4  
ATOM 5426  N N    . LYS A 1 10  ? -25.303 10.469  7.799  1.00 0.00 ? 10  LYS A N    4  
ATOM 5427  C CA   . LYS A 1 10  ? -25.171 11.549  6.835  1.00 0.00 ? 10  LYS A CA   4  
ATOM 5428  C C    . LYS A 1 10  ? -25.620 12.861  7.482  1.00 0.00 ? 10  LYS A C    4  
ATOM 5429  O O    . LYS A 1 10  ? -26.754 13.297  7.286  1.00 0.00 ? 10  LYS A O    4  
ATOM 5430  C CB   . LYS A 1 10  ? -25.920 11.211  5.545  1.00 0.00 ? 10  LYS A CB   4  
ATOM 5431  C CG   . LYS A 1 10  ? -25.134 11.672  4.317  1.00 0.00 ? 10  LYS A CG   4  
ATOM 5432  C CD   . LYS A 1 10  ? -25.464 13.125  3.968  1.00 0.00 ? 10  LYS A CD   4  
ATOM 5433  C CE   . LYS A 1 10  ? -26.498 13.197  2.843  1.00 0.00 ? 10  LYS A CE   4  
ATOM 5434  N NZ   . LYS A 1 10  ? -27.196 14.502  2.863  1.00 0.00 ? 10  LYS A NZ   4  
ATOM 5435  H H    . LYS A 1 10  ? -25.741 10.723  8.661  1.00 0.00 ? 10  LYS A H    4  
ATOM 5436  H HA   . LYS A 1 10  ? -24.114 11.633  6.582  1.00 0.00 ? 10  LYS A HA   4  
ATOM 5437  H HB2  . LYS A 1 10  ? -26.090 10.135  5.490  1.00 0.00 ? 10  LYS A HB2  4  
ATOM 5438  H HB3  . LYS A 1 10  ? -26.901 11.687  5.554  1.00 0.00 ? 10  LYS A HB3  4  
ATOM 5439  H HG2  . LYS A 1 10  ? -24.065 11.574  4.507  1.00 0.00 ? 10  LYS A HG2  4  
ATOM 5440  H HG3  . LYS A 1 10  ? -25.367 11.028  3.469  1.00 0.00 ? 10  LYS A HG3  4  
ATOM 5441  H HD2  . LYS A 1 10  ? -25.846 13.637  4.851  1.00 0.00 ? 10  LYS A HD2  4  
ATOM 5442  H HD3  . LYS A 1 10  ? -24.555 13.645  3.666  1.00 0.00 ? 10  LYS A HD3  4  
ATOM 5443  H HE2  . LYS A 1 10  ? -26.007 13.055  1.880  1.00 0.00 ? 10  LYS A HE2  4  
ATOM 5444  H HE3  . LYS A 1 10  ? -27.221 12.389  2.953  1.00 0.00 ? 10  LYS A HE3  4  
ATOM 5445  H HZ1  . LYS A 1 10  ? -27.620 14.667  1.973  1.00 0.00 ? 10  LYS A HZ1  4  
ATOM 5446  H HZ2  . LYS A 1 10  ? -27.901 14.491  3.572  1.00 0.00 ? 10  LYS A HZ2  4  
ATOM 5447  H HZ3  . LYS A 1 10  ? -26.538 15.229  3.058  1.00 0.00 ? 10  LYS A HZ3  4  
ATOM 5448  N N    . THR A 1 11  ? -24.708 13.454  8.238  1.00 0.00 ? 11  THR A N    4  
ATOM 5449  C CA   . THR A 1 11  ? -24.996 14.707  8.914  1.00 0.00 ? 11  THR A CA   4  
ATOM 5450  C C    . THR A 1 11  ? -23.920 15.746  8.594  1.00 0.00 ? 11  THR A C    4  
ATOM 5451  O O    . THR A 1 11  ? -23.245 16.244  9.494  1.00 0.00 ? 11  THR A O    4  
ATOM 5452  C CB   . THR A 1 11  ? -25.134 14.417  10.410 1.00 0.00 ? 11  THR A CB   4  
ATOM 5453  O OG1  . THR A 1 11  ? -23.942 13.709  10.738 1.00 0.00 ? 11  THR A OG1  4  
ATOM 5454  C CG2  . THR A 1 11  ? -26.255 13.419  10.712 1.00 0.00 ? 11  THR A CG2  4  
ATOM 5455  H H    . THR A 1 11  ? -23.788 13.093  8.392  1.00 0.00 ? 11  THR A H    4  
ATOM 5456  H HA   . THR A 1 11  ? -25.940 15.096  8.530  1.00 0.00 ? 11  THR A HA   4  
ATOM 5457  H HB   . THR A 1 11  ? -25.271 15.339  10.975 1.00 0.00 ? 11  THR A HB   4  
ATOM 5458  H HG1  . THR A 1 11  ? -23.721 13.839  11.704 1.00 0.00 ? 11  THR A HG1  4  
ATOM 5459  H HG21 . THR A 1 11  ? -27.165 13.729  10.198 1.00 0.00 ? 11  THR A HG21 4  
ATOM 5460  H HG22 . THR A 1 11  ? -25.961 12.428  10.366 1.00 0.00 ? 11  THR A HG22 4  
ATOM 5461  H HG23 . THR A 1 11  ? -26.436 13.391  11.786 1.00 0.00 ? 11  THR A HG23 4  
ATOM 5462  N N    . LEU A 1 12  ? -23.792 16.042  7.309  1.00 0.00 ? 12  LEU A N    4  
ATOM 5463  C CA   . LEU A 1 12  ? -22.809 17.013  6.858  1.00 0.00 ? 12  LEU A CA   4  
ATOM 5464  C C    . LEU A 1 12  ? -21.418 16.576  7.322  1.00 0.00 ? 12  LEU A C    4  
ATOM 5465  O O    . LEU A 1 12  ? -21.286 15.620  8.085  1.00 0.00 ? 12  LEU A O    4  
ATOM 5466  C CB   . LEU A 1 12  ? -23.197 18.420  7.316  1.00 0.00 ? 12  LEU A CB   4  
ATOM 5467  C CG   . LEU A 1 12  ? -23.940 19.278  6.291  1.00 0.00 ? 12  LEU A CG   4  
ATOM 5468  C CD1  . LEU A 1 12  ? -25.454 19.105  6.425  1.00 0.00 ? 12  LEU A CD1  4  
ATOM 5469  C CD2  . LEU A 1 12  ? -23.519 20.746  6.396  1.00 0.00 ? 12  LEU A CD2  4  
ATOM 5470  H H    . LEU A 1 12  ? -24.345 15.633  6.583  1.00 0.00 ? 12  LEU A H    4  
ATOM 5471  H HA   . LEU A 1 12  ? -22.826 17.012  5.768  1.00 0.00 ? 12  LEU A HA   4  
ATOM 5472  H HB2  . LEU A 1 12  ? -23.819 18.332  8.207  1.00 0.00 ? 12  LEU A HB2  4  
ATOM 5473  H HB3  . LEU A 1 12  ? -22.289 18.947  7.612  1.00 0.00 ? 12  LEU A HB3  4  
ATOM 5474  H HG   . LEU A 1 12  ? -23.664 18.935  5.294  1.00 0.00 ? 12  LEU A HG   4  
ATOM 5475  H HD11 . LEU A 1 12  ? -25.806 19.651  7.301  1.00 0.00 ? 12  LEU A HD11 4  
ATOM 5476  H HD12 . LEU A 1 12  ? -25.945 19.495  5.534  1.00 0.00 ? 12  LEU A HD12 4  
ATOM 5477  H HD13 . LEU A 1 12  ? -25.690 18.047  6.537  1.00 0.00 ? 12  LEU A HD13 4  
ATOM 5478  H HD21 . LEU A 1 12  ? -24.367 21.344  6.728  1.00 0.00 ? 12  LEU A HD21 4  
ATOM 5479  H HD22 . LEU A 1 12  ? -22.704 20.839  7.114  1.00 0.00 ? 12  LEU A HD22 4  
ATOM 5480  H HD23 . LEU A 1 12  ? -23.186 21.099  5.420  1.00 0.00 ? 12  LEU A HD23 4  
ATOM 5481  N N    . GLU A 1 13  ? -20.416 17.297  6.842  1.00 0.00 ? 13  GLU A N    4  
ATOM 5482  C CA   . GLU A 1 13  ? -19.040 16.996  7.198  1.00 0.00 ? 13  GLU A CA   4  
ATOM 5483  C C    . GLU A 1 13  ? -18.484 18.076  8.130  1.00 0.00 ? 13  GLU A C    4  
ATOM 5484  O O    . GLU A 1 13  ? -19.150 19.075  8.394  1.00 0.00 ? 13  GLU A O    4  
ATOM 5485  C CB   . GLU A 1 13  ? -18.169 16.849  5.949  1.00 0.00 ? 13  GLU A CB   4  
ATOM 5486  C CG   . GLU A 1 13  ? -17.575 15.443  5.856  1.00 0.00 ? 13  GLU A CG   4  
ATOM 5487  C CD   . GLU A 1 13  ? -18.611 14.443  5.339  1.00 0.00 ? 13  GLU A CD   4  
ATOM 5488  O OE1  . GLU A 1 13  ? -19.742 14.470  5.872  1.00 0.00 ? 13  GLU A OE1  4  
ATOM 5489  O OE2  . GLU A 1 13  ? -18.250 13.674  4.422  1.00 0.00 ? 13  GLU A OE2  4  
ATOM 5490  H H    . GLU A 1 13  ? -20.532 18.073  6.222  1.00 0.00 ? 13  GLU A H    4  
ATOM 5491  H HA   . GLU A 1 13  ? -19.078 16.041  7.721  1.00 0.00 ? 13  GLU A HA   4  
ATOM 5492  H HB2  . GLU A 1 13  ? -18.766 17.055  5.060  1.00 0.00 ? 13  GLU A HB2  4  
ATOM 5493  H HB3  . GLU A 1 13  ? -17.366 17.586  5.971  1.00 0.00 ? 13  GLU A HB3  4  
ATOM 5494  H HG2  . GLU A 1 13  ? -16.710 15.452  5.193  1.00 0.00 ? 13  GLU A HG2  4  
ATOM 5495  H HG3  . GLU A 1 13  ? -17.220 15.129  6.838  1.00 0.00 ? 13  GLU A HG3  4  
ATOM 5496  N N    . THR A 1 14  ? -17.269 17.837  8.602  1.00 0.00 ? 14  THR A N    4  
ATOM 5497  C CA   . THR A 1 14  ? -16.617 18.776  9.498  1.00 0.00 ? 14  THR A CA   4  
ATOM 5498  C C    . THR A 1 14  ? -15.615 19.639  8.729  1.00 0.00 ? 14  THR A C    4  
ATOM 5499  O O    . THR A 1 14  ? -14.449 19.731  9.109  1.00 0.00 ? 14  THR A O    4  
ATOM 5500  C CB   . THR A 1 14  ? -15.982 17.978  10.638 1.00 0.00 ? 14  THR A CB   4  
ATOM 5501  O OG1  . THR A 1 14  ? -15.448 18.976  11.505 1.00 0.00 ? 14  THR A OG1  4  
ATOM 5502  C CG2  . THR A 1 14  ? -14.756 17.183  10.185 1.00 0.00 ? 14  THR A CG2  4  
ATOM 5503  H H    . THR A 1 14  ? -16.734 17.021  8.382  1.00 0.00 ? 14  THR A H    4  
ATOM 5504  H HA   . THR A 1 14  ? -17.374 19.449  9.902  1.00 0.00 ? 14  THR A HA   4  
ATOM 5505  H HB   . THR A 1 14  ? -16.715 17.326  11.113 1.00 0.00 ? 14  THR A HB   4  
ATOM 5506  H HG1  . THR A 1 14  ? -14.693 19.452  11.054 1.00 0.00 ? 14  THR A HG1  4  
ATOM 5507  H HG21 . THR A 1 14  ? -14.501 17.460  9.162  1.00 0.00 ? 14  THR A HG21 4  
ATOM 5508  H HG22 . THR A 1 14  ? -13.915 17.407  10.842 1.00 0.00 ? 14  THR A HG22 4  
ATOM 5509  H HG23 . THR A 1 14  ? -14.977 16.117  10.228 1.00 0.00 ? 14  THR A HG23 4  
ATOM 5510  N N    . VAL A 1 15  ? -16.106 20.249  7.660  1.00 0.00 ? 15  VAL A N    4  
ATOM 5511  C CA   . VAL A 1 15  ? -15.268 21.102  6.834  1.00 0.00 ? 15  VAL A CA   4  
ATOM 5512  C C    . VAL A 1 15  ? -14.049 20.307  6.361  1.00 0.00 ? 15  VAL A C    4  
ATOM 5513  O O    . VAL A 1 15  ? -13.697 19.290  6.957  1.00 0.00 ? 15  VAL A O    4  
ATOM 5514  C CB   . VAL A 1 15  ? -14.894 22.371  7.602  1.00 0.00 ? 15  VAL A CB   4  
ATOM 5515  C CG1  . VAL A 1 15  ? -16.112 22.958  8.318  1.00 0.00 ? 15  VAL A CG1  4  
ATOM 5516  C CG2  . VAL A 1 15  ? -13.756 22.099  8.588  1.00 0.00 ? 15  VAL A CG2  4  
ATOM 5517  H H    . VAL A 1 15  ? -17.056 20.169  7.357  1.00 0.00 ? 15  VAL A H    4  
ATOM 5518  H HA   . VAL A 1 15  ? -15.854 21.395  5.963  1.00 0.00 ? 15  VAL A HA   4  
ATOM 5519  H HB   . VAL A 1 15  ? -14.542 23.108  6.880  1.00 0.00 ? 15  VAL A HB   4  
ATOM 5520  H HG11 . VAL A 1 15  ? -17.022 22.619  7.823  1.00 0.00 ? 15  VAL A HG11 4  
ATOM 5521  H HG12 . VAL A 1 15  ? -16.118 22.626  9.356  1.00 0.00 ? 15  VAL A HG12 4  
ATOM 5522  H HG13 . VAL A 1 15  ? -16.063 24.046  8.284  1.00 0.00 ? 15  VAL A HG13 4  
ATOM 5523  H HG21 . VAL A 1 15  ? -13.153 21.266  8.227  1.00 0.00 ? 15  VAL A HG21 4  
ATOM 5524  H HG22 . VAL A 1 15  ? -13.132 22.988  8.677  1.00 0.00 ? 15  VAL A HG22 4  
ATOM 5525  H HG23 . VAL A 1 15  ? -14.173 21.849  9.564  1.00 0.00 ? 15  VAL A HG23 4  
ATOM 5526  N N    . PRO A 1 16  ? -13.421 20.814  5.267  1.00 0.00 ? 16  PRO A N    4  
ATOM 5527  C CA   . PRO A 1 16  ? -12.249 20.163  4.708  1.00 0.00 ? 16  PRO A CA   4  
ATOM 5528  C C    . PRO A 1 16  ? -11.014 20.417  5.576  1.00 0.00 ? 16  PRO A C    4  
ATOM 5529  O O    . PRO A 1 16  ? -10.270 19.489  5.888  1.00 0.00 ? 16  PRO A O    4  
ATOM 5530  C CB   . PRO A 1 16  ? -12.115 20.732  3.304  1.00 0.00 ? 16  PRO A CB   4  
ATOM 5531  C CG   . PRO A 1 16  ? -12.932 22.013  3.294  1.00 0.00 ? 16  PRO A CG   4  
ATOM 5532  C CD   . PRO A 1 16  ? -13.809 22.017  4.535  1.00 0.00 ? 16  PRO A CD   4  
ATOM 5533  H HA   . PRO A 1 16  ? -12.375 19.171  4.695  1.00 0.00 ? 16  PRO A HA   4  
ATOM 5534  H HB2  . PRO A 1 16  ? -11.071 20.932  3.062  1.00 0.00 ? 16  PRO A HB2  4  
ATOM 5535  H HB3  . PRO A 1 16  ? -12.485 20.026  2.560  1.00 0.00 ? 16  PRO A HB3  4  
ATOM 5536  H HG2  . PRO A 1 16  ? -12.276 22.884  3.287  1.00 0.00 ? 16  PRO A HG2  4  
ATOM 5537  H HG3  . PRO A 1 16  ? -13.544 22.068  2.393  1.00 0.00 ? 16  PRO A HG3  4  
ATOM 5538  H HD2  . PRO A 1 16  ? -13.647 22.914  5.133  1.00 0.00 ? 16  PRO A HD2  4  
ATOM 5539  H HD3  . PRO A 1 16  ? -14.867 21.996  4.272  1.00 0.00 ? 16  PRO A HD3  4  
ATOM 5540  N N    . LEU A 1 17  ? -10.836 21.678  5.940  1.00 0.00 ? 17  LEU A N    4  
ATOM 5541  C CA   . LEU A 1 17  ? -9.705  22.065  6.766  1.00 0.00 ? 17  LEU A CA   4  
ATOM 5542  C C    . LEU A 1 17  ? -9.942  23.471  7.322  1.00 0.00 ? 17  LEU A C    4  
ATOM 5543  O O    . LEU A 1 17  ? -10.595 24.293  6.682  1.00 0.00 ? 17  LEU A O    4  
ATOM 5544  C CB   . LEU A 1 17  ? -8.397  21.927  5.983  1.00 0.00 ? 17  LEU A CB   4  
ATOM 5545  C CG   . LEU A 1 17  ? -7.127  22.361  6.717  1.00 0.00 ? 17  LEU A CG   4  
ATOM 5546  C CD1  . LEU A 1 17  ? -6.288  21.149  7.125  1.00 0.00 ? 17  LEU A CD1  4  
ATOM 5547  C CD2  . LEU A 1 17  ? -6.324  23.358  5.879  1.00 0.00 ? 17  LEU A CD2  4  
ATOM 5548  H H    . LEU A 1 17  ? -11.446 22.427  5.682  1.00 0.00 ? 17  LEU A H    4  
ATOM 5549  H HA   . LEU A 1 17  ? -9.656  21.367  7.601  1.00 0.00 ? 17  LEU A HA   4  
ATOM 5550  H HB2  . LEU A 1 17  ? -8.283  20.884  5.687  1.00 0.00 ? 17  LEU A HB2  4  
ATOM 5551  H HB3  . LEU A 1 17  ? -8.482  22.511  5.067  1.00 0.00 ? 17  LEU A HB3  4  
ATOM 5552  H HG   . LEU A 1 17  ? -7.420  22.873  7.633  1.00 0.00 ? 17  LEU A HG   4  
ATOM 5553  H HD11 . LEU A 1 17  ? -6.071  21.200  8.192  1.00 0.00 ? 17  LEU A HD11 4  
ATOM 5554  H HD12 . LEU A 1 17  ? -6.841  20.235  6.910  1.00 0.00 ? 17  LEU A HD12 4  
ATOM 5555  H HD13 . LEU A 1 17  ? -5.353  21.148  6.564  1.00 0.00 ? 17  LEU A HD13 4  
ATOM 5556  H HD21 . LEU A 1 17  ? -5.261  23.135  5.969  1.00 0.00 ? 17  LEU A HD21 4  
ATOM 5557  H HD22 . LEU A 1 17  ? -6.625  23.280  4.834  1.00 0.00 ? 17  LEU A HD22 4  
ATOM 5558  H HD23 . LEU A 1 17  ? -6.514  24.370  6.238  1.00 0.00 ? 17  LEU A HD23 4  
ATOM 5559  N N    . GLU A 1 18  ? -9.399  23.703  8.508  1.00 0.00 ? 18  GLU A N    4  
ATOM 5560  C CA   . GLU A 1 18  ? -9.544  24.994  9.158  1.00 0.00 ? 18  GLU A CA   4  
ATOM 5561  C C    . GLU A 1 18  ? -8.843  24.986  10.518 1.00 0.00 ? 18  GLU A C    4  
ATOM 5562  O O    . GLU A 1 18  ? -8.900  23.994  11.243 1.00 0.00 ? 18  GLU A O    4  
ATOM 5563  C CB   . GLU A 1 18  ? -11.019 25.372  9.304  1.00 0.00 ? 18  GLU A CB   4  
ATOM 5564  C CG   . GLU A 1 18  ? -11.260 26.819  8.868  1.00 0.00 ? 18  GLU A CG   4  
ATOM 5565  C CD   . GLU A 1 18  ? -11.447 26.912  7.353  1.00 0.00 ? 18  GLU A CD   4  
ATOM 5566  O OE1  . GLU A 1 18  ? -10.425 26.783  6.646  1.00 0.00 ? 18  GLU A OE1  4  
ATOM 5567  O OE2  . GLU A 1 18  ? -12.609 27.110  6.936  1.00 0.00 ? 18  GLU A OE2  4  
ATOM 5568  H H    . GLU A 1 18  ? -8.870  23.028  9.023  1.00 0.00 ? 18  GLU A H    4  
ATOM 5569  H HA   . GLU A 1 18  ? -9.056  25.708  8.495  1.00 0.00 ? 18  GLU A HA   4  
ATOM 5570  H HB2  . GLU A 1 18  ? -11.632 24.701  8.701  1.00 0.00 ? 18  GLU A HB2  4  
ATOM 5571  H HB3  . GLU A 1 18  ? -11.331 25.244  10.340 1.00 0.00 ? 18  GLU A HB3  4  
ATOM 5572  H HG2  . GLU A 1 18  ? -12.143 27.212  9.372  1.00 0.00 ? 18  GLU A HG2  4  
ATOM 5573  H HG3  . GLU A 1 18  ? -10.417 27.439  9.173  1.00 0.00 ? 18  GLU A HG3  4  
ATOM 5574  N N    . ARG A 1 19  ? -8.199  26.103  10.823 1.00 0.00 ? 19  ARG A N    4  
ATOM 5575  C CA   . ARG A 1 19  ? -7.488  26.236  12.083 1.00 0.00 ? 19  ARG A CA   4  
ATOM 5576  C C    . ARG A 1 19  ? -6.331  25.237  12.148 1.00 0.00 ? 19  ARG A C    4  
ATOM 5577  O O    . ARG A 1 19  ? -6.482  24.141  12.686 1.00 0.00 ? 19  ARG A O    4  
ATOM 5578  C CB   . ARG A 1 19  ? -8.424  26.001  13.271 1.00 0.00 ? 19  ARG A CB   4  
ATOM 5579  C CG   . ARG A 1 19  ? -8.782  27.322  13.956 1.00 0.00 ? 19  ARG A CG   4  
ATOM 5580  C CD   . ARG A 1 19  ? -9.232  27.085  15.399 1.00 0.00 ? 19  ARG A CD   4  
ATOM 5581  N NE   . ARG A 1 19  ? -8.269  27.703  16.338 1.00 0.00 ? 19  ARG A NE   4  
ATOM 5582  C CZ   . ARG A 1 19  ? -8.364  27.625  17.672 1.00 0.00 ? 19  ARG A CZ   4  
ATOM 5583  N NH1  . ARG A 1 19  ? -9.380  26.955  18.233 1.00 0.00 ? 19  ARG A NH1  4  
ATOM 5584  N NH2  . ARG A 1 19  ? -7.443  28.216  18.445 1.00 0.00 ? 19  ARG A NH2  4  
ATOM 5585  H H    . ARG A 1 19  ? -8.158  26.905  10.227 1.00 0.00 ? 19  ARG A H    4  
ATOM 5586  H HA   . ARG A 1 19  ? -7.121  27.263  12.088 1.00 0.00 ? 19  ARG A HA   4  
ATOM 5587  H HB2  . ARG A 1 19  ? -9.333  25.506  12.930 1.00 0.00 ? 19  ARG A HB2  4  
ATOM 5588  H HB3  . ARG A 1 19  ? -7.947  25.333  13.987 1.00 0.00 ? 19  ARG A HB3  4  
ATOM 5589  H HG2  . ARG A 1 19  ? -7.918  27.987  13.945 1.00 0.00 ? 19  ARG A HG2  4  
ATOM 5590  H HG3  . ARG A 1 19  ? -9.576  27.820  13.401 1.00 0.00 ? 19  ARG A HG3  4  
ATOM 5591  H HD2  . ARG A 1 19  ? -10.224 27.509  15.553 1.00 0.00 ? 19  ARG A HD2  4  
ATOM 5592  H HD3  . ARG A 1 19  ? -9.308  26.016  15.595 1.00 0.00 ? 19  ARG A HD3  4  
ATOM 5593  H HE   . ARG A 1 19  ? -7.498  28.211  15.952 1.00 0.00 ? 19  ARG A HE   4  
ATOM 5594  H HH11 . ARG A 1 19  ? -10.067 26.514  17.656 1.00 0.00 ? 19  ARG A HH11 4  
ATOM 5595  H HH12 . ARG A 1 19  ? -9.451  26.897  19.229 1.00 0.00 ? 19  ARG A HH12 4  
ATOM 5596  H HH21 . ARG A 1 19  ? -6.685  28.716  18.027 1.00 0.00 ? 19  ARG A HH21 4  
ATOM 5597  H HH22 . ARG A 1 19  ? -7.515  28.158  19.441 1.00 0.00 ? 19  ARG A HH22 4  
ATOM 5598  N N    . LYS A 1 20  ? -5.202  25.651  11.593 1.00 0.00 ? 20  LYS A N    4  
ATOM 5599  C CA   . LYS A 1 20  ? -4.020  24.807  11.582 1.00 0.00 ? 20  LYS A CA   4  
ATOM 5600  C C    . LYS A 1 20  ? -4.333  23.509  10.834 1.00 0.00 ? 20  LYS A C    4  
ATOM 5601  O O    . LYS A 1 20  ? -5.493  23.217  10.550 1.00 0.00 ? 20  LYS A O    4  
ATOM 5602  C CB   . LYS A 1 20  ? -3.504  24.587  13.005 1.00 0.00 ? 20  LYS A CB   4  
ATOM 5603  C CG   . LYS A 1 20  ? -2.280  25.461  13.287 1.00 0.00 ? 20  LYS A CG   4  
ATOM 5604  C CD   . LYS A 1 20  ? -1.006  24.810  12.745 1.00 0.00 ? 20  LYS A CD   4  
ATOM 5605  C CE   . LYS A 1 20  ? -0.326  23.959  13.820 1.00 0.00 ? 20  LYS A CE   4  
ATOM 5606  N NZ   . LYS A 1 20  ? 1.138   24.177  13.804 1.00 0.00 ? 20  LYS A NZ   4  
ATOM 5607  H H    . LYS A 1 20  ? -5.087  26.544  11.158 1.00 0.00 ? 20  LYS A H    4  
ATOM 5608  H HA   . LYS A 1 20  ? -3.242  25.341  11.036 1.00 0.00 ? 20  LYS A HA   4  
ATOM 5609  H HB2  . LYS A 1 20  ? -4.293  24.818  13.722 1.00 0.00 ? 20  LYS A HB2  4  
ATOM 5610  H HB3  . LYS A 1 20  ? -3.246  23.537  13.145 1.00 0.00 ? 20  LYS A HB3  4  
ATOM 5611  H HG2  . LYS A 1 20  ? -2.416  26.440  12.828 1.00 0.00 ? 20  LYS A HG2  4  
ATOM 5612  H HG3  . LYS A 1 20  ? -2.183  25.622  14.360 1.00 0.00 ? 20  LYS A HG3  4  
ATOM 5613  H HD2  . LYS A 1 20  ? -1.249  24.188  11.883 1.00 0.00 ? 20  LYS A HD2  4  
ATOM 5614  H HD3  . LYS A 1 20  ? -0.318  25.581  12.398 1.00 0.00 ? 20  LYS A HD3  4  
ATOM 5615  H HE2  . LYS A 1 20  ? -0.727  24.213  14.801 1.00 0.00 ? 20  LYS A HE2  4  
ATOM 5616  H HE3  . LYS A 1 20  ? -0.545  22.905  13.649 1.00 0.00 ? 20  LYS A HE3  4  
ATOM 5617  H HZ1  . LYS A 1 20  ? 1.606   23.301  13.923 1.00 0.00 ? 20  LYS A HZ1  4  
ATOM 5618  H HZ2  . LYS A 1 20  ? 1.405   24.582  12.929 1.00 0.00 ? 20  LYS A HZ2  4  
ATOM 5619  H HZ3  . LYS A 1 20  ? 1.391   24.794  14.549 1.00 0.00 ? 20  LYS A HZ3  4  
ATOM 5620  N N    . LYS A 1 21  ? -3.277  22.766  10.536 1.00 0.00 ? 21  LYS A N    4  
ATOM 5621  C CA   . LYS A 1 21  ? -3.425  21.506  9.827  1.00 0.00 ? 21  LYS A CA   4  
ATOM 5622  C C    . LYS A 1 21  ? -3.502  20.361  10.839 1.00 0.00 ? 21  LYS A C    4  
ATOM 5623  O O    . LYS A 1 21  ? -2.787  20.365  11.841 1.00 0.00 ? 21  LYS A O    4  
ATOM 5624  C CB   . LYS A 1 21  ? -2.309  21.339  8.793  1.00 0.00 ? 21  LYS A CB   4  
ATOM 5625  C CG   . LYS A 1 21  ? -0.980  20.999  9.471  1.00 0.00 ? 21  LYS A CG   4  
ATOM 5626  C CD   . LYS A 1 21  ? 0.169   21.014  8.462  1.00 0.00 ? 21  LYS A CD   4  
ATOM 5627  C CE   . LYS A 1 21  ? 1.471   21.475  9.121  1.00 0.00 ? 21  LYS A CE   4  
ATOM 5628  N NZ   . LYS A 1 21  ? 1.763   22.882  8.763  1.00 0.00 ? 21  LYS A NZ   4  
ATOM 5629  H H    . LYS A 1 21  ? -2.337  23.010  10.771 1.00 0.00 ? 21  LYS A H    4  
ATOM 5630  H HA   . LYS A 1 21  ? -4.367  21.547  9.280  1.00 0.00 ? 21  LYS A HA   4  
ATOM 5631  H HB2  . LYS A 1 21  ? -2.575  20.550  8.090  1.00 0.00 ? 21  LYS A HB2  4  
ATOM 5632  H HB3  . LYS A 1 21  ? -2.203  22.258  8.216  1.00 0.00 ? 21  LYS A HB3  4  
ATOM 5633  H HG2  . LYS A 1 21  ? -0.780  21.717  10.267 1.00 0.00 ? 21  LYS A HG2  4  
ATOM 5634  H HG3  . LYS A 1 21  ? -1.047  20.016  9.938  1.00 0.00 ? 21  LYS A HG3  4  
ATOM 5635  H HD2  . LYS A 1 21  ? 0.303   20.017  8.043  1.00 0.00 ? 21  LYS A HD2  4  
ATOM 5636  H HD3  . LYS A 1 21  ? -0.078  21.678  7.633  1.00 0.00 ? 21  LYS A HD3  4  
ATOM 5637  H HE2  . LYS A 1 21  ? 1.392   21.378  10.203 1.00 0.00 ? 21  LYS A HE2  4  
ATOM 5638  H HE3  . LYS A 1 21  ? 2.293   20.835  8.802  1.00 0.00 ? 21  LYS A HE3  4  
ATOM 5639  H HZ1  . LYS A 1 21  ? 1.706   23.453  9.582  1.00 0.00 ? 21  LYS A HZ1  4  
ATOM 5640  H HZ2  . LYS A 1 21  ? 2.684   22.943  8.378  1.00 0.00 ? 21  LYS A HZ2  4  
ATOM 5641  H HZ3  . LYS A 1 21  ? 1.097   23.199  8.088  1.00 0.00 ? 21  LYS A HZ3  4  
ATOM 5642  N N    . ARG A 1 22  ? -4.375  19.410  10.543 1.00 0.00 ? 22  ARG A N    4  
ATOM 5643  C CA   . ARG A 1 22  ? -4.554  18.261  11.415 1.00 0.00 ? 22  ARG A CA   4  
ATOM 5644  C C    . ARG A 1 22  ? -5.492  17.242  10.765 1.00 0.00 ? 22  ARG A C    4  
ATOM 5645  O O    . ARG A 1 22  ? -5.244  16.039  10.824 1.00 0.00 ? 22  ARG A O    4  
ATOM 5646  C CB   . ARG A 1 22  ? -5.129  18.682  12.769 1.00 0.00 ? 22  ARG A CB   4  
ATOM 5647  C CG   . ARG A 1 22  ? -4.756  17.676  13.860 1.00 0.00 ? 22  ARG A CG   4  
ATOM 5648  C CD   . ARG A 1 22  ? -4.760  18.337  15.240 1.00 0.00 ? 22  ARG A CD   4  
ATOM 5649  N NE   . ARG A 1 22  ? -5.882  17.811  16.049 1.00 0.00 ? 22  ARG A NE   4  
ATOM 5650  C CZ   . ARG A 1 22  ? -7.136  18.279  15.990 1.00 0.00 ? 22  ARG A CZ   4  
ATOM 5651  N NH1  . ARG A 1 22  ? -7.436  19.287  15.158 1.00 0.00 ? 22  ARG A NH1  4  
ATOM 5652  N NH2  . ARG A 1 22  ? -8.090  17.741  16.761 1.00 0.00 ? 22  ARG A NH2  4  
ATOM 5653  H H    . ARG A 1 22  ? -4.952  19.414  9.727  1.00 0.00 ? 22  ARG A H    4  
ATOM 5654  H HA   . ARG A 1 22  ? -3.553  17.848  11.542 1.00 0.00 ? 22  ARG A HA   4  
ATOM 5655  H HB2  . ARG A 1 22  ? -4.753  19.670  13.037 1.00 0.00 ? 22  ARG A HB2  4  
ATOM 5656  H HB3  . ARG A 1 22  ? -6.214  18.762  12.699 1.00 0.00 ? 22  ARG A HB3  4  
ATOM 5657  H HG2  . ARG A 1 22  ? -5.460  16.844  13.849 1.00 0.00 ? 22  ARG A HG2  4  
ATOM 5658  H HG3  . ARG A 1 22  ? -3.769  17.261  13.655 1.00 0.00 ? 22  ARG A HG3  4  
ATOM 5659  H HD2  . ARG A 1 22  ? -3.814  18.145  15.747 1.00 0.00 ? 22  ARG A HD2  4  
ATOM 5660  H HD3  . ARG A 1 22  ? -4.852  19.417  15.135 1.00 0.00 ? 22  ARG A HD3  4  
ATOM 5661  H HE   . ARG A 1 22  ? -5.692  17.058  16.681 1.00 0.00 ? 22  ARG A HE   4  
ATOM 5662  H HH11 . ARG A 1 22  ? -6.724  19.689  14.583 1.00 0.00 ? 22  ARG A HH11 4  
ATOM 5663  H HH12 . ARG A 1 22  ? -8.372  19.637  15.114 1.00 0.00 ? 22  ARG A HH12 4  
ATOM 5664  H HH21 . ARG A 1 22  ? -7.866  16.989  17.382 1.00 0.00 ? 22  ARG A HH21 4  
ATOM 5665  H HH22 . ARG A 1 22  ? -9.026  18.091  16.717 1.00 0.00 ? 22  ARG A HH22 4  
ATOM 5666  N N    . GLU A 1 23  ? -6.550  17.762  10.160 1.00 0.00 ? 23  GLU A N    4  
ATOM 5667  C CA   . GLU A 1 23  ? -7.526  16.912  9.499  1.00 0.00 ? 23  GLU A CA   4  
ATOM 5668  C C    . GLU A 1 23  ? -6.922  16.291  8.238  1.00 0.00 ? 23  GLU A C    4  
ATOM 5669  O O    . GLU A 1 23  ? -7.050  15.089  8.011  1.00 0.00 ? 23  GLU A O    4  
ATOM 5670  C CB   . GLU A 1 23  ? -8.799  17.694  9.169  1.00 0.00 ? 23  GLU A CB   4  
ATOM 5671  C CG   . GLU A 1 23  ? -9.737  17.749  10.377 1.00 0.00 ? 23  GLU A CG   4  
ATOM 5672  C CD   . GLU A 1 23  ? -10.434 19.108  10.468 1.00 0.00 ? 23  GLU A CD   4  
ATOM 5673  O OE1  . GLU A 1 23  ? -10.675 19.695  9.392  1.00 0.00 ? 23  GLU A OE1  4  
ATOM 5674  O OE2  . GLU A 1 23  ? -10.710 19.529  11.613 1.00 0.00 ? 23  GLU A OE2  4  
ATOM 5675  H H    . GLU A 1 23  ? -6.744  18.742  10.116 1.00 0.00 ? 23  GLU A H    4  
ATOM 5676  H HA   . GLU A 1 23  ? -7.764  16.130  10.219 1.00 0.00 ? 23  GLU A HA   4  
ATOM 5677  H HB2  . GLU A 1 23  ? -8.539  18.706  8.860  1.00 0.00 ? 23  GLU A HB2  4  
ATOM 5678  H HB3  . GLU A 1 23  ? -9.311  17.225  8.329  1.00 0.00 ? 23  GLU A HB3  4  
ATOM 5679  H HG2  . GLU A 1 23  ? -10.483 16.958  10.299 1.00 0.00 ? 23  GLU A HG2  4  
ATOM 5680  H HG3  . GLU A 1 23  ? -9.171  17.565  11.290 1.00 0.00 ? 23  GLU A HG3  4  
ATOM 5681  N N    . LYS A 1 24  ? -6.276  17.138  7.450  1.00 0.00 ? 24  LYS A N    4  
ATOM 5682  C CA   . LYS A 1 24  ? -5.652  16.688  6.218  1.00 0.00 ? 24  LYS A CA   4  
ATOM 5683  C C    . LYS A 1 24  ? -4.586  15.640  6.545  1.00 0.00 ? 24  LYS A C    4  
ATOM 5684  O O    . LYS A 1 24  ? -4.205  14.847  5.685  1.00 0.00 ? 24  LYS A O    4  
ATOM 5685  C CB   . LYS A 1 24  ? -5.119  17.879  5.420  1.00 0.00 ? 24  LYS A CB   4  
ATOM 5686  C CG   . LYS A 1 24  ? -5.793  17.967  4.049  1.00 0.00 ? 24  LYS A CG   4  
ATOM 5687  C CD   . LYS A 1 24  ? -6.891  19.032  4.045  1.00 0.00 ? 24  LYS A CD   4  
ATOM 5688  C CE   . LYS A 1 24  ? -6.407  20.316  3.368  1.00 0.00 ? 24  LYS A CE   4  
ATOM 5689  N NZ   . LYS A 1 24  ? -6.600  20.234  1.903  1.00 0.00 ? 24  LYS A NZ   4  
ATOM 5690  H H    . LYS A 1 24  ? -6.176  18.115  7.642  1.00 0.00 ? 24  LYS A H    4  
ATOM 5691  H HA   . LYS A 1 24  ? -6.426  16.215  5.614  1.00 0.00 ? 24  LYS A HA   4  
ATOM 5692  H HB2  . LYS A 1 24  ? -5.295  18.801  5.975  1.00 0.00 ? 24  LYS A HB2  4  
ATOM 5693  H HB3  . LYS A 1 24  ? -4.041  17.784  5.294  1.00 0.00 ? 24  LYS A HB3  4  
ATOM 5694  H HG2  . LYS A 1 24  ? -5.048  18.203  3.289  1.00 0.00 ? 24  LYS A HG2  4  
ATOM 5695  H HG3  . LYS A 1 24  ? -6.219  16.998  3.787  1.00 0.00 ? 24  LYS A HG3  4  
ATOM 5696  H HD2  . LYS A 1 24  ? -7.770  18.651  3.524  1.00 0.00 ? 24  LYS A HD2  4  
ATOM 5697  H HD3  . LYS A 1 24  ? -7.196  19.249  5.068  1.00 0.00 ? 24  LYS A HD3  4  
ATOM 5698  H HE2  . LYS A 1 24  ? -6.952  21.171  3.766  1.00 0.00 ? 24  LYS A HE2  4  
ATOM 5699  H HE3  . LYS A 1 24  ? -5.353  20.477  3.593  1.00 0.00 ? 24  LYS A HE3  4  
ATOM 5700  H HZ1  . LYS A 1 24  ? -7.549  19.989  1.705  1.00 0.00 ? 24  LYS A HZ1  4  
ATOM 5701  H HZ2  . LYS A 1 24  ? -6.391  21.120  1.489  1.00 0.00 ? 24  LYS A HZ2  4  
ATOM 5702  H HZ3  . LYS A 1 24  ? -5.991  19.537  1.524  1.00 0.00 ? 24  LYS A HZ3  4  
ATOM 5703  N N    . GLU A 1 25  ? -4.133  15.671  7.790  1.00 0.00 ? 25  GLU A N    4  
ATOM 5704  C CA   . GLU A 1 25  ? -3.118  14.735  8.241  1.00 0.00 ? 25  GLU A CA   4  
ATOM 5705  C C    . GLU A 1 25  ? -3.740  13.359  8.493  1.00 0.00 ? 25  GLU A C    4  
ATOM 5706  O O    . GLU A 1 25  ? -3.326  12.368  7.893  1.00 0.00 ? 25  GLU A O    4  
ATOM 5707  C CB   . GLU A 1 25  ? -2.411  15.254  9.494  1.00 0.00 ? 25  GLU A CB   4  
ATOM 5708  C CG   . GLU A 1 25  ? -0.962  14.765  9.548  1.00 0.00 ? 25  GLU A CG   4  
ATOM 5709  C CD   . GLU A 1 25  ? -0.365  14.974  10.942 1.00 0.00 ? 25  GLU A CD   4  
ATOM 5710  O OE1  . GLU A 1 25  ? -0.611  16.060  11.508 1.00 0.00 ? 25  GLU A OE1  4  
ATOM 5711  O OE2  . GLU A 1 25  ? 0.324   14.041  11.409 1.00 0.00 ? 25  GLU A OE2  4  
ATOM 5712  H H    . GLU A 1 25  ? -4.448  16.320  8.483  1.00 0.00 ? 25  GLU A H    4  
ATOM 5713  H HA   . GLU A 1 25  ? -2.399  14.672  7.425  1.00 0.00 ? 25  GLU A HA   4  
ATOM 5714  H HB2  . GLU A 1 25  ? -2.431  16.344  9.502  1.00 0.00 ? 25  GLU A HB2  4  
ATOM 5715  H HB3  . GLU A 1 25  ? -2.945  14.919  10.383 1.00 0.00 ? 25  GLU A HB3  4  
ATOM 5716  H HG2  . GLU A 1 25  ? -0.921  13.708  9.285  1.00 0.00 ? 25  GLU A HG2  4  
ATOM 5717  H HG3  . GLU A 1 25  ? -0.366  15.301  8.810  1.00 0.00 ? 25  GLU A HG3  4  
ATOM 5718  N N    . GLN A 1 26  ? -4.723  13.343  9.380  1.00 0.00 ? 26  GLN A N    4  
ATOM 5719  C CA   . GLN A 1 26  ? -5.406  12.105  9.719  1.00 0.00 ? 26  GLN A CA   4  
ATOM 5720  C C    . GLN A 1 26  ? -6.276  11.642  8.549  1.00 0.00 ? 26  GLN A C    4  
ATOM 5721  O O    . GLN A 1 26  ? -6.813  10.536  8.569  1.00 0.00 ? 26  GLN A O    4  
ATOM 5722  C CB   . GLN A 1 26  ? -6.239  12.269  10.991 1.00 0.00 ? 26  GLN A CB   4  
ATOM 5723  C CG   . GLN A 1 26  ? -7.491  13.106  10.722 1.00 0.00 ? 26  GLN A CG   4  
ATOM 5724  C CD   . GLN A 1 26  ? -8.358  13.215  11.978 1.00 0.00 ? 26  GLN A CD   4  
ATOM 5725  O OE1  . GLN A 1 26  ? -7.899  13.051  13.097 1.00 0.00 ? 26  GLN A OE1  4  
ATOM 5726  N NE2  . GLN A 1 26  ? -9.634  13.500  11.732 1.00 0.00 ? 26  GLN A NE2  4  
ATOM 5727  H H    . GLN A 1 26  ? -5.054  14.153  9.864  1.00 0.00 ? 26  GLN A H    4  
ATOM 5728  H HA   . GLN A 1 26  ? -4.614  11.379  9.901  1.00 0.00 ? 26  GLN A HA   4  
ATOM 5729  H HB2  . GLN A 1 26  ? -6.527  11.289  11.370 1.00 0.00 ? 26  GLN A HB2  4  
ATOM 5730  H HB3  . GLN A 1 26  ? -5.638  12.746  11.765 1.00 0.00 ? 26  GLN A HB3  4  
ATOM 5731  H HG2  . GLN A 1 26  ? -7.202  14.103  10.388 1.00 0.00 ? 26  GLN A HG2  4  
ATOM 5732  H HG3  . GLN A 1 26  ? -8.069  12.655  9.916  1.00 0.00 ? 26  GLN A HG3  4  
ATOM 5733  H HE21 . GLN A 1 26  ? -9.946  13.622  10.790 1.00 0.00 ? 26  GLN A HE21 4  
ATOM 5734  H HE22 . GLN A 1 26  ? -10.281 13.592  12.489 1.00 0.00 ? 26  GLN A HE22 4  
ATOM 5735  N N    . PHE A 1 27  ? -6.389  12.513  7.556  1.00 0.00 ? 27  PHE A N    4  
ATOM 5736  C CA   . PHE A 1 27  ? -7.185  12.207  6.379  1.00 0.00 ? 27  PHE A CA   4  
ATOM 5737  C C    . PHE A 1 27  ? -6.399  11.336  5.397  1.00 0.00 ? 27  PHE A C    4  
ATOM 5738  O O    . PHE A 1 27  ? -6.930  10.365  4.860  1.00 0.00 ? 27  PHE A O    4  
ATOM 5739  C CB   . PHE A 1 27  ? -7.519  13.540  5.707  1.00 0.00 ? 27  PHE A CB   4  
ATOM 5740  C CG   . PHE A 1 27  ? -8.866  14.129  6.129  1.00 0.00 ? 27  PHE A CG   4  
ATOM 5741  C CD1  . PHE A 1 27  ? -9.345  13.902  7.381  1.00 0.00 ? 27  PHE A CD1  4  
ATOM 5742  C CD2  . PHE A 1 27  ? -9.584  14.882  5.253  1.00 0.00 ? 27  PHE A CD2  4  
ATOM 5743  C CE1  . PHE A 1 27  ? -10.595 14.449  7.773  1.00 0.00 ? 27  PHE A CE1  4  
ATOM 5744  C CE2  . PHE A 1 27  ? -10.834 15.429  5.645  1.00 0.00 ? 27  PHE A CE2  4  
ATOM 5745  C CZ   . PHE A 1 27  ? -11.313 15.201  6.897  1.00 0.00 ? 27  PHE A CZ   4  
ATOM 5746  H H    . PHE A 1 27  ? -5.949  13.411  7.547  1.00 0.00 ? 27  PHE A H    4  
ATOM 5747  H HA   . PHE A 1 27  ? -8.067  11.664  6.718  1.00 0.00 ? 27  PHE A HA   4  
ATOM 5748  H HB2  . PHE A 1 27  ? -6.731  14.258  5.935  1.00 0.00 ? 27  PHE A HB2  4  
ATOM 5749  H HB3  . PHE A 1 27  ? -7.518  13.399  4.626  1.00 0.00 ? 27  PHE A HB3  4  
ATOM 5750  H HD1  . PHE A 1 27  ? -8.770  13.299  8.084  1.00 0.00 ? 27  PHE A HD1  4  
ATOM 5751  H HD2  . PHE A 1 27  ? -9.200  15.064  4.249  1.00 0.00 ? 27  PHE A HD2  4  
ATOM 5752  H HE1  . PHE A 1 27  ? -10.979 14.267  8.777  1.00 0.00 ? 27  PHE A HE1  4  
ATOM 5753  H HE2  . PHE A 1 27  ? -11.410 16.032  4.942  1.00 0.00 ? 27  PHE A HE2  4  
ATOM 5754  H HZ   . PHE A 1 27  ? -12.273 15.621  7.198  1.00 0.00 ? 27  PHE A HZ   4  
ATOM 5755  N N    . ARG A 1 28  ? -5.146  11.715  5.191  1.00 0.00 ? 28  ARG A N    4  
ATOM 5756  C CA   . ARG A 1 28  ? -4.282  10.980  4.283  1.00 0.00 ? 28  ARG A CA   4  
ATOM 5757  C C    . ARG A 1 28  ? -3.428  9.975   5.058  1.00 0.00 ? 28  ARG A C    4  
ATOM 5758  O O    . ARG A 1 28  ? -2.766  9.127   4.462  1.00 0.00 ? 28  ARG A O    4  
ATOM 5759  C CB   . ARG A 1 28  ? -3.364  11.929  3.509  1.00 0.00 ? 28  ARG A CB   4  
ATOM 5760  C CG   . ARG A 1 28  ? -4.128  13.167  3.035  1.00 0.00 ? 28  ARG A CG   4  
ATOM 5761  C CD   . ARG A 1 28  ? -3.172  14.218  2.468  1.00 0.00 ? 28  ARG A CD   4  
ATOM 5762  N NE   . ARG A 1 28  ? -3.941  15.337  1.880  1.00 0.00 ? 28  ARG A NE   4  
ATOM 5763  C CZ   . ARG A 1 28  ? -3.384  16.393  1.272  1.00 0.00 ? 28  ARG A CZ   4  
ATOM 5764  N NH1  . ARG A 1 28  ? -2.051  16.481  1.168  1.00 0.00 ? 28  ARG A NH1  4  
ATOM 5765  N NH2  . ARG A 1 28  ? -4.160  17.362  0.768  1.00 0.00 ? 28  ARG A NH2  4  
ATOM 5766  H H    . ARG A 1 28  ? -4.722  12.506  5.632  1.00 0.00 ? 28  ARG A H    4  
ATOM 5767  H HA   . ARG A 1 28  ? -4.963  10.472  3.600  1.00 0.00 ? 28  ARG A HA   4  
ATOM 5768  H HB2  . ARG A 1 28  ? -2.530  12.232  4.143  1.00 0.00 ? 28  ARG A HB2  4  
ATOM 5769  H HB3  . ARG A 1 28  ? -2.939  11.409  2.650  1.00 0.00 ? 28  ARG A HB3  4  
ATOM 5770  H HG2  . ARG A 1 28  ? -4.854  12.881  2.274  1.00 0.00 ? 28  ARG A HG2  4  
ATOM 5771  H HG3  . ARG A 1 28  ? -4.689  13.592  3.867  1.00 0.00 ? 28  ARG A HG3  4  
ATOM 5772  H HD2  . ARG A 1 28  ? -2.517  14.589  3.256  1.00 0.00 ? 28  ARG A HD2  4  
ATOM 5773  H HD3  . ARG A 1 28  ? -2.532  13.767  1.709  1.00 0.00 ? 28  ARG A HD3  4  
ATOM 5774  H HE   . ARG A 1 28  ? -4.938  15.303  1.940  1.00 0.00 ? 28  ARG A HE   4  
ATOM 5775  H HH11 . ARG A 1 28  ? -1.472  15.758  1.545  1.00 0.00 ? 28  ARG A HH11 4  
ATOM 5776  H HH12 . ARG A 1 28  ? -1.636  17.270  0.715  1.00 0.00 ? 28  ARG A HH12 4  
ATOM 5777  H HH21 . ARG A 1 28  ? -5.155  17.297  0.845  1.00 0.00 ? 28  ARG A HH21 4  
ATOM 5778  H HH22 . ARG A 1 28  ? -3.745  18.151  0.314  1.00 0.00 ? 28  ARG A HH22 4  
ATOM 5779  N N    . LYS A 1 29  ? -3.471  10.103  6.376  1.00 0.00 ? 29  LYS A N    4  
ATOM 5780  C CA   . LYS A 1 29  ? -2.710  9.217   7.240  1.00 0.00 ? 29  LYS A CA   4  
ATOM 5781  C C    . LYS A 1 29  ? -3.531  7.957   7.521  1.00 0.00 ? 29  LYS A C    4  
ATOM 5782  O O    . LYS A 1 29  ? -4.572  8.023   8.174  1.00 0.00 ? 29  LYS A O    4  
ATOM 5783  C CB   . LYS A 1 29  ? -2.262  9.954   8.503  1.00 0.00 ? 29  LYS A CB   4  
ATOM 5784  C CG   . LYS A 1 29  ? -1.543  9.005   9.466  1.00 0.00 ? 29  LYS A CG   4  
ATOM 5785  C CD   . LYS A 1 29  ? -2.156  9.077   10.866 1.00 0.00 ? 29  LYS A CD   4  
ATOM 5786  C CE   . LYS A 1 29  ? -1.087  9.381   11.917 1.00 0.00 ? 29  LYS A CE   4  
ATOM 5787  N NZ   . LYS A 1 29  ? -1.707  9.564   13.249 1.00 0.00 ? 29  LYS A NZ   4  
ATOM 5788  H H    . LYS A 1 29  ? -4.013  10.796  6.854  1.00 0.00 ? 29  LYS A H    4  
ATOM 5789  H HA   . LYS A 1 29  ? -1.809  8.928   6.699  1.00 0.00 ? 29  LYS A HA   4  
ATOM 5790  H HB2  . LYS A 1 29  ? -1.599  10.776  8.234  1.00 0.00 ? 29  LYS A HB2  4  
ATOM 5791  H HB3  . LYS A 1 29  ? -3.128  10.393  8.999  1.00 0.00 ? 29  LYS A HB3  4  
ATOM 5792  H HG2  . LYS A 1 29  ? -1.605  7.984   9.089  1.00 0.00 ? 29  LYS A HG2  4  
ATOM 5793  H HG3  . LYS A 1 29  ? -0.486  9.264   9.514  1.00 0.00 ? 29  LYS A HG3  4  
ATOM 5794  H HD2  . LYS A 1 29  ? -2.926  9.848   10.891 1.00 0.00 ? 29  LYS A HD2  4  
ATOM 5795  H HD3  . LYS A 1 29  ? -2.645  8.131   11.101 1.00 0.00 ? 29  LYS A HD3  4  
ATOM 5796  H HE2  . LYS A 1 29  ? -0.364  8.567   11.955 1.00 0.00 ? 29  LYS A HE2  4  
ATOM 5797  H HE3  . LYS A 1 29  ? -0.540  10.281  11.638 1.00 0.00 ? 29  LYS A HE3  4  
ATOM 5798  H HZ1  . LYS A 1 29  ? -1.568  8.740   13.797 1.00 0.00 ? 29  LYS A HZ1  4  
ATOM 5799  H HZ2  . LYS A 1 29  ? -1.285  10.346  13.708 1.00 0.00 ? 29  LYS A HZ2  4  
ATOM 5800  H HZ3  . LYS A 1 29  ? -2.687  9.731   13.140 1.00 0.00 ? 29  LYS A HZ3  4  
ATOM 5801  N N    . LEU A 1 30  ? -3.033  6.838   7.015  1.00 0.00 ? 30  LEU A N    4  
ATOM 5802  C CA   . LEU A 1 30  ? -3.707  5.566   7.204  1.00 0.00 ? 30  LEU A CA   4  
ATOM 5803  C C    . LEU A 1 30  ? -2.931  4.728   8.222  1.00 0.00 ? 30  LEU A C    4  
ATOM 5804  O O    . LEU A 1 30  ? -1.707  4.629   8.146  1.00 0.00 ? 30  LEU A O    4  
ATOM 5805  C CB   . LEU A 1 30  ? -3.914  4.864   5.860  1.00 0.00 ? 30  LEU A CB   4  
ATOM 5806  C CG   . LEU A 1 30  ? -5.286  5.050   5.210  1.00 0.00 ? 30  LEU A CG   4  
ATOM 5807  C CD1  . LEU A 1 30  ? -5.514  6.512   4.819  1.00 0.00 ? 30  LEU A CD1  4  
ATOM 5808  C CD2  . LEU A 1 30  ? -5.462  4.105   4.020  1.00 0.00 ? 30  LEU A CD2  4  
ATOM 5809  H H    . LEU A 1 30  ? -2.186  6.793   6.486  1.00 0.00 ? 30  LEU A H    4  
ATOM 5810  H HA   . LEU A 1 30  ? -4.696  5.777   7.612  1.00 0.00 ? 30  LEU A HA   4  
ATOM 5811  H HB2  . LEU A 1 30  ? -3.153  5.221   5.166  1.00 0.00 ? 30  LEU A HB2  4  
ATOM 5812  H HB3  . LEU A 1 30  ? -3.742  3.797   6.000  1.00 0.00 ? 30  LEU A HB3  4  
ATOM 5813  H HG   . LEU A 1 30  ? -6.050  4.790   5.943  1.00 0.00 ? 30  LEU A HG   4  
ATOM 5814  H HD11 . LEU A 1 30  ? -4.586  6.934   4.434  1.00 0.00 ? 30  LEU A HD11 4  
ATOM 5815  H HD12 . LEU A 1 30  ? -6.285  6.567   4.051  1.00 0.00 ? 30  LEU A HD12 4  
ATOM 5816  H HD13 . LEU A 1 30  ? -5.833  7.076   5.695  1.00 0.00 ? 30  LEU A HD13 4  
ATOM 5817  H HD21 . LEU A 1 30  ? -5.063  4.575   3.120  1.00 0.00 ? 30  LEU A HD21 4  
ATOM 5818  H HD22 . LEU A 1 30  ? -4.925  3.175   4.212  1.00 0.00 ? 30  LEU A HD22 4  
ATOM 5819  H HD23 . LEU A 1 30  ? -6.521  3.891   3.879  1.00 0.00 ? 30  LEU A HD23 4  
ATOM 5820  N N    . PHE A 1 31  ? -3.675  4.146   9.152  1.00 0.00 ? 31  PHE A N    4  
ATOM 5821  C CA   . PHE A 1 31  ? -3.072  3.320   10.184 1.00 0.00 ? 31  PHE A CA   4  
ATOM 5822  C C    . PHE A 1 31  ? -3.133  1.839   9.806  1.00 0.00 ? 31  PHE A C    4  
ATOM 5823  O O    . PHE A 1 31  ? -4.205  1.236   9.816  1.00 0.00 ? 31  PHE A O    4  
ATOM 5824  C CB   . PHE A 1 31  ? -3.880  3.542   11.464 1.00 0.00 ? 31  PHE A CB   4  
ATOM 5825  C CG   . PHE A 1 31  ? -3.395  2.716   12.657 1.00 0.00 ? 31  PHE A CG   4  
ATOM 5826  C CD1  . PHE A 1 31  ? -3.730  1.402   12.756 1.00 0.00 ? 31  PHE A CD1  4  
ATOM 5827  C CD2  . PHE A 1 31  ? -2.630  3.297   13.619 1.00 0.00 ? 31  PHE A CD2  4  
ATOM 5828  C CE1  . PHE A 1 31  ? -3.280  0.636   13.863 1.00 0.00 ? 31  PHE A CE1  4  
ATOM 5829  C CE2  . PHE A 1 31  ? -2.180  2.531   14.727 1.00 0.00 ? 31  PHE A CE2  4  
ATOM 5830  C CZ   . PHE A 1 31  ? -2.515  1.217   14.826 1.00 0.00 ? 31  PHE A CZ   4  
ATOM 5831  H H    . PHE A 1 31  ? -4.670  4.231   9.206  1.00 0.00 ? 31  PHE A H    4  
ATOM 5832  H HA   . PHE A 1 31  ? -2.030  3.627   10.276 1.00 0.00 ? 31  PHE A HA   4  
ATOM 5833  H HB2  . PHE A 1 31  ? -3.842  4.599   11.727 1.00 0.00 ? 31  PHE A HB2  4  
ATOM 5834  H HB3  . PHE A 1 31  ? -4.925  3.300   11.268 1.00 0.00 ? 31  PHE A HB3  4  
ATOM 5835  H HD1  . PHE A 1 31  ? -4.344  0.937   11.984 1.00 0.00 ? 31  PHE A HD1  4  
ATOM 5836  H HD2  . PHE A 1 31  ? -2.362  4.351   13.540 1.00 0.00 ? 31  PHE A HD2  4  
ATOM 5837  H HE1  . PHE A 1 31  ? -3.549  -0.418  13.942 1.00 0.00 ? 31  PHE A HE1  4  
ATOM 5838  H HE2  . PHE A 1 31  ? -1.566  2.997   15.498 1.00 0.00 ? 31  PHE A HE2  4  
ATOM 5839  H HZ   . PHE A 1 31  ? -2.169  0.629   15.676 1.00 0.00 ? 31  PHE A HZ   4  
ATOM 5840  N N    . ILE A 1 32  ? -1.969  1.295   9.483  1.00 0.00 ? 32  ILE A N    4  
ATOM 5841  C CA   . ILE A 1 32  ? -1.877  -0.105  9.103  1.00 0.00 ? 32  ILE A CA   4  
ATOM 5842  C C    . ILE A 1 32  ? -1.820  -0.969  10.364 1.00 0.00 ? 32  ILE A C    4  
ATOM 5843  O O    . ILE A 1 32  ? -0.948  -0.780  11.211 1.00 0.00 ? 32  ILE A O    4  
ATOM 5844  C CB   . ILE A 1 32  ? -0.699  -0.326  8.152  1.00 0.00 ? 32  ILE A CB   4  
ATOM 5845  C CG1  . ILE A 1 32  ? -0.587  0.819   7.143  1.00 0.00 ? 32  ILE A CG1  4  
ATOM 5846  C CG2  . ILE A 1 32  ? -0.797  -1.689  7.465  1.00 0.00 ? 32  ILE A CG2  4  
ATOM 5847  C CD1  . ILE A 1 32  ? -1.841  0.905   6.270  1.00 0.00 ? 32  ILE A CD1  4  
ATOM 5848  H H    . ILE A 1 32  ? -1.102  1.792   9.478  1.00 0.00 ? 32  ILE A H    4  
ATOM 5849  H HA   . ILE A 1 32  ? -2.785  -0.355  8.554  1.00 0.00 ? 32  ILE A HA   4  
ATOM 5850  H HB   . ILE A 1 32  ? 0.219   -0.327  8.740  1.00 0.00 ? 32  ILE A HB   4  
ATOM 5851  H HG12 . ILE A 1 32  ? -0.441  1.761   7.671  1.00 0.00 ? 32  ILE A HG12 4  
ATOM 5852  H HG13 . ILE A 1 32  ? 0.290   0.668   6.513  1.00 0.00 ? 32  ILE A HG13 4  
ATOM 5853  H HG21 . ILE A 1 32  ? -1.562  -1.650  6.689  1.00 0.00 ? 32  ILE A HG21 4  
ATOM 5854  H HG22 . ILE A 1 32  ? 0.164   -1.939  7.015  1.00 0.00 ? 32  ILE A HG22 4  
ATOM 5855  H HG23 . ILE A 1 32  ? -1.062  -2.448  8.200  1.00 0.00 ? 32  ILE A HG23 4  
ATOM 5856  H HD11 . ILE A 1 32  ? -2.585  0.195   6.632  1.00 0.00 ? 32  ILE A HD11 4  
ATOM 5857  H HD12 . ILE A 1 32  ? -2.248  1.915   6.319  1.00 0.00 ? 32  ILE A HD12 4  
ATOM 5858  H HD13 . ILE A 1 32  ? -1.582  0.666   5.239  1.00 0.00 ? 32  ILE A HD13 4  
ATOM 5859  N N    . GLY A 1 33  ? -2.760  -1.899  10.449 1.00 0.00 ? 33  GLY A N    4  
ATOM 5860  C CA   . GLY A 1 33  ? -2.827  -2.792  11.593 1.00 0.00 ? 33  GLY A CA   4  
ATOM 5861  C C    . GLY A 1 33  ? -2.471  -4.225  11.191 1.00 0.00 ? 33  GLY A C    4  
ATOM 5862  O O    . GLY A 1 33  ? -2.943  -4.722  10.170 1.00 0.00 ? 33  GLY A O    4  
ATOM 5863  H H    . GLY A 1 33  ? -3.465  -2.046  9.756  1.00 0.00 ? 33  GLY A H    4  
ATOM 5864  H HA2  . GLY A 1 33  ? -2.143  -2.448  12.369 1.00 0.00 ? 33  GLY A HA2  4  
ATOM 5865  H HA3  . GLY A 1 33  ? -3.830  -2.768  12.019 1.00 0.00 ? 33  GLY A HA3  4  
ATOM 5866  N N    . GLY A 1 34  ? -1.643  -4.849  12.016 1.00 0.00 ? 34  GLY A N    4  
ATOM 5867  C CA   . GLY A 1 34  ? -1.219  -6.215  11.760 1.00 0.00 ? 34  GLY A CA   4  
ATOM 5868  C C    . GLY A 1 34  ? -0.070  -6.251  10.750 1.00 0.00 ? 34  GLY A C    4  
ATOM 5869  O O    . GLY A 1 34  ? -0.287  -6.501  9.565  1.00 0.00 ? 34  GLY A O    4  
ATOM 5870  H H    . GLY A 1 34  ? -1.264  -4.437  12.845 1.00 0.00 ? 34  GLY A H    4  
ATOM 5871  H HA2  . GLY A 1 34  ? -0.904  -6.683  12.692 1.00 0.00 ? 34  GLY A HA2  4  
ATOM 5872  H HA3  . GLY A 1 34  ? -2.060  -6.795  11.380 1.00 0.00 ? 34  GLY A HA3  4  
ATOM 5873  N N    . LEU A 1 35  ? 1.128   -5.999  11.256 1.00 0.00 ? 35  LEU A N    4  
ATOM 5874  C CA   . LEU A 1 35  ? 2.312   -6.001  10.414 1.00 0.00 ? 35  LEU A CA   4  
ATOM 5875  C C    . LEU A 1 35  ? 3.140   -7.254  10.707 1.00 0.00 ? 35  LEU A C    4  
ATOM 5876  O O    . LEU A 1 35  ? 4.221   -7.432  10.148 1.00 0.00 ? 35  LEU A O    4  
ATOM 5877  C CB   . LEU A 1 35  ? 3.092   -4.695  10.583 1.00 0.00 ? 35  LEU A CB   4  
ATOM 5878  C CG   . LEU A 1 35  ? 2.385   -3.425  10.104 1.00 0.00 ? 35  LEU A CG   4  
ATOM 5879  C CD1  . LEU A 1 35  ? 3.393   -2.409  9.562  1.00 0.00 ? 35  LEU A CD1  4  
ATOM 5880  C CD2  . LEU A 1 35  ? 1.297   -3.756  9.080  1.00 0.00 ? 35  LEU A CD2  4  
ATOM 5881  H H    . LEU A 1 35  ? 1.296   -5.798  12.221 1.00 0.00 ? 35  LEU A H    4  
ATOM 5882  H HA   . LEU A 1 35  ? 1.976   -6.043  9.378  1.00 0.00 ? 35  LEU A HA   4  
ATOM 5883  H HB2  . LEU A 1 35  ? 3.336   -4.575  11.639 1.00 0.00 ? 35  LEU A HB2  4  
ATOM 5884  H HB3  . LEU A 1 35  ? 4.036   -4.787  10.046 1.00 0.00 ? 35  LEU A HB3  4  
ATOM 5885  H HG   . LEU A 1 35  ? 1.892   -2.965  10.960 1.00 0.00 ? 35  LEU A HG   4  
ATOM 5886  H HD11 . LEU A 1 35  ? 3.344   -1.497  10.157 1.00 0.00 ? 35  LEU A HD11 4  
ATOM 5887  H HD12 . LEU A 1 35  ? 4.397   -2.828  9.620  1.00 0.00 ? 35  LEU A HD12 4  
ATOM 5888  H HD13 . LEU A 1 35  ? 3.154   -2.179  8.524  1.00 0.00 ? 35  LEU A HD13 4  
ATOM 5889  H HD21 . LEU A 1 35  ? 0.477   -4.274  9.577  1.00 0.00 ? 35  LEU A HD21 4  
ATOM 5890  H HD22 . LEU A 1 35  ? 0.927   -2.834  8.633  1.00 0.00 ? 35  LEU A HD22 4  
ATOM 5891  H HD23 . LEU A 1 35  ? 1.713   -4.396  8.302  1.00 0.00 ? 35  LEU A HD23 4  
ATOM 5892  N N    . SER A 1 36  ? 2.601   -8.089  11.583 1.00 0.00 ? 36  SER A N    4  
ATOM 5893  C CA   . SER A 1 36  ? 3.276   -9.320  11.957 1.00 0.00 ? 36  SER A CA   4  
ATOM 5894  C C    . SER A 1 36  ? 4.449   -9.011  12.889 1.00 0.00 ? 36  SER A C    4  
ATOM 5895  O O    . SER A 1 36  ? 5.170   -9.916  13.306 1.00 0.00 ? 36  SER A O    4  
ATOM 5896  C CB   . SER A 1 36  ? 3.766   -10.077 10.720 1.00 0.00 ? 36  SER A CB   4  
ATOM 5897  O OG   . SER A 1 36  ? 5.165   -10.343 10.777 1.00 0.00 ? 36  SER A OG   4  
ATOM 5898  H H    . SER A 1 36  ? 1.721   -7.936  12.033 1.00 0.00 ? 36  SER A H    4  
ATOM 5899  H HA   . SER A 1 36  ? 2.524   -9.916  12.473 1.00 0.00 ? 36  SER A HA   4  
ATOM 5900  H HB2  . SER A 1 36  ? 3.222   -11.017 10.631 1.00 0.00 ? 36  SER A HB2  4  
ATOM 5901  H HB3  . SER A 1 36  ? 3.544   -9.494  9.827  1.00 0.00 ? 36  SER A HB3  4  
ATOM 5902  H HG   . SER A 1 36  ? 5.326   -11.329 10.762 1.00 0.00 ? 36  SER A HG   4  
ATOM 5903  N N    . PHE A 1 37  ? 4.603   -7.730  13.189 1.00 0.00 ? 37  PHE A N    4  
ATOM 5904  C CA   . PHE A 1 37  ? 5.676   -7.290  14.065 1.00 0.00 ? 37  PHE A CA   4  
ATOM 5905  C C    . PHE A 1 37  ? 7.022   -7.313  13.337 1.00 0.00 ? 37  PHE A C    4  
ATOM 5906  O O    . PHE A 1 37  ? 8.045   -6.934  13.905 1.00 0.00 ? 37  PHE A O    4  
ATOM 5907  C CB   . PHE A 1 37  ? 5.727   -8.271  15.238 1.00 0.00 ? 37  PHE A CB   4  
ATOM 5908  C CG   . PHE A 1 37  ? 4.356   -8.795  15.670 1.00 0.00 ? 37  PHE A CG   4  
ATOM 5909  C CD1  . PHE A 1 37  ? 3.401   -7.927  16.098 1.00 0.00 ? 37  PHE A CD1  4  
ATOM 5910  C CD2  . PHE A 1 37  ? 4.094   -10.129 15.628 1.00 0.00 ? 37  PHE A CD2  4  
ATOM 5911  C CE1  . PHE A 1 37  ? 2.128   -8.413  16.499 1.00 0.00 ? 37  PHE A CE1  4  
ATOM 5912  C CE2  . PHE A 1 37  ? 2.821   -10.615 16.030 1.00 0.00 ? 37  PHE A CE2  4  
ATOM 5913  C CZ   . PHE A 1 37  ? 1.866   -9.747  16.457 1.00 0.00 ? 37  PHE A CZ   4  
ATOM 5914  H H    . PHE A 1 37  ? 4.012   -7.000  12.846 1.00 0.00 ? 37  PHE A H    4  
ATOM 5915  H HA   . PHE A 1 37  ? 5.448   -6.269  14.369 1.00 0.00 ? 37  PHE A HA   4  
ATOM 5916  H HB2  . PHE A 1 37  ? 6.358   -9.117  14.964 1.00 0.00 ? 37  PHE A HB2  4  
ATOM 5917  H HB3  . PHE A 1 37  ? 6.202   -7.781  16.088 1.00 0.00 ? 37  PHE A HB3  4  
ATOM 5918  H HD1  . PHE A 1 37  ? 3.611   -6.858  16.132 1.00 0.00 ? 37  PHE A HD1  4  
ATOM 5919  H HD2  . PHE A 1 37  ? 4.860   -10.825 15.286 1.00 0.00 ? 37  PHE A HD2  4  
ATOM 5920  H HE1  . PHE A 1 37  ? 1.362   -7.718  16.842 1.00 0.00 ? 37  PHE A HE1  4  
ATOM 5921  H HE2  . PHE A 1 37  ? 2.611   -11.684 15.996 1.00 0.00 ? 37  PHE A HE2  4  
ATOM 5922  H HZ   . PHE A 1 37  ? 0.889   -10.120 16.765 1.00 0.00 ? 37  PHE A HZ   4  
ATOM 5923  N N    . GLU A 1 38  ? 6.977   -7.761  12.091 1.00 0.00 ? 38  GLU A N    4  
ATOM 5924  C CA   . GLU A 1 38  ? 8.180   -7.839  11.280 1.00 0.00 ? 38  GLU A CA   4  
ATOM 5925  C C    . GLU A 1 38  ? 8.184   -6.728  10.229 1.00 0.00 ? 38  GLU A C    4  
ATOM 5926  O O    . GLU A 1 38  ? 9.039   -5.844  10.258 1.00 0.00 ? 38  GLU A O    4  
ATOM 5927  C CB   . GLU A 1 38  ? 8.311   -9.215  10.624 1.00 0.00 ? 38  GLU A CB   4  
ATOM 5928  C CG   . GLU A 1 38  ? 8.935   -10.225 11.589 1.00 0.00 ? 38  GLU A CG   4  
ATOM 5929  C CD   . GLU A 1 38  ? 10.078  -10.990 10.918 1.00 0.00 ? 38  GLU A CD   4  
ATOM 5930  O OE1  . GLU A 1 38  ? 11.061  -10.320 10.535 1.00 0.00 ? 38  GLU A OE1  4  
ATOM 5931  O OE2  . GLU A 1 38  ? 9.944   -12.227 10.805 1.00 0.00 ? 38  GLU A OE2  4  
ATOM 5932  H H    . GLU A 1 38  ? 6.141   -8.068  11.637 1.00 0.00 ? 38  GLU A H    4  
ATOM 5933  H HA   . GLU A 1 38  ? 9.008   -7.694  11.975 1.00 0.00 ? 38  GLU A HA   4  
ATOM 5934  H HB2  . GLU A 1 38  ? 7.329   -9.566  10.308 1.00 0.00 ? 38  GLU A HB2  4  
ATOM 5935  H HB3  . GLU A 1 38  ? 8.925   -9.137  9.727  1.00 0.00 ? 38  GLU A HB3  4  
ATOM 5936  H HG2  . GLU A 1 38  ? 9.308   -9.708  12.472 1.00 0.00 ? 38  GLU A HG2  4  
ATOM 5937  H HG3  . GLU A 1 38  ? 8.173   -10.927 11.928 1.00 0.00 ? 38  GLU A HG3  4  
ATOM 5938  N N    . THR A 1 39  ? 7.219   -6.808  9.325  1.00 0.00 ? 39  THR A N    4  
ATOM 5939  C CA   . THR A 1 39  ? 7.100   -5.820  8.266  1.00 0.00 ? 39  THR A CA   4  
ATOM 5940  C C    . THR A 1 39  ? 7.443   -4.426  8.797  1.00 0.00 ? 39  THR A C    4  
ATOM 5941  O O    . THR A 1 39  ? 6.598   -3.760  9.393  1.00 0.00 ? 39  THR A O    4  
ATOM 5942  C CB   . THR A 1 39  ? 5.689   -5.918  7.684  1.00 0.00 ? 39  THR A CB   4  
ATOM 5943  O OG1  . THR A 1 39  ? 5.846   -6.738  6.529  1.00 0.00 ? 39  THR A OG1  4  
ATOM 5944  C CG2  . THR A 1 39  ? 5.190   -4.583  7.128  1.00 0.00 ? 39  THR A CG2  4  
ATOM 5945  H H    . THR A 1 39  ? 6.527   -7.530  9.308  1.00 0.00 ? 39  THR A H    4  
ATOM 5946  H HA   . THR A 1 39  ? 7.830   -6.056  7.493  1.00 0.00 ? 39  THR A HA   4  
ATOM 5947  H HB   . THR A 1 39  ? 4.991   -6.319  8.419  1.00 0.00 ? 39  THR A HB   4  
ATOM 5948  H HG1  . THR A 1 39  ? 6.175   -7.644  6.795  1.00 0.00 ? 39  THR A HG1  4  
ATOM 5949  H HG21 . THR A 1 39  ? 5.976   -4.122  6.529  1.00 0.00 ? 39  THR A HG21 4  
ATOM 5950  H HG22 . THR A 1 39  ? 4.312   -4.754  6.505  1.00 0.00 ? 39  THR A HG22 4  
ATOM 5951  H HG23 . THR A 1 39  ? 4.927   -3.921  7.953  1.00 0.00 ? 39  THR A HG23 4  
ATOM 5952  N N    . THR A 1 40  ? 8.684   -4.027  8.561  1.00 0.00 ? 40  THR A N    4  
ATOM 5953  C CA   . THR A 1 40  ? 9.149   -2.725  9.008  1.00 0.00 ? 40  THR A CA   4  
ATOM 5954  C C    . THR A 1 40  ? 8.532   -1.616  8.152  1.00 0.00 ? 40  THR A C    4  
ATOM 5955  O O    . THR A 1 40  ? 7.590   -1.859  7.400  1.00 0.00 ? 40  THR A O    4  
ATOM 5956  C CB   . THR A 1 40  ? 10.678  -2.734  8.981  1.00 0.00 ? 40  THR A CB   4  
ATOM 5957  O OG1  . THR A 1 40  ? 11.000  -3.280  7.704  1.00 0.00 ? 40  THR A OG1  4  
ATOM 5958  C CG2  . THR A 1 40  ? 11.275  -3.733  9.974  1.00 0.00 ? 40  THR A CG2  4  
ATOM 5959  H H    . THR A 1 40  ? 9.365   -4.575  8.076  1.00 0.00 ? 40  THR A H    4  
ATOM 5960  H HA   . THR A 1 40  ? 8.803   -2.569  10.030 1.00 0.00 ? 40  THR A HA   4  
ATOM 5961  H HB   . THR A 1 40  ? 11.076  -1.733  9.148  1.00 0.00 ? 40  THR A HB   4  
ATOM 5962  H HG1  . THR A 1 40  ? 10.900  -2.580  6.998  1.00 0.00 ? 40  THR A HG1  4  
ATOM 5963  H HG21 . THR A 1 40  ? 10.985  -4.745  9.691  1.00 0.00 ? 40  THR A HG21 4  
ATOM 5964  H HG22 . THR A 1 40  ? 12.362  -3.650  9.964  1.00 0.00 ? 40  THR A HG22 4  
ATOM 5965  H HG23 . THR A 1 40  ? 10.904  -3.515  10.976 1.00 0.00 ? 40  THR A HG23 4  
ATOM 5966  N N    . GLU A 1 41  ? 9.090   -0.423  8.295  1.00 0.00 ? 41  GLU A N    4  
ATOM 5967  C CA   . GLU A 1 41  ? 8.607   0.723   7.545  1.00 0.00 ? 41  GLU A CA   4  
ATOM 5968  C C    . GLU A 1 41  ? 8.748   0.472   6.042  1.00 0.00 ? 41  GLU A C    4  
ATOM 5969  O O    . GLU A 1 41  ? 7.776   0.584   5.297  1.00 0.00 ? 41  GLU A O    4  
ATOM 5970  C CB   . GLU A 1 41  ? 9.344   1.999   7.958  1.00 0.00 ? 41  GLU A CB   4  
ATOM 5971  C CG   . GLU A 1 41  ? 9.207   2.248   9.461  1.00 0.00 ? 41  GLU A CG   4  
ATOM 5972  C CD   . GLU A 1 41  ? 9.663   3.663   9.826  1.00 0.00 ? 41  GLU A CD   4  
ATOM 5973  O OE1  . GLU A 1 41  ? 10.448  4.228   9.035  1.00 0.00 ? 41  GLU A OE1  4  
ATOM 5974  O OE2  . GLU A 1 41  ? 9.216   4.146   10.889 1.00 0.00 ? 41  GLU A OE2  4  
ATOM 5975  H H    . GLU A 1 41  ? 9.857   -0.234  8.909  1.00 0.00 ? 41  GLU A H    4  
ATOM 5976  H HA   . GLU A 1 41  ? 7.554   0.818   7.807  1.00 0.00 ? 41  GLU A HA   4  
ATOM 5977  H HB2  . GLU A 1 41  ? 10.398  1.916   7.694  1.00 0.00 ? 41  GLU A HB2  4  
ATOM 5978  H HB3  . GLU A 1 41  ? 8.943   2.850   7.407  1.00 0.00 ? 41  GLU A HB3  4  
ATOM 5979  H HG2  . GLU A 1 41  ? 8.169   2.107   9.764  1.00 0.00 ? 41  GLU A HG2  4  
ATOM 5980  H HG3  . GLU A 1 41  ? 9.801   1.518   10.010 1.00 0.00 ? 41  GLU A HG3  4  
ATOM 5981  N N    . GLU A 1 42  ? 9.966   0.136   5.642  1.00 0.00 ? 42  GLU A N    4  
ATOM 5982  C CA   . GLU A 1 42  ? 10.246  -0.132  4.242  1.00 0.00 ? 42  GLU A CA   4  
ATOM 5983  C C    . GLU A 1 42  ? 9.420   -1.324  3.754  1.00 0.00 ? 42  GLU A C    4  
ATOM 5984  O O    . GLU A 1 42  ? 8.588   -1.182  2.859  1.00 0.00 ? 42  GLU A O    4  
ATOM 5985  C CB   . GLU A 1 42  ? 11.740  -0.373  4.018  1.00 0.00 ? 42  GLU A CB   4  
ATOM 5986  C CG   . GLU A 1 42  ? 12.188  0.179   2.663  1.00 0.00 ? 42  GLU A CG   4  
ATOM 5987  C CD   . GLU A 1 42  ? 13.710  0.326   2.607  1.00 0.00 ? 42  GLU A CD   4  
ATOM 5988  O OE1  . GLU A 1 42  ? 14.389  -0.622  3.059  1.00 0.00 ? 42  GLU A OE1  4  
ATOM 5989  O OE2  . GLU A 1 42  ? 14.161  1.382   2.114  1.00 0.00 ? 42  GLU A OE2  4  
ATOM 5990  H H    . GLU A 1 42  ? 10.751  0.048   6.255  1.00 0.00 ? 42  GLU A H    4  
ATOM 5991  H HA   . GLU A 1 42  ? 9.946   0.770   3.708  1.00 0.00 ? 42  GLU A HA   4  
ATOM 5992  H HB2  . GLU A 1 42  ? 12.312  0.102   4.815  1.00 0.00 ? 42  GLU A HB2  4  
ATOM 5993  H HB3  . GLU A 1 42  ? 11.952  -1.441  4.067  1.00 0.00 ? 42  GLU A HB3  4  
ATOM 5994  H HG2  . GLU A 1 42  ? 11.854  -0.485  1.867  1.00 0.00 ? 42  GLU A HG2  4  
ATOM 5995  H HG3  . GLU A 1 42  ? 11.719  1.148   2.489  1.00 0.00 ? 42  GLU A HG3  4  
ATOM 5996  N N    . SER A 1 43  ? 9.677   -2.471  4.364  1.00 0.00 ? 43  SER A N    4  
ATOM 5997  C CA   . SER A 1 43  ? 8.968   -3.687  4.003  1.00 0.00 ? 43  SER A CA   4  
ATOM 5998  C C    . SER A 1 43  ? 7.489   -3.377  3.760  1.00 0.00 ? 43  SER A C    4  
ATOM 5999  O O    . SER A 1 43  ? 6.832   -4.049  2.967  1.00 0.00 ? 43  SER A O    4  
ATOM 6000  C CB   . SER A 1 43  ? 9.114   -4.754  5.089  1.00 0.00 ? 43  SER A CB   4  
ATOM 6001  O OG   . SER A 1 43  ? 10.340  -5.471  4.971  1.00 0.00 ? 43  SER A OG   4  
ATOM 6002  H H    . SER A 1 43  ? 10.355  -2.578  5.091  1.00 0.00 ? 43  SER A H    4  
ATOM 6003  H HA   . SER A 1 43  ? 9.441   -4.036  3.085  1.00 0.00 ? 43  SER A HA   4  
ATOM 6004  H HB2  . SER A 1 43  ? 9.064   -4.281  6.071  1.00 0.00 ? 43  SER A HB2  4  
ATOM 6005  H HB3  . SER A 1 43  ? 8.279   -5.451  5.028  1.00 0.00 ? 43  SER A HB3  4  
ATOM 6006  H HG   . SER A 1 43  ? 10.362  -5.970  4.104  1.00 0.00 ? 43  SER A HG   4  
ATOM 6007  N N    . LEU A 1 44  ? 7.009   -2.358  4.458  1.00 0.00 ? 44  LEU A N    4  
ATOM 6008  C CA   . LEU A 1 44  ? 5.620   -1.951  4.328  1.00 0.00 ? 44  LEU A CA   4  
ATOM 6009  C C    . LEU A 1 44  ? 5.445   -1.154  3.033  1.00 0.00 ? 44  LEU A C    4  
ATOM 6010  O O    . LEU A 1 44  ? 4.697   -1.561  2.146  1.00 0.00 ? 44  LEU A O    4  
ATOM 6011  C CB   . LEU A 1 44  ? 5.163   -1.198  5.579  1.00 0.00 ? 44  LEU A CB   4  
ATOM 6012  C CG   . LEU A 1 44  ? 3.783   -0.542  5.500  1.00 0.00 ? 44  LEU A CG   4  
ATOM 6013  C CD1  . LEU A 1 44  ? 2.672   -1.575  5.695  1.00 0.00 ? 44  LEU A CD1  4  
ATOM 6014  C CD2  . LEU A 1 44  ? 3.669   0.616   6.494  1.00 0.00 ? 44  LEU A CD2  4  
ATOM 6015  H H    . LEU A 1 44  ? 7.549   -1.816  5.101  1.00 0.00 ? 44  LEU A H    4  
ATOM 6016  H HA   . LEU A 1 44  ? 5.019   -2.857  4.259  1.00 0.00 ? 44  LEU A HA   4  
ATOM 6017  H HB2  . LEU A 1 44  ? 5.165   -1.894  6.418  1.00 0.00 ? 44  LEU A HB2  4  
ATOM 6018  H HB3  . LEU A 1 44  ? 5.898   -0.426  5.803  1.00 0.00 ? 44  LEU A HB3  4  
ATOM 6019  H HG   . LEU A 1 44  ? 3.661   -0.122  4.502  1.00 0.00 ? 44  LEU A HG   4  
ATOM 6020  H HD11 . LEU A 1 44  ? 2.581   -2.185  4.796  1.00 0.00 ? 44  LEU A HD11 4  
ATOM 6021  H HD12 . LEU A 1 44  ? 2.915   -2.214  6.544  1.00 0.00 ? 44  LEU A HD12 4  
ATOM 6022  H HD13 . LEU A 1 44  ? 1.728   -1.064  5.884  1.00 0.00 ? 44  LEU A HD13 4  
ATOM 6023  H HD21 . LEU A 1 44  ? 4.126   1.509   6.066  1.00 0.00 ? 44  LEU A HD21 4  
ATOM 6024  H HD22 . LEU A 1 44  ? 2.618   0.811   6.706  1.00 0.00 ? 44  LEU A HD22 4  
ATOM 6025  H HD23 . LEU A 1 44  ? 4.183   0.353   7.419  1.00 0.00 ? 44  LEU A HD23 4  
ATOM 6026  N N    . ARG A 1 45  ? 6.149   -0.034  2.966  1.00 0.00 ? 45  ARG A N    4  
ATOM 6027  C CA   . ARG A 1 45  ? 6.082   0.823   1.795  1.00 0.00 ? 45  ARG A CA   4  
ATOM 6028  C C    . ARG A 1 45  ? 6.205   -0.011  0.518  1.00 0.00 ? 45  ARG A C    4  
ATOM 6029  O O    . ARG A 1 45  ? 5.409   0.141   -0.407 1.00 0.00 ? 45  ARG A O    4  
ATOM 6030  C CB   . ARG A 1 45  ? 7.192   1.876   1.817  1.00 0.00 ? 45  ARG A CB   4  
ATOM 6031  C CG   . ARG A 1 45  ? 7.185   2.652   3.135  1.00 0.00 ? 45  ARG A CG   4  
ATOM 6032  C CD   . ARG A 1 45  ? 7.525   4.126   2.906  1.00 0.00 ? 45  ARG A CD   4  
ATOM 6033  N NE   . ARG A 1 45  ? 8.844   4.440   3.501  1.00 0.00 ? 45  ARG A NE   4  
ATOM 6034  C CZ   . ARG A 1 45  ? 10.016  4.207   2.895  1.00 0.00 ? 45  ARG A CZ   4  
ATOM 6035  N NH1  . ARG A 1 45  ? 10.041  3.656   1.673  1.00 0.00 ? 45  ARG A NH1  4  
ATOM 6036  N NH2  . ARG A 1 45  ? 11.163  4.524   3.511  1.00 0.00 ? 45  ARG A NH2  4  
ATOM 6037  H H    . ARG A 1 45  ? 6.756   0.290   3.692  1.00 0.00 ? 45  ARG A H    4  
ATOM 6038  H HA   . ARG A 1 45  ? 5.105   1.303   1.856  1.00 0.00 ? 45  ARG A HA   4  
ATOM 6039  H HB2  . ARG A 1 45  ? 8.159   1.392   1.682  1.00 0.00 ? 45  ARG A HB2  4  
ATOM 6040  H HB3  . ARG A 1 45  ? 7.061   2.566   0.984  1.00 0.00 ? 45  ARG A HB3  4  
ATOM 6041  H HG2  . ARG A 1 45  ? 6.204   2.571   3.604  1.00 0.00 ? 45  ARG A HG2  4  
ATOM 6042  H HG3  . ARG A 1 45  ? 7.905   2.212   3.825  1.00 0.00 ? 45  ARG A HG3  4  
ATOM 6043  H HD2  . ARG A 1 45  ? 7.538   4.343   1.837  1.00 0.00 ? 45  ARG A HD2  4  
ATOM 6044  H HD3  . ARG A 1 45  ? 6.757   4.759   3.349  1.00 0.00 ? 45  ARG A HD3  4  
ATOM 6045  H HE   . ARG A 1 45  ? 8.861   4.852   4.412  1.00 0.00 ? 45  ARG A HE   4  
ATOM 6046  H HH11 . ARG A 1 45  ? 9.185   3.420   1.214  1.00 0.00 ? 45  ARG A HH11 4  
ATOM 6047  H HH12 . ARG A 1 45  ? 10.916  3.482   1.221  1.00 0.00 ? 45  ARG A HH12 4  
ATOM 6048  H HH21 . ARG A 1 45  ? 11.144  4.935   4.422  1.00 0.00 ? 45  ARG A HH21 4  
ATOM 6049  H HH22 . ARG A 1 45  ? 12.038  4.350   3.059  1.00 0.00 ? 45  ARG A HH22 4  
ATOM 6050  N N    . ASN A 1 46  ? 7.210   -0.875  0.509  1.00 0.00 ? 46  ASN A N    4  
ATOM 6051  C CA   . ASN A 1 46  ? 7.448   -1.734  -0.638 1.00 0.00 ? 46  ASN A CA   4  
ATOM 6052  C C    . ASN A 1 46  ? 6.130   -2.381  -1.068 1.00 0.00 ? 46  ASN A C    4  
ATOM 6053  O O    . ASN A 1 46  ? 5.966   -2.752  -2.229 1.00 0.00 ? 46  ASN A O    4  
ATOM 6054  C CB   . ASN A 1 46  ? 8.433   -2.852  -0.294 1.00 0.00 ? 46  ASN A CB   4  
ATOM 6055  C CG   . ASN A 1 46  ? 8.545   -3.858  -1.442 1.00 0.00 ? 46  ASN A CG   4  
ATOM 6056  O OD1  . ASN A 1 46  ? 8.920   -3.529  -2.555 1.00 0.00 ? 46  ASN A OD1  4  
ATOM 6057  N ND2  . ASN A 1 46  ? 8.198   -5.098  -1.110 1.00 0.00 ? 46  ASN A ND2  4  
ATOM 6058  H H    . ASN A 1 46  ? 7.853   -0.993  1.266  1.00 0.00 ? 46  ASN A H    4  
ATOM 6059  H HA   . ASN A 1 46  ? 7.861   -1.079  -1.405 1.00 0.00 ? 46  ASN A HA   4  
ATOM 6060  H HB2  . ASN A 1 46  ? 9.414   -2.426  -0.083 1.00 0.00 ? 46  ASN A HB2  4  
ATOM 6061  H HB3  . ASN A 1 46  ? 8.107   -3.364  0.612  1.00 0.00 ? 46  ASN A HB3  4  
ATOM 6062  H HD21 . ASN A 1 46  ? 7.898   -5.301  -0.178 1.00 0.00 ? 46  ASN A HD21 4  
ATOM 6063  H HD22 . ASN A 1 46  ? 8.237   -5.828  -1.793 1.00 0.00 ? 46  ASN A HD22 4  
ATOM 6064  N N    . TYR A 1 47  ? 5.224   -2.497  -0.108 1.00 0.00 ? 47  TYR A N    4  
ATOM 6065  C CA   . TYR A 1 47  ? 3.925   -3.093  -0.372 1.00 0.00 ? 47  TYR A CA   4  
ATOM 6066  C C    . TYR A 1 47  ? 2.889   -2.020  -0.713 1.00 0.00 ? 47  TYR A C    4  
ATOM 6067  O O    . TYR A 1 47  ? 2.124   -2.170  -1.664 1.00 0.00 ? 47  TYR A O    4  
ATOM 6068  C CB   . TYR A 1 47  ? 3.510   -3.792  0.924  1.00 0.00 ? 47  TYR A CB   4  
ATOM 6069  C CG   . TYR A 1 47  ? 2.411   -4.840  0.741  1.00 0.00 ? 47  TYR A CG   4  
ATOM 6070  C CD1  . TYR A 1 47  ? 1.084   -4.470  0.827  1.00 0.00 ? 47  TYR A CD1  4  
ATOM 6071  C CD2  . TYR A 1 47  ? 2.745   -6.155  0.489  1.00 0.00 ? 47  TYR A CD2  4  
ATOM 6072  C CE1  . TYR A 1 47  ? 0.049   -5.456  0.654  1.00 0.00 ? 47  TYR A CE1  4  
ATOM 6073  C CE2  . TYR A 1 47  ? 1.710   -7.141  0.317  1.00 0.00 ? 47  TYR A CE2  4  
ATOM 6074  C CZ   . TYR A 1 47  ? 0.413   -6.743  0.408  1.00 0.00 ? 47  TYR A CZ   4  
ATOM 6075  O OH   . TYR A 1 47  ? -0.564  -7.674  0.246  1.00 0.00 ? 47  TYR A OH   4  
ATOM 6076  H H    . TYR A 1 47  ? 5.365   -2.193  0.834  1.00 0.00 ? 47  TYR A H    4  
ATOM 6077  H HA   . TYR A 1 47  ? 4.031   -3.767  -1.222 1.00 0.00 ? 47  TYR A HA   4  
ATOM 6078  H HB2  . TYR A 1 47  ? 4.386   -4.272  1.362  1.00 0.00 ? 47  TYR A HB2  4  
ATOM 6079  H HB3  . TYR A 1 47  ? 3.168   -3.042  1.636  1.00 0.00 ? 47  TYR A HB3  4  
ATOM 6080  H HD1  . TYR A 1 47  ? 0.820   -3.431  1.025  1.00 0.00 ? 47  TYR A HD1  4  
ATOM 6081  H HD2  . TYR A 1 47  ? 3.793   -6.447  0.421  1.00 0.00 ? 47  TYR A HD2  4  
ATOM 6082  H HE1  . TYR A 1 47  ? -1.003  -5.177  0.720  1.00 0.00 ? 47  TYR A HE1  4  
ATOM 6083  H HE2  . TYR A 1 47  ? 1.961   -8.183  0.118  1.00 0.00 ? 47  TYR A HE2  4  
ATOM 6084  H HH   . TYR A 1 47  ? -1.426  -7.227  0.005  1.00 0.00 ? 47  TYR A HH   4  
ATOM 6085  N N    . TYR A 1 48  ? 2.898   -0.960  0.083  1.00 0.00 ? 48  TYR A N    4  
ATOM 6086  C CA   . TYR A 1 48  ? 1.968   0.137   -0.122 1.00 0.00 ? 48  TYR A CA   4  
ATOM 6087  C C    . TYR A 1 48  ? 2.549   1.175   -1.085 1.00 0.00 ? 48  TYR A C    4  
ATOM 6088  O O    . TYR A 1 48  ? 2.140   2.336   -1.073 1.00 0.00 ? 48  TYR A O    4  
ATOM 6089  C CB   . TYR A 1 48  ? 1.771   0.785   1.250  1.00 0.00 ? 48  TYR A CB   4  
ATOM 6090  C CG   . TYR A 1 48  ? 0.719   0.093   2.119  1.00 0.00 ? 48  TYR A CG   4  
ATOM 6091  C CD1  . TYR A 1 48  ? -0.615  0.420   1.979  1.00 0.00 ? 48  TYR A CD1  4  
ATOM 6092  C CD2  . TYR A 1 48  ? 1.104   -0.857  3.043  1.00 0.00 ? 48  TYR A CD2  4  
ATOM 6093  C CE1  . TYR A 1 48  ? -1.605  -0.232  2.797  1.00 0.00 ? 48  TYR A CE1  4  
ATOM 6094  C CE2  . TYR A 1 48  ? 0.113   -1.508  3.861  1.00 0.00 ? 48  TYR A CE2  4  
ATOM 6095  C CZ   . TYR A 1 48  ? -1.192  -1.163  3.698  1.00 0.00 ? 48  TYR A CZ   4  
ATOM 6096  O OH   . TYR A 1 48  ? -2.127  -1.778  4.471  1.00 0.00 ? 48  TYR A OH   4  
ATOM 6097  H H    . TYR A 1 48  ? 3.523   -0.845  0.854  1.00 0.00 ? 48  TYR A H    4  
ATOM 6098  H HA   . TYR A 1 48  ? 1.053   -0.272  -0.551 1.00 0.00 ? 48  TYR A HA   4  
ATOM 6099  H HB2  . TYR A 1 48  ? 2.723   0.785   1.780  1.00 0.00 ? 48  TYR A HB2  4  
ATOM 6100  H HB3  . TYR A 1 48  ? 1.484   1.827   1.110  1.00 0.00 ? 48  TYR A HB3  4  
ATOM 6101  H HD1  . TYR A 1 48  ? -0.919  1.170   1.249  1.00 0.00 ? 48  TYR A HD1  4  
ATOM 6102  H HD2  . TYR A 1 48  ? 2.157   -1.114  3.154  1.00 0.00 ? 48  TYR A HD2  4  
ATOM 6103  H HE1  . TYR A 1 48  ? -2.662  0.017   2.697  1.00 0.00 ? 48  TYR A HE1  4  
ATOM 6104  H HE2  . TYR A 1 48  ? 0.404   -2.260  4.595  1.00 0.00 ? 48  TYR A HE2  4  
ATOM 6105  H HH   . TYR A 1 48  ? -3.025  -1.716  4.035  1.00 0.00 ? 48  TYR A HH   4  
ATOM 6106  N N    . GLU A 1 49  ? 3.493   0.721   -1.895 1.00 0.00 ? 49  GLU A N    4  
ATOM 6107  C CA   . GLU A 1 49  ? 4.135   1.596   -2.862 1.00 0.00 ? 49  GLU A CA   4  
ATOM 6108  C C    . GLU A 1 49  ? 3.510   1.406   -4.245 1.00 0.00 ? 49  GLU A C    4  
ATOM 6109  O O    . GLU A 1 49  ? 3.721   2.221   -5.143 1.00 0.00 ? 49  GLU A O    4  
ATOM 6110  C CB   . GLU A 1 49  ? 5.645   1.353   -2.904 1.00 0.00 ? 49  GLU A CB   4  
ATOM 6111  C CG   . GLU A 1 49  ? 6.389   2.378   -2.045 1.00 0.00 ? 49  GLU A CG   4  
ATOM 6112  C CD   . GLU A 1 49  ? 7.761   2.699   -2.641 1.00 0.00 ? 49  GLU A CD   4  
ATOM 6113  O OE1  . GLU A 1 49  ? 8.561   1.746   -2.769 1.00 0.00 ? 49  GLU A OE1  4  
ATOM 6114  O OE2  . GLU A 1 49  ? 7.980   3.888   -2.956 1.00 0.00 ? 49  GLU A OE2  4  
ATOM 6115  H H    . GLU A 1 49  ? 3.820   -0.224  -1.898 1.00 0.00 ? 49  GLU A H    4  
ATOM 6116  H HA   . GLU A 1 49  ? 3.946   2.609   -2.506 1.00 0.00 ? 49  GLU A HA   4  
ATOM 6117  H HB2  . GLU A 1 49  ? 5.865   0.347   -2.548 1.00 0.00 ? 49  GLU A HB2  4  
ATOM 6118  H HB3  . GLU A 1 49  ? 5.998   1.411   -3.933 1.00 0.00 ? 49  GLU A HB3  4  
ATOM 6119  H HG2  . GLU A 1 49  ? 5.799   3.291   -1.970 1.00 0.00 ? 49  GLU A HG2  4  
ATOM 6120  H HG3  . GLU A 1 49  ? 6.509   1.991   -1.034 1.00 0.00 ? 49  GLU A HG3  4  
ATOM 6121  N N    . GLN A 1 50  ? 2.754   0.326   -4.375 1.00 0.00 ? 50  GLN A N    4  
ATOM 6122  C CA   . GLN A 1 50  ? 2.097   0.019   -5.634 1.00 0.00 ? 50  GLN A CA   4  
ATOM 6123  C C    . GLN A 1 50  ? 0.780   0.789   -5.748 1.00 0.00 ? 50  GLN A C    4  
ATOM 6124  O O    . GLN A 1 50  ? 0.144   0.787   -6.801 1.00 0.00 ? 50  GLN A O    4  
ATOM 6125  C CB   . GLN A 1 50  ? 1.866   -1.486  -5.780 1.00 0.00 ? 50  GLN A CB   4  
ATOM 6126  C CG   . GLN A 1 50  ? 0.700   -1.949  -4.905 1.00 0.00 ? 50  GLN A CG   4  
ATOM 6127  C CD   . GLN A 1 50  ? 1.152   -3.022  -3.912 1.00 0.00 ? 50  GLN A CD   4  
ATOM 6128  O OE1  . GLN A 1 50  ? 2.328   -3.314  -3.766 1.00 0.00 ? 50  GLN A OE1  4  
ATOM 6129  N NE2  . GLN A 1 50  ? 0.156   -3.590  -3.239 1.00 0.00 ? 50  GLN A NE2  4  
ATOM 6130  H H    . GLN A 1 50  ? 2.587   -0.331  -3.640 1.00 0.00 ? 50  GLN A H    4  
ATOM 6131  H HA   . GLN A 1 50  ? 2.787   0.352   -6.410 1.00 0.00 ? 50  GLN A HA   4  
ATOM 6132  H HB2  . GLN A 1 50  ? 1.661   -1.727  -6.823 1.00 0.00 ? 50  GLN A HB2  4  
ATOM 6133  H HB3  . GLN A 1 50  ? 2.772   -2.025  -5.501 1.00 0.00 ? 50  GLN A HB3  4  
ATOM 6134  H HG2  . GLN A 1 50  ? 0.287   -1.098  -4.364 1.00 0.00 ? 50  GLN A HG2  4  
ATOM 6135  H HG3  . GLN A 1 50  ? -0.097  -2.345  -5.535 1.00 0.00 ? 50  GLN A HG3  4  
ATOM 6136  H HE21 . GLN A 1 50  ? -0.788  -3.304  -3.406 1.00 0.00 ? 50  GLN A HE21 4  
ATOM 6137  H HE22 . GLN A 1 50  ? 0.350   -4.303  -2.565 1.00 0.00 ? 50  GLN A HE22 4  
ATOM 6138  N N    . TRP A 1 51  ? 0.409   1.429   -4.648 1.00 0.00 ? 51  TRP A N    4  
ATOM 6139  C CA   . TRP A 1 51  ? -0.821  2.201   -4.611 1.00 0.00 ? 51  TRP A CA   4  
ATOM 6140  C C    . TRP A 1 51  ? -0.452  3.683   -4.706 1.00 0.00 ? 51  TRP A C    4  
ATOM 6141  O O    . TRP A 1 51  ? -1.152  4.460   -5.354 1.00 0.00 ? 51  TRP A O    4  
ATOM 6142  C CB   . TRP A 1 51  ? -1.640  1.869   -3.362 1.00 0.00 ? 51  TRP A CB   4  
ATOM 6143  C CG   . TRP A 1 51  ? -2.231  0.458   -3.363 1.00 0.00 ? 51  TRP A CG   4  
ATOM 6144  C CD1  . TRP A 1 51  ? -2.996  -0.116  -4.302 1.00 0.00 ? 51  TRP A CD1  4  
ATOM 6145  C CD2  . TRP A 1 51  ? -2.075  -0.541  -2.333 1.00 0.00 ? 51  TRP A CD2  4  
ATOM 6146  N NE1  . TRP A 1 51  ? -3.342  -1.406  -3.955 1.00 0.00 ? 51  TRP A NE1  4  
ATOM 6147  C CE2  . TRP A 1 51  ? -2.764  -1.673  -2.719 1.00 0.00 ? 51  TRP A CE2  4  
ATOM 6148  C CE3  . TRP A 1 51  ? -1.373  -0.491  -1.115 1.00 0.00 ? 51  TRP A CE3  4  
ATOM 6149  C CZ2  . TRP A 1 51  ? -2.820  -2.838  -1.945 1.00 0.00 ? 51  TRP A CZ2  4  
ATOM 6150  C CZ3  . TRP A 1 51  ? -1.439  -1.663  -0.353 1.00 0.00 ? 51  TRP A CZ3  4  
ATOM 6151  C CH2  . TRP A 1 51  ? -2.128  -2.810  -0.728 1.00 0.00 ? 51  TRP A CH2  4  
ATOM 6152  H H    . TRP A 1 51  ? 0.932   1.426   -3.796 1.00 0.00 ? 51  TRP A H    4  
ATOM 6153  H HA   . TRP A 1 51  ? -1.424  1.911   -5.471 1.00 0.00 ? 51  TRP A HA   4  
ATOM 6154  H HB2  . TRP A 1 51  ? -1.006  1.985   -2.483 1.00 0.00 ? 51  TRP A HB2  4  
ATOM 6155  H HB3  . TRP A 1 51  ? -2.451  2.591   -3.268 1.00 0.00 ? 51  TRP A HB3  4  
ATOM 6156  H HD1  . TRP A 1 51  ? -3.306  0.375   -5.225 1.00 0.00 ? 51  TRP A HD1  4  
ATOM 6157  H HE1  . TRP A 1 51  ? -3.956  -2.089  -4.541 1.00 0.00 ? 51  TRP A HE1  4  
ATOM 6158  H HE3  . TRP A 1 51  ? -0.822  0.391   -0.788 1.00 0.00 ? 51  TRP A HE3  4  
ATOM 6159  H HZ2  . TRP A 1 51  ? -3.371  -3.719  -2.273 1.00 0.00 ? 51  TRP A HZ2  4  
ATOM 6160  H HZ3  . TRP A 1 51  ? -0.912  -1.678  0.601  1.00 0.00 ? 51  TRP A HZ3  4  
ATOM 6161  H HH2  . TRP A 1 51  ? -2.131  -3.685  -0.077 1.00 0.00 ? 51  TRP A HH2  4  
ATOM 6162  N N    . GLY A 1 52  ? 0.646   4.030   -4.052 1.00 0.00 ? 52  GLY A N    4  
ATOM 6163  C CA   . GLY A 1 52  ? 1.116   5.405   -4.055 1.00 0.00 ? 52  GLY A CA   4  
ATOM 6164  C C    . GLY A 1 52  ? 2.388   5.551   -3.217 1.00 0.00 ? 52  GLY A C    4  
ATOM 6165  O O    . GLY A 1 52  ? 2.680   4.706   -2.373 1.00 0.00 ? 52  GLY A O    4  
ATOM 6166  H H    . GLY A 1 52  ? 1.210   3.392   -3.527 1.00 0.00 ? 52  GLY A H    4  
ATOM 6167  H HA2  . GLY A 1 52  ? 1.312   5.724   -5.079 1.00 0.00 ? 52  GLY A HA2  4  
ATOM 6168  H HA3  . GLY A 1 52  ? 0.339   6.060   -3.660 1.00 0.00 ? 52  GLY A HA3  4  
ATOM 6169  N N    . LYS A 1 53  ? 3.111   6.630   -3.481 1.00 0.00 ? 53  LYS A N    4  
ATOM 6170  C CA   . LYS A 1 53  ? 4.345   6.898   -2.762 1.00 0.00 ? 53  LYS A CA   4  
ATOM 6171  C C    . LYS A 1 53  ? 4.014   7.505   -1.397 1.00 0.00 ? 53  LYS A C    4  
ATOM 6172  O O    . LYS A 1 53  ? 3.480   8.610   -1.319 1.00 0.00 ? 53  LYS A O    4  
ATOM 6173  C CB   . LYS A 1 53  ? 5.282   7.762   -3.608 1.00 0.00 ? 53  LYS A CB   4  
ATOM 6174  C CG   . LYS A 1 53  ? 6.159   6.896   -4.514 1.00 0.00 ? 53  LYS A CG   4  
ATOM 6175  C CD   . LYS A 1 53  ? 6.204   7.459   -5.936 1.00 0.00 ? 53  LYS A CD   4  
ATOM 6176  C CE   . LYS A 1 53  ? 5.037   6.931   -6.773 1.00 0.00 ? 53  LYS A CE   4  
ATOM 6177  N NZ   . LYS A 1 53  ? 5.497   6.561   -8.130 1.00 0.00 ? 53  LYS A NZ   4  
ATOM 6178  H H    . LYS A 1 53  ? 2.867   7.312   -4.170 1.00 0.00 ? 53  LYS A H    4  
ATOM 6179  H HA   . LYS A 1 53  ? 4.845   5.942   -2.603 1.00 0.00 ? 53  LYS A HA   4  
ATOM 6180  H HB2  . LYS A 1 53  ? 4.696   8.453   -4.216 1.00 0.00 ? 53  LYS A HB2  4  
ATOM 6181  H HB3  . LYS A 1 53  ? 5.912   8.367   -2.957 1.00 0.00 ? 53  LYS A HB3  4  
ATOM 6182  H HG2  . LYS A 1 53  ? 7.169   6.844   -4.108 1.00 0.00 ? 53  LYS A HG2  4  
ATOM 6183  H HG3  . LYS A 1 53  ? 5.771   5.877   -4.535 1.00 0.00 ? 53  LYS A HG3  4  
ATOM 6184  H HD2  . LYS A 1 53  ? 6.167   8.548   -5.901 1.00 0.00 ? 53  LYS A HD2  4  
ATOM 6185  H HD3  . LYS A 1 53  ? 7.147   7.187   -6.409 1.00 0.00 ? 53  LYS A HD3  4  
ATOM 6186  H HE2  . LYS A 1 53  ? 4.594   6.064   -6.283 1.00 0.00 ? 53  LYS A HE2  4  
ATOM 6187  H HE3  . LYS A 1 53  ? 4.257   7.690   -6.841 1.00 0.00 ? 53  LYS A HE3  4  
ATOM 6188  H HZ1  . LYS A 1 53  ? 6.139   7.251   -8.463 1.00 0.00 ? 53  LYS A HZ1  4  
ATOM 6189  H HZ2  . LYS A 1 53  ? 5.952   5.671   -8.096 1.00 0.00 ? 53  LYS A HZ2  4  
ATOM 6190  H HZ3  . LYS A 1 53  ? 4.711   6.511   -8.746 1.00 0.00 ? 53  LYS A HZ3  4  
ATOM 6191  N N    . LEU A 1 54  ? 4.344   6.755   -0.356 1.00 0.00 ? 54  LEU A N    4  
ATOM 6192  C CA   . LEU A 1 54  ? 4.088   7.205   1.002  1.00 0.00 ? 54  LEU A CA   4  
ATOM 6193  C C    . LEU A 1 54  ? 5.060   8.334   1.352  1.00 0.00 ? 54  LEU A C    4  
ATOM 6194  O O    . LEU A 1 54  ? 6.274   8.173   1.233  1.00 0.00 ? 54  LEU A O    4  
ATOM 6195  C CB   . LEU A 1 54  ? 4.139   6.027   1.976  1.00 0.00 ? 54  LEU A CB   4  
ATOM 6196  C CG   . LEU A 1 54  ? 3.367   4.774   1.554  1.00 0.00 ? 54  LEU A CG   4  
ATOM 6197  C CD1  . LEU A 1 54  ? 3.664   3.605   2.494  1.00 0.00 ? 54  LEU A CD1  4  
ATOM 6198  C CD2  . LEU A 1 54  ? 1.868   5.062   1.452  1.00 0.00 ? 54  LEU A CD2  4  
ATOM 6199  H H    . LEU A 1 54  ? 4.778   5.857   -0.428 1.00 0.00 ? 54  LEU A H    4  
ATOM 6200  H HA   . LEU A 1 54  ? 3.074   7.602   1.028  1.00 0.00 ? 54  LEU A HA   4  
ATOM 6201  H HB2  . LEU A 1 54  ? 5.182   5.752   2.129  1.00 0.00 ? 54  LEU A HB2  4  
ATOM 6202  H HB3  . LEU A 1 54  ? 3.752   6.360   2.939  1.00 0.00 ? 54  LEU A HB3  4  
ATOM 6203  H HG   . LEU A 1 54  ? 3.707   4.483   0.560  1.00 0.00 ? 54  LEU A HG   4  
ATOM 6204  H HD11 . LEU A 1 54  ? 4.742   3.507   2.624  1.00 0.00 ? 54  LEU A HD11 4  
ATOM 6205  H HD12 . LEU A 1 54  ? 3.197   3.789   3.462  1.00 0.00 ? 54  LEU A HD12 4  
ATOM 6206  H HD13 . LEU A 1 54  ? 3.265   2.685   2.067  1.00 0.00 ? 54  LEU A HD13 4  
ATOM 6207  H HD21 . LEU A 1 54  ? 1.320   4.353   2.072  1.00 0.00 ? 54  LEU A HD21 4  
ATOM 6208  H HD22 . LEU A 1 54  ? 1.669   6.077   1.797  1.00 0.00 ? 54  LEU A HD22 4  
ATOM 6209  H HD23 . LEU A 1 54  ? 1.548   4.961   0.415  1.00 0.00 ? 54  LEU A HD23 4  
ATOM 6210  N N    . THR A 1 55  ? 4.490   9.452   1.776  1.00 0.00 ? 55  THR A N    4  
ATOM 6211  C CA   . THR A 1 55  ? 5.291   10.608  2.144  1.00 0.00 ? 55  THR A CA   4  
ATOM 6212  C C    . THR A 1 55  ? 5.811   10.462  3.576  1.00 0.00 ? 55  THR A C    4  
ATOM 6213  O O    . THR A 1 55  ? 6.712   11.190  3.990  1.00 0.00 ? 55  THR A O    4  
ATOM 6214  C CB   . THR A 1 55  ? 4.439   11.860  1.932  1.00 0.00 ? 55  THR A CB   4  
ATOM 6215  O OG1  . THR A 1 55  ? 3.292   11.644  2.750  1.00 0.00 ? 55  THR A OG1  4  
ATOM 6216  C CG2  . THR A 1 55  ? 3.872   11.950  0.513  1.00 0.00 ? 55  THR A CG2  4  
ATOM 6217  H H    . THR A 1 55  ? 3.502   9.576   1.870  1.00 0.00 ? 55  THR A H    4  
ATOM 6218  H HA   . THR A 1 55  ? 6.162   10.645  1.490  1.00 0.00 ? 55  THR A HA   4  
ATOM 6219  H HB   . THR A 1 55  ? 5.000   12.760  2.184  1.00 0.00 ? 55  THR A HB   4  
ATOM 6220  H HG1  . THR A 1 55  ? 3.322   12.248  3.547  1.00 0.00 ? 55  THR A HG1  4  
ATOM 6221  H HG21 . THR A 1 55  ? 3.721   10.945  0.118  1.00 0.00 ? 55  THR A HG21 4  
ATOM 6222  H HG22 . THR A 1 55  ? 2.919   12.478  0.535  1.00 0.00 ? 55  THR A HG22 4  
ATOM 6223  H HG23 . THR A 1 55  ? 4.572   12.489  -0.124 1.00 0.00 ? 55  THR A HG23 4  
ATOM 6224  N N    . ASP A 1 56  ? 5.220   9.517   4.293  1.00 0.00 ? 56  ASP A N    4  
ATOM 6225  C CA   . ASP A 1 56  ? 5.612   9.267   5.669  1.00 0.00 ? 56  ASP A CA   4  
ATOM 6226  C C    . ASP A 1 56  ? 5.137   7.873   6.085  1.00 0.00 ? 56  ASP A C    4  
ATOM 6227  O O    . ASP A 1 56  ? 3.941   7.586   6.052  1.00 0.00 ? 56  ASP A O    4  
ATOM 6228  C CB   . ASP A 1 56  ? 4.977   10.286  6.617  1.00 0.00 ? 56  ASP A CB   4  
ATOM 6229  C CG   . ASP A 1 56  ? 5.787   10.587  7.879  1.00 0.00 ? 56  ASP A CG   4  
ATOM 6230  O OD1  . ASP A 1 56  ? 6.899   11.134  7.723  1.00 0.00 ? 56  ASP A OD1  4  
ATOM 6231  O OD2  . ASP A 1 56  ? 5.275   10.264  8.973  1.00 0.00 ? 56  ASP A OD2  4  
ATOM 6232  H H    . ASP A 1 56  ? 4.488   8.929   3.948  1.00 0.00 ? 56  ASP A H    4  
ATOM 6233  H HA   . ASP A 1 56  ? 6.699   9.356   5.678  1.00 0.00 ? 56  ASP A HA   4  
ATOM 6234  H HB2  . ASP A 1 56  ? 4.820   11.217  6.073  1.00 0.00 ? 56  ASP A HB2  4  
ATOM 6235  H HB3  . ASP A 1 56  ? 3.993   9.920   6.913  1.00 0.00 ? 56  ASP A HB3  4  
ATOM 6236  N N    . CYS A 1 57  ? 6.097   7.044   6.467  1.00 0.00 ? 57  CYS A N    4  
ATOM 6237  C CA   . CYS A 1 57  ? 5.792   5.688   6.889  1.00 0.00 ? 57  CYS A CA   4  
ATOM 6238  C C    . CYS A 1 57  ? 6.442   5.451   8.253  1.00 0.00 ? 57  CYS A C    4  
ATOM 6239  O O    . CYS A 1 57  ? 7.662   5.537   8.387  1.00 0.00 ? 57  CYS A O    4  
ATOM 6240  C CB   . CYS A 1 57  ? 6.246   4.657   5.853  1.00 0.00 ? 57  CYS A CB   4  
ATOM 6241  S SG   . CYS A 1 57  ? 6.208   2.979   6.582  1.00 0.00 ? 57  CYS A SG   4  
ATOM 6242  H H    . CYS A 1 57  ? 7.068   7.286   6.491  1.00 0.00 ? 57  CYS A H    4  
ATOM 6243  H HA   . CYS A 1 57  ? 4.706   5.619   6.960  1.00 0.00 ? 57  CYS A HA   4  
ATOM 6244  H HB2  . CYS A 1 57  ? 5.597   4.698   4.978  1.00 0.00 ? 57  CYS A HB2  4  
ATOM 6245  H HB3  . CYS A 1 57  ? 7.255   4.892   5.513  1.00 0.00 ? 57  CYS A HB3  4  
ATOM 6246  H HG   . CYS A 1 57  ? 5.303   3.254   7.516  1.00 0.00 ? 57  CYS A HG   4  
ATOM 6247  N N    . VAL A 1 58  ? 5.599   5.158   9.232  1.00 0.00 ? 58  VAL A N    4  
ATOM 6248  C CA   . VAL A 1 58  ? 6.076   4.909   10.582 1.00 0.00 ? 58  VAL A CA   4  
ATOM 6249  C C    . VAL A 1 58  ? 5.528   3.567   11.072 1.00 0.00 ? 58  VAL A C    4  
ATOM 6250  O O    . VAL A 1 58  ? 4.377   3.227   10.802 1.00 0.00 ? 58  VAL A O    4  
ATOM 6251  C CB   . VAL A 1 58  ? 5.700   6.078   11.494 1.00 0.00 ? 58  VAL A CB   4  
ATOM 6252  C CG1  . VAL A 1 58  ? 5.697   5.647   12.963 1.00 0.00 ? 58  VAL A CG1  4  
ATOM 6253  C CG2  . VAL A 1 58  ? 6.636   7.268   11.274 1.00 0.00 ? 58  VAL A CG2  4  
ATOM 6254  H H    . VAL A 1 58  ? 4.608   5.091   9.115  1.00 0.00 ? 58  VAL A H    4  
ATOM 6255  H HA   . VAL A 1 58  ? 7.164   4.849   10.540 1.00 0.00 ? 58  VAL A HA   4  
ATOM 6256  H HB   . VAL A 1 58  ? 4.690   6.393   11.235 1.00 0.00 ? 58  VAL A HB   4  
ATOM 6257  H HG11 . VAL A 1 58  ? 4.683   5.376   13.259 1.00 0.00 ? 58  VAL A HG11 4  
ATOM 6258  H HG12 . VAL A 1 58  ? 6.355   4.788   13.091 1.00 0.00 ? 58  VAL A HG12 4  
ATOM 6259  H HG13 . VAL A 1 58  ? 6.049   6.471   13.583 1.00 0.00 ? 58  VAL A HG13 4  
ATOM 6260  H HG21 . VAL A 1 58  ? 6.228   7.910   10.493 1.00 0.00 ? 58  VAL A HG21 4  
ATOM 6261  H HG22 . VAL A 1 58  ? 6.726   7.835   12.201 1.00 0.00 ? 58  VAL A HG22 4  
ATOM 6262  H HG23 . VAL A 1 58  ? 7.618   6.907   10.971 1.00 0.00 ? 58  VAL A HG23 4  
ATOM 6263  N N    . VAL A 1 59  ? 6.377   2.841   11.784 1.00 0.00 ? 59  VAL A N    4  
ATOM 6264  C CA   . VAL A 1 59  ? 5.992   1.545   12.314 1.00 0.00 ? 59  VAL A CA   4  
ATOM 6265  C C    . VAL A 1 59  ? 6.202   1.535   13.830 1.00 0.00 ? 59  VAL A C    4  
ATOM 6266  O O    . VAL A 1 59  ? 7.336   1.597   14.304 1.00 0.00 ? 59  VAL A O    4  
ATOM 6267  C CB   . VAL A 1 59  ? 6.765   0.435   11.597 1.00 0.00 ? 59  VAL A CB   4  
ATOM 6268  C CG1  . VAL A 1 59  ? 8.258   0.510   11.921 1.00 0.00 ? 59  VAL A CG1  4  
ATOM 6269  C CG2  . VAL A 1 59  ? 6.197   -0.942  11.945 1.00 0.00 ? 59  VAL A CG2  4  
ATOM 6270  H H    . VAL A 1 59  ? 7.312   3.125   11.999 1.00 0.00 ? 59  VAL A H    4  
ATOM 6271  H HA   . VAL A 1 59  ? 4.931   1.406   12.106 1.00 0.00 ? 59  VAL A HA   4  
ATOM 6272  H HB   . VAL A 1 59  ? 6.647   0.585   10.524 1.00 0.00 ? 59  VAL A HB   4  
ATOM 6273  H HG11 . VAL A 1 59  ? 8.833   0.134   11.074 1.00 0.00 ? 59  VAL A HG11 4  
ATOM 6274  H HG12 . VAL A 1 59  ? 8.536   1.546   12.117 1.00 0.00 ? 59  VAL A HG12 4  
ATOM 6275  H HG13 . VAL A 1 59  ? 8.470   -0.096  12.802 1.00 0.00 ? 59  VAL A HG13 4  
ATOM 6276  H HG21 . VAL A 1 59  ? 5.109   -0.914  11.875 1.00 0.00 ? 59  VAL A HG21 4  
ATOM 6277  H HG22 . VAL A 1 59  ? 6.587   -1.683  11.247 1.00 0.00 ? 59  VAL A HG22 4  
ATOM 6278  H HG23 . VAL A 1 59  ? 6.488   -1.209  12.961 1.00 0.00 ? 59  VAL A HG23 4  
ATOM 6279  N N    . MET A 1 60  ? 5.092   1.458   14.548 1.00 0.00 ? 60  MET A N    4  
ATOM 6280  C CA   . MET A 1 60  ? 5.140   1.440   16.001 1.00 0.00 ? 60  MET A CA   4  
ATOM 6281  C C    . MET A 1 60  ? 5.756   0.137   16.513 1.00 0.00 ? 60  MET A C    4  
ATOM 6282  O O    . MET A 1 60  ? 5.609   -0.912  15.886 1.00 0.00 ? 60  MET A O    4  
ATOM 6283  C CB   . MET A 1 60  ? 3.724   1.591   16.560 1.00 0.00 ? 60  MET A CB   4  
ATOM 6284  C CG   . MET A 1 60  ? 3.245   3.040   16.458 1.00 0.00 ? 60  MET A CG   4  
ATOM 6285  S SD   . MET A 1 60  ? 4.329   4.109   17.390 1.00 0.00 ? 60  MET A SD   4  
ATOM 6286  C CE   . MET A 1 60  ? 5.357   4.734   16.071 1.00 0.00 ? 60  MET A CE   4  
ATOM 6287  H H    . MET A 1 60  ? 4.174   1.408   14.155 1.00 0.00 ? 60  MET A H    4  
ATOM 6288  H HA   . MET A 1 60  ? 5.770   2.284   16.283 1.00 0.00 ? 60  MET A HA   4  
ATOM 6289  H HB2  . MET A 1 60  ? 3.042   0.939   16.014 1.00 0.00 ? 60  MET A HB2  4  
ATOM 6290  H HB3  . MET A 1 60  ? 3.705   1.270   17.602 1.00 0.00 ? 60  MET A HB3  4  
ATOM 6291  H HG2  . MET A 1 60  ? 3.223   3.352   15.414 1.00 0.00 ? 60  MET A HG2  4  
ATOM 6292  H HG3  . MET A 1 60  ? 2.226   3.123   16.836 1.00 0.00 ? 60  MET A HG3  4  
ATOM 6293  H HE1  . MET A 1 60  ? 4.959   5.687   15.721 1.00 0.00 ? 60  MET A HE1  4  
ATOM 6294  H HE2  . MET A 1 60  ? 6.373   4.878   16.439 1.00 0.00 ? 60  MET A HE2  4  
ATOM 6295  H HE3  . MET A 1 60  ? 5.366   4.020   15.248 1.00 0.00 ? 60  MET A HE3  4  
ATOM 6296  N N    . ARG A 1 61  ? 6.432   0.245   17.647 1.00 0.00 ? 61  ARG A N    4  
ATOM 6297  C CA   . ARG A 1 61  ? 7.071   -0.912  18.250 1.00 0.00 ? 61  ARG A CA   4  
ATOM 6298  C C    . ARG A 1 61  ? 6.899   -0.881  19.770 1.00 0.00 ? 61  ARG A C    4  
ATOM 6299  O O    . ARG A 1 61  ? 7.221   0.116   20.415 1.00 0.00 ? 61  ARG A O    4  
ATOM 6300  C CB   . ARG A 1 61  ? 8.563   -0.956  17.914 1.00 0.00 ? 61  ARG A CB   4  
ATOM 6301  C CG   . ARG A 1 61  ? 8.805   -0.590  16.448 1.00 0.00 ? 61  ARG A CG   4  
ATOM 6302  C CD   . ARG A 1 61  ? 10.289  -0.328  16.186 1.00 0.00 ? 61  ARG A CD   4  
ATOM 6303  N NE   . ARG A 1 61  ? 10.646  -0.761  14.817 1.00 0.00 ? 61  ARG A NE   4  
ATOM 6304  C CZ   . ARG A 1 61  ? 11.894  -1.047  14.420 1.00 0.00 ? 61  ARG A CZ   4  
ATOM 6305  N NH1  . ARG A 1 61  ? 12.912  -0.947  15.286 1.00 0.00 ? 61  ARG A NH1  4  
ATOM 6306  N NH2  . ARG A 1 61  ? 12.124  -1.432  13.157 1.00 0.00 ? 61  ARG A NH2  4  
ATOM 6307  H H    . ARG A 1 61  ? 6.547   1.101   18.150 1.00 0.00 ? 61  ARG A H    4  
ATOM 6308  H HA   . ARG A 1 61  ? 6.560   -1.771  17.815 1.00 0.00 ? 61  ARG A HA   4  
ATOM 6309  H HB2  . ARG A 1 61  ? 9.105   -0.265  18.559 1.00 0.00 ? 61  ARG A HB2  4  
ATOM 6310  H HB3  . ARG A 1 61  ? 8.955   -1.953  18.113 1.00 0.00 ? 61  ARG A HB3  4  
ATOM 6311  H HG2  . ARG A 1 61  ? 8.456   -1.399  15.805 1.00 0.00 ? 61  ARG A HG2  4  
ATOM 6312  H HG3  . ARG A 1 61  ? 8.225   0.295   16.190 1.00 0.00 ? 61  ARG A HG3  4  
ATOM 6313  H HD2  . ARG A 1 61  ? 10.507  0.733   16.309 1.00 0.00 ? 61  ARG A HD2  4  
ATOM 6314  H HD3  . ARG A 1 61  ? 10.896  -0.865  16.916 1.00 0.00 ? 61  ARG A HD3  4  
ATOM 6315  H HE   . ARG A 1 61  ? 9.910   -0.846  14.145 1.00 0.00 ? 61  ARG A HE   4  
ATOM 6316  H HH11 . ARG A 1 61  ? 12.740  -0.659  16.228 1.00 0.00 ? 61  ARG A HH11 4  
ATOM 6317  H HH12 . ARG A 1 61  ? 13.843  -1.160  14.990 1.00 0.00 ? 61  ARG A HH12 4  
ATOM 6318  H HH21 . ARG A 1 61  ? 11.365  -1.506  12.511 1.00 0.00 ? 61  ARG A HH21 4  
ATOM 6319  H HH22 . ARG A 1 61  ? 13.055  -1.645  12.861 1.00 0.00 ? 61  ARG A HH22 4  
ATOM 6320  N N    . ASP A 1 62  ? 6.392   -1.985  20.299 1.00 0.00 ? 62  ASP A N    4  
ATOM 6321  C CA   . ASP A 1 62  ? 6.173   -2.096  21.731 1.00 0.00 ? 62  ASP A CA   4  
ATOM 6322  C C    . ASP A 1 62  ? 7.357   -1.473  22.474 1.00 0.00 ? 62  ASP A C    4  
ATOM 6323  O O    . ASP A 1 62  ? 8.500   -1.883  22.282 1.00 0.00 ? 62  ASP A O    4  
ATOM 6324  C CB   . ASP A 1 62  ? 6.065   -3.561  22.160 1.00 0.00 ? 62  ASP A CB   4  
ATOM 6325  C CG   . ASP A 1 62  ? 4.897   -4.332  21.540 1.00 0.00 ? 62  ASP A CG   4  
ATOM 6326  O OD1  . ASP A 1 62  ? 3.746   -3.913  21.789 1.00 0.00 ? 62  ASP A OD1  4  
ATOM 6327  O OD2  . ASP A 1 62  ? 5.183   -5.322  20.832 1.00 0.00 ? 62  ASP A OD2  4  
ATOM 6328  H H    . ASP A 1 62  ? 6.132   -2.792  19.768 1.00 0.00 ? 62  ASP A H    4  
ATOM 6329  H HA   . ASP A 1 62  ? 5.238   -1.569  21.920 1.00 0.00 ? 62  ASP A HA   4  
ATOM 6330  H HB2  . ASP A 1 62  ? 6.994   -4.069  21.901 1.00 0.00 ? 62  ASP A HB2  4  
ATOM 6331  H HB3  . ASP A 1 62  ? 5.972   -3.601  23.245 1.00 0.00 ? 62  ASP A HB3  4  
ATOM 6332  N N    . PRO A 1 63  ? 7.033   -0.465  23.328 1.00 0.00 ? 63  PRO A N    4  
ATOM 6333  C CA   . PRO A 1 63  ? 8.056   0.219   24.100 1.00 0.00 ? 63  PRO A CA   4  
ATOM 6334  C C    . PRO A 1 63  ? 8.544   -0.653  25.259 1.00 0.00 ? 63  PRO A C    4  
ATOM 6335  O O    . PRO A 1 63  ? 9.637   -0.442  25.782 1.00 0.00 ? 63  PRO A O    4  
ATOM 6336  C CB   . PRO A 1 63  ? 7.402   1.511   24.562 1.00 0.00 ? 63  PRO A CB   4  
ATOM 6337  C CG   . PRO A 1 63  ? 5.904   1.290   24.429 1.00 0.00 ? 63  PRO A CG   4  
ATOM 6338  C CD   . PRO A 1 63  ? 5.690   0.048   23.580 1.00 0.00 ? 63  PRO A CD   4  
ATOM 6339  H HA   . PRO A 1 63  ? 8.861   0.394   23.532 1.00 0.00 ? 63  PRO A HA   4  
ATOM 6340  H HB2  . PRO A 1 63  ? 7.673   1.738   25.593 1.00 0.00 ? 63  PRO A HB2  4  
ATOM 6341  H HB3  . PRO A 1 63  ? 7.728   2.354   23.954 1.00 0.00 ? 63  PRO A HB3  4  
ATOM 6342  H HG2  . PRO A 1 63  ? 5.447   1.166   25.410 1.00 0.00 ? 63  PRO A HG2  4  
ATOM 6343  H HG3  . PRO A 1 63  ? 5.431   2.156   23.965 1.00 0.00 ? 63  PRO A HG3  4  
ATOM 6344  H HD2  . PRO A 1 63  ? 5.077   -0.687  24.102 1.00 0.00 ? 63  PRO A HD2  4  
ATOM 6345  H HD3  . PRO A 1 63  ? 5.176   0.288   22.649 1.00 0.00 ? 63  PRO A HD3  4  
ATOM 6346  N N    . ALA A 1 64  ? 7.709   -1.614  25.626 1.00 0.00 ? 64  ALA A N    4  
ATOM 6347  C CA   . ALA A 1 64  ? 8.041   -2.519  26.713 1.00 0.00 ? 64  ALA A CA   4  
ATOM 6348  C C    . ALA A 1 64  ? 8.705   -3.773  26.142 1.00 0.00 ? 64  ALA A C    4  
ATOM 6349  O O    . ALA A 1 64  ? 9.700   -4.254  26.683 1.00 0.00 ? 64  ALA A O    4  
ATOM 6350  C CB   . ALA A 1 64  ? 6.777   -2.841  27.513 1.00 0.00 ? 64  ALA A CB   4  
ATOM 6351  H H    . ALA A 1 64  ? 6.822   -1.779  25.195 1.00 0.00 ? 64  ALA A H    4  
ATOM 6352  H HA   . ALA A 1 64  ? 8.749   -2.008  27.365 1.00 0.00 ? 64  ALA A HA   4  
ATOM 6353  H HB1  . ALA A 1 64  ? 6.497   -3.881  27.347 1.00 0.00 ? 64  ALA A HB1  4  
ATOM 6354  H HB2  . ALA A 1 64  ? 6.969   -2.681  28.574 1.00 0.00 ? 64  ALA A HB2  4  
ATOM 6355  H HB3  . ALA A 1 64  ? 5.966   -2.190  27.189 1.00 0.00 ? 64  ALA A HB3  4  
ATOM 6356  N N    . SER A 1 65  ? 8.128   -4.267  25.056 1.00 0.00 ? 65  SER A N    4  
ATOM 6357  C CA   . SER A 1 65  ? 8.652   -5.457  24.406 1.00 0.00 ? 65  SER A CA   4  
ATOM 6358  C C    . SER A 1 65  ? 9.846   -5.088  23.523 1.00 0.00 ? 65  SER A C    4  
ATOM 6359  O O    . SER A 1 65  ? 10.890  -5.735  23.583 1.00 0.00 ? 65  SER A O    4  
ATOM 6360  C CB   . SER A 1 65  ? 7.571   -6.151  23.575 1.00 0.00 ? 65  SER A CB   4  
ATOM 6361  O OG   . SER A 1 65  ? 6.261   -5.859  24.052 1.00 0.00 ? 65  SER A OG   4  
ATOM 6362  H H    . SER A 1 65  ? 7.319   -3.870  24.623 1.00 0.00 ? 65  SER A H    4  
ATOM 6363  H HA   . SER A 1 65  ? 8.965   -6.115  25.217 1.00 0.00 ? 65  SER A HA   4  
ATOM 6364  H HB2  . SER A 1 65  ? 7.657   -5.837  22.534 1.00 0.00 ? 65  SER A HB2  4  
ATOM 6365  H HB3  . SER A 1 65  ? 7.733   -7.228  23.597 1.00 0.00 ? 65  SER A HB3  4  
ATOM 6366  H HG   . SER A 1 65  ? 6.155   -6.193  24.988 1.00 0.00 ? 65  SER A HG   4  
ATOM 6367  N N    . LYS A 1 66  ? 9.651   -4.049  22.724 1.00 0.00 ? 66  LYS A N    4  
ATOM 6368  C CA   . LYS A 1 66  ? 10.699  -3.586  21.830 1.00 0.00 ? 66  LYS A CA   4  
ATOM 6369  C C    . LYS A 1 66  ? 10.841  -4.569  20.666 1.00 0.00 ? 66  LYS A C    4  
ATOM 6370  O O    . LYS A 1 66  ? 11.924  -4.714  20.100 1.00 0.00 ? 66  LYS A O    4  
ATOM 6371  C CB   . LYS A 1 66  ? 11.999  -3.355  22.603 1.00 0.00 ? 66  LYS A CB   4  
ATOM 6372  C CG   . LYS A 1 66  ? 12.481  -1.911  22.447 1.00 0.00 ? 66  LYS A CG   4  
ATOM 6373  C CD   . LYS A 1 66  ? 13.531  -1.800  21.340 1.00 0.00 ? 66  LYS A CD   4  
ATOM 6374  C CE   . LYS A 1 66  ? 14.848  -1.245  21.888 1.00 0.00 ? 66  LYS A CE   4  
ATOM 6375  N NZ   . LYS A 1 66  ? 15.594  -0.535  20.824 1.00 0.00 ? 66  LYS A NZ   4  
ATOM 6376  H H    . LYS A 1 66  ? 8.799   -3.528  22.682 1.00 0.00 ? 66  LYS A H    4  
ATOM 6377  H HA   . LYS A 1 66  ? 10.386  -2.621  21.431 1.00 0.00 ? 66  LYS A HA   4  
ATOM 6378  H HB2  . LYS A 1 66  ? 11.845  -3.579  23.658 1.00 0.00 ? 66  LYS A HB2  4  
ATOM 6379  H HB3  . LYS A 1 66  ? 12.767  -4.039  22.242 1.00 0.00 ? 66  LYS A HB3  4  
ATOM 6380  H HG2  . LYS A 1 66  ? 11.634  -1.265  22.216 1.00 0.00 ? 66  LYS A HG2  4  
ATOM 6381  H HG3  . LYS A 1 66  ? 12.901  -1.561  23.389 1.00 0.00 ? 66  LYS A HG3  4  
ATOM 6382  H HD2  . LYS A 1 66  ? 13.703  -2.780  20.896 1.00 0.00 ? 66  LYS A HD2  4  
ATOM 6383  H HD3  . LYS A 1 66  ? 13.161  -1.151  20.546 1.00 0.00 ? 66  LYS A HD3  4  
ATOM 6384  H HE2  . LYS A 1 66  ? 14.646  -0.564  22.715 1.00 0.00 ? 66  LYS A HE2  4  
ATOM 6385  H HE3  . LYS A 1 66  ? 15.455  -2.058  22.285 1.00 0.00 ? 66  LYS A HE3  4  
ATOM 6386  H HZ1  . LYS A 1 66  ? 15.029  0.205   20.459 1.00 0.00 ? 66  LYS A HZ1  4  
ATOM 6387  H HZ2  . LYS A 1 66  ? 16.436  -0.155  21.205 1.00 0.00 ? 66  LYS A HZ2  4  
ATOM 6388  H HZ3  . LYS A 1 66  ? 15.819  -1.177  20.091 1.00 0.00 ? 66  LYS A HZ3  4  
ATOM 6389  N N    . ARG A 1 67  ? 9.733   -5.219  20.344 1.00 0.00 ? 67  ARG A N    4  
ATOM 6390  C CA   . ARG A 1 67  ? 9.721   -6.184  19.258 1.00 0.00 ? 67  ARG A CA   4  
ATOM 6391  C C    . ARG A 1 67  ? 8.587   -5.869  18.280 1.00 0.00 ? 67  ARG A C    4  
ATOM 6392  O O    . ARG A 1 67  ? 7.818   -6.755  17.909 1.00 0.00 ? 67  ARG A O    4  
ATOM 6393  C CB   . ARG A 1 67  ? 9.546   -7.609  19.789 1.00 0.00 ? 67  ARG A CB   4  
ATOM 6394  C CG   . ARG A 1 67  ? 10.592  -7.927  20.858 1.00 0.00 ? 67  ARG A CG   4  
ATOM 6395  C CD   . ARG A 1 67  ? 10.679  -9.434  21.109 1.00 0.00 ? 67  ARG A CD   4  
ATOM 6396  N NE   . ARG A 1 67  ? 11.972  -9.768  21.747 1.00 0.00 ? 67  ARG A NE   4  
ATOM 6397  C CZ   . ARG A 1 67  ? 12.292  -10.986 22.204 1.00 0.00 ? 67  ARG A CZ   4  
ATOM 6398  N NH1  . ARG A 1 67  ? 11.415  -11.993 22.098 1.00 0.00 ? 67  ARG A NH1  4  
ATOM 6399  N NH2  . ARG A 1 67  ? 13.489  -11.196 22.768 1.00 0.00 ? 67  ARG A NH2  4  
ATOM 6400  H H    . ARG A 1 67  ? 8.857   -5.096  20.809 1.00 0.00 ? 67  ARG A H    4  
ATOM 6401  H HA   . ARG A 1 67  ? 10.693  -6.077  18.778 1.00 0.00 ? 67  ARG A HA   4  
ATOM 6402  H HB2  . ARG A 1 67  ? 8.546   -7.725  20.207 1.00 0.00 ? 67  ARG A HB2  4  
ATOM 6403  H HB3  . ARG A 1 67  ? 9.632   -8.320  18.967 1.00 0.00 ? 67  ARG A HB3  4  
ATOM 6404  H HG2  . ARG A 1 67  ? 11.566  -7.551  20.544 1.00 0.00 ? 67  ARG A HG2  4  
ATOM 6405  H HG3  . ARG A 1 67  ? 10.337  -7.415  21.786 1.00 0.00 ? 67  ARG A HG3  4  
ATOM 6406  H HD2  . ARG A 1 67  ? 9.856   -9.753  21.749 1.00 0.00 ? 67  ARG A HD2  4  
ATOM 6407  H HD3  . ARG A 1 67  ? 10.579  -9.974  20.167 1.00 0.00 ? 67  ARG A HD3  4  
ATOM 6408  H HE   . ARG A 1 67  ? 12.650  -9.038  21.842 1.00 0.00 ? 67  ARG A HE   4  
ATOM 6409  H HH11 . ARG A 1 67  ? 10.522  -11.836 21.676 1.00 0.00 ? 67  ARG A HH11 4  
ATOM 6410  H HH12 . ARG A 1 67  ? 11.654  -12.902 22.439 1.00 0.00 ? 67  ARG A HH12 4  
ATOM 6411  H HH21 . ARG A 1 67  ? 14.144  -10.444 22.848 1.00 0.00 ? 67  ARG A HH21 4  
ATOM 6412  H HH22 . ARG A 1 67  ? 13.728  -12.105 23.110 1.00 0.00 ? 67  ARG A HH22 4  
ATOM 6413  N N    . SER A 1 68  ? 8.518   -4.604  17.891 1.00 0.00 ? 68  SER A N    4  
ATOM 6414  C CA   . SER A 1 68  ? 7.491   -4.161  16.964 1.00 0.00 ? 68  SER A CA   4  
ATOM 6415  C C    . SER A 1 68  ? 6.104   -4.404  17.564 1.00 0.00 ? 68  SER A C    4  
ATOM 6416  O O    . SER A 1 68  ? 5.903   -5.369  18.300 1.00 0.00 ? 68  SER A O    4  
ATOM 6417  C CB   . SER A 1 68  ? 7.619   -4.876  15.618 1.00 0.00 ? 68  SER A CB   4  
ATOM 6418  O OG   . SER A 1 68  ? 8.929   -4.755  15.071 1.00 0.00 ? 68  SER A OG   4  
ATOM 6419  H H    . SER A 1 68  ? 9.147   -3.890  18.198 1.00 0.00 ? 68  SER A H    4  
ATOM 6420  H HA   . SER A 1 68  ? 7.666   -3.094  16.827 1.00 0.00 ? 68  SER A HA   4  
ATOM 6421  H HB2  . SER A 1 68  ? 7.374   -5.931  15.742 1.00 0.00 ? 68  SER A HB2  4  
ATOM 6422  H HB3  . SER A 1 68  ? 6.894   -4.461  14.917 1.00 0.00 ? 68  SER A HB3  4  
ATOM 6423  H HG   . SER A 1 68  ? 9.335   -3.883  15.345 1.00 0.00 ? 68  SER A HG   4  
ATOM 6424  N N    . ARG A 1 69  ? 5.184   -3.512  17.228 1.00 0.00 ? 69  ARG A N    4  
ATOM 6425  C CA   . ARG A 1 69  ? 3.823   -3.617  17.725 1.00 0.00 ? 69  ARG A CA   4  
ATOM 6426  C C    . ARG A 1 69  ? 2.958   -4.405  16.739 1.00 0.00 ? 69  ARG A C    4  
ATOM 6427  O O    . ARG A 1 69  ? 2.091   -5.176  17.147 1.00 0.00 ? 69  ARG A O    4  
ATOM 6428  C CB   . ARG A 1 69  ? 3.207   -2.233  17.940 1.00 0.00 ? 69  ARG A CB   4  
ATOM 6429  C CG   . ARG A 1 69  ? 3.176   -1.873  19.427 1.00 0.00 ? 69  ARG A CG   4  
ATOM 6430  C CD   . ARG A 1 69  ? 2.891   -0.382  19.624 1.00 0.00 ? 69  ARG A CD   4  
ATOM 6431  N NE   . ARG A 1 69  ? 1.865   -0.197  20.674 1.00 0.00 ? 69  ARG A NE   4  
ATOM 6432  C CZ   . ARG A 1 69  ? 1.427   0.998   21.094 1.00 0.00 ? 69  ARG A CZ   4  
ATOM 6433  N NH1  . ARG A 1 69  ? 1.922   2.120   20.555 1.00 0.00 ? 69  ARG A NH1  4  
ATOM 6434  N NH2  . ARG A 1 69  ? 0.493   1.070   22.052 1.00 0.00 ? 69  ARG A NH2  4  
ATOM 6435  H H    . ARG A 1 69  ? 5.357   -2.729  16.630 1.00 0.00 ? 69  ARG A H    4  
ATOM 6436  H HA   . ARG A 1 69  ? 3.913   -4.143  18.675 1.00 0.00 ? 69  ARG A HA   4  
ATOM 6437  H HB2  . ARG A 1 69  ? 3.782   -1.486  17.393 1.00 0.00 ? 69  ARG A HB2  4  
ATOM 6438  H HB3  . ARG A 1 69  ? 2.195   -2.215  17.537 1.00 0.00 ? 69  ARG A HB3  4  
ATOM 6439  H HG2  . ARG A 1 69  ? 2.411   -2.462  19.932 1.00 0.00 ? 69  ARG A HG2  4  
ATOM 6440  H HG3  . ARG A 1 69  ? 4.131   -2.128  19.887 1.00 0.00 ? 69  ARG A HG3  4  
ATOM 6441  H HD2  . ARG A 1 69  ? 3.808   0.138   19.904 1.00 0.00 ? 69  ARG A HD2  4  
ATOM 6442  H HD3  . ARG A 1 69  ? 2.549   0.058   18.687 1.00 0.00 ? 69  ARG A HD3  4  
ATOM 6443  H HE   . ARG A 1 69  ? 1.475   -1.015  21.097 1.00 0.00 ? 69  ARG A HE   4  
ATOM 6444  H HH11 . ARG A 1 69  ? 2.619   2.066   19.840 1.00 0.00 ? 69  ARG A HH11 4  
ATOM 6445  H HH12 . ARG A 1 69  ? 1.595   3.012   20.869 1.00 0.00 ? 69  ARG A HH12 4  
ATOM 6446  H HH21 . ARG A 1 69  ? 0.123   0.232   22.454 1.00 0.00 ? 69  ARG A HH21 4  
ATOM 6447  H HH22 . ARG A 1 69  ? 0.166   1.961   22.365 1.00 0.00 ? 69  ARG A HH22 4  
ATOM 6448  N N    . GLY A 1 70  ? 3.224   -4.183  15.460 1.00 0.00 ? 70  GLY A N    4  
ATOM 6449  C CA   . GLY A 1 70  ? 2.480   -4.863  14.412 1.00 0.00 ? 70  GLY A CA   4  
ATOM 6450  C C    . GLY A 1 70  ? 1.525   -3.900  13.705 1.00 0.00 ? 70  GLY A C    4  
ATOM 6451  O O    . GLY A 1 70  ? 0.559   -4.328  13.075 1.00 0.00 ? 70  GLY A O    4  
ATOM 6452  H H    . GLY A 1 70  ? 3.931   -3.554  15.136 1.00 0.00 ? 70  GLY A H    4  
ATOM 6453  H HA2  . GLY A 1 70  ? 3.174   -5.290  13.688 1.00 0.00 ? 70  GLY A HA2  4  
ATOM 6454  H HA3  . GLY A 1 70  ? 1.916   -5.691  14.841 1.00 0.00 ? 70  GLY A HA3  4  
ATOM 6455  N N    . PHE A 1 71  ? 1.828   -2.616  13.832 1.00 0.00 ? 71  PHE A N    4  
ATOM 6456  C CA   . PHE A 1 71  ? 1.008   -1.589  13.213 1.00 0.00 ? 71  PHE A CA   4  
ATOM 6457  C C    . PHE A 1 71  ? 1.784   -0.277  13.075 1.00 0.00 ? 71  PHE A C    4  
ATOM 6458  O O    . PHE A 1 71  ? 2.684   0.002   13.866 1.00 0.00 ? 71  PHE A O    4  
ATOM 6459  C CB   . PHE A 1 71  ? -0.194  -1.362  14.131 1.00 0.00 ? 71  PHE A CB   4  
ATOM 6460  C CG   . PHE A 1 71  ? 0.072   -0.378  15.273 1.00 0.00 ? 71  PHE A CG   4  
ATOM 6461  C CD1  . PHE A 1 71  ? 0.161   0.954   15.015 1.00 0.00 ? 71  PHE A CD1  4  
ATOM 6462  C CD2  . PHE A 1 71  ? 0.218   -0.837  16.545 1.00 0.00 ? 71  PHE A CD2  4  
ATOM 6463  C CE1  . PHE A 1 71  ? 0.408   1.867   16.075 1.00 0.00 ? 71  PHE A CE1  4  
ATOM 6464  C CE2  . PHE A 1 71  ? 0.465   0.076   17.604 1.00 0.00 ? 71  PHE A CE2  4  
ATOM 6465  C CZ   . PHE A 1 71  ? 0.554   1.409   17.347 1.00 0.00 ? 71  PHE A CZ   4  
ATOM 6466  H H    . PHE A 1 71  ? 2.615   -2.276  14.346 1.00 0.00 ? 71  PHE A H    4  
ATOM 6467  H HA   . PHE A 1 71  ? 0.730   -1.950  12.223 1.00 0.00 ? 71  PHE A HA   4  
ATOM 6468  H HB2  . PHE A 1 71  ? -1.029  -0.994  13.535 1.00 0.00 ? 71  PHE A HB2  4  
ATOM 6469  H HB3  . PHE A 1 71  ? -0.501  -2.319  14.554 1.00 0.00 ? 71  PHE A HB3  4  
ATOM 6470  H HD1  . PHE A 1 71  ? 0.043   1.321   13.996 1.00 0.00 ? 71  PHE A HD1  4  
ATOM 6471  H HD2  . PHE A 1 71  ? 0.147   -1.904  16.751 1.00 0.00 ? 71  PHE A HD2  4  
ATOM 6472  H HE1  . PHE A 1 71  ? 0.479   2.935   15.869 1.00 0.00 ? 71  PHE A HE1  4  
ATOM 6473  H HE2  . PHE A 1 71  ? 0.583   -0.291  18.624 1.00 0.00 ? 71  PHE A HE2  4  
ATOM 6474  H HZ   . PHE A 1 71  ? 0.744   2.109   18.160 1.00 0.00 ? 71  PHE A HZ   4  
ATOM 6475  N N    . GLY A 1 72  ? 1.408   0.492   12.064 1.00 0.00 ? 72  GLY A N    4  
ATOM 6476  C CA   . GLY A 1 72  ? 2.058   1.768   11.812 1.00 0.00 ? 72  GLY A CA   4  
ATOM 6477  C C    . GLY A 1 72  ? 1.137   2.707   11.030 1.00 0.00 ? 72  GLY A C    4  
ATOM 6478  O O    . GLY A 1 72  ? -0.076  2.507   10.997 1.00 0.00 ? 72  GLY A O    4  
ATOM 6479  H H    . GLY A 1 72  ? 0.676   0.258   11.425 1.00 0.00 ? 72  GLY A H    4  
ATOM 6480  H HA2  . GLY A 1 72  ? 2.336   2.231   12.759 1.00 0.00 ? 72  GLY A HA2  4  
ATOM 6481  H HA3  . GLY A 1 72  ? 2.979   1.606   11.253 1.00 0.00 ? 72  GLY A HA3  4  
ATOM 6482  N N    . PHE A 1 73  ? 1.749   3.711   10.420 1.00 0.00 ? 73  PHE A N    4  
ATOM 6483  C CA   . PHE A 1 73  ? 1.000   4.681   9.640  1.00 0.00 ? 73  PHE A CA   4  
ATOM 6484  C C    . PHE A 1 73  ? 1.642   4.896   8.269  1.00 0.00 ? 73  PHE A C    4  
ATOM 6485  O O    . PHE A 1 73  ? 2.862   4.819   8.131  1.00 0.00 ? 73  PHE A O    4  
ATOM 6486  C CB   . PHE A 1 73  ? 1.031   5.999   10.417 1.00 0.00 ? 73  PHE A CB   4  
ATOM 6487  C CG   . PHE A 1 73  ? 0.914   5.831   11.933 1.00 0.00 ? 73  PHE A CG   4  
ATOM 6488  C CD1  . PHE A 1 73  ? 2.024   5.581   12.678 1.00 0.00 ? 73  PHE A CD1  4  
ATOM 6489  C CD2  . PHE A 1 73  ? -0.301  5.931   12.536 1.00 0.00 ? 73  PHE A CD2  4  
ATOM 6490  C CE1  . PHE A 1 73  ? 1.915   5.425   14.085 1.00 0.00 ? 73  PHE A CE1  4  
ATOM 6491  C CE2  . PHE A 1 73  ? -0.410  5.775   13.944 1.00 0.00 ? 73  PHE A CE2  4  
ATOM 6492  C CZ   . PHE A 1 73  ? 0.700   5.525   14.688 1.00 0.00 ? 73  PHE A CZ   4  
ATOM 6493  H H    . PHE A 1 73  ? 2.737   3.866   10.452 1.00 0.00 ? 73  PHE A H    4  
ATOM 6494  H HA   . PHE A 1 73  ? -0.007  4.284   9.510  1.00 0.00 ? 73  PHE A HA   4  
ATOM 6495  H HB2  . PHE A 1 73  ? 1.962   6.520   10.191 1.00 0.00 ? 73  PHE A HB2  4  
ATOM 6496  H HB3  . PHE A 1 73  ? 0.217   6.634   10.068 1.00 0.00 ? 73  PHE A HB3  4  
ATOM 6497  H HD1  . PHE A 1 73  ? 2.998   5.501   12.195 1.00 0.00 ? 73  PHE A HD1  4  
ATOM 6498  H HD2  . PHE A 1 73  ? -1.191  6.131   11.940 1.00 0.00 ? 73  PHE A HD2  4  
ATOM 6499  H HE1  . PHE A 1 73  ? 2.805   5.225   14.682 1.00 0.00 ? 73  PHE A HE1  4  
ATOM 6500  H HE2  . PHE A 1 73  ? -1.384  5.855   14.427 1.00 0.00 ? 73  PHE A HE2  4  
ATOM 6501  H HZ   . PHE A 1 73  ? 0.616   5.405   15.768 1.00 0.00 ? 73  PHE A HZ   4  
ATOM 6502  N N    . VAL A 1 74  ? 0.792   5.162   7.288  1.00 0.00 ? 74  VAL A N    4  
ATOM 6503  C CA   . VAL A 1 74  ? 1.262   5.388   5.931  1.00 0.00 ? 74  VAL A CA   4  
ATOM 6504  C C    . VAL A 1 74  ? 0.546   6.607   5.346  1.00 0.00 ? 74  VAL A C    4  
ATOM 6505  O O    . VAL A 1 74  ? -0.655  6.560   5.083  1.00 0.00 ? 74  VAL A O    4  
ATOM 6506  C CB   . VAL A 1 74  ? 1.070   4.122   5.093  1.00 0.00 ? 74  VAL A CB   4  
ATOM 6507  C CG1  . VAL A 1 74  ? 1.958   2.987   5.604  1.00 0.00 ? 74  VAL A CG1  4  
ATOM 6508  C CG2  . VAL A 1 74  ? -0.400  3.700   5.067  1.00 0.00 ? 74  VAL A CG2  4  
ATOM 6509  H H    . VAL A 1 74  ? -0.199  5.223   7.408  1.00 0.00 ? 74  VAL A H    4  
ATOM 6510  H HA   . VAL A 1 74  ? 2.329   5.600   5.984  1.00 0.00 ? 74  VAL A HA   4  
ATOM 6511  H HB   . VAL A 1 74  ? 1.371   4.349   4.070  1.00 0.00 ? 74  VAL A HB   4  
ATOM 6512  H HG11 . VAL A 1 74  ? 2.223   2.331   4.775  1.00 0.00 ? 74  VAL A HG11 4  
ATOM 6513  H HG12 . VAL A 1 74  ? 2.866   3.404   6.041  1.00 0.00 ? 74  VAL A HG12 4  
ATOM 6514  H HG13 . VAL A 1 74  ? 1.420   2.416   6.361  1.00 0.00 ? 74  VAL A HG13 4  
ATOM 6515  H HG21 . VAL A 1 74  ? -0.801  3.842   4.064  1.00 0.00 ? 74  VAL A HG21 4  
ATOM 6516  H HG22 . VAL A 1 74  ? -0.481  2.649   5.345  1.00 0.00 ? 74  VAL A HG22 4  
ATOM 6517  H HG23 . VAL A 1 74  ? -0.966  4.307   5.774  1.00 0.00 ? 74  VAL A HG23 4  
ATOM 6518  N N    . THR A 1 75  ? 1.314   7.670   5.157  1.00 0.00 ? 75  THR A N    4  
ATOM 6519  C CA   . THR A 1 75  ? 0.769   8.900   4.608  1.00 0.00 ? 75  THR A CA   4  
ATOM 6520  C C    . THR A 1 75  ? 1.050   8.983   3.106  1.00 0.00 ? 75  THR A C    4  
ATOM 6521  O O    . THR A 1 75  ? 2.175   9.265   2.696  1.00 0.00 ? 75  THR A O    4  
ATOM 6522  C CB   . THR A 1 75  ? 1.351   10.071  5.401  1.00 0.00 ? 75  THR A CB   4  
ATOM 6523  O OG1  . THR A 1 75  ? 1.136   9.710   6.762  1.00 0.00 ? 75  THR A OG1  4  
ATOM 6524  C CG2  . THR A 1 75  ? 0.541   11.358  5.224  1.00 0.00 ? 75  THR A CG2  4  
ATOM 6525  H H    . THR A 1 75  ? 2.290   7.700   5.373  1.00 0.00 ? 75  THR A H    4  
ATOM 6526  H HA   . THR A 1 75  ? -0.314  8.880   4.730  1.00 0.00 ? 75  THR A HA   4  
ATOM 6527  H HB   . THR A 1 75  ? 2.398   10.232  5.145  1.00 0.00 ? 75  THR A HB   4  
ATOM 6528  H HG1  . THR A 1 75  ? 1.525   10.405  7.366  1.00 0.00 ? 75  THR A HG1  4  
ATOM 6529  H HG21 . THR A 1 75  ? 0.885   11.884  4.334  1.00 0.00 ? 75  THR A HG21 4  
ATOM 6530  H HG22 . THR A 1 75  ? -0.515  11.110  5.115  1.00 0.00 ? 75  THR A HG22 4  
ATOM 6531  H HG23 . THR A 1 75  ? 0.676   11.995  6.098  1.00 0.00 ? 75  THR A HG23 4  
ATOM 6532  N N    . PHE A 1 76  ? 0.008   8.733   2.327  1.00 0.00 ? 76  PHE A N    4  
ATOM 6533  C CA   . PHE A 1 76  ? 0.128   8.776   0.879  1.00 0.00 ? 76  PHE A CA   4  
ATOM 6534  C C    . PHE A 1 76  ? 0.342   10.210  0.389  1.00 0.00 ? 76  PHE A C    4  
ATOM 6535  O O    . PHE A 1 76  ? 0.209   11.159  1.160  1.00 0.00 ? 76  PHE A O    4  
ATOM 6536  C CB   . PHE A 1 76  ? -1.186  8.244   0.305  1.00 0.00 ? 76  PHE A CB   4  
ATOM 6537  C CG   . PHE A 1 76  ? -1.264  6.717   0.240  1.00 0.00 ? 76  PHE A CG   4  
ATOM 6538  C CD1  . PHE A 1 76  ? -0.692  6.050   -0.798 1.00 0.00 ? 76  PHE A CD1  4  
ATOM 6539  C CD2  . PHE A 1 76  ? -1.905  6.027   1.222  1.00 0.00 ? 76  PHE A CD2  4  
ATOM 6540  C CE1  . PHE A 1 76  ? -0.764  4.633   -0.858 1.00 0.00 ? 76  PHE A CE1  4  
ATOM 6541  C CE2  . PHE A 1 76  ? -1.977  4.610   1.162  1.00 0.00 ? 76  PHE A CE2  4  
ATOM 6542  C CZ   . PHE A 1 76  ? -1.405  3.943   0.124  1.00 0.00 ? 76  PHE A CZ   4  
ATOM 6543  H H    . PHE A 1 76  ? -0.904  8.505   2.668  1.00 0.00 ? 76  PHE A H    4  
ATOM 6544  H HA   . PHE A 1 76  ? 0.992   8.169   0.608  1.00 0.00 ? 76  PHE A HA   4  
ATOM 6545  H HB2  . PHE A 1 76  ? -2.012  8.614   0.912  1.00 0.00 ? 76  PHE A HB2  4  
ATOM 6546  H HB3  . PHE A 1 76  ? -1.322  8.647   -0.699 1.00 0.00 ? 76  PHE A HB3  4  
ATOM 6547  H HD1  . PHE A 1 76  ? -0.179  6.603   -1.584 1.00 0.00 ? 76  PHE A HD1  4  
ATOM 6548  H HD2  . PHE A 1 76  ? -2.363  6.561   2.054  1.00 0.00 ? 76  PHE A HD2  4  
ATOM 6549  H HE1  . PHE A 1 76  ? -0.306  4.099   -1.690 1.00 0.00 ? 76  PHE A HE1  4  
ATOM 6550  H HE2  . PHE A 1 76  ? -2.491  4.057   1.948  1.00 0.00 ? 76  PHE A HE2  4  
ATOM 6551  H HZ   . PHE A 1 76  ? -1.461  2.855   0.078  1.00 0.00 ? 76  PHE A HZ   4  
ATOM 6552  N N    . SER A 1 77  ? 0.669   10.321  -0.890 1.00 0.00 ? 77  SER A N    4  
ATOM 6553  C CA   . SER A 1 77  ? 0.902   11.623  -1.492 1.00 0.00 ? 77  SER A CA   4  
ATOM 6554  C C    . SER A 1 77  ? -0.428  12.248  -1.917 1.00 0.00 ? 77  SER A C    4  
ATOM 6555  O O    . SER A 1 77  ? -0.680  13.422  -1.650 1.00 0.00 ? 77  SER A O    4  
ATOM 6556  C CB   . SER A 1 77  ? 1.845   11.515  -2.691 1.00 0.00 ? 77  SER A CB   4  
ATOM 6557  O OG   . SER A 1 77  ? 1.424   12.335  -3.778 1.00 0.00 ? 77  SER A OG   4  
ATOM 6558  H H    . SER A 1 77  ? 0.775   9.544   -1.510 1.00 0.00 ? 77  SER A H    4  
ATOM 6559  H HA   . SER A 1 77  ? 1.374   12.221  -0.712 1.00 0.00 ? 77  SER A HA   4  
ATOM 6560  H HB2  . SER A 1 77  ? 2.852   11.803  -2.388 1.00 0.00 ? 77  SER A HB2  4  
ATOM 6561  H HB3  . SER A 1 77  ? 1.896   10.476  -3.019 1.00 0.00 ? 77  SER A HB3  4  
ATOM 6562  H HG   . SER A 1 77  ? 1.036   11.768  -4.504 1.00 0.00 ? 77  SER A HG   4  
ATOM 6563  N N    . SER A 1 78  ? -1.244  11.436  -2.573 1.00 0.00 ? 78  SER A N    4  
ATOM 6564  C CA   . SER A 1 78  ? -2.542  11.895  -3.038 1.00 0.00 ? 78  SER A CA   4  
ATOM 6565  C C    . SER A 1 78  ? -3.656  11.127  -2.324 1.00 0.00 ? 78  SER A C    4  
ATOM 6566  O O    . SER A 1 78  ? -3.391  10.152  -1.623 1.00 0.00 ? 78  SER A O    4  
ATOM 6567  C CB   . SER A 1 78  ? -2.673  11.732  -4.554 1.00 0.00 ? 78  SER A CB   4  
ATOM 6568  O OG   . SER A 1 78  ? -3.197  12.904  -5.173 1.00 0.00 ? 78  SER A OG   4  
ATOM 6569  H H    . SER A 1 78  ? -1.032  10.483  -2.786 1.00 0.00 ? 78  SER A H    4  
ATOM 6570  H HA   . SER A 1 78  ? -2.582  12.954  -2.782 1.00 0.00 ? 78  SER A HA   4  
ATOM 6571  H HB2  . SER A 1 78  ? -1.696  11.503  -4.980 1.00 0.00 ? 78  SER A HB2  4  
ATOM 6572  H HB3  . SER A 1 78  ? -3.323  10.885  -4.773 1.00 0.00 ? 78  SER A HB3  4  
ATOM 6573  H HG   . SER A 1 78  ? -3.126  12.825  -6.168 1.00 0.00 ? 78  SER A HG   4  
ATOM 6574  N N    . MET A 1 79  ? -4.878  11.596  -2.526 1.00 0.00 ? 79  MET A N    4  
ATOM 6575  C CA   . MET A 1 79  ? -6.033  10.966  -1.910 1.00 0.00 ? 79  MET A CA   4  
ATOM 6576  C C    . MET A 1 79  ? -6.478  9.738   -2.707 1.00 0.00 ? 79  MET A C    4  
ATOM 6577  O O    . MET A 1 79  ? -7.044  8.800   -2.146 1.00 0.00 ? 79  MET A O    4  
ATOM 6578  C CB   . MET A 1 79  ? -7.185  11.971  -1.836 1.00 0.00 ? 79  MET A CB   4  
ATOM 6579  C CG   . MET A 1 79  ? -8.097  11.672  -0.644 1.00 0.00 ? 79  MET A CG   4  
ATOM 6580  S SD   . MET A 1 79  ? -7.304  12.178  0.873  1.00 0.00 ? 79  MET A SD   4  
ATOM 6581  C CE   . MET A 1 79  ? -8.508  11.601  2.059  1.00 0.00 ? 79  MET A CE   4  
ATOM 6582  H H    . MET A 1 79  ? -5.085  12.390  -3.098 1.00 0.00 ? 79  MET A H    4  
ATOM 6583  H HA   . MET A 1 79  ? -5.706  10.663  -0.915 1.00 0.00 ? 79  MET A HA   4  
ATOM 6584  H HB2  . MET A 1 79  ? -6.785  12.981  -1.748 1.00 0.00 ? 79  MET A HB2  4  
ATOM 6585  H HB3  . MET A 1 79  ? -7.763  11.935  -2.759 1.00 0.00 ? 79  MET A HB3  4  
ATOM 6586  H HG2  . MET A 1 79  ? -9.045  12.196  -0.761 1.00 0.00 ? 79  MET A HG2  4  
ATOM 6587  H HG3  . MET A 1 79  ? -8.324  10.606  -0.608 1.00 0.00 ? 79  MET A HG3  4  
ATOM 6588  H HE1  . MET A 1 79  ? -8.415  12.175  2.980  1.00 0.00 ? 79  MET A HE1  4  
ATOM 6589  H HE2  . MET A 1 79  ? -9.510  11.729  1.651  1.00 0.00 ? 79  MET A HE2  4  
ATOM 6590  H HE3  . MET A 1 79  ? -8.333  10.546  2.269  1.00 0.00 ? 79  MET A HE3  4  
ATOM 6591  N N    . ALA A 1 80  ? -6.205  9.782   -4.003 1.00 0.00 ? 80  ALA A N    4  
ATOM 6592  C CA   . ALA A 1 80  ? -6.569  8.685   -4.882 1.00 0.00 ? 80  ALA A CA   4  
ATOM 6593  C C    . ALA A 1 80  ? -5.845  7.414   -4.433 1.00 0.00 ? 80  ALA A C    4  
ATOM 6594  O O    . ALA A 1 80  ? -6.480  6.448   -4.013 1.00 0.00 ? 80  ALA A O    4  
ATOM 6595  C CB   . ALA A 1 80  ? -6.244  9.061   -6.329 1.00 0.00 ? 80  ALA A CB   4  
ATOM 6596  H H    . ALA A 1 80  ? -5.744  10.548  -4.451 1.00 0.00 ? 80  ALA A H    4  
ATOM 6597  H HA   . ALA A 1 80  ? -7.645  8.531   -4.793 1.00 0.00 ? 80  ALA A HA   4  
ATOM 6598  H HB1  . ALA A 1 80  ? -5.164  9.041   -6.476 1.00 0.00 ? 80  ALA A HB1  4  
ATOM 6599  H HB2  . ALA A 1 80  ? -6.716  8.347   -7.005 1.00 0.00 ? 80  ALA A HB2  4  
ATOM 6600  H HB3  . ALA A 1 80  ? -6.621  10.062  -6.538 1.00 0.00 ? 80  ALA A HB3  4  
ATOM 6601  N N    . GLU A 1 81  ? -4.525  7.456   -4.537 1.00 0.00 ? 81  GLU A N    4  
ATOM 6602  C CA   . GLU A 1 81  ? -3.707  6.320   -4.147 1.00 0.00 ? 81  GLU A CA   4  
ATOM 6603  C C    . GLU A 1 81  ? -4.241  5.700   -2.854 1.00 0.00 ? 81  GLU A C    4  
ATOM 6604  O O    . GLU A 1 81  ? -4.616  4.529   -2.832 1.00 0.00 ? 81  GLU A O    4  
ATOM 6605  C CB   . GLU A 1 81  ? -2.240  6.727   -3.994 1.00 0.00 ? 81  GLU A CB   4  
ATOM 6606  C CG   . GLU A 1 81  ? -1.687  7.287   -5.306 1.00 0.00 ? 81  GLU A CG   4  
ATOM 6607  C CD   . GLU A 1 81  ? -1.390  8.783   -5.182 1.00 0.00 ? 81  GLU A CD   4  
ATOM 6608  O OE1  . GLU A 1 81  ? -1.078  9.208   -4.048 1.00 0.00 ? 81  GLU A OE1  4  
ATOM 6609  O OE2  . GLU A 1 81  ? -1.483  9.468   -6.223 1.00 0.00 ? 81  GLU A OE2  4  
ATOM 6610  H H    . GLU A 1 81  ? -4.015  8.245   -4.880 1.00 0.00 ? 81  GLU A H    4  
ATOM 6611  H HA   . GLU A 1 81  ? -3.795  5.605   -4.964 1.00 0.00 ? 81  GLU A HA   4  
ATOM 6612  H HB2  . GLU A 1 81  ? -2.147  7.476   -3.207 1.00 0.00 ? 81  GLU A HB2  4  
ATOM 6613  H HB3  . GLU A 1 81  ? -1.650  5.865   -3.685 1.00 0.00 ? 81  GLU A HB3  4  
ATOM 6614  H HG2  . GLU A 1 81  ? -0.776  6.754   -5.577 1.00 0.00 ? 81  GLU A HG2  4  
ATOM 6615  H HG3  . GLU A 1 81  ? -2.405  7.120   -6.108 1.00 0.00 ? 81  GLU A HG3  4  
ATOM 6616  N N    . VAL A 1 82  ? -4.260  6.514   -1.809 1.00 0.00 ? 82  VAL A N    4  
ATOM 6617  C CA   . VAL A 1 82  ? -4.743  6.061   -0.516 1.00 0.00 ? 82  VAL A CA   4  
ATOM 6618  C C    . VAL A 1 82  ? -6.140  5.460   -0.680 1.00 0.00 ? 82  VAL A C    4  
ATOM 6619  O O    . VAL A 1 82  ? -6.427  4.390   -0.144 1.00 0.00 ? 82  VAL A O    4  
ATOM 6620  C CB   . VAL A 1 82  ? -4.701  7.212   0.492  1.00 0.00 ? 82  VAL A CB   4  
ATOM 6621  C CG1  . VAL A 1 82  ? -5.526  8.402   -0.002 1.00 0.00 ? 82  VAL A CG1  4  
ATOM 6622  C CG2  . VAL A 1 82  ? -5.176  6.750   1.871  1.00 0.00 ? 82  VAL A CG2  4  
ATOM 6623  H H    . VAL A 1 82  ? -3.954  7.466   -1.835 1.00 0.00 ? 82  VAL A H    4  
ATOM 6624  H HA   . VAL A 1 82  ? -4.065  5.282   -0.166 1.00 0.00 ? 82  VAL A HA   4  
ATOM 6625  H HB   . VAL A 1 82  ? -3.665  7.537   0.586  1.00 0.00 ? 82  VAL A HB   4  
ATOM 6626  H HG11 . VAL A 1 82  ? -5.141  8.736   -0.966 1.00 0.00 ? 82  VAL A HG11 4  
ATOM 6627  H HG12 . VAL A 1 82  ? -6.568  8.102   -0.111 1.00 0.00 ? 82  VAL A HG12 4  
ATOM 6628  H HG13 . VAL A 1 82  ? -5.455  9.217   0.718  1.00 0.00 ? 82  VAL A HG13 4  
ATOM 6629  H HG21 . VAL A 1 82  ? -4.312  6.525   2.496  1.00 0.00 ? 82  VAL A HG21 4  
ATOM 6630  H HG22 . VAL A 1 82  ? -5.764  7.542   2.336  1.00 0.00 ? 82  VAL A HG22 4  
ATOM 6631  H HG23 . VAL A 1 82  ? -5.791  5.857   1.764  1.00 0.00 ? 82  VAL A HG23 4  
ATOM 6632  N N    . ASP A 1 83  ? -6.973  6.174   -1.423 1.00 0.00 ? 83  ASP A N    4  
ATOM 6633  C CA   . ASP A 1 83  ? -8.333  5.724   -1.664 1.00 0.00 ? 83  ASP A CA   4  
ATOM 6634  C C    . ASP A 1 83  ? -8.302  4.325   -2.282 1.00 0.00 ? 83  ASP A C    4  
ATOM 6635  O O    . ASP A 1 83  ? -9.239  3.546   -2.112 1.00 0.00 ? 83  ASP A O    4  
ATOM 6636  C CB   . ASP A 1 83  ? -9.056  6.656   -2.640 1.00 0.00 ? 83  ASP A CB   4  
ATOM 6637  C CG   . ASP A 1 83  ? -10.115 7.560   -2.006 1.00 0.00 ? 83  ASP A CG   4  
ATOM 6638  O OD1  . ASP A 1 83  ? -9.757  8.259   -1.034 1.00 0.00 ? 83  ASP A OD1  4  
ATOM 6639  O OD2  . ASP A 1 83  ? -11.260 7.531   -2.508 1.00 0.00 ? 83  ASP A OD2  4  
ATOM 6640  H H    . ASP A 1 83  ? -6.732  7.043   -1.855 1.00 0.00 ? 83  ASP A H    4  
ATOM 6641  H HA   . ASP A 1 83  ? -8.817  5.738   -0.687 1.00 0.00 ? 83  ASP A HA   4  
ATOM 6642  H HB2  . ASP A 1 83  ? -8.316  7.282   -3.137 1.00 0.00 ? 83  ASP A HB2  4  
ATOM 6643  H HB3  . ASP A 1 83  ? -9.531  6.050   -3.412 1.00 0.00 ? 83  ASP A HB3  4  
ATOM 6644  N N    . ALA A 1 84  ? -7.214  4.048   -2.986 1.00 0.00 ? 84  ALA A N    4  
ATOM 6645  C CA   . ALA A 1 84  ? -7.048  2.757   -3.630 1.00 0.00 ? 84  ALA A CA   4  
ATOM 6646  C C    . ALA A 1 84  ? -6.757  1.695   -2.567 1.00 0.00 ? 84  ALA A C    4  
ATOM 6647  O O    . ALA A 1 84  ? -7.383  0.636   -2.555 1.00 0.00 ? 84  ALA A O    4  
ATOM 6648  C CB   . ALA A 1 84  ? -5.940  2.848   -4.681 1.00 0.00 ? 84  ALA A CB   4  
ATOM 6649  H H    . ALA A 1 84  ? -6.457  4.688   -3.120 1.00 0.00 ? 84  ALA A H    4  
ATOM 6650  H HA   . ALA A 1 84  ? -7.986  2.512   -4.129 1.00 0.00 ? 84  ALA A HA   4  
ATOM 6651  H HB1  . ALA A 1 84  ? -5.994  3.814   -5.183 1.00 0.00 ? 84  ALA A HB1  4  
ATOM 6652  H HB2  . ALA A 1 84  ? -4.969  2.746   -4.195 1.00 0.00 ? 84  ALA A HB2  4  
ATOM 6653  H HB3  . ALA A 1 84  ? -6.066  2.051   -5.413 1.00 0.00 ? 84  ALA A HB3  4  
ATOM 6654  N N    . ALA A 1 85  ? -5.808  2.016   -1.701 1.00 0.00 ? 85  ALA A N    4  
ATOM 6655  C CA   . ALA A 1 85  ? -5.427  1.103   -0.636 1.00 0.00 ? 85  ALA A CA   4  
ATOM 6656  C C    . ALA A 1 85  ? -6.667  0.732   0.179  1.00 0.00 ? 85  ALA A C    4  
ATOM 6657  O O    . ALA A 1 85  ? -6.828  -0.420  0.580  1.00 0.00 ? 85  ALA A O    4  
ATOM 6658  C CB   . ALA A 1 85  ? -4.336  1.747   0.222  1.00 0.00 ? 85  ALA A CB   4  
ATOM 6659  H H    . ALA A 1 85  ? -5.304  2.880   -1.718 1.00 0.00 ? 85  ALA A H    4  
ATOM 6660  H HA   . ALA A 1 85  ? -5.023  0.203   -1.100 1.00 0.00 ? 85  ALA A HA   4  
ATOM 6661  H HB1  . ALA A 1 85  ? -4.117  1.104   1.075  1.00 0.00 ? 85  ALA A HB1  4  
ATOM 6662  H HB2  . ALA A 1 85  ? -3.433  1.877   -0.375 1.00 0.00 ? 85  ALA A HB2  4  
ATOM 6663  H HB3  . ALA A 1 85  ? -4.679  2.718   0.578  1.00 0.00 ? 85  ALA A HB3  4  
ATOM 6664  N N    . MET A 1 86  ? -7.511  1.729   0.401  1.00 0.00 ? 86  MET A N    4  
ATOM 6665  C CA   . MET A 1 86  ? -8.731  1.521   1.161  1.00 0.00 ? 86  MET A CA   4  
ATOM 6666  C C    . MET A 1 86  ? -9.589  0.421   0.532  1.00 0.00 ? 86  MET A C    4  
ATOM 6667  O O    . MET A 1 86  ? -10.160 -0.408  1.240  1.00 0.00 ? 86  MET A O    4  
ATOM 6668  C CB   . MET A 1 86  ? -9.530  2.825   1.212  1.00 0.00 ? 86  MET A CB   4  
ATOM 6669  C CG   . MET A 1 86  ? -8.693  3.957   1.810  1.00 0.00 ? 86  MET A CG   4  
ATOM 6670  S SD   . MET A 1 86  ? -9.579  4.726   3.155  1.00 0.00 ? 86  MET A SD   4  
ATOM 6671  C CE   . MET A 1 86  ? -9.491  3.421   4.370  1.00 0.00 ? 86  MET A CE   4  
ATOM 6672  H H    . MET A 1 86  ? -7.372  2.662   0.071  1.00 0.00 ? 86  MET A H    4  
ATOM 6673  H HA   . MET A 1 86  ? -8.408  1.215   2.156  1.00 0.00 ? 86  MET A HA   4  
ATOM 6674  H HB2  . MET A 1 86  ? -9.852  3.097   0.207  1.00 0.00 ? 86  MET A HB2  4  
ATOM 6675  H HB3  . MET A 1 86  ? -10.432 2.680   1.807  1.00 0.00 ? 86  MET A HB3  4  
ATOM 6676  H HG2  . MET A 1 86  ? -7.740  3.567   2.167  1.00 0.00 ? 86  MET A HG2  4  
ATOM 6677  H HG3  . MET A 1 86  ? -8.467  4.698   1.042  1.00 0.00 ? 86  MET A HG3  4  
ATOM 6678  H HE1  . MET A 1 86  ? -9.266  2.477   3.874  1.00 0.00 ? 86  MET A HE1  4  
ATOM 6679  H HE2  . MET A 1 86  ? -8.707  3.649   5.092  1.00 0.00 ? 86  MET A HE2  4  
ATOM 6680  H HE3  . MET A 1 86  ? -10.448 3.341   4.886  1.00 0.00 ? 86  MET A HE3  4  
ATOM 6681  N N    . ALA A 1 87  ? -9.652  0.448   -0.791 1.00 0.00 ? 87  ALA A N    4  
ATOM 6682  C CA   . ALA A 1 87  ? -10.430 -0.537  -1.523 1.00 0.00 ? 87  ALA A CA   4  
ATOM 6683  C C    . ALA A 1 87  ? -9.484  -1.441  -2.316 1.00 0.00 ? 87  ALA A C    4  
ATOM 6684  O O    . ALA A 1 87  ? -9.772  -1.798  -3.458 1.00 0.00 ? 87  ALA A O    4  
ATOM 6685  C CB   . ALA A 1 87  ? -11.443 0.177   -2.420 1.00 0.00 ? 87  ALA A CB   4  
ATOM 6686  H H    . ALA A 1 87  ? -9.184  1.125   -1.359 1.00 0.00 ? 87  ALA A H    4  
ATOM 6687  H HA   . ALA A 1 87  ? -10.971 -1.141  -0.795 1.00 0.00 ? 87  ALA A HA   4  
ATOM 6688  H HB1  . ALA A 1 87  ? -11.970 -0.557  -3.030 1.00 0.00 ? 87  ALA A HB1  4  
ATOM 6689  H HB2  . ALA A 1 87  ? -12.159 0.717   -1.801 1.00 0.00 ? 87  ALA A HB2  4  
ATOM 6690  H HB3  . ALA A 1 87  ? -10.921 0.880   -3.069 1.00 0.00 ? 87  ALA A HB3  4  
ATOM 6691  N N    . ALA A 1 88  ? -8.374  -1.785  -1.680 1.00 0.00 ? 88  ALA A N    4  
ATOM 6692  C CA   . ALA A 1 88  ? -7.384  -2.641  -2.312 1.00 0.00 ? 88  ALA A CA   4  
ATOM 6693  C C    . ALA A 1 88  ? -7.368  -4.000  -1.609 1.00 0.00 ? 88  ALA A C    4  
ATOM 6694  O O    . ALA A 1 88  ? -6.883  -4.984  -2.165 1.00 0.00 ? 88  ALA A O    4  
ATOM 6695  C CB   . ALA A 1 88  ? -6.019  -1.952  -2.280 1.00 0.00 ? 88  ALA A CB   4  
ATOM 6696  H H    . ALA A 1 88  ? -8.147  -1.491  -0.752 1.00 0.00 ? 88  ALA A H    4  
ATOM 6697  H HA   . ALA A 1 88  ? -7.682  -2.782  -3.351 1.00 0.00 ? 88  ALA A HA   4  
ATOM 6698  H HB1  . ALA A 1 88  ? -5.792  -1.641  -1.260 1.00 0.00 ? 88  ALA A HB1  4  
ATOM 6699  H HB2  . ALA A 1 88  ? -5.253  -2.646  -2.627 1.00 0.00 ? 88  ALA A HB2  4  
ATOM 6700  H HB3  . ALA A 1 88  ? -6.038  -1.077  -2.930 1.00 0.00 ? 88  ALA A HB3  4  
ATOM 6701  N N    . ARG A 1 89  ? -7.903  -4.010  -0.397 1.00 0.00 ? 89  ARG A N    4  
ATOM 6702  C CA   . ARG A 1 89  ? -7.957  -5.232  0.387  1.00 0.00 ? 89  ARG A CA   4  
ATOM 6703  C C    . ARG A 1 89  ? -8.455  -6.394  -0.474 1.00 0.00 ? 89  ARG A C    4  
ATOM 6704  O O    . ARG A 1 89  ? -9.093  -6.180  -1.504 1.00 0.00 ? 89  ARG A O    4  
ATOM 6705  C CB   . ARG A 1 89  ? -8.880  -5.071  1.596  1.00 0.00 ? 89  ARG A CB   4  
ATOM 6706  C CG   . ARG A 1 89  ? -8.107  -4.550  2.810  1.00 0.00 ? 89  ARG A CG   4  
ATOM 6707  C CD   . ARG A 1 89  ? -8.306  -5.465  4.020  1.00 0.00 ? 89  ARG A CD   4  
ATOM 6708  N NE   . ARG A 1 89  ? -9.723  -5.439  4.447  1.00 0.00 ? 89  ARG A NE   4  
ATOM 6709  C CZ   . ARG A 1 89  ? -10.242 -6.249  5.380  1.00 0.00 ? 89  ARG A CZ   4  
ATOM 6710  N NH1  . ARG A 1 89  ? -9.463  -7.153  5.990  1.00 0.00 ? 89  ARG A NH1  4  
ATOM 6711  N NH2  . ARG A 1 89  ? -11.539 -6.154  5.703  1.00 0.00 ? 89  ARG A NH2  4  
ATOM 6712  H H    . ARG A 1 89  ? -8.295  -3.205  0.048  1.00 0.00 ? 89  ARG A H    4  
ATOM 6713  H HA   . ARG A 1 89  ? -6.930  -5.398  0.714  1.00 0.00 ? 89  ARG A HA   4  
ATOM 6714  H HB2  . ARG A 1 89  ? -9.688  -4.381  1.352  1.00 0.00 ? 89  ARG A HB2  4  
ATOM 6715  H HB3  . ARG A 1 89  ? -9.340  -6.029  1.837  1.00 0.00 ? 89  ARG A HB3  4  
ATOM 6716  H HG2  . ARG A 1 89  ? -7.046  -4.485  2.570  1.00 0.00 ? 89  ARG A HG2  4  
ATOM 6717  H HG3  . ARG A 1 89  ? -8.441  -3.542  3.053  1.00 0.00 ? 89  ARG A HG3  4  
ATOM 6718  H HD2  . ARG A 1 89  ? -8.012  -6.484  3.768  1.00 0.00 ? 89  ARG A HD2  4  
ATOM 6719  H HD3  . ARG A 1 89  ? -7.665  -5.142  4.840  1.00 0.00 ? 89  ARG A HD3  4  
ATOM 6720  H HE   . ARG A 1 89  ? -10.331 -4.776  4.011  1.00 0.00 ? 89  ARG A HE   4  
ATOM 6721  H HH11 . ARG A 1 89  ? -8.496  -7.224  5.748  1.00 0.00 ? 89  ARG A HH11 4  
ATOM 6722  H HH12 . ARG A 1 89  ? -9.851  -7.758  6.686  1.00 0.00 ? 89  ARG A HH12 4  
ATOM 6723  H HH21 . ARG A 1 89  ? -12.119 -5.479  5.248  1.00 0.00 ? 89  ARG A HH21 4  
ATOM 6724  H HH22 . ARG A 1 89  ? -11.926 -6.759  6.400  1.00 0.00 ? 89  ARG A HH22 4  
ATOM 6725  N N    . PRO A 1 90  ? -8.136  -7.632  -0.010 1.00 0.00 ? 90  PRO A N    4  
ATOM 6726  C CA   . PRO A 1 90  ? -7.376  -7.798  1.218  1.00 0.00 ? 90  PRO A CA   4  
ATOM 6727  C C    . PRO A 1 90  ? -5.900  -7.462  0.999  1.00 0.00 ? 90  PRO A C    4  
ATOM 6728  O O    . PRO A 1 90  ? -5.508  -7.052  -0.092 1.00 0.00 ? 90  PRO A O    4  
ATOM 6729  C CB   . PRO A 1 90  ? -7.602  -9.244  1.628  1.00 0.00 ? 90  PRO A CB   4  
ATOM 6730  C CG   . PRO A 1 90  ? -8.093  -9.959  0.379  1.00 0.00 ? 90  PRO A CG   4  
ATOM 6731  C CD   . PRO A 1 90  ? -8.488  -8.902  -0.639 1.00 0.00 ? 90  PRO A CD   4  
ATOM 6732  H HA   . PRO A 1 90  ? -7.702  -7.160  1.916  1.00 0.00 ? 90  PRO A HA   4  
ATOM 6733  H HB2  . PRO A 1 90  ? -6.680  -9.693  1.998  1.00 0.00 ? 90  PRO A HB2  4  
ATOM 6734  H HB3  . PRO A 1 90  ? -8.335  -9.313  2.431  1.00 0.00 ? 90  PRO A HB3  4  
ATOM 6735  H HG2  . PRO A 1 90  ? -7.312  -10.604 -0.023 1.00 0.00 ? 90  PRO A HG2  4  
ATOM 6736  H HG3  . PRO A 1 90  ? -8.944  -10.598 0.616  1.00 0.00 ? 90  PRO A HG3  4  
ATOM 6737  H HD2  . PRO A 1 90  ? -7.955  -9.039  -1.579 1.00 0.00 ? 90  PRO A HD2  4  
ATOM 6738  H HD3  . PRO A 1 90  ? -9.553  -8.949  -0.866 1.00 0.00 ? 90  PRO A HD3  4  
ATOM 6739  N N    . HIS A 1 91  ? -5.121  -7.647  2.055  1.00 0.00 ? 91  HIS A N    4  
ATOM 6740  C CA   . HIS A 1 91  ? -3.697  -7.368  1.992  1.00 0.00 ? 91  HIS A CA   4  
ATOM 6741  C C    . HIS A 1 91  ? -2.929  -8.439  2.770  1.00 0.00 ? 91  HIS A C    4  
ATOM 6742  O O    . HIS A 1 91  ? -3.248  -8.721  3.924  1.00 0.00 ? 91  HIS A O    4  
ATOM 6743  C CB   . HIS A 1 91  ? -3.398  -5.950  2.484  1.00 0.00 ? 91  HIS A CB   4  
ATOM 6744  C CG   . HIS A 1 91  ? -4.120  -4.869  1.715  1.00 0.00 ? 91  HIS A CG   4  
ATOM 6745  N ND1  . HIS A 1 91  ? -4.839  -3.862  2.335  1.00 0.00 ? 91  HIS A ND1  4  
ATOM 6746  C CD2  . HIS A 1 91  ? -4.224  -4.648  0.374  1.00 0.00 ? 91  HIS A CD2  4  
ATOM 6747  C CE1  . HIS A 1 91  ? -5.350  -3.076  1.398  1.00 0.00 ? 91  HIS A CE1  4  
ATOM 6748  N NE2  . HIS A 1 91  ? -4.968  -3.565  0.183  1.00 0.00 ? 91  HIS A NE2  4  
ATOM 6749  H H    . HIS A 1 91  ? -5.448  -7.980  2.939  1.00 0.00 ? 91  HIS A H    4  
ATOM 6750  H HA   . HIS A 1 91  ? -3.413  -7.421  0.941  1.00 0.00 ? 91  HIS A HA   4  
ATOM 6751  H HB2  . HIS A 1 91  ? -3.671  -5.877  3.537  1.00 0.00 ? 91  HIS A HB2  4  
ATOM 6752  H HB3  . HIS A 1 91  ? -2.325  -5.773  2.420  1.00 0.00 ? 91  HIS A HB3  4  
ATOM 6753  H HD1  . HIS A 1 91  ? -4.954  -3.747  3.321  1.00 0.00 ? 91  HIS A HD1  4  
ATOM 6754  H HD2  . HIS A 1 91  ? -3.773  -5.257  -0.410 1.00 0.00 ? 91  HIS A HD2  4  
ATOM 6755  H HE1  . HIS A 1 91  ? -5.966  -2.194  1.568  1.00 0.00 ? 91  HIS A HE1  4  
ATOM 6756  N N    . SER A 1 92  ? -1.933  -9.007  2.106  1.00 0.00 ? 92  SER A N    4  
ATOM 6757  C CA   . SER A 1 92  ? -1.117  -10.040 2.721  1.00 0.00 ? 92  SER A CA   4  
ATOM 6758  C C    . SER A 1 92  ? 0.342   -9.587  2.785  1.00 0.00 ? 92  SER A C    4  
ATOM 6759  O O    . SER A 1 92  ? 1.006   -9.471  1.756  1.00 0.00 ? 92  SER A O    4  
ATOM 6760  C CB   . SER A 1 92  ? -1.230  -11.359 1.953  1.00 0.00 ? 92  SER A CB   4  
ATOM 6761  O OG   . SER A 1 92  ? -1.245  -11.157 0.543  1.00 0.00 ? 92  SER A OG   4  
ATOM 6762  H H    . SER A 1 92  ? -1.680  -8.771  1.168  1.00 0.00 ? 92  SER A H    4  
ATOM 6763  H HA   . SER A 1 92  ? -1.523  -10.169 3.724  1.00 0.00 ? 92  SER A HA   4  
ATOM 6764  H HB2  . SER A 1 92  ? -0.393  -12.005 2.218  1.00 0.00 ? 92  SER A HB2  4  
ATOM 6765  H HB3  . SER A 1 92  ? -2.140  -11.878 2.255  1.00 0.00 ? 92  SER A HB3  4  
ATOM 6766  H HG   . SER A 1 92  ? -2.098  -10.712 0.270  1.00 0.00 ? 92  SER A HG   4  
ATOM 6767  N N    . ILE A 1 93  ? 0.799   -9.341  4.004  1.00 0.00 ? 93  ILE A N    4  
ATOM 6768  C CA   . ILE A 1 93  ? 2.168   -8.903  4.216  1.00 0.00 ? 93  ILE A CA   4  
ATOM 6769  C C    . ILE A 1 93  ? 2.836   -9.812  5.249  1.00 0.00 ? 93  ILE A C    4  
ATOM 6770  O O    . ILE A 1 93  ? 2.231   -10.156 6.263  1.00 0.00 ? 93  ILE A O    4  
ATOM 6771  C CB   . ILE A 1 93  ? 2.204   -7.419  4.588  1.00 0.00 ? 93  ILE A CB   4  
ATOM 6772  C CG1  . ILE A 1 93  ? 1.322   -6.596  3.647  1.00 0.00 ? 93  ILE A CG1  4  
ATOM 6773  C CG2  . ILE A 1 93  ? 3.642   -6.898  4.628  1.00 0.00 ? 93  ILE A CG2  4  
ATOM 6774  C CD1  . ILE A 1 93  ? 1.348   -5.114  4.027  1.00 0.00 ? 93  ILE A CD1  4  
ATOM 6775  H H    . ILE A 1 93  ? 0.253   -9.438  4.836  1.00 0.00 ? 93  ILE A H    4  
ATOM 6776  H HA   . ILE A 1 93  ? 2.696   -9.010  3.268  1.00 0.00 ? 93  ILE A HA   4  
ATOM 6777  H HB   . ILE A 1 93  ? 1.794   -7.309  5.592  1.00 0.00 ? 93  ILE A HB   4  
ATOM 6778  H HG12 . ILE A 1 93  ? 1.667   -6.718  2.621  1.00 0.00 ? 93  ILE A HG12 4  
ATOM 6779  H HG13 . ILE A 1 93  ? 0.298   -6.967  3.686  1.00 0.00 ? 93  ILE A HG13 4  
ATOM 6780  H HG21 . ILE A 1 93  ? 3.856   -6.499  5.619  1.00 0.00 ? 93  ILE A HG21 4  
ATOM 6781  H HG22 . ILE A 1 93  ? 4.330   -7.715  4.409  1.00 0.00 ? 93  ILE A HG22 4  
ATOM 6782  H HG23 . ILE A 1 93  ? 3.764   -6.111  3.885  1.00 0.00 ? 93  ILE A HG23 4  
ATOM 6783  H HD11 . ILE A 1 93  ? 1.956   -4.566  3.309  1.00 0.00 ? 93  ILE A HD11 4  
ATOM 6784  H HD12 . ILE A 1 93  ? 0.332   -4.719  4.019  1.00 0.00 ? 93  ILE A HD12 4  
ATOM 6785  H HD13 . ILE A 1 93  ? 1.773   -5.003  5.025  1.00 0.00 ? 93  ILE A HD13 4  
ATOM 6786  N N    . ASP A 1 94  ? 4.076   -10.177 4.956  1.00 0.00 ? 94  ASP A N    4  
ATOM 6787  C CA   . ASP A 1 94  ? 4.833   -11.040 5.846  1.00 0.00 ? 94  ASP A CA   4  
ATOM 6788  C C    . ASP A 1 94  ? 4.212   -12.438 5.844  1.00 0.00 ? 94  ASP A C    4  
ATOM 6789  O O    . ASP A 1 94  ? 4.578   -13.285 6.658  1.00 0.00 ? 94  ASP A O    4  
ATOM 6790  C CB   . ASP A 1 94  ? 4.803   -10.511 7.282  1.00 0.00 ? 94  ASP A CB   4  
ATOM 6791  C CG   . ASP A 1 94  ? 6.003   -10.911 8.143  1.00 0.00 ? 94  ASP A CG   4  
ATOM 6792  O OD1  . ASP A 1 94  ? 5.948   -12.023 8.712  1.00 0.00 ? 94  ASP A OD1  4  
ATOM 6793  O OD2  . ASP A 1 94  ? 6.948   -10.096 8.213  1.00 0.00 ? 94  ASP A OD2  4  
ATOM 6794  H H    . ASP A 1 94  ? 4.561   -9.893  4.129  1.00 0.00 ? 94  ASP A H    4  
ATOM 6795  H HA   . ASP A 1 94  ? 5.850   -11.034 5.454  1.00 0.00 ? 94  ASP A HA   4  
ATOM 6796  H HB2  . ASP A 1 94  ? 4.743   -9.423  7.252  1.00 0.00 ? 94  ASP A HB2  4  
ATOM 6797  H HB3  . ASP A 1 94  ? 3.894   -10.867 7.765  1.00 0.00 ? 94  ASP A HB3  4  
ATOM 6798  N N    . GLY A 1 95  ? 3.284   -12.637 4.920  1.00 0.00 ? 95  GLY A N    4  
ATOM 6799  C CA   . GLY A 1 95  ? 2.608   -13.918 4.801  1.00 0.00 ? 95  GLY A CA   4  
ATOM 6800  C C    . GLY A 1 95  ? 1.294   -13.920 5.584  1.00 0.00 ? 95  GLY A C    4  
ATOM 6801  O O    . GLY A 1 95  ? 0.509   -14.861 5.484  1.00 0.00 ? 95  GLY A O    4  
ATOM 6802  H H    . GLY A 1 95  ? 2.992   -11.943 4.262  1.00 0.00 ? 95  GLY A H    4  
ATOM 6803  H HA2  . GLY A 1 95  ? 2.411   -14.133 3.751  1.00 0.00 ? 95  GLY A HA2  4  
ATOM 6804  H HA3  . GLY A 1 95  ? 3.258   -14.711 5.173  1.00 0.00 ? 95  GLY A HA3  4  
ATOM 6805  N N    . ARG A 1 96  ? 1.094   -12.854 6.346  1.00 0.00 ? 96  ARG A N    4  
ATOM 6806  C CA   . ARG A 1 96  ? -0.112  -12.721 7.145  1.00 0.00 ? 96  ARG A CA   4  
ATOM 6807  C C    . ARG A 1 96  ? -1.055  -11.694 6.515  1.00 0.00 ? 96  ARG A C    4  
ATOM 6808  O O    . ARG A 1 96  ? -0.631  -10.870 5.707  1.00 0.00 ? 96  ARG A O    4  
ATOM 6809  C CB   . ARG A 1 96  ? 0.220   -12.289 8.575  1.00 0.00 ? 96  ARG A CB   4  
ATOM 6810  C CG   . ARG A 1 96  ? 0.864   -10.901 8.593  1.00 0.00 ? 96  ARG A CG   4  
ATOM 6811  C CD   . ARG A 1 96  ? 0.688   -10.233 9.958  1.00 0.00 ? 96  ARG A CD   4  
ATOM 6812  N NE   . ARG A 1 96  ? 0.651   -11.260 11.023 1.00 0.00 ? 96  ARG A NE   4  
ATOM 6813  C CZ   . ARG A 1 96  ? -0.476  -11.796 11.511 1.00 0.00 ? 96  ARG A CZ   4  
ATOM 6814  N NH1  . ARG A 1 96  ? -1.665  -11.405 11.033 1.00 0.00 ? 96  ARG A NH1  4  
ATOM 6815  N NH2  . ARG A 1 96  ? -0.413  -12.722 12.478 1.00 0.00 ? 96  ARG A NH2  4  
ATOM 6816  H H    . ARG A 1 96  ? 1.738   -12.092 6.422  1.00 0.00 ? 96  ARG A H    4  
ATOM 6817  H HA   . ARG A 1 96  ? -0.558  -13.715 7.145  1.00 0.00 ? 96  ARG A HA   4  
ATOM 6818  H HB2  . ARG A 1 96  ? -0.689  -12.280 9.176  1.00 0.00 ? 96  ARG A HB2  4  
ATOM 6819  H HB3  . ARG A 1 96  ? 0.896   -13.013 9.030  1.00 0.00 ? 96  ARG A HB3  4  
ATOM 6820  H HG2  . ARG A 1 96  ? 1.925   -10.985 8.359  1.00 0.00 ? 96  ARG A HG2  4  
ATOM 6821  H HG3  . ARG A 1 96  ? 0.415   -10.278 7.819  1.00 0.00 ? 96  ARG A HG3  4  
ATOM 6822  H HD2  . ARG A 1 96  ? 1.508   -9.538  10.140 1.00 0.00 ? 96  ARG A HD2  4  
ATOM 6823  H HD3  . ARG A 1 96  ? -0.233  -9.650  9.972  1.00 0.00 ? 96  ARG A HD3  4  
ATOM 6824  H HE   . ARG A 1 96  ? 1.522   -11.574 11.402 1.00 0.00 ? 96  ARG A HE   4  
ATOM 6825  H HH11 . ARG A 1 96  ? -1.711  -10.714 10.312 1.00 0.00 ? 96  ARG A HH11 4  
ATOM 6826  H HH12 . ARG A 1 96  ? -2.506  -11.805 11.398 1.00 0.00 ? 96  ARG A HH12 4  
ATOM 6827  H HH21 . ARG A 1 96  ? 0.474   -13.014 12.834 1.00 0.00 ? 96  ARG A HH21 4  
ATOM 6828  H HH22 . ARG A 1 96  ? -1.255  -13.122 12.842 1.00 0.00 ? 96  ARG A HH22 4  
ATOM 6829  N N    . VAL A 1 97  ? -2.317  -11.777 6.910  1.00 0.00 ? 97  VAL A N    4  
ATOM 6830  C CA   . VAL A 1 97  ? -3.324  -10.865 6.394  1.00 0.00 ? 97  VAL A CA   4  
ATOM 6831  C C    . VAL A 1 97  ? -3.393  -9.627  7.291  1.00 0.00 ? 97  VAL A C    4  
ATOM 6832  O O    . VAL A 1 97  ? -3.734  -9.728  8.468  1.00 0.00 ? 97  VAL A O    4  
ATOM 6833  C CB   . VAL A 1 97  ? -4.667  -11.586 6.267  1.00 0.00 ? 97  VAL A CB   4  
ATOM 6834  C CG1  . VAL A 1 97  ? -5.720  -10.677 5.630  1.00 0.00 ? 97  VAL A CG1  4  
ATOM 6835  C CG2  . VAL A 1 97  ? -4.518  -12.889 5.478  1.00 0.00 ? 97  VAL A CG2  4  
ATOM 6836  H H    . VAL A 1 97  ? -2.654  -12.450 7.568  1.00 0.00 ? 97  VAL A H    4  
ATOM 6837  H HA   . VAL A 1 97  ? -3.010  -10.558 5.396  1.00 0.00 ? 97  VAL A HA   4  
ATOM 6838  H HB   . VAL A 1 97  ? -5.008  -11.840 7.271  1.00 0.00 ? 97  VAL A HB   4  
ATOM 6839  H HG11 . VAL A 1 97  ? -6.650  -10.747 6.194  1.00 0.00 ? 97  VAL A HG11 4  
ATOM 6840  H HG12 . VAL A 1 97  ? -5.365  -9.646  5.642  1.00 0.00 ? 97  VAL A HG12 4  
ATOM 6841  H HG13 . VAL A 1 97  ? -5.895  -10.989 4.600  1.00 0.00 ? 97  VAL A HG13 4  
ATOM 6842  H HG21 . VAL A 1 97  ? -4.543  -12.671 4.410  1.00 0.00 ? 97  VAL A HG21 4  
ATOM 6843  H HG22 . VAL A 1 97  ? -3.568  -13.360 5.731  1.00 0.00 ? 97  VAL A HG22 4  
ATOM 6844  H HG23 . VAL A 1 97  ? -5.336  -13.563 5.731  1.00 0.00 ? 97  VAL A HG23 4  
ATOM 6845  N N    . VAL A 1 98  ? -3.062  -8.489  6.700  1.00 0.00 ? 98  VAL A N    4  
ATOM 6846  C CA   . VAL A 1 98  ? -3.082  -7.233  7.431  1.00 0.00 ? 98  VAL A CA   4  
ATOM 6847  C C    . VAL A 1 98  ? -4.437  -6.553  7.231  1.00 0.00 ? 98  VAL A C    4  
ATOM 6848  O O    . VAL A 1 98  ? -5.308  -7.086  6.546  1.00 0.00 ? 98  VAL A O    4  
ATOM 6849  C CB   . VAL A 1 98  ? -1.904  -6.358  6.999  1.00 0.00 ? 98  VAL A CB   4  
ATOM 6850  C CG1  . VAL A 1 98  ? -0.588  -7.136  7.067  1.00 0.00 ? 98  VAL A CG1  4  
ATOM 6851  C CG2  . VAL A 1 98  ? -2.131  -5.785  5.599  1.00 0.00 ? 98  VAL A CG2  4  
ATOM 6852  H H    . VAL A 1 98  ? -2.785  -8.416  5.742  1.00 0.00 ? 98  VAL A H    4  
ATOM 6853  H HA   . VAL A 1 98  ? -2.959  -7.466  8.489  1.00 0.00 ? 98  VAL A HA   4  
ATOM 6854  H HB   . VAL A 1 98  ? -1.834  -5.522  7.696  1.00 0.00 ? 98  VAL A HB   4  
ATOM 6855  H HG11 . VAL A 1 98  ? -0.422  -7.650  6.120  1.00 0.00 ? 98  VAL A HG11 4  
ATOM 6856  H HG12 . VAL A 1 98  ? 0.234   -6.445  7.255  1.00 0.00 ? 98  VAL A HG12 4  
ATOM 6857  H HG13 . VAL A 1 98  ? -0.640  -7.868  7.873  1.00 0.00 ? 98  VAL A HG13 4  
ATOM 6858  H HG21 . VAL A 1 98  ? -3.180  -5.514  5.483  1.00 0.00 ? 98  VAL A HG21 4  
ATOM 6859  H HG22 . VAL A 1 98  ? -1.510  -4.899  5.464  1.00 0.00 ? 98  VAL A HG22 4  
ATOM 6860  H HG23 . VAL A 1 98  ? -1.863  -6.533  4.853  1.00 0.00 ? 98  VAL A HG23 4  
ATOM 6861  N N    . GLU A 1 99  ? -4.573  -5.384  7.841  1.00 0.00 ? 99  GLU A N    4  
ATOM 6862  C CA   . GLU A 1 99  ? -5.808  -4.625  7.739  1.00 0.00 ? 99  GLU A CA   4  
ATOM 6863  C C    . GLU A 1 99  ? -5.541  -3.141  7.996  1.00 0.00 ? 99  GLU A C    4  
ATOM 6864  O O    . GLU A 1 99  ? -5.266  -2.743  9.127  1.00 0.00 ? 99  GLU A O    4  
ATOM 6865  C CB   . GLU A 1 99  ? -6.866  -5.168  8.701  1.00 0.00 ? 99  GLU A CB   4  
ATOM 6866  C CG   . GLU A 1 99  ? -6.223  -5.684  9.989  1.00 0.00 ? 99  GLU A CG   4  
ATOM 6867  C CD   . GLU A 1 99  ? -6.240  -7.213  10.036 1.00 0.00 ? 99  GLU A CD   4  
ATOM 6868  O OE1  . GLU A 1 99  ? -7.242  -7.784  9.554  1.00 0.00 ? 99  GLU A OE1  4  
ATOM 6869  O OE2  . GLU A 1 99  ? -5.252  -7.777  10.553 1.00 0.00 ? 99  GLU A OE2  4  
ATOM 6870  H H    . GLU A 1 99  ? -3.859  -4.957  8.397  1.00 0.00 ? 99  GLU A H    4  
ATOM 6871  H HA   . GLU A 1 99  ? -6.151  -4.767  6.714  1.00 0.00 ? 99  GLU A HA   4  
ATOM 6872  H HB2  . GLU A 1 99  ? -7.584  -4.382  8.938  1.00 0.00 ? 99  GLU A HB2  4  
ATOM 6873  H HB3  . GLU A 1 99  ? -7.422  -5.972  8.220  1.00 0.00 ? 99  GLU A HB3  4  
ATOM 6874  H HG2  . GLU A 1 99  ? -5.195  -5.327  10.056 1.00 0.00 ? 99  GLU A HG2  4  
ATOM 6875  H HG3  . GLU A 1 99  ? -6.756  -5.284  10.852 1.00 0.00 ? 99  GLU A HG3  4  
ATOM 6876  N N    . PRO A 1 100 ? -5.635  -2.341  6.900  1.00 0.00 ? 100 PRO A N    4  
ATOM 6877  C CA   . PRO A 1 100 ? -5.407  -0.910  6.996  1.00 0.00 ? 100 PRO A CA   4  
ATOM 6878  C C    . PRO A 1 100 ? -6.598  -0.208  7.653  1.00 0.00 ? 100 PRO A C    4  
ATOM 6879  O O    . PRO A 1 100 ? -7.714  -0.726  7.638  1.00 0.00 ? 100 PRO A O    4  
ATOM 6880  C CB   . PRO A 1 100 ? -5.163  -0.453  5.567  1.00 0.00 ? 100 PRO A CB   4  
ATOM 6881  C CG   . PRO A 1 100 ? -5.720  -1.553  4.678  1.00 0.00 ? 100 PRO A CG   4  
ATOM 6882  C CD   . PRO A 1 100 ? -5.959  -2.778  5.545  1.00 0.00 ? 100 PRO A CD   4  
ATOM 6883  H HA   . PRO A 1 100 ? -4.621  -0.722  7.585  1.00 0.00 ? 100 PRO A HA   4  
ATOM 6884  H HB2  . PRO A 1 100 ? -5.659  0.497   5.371  1.00 0.00 ? 100 PRO A HB2  4  
ATOM 6885  H HB3  . PRO A 1 100 ? -4.100  -0.301  5.382  1.00 0.00 ? 100 PRO A HB3  4  
ATOM 6886  H HG2  . PRO A 1 100 ? -6.648  -1.230  4.208  1.00 0.00 ? 100 PRO A HG2  4  
ATOM 6887  H HG3  . PRO A 1 100 ? -5.020  -1.785  3.875  1.00 0.00 ? 100 PRO A HG3  4  
ATOM 6888  H HD2  . PRO A 1 100 ? -6.993  -3.117  5.475  1.00 0.00 ? 100 PRO A HD2  4  
ATOM 6889  H HD3  . PRO A 1 100 ? -5.329  -3.611  5.236  1.00 0.00 ? 100 PRO A HD3  4  
ATOM 6890  N N    . LYS A 1 101 ? -6.320  0.960   8.213  1.00 0.00 ? 101 LYS A N    4  
ATOM 6891  C CA   . LYS A 1 101 ? -7.355  1.738   8.874  1.00 0.00 ? 101 LYS A CA   4  
ATOM 6892  C C    . LYS A 1 101 ? -7.248  3.199   8.432  1.00 0.00 ? 101 LYS A C    4  
ATOM 6893  O O    . LYS A 1 101 ? -6.160  3.677   8.112  1.00 0.00 ? 101 LYS A O    4  
ATOM 6894  C CB   . LYS A 1 101 ? -7.283  1.547   10.390 1.00 0.00 ? 101 LYS A CB   4  
ATOM 6895  C CG   . LYS A 1 101 ? -6.998  0.086   10.745 1.00 0.00 ? 101 LYS A CG   4  
ATOM 6896  C CD   . LYS A 1 101 ? -8.248  -0.777  10.564 1.00 0.00 ? 101 LYS A CD   4  
ATOM 6897  C CE   . LYS A 1 101 ? -8.490  -1.656  11.792 1.00 0.00 ? 101 LYS A CE   4  
ATOM 6898  N NZ   . LYS A 1 101 ? -8.391  -3.088  11.432 1.00 0.00 ? 101 LYS A NZ   4  
ATOM 6899  H H    . LYS A 1 101 ? -5.410  1.374   8.221  1.00 0.00 ? 101 LYS A H    4  
ATOM 6900  H HA   . LYS A 1 101 ? -8.318  1.347   8.545  1.00 0.00 ? 101 LYS A HA   4  
ATOM 6901  H HB2  . LYS A 1 101 ? -6.503  2.185   10.805 1.00 0.00 ? 101 LYS A HB2  4  
ATOM 6902  H HB3  . LYS A 1 101 ? -8.224  1.858   10.844 1.00 0.00 ? 101 LYS A HB3  4  
ATOM 6903  H HG2  . LYS A 1 101 ? -6.194  -0.295  10.115 1.00 0.00 ? 101 LYS A HG2  4  
ATOM 6904  H HG3  . LYS A 1 101 ? -6.653  0.020   11.777 1.00 0.00 ? 101 LYS A HG3  4  
ATOM 6905  H HD2  . LYS A 1 101 ? -9.114  -0.137  10.393 1.00 0.00 ? 101 LYS A HD2  4  
ATOM 6906  H HD3  . LYS A 1 101 ? -8.136  -1.404  9.679  1.00 0.00 ? 101 LYS A HD3  4  
ATOM 6907  H HE2  . LYS A 1 101 ? -7.761  -1.418  12.567 1.00 0.00 ? 101 LYS A HE2  4  
ATOM 6908  H HE3  . LYS A 1 101 ? -9.476  -1.447  12.207 1.00 0.00 ? 101 LYS A HE3  4  
ATOM 6909  H HZ1  . LYS A 1 101 ? -8.188  -3.625  12.251 1.00 0.00 ? 101 LYS A HZ1  4  
ATOM 6910  H HZ2  . LYS A 1 101 ? -9.259  -3.394  11.040 1.00 0.00 ? 101 LYS A HZ2  4  
ATOM 6911  H HZ3  . LYS A 1 101 ? -7.660  -3.213  10.761 1.00 0.00 ? 101 LYS A HZ3  4  
ATOM 6912  N N    . ARG A 1 102 ? -8.391  3.868   8.430  1.00 0.00 ? 102 ARG A N    4  
ATOM 6913  C CA   . ARG A 1 102 ? -8.440  5.265   8.033  1.00 0.00 ? 102 ARG A CA   4  
ATOM 6914  C C    . ARG A 1 102 ? -7.529  6.104   8.932  1.00 0.00 ? 102 ARG A C    4  
ATOM 6915  O O    . ARG A 1 102 ? -7.002  7.129   8.503  1.00 0.00 ? 102 ARG A O    4  
ATOM 6916  C CB   . ARG A 1 102 ? -9.867  5.811   8.113  1.00 0.00 ? 102 ARG A CB   4  
ATOM 6917  C CG   . ARG A 1 102 ? -10.582 5.678   6.767  1.00 0.00 ? 102 ARG A CG   4  
ATOM 6918  C CD   . ARG A 1 102 ? -12.096 5.576   6.958  1.00 0.00 ? 102 ARG A CD   4  
ATOM 6919  N NE   . ARG A 1 102 ? -12.794 6.148   5.785  1.00 0.00 ? 102 ARG A NE   4  
ATOM 6920  C CZ   . ARG A 1 102 ? -14.098 6.456   5.763  1.00 0.00 ? 102 ARG A CZ   4  
ATOM 6921  N NH1  . ARG A 1 102 ? -14.854 6.248   6.850  1.00 0.00 ? 102 ARG A NH1  4  
ATOM 6922  N NH2  . ARG A 1 102 ? -14.646 6.971   4.654  1.00 0.00 ? 102 ARG A NH2  4  
ATOM 6923  H H    . ARG A 1 102 ? -9.272  3.472   8.691  1.00 0.00 ? 102 ARG A H    4  
ATOM 6924  H HA   . ARG A 1 102 ? -8.089  5.274   7.001  1.00 0.00 ? 102 ARG A HA   4  
ATOM 6925  H HB2  . ARG A 1 102 ? -10.424 5.272   8.880  1.00 0.00 ? 102 ARG A HB2  4  
ATOM 6926  H HB3  . ARG A 1 102 ? -9.843  6.859   8.414  1.00 0.00 ? 102 ARG A HB3  4  
ATOM 6927  H HG2  . ARG A 1 102 ? -10.348 6.539   6.140  1.00 0.00 ? 102 ARG A HG2  4  
ATOM 6928  H HG3  . ARG A 1 102 ? -10.217 4.794   6.244  1.00 0.00 ? 102 ARG A HG3  4  
ATOM 6929  H HD2  . ARG A 1 102 ? -12.385 4.533   7.090  1.00 0.00 ? 102 ARG A HD2  4  
ATOM 6930  H HD3  . ARG A 1 102 ? -12.394 6.106   7.863  1.00 0.00 ? 102 ARG A HD3  4  
ATOM 6931  H HE   . ARG A 1 102 ? -12.259 6.316   4.957  1.00 0.00 ? 102 ARG A HE   4  
ATOM 6932  H HH11 . ARG A 1 102 ? -14.445 5.863   7.677  1.00 0.00 ? 102 ARG A HH11 4  
ATOM 6933  H HH12 . ARG A 1 102 ? -15.827 6.478   6.833  1.00 0.00 ? 102 ARG A HH12 4  
ATOM 6934  H HH21 . ARG A 1 102 ? -14.082 7.127   3.843  1.00 0.00 ? 102 ARG A HH21 4  
ATOM 6935  H HH22 . ARG A 1 102 ? -15.619 7.201   4.638  1.00 0.00 ? 102 ARG A HH22 4  
ATOM 6936  N N    . ALA A 1 103 ? -7.372  5.638   10.162 1.00 0.00 ? 103 ALA A N    4  
ATOM 6937  C CA   . ALA A 1 103 ? -6.534  6.332   11.124 1.00 0.00 ? 103 ALA A CA   4  
ATOM 6938  C C    . ALA A 1 103 ? -7.297  7.534   11.685 1.00 0.00 ? 103 ALA A C    4  
ATOM 6939  O O    . ALA A 1 103 ? -6.716  8.595   11.906 1.00 0.00 ? 103 ALA A O    4  
ATOM 6940  C CB   . ALA A 1 103 ? -5.218  6.737   10.457 1.00 0.00 ? 103 ALA A CB   4  
ATOM 6941  H H    . ALA A 1 103 ? -7.805  4.803   10.503 1.00 0.00 ? 103 ALA A H    4  
ATOM 6942  H HA   . ALA A 1 103 ? -6.317  5.638   11.937 1.00 0.00 ? 103 ALA A HA   4  
ATOM 6943  H HB1  . ALA A 1 103 ? -5.214  7.813   10.285 1.00 0.00 ? 103 ALA A HB1  4  
ATOM 6944  H HB2  . ALA A 1 103 ? -4.384  6.470   11.107 1.00 0.00 ? 103 ALA A HB2  4  
ATOM 6945  H HB3  . ALA A 1 103 ? -5.118  6.216   9.505  1.00 0.00 ? 103 ALA A HB3  4  
ATOM 6946  N N    . VAL A 1 104 ? -8.588  7.327   11.899 1.00 0.00 ? 104 VAL A N    4  
ATOM 6947  C CA   . VAL A 1 104 ? -9.437  8.380   12.430 1.00 0.00 ? 104 VAL A CA   4  
ATOM 6948  C C    . VAL A 1 104 ? -9.793  8.058   13.883 1.00 0.00 ? 104 VAL A C    4  
ATOM 6949  O O    . VAL A 1 104 ? -9.738  8.932   14.747 1.00 0.00 ? 104 VAL A O    4  
ATOM 6950  C CB   . VAL A 1 104 ? -10.668 8.559   11.539 1.00 0.00 ? 104 VAL A CB   4  
ATOM 6951  C CG1  . VAL A 1 104 ? -10.270 9.070   10.152 1.00 0.00 ? 104 VAL A CG1  4  
ATOM 6952  C CG2  . VAL A 1 104 ? -11.465 7.258   11.436 1.00 0.00 ? 104 VAL A CG2  4  
ATOM 6953  H H    . VAL A 1 104 ? -9.054  6.461   11.716 1.00 0.00 ? 104 VAL A H    4  
ATOM 6954  H HA   . VAL A 1 104 ? -8.865  9.307   12.406 1.00 0.00 ? 104 VAL A HA   4  
ATOM 6955  H HB   . VAL A 1 104 ? -11.309 9.309   12.001 1.00 0.00 ? 104 VAL A HB   4  
ATOM 6956  H HG11 . VAL A 1 104 ? -10.950 8.660   9.405  1.00 0.00 ? 104 VAL A HG11 4  
ATOM 6957  H HG12 . VAL A 1 104 ? -10.327 10.158  10.136 1.00 0.00 ? 104 VAL A HG12 4  
ATOM 6958  H HG13 . VAL A 1 104 ? -9.251  8.756   9.927  1.00 0.00 ? 104 VAL A HG13 4  
ATOM 6959  H HG21 . VAL A 1 104 ? -12.366 7.429   10.847 1.00 0.00 ? 104 VAL A HG21 4  
ATOM 6960  H HG22 . VAL A 1 104 ? -10.854 6.495   10.952 1.00 0.00 ? 104 VAL A HG22 4  
ATOM 6961  H HG23 . VAL A 1 104 ? -11.742 6.921   12.435 1.00 0.00 ? 104 VAL A HG23 4  
ATOM 6962  N N    . ALA A 1 105 ? -10.150 6.802   14.107 1.00 0.00 ? 105 ALA A N    4  
ATOM 6963  C CA   . ALA A 1 105 ? -10.515 6.354   15.440 1.00 0.00 ? 105 ALA A CA   4  
ATOM 6964  C C    . ALA A 1 105 ? -11.184 4.981   15.347 1.00 0.00 ? 105 ALA A C    4  
ATOM 6965  O O    . ALA A 1 105 ? -10.536 3.956   15.554 1.00 0.00 ? 105 ALA A O    4  
ATOM 6966  C CB   . ALA A 1 105 ? -11.418 7.399   16.100 1.00 0.00 ? 105 ALA A CB   4  
ATOM 6967  H H    . ALA A 1 105 ? -10.193 6.098   13.398 1.00 0.00 ? 105 ALA A H    4  
ATOM 6968  H HA   . ALA A 1 105 ? -9.598  6.264   16.023 1.00 0.00 ? 105 ALA A HA   4  
ATOM 6969  H HB1  . ALA A 1 105 ? -10.803 8.177   16.553 1.00 0.00 ? 105 ALA A HB1  4  
ATOM 6970  H HB2  . ALA A 1 105 ? -12.070 7.842   15.348 1.00 0.00 ? 105 ALA A HB2  4  
ATOM 6971  H HB3  . ALA A 1 105 ? -12.024 6.921   16.870 1.00 0.00 ? 105 ALA A HB3  4  
ATOM 6972  N N    . ARG A 1 106 ? -12.471 5.005   15.036 1.00 0.00 ? 106 ARG A N    4  
ATOM 6973  C CA   . ARG A 1 106 ? -13.235 3.775   14.914 1.00 0.00 ? 106 ARG A CA   4  
ATOM 6974  C C    . ARG A 1 106 ? -14.343 3.940   13.872 1.00 0.00 ? 106 ARG A C    4  
ATOM 6975  O O    . ARG A 1 106 ? -14.474 4.999   13.261 1.00 0.00 ? 106 ARG A O    4  
ATOM 6976  C CB   . ARG A 1 106 ? -13.858 3.377   16.253 1.00 0.00 ? 106 ARG A CB   4  
ATOM 6977  C CG   . ARG A 1 106 ? -13.824 1.859   16.444 1.00 0.00 ? 106 ARG A CG   4  
ATOM 6978  C CD   . ARG A 1 106 ? -15.132 1.355   17.059 1.00 0.00 ? 106 ARG A CD   4  
ATOM 6979  N NE   . ARG A 1 106 ? -14.896 0.903   18.448 1.00 0.00 ? 106 ARG A NE   4  
ATOM 6980  C CZ   . ARG A 1 106 ? -14.136 -0.150  18.777 1.00 0.00 ? 106 ARG A CZ   4  
ATOM 6981  N NH1  . ARG A 1 106 ? -13.534 -0.867  17.818 1.00 0.00 ? 106 ARG A NH1  4  
ATOM 6982  N NH2  . ARG A 1 106 ? -13.979 -0.488  20.064 1.00 0.00 ? 106 ARG A NH2  4  
ATOM 6983  H H    . ARG A 1 106 ? -12.991 5.843   14.870 1.00 0.00 ? 106 ARG A H    4  
ATOM 6984  H HA   . ARG A 1 106 ? -12.508 3.026   14.597 1.00 0.00 ? 106 ARG A HA   4  
ATOM 6985  H HB2  . ARG A 1 106 ? -13.318 3.861   17.067 1.00 0.00 ? 106 ARG A HB2  4  
ATOM 6986  H HB3  . ARG A 1 106 ? -14.888 3.730   16.299 1.00 0.00 ? 106 ARG A HB3  4  
ATOM 6987  H HG2  . ARG A 1 106 ? -13.658 1.372   15.484 1.00 0.00 ? 106 ARG A HG2  4  
ATOM 6988  H HG3  . ARG A 1 106 ? -12.987 1.588   17.088 1.00 0.00 ? 106 ARG A HG3  4  
ATOM 6989  H HD2  . ARG A 1 106 ? -15.878 2.149   17.048 1.00 0.00 ? 106 ARG A HD2  4  
ATOM 6990  H HD3  . ARG A 1 106 ? -15.530 0.534   16.463 1.00 0.00 ? 106 ARG A HD3  4  
ATOM 6991  H HE   . ARG A 1 106 ? -15.332 1.416   19.188 1.00 0.00 ? 106 ARG A HE   4  
ATOM 6992  H HH11 . ARG A 1 106 ? -13.651 -0.615  16.858 1.00 0.00 ? 106 ARG A HH11 4  
ATOM 6993  H HH12 . ARG A 1 106 ? -12.966 -1.653  18.063 1.00 0.00 ? 106 ARG A HH12 4  
ATOM 6994  H HH21 . ARG A 1 106 ? -14.429 0.047   20.780 1.00 0.00 ? 106 ARG A HH21 4  
ATOM 6995  H HH22 . ARG A 1 106 ? -13.412 -1.274  20.309 1.00 0.00 ? 106 ARG A HH22 4  
ATOM 6996  N N    . GLU A 1 107 ? -15.115 2.876   13.702 1.00 0.00 ? 107 GLU A N    4  
ATOM 6997  C CA   . GLU A 1 107 ? -16.208 2.889   12.745 1.00 0.00 ? 107 GLU A CA   4  
ATOM 6998  C C    . GLU A 1 107 ? -17.539 3.120   13.464 1.00 0.00 ? 107 GLU A C    4  
ATOM 6999  O O    . GLU A 1 107 ? -18.108 2.193   14.038 1.00 0.00 ? 107 GLU A O    4  
ATOM 7000  C CB   . GLU A 1 107 ? -16.241 1.594   11.932 1.00 0.00 ? 107 GLU A CB   4  
ATOM 7001  C CG   . GLU A 1 107 ? -16.542 1.878   10.459 1.00 0.00 ? 107 GLU A CG   4  
ATOM 7002  C CD   . GLU A 1 107 ? -16.925 0.595   9.720  1.00 0.00 ? 107 GLU A CD   4  
ATOM 7003  O OE1  . GLU A 1 107 ? -16.299 -0.444  10.025 1.00 0.00 ? 107 GLU A OE1  4  
ATOM 7004  O OE2  . GLU A 1 107 ? -17.834 0.681   8.867  1.00 0.00 ? 107 GLU A OE2  4  
ATOM 7005  H H    . GLU A 1 107 ? -15.002 2.018   14.203 1.00 0.00 ? 107 GLU A H    4  
ATOM 7006  H HA   . GLU A 1 107 ? -15.998 3.725   12.078 1.00 0.00 ? 107 GLU A HA   4  
ATOM 7007  H HB2  . GLU A 1 107 ? -15.283 1.081   12.019 1.00 0.00 ? 107 GLU A HB2  4  
ATOM 7008  H HB3  . GLU A 1 107 ? -16.999 0.924   12.339 1.00 0.00 ? 107 GLU A HB3  4  
ATOM 7009  H HG2  . GLU A 1 107 ? -17.354 2.602   10.384 1.00 0.00 ? 107 GLU A HG2  4  
ATOM 7010  H HG3  . GLU A 1 107 ? -15.669 2.328   9.987  1.00 0.00 ? 107 GLU A HG3  4  
ATOM 7011  N N    . GLU A 1 108 ? -17.997 4.362   13.409 1.00 0.00 ? 108 GLU A N    4  
ATOM 7012  C CA   . GLU A 1 108 ? -19.251 4.726   14.047 1.00 0.00 ? 108 GLU A CA   4  
ATOM 7013  C C    . GLU A 1 108 ? -19.651 6.151   13.657 1.00 0.00 ? 108 GLU A C    4  
ATOM 7014  O O    . GLU A 1 108 ? -20.673 6.356   13.005 1.00 0.00 ? 108 GLU A O    4  
ATOM 7015  C CB   . GLU A 1 108 ? -19.155 4.580   15.567 1.00 0.00 ? 108 GLU A CB   4  
ATOM 7016  C CG   . GLU A 1 108 ? -20.394 3.882   16.130 1.00 0.00 ? 108 GLU A CG   4  
ATOM 7017  C CD   . GLU A 1 108 ? -20.342 3.819   17.658 1.00 0.00 ? 108 GLU A CD   4  
ATOM 7018  O OE1  . GLU A 1 108 ? -19.598 2.952   18.165 1.00 0.00 ? 108 GLU A OE1  4  
ATOM 7019  O OE2  . GLU A 1 108 ? -21.047 4.640   18.284 1.00 0.00 ? 108 GLU A OE2  4  
ATOM 7020  H H    . GLU A 1 108 ? -17.529 5.111   12.940 1.00 0.00 ? 108 GLU A H    4  
ATOM 7021  H HA   . GLU A 1 108 ? -19.987 4.018   13.666 1.00 0.00 ? 108 GLU A HA   4  
ATOM 7022  H HB2  . GLU A 1 108 ? -18.263 4.010   15.825 1.00 0.00 ? 108 GLU A HB2  4  
ATOM 7023  H HB3  . GLU A 1 108 ? -19.048 5.564   16.024 1.00 0.00 ? 108 GLU A HB3  4  
ATOM 7024  H HG2  . GLU A 1 108 ? -21.291 4.414   15.814 1.00 0.00 ? 108 GLU A HG2  4  
ATOM 7025  H HG3  . GLU A 1 108 ? -20.463 2.872   15.723 1.00 0.00 ? 108 GLU A HG3  4  
ATOM 7026  N N    . SER A 1 109 ? -18.823 7.098   14.073 1.00 0.00 ? 109 SER A N    4  
ATOM 7027  C CA   . SER A 1 109 ? -19.077 8.498   13.775 1.00 0.00 ? 109 SER A CA   4  
ATOM 7028  C C    . SER A 1 109 ? -20.378 8.947   14.443 1.00 0.00 ? 109 SER A C    4  
ATOM 7029  O O    . SER A 1 109 ? -21.457 8.804   13.869 1.00 0.00 ? 109 SER A O    4  
ATOM 7030  C CB   . SER A 1 109 ? -19.146 8.736   12.265 1.00 0.00 ? 109 SER A CB   4  
ATOM 7031  O OG   . SER A 1 109 ? -17.878 9.094   11.723 1.00 0.00 ? 109 SER A OG   4  
ATOM 7032  H H    . SER A 1 109 ? -17.993 6.923   14.602 1.00 0.00 ? 109 SER A H    4  
ATOM 7033  H HA   . SER A 1 109 ? -18.228 9.040   14.190 1.00 0.00 ? 109 SER A HA   4  
ATOM 7034  H HB2  . SER A 1 109 ? -19.510 7.834   11.772 1.00 0.00 ? 109 SER A HB2  4  
ATOM 7035  H HB3  . SER A 1 109 ? -19.867 9.527   12.056 1.00 0.00 ? 109 SER A HB3  4  
ATOM 7036  H HG   . SER A 1 109 ? -17.864 10.069  11.501 1.00 0.00 ? 109 SER A HG   4  
ATOM 7037  N N    . GLY A 1 110 ? -20.235 9.480   15.647 1.00 0.00 ? 110 GLY A N    4  
ATOM 7038  C CA   . GLY A 1 110 ? -21.385 9.951   16.400 1.00 0.00 ? 110 GLY A CA   4  
ATOM 7039  C C    . GLY A 1 110 ? -21.892 11.285  15.849 1.00 0.00 ? 110 GLY A C    4  
ATOM 7040  O O    . GLY A 1 110 ? -21.238 11.903  15.011 1.00 0.00 ? 110 GLY A O    4  
ATOM 7041  H H    . GLY A 1 110 ? -19.354 9.592   16.108 1.00 0.00 ? 110 GLY A H    4  
ATOM 7042  H HA2  . GLY A 1 110 ? -22.182 9.208   16.354 1.00 0.00 ? 110 GLY A HA2  4  
ATOM 7043  H HA3  . GLY A 1 110 ? -21.115 10.065  17.450 1.00 0.00 ? 110 GLY A HA3  4  
ATOM 7044  N N    . SER A 1 111 ? -23.052 11.690  16.343 1.00 0.00 ? 111 SER A N    4  
ATOM 7045  C CA   . SER A 1 111 ? -23.654 12.940  15.911 1.00 0.00 ? 111 SER A CA   4  
ATOM 7046  C C    . SER A 1 111 ? -23.325 14.052  16.910 1.00 0.00 ? 111 SER A C    4  
ATOM 7047  O O    . SER A 1 111 ? -23.518 13.888  18.113 1.00 0.00 ? 111 SER A O    4  
ATOM 7048  C CB   . SER A 1 111 ? -25.169 12.798  15.756 1.00 0.00 ? 111 SER A CB   4  
ATOM 7049  O OG   . SER A 1 111 ? -25.516 11.833  14.767 1.00 0.00 ? 111 SER A OG   4  
ATOM 7050  H H    . SER A 1 111 ? -23.578 11.182  17.025 1.00 0.00 ? 111 SER A H    4  
ATOM 7051  H HA   . SER A 1 111 ? -23.209 13.155  14.940 1.00 0.00 ? 111 SER A HA   4  
ATOM 7052  H HB2  . SER A 1 111 ? -25.606 12.509  16.712 1.00 0.00 ? 111 SER A HB2  4  
ATOM 7053  H HB3  . SER A 1 111 ? -25.599 13.763  15.488 1.00 0.00 ? 111 SER A HB3  4  
ATOM 7054  H HG   . SER A 1 111 ? -24.693 11.375  14.432 1.00 0.00 ? 111 SER A HG   4  
ATOM 7055  N N    . GLY A 1 112 ? -22.834 15.159  16.373 1.00 0.00 ? 112 GLY A N    4  
ATOM 7056  C CA   . GLY A 1 112 ? -22.477 16.298  17.202 1.00 0.00 ? 112 GLY A CA   4  
ATOM 7057  C C    . GLY A 1 112 ? -23.586 16.614  18.207 1.00 0.00 ? 112 GLY A C    4  
ATOM 7058  O O    . GLY A 1 112 ? -24.747 16.761  17.830 1.00 0.00 ? 112 GLY A O    4  
ATOM 7059  H H    . GLY A 1 112 ? -22.680 15.285  15.393 1.00 0.00 ? 112 GLY A H    4  
ATOM 7060  H HA2  . GLY A 1 112 ? -21.548 16.088  17.733 1.00 0.00 ? 112 GLY A HA2  4  
ATOM 7061  H HA3  . GLY A 1 112 ? -22.293 17.168  16.572 1.00 0.00 ? 112 GLY A HA3  4  
ATOM 7062  N N    . PRO A 1 113 ? -23.178 16.711  19.501 1.00 0.00 ? 113 PRO A N    4  
ATOM 7063  C CA   . PRO A 1 113 ? -24.124 17.007  20.564 1.00 0.00 ? 113 PRO A CA   4  
ATOM 7064  C C    . PRO A 1 113 ? -24.528 18.483  20.543 1.00 0.00 ? 113 PRO A C    4  
ATOM 7065  O O    . PRO A 1 113 ? -25.705 18.810  20.681 1.00 0.00 ? 113 PRO A O    4  
ATOM 7066  C CB   . PRO A 1 113 ? -23.415 16.603  21.846 1.00 0.00 ? 113 PRO A CB   4  
ATOM 7067  C CG   . PRO A 1 113 ? -21.936 16.533  21.500 1.00 0.00 ? 113 PRO A CG   4  
ATOM 7068  C CD   . PRO A 1 113 ? -21.811 16.543  19.985 1.00 0.00 ? 113 PRO A CD   4  
ATOM 7069  H HA   . PRO A 1 113 ? -24.970 16.491  20.429 1.00 0.00 ? 113 PRO A HA   4  
ATOM 7070  H HB2  . PRO A 1 113 ? -23.597 17.329  22.638 1.00 0.00 ? 113 PRO A HB2  4  
ATOM 7071  H HB3  . PRO A 1 113 ? -23.778 15.641  22.206 1.00 0.00 ? 113 PRO A HB3  4  
ATOM 7072  H HG2  . PRO A 1 113 ? -21.402 17.379  21.933 1.00 0.00 ? 113 PRO A HG2  4  
ATOM 7073  H HG3  . PRO A 1 113 ? -21.490 15.628  21.914 1.00 0.00 ? 113 PRO A HG3  4  
ATOM 7074  H HD2  . PRO A 1 113 ? -21.168 17.356  19.646 1.00 0.00 ? 113 PRO A HD2  4  
ATOM 7075  H HD3  . PRO A 1 113 ? -21.372 15.616  19.618 1.00 0.00 ? 113 PRO A HD3  4  
ATOM 7076  N N    . SER A 1 114 ? -23.527 19.335  20.370 1.00 0.00 ? 114 SER A N    4  
ATOM 7077  C CA   . SER A 1 114 ? -23.763 20.768  20.330 1.00 0.00 ? 114 SER A CA   4  
ATOM 7078  C C    . SER A 1 114 ? -24.856 21.090  19.309 1.00 0.00 ? 114 SER A C    4  
ATOM 7079  O O    . SER A 1 114 ? -24.644 20.956  18.105 1.00 0.00 ? 114 SER A O    4  
ATOM 7080  C CB   . SER A 1 114 ? -22.479 21.528  19.991 1.00 0.00 ? 114 SER A CB   4  
ATOM 7081  O OG   . SER A 1 114 ? -22.704 22.930  19.874 1.00 0.00 ? 114 SER A OG   4  
ATOM 7082  H H    . SER A 1 114 ? -22.572 19.060  20.259 1.00 0.00 ? 114 SER A H    4  
ATOM 7083  H HA   . SER A 1 114 ? -24.088 21.035  21.336 1.00 0.00 ? 114 SER A HA   4  
ATOM 7084  H HB2  . SER A 1 114 ? -21.734 21.344  20.766 1.00 0.00 ? 114 SER A HB2  4  
ATOM 7085  H HB3  . SER A 1 114 ? -22.068 21.147  19.057 1.00 0.00 ? 114 SER A HB3  4  
ATOM 7086  H HG   . SER A 1 114 ? -23.005 23.303  20.751 1.00 0.00 ? 114 SER A HG   4  
ATOM 7087  N N    . SER A 1 115 ? -26.001 21.508  19.828 1.00 0.00 ? 115 SER A N    4  
ATOM 7088  C CA   . SER A 1 115 ? -27.127 21.851  18.976 1.00 0.00 ? 115 SER A CA   4  
ATOM 7089  C C    . SER A 1 115 ? -27.442 23.343  19.099 1.00 0.00 ? 115 SER A C    4  
ATOM 7090  O O    . SER A 1 115 ? -28.321 23.734  19.865 1.00 0.00 ? 115 SER A O    4  
ATOM 7091  C CB   . SER A 1 115 ? -28.360 21.017  19.331 1.00 0.00 ? 115 SER A CB   4  
ATOM 7092  O OG   . SER A 1 115 ? -28.453 19.836  18.539 1.00 0.00 ? 115 SER A OG   4  
ATOM 7093  H H    . SER A 1 115 ? -26.165 21.614  20.808 1.00 0.00 ? 115 SER A H    4  
ATOM 7094  H HA   . SER A 1 115 ? -26.807 21.610  17.962 1.00 0.00 ? 115 SER A HA   4  
ATOM 7095  H HB2  . SER A 1 115 ? -28.321 20.744  20.386 1.00 0.00 ? 115 SER A HB2  4  
ATOM 7096  H HB3  . SER A 1 115 ? -29.258 21.619  19.191 1.00 0.00 ? 115 SER A HB3  4  
ATOM 7097  H HG   . SER A 1 115 ? -29.345 19.796  18.089 1.00 0.00 ? 115 SER A HG   4  
ATOM 7098  N N    . GLY A 1 116 ? -26.707 24.135  18.333 1.00 0.00 ? 116 GLY A N    4  
ATOM 7099  C CA   . GLY A 1 116 ? -26.896 25.576  18.347 1.00 0.00 ? 116 GLY A CA   4  
ATOM 7100  C C    . GLY A 1 116 ? -27.148 26.082  19.769 1.00 0.00 ? 116 GLY A C    4  
ATOM 7101  O O    . GLY A 1 116 ? -26.308 26.773  20.344 1.00 0.00 ? 116 GLY A O    4  
ATOM 7102  H H    . GLY A 1 116 ? -25.994 23.809  17.713 1.00 0.00 ? 116 GLY A H    4  
ATOM 7103  H HA2  . GLY A 1 116 ? -26.015 26.066  17.933 1.00 0.00 ? 116 GLY A HA2  4  
ATOM 7104  H HA3  . GLY A 1 116 ? -27.739 25.842  17.708 1.00 0.00 ? 116 GLY A HA3  4  
ATOM 7105  N N    . GLY A 1 1   ? -2.252  -30.573 12.288 1.00 0.00 ? 1   GLY A N    5  
ATOM 7106  C CA   . GLY A 1 1   ? -2.015  -29.945 13.577 1.00 0.00 ? 1   GLY A CA   5  
ATOM 7107  C C    . GLY A 1 1   ? -1.932  -28.424 13.439 1.00 0.00 ? 1   GLY A C    5  
ATOM 7108  O O    . GLY A 1 1   ? -1.267  -27.914 12.539 1.00 0.00 ? 1   GLY A O    5  
ATOM 7109  H H1   . GLY A 1 1   ? -2.646  -29.973 11.593 1.00 0.00 ? 1   GLY A H1   5  
ATOM 7110  H HA2  . GLY A 1 1   ? -2.818  -30.208 14.267 1.00 0.00 ? 1   GLY A HA2  5  
ATOM 7111  H HA3  . GLY A 1 1   ? -1.089  -30.327 14.007 1.00 0.00 ? 1   GLY A HA3  5  
ATOM 7112  N N    . SER A 1 2   ? -2.615  -27.741 14.346 1.00 0.00 ? 2   SER A N    5  
ATOM 7113  C CA   . SER A 1 2   ? -2.627  -26.288 14.336 1.00 0.00 ? 2   SER A CA   5  
ATOM 7114  C C    . SER A 1 2   ? -3.273  -25.762 15.620 1.00 0.00 ? 2   SER A C    5  
ATOM 7115  O O    . SER A 1 2   ? -4.479  -25.902 15.814 1.00 0.00 ? 2   SER A O    5  
ATOM 7116  C CB   . SER A 1 2   ? -3.368  -25.751 13.110 1.00 0.00 ? 2   SER A CB   5  
ATOM 7117  O OG   . SER A 1 2   ? -4.765  -26.026 13.168 1.00 0.00 ? 2   SER A OG   5  
ATOM 7118  H H    . SER A 1 2   ? -3.154  -28.163 15.075 1.00 0.00 ? 2   SER A H    5  
ATOM 7119  H HA   . SER A 1 2   ? -1.579  -25.992 14.285 1.00 0.00 ? 2   SER A HA   5  
ATOM 7120  H HB2  . SER A 1 2   ? -3.213  -24.675 13.036 1.00 0.00 ? 2   SER A HB2  5  
ATOM 7121  H HB3  . SER A 1 2   ? -2.948  -26.197 12.209 1.00 0.00 ? 2   SER A HB3  5  
ATOM 7122  H HG   . SER A 1 2   ? -5.101  -26.283 12.262 1.00 0.00 ? 2   SER A HG   5  
ATOM 7123  N N    . SER A 1 3   ? -2.440  -25.167 16.462 1.00 0.00 ? 3   SER A N    5  
ATOM 7124  C CA   . SER A 1 3   ? -2.915  -24.619 17.721 1.00 0.00 ? 3   SER A CA   5  
ATOM 7125  C C    . SER A 1 3   ? -1.760  -23.949 18.469 1.00 0.00 ? 3   SER A C    5  
ATOM 7126  O O    . SER A 1 3   ? -0.712  -24.560 18.674 1.00 0.00 ? 3   SER A O    5  
ATOM 7127  C CB   . SER A 1 3   ? -3.550  -25.706 18.590 1.00 0.00 ? 3   SER A CB   5  
ATOM 7128  O OG   . SER A 1 3   ? -4.955  -25.810 18.373 1.00 0.00 ? 3   SER A OG   5  
ATOM 7129  H H    . SER A 1 3   ? -1.460  -25.058 16.296 1.00 0.00 ? 3   SER A H    5  
ATOM 7130  H HA   . SER A 1 3   ? -3.672  -23.884 17.449 1.00 0.00 ? 3   SER A HA   5  
ATOM 7131  H HB2  . SER A 1 3   ? -3.078  -26.665 18.374 1.00 0.00 ? 3   SER A HB2  5  
ATOM 7132  H HB3  . SER A 1 3   ? -3.361  -25.487 19.641 1.00 0.00 ? 3   SER A HB3  5  
ATOM 7133  H HG   . SER A 1 3   ? -5.147  -25.856 17.393 1.00 0.00 ? 3   SER A HG   5  
ATOM 7134  N N    . GLY A 1 4   ? -1.991  -22.703 18.855 1.00 0.00 ? 4   GLY A N    5  
ATOM 7135  C CA   . GLY A 1 4   ? -0.983  -21.944 19.576 1.00 0.00 ? 4   GLY A CA   5  
ATOM 7136  C C    . GLY A 1 4   ? -1.501  -20.551 19.938 1.00 0.00 ? 4   GLY A C    5  
ATOM 7137  O O    . GLY A 1 4   ? -2.181  -19.910 19.138 1.00 0.00 ? 4   GLY A O    5  
ATOM 7138  H H    . GLY A 1 4   ? -2.847  -22.214 18.684 1.00 0.00 ? 4   GLY A H    5  
ATOM 7139  H HA2  . GLY A 1 4   ? -0.700  -22.478 20.483 1.00 0.00 ? 4   GLY A HA2  5  
ATOM 7140  H HA3  . GLY A 1 4   ? -0.085  -21.855 18.965 1.00 0.00 ? 4   GLY A HA3  5  
ATOM 7141  N N    . SER A 1 5   ? -1.160  -20.123 21.145 1.00 0.00 ? 5   SER A N    5  
ATOM 7142  C CA   . SER A 1 5   ? -1.582  -18.818 21.623 1.00 0.00 ? 5   SER A CA   5  
ATOM 7143  C C    . SER A 1 5   ? -1.020  -18.566 23.024 1.00 0.00 ? 5   SER A C    5  
ATOM 7144  O O    . SER A 1 5   ? -1.342  -19.290 23.965 1.00 0.00 ? 5   SER A O    5  
ATOM 7145  C CB   . SER A 1 5   ? -3.108  -18.702 21.635 1.00 0.00 ? 5   SER A CB   5  
ATOM 7146  O OG   . SER A 1 5   ? -3.550  -17.425 21.185 1.00 0.00 ? 5   SER A OG   5  
ATOM 7147  H H    . SER A 1 5   ? -0.607  -20.651 21.790 1.00 0.00 ? 5   SER A H    5  
ATOM 7148  H HA   . SER A 1 5   ? -1.170  -18.103 20.911 1.00 0.00 ? 5   SER A HA   5  
ATOM 7149  H HB2  . SER A 1 5   ? -3.535  -19.479 21.000 1.00 0.00 ? 5   SER A HB2  5  
ATOM 7150  H HB3  . SER A 1 5   ? -3.477  -18.878 22.646 1.00 0.00 ? 5   SER A HB3  5  
ATOM 7151  H HG   . SER A 1 5   ? -4.279  -17.534 20.509 1.00 0.00 ? 5   SER A HG   5  
ATOM 7152  N N    . SER A 1 6   ? -0.189  -17.538 23.117 1.00 0.00 ? 6   SER A N    5  
ATOM 7153  C CA   . SER A 1 6   ? 0.421   -17.183 24.387 1.00 0.00 ? 6   SER A CA   5  
ATOM 7154  C C    . SER A 1 6   ? 0.619   -15.668 24.466 1.00 0.00 ? 6   SER A C    5  
ATOM 7155  O O    . SER A 1 6   ? 0.856   -15.015 23.451 1.00 0.00 ? 6   SER A O    5  
ATOM 7156  C CB   . SER A 1 6   ? 1.757   -17.904 24.578 1.00 0.00 ? 6   SER A CB   5  
ATOM 7157  O OG   . SER A 1 6   ? 1.657   -18.975 25.512 1.00 0.00 ? 6   SER A OG   5  
ATOM 7158  H H    . SER A 1 6   ? 0.067   -16.955 22.347 1.00 0.00 ? 6   SER A H    5  
ATOM 7159  H HA   . SER A 1 6   ? -0.283  -17.517 25.149 1.00 0.00 ? 6   SER A HA   5  
ATOM 7160  H HB2  . SER A 1 6   ? 2.100   -18.291 23.618 1.00 0.00 ? 6   SER A HB2  5  
ATOM 7161  H HB3  . SER A 1 6   ? 2.507   -17.192 24.921 1.00 0.00 ? 6   SER A HB3  5  
ATOM 7162  H HG   . SER A 1 6   ? 2.446   -18.968 26.126 1.00 0.00 ? 6   SER A HG   5  
ATOM 7163  N N    . GLY A 1 7   ? 0.515   -15.152 25.682 1.00 0.00 ? 7   GLY A N    5  
ATOM 7164  C CA   . GLY A 1 7   ? 0.680   -13.726 25.907 1.00 0.00 ? 7   GLY A CA   5  
ATOM 7165  C C    . GLY A 1 7   ? -0.645  -13.078 26.313 1.00 0.00 ? 7   GLY A C    5  
ATOM 7166  O O    . GLY A 1 7   ? -1.607  -13.773 26.634 1.00 0.00 ? 7   GLY A O    5  
ATOM 7167  H H    . GLY A 1 7   ? 0.322   -15.690 26.503 1.00 0.00 ? 7   GLY A H    5  
ATOM 7168  H HA2  . GLY A 1 7   ? 1.424   -13.561 26.686 1.00 0.00 ? 7   GLY A HA2  5  
ATOM 7169  H HA3  . GLY A 1 7   ? 1.058   -13.253 25.001 1.00 0.00 ? 7   GLY A HA3  5  
ATOM 7170  N N    . MET A 1 8   ? -0.651  -11.753 26.287 1.00 0.00 ? 8   MET A N    5  
ATOM 7171  C CA   . MET A 1 8   ? -1.842  -11.003 26.649 1.00 0.00 ? 8   MET A CA   5  
ATOM 7172  C C    . MET A 1 8   ? -1.994  -9.759  25.772 1.00 0.00 ? 8   MET A C    5  
ATOM 7173  O O    . MET A 1 8   ? -1.007  -9.233  25.258 1.00 0.00 ? 8   MET A O    5  
ATOM 7174  C CB   . MET A 1 8   ? -1.756  -10.586 28.118 1.00 0.00 ? 8   MET A CB   5  
ATOM 7175  C CG   . MET A 1 8   ? -2.488  -11.585 29.016 1.00 0.00 ? 8   MET A CG   5  
ATOM 7176  S SD   . MET A 1 8   ? -2.095  -11.270 30.728 1.00 0.00 ? 8   MET A SD   5  
ATOM 7177  C CE   . MET A 1 8   ? -3.560  -11.926 31.509 1.00 0.00 ? 8   MET A CE   5  
ATOM 7178  H H    . MET A 1 8   ? 0.136   -11.195 26.025 1.00 0.00 ? 8   MET A H    5  
ATOM 7179  H HA   . MET A 1 8   ? -2.678  -11.681 26.477 1.00 0.00 ? 8   MET A HA   5  
ATOM 7180  H HB2  . MET A 1 8   ? -0.711  -10.518 28.420 1.00 0.00 ? 8   MET A HB2  5  
ATOM 7181  H HB3  . MET A 1 8   ? -2.189  -9.593  28.244 1.00 0.00 ? 8   MET A HB3  5  
ATOM 7182  H HG2  . MET A 1 8   ? -3.564  -11.506 28.861 1.00 0.00 ? 8   MET A HG2  5  
ATOM 7183  H HG3  . MET A 1 8   ? -2.202  -12.603 28.750 1.00 0.00 ? 8   MET A HG3  5  
ATOM 7184  H HE1  . MET A 1 8   ? -3.411  -12.983 31.731 1.00 0.00 ? 8   MET A HE1  5  
ATOM 7185  H HE2  . MET A 1 8   ? -3.752  -11.384 32.435 1.00 0.00 ? 8   MET A HE2  5  
ATOM 7186  H HE3  . MET A 1 8   ? -4.411  -11.812 30.838 1.00 0.00 ? 8   MET A HE3  5  
ATOM 7187  N N    . GLU A 1 9   ? -3.237  -9.323  25.629 1.00 0.00 ? 9   GLU A N    5  
ATOM 7188  C CA   . GLU A 1 9   ? -3.530  -8.150  24.823 1.00 0.00 ? 9   GLU A CA   5  
ATOM 7189  C C    . GLU A 1 9   ? -4.866  -7.536  25.246 1.00 0.00 ? 9   GLU A C    5  
ATOM 7190  O O    . GLU A 1 9   ? -5.917  -7.910  24.727 1.00 0.00 ? 9   GLU A O    5  
ATOM 7191  C CB   . GLU A 1 9   ? -3.532  -8.495  23.332 1.00 0.00 ? 9   GLU A CB   5  
ATOM 7192  C CG   . GLU A 1 9   ? -3.446  -7.229  22.477 1.00 0.00 ? 9   GLU A CG   5  
ATOM 7193  C CD   . GLU A 1 9   ? -2.627  -7.480  21.208 1.00 0.00 ? 9   GLU A CD   5  
ATOM 7194  O OE1  . GLU A 1 9   ? -2.849  -8.544  20.591 1.00 0.00 ? 9   GLU A OE1  5  
ATOM 7195  O OE2  . GLU A 1 9   ? -1.799  -6.601  20.885 1.00 0.00 ? 9   GLU A OE2  5  
ATOM 7196  H H    . GLU A 1 9   ? -4.033  -9.756  26.050 1.00 0.00 ? 9   GLU A H    5  
ATOM 7197  H HA   . GLU A 1 9   ? -2.720  -7.449  25.026 1.00 0.00 ? 9   GLU A HA   5  
ATOM 7198  H HB2  . GLU A 1 9   ? -2.691  -9.149  23.106 1.00 0.00 ? 9   GLU A HB2  5  
ATOM 7199  H HB3  . GLU A 1 9   ? -4.440  -9.045  23.084 1.00 0.00 ? 9   GLU A HB3  5  
ATOM 7200  H HG2  . GLU A 1 9   ? -4.449  -6.899  22.207 1.00 0.00 ? 9   GLU A HG2  5  
ATOM 7201  H HG3  . GLU A 1 9   ? -2.991  -6.425  23.055 1.00 0.00 ? 9   GLU A HG3  5  
ATOM 7202  N N    . LYS A 1 10  ? -4.783  -6.604  26.184 1.00 0.00 ? 10  LYS A N    5  
ATOM 7203  C CA   . LYS A 1 10  ? -5.972  -5.935  26.682 1.00 0.00 ? 10  LYS A CA   5  
ATOM 7204  C C    . LYS A 1 10  ? -5.583  -4.571  27.256 1.00 0.00 ? 10  LYS A C    5  
ATOM 7205  O O    . LYS A 1 10  ? -4.702  -4.481  28.110 1.00 0.00 ? 10  LYS A O    5  
ATOM 7206  C CB   . LYS A 1 10  ? -6.714  -6.831  27.676 1.00 0.00 ? 10  LYS A CB   5  
ATOM 7207  C CG   . LYS A 1 10  ? -7.810  -7.636  26.975 1.00 0.00 ? 10  LYS A CG   5  
ATOM 7208  C CD   . LYS A 1 10  ? -8.968  -7.933  27.931 1.00 0.00 ? 10  LYS A CD   5  
ATOM 7209  C CE   . LYS A 1 10  ? -10.317 -7.698  27.248 1.00 0.00 ? 10  LYS A CE   5  
ATOM 7210  N NZ   . LYS A 1 10  ? -11.216 -6.923  28.132 1.00 0.00 ? 10  LYS A NZ   5  
ATOM 7211  H H    . LYS A 1 10  ? -3.924  -6.305  26.600 1.00 0.00 ? 10  LYS A H    5  
ATOM 7212  H HA   . LYS A 1 10  ? -6.637  -5.775  25.833 1.00 0.00 ? 10  LYS A HA   5  
ATOM 7213  H HB2  . LYS A 1 10  ? -6.010  -7.510  28.156 1.00 0.00 ? 10  LYS A HB2  5  
ATOM 7214  H HB3  . LYS A 1 10  ? -7.154  -6.219  28.464 1.00 0.00 ? 10  LYS A HB3  5  
ATOM 7215  H HG2  . LYS A 1 10  ? -8.179  -7.081  26.113 1.00 0.00 ? 10  LYS A HG2  5  
ATOM 7216  H HG3  . LYS A 1 10  ? -7.395  -8.571  26.599 1.00 0.00 ? 10  LYS A HG3  5  
ATOM 7217  H HD2  . LYS A 1 10  ? -8.905  -8.966  28.274 1.00 0.00 ? 10  LYS A HD2  5  
ATOM 7218  H HD3  . LYS A 1 10  ? -8.887  -7.299  28.814 1.00 0.00 ? 10  LYS A HD3  5  
ATOM 7219  H HE2  . LYS A 1 10  ? -10.168 -7.162  26.311 1.00 0.00 ? 10  LYS A HE2  5  
ATOM 7220  H HE3  . LYS A 1 10  ? -10.777 -8.654  26.999 1.00 0.00 ? 10  LYS A HE3  5  
ATOM 7221  H HZ1  . LYS A 1 10  ? -11.130 -5.949  27.924 1.00 0.00 ? 10  LYS A HZ1  5  
ATOM 7222  H HZ2  . LYS A 1 10  ? -12.162 -7.214  27.983 1.00 0.00 ? 10  LYS A HZ2  5  
ATOM 7223  H HZ3  . LYS A 1 10  ? -10.965 -7.084  29.087 1.00 0.00 ? 10  LYS A HZ3  5  
ATOM 7224  N N    . THR A 1 11  ? -6.257  -3.543  26.762 1.00 0.00 ? 11  THR A N    5  
ATOM 7225  C CA   . THR A 1 11  ? -5.993  -2.188  27.215 1.00 0.00 ? 11  THR A CA   5  
ATOM 7226  C C    . THR A 1 11  ? -4.558  -1.782  26.874 1.00 0.00 ? 11  THR A C    5  
ATOM 7227  O O    . THR A 1 11  ? -3.608  -2.458  27.267 1.00 0.00 ? 11  THR A O    5  
ATOM 7228  C CB   . THR A 1 11  ? -6.304  -2.120  28.712 1.00 0.00 ? 11  THR A CB   5  
ATOM 7229  O OG1  . THR A 1 11  ? -7.727  -2.078  28.769 1.00 0.00 ? 11  THR A OG1  5  
ATOM 7230  C CG2  . THR A 1 11  ? -5.867  -0.796  29.342 1.00 0.00 ? 11  THR A CG2  5  
ATOM 7231  H H    . THR A 1 11  ? -6.972  -3.624  26.068 1.00 0.00 ? 11  THR A H    5  
ATOM 7232  H HA   . THR A 1 11  ? -6.654  -1.510  26.675 1.00 0.00 ? 11  THR A HA   5  
ATOM 7233  H HB   . THR A 1 11  ? -5.864  -2.966  29.239 1.00 0.00 ? 11  THR A HB   5  
ATOM 7234  H HG1  . THR A 1 11  ? -8.107  -2.964  28.504 1.00 0.00 ? 11  THR A HG1  5  
ATOM 7235  H HG21 . THR A 1 11  ? -4.898  -0.504  28.937 1.00 0.00 ? 11  THR A HG21 5  
ATOM 7236  H HG22 . THR A 1 11  ? -6.603  -0.025  29.115 1.00 0.00 ? 11  THR A HG22 5  
ATOM 7237  H HG23 . THR A 1 11  ? -5.788  -0.916  30.422 1.00 0.00 ? 11  THR A HG23 5  
ATOM 7238  N N    . LEU A 1 12  ? -4.445  -0.681  26.146 1.00 0.00 ? 12  LEU A N    5  
ATOM 7239  C CA   . LEU A 1 12  ? -3.141  -0.177  25.748 1.00 0.00 ? 12  LEU A CA   5  
ATOM 7240  C C    . LEU A 1 12  ? -2.644  0.823   26.794 1.00 0.00 ? 12  LEU A C    5  
ATOM 7241  O O    . LEU A 1 12  ? -3.270  1.858   27.015 1.00 0.00 ? 12  LEU A O    5  
ATOM 7242  C CB   . LEU A 1 12  ? -3.198  0.394   24.330 1.00 0.00 ? 12  LEU A CB   5  
ATOM 7243  C CG   . LEU A 1 12  ? -2.001  0.079   23.431 1.00 0.00 ? 12  LEU A CG   5  
ATOM 7244  C CD1  . LEU A 1 12  ? -2.425  -0.766  22.229 1.00 0.00 ? 12  LEU A CD1  5  
ATOM 7245  C CD2  . LEU A 1 12  ? -1.282  1.362   23.006 1.00 0.00 ? 12  LEU A CD2  5  
ATOM 7246  H H    . LEU A 1 12  ? -5.223  -0.137  25.831 1.00 0.00 ? 12  LEU A H    5  
ATOM 7247  H HA   . LEU A 1 12  ? -2.456  -1.025  25.727 1.00 0.00 ? 12  LEU A HA   5  
ATOM 7248  H HB2  . LEU A 1 12  ? -4.100  0.020   23.844 1.00 0.00 ? 12  LEU A HB2  5  
ATOM 7249  H HB3  . LEU A 1 12  ? -3.300  1.477   24.399 1.00 0.00 ? 12  LEU A HB3  5  
ATOM 7250  H HG   . LEU A 1 12  ? -1.289  -0.513  24.006 1.00 0.00 ? 12  LEU A HG   5  
ATOM 7251  H HD11 . LEU A 1 12  ? -2.635  -1.784  22.556 1.00 0.00 ? 12  LEU A HD11 5  
ATOM 7252  H HD12 . LEU A 1 12  ? -3.320  -0.336  21.780 1.00 0.00 ? 12  LEU A HD12 5  
ATOM 7253  H HD13 . LEU A 1 12  ? -1.621  -0.780  21.493 1.00 0.00 ? 12  LEU A HD13 5  
ATOM 7254  H HD21 . LEU A 1 12  ? -0.507  1.602   23.734 1.00 0.00 ? 12  LEU A HD21 5  
ATOM 7255  H HD22 . LEU A 1 12  ? -0.828  1.216   22.026 1.00 0.00 ? 12  LEU A HD22 5  
ATOM 7256  H HD23 . LEU A 1 12  ? -2.000  2.180   22.956 1.00 0.00 ? 12  LEU A HD23 5  
ATOM 7257  N N    . GLU A 1 13  ? -1.523  0.477   27.410 1.00 0.00 ? 13  GLU A N    5  
ATOM 7258  C CA   . GLU A 1 13  ? -0.935  1.331   28.428 1.00 0.00 ? 13  GLU A CA   5  
ATOM 7259  C C    . GLU A 1 13  ? -0.120  2.449   27.776 1.00 0.00 ? 13  GLU A C    5  
ATOM 7260  O O    . GLU A 1 13  ? 0.967   2.206   27.252 1.00 0.00 ? 13  GLU A O    5  
ATOM 7261  C CB   . GLU A 1 13  ? -0.074  0.517   29.396 1.00 0.00 ? 13  GLU A CB   5  
ATOM 7262  C CG   . GLU A 1 13  ? -0.696  0.490   30.793 1.00 0.00 ? 13  GLU A CG   5  
ATOM 7263  C CD   . GLU A 1 13  ? 0.138   1.307   31.782 1.00 0.00 ? 13  GLU A CD   5  
ATOM 7264  O OE1  . GLU A 1 13  ? 0.437   2.473   31.444 1.00 0.00 ? 13  GLU A OE1  5  
ATOM 7265  O OE2  . GLU A 1 13  ? 0.459   0.747   32.852 1.00 0.00 ? 13  GLU A OE2  5  
ATOM 7266  H H    . GLU A 1 13  ? -1.021  -0.367  27.225 1.00 0.00 ? 13  GLU A H    5  
ATOM 7267  H HA   . GLU A 1 13  ? -1.778  1.757   28.972 1.00 0.00 ? 13  GLU A HA   5  
ATOM 7268  H HB2  . GLU A 1 13  ? 0.036   -0.501  29.022 1.00 0.00 ? 13  GLU A HB2  5  
ATOM 7269  H HB3  . GLU A 1 13  ? 0.927   0.948   29.448 1.00 0.00 ? 13  GLU A HB3  5  
ATOM 7270  H HG2  . GLU A 1 13  ? -1.710  0.888   30.751 1.00 0.00 ? 13  GLU A HG2  5  
ATOM 7271  H HG3  . GLU A 1 13  ? -0.772  -0.541  31.141 1.00 0.00 ? 13  GLU A HG3  5  
ATOM 7272  N N    . THR A 1 14  ? -0.675  3.651   27.829 1.00 0.00 ? 14  THR A N    5  
ATOM 7273  C CA   . THR A 1 14  ? -0.012  4.808   27.250 1.00 0.00 ? 14  THR A CA   5  
ATOM 7274  C C    . THR A 1 14  ? -0.715  6.096   27.682 1.00 0.00 ? 14  THR A C    5  
ATOM 7275  O O    . THR A 1 14  ? -1.923  6.102   27.913 1.00 0.00 ? 14  THR A O    5  
ATOM 7276  C CB   . THR A 1 14  ? 0.029   4.618   25.732 1.00 0.00 ? 14  THR A CB   5  
ATOM 7277  O OG1  . THR A 1 14  ? 0.759   5.748   25.261 1.00 0.00 ? 14  THR A OG1  5  
ATOM 7278  C CG2  . THR A 1 14  ? -1.349  4.768   25.085 1.00 0.00 ? 14  THR A CG2  5  
ATOM 7279  H H    . THR A 1 14  ? -1.558  3.841   28.257 1.00 0.00 ? 14  THR A H    5  
ATOM 7280  H HA   . THR A 1 14  ? 1.005   4.852   27.639 1.00 0.00 ? 14  THR A HA   5  
ATOM 7281  H HB   . THR A 1 14  ? 0.480   3.660   25.472 1.00 0.00 ? 14  THR A HB   5  
ATOM 7282  H HG1  . THR A 1 14  ? 1.552   5.446   24.732 1.00 0.00 ? 14  THR A HG1  5  
ATOM 7283  H HG21 . THR A 1 14  ? -1.489  3.983   24.341 1.00 0.00 ? 14  THR A HG21 5  
ATOM 7284  H HG22 . THR A 1 14  ? -2.121  4.684   25.850 1.00 0.00 ? 14  THR A HG22 5  
ATOM 7285  H HG23 . THR A 1 14  ? -1.420  5.743   24.603 1.00 0.00 ? 14  THR A HG23 5  
ATOM 7286  N N    . VAL A 1 15  ? 0.072   7.158   27.777 1.00 0.00 ? 15  VAL A N    5  
ATOM 7287  C CA   . VAL A 1 15  ? -0.459  8.450   28.177 1.00 0.00 ? 15  VAL A CA   5  
ATOM 7288  C C    . VAL A 1 15  ? -1.601  8.841   27.236 1.00 0.00 ? 15  VAL A C    5  
ATOM 7289  O O    . VAL A 1 15  ? -1.638  8.406   26.086 1.00 0.00 ? 15  VAL A O    5  
ATOM 7290  C CB   . VAL A 1 15  ? 0.664   9.488   28.218 1.00 0.00 ? 15  VAL A CB   5  
ATOM 7291  C CG1  . VAL A 1 15  ? 1.676   9.158   29.317 1.00 0.00 ? 15  VAL A CG1  5  
ATOM 7292  C CG2  . VAL A 1 15  ? 1.352   9.604   26.856 1.00 0.00 ? 15  VAL A CG2  5  
ATOM 7293  H H    . VAL A 1 15  ? 1.054   7.145   27.587 1.00 0.00 ? 15  VAL A H    5  
ATOM 7294  H HA   . VAL A 1 15  ? -0.857  8.344   29.186 1.00 0.00 ? 15  VAL A HA   5  
ATOM 7295  H HB   . VAL A 1 15  ? 0.219   10.455  28.451 1.00 0.00 ? 15  VAL A HB   5  
ATOM 7296  H HG11 . VAL A 1 15  ? 1.145   8.848   30.218 1.00 0.00 ? 15  VAL A HG11 5  
ATOM 7297  H HG12 . VAL A 1 15  ? 2.326   8.350   28.982 1.00 0.00 ? 15  VAL A HG12 5  
ATOM 7298  H HG13 . VAL A 1 15  ? 2.276   10.042  29.535 1.00 0.00 ? 15  VAL A HG13 5  
ATOM 7299  H HG21 . VAL A 1 15  ? 1.684   10.631  26.704 1.00 0.00 ? 15  VAL A HG21 5  
ATOM 7300  H HG22 . VAL A 1 15  ? 2.213   8.936   26.826 1.00 0.00 ? 15  VAL A HG22 5  
ATOM 7301  H HG23 . VAL A 1 15  ? 0.650   9.329   26.069 1.00 0.00 ? 15  VAL A HG23 5  
ATOM 7302  N N    . PRO A 1 16  ? -2.527  9.679   27.774 1.00 0.00 ? 16  PRO A N    5  
ATOM 7303  C CA   . PRO A 1 16  ? -3.667  10.133  26.995 1.00 0.00 ? 16  PRO A CA   5  
ATOM 7304  C C    . PRO A 1 16  ? -3.246  11.195  25.977 1.00 0.00 ? 16  PRO A C    5  
ATOM 7305  O O    . PRO A 1 16  ? -2.109  11.663  25.996 1.00 0.00 ? 16  PRO A O    5  
ATOM 7306  C CB   . PRO A 1 16  ? -4.661  10.653  28.020 1.00 0.00 ? 16  PRO A CB   5  
ATOM 7307  C CG   . PRO A 1 16  ? -3.861  10.901  29.288 1.00 0.00 ? 16  PRO A CG   5  
ATOM 7308  C CD   . PRO A 1 16  ? -2.515  10.214  29.132 1.00 0.00 ? 16  PRO A CD   5  
ATOM 7309  H HA   . PRO A 1 16  ? -4.046  9.377   26.461 1.00 0.00 ? 16  PRO A HA   5  
ATOM 7310  H HB2  . PRO A 1 16  ? -5.136  11.571  27.672 1.00 0.00 ? 16  PRO A HB2  5  
ATOM 7311  H HB3  . PRO A 1 16  ? -5.457  9.929   28.195 1.00 0.00 ? 16  PRO A HB3  5  
ATOM 7312  H HG2  . PRO A 1 16  ? -3.728  11.970  29.453 1.00 0.00 ? 16  PRO A HG2  5  
ATOM 7313  H HG3  . PRO A 1 16  ? -4.392  10.509  30.156 1.00 0.00 ? 16  PRO A HG3  5  
ATOM 7314  H HD2  . PRO A 1 16  ? -1.693  10.916  29.273 1.00 0.00 ? 16  PRO A HD2  5  
ATOM 7315  H HD3  . PRO A 1 16  ? -2.387  9.421   29.869 1.00 0.00 ? 16  PRO A HD3  5  
ATOM 7316  N N    . LEU A 1 17  ? -4.187  11.544  25.111 1.00 0.00 ? 17  LEU A N    5  
ATOM 7317  C CA   . LEU A 1 17  ? -3.929  12.542  24.087 1.00 0.00 ? 17  LEU A CA   5  
ATOM 7318  C C    . LEU A 1 17  ? -5.240  12.895  23.383 1.00 0.00 ? 17  LEU A C    5  
ATOM 7319  O O    . LEU A 1 17  ? -6.100  12.036  23.196 1.00 0.00 ? 17  LEU A O    5  
ATOM 7320  C CB   . LEU A 1 17  ? -2.831  12.061  23.136 1.00 0.00 ? 17  LEU A CB   5  
ATOM 7321  C CG   . LEU A 1 17  ? -1.921  13.147  22.559 1.00 0.00 ? 17  LEU A CG   5  
ATOM 7322  C CD1  . LEU A 1 17  ? -0.454  12.715  22.605 1.00 0.00 ? 17  LEU A CD1  5  
ATOM 7323  C CD2  . LEU A 1 17  ? -2.359  13.537  21.146 1.00 0.00 ? 17  LEU A CD2  5  
ATOM 7324  H H    . LEU A 1 17  ? -5.110  11.158  25.102 1.00 0.00 ? 17  LEU A H    5  
ATOM 7325  H HA   . LEU A 1 17  ? -3.554  13.434  24.588 1.00 0.00 ? 17  LEU A HA   5  
ATOM 7326  H HB2  . LEU A 1 17  ? -2.210  11.338  23.665 1.00 0.00 ? 17  LEU A HB2  5  
ATOM 7327  H HB3  . LEU A 1 17  ? -3.301  11.532  22.308 1.00 0.00 ? 17  LEU A HB3  5  
ATOM 7328  H HG   . LEU A 1 17  ? -2.014  14.037  23.182 1.00 0.00 ? 17  LEU A HG   5  
ATOM 7329  H HD11 . LEU A 1 17  ? -0.327  11.939  23.360 1.00 0.00 ? 17  LEU A HD11 5  
ATOM 7330  H HD12 . LEU A 1 17  ? -0.159  12.326  21.631 1.00 0.00 ? 17  LEU A HD12 5  
ATOM 7331  H HD13 . LEU A 1 17  ? 0.170   13.573  22.857 1.00 0.00 ? 17  LEU A HD13 5  
ATOM 7332  H HD21 . LEU A 1 17  ? -3.229  14.191  21.203 1.00 0.00 ? 17  LEU A HD21 5  
ATOM 7333  H HD22 . LEU A 1 17  ? -1.545  14.058  20.643 1.00 0.00 ? 17  LEU A HD22 5  
ATOM 7334  H HD23 . LEU A 1 17  ? -2.617  12.639  20.585 1.00 0.00 ? 17  LEU A HD23 5  
ATOM 7335  N N    . GLU A 1 18  ? -5.353  14.162  23.013 1.00 0.00 ? 18  GLU A N    5  
ATOM 7336  C CA   . GLU A 1 18  ? -6.545  14.640  22.334 1.00 0.00 ? 18  GLU A CA   5  
ATOM 7337  C C    . GLU A 1 18  ? -6.235  15.918  21.552 1.00 0.00 ? 18  GLU A C    5  
ATOM 7338  O O    . GLU A 1 18  ? -5.448  16.750  22.002 1.00 0.00 ? 18  GLU A O    5  
ATOM 7339  C CB   . GLU A 1 18  ? -7.687  14.869  23.327 1.00 0.00 ? 18  GLU A CB   5  
ATOM 7340  C CG   . GLU A 1 18  ? -8.978  15.248  22.599 1.00 0.00 ? 18  GLU A CG   5  
ATOM 7341  C CD   . GLU A 1 18  ? -9.476  16.625  23.046 1.00 0.00 ? 18  GLU A CD   5  
ATOM 7342  O OE1  . GLU A 1 18  ? -9.463  16.862  24.273 1.00 0.00 ? 18  GLU A OE1  5  
ATOM 7343  O OE2  . GLU A 1 18  ? -9.858  17.408  22.150 1.00 0.00 ? 18  GLU A OE2  5  
ATOM 7344  H H    . GLU A 1 18  ? -4.649  14.855  23.169 1.00 0.00 ? 18  GLU A H    5  
ATOM 7345  H HA   . GLU A 1 18  ? -6.826  13.844  21.645 1.00 0.00 ? 18  GLU A HA   5  
ATOM 7346  H HB2  . GLU A 1 18  ? -7.849  13.966  23.915 1.00 0.00 ? 18  GLU A HB2  5  
ATOM 7347  H HB3  . GLU A 1 18  ? -7.413  15.660  24.025 1.00 0.00 ? 18  GLU A HB3  5  
ATOM 7348  H HG2  . GLU A 1 18  ? -8.806  15.252  21.523 1.00 0.00 ? 18  GLU A HG2  5  
ATOM 7349  H HG3  . GLU A 1 18  ? -9.745  14.499  22.797 1.00 0.00 ? 18  GLU A HG3  5  
ATOM 7350  N N    . ARG A 1 19  ? -6.869  16.034  20.394 1.00 0.00 ? 19  ARG A N    5  
ATOM 7351  C CA   . ARG A 1 19  ? -6.670  17.197  19.545 1.00 0.00 ? 19  ARG A CA   5  
ATOM 7352  C C    . ARG A 1 19  ? -5.175  17.461  19.350 1.00 0.00 ? 19  ARG A C    5  
ATOM 7353  O O    . ARG A 1 19  ? -4.549  18.135  20.166 1.00 0.00 ? 19  ARG A O    5  
ATOM 7354  C CB   . ARG A 1 19  ? -7.326  18.439  20.150 1.00 0.00 ? 19  ARG A CB   5  
ATOM 7355  C CG   . ARG A 1 19  ? -8.194  19.159  19.117 1.00 0.00 ? 19  ARG A CG   5  
ATOM 7356  C CD   . ARG A 1 19  ? -9.297  19.972  19.798 1.00 0.00 ? 19  ARG A CD   5  
ATOM 7357  N NE   . ARG A 1 19  ? -10.619 19.584  19.258 1.00 0.00 ? 19  ARG A NE   5  
ATOM 7358  C CZ   . ARG A 1 19  ? -11.737 20.305  19.416 1.00 0.00 ? 19  ARG A CZ   5  
ATOM 7359  N NH1  . ARG A 1 19  ? -11.699 21.457  20.100 1.00 0.00 ? 19  ARG A NH1  5  
ATOM 7360  N NH2  . ARG A 1 19  ? -12.892 19.875  18.891 1.00 0.00 ? 19  ARG A NH2  5  
ATOM 7361  H H    . ARG A 1 19  ? -7.507  15.353  20.036 1.00 0.00 ? 19  ARG A H    5  
ATOM 7362  H HA   . ARG A 1 19  ? -7.149  16.937  18.601 1.00 0.00 ? 19  ARG A HA   5  
ATOM 7363  H HB2  . ARG A 1 19  ? -7.936  18.152  21.007 1.00 0.00 ? 19  ARG A HB2  5  
ATOM 7364  H HB3  . ARG A 1 19  ? -6.557  19.118  20.520 1.00 0.00 ? 19  ARG A HB3  5  
ATOM 7365  H HG2  . ARG A 1 19  ? -7.573  19.818  18.510 1.00 0.00 ? 19  ARG A HG2  5  
ATOM 7366  H HG3  . ARG A 1 19  ? -8.640  18.430  18.440 1.00 0.00 ? 19  ARG A HG3  5  
ATOM 7367  H HD2  . ARG A 1 19  ? -9.271  19.805  20.874 1.00 0.00 ? 19  ARG A HD2  5  
ATOM 7368  H HD3  . ARG A 1 19  ? -9.128  21.037  19.636 1.00 0.00 ? 19  ARG A HD3  5  
ATOM 7369  H HE   . ARG A 1 19  ? -10.683 18.729  18.742 1.00 0.00 ? 19  ARG A HE   5  
ATOM 7370  H HH11 . ARG A 1 19  ? -10.837 21.778  20.492 1.00 0.00 ? 19  ARG A HH11 5  
ATOM 7371  H HH12 . ARG A 1 19  ? -12.534 21.996  20.218 1.00 0.00 ? 19  ARG A HH12 5  
ATOM 7372  H HH21 . ARG A 1 19  ? -12.921 19.016  18.381 1.00 0.00 ? 19  ARG A HH21 5  
ATOM 7373  H HH22 . ARG A 1 19  ? -13.727 20.414  19.010 1.00 0.00 ? 19  ARG A HH22 5  
ATOM 7374  N N    . LYS A 1 20  ? -4.648  16.918  18.262 1.00 0.00 ? 20  LYS A N    5  
ATOM 7375  C CA   . LYS A 1 20  ? -3.240  17.087  17.949 1.00 0.00 ? 20  LYS A CA   5  
ATOM 7376  C C    . LYS A 1 20  ? -3.038  16.957  16.438 1.00 0.00 ? 20  LYS A C    5  
ATOM 7377  O O    . LYS A 1 20  ? -2.717  17.935  15.764 1.00 0.00 ? 20  LYS A O    5  
ATOM 7378  C CB   . LYS A 1 20  ? -2.388  16.115  18.768 1.00 0.00 ? 20  LYS A CB   5  
ATOM 7379  C CG   . LYS A 1 20  ? -1.059  16.757  19.173 1.00 0.00 ? 20  LYS A CG   5  
ATOM 7380  C CD   . LYS A 1 20  ? -1.035  17.069  20.671 1.00 0.00 ? 20  LYS A CD   5  
ATOM 7381  C CE   . LYS A 1 20  ? -0.192  18.314  20.958 1.00 0.00 ? 20  LYS A CE   5  
ATOM 7382  N NZ   . LYS A 1 20  ? 0.477   18.194  22.272 1.00 0.00 ? 20  LYS A NZ   5  
ATOM 7383  H H    . LYS A 1 20  ? -5.165  16.371  17.603 1.00 0.00 ? 20  LYS A H    5  
ATOM 7384  H HA   . LYS A 1 20  ? -2.957  18.096  18.250 1.00 0.00 ? 20  LYS A HA   5  
ATOM 7385  H HB2  . LYS A 1 20  ? -2.935  15.809  19.660 1.00 0.00 ? 20  LYS A HB2  5  
ATOM 7386  H HB3  . LYS A 1 20  ? -2.198  15.213  18.187 1.00 0.00 ? 20  LYS A HB3  5  
ATOM 7387  H HG2  . LYS A 1 20  ? -0.237  16.087  18.924 1.00 0.00 ? 20  LYS A HG2  5  
ATOM 7388  H HG3  . LYS A 1 20  ? -0.907  17.674  18.604 1.00 0.00 ? 20  LYS A HG3  5  
ATOM 7389  H HD2  . LYS A 1 20  ? -2.052  17.224  21.030 1.00 0.00 ? 20  LYS A HD2  5  
ATOM 7390  H HD3  . LYS A 1 20  ? -0.630  16.217  21.217 1.00 0.00 ? 20  LYS A HD3  5  
ATOM 7391  H HE2  . LYS A 1 20  ? 0.553   18.444  20.174 1.00 0.00 ? 20  LYS A HE2  5  
ATOM 7392  H HE3  . LYS A 1 20  ? -0.827  19.200  20.945 1.00 0.00 ? 20  LYS A HE3  5  
ATOM 7393  H HZ1  . LYS A 1 20  ? -0.213  18.150  22.995 1.00 0.00 ? 20  LYS A HZ1  5  
ATOM 7394  H HZ2  . LYS A 1 20  ? 1.032   17.362  22.290 1.00 0.00 ? 20  LYS A HZ2  5  
ATOM 7395  H HZ3  . LYS A 1 20  ? 1.065   18.990  22.420 1.00 0.00 ? 20  LYS A HZ3  5  
ATOM 7396  N N    . LYS A 1 21  ? -3.237  15.741  15.949 1.00 0.00 ? 21  LYS A N    5  
ATOM 7397  C CA   . LYS A 1 21  ? -3.081  15.471  14.530 1.00 0.00 ? 21  LYS A CA   5  
ATOM 7398  C C    . LYS A 1 21  ? -3.761  16.581  13.726 1.00 0.00 ? 21  LYS A C    5  
ATOM 7399  O O    . LYS A 1 21  ? -4.699  17.215  14.207 1.00 0.00 ? 21  LYS A O    5  
ATOM 7400  C CB   . LYS A 1 21  ? -3.590  14.068  14.193 1.00 0.00 ? 21  LYS A CB   5  
ATOM 7401  C CG   . LYS A 1 21  ? -2.439  13.061  14.159 1.00 0.00 ? 21  LYS A CG   5  
ATOM 7402  C CD   . LYS A 1 21  ? -2.410  12.219  15.436 1.00 0.00 ? 21  LYS A CD   5  
ATOM 7403  C CE   . LYS A 1 21  ? -0.986  12.101  15.983 1.00 0.00 ? 21  LYS A CE   5  
ATOM 7404  N NZ   . LYS A 1 21  ? -0.847  12.874  17.237 1.00 0.00 ? 21  LYS A NZ   5  
ATOM 7405  H H    . LYS A 1 21  ? -3.498  14.952  16.504 1.00 0.00 ? 21  LYS A H    5  
ATOM 7406  H HA   . LYS A 1 21  ? -2.014  15.489  14.309 1.00 0.00 ? 21  LYS A HA   5  
ATOM 7407  H HB2  . LYS A 1 21  ? -4.328  13.757  14.932 1.00 0.00 ? 21  LYS A HB2  5  
ATOM 7408  H HB3  . LYS A 1 21  ? -4.094  14.082  13.226 1.00 0.00 ? 21  LYS A HB3  5  
ATOM 7409  H HG2  . LYS A 1 21  ? -2.546  12.409  13.292 1.00 0.00 ? 21  LYS A HG2  5  
ATOM 7410  H HG3  . LYS A 1 21  ? -1.492  13.589  14.046 1.00 0.00 ? 21  LYS A HG3  5  
ATOM 7411  H HD2  . LYS A 1 21  ? -3.056  12.671  16.189 1.00 0.00 ? 21  LYS A HD2  5  
ATOM 7412  H HD3  . LYS A 1 21  ? -2.807  11.225  15.230 1.00 0.00 ? 21  LYS A HD3  5  
ATOM 7413  H HE2  . LYS A 1 21  ? -0.745  11.054  16.166 1.00 0.00 ? 21  LYS A HE2  5  
ATOM 7414  H HE3  . LYS A 1 21  ? -0.274  12.467  15.243 1.00 0.00 ? 21  LYS A HE3  5  
ATOM 7415  H HZ1  . LYS A 1 21  ? -0.239  12.387  17.864 1.00 0.00 ? 21  LYS A HZ1  5  
ATOM 7416  H HZ2  . LYS A 1 21  ? -0.462  13.775  17.033 1.00 0.00 ? 21  LYS A HZ2  5  
ATOM 7417  H HZ3  . LYS A 1 21  ? -1.745  12.985  17.662 1.00 0.00 ? 21  LYS A HZ3  5  
ATOM 7418  N N    . ARG A 1 22  ? -3.261  16.783  12.516 1.00 0.00 ? 22  ARG A N    5  
ATOM 7419  C CA   . ARG A 1 22  ? -3.809  17.805  11.641 1.00 0.00 ? 22  ARG A CA   5  
ATOM 7420  C C    . ARG A 1 22  ? -4.900  17.211  10.748 1.00 0.00 ? 22  ARG A C    5  
ATOM 7421  O O    . ARG A 1 22  ? -4.912  16.008  10.493 1.00 0.00 ? 22  ARG A O    5  
ATOM 7422  C CB   . ARG A 1 22  ? -2.718  18.419  10.761 1.00 0.00 ? 22  ARG A CB   5  
ATOM 7423  C CG   . ARG A 1 22  ? -2.639  19.934  10.961 1.00 0.00 ? 22  ARG A CG   5  
ATOM 7424  C CD   . ARG A 1 22  ? -3.180  20.678  9.738  1.00 0.00 ? 22  ARG A CD   5  
ATOM 7425  N NE   . ARG A 1 22  ? -4.305  21.554  10.135 1.00 0.00 ? 22  ARG A NE   5  
ATOM 7426  C CZ   . ARG A 1 22  ? -4.952  22.372  9.295  1.00 0.00 ? 22  ARG A CZ   5  
ATOM 7427  N NH1  . ARG A 1 22  ? -4.590  22.432  8.006  1.00 0.00 ? 22  ARG A NH1  5  
ATOM 7428  N NH2  . ARG A 1 22  ? -5.962  23.131  9.743  1.00 0.00 ? 22  ARG A NH2  5  
ATOM 7429  H H    . ARG A 1 22  ? -2.498  16.263  12.132 1.00 0.00 ? 22  ARG A H    5  
ATOM 7430  H HA   . ARG A 1 22  ? -4.219  18.558  12.314 1.00 0.00 ? 22  ARG A HA   5  
ATOM 7431  H HB2  . ARG A 1 22  ? -1.755  17.967  11.000 1.00 0.00 ? 22  ARG A HB2  5  
ATOM 7432  H HB3  . ARG A 1 22  ? -2.922  18.197  9.714  1.00 0.00 ? 22  ARG A HB3  5  
ATOM 7433  H HG2  . ARG A 1 22  ? -3.210  20.218  11.846 1.00 0.00 ? 22  ARG A HG2  5  
ATOM 7434  H HG3  . ARG A 1 22  ? -1.605  20.228  11.142 1.00 0.00 ? 22  ARG A HG3  5  
ATOM 7435  H HD2  . ARG A 1 22  ? -2.388  21.272  9.284  1.00 0.00 ? 22  ARG A HD2  5  
ATOM 7436  H HD3  . ARG A 1 22  ? -3.513  19.963  8.986  1.00 0.00 ? 22  ARG A HD3  5  
ATOM 7437  H HE   . ARG A 1 22  ? -4.600  21.534  11.090 1.00 0.00 ? 22  ARG A HE   5  
ATOM 7438  H HH11 . ARG A 1 22  ? -3.837  21.866  7.671  1.00 0.00 ? 22  ARG A HH11 5  
ATOM 7439  H HH12 . ARG A 1 22  ? -5.074  23.043  7.379  1.00 0.00 ? 22  ARG A HH12 5  
ATOM 7440  H HH21 . ARG A 1 22  ? -6.232  23.087  10.705 1.00 0.00 ? 22  ARG A HH21 5  
ATOM 7441  H HH22 . ARG A 1 22  ? -6.445  23.742  9.116  1.00 0.00 ? 22  ARG A HH22 5  
ATOM 7442  N N    . GLU A 1 23  ? -5.790  18.083  10.297 1.00 0.00 ? 23  GLU A N    5  
ATOM 7443  C CA   . GLU A 1 23  ? -6.883  17.660  9.438  1.00 0.00 ? 23  GLU A CA   5  
ATOM 7444  C C    . GLU A 1 23  ? -6.337  17.049  8.146  1.00 0.00 ? 23  GLU A C    5  
ATOM 7445  O O    . GLU A 1 23  ? -6.679  15.921  7.795  1.00 0.00 ? 23  GLU A O    5  
ATOM 7446  C CB   . GLU A 1 23  ? -7.827  18.826  9.137  1.00 0.00 ? 23  GLU A CB   5  
ATOM 7447  C CG   . GLU A 1 23  ? -9.044  18.799  10.063 1.00 0.00 ? 23  GLU A CG   5  
ATOM 7448  C CD   . GLU A 1 23  ? -9.381  20.204  10.567 1.00 0.00 ? 23  GLU A CD   5  
ATOM 7449  O OE1  . GLU A 1 23  ? -9.840  21.012  9.730  1.00 0.00 ? 23  GLU A OE1  5  
ATOM 7450  O OE2  . GLU A 1 23  ? -9.171  20.439  11.776 1.00 0.00 ? 23  GLU A OE2  5  
ATOM 7451  H H    . GLU A 1 23  ? -5.773  19.060  10.508 1.00 0.00 ? 23  GLU A H    5  
ATOM 7452  H HA   . GLU A 1 23  ? -7.422  16.902  10.006 1.00 0.00 ? 23  GLU A HA   5  
ATOM 7453  H HB2  . GLU A 1 23  ? -7.295  19.769  9.256  1.00 0.00 ? 23  GLU A HB2  5  
ATOM 7454  H HB3  . GLU A 1 23  ? -8.155  18.774  8.098  1.00 0.00 ? 23  GLU A HB3  5  
ATOM 7455  H HG2  . GLU A 1 23  ? -9.901  18.384  9.532  1.00 0.00 ? 23  GLU A HG2  5  
ATOM 7456  H HG3  . GLU A 1 23  ? -8.846  18.143  10.911 1.00 0.00 ? 23  GLU A HG3  5  
ATOM 7457  N N    . LYS A 1 24  ? -5.496  17.821  7.473  1.00 0.00 ? 24  LYS A N    5  
ATOM 7458  C CA   . LYS A 1 24  ? -4.899  17.370  6.227  1.00 0.00 ? 24  LYS A CA   5  
ATOM 7459  C C    . LYS A 1 24  ? -4.020  16.148  6.501  1.00 0.00 ? 24  LYS A C    5  
ATOM 7460  O O    . LYS A 1 24  ? -3.680  15.404  5.582  1.00 0.00 ? 24  LYS A O    5  
ATOM 7461  C CB   . LYS A 1 24  ? -4.158  18.519  5.541  1.00 0.00 ? 24  LYS A CB   5  
ATOM 7462  C CG   . LYS A 1 24  ? -4.421  18.519  4.034  1.00 0.00 ? 24  LYS A CG   5  
ATOM 7463  C CD   . LYS A 1 24  ? -5.178  19.778  3.609  1.00 0.00 ? 24  LYS A CD   5  
ATOM 7464  C CE   . LYS A 1 24  ? -4.609  20.348  2.308  1.00 0.00 ? 24  LYS A CE   5  
ATOM 7465  N NZ   . LYS A 1 24  ? -5.602  20.237  1.216  1.00 0.00 ? 24  LYS A NZ   5  
ATOM 7466  H H    . LYS A 1 24  ? -5.223  18.737  7.765  1.00 0.00 ? 24  LYS A H    5  
ATOM 7467  H HA   . LYS A 1 24  ? -5.711  17.069  5.566  1.00 0.00 ? 24  LYS A HA   5  
ATOM 7468  H HB2  . LYS A 1 24  ? -4.477  19.470  5.969  1.00 0.00 ? 24  LYS A HB2  5  
ATOM 7469  H HB3  . LYS A 1 24  ? -3.088  18.430  5.727  1.00 0.00 ? 24  LYS A HB3  5  
ATOM 7470  H HG2  . LYS A 1 24  ? -3.475  18.460  3.496  1.00 0.00 ? 24  LYS A HG2  5  
ATOM 7471  H HG3  . LYS A 1 24  ? -4.998  17.635  3.762  1.00 0.00 ? 24  LYS A HG3  5  
ATOM 7472  H HD2  . LYS A 1 24  ? -6.235  19.545  3.476  1.00 0.00 ? 24  LYS A HD2  5  
ATOM 7473  H HD3  . LYS A 1 24  ? -5.114  20.529  4.397  1.00 0.00 ? 24  LYS A HD3  5  
ATOM 7474  H HE2  . LYS A 1 24  ? -4.332  21.392  2.451  1.00 0.00 ? 24  LYS A HE2  5  
ATOM 7475  H HE3  . LYS A 1 24  ? -3.700  19.811  2.036  1.00 0.00 ? 24  LYS A HE3  5  
ATOM 7476  H HZ1  . LYS A 1 24  ? -5.843  19.276  1.081  1.00 0.00 ? 24  LYS A HZ1  5  
ATOM 7477  H HZ2  . LYS A 1 24  ? -6.421  20.757  1.457  1.00 0.00 ? 24  LYS A HZ2  5  
ATOM 7478  H HZ3  . LYS A 1 24  ? -5.211  20.604  0.372  1.00 0.00 ? 24  LYS A HZ3  5  
ATOM 7479  N N    . GLU A 1 25  ? -3.675  15.979  7.770  1.00 0.00 ? 25  GLU A N    5  
ATOM 7480  C CA   . GLU A 1 25  ? -2.842  14.861  8.176  1.00 0.00 ? 25  GLU A CA   5  
ATOM 7481  C C    . GLU A 1 25  ? -3.678  13.583  8.273  1.00 0.00 ? 25  GLU A C    5  
ATOM 7482  O O    . GLU A 1 25  ? -3.381  12.591  7.609  1.00 0.00 ? 25  GLU A O    5  
ATOM 7483  C CB   . GLU A 1 25  ? -2.137  15.155  9.501  1.00 0.00 ? 25  GLU A CB   5  
ATOM 7484  C CG   . GLU A 1 25  ? -0.756  14.497  9.546  1.00 0.00 ? 25  GLU A CG   5  
ATOM 7485  C CD   . GLU A 1 25  ? -0.174  14.540  10.961 1.00 0.00 ? 25  GLU A CD   5  
ATOM 7486  O OE1  . GLU A 1 25  ? -0.124  15.657  11.520 1.00 0.00 ? 25  GLU A OE1  5  
ATOM 7487  O OE2  . GLU A 1 25  ? 0.208   13.455  11.450 1.00 0.00 ? 25  GLU A OE2  5  
ATOM 7488  H H    . GLU A 1 25  ? -3.955  16.589  8.511  1.00 0.00 ? 25  GLU A H    5  
ATOM 7489  H HA   . GLU A 1 25  ? -2.095  14.755  7.390  1.00 0.00 ? 25  GLU A HA   5  
ATOM 7490  H HB2  . GLU A 1 25  ? -2.033  16.233  9.631  1.00 0.00 ? 25  GLU A HB2  5  
ATOM 7491  H HB3  . GLU A 1 25  ? -2.744  14.792  10.330 1.00 0.00 ? 25  GLU A HB3  5  
ATOM 7492  H HG2  . GLU A 1 25  ? -0.832  13.462  9.212  1.00 0.00 ? 25  GLU A HG2  5  
ATOM 7493  H HG3  . GLU A 1 25  ? -0.084  15.006  8.856  1.00 0.00 ? 25  GLU A HG3  5  
ATOM 7494  N N    . GLN A 1 26  ? -4.708  13.649  9.104  1.00 0.00 ? 26  GLN A N    5  
ATOM 7495  C CA   . GLN A 1 26  ? -5.589  12.510  9.296  1.00 0.00 ? 26  GLN A CA   5  
ATOM 7496  C C    . GLN A 1 26  ? -6.361  12.214  8.009  1.00 0.00 ? 26  GLN A C    5  
ATOM 7497  O O    . GLN A 1 26  ? -7.026  11.184  7.903  1.00 0.00 ? 26  GLN A O    5  
ATOM 7498  C CB   . GLN A 1 26  ? -6.546  12.748  10.466 1.00 0.00 ? 26  GLN A CB   5  
ATOM 7499  C CG   . GLN A 1 26  ? -7.623  13.768  10.095 1.00 0.00 ? 26  GLN A CG   5  
ATOM 7500  C CD   . GLN A 1 26  ? -8.344  14.283  11.343 1.00 0.00 ? 26  GLN A CD   5  
ATOM 7501  O OE1  . GLN A 1 26  ? -7.761  14.459  12.400 1.00 0.00 ? 26  GLN A OE1  5  
ATOM 7502  N NE2  . GLN A 1 26  ? -9.642  14.512  11.162 1.00 0.00 ? 26  GLN A NE2  5  
ATOM 7503  H H    . GLN A 1 26  ? -4.943  14.460  9.640  1.00 0.00 ? 26  GLN A H    5  
ATOM 7504  H HA   . GLN A 1 26  ? -4.933  11.673  9.535  1.00 0.00 ? 26  GLN A HA   5  
ATOM 7505  H HB2  . GLN A 1 26  ? -7.014  11.807  10.754 1.00 0.00 ? 26  GLN A HB2  5  
ATOM 7506  H HB3  . GLN A 1 26  ? -5.986  13.103  11.332 1.00 0.00 ? 26  GLN A HB3  5  
ATOM 7507  H HG2  . GLN A 1 26  ? -7.170  14.604  9.563  1.00 0.00 ? 26  GLN A HG2  5  
ATOM 7508  H HG3  . GLN A 1 26  ? -8.344  13.311  9.417  1.00 0.00 ? 26  GLN A HG3  5  
ATOM 7509  H HE21 . GLN A 1 26  ? -10.059 14.347  10.268 1.00 0.00 ? 26  GLN A HE21 5  
ATOM 7510  H HE22 . GLN A 1 26  ? -10.200 14.851  11.920 1.00 0.00 ? 26  GLN A HE22 5  
ATOM 7511  N N    . PHE A 1 27  ? -6.247  13.134  7.063  1.00 0.00 ? 27  PHE A N    5  
ATOM 7512  C CA   . PHE A 1 27  ? -6.926  12.985  5.787  1.00 0.00 ? 27  PHE A CA   5  
ATOM 7513  C C    . PHE A 1 27  ? -6.188  11.993  4.886  1.00 0.00 ? 27  PHE A C    5  
ATOM 7514  O O    . PHE A 1 27  ? -6.808  11.127  4.270  1.00 0.00 ? 27  PHE A O    5  
ATOM 7515  C CB   . PHE A 1 27  ? -6.928  14.360  5.117  1.00 0.00 ? 27  PHE A CB   5  
ATOM 7516  C CG   . PHE A 1 27  ? -8.198  15.175  5.373  1.00 0.00 ? 27  PHE A CG   5  
ATOM 7517  C CD1  . PHE A 1 27  ? -8.882  15.020  6.538  1.00 0.00 ? 27  PHE A CD1  5  
ATOM 7518  C CD2  . PHE A 1 27  ? -8.642  16.054  4.435  1.00 0.00 ? 27  PHE A CD2  5  
ATOM 7519  C CE1  . PHE A 1 27  ? -10.060 15.777  6.775  1.00 0.00 ? 27  PHE A CE1  5  
ATOM 7520  C CE2  . PHE A 1 27  ? -9.820  16.811  4.672  1.00 0.00 ? 27  PHE A CE2  5  
ATOM 7521  C CZ   . PHE A 1 27  ? -10.504 16.656  5.837  1.00 0.00 ? 27  PHE A CZ   5  
ATOM 7522  H H    . PHE A 1 27  ? -5.704  13.969  7.157  1.00 0.00 ? 27  PHE A H    5  
ATOM 7523  H HA   . PHE A 1 27  ? -7.927  12.607  5.995  1.00 0.00 ? 27  PHE A HA   5  
ATOM 7524  H HB2  . PHE A 1 27  ? -6.067  14.927  5.471  1.00 0.00 ? 27  PHE A HB2  5  
ATOM 7525  H HB3  . PHE A 1 27  ? -6.803  14.230  4.042  1.00 0.00 ? 27  PHE A HB3  5  
ATOM 7526  H HD1  . PHE A 1 27  ? -8.526  14.316  7.289  1.00 0.00 ? 27  PHE A HD1  5  
ATOM 7527  H HD2  . PHE A 1 27  ? -8.093  16.178  3.501  1.00 0.00 ? 27  PHE A HD2  5  
ATOM 7528  H HE1  . PHE A 1 27  ? -10.608 15.653  7.709  1.00 0.00 ? 27  PHE A HE1  5  
ATOM 7529  H HE2  . PHE A 1 27  ? -10.176 17.515  3.921  1.00 0.00 ? 27  PHE A HE2  5  
ATOM 7530  H HZ   . PHE A 1 27  ? -11.408 17.236  6.020  1.00 0.00 ? 27  PHE A HZ   5  
ATOM 7531  N N    . ARG A 1 28  ? -4.873  12.151  4.838  1.00 0.00 ? 28  ARG A N    5  
ATOM 7532  C CA   . ARG A 1 28  ? -4.044  11.280  4.022  1.00 0.00 ? 28  ARG A CA   5  
ATOM 7533  C C    . ARG A 1 28  ? -3.168  10.396  4.912  1.00 0.00 ? 28  ARG A C    5  
ATOM 7534  O O    . ARG A 1 28  ? -2.130  9.903   4.474  1.00 0.00 ? 28  ARG A O    5  
ATOM 7535  C CB   . ARG A 1 28  ? -3.149  12.093  3.084  1.00 0.00 ? 28  ARG A CB   5  
ATOM 7536  C CG   . ARG A 1 28  ? -3.979  13.049  2.226  1.00 0.00 ? 28  ARG A CG   5  
ATOM 7537  C CD   . ARG A 1 28  ? -3.242  13.407  0.934  1.00 0.00 ? 28  ARG A CD   5  
ATOM 7538  N NE   . ARG A 1 28  ? -2.863  14.837  0.947  1.00 0.00 ? 28  ARG A NE   5  
ATOM 7539  C CZ   . ARG A 1 28  ? -3.737  15.847  0.842  1.00 0.00 ? 28  ARG A CZ   5  
ATOM 7540  N NH1  . ARG A 1 28  ? -5.046  15.590  0.715  1.00 0.00 ? 28  ARG A NH1  5  
ATOM 7541  N NH2  . ARG A 1 28  ? -3.302  17.115  0.864  1.00 0.00 ? 28  ARG A NH2  5  
ATOM 7542  H H    . ARG A 1 28  ? -4.377  12.858  5.342  1.00 0.00 ? 28  ARG A H    5  
ATOM 7543  H HA   . ARG A 1 28  ? -4.750  10.682  3.447  1.00 0.00 ? 28  ARG A HA   5  
ATOM 7544  H HB2  . ARG A 1 28  ? -2.423  12.659  3.668  1.00 0.00 ? 28  ARG A HB2  5  
ATOM 7545  H HB3  . ARG A 1 28  ? -2.584  11.418  2.441  1.00 0.00 ? 28  ARG A HB3  5  
ATOM 7546  H HG2  . ARG A 1 28  ? -4.938  12.589  1.986  1.00 0.00 ? 28  ARG A HG2  5  
ATOM 7547  H HG3  . ARG A 1 28  ? -4.193  13.957  2.790  1.00 0.00 ? 28  ARG A HG3  5  
ATOM 7548  H HD2  . ARG A 1 28  ? -2.352  12.787  0.830  1.00 0.00 ? 28  ARG A HD2  5  
ATOM 7549  H HD3  . ARG A 1 28  ? -3.878  13.199  0.073  1.00 0.00 ? 28  ARG A HD3  5  
ATOM 7550  H HE   . ARG A 1 28  ? -1.893  15.064  1.040  1.00 0.00 ? 28  ARG A HE   5  
ATOM 7551  H HH11 . ARG A 1 28  ? -5.370  14.644  0.699  1.00 0.00 ? 28  ARG A HH11 5  
ATOM 7552  H HH12 . ARG A 1 28  ? -5.698  16.344  0.637  1.00 0.00 ? 28  ARG A HH12 5  
ATOM 7553  H HH21 . ARG A 1 28  ? -2.325  17.307  0.958  1.00 0.00 ? 28  ARG A HH21 5  
ATOM 7554  H HH22 . ARG A 1 28  ? -3.954  17.869  0.785  1.00 0.00 ? 28  ARG A HH22 5  
ATOM 7555  N N    . LYS A 1 29  ? -3.619  10.222  6.146  1.00 0.00 ? 29  LYS A N    5  
ATOM 7556  C CA   . LYS A 1 29  ? -2.890  9.405   7.101  1.00 0.00 ? 29  LYS A CA   5  
ATOM 7557  C C    . LYS A 1 29  ? -3.717  8.164   7.441  1.00 0.00 ? 29  LYS A C    5  
ATOM 7558  O O    . LYS A 1 29  ? -4.826  8.276   7.962  1.00 0.00 ? 29  LYS A O    5  
ATOM 7559  C CB   . LYS A 1 29  ? -2.495  10.235  8.324  1.00 0.00 ? 29  LYS A CB   5  
ATOM 7560  C CG   . LYS A 1 29  ? -1.799  9.367   9.374  1.00 0.00 ? 29  LYS A CG   5  
ATOM 7561  C CD   . LYS A 1 29  ? -2.483  9.500   10.736 1.00 0.00 ? 29  LYS A CD   5  
ATOM 7562  C CE   . LYS A 1 29  ? -1.466  9.832   11.831 1.00 0.00 ? 29  LYS A CE   5  
ATOM 7563  N NZ   . LYS A 1 29  ? -1.883  9.241   13.122 1.00 0.00 ? 29  LYS A NZ   5  
ATOM 7564  H H    . LYS A 1 29  ? -4.465  10.626  6.494  1.00 0.00 ? 29  LYS A H    5  
ATOM 7565  H HA   . LYS A 1 29  ? -1.967  9.083   6.618  1.00 0.00 ? 29  LYS A HA   5  
ATOM 7566  H HB2  . LYS A 1 29  ? -1.833  11.046  8.020  1.00 0.00 ? 29  LYS A HB2  5  
ATOM 7567  H HB3  . LYS A 1 29  ? -3.383  10.695  8.758  1.00 0.00 ? 29  LYS A HB3  5  
ATOM 7568  H HG2  . LYS A 1 29  ? -1.812  8.325   9.057  1.00 0.00 ? 29  LYS A HG2  5  
ATOM 7569  H HG3  . LYS A 1 29  ? -0.753  9.661   9.459  1.00 0.00 ? 29  LYS A HG3  5  
ATOM 7570  H HD2  . LYS A 1 29  ? -3.242  10.281  10.692 1.00 0.00 ? 29  LYS A HD2  5  
ATOM 7571  H HD3  . LYS A 1 29  ? -2.996  8.570   10.982 1.00 0.00 ? 29  LYS A HD3  5  
ATOM 7572  H HE2  . LYS A 1 29  ? -0.484  9.451   11.550 1.00 0.00 ? 29  LYS A HE2  5  
ATOM 7573  H HE3  . LYS A 1 29  ? -1.372  10.913  11.932 1.00 0.00 ? 29  LYS A HE3  5  
ATOM 7574  H HZ1  . LYS A 1 29  ? -2.879  9.147   13.140 1.00 0.00 ? 29  LYS A HZ1  5  
ATOM 7575  H HZ2  . LYS A 1 29  ? -1.461  8.341   13.229 1.00 0.00 ? 29  LYS A HZ2  5  
ATOM 7576  H HZ3  . LYS A 1 29  ? -1.591  9.837   13.870 1.00 0.00 ? 29  LYS A HZ3  5  
ATOM 7577  N N    . LEU A 1 30  ? -3.147  7.009   7.133  1.00 0.00 ? 30  LEU A N    5  
ATOM 7578  C CA   . LEU A 1 30  ? -3.818  5.748   7.400  1.00 0.00 ? 30  LEU A CA   5  
ATOM 7579  C C    . LEU A 1 30  ? -3.072  5.003   8.509  1.00 0.00 ? 30  LEU A C    5  
ATOM 7580  O O    . LEU A 1 30  ? -1.904  5.284   8.774  1.00 0.00 ? 30  LEU A O    5  
ATOM 7581  C CB   . LEU A 1 30  ? -3.969  4.939   6.110  1.00 0.00 ? 30  LEU A CB   5  
ATOM 7582  C CG   . LEU A 1 30  ? -5.279  5.137   5.344  1.00 0.00 ? 30  LEU A CG   5  
ATOM 7583  C CD1  . LEU A 1 30  ? -5.440  6.593   4.903  1.00 0.00 ? 30  LEU A CD1  5  
ATOM 7584  C CD2  . LEU A 1 30  ? -5.376  4.167   4.165  1.00 0.00 ? 30  LEU A CD2  5  
ATOM 7585  H H    . LEU A 1 30  ? -2.244  6.926   6.710  1.00 0.00 ? 30  LEU A H    5  
ATOM 7586  H HA   . LEU A 1 30  ? -4.822  5.981   7.754  1.00 0.00 ? 30  LEU A HA   5  
ATOM 7587  H HB2  . LEU A 1 30  ? -3.142  5.190   5.447  1.00 0.00 ? 30  LEU A HB2  5  
ATOM 7588  H HB3  . LEU A 1 30  ? -3.872  3.881   6.355  1.00 0.00 ? 30  LEU A HB3  5  
ATOM 7589  H HG   . LEU A 1 30  ? -6.106  4.911   6.016  1.00 0.00 ? 30  LEU A HG   5  
ATOM 7590  H HD11 . LEU A 1 30  ? -5.764  7.196   5.752  1.00 0.00 ? 30  LEU A HD11 5  
ATOM 7591  H HD12 . LEU A 1 30  ? -4.486  6.969   4.534  1.00 0.00 ? 30  LEU A HD12 5  
ATOM 7592  H HD13 . LEU A 1 30  ? -6.186  6.653   4.110  1.00 0.00 ? 30  LEU A HD13 5  
ATOM 7593  H HD21 . LEU A 1 30  ? -6.314  4.333   3.635  1.00 0.00 ? 30  LEU A HD21 5  
ATOM 7594  H HD22 . LEU A 1 30  ? -4.541  4.336   3.485  1.00 0.00 ? 30  LEU A HD22 5  
ATOM 7595  H HD23 . LEU A 1 30  ? -5.344  3.142   4.534  1.00 0.00 ? 30  LEU A HD23 5  
ATOM 7596  N N    . PHE A 1 31  ? -3.778  4.067   9.127  1.00 0.00 ? 31  PHE A N    5  
ATOM 7597  C CA   . PHE A 1 31  ? -3.198  3.280   10.202 1.00 0.00 ? 31  PHE A CA   5  
ATOM 7598  C C    . PHE A 1 31  ? -3.259  1.785   9.881  1.00 0.00 ? 31  PHE A C    5  
ATOM 7599  O O    . PHE A 1 31  ? -4.337  1.192   9.873  1.00 0.00 ? 31  PHE A O    5  
ATOM 7600  C CB   . PHE A 1 31  ? -4.029  3.554   11.457 1.00 0.00 ? 31  PHE A CB   5  
ATOM 7601  C CG   . PHE A 1 31  ? -3.555  2.792   12.696 1.00 0.00 ? 31  PHE A CG   5  
ATOM 7602  C CD1  . PHE A 1 31  ? -3.834  1.468   12.827 1.00 0.00 ? 31  PHE A CD1  5  
ATOM 7603  C CD2  . PHE A 1 31  ? -2.855  3.439   13.666 1.00 0.00 ? 31  PHE A CD2  5  
ATOM 7604  C CE1  . PHE A 1 31  ? -3.395  0.760   13.978 1.00 0.00 ? 31  PHE A CE1  5  
ATOM 7605  C CE2  . PHE A 1 31  ? -2.415  2.732   14.816 1.00 0.00 ? 31  PHE A CE2  5  
ATOM 7606  C CZ   . PHE A 1 31  ? -2.694  1.408   14.947 1.00 0.00 ? 31  PHE A CZ   5  
ATOM 7607  H H    . PHE A 1 31  ? -4.727  3.845   8.905  1.00 0.00 ? 31  PHE A H    5  
ATOM 7608  H HA   . PHE A 1 31  ? -2.156  3.586   10.301 1.00 0.00 ? 31  PHE A HA   5  
ATOM 7609  H HB2  . PHE A 1 31  ? -4.005  4.623   11.669 1.00 0.00 ? 31  PHE A HB2  5  
ATOM 7610  H HB3  . PHE A 1 31  ? -5.068  3.292   11.256 1.00 0.00 ? 31  PHE A HB3  5  
ATOM 7611  H HD1  . PHE A 1 31  ? -4.395  0.949   12.050 1.00 0.00 ? 31  PHE A HD1  5  
ATOM 7612  H HD2  . PHE A 1 31  ? -2.631  4.501   13.560 1.00 0.00 ? 31  PHE A HD2  5  
ATOM 7613  H HE1  . PHE A 1 31  ? -3.618  -0.301  14.083 1.00 0.00 ? 31  PHE A HE1  5  
ATOM 7614  H HE2  . PHE A 1 31  ? -1.854  3.251   15.593 1.00 0.00 ? 31  PHE A HE2  5  
ATOM 7615  H HZ   . PHE A 1 31  ? -2.357  0.865   15.830 1.00 0.00 ? 31  PHE A HZ   5  
ATOM 7616  N N    . ILE A 1 32  ? -2.089  1.219   9.624  1.00 0.00 ? 32  ILE A N    5  
ATOM 7617  C CA   . ILE A 1 32  ? -1.996  -0.195  9.303  1.00 0.00 ? 32  ILE A CA   5  
ATOM 7618  C C    . ILE A 1 32  ? -1.993  -1.008  10.599 1.00 0.00 ? 32  ILE A C    5  
ATOM 7619  O O    . ILE A 1 32  ? -1.267  -0.685  11.538 1.00 0.00 ? 32  ILE A O    5  
ATOM 7620  C CB   . ILE A 1 32  ? -0.785  -0.463  8.407  1.00 0.00 ? 32  ILE A CB   5  
ATOM 7621  C CG1  . ILE A 1 32  ? -0.588  0.671   7.398  1.00 0.00 ? 32  ILE A CG1  5  
ATOM 7622  C CG2  . ILE A 1 32  ? -0.900  -1.826  7.723  1.00 0.00 ? 32  ILE A CG2  5  
ATOM 7623  C CD1  . ILE A 1 32  ? -1.865  0.913   6.590  1.00 0.00 ? 32  ILE A CD1  5  
ATOM 7624  H H    . ILE A 1 32  ? -1.217  1.709   9.633  1.00 0.00 ? 32  ILE A H    5  
ATOM 7625  H HA   . ILE A 1 32  ? -2.885  -0.459  8.731  1.00 0.00 ? 32  ILE A HA   5  
ATOM 7626  H HB   . ILE A 1 32  ? 0.105   -0.492  9.036  1.00 0.00 ? 32  ILE A HB   5  
ATOM 7627  H HG12 . ILE A 1 32  ? -0.307  1.584   7.922  1.00 0.00 ? 32  ILE A HG12 5  
ATOM 7628  H HG13 . ILE A 1 32  ? 0.232   0.424   6.724  1.00 0.00 ? 32  ILE A HG13 5  
ATOM 7629  H HG21 . ILE A 1 32  ? 0.086   -2.149  7.388  1.00 0.00 ? 32  ILE A HG21 5  
ATOM 7630  H HG22 . ILE A 1 32  ? -1.301  -2.554  8.428  1.00 0.00 ? 32  ILE A HG22 5  
ATOM 7631  H HG23 . ILE A 1 32  ? -1.567  -1.746  6.865  1.00 0.00 ? 32  ILE A HG23 5  
ATOM 7632  H HD11 . ILE A 1 32  ? -1.639  0.849   5.526  1.00 0.00 ? 32  ILE A HD11 5  
ATOM 7633  H HD12 . ILE A 1 32  ? -2.608  0.159   6.850  1.00 0.00 ? 32  ILE A HD12 5  
ATOM 7634  H HD13 . ILE A 1 32  ? -2.258  1.904   6.820  1.00 0.00 ? 32  ILE A HD13 5  
ATOM 7635  N N    . GLY A 1 33  ? -2.815  -2.048  10.610 1.00 0.00 ? 33  GLY A N    5  
ATOM 7636  C CA   . GLY A 1 33  ? -2.917  -2.910  11.775 1.00 0.00 ? 33  GLY A CA   5  
ATOM 7637  C C    . GLY A 1 33  ? -2.672  -4.372  11.398 1.00 0.00 ? 33  GLY A C    5  
ATOM 7638  O O    . GLY A 1 33  ? -3.453  -4.964  10.654 1.00 0.00 ? 33  GLY A O    5  
ATOM 7639  H H    . GLY A 1 33  ? -3.403  -2.303  9.842  1.00 0.00 ? 33  GLY A H    5  
ATOM 7640  H HA2  . GLY A 1 33  ? -2.192  -2.598  12.527 1.00 0.00 ? 33  GLY A HA2  5  
ATOM 7641  H HA3  . GLY A 1 33  ? -3.905  -2.806  12.223 1.00 0.00 ? 33  GLY A HA3  5  
ATOM 7642  N N    . GLY A 1 34  ? -1.585  -4.913  11.928 1.00 0.00 ? 34  GLY A N    5  
ATOM 7643  C CA   . GLY A 1 34  ? -1.228  -6.295  11.657 1.00 0.00 ? 34  GLY A CA   5  
ATOM 7644  C C    . GLY A 1 34  ? 0.042   -6.376  10.807 1.00 0.00 ? 34  GLY A C    5  
ATOM 7645  O O    . GLY A 1 34  ? -0.013  -6.752  9.637  1.00 0.00 ? 34  GLY A O    5  
ATOM 7646  H H    . GLY A 1 34  ? -0.955  -4.424  12.532 1.00 0.00 ? 34  GLY A H    5  
ATOM 7647  H HA2  . GLY A 1 34  ? -1.075  -6.826  12.596 1.00 0.00 ? 34  GLY A HA2  5  
ATOM 7648  H HA3  . GLY A 1 34  ? -2.048  -6.791  11.139 1.00 0.00 ? 34  GLY A HA3  5  
ATOM 7649  N N    . LEU A 1 35  ? 1.156   -6.018  11.429 1.00 0.00 ? 35  LEU A N    5  
ATOM 7650  C CA   . LEU A 1 35  ? 2.437   -6.045  10.744 1.00 0.00 ? 35  LEU A CA   5  
ATOM 7651  C C    . LEU A 1 35  ? 3.261   -7.227  11.260 1.00 0.00 ? 35  LEU A C    5  
ATOM 7652  O O    . LEU A 1 35  ? 4.442   -7.351  10.941 1.00 0.00 ? 35  LEU A O    5  
ATOM 7653  C CB   . LEU A 1 35  ? 3.146   -4.696  10.879 1.00 0.00 ? 35  LEU A CB   5  
ATOM 7654  C CG   . LEU A 1 35  ? 2.285   -3.458  10.624 1.00 0.00 ? 35  LEU A CG   5  
ATOM 7655  C CD1  . LEU A 1 35  ? 3.148   -2.266  10.206 1.00 0.00 ? 35  LEU A CD1  5  
ATOM 7656  C CD2  . LEU A 1 35  ? 1.185   -3.755  9.602  1.00 0.00 ? 35  LEU A CD2  5  
ATOM 7657  H H    . LEU A 1 35  ? 1.192   -5.713  12.380 1.00 0.00 ? 35  LEU A H    5  
ATOM 7658  H HA   . LEU A 1 35  ? 2.238   -6.200  9.684  1.00 0.00 ? 35  LEU A HA   5  
ATOM 7659  H HB2  . LEU A 1 35  ? 3.561   -4.625  11.884 1.00 0.00 ? 35  LEU A HB2  5  
ATOM 7660  H HB3  . LEU A 1 35  ? 3.987   -4.679  10.185 1.00 0.00 ? 35  LEU A HB3  5  
ATOM 7661  H HG   . LEU A 1 35  ? 1.792   -3.186  11.557 1.00 0.00 ? 35  LEU A HG   5  
ATOM 7662  H HD11 . LEU A 1 35  ? 3.396   -1.671  11.084 1.00 0.00 ? 35  LEU A HD11 5  
ATOM 7663  H HD12 . LEU A 1 35  ? 4.066   -2.627  9.741  1.00 0.00 ? 35  LEU A HD12 5  
ATOM 7664  H HD13 . LEU A 1 35  ? 2.599   -1.651  9.493  1.00 0.00 ? 35  LEU A HD13 5  
ATOM 7665  H HD21 . LEU A 1 35  ? 1.532   -4.521  8.908  1.00 0.00 ? 35  LEU A HD21 5  
ATOM 7666  H HD22 . LEU A 1 35  ? 0.294   -4.110  10.120 1.00 0.00 ? 35  LEU A HD22 5  
ATOM 7667  H HD23 . LEU A 1 35  ? 0.947   -2.846  9.050  1.00 0.00 ? 35  LEU A HD23 5  
ATOM 7668  N N    . SER A 1 36  ? 2.604   -8.065  12.049 1.00 0.00 ? 36  SER A N    5  
ATOM 7669  C CA   . SER A 1 36  ? 3.261   -9.233  12.612 1.00 0.00 ? 36  SER A CA   5  
ATOM 7670  C C    . SER A 1 36  ? 4.338   -8.798  13.608 1.00 0.00 ? 36  SER A C    5  
ATOM 7671  O O    . SER A 1 36  ? 4.156   -8.923  14.818 1.00 0.00 ? 36  SER A O    5  
ATOM 7672  C CB   . SER A 1 36  ? 3.875   -10.103 11.513 1.00 0.00 ? 36  SER A CB   5  
ATOM 7673  O OG   . SER A 1 36  ? 5.053   -10.771 11.957 1.00 0.00 ? 36  SER A OG   5  
ATOM 7674  H H    . SER A 1 36  ? 1.643   -7.957  12.303 1.00 0.00 ? 36  SER A H    5  
ATOM 7675  H HA   . SER A 1 36  ? 2.474   -9.790  13.119 1.00 0.00 ? 36  SER A HA   5  
ATOM 7676  H HB2  . SER A 1 36  ? 3.143   -10.840 11.183 1.00 0.00 ? 36  SER A HB2  5  
ATOM 7677  H HB3  . SER A 1 36  ? 4.114   -9.482  10.650 1.00 0.00 ? 36  SER A HB3  5  
ATOM 7678  H HG   . SER A 1 36  ? 4.893   -11.758 11.993 1.00 0.00 ? 36  SER A HG   5  
ATOM 7679  N N    . PHE A 1 37  ? 5.435   -8.295  13.062 1.00 0.00 ? 37  PHE A N    5  
ATOM 7680  C CA   . PHE A 1 37  ? 6.541   -7.841  13.888 1.00 0.00 ? 37  PHE A CA   5  
ATOM 7681  C C    . PHE A 1 37  ? 7.828   -7.727  13.067 1.00 0.00 ? 37  PHE A C    5  
ATOM 7682  O O    . PHE A 1 37  ? 8.718   -6.949  13.407 1.00 0.00 ? 37  PHE A O    5  
ATOM 7683  C CB   . PHE A 1 37  ? 6.741   -8.889  14.984 1.00 0.00 ? 37  PHE A CB   5  
ATOM 7684  C CG   . PHE A 1 37  ? 6.332   -8.415  16.380 1.00 0.00 ? 37  PHE A CG   5  
ATOM 7685  C CD1  . PHE A 1 37  ? 5.367   -7.468  16.521 1.00 0.00 ? 37  PHE A CD1  5  
ATOM 7686  C CD2  . PHE A 1 37  ? 6.935   -8.941  17.481 1.00 0.00 ? 37  PHE A CD2  5  
ATOM 7687  C CE1  . PHE A 1 37  ? 4.988   -7.027  17.817 1.00 0.00 ? 37  PHE A CE1  5  
ATOM 7688  C CE2  . PHE A 1 37  ? 6.556   -8.500  18.776 1.00 0.00 ? 37  PHE A CE2  5  
ATOM 7689  C CZ   . PHE A 1 37  ? 5.590   -7.553  18.917 1.00 0.00 ? 37  PHE A CZ   5  
ATOM 7690  H H    . PHE A 1 37  ? 5.575   -8.197  12.077 1.00 0.00 ? 37  PHE A H    5  
ATOM 7691  H HA   . PHE A 1 37  ? 6.273   -6.859  14.277 1.00 0.00 ? 37  PHE A HA   5  
ATOM 7692  H HB2  . PHE A 1 37  ? 6.165   -9.779  14.731 1.00 0.00 ? 37  PHE A HB2  5  
ATOM 7693  H HB3  . PHE A 1 37  ? 7.790   -9.184  15.005 1.00 0.00 ? 37  PHE A HB3  5  
ATOM 7694  H HD1  . PHE A 1 37  ? 4.884   -7.046  15.640 1.00 0.00 ? 37  PHE A HD1  5  
ATOM 7695  H HD2  . PHE A 1 37  ? 7.709   -9.700  17.368 1.00 0.00 ? 37  PHE A HD2  5  
ATOM 7696  H HE1  . PHE A 1 37  ? 4.214   -6.268  17.930 1.00 0.00 ? 37  PHE A HE1  5  
ATOM 7697  H HE2  . PHE A 1 37  ? 7.039   -8.922  19.658 1.00 0.00 ? 37  PHE A HE2  5  
ATOM 7698  H HZ   . PHE A 1 37  ? 5.300   -7.215  19.912 1.00 0.00 ? 37  PHE A HZ   5  
ATOM 7699  N N    . GLU A 1 38  ? 7.884   -8.515  12.003 1.00 0.00 ? 38  GLU A N    5  
ATOM 7700  C CA   . GLU A 1 38  ? 9.047   -8.512  11.132 1.00 0.00 ? 38  GLU A CA   5  
ATOM 7701  C C    . GLU A 1 38  ? 8.781   -7.651  9.895  1.00 0.00 ? 38  GLU A C    5  
ATOM 7702  O O    . GLU A 1 38  ? 9.325   -7.914  8.823  1.00 0.00 ? 38  GLU A O    5  
ATOM 7703  C CB   . GLU A 1 38  ? 9.437   -9.937  10.734 1.00 0.00 ? 38  GLU A CB   5  
ATOM 7704  C CG   . GLU A 1 38  ? 10.371  -10.560 11.774 1.00 0.00 ? 38  GLU A CG   5  
ATOM 7705  C CD   . GLU A 1 38  ? 10.934  -11.893 11.277 1.00 0.00 ? 38  GLU A CD   5  
ATOM 7706  O OE1  . GLU A 1 38  ? 10.157  -12.633 10.635 1.00 0.00 ? 38  GLU A OE1  5  
ATOM 7707  O OE2  . GLU A 1 38  ? 12.128  -12.142 11.550 1.00 0.00 ? 38  GLU A OE2  5  
ATOM 7708  H H    . GLU A 1 38  ? 7.156   -9.144  11.734 1.00 0.00 ? 38  GLU A H    5  
ATOM 7709  H HA   . GLU A 1 38  ? 9.851   -8.073  11.722 1.00 0.00 ? 38  GLU A HA   5  
ATOM 7710  H HB2  . GLU A 1 38  ? 8.541   -10.548 10.632 1.00 0.00 ? 38  GLU A HB2  5  
ATOM 7711  H HB3  . GLU A 1 38  ? 9.928   -9.925  9.761  1.00 0.00 ? 38  GLU A HB3  5  
ATOM 7712  H HG2  . GLU A 1 38  ? 11.189  -9.874  11.991 1.00 0.00 ? 38  GLU A HG2  5  
ATOM 7713  H HG3  . GLU A 1 38  ? 9.829   -10.716 12.707 1.00 0.00 ? 38  GLU A HG3  5  
ATOM 7714  N N    . THR A 1 39  ? 7.946   -6.640  10.085 1.00 0.00 ? 39  THR A N    5  
ATOM 7715  C CA   . THR A 1 39  ? 7.602   -5.739  8.998  1.00 0.00 ? 39  THR A CA   5  
ATOM 7716  C C    . THR A 1 39  ? 8.141   -4.335  9.279  1.00 0.00 ? 39  THR A C    5  
ATOM 7717  O O    . THR A 1 39  ? 7.677   -3.661  10.197 1.00 0.00 ? 39  THR A O    5  
ATOM 7718  C CB   . THR A 1 39  ? 6.084   -5.782  8.812  1.00 0.00 ? 39  THR A CB   5  
ATOM 7719  O OG1  . THR A 1 39  ? 5.876   -6.854  7.896  1.00 0.00 ? 39  THR A OG1  5  
ATOM 7720  C CG2  . THR A 1 39  ? 5.550   -4.553  8.074  1.00 0.00 ? 39  THR A CG2  5  
ATOM 7721  H H    . THR A 1 39  ? 7.508   -6.434  10.960 1.00 0.00 ? 39  THR A H    5  
ATOM 7722  H HA   . THR A 1 39  ? 8.090   -6.094  8.091  1.00 0.00 ? 39  THR A HA   5  
ATOM 7723  H HB   . THR A 1 39  ? 5.578   -5.912  9.768  1.00 0.00 ? 39  THR A HB   5  
ATOM 7724  H HG1  . THR A 1 39  ? 4.975   -7.260  8.044  1.00 0.00 ? 39  THR A HG1  5  
ATOM 7725  H HG21 . THR A 1 39  ? 6.158   -4.368  7.188  1.00 0.00 ? 39  THR A HG21 5  
ATOM 7726  H HG22 . THR A 1 39  ? 4.517   -4.728  7.775  1.00 0.00 ? 39  THR A HG22 5  
ATOM 7727  H HG23 . THR A 1 39  ? 5.595   -3.685  8.732  1.00 0.00 ? 39  THR A HG23 5  
ATOM 7728  N N    . THR A 1 40  ? 9.112   -3.936  8.471  1.00 0.00 ? 40  THR A N    5  
ATOM 7729  C CA   . THR A 1 40  ? 9.719   -2.625  8.620  1.00 0.00 ? 40  THR A CA   5  
ATOM 7730  C C    . THR A 1 40  ? 9.015   -1.606  7.721  1.00 0.00 ? 40  THR A C    5  
ATOM 7731  O O    . THR A 1 40  ? 8.267   -1.980  6.820  1.00 0.00 ? 40  THR A O    5  
ATOM 7732  C CB   . THR A 1 40  ? 11.215  -2.760  8.331  1.00 0.00 ? 40  THR A CB   5  
ATOM 7733  O OG1  . THR A 1 40  ? 11.265  -3.394  7.055  1.00 0.00 ? 40  THR A OG1  5  
ATOM 7734  C CG2  . THR A 1 40  ? 11.905  -3.752  9.268  1.00 0.00 ? 40  THR A CG2  5  
ATOM 7735  H H    . THR A 1 40  ? 9.483   -4.491  7.726  1.00 0.00 ? 40  THR A H    5  
ATOM 7736  H HA   . THR A 1 40  ? 9.575   -2.295  9.650  1.00 0.00 ? 40  THR A HA   5  
ATOM 7737  H HB   . THR A 1 40  ? 11.707  -1.788  8.362  1.00 0.00 ? 40  THR A HB   5  
ATOM 7738  H HG1  . THR A 1 40  ? 11.573  -2.743  6.362  1.00 0.00 ? 40  THR A HG1  5  
ATOM 7739  H HG21 . THR A 1 40  ? 12.447  -4.492  8.679  1.00 0.00 ? 40  THR A HG21 5  
ATOM 7740  H HG22 . THR A 1 40  ? 12.604  -3.218  9.912  1.00 0.00 ? 40  THR A HG22 5  
ATOM 7741  H HG23 . THR A 1 40  ? 11.157  -4.254  9.881  1.00 0.00 ? 40  THR A HG23 5  
ATOM 7742  N N    . GLU A 1 41  ? 9.281   -0.338  7.998  1.00 0.00 ? 41  GLU A N    5  
ATOM 7743  C CA   . GLU A 1 41  ? 8.682   0.738   7.226  1.00 0.00 ? 41  GLU A CA   5  
ATOM 7744  C C    . GLU A 1 41  ? 8.826   0.459   5.728  1.00 0.00 ? 41  GLU A C    5  
ATOM 7745  O O    . GLU A 1 41  ? 7.839   0.468   4.994  1.00 0.00 ? 41  GLU A O    5  
ATOM 7746  C CB   . GLU A 1 41  ? 9.302   2.088   7.594  1.00 0.00 ? 41  GLU A CB   5  
ATOM 7747  C CG   . GLU A 1 41  ? 9.162   2.364   9.092  1.00 0.00 ? 41  GLU A CG   5  
ATOM 7748  C CD   . GLU A 1 41  ? 9.563   3.803   9.424  1.00 0.00 ? 41  GLU A CD   5  
ATOM 7749  O OE1  . GLU A 1 41  ? 10.366  4.362   8.646  1.00 0.00 ? 41  GLU A OE1  5  
ATOM 7750  O OE2  . GLU A 1 41  ? 9.057   4.312   10.448 1.00 0.00 ? 41  GLU A OE2  5  
ATOM 7751  H H    . GLU A 1 41  ? 9.891   -0.041  8.733  1.00 0.00 ? 41  GLU A H    5  
ATOM 7752  H HA   . GLU A 1 41  ? 7.628   0.741   7.502  1.00 0.00 ? 41  GLU A HA   5  
ATOM 7753  H HB2  . GLU A 1 41  ? 10.355  2.097   7.316  1.00 0.00 ? 41  GLU A HB2  5  
ATOM 7754  H HB3  . GLU A 1 41  ? 8.815   2.882   7.027  1.00 0.00 ? 41  GLU A HB3  5  
ATOM 7755  H HG2  . GLU A 1 41  ? 8.132   2.189   9.404  1.00 0.00 ? 41  GLU A HG2  5  
ATOM 7756  H HG3  . GLU A 1 41  ? 9.787   1.670   9.654  1.00 0.00 ? 41  GLU A HG3  5  
ATOM 7757  N N    . GLU A 1 42  ? 10.063  0.219   5.319  1.00 0.00 ? 42  GLU A N    5  
ATOM 7758  C CA   . GLU A 1 42  ? 10.349  -0.062  3.923  1.00 0.00 ? 42  GLU A CA   5  
ATOM 7759  C C    . GLU A 1 42  ? 9.485   -1.223  3.427  1.00 0.00 ? 42  GLU A C    5  
ATOM 7760  O O    . GLU A 1 42  ? 8.672   -1.054  2.519  1.00 0.00 ? 42  GLU A O    5  
ATOM 7761  C CB   . GLU A 1 42  ? 11.836  -0.357  3.715  1.00 0.00 ? 42  GLU A CB   5  
ATOM 7762  C CG   . GLU A 1 42  ? 12.618  0.930   3.448  1.00 0.00 ? 42  GLU A CG   5  
ATOM 7763  C CD   . GLU A 1 42  ? 14.092  0.764   3.826  1.00 0.00 ? 42  GLU A CD   5  
ATOM 7764  O OE1  . GLU A 1 42  ? 14.760  -0.057  3.162  1.00 0.00 ? 42  GLU A OE1  5  
ATOM 7765  O OE2  . GLU A 1 42  ? 14.516  1.462   4.772  1.00 0.00 ? 42  GLU A OE2  5  
ATOM 7766  H H    . GLU A 1 42  ? 10.861  0.214   5.923  1.00 0.00 ? 42  GLU A H    5  
ATOM 7767  H HA   . GLU A 1 42  ? 10.088  0.850   3.385  1.00 0.00 ? 42  GLU A HA   5  
ATOM 7768  H HB2  . GLU A 1 42  ? 12.237  -0.855  4.598  1.00 0.00 ? 42  GLU A HB2  5  
ATOM 7769  H HB3  . GLU A 1 42  ? 11.960  -1.044  2.878  1.00 0.00 ? 42  GLU A HB3  5  
ATOM 7770  H HG2  . GLU A 1 42  ? 12.538  1.196   2.394  1.00 0.00 ? 42  GLU A HG2  5  
ATOM 7771  H HG3  . GLU A 1 42  ? 12.183  1.750   4.018  1.00 0.00 ? 42  GLU A HG3  5  
ATOM 7772  N N    . SER A 1 43  ? 9.689   -2.377  4.046  1.00 0.00 ? 43  SER A N    5  
ATOM 7773  C CA   . SER A 1 43  ? 8.938   -3.566  3.679  1.00 0.00 ? 43  SER A CA   5  
ATOM 7774  C C    . SER A 1 43  ? 7.483   -3.196  3.386  1.00 0.00 ? 43  SER A C    5  
ATOM 7775  O O    . SER A 1 43  ? 6.977   -3.465  2.298  1.00 0.00 ? 43  SER A O    5  
ATOM 7776  C CB   . SER A 1 43  ? 9.006   -4.622  4.783  1.00 0.00 ? 43  SER A CB   5  
ATOM 7777  O OG   . SER A 1 43  ? 10.086  -5.531  4.588  1.00 0.00 ? 43  SER A OG   5  
ATOM 7778  H H    . SER A 1 43  ? 10.351  -2.506  4.784  1.00 0.00 ? 43  SER A H    5  
ATOM 7779  H HA   . SER A 1 43  ? 9.424   -3.948  2.781  1.00 0.00 ? 43  SER A HA   5  
ATOM 7780  H HB2  . SER A 1 43  ? 9.117   -4.130  5.750  1.00 0.00 ? 43  SER A HB2  5  
ATOM 7781  H HB3  . SER A 1 43  ? 8.068   -5.176  4.814  1.00 0.00 ? 43  SER A HB3  5  
ATOM 7782  H HG   . SER A 1 43  ? 10.693  -5.191  3.869  1.00 0.00 ? 43  SER A HG   5  
ATOM 7783  N N    . LEU A 1 44  ? 6.850   -2.585  4.377  1.00 0.00 ? 44  LEU A N    5  
ATOM 7784  C CA   . LEU A 1 44  ? 5.462   -2.176  4.240  1.00 0.00 ? 44  LEU A CA   5  
ATOM 7785  C C    . LEU A 1 44  ? 5.324   -1.260  3.023  1.00 0.00 ? 44  LEU A C    5  
ATOM 7786  O O    . LEU A 1 44  ? 4.437   -1.455  2.192  1.00 0.00 ? 44  LEU A O    5  
ATOM 7787  C CB   . LEU A 1 44  ? 4.957   -1.551  5.541  1.00 0.00 ? 44  LEU A CB   5  
ATOM 7788  C CG   . LEU A 1 44  ? 3.481   -1.149  5.563  1.00 0.00 ? 44  LEU A CG   5  
ATOM 7789  C CD1  . LEU A 1 44  ? 2.667   -2.097  6.445  1.00 0.00 ? 44  LEU A CD1  5  
ATOM 7790  C CD2  . LEU A 1 44  ? 3.317   0.312   5.988  1.00 0.00 ? 44  LEU A CD2  5  
ATOM 7791  H H    . LEU A 1 44  ? 7.268   -2.370  5.260  1.00 0.00 ? 44  LEU A H    5  
ATOM 7792  H HA   . LEU A 1 44  ? 4.873   -3.076  4.064  1.00 0.00 ? 44  LEU A HA   5  
ATOM 7793  H HB2  . LEU A 1 44  ? 5.133   -2.257  6.353  1.00 0.00 ? 44  LEU A HB2  5  
ATOM 7794  H HB3  . LEU A 1 44  ? 5.557   -0.666  5.753  1.00 0.00 ? 44  LEU A HB3  5  
ATOM 7795  H HG   . LEU A 1 44  ? 3.088   -1.235  4.550  1.00 0.00 ? 44  LEU A HG   5  
ATOM 7796  H HD11 . LEU A 1 44  ? 1.684   -2.254  6.001  1.00 0.00 ? 44  LEU A HD11 5  
ATOM 7797  H HD12 . LEU A 1 44  ? 3.185   -3.053  6.526  1.00 0.00 ? 44  LEU A HD12 5  
ATOM 7798  H HD13 . LEU A 1 44  ? 2.552   -1.662  7.438  1.00 0.00 ? 44  LEU A HD13 5  
ATOM 7799  H HD21 . LEU A 1 44  ? 2.256   0.544   6.090  1.00 0.00 ? 44  LEU A HD21 5  
ATOM 7800  H HD22 . LEU A 1 44  ? 3.816   0.470   6.944  1.00 0.00 ? 44  LEU A HD22 5  
ATOM 7801  H HD23 . LEU A 1 44  ? 3.760   0.962   5.234  1.00 0.00 ? 44  LEU A HD23 5  
ATOM 7802  N N    . ARG A 1 45  ? 6.213   -0.280  2.955  1.00 0.00 ? 45  ARG A N    5  
ATOM 7803  C CA   . ARG A 1 45  ? 6.200   0.667   1.853  1.00 0.00 ? 45  ARG A CA   5  
ATOM 7804  C C    . ARG A 1 45  ? 6.283   -0.073  0.516  1.00 0.00 ? 45  ARG A C    5  
ATOM 7805  O O    . ARG A 1 45  ? 5.410   0.079   -0.336 1.00 0.00 ? 45  ARG A O    5  
ATOM 7806  C CB   . ARG A 1 45  ? 7.369   1.649   1.958  1.00 0.00 ? 45  ARG A CB   5  
ATOM 7807  C CG   . ARG A 1 45  ? 7.011   2.833   2.858  1.00 0.00 ? 45  ARG A CG   5  
ATOM 7808  C CD   . ARG A 1 45  ? 8.270   3.490   3.427  1.00 0.00 ? 45  ARG A CD   5  
ATOM 7809  N NE   . ARG A 1 45  ? 9.137   3.962   2.324  1.00 0.00 ? 45  ARG A NE   5  
ATOM 7810  C CZ   . ARG A 1 45  ? 10.423  4.306   2.474  1.00 0.00 ? 45  ARG A CZ   5  
ATOM 7811  N NH1  . ARG A 1 45  ? 11.000  4.234   3.681  1.00 0.00 ? 45  ARG A NH1  5  
ATOM 7812  N NH2  . ARG A 1 45  ? 11.133  4.723   1.416  1.00 0.00 ? 45  ARG A NH2  5  
ATOM 7813  H H    . ARG A 1 45  ? 6.930   -0.128  3.635  1.00 0.00 ? 45  ARG A H    5  
ATOM 7814  H HA   . ARG A 1 45  ? 5.252   1.196   1.951  1.00 0.00 ? 45  ARG A HA   5  
ATOM 7815  H HB2  . ARG A 1 45  ? 8.245   1.137   2.356  1.00 0.00 ? 45  ARG A HB2  5  
ATOM 7816  H HB3  . ARG A 1 45  ? 7.635   2.010   0.965  1.00 0.00 ? 45  ARG A HB3  5  
ATOM 7817  H HG2  . ARG A 1 45  ? 6.439   3.567   2.290  1.00 0.00 ? 45  ARG A HG2  5  
ATOM 7818  H HG3  . ARG A 1 45  ? 6.373   2.494   3.675  1.00 0.00 ? 45  ARG A HG3  5  
ATOM 7819  H HD2  . ARG A 1 45  ? 7.996   4.328   4.068  1.00 0.00 ? 45  ARG A HD2  5  
ATOM 7820  H HD3  . ARG A 1 45  ? 8.814   2.778   4.048  1.00 0.00 ? 45  ARG A HD3  5  
ATOM 7821  H HE   . ARG A 1 45  ? 8.738   4.027   1.409  1.00 0.00 ? 45  ARG A HE   5  
ATOM 7822  H HH11 . ARG A 1 45  ? 10.470  3.924   4.470  1.00 0.00 ? 45  ARG A HH11 5  
ATOM 7823  H HH12 . ARG A 1 45  ? 11.960  4.492   3.793  1.00 0.00 ? 45  ARG A HH12 5  
ATOM 7824  H HH21 . ARG A 1 45  ? 10.703  4.777   0.515  1.00 0.00 ? 45  ARG A HH21 5  
ATOM 7825  H HH22 . ARG A 1 45  ? 12.093  4.981   1.528  1.00 0.00 ? 45  ARG A HH22 5  
ATOM 7826  N N    . ASN A 1 46  ? 7.341   -0.858  0.376  1.00 0.00 ? 46  ASN A N    5  
ATOM 7827  C CA   . ASN A 1 46  ? 7.549   -1.622  -0.842 1.00 0.00 ? 46  ASN A CA   5  
ATOM 7828  C C    . ASN A 1 46  ? 6.218   -2.225  -1.295 1.00 0.00 ? 46  ASN A C    5  
ATOM 7829  O O    . ASN A 1 46  ? 6.002   -2.439  -2.487 1.00 0.00 ? 46  ASN A O    5  
ATOM 7830  C CB   . ASN A 1 46  ? 8.533   -2.771  -0.611 1.00 0.00 ? 46  ASN A CB   5  
ATOM 7831  C CG   . ASN A 1 46  ? 8.763   -3.563  -1.900 1.00 0.00 ? 46  ASN A CG   5  
ATOM 7832  O OD1  . ASN A 1 46  ? 9.554   -3.195  -2.753 1.00 0.00 ? 46  ASN A OD1  5  
ATOM 7833  N ND2  . ASN A 1 46  ? 8.031   -4.669  -1.992 1.00 0.00 ? 46  ASN A ND2  5  
ATOM 7834  H H    . ASN A 1 46  ? 8.046   -0.977  1.075  1.00 0.00 ? 46  ASN A H    5  
ATOM 7835  H HA   . ASN A 1 46  ? 7.950   -0.909  -1.563 1.00 0.00 ? 46  ASN A HA   5  
ATOM 7836  H HB2  . ASN A 1 46  ? 9.482   -2.374  -0.250 1.00 0.00 ? 46  ASN A HB2  5  
ATOM 7837  H HB3  . ASN A 1 46  ? 8.149   -3.433  0.164  1.00 0.00 ? 46  ASN A HB3  5  
ATOM 7838  H HD21 . ASN A 1 46  ? 7.400   -4.915  -1.256 1.00 0.00 ? 46  ASN A HD21 5  
ATOM 7839  H HD22 . ASN A 1 46  ? 8.110   -5.256  -2.798 1.00 0.00 ? 46  ASN A HD22 5  
ATOM 7840  N N    . TYR A 1 47  ? 5.359   -2.482  -0.320 1.00 0.00 ? 47  TYR A N    5  
ATOM 7841  C CA   . TYR A 1 47  ? 4.054   -3.055  -0.603 1.00 0.00 ? 47  TYR A CA   5  
ATOM 7842  C C    . TYR A 1 47  ? 3.028   -1.961  -0.904 1.00 0.00 ? 47  TYR A C    5  
ATOM 7843  O O    . TYR A 1 47  ? 2.354   -2.004  -1.932 1.00 0.00 ? 47  TYR A O    5  
ATOM 7844  C CB   . TYR A 1 47  ? 3.634   -3.796  0.669  1.00 0.00 ? 47  TYR A CB   5  
ATOM 7845  C CG   . TYR A 1 47  ? 2.624   -4.920  0.429  1.00 0.00 ? 47  TYR A CG   5  
ATOM 7846  C CD1  . TYR A 1 47  ? 3.062   -6.172  0.049  1.00 0.00 ? 47  TYR A CD1  5  
ATOM 7847  C CD2  . TYR A 1 47  ? 1.274   -4.681  0.593  1.00 0.00 ? 47  TYR A CD2  5  
ATOM 7848  C CE1  . TYR A 1 47  ? 2.111   -7.229  -0.176 1.00 0.00 ? 47  TYR A CE1  5  
ATOM 7849  C CE2  . TYR A 1 47  ? 0.324   -5.739  0.368  1.00 0.00 ? 47  TYR A CE2  5  
ATOM 7850  C CZ   . TYR A 1 47  ? 0.789   -6.961  -0.006 1.00 0.00 ? 47  TYR A CZ   5  
ATOM 7851  O OH   . TYR A 1 47  ? -0.109  -7.960  -0.218 1.00 0.00 ? 47  TYR A OH   5  
ATOM 7852  H H    . TYR A 1 47  ? 5.541   -2.304  0.647  1.00 0.00 ? 47  TYR A H    5  
ATOM 7853  H HA   . TYR A 1 47  ? 4.153   -3.701  -1.475 1.00 0.00 ? 47  TYR A HA   5  
ATOM 7854  H HB2  . TYR A 1 47  ? 4.522   -4.214  1.143  1.00 0.00 ? 47  TYR A HB2  5  
ATOM 7855  H HB3  . TYR A 1 47  ? 3.205   -3.079  1.369  1.00 0.00 ? 47  TYR A HB3  5  
ATOM 7856  H HD1  . TYR A 1 47  ? 4.128   -6.360  -0.080 1.00 0.00 ? 47  TYR A HD1  5  
ATOM 7857  H HD2  . TYR A 1 47  ? 0.928   -3.692  0.893  1.00 0.00 ? 47  TYR A HD2  5  
ATOM 7858  H HE1  . TYR A 1 47  ? 2.444   -8.223  -0.476 1.00 0.00 ? 47  TYR A HE1  5  
ATOM 7859  H HE2  . TYR A 1 47  ? -0.745  -5.564  0.494  1.00 0.00 ? 47  TYR A HE2  5  
ATOM 7860  H HH   . TYR A 1 47  ? 0.346   -8.745  -0.639 1.00 0.00 ? 47  TYR A HH   5  
ATOM 7861  N N    . TYR A 1 48  ? 2.941   -1.007  0.011  1.00 0.00 ? 48  TYR A N    5  
ATOM 7862  C CA   . TYR A 1 48  ? 2.009   0.096   -0.145 1.00 0.00 ? 48  TYR A CA   5  
ATOM 7863  C C    . TYR A 1 48  ? 2.656   1.260   -0.899 1.00 0.00 ? 48  TYR A C    5  
ATOM 7864  O O    . TYR A 1 48  ? 2.327   2.420   -0.658 1.00 0.00 ? 48  TYR A O    5  
ATOM 7865  C CB   . TYR A 1 48  ? 1.658   0.555   1.272  1.00 0.00 ? 48  TYR A CB   5  
ATOM 7866  C CG   . TYR A 1 48  ? 0.562   -0.275  1.942  1.00 0.00 ? 48  TYR A CG   5  
ATOM 7867  C CD1  . TYR A 1 48  ? -0.764  0.074   1.781  1.00 0.00 ? 48  TYR A CD1  5  
ATOM 7868  C CD2  . TYR A 1 48  ? 0.898   -1.374  2.707  1.00 0.00 ? 48  TYR A CD2  5  
ATOM 7869  C CE1  . TYR A 1 48  ? -1.796  -0.708  2.412  1.00 0.00 ? 48  TYR A CE1  5  
ATOM 7870  C CE2  . TYR A 1 48  ? -0.134  -2.156  3.337  1.00 0.00 ? 48  TYR A CE2  5  
ATOM 7871  C CZ   . TYR A 1 48  ? -1.430  -1.784  3.159  1.00 0.00 ? 48  TYR A CZ   5  
ATOM 7872  O OH   . TYR A 1 48  ? -2.405  -2.522  3.754  1.00 0.00 ? 48  TYR A OH   5  
ATOM 7873  H H    . TYR A 1 48  ? 3.493   -0.980  0.844  1.00 0.00 ? 48  TYR A H    5  
ATOM 7874  H HA   . TYR A 1 48  ? 1.152   -0.265  -0.714 1.00 0.00 ? 48  TYR A HA   5  
ATOM 7875  H HB2  . TYR A 1 48  ? 2.557   0.516   1.888  1.00 0.00 ? 48  TYR A HB2  5  
ATOM 7876  H HB3  . TYR A 1 48  ? 1.341   1.597   1.238  1.00 0.00 ? 48  TYR A HB3  5  
ATOM 7877  H HD1  . TYR A 1 48  ? -1.029  0.941   1.177  1.00 0.00 ? 48  TYR A HD1  5  
ATOM 7878  H HD2  . TYR A 1 48  ? 1.945   -1.650  2.834  1.00 0.00 ? 48  TYR A HD2  5  
ATOM 7879  H HE1  . TYR A 1 48  ? -2.846  -0.443  2.293  1.00 0.00 ? 48  TYR A HE1  5  
ATOM 7880  H HE2  . TYR A 1 48  ? 0.117   -3.025  3.944  1.00 0.00 ? 48  TYR A HE2  5  
ATOM 7881  H HH   . TYR A 1 48  ? -2.153  -3.490  3.748  1.00 0.00 ? 48  TYR A HH   5  
ATOM 7882  N N    . GLU A 1 49  ? 3.564   0.908   -1.797 1.00 0.00 ? 49  GLU A N    5  
ATOM 7883  C CA   . GLU A 1 49  ? 4.260   1.908   -2.589 1.00 0.00 ? 49  GLU A CA   5  
ATOM 7884  C C    . GLU A 1 49  ? 3.607   2.044   -3.966 1.00 0.00 ? 49  GLU A C    5  
ATOM 7885  O O    . GLU A 1 49  ? 3.624   3.121   -4.561 1.00 0.00 ? 49  GLU A O    5  
ATOM 7886  C CB   . GLU A 1 49  ? 5.746   1.568   -2.718 1.00 0.00 ? 49  GLU A CB   5  
ATOM 7887  C CG   . GLU A 1 49  ? 6.598   2.494   -1.847 1.00 0.00 ? 49  GLU A CG   5  
ATOM 7888  C CD   . GLU A 1 49  ? 7.858   2.940   -2.591 1.00 0.00 ? 49  GLU A CD   5  
ATOM 7889  O OE1  . GLU A 1 49  ? 8.776   2.099   -2.709 1.00 0.00 ? 49  GLU A OE1  5  
ATOM 7890  O OE2  . GLU A 1 49  ? 7.876   4.113   -3.025 1.00 0.00 ? 49  GLU A OE2  5  
ATOM 7891  H H    . GLU A 1 49  ? 3.825   -0.038  -1.988 1.00 0.00 ? 49  GLU A H    5  
ATOM 7892  H HA   . GLU A 1 49  ? 4.154   2.841   -2.035 1.00 0.00 ? 49  GLU A HA   5  
ATOM 7893  H HB2  . GLU A 1 49  ? 5.913   0.532   -2.424 1.00 0.00 ? 49  GLU A HB2  5  
ATOM 7894  H HB3  . GLU A 1 49  ? 6.054   1.657   -3.759 1.00 0.00 ? 49  GLU A HB3  5  
ATOM 7895  H HG2  . GLU A 1 49  ? 6.014   3.367   -1.558 1.00 0.00 ? 49  GLU A HG2  5  
ATOM 7896  H HG3  . GLU A 1 49  ? 6.878   1.979   -0.928 1.00 0.00 ? 49  GLU A HG3  5  
ATOM 7897  N N    . GLN A 1 50  ? 3.047   0.938   -4.432 1.00 0.00 ? 50  GLN A N    5  
ATOM 7898  C CA   . GLN A 1 50  ? 2.390   0.920   -5.727 1.00 0.00 ? 50  GLN A CA   5  
ATOM 7899  C C    . GLN A 1 50  ? 1.125   1.781   -5.693 1.00 0.00 ? 50  GLN A C    5  
ATOM 7900  O O    . GLN A 1 50  ? 0.953   2.671   -6.524 1.00 0.00 ? 50  GLN A O    5  
ATOM 7901  C CB   . GLN A 1 50  ? 2.067   -0.512  -6.159 1.00 0.00 ? 50  GLN A CB   5  
ATOM 7902  C CG   . GLN A 1 50  ? 1.099   -1.175  -5.178 1.00 0.00 ? 50  GLN A CG   5  
ATOM 7903  C CD   . GLN A 1 50  ? 1.090   -2.694  -5.360 1.00 0.00 ? 50  GLN A CD   5  
ATOM 7904  O OE1  . GLN A 1 50  ? 1.298   -3.217  -6.443 1.00 0.00 ? 50  GLN A OE1  5  
ATOM 7905  N NE2  . GLN A 1 50  ? 0.837   -3.371  -4.243 1.00 0.00 ? 50  GLN A NE2  5  
ATOM 7906  H H    . GLN A 1 50  ? 3.038   0.066   -3.941 1.00 0.00 ? 50  GLN A H    5  
ATOM 7907  H HA   . GLN A 1 50  ? 3.111   1.349   -6.424 1.00 0.00 ? 50  GLN A HA   5  
ATOM 7908  H HB2  . GLN A 1 50  ? 1.631   -0.505  -7.158 1.00 0.00 ? 50  GLN A HB2  5  
ATOM 7909  H HB3  . GLN A 1 50  ? 2.987   -1.094  -6.218 1.00 0.00 ? 50  GLN A HB3  5  
ATOM 7910  H HG2  . GLN A 1 50  ? 1.387   -0.930  -4.156 1.00 0.00 ? 50  GLN A HG2  5  
ATOM 7911  H HG3  . GLN A 1 50  ? 0.095   -0.781  -5.330 1.00 0.00 ? 50  GLN A HG3  5  
ATOM 7912  H HE21 . GLN A 1 50  ? 0.675   -2.881  -3.387 1.00 0.00 ? 50  GLN A HE21 5  
ATOM 7913  H HE22 . GLN A 1 50  ? 0.809   -4.371  -4.260 1.00 0.00 ? 50  GLN A HE22 5  
ATOM 7914  N N    . TRP A 1 51  ? 0.273   1.485   -4.722 1.00 0.00 ? 51  TRP A N    5  
ATOM 7915  C CA   . TRP A 1 51  ? -0.971  2.220   -4.568 1.00 0.00 ? 51  TRP A CA   5  
ATOM 7916  C C    . TRP A 1 51  ? -0.630  3.708   -4.461 1.00 0.00 ? 51  TRP A C    5  
ATOM 7917  O O    . TRP A 1 51  ? -1.478  4.562   -4.713 1.00 0.00 ? 51  TRP A O    5  
ATOM 7918  C CB   . TRP A 1 51  ? -1.769  1.702   -3.371 1.00 0.00 ? 51  TRP A CB   5  
ATOM 7919  C CG   . TRP A 1 51  ? -2.201  0.239   -3.496 1.00 0.00 ? 51  TRP A CG   5  
ATOM 7920  C CD1  . TRP A 1 51  ? -2.896  -0.334  -4.488 1.00 0.00 ? 51  TRP A CD1  5  
ATOM 7921  C CD2  . TRP A 1 51  ? -1.935  -0.819  -2.552 1.00 0.00 ? 51  TRP A CD2  5  
ATOM 7922  N NE1  . TRP A 1 51  ? -3.097  -1.679  -4.254 1.00 0.00 ? 51  TRP A NE1  5  
ATOM 7923  C CE2  . TRP A 1 51  ? -2.494  -1.983  -3.039 1.00 0.00 ? 51  TRP A CE2  5  
ATOM 7924  C CE3  . TRP A 1 51  ? -1.245  -0.794  -1.328 1.00 0.00 ? 51  TRP A CE3  5  
ATOM 7925  C CZ2  . TRP A 1 51  ? -2.420  -3.209  -2.366 1.00 0.00 ? 51  TRP A CZ2  5  
ATOM 7926  C CZ3  . TRP A 1 51  ? -1.180  -2.027  -0.667 1.00 0.00 ? 51  TRP A CZ3  5  
ATOM 7927  C CH2  . TRP A 1 51  ? -1.738  -3.208  -1.143 1.00 0.00 ? 51  TRP A CH2  5  
ATOM 7928  H H    . TRP A 1 51  ? 0.421   0.759   -4.050 1.00 0.00 ? 51  TRP A H    5  
ATOM 7929  H HA   . TRP A 1 51  ? -1.576  2.039   -5.456 1.00 0.00 ? 51  TRP A HA   5  
ATOM 7930  H HB2  . TRP A 1 51  ? -1.168  1.817   -2.469 1.00 0.00 ? 51  TRP A HB2  5  
ATOM 7931  H HB3  . TRP A 1 51  ? -2.657  2.322   -3.243 1.00 0.00 ? 51  TRP A HB3  5  
ATOM 7932  H HD1  . TRP A 1 51  ? -3.257  0.196   -5.370 1.00 0.00 ? 51  TRP A HD1  5  
ATOM 7933  H HE1  . TRP A 1 51  ? -3.630  -2.374  -4.902 1.00 0.00 ? 51  TRP A HE1  5  
ATOM 7934  H HE3  . TRP A 1 51  ? -0.795  0.112   -0.922 1.00 0.00 ? 51  TRP A HE3  5  
ATOM 7935  H HZ2  . TRP A 1 51  ? -2.871  -4.115  -2.771 1.00 0.00 ? 51  TRP A HZ2  5  
ATOM 7936  H HZ3  . TRP A 1 51  ? -0.656  -2.063  0.288  1.00 0.00 ? 51  TRP A HZ3  5  
ATOM 7937  H HH2  . TRP A 1 51  ? -1.644  -4.129  -0.568 1.00 0.00 ? 51  TRP A HH2  5  
ATOM 7938  N N    . GLY A 1 52  ? 0.613   3.972   -4.087 1.00 0.00 ? 52  GLY A N    5  
ATOM 7939  C CA   . GLY A 1 52  ? 1.076   5.342   -3.944 1.00 0.00 ? 52  GLY A CA   5  
ATOM 7940  C C    . GLY A 1 52  ? 2.380   5.399   -3.145 1.00 0.00 ? 52  GLY A C    5  
ATOM 7941  O O    . GLY A 1 52  ? 2.737   4.439   -2.464 1.00 0.00 ? 52  GLY A O    5  
ATOM 7942  H H    . GLY A 1 52  ? 1.297   3.271   -3.885 1.00 0.00 ? 52  GLY A H    5  
ATOM 7943  H HA2  . GLY A 1 52  ? 1.230   5.783   -4.929 1.00 0.00 ? 52  GLY A HA2  5  
ATOM 7944  H HA3  . GLY A 1 52  ? 0.313   5.937   -3.444 1.00 0.00 ? 52  GLY A HA3  5  
ATOM 7945  N N    . LYS A 1 53  ? 3.054   6.534   -3.254 1.00 0.00 ? 53  LYS A N    5  
ATOM 7946  C CA   . LYS A 1 53  ? 4.311   6.729   -2.550 1.00 0.00 ? 53  LYS A CA   5  
ATOM 7947  C C    . LYS A 1 53  ? 4.026   7.281   -1.152 1.00 0.00 ? 53  LYS A C    5  
ATOM 7948  O O    . LYS A 1 53  ? 3.592   8.423   -1.008 1.00 0.00 ? 53  LYS A O    5  
ATOM 7949  C CB   . LYS A 1 53  ? 5.257   7.603   -3.376 1.00 0.00 ? 53  LYS A CB   5  
ATOM 7950  C CG   . LYS A 1 53  ? 6.163   6.745   -4.261 1.00 0.00 ? 53  LYS A CG   5  
ATOM 7951  C CD   . LYS A 1 53  ? 6.209   7.289   -5.690 1.00 0.00 ? 53  LYS A CD   5  
ATOM 7952  C CE   . LYS A 1 53  ? 4.950   6.900   -6.466 1.00 0.00 ? 53  LYS A CE   5  
ATOM 7953  N NZ   . LYS A 1 53  ? 5.296   6.496   -7.848 1.00 0.00 ? 53  LYS A NZ   5  
ATOM 7954  H H    . LYS A 1 53  ? 2.757   7.310   -3.810 1.00 0.00 ? 53  LYS A H    5  
ATOM 7955  H HA   . LYS A 1 53  ? 4.782   5.752   -2.447 1.00 0.00 ? 53  LYS A HA   5  
ATOM 7956  H HB2  . LYS A 1 53  ? 4.679   8.287   -3.997 1.00 0.00 ? 53  LYS A HB2  5  
ATOM 7957  H HB3  . LYS A 1 53  ? 5.867   8.214   -2.711 1.00 0.00 ? 53  LYS A HB3  5  
ATOM 7958  H HG2  . LYS A 1 53  ? 7.170   6.723   -3.844 1.00 0.00 ? 53  LYS A HG2  5  
ATOM 7959  H HG3  . LYS A 1 53  ? 5.800   5.717   -4.272 1.00 0.00 ? 53  LYS A HG3  5  
ATOM 7960  H HD2  . LYS A 1 53  ? 6.305   8.375   -5.666 1.00 0.00 ? 53  LYS A HD2  5  
ATOM 7961  H HD3  . LYS A 1 53  ? 7.091   6.903   -6.202 1.00 0.00 ? 53  LYS A HD3  5  
ATOM 7962  H HE2  . LYS A 1 53  ? 4.442   6.080   -5.958 1.00 0.00 ? 53  LYS A HE2  5  
ATOM 7963  H HE3  . LYS A 1 53  ? 4.255   7.739   -6.490 1.00 0.00 ? 53  LYS A HE3  5  
ATOM 7964  H HZ1  . LYS A 1 53  ? 6.286   6.564   -7.976 1.00 0.00 ? 53  LYS A HZ1  5  
ATOM 7965  H HZ2  . LYS A 1 53  ? 5.004   5.552   -8.002 1.00 0.00 ? 53  LYS A HZ2  5  
ATOM 7966  H HZ3  . LYS A 1 53  ? 4.833   7.099   -8.497 1.00 0.00 ? 53  LYS A HZ3  5  
ATOM 7967  N N    . LEU A 1 54  ? 4.283   6.445   -0.157 1.00 0.00 ? 54  LEU A N    5  
ATOM 7968  C CA   . LEU A 1 54  ? 4.060   6.835   1.225  1.00 0.00 ? 54  LEU A CA   5  
ATOM 7969  C C    . LEU A 1 54  ? 5.056   7.932   1.607  1.00 0.00 ? 54  LEU A C    5  
ATOM 7970  O O    . LEU A 1 54  ? 6.212   7.645   1.917  1.00 0.00 ? 54  LEU A O    5  
ATOM 7971  C CB   . LEU A 1 54  ? 4.110   5.612   2.142  1.00 0.00 ? 54  LEU A CB   5  
ATOM 7972  C CG   . LEU A 1 54  ? 3.335   4.382   1.662  1.00 0.00 ? 54  LEU A CG   5  
ATOM 7973  C CD1  . LEU A 1 54  ? 3.436   3.241   2.676  1.00 0.00 ? 54  LEU A CD1  5  
ATOM 7974  C CD2  . LEU A 1 54  ? 1.882   4.739   1.343  1.00 0.00 ? 54  LEU A CD2  5  
ATOM 7975  H H    . LEU A 1 54  ? 4.636   5.518   -0.283 1.00 0.00 ? 54  LEU A H    5  
ATOM 7976  H HA   . LEU A 1 54  ? 3.052   7.246   1.290  1.00 0.00 ? 54  LEU A HA   5  
ATOM 7977  H HB2  . LEU A 1 54  ? 5.153   5.328   2.280  1.00 0.00 ? 54  LEU A HB2  5  
ATOM 7978  H HB3  . LEU A 1 54  ? 3.725   5.900   3.120  1.00 0.00 ? 54  LEU A HB3  5  
ATOM 7979  H HG   . LEU A 1 54  ? 3.791   4.031   0.736  1.00 0.00 ? 54  LEU A HG   5  
ATOM 7980  H HD11 . LEU A 1 54  ? 3.163   3.609   3.665  1.00 0.00 ? 54  LEU A HD11 5  
ATOM 7981  H HD12 . LEU A 1 54  ? 2.758   2.438   2.388  1.00 0.00 ? 54  LEU A HD12 5  
ATOM 7982  H HD13 . LEU A 1 54  ? 4.458   2.863   2.698  1.00 0.00 ? 54  LEU A HD13 5  
ATOM 7983  H HD21 . LEU A 1 54  ? 1.703   5.786   1.589  1.00 0.00 ? 54  LEU A HD21 5  
ATOM 7984  H HD22 . LEU A 1 54  ? 1.693   4.578   0.282  1.00 0.00 ? 54  LEU A HD22 5  
ATOM 7985  H HD23 . LEU A 1 54  ? 1.216   4.108   1.931  1.00 0.00 ? 54  LEU A HD23 5  
ATOM 7986  N N    . THR A 1 55  ? 4.572   9.165   1.574  1.00 0.00 ? 55  THR A N    5  
ATOM 7987  C CA   . THR A 1 55  ? 5.406   10.305  1.914  1.00 0.00 ? 55  THR A CA   5  
ATOM 7988  C C    . THR A 1 55  ? 6.062   10.098  3.281  1.00 0.00 ? 55  THR A C    5  
ATOM 7989  O O    . THR A 1 55  ? 7.099   10.691  3.572  1.00 0.00 ? 55  THR A O    5  
ATOM 7990  C CB   . THR A 1 55  ? 4.538   11.563  1.840  1.00 0.00 ? 55  THR A CB   5  
ATOM 7991  O OG1  . THR A 1 55  ? 3.479   11.309  2.759  1.00 0.00 ? 55  THR A OG1  5  
ATOM 7992  C CG2  . THR A 1 55  ? 3.834   11.711  0.490  1.00 0.00 ? 55  THR A CG2  5  
ATOM 7993  H H    . THR A 1 55  ? 3.631   9.389   1.322  1.00 0.00 ? 55  THR A H    5  
ATOM 7994  H HA   . THR A 1 55  ? 6.209   10.374  1.181  1.00 0.00 ? 55  THR A HA   5  
ATOM 7995  H HB   . THR A 1 55  ? 5.123   12.453  2.074  1.00 0.00 ? 55  THR A HB   5  
ATOM 7996  H HG1  . THR A 1 55  ? 3.802   11.436  3.697  1.00 0.00 ? 55  THR A HG1  5  
ATOM 7997  H HG21 . THR A 1 55  ? 2.790   11.980  0.653  1.00 0.00 ? 55  THR A HG21 5  
ATOM 7998  H HG22 . THR A 1 55  ? 4.324   12.491  -0.092 1.00 0.00 ? 55  THR A HG22 5  
ATOM 7999  H HG23 . THR A 1 55  ? 3.886   10.767  -0.052 1.00 0.00 ? 55  THR A HG23 5  
ATOM 8000  N N    . ASP A 1 56  ? 5.429   9.255   4.083  1.00 0.00 ? 56  ASP A N    5  
ATOM 8001  C CA   . ASP A 1 56  ? 5.938   8.962   5.412  1.00 0.00 ? 56  ASP A CA   5  
ATOM 8002  C C    . ASP A 1 56  ? 5.316   7.658   5.916  1.00 0.00 ? 56  ASP A C    5  
ATOM 8003  O O    . ASP A 1 56  ? 4.098   7.493   5.881  1.00 0.00 ? 56  ASP A O    5  
ATOM 8004  C CB   . ASP A 1 56  ? 5.572   10.073  6.399  1.00 0.00 ? 56  ASP A CB   5  
ATOM 8005  C CG   . ASP A 1 56  ? 6.751   10.659  7.178  1.00 0.00 ? 56  ASP A CG   5  
ATOM 8006  O OD1  . ASP A 1 56  ? 7.849   10.722  6.584  1.00 0.00 ? 56  ASP A OD1  5  
ATOM 8007  O OD2  . ASP A 1 56  ? 6.528   11.031  8.351  1.00 0.00 ? 56  ASP A OD2  5  
ATOM 8008  H H    . ASP A 1 56  ? 4.586   8.776   3.839  1.00 0.00 ? 56  ASP A H    5  
ATOM 8009  H HA   . ASP A 1 56  ? 7.019   8.891   5.296  1.00 0.00 ? 56  ASP A HA   5  
ATOM 8010  H HB2  . ASP A 1 56  ? 5.082   10.878  5.851  1.00 0.00 ? 56  ASP A HB2  5  
ATOM 8011  H HB3  . ASP A 1 56  ? 4.845   9.682   7.110  1.00 0.00 ? 56  ASP A HB3  5  
ATOM 8012  N N    . CYS A 1 57  ? 6.181   6.766   6.374  1.00 0.00 ? 57  CYS A N    5  
ATOM 8013  C CA   . CYS A 1 57  ? 5.732   5.482   6.885  1.00 0.00 ? 57  CYS A CA   5  
ATOM 8014  C C    . CYS A 1 57  ? 6.329   5.284   8.280  1.00 0.00 ? 57  CYS A C    5  
ATOM 8015  O O    . CYS A 1 57  ? 7.549   5.247   8.437  1.00 0.00 ? 57  CYS A O    5  
ATOM 8016  C CB   . CYS A 1 57  ? 6.100   4.337   5.939  1.00 0.00 ? 57  CYS A CB   5  
ATOM 8017  S SG   . CYS A 1 57  ? 5.347   2.775   6.524  1.00 0.00 ? 57  CYS A SG   5  
ATOM 8018  H H    . CYS A 1 57  ? 7.171   6.908   6.400  1.00 0.00 ? 57  CYS A H    5  
ATOM 8019  H HA   . CYS A 1 57  ? 4.644   5.527   6.932  1.00 0.00 ? 57  CYS A HA   5  
ATOM 8020  H HB2  . CYS A 1 57  ? 5.753   4.562   4.930  1.00 0.00 ? 57  CYS A HB2  5  
ATOM 8021  H HB3  . CYS A 1 57  ? 7.183   4.230   5.887  1.00 0.00 ? 57  CYS A HB3  5  
ATOM 8022  H HG   . CYS A 1 57  ? 4.598   3.329   7.474  1.00 0.00 ? 57  CYS A HG   5  
ATOM 8023  N N    . VAL A 1 58  ? 5.442   5.161   9.256  1.00 0.00 ? 58  VAL A N    5  
ATOM 8024  C CA   . VAL A 1 58  ? 5.866   4.968   10.632 1.00 0.00 ? 58  VAL A CA   5  
ATOM 8025  C C    . VAL A 1 58  ? 5.348   3.619   11.136 1.00 0.00 ? 58  VAL A C    5  
ATOM 8026  O O    . VAL A 1 58  ? 4.187   3.276   10.921 1.00 0.00 ? 58  VAL A O    5  
ATOM 8027  C CB   . VAL A 1 58  ? 5.404   6.145   11.493 1.00 0.00 ? 58  VAL A CB   5  
ATOM 8028  C CG1  . VAL A 1 58  ? 5.325   5.748   12.968 1.00 0.00 ? 58  VAL A CG1  5  
ATOM 8029  C CG2  . VAL A 1 58  ? 6.317   7.358   11.299 1.00 0.00 ? 58  VAL A CG2  5  
ATOM 8030  H H    . VAL A 1 58  ? 4.452   5.192   9.119  1.00 0.00 ? 58  VAL A H    5  
ATOM 8031  H HA   . VAL A 1 58  ? 6.956   4.951   10.641 1.00 0.00 ? 58  VAL A HA   5  
ATOM 8032  H HB   . VAL A 1 58  ? 4.402   6.425   11.167 1.00 0.00 ? 58  VAL A HB   5  
ATOM 8033  H HG11 . VAL A 1 58  ? 4.283   5.588   13.246 1.00 0.00 ? 58  VAL A HG11 5  
ATOM 8034  H HG12 . VAL A 1 58  ? 5.889   4.830   13.128 1.00 0.00 ? 58  VAL A HG12 5  
ATOM 8035  H HG13 . VAL A 1 58  ? 5.745   6.545   13.582 1.00 0.00 ? 58  VAL A HG13 5  
ATOM 8036  H HG21 . VAL A 1 58  ? 7.325   7.019   11.063 1.00 0.00 ? 58  VAL A HG21 5  
ATOM 8037  H HG22 . VAL A 1 58  ? 5.938   7.970   10.481 1.00 0.00 ? 58  VAL A HG22 5  
ATOM 8038  H HG23 . VAL A 1 58  ? 6.336   7.948   12.215 1.00 0.00 ? 58  VAL A HG23 5  
ATOM 8039  N N    . VAL A 1 59  ? 6.235   2.891   11.799 1.00 0.00 ? 59  VAL A N    5  
ATOM 8040  C CA   . VAL A 1 59  ? 5.882   1.588   12.335 1.00 0.00 ? 59  VAL A CA   5  
ATOM 8041  C C    . VAL A 1 59  ? 6.166   1.566   13.839 1.00 0.00 ? 59  VAL A C    5  
ATOM 8042  O O    . VAL A 1 59  ? 7.319   1.651   14.258 1.00 0.00 ? 59  VAL A O    5  
ATOM 8043  C CB   . VAL A 1 59  ? 6.624   0.489   11.571 1.00 0.00 ? 59  VAL A CB   5  
ATOM 8044  C CG1  . VAL A 1 59  ? 8.132   0.573   11.815 1.00 0.00 ? 59  VAL A CG1  5  
ATOM 8045  C CG2  . VAL A 1 59  ? 6.085   -0.895  11.940 1.00 0.00 ? 59  VAL A CG2  5  
ATOM 8046  H H    . VAL A 1 59  ? 7.178   3.177   11.970 1.00 0.00 ? 59  VAL A H    5  
ATOM 8047  H HA   . VAL A 1 59  ? 4.813   1.446   12.178 1.00 0.00 ? 59  VAL A HA   5  
ATOM 8048  H HB   . VAL A 1 59  ? 6.447   0.644   10.507 1.00 0.00 ? 59  VAL A HB   5  
ATOM 8049  H HG11 . VAL A 1 59  ? 8.657   0.541   10.860 1.00 0.00 ? 59  VAL A HG11 5  
ATOM 8050  H HG12 . VAL A 1 59  ? 8.365   1.507   12.327 1.00 0.00 ? 59  VAL A HG12 5  
ATOM 8051  H HG13 . VAL A 1 59  ? 8.447   -0.268  12.432 1.00 0.00 ? 59  VAL A HG13 5  
ATOM 8052  H HG21 . VAL A 1 59  ? 6.731   -1.348  12.692 1.00 0.00 ? 59  VAL A HG21 5  
ATOM 8053  H HG22 . VAL A 1 59  ? 5.075   -0.797  12.340 1.00 0.00 ? 59  VAL A HG22 5  
ATOM 8054  H HG23 . VAL A 1 59  ? 6.064   -1.526  11.051 1.00 0.00 ? 59  VAL A HG23 5  
ATOM 8055  N N    . MET A 1 60  ? 5.094   1.451   14.609 1.00 0.00 ? 60  MET A N    5  
ATOM 8056  C CA   . MET A 1 60  ? 5.213   1.417   16.057 1.00 0.00 ? 60  MET A CA   5  
ATOM 8057  C C    . MET A 1 60  ? 5.917   0.140   16.519 1.00 0.00 ? 60  MET A C    5  
ATOM 8058  O O    . MET A 1 60  ? 5.726   -0.925  15.934 1.00 0.00 ? 60  MET A O    5  
ATOM 8059  C CB   . MET A 1 60  ? 3.820   1.489   16.686 1.00 0.00 ? 60  MET A CB   5  
ATOM 8060  C CG   . MET A 1 60  ? 3.240   2.900   16.573 1.00 0.00 ? 60  MET A CG   5  
ATOM 8061  S SD   . MET A 1 60  ? 4.286   4.062   17.435 1.00 0.00 ? 60  MET A SD   5  
ATOM 8062  C CE   . MET A 1 60  ? 5.220   4.716   16.061 1.00 0.00 ? 60  MET A CE   5  
ATOM 8063  H H    . MET A 1 60  ? 4.159   1.383   14.260 1.00 0.00 ? 60  MET A H    5  
ATOM 8064  H HA   . MET A 1 60  ? 5.813   2.288   16.321 1.00 0.00 ? 60  MET A HA   5  
ATOM 8065  H HB2  . MET A 1 60  ? 3.157   0.779   16.192 1.00 0.00 ? 60  MET A HB2  5  
ATOM 8066  H HB3  . MET A 1 60  ? 3.875   1.197   17.734 1.00 0.00 ? 60  MET A HB3  5  
ATOM 8067  H HG2  . MET A 1 60  ? 3.154   3.185   15.524 1.00 0.00 ? 60  MET A HG2  5  
ATOM 8068  H HG3  . MET A 1 60  ? 2.234   2.923   16.992 1.00 0.00 ? 60  MET A HG3  5  
ATOM 8069  H HE1  . MET A 1 60  ? 5.213   3.997   15.242 1.00 0.00 ? 60  MET A HE1  5  
ATOM 8070  H HE2  . MET A 1 60  ? 4.770   5.651   15.728 1.00 0.00 ? 60  MET A HE2  5  
ATOM 8071  H HE3  . MET A 1 60  ? 6.248   4.899   16.376 1.00 0.00 ? 60  MET A HE3  5  
ATOM 8072  N N    . ARG A 1 61  ? 6.716   0.289   17.565 1.00 0.00 ? 61  ARG A N    5  
ATOM 8073  C CA   . ARG A 1 61  ? 7.450   -0.840  18.113 1.00 0.00 ? 61  ARG A CA   5  
ATOM 8074  C C    . ARG A 1 61  ? 7.323   -0.866  19.638 1.00 0.00 ? 61  ARG A C    5  
ATOM 8075  O O    . ARG A 1 61  ? 7.198   0.181   20.271 1.00 0.00 ? 61  ARG A O    5  
ATOM 8076  C CB   . ARG A 1 61  ? 8.930   -0.772  17.732 1.00 0.00 ? 61  ARG A CB   5  
ATOM 8077  C CG   . ARG A 1 61  ? 9.100   -0.413  16.255 1.00 0.00 ? 61  ARG A CG   5  
ATOM 8078  C CD   . ARG A 1 61  ? 10.521  0.077   15.969 1.00 0.00 ? 61  ARG A CD   5  
ATOM 8079  N NE   . ARG A 1 61  ? 10.604  1.539   16.179 1.00 0.00 ? 61  ARG A NE   5  
ATOM 8080  C CZ   . ARG A 1 61  ? 11.702  2.271   15.944 1.00 0.00 ? 61  ARG A CZ   5  
ATOM 8081  N NH1  . ARG A 1 61  ? 12.816  1.681   15.491 1.00 0.00 ? 61  ARG A NH1  5  
ATOM 8082  N NH2  . ARG A 1 61  ? 11.685  3.593   16.162 1.00 0.00 ? 61  ARG A NH2  5  
ATOM 8083  H H    . ARG A 1 61  ? 6.866   1.158   18.036 1.00 0.00 ? 61  ARG A H    5  
ATOM 8084  H HA   . ARG A 1 61  ? 6.984   -1.718  17.666 1.00 0.00 ? 61  ARG A HA   5  
ATOM 8085  H HB2  . ARG A 1 61  ? 9.434   -0.030  18.351 1.00 0.00 ? 61  ARG A HB2  5  
ATOM 8086  H HB3  . ARG A 1 61  ? 9.406   -1.731  17.934 1.00 0.00 ? 61  ARG A HB3  5  
ATOM 8087  H HG2  . ARG A 1 61  ? 8.881   -1.285  15.638 1.00 0.00 ? 61  ARG A HG2  5  
ATOM 8088  H HG3  . ARG A 1 61  ? 8.383   0.360   15.979 1.00 0.00 ? 61  ARG A HG3  5  
ATOM 8089  H HD2  . ARG A 1 61  ? 11.228  -0.433  16.623 1.00 0.00 ? 61  ARG A HD2  5  
ATOM 8090  H HD3  . ARG A 1 61  ? 10.801  -0.169  14.945 1.00 0.00 ? 61  ARG A HD3  5  
ATOM 8091  H HE   . ARG A 1 61  ? 9.790   2.011   16.516 1.00 0.00 ? 61  ARG A HE   5  
ATOM 8092  H HH11 . ARG A 1 61  ? 12.828  0.694   15.328 1.00 0.00 ? 61  ARG A HH11 5  
ATOM 8093  H HH12 . ARG A 1 61  ? 13.635  2.227   15.316 1.00 0.00 ? 61  ARG A HH12 5  
ATOM 8094  H HH21 . ARG A 1 61  ? 10.854  4.034   16.500 1.00 0.00 ? 61  ARG A HH21 5  
ATOM 8095  H HH22 . ARG A 1 61  ? 12.504  4.139   15.987 1.00 0.00 ? 61  ARG A HH22 5  
ATOM 8096  N N    . ASP A 1 62  ? 7.360   -2.073  20.182 1.00 0.00 ? 62  ASP A N    5  
ATOM 8097  C CA   . ASP A 1 62  ? 7.251   -2.249  21.620 1.00 0.00 ? 62  ASP A CA   5  
ATOM 8098  C C    . ASP A 1 62  ? 8.081   -1.175  22.326 1.00 0.00 ? 62  ASP A C    5  
ATOM 8099  O O    . ASP A 1 62  ? 9.226   -0.925  21.952 1.00 0.00 ? 62  ASP A O    5  
ATOM 8100  C CB   . ASP A 1 62  ? 7.785   -3.617  22.050 1.00 0.00 ? 62  ASP A CB   5  
ATOM 8101  C CG   . ASP A 1 62  ? 7.087   -4.815  21.403 1.00 0.00 ? 62  ASP A CG   5  
ATOM 8102  O OD1  . ASP A 1 62  ? 5.871   -4.693  21.145 1.00 0.00 ? 62  ASP A OD1  5  
ATOM 8103  O OD2  . ASP A 1 62  ? 7.787   -5.827  21.181 1.00 0.00 ? 62  ASP A OD2  5  
ATOM 8104  H H    . ASP A 1 62  ? 7.462   -2.919  19.659 1.00 0.00 ? 62  ASP A H    5  
ATOM 8105  H HA   . ASP A 1 62  ? 6.186   -2.164  21.839 1.00 0.00 ? 62  ASP A HA   5  
ATOM 8106  H HB2  . ASP A 1 62  ? 8.848   -3.665  21.816 1.00 0.00 ? 62  ASP A HB2  5  
ATOM 8107  H HB3  . ASP A 1 62  ? 7.692   -3.703  23.133 1.00 0.00 ? 62  ASP A HB3  5  
ATOM 8108  N N    . PRO A 1 63  ? 7.455   -0.551  23.360 1.00 0.00 ? 63  PRO A N    5  
ATOM 8109  C CA   . PRO A 1 63  ? 8.124   0.491   24.120 1.00 0.00 ? 63  PRO A CA   5  
ATOM 8110  C C    . PRO A 1 63  ? 9.168   -0.106  25.067 1.00 0.00 ? 63  PRO A C    5  
ATOM 8111  O O    . PRO A 1 63  ? 9.972   0.622   25.648 1.00 0.00 ? 63  PRO A O    5  
ATOM 8112  C CB   . PRO A 1 63  ? 7.009   1.221   24.851 1.00 0.00 ? 63  PRO A CB   5  
ATOM 8113  C CG   . PRO A 1 63  ? 5.816   0.279   24.840 1.00 0.00 ? 63  PRO A CG   5  
ATOM 8114  C CD   . PRO A 1 63  ? 6.099   -0.820  23.830 1.00 0.00 ? 63  PRO A CD   5  
ATOM 8115  H HA   . PRO A 1 63  ? 8.627   1.100   23.507 1.00 0.00 ? 63  PRO A HA   5  
ATOM 8116  H HB2  . PRO A 1 63  ? 7.305   1.466   25.871 1.00 0.00 ? 63  PRO A HB2  5  
ATOM 8117  H HB3  . PRO A 1 63  ? 6.768   2.162   24.355 1.00 0.00 ? 63  PRO A HB3  5  
ATOM 8118  H HG2  . PRO A 1 63  ? 5.656   -0.145  25.831 1.00 0.00 ? 63  PRO A HG2  5  
ATOM 8119  H HG3  . PRO A 1 63  ? 4.907   0.818   24.574 1.00 0.00 ? 63  PRO A HG3  5  
ATOM 8120  H HD2  . PRO A 1 63  ? 6.028   -1.807  24.288 1.00 0.00 ? 63  PRO A HD2  5  
ATOM 8121  H HD3  . PRO A 1 63  ? 5.383   -0.797  23.008 1.00 0.00 ? 63  PRO A HD3  5  
ATOM 8122  N N    . ALA A 1 64  ? 9.121   -1.424  25.193 1.00 0.00 ? 64  ALA A N    5  
ATOM 8123  C CA   . ALA A 1 64  ? 10.053  -2.126  26.058 1.00 0.00 ? 64  ALA A CA   5  
ATOM 8124  C C    . ALA A 1 64  ? 10.990  -2.982  25.204 1.00 0.00 ? 64  ALA A C    5  
ATOM 8125  O O    . ALA A 1 64  ? 12.191  -3.042  25.464 1.00 0.00 ? 64  ALA A O    5  
ATOM 8126  C CB   . ALA A 1 64  ? 9.274   -2.957  27.080 1.00 0.00 ? 64  ALA A CB   5  
ATOM 8127  H H    . ALA A 1 64  ? 8.464   -2.008  24.717 1.00 0.00 ? 64  ALA A H    5  
ATOM 8128  H HA   . ALA A 1 64  ? 10.641  -1.378  26.590 1.00 0.00 ? 64  ALA A HA   5  
ATOM 8129  H HB1  . ALA A 1 64  ? 9.613   -3.992  27.041 1.00 0.00 ? 64  ALA A HB1  5  
ATOM 8130  H HB2  . ALA A 1 64  ? 9.443   -2.557  28.079 1.00 0.00 ? 64  ALA A HB2  5  
ATOM 8131  H HB3  . ALA A 1 64  ? 8.210   -2.914  26.847 1.00 0.00 ? 64  ALA A HB3  5  
ATOM 8132  N N    . SER A 1 65  ? 10.406  -3.623  24.203 1.00 0.00 ? 65  SER A N    5  
ATOM 8133  C CA   . SER A 1 65  ? 11.174  -4.473  23.309 1.00 0.00 ? 65  SER A CA   5  
ATOM 8134  C C    . SER A 1 65  ? 11.877  -3.620  22.251 1.00 0.00 ? 65  SER A C    5  
ATOM 8135  O O    . SER A 1 65  ? 13.003  -3.918  21.856 1.00 0.00 ? 65  SER A O    5  
ATOM 8136  C CB   . SER A 1 65  ? 10.279  -5.518  22.639 1.00 0.00 ? 65  SER A CB   5  
ATOM 8137  O OG   . SER A 1 65  ? 10.639  -6.846  23.010 1.00 0.00 ? 65  SER A OG   5  
ATOM 8138  H H    . SER A 1 65  ? 9.428   -3.569  23.998 1.00 0.00 ? 65  SER A H    5  
ATOM 8139  H HA   . SER A 1 65  ? 11.904  -4.975  23.944 1.00 0.00 ? 65  SER A HA   5  
ATOM 8140  H HB2  . SER A 1 65  ? 9.240   -5.335  22.912 1.00 0.00 ? 65  SER A HB2  5  
ATOM 8141  H HB3  . SER A 1 65  ? 10.347  -5.413  21.556 1.00 0.00 ? 65  SER A HB3  5  
ATOM 8142  H HG   . SER A 1 65  ? 10.231  -7.501  22.374 1.00 0.00 ? 65  SER A HG   5  
ATOM 8143  N N    . LYS A 1 66  ? 11.183  -2.576  21.822 1.00 0.00 ? 66  LYS A N    5  
ATOM 8144  C CA   . LYS A 1 66  ? 11.728  -1.677  20.818 1.00 0.00 ? 66  LYS A CA   5  
ATOM 8145  C C    . LYS A 1 66  ? 11.975  -2.455  19.524 1.00 0.00 ? 66  LYS A C    5  
ATOM 8146  O O    . LYS A 1 66  ? 12.905  -2.149  18.780 1.00 0.00 ? 66  LYS A O    5  
ATOM 8147  C CB   . LYS A 1 66  ? 12.971  -0.965  21.354 1.00 0.00 ? 66  LYS A CB   5  
ATOM 8148  C CG   . LYS A 1 66  ? 12.601  0.372   22.001 1.00 0.00 ? 66  LYS A CG   5  
ATOM 8149  C CD   . LYS A 1 66  ? 13.385  1.523   21.369 1.00 0.00 ? 66  LYS A CD   5  
ATOM 8150  C CE   . LYS A 1 66  ? 13.674  2.620   22.396 1.00 0.00 ? 66  LYS A CE   5  
ATOM 8151  N NZ   . LYS A 1 66  ? 13.036  3.892   21.989 1.00 0.00 ? 66  LYS A NZ   5  
ATOM 8152  H H    . LYS A 1 66  ? 10.268  -2.340  22.149 1.00 0.00 ? 66  LYS A H    5  
ATOM 8153  H HA   . LYS A 1 66  ? 10.976  -0.912  20.623 1.00 0.00 ? 66  LYS A HA   5  
ATOM 8154  H HB2  . LYS A 1 66  ? 13.473  -1.599  22.085 1.00 0.00 ? 66  LYS A HB2  5  
ATOM 8155  H HB3  . LYS A 1 66  ? 13.677  -0.796  20.541 1.00 0.00 ? 66  LYS A HB3  5  
ATOM 8156  H HG2  . LYS A 1 66  ? 11.531  0.551   21.888 1.00 0.00 ? 66  LYS A HG2  5  
ATOM 8157  H HG3  . LYS A 1 66  ? 12.806  0.331   23.071 1.00 0.00 ? 66  LYS A HG3  5  
ATOM 8158  H HD2  . LYS A 1 66  ? 14.324  1.147   20.960 1.00 0.00 ? 66  LYS A HD2  5  
ATOM 8159  H HD3  . LYS A 1 66  ? 12.819  1.940   20.536 1.00 0.00 ? 66  LYS A HD3  5  
ATOM 8160  H HE2  . LYS A 1 66  ? 13.301  2.316   23.374 1.00 0.00 ? 66  LYS A HE2  5  
ATOM 8161  H HE3  . LYS A 1 66  ? 14.750  2.760   22.494 1.00 0.00 ? 66  LYS A HE3  5  
ATOM 8162  H HZ1  . LYS A 1 66  ? 12.279  3.700   21.364 1.00 0.00 ? 66  LYS A HZ1  5  
ATOM 8163  H HZ2  . LYS A 1 66  ? 12.689  4.365   22.798 1.00 0.00 ? 66  LYS A HZ2  5  
ATOM 8164  H HZ3  . LYS A 1 66  ? 13.710  4.470   21.528 1.00 0.00 ? 66  LYS A HZ3  5  
ATOM 8165  N N    . ARG A 1 67  ? 11.126  -3.447  19.296 1.00 0.00 ? 67  ARG A N    5  
ATOM 8166  C CA   . ARG A 1 67  ? 11.240  -4.271  18.105 1.00 0.00 ? 67  ARG A CA   5  
ATOM 8167  C C    . ARG A 1 67  ? 10.147  -3.905  17.099 1.00 0.00 ? 67  ARG A C    5  
ATOM 8168  O O    . ARG A 1 67  ? 10.436  -3.374  16.029 1.00 0.00 ? 67  ARG A O    5  
ATOM 8169  C CB   . ARG A 1 67  ? 11.130  -5.757  18.451 1.00 0.00 ? 67  ARG A CB   5  
ATOM 8170  C CG   . ARG A 1 67  ? 12.325  -6.216  19.288 1.00 0.00 ? 67  ARG A CG   5  
ATOM 8171  C CD   . ARG A 1 67  ? 12.824  -7.587  18.827 1.00 0.00 ? 67  ARG A CD   5  
ATOM 8172  N NE   . ARG A 1 67  ? 13.866  -8.084  19.752 1.00 0.00 ? 67  ARG A NE   5  
ATOM 8173  C CZ   . ARG A 1 67  ? 13.610  -8.641  20.943 1.00 0.00 ? 67  ARG A CZ   5  
ATOM 8174  N NH1  . ARG A 1 67  ? 12.344  -8.776  21.361 1.00 0.00 ? 67  ARG A NH1  5  
ATOM 8175  N NH2  . ARG A 1 67  ? 14.619  -9.064  21.717 1.00 0.00 ? 67  ARG A NH2  5  
ATOM 8176  H H    . ARG A 1 67  ? 10.372  -3.689  19.907 1.00 0.00 ? 67  ARG A H    5  
ATOM 8177  H HA   . ARG A 1 67  ? 12.230  -4.048  17.706 1.00 0.00 ? 67  ARG A HA   5  
ATOM 8178  H HB2  . ARG A 1 67  ? 10.206  -5.938  19.000 1.00 0.00 ? 67  ARG A HB2  5  
ATOM 8179  H HB3  . ARG A 1 67  ? 11.076  -6.344  17.534 1.00 0.00 ? 67  ARG A HB3  5  
ATOM 8180  H HG2  . ARG A 1 67  ? 13.131  -5.486  19.208 1.00 0.00 ? 67  ARG A HG2  5  
ATOM 8181  H HG3  . ARG A 1 67  ? 12.041  -6.263  20.339 1.00 0.00 ? 67  ARG A HG3  5  
ATOM 8182  H HD2  . ARG A 1 67  ? 11.993  -8.291  18.789 1.00 0.00 ? 67  ARG A HD2  5  
ATOM 8183  H HD3  . ARG A 1 67  ? 13.227  -7.515  17.816 1.00 0.00 ? 67  ARG A HD3  5  
ATOM 8184  H HE   . ARG A 1 67  ? 14.822  -7.999  19.471 1.00 0.00 ? 67  ARG A HE   5  
ATOM 8185  H HH11 . ARG A 1 67  ? 11.590  -8.460  20.784 1.00 0.00 ? 67  ARG A HH11 5  
ATOM 8186  H HH12 . ARG A 1 67  ? 12.152  -9.191  22.250 1.00 0.00 ? 67  ARG A HH12 5  
ATOM 8187  H HH21 . ARG A 1 67  ? 15.564  -8.964  21.405 1.00 0.00 ? 67  ARG A HH21 5  
ATOM 8188  H HH22 . ARG A 1 67  ? 14.427  -9.480  22.606 1.00 0.00 ? 67  ARG A HH22 5  
ATOM 8189  N N    . SER A 1 68  ? 8.913   -4.205  17.480 1.00 0.00 ? 68  SER A N    5  
ATOM 8190  C CA   . SER A 1 68  ? 7.775   -3.915  16.625 1.00 0.00 ? 68  SER A CA   5  
ATOM 8191  C C    . SER A 1 68  ? 6.472   -4.116  17.401 1.00 0.00 ? 68  SER A C    5  
ATOM 8192  O O    . SER A 1 68  ? 6.400   -4.964  18.290 1.00 0.00 ? 68  SER A O    5  
ATOM 8193  C CB   . SER A 1 68  ? 7.788   -4.794  15.373 1.00 0.00 ? 68  SER A CB   5  
ATOM 8194  O OG   . SER A 1 68  ? 6.665   -4.542  14.532 1.00 0.00 ? 68  SER A OG   5  
ATOM 8195  H H    . SER A 1 68  ? 8.687   -4.637  18.353 1.00 0.00 ? 68  SER A H    5  
ATOM 8196  H HA   . SER A 1 68  ? 7.890   -2.870  16.335 1.00 0.00 ? 68  SER A HA   5  
ATOM 8197  H HB2  . SER A 1 68  ? 8.707   -4.616  14.814 1.00 0.00 ? 68  SER A HB2  5  
ATOM 8198  H HB3  . SER A 1 68  ? 7.792   -5.844  15.667 1.00 0.00 ? 68  SER A HB3  5  
ATOM 8199  H HG   . SER A 1 68  ? 5.819   -4.628  15.057 1.00 0.00 ? 68  SER A HG   5  
ATOM 8200  N N    . ARG A 1 69  ? 5.476   -3.322  17.038 1.00 0.00 ? 69  ARG A N    5  
ATOM 8201  C CA   . ARG A 1 69  ? 4.179   -3.402  17.690 1.00 0.00 ? 69  ARG A CA   5  
ATOM 8202  C C    . ARG A 1 69  ? 3.214   -4.240  16.849 1.00 0.00 ? 69  ARG A C    5  
ATOM 8203  O O    . ARG A 1 69  ? 2.434   -5.023  17.389 1.00 0.00 ? 69  ARG A O    5  
ATOM 8204  C CB   . ARG A 1 69  ? 3.583   -2.010  17.904 1.00 0.00 ? 69  ARG A CB   5  
ATOM 8205  C CG   . ARG A 1 69  ? 3.961   -1.457  19.279 1.00 0.00 ? 69  ARG A CG   5  
ATOM 8206  C CD   . ARG A 1 69  ? 2.722   -0.967  20.032 1.00 0.00 ? 69  ARG A CD   5  
ATOM 8207  N NE   . ARG A 1 69  ? 2.969   -1.003  21.491 1.00 0.00 ? 69  ARG A NE   5  
ATOM 8208  C CZ   . ARG A 1 69  ? 2.804   -2.092  22.254 1.00 0.00 ? 69  ARG A CZ   5  
ATOM 8209  N NH1  . ARG A 1 69  ? 2.389   -3.240  21.702 1.00 0.00 ? 69  ARG A NH1  5  
ATOM 8210  N NH2  . ARG A 1 69  ? 3.052   -2.032  23.570 1.00 0.00 ? 69  ARG A NH2  5  
ATOM 8211  H H    . ARG A 1 69  ? 5.543   -2.635  16.315 1.00 0.00 ? 69  ARG A H    5  
ATOM 8212  H HA   . ARG A 1 69  ? 4.379   -3.880  18.650 1.00 0.00 ? 69  ARG A HA   5  
ATOM 8213  H HB2  . ARG A 1 69  ? 3.939   -1.334  17.126 1.00 0.00 ? 69  ARG A HB2  5  
ATOM 8214  H HB3  . ARG A 1 69  ? 2.498   -2.057  17.812 1.00 0.00 ? 69  ARG A HB3  5  
ATOM 8215  H HG2  . ARG A 1 69  ? 4.462   -2.230  19.861 1.00 0.00 ? 69  ARG A HG2  5  
ATOM 8216  H HG3  . ARG A 1 69  ? 4.669   -0.636  19.163 1.00 0.00 ? 69  ARG A HG3  5  
ATOM 8217  H HD2  . ARG A 1 69  ? 2.476   0.049   19.722 1.00 0.00 ? 69  ARG A HD2  5  
ATOM 8218  H HD3  . ARG A 1 69  ? 1.865   -1.592  19.785 1.00 0.00 ? 69  ARG A HD3  5  
ATOM 8219  H HE   . ARG A 1 69  ? 3.280   -0.162  21.935 1.00 0.00 ? 69  ARG A HE   5  
ATOM 8220  H HH11 . ARG A 1 69  ? 2.204   -3.285  20.720 1.00 0.00 ? 69  ARG A HH11 5  
ATOM 8221  H HH12 . ARG A 1 69  ? 2.265   -4.053  22.272 1.00 0.00 ? 69  ARG A HH12 5  
ATOM 8222  H HH21 . ARG A 1 69  ? 3.361   -1.175  23.982 1.00 0.00 ? 69  ARG A HH21 5  
ATOM 8223  H HH22 . ARG A 1 69  ? 2.928   -2.844  24.139 1.00 0.00 ? 69  ARG A HH22 5  
ATOM 8224  N N    . GLY A 1 70  ? 3.297   -4.046  15.541 1.00 0.00 ? 70  GLY A N    5  
ATOM 8225  C CA   . GLY A 1 70  ? 2.440   -4.774  14.621 1.00 0.00 ? 70  GLY A CA   5  
ATOM 8226  C C    . GLY A 1 70  ? 1.464   -3.829  13.917 1.00 0.00 ? 70  GLY A C    5  
ATOM 8227  O O    . GLY A 1 70  ? 0.520   -4.276  13.269 1.00 0.00 ? 70  GLY A O    5  
ATOM 8228  H H    . GLY A 1 70  ? 3.934   -3.407  15.110 1.00 0.00 ? 70  GLY A H    5  
ATOM 8229  H HA2  . GLY A 1 70  ? 3.051   -5.289  13.880 1.00 0.00 ? 70  GLY A HA2  5  
ATOM 8230  H HA3  . GLY A 1 70  ? 1.885   -5.539  15.163 1.00 0.00 ? 70  GLY A HA3  5  
ATOM 8231  N N    . PHE A 1 71  ? 1.726   -2.539  14.069 1.00 0.00 ? 71  PHE A N    5  
ATOM 8232  C CA   . PHE A 1 71  ? 0.882   -1.527  13.456 1.00 0.00 ? 71  PHE A CA   5  
ATOM 8233  C C    . PHE A 1 71  ? 1.638   -0.207  13.294 1.00 0.00 ? 71  PHE A C    5  
ATOM 8234  O O    . PHE A 1 71  ? 2.564   0.080   14.053 1.00 0.00 ? 71  PHE A O    5  
ATOM 8235  C CB   . PHE A 1 71  ? -0.307  -1.308  14.394 1.00 0.00 ? 71  PHE A CB   5  
ATOM 8236  C CG   . PHE A 1 71  ? -0.037  -0.305  15.518 1.00 0.00 ? 71  PHE A CG   5  
ATOM 8237  C CD1  . PHE A 1 71  ? -0.038  1.029   15.254 1.00 0.00 ? 71  PHE A CD1  5  
ATOM 8238  C CD2  . PHE A 1 71  ? 0.205   -0.748  16.781 1.00 0.00 ? 71  PHE A CD2  5  
ATOM 8239  C CE1  . PHE A 1 71  ? 0.213   1.959   16.297 1.00 0.00 ? 71  PHE A CE1  5  
ATOM 8240  C CE2  . PHE A 1 71  ? 0.456   0.182   17.824 1.00 0.00 ? 71  PHE A CE2  5  
ATOM 8241  C CZ   . PHE A 1 71  ? 0.455   1.516   17.560 1.00 0.00 ? 71  PHE A CZ   5  
ATOM 8242  H H    . PHE A 1 71  ? 2.496   -2.183  14.598 1.00 0.00 ? 71  PHE A H    5  
ATOM 8243  H HA   . PHE A 1 71  ? 0.591   -1.900  12.474 1.00 0.00 ? 71  PHE A HA   5  
ATOM 8244  H HB2  . PHE A 1 71  ? -1.159  -0.962  13.809 1.00 0.00 ? 71  PHE A HB2  5  
ATOM 8245  H HB3  . PHE A 1 71  ? -0.590  -2.264  14.834 1.00 0.00 ? 71  PHE A HB3  5  
ATOM 8246  H HD1  . PHE A 1 71  ? -0.232  1.384   14.242 1.00 0.00 ? 71  PHE A HD1  5  
ATOM 8247  H HD2  . PHE A 1 71  ? 0.207   -1.818  16.992 1.00 0.00 ? 71  PHE A HD2  5  
ATOM 8248  H HE1  . PHE A 1 71  ? 0.211   3.028   16.085 1.00 0.00 ? 71  PHE A HE1  5  
ATOM 8249  H HE2  . PHE A 1 71  ? 0.650   -0.173  18.836 1.00 0.00 ? 71  PHE A HE2  5  
ATOM 8250  H HZ   . PHE A 1 71  ? 0.647   2.230   18.360 1.00 0.00 ? 71  PHE A HZ   5  
ATOM 8251  N N    . GLY A 1 72  ? 1.217   0.562   12.301 1.00 0.00 ? 72  GLY A N    5  
ATOM 8252  C CA   . GLY A 1 72  ? 1.843   1.845   12.030 1.00 0.00 ? 72  GLY A CA   5  
ATOM 8253  C C    . GLY A 1 72  ? 0.928   2.734   11.185 1.00 0.00 ? 72  GLY A C    5  
ATOM 8254  O O    . GLY A 1 72  ? -0.285  2.537   11.161 1.00 0.00 ? 72  GLY A O    5  
ATOM 8255  H H    . GLY A 1 72  ? 0.464   0.322   11.689 1.00 0.00 ? 72  GLY A H    5  
ATOM 8256  H HA2  . GLY A 1 72  ? 2.076   2.346   12.970 1.00 0.00 ? 72  GLY A HA2  5  
ATOM 8257  H HA3  . GLY A 1 72  ? 2.788   1.690   11.509 1.00 0.00 ? 72  GLY A HA3  5  
ATOM 8258  N N    . PHE A 1 73  ? 1.546   3.693   10.511 1.00 0.00 ? 73  PHE A N    5  
ATOM 8259  C CA   . PHE A 1 73  ? 0.803   4.612   9.667  1.00 0.00 ? 73  PHE A CA   5  
ATOM 8260  C C    . PHE A 1 73  ? 1.500   4.804   8.318  1.00 0.00 ? 73  PHE A C    5  
ATOM 8261  O O    . PHE A 1 73  ? 2.720   4.674   8.222  1.00 0.00 ? 73  PHE A O    5  
ATOM 8262  C CB   . PHE A 1 73  ? 0.758   5.955   10.399 1.00 0.00 ? 73  PHE A CB   5  
ATOM 8263  C CG   . PHE A 1 73  ? 0.576   5.832   11.913 1.00 0.00 ? 73  PHE A CG   5  
ATOM 8264  C CD1  . PHE A 1 73  ? 1.624   5.460   12.696 1.00 0.00 ? 73  PHE A CD1  5  
ATOM 8265  C CD2  . PHE A 1 73  ? -0.634  6.095   12.477 1.00 0.00 ? 73  PHE A CD2  5  
ATOM 8266  C CE1  . PHE A 1 73  ? 1.456   5.346   14.101 1.00 0.00 ? 73  PHE A CE1  5  
ATOM 8267  C CE2  . PHE A 1 73  ? -0.802  5.981   13.882 1.00 0.00 ? 73  PHE A CE2  5  
ATOM 8268  C CZ   . PHE A 1 73  ? 0.246   5.609   14.665 1.00 0.00 ? 73  PHE A CZ   5  
ATOM 8269  H H    . PHE A 1 73  ? 2.534   3.846   10.536 1.00 0.00 ? 73  PHE A H    5  
ATOM 8270  H HA   . PHE A 1 73  ? -0.183  4.178   9.505  1.00 0.00 ? 73  PHE A HA   5  
ATOM 8271  H HB2  . PHE A 1 73  ? 1.681   6.499   10.197 1.00 0.00 ? 73  PHE A HB2  5  
ATOM 8272  H HB3  . PHE A 1 73  ? -0.059  6.551   9.993  1.00 0.00 ? 73  PHE A HB3  5  
ATOM 8273  H HD1  . PHE A 1 73  ? 2.594   5.250   12.245 1.00 0.00 ? 73  PHE A HD1  5  
ATOM 8274  H HD2  . PHE A 1 73  ? -1.474  6.393   11.849 1.00 0.00 ? 73  PHE A HD2  5  
ATOM 8275  H HE1  . PHE A 1 73  ? 2.296   5.048   14.729 1.00 0.00 ? 73  PHE A HE1  5  
ATOM 8276  H HE2  . PHE A 1 73  ? -1.772  6.191   14.333 1.00 0.00 ? 73  PHE A HE2  5  
ATOM 8277  H HZ   . PHE A 1 73  ? 0.116   5.521   15.743 1.00 0.00 ? 73  PHE A HZ   5  
ATOM 8278  N N    . VAL A 1 74  ? 0.696   5.109   7.311  1.00 0.00 ? 74  VAL A N    5  
ATOM 8279  C CA   . VAL A 1 74  ? 1.220   5.320   5.972  1.00 0.00 ? 74  VAL A CA   5  
ATOM 8280  C C    . VAL A 1 74  ? 0.578   6.571   5.368  1.00 0.00 ? 74  VAL A C    5  
ATOM 8281  O O    . VAL A 1 74  ? -0.619  6.585   5.089  1.00 0.00 ? 74  VAL A O    5  
ATOM 8282  C CB   . VAL A 1 74  ? 1.003   4.067   5.122  1.00 0.00 ? 74  VAL A CB   5  
ATOM 8283  C CG1  . VAL A 1 74  ? 1.907   2.924   5.589  1.00 0.00 ? 74  VAL A CG1  5  
ATOM 8284  C CG2  . VAL A 1 74  ? -0.467  3.643   5.135  1.00 0.00 ? 74  VAL A CG2  5  
ATOM 8285  H H    . VAL A 1 74  ? -0.295  5.213   7.398  1.00 0.00 ? 74  VAL A H    5  
ATOM 8286  H HA   . VAL A 1 74  ? 2.294   5.485   6.062  1.00 0.00 ? 74  VAL A HA   5  
ATOM 8287  H HB   . VAL A 1 74  ? 1.273   4.308   4.094  1.00 0.00 ? 74  VAL A HB   5  
ATOM 8288  H HG11 . VAL A 1 74  ? 2.079   2.236   4.761  1.00 0.00 ? 74  VAL A HG11 5  
ATOM 8289  H HG12 . VAL A 1 74  ? 2.860   3.330   5.928  1.00 0.00 ? 74  VAL A HG12 5  
ATOM 8290  H HG13 . VAL A 1 74  ? 1.426   2.392   6.409  1.00 0.00 ? 74  VAL A HG13 5  
ATOM 8291  H HG21 . VAL A 1 74  ? -0.578  2.732   5.723  1.00 0.00 ? 74  VAL A HG21 5  
ATOM 8292  H HG22 . VAL A 1 74  ? -1.070  4.437   5.578  1.00 0.00 ? 74  VAL A HG22 5  
ATOM 8293  H HG23 . VAL A 1 74  ? -0.802  3.460   4.114  1.00 0.00 ? 74  VAL A HG23 5  
ATOM 8294  N N    . THR A 1 75  ? 1.404   7.591   5.185  1.00 0.00 ? 75  THR A N    5  
ATOM 8295  C CA   . THR A 1 75  ? 0.931   8.843   4.620  1.00 0.00 ? 75  THR A CA   5  
ATOM 8296  C C    . THR A 1 75  ? 1.208   8.887   3.115  1.00 0.00 ? 75  THR A C    5  
ATOM 8297  O O    . THR A 1 75  ? 2.343   9.108   2.695  1.00 0.00 ? 75  THR A O    5  
ATOM 8298  C CB   . THR A 1 75  ? 1.589   9.988   5.392  1.00 0.00 ? 75  THR A CB   5  
ATOM 8299  O OG1  . THR A 1 75  ? 1.593   9.538   6.744  1.00 0.00 ? 75  THR A OG1  5  
ATOM 8300  C CG2  . THR A 1 75  ? 0.722   11.249  5.422  1.00 0.00 ? 75  THR A CG2  5  
ATOM 8301  H H    . THR A 1 75  ? 2.377   7.571   5.415  1.00 0.00 ? 75  THR A H    5  
ATOM 8302  H HA   . THR A 1 75  ? -0.150  8.892   4.747  1.00 0.00 ? 75  THR A HA   5  
ATOM 8303  H HB   . THR A 1 75  ? 2.580   10.207  4.995  1.00 0.00 ? 75  THR A HB   5  
ATOM 8304  H HG1  . THR A 1 75  ? 2.422   9.852   7.206  1.00 0.00 ? 75  THR A HG1  5  
ATOM 8305  H HG21 . THR A 1 75  ? -0.240  11.017  5.878  1.00 0.00 ? 75  THR A HG21 5  
ATOM 8306  H HG22 . THR A 1 75  ? 1.224   12.021  6.005  1.00 0.00 ? 75  THR A HG22 5  
ATOM 8307  H HG23 . THR A 1 75  ? 0.565   11.606  4.404  1.00 0.00 ? 75  THR A HG23 5  
ATOM 8308  N N    . PHE A 1 76  ? 0.151   8.674   2.345  1.00 0.00 ? 76  PHE A N    5  
ATOM 8309  C CA   . PHE A 1 76  ? 0.266   8.686   0.897  1.00 0.00 ? 76  PHE A CA   5  
ATOM 8310  C C    . PHE A 1 76  ? 0.563   10.096  0.383  1.00 0.00 ? 76  PHE A C    5  
ATOM 8311  O O    . PHE A 1 76  ? 0.752   11.021  1.171  1.00 0.00 ? 76  PHE A O    5  
ATOM 8312  C CB   . PHE A 1 76  ? -1.082  8.226   0.338  1.00 0.00 ? 76  PHE A CB   5  
ATOM 8313  C CG   . PHE A 1 76  ? -1.211  6.708   0.198  1.00 0.00 ? 76  PHE A CG   5  
ATOM 8314  C CD1  . PHE A 1 76  ? -0.643  6.072   -0.862 1.00 0.00 ? 76  PHE A CD1  5  
ATOM 8315  C CD2  . PHE A 1 76  ? -1.894  5.994   1.132  1.00 0.00 ? 76  PHE A CD2  5  
ATOM 8316  C CE1  . PHE A 1 76  ? -0.763  4.663   -0.992 1.00 0.00 ? 76  PHE A CE1  5  
ATOM 8317  C CE2  . PHE A 1 76  ? -2.014  4.585   1.002  1.00 0.00 ? 76  PHE A CE2  5  
ATOM 8318  C CZ   . PHE A 1 76  ? -1.446  3.949   -0.057 1.00 0.00 ? 76  PHE A CZ   5  
ATOM 8319  H H    . PHE A 1 76  ? -0.769  8.495   2.695  1.00 0.00 ? 76  PHE A H    5  
ATOM 8320  H HA   . PHE A 1 76  ? 1.090   8.024   0.632  1.00 0.00 ? 76  PHE A HA   5  
ATOM 8321  H HB2  . PHE A 1 76  ? -1.877  8.589   0.988  1.00 0.00 ? 76  PHE A HB2  5  
ATOM 8322  H HB3  . PHE A 1 76  ? -1.234  8.685   -0.639 1.00 0.00 ? 76  PHE A HB3  5  
ATOM 8323  H HD1  . PHE A 1 76  ? -0.096  6.644   -1.611 1.00 0.00 ? 76  PHE A HD1  5  
ATOM 8324  H HD2  . PHE A 1 76  ? -2.349  6.504   1.982  1.00 0.00 ? 76  PHE A HD2  5  
ATOM 8325  H HE1  . PHE A 1 76  ? -0.308  4.153   -1.841 1.00 0.00 ? 76  PHE A HE1  5  
ATOM 8326  H HE2  . PHE A 1 76  ? -2.561  4.013   1.752  1.00 0.00 ? 76  PHE A HE2  5  
ATOM 8327  H HZ   . PHE A 1 76  ? -1.538  2.868   -0.157 1.00 0.00 ? 76  PHE A HZ   5  
ATOM 8328  N N    . SER A 1 77  ? 0.593   10.216  -0.936 1.00 0.00 ? 77  SER A N    5  
ATOM 8329  C CA   . SER A 1 77  ? 0.864   11.498  -1.565 1.00 0.00 ? 77  SER A CA   5  
ATOM 8330  C C    . SER A 1 77  ? -0.451  12.209  -1.891 1.00 0.00 ? 77  SER A C    5  
ATOM 8331  O O    . SER A 1 77  ? -0.647  13.363  -1.512 1.00 0.00 ? 77  SER A O    5  
ATOM 8332  C CB   . SER A 1 77  ? 1.701   11.323  -2.834 1.00 0.00 ? 77  SER A CB   5  
ATOM 8333  O OG   . SER A 1 77  ? 2.256   12.557  -3.282 1.00 0.00 ? 77  SER A OG   5  
ATOM 8334  H H    . SER A 1 77  ? 0.438   9.459   -1.571 1.00 0.00 ? 77  SER A H    5  
ATOM 8335  H HA   . SER A 1 77  ? 1.434   12.066  -0.830 1.00 0.00 ? 77  SER A HA   5  
ATOM 8336  H HB2  . SER A 1 77  ? 2.505   10.612  -2.643 1.00 0.00 ? 77  SER A HB2  5  
ATOM 8337  H HB3  . SER A 1 77  ? 1.081   10.898  -3.622 1.00 0.00 ? 77  SER A HB3  5  
ATOM 8338  H HG   . SER A 1 77  ? 2.686   13.036  -2.516 1.00 0.00 ? 77  SER A HG   5  
ATOM 8339  N N    . SER A 1 78  ? -1.318  11.491  -2.590 1.00 0.00 ? 78  SER A N    5  
ATOM 8340  C CA   . SER A 1 78  ? -2.608  12.039  -2.971 1.00 0.00 ? 78  SER A CA   5  
ATOM 8341  C C    . SER A 1 78  ? -3.733  11.203  -2.356 1.00 0.00 ? 78  SER A C    5  
ATOM 8342  O O    . SER A 1 78  ? -3.489  10.119  -1.829 1.00 0.00 ? 78  SER A O    5  
ATOM 8343  C CB   . SER A 1 78  ? -2.757  12.092  -4.493 1.00 0.00 ? 78  SER A CB   5  
ATOM 8344  O OG   . SER A 1 78  ? -1.813  12.976  -5.091 1.00 0.00 ? 78  SER A OG   5  
ATOM 8345  H H    . SER A 1 78  ? -1.150  10.553  -2.894 1.00 0.00 ? 78  SER A H    5  
ATOM 8346  H HA   . SER A 1 78  ? -2.621  13.052  -2.570 1.00 0.00 ? 78  SER A HA   5  
ATOM 8347  H HB2  . SER A 1 78  ? -2.627  11.091  -4.905 1.00 0.00 ? 78  SER A HB2  5  
ATOM 8348  H HB3  . SER A 1 78  ? -3.767  12.412  -4.748 1.00 0.00 ? 78  SER A HB3  5  
ATOM 8349  H HG   . SER A 1 78  ? -2.261  13.531  -5.792 1.00 0.00 ? 78  SER A HG   5  
ATOM 8350  N N    . MET A 1 79  ? -4.942  11.740  -2.445 1.00 0.00 ? 79  MET A N    5  
ATOM 8351  C CA   . MET A 1 79  ? -6.105  11.058  -1.904 1.00 0.00 ? 79  MET A CA   5  
ATOM 8352  C C    . MET A 1 79  ? -6.437  9.808   -2.723 1.00 0.00 ? 79  MET A C    5  
ATOM 8353  O O    . MET A 1 79  ? -6.752  8.760   -2.162 1.00 0.00 ? 79  MET A O    5  
ATOM 8354  C CB   . MET A 1 79  ? -7.304  12.008  -1.913 1.00 0.00 ? 79  MET A CB   5  
ATOM 8355  C CG   . MET A 1 79  ? -8.230  11.732  -0.727 1.00 0.00 ? 79  MET A CG   5  
ATOM 8356  S SD   . MET A 1 79  ? -7.974  12.958  0.546  1.00 0.00 ? 79  MET A SD   5  
ATOM 8357  C CE   . MET A 1 79  ? -8.135  11.934  1.999  1.00 0.00 ? 79  MET A CE   5  
ATOM 8358  H H    . MET A 1 79  ? -5.132  12.622  -2.876 1.00 0.00 ? 79  MET A H    5  
ATOM 8359  H HA   . MET A 1 79  ? -5.831  10.773  -0.888 1.00 0.00 ? 79  MET A HA   5  
ATOM 8360  H HB2  . MET A 1 79  ? -6.955  13.040  -1.875 1.00 0.00 ? 79  MET A HB2  5  
ATOM 8361  H HB3  . MET A 1 79  ? -7.857  11.892  -2.845 1.00 0.00 ? 79  MET A HB3  5  
ATOM 8362  H HG2  . MET A 1 79  ? -9.270  11.749  -1.054 1.00 0.00 ? 79  MET A HG2  5  
ATOM 8363  H HG3  . MET A 1 79  ? -8.038  10.736  -0.328 1.00 0.00 ? 79  MET A HG3  5  
ATOM 8364  H HE1  . MET A 1 79  ? -7.483  11.066  1.906  1.00 0.00 ? 79  MET A HE1  5  
ATOM 8365  H HE2  . MET A 1 79  ? -7.851  12.509  2.881  1.00 0.00 ? 79  MET A HE2  5  
ATOM 8366  H HE3  . MET A 1 79  ? -9.168  11.604  2.098  1.00 0.00 ? 79  MET A HE3  5  
ATOM 8367  N N    . ALA A 1 80  ? -6.356  9.961   -4.036 1.00 0.00 ? 80  ALA A N    5  
ATOM 8368  C CA   . ALA A 1 80  ? -6.644  8.859   -4.938 1.00 0.00 ? 80  ALA A CA   5  
ATOM 8369  C C    . ALA A 1 80  ? -5.856  7.624   -4.494 1.00 0.00 ? 80  ALA A C    5  
ATOM 8370  O O    . ALA A 1 80  ? -6.443  6.597   -4.158 1.00 0.00 ? 80  ALA A O    5  
ATOM 8371  C CB   . ALA A 1 80  ? -6.317  9.274   -6.373 1.00 0.00 ? 80  ALA A CB   5  
ATOM 8372  H H    . ALA A 1 80  ? -6.098  10.817  -4.485 1.00 0.00 ? 80  ALA A H    5  
ATOM 8373  H HA   . ALA A 1 80  ? -7.710  8.643   -4.868 1.00 0.00 ? 80  ALA A HA   5  
ATOM 8374  H HB1  . ALA A 1 80  ? -6.769  8.565   -7.068 1.00 0.00 ? 80  ALA A HB1  5  
ATOM 8375  H HB2  . ALA A 1 80  ? -6.714  10.271  -6.562 1.00 0.00 ? 80  ALA A HB2  5  
ATOM 8376  H HB3  . ALA A 1 80  ? -5.236  9.281   -6.513 1.00 0.00 ? 80  ALA A HB3  5  
ATOM 8377  N N    . GLU A 1 81  ? -4.539  7.765   -4.509 1.00 0.00 ? 81  GLU A N    5  
ATOM 8378  C CA   . GLU A 1 81  ? -3.664  6.675   -4.113 1.00 0.00 ? 81  GLU A CA   5  
ATOM 8379  C C    . GLU A 1 81  ? -4.204  5.993   -2.853 1.00 0.00 ? 81  GLU A C    5  
ATOM 8380  O O    . GLU A 1 81  ? -4.575  4.821   -2.888 1.00 0.00 ? 81  GLU A O    5  
ATOM 8381  C CB   . GLU A 1 81  ? -2.233  7.170   -3.898 1.00 0.00 ? 81  GLU A CB   5  
ATOM 8382  C CG   . GLU A 1 81  ? -1.619  7.658   -5.211 1.00 0.00 ? 81  GLU A CG   5  
ATOM 8383  C CD   . GLU A 1 81  ? -1.920  6.684   -6.353 1.00 0.00 ? 81  GLU A CD   5  
ATOM 8384  O OE1  . GLU A 1 81  ? -3.045  6.771   -6.891 1.00 0.00 ? 81  GLU A OE1  5  
ATOM 8385  O OE2  . GLU A 1 81  ? -1.018  5.876   -6.662 1.00 0.00 ? 81  GLU A OE2  5  
ATOM 8386  H H    . GLU A 1 81  ? -4.069  8.604   -4.784 1.00 0.00 ? 81  GLU A H    5  
ATOM 8387  H HA   . GLU A 1 81  ? -3.679  5.974   -4.947 1.00 0.00 ? 81  GLU A HA   5  
ATOM 8388  H HB2  . GLU A 1 81  ? -2.230  7.979   -3.168 1.00 0.00 ? 81  GLU A HB2  5  
ATOM 8389  H HB3  . GLU A 1 81  ? -1.624  6.365   -3.485 1.00 0.00 ? 81  GLU A HB3  5  
ATOM 8390  H HG2  . GLU A 1 81  ? -2.013  8.644   -5.457 1.00 0.00 ? 81  GLU A HG2  5  
ATOM 8391  H HG3  . GLU A 1 81  ? -0.540  7.765   -5.095 1.00 0.00 ? 81  GLU A HG3  5  
ATOM 8392  N N    . VAL A 1 82  ? -4.229  6.757   -1.771 1.00 0.00 ? 82  VAL A N    5  
ATOM 8393  C CA   . VAL A 1 82  ? -4.717  6.241   -0.503 1.00 0.00 ? 82  VAL A CA   5  
ATOM 8394  C C    . VAL A 1 82  ? -6.115  5.652   -0.700 1.00 0.00 ? 82  VAL A C    5  
ATOM 8395  O O    . VAL A 1 82  ? -6.478  4.673   -0.050 1.00 0.00 ? 82  VAL A O    5  
ATOM 8396  C CB   . VAL A 1 82  ? -4.676  7.341   0.560  1.00 0.00 ? 82  VAL A CB   5  
ATOM 8397  C CG1  . VAL A 1 82  ? -5.475  8.566   0.112  1.00 0.00 ? 82  VAL A CG1  5  
ATOM 8398  C CG2  . VAL A 1 82  ? -5.180  6.821   1.907  1.00 0.00 ? 82  VAL A CG2  5  
ATOM 8399  H H    . VAL A 1 82  ? -3.925  7.709   -1.751 1.00 0.00 ? 82  VAL A H    5  
ATOM 8400  H HA   . VAL A 1 82  ? -4.041  5.444   -0.190 1.00 0.00 ? 82  VAL A HA   5  
ATOM 8401  H HB   . VAL A 1 82  ? -3.637  7.646   0.686  1.00 0.00 ? 82  VAL A HB   5  
ATOM 8402  H HG11 . VAL A 1 82  ? -5.053  8.956   -0.815 1.00 0.00 ? 82  VAL A HG11 5  
ATOM 8403  H HG12 . VAL A 1 82  ? -6.514  8.282   -0.054 1.00 0.00 ? 82  VAL A HG12 5  
ATOM 8404  H HG13 . VAL A 1 82  ? -5.427  9.334   0.884  1.00 0.00 ? 82  VAL A HG13 5  
ATOM 8405  H HG21 . VAL A 1 82  ? -4.330  6.611   2.557  1.00 0.00 ? 82  VAL A HG21 5  
ATOM 8406  H HG22 . VAL A 1 82  ? -5.816  7.574   2.373  1.00 0.00 ? 82  VAL A HG22 5  
ATOM 8407  H HG23 . VAL A 1 82  ? -5.753  5.906   1.753  1.00 0.00 ? 82  VAL A HG23 5  
ATOM 8408  N N    . ASP A 1 83  ? -6.862  6.274   -1.601 1.00 0.00 ? 83  ASP A N    5  
ATOM 8409  C CA   . ASP A 1 83  ? -8.213  5.823   -1.892 1.00 0.00 ? 83  ASP A CA   5  
ATOM 8410  C C    . ASP A 1 83  ? -8.163  4.392   -2.431 1.00 0.00 ? 83  ASP A C    5  
ATOM 8411  O O    . ASP A 1 83  ? -9.047  3.586   -2.144 1.00 0.00 ? 83  ASP A O    5  
ATOM 8412  C CB   . ASP A 1 83  ? -8.871  6.706   -2.954 1.00 0.00 ? 83  ASP A CB   5  
ATOM 8413  C CG   . ASP A 1 83  ? -10.214 7.315   -2.547 1.00 0.00 ? 83  ASP A CG   5  
ATOM 8414  O OD1  . ASP A 1 83  ? -10.739 6.882   -1.499 1.00 0.00 ? 83  ASP A OD1  5  
ATOM 8415  O OD2  . ASP A 1 83  ? -10.684 8.201   -3.293 1.00 0.00 ? 83  ASP A OD2  5  
ATOM 8416  H H    . ASP A 1 83  ? -6.560  7.069   -2.125 1.00 0.00 ? 83  ASP A H    5  
ATOM 8417  H HA   . ASP A 1 83  ? -8.748  5.894   -0.945 1.00 0.00 ? 83  ASP A HA   5  
ATOM 8418  H HB2  . ASP A 1 83  ? -8.185  7.514   -3.209 1.00 0.00 ? 83  ASP A HB2  5  
ATOM 8419  H HB3  . ASP A 1 83  ? -9.016  6.114   -3.858 1.00 0.00 ? 83  ASP A HB3  5  
ATOM 8420  N N    . ALA A 1 84  ? -7.121  4.120   -3.202 1.00 0.00 ? 84  ALA A N    5  
ATOM 8421  C CA   . ALA A 1 84  ? -6.945  2.800   -3.784 1.00 0.00 ? 84  ALA A CA   5  
ATOM 8422  C C    . ALA A 1 84  ? -6.662  1.790   -2.670 1.00 0.00 ? 84  ALA A C    5  
ATOM 8423  O O    . ALA A 1 84  ? -7.342  0.771   -2.564 1.00 0.00 ? 84  ALA A O    5  
ATOM 8424  C CB   . ALA A 1 84  ? -5.825  2.847   -4.826 1.00 0.00 ? 84  ALA A CB   5  
ATOM 8425  H H    . ALA A 1 84  ? -6.406  4.781   -3.430 1.00 0.00 ? 84  ALA A H    5  
ATOM 8426  H HA   . ALA A 1 84  ? -7.876  2.529   -4.281 1.00 0.00 ? 84  ALA A HA   5  
ATOM 8427  H HB1  . ALA A 1 84  ? -5.235  3.752   -4.685 1.00 0.00 ? 84  ALA A HB1  5  
ATOM 8428  H HB2  . ALA A 1 84  ? -5.184  1.973   -4.710 1.00 0.00 ? 84  ALA A HB2  5  
ATOM 8429  H HB3  . ALA A 1 84  ? -6.260  2.848   -5.826 1.00 0.00 ? 84  ALA A HB3  5  
ATOM 8430  N N    . ALA A 1 85  ? -5.658  2.108   -1.867 1.00 0.00 ? 85  ALA A N    5  
ATOM 8431  C CA   . ALA A 1 85  ? -5.277  1.241   -0.764 1.00 0.00 ? 85  ALA A CA   5  
ATOM 8432  C C    . ALA A 1 85  ? -6.520  0.893   0.058  1.00 0.00 ? 85  ALA A C    5  
ATOM 8433  O O    . ALA A 1 85  ? -6.642  -0.222  0.562  1.00 0.00 ? 85  ALA A O    5  
ATOM 8434  C CB   . ALA A 1 85  ? -4.196  1.926   0.074  1.00 0.00 ? 85  ALA A CB   5  
ATOM 8435  H H    . ALA A 1 85  ? -5.109  2.940   -1.959 1.00 0.00 ? 85  ALA A H    5  
ATOM 8436  H HA   . ALA A 1 85  ? -4.864  0.326   -1.189 1.00 0.00 ? 85  ALA A HA   5  
ATOM 8437  H HB1  . ALA A 1 85  ? -4.463  2.972   0.227  1.00 0.00 ? 85  ALA A HB1  5  
ATOM 8438  H HB2  . ALA A 1 85  ? -4.115  1.427   1.040  1.00 0.00 ? 85  ALA A HB2  5  
ATOM 8439  H HB3  . ALA A 1 85  ? -3.240  1.867   -0.446 1.00 0.00 ? 85  ALA A HB3  5  
ATOM 8440  N N    . MET A 1 86  ? -7.410  1.868   0.167  1.00 0.00 ? 86  MET A N    5  
ATOM 8441  C CA   . MET A 1 86  ? -8.639  1.679   0.919  1.00 0.00 ? 86  MET A CA   5  
ATOM 8442  C C    . MET A 1 86  ? -9.491  0.566   0.305  1.00 0.00 ? 86  MET A C    5  
ATOM 8443  O O    . MET A 1 86  ? -10.242 -0.105  1.010  1.00 0.00 ? 86  MET A O    5  
ATOM 8444  C CB   . MET A 1 86  ? -9.436  2.985   0.932  1.00 0.00 ? 86  MET A CB   5  
ATOM 8445  C CG   . MET A 1 86  ? -8.608  4.127   1.525  1.00 0.00 ? 86  MET A CG   5  
ATOM 8446  S SD   . MET A 1 86  ? -9.407  4.763   2.989  1.00 0.00 ? 86  MET A SD   5  
ATOM 8447  C CE   . MET A 1 86  ? -9.105  3.414   4.118  1.00 0.00 ? 86  MET A CE   5  
ATOM 8448  H H    . MET A 1 86  ? -7.303  2.772   -0.247 1.00 0.00 ? 86  MET A H    5  
ATOM 8449  H HA   . MET A 1 86  ? -8.326  1.395   1.923  1.00 0.00 ? 86  MET A HA   5  
ATOM 8450  H HB2  . MET A 1 86  ? -9.739  3.240   -0.084 1.00 0.00 ? 86  MET A HB2  5  
ATOM 8451  H HB3  . MET A 1 86  ? -10.349 2.852   1.513  1.00 0.00 ? 86  MET A HB3  5  
ATOM 8452  H HG2  . MET A 1 86  ? -7.608  3.771   1.772  1.00 0.00 ? 86  MET A HG2  5  
ATOM 8453  H HG3  . MET A 1 86  ? -8.491  4.923   0.790  1.00 0.00 ? 86  MET A HG3  5  
ATOM 8454  H HE1  . MET A 1 86  ? -8.169  3.587   4.649  1.00 0.00 ? 86  MET A HE1  5  
ATOM 8455  H HE2  . MET A 1 86  ? -9.923  3.350   4.836  1.00 0.00 ? 86  MET A HE2  5  
ATOM 8456  H HE3  . MET A 1 86  ? -9.039  2.480   3.560  1.00 0.00 ? 86  MET A HE3  5  
ATOM 8457  N N    . ALA A 1 87  ? -9.346  0.406   -1.002 1.00 0.00 ? 87  ALA A N    5  
ATOM 8458  C CA   . ALA A 1 87  ? -10.094 -0.613  -1.718 1.00 0.00 ? 87  ALA A CA   5  
ATOM 8459  C C    . ALA A 1 87  ? -9.118  -1.527  -2.462 1.00 0.00 ? 87  ALA A C    5  
ATOM 8460  O O    . ALA A 1 87  ? -9.383  -1.936  -3.591 1.00 0.00 ? 87  ALA A O    5  
ATOM 8461  C CB   . ALA A 1 87  ? -11.098 0.056   -2.659 1.00 0.00 ? 87  ALA A CB   5  
ATOM 8462  H H    . ALA A 1 87  ? -8.733  0.957   -1.568 1.00 0.00 ? 87  ALA A H    5  
ATOM 8463  H HA   . ALA A 1 87  ? -10.641 -1.202  -0.982 1.00 0.00 ? 87  ALA A HA   5  
ATOM 8464  H HB1  . ALA A 1 87  ? -10.567 0.710   -3.351 1.00 0.00 ? 87  ALA A HB1  5  
ATOM 8465  H HB2  . ALA A 1 87  ? -11.635 -0.708  -3.221 1.00 0.00 ? 87  ALA A HB2  5  
ATOM 8466  H HB3  . ALA A 1 87  ? -11.807 0.643   -2.076 1.00 0.00 ? 87  ALA A HB3  5  
ATOM 8467  N N    . ALA A 1 88  ? -8.009  -1.820  -1.798 1.00 0.00 ? 88  ALA A N    5  
ATOM 8468  C CA   . ALA A 1 88  ? -6.992  -2.678  -2.382 1.00 0.00 ? 88  ALA A CA   5  
ATOM 8469  C C    . ALA A 1 88  ? -6.976  -4.018  -1.645 1.00 0.00 ? 88  ALA A C    5  
ATOM 8470  O O    . ALA A 1 88  ? -6.506  -5.020  -2.181 1.00 0.00 ? 88  ALA A O    5  
ATOM 8471  C CB   . ALA A 1 88  ? -5.636  -1.970  -2.333 1.00 0.00 ? 88  ALA A CB   5  
ATOM 8472  H H    . ALA A 1 88  ? -7.801  -1.483  -0.880 1.00 0.00 ? 88  ALA A H    5  
ATOM 8473  H HA   . ALA A 1 88  ? -7.261  -2.849  -3.425 1.00 0.00 ? 88  ALA A HA   5  
ATOM 8474  H HB1  . ALA A 1 88  ? -5.373  -1.761  -1.296 1.00 0.00 ? 88  ALA A HB1  5  
ATOM 8475  H HB2  . ALA A 1 88  ? -4.876  -2.610  -2.779 1.00 0.00 ? 88  ALA A HB2  5  
ATOM 8476  H HB3  . ALA A 1 88  ? -5.695  -1.034  -2.888 1.00 0.00 ? 88  ALA A HB3  5  
ATOM 8477  N N    . ARG A 1 89  ? -7.497  -3.993  -0.427 1.00 0.00 ? 89  ARG A N    5  
ATOM 8478  C CA   . ARG A 1 89  ? -7.549  -5.194  0.390  1.00 0.00 ? 89  ARG A CA   5  
ATOM 8479  C C    . ARG A 1 89  ? -8.074  -6.373  -0.433 1.00 0.00 ? 89  ARG A C    5  
ATOM 8480  O O    . ARG A 1 89  ? -8.701  -6.178  -1.473 1.00 0.00 ? 89  ARG A O    5  
ATOM 8481  C CB   . ARG A 1 89  ? -8.449  -4.991  1.610  1.00 0.00 ? 89  ARG A CB   5  
ATOM 8482  C CG   . ARG A 1 89  ? -7.622  -4.656  2.852  1.00 0.00 ? 89  ARG A CG   5  
ATOM 8483  C CD   . ARG A 1 89  ? -8.397  -4.977  4.132  1.00 0.00 ? 89  ARG A CD   5  
ATOM 8484  N NE   . ARG A 1 89  ? -9.222  -3.814  4.529  1.00 0.00 ? 89  ARG A NE   5  
ATOM 8485  C CZ   . ARG A 1 89  ? -10.454 -3.571  4.062  1.00 0.00 ? 89  ARG A CZ   5  
ATOM 8486  N NH1  . ARG A 1 89  ? -11.012 -4.409  3.177  1.00 0.00 ? 89  ARG A NH1  5  
ATOM 8487  N NH2  . ARG A 1 89  ? -11.128 -2.491  4.479  1.00 0.00 ? 89  ARG A NH2  5  
ATOM 8488  H H    . ARG A 1 89  ? -7.878  -3.174  0.002  1.00 0.00 ? 89  ARG A H    5  
ATOM 8489  H HA   . ARG A 1 89  ? -6.519  -5.363  0.703  1.00 0.00 ? 89  ARG A HA   5  
ATOM 8490  H HB2  . ARG A 1 89  ? -9.159  -4.188  1.414  1.00 0.00 ? 89  ARG A HB2  5  
ATOM 8491  H HB3  . ARG A 1 89  ? -9.032  -5.895  1.791  1.00 0.00 ? 89  ARG A HB3  5  
ATOM 8492  H HG2  . ARG A 1 89  ? -6.690  -5.220  2.836  1.00 0.00 ? 89  ARG A HG2  5  
ATOM 8493  H HG3  . ARG A 1 89  ? -7.354  -3.599  2.841  1.00 0.00 ? 89  ARG A HG3  5  
ATOM 8494  H HD2  . ARG A 1 89  ? -9.034  -5.847  3.972  1.00 0.00 ? 89  ARG A HD2  5  
ATOM 8495  H HD3  . ARG A 1 89  ? -7.703  -5.232  4.933  1.00 0.00 ? 89  ARG A HD3  5  
ATOM 8496  H HE   . ARG A 1 89  ? -8.835  -3.168  5.188  1.00 0.00 ? 89  ARG A HE   5  
ATOM 8497  H HH11 . ARG A 1 89  ? -10.508 -5.215  2.866  1.00 0.00 ? 89  ARG A HH11 5  
ATOM 8498  H HH12 . ARG A 1 89  ? -11.931 -4.228  2.828  1.00 0.00 ? 89  ARG A HH12 5  
ATOM 8499  H HH21 . ARG A 1 89  ? -10.712 -1.866  5.139  1.00 0.00 ? 89  ARG A HH21 5  
ATOM 8500  H HH22 . ARG A 1 89  ? -12.048 -2.310  4.130  1.00 0.00 ? 89  ARG A HH22 5  
ATOM 8501  N N    . PRO A 1 90  ? -7.792  -7.601  0.078  1.00 0.00 ? 90  PRO A N    5  
ATOM 8502  C CA   . PRO A 1 90  ? -7.044  -7.743  1.316  1.00 0.00 ? 90  PRO A CA   5  
ATOM 8503  C C    . PRO A 1 90  ? -5.558  -7.455  1.095  1.00 0.00 ? 90  PRO A C    5  
ATOM 8504  O O    . PRO A 1 90  ? -5.132  -7.201  -0.031 1.00 0.00 ? 90  PRO A O    5  
ATOM 8505  C CB   . PRO A 1 90  ? -7.311  -9.167  1.776  1.00 0.00 ? 90  PRO A CB   5  
ATOM 8506  C CG   . PRO A 1 90  ? -7.815  -9.913  0.551  1.00 0.00 ? 90  PRO A CG   5  
ATOM 8507  C CD   . PRO A 1 90  ? -8.175  -8.882  -0.507 1.00 0.00 ? 90  PRO A CD   5  
ATOM 8508  H HA   . PRO A 1 90  ? -7.356  -7.072  1.989  1.00 0.00 ? 90  PRO A HA   5  
ATOM 8509  H HB2  . PRO A 1 90  ? -6.404  -9.627  2.168  1.00 0.00 ? 90  PRO A HB2  5  
ATOM 8510  H HB3  . PRO A 1 90  ? -8.050  -9.187  2.577  1.00 0.00 ? 90  PRO A HB3  5  
ATOM 8511  H HG2  . PRO A 1 90  ? -7.050  -10.593 0.177  1.00 0.00 ? 90  PRO A HG2  5  
ATOM 8512  H HG3  . PRO A 1 90  ? -8.684  -10.520 0.805  1.00 0.00 ? 90  PRO A HG3  5  
ATOM 8513  H HD2  . PRO A 1 90  ? -7.641  -9.068  -1.439 1.00 0.00 ? 90  PRO A HD2  5  
ATOM 8514  H HD3  . PRO A 1 90  ? -9.240  -8.909  -0.739 1.00 0.00 ? 90  PRO A HD3  5  
ATOM 8515  N N    . HIS A 1 91  ? -4.810  -7.503  2.187  1.00 0.00 ? 91  HIS A N    5  
ATOM 8516  C CA   . HIS A 1 91  ? -3.380  -7.251  2.127  1.00 0.00 ? 91  HIS A CA   5  
ATOM 8517  C C    . HIS A 1 91  ? -2.645  -8.242  3.031  1.00 0.00 ? 91  HIS A C    5  
ATOM 8518  O O    . HIS A 1 91  ? -3.039  -8.453  4.177  1.00 0.00 ? 91  HIS A O    5  
ATOM 8519  C CB   . HIS A 1 91  ? -3.071  -5.792  2.471  1.00 0.00 ? 91  HIS A CB   5  
ATOM 8520  C CG   . HIS A 1 91  ? -3.586  -4.799  1.457  1.00 0.00 ? 91  HIS A CG   5  
ATOM 8521  N ND1  . HIS A 1 91  ? -3.996  -3.522  1.799  1.00 0.00 ? 91  HIS A ND1  5  
ATOM 8522  C CD2  . HIS A 1 91  ? -3.752  -4.908  0.108  1.00 0.00 ? 91  HIS A CD2  5  
ATOM 8523  C CE1  . HIS A 1 91  ? -4.390  -2.900  0.698  1.00 0.00 ? 91  HIS A CE1  5  
ATOM 8524  N NE2  . HIS A 1 91  ? -4.238  -3.761  -0.349 1.00 0.00 ? 91  HIS A NE2  5  
ATOM 8525  H H    . HIS A 1 91  ? -5.164  -7.710  3.099  1.00 0.00 ? 91  HIS A H    5  
ATOM 8526  H HA   . HIS A 1 91  ? -3.076  -7.420  1.094  1.00 0.00 ? 91  HIS A HA   5  
ATOM 8527  H HB2  . HIS A 1 91  ? -3.504  -5.560  3.444  1.00 0.00 ? 91  HIS A HB2  5  
ATOM 8528  H HB3  . HIS A 1 91  ? -1.992  -5.673  2.566  1.00 0.00 ? 91  HIS A HB3  5  
ATOM 8529  H HD1  . HIS A 1 91  ? -3.996  -3.135  2.721  1.00 0.00 ? 91  HIS A HD1  5  
ATOM 8530  H HD2  . HIS A 1 91  ? -3.523  -5.788  -0.493 1.00 0.00 ? 91  HIS A HD2  5  
ATOM 8531  H HE1  . HIS A 1 91  ? -4.769  -1.880  0.639  1.00 0.00 ? 91  HIS A HE1  5  
ATOM 8532  N N    . SER A 1 92  ? -1.589  -8.824  2.482  1.00 0.00 ? 92  SER A N    5  
ATOM 8533  C CA   . SER A 1 92  ? -0.795  -9.788  3.224  1.00 0.00 ? 92  SER A CA   5  
ATOM 8534  C C    . SER A 1 92  ? 0.643   -9.286  3.363  1.00 0.00 ? 92  SER A C    5  
ATOM 8535  O O    . SER A 1 92  ? 1.319   -9.044  2.364  1.00 0.00 ? 92  SER A O    5  
ATOM 8536  C CB   . SER A 1 92  ? -0.816  -11.159 2.544  1.00 0.00 ? 92  SER A CB   5  
ATOM 8537  O OG   . SER A 1 92  ? -0.693  -11.054 1.129  1.00 0.00 ? 92  SER A OG   5  
ATOM 8538  H H    . SER A 1 92  ? -1.275  -8.647  1.549  1.00 0.00 ? 92  SER A H    5  
ATOM 8539  H HA   . SER A 1 92  ? -1.271  -9.862  4.202  1.00 0.00 ? 92  SER A HA   5  
ATOM 8540  H HB2  . SER A 1 92  ? -0.002  -11.769 2.935  1.00 0.00 ? 92  SER A HB2  5  
ATOM 8541  H HB3  . SER A 1 92  ? -1.745  -11.672 2.791  1.00 0.00 ? 92  SER A HB3  5  
ATOM 8542  H HG   . SER A 1 92  ? -1.559  -10.751 0.731  1.00 0.00 ? 92  SER A HG   5  
ATOM 8543  N N    . ILE A 1 93  ? 1.069   -9.144  4.609  1.00 0.00 ? 93  ILE A N    5  
ATOM 8544  C CA   . ILE A 1 93  ? 2.415   -8.675  4.891  1.00 0.00 ? 93  ILE A CA   5  
ATOM 8545  C C    . ILE A 1 93  ? 3.086   -9.628  5.883  1.00 0.00 ? 93  ILE A C    5  
ATOM 8546  O O    . ILE A 1 93  ? 2.457   -10.076 6.840  1.00 0.00 ? 93  ILE A O    5  
ATOM 8547  C CB   . ILE A 1 93  ? 2.388   -7.219  5.360  1.00 0.00 ? 93  ILE A CB   5  
ATOM 8548  C CG1  . ILE A 1 93  ? 1.379   -6.401  4.552  1.00 0.00 ? 93  ILE A CG1  5  
ATOM 8549  C CG2  . ILE A 1 93  ? 3.788   -6.604  5.320  1.00 0.00 ? 93  ILE A CG2  5  
ATOM 8550  C CD1  . ILE A 1 93  ? 1.712   -6.441  3.059  1.00 0.00 ? 93  ILE A CD1  5  
ATOM 8551  H H    . ILE A 1 93  ? 0.514   -9.344  5.416  1.00 0.00 ? 93  ILE A H    5  
ATOM 8552  H HA   . ILE A 1 93  ? 2.973   -8.702  3.955  1.00 0.00 ? 93  ILE A HA   5  
ATOM 8553  H HB   . ILE A 1 93  ? 2.059   -7.201  6.399  1.00 0.00 ? 93  ILE A HB   5  
ATOM 8554  H HG12 . ILE A 1 93  ? 0.375   -6.793  4.714  1.00 0.00 ? 93  ILE A HG12 5  
ATOM 8555  H HG13 . ILE A 1 93  ? 1.379   -5.369  4.901  1.00 0.00 ? 93  ILE A HG13 5  
ATOM 8556  H HG21 . ILE A 1 93  ? 4.251   -6.816  4.356  1.00 0.00 ? 93  ILE A HG21 5  
ATOM 8557  H HG22 . ILE A 1 93  ? 3.715   -5.525  5.457  1.00 0.00 ? 93  ILE A HG22 5  
ATOM 8558  H HG23 . ILE A 1 93  ? 4.396   -7.031  6.117  1.00 0.00 ? 93  ILE A HG23 5  
ATOM 8559  H HD11 . ILE A 1 93  ? 0.855   -6.824  2.505  1.00 0.00 ? 93  ILE A HD11 5  
ATOM 8560  H HD12 . ILE A 1 93  ? 1.947   -5.434  2.713  1.00 0.00 ? 93  ILE A HD12 5  
ATOM 8561  H HD13 . ILE A 1 93  ? 2.571   -7.091  2.895  1.00 0.00 ? 93  ILE A HD13 5  
ATOM 8562  N N    . ASP A 1 94  ? 4.353   -9.910  5.619  1.00 0.00 ? 94  ASP A N    5  
ATOM 8563  C CA   . ASP A 1 94  ? 5.116   -10.802 6.476  1.00 0.00 ? 94  ASP A CA   5  
ATOM 8564  C C    . ASP A 1 94  ? 4.513   -12.206 6.409  1.00 0.00 ? 94  ASP A C    5  
ATOM 8565  O O    . ASP A 1 94  ? 4.852   -13.071 7.216  1.00 0.00 ? 94  ASP A O    5  
ATOM 8566  C CB   . ASP A 1 94  ? 5.070   -10.337 7.933  1.00 0.00 ? 94  ASP A CB   5  
ATOM 8567  C CG   . ASP A 1 94  ? 6.272   -10.755 8.783  1.00 0.00 ? 94  ASP A CG   5  
ATOM 8568  O OD1  . ASP A 1 94  ? 6.493   -11.980 8.890  1.00 0.00 ? 94  ASP A OD1  5  
ATOM 8569  O OD2  . ASP A 1 94  ? 6.943   -9.839  9.305  1.00 0.00 ? 94  ASP A OD2  5  
ATOM 8570  H H    . ASP A 1 94  ? 4.857   -9.541  4.838  1.00 0.00 ? 94  ASP A H    5  
ATOM 8571  H HA   . ASP A 1 94  ? 6.135   -10.767 6.092  1.00 0.00 ? 94  ASP A HA   5  
ATOM 8572  H HB2  . ASP A 1 94  ? 4.993   -9.250  7.950  1.00 0.00 ? 94  ASP A HB2  5  
ATOM 8573  H HB3  . ASP A 1 94  ? 4.164   -10.729 8.396  1.00 0.00 ? 94  ASP A HB3  5  
ATOM 8574  N N    . GLY A 1 95  ? 3.629   -12.390 5.439  1.00 0.00 ? 95  GLY A N    5  
ATOM 8575  C CA   . GLY A 1 95  ? 2.976   -13.675 5.255  1.00 0.00 ? 95  GLY A CA   5  
ATOM 8576  C C    . GLY A 1 95  ? 1.730   -13.787 6.136  1.00 0.00 ? 95  GLY A C    5  
ATOM 8577  O O    . GLY A 1 95  ? 1.239   -14.887 6.387  1.00 0.00 ? 95  GLY A O    5  
ATOM 8578  H H    . GLY A 1 95  ? 3.359   -11.682 4.786  1.00 0.00 ? 95  GLY A H    5  
ATOM 8579  H HA2  . GLY A 1 95  ? 2.698   -13.800 4.209  1.00 0.00 ? 95  GLY A HA2  5  
ATOM 8580  H HA3  . GLY A 1 95  ? 3.671   -14.479 5.499  1.00 0.00 ? 95  GLY A HA3  5  
ATOM 8581  N N    . ARG A 1 96  ? 1.254   -12.634 6.582  1.00 0.00 ? 96  ARG A N    5  
ATOM 8582  C CA   . ARG A 1 96  ? 0.074   -12.588 7.429  1.00 0.00 ? 96  ARG A CA   5  
ATOM 8583  C C    . ARG A 1 96  ? -0.965  -11.631 6.841  1.00 0.00 ? 96  ARG A C    5  
ATOM 8584  O O    . ARG A 1 96  ? -0.617  -10.702 6.115  1.00 0.00 ? 96  ARG A O    5  
ATOM 8585  C CB   . ARG A 1 96  ? 0.431   -12.135 8.846  1.00 0.00 ? 96  ARG A CB   5  
ATOM 8586  C CG   . ARG A 1 96  ? 0.870   -10.670 8.859  1.00 0.00 ? 96  ARG A CG   5  
ATOM 8587  C CD   . ARG A 1 96  ? 0.259   -9.925  10.048 1.00 0.00 ? 96  ARG A CD   5  
ATOM 8588  N NE   . ARG A 1 96  ? 0.504   -10.680 11.297 1.00 0.00 ? 96  ARG A NE   5  
ATOM 8589  C CZ   . ARG A 1 96  ? -0.227  -10.545 12.412 1.00 0.00 ? 96  ARG A CZ   5  
ATOM 8590  N NH1  . ARG A 1 96  ? -1.254  -9.684  12.440 1.00 0.00 ? 96  ARG A NH1  5  
ATOM 8591  N NH2  . ARG A 1 96  ? 0.067   -11.271 13.499 1.00 0.00 ? 96  ARG A NH2  5  
ATOM 8592  H H    . ARG A 1 96  ? 1.659   -11.744 6.373  1.00 0.00 ? 96  ARG A H    5  
ATOM 8593  H HA   . ARG A 1 96  ? -0.299  -13.612 7.442  1.00 0.00 ? 96  ARG A HA   5  
ATOM 8594  H HB2  . ARG A 1 96  ? -0.430  -12.267 9.501  1.00 0.00 ? 96  ARG A HB2  5  
ATOM 8595  H HB3  . ARG A 1 96  ? 1.231   -12.761 9.241  1.00 0.00 ? 96  ARG A HB3  5  
ATOM 8596  H HG2  . ARG A 1 96  ? 1.957   -10.612 8.908  1.00 0.00 ? 96  ARG A HG2  5  
ATOM 8597  H HG3  . ARG A 1 96  ? 0.567   -10.187 7.929  1.00 0.00 ? 96  ARG A HG3  5  
ATOM 8598  H HD2  . ARG A 1 96  ? 0.693   -8.928  10.125 1.00 0.00 ? 96  ARG A HD2  5  
ATOM 8599  H HD3  . ARG A 1 96  ? -0.812  -9.796  9.896  1.00 0.00 ? 96  ARG A HD3  5  
ATOM 8600  H HE   . ARG A 1 96  ? 1.263   -11.331 11.311 1.00 0.00 ? 96  ARG A HE   5  
ATOM 8601  H HH11 . ARG A 1 96  ? -1.474  -9.142  11.629 1.00 0.00 ? 96  ARG A HH11 5  
ATOM 8602  H HH12 . ARG A 1 96  ? -1.800  -9.584  13.272 1.00 0.00 ? 96  ARG A HH12 5  
ATOM 8603  H HH21 . ARG A 1 96  ? 0.834   -11.914 13.478 1.00 0.00 ? 96  ARG A HH21 5  
ATOM 8604  H HH22 . ARG A 1 96  ? -0.478  -11.171 14.331 1.00 0.00 ? 96  ARG A HH22 5  
ATOM 8605  N N    . VAL A 1 97  ? -2.220  -11.892 7.178  1.00 0.00 ? 97  VAL A N    5  
ATOM 8606  C CA   . VAL A 1 97  ? -3.312  -11.065 6.693  1.00 0.00 ? 97  VAL A CA   5  
ATOM 8607  C C    . VAL A 1 97  ? -3.430  -9.817  7.571  1.00 0.00 ? 97  VAL A C    5  
ATOM 8608  O O    . VAL A 1 97  ? -3.924  -9.889  8.695  1.00 0.00 ? 97  VAL A O    5  
ATOM 8609  C CB   . VAL A 1 97  ? -4.604  -11.883 6.640  1.00 0.00 ? 97  VAL A CB   5  
ATOM 8610  C CG1  . VAL A 1 97  ? -5.698  -11.131 5.880  1.00 0.00 ? 97  VAL A CG1  5  
ATOM 8611  C CG2  . VAL A 1 97  ? -4.355  -13.261 6.022  1.00 0.00 ? 97  VAL A CG2  5  
ATOM 8612  H H    . VAL A 1 97  ? -2.494  -12.650 7.770  1.00 0.00 ? 97  VAL A H    5  
ATOM 8613  H HA   . VAL A 1 97  ? -3.065  -10.757 5.677  1.00 0.00 ? 97  VAL A HA   5  
ATOM 8614  H HB   . VAL A 1 97  ? -4.948  -12.032 7.663  1.00 0.00 ? 97  VAL A HB   5  
ATOM 8615  H HG11 . VAL A 1 97  ? -5.552  -10.057 6.001  1.00 0.00 ? 97  VAL A HG11 5  
ATOM 8616  H HG12 . VAL A 1 97  ? -5.647  -11.387 4.822  1.00 0.00 ? 97  VAL A HG12 5  
ATOM 8617  H HG13 . VAL A 1 97  ? -6.674  -11.412 6.275  1.00 0.00 ? 97  VAL A HG13 5  
ATOM 8618  H HG21 . VAL A 1 97  ? -3.980  -13.940 6.788  1.00 0.00 ? 97  VAL A HG21 5  
ATOM 8619  H HG22 . VAL A 1 97  ? -5.289  -13.651 5.617  1.00 0.00 ? 97  VAL A HG22 5  
ATOM 8620  H HG23 . VAL A 1 97  ? -3.620  -13.173 5.223  1.00 0.00 ? 97  VAL A HG23 5  
ATOM 8621  N N    . VAL A 1 98  ? -2.968  -8.702  7.024  1.00 0.00 ? 98  VAL A N    5  
ATOM 8622  C CA   . VAL A 1 98  ? -3.016  -7.441  7.743  1.00 0.00 ? 98  VAL A CA   5  
ATOM 8623  C C    . VAL A 1 98  ? -4.373  -6.775  7.507  1.00 0.00 ? 98  VAL A C    5  
ATOM 8624  O O    . VAL A 1 98  ? -5.220  -7.318  6.799  1.00 0.00 ? 98  VAL A O    5  
ATOM 8625  C CB   . VAL A 1 98  ? -1.837  -6.558  7.329  1.00 0.00 ? 98  VAL A CB   5  
ATOM 8626  C CG1  . VAL A 1 98  ? -0.559  -7.385  7.178  1.00 0.00 ? 98  VAL A CG1  5  
ATOM 8627  C CG2  . VAL A 1 98  ? -2.150  -5.792  6.042  1.00 0.00 ? 98  VAL A CG2  5  
ATOM 8628  H H    . VAL A 1 98  ? -2.567  -8.653  6.109  1.00 0.00 ? 98  VAL A H    5  
ATOM 8629  H HA   . VAL A 1 98  ? -2.914  -7.663  8.805  1.00 0.00 ? 98  VAL A HA   5  
ATOM 8630  H HB   . VAL A 1 98  ? -1.671  -5.827  8.121  1.00 0.00 ? 98  VAL A HB   5  
ATOM 8631  H HG11 . VAL A 1 98  ? -0.566  -7.891  6.213  1.00 0.00 ? 98  VAL A HG11 5  
ATOM 8632  H HG12 . VAL A 1 98  ? 0.309   -6.728  7.237  1.00 0.00 ? 98  VAL A HG12 5  
ATOM 8633  H HG13 . VAL A 1 98  ? -0.509  -8.125  7.976  1.00 0.00 ? 98  VAL A HG13 5  
ATOM 8634  H HG21 . VAL A 1 98  ? -2.899  -6.338  5.468  1.00 0.00 ? 98  VAL A HG21 5  
ATOM 8635  H HG22 . VAL A 1 98  ? -2.534  -4.803  6.292  1.00 0.00 ? 98  VAL A HG22 5  
ATOM 8636  H HG23 . VAL A 1 98  ? -1.241  -5.691  5.449  1.00 0.00 ? 98  VAL A HG23 5  
ATOM 8637  N N    . GLU A 1 99  ? -4.538  -5.609  8.114  1.00 0.00 ? 99  GLU A N    5  
ATOM 8638  C CA   . GLU A 1 99  ? -5.778  -4.864  7.979  1.00 0.00 ? 99  GLU A CA   5  
ATOM 8639  C C    . GLU A 1 99  ? -5.526  -3.370  8.198  1.00 0.00 ? 99  GLU A C    5  
ATOM 8640  O O    . GLU A 1 99  ? -5.259  -2.940  9.319  1.00 0.00 ? 99  GLU A O    5  
ATOM 8641  C CB   . GLU A 1 99  ? -6.841  -5.388  8.946  1.00 0.00 ? 99  GLU A CB   5  
ATOM 8642  C CG   . GLU A 1 99  ? -6.198  -5.952  10.215 1.00 0.00 ? 99  GLU A CG   5  
ATOM 8643  C CD   . GLU A 1 99  ? -7.250  -6.585  11.128 1.00 0.00 ? 99  GLU A CD   5  
ATOM 8644  O OE1  . GLU A 1 99  ? -8.266  -5.902  11.381 1.00 0.00 ? 99  GLU A OE1  5  
ATOM 8645  O OE2  . GLU A 1 99  ? -7.015  -7.737  11.551 1.00 0.00 ? 99  GLU A OE2  5  
ATOM 8646  H H    . GLU A 1 99  ? -3.844  -5.175  8.688  1.00 0.00 ? 99  GLU A H    5  
ATOM 8647  H HA   . GLU A 1 99  ? -6.110  -5.037  6.955  1.00 0.00 ? 99  GLU A HA   5  
ATOM 8648  H HB2  . GLU A 1 99  ? -7.528  -4.584  9.208  1.00 0.00 ? 99  GLU A HB2  5  
ATOM 8649  H HB3  . GLU A 1 99  ? -7.431  -6.164  8.457  1.00 0.00 ? 99  GLU A HB3  5  
ATOM 8650  H HG2  . GLU A 1 99  ? -5.449  -6.697  9.947  1.00 0.00 ? 99  GLU A HG2  5  
ATOM 8651  H HG3  . GLU A 1 99  ? -5.680  -5.156  10.748 1.00 0.00 ? 99  GLU A HG3  5  
ATOM 8652  N N    . PRO A 1 100 ? -5.623  -2.601  7.081  1.00 0.00 ? 100 PRO A N    5  
ATOM 8653  C CA   . PRO A 1 100 ? -5.409  -1.165  7.140  1.00 0.00 ? 100 PRO A CA   5  
ATOM 8654  C C    . PRO A 1 100 ? -6.609  -0.458  7.773  1.00 0.00 ? 100 PRO A C    5  
ATOM 8655  O O    . PRO A 1 100 ? -7.706  -1.011  7.821  1.00 0.00 ? 100 PRO A O    5  
ATOM 8656  C CB   . PRO A 1 100 ? -5.163  -0.744  5.700  1.00 0.00 ? 100 PRO A CB   5  
ATOM 8657  C CG   . PRO A 1 100 ? -5.706  -1.872  4.838  1.00 0.00 ? 100 PRO A CG   5  
ATOM 8658  C CD   . PRO A 1 100 ? -5.938  -3.076  5.737  1.00 0.00 ? 100 PRO A CD   5  
ATOM 8659  H HA   . PRO A 1 100 ? -4.627  -0.955  7.727  1.00 0.00 ? 100 PRO A HA   5  
ATOM 8660  H HB2  . PRO A 1 100 ? -5.667  0.196   5.477  1.00 0.00 ? 100 PRO A HB2  5  
ATOM 8661  H HB3  . PRO A 1 100 ? -4.100  -0.588  5.515  1.00 0.00 ? 100 PRO A HB3  5  
ATOM 8662  H HG2  . PRO A 1 100 ? -6.636  -1.571  4.356  1.00 0.00 ? 100 PRO A HG2  5  
ATOM 8663  H HG3  . PRO A 1 100 ? -5.001  -2.119  4.044  1.00 0.00 ? 100 PRO A HG3  5  
ATOM 8664  H HD2  . PRO A 1 100 ? -6.968  -3.426  5.671  1.00 0.00 ? 100 PRO A HD2  5  
ATOM 8665  H HD3  . PRO A 1 100 ? -5.298  -3.912  5.452  1.00 0.00 ? 100 PRO A HD3  5  
ATOM 8666  N N    . LYS A 1 101 ? -6.359  0.755   8.244  1.00 0.00 ? 101 LYS A N    5  
ATOM 8667  C CA   . LYS A 1 101 ? -7.405  1.544   8.873  1.00 0.00 ? 101 LYS A CA   5  
ATOM 8668  C C    . LYS A 1 101 ? -7.322  2.987   8.369  1.00 0.00 ? 101 LYS A C    5  
ATOM 8669  O O    . LYS A 1 101 ? -6.306  3.394   7.807  1.00 0.00 ? 101 LYS A O    5  
ATOM 8670  C CB   . LYS A 1 101 ? -7.329  1.419   10.395 1.00 0.00 ? 101 LYS A CB   5  
ATOM 8671  C CG   . LYS A 1 101 ? -7.102  -0.035  10.815 1.00 0.00 ? 101 LYS A CG   5  
ATOM 8672  C CD   . LYS A 1 101 ? -8.411  -0.827  10.778 1.00 0.00 ? 101 LYS A CD   5  
ATOM 8673  C CE   . LYS A 1 101 ? -8.230  -2.214  11.398 1.00 0.00 ? 101 LYS A CE   5  
ATOM 8674  N NZ   . LYS A 1 101 ? -9.189  -2.416  12.506 1.00 0.00 ? 101 LYS A NZ   5  
ATOM 8675  H H    . LYS A 1 101 ? -5.463  1.198   8.202  1.00 0.00 ? 101 LYS A H    5  
ATOM 8676  H HA   . LYS A 1 101 ? -8.362  1.125   8.562  1.00 0.00 ? 101 LYS A HA   5  
ATOM 8677  H HB2  . LYS A 1 101 ? -6.519  2.042   10.776 1.00 0.00 ? 101 LYS A HB2  5  
ATOM 8678  H HB3  . LYS A 1 101 ? -8.252  1.790   10.841 1.00 0.00 ? 101 LYS A HB3  5  
ATOM 8679  H HG2  . LYS A 1 101 ? -6.373  -0.499  10.152 1.00 0.00 ? 101 LYS A HG2  5  
ATOM 8680  H HG3  . LYS A 1 101 ? -6.683  -0.065  11.821 1.00 0.00 ? 101 LYS A HG3  5  
ATOM 8681  H HD2  . LYS A 1 101 ? -9.185  -0.282  11.318 1.00 0.00 ? 101 LYS A HD2  5  
ATOM 8682  H HD3  . LYS A 1 101 ? -8.750  -0.927  9.748  1.00 0.00 ? 101 LYS A HD3  5  
ATOM 8683  H HE2  . LYS A 1 101 ? -8.377  -2.981  10.638 1.00 0.00 ? 101 LYS A HE2  5  
ATOM 8684  H HE3  . LYS A 1 101 ? -7.210  -2.323  11.768 1.00 0.00 ? 101 LYS A HE3  5  
ATOM 8685  H HZ1  . LYS A 1 101 ? -10.109 -2.172  12.199 1.00 0.00 ? 101 LYS A HZ1  5  
ATOM 8686  H HZ2  . LYS A 1 101 ? -9.176  -3.375  12.789 1.00 0.00 ? 101 LYS A HZ2  5  
ATOM 8687  H HZ3  . LYS A 1 101 ? -8.932  -1.837  13.280 1.00 0.00 ? 101 LYS A HZ3  5  
ATOM 8688  N N    . ARG A 1 102 ? -8.403  3.720   8.590  1.00 0.00 ? 102 ARG A N    5  
ATOM 8689  C CA   . ARG A 1 102 ? -8.465  5.108   8.166  1.00 0.00 ? 102 ARG A CA   5  
ATOM 8690  C C    . ARG A 1 102 ? -7.490  5.957   8.984  1.00 0.00 ? 102 ARG A C    5  
ATOM 8691  O O    . ARG A 1 102 ? -6.817  6.832   8.441  1.00 0.00 ? 102 ARG A O    5  
ATOM 8692  C CB   . ARG A 1 102 ? -9.879  5.671   8.326  1.00 0.00 ? 102 ARG A CB   5  
ATOM 8693  C CG   . ARG A 1 102 ? -10.546 5.875   6.964  1.00 0.00 ? 102 ARG A CG   5  
ATOM 8694  C CD   . ARG A 1 102 ? -12.058 5.660   7.056  1.00 0.00 ? 102 ARG A CD   5  
ATOM 8695  N NE   . ARG A 1 102 ? -12.768 6.745   6.345  1.00 0.00 ? 102 ARG A NE   5  
ATOM 8696  C CZ   . ARG A 1 102 ? -12.808 6.869   5.011  1.00 0.00 ? 102 ARG A CZ   5  
ATOM 8697  N NH1  . ARG A 1 102 ? -12.178 5.975   4.236  1.00 0.00 ? 102 ARG A NH1  5  
ATOM 8698  N NH2  . ARG A 1 102 ? -13.477 7.887   4.452  1.00 0.00 ? 102 ARG A NH2  5  
ATOM 8699  H H    . ARG A 1 102 ? -9.225  3.381   9.048  1.00 0.00 ? 102 ARG A H    5  
ATOM 8700  H HA   . ARG A 1 102 ? -8.182  5.091   7.113  1.00 0.00 ? 102 ARG A HA   5  
ATOM 8701  H HB2  . ARG A 1 102 ? -10.479 4.990   8.930  1.00 0.00 ? 102 ARG A HB2  5  
ATOM 8702  H HB3  . ARG A 1 102 ? -9.838  6.619   8.861  1.00 0.00 ? 102 ARG A HB3  5  
ATOM 8703  H HG2  . ARG A 1 102 ? -10.340 6.882   6.602  1.00 0.00 ? 102 ARG A HG2  5  
ATOM 8704  H HG3  . ARG A 1 102 ? -10.119 5.182   6.239  1.00 0.00 ? 102 ARG A HG3  5  
ATOM 8705  H HD2  . ARG A 1 102 ? -12.323 4.695   6.623  1.00 0.00 ? 102 ARG A HD2  5  
ATOM 8706  H HD3  . ARG A 1 102 ? -12.367 5.635   8.101  1.00 0.00 ? 102 ARG A HD3  5  
ATOM 8707  H HE   . ARG A 1 102 ? -13.248 7.430   6.893  1.00 0.00 ? 102 ARG A HE   5  
ATOM 8708  H HH11 . ARG A 1 102 ? -11.678 5.216   4.653  1.00 0.00 ? 102 ARG A HH11 5  
ATOM 8709  H HH12 . ARG A 1 102 ? -12.207 6.068   3.241  1.00 0.00 ? 102 ARG A HH12 5  
ATOM 8710  H HH21 . ARG A 1 102 ? -13.947 8.554   5.030  1.00 0.00 ? 102 ARG A HH21 5  
ATOM 8711  H HH22 . ARG A 1 102 ? -13.506 7.979   3.457  1.00 0.00 ? 102 ARG A HH22 5  
ATOM 8712  N N    . ALA A 1 103 ? -7.445  5.669   10.276 1.00 0.00 ? 103 ALA A N    5  
ATOM 8713  C CA   . ALA A 1 103 ? -6.563  6.396   11.174 1.00 0.00 ? 103 ALA A CA   5  
ATOM 8714  C C    . ALA A 1 103 ? -7.240  7.699   11.603 1.00 0.00 ? 103 ALA A C    5  
ATOM 8715  O O    . ALA A 1 103 ? -6.591  8.740   11.691 1.00 0.00 ? 103 ALA A O    5  
ATOM 8716  C CB   . ALA A 1 103 ? -5.218  6.636   10.486 1.00 0.00 ? 103 ALA A CB   5  
ATOM 8717  H H    . ALA A 1 103 ? -7.996  4.956   10.710 1.00 0.00 ? 103 ALA A H    5  
ATOM 8718  H HA   . ALA A 1 103 ? -6.401  5.774   12.055 1.00 0.00 ? 103 ALA A HA   5  
ATOM 8719  H HB1  . ALA A 1 103 ? -5.060  5.876   9.721  1.00 0.00 ? 103 ALA A HB1  5  
ATOM 8720  H HB2  . ALA A 1 103 ? -5.219  7.623   10.022 1.00 0.00 ? 103 ALA A HB2  5  
ATOM 8721  H HB3  . ALA A 1 103 ? -4.418  6.582   11.223 1.00 0.00 ? 103 ALA A HB3  5  
ATOM 8722  N N    . VAL A 1 104 ? -8.536  7.599   11.859 1.00 0.00 ? 104 VAL A N    5  
ATOM 8723  C CA   . VAL A 1 104 ? -9.308  8.757   12.276 1.00 0.00 ? 104 VAL A CA   5  
ATOM 8724  C C    . VAL A 1 104 ? -9.883  8.505   13.672 1.00 0.00 ? 104 VAL A C    5  
ATOM 8725  O O    . VAL A 1 104 ? -9.741  7.412   14.218 1.00 0.00 ? 104 VAL A O    5  
ATOM 8726  C CB   . VAL A 1 104 ? -10.384 9.072   11.235 1.00 0.00 ? 104 VAL A CB   5  
ATOM 8727  C CG1  . VAL A 1 104 ? -9.757  9.358   9.869  1.00 0.00 ? 104 VAL A CG1  5  
ATOM 8728  C CG2  . VAL A 1 104 ? -11.407 7.938   11.142 1.00 0.00 ? 104 VAL A CG2  5  
ATOM 8729  H H    . VAL A 1 104 ? -9.057  6.748   11.785 1.00 0.00 ? 104 VAL A H    5  
ATOM 8730  H HA   . VAL A 1 104 ? -8.627  9.606   12.325 1.00 0.00 ? 104 VAL A HA   5  
ATOM 8731  H HB   . VAL A 1 104 ? -10.909 9.971   11.557 1.00 0.00 ? 104 VAL A HB   5  
ATOM 8732  H HG11 . VAL A 1 104 ? -8.956  8.644   9.680  1.00 0.00 ? 104 VAL A HG11 5  
ATOM 8733  H HG12 . VAL A 1 104 ? -10.517 9.264   9.093  1.00 0.00 ? 104 VAL A HG12 5  
ATOM 8734  H HG13 . VAL A 1 104 ? -9.351  10.370  9.860  1.00 0.00 ? 104 VAL A HG13 5  
ATOM 8735  H HG21 . VAL A 1 104 ? -11.996 7.904   12.059 1.00 0.00 ? 104 VAL A HG21 5  
ATOM 8736  H HG22 . VAL A 1 104 ? -12.067 8.113   10.293 1.00 0.00 ? 104 VAL A HG22 5  
ATOM 8737  H HG23 . VAL A 1 104 ? -10.886 6.989   11.009 1.00 0.00 ? 104 VAL A HG23 5  
ATOM 8738  N N    . ALA A 1 105 ? -10.520 9.535   14.209 1.00 0.00 ? 105 ALA A N    5  
ATOM 8739  C CA   . ALA A 1 105 ? -11.117 9.440   15.530 1.00 0.00 ? 105 ALA A CA   5  
ATOM 8740  C C    . ALA A 1 105 ? -10.018 9.183   16.564 1.00 0.00 ? 105 ALA A C    5  
ATOM 8741  O O    . ALA A 1 105 ? -9.135  8.356   16.344 1.00 0.00 ? 105 ALA A O    5  
ATOM 8742  C CB   . ALA A 1 105 ? -12.185 8.344   15.530 1.00 0.00 ? 105 ALA A CB   5  
ATOM 8743  H H    . ALA A 1 105 ? -10.631 10.421  13.759 1.00 0.00 ? 105 ALA A H    5  
ATOM 8744  H HA   . ALA A 1 105 ? -11.594 10.395  15.749 1.00 0.00 ? 105 ALA A HA   5  
ATOM 8745  H HB1  . ALA A 1 105 ? -13.085 8.715   15.040 1.00 0.00 ? 105 ALA A HB1  5  
ATOM 8746  H HB2  . ALA A 1 105 ? -11.811 7.473   14.993 1.00 0.00 ? 105 ALA A HB2  5  
ATOM 8747  H HB3  . ALA A 1 105 ? -12.419 8.065   16.558 1.00 0.00 ? 105 ALA A HB3  5  
ATOM 8748  N N    . ARG A 1 106 ? -10.109 9.907   17.670 1.00 0.00 ? 106 ARG A N    5  
ATOM 8749  C CA   . ARG A 1 106 ? -9.134  9.768   18.738 1.00 0.00 ? 106 ARG A CA   5  
ATOM 8750  C C    . ARG A 1 106 ? -8.812  8.291   18.973 1.00 0.00 ? 106 ARG A C    5  
ATOM 8751  O O    . ARG A 1 106 ? -9.703  7.445   18.940 1.00 0.00 ? 106 ARG A O    5  
ATOM 8752  C CB   . ARG A 1 106 ? -9.651  10.384  20.039 1.00 0.00 ? 106 ARG A CB   5  
ATOM 8753  C CG   . ARG A 1 106 ? -10.906 9.658   20.529 1.00 0.00 ? 106 ARG A CG   5  
ATOM 8754  C CD   . ARG A 1 106 ? -12.024 10.652  20.850 1.00 0.00 ? 106 ARG A CD   5  
ATOM 8755  N NE   . ARG A 1 106 ? -12.886 10.114  21.927 1.00 0.00 ? 106 ARG A NE   5  
ATOM 8756  C CZ   . ARG A 1 106 ? -14.084 10.617  22.253 1.00 0.00 ? 106 ARG A CZ   5  
ATOM 8757  N NH1  . ARG A 1 106 ? -14.570 11.674  21.588 1.00 0.00 ? 106 ARG A NH1  5  
ATOM 8758  N NH2  . ARG A 1 106 ? -14.796 10.064  23.244 1.00 0.00 ? 106 ARG A NH2  5  
ATOM 8759  H H    . ARG A 1 106 ? -10.831 10.578  17.841 1.00 0.00 ? 106 ARG A H    5  
ATOM 8760  H HA   . ARG A 1 106 ? -8.256  10.310  18.386 1.00 0.00 ? 106 ARG A HA   5  
ATOM 8761  H HB2  . ARG A 1 106 ? -8.876  10.333  20.804 1.00 0.00 ? 106 ARG A HB2  5  
ATOM 8762  H HB3  . ARG A 1 106 ? -9.875  11.439  19.883 1.00 0.00 ? 106 ARG A HB3  5  
ATOM 8763  H HG2  . ARG A 1 106 ? -11.246 8.958   19.766 1.00 0.00 ? 106 ARG A HG2  5  
ATOM 8764  H HG3  . ARG A 1 106 ? -10.669 9.072   21.416 1.00 0.00 ? 106 ARG A HG3  5  
ATOM 8765  H HD2  . ARG A 1 106 ? -11.596 11.606  21.159 1.00 0.00 ? 106 ARG A HD2  5  
ATOM 8766  H HD3  . ARG A 1 106 ? -12.620 10.843  19.958 1.00 0.00 ? 106 ARG A HD3  5  
ATOM 8767  H HE   . ARG A 1 106 ? -12.553 9.325   22.443 1.00 0.00 ? 106 ARG A HE   5  
ATOM 8768  H HH11 . ARG A 1 106 ? -14.038 12.087  20.848 1.00 0.00 ? 106 ARG A HH11 5  
ATOM 8769  H HH12 . ARG A 1 106 ? -15.464 12.050  21.831 1.00 0.00 ? 106 ARG A HH12 5  
ATOM 8770  H HH21 . ARG A 1 106 ? -14.433 9.275   23.740 1.00 0.00 ? 106 ARG A HH21 5  
ATOM 8771  H HH22 . ARG A 1 106 ? -15.690 10.440  23.487 1.00 0.00 ? 106 ARG A HH22 5  
ATOM 8772  N N    . GLU A 1 107 ? -7.534  8.027   19.206 1.00 0.00 ? 107 GLU A N    5  
ATOM 8773  C CA   . GLU A 1 107 ? -7.083  6.667   19.447 1.00 0.00 ? 107 GLU A CA   5  
ATOM 8774  C C    . GLU A 1 107 ? -5.670  6.673   20.035 1.00 0.00 ? 107 GLU A C    5  
ATOM 8775  O O    . GLU A 1 107 ? -4.849  7.517   19.678 1.00 0.00 ? 107 GLU A O    5  
ATOM 8776  C CB   . GLU A 1 107 ? -7.140  5.835   18.164 1.00 0.00 ? 107 GLU A CB   5  
ATOM 8777  C CG   . GLU A 1 107 ? -8.300  4.839   18.209 1.00 0.00 ? 107 GLU A CG   5  
ATOM 8778  C CD   . GLU A 1 107 ? -8.152  3.776   17.118 1.00 0.00 ? 107 GLU A CD   5  
ATOM 8779  O OE1  . GLU A 1 107 ? -7.431  2.790   17.380 1.00 0.00 ? 107 GLU A OE1  5  
ATOM 8780  O OE2  . GLU A 1 107 ? -8.763  3.975   16.045 1.00 0.00 ? 107 GLU A OE2  5  
ATOM 8781  H H    . GLU A 1 107 ? -6.815  8.722   19.232 1.00 0.00 ? 107 GLU A H    5  
ATOM 8782  H HA   . GLU A 1 107 ? -7.784  6.254   20.173 1.00 0.00 ? 107 GLU A HA   5  
ATOM 8783  H HB2  . GLU A 1 107 ? -7.255  6.495   17.304 1.00 0.00 ? 107 GLU A HB2  5  
ATOM 8784  H HB3  . GLU A 1 107 ? -6.200  5.300   18.032 1.00 0.00 ? 107 GLU A HB3  5  
ATOM 8785  H HG2  . GLU A 1 107 ? -8.335  4.358   19.186 1.00 0.00 ? 107 GLU A HG2  5  
ATOM 8786  H HG3  . GLU A 1 107 ? -9.244  5.368   18.080 1.00 0.00 ? 107 GLU A HG3  5  
ATOM 8787  N N    . GLU A 1 108 ? -5.430  5.722   20.925 1.00 0.00 ? 108 GLU A N    5  
ATOM 8788  C CA   . GLU A 1 108 ? -4.131  5.607   21.566 1.00 0.00 ? 108 GLU A CA   5  
ATOM 8789  C C    . GLU A 1 108 ? -3.014  5.745   20.529 1.00 0.00 ? 108 GLU A C    5  
ATOM 8790  O O    . GLU A 1 108 ? -3.192  5.382   19.367 1.00 0.00 ? 108 GLU A O    5  
ATOM 8791  C CB   . GLU A 1 108 ? -4.011  4.286   22.328 1.00 0.00 ? 108 GLU A CB   5  
ATOM 8792  C CG   . GLU A 1 108 ? -4.166  3.092   21.384 1.00 0.00 ? 108 GLU A CG   5  
ATOM 8793  C CD   . GLU A 1 108 ? -5.640  2.724   21.202 1.00 0.00 ? 108 GLU A CD   5  
ATOM 8794  O OE1  . GLU A 1 108 ? -6.306  2.518   22.239 1.00 0.00 ? 108 GLU A OE1  5  
ATOM 8795  O OE2  . GLU A 1 108 ? -6.068  2.658   20.029 1.00 0.00 ? 108 GLU A OE2  5  
ATOM 8796  H H    . GLU A 1 108 ? -6.104  5.039   21.210 1.00 0.00 ? 108 GLU A H    5  
ATOM 8797  H HA   . GLU A 1 108 ? -4.083  6.433   22.274 1.00 0.00 ? 108 GLU A HA   5  
ATOM 8798  H HB2  . GLU A 1 108 ? -3.043  4.236   22.827 1.00 0.00 ? 108 GLU A HB2  5  
ATOM 8799  H HB3  . GLU A 1 108 ? -4.773  4.240   23.106 1.00 0.00 ? 108 GLU A HB3  5  
ATOM 8800  H HG2  . GLU A 1 108 ? -3.724  3.329   20.416 1.00 0.00 ? 108 GLU A HG2  5  
ATOM 8801  H HG3  . GLU A 1 108 ? -3.621  2.236   21.782 1.00 0.00 ? 108 GLU A HG3  5  
ATOM 8802  N N    . SER A 1 109 ? -1.888  6.271   20.986 1.00 0.00 ? 109 SER A N    5  
ATOM 8803  C CA   . SER A 1 109 ? -0.742  6.462   20.113 1.00 0.00 ? 109 SER A CA   5  
ATOM 8804  C C    . SER A 1 109 ? 0.543   6.520   20.941 1.00 0.00 ? 109 SER A C    5  
ATOM 8805  O O    . SER A 1 109 ? 0.512   6.878   22.118 1.00 0.00 ? 109 SER A O    5  
ATOM 8806  C CB   . SER A 1 109 ? -0.893  7.735   19.278 1.00 0.00 ? 109 SER A CB   5  
ATOM 8807  O OG   . SER A 1 109 ? -0.566  8.905   20.023 1.00 0.00 ? 109 SER A OG   5  
ATOM 8808  H H    . SER A 1 109 ? -1.751  6.565   21.933 1.00 0.00 ? 109 SER A H    5  
ATOM 8809  H HA   . SER A 1 109 ? -0.734  5.595   19.454 1.00 0.00 ? 109 SER A HA   5  
ATOM 8810  H HB2  . SER A 1 109 ? -0.248  7.672   18.401 1.00 0.00 ? 109 SER A HB2  5  
ATOM 8811  H HB3  . SER A 1 109 ? -1.918  7.811   18.914 1.00 0.00 ? 109 SER A HB3  5  
ATOM 8812  H HG   . SER A 1 109 ? -0.539  9.700   19.417 1.00 0.00 ? 109 SER A HG   5  
ATOM 8813  N N    . GLY A 1 110 ? 1.642   6.162   20.294 1.00 0.00 ? 110 GLY A N    5  
ATOM 8814  C CA   . GLY A 1 110 ? 2.936   6.168   20.956 1.00 0.00 ? 110 GLY A CA   5  
ATOM 8815  C C    . GLY A 1 110 ? 3.654   7.502   20.743 1.00 0.00 ? 110 GLY A C    5  
ATOM 8816  O O    . GLY A 1 110 ? 3.177   8.356   19.997 1.00 0.00 ? 110 GLY A O    5  
ATOM 8817  H H    . GLY A 1 110 ? 1.659   5.872   19.337 1.00 0.00 ? 110 GLY A H    5  
ATOM 8818  H HA2  . GLY A 1 110 ? 2.803   5.989   22.023 1.00 0.00 ? 110 GLY A HA2  5  
ATOM 8819  H HA3  . GLY A 1 110 ? 3.550   5.355   20.570 1.00 0.00 ? 110 GLY A HA3  5  
ATOM 8820  N N    . SER A 1 111 ? 4.790   7.640   21.411 1.00 0.00 ? 111 SER A N    5  
ATOM 8821  C CA   . SER A 1 111 ? 5.579   8.855   21.304 1.00 0.00 ? 111 SER A CA   5  
ATOM 8822  C C    . SER A 1 111 ? 4.777   10.048  21.827 1.00 0.00 ? 111 SER A C    5  
ATOM 8823  O O    . SER A 1 111 ? 3.718   10.372  21.291 1.00 0.00 ? 111 SER A O    5  
ATOM 8824  C CB   . SER A 1 111 ? 6.016   9.102   19.859 1.00 0.00 ? 111 SER A CB   5  
ATOM 8825  O OG   . SER A 1 111 ? 6.877   10.232  19.747 1.00 0.00 ? 111 SER A OG   5  
ATOM 8826  H H    . SER A 1 111 ? 5.172   6.940   22.015 1.00 0.00 ? 111 SER A H    5  
ATOM 8827  H HA   . SER A 1 111 ? 6.459   8.684   21.925 1.00 0.00 ? 111 SER A HA   5  
ATOM 8828  H HB2  . SER A 1 111 ? 6.528   8.218   19.478 1.00 0.00 ? 111 SER A HB2  5  
ATOM 8829  H HB3  . SER A 1 111 ? 5.136   9.255   19.235 1.00 0.00 ? 111 SER A HB3  5  
ATOM 8830  H HG   . SER A 1 111 ? 7.739   10.054  20.223 1.00 0.00 ? 111 SER A HG   5  
ATOM 8831  N N    . GLY A 1 112 ? 5.311   10.668  22.869 1.00 0.00 ? 112 GLY A N    5  
ATOM 8832  C CA   . GLY A 1 112 ? 4.657   11.818  23.471 1.00 0.00 ? 112 GLY A CA   5  
ATOM 8833  C C    . GLY A 1 112 ? 4.969   11.905  24.966 1.00 0.00 ? 112 GLY A C    5  
ATOM 8834  O O    . GLY A 1 112 ? 4.326   11.242  25.778 1.00 0.00 ? 112 GLY A O    5  
ATOM 8835  H H    . GLY A 1 112 ? 6.172   10.398  23.300 1.00 0.00 ? 112 GLY A H    5  
ATOM 8836  H HA2  . GLY A 1 112 ? 4.987   12.730  22.973 1.00 0.00 ? 112 GLY A HA2  5  
ATOM 8837  H HA3  . GLY A 1 112 ? 3.580   11.747  23.324 1.00 0.00 ? 112 GLY A HA3  5  
ATOM 8838  N N    . PRO A 1 113 ? 5.982   12.752  25.294 1.00 0.00 ? 113 PRO A N    5  
ATOM 8839  C CA   . PRO A 1 113 ? 6.387   12.934  26.677 1.00 0.00 ? 113 PRO A CA   5  
ATOM 8840  C C    . PRO A 1 113 ? 5.375   13.797  27.435 1.00 0.00 ? 113 PRO A C    5  
ATOM 8841  O O    . PRO A 1 113 ? 5.709   14.883  27.904 1.00 0.00 ? 113 PRO A O    5  
ATOM 8842  C CB   . PRO A 1 113 ? 7.768   13.565  26.603 1.00 0.00 ? 113 PRO A CB   5  
ATOM 8843  C CG   . PRO A 1 113 ? 7.890   14.138  25.200 1.00 0.00 ? 113 PRO A CG   5  
ATOM 8844  C CD   . PRO A 1 113 ? 6.766   13.554  24.359 1.00 0.00 ? 113 PRO A CD   5  
ATOM 8845  H HA   . PRO A 1 113 ? 6.406   12.055  27.152 1.00 0.00 ? 113 PRO A HA   5  
ATOM 8846  H HB2  . PRO A 1 113 ? 7.881   14.346  27.354 1.00 0.00 ? 113 PRO A HB2  5  
ATOM 8847  H HB3  . PRO A 1 113 ? 8.546   12.826  26.792 1.00 0.00 ? 113 PRO A HB3  5  
ATOM 8848  H HG2  . PRO A 1 113 ? 7.823   15.225  25.224 1.00 0.00 ? 113 PRO A HG2  5  
ATOM 8849  H HG3  . PRO A 1 113 ? 8.859   13.888  24.769 1.00 0.00 ? 113 PRO A HG3  5  
ATOM 8850  H HD2  . PRO A 1 113 ? 6.161   14.339  23.907 1.00 0.00 ? 113 PRO A HD2  5  
ATOM 8851  H HD3  . PRO A 1 113 ? 7.157   12.944  23.545 1.00 0.00 ? 113 PRO A HD3  5  
ATOM 8852  N N    . SER A 1 114 ? 4.159   13.280  27.531 1.00 0.00 ? 114 SER A N    5  
ATOM 8853  C CA   . SER A 1 114 ? 3.097   13.989  28.224 1.00 0.00 ? 114 SER A CA   5  
ATOM 8854  C C    . SER A 1 114 ? 3.227   13.780  29.734 1.00 0.00 ? 114 SER A C    5  
ATOM 8855  O O    . SER A 1 114 ? 3.227   12.645  30.209 1.00 0.00 ? 114 SER A O    5  
ATOM 8856  C CB   . SER A 1 114 ? 1.721   13.528  27.740 1.00 0.00 ? 114 SER A CB   5  
ATOM 8857  O OG   . SER A 1 114 ? 1.015   14.567  27.068 1.00 0.00 ? 114 SER A OG   5  
ATOM 8858  H H    . SER A 1 114 ? 3.896   12.395  27.146 1.00 0.00 ? 114 SER A H    5  
ATOM 8859  H HA   . SER A 1 114 ? 3.238   15.039  27.970 1.00 0.00 ? 114 SER A HA   5  
ATOM 8860  H HB2  . SER A 1 114 ? 1.838   12.677  27.069 1.00 0.00 ? 114 SER A HB2  5  
ATOM 8861  H HB3  . SER A 1 114 ? 1.134   13.183  28.592 1.00 0.00 ? 114 SER A HB3  5  
ATOM 8862  H HG   . SER A 1 114 ? 0.084   14.269  26.858 1.00 0.00 ? 114 SER A HG   5  
ATOM 8863  N N    . SER A 1 115 ? 3.334   14.892  30.446 1.00 0.00 ? 115 SER A N    5  
ATOM 8864  C CA   . SER A 1 115 ? 3.464   14.845  31.892 1.00 0.00 ? 115 SER A CA   5  
ATOM 8865  C C    . SER A 1 115 ? 4.775   14.156  32.278 1.00 0.00 ? 115 SER A C    5  
ATOM 8866  O O    . SER A 1 115 ? 5.378   13.461  31.462 1.00 0.00 ? 115 SER A O    5  
ATOM 8867  C CB   . SER A 1 115 ? 2.277   14.120  32.529 1.00 0.00 ? 115 SER A CB   5  
ATOM 8868  O OG   . SER A 1 115 ? 1.037   14.747  32.214 1.00 0.00 ? 115 SER A OG   5  
ATOM 8869  H H    . SER A 1 115 ? 3.333   15.811  30.051 1.00 0.00 ? 115 SER A H    5  
ATOM 8870  H HA   . SER A 1 115 ? 3.469   15.885  32.216 1.00 0.00 ? 115 SER A HA   5  
ATOM 8871  H HB2  . SER A 1 115 ? 2.257   13.085  32.185 1.00 0.00 ? 115 SER A HB2  5  
ATOM 8872  H HB3  . SER A 1 115 ? 2.405   14.093  33.611 1.00 0.00 ? 115 SER A HB3  5  
ATOM 8873  H HG   . SER A 1 115 ? 1.116   15.247  31.351 1.00 0.00 ? 115 SER A HG   5  
ATOM 8874  N N    . GLY A 1 116 ? 5.177   14.373  33.522 1.00 0.00 ? 116 GLY A N    5  
ATOM 8875  C CA   . GLY A 1 116 ? 6.405   13.782  34.025 1.00 0.00 ? 116 GLY A CA   5  
ATOM 8876  C C    . GLY A 1 116 ? 6.255   13.372  35.491 1.00 0.00 ? 116 GLY A C    5  
ATOM 8877  O O    . GLY A 1 116 ? 5.167   13.464  36.057 1.00 0.00 ? 116 GLY A O    5  
ATOM 8878  H H    . GLY A 1 116 ? 4.680   14.940  34.179 1.00 0.00 ? 116 GLY A H    5  
ATOM 8879  H HA2  . GLY A 1 116 ? 6.666   12.911  33.425 1.00 0.00 ? 116 GLY A HA2  5  
ATOM 8880  H HA3  . GLY A 1 116 ? 7.223   14.495  33.925 1.00 0.00 ? 116 GLY A HA3  5  
ATOM 8881  N N    . GLY A 1 1   ? -20.125 -23.752 14.876 1.00 0.00 ? 1   GLY A N    6  
ATOM 8882  C CA   . GLY A 1 1   ? -19.462 -22.893 15.843 1.00 0.00 ? 1   GLY A CA   6  
ATOM 8883  C C    . GLY A 1 1   ? -18.498 -21.928 15.149 1.00 0.00 ? 1   GLY A C    6  
ATOM 8884  O O    . GLY A 1 1   ? -17.886 -22.276 14.140 1.00 0.00 ? 1   GLY A O    6  
ATOM 8885  H H1   . GLY A 1 1   ? -21.050 -23.469 14.624 1.00 0.00 ? 1   GLY A H1   6  
ATOM 8886  H HA2  . GLY A 1 1   ? -20.207 -22.328 16.403 1.00 0.00 ? 1   GLY A HA2  6  
ATOM 8887  H HA3  . GLY A 1 1   ? -18.917 -23.503 16.563 1.00 0.00 ? 1   GLY A HA3  6  
ATOM 8888  N N    . SER A 1 2   ? -18.393 -20.736 15.718 1.00 0.00 ? 2   SER A N    6  
ATOM 8889  C CA   . SER A 1 2   ? -17.514 -19.719 15.167 1.00 0.00 ? 2   SER A CA   6  
ATOM 8890  C C    . SER A 1 2   ? -17.411 -18.537 16.132 1.00 0.00 ? 2   SER A C    6  
ATOM 8891  O O    . SER A 1 2   ? -18.355 -17.760 16.270 1.00 0.00 ? 2   SER A O    6  
ATOM 8892  C CB   . SER A 1 2   ? -18.008 -19.246 13.798 1.00 0.00 ? 2   SER A CB   6  
ATOM 8893  O OG   . SER A 1 2   ? -17.181 -18.220 13.257 1.00 0.00 ? 2   SER A OG   6  
ATOM 8894  H H    . SER A 1 2   ? -18.894 -20.462 16.538 1.00 0.00 ? 2   SER A H    6  
ATOM 8895  H HA   . SER A 1 2   ? -16.545 -20.206 15.053 1.00 0.00 ? 2   SER A HA   6  
ATOM 8896  H HB2  . SER A 1 2   ? -18.035 -20.091 13.110 1.00 0.00 ? 2   SER A HB2  6  
ATOM 8897  H HB3  . SER A 1 2   ? -19.030 -18.877 13.890 1.00 0.00 ? 2   SER A HB3  6  
ATOM 8898  H HG   . SER A 1 2   ? -17.316 -18.157 12.269 1.00 0.00 ? 2   SER A HG   6  
ATOM 8899  N N    . SER A 1 3   ? -16.257 -18.438 16.776 1.00 0.00 ? 3   SER A N    6  
ATOM 8900  C CA   . SER A 1 3   ? -16.019 -17.363 17.724 1.00 0.00 ? 3   SER A CA   6  
ATOM 8901  C C    . SER A 1 3   ? -14.552 -17.362 18.156 1.00 0.00 ? 3   SER A C    6  
ATOM 8902  O O    . SER A 1 3   ? -13.941 -18.421 18.296 1.00 0.00 ? 3   SER A O    6  
ATOM 8903  C CB   . SER A 1 3   ? -16.932 -17.494 18.945 1.00 0.00 ? 3   SER A CB   6  
ATOM 8904  O OG   . SER A 1 3   ? -17.317 -16.224 19.462 1.00 0.00 ? 3   SER A OG   6  
ATOM 8905  H H    . SER A 1 3   ? -15.495 -19.074 16.658 1.00 0.00 ? 3   SER A H    6  
ATOM 8906  H HA   . SER A 1 3   ? -16.261 -16.446 17.188 1.00 0.00 ? 3   SER A HA   6  
ATOM 8907  H HB2  . SER A 1 3   ? -17.823 -18.060 18.673 1.00 0.00 ? 3   SER A HB2  6  
ATOM 8908  H HB3  . SER A 1 3   ? -16.419 -18.062 19.722 1.00 0.00 ? 3   SER A HB3  6  
ATOM 8909  H HG   . SER A 1 3   ? -17.471 -15.581 18.712 1.00 0.00 ? 3   SER A HG   6  
ATOM 8910  N N    . GLY A 1 4   ? -14.027 -16.162 18.356 1.00 0.00 ? 4   GLY A N    6  
ATOM 8911  C CA   . GLY A 1 4   ? -12.643 -16.009 18.769 1.00 0.00 ? 4   GLY A CA   6  
ATOM 8912  C C    . GLY A 1 4   ? -12.512 -14.952 19.868 1.00 0.00 ? 4   GLY A C    6  
ATOM 8913  O O    . GLY A 1 4   ? -11.905 -13.903 19.656 1.00 0.00 ? 4   GLY A O    6  
ATOM 8914  H H    . GLY A 1 4   ? -14.531 -15.305 18.240 1.00 0.00 ? 4   GLY A H    6  
ATOM 8915  H HA2  . GLY A 1 4   ? -12.260 -16.963 19.131 1.00 0.00 ? 4   GLY A HA2  6  
ATOM 8916  H HA3  . GLY A 1 4   ? -12.033 -15.725 17.912 1.00 0.00 ? 4   GLY A HA3  6  
ATOM 8917  N N    . SER A 1 5   ? -13.092 -15.264 21.017 1.00 0.00 ? 5   SER A N    6  
ATOM 8918  C CA   . SER A 1 5   ? -13.048 -14.353 22.149 1.00 0.00 ? 5   SER A CA   6  
ATOM 8919  C C    . SER A 1 5   ? -13.603 -15.043 23.397 1.00 0.00 ? 5   SER A C    6  
ATOM 8920  O O    . SER A 1 5   ? -14.815 -15.199 23.537 1.00 0.00 ? 5   SER A O    6  
ATOM 8921  C CB   . SER A 1 5   ? -13.832 -13.073 21.857 1.00 0.00 ? 5   SER A CB   6  
ATOM 8922  O OG   . SER A 1 5   ? -13.201 -11.922 22.411 1.00 0.00 ? 5   SER A OG   6  
ATOM 8923  H H    . SER A 1 5   ? -13.584 -16.119 21.182 1.00 0.00 ? 5   SER A H    6  
ATOM 8924  H HA   . SER A 1 5   ? -11.994 -14.110 22.283 1.00 0.00 ? 5   SER A HA   6  
ATOM 8925  H HB2  . SER A 1 5   ? -13.933 -12.947 20.779 1.00 0.00 ? 5   SER A HB2  6  
ATOM 8926  H HB3  . SER A 1 5   ? -14.840 -13.165 22.262 1.00 0.00 ? 5   SER A HB3  6  
ATOM 8927  H HG   . SER A 1 5   ? -12.700 -12.172 23.240 1.00 0.00 ? 5   SER A HG   6  
ATOM 8928  N N    . SER A 1 6   ? -12.689 -15.437 24.272 1.00 0.00 ? 6   SER A N    6  
ATOM 8929  C CA   . SER A 1 6   ? -13.072 -16.106 25.504 1.00 0.00 ? 6   SER A CA   6  
ATOM 8930  C C    . SER A 1 6   ? -13.182 -15.088 26.640 1.00 0.00 ? 6   SER A C    6  
ATOM 8931  O O    . SER A 1 6   ? -12.220 -14.865 27.374 1.00 0.00 ? 6   SER A O    6  
ATOM 8932  C CB   . SER A 1 6   ? -12.070 -17.203 25.869 1.00 0.00 ? 6   SER A CB   6  
ATOM 8933  O OG   . SER A 1 6   ? -12.688 -18.484 25.954 1.00 0.00 ? 6   SER A OG   6  
ATOM 8934  H H    . SER A 1 6   ? -11.705 -15.306 24.150 1.00 0.00 ? 6   SER A H    6  
ATOM 8935  H HA   . SER A 1 6   ? -14.043 -16.556 25.298 1.00 0.00 ? 6   SER A HA   6  
ATOM 8936  H HB2  . SER A 1 6   ? -11.276 -17.232 25.123 1.00 0.00 ? 6   SER A HB2  6  
ATOM 8937  H HB3  . SER A 1 6   ? -11.601 -16.963 26.823 1.00 0.00 ? 6   SER A HB3  6  
ATOM 8938  H HG   . SER A 1 6   ? -13.518 -18.501 25.396 1.00 0.00 ? 6   SER A HG   6  
ATOM 8939  N N    . GLY A 1 7   ? -14.363 -14.497 26.750 1.00 0.00 ? 7   GLY A N    6  
ATOM 8940  C CA   . GLY A 1 7   ? -14.611 -13.507 27.784 1.00 0.00 ? 7   GLY A CA   6  
ATOM 8941  C C    . GLY A 1 7   ? -13.390 -12.607 27.986 1.00 0.00 ? 7   GLY A C    6  
ATOM 8942  O O    . GLY A 1 7   ? -12.536 -12.892 28.824 1.00 0.00 ? 7   GLY A O    6  
ATOM 8943  H H    . GLY A 1 7   ? -15.140 -14.684 26.149 1.00 0.00 ? 7   GLY A H    6  
ATOM 8944  H HA2  . GLY A 1 7   ? -15.474 -12.900 27.512 1.00 0.00 ? 7   GLY A HA2  6  
ATOM 8945  H HA3  . GLY A 1 7   ? -14.856 -14.008 28.721 1.00 0.00 ? 7   GLY A HA3  6  
ATOM 8946  N N    . MET A 1 8   ? -13.347 -11.538 27.204 1.00 0.00 ? 8   MET A N    6  
ATOM 8947  C CA   . MET A 1 8   ? -12.245 -10.595 27.287 1.00 0.00 ? 8   MET A CA   6  
ATOM 8948  C C    . MET A 1 8   ? -12.355 -9.732  28.546 1.00 0.00 ? 8   MET A C    6  
ATOM 8949  O O    . MET A 1 8   ? -13.235 -9.951  29.377 1.00 0.00 ? 8   MET A O    6  
ATOM 8950  C CB   . MET A 1 8   ? -12.250 -9.695  26.049 1.00 0.00 ? 8   MET A CB   6  
ATOM 8951  C CG   . MET A 1 8   ? -11.656 -10.421 24.841 1.00 0.00 ? 8   MET A CG   6  
ATOM 8952  S SD   . MET A 1 8   ? -10.066 -9.722  24.429 1.00 0.00 ? 8   MET A SD   6  
ATOM 8953  C CE   . MET A 1 8   ? -10.187 -9.704  22.648 1.00 0.00 ? 8   MET A CE   6  
ATOM 8954  H H    . MET A 1 8   ? -14.046 -11.314 26.525 1.00 0.00 ? 8   MET A H    6  
ATOM 8955  H HA   . MET A 1 8   ? -11.342 -11.203 27.332 1.00 0.00 ? 8   MET A HA   6  
ATOM 8956  H HB2  . MET A 1 8   ? -13.271 -9.383  25.826 1.00 0.00 ? 8   MET A HB2  6  
ATOM 8957  H HB3  . MET A 1 8   ? -11.678 -8.789  26.251 1.00 0.00 ? 8   MET A HB3  6  
ATOM 8958  H HG2  . MET A 1 8   ? -11.549 -11.483 25.061 1.00 0.00 ? 8   MET A HG2  6  
ATOM 8959  H HG3  . MET A 1 8   ? -12.331 -10.338 23.989 1.00 0.00 ? 8   MET A HG3  6  
ATOM 8960  H HE1  . MET A 1 8   ? -9.623  -10.542 22.238 1.00 0.00 ? 8   MET A HE1  6  
ATOM 8961  H HE2  . MET A 1 8   ? -11.233 -9.792  22.354 1.00 0.00 ? 8   MET A HE2  6  
ATOM 8962  H HE3  . MET A 1 8   ? -9.779  -8.769  22.265 1.00 0.00 ? 8   MET A HE3  6  
ATOM 8963  N N    . GLU A 1 9   ? -11.449 -8.771  28.646 1.00 0.00 ? 9   GLU A N    6  
ATOM 8964  C CA   . GLU A 1 9   ? -11.433 -7.874  29.790 1.00 0.00 ? 9   GLU A CA   6  
ATOM 8965  C C    . GLU A 1 9   ? -10.331 -6.826  29.627 1.00 0.00 ? 9   GLU A C    6  
ATOM 8966  O O    . GLU A 1 9   ? -10.518 -5.663  29.981 1.00 0.00 ? 9   GLU A O    6  
ATOM 8967  C CB   . GLU A 1 9   ? -11.260 -8.654  31.095 1.00 0.00 ? 9   GLU A CB   6  
ATOM 8968  C CG   . GLU A 1 9   ? -10.010 -9.534  31.046 1.00 0.00 ? 9   GLU A CG   6  
ATOM 8969  C CD   . GLU A 1 9   ? -10.225 -10.743 30.133 1.00 0.00 ? 9   GLU A CD   6  
ATOM 8970  O OE1  . GLU A 1 9   ? -10.925 -11.676 30.582 1.00 0.00 ? 9   GLU A OE1  6  
ATOM 8971  O OE2  . GLU A 1 9   ? -9.686  -10.705 29.006 1.00 0.00 ? 9   GLU A OE2  6  
ATOM 8972  H H    . GLU A 1 9   ? -10.737 -8.600  27.965 1.00 0.00 ? 9   GLU A H    6  
ATOM 8973  H HA   . GLU A 1 9   ? -12.409 -7.388  29.791 1.00 0.00 ? 9   GLU A HA   6  
ATOM 8974  H HB2  . GLU A 1 9   ? -11.187 -7.958  31.931 1.00 0.00 ? 9   GLU A HB2  6  
ATOM 8975  H HB3  . GLU A 1 9   ? -12.139 -9.274  31.272 1.00 0.00 ? 9   GLU A HB3  6  
ATOM 8976  H HG2  . GLU A 1 9   ? -9.163  -8.949  30.688 1.00 0.00 ? 9   GLU A HG2  6  
ATOM 8977  H HG3  . GLU A 1 9   ? -9.760  -9.874  32.051 1.00 0.00 ? 9   GLU A HG3  6  
ATOM 8978  N N    . LYS A 1 10  ? -9.205  -7.275  29.092 1.00 0.00 ? 10  LYS A N    6  
ATOM 8979  C CA   . LYS A 1 10  ? -8.073  -6.390  28.878 1.00 0.00 ? 10  LYS A CA   6  
ATOM 8980  C C    . LYS A 1 10  ? -8.257  -5.645  27.554 1.00 0.00 ? 10  LYS A C    6  
ATOM 8981  O O    . LYS A 1 10  ? -7.497  -5.854  26.610 1.00 0.00 ? 10  LYS A O    6  
ATOM 8982  C CB   . LYS A 1 10  ? -6.759  -7.170  28.967 1.00 0.00 ? 10  LYS A CB   6  
ATOM 8983  C CG   . LYS A 1 10  ? -5.599  -6.247  29.343 1.00 0.00 ? 10  LYS A CG   6  
ATOM 8984  C CD   . LYS A 1 10  ? -4.419  -6.432  28.387 1.00 0.00 ? 10  LYS A CD   6  
ATOM 8985  C CE   . LYS A 1 10  ? -3.172  -5.717  28.909 1.00 0.00 ? 10  LYS A CE   6  
ATOM 8986  N NZ   . LYS A 1 10  ? -3.109  -4.334  28.384 1.00 0.00 ? 10  LYS A NZ   6  
ATOM 8987  H H    . LYS A 1 10  ? -9.061  -8.223  28.807 1.00 0.00 ? 10  LYS A H    6  
ATOM 8988  H HA   . LYS A 1 10  ? -8.071  -5.661  29.688 1.00 0.00 ? 10  LYS A HA   6  
ATOM 8989  H HB2  . LYS A 1 10  ? -6.852  -7.963  29.709 1.00 0.00 ? 10  LYS A HB2  6  
ATOM 8990  H HB3  . LYS A 1 10  ? -6.552  -7.651  28.012 1.00 0.00 ? 10  LYS A HB3  6  
ATOM 8991  H HG2  . LYS A 1 10  ? -5.932  -5.209  29.318 1.00 0.00 ? 10  LYS A HG2  6  
ATOM 8992  H HG3  . LYS A 1 10  ? -5.280  -6.455  30.365 1.00 0.00 ? 10  LYS A HG3  6  
ATOM 8993  H HD2  . LYS A 1 10  ? -4.208  -7.495  28.265 1.00 0.00 ? 10  LYS A HD2  6  
ATOM 8994  H HD3  . LYS A 1 10  ? -4.680  -6.044  27.402 1.00 0.00 ? 10  LYS A HD3  6  
ATOM 8995  H HE2  . LYS A 1 10  ? -3.186  -5.697  29.999 1.00 0.00 ? 10  LYS A HE2  6  
ATOM 8996  H HE3  . LYS A 1 10  ? -2.278  -6.266  28.612 1.00 0.00 ? 10  LYS A HE3  6  
ATOM 8997  H HZ1  . LYS A 1 10  ? -2.206  -3.947  28.573 1.00 0.00 ? 10  LYS A HZ1  6  
ATOM 8998  H HZ2  . LYS A 1 10  ? -3.266  -4.346  27.396 1.00 0.00 ? 10  LYS A HZ2  6  
ATOM 8999  H HZ3  . LYS A 1 10  ? -3.811  -3.777  28.827 1.00 0.00 ? 10  LYS A HZ3  6  
ATOM 9000  N N    . THR A 1 11  ? -9.269  -4.791  27.529 1.00 0.00 ? 11  THR A N    6  
ATOM 9001  C CA   . THR A 1 11  ? -9.562  -4.013  26.337 1.00 0.00 ? 11  THR A CA   6  
ATOM 9002  C C    . THR A 1 11  ? -9.948  -2.582  26.715 1.00 0.00 ? 11  THR A C    6  
ATOM 9003  O O    . THR A 1 11  ? -11.061 -2.140  26.433 1.00 0.00 ? 11  THR A O    6  
ATOM 9004  C CB   . THR A 1 11  ? -10.649 -4.747  25.548 1.00 0.00 ? 11  THR A CB   6  
ATOM 9005  O OG1  . THR A 1 11  ? -10.857 -3.930  24.400 1.00 0.00 ? 11  THR A OG1  6  
ATOM 9006  C CG2  . THR A 1 11  ? -12.001 -4.736  26.265 1.00 0.00 ? 11  THR A CG2  6  
ATOM 9007  H H    . THR A 1 11  ? -9.882  -4.627  28.301 1.00 0.00 ? 11  THR A H    6  
ATOM 9008  H HA   . THR A 1 11  ? -8.655  -3.951  25.735 1.00 0.00 ? 11  THR A HA   6  
ATOM 9009  H HB   . THR A 1 11  ? -10.339 -5.766  25.316 1.00 0.00 ? 11  THR A HB   6  
ATOM 9010  H HG1  . THR A 1 11  ? -11.645 -4.262  23.882 1.00 0.00 ? 11  THR A HG1  6  
ATOM 9011  H HG21 . THR A 1 11  ? -12.543 -5.652  26.031 1.00 0.00 ? 11  THR A HG21 6  
ATOM 9012  H HG22 . THR A 1 11  ? -11.841 -4.673  27.341 1.00 0.00 ? 11  THR A HG22 6  
ATOM 9013  H HG23 . THR A 1 11  ? -12.581 -3.875  25.932 1.00 0.00 ? 11  THR A HG23 6  
ATOM 9014  N N    . LEU A 1 12  ? -9.008  -1.897  27.349 1.00 0.00 ? 12  LEU A N    6  
ATOM 9015  C CA   . LEU A 1 12  ? -9.236  -0.525  27.769 1.00 0.00 ? 12  LEU A CA   6  
ATOM 9016  C C    . LEU A 1 12  ? -7.920  0.076   28.269 1.00 0.00 ? 12  LEU A C    6  
ATOM 9017  O O    . LEU A 1 12  ? -7.773  0.353   29.458 1.00 0.00 ? 12  LEU A O    6  
ATOM 9018  C CB   . LEU A 1 12  ? -10.370 -0.460  28.793 1.00 0.00 ? 12  LEU A CB   6  
ATOM 9019  C CG   . LEU A 1 12  ? -10.194 -1.321  30.045 1.00 0.00 ? 12  LEU A CG   6  
ATOM 9020  C CD1  . LEU A 1 12  ? -10.441 -0.502  31.314 1.00 0.00 ? 12  LEU A CD1  6  
ATOM 9021  C CD2  . LEU A 1 12  ? -11.081 -2.566  29.984 1.00 0.00 ? 12  LEU A CD2  6  
ATOM 9022  H H    . LEU A 1 12  ? -8.105  -2.264  27.574 1.00 0.00 ? 12  LEU A H    6  
ATOM 9023  H HA   . LEU A 1 12  ? -9.560  0.036   26.892 1.00 0.00 ? 12  LEU A HA   6  
ATOM 9024  H HB2  . LEU A 1 12  ? -10.493 0.578   29.104 1.00 0.00 ? 12  LEU A HB2  6  
ATOM 9025  H HB3  . LEU A 1 12  ? -11.296 -0.756  28.300 1.00 0.00 ? 12  LEU A HB3  6  
ATOM 9026  H HG   . LEU A 1 12  ? -9.160  -1.664  30.081 1.00 0.00 ? 12  LEU A HG   6  
ATOM 9027  H HD11 . LEU A 1 12  ? -9.486  -0.211  31.751 1.00 0.00 ? 12  LEU A HD11 6  
ATOM 9028  H HD12 . LEU A 1 12  ? -11.014 0.391   31.063 1.00 0.00 ? 12  LEU A HD12 6  
ATOM 9029  H HD13 . LEU A 1 12  ? -11.001 -1.103  32.031 1.00 0.00 ? 12  LEU A HD13 6  
ATOM 9030  H HD21 . LEU A 1 12  ? -11.805 -2.536  30.799 1.00 0.00 ? 12  LEU A HD21 6  
ATOM 9031  H HD22 . LEU A 1 12  ? -11.608 -2.590  29.030 1.00 0.00 ? 12  LEU A HD22 6  
ATOM 9032  H HD23 . LEU A 1 12  ? -10.462 -3.458  30.080 1.00 0.00 ? 12  LEU A HD23 6  
ATOM 9033  N N    . GLU A 1 13  ? -6.998  0.260   27.335 1.00 0.00 ? 13  GLU A N    6  
ATOM 9034  C CA   . GLU A 1 13  ? -5.700  0.823   27.666 1.00 0.00 ? 13  GLU A CA   6  
ATOM 9035  C C    . GLU A 1 13  ? -5.569  2.233   27.086 1.00 0.00 ? 13  GLU A C    6  
ATOM 9036  O O    . GLU A 1 13  ? -6.278  2.589   26.145 1.00 0.00 ? 13  GLU A O    6  
ATOM 9037  C CB   . GLU A 1 13  ? -4.569  -0.081  27.172 1.00 0.00 ? 13  GLU A CB   6  
ATOM 9038  C CG   . GLU A 1 13  ? -4.416  -1.309  28.071 1.00 0.00 ? 13  GLU A CG   6  
ATOM 9039  C CD   . GLU A 1 13  ? -5.604  -2.260  27.907 1.00 0.00 ? 13  GLU A CD   6  
ATOM 9040  O OE1  . GLU A 1 13  ? -6.027  -2.444  26.745 1.00 0.00 ? 13  GLU A OE1  6  
ATOM 9041  O OE2  . GLU A 1 13  ? -6.063  -2.779  28.947 1.00 0.00 ? 13  GLU A OE2  6  
ATOM 9042  H H    . GLU A 1 13  ? -7.126  0.032   26.370 1.00 0.00 ? 13  GLU A H    6  
ATOM 9043  H HA   . GLU A 1 13  ? -5.673  0.867   28.755 1.00 0.00 ? 13  GLU A HA   6  
ATOM 9044  H HB2  . GLU A 1 13  ? -4.771  -0.397  26.149 1.00 0.00 ? 13  GLU A HB2  6  
ATOM 9045  H HB3  . GLU A 1 13  ? -3.633  0.479   27.153 1.00 0.00 ? 13  GLU A HB3  6  
ATOM 9046  H HG2  . GLU A 1 13  ? -3.491  -1.832  27.825 1.00 0.00 ? 13  GLU A HG2  6  
ATOM 9047  H HG3  . GLU A 1 13  ? -4.338  -0.996  29.112 1.00 0.00 ? 13  GLU A HG3  6  
ATOM 9048  N N    . THR A 1 14  ? -4.658  2.996   27.670 1.00 0.00 ? 14  THR A N    6  
ATOM 9049  C CA   . THR A 1 14  ? -4.426  4.359   27.223 1.00 0.00 ? 14  THR A CA   6  
ATOM 9050  C C    . THR A 1 14  ? -5.734  5.152   27.226 1.00 0.00 ? 14  THR A C    6  
ATOM 9051  O O    . THR A 1 14  ? -6.577  4.969   26.350 1.00 0.00 ? 14  THR A O    6  
ATOM 9052  C CB   . THR A 1 14  ? -3.756  4.298   25.849 1.00 0.00 ? 14  THR A CB   6  
ATOM 9053  O OG1  . THR A 1 14  ? -2.410  3.926   26.135 1.00 0.00 ? 14  THR A OG1  6  
ATOM 9054  C CG2  . THR A 1 14  ? -3.630  5.676   25.197 1.00 0.00 ? 14  THR A CG2  6  
ATOM 9055  H H    . THR A 1 14  ? -4.086  2.699   28.435 1.00 0.00 ? 14  THR A H    6  
ATOM 9056  H HA   . THR A 1 14  ? -3.756  4.844   27.933 1.00 0.00 ? 14  THR A HA   6  
ATOM 9057  H HB   . THR A 1 14  ? -4.278  3.602   25.192 1.00 0.00 ? 14  THR A HB   6  
ATOM 9058  H HG1  . THR A 1 14  ? -1.985  3.528   25.322 1.00 0.00 ? 14  THR A HG1  6  
ATOM 9059  H HG21 . THR A 1 14  ? -4.374  6.349   25.623 1.00 0.00 ? 14  THR A HG21 6  
ATOM 9060  H HG22 . THR A 1 14  ? -2.632  6.075   25.379 1.00 0.00 ? 14  THR A HG22 6  
ATOM 9061  H HG23 . THR A 1 14  ? -3.795  5.586   24.123 1.00 0.00 ? 14  THR A HG23 6  
ATOM 9062  N N    . VAL A 1 15  ? -5.862  6.017   28.222 1.00 0.00 ? 15  VAL A N    6  
ATOM 9063  C CA   . VAL A 1 15  ? -7.054  6.839   28.351 1.00 0.00 ? 15  VAL A CA   6  
ATOM 9064  C C    . VAL A 1 15  ? -7.105  7.840   27.195 1.00 0.00 ? 15  VAL A C    6  
ATOM 9065  O O    . VAL A 1 15  ? -6.077  8.158   26.599 1.00 0.00 ? 15  VAL A O    6  
ATOM 9066  C CB   . VAL A 1 15  ? -7.080  7.510   29.725 1.00 0.00 ? 15  VAL A CB   6  
ATOM 9067  C CG1  . VAL A 1 15  ? -7.161  6.468   30.843 1.00 0.00 ? 15  VAL A CG1  6  
ATOM 9068  C CG2  . VAL A 1 15  ? -5.867  8.423   29.913 1.00 0.00 ? 15  VAL A CG2  6  
ATOM 9069  H H    . VAL A 1 15  ? -5.172  6.160   28.931 1.00 0.00 ? 15  VAL A H    6  
ATOM 9070  H HA   . VAL A 1 15  ? -7.918  6.178   28.281 1.00 0.00 ? 15  VAL A HA   6  
ATOM 9071  H HB   . VAL A 1 15  ? -7.976  8.129   29.779 1.00 0.00 ? 15  VAL A HB   6  
ATOM 9072  H HG11 . VAL A 1 15  ? -6.171  6.046   31.017 1.00 0.00 ? 15  VAL A HG11 6  
ATOM 9073  H HG12 . VAL A 1 15  ? -7.519  6.943   31.757 1.00 0.00 ? 15  VAL A HG12 6  
ATOM 9074  H HG13 . VAL A 1 15  ? -7.848  5.675   30.551 1.00 0.00 ? 15  VAL A HG13 6  
ATOM 9075  H HG21 . VAL A 1 15  ? -5.128  7.921   30.538 1.00 0.00 ? 15  VAL A HG21 6  
ATOM 9076  H HG22 . VAL A 1 15  ? -5.428  8.648   28.941 1.00 0.00 ? 15  VAL A HG22 6  
ATOM 9077  H HG23 . VAL A 1 15  ? -6.180  9.350   30.394 1.00 0.00 ? 15  VAL A HG23 6  
ATOM 9078  N N    . PRO A 1 16  ? -8.344  8.321   26.906 1.00 0.00 ? 16  PRO A N    6  
ATOM 9079  C CA   . PRO A 1 16  ? -8.542  9.279   25.832 1.00 0.00 ? 16  PRO A CA   6  
ATOM 9080  C C    . PRO A 1 16  ? -8.060  10.672  26.244 1.00 0.00 ? 16  PRO A C    6  
ATOM 9081  O O    . PRO A 1 16  ? -8.430  11.172  27.305 1.00 0.00 ? 16  PRO A O    6  
ATOM 9082  C CB   . PRO A 1 16  ? -10.031 9.231   25.532 1.00 0.00 ? 16  PRO A CB   6  
ATOM 9083  C CG   . PRO A 1 16  ? -10.682 8.598   26.751 1.00 0.00 ? 16  PRO A CG   6  
ATOM 9084  C CD   . PRO A 1 16  ? -9.583  7.966   27.590 1.00 0.00 ? 16  PRO A CD   6  
ATOM 9085  H HA   . PRO A 1 16  ? -7.995  9.026   25.035 1.00 0.00 ? 16  PRO A HA   6  
ATOM 9086  H HB2  . PRO A 1 16  ? -10.426 10.231  25.354 1.00 0.00 ? 16  PRO A HB2  6  
ATOM 9087  H HB3  . PRO A 1 16  ? -10.230 8.645   24.635 1.00 0.00 ? 16  PRO A HB3  6  
ATOM 9088  H HG2  . PRO A 1 16  ? -11.220 9.349   27.330 1.00 0.00 ? 16  PRO A HG2  6  
ATOM 9089  H HG3  . PRO A 1 16  ? -11.411 7.847   26.448 1.00 0.00 ? 16  PRO A HG3  6  
ATOM 9090  H HD2  . PRO A 1 16  ? -9.595  8.348   28.611 1.00 0.00 ? 16  PRO A HD2  6  
ATOM 9091  H HD3  . PRO A 1 16  ? -9.705  6.885   27.653 1.00 0.00 ? 16  PRO A HD3  6  
ATOM 9092  N N    . LEU A 1 17  ? -7.241  11.258  25.384 1.00 0.00 ? 17  LEU A N    6  
ATOM 9093  C CA   . LEU A 1 17  ? -6.704  12.583  25.645 1.00 0.00 ? 17  LEU A CA   6  
ATOM 9094  C C    . LEU A 1 17  ? -6.891  13.458  24.404 1.00 0.00 ? 17  LEU A C    6  
ATOM 9095  O O    . LEU A 1 17  ? -6.953  12.950  23.285 1.00 0.00 ? 17  LEU A O    6  
ATOM 9096  C CB   . LEU A 1 17  ? -5.252  12.489  26.118 1.00 0.00 ? 17  LEU A CB   6  
ATOM 9097  C CG   . LEU A 1 17  ? -4.907  13.278  27.383 1.00 0.00 ? 17  LEU A CG   6  
ATOM 9098  C CD1  . LEU A 1 17  ? -5.138  12.433  28.637 1.00 0.00 ? 17  LEU A CD1  6  
ATOM 9099  C CD2  . LEU A 1 17  ? -3.479  13.825  27.315 1.00 0.00 ? 17  LEU A CD2  6  
ATOM 9100  H H    . LEU A 1 17  ? -6.944  10.844  24.523 1.00 0.00 ? 17  LEU A H    6  
ATOM 9101  H HA   . LEU A 1 17  ? -7.282  13.014  26.462 1.00 0.00 ? 17  LEU A HA   6  
ATOM 9102  H HB2  . LEU A 1 17  ? -5.015  11.440  26.292 1.00 0.00 ? 17  LEU A HB2  6  
ATOM 9103  H HB3  . LEU A 1 17  ? -4.605  12.833  25.311 1.00 0.00 ? 17  LEU A HB3  6  
ATOM 9104  H HG   . LEU A 1 17  ? -5.577  14.136  27.444 1.00 0.00 ? 17  LEU A HG   6  
ATOM 9105  H HD11 . LEU A 1 17  ? -6.208  12.350  28.827 1.00 0.00 ? 17  LEU A HD11 6  
ATOM 9106  H HD12 . LEU A 1 17  ? -4.718  11.438  28.487 1.00 0.00 ? 17  LEU A HD12 6  
ATOM 9107  H HD13 . LEU A 1 17  ? -4.653  12.908  29.490 1.00 0.00 ? 17  LEU A HD13 6  
ATOM 9108  H HD21 . LEU A 1 17  ? -3.227  14.056  26.280 1.00 0.00 ? 17  LEU A HD21 6  
ATOM 9109  H HD22 . LEU A 1 17  ? -3.408  14.730  27.917 1.00 0.00 ? 17  LEU A HD22 6  
ATOM 9110  H HD23 . LEU A 1 17  ? -2.786  13.077  27.700 1.00 0.00 ? 17  LEU A HD23 6  
ATOM 9111  N N    . GLU A 1 18  ? -6.976  14.758  24.643 1.00 0.00 ? 18  GLU A N    6  
ATOM 9112  C CA   . GLU A 1 18  ? -7.154  15.709  23.558 1.00 0.00 ? 18  GLU A CA   6  
ATOM 9113  C C    . GLU A 1 18  ? -5.871  15.819  22.733 1.00 0.00 ? 18  GLU A C    6  
ATOM 9114  O O    . GLU A 1 18  ? -4.770  15.748  23.277 1.00 0.00 ? 18  GLU A O    6  
ATOM 9115  C CB   . GLU A 1 18  ? -7.581  17.077  24.093 1.00 0.00 ? 18  GLU A CB   6  
ATOM 9116  C CG   . GLU A 1 18  ? -6.637  17.553  25.199 1.00 0.00 ? 18  GLU A CG   6  
ATOM 9117  C CD   . GLU A 1 18  ? -6.371  19.055  25.085 1.00 0.00 ? 18  GLU A CD   6  
ATOM 9118  O OE1  . GLU A 1 18  ? -5.514  19.418  24.251 1.00 0.00 ? 18  GLU A OE1  6  
ATOM 9119  O OE2  . GLU A 1 18  ? -7.031  19.807  25.834 1.00 0.00 ? 18  GLU A OE2  6  
ATOM 9120  H H    . GLU A 1 18  ? -6.924  15.164  25.556 1.00 0.00 ? 18  GLU A H    6  
ATOM 9121  H HA   . GLU A 1 18  ? -7.956  15.300  22.944 1.00 0.00 ? 18  GLU A HA   6  
ATOM 9122  H HB2  . GLU A 1 18  ? -7.589  17.803  23.280 1.00 0.00 ? 18  GLU A HB2  6  
ATOM 9123  H HB3  . GLU A 1 18  ? -8.599  17.019  24.479 1.00 0.00 ? 18  GLU A HB3  6  
ATOM 9124  H HG2  . GLU A 1 18  ? -7.071  17.330  26.174 1.00 0.00 ? 18  GLU A HG2  6  
ATOM 9125  H HG3  . GLU A 1 18  ? -5.695  17.007  25.138 1.00 0.00 ? 18  GLU A HG3  6  
ATOM 9126  N N    . ARG A 1 19  ? -6.055  15.991  21.432 1.00 0.00 ? 19  ARG A N    6  
ATOM 9127  C CA   . ARG A 1 19  ? -4.925  16.112  20.526 1.00 0.00 ? 19  ARG A CA   6  
ATOM 9128  C C    . ARG A 1 19  ? -5.302  16.978  19.321 1.00 0.00 ? 19  ARG A C    6  
ATOM 9129  O O    . ARG A 1 19  ? -6.434  16.925  18.844 1.00 0.00 ? 19  ARG A O    6  
ATOM 9130  C CB   . ARG A 1 19  ? -4.464  14.739  20.034 1.00 0.00 ? 19  ARG A CB   6  
ATOM 9131  C CG   . ARG A 1 19  ? -3.354  14.181  20.927 1.00 0.00 ? 19  ARG A CG   6  
ATOM 9132  C CD   . ARG A 1 19  ? -1.996  14.258  20.226 1.00 0.00 ? 19  ARG A CD   6  
ATOM 9133  N NE   . ARG A 1 19  ? -0.912  13.962  21.189 1.00 0.00 ? 19  ARG A NE   6  
ATOM 9134  C CZ   . ARG A 1 19  ? -0.421  14.850  22.063 1.00 0.00 ? 19  ARG A CZ   6  
ATOM 9135  N NH1  . ARG A 1 19  ? -0.914  16.096  22.102 1.00 0.00 ? 19  ARG A NH1  6  
ATOM 9136  N NH2  . ARG A 1 19  ? 0.563   14.494  22.900 1.00 0.00 ? 19  ARG A NH2  6  
ATOM 9137  H H    . ARG A 1 19  ? -6.954  16.048  20.997 1.00 0.00 ? 19  ARG A H    6  
ATOM 9138  H HA   . ARG A 1 19  ? -4.142  16.584  21.119 1.00 0.00 ? 19  ARG A HA   6  
ATOM 9139  H HB2  . ARG A 1 19  ? -5.309  14.049  20.025 1.00 0.00 ? 19  ARG A HB2  6  
ATOM 9140  H HB3  . ARG A 1 19  ? -4.106  14.817  19.008 1.00 0.00 ? 19  ARG A HB3  6  
ATOM 9141  H HG2  . ARG A 1 19  ? -3.318  14.741  21.861 1.00 0.00 ? 19  ARG A HG2  6  
ATOM 9142  H HG3  . ARG A 1 19  ? -3.576  13.145  21.185 1.00 0.00 ? 19  ARG A HG3  6  
ATOM 9143  H HD2  . ARG A 1 19  ? -1.964  13.548  19.399 1.00 0.00 ? 19  ARG A HD2  6  
ATOM 9144  H HD3  . ARG A 1 19  ? -1.854  15.251  19.799 1.00 0.00 ? 19  ARG A HD3  6  
ATOM 9145  H HE   . ARG A 1 19  ? -0.521  13.042  21.186 1.00 0.00 ? 19  ARG A HE   6  
ATOM 9146  H HH11 . ARG A 1 19  ? -1.649  16.362  21.478 1.00 0.00 ? 19  ARG A HH11 6  
ATOM 9147  H HH12 . ARG A 1 19  ? -0.548  16.759  22.755 1.00 0.00 ? 19  ARG A HH12 6  
ATOM 9148  H HH21 . ARG A 1 19  ? 0.932   13.564  22.871 1.00 0.00 ? 19  ARG A HH21 6  
ATOM 9149  H HH22 . ARG A 1 19  ? 0.930   15.156  23.553 1.00 0.00 ? 19  ARG A HH22 6  
ATOM 9150  N N    . LYS A 1 20  ? -4.330  17.754  18.865 1.00 0.00 ? 20  LYS A N    6  
ATOM 9151  C CA   . LYS A 1 20  ? -4.545  18.630  17.725 1.00 0.00 ? 20  LYS A CA   6  
ATOM 9152  C C    . LYS A 1 20  ? -3.959  17.979  16.470 1.00 0.00 ? 20  LYS A C    6  
ATOM 9153  O O    . LYS A 1 20  ? -2.822  18.259  16.095 1.00 0.00 ? 20  LYS A O    6  
ATOM 9154  C CB   . LYS A 1 20  ? -3.989  20.026  18.011 1.00 0.00 ? 20  LYS A CB   6  
ATOM 9155  C CG   . LYS A 1 20  ? -5.082  21.089  17.879 1.00 0.00 ? 20  LYS A CG   6  
ATOM 9156  C CD   . LYS A 1 20  ? -5.452  21.316  16.412 1.00 0.00 ? 20  LYS A CD   6  
ATOM 9157  C CE   . LYS A 1 20  ? -6.889  21.824  16.281 1.00 0.00 ? 20  LYS A CE   6  
ATOM 9158  N NZ   . LYS A 1 20  ? -7.245  22.010  14.857 1.00 0.00 ? 20  LYS A NZ   6  
ATOM 9159  H H    . LYS A 1 20  ? -3.412  17.791  19.259 1.00 0.00 ? 20  LYS A H    6  
ATOM 9160  H HA   . LYS A 1 20  ? -5.622  18.733  17.591 1.00 0.00 ? 20  LYS A HA   6  
ATOM 9161  H HB2  . LYS A 1 20  ? -3.567  20.056  19.015 1.00 0.00 ? 20  LYS A HB2  6  
ATOM 9162  H HB3  . LYS A 1 20  ? -3.177  20.247  17.318 1.00 0.00 ? 20  LYS A HB3  6  
ATOM 9163  H HG2  . LYS A 1 20  ? -5.965  20.778  18.436 1.00 0.00 ? 20  LYS A HG2  6  
ATOM 9164  H HG3  . LYS A 1 20  ? -4.739  22.025  18.320 1.00 0.00 ? 20  LYS A HG3  6  
ATOM 9165  H HD2  . LYS A 1 20  ? -4.765  22.037  15.967 1.00 0.00 ? 20  LYS A HD2  6  
ATOM 9166  H HD3  . LYS A 1 20  ? -5.339  20.385  15.856 1.00 0.00 ? 20  LYS A HD3  6  
ATOM 9167  H HE2  . LYS A 1 20  ? -7.575  21.115  16.744 1.00 0.00 ? 20  LYS A HE2  6  
ATOM 9168  H HE3  . LYS A 1 20  ? -6.997  22.768  16.815 1.00 0.00 ? 20  LYS A HE3  6  
ATOM 9169  H HZ1  . LYS A 1 20  ? -8.155  21.631  14.689 1.00 0.00 ? 20  LYS A HZ1  6  
ATOM 9170  H HZ2  . LYS A 1 20  ? -7.246  22.986  14.638 1.00 0.00 ? 20  LYS A HZ2  6  
ATOM 9171  H HZ3  . LYS A 1 20  ? -6.576  21.540  14.282 1.00 0.00 ? 20  LYS A HZ3  6  
ATOM 9172  N N    . LYS A 1 21  ? -4.763  17.124  15.856 1.00 0.00 ? 21  LYS A N    6  
ATOM 9173  C CA   . LYS A 1 21  ? -4.339  16.432  14.651 1.00 0.00 ? 21  LYS A CA   6  
ATOM 9174  C C    . LYS A 1 21  ? -4.602  17.323  13.436 1.00 0.00 ? 21  LYS A C    6  
ATOM 9175  O O    . LYS A 1 21  ? -5.223  18.378  13.559 1.00 0.00 ? 21  LYS A O    6  
ATOM 9176  C CB   . LYS A 1 21  ? -5.005  15.057  14.561 1.00 0.00 ? 21  LYS A CB   6  
ATOM 9177  C CG   . LYS A 1 21  ? -4.365  14.072  15.541 1.00 0.00 ? 21  LYS A CG   6  
ATOM 9178  C CD   . LYS A 1 21  ? -3.314  13.207  14.842 1.00 0.00 ? 21  LYS A CD   6  
ATOM 9179  C CE   . LYS A 1 21  ? -2.673  12.223  15.823 1.00 0.00 ? 21  LYS A CE   6  
ATOM 9180  N NZ   . LYS A 1 21  ? -3.440  10.958  15.862 1.00 0.00 ? 21  LYS A NZ   6  
ATOM 9181  H H    . LYS A 1 21  ? -5.687  16.902  16.168 1.00 0.00 ? 21  LYS A H    6  
ATOM 9182  H HA   . LYS A 1 21  ? -3.265  16.265  14.731 1.00 0.00 ? 21  LYS A HA   6  
ATOM 9183  H HB2  . LYS A 1 21  ? -6.069  15.149  14.775 1.00 0.00 ? 21  LYS A HB2  6  
ATOM 9184  H HB3  . LYS A 1 21  ? -4.917  14.673  13.544 1.00 0.00 ? 21  LYS A HB3  6  
ATOM 9185  H HG2  . LYS A 1 21  ? -3.902  14.620  16.362 1.00 0.00 ? 21  LYS A HG2  6  
ATOM 9186  H HG3  . LYS A 1 21  ? -5.134  13.435  15.977 1.00 0.00 ? 21  LYS A HG3  6  
ATOM 9187  H HD2  . LYS A 1 21  ? -3.776  12.659  14.021 1.00 0.00 ? 21  LYS A HD2  6  
ATOM 9188  H HD3  . LYS A 1 21  ? -2.544  13.844  14.406 1.00 0.00 ? 21  LYS A HD3  6  
ATOM 9189  H HE2  . LYS A 1 21  ? -1.644  12.022  15.525 1.00 0.00 ? 21  LYS A HE2  6  
ATOM 9190  H HE3  . LYS A 1 21  ? -2.637  12.665  16.819 1.00 0.00 ? 21  LYS A HE3  6  
ATOM 9191  H HZ1  . LYS A 1 21  ? -3.843  10.784  14.964 1.00 0.00 ? 21  LYS A HZ1  6  
ATOM 9192  H HZ2  . LYS A 1 21  ? -2.828  10.205  16.105 1.00 0.00 ? 21  LYS A HZ2  6  
ATOM 9193  H HZ3  . LYS A 1 21  ? -4.167  11.030  16.545 1.00 0.00 ? 21  LYS A HZ3  6  
ATOM 9194  N N    . ARG A 1 22  ? -4.118  16.867  12.291 1.00 0.00 ? 22  ARG A N    6  
ATOM 9195  C CA   . ARG A 1 22  ? -4.293  17.610  11.055 1.00 0.00 ? 22  ARG A CA   6  
ATOM 9196  C C    . ARG A 1 22  ? -5.285  16.891  10.139 1.00 0.00 ? 22  ARG A C    6  
ATOM 9197  O O    . ARG A 1 22  ? -5.259  15.666  10.029 1.00 0.00 ? 22  ARG A O    6  
ATOM 9198  C CB   . ARG A 1 22  ? -2.961  17.779  10.320 1.00 0.00 ? 22  ARG A CB   6  
ATOM 9199  C CG   . ARG A 1 22  ? -2.389  19.181  10.536 1.00 0.00 ? 22  ARG A CG   6  
ATOM 9200  C CD   . ARG A 1 22  ? -1.172  19.139  11.463 1.00 0.00 ? 22  ARG A CD   6  
ATOM 9201  N NE   . ARG A 1 22  ? -1.201  20.293  12.389 1.00 0.00 ? 22  ARG A NE   6  
ATOM 9202  C CZ   . ARG A 1 22  ? -0.167  20.669  13.154 1.00 0.00 ? 22  ARG A CZ   6  
ATOM 9203  N NH1  . ARG A 1 22  ? 0.984   19.984  13.108 1.00 0.00 ? 22  ARG A NH1  6  
ATOM 9204  N NH2  . ARG A 1 22  ? -0.285  21.729  13.965 1.00 0.00 ? 22  ARG A NH2  6  
ATOM 9205  H H    . ARG A 1 22  ? -3.614  16.008  12.200 1.00 0.00 ? 22  ARG A H    6  
ATOM 9206  H HA   . ARG A 1 22  ? -4.678  18.581  11.366 1.00 0.00 ? 22  ARG A HA   6  
ATOM 9207  H HB2  . ARG A 1 22  ? -2.250  17.033  10.674 1.00 0.00 ? 22  ARG A HB2  6  
ATOM 9208  H HB3  . ARG A 1 22  ? -3.105  17.601  9.254  1.00 0.00 ? 22  ARG A HB3  6  
ATOM 9209  H HG2  . ARG A 1 22  ? -2.105  19.614  9.577  1.00 0.00 ? 22  ARG A HG2  6  
ATOM 9210  H HG3  . ARG A 1 22  ? -3.155  19.828  10.965 1.00 0.00 ? 22  ARG A HG3  6  
ATOM 9211  H HD2  . ARG A 1 22  ? -1.168  18.208  12.029 1.00 0.00 ? 22  ARG A HD2  6  
ATOM 9212  H HD3  . ARG A 1 22  ? -0.255  19.158  10.874 1.00 0.00 ? 22  ARG A HD3  6  
ATOM 9213  H HE   . ARG A 1 22  ? -2.046  20.825  12.448 1.00 0.00 ? 22  ARG A HE   6  
ATOM 9214  H HH11 . ARG A 1 22  ? 1.071   19.193  12.503 1.00 0.00 ? 22  ARG A HH11 6  
ATOM 9215  H HH12 . ARG A 1 22  ? 1.755   20.265  13.679 1.00 0.00 ? 22  ARG A HH12 6  
ATOM 9216  H HH21 . ARG A 1 22  ? -1.144  22.240  14.000 1.00 0.00 ? 22  ARG A HH21 6  
ATOM 9217  H HH22 . ARG A 1 22  ? 0.487   22.009  14.536 1.00 0.00 ? 22  ARG A HH22 6  
ATOM 9218  N N    . GLU A 1 23  ? -6.138  17.683  9.505  1.00 0.00 ? 23  GLU A N    6  
ATOM 9219  C CA   . GLU A 1 23  ? -7.137  17.138  8.602  1.00 0.00 ? 23  GLU A CA   6  
ATOM 9220  C C    . GLU A 1 23  ? -6.477  16.655  7.309  1.00 0.00 ? 23  GLU A C    6  
ATOM 9221  O O    . GLU A 1 23  ? -6.718  15.532  6.867  1.00 0.00 ? 23  GLU A O    6  
ATOM 9222  C CB   . GLU A 1 23  ? -8.231  18.166  8.309  1.00 0.00 ? 23  GLU A CB   6  
ATOM 9223  C CG   . GLU A 1 23  ? -9.276  18.189  9.426  1.00 0.00 ? 23  GLU A CG   6  
ATOM 9224  C CD   . GLU A 1 23  ? -9.101  19.420  10.317 1.00 0.00 ? 23  GLU A CD   6  
ATOM 9225  O OE1  . GLU A 1 23  ? -8.047  19.491  10.986 1.00 0.00 ? 23  GLU A OE1  6  
ATOM 9226  O OE2  . GLU A 1 23  ? -10.024 20.263  10.309 1.00 0.00 ? 23  GLU A OE2  6  
ATOM 9227  H H    . GLU A 1 23  ? -6.152  18.679  9.600  1.00 0.00 ? 23  GLU A H    6  
ATOM 9228  H HA   . GLU A 1 23  ? -7.575  16.292  9.132  1.00 0.00 ? 23  GLU A HA   6  
ATOM 9229  H HB2  . GLU A 1 23  ? -7.785  19.156  8.203  1.00 0.00 ? 23  GLU A HB2  6  
ATOM 9230  H HB3  . GLU A 1 23  ? -8.712  17.930  7.360  1.00 0.00 ? 23  GLU A HB3  6  
ATOM 9231  H HG2  . GLU A 1 23  ? -10.276 18.189  8.992  1.00 0.00 ? 23  GLU A HG2  6  
ATOM 9232  H HG3  . GLU A 1 23  ? -9.190  17.284  10.028 1.00 0.00 ? 23  GLU A HG3  6  
ATOM 9233  N N    . LYS A 1 24  ? -5.658  17.526  6.739  1.00 0.00 ? 24  LYS A N    6  
ATOM 9234  C CA   . LYS A 1 24  ? -4.962  17.203  5.506  1.00 0.00 ? 24  LYS A CA   6  
ATOM 9235  C C    . LYS A 1 24  ? -3.952  16.085  5.773  1.00 0.00 ? 24  LYS A C    6  
ATOM 9236  O O    . LYS A 1 24  ? -3.455  15.456  4.840  1.00 0.00 ? 24  LYS A O    6  
ATOM 9237  C CB   . LYS A 1 24  ? -4.340  18.461  4.896  1.00 0.00 ? 24  LYS A CB   6  
ATOM 9238  C CG   . LYS A 1 24  ? -4.528  18.485  3.377  1.00 0.00 ? 24  LYS A CG   6  
ATOM 9239  C CD   . LYS A 1 24  ? -5.419  19.654  2.954  1.00 0.00 ? 24  LYS A CD   6  
ATOM 9240  C CE   . LYS A 1 24  ? -5.169  20.032  1.492  1.00 0.00 ? 24  LYS A CE   6  
ATOM 9241  N NZ   . LYS A 1 24  ? -6.195  20.990  1.022  1.00 0.00 ? 24  LYS A NZ   6  
ATOM 9242  H H    . LYS A 1 24  ? -5.468  18.437  7.105  1.00 0.00 ? 24  LYS A H    6  
ATOM 9243  H HA   . LYS A 1 24  ? -5.705  16.835  4.798  1.00 0.00 ? 24  LYS A HA   6  
ATOM 9244  H HB2  . LYS A 1 24  ? -4.796  19.347  5.336  1.00 0.00 ? 24  LYS A HB2  6  
ATOM 9245  H HB3  . LYS A 1 24  ? -3.277  18.498  5.135  1.00 0.00 ? 24  LYS A HB3  6  
ATOM 9246  H HG2  . LYS A 1 24  ? -3.558  18.566  2.888  1.00 0.00 ? 24  LYS A HG2  6  
ATOM 9247  H HG3  . LYS A 1 24  ? -4.973  17.546  3.048  1.00 0.00 ? 24  LYS A HG3  6  
ATOM 9248  H HD2  . LYS A 1 24  ? -6.467  19.386  3.090  1.00 0.00 ? 24  LYS A HD2  6  
ATOM 9249  H HD3  . LYS A 1 24  ? -5.225  20.514  3.594  1.00 0.00 ? 24  LYS A HD3  6  
ATOM 9250  H HE2  . LYS A 1 24  ? -4.177  20.473  1.389  1.00 0.00 ? 24  LYS A HE2  6  
ATOM 9251  H HE3  . LYS A 1 24  ? -5.186  19.137  0.871  1.00 0.00 ? 24  LYS A HE3  6  
ATOM 9252  H HZ1  . LYS A 1 24  ? -6.025  21.887  1.430  1.00 0.00 ? 24  LYS A HZ1  6  
ATOM 9253  H HZ2  . LYS A 1 24  ? -6.151  21.063  0.026  1.00 0.00 ? 24  LYS A HZ2  6  
ATOM 9254  H HZ3  . LYS A 1 24  ? -7.102  20.667  1.293  1.00 0.00 ? 24  LYS A HZ3  6  
ATOM 9255  N N    . GLU A 1 25  ? -3.678  15.872  7.052  1.00 0.00 ? 25  GLU A N    6  
ATOM 9256  C CA   . GLU A 1 25  ? -2.737  14.841  7.454  1.00 0.00 ? 25  GLU A CA   6  
ATOM 9257  C C    . GLU A 1 25  ? -3.474  13.533  7.746  1.00 0.00 ? 25  GLU A C    6  
ATOM 9258  O O    . GLU A 1 25  ? -3.141  12.490  7.185  1.00 0.00 ? 25  GLU A O    6  
ATOM 9259  C CB   . GLU A 1 25  ? -1.916  15.290  8.665  1.00 0.00 ? 25  GLU A CB   6  
ATOM 9260  C CG   . GLU A 1 25  ? -0.690  14.395  8.858  1.00 0.00 ? 25  GLU A CG   6  
ATOM 9261  C CD   . GLU A 1 25  ? 0.077   14.783  10.125 1.00 0.00 ? 25  GLU A CD   6  
ATOM 9262  O OE1  . GLU A 1 25  ? -0.310  14.276  11.200 1.00 0.00 ? 25  GLU A OE1  6  
ATOM 9263  O OE2  . GLU A 1 25  ? 1.032   15.577  9.989  1.00 0.00 ? 25  GLU A OE2  6  
ATOM 9264  H H    . GLU A 1 25  ? -4.087  16.388  7.805  1.00 0.00 ? 25  GLU A H    6  
ATOM 9265  H HA   . GLU A 1 25  ? -2.071  14.708  6.601  1.00 0.00 ? 25  GLU A HA   6  
ATOM 9266  H HB2  . GLU A 1 25  ? -1.599  16.324  8.531  1.00 0.00 ? 25  GLU A HB2  6  
ATOM 9267  H HB3  . GLU A 1 25  ? -2.537  15.261  9.560  1.00 0.00 ? 25  GLU A HB3  6  
ATOM 9268  H HG2  . GLU A 1 25  ? -1.002  13.353  8.923  1.00 0.00 ? 25  GLU A HG2  6  
ATOM 9269  H HG3  . GLU A 1 25  ? -0.034  14.479  7.992  1.00 0.00 ? 25  GLU A HG3  6  
ATOM 9270  N N    . GLN A 1 26  ? -4.463  13.631  8.622  1.00 0.00 ? 26  GLN A N    6  
ATOM 9271  C CA   . GLN A 1 26  ? -5.251  12.468  8.995  1.00 0.00 ? 26  GLN A CA   6  
ATOM 9272  C C    . GLN A 1 26  ? -6.046  11.957  7.792  1.00 0.00 ? 26  GLN A C    6  
ATOM 9273  O O    . GLN A 1 26  ? -6.613  10.867  7.835  1.00 0.00 ? 26  GLN A O    6  
ATOM 9274  C CB   . GLN A 1 26  ? -6.178  12.788  10.169 1.00 0.00 ? 26  GLN A CB   6  
ATOM 9275  C CG   . GLN A 1 26  ? -7.392  13.595  9.705  1.00 0.00 ? 26  GLN A CG   6  
ATOM 9276  C CD   . GLN A 1 26  ? -7.966  14.431  10.851 1.00 0.00 ? 26  GLN A CD   6  
ATOM 9277  O OE1  . GLN A 1 26  ? -7.279  14.797  11.791 1.00 0.00 ? 26  GLN A OE1  6  
ATOM 9278  N NE2  . GLN A 1 26  ? -9.259  14.711  10.722 1.00 0.00 ? 26  GLN A NE2  6  
ATOM 9279  H H    . GLN A 1 26  ? -4.728  14.483  9.073  1.00 0.00 ? 26  GLN A H    6  
ATOM 9280  H HA   . GLN A 1 26  ? -4.527  11.715  9.306  1.00 0.00 ? 26  GLN A HA   6  
ATOM 9281  H HB2  . GLN A 1 26  ? -6.510  11.861  10.638 1.00 0.00 ? 26  GLN A HB2  6  
ATOM 9282  H HB3  . GLN A 1 26  ? -5.631  13.350  10.926 1.00 0.00 ? 26  GLN A HB3  6  
ATOM 9283  H HG2  . GLN A 1 26  ? -7.106  14.248  8.881  1.00 0.00 ? 26  GLN A HG2  6  
ATOM 9284  H HG3  . GLN A 1 26  ? -8.158  12.919  9.324  1.00 0.00 ? 26  GLN A HG3  6  
ATOM 9285  H HE21 . GLN A 1 26  ? -9.765  14.380  9.925  1.00 0.00 ? 26  GLN A HE21 6  
ATOM 9286  H HE22 . GLN A 1 26  ? -9.726  15.253  11.421 1.00 0.00 ? 26  GLN A HE22 6  
ATOM 9287  N N    . PHE A 1 27  ? -6.062  12.770  6.745  1.00 0.00 ? 27  PHE A N    6  
ATOM 9288  C CA   . PHE A 1 27  ? -6.778  12.414  5.532  1.00 0.00 ? 27  PHE A CA   6  
ATOM 9289  C C    . PHE A 1 27  ? -5.979  11.411  4.698  1.00 0.00 ? 27  PHE A C    6  
ATOM 9290  O O    . PHE A 1 27  ? -6.533  10.433  4.197  1.00 0.00 ? 27  PHE A O    6  
ATOM 9291  C CB   . PHE A 1 27  ? -6.958  13.701  4.725  1.00 0.00 ? 27  PHE A CB   6  
ATOM 9292  C CG   . PHE A 1 27  ? -8.341  14.339  4.870  1.00 0.00 ? 27  PHE A CG   6  
ATOM 9293  C CD1  . PHE A 1 27  ? -9.060  14.150  6.009  1.00 0.00 ? 27  PHE A CD1  6  
ATOM 9294  C CD2  . PHE A 1 27  ? -8.851  15.094  3.861  1.00 0.00 ? 27  PHE A CD2  6  
ATOM 9295  C CE1  . PHE A 1 27  ? -10.344 14.742  6.144  1.00 0.00 ? 27  PHE A CE1  6  
ATOM 9296  C CE2  . PHE A 1 27  ? -10.135 15.685  3.996  1.00 0.00 ? 27  PHE A CE2  6  
ATOM 9297  C CZ   . PHE A 1 27  ? -10.854 15.497  5.134  1.00 0.00 ? 27  PHE A CZ   6  
ATOM 9298  H H    . PHE A 1 27  ? -5.597  13.655  6.718  1.00 0.00 ? 27  PHE A H    6  
ATOM 9299  H HA   . PHE A 1 27  ? -7.722  11.962  5.835  1.00 0.00 ? 27  PHE A HA   6  
ATOM 9300  H HB2  . PHE A 1 27  ? -6.202  14.422  5.037  1.00 0.00 ? 27  PHE A HB2  6  
ATOM 9301  H HB3  . PHE A 1 27  ? -6.777  13.486  3.672  1.00 0.00 ? 27  PHE A HB3  6  
ATOM 9302  H HD1  . PHE A 1 27  ? -8.651  13.545  6.818  1.00 0.00 ? 27  PHE A HD1  6  
ATOM 9303  H HD2  . PHE A 1 27  ? -8.275  15.245  2.948  1.00 0.00 ? 27  PHE A HD2  6  
ATOM 9304  H HE1  . PHE A 1 27  ? -10.920 14.591  7.056  1.00 0.00 ? 27  PHE A HE1  6  
ATOM 9305  H HE2  . PHE A 1 27  ? -10.544 16.291  3.186  1.00 0.00 ? 27  PHE A HE2  6  
ATOM 9306  H HZ   . PHE A 1 27  ? -11.840 15.951  5.238  1.00 0.00 ? 27  PHE A HZ   6  
ATOM 9307  N N    . ARG A 1 28  ? -4.689  11.687  4.575  1.00 0.00 ? 28  ARG A N    6  
ATOM 9308  C CA   . ARG A 1 28  ? -3.808  10.820  3.810  1.00 0.00 ? 28  ARG A CA   6  
ATOM 9309  C C    . ARG A 1 28  ? -3.083  9.845   4.741  1.00 0.00 ? 28  ARG A C    6  
ATOM 9310  O O    . ARG A 1 28  ? -2.479  8.877   4.282  1.00 0.00 ? 28  ARG A O    6  
ATOM 9311  C CB   . ARG A 1 28  ? -2.773  11.635  3.031  1.00 0.00 ? 28  ARG A CB   6  
ATOM 9312  C CG   . ARG A 1 28  ? -3.445  12.757  2.236  1.00 0.00 ? 28  ARG A CG   6  
ATOM 9313  C CD   . ARG A 1 28  ? -2.784  12.929  0.867  1.00 0.00 ? 28  ARG A CD   6  
ATOM 9314  N NE   . ARG A 1 28  ? -1.667  13.895  0.961  1.00 0.00 ? 28  ARG A NE   6  
ATOM 9315  C CZ   . ARG A 1 28  ? -1.823  15.226  0.967  1.00 0.00 ? 28  ARG A CZ   6  
ATOM 9316  N NH1  . ARG A 1 28  ? -3.051  15.757  0.884  1.00 0.00 ? 28  ARG A NH1  6  
ATOM 9317  N NH2  . ARG A 1 28  ? -0.752  16.026  1.056  1.00 0.00 ? 28  ARG A NH2  6  
ATOM 9318  H H    . ARG A 1 28  ? -4.246  12.484  4.985  1.00 0.00 ? 28  ARG A H    6  
ATOM 9319  H HA   . ARG A 1 28  ? -4.467  10.290  3.122  1.00 0.00 ? 28  ARG A HA   6  
ATOM 9320  H HB2  . ARG A 1 28  ? -2.045  12.060  3.722  1.00 0.00 ? 28  ARG A HB2  6  
ATOM 9321  H HB3  . ARG A 1 28  ? -2.225  10.982  2.353  1.00 0.00 ? 28  ARG A HB3  6  
ATOM 9322  H HG2  . ARG A 1 28  ? -4.504  12.533  2.108  1.00 0.00 ? 28  ARG A HG2  6  
ATOM 9323  H HG3  . ARG A 1 28  ? -3.382  13.691  2.794  1.00 0.00 ? 28  ARG A HG3  6  
ATOM 9324  H HD2  . ARG A 1 28  ? -2.416  11.968  0.508  1.00 0.00 ? 28  ARG A HD2  6  
ATOM 9325  H HD3  . ARG A 1 28  ? -3.519  13.280  0.141  1.00 0.00 ? 28  ARG A HD3  6  
ATOM 9326  H HE   . ARG A 1 28  ? -0.738  13.532  1.025  1.00 0.00 ? 28  ARG A HE   6  
ATOM 9327  H HH11 . ARG A 1 28  ? -3.850  15.160  0.817  1.00 0.00 ? 28  ARG A HH11 6  
ATOM 9328  H HH12 . ARG A 1 28  ? -3.167  16.750  0.888  1.00 0.00 ? 28  ARG A HH12 6  
ATOM 9329  H HH21 . ARG A 1 28  ? 0.164   15.630  1.118  1.00 0.00 ? 28  ARG A HH21 6  
ATOM 9330  H HH22 . ARG A 1 28  ? -0.868  17.019  1.060  1.00 0.00 ? 28  ARG A HH22 6  
ATOM 9331  N N    . LYS A 1 29  ? -3.169  10.134  6.031  1.00 0.00 ? 29  LYS A N    6  
ATOM 9332  C CA   . LYS A 1 29  ? -2.529  9.295   7.030  1.00 0.00 ? 29  LYS A CA   6  
ATOM 9333  C C    . LYS A 1 29  ? -3.490  8.178   7.442  1.00 0.00 ? 29  LYS A C    6  
ATOM 9334  O O    . LYS A 1 29  ? -4.561  8.445   7.985  1.00 0.00 ? 29  LYS A O    6  
ATOM 9335  C CB   . LYS A 1 29  ? -2.031  10.143  8.202  1.00 0.00 ? 29  LYS A CB   6  
ATOM 9336  C CG   . LYS A 1 29  ? -1.436  9.261   9.302  1.00 0.00 ? 29  LYS A CG   6  
ATOM 9337  C CD   . LYS A 1 29  ? -2.155  9.486   10.634 1.00 0.00 ? 29  LYS A CD   6  
ATOM 9338  C CE   . LYS A 1 29  ? -1.288  10.302  11.595 1.00 0.00 ? 29  LYS A CE   6  
ATOM 9339  N NZ   . LYS A 1 29  ? -0.969  11.623  11.010 1.00 0.00 ? 29  LYS A NZ   6  
ATOM 9340  H H    . LYS A 1 29  ? -3.663  10.924  6.395  1.00 0.00 ? 29  LYS A H    6  
ATOM 9341  H HA   . LYS A 1 29  ? -1.653  8.843   6.564  1.00 0.00 ? 29  LYS A HA   6  
ATOM 9342  H HB2  . LYS A 1 29  ? -1.280  10.850  7.852  1.00 0.00 ? 29  LYS A HB2  6  
ATOM 9343  H HB3  . LYS A 1 29  ? -2.856  10.729  8.607  1.00 0.00 ? 29  LYS A HB3  6  
ATOM 9344  H HG2  . LYS A 1 29  ? -1.514  8.213   9.015  1.00 0.00 ? 29  LYS A HG2  6  
ATOM 9345  H HG3  . LYS A 1 29  ? -0.375  9.483   9.416  1.00 0.00 ? 29  LYS A HG3  6  
ATOM 9346  H HD2  . LYS A 1 29  ? -3.098  10.004  10.459 1.00 0.00 ? 29  LYS A HD2  6  
ATOM 9347  H HD3  . LYS A 1 29  ? -2.400  8.524   11.086 1.00 0.00 ? 29  LYS A HD3  6  
ATOM 9348  H HE2  . LYS A 1 29  ? -1.810  10.433  12.542 1.00 0.00 ? 29  LYS A HE2  6  
ATOM 9349  H HE3  . LYS A 1 29  ? -0.367  9.761   11.811 1.00 0.00 ? 29  LYS A HE3  6  
ATOM 9350  H HZ1  . LYS A 1 29  ? -1.775  12.213  11.060 1.00 0.00 ? 29  LYS A HZ1  6  
ATOM 9351  H HZ2  . LYS A 1 29  ? -0.218  12.041  11.520 1.00 0.00 ? 29  LYS A HZ2  6  
ATOM 9352  H HZ3  . LYS A 1 29  ? -0.700  11.508  10.053 1.00 0.00 ? 29  LYS A HZ3  6  
ATOM 9353  N N    . LEU A 1 30  ? -3.072  6.951   7.169  1.00 0.00 ? 30  LEU A N    6  
ATOM 9354  C CA   . LEU A 1 30  ? -3.882  5.792   7.505  1.00 0.00 ? 30  LEU A CA   6  
ATOM 9355  C C    . LEU A 1 30  ? -3.202  5.009   8.629  1.00 0.00 ? 30  LEU A C    6  
ATOM 9356  O O    . LEU A 1 30  ? -2.028  5.230   8.923  1.00 0.00 ? 30  LEU A O    6  
ATOM 9357  C CB   . LEU A 1 30  ? -4.164  4.956   6.255  1.00 0.00 ? 30  LEU A CB   6  
ATOM 9358  C CG   . LEU A 1 30  ? -5.345  5.411   5.396  1.00 0.00 ? 30  LEU A CG   6  
ATOM 9359  C CD1  . LEU A 1 30  ? -5.360  6.933   5.246  1.00 0.00 ? 30  LEU A CD1  6  
ATOM 9360  C CD2  . LEU A 1 30  ? -5.342  4.701   4.040  1.00 0.00 ? 30  LEU A CD2  6  
ATOM 9361  H H    . LEU A 1 30  ? -2.199  6.743   6.727  1.00 0.00 ? 30  LEU A H    6  
ATOM 9362  H HA   . LEU A 1 30  ? -4.841  6.159   7.870  1.00 0.00 ? 30  LEU A HA   6  
ATOM 9363  H HB2  . LEU A 1 30  ? -3.268  4.952   5.634  1.00 0.00 ? 30  LEU A HB2  6  
ATOM 9364  H HB3  . LEU A 1 30  ? -4.341  3.925   6.565  1.00 0.00 ? 30  LEU A HB3  6  
ATOM 9365  H HG   . LEU A 1 30  ? -6.267  5.129   5.905  1.00 0.00 ? 30  LEU A HG   6  
ATOM 9366  H HD11 . LEU A 1 30  ? -4.454  7.256   4.733  1.00 0.00 ? 30  LEU A HD11 6  
ATOM 9367  H HD12 . LEU A 1 30  ? -6.232  7.233   4.665  1.00 0.00 ? 30  LEU A HD12 6  
ATOM 9368  H HD13 . LEU A 1 30  ? -5.403  7.395   6.232  1.00 0.00 ? 30  LEU A HD13 6  
ATOM 9369  H HD21 . LEU A 1 30  ? -6.056  5.186   3.374  1.00 0.00 ? 30  LEU A HD21 6  
ATOM 9370  H HD22 . LEU A 1 30  ? -4.345  4.754   3.604  1.00 0.00 ? 30  LEU A HD22 6  
ATOM 9371  H HD23 . LEU A 1 30  ? -5.624  3.657   4.176  1.00 0.00 ? 30  LEU A HD23 6  
ATOM 9372  N N    . PHE A 1 31  ? -3.968  4.109   9.227  1.00 0.00 ? 31  PHE A N    6  
ATOM 9373  C CA   . PHE A 1 31  ? -3.454  3.291   10.313 1.00 0.00 ? 31  PHE A CA   6  
ATOM 9374  C C    . PHE A 1 31  ? -3.403  1.816   9.911  1.00 0.00 ? 31  PHE A C    6  
ATOM 9375  O O    . PHE A 1 31  ? -4.431  1.141   9.878  1.00 0.00 ? 31  PHE A O    6  
ATOM 9376  C CB   . PHE A 1 31  ? -4.418  3.453   11.490 1.00 0.00 ? 31  PHE A CB   6  
ATOM 9377  C CG   . PHE A 1 31  ? -3.948  2.775   12.778 1.00 0.00 ? 31  PHE A CG   6  
ATOM 9378  C CD1  . PHE A 1 31  ? -4.199  1.454   12.981 1.00 0.00 ? 31  PHE A CD1  6  
ATOM 9379  C CD2  . PHE A 1 31  ? -3.278  3.493   13.719 1.00 0.00 ? 31  PHE A CD2  6  
ATOM 9380  C CE1  . PHE A 1 31  ? -3.762  0.824   14.177 1.00 0.00 ? 31  PHE A CE1  6  
ATOM 9381  C CE2  . PHE A 1 31  ? -2.841  2.863   14.914 1.00 0.00 ? 31  PHE A CE2  6  
ATOM 9382  C CZ   . PHE A 1 31  ? -3.092  1.542   15.118 1.00 0.00 ? 31  PHE A CZ   6  
ATOM 9383  H H    . PHE A 1 31  ? -4.922  3.935   8.982  1.00 0.00 ? 31  PHE A H    6  
ATOM 9384  H HA   . PHE A 1 31  ? -2.446  3.642   10.533 1.00 0.00 ? 31  PHE A HA   6  
ATOM 9385  H HB2  . PHE A 1 31  ? -4.564  4.516   11.684 1.00 0.00 ? 31  PHE A HB2  6  
ATOM 9386  H HB3  . PHE A 1 31  ? -5.389  3.044   11.210 1.00 0.00 ? 31  PHE A HB3  6  
ATOM 9387  H HD1  . PHE A 1 31  ? -4.735  0.878   12.227 1.00 0.00 ? 31  PHE A HD1  6  
ATOM 9388  H HD2  . PHE A 1 31  ? -3.077  4.551   13.556 1.00 0.00 ? 31  PHE A HD2  6  
ATOM 9389  H HE1  . PHE A 1 31  ? -3.963  -0.235  14.340 1.00 0.00 ? 31  PHE A HE1  6  
ATOM 9390  H HE2  . PHE A 1 31  ? -2.304  3.438   15.669 1.00 0.00 ? 31  PHE A HE2  6  
ATOM 9391  H HZ   . PHE A 1 31  ? -2.757  1.058   16.035 1.00 0.00 ? 31  PHE A HZ   6  
ATOM 9392  N N    . ILE A 1 32  ? -2.195  1.358   9.615  1.00 0.00 ? 32  ILE A N    6  
ATOM 9393  C CA   . ILE A 1 32  ? -1.995  -0.025  9.216  1.00 0.00 ? 32  ILE A CA   6  
ATOM 9394  C C    . ILE A 1 32  ? -2.009  -0.916  10.460 1.00 0.00 ? 32  ILE A C    6  
ATOM 9395  O O    . ILE A 1 32  ? -1.324  -0.630  11.441 1.00 0.00 ? 32  ILE A O    6  
ATOM 9396  C CB   . ILE A 1 32  ? -0.725  -0.162  8.375  1.00 0.00 ? 32  ILE A CB   6  
ATOM 9397  C CG1  . ILE A 1 32  ? -0.569  1.022   7.419  1.00 0.00 ? 32  ILE A CG1  6  
ATOM 9398  C CG2  . ILE A 1 32  ? -0.698  -1.502  7.637  1.00 0.00 ? 32  ILE A CG2  6  
ATOM 9399  C CD1  . ILE A 1 32  ? -1.837  1.224   6.586  1.00 0.00 ? 32  ILE A CD1  6  
ATOM 9400  H H    . ILE A 1 32  ? -1.364  1.914   9.644  1.00 0.00 ? 32  ILE A H    6  
ATOM 9401  H HA   . ILE A 1 32  ? -2.835  -0.306  8.580  1.00 0.00 ? 32  ILE A HA   6  
ATOM 9402  H HB   . ILE A 1 32  ? 0.133   -0.148  9.048  1.00 0.00 ? 32  ILE A HB   6  
ATOM 9403  H HG12 . ILE A 1 32  ? -0.356  1.927   7.988  1.00 0.00 ? 32  ILE A HG12 6  
ATOM 9404  H HG13 . ILE A 1 32  ? 0.281   0.852   6.759  1.00 0.00 ? 32  ILE A HG13 6  
ATOM 9405  H HG21 . ILE A 1 32  ? -1.144  -1.382  6.650  1.00 0.00 ? 32  ILE A HG21 6  
ATOM 9406  H HG22 . ILE A 1 32  ? 0.334   -1.838  7.531  1.00 0.00 ? 32  ILE A HG22 6  
ATOM 9407  H HG23 . ILE A 1 32  ? -1.264  -2.241  8.205  1.00 0.00 ? 32  ILE A HG23 6  
ATOM 9408  H HD11 . ILE A 1 32  ? -2.481  0.351   6.688  1.00 0.00 ? 32  ILE A HD11 6  
ATOM 9409  H HD12 . ILE A 1 32  ? -2.366  2.109   6.937  1.00 0.00 ? 32  ILE A HD12 6  
ATOM 9410  H HD13 . ILE A 1 32  ? -1.565  1.354   5.538  1.00 0.00 ? 32  ILE A HD13 6  
ATOM 9411  N N    . GLY A 1 33  ? -2.797  -1.978  10.378 1.00 0.00 ? 33  GLY A N    6  
ATOM 9412  C CA   . GLY A 1 33  ? -2.909  -2.913  11.485 1.00 0.00 ? 33  GLY A CA   6  
ATOM 9413  C C    . GLY A 1 33  ? -2.576  -4.337  11.035 1.00 0.00 ? 33  GLY A C    6  
ATOM 9414  O O    . GLY A 1 33  ? -2.982  -4.762  9.955  1.00 0.00 ? 33  GLY A O    6  
ATOM 9415  H H    . GLY A 1 33  ? -3.351  -2.204  9.577  1.00 0.00 ? 33  GLY A H    6  
ATOM 9416  H HA2  . GLY A 1 33  ? -2.235  -2.615  12.288 1.00 0.00 ? 33  GLY A HA2  6  
ATOM 9417  H HA3  . GLY A 1 33  ? -3.921  -2.884  11.890 1.00 0.00 ? 33  GLY A HA3  6  
ATOM 9418  N N    . GLY A 1 34  ? -1.839  -5.035  11.887 1.00 0.00 ? 34  GLY A N    6  
ATOM 9419  C CA   . GLY A 1 34  ? -1.446  -6.403  11.591 1.00 0.00 ? 34  GLY A CA   6  
ATOM 9420  C C    . GLY A 1 34  ? -0.152  -6.437  10.776 1.00 0.00 ? 34  GLY A C    6  
ATOM 9421  O O    . GLY A 1 34  ? -0.160  -6.821  9.607  1.00 0.00 ? 34  GLY A O    6  
ATOM 9422  H H    . GLY A 1 34  ? -1.512  -4.682  12.764 1.00 0.00 ? 34  GLY A H    6  
ATOM 9423  H HA2  . GLY A 1 34  ? -1.309  -6.955  12.521 1.00 0.00 ? 34  GLY A HA2  6  
ATOM 9424  H HA3  . GLY A 1 34  ? -2.242  -6.902  11.038 1.00 0.00 ? 34  GLY A HA3  6  
ATOM 9425  N N    . LEU A 1 35  ? 0.929   -6.030  11.424 1.00 0.00 ? 35  LEU A N    6  
ATOM 9426  C CA   . LEU A 1 35  ? 2.229   -6.010  10.774 1.00 0.00 ? 35  LEU A CA   6  
ATOM 9427  C C    . LEU A 1 35  ? 3.057   -7.201  11.261 1.00 0.00 ? 35  LEU A C    6  
ATOM 9428  O O    . LEU A 1 35  ? 4.249   -7.292  10.972 1.00 0.00 ? 35  LEU A O    6  
ATOM 9429  C CB   . LEU A 1 35  ? 2.912   -4.658  10.986 1.00 0.00 ? 35  LEU A CB   6  
ATOM 9430  C CG   . LEU A 1 35  ? 2.102   -3.425  10.579 1.00 0.00 ? 35  LEU A CG   6  
ATOM 9431  C CD1  . LEU A 1 35  ? 3.011   -2.210  10.386 1.00 0.00 ? 35  LEU A CD1  6  
ATOM 9432  C CD2  . LEU A 1 35  ? 1.256   -3.711  9.337  1.00 0.00 ? 35  LEU A CD2  6  
ATOM 9433  H H    . LEU A 1 35  ? 0.927   -5.719  12.375 1.00 0.00 ? 35  LEU A H    6  
ATOM 9434  H HA   . LEU A 1 35  ? 2.060   -6.121  9.703  1.00 0.00 ? 35  LEU A HA   6  
ATOM 9435  H HB2  . LEU A 1 35  ? 3.172   -4.566  12.040 1.00 0.00 ? 35  LEU A HB2  6  
ATOM 9436  H HB3  . LEU A 1 35  ? 3.847   -4.654  10.426 1.00 0.00 ? 35  LEU A HB3  6  
ATOM 9437  H HG   . LEU A 1 35  ? 1.414   -3.186  11.390 1.00 0.00 ? 35  LEU A HG   6  
ATOM 9438  H HD11 . LEU A 1 35  ? 3.943   -2.525  9.916  1.00 0.00 ? 35  LEU A HD11 6  
ATOM 9439  H HD12 . LEU A 1 35  ? 2.512   -1.480  9.750  1.00 0.00 ? 35  LEU A HD12 6  
ATOM 9440  H HD13 . LEU A 1 35  ? 3.227   -1.760  11.356 1.00 0.00 ? 35  LEU A HD13 6  
ATOM 9441  H HD21 . LEU A 1 35  ? 0.736   -4.661  9.462  1.00 0.00 ? 35  LEU A HD21 6  
ATOM 9442  H HD22 . LEU A 1 35  ? 0.526   -2.912  9.204  1.00 0.00 ? 35  LEU A HD22 6  
ATOM 9443  H HD23 . LEU A 1 35  ? 1.902   -3.762  8.461  1.00 0.00 ? 35  LEU A HD23 6  
ATOM 9444  N N    . SER A 1 36  ? 2.392   -8.084  11.991 1.00 0.00 ? 36  SER A N    6  
ATOM 9445  C CA   . SER A 1 36  ? 3.051   -9.265  12.521 1.00 0.00 ? 36  SER A CA   6  
ATOM 9446  C C    . SER A 1 36  ? 4.097   -8.858  13.562 1.00 0.00 ? 36  SER A C    6  
ATOM 9447  O O    . SER A 1 36  ? 3.925   -9.115  14.752 1.00 0.00 ? 36  SER A O    6  
ATOM 9448  C CB   . SER A 1 36  ? 3.705   -10.079 11.403 1.00 0.00 ? 36  SER A CB   6  
ATOM 9449  O OG   . SER A 1 36  ? 4.864   -10.774 11.855 1.00 0.00 ? 36  SER A OG   6  
ATOM 9450  H H    . SER A 1 36  ? 1.422   -8.002  12.222 1.00 0.00 ? 36  SER A H    6  
ATOM 9451  H HA   . SER A 1 36  ? 2.260   -9.854  12.984 1.00 0.00 ? 36  SER A HA   6  
ATOM 9452  H HB2  . SER A 1 36  ? 2.984   -10.795 11.007 1.00 0.00 ? 36  SER A HB2  6  
ATOM 9453  H HB3  . SER A 1 36  ? 3.977   -9.415  10.582 1.00 0.00 ? 36  SER A HB3  6  
ATOM 9454  H HG   . SER A 1 36  ? 5.563   -10.120 12.145 1.00 0.00 ? 36  SER A HG   6  
ATOM 9455  N N    . PHE A 1 37  ? 5.157   -8.231  13.074 1.00 0.00 ? 37  PHE A N    6  
ATOM 9456  C CA   . PHE A 1 37  ? 6.230   -7.786  13.947 1.00 0.00 ? 37  PHE A CA   6  
ATOM 9457  C C    . PHE A 1 37  ? 7.505   -7.504  13.149 1.00 0.00 ? 37  PHE A C    6  
ATOM 9458  O O    . PHE A 1 37  ? 8.346   -6.714  13.575 1.00 0.00 ? 37  PHE A O    6  
ATOM 9459  C CB   . PHE A 1 37  ? 6.502   -8.921  14.936 1.00 0.00 ? 37  PHE A CB   6  
ATOM 9460  C CG   . PHE A 1 37  ? 6.065   -8.616  16.370 1.00 0.00 ? 37  PHE A CG   6  
ATOM 9461  C CD1  . PHE A 1 37  ? 5.036   -7.756  16.599 1.00 0.00 ? 37  PHE A CD1  6  
ATOM 9462  C CD2  . PHE A 1 37  ? 6.705   -9.204  17.416 1.00 0.00 ? 37  PHE A CD2  6  
ATOM 9463  C CE1  . PHE A 1 37  ? 4.630   -7.473  17.930 1.00 0.00 ? 37  PHE A CE1  6  
ATOM 9464  C CE2  . PHE A 1 37  ? 6.299   -8.920  18.747 1.00 0.00 ? 37  PHE A CE2  6  
ATOM 9465  C CZ   . PHE A 1 37  ? 5.270   -8.061  18.976 1.00 0.00 ? 37  PHE A CZ   6  
ATOM 9466  H H    . PHE A 1 37  ? 5.289   -8.026  12.104 1.00 0.00 ? 37  PHE A H    6  
ATOM 9467  H HA   . PHE A 1 37  ? 5.895   -6.868  14.430 1.00 0.00 ? 37  PHE A HA   6  
ATOM 9468  H HB2  . PHE A 1 37  ? 5.987   -9.819  14.593 1.00 0.00 ? 37  PHE A HB2  6  
ATOM 9469  H HB3  . PHE A 1 37  ? 7.569   -9.145  14.932 1.00 0.00 ? 37  PHE A HB3  6  
ATOM 9470  H HD1  . PHE A 1 37  ? 4.523   -7.285  15.760 1.00 0.00 ? 37  PHE A HD1  6  
ATOM 9471  H HD2  . PHE A 1 37  ? 7.530   -9.893  17.233 1.00 0.00 ? 37  PHE A HD2  6  
ATOM 9472  H HE1  . PHE A 1 37  ? 3.805   -6.784  18.113 1.00 0.00 ? 37  PHE A HE1  6  
ATOM 9473  H HE2  . PHE A 1 37  ? 6.812   -9.392  19.585 1.00 0.00 ? 37  PHE A HE2  6  
ATOM 9474  H HZ   . PHE A 1 37  ? 4.958   -7.843  19.997 1.00 0.00 ? 37  PHE A HZ   6  
ATOM 9475  N N    . GLU A 1 38  ? 7.608   -8.166  12.006 1.00 0.00 ? 38  GLU A N    6  
ATOM 9476  C CA   . GLU A 1 38  ? 8.766   -7.997  11.145 1.00 0.00 ? 38  GLU A CA   6  
ATOM 9477  C C    . GLU A 1 38  ? 8.530   -6.851  10.158 1.00 0.00 ? 38  GLU A C    6  
ATOM 9478  O O    . GLU A 1 38  ? 9.404   -6.008  9.962  1.00 0.00 ? 38  GLU A O    6  
ATOM 9479  C CB   . GLU A 1 38  ? 9.095   -9.296  10.408 1.00 0.00 ? 38  GLU A CB   6  
ATOM 9480  C CG   . GLU A 1 38  ? 10.033  -10.175 11.238 1.00 0.00 ? 38  GLU A CG   6  
ATOM 9481  C CD   . GLU A 1 38  ? 9.284   -11.373 11.825 1.00 0.00 ? 38  GLU A CD   6  
ATOM 9482  O OE1  . GLU A 1 38  ? 8.478   -11.963 11.074 1.00 0.00 ? 38  GLU A OE1  6  
ATOM 9483  O OE2  . GLU A 1 38  ? 9.535   -11.672 13.013 1.00 0.00 ? 38  GLU A OE2  6  
ATOM 9484  H H    . GLU A 1 38  ? 6.919   -8.807  11.667 1.00 0.00 ? 38  GLU A H    6  
ATOM 9485  H HA   . GLU A 1 38  ? 9.590   -7.746  11.813 1.00 0.00 ? 38  GLU A HA   6  
ATOM 9486  H HB2  . GLU A 1 38  ? 8.175   -9.840  10.193 1.00 0.00 ? 38  GLU A HB2  6  
ATOM 9487  H HB3  . GLU A 1 38  ? 9.560   -9.067  9.449  1.00 0.00 ? 38  GLU A HB3  6  
ATOM 9488  H HG2  . GLU A 1 38  ? 10.855  -10.526 10.614 1.00 0.00 ? 38  GLU A HG2  6  
ATOM 9489  H HG3  . GLU A 1 38  ? 10.472  -9.586  12.043 1.00 0.00 ? 38  GLU A HG3  6  
ATOM 9490  N N    . THR A 1 39  ? 7.346   -6.858  9.564  1.00 0.00 ? 39  THR A N    6  
ATOM 9491  C CA   . THR A 1 39  ? 6.985   -5.830  8.603  1.00 0.00 ? 39  THR A CA   6  
ATOM 9492  C C    . THR A 1 39  ? 7.537   -4.472  9.042  1.00 0.00 ? 39  THR A C    6  
ATOM 9493  O O    . THR A 1 39  ? 6.925   -3.783  9.857  1.00 0.00 ? 39  THR A O    6  
ATOM 9494  C CB   . THR A 1 39  ? 5.464   -5.844  8.444  1.00 0.00 ? 39  THR A CB   6  
ATOM 9495  O OG1  . THR A 1 39  ? 5.220   -6.915  7.537  1.00 0.00 ? 39  THR A OG1  6  
ATOM 9496  C CG2  . THR A 1 39  ? 4.939   -4.608  7.711  1.00 0.00 ? 39  THR A CG2  6  
ATOM 9497  H H    . THR A 1 39  ? 6.641   -7.548  9.730  1.00 0.00 ? 39  THR A H    6  
ATOM 9498  H HA   . THR A 1 39  ? 7.453   -6.072  7.649  1.00 0.00 ? 39  THR A HA   6  
ATOM 9499  H HB   . THR A 1 39  ? 4.972   -5.962  9.410  1.00 0.00 ? 39  THR A HB   6  
ATOM 9500  H HG1  . THR A 1 39  ? 4.421   -7.440  7.833  1.00 0.00 ? 39  THR A HG1  6  
ATOM 9501  H HG21 . THR A 1 39  ? 3.958   -4.824  7.290  1.00 0.00 ? 39  THR A HG21 6  
ATOM 9502  H HG22 . THR A 1 39  ? 4.859   -3.777  8.412  1.00 0.00 ? 39  THR A HG22 6  
ATOM 9503  H HG23 . THR A 1 39  ? 5.628   -4.341  6.910  1.00 0.00 ? 39  THR A HG23 6  
ATOM 9504  N N    . THR A 1 40  ? 8.688   -4.128  8.482  1.00 0.00 ? 40  THR A N    6  
ATOM 9505  C CA   . THR A 1 40  ? 9.329   -2.865  8.805  1.00 0.00 ? 40  THR A CA   6  
ATOM 9506  C C    . THR A 1 40  ? 8.734   -1.734  7.964  1.00 0.00 ? 40  THR A C    6  
ATOM 9507  O O    . THR A 1 40  ? 7.864   -1.969  7.128  1.00 0.00 ? 40  THR A O    6  
ATOM 9508  C CB   . THR A 1 40  ? 10.837  -3.037  8.613  1.00 0.00 ? 40  THR A CB   6  
ATOM 9509  O OG1  . THR A 1 40  ? 10.972  -3.412  7.245  1.00 0.00 ? 40  THR A OG1  6  
ATOM 9510  C CG2  . THR A 1 40  ? 11.392  -4.236  9.384  1.00 0.00 ? 40  THR A CG2  6  
ATOM 9511  H H    . THR A 1 40  ? 9.179   -4.694  7.820  1.00 0.00 ? 40  THR A H    6  
ATOM 9512  H HA   . THR A 1 40  ? 9.120   -2.630  9.849  1.00 0.00 ? 40  THR A HA   6  
ATOM 9513  H HB   . THR A 1 40  ? 11.370  -2.124  8.877  1.00 0.00 ? 40  THR A HB   6  
ATOM 9514  H HG1  . THR A 1 40  ? 11.873  -3.145  6.904  1.00 0.00 ? 40  THR A HG1  6  
ATOM 9515  H HG21 . THR A 1 40  ? 12.478  -4.162  9.438  1.00 0.00 ? 40  THR A HG21 6  
ATOM 9516  H HG22 . THR A 1 40  ? 10.978  -4.244  10.392 1.00 0.00 ? 40  THR A HG22 6  
ATOM 9517  H HG23 . THR A 1 40  ? 11.116  -5.158  8.871  1.00 0.00 ? 40  THR A HG23 6  
ATOM 9518  N N    . GLU A 1 41  ? 9.229   -0.530  8.214  1.00 0.00 ? 41  GLU A N    6  
ATOM 9519  C CA   . GLU A 1 41  ? 8.757   0.638   7.490  1.00 0.00 ? 41  GLU A CA   6  
ATOM 9520  C C    . GLU A 1 41  ? 8.853   0.401   5.981  1.00 0.00 ? 41  GLU A C    6  
ATOM 9521  O O    . GLU A 1 41  ? 7.885   0.616   5.253  1.00 0.00 ? 41  GLU A O    6  
ATOM 9522  C CB   . GLU A 1 41  ? 9.538   1.889   7.899  1.00 0.00 ? 41  GLU A CB   6  
ATOM 9523  C CG   . GLU A 1 41  ? 9.430   2.134   9.405  1.00 0.00 ? 41  GLU A CG   6  
ATOM 9524  C CD   . GLU A 1 41  ? 10.156  3.420   9.805  1.00 0.00 ? 41  GLU A CD   6  
ATOM 9525  O OE1  . GLU A 1 41  ? 11.180  3.719   9.154  1.00 0.00 ? 41  GLU A OE1  6  
ATOM 9526  O OE2  . GLU A 1 41  ? 9.670   4.075   10.752 1.00 0.00 ? 41  GLU A OE2  6  
ATOM 9527  H H    . GLU A 1 41  ? 9.937   -0.347  8.896  1.00 0.00 ? 41  GLU A H    6  
ATOM 9528  H HA   . GLU A 1 41  ? 7.714   0.757   7.780  1.00 0.00 ? 41  GLU A HA   6  
ATOM 9529  H HB2  . GLU A 1 41  ? 10.585  1.776   7.619  1.00 0.00 ? 41  GLU A HB2  6  
ATOM 9530  H HB3  . GLU A 1 41  ? 9.155   2.754   7.358  1.00 0.00 ? 41  GLU A HB3  6  
ATOM 9531  H HG2  . GLU A 1 41  ? 8.380   2.200   9.692  1.00 0.00 ? 41  GLU A HG2  6  
ATOM 9532  H HG3  . GLU A 1 41  ? 9.855   1.289   9.946  1.00 0.00 ? 41  GLU A HG3  6  
ATOM 9533  N N    . GLU A 1 42  ? 10.028  -0.039  5.557  1.00 0.00 ? 42  GLU A N    6  
ATOM 9534  C CA   . GLU A 1 42  ? 10.263  -0.307  4.148  1.00 0.00 ? 42  GLU A CA   6  
ATOM 9535  C C    . GLU A 1 42  ? 9.346   -1.432  3.662  1.00 0.00 ? 42  GLU A C    6  
ATOM 9536  O O    . GLU A 1 42  ? 8.509   -1.220  2.786  1.00 0.00 ? 42  GLU A O    6  
ATOM 9537  C CB   . GLU A 1 42  ? 11.732  -0.648  3.892  1.00 0.00 ? 42  GLU A CB   6  
ATOM 9538  C CG   . GLU A 1 42  ? 12.067  -0.547  2.402  1.00 0.00 ? 42  GLU A CG   6  
ATOM 9539  C CD   . GLU A 1 42  ? 13.551  -0.236  2.194  1.00 0.00 ? 42  GLU A CD   6  
ATOM 9540  O OE1  . GLU A 1 42  ? 14.025  0.723   2.839  1.00 0.00 ? 42  GLU A OE1  6  
ATOM 9541  O OE2  . GLU A 1 42  ? 14.176  -0.964  1.393  1.00 0.00 ? 42  GLU A OE2  6  
ATOM 9542  H H    . GLU A 1 42  ? 10.810  -0.211  6.155  1.00 0.00 ? 42  GLU A H    6  
ATOM 9543  H HA   . GLU A 1 42  ? 10.016  0.621   3.631  1.00 0.00 ? 42  GLU A HA   6  
ATOM 9544  H HB2  . GLU A 1 42  ? 12.371  0.030   4.458  1.00 0.00 ? 42  GLU A HB2  6  
ATOM 9545  H HB3  . GLU A 1 42  ? 11.943  -1.656  4.248  1.00 0.00 ? 42  GLU A HB3  6  
ATOM 9546  H HG2  . GLU A 1 42  ? 11.815  -1.483  1.905  1.00 0.00 ? 42  GLU A HG2  6  
ATOM 9547  H HG3  . GLU A 1 42  ? 11.460  0.232   1.942  1.00 0.00 ? 42  GLU A HG3  6  
ATOM 9548  N N    . SER A 1 43  ? 9.536   -2.603  4.252  1.00 0.00 ? 43  SER A N    6  
ATOM 9549  C CA   . SER A 1 43  ? 8.737   -3.761  3.890  1.00 0.00 ? 43  SER A CA   6  
ATOM 9550  C C    . SER A 1 43  ? 7.285   -3.342  3.653  1.00 0.00 ? 43  SER A C    6  
ATOM 9551  O O    . SER A 1 43  ? 6.681   -3.722  2.651  1.00 0.00 ? 43  SER A O    6  
ATOM 9552  C CB   . SER A 1 43  ? 8.808   -4.840  4.973  1.00 0.00 ? 43  SER A CB   6  
ATOM 9553  O OG   . SER A 1 43  ? 10.017  -5.590  4.900  1.00 0.00 ? 43  SER A OG   6  
ATOM 9554  H H    . SER A 1 43  ? 10.220  -2.767  4.963  1.00 0.00 ? 43  SER A H    6  
ATOM 9555  H HA   . SER A 1 43  ? 9.181   -4.142  2.969  1.00 0.00 ? 43  SER A HA   6  
ATOM 9556  H HB2  . SER A 1 43  ? 8.730   -4.373  5.955  1.00 0.00 ? 43  SER A HB2  6  
ATOM 9557  H HB3  . SER A 1 43  ? 7.957   -5.512  4.871  1.00 0.00 ? 43  SER A HB3  6  
ATOM 9558  H HG   . SER A 1 43  ? 10.751  -5.021  4.529  1.00 0.00 ? 43  SER A HG   6  
ATOM 9559  N N    . LEU A 1 44  ? 6.767   -2.563  4.591  1.00 0.00 ? 44  LEU A N    6  
ATOM 9560  C CA   . LEU A 1 44  ? 5.397   -2.088  4.497  1.00 0.00 ? 44  LEU A CA   6  
ATOM 9561  C C    . LEU A 1 44  ? 5.241   -1.242  3.232  1.00 0.00 ? 44  LEU A C    6  
ATOM 9562  O O    . LEU A 1 44  ? 4.509   -1.616  2.317  1.00 0.00 ? 44  LEU A O    6  
ATOM 9563  C CB   . LEU A 1 44  ? 4.994   -1.357  5.780  1.00 0.00 ? 44  LEU A CB   6  
ATOM 9564  C CG   . LEU A 1 44  ? 3.616   -0.692  5.768  1.00 0.00 ? 44  LEU A CG   6  
ATOM 9565  C CD1  . LEU A 1 44  ? 2.572   -1.583  6.443  1.00 0.00 ? 44  LEU A CD1  6  
ATOM 9566  C CD2  . LEU A 1 44  ? 3.675   0.701   6.397  1.00 0.00 ? 44  LEU A CD2  6  
ATOM 9567  H H    . LEU A 1 44  ? 7.265   -2.258  5.403  1.00 0.00 ? 44  LEU A H    6  
ATOM 9568  H HA   . LEU A 1 44  ? 4.753   -2.963  4.409  1.00 0.00 ? 44  LEU A HA   6  
ATOM 9569  H HB2  . LEU A 1 44  ? 5.025   -2.068  6.605  1.00 0.00 ? 44  LEU A HB2  6  
ATOM 9570  H HB3  . LEU A 1 44  ? 5.743   -0.593  5.989  1.00 0.00 ? 44  LEU A HB3  6  
ATOM 9571  H HG   . LEU A 1 44  ? 3.307   -0.564  4.730  1.00 0.00 ? 44  LEU A HG   6  
ATOM 9572  H HD11 . LEU A 1 44  ? 2.823   -2.630  6.274  1.00 0.00 ? 44  LEU A HD11 6  
ATOM 9573  H HD12 . LEU A 1 44  ? 2.560   -1.380  7.514  1.00 0.00 ? 44  LEU A HD12 6  
ATOM 9574  H HD13 . LEU A 1 44  ? 1.588   -1.373  6.023  1.00 0.00 ? 44  LEU A HD13 6  
ATOM 9575  H HD21 . LEU A 1 44  ? 2.662   1.080   6.536  1.00 0.00 ? 44  LEU A HD21 6  
ATOM 9576  H HD22 . LEU A 1 44  ? 4.177   0.643   7.363  1.00 0.00 ? 44  LEU A HD22 6  
ATOM 9577  H HD23 . LEU A 1 44  ? 4.227   1.374   5.741  1.00 0.00 ? 44  LEU A HD23 6  
ATOM 9578  N N    . ARG A 1 45  ? 5.942   -0.118  3.221  1.00 0.00 ? 45  ARG A N    6  
ATOM 9579  C CA   . ARG A 1 45  ? 5.890   0.785   2.083  1.00 0.00 ? 45  ARG A CA   6  
ATOM 9580  C C    . ARG A 1 45  ? 6.043   0.002   0.777  1.00 0.00 ? 45  ARG A C    6  
ATOM 9581  O O    . ARG A 1 45  ? 5.280   0.204   -0.165 1.00 0.00 ? 45  ARG A O    6  
ATOM 9582  C CB   . ARG A 1 45  ? 6.993   1.842   2.168  1.00 0.00 ? 45  ARG A CB   6  
ATOM 9583  C CG   . ARG A 1 45  ? 6.415   3.207   2.546  1.00 0.00 ? 45  ARG A CG   6  
ATOM 9584  C CD   . ARG A 1 45  ? 7.451   4.316   2.345  1.00 0.00 ? 45  ARG A CD   6  
ATOM 9585  N NE   . ARG A 1 45  ? 7.330   4.881   0.983  1.00 0.00 ? 45  ARG A NE   6  
ATOM 9586  C CZ   . ARG A 1 45  ? 8.152   5.813   0.480  1.00 0.00 ? 45  ARG A CZ   6  
ATOM 9587  N NH1  . ARG A 1 45  ? 9.159   6.289   1.225  1.00 0.00 ? 45  ARG A NH1  6  
ATOM 9588  N NH2  . ARG A 1 45  ? 7.966   6.268   -0.766 1.00 0.00 ? 45  ARG A NH2  6  
ATOM 9589  H H    . ARG A 1 45  ? 6.535   0.179   3.969  1.00 0.00 ? 45  ARG A H    6  
ATOM 9590  H HA   . ARG A 1 45  ? 4.909   1.256   2.145  1.00 0.00 ? 45  ARG A HA   6  
ATOM 9591  H HB2  . ARG A 1 45  ? 7.735   1.540   2.907  1.00 0.00 ? 45  ARG A HB2  6  
ATOM 9592  H HB3  . ARG A 1 45  ? 7.508   1.913   1.210  1.00 0.00 ? 45  ARG A HB3  6  
ATOM 9593  H HG2  . ARG A 1 45  ? 5.534   3.414   1.938  1.00 0.00 ? 45  ARG A HG2  6  
ATOM 9594  H HG3  . ARG A 1 45  ? 6.089   3.193   3.586  1.00 0.00 ? 45  ARG A HG3  6  
ATOM 9595  H HD2  . ARG A 1 45  ? 7.305   5.100   3.088  1.00 0.00 ? 45  ARG A HD2  6  
ATOM 9596  H HD3  . ARG A 1 45  ? 8.455   3.918   2.495  1.00 0.00 ? 45  ARG A HD3  6  
ATOM 9597  H HE   . ARG A 1 45  ? 6.588   4.547   0.401  1.00 0.00 ? 45  ARG A HE   6  
ATOM 9598  H HH11 . ARG A 1 45  ? 9.297   5.950   2.155  1.00 0.00 ? 45  ARG A HH11 6  
ATOM 9599  H HH12 . ARG A 1 45  ? 9.772   6.985   0.850  1.00 0.00 ? 45  ARG A HH12 6  
ATOM 9600  H HH21 . ARG A 1 45  ? 7.214   5.912   -1.322 1.00 0.00 ? 45  ARG A HH21 6  
ATOM 9601  H HH22 . ARG A 1 45  ? 8.579   6.963   -1.141 1.00 0.00 ? 45  ARG A HH22 6  
ATOM 9602  N N    . ASN A 1 46  ? 7.036   -0.876  0.764  1.00 0.00 ? 46  ASN A N    6  
ATOM 9603  C CA   . ASN A 1 46  ? 7.299   -1.690  -0.410 1.00 0.00 ? 46  ASN A CA   6  
ATOM 9604  C C    . ASN A 1 46  ? 5.984   -2.288  -0.916 1.00 0.00 ? 46  ASN A C    6  
ATOM 9605  O O    . ASN A 1 46  ? 5.858   -2.610  -2.097 1.00 0.00 ? 46  ASN A O    6  
ATOM 9606  C CB   . ASN A 1 46  ? 8.246   -2.845  -0.079 1.00 0.00 ? 46  ASN A CB   6  
ATOM 9607  C CG   . ASN A 1 46  ? 8.324   -3.841  -1.238 1.00 0.00 ? 46  ASN A CG   6  
ATOM 9608  O OD1  . ASN A 1 46  ? 9.087   -3.682  -2.177 1.00 0.00 ? 46  ASN A OD1  6  
ATOM 9609  N ND2  . ASN A 1 46  ? 7.493   -4.873  -1.121 1.00 0.00 ? 46  ASN A ND2  6  
ATOM 9610  H H    . ASN A 1 46  ? 7.652   -1.035  1.535  1.00 0.00 ? 46  ASN A H    6  
ATOM 9611  H HA   . ASN A 1 46  ? 7.754   -1.013  -1.133 1.00 0.00 ? 46  ASN A HA   6  
ATOM 9612  H HB2  . ASN A 1 46  ? 9.241   -2.453  0.136  1.00 0.00 ? 46  ASN A HB2  6  
ATOM 9613  H HB3  . ASN A 1 46  ? 7.903   -3.355  0.821  1.00 0.00 ? 46  ASN A HB3  6  
ATOM 9614  H HD21 . ASN A 1 46  ? 6.892   -4.943  -0.325 1.00 0.00 ? 46  ASN A HD21 6  
ATOM 9615  H HD22 . ASN A 1 46  ? 7.470   -5.578  -1.829 1.00 0.00 ? 46  ASN A HD22 6  
ATOM 9616  N N    . TYR A 1 47  ? 5.038   -2.418  0.002  1.00 0.00 ? 47  TYR A N    6  
ATOM 9617  C CA   . TYR A 1 47  ? 3.738   -2.971  -0.336 1.00 0.00 ? 47  TYR A CA   6  
ATOM 9618  C C    . TYR A 1 47  ? 2.744   -1.862  -0.686 1.00 0.00 ? 47  TYR A C    6  
ATOM 9619  O O    . TYR A 1 47  ? 2.043   -1.947  -1.693 1.00 0.00 ? 47  TYR A O    6  
ATOM 9620  C CB   . TYR A 1 47  ? 3.250   -3.699  0.918  1.00 0.00 ? 47  TYR A CB   6  
ATOM 9621  C CG   . TYR A 1 47  ? 2.118   -4.695  0.659  1.00 0.00 ? 47  TYR A CG   6  
ATOM 9622  C CD1  . TYR A 1 47  ? 2.397   -5.931  0.112  1.00 0.00 ? 47  TYR A CD1  6  
ATOM 9623  C CD2  . TYR A 1 47  ? 0.817   -4.357  0.973  1.00 0.00 ? 47  TYR A CD2  6  
ATOM 9624  C CE1  . TYR A 1 47  ? 1.331   -6.868  -0.131 1.00 0.00 ? 47  TYR A CE1  6  
ATOM 9625  C CE2  . TYR A 1 47  ? -0.249  -5.294  0.729  1.00 0.00 ? 47  TYR A CE2  6  
ATOM 9626  C CZ   . TYR A 1 47  ? 0.061   -6.503  0.189  1.00 0.00 ? 47  TYR A CZ   6  
ATOM 9627  O OH   . TYR A 1 47  ? -0.946  -7.388  -0.041 1.00 0.00 ? 47  TYR A OH   6  
ATOM 9628  H H    . TYR A 1 47  ? 5.149   -2.154  0.960  1.00 0.00 ? 47  TYR A H    6  
ATOM 9629  H HA   . TYR A 1 47  ? 3.864   -3.622  -1.201 1.00 0.00 ? 47  TYR A HA   6  
ATOM 9630  H HB2  . TYR A 1 47  ? 4.090   -4.229  1.368  1.00 0.00 ? 47  TYR A HB2  6  
ATOM 9631  H HB3  . TYR A 1 47  ? 2.912   -2.962  1.646  1.00 0.00 ? 47  TYR A HB3  6  
ATOM 9632  H HD1  . TYR A 1 47  ? 3.425   -6.198  -0.135 1.00 0.00 ? 47  TYR A HD1  6  
ATOM 9633  H HD2  . TYR A 1 47  ? 0.596   -3.381  1.405  1.00 0.00 ? 47  TYR A HD2  6  
ATOM 9634  H HE1  . TYR A 1 47  ? 1.538   -7.847  -0.563 1.00 0.00 ? 47  TYR A HE1  6  
ATOM 9635  H HE2  . TYR A 1 47  ? -1.281  -5.040  0.971  1.00 0.00 ? 47  TYR A HE2  6  
ATOM 9636  H HH   . TYR A 1 47  ? -1.296  -7.274  -0.971 1.00 0.00 ? 47  TYR A HH   6  
ATOM 9637  N N    . TYR A 1 48  ? 2.715   -0.847  0.165  1.00 0.00 ? 48  TYR A N    6  
ATOM 9638  C CA   . TYR A 1 48  ? 1.819   0.278   -0.041 1.00 0.00 ? 48  TYR A CA   6  
ATOM 9639  C C    . TYR A 1 48  ? 2.491   1.367   -0.880 1.00 0.00 ? 48  TYR A C    6  
ATOM 9640  O O    . TYR A 1 48  ? 2.136   2.541   -0.779 1.00 0.00 ? 48  TYR A O    6  
ATOM 9641  C CB   . TYR A 1 48  ? 1.516   0.837   1.350  1.00 0.00 ? 48  TYR A CB   6  
ATOM 9642  C CG   . TYR A 1 48  ? 0.451   0.051   2.118  1.00 0.00 ? 48  TYR A CG   6  
ATOM 9643  C CD1  . TYR A 1 48  ? -0.885  0.350   1.947  1.00 0.00 ? 48  TYR A CD1  6  
ATOM 9644  C CD2  . TYR A 1 48  ? 0.827   -0.957  2.982  1.00 0.00 ? 48  TYR A CD2  6  
ATOM 9645  C CE1  . TYR A 1 48  ? -1.887  -0.390  2.669  1.00 0.00 ? 48  TYR A CE1  6  
ATOM 9646  C CE2  . TYR A 1 48  ? -0.174  -1.697  3.705  1.00 0.00 ? 48  TYR A CE2  6  
ATOM 9647  C CZ   . TYR A 1 48  ? -1.482  -1.377  3.513  1.00 0.00 ? 48  TYR A CZ   6  
ATOM 9648  O OH   . TYR A 1 48  ? -2.428  -2.076  4.196  1.00 0.00 ? 48  TYR A OH   6  
ATOM 9649  H H    . TYR A 1 48  ? 3.289   -0.786  0.982  1.00 0.00 ? 48  TYR A H    6  
ATOM 9650  H HA   . TYR A 1 48  ? 0.938   -0.086  -0.570 1.00 0.00 ? 48  TYR A HA   6  
ATOM 9651  H HB2  . TYR A 1 48  ? 2.436   0.848   1.934  1.00 0.00 ? 48  TYR A HB2  6  
ATOM 9652  H HB3  . TYR A 1 48  ? 1.188   1.872   1.251  1.00 0.00 ? 48  TYR A HB3  6  
ATOM 9653  H HD1  . TYR A 1 48  ? -1.182  1.146   1.264  1.00 0.00 ? 48  TYR A HD1  6  
ATOM 9654  H HD2  . TYR A 1 48  ? 1.883   -1.194  3.118  1.00 0.00 ? 48  TYR A HD2  6  
ATOM 9655  H HE1  . TYR A 1 48  ? -2.946  -0.164  2.543  1.00 0.00 ? 48  TYR A HE1  6  
ATOM 9656  H HE2  . TYR A 1 48  ? 0.109   -2.496  4.391  1.00 0.00 ? 48  TYR A HE2  6  
ATOM 9657  H HH   . TYR A 1 48  ? -1.992  -2.700  4.843  1.00 0.00 ? 48  TYR A HH   6  
ATOM 9658  N N    . GLU A 1 49  ? 3.448   0.940   -1.690 1.00 0.00 ? 49  GLU A N    6  
ATOM 9659  C CA   . GLU A 1 49  ? 4.173   1.864   -2.546 1.00 0.00 ? 49  GLU A CA   6  
ATOM 9660  C C    . GLU A 1 49  ? 3.603   1.830   -3.966 1.00 0.00 ? 49  GLU A C    6  
ATOM 9661  O O    . GLU A 1 49  ? 3.900   2.704   -4.778 1.00 0.00 ? 49  GLU A O    6  
ATOM 9662  C CB   . GLU A 1 49  ? 5.670   1.550   -2.548 1.00 0.00 ? 49  GLU A CB   6  
ATOM 9663  C CG   . GLU A 1 49  ? 6.423   2.465   -1.580 1.00 0.00 ? 49  GLU A CG   6  
ATOM 9664  C CD   . GLU A 1 49  ? 7.837   2.756   -2.088 1.00 0.00 ? 49  GLU A CD   6  
ATOM 9665  O OE1  . GLU A 1 49  ? 8.312   1.963   -2.930 1.00 0.00 ? 49  GLU A OE1  6  
ATOM 9666  O OE2  . GLU A 1 49  ? 8.410   3.765   -1.624 1.00 0.00 ? 49  GLU A OE2  6  
ATOM 9667  H H    . GLU A 1 49  ? 3.730   -0.017  -1.767 1.00 0.00 ? 49  GLU A H    6  
ATOM 9668  H HA   . GLU A 1 49  ? 4.015   2.849   -2.107 1.00 0.00 ? 49  GLU A HA   6  
ATOM 9669  H HB2  . GLU A 1 49  ? 5.828   0.509   -2.267 1.00 0.00 ? 49  GLU A HB2  6  
ATOM 9670  H HB3  . GLU A 1 49  ? 6.070   1.672   -3.555 1.00 0.00 ? 49  GLU A HB3  6  
ATOM 9671  H HG2  . GLU A 1 49  ? 5.877   3.400   -1.458 1.00 0.00 ? 49  GLU A HG2  6  
ATOM 9672  H HG3  . GLU A 1 49  ? 6.476   1.996   -0.597 1.00 0.00 ? 49  GLU A HG3  6  
ATOM 9673  N N    . GLN A 1 50  ? 2.796   0.811   -4.221 1.00 0.00 ? 50  GLN A N    6  
ATOM 9674  C CA   . GLN A 1 50  ? 2.182   0.651   -5.528 1.00 0.00 ? 50  GLN A CA   6  
ATOM 9675  C C    . GLN A 1 50  ? 1.022   1.635   -5.694 1.00 0.00 ? 50  GLN A C    6  
ATOM 9676  O O    . GLN A 1 50  ? 1.046   2.485   -6.583 1.00 0.00 ? 50  GLN A O    6  
ATOM 9677  C CB   . GLN A 1 50  ? 1.714   -0.789  -5.742 1.00 0.00 ? 50  GLN A CB   6  
ATOM 9678  C CG   . GLN A 1 50  ? 2.887   -1.767  -5.647 1.00 0.00 ? 50  GLN A CG   6  
ATOM 9679  C CD   . GLN A 1 50  ? 2.392   -3.214  -5.597 1.00 0.00 ? 50  GLN A CD   6  
ATOM 9680  O OE1  . GLN A 1 50  ? 2.727   -4.041  -6.429 1.00 0.00 ? 50  GLN A OE1  6  
ATOM 9681  N NE2  . GLN A 1 50  ? 1.579   -3.473  -4.577 1.00 0.00 ? 50  GLN A NE2  6  
ATOM 9682  H H    . GLN A 1 50  ? 2.560   0.104   -3.554 1.00 0.00 ? 50  GLN A H    6  
ATOM 9683  H HA   . GLN A 1 50  ? 2.968   0.882   -6.247 1.00 0.00 ? 50  GLN A HA   6  
ATOM 9684  H HB2  . GLN A 1 50  ? 0.961   -1.045  -4.997 1.00 0.00 ? 50  GLN A HB2  6  
ATOM 9685  H HB3  . GLN A 1 50  ? 1.239   -0.880  -6.719 1.00 0.00 ? 50  GLN A HB3  6  
ATOM 9686  H HG2  . GLN A 1 50  ? 3.547   -1.634  -6.504 1.00 0.00 ? 50  GLN A HG2  6  
ATOM 9687  H HG3  . GLN A 1 50  ? 3.475   -1.549  -4.755 1.00 0.00 ? 50  GLN A HG3  6  
ATOM 9688  H HE21 . GLN A 1 50  ? 1.344   -2.748  -3.928 1.00 0.00 ? 50  GLN A HE21 6  
ATOM 9689  H HE22 . GLN A 1 50  ? 1.203   -4.392  -4.458 1.00 0.00 ? 50  GLN A HE22 6  
ATOM 9690  N N    . TRP A 1 51  ? 0.034   1.487   -4.824 1.00 0.00 ? 51  TRP A N    6  
ATOM 9691  C CA   . TRP A 1 51  ? -1.133  2.352   -4.862 1.00 0.00 ? 51  TRP A CA   6  
ATOM 9692  C C    . TRP A 1 51  ? -0.646  3.802   -4.895 1.00 0.00 ? 51  TRP A C    6  
ATOM 9693  O O    . TRP A 1 51  ? -1.241  4.645   -5.564 1.00 0.00 ? 51  TRP A O    6  
ATOM 9694  C CB   . TRP A 1 51  ? -2.070  2.062   -3.688 1.00 0.00 ? 51  TRP A CB   6  
ATOM 9695  C CG   . TRP A 1 51  ? -2.669  0.655   -3.702 1.00 0.00 ? 51  TRP A CG   6  
ATOM 9696  C CD1  . TRP A 1 51  ? -3.612  0.168   -4.521 1.00 0.00 ? 51  TRP A CD1  6  
ATOM 9697  C CD2  . TRP A 1 51  ? -2.326  -0.435  -2.821 1.00 0.00 ? 51  TRP A CD2  6  
ATOM 9698  N NE1  . TRP A 1 51  ? -3.900  -1.151  -4.232 1.00 0.00 ? 51  TRP A NE1  6  
ATOM 9699  C CE2  . TRP A 1 51  ? -3.093  -1.529  -3.166 1.00 0.00 ? 51  TRP A CE2  6  
ATOM 9700  C CE3  . TRP A 1 51  ? -1.397  -0.495  -1.767 1.00 0.00 ? 51  TRP A CE3  6  
ATOM 9701  C CZ2  . TRP A 1 51  ? -3.011  -2.762  -2.507 1.00 0.00 ? 51  TRP A CZ2  6  
ATOM 9702  C CZ3  . TRP A 1 51  ? -1.327  -1.734  -1.118 1.00 0.00 ? 51  TRP A CZ3  6  
ATOM 9703  C CH2  . TRP A 1 51  ? -2.093  -2.845  -1.453 1.00 0.00 ? 51  TRP A CH2  6  
ATOM 9704  H H    . TRP A 1 51  ? 0.022   0.793   -4.104 1.00 0.00 ? 51  TRP A H    6  
ATOM 9705  H HA   . TRP A 1 51  ? -1.687  2.124   -5.773 1.00 0.00 ? 51  TRP A HA   6  
ATOM 9706  H HB2  . TRP A 1 51  ? -1.521  2.203   -2.756 1.00 0.00 ? 51  TRP A HB2  6  
ATOM 9707  H HB3  . TRP A 1 51  ? -2.880  2.791   -3.694 1.00 0.00 ? 51  TRP A HB3  6  
ATOM 9708  H HD1  . TRP A 1 51  ? -4.091  0.741   -5.314 1.00 0.00 ? 51  TRP A HD1  6  
ATOM 9709  H HE1  . TRP A 1 51  ? -4.627  -1.780  -4.746 1.00 0.00 ? 51  TRP A HE1  6  
ATOM 9710  H HE3  . TRP A 1 51  ? -0.780  0.354   -1.475 1.00 0.00 ? 51  TRP A HE3  6  
ATOM 9711  H HZ2  . TRP A 1 51  ? -3.629  -3.611  -2.799 1.00 0.00 ? 51  TRP A HZ2  6  
ATOM 9712  H HZ3  . TRP A 1 51  ? -0.622  -1.835  -0.293 1.00 0.00 ? 51  TRP A HZ3  6  
ATOM 9713  H HH2  . TRP A 1 51  ? -1.979  -3.776  -0.899 1.00 0.00 ? 51  TRP A HH2  6  
ATOM 9714  N N    . GLY A 1 52  ? 0.431   4.047   -4.164 1.00 0.00 ? 52  GLY A N    6  
ATOM 9715  C CA   . GLY A 1 52  ? 1.005   5.381   -4.101 1.00 0.00 ? 52  GLY A CA   6  
ATOM 9716  C C    . GLY A 1 52  ? 2.261   5.396   -3.228 1.00 0.00 ? 52  GLY A C    6  
ATOM 9717  O O    . GLY A 1 52  ? 2.513   4.453   -2.479 1.00 0.00 ? 52  GLY A O    6  
ATOM 9718  H H    . GLY A 1 52  ? 0.909   3.356   -3.623 1.00 0.00 ? 52  GLY A H    6  
ATOM 9719  H HA2  . GLY A 1 52  ? 1.252   5.722   -5.106 1.00 0.00 ? 52  GLY A HA2  6  
ATOM 9720  H HA3  . GLY A 1 52  ? 0.270   6.078   -3.700 1.00 0.00 ? 52  GLY A HA3  6  
ATOM 9721  N N    . LYS A 1 53  ? 3.017   6.478   -3.353 1.00 0.00 ? 53  LYS A N    6  
ATOM 9722  C CA   . LYS A 1 53  ? 4.240   6.629   -2.584 1.00 0.00 ? 53  LYS A CA   6  
ATOM 9723  C C    . LYS A 1 53  ? 3.916   7.283   -1.240 1.00 0.00 ? 53  LYS A C    6  
ATOM 9724  O O    . LYS A 1 53  ? 3.435   8.415   -1.196 1.00 0.00 ? 53  LYS A O    6  
ATOM 9725  C CB   . LYS A 1 53  ? 5.294   7.383   -3.397 1.00 0.00 ? 53  LYS A CB   6  
ATOM 9726  C CG   . LYS A 1 53  ? 6.245   6.412   -4.099 1.00 0.00 ? 53  LYS A CG   6  
ATOM 9727  C CD   . LYS A 1 53  ? 6.483   6.831   -5.551 1.00 0.00 ? 53  LYS A CD   6  
ATOM 9728  C CE   . LYS A 1 53  ? 5.332   6.373   -6.450 1.00 0.00 ? 53  LYS A CE   6  
ATOM 9729  N NZ   . LYS A 1 53  ? 4.941   7.454   -7.382 1.00 0.00 ? 53  LYS A NZ   6  
ATOM 9730  H H    . LYS A 1 53  ? 2.805   7.240   -3.964 1.00 0.00 ? 53  LYS A H    6  
ATOM 9731  H HA   . LYS A 1 53  ? 4.633   5.630   -2.396 1.00 0.00 ? 53  LYS A HA   6  
ATOM 9732  H HB2  . LYS A 1 53  ? 4.804   8.016   -4.137 1.00 0.00 ? 53  LYS A HB2  6  
ATOM 9733  H HB3  . LYS A 1 53  ? 5.862   8.043   -2.740 1.00 0.00 ? 53  LYS A HB3  6  
ATOM 9734  H HG2  . LYS A 1 53  ? 7.195   6.378   -3.566 1.00 0.00 ? 53  LYS A HG2  6  
ATOM 9735  H HG3  . LYS A 1 53  ? 5.827   5.405   -4.071 1.00 0.00 ? 53  LYS A HG3  6  
ATOM 9736  H HD2  . LYS A 1 53  ? 6.586   7.914   -5.608 1.00 0.00 ? 53  LYS A HD2  6  
ATOM 9737  H HD3  . LYS A 1 53  ? 7.420   6.403   -5.908 1.00 0.00 ? 53  LYS A HD3  6  
ATOM 9738  H HE2  . LYS A 1 53  ? 5.632   5.490   -7.013 1.00 0.00 ? 53  LYS A HE2  6  
ATOM 9739  H HE3  . LYS A 1 53  ? 4.477   6.086   -5.838 1.00 0.00 ? 53  LYS A HE3  6  
ATOM 9740  H HZ1  . LYS A 1 53  ? 4.090   7.874   -7.067 1.00 0.00 ? 53  LYS A HZ1  6  
ATOM 9741  H HZ2  . LYS A 1 53  ? 5.663   8.146   -7.411 1.00 0.00 ? 53  LYS A HZ2  6  
ATOM 9742  H HZ3  . LYS A 1 53  ? 4.807   7.073   -8.297 1.00 0.00 ? 53  LYS A HZ3  6  
ATOM 9743  N N    . LEU A 1 54  ? 4.192   6.544   -0.176 1.00 0.00 ? 54  LEU A N    6  
ATOM 9744  C CA   . LEU A 1 54  ? 3.935   7.038   1.166  1.00 0.00 ? 54  LEU A CA   6  
ATOM 9745  C C    . LEU A 1 54  ? 5.003   8.069   1.538  1.00 0.00 ? 54  LEU A C    6  
ATOM 9746  O O    . LEU A 1 54  ? 6.112   7.706   1.926  1.00 0.00 ? 54  LEU A O    6  
ATOM 9747  C CB   . LEU A 1 54  ? 3.832   5.875   2.155  1.00 0.00 ? 54  LEU A CB   6  
ATOM 9748  C CG   . LEU A 1 54  ? 3.039   4.657   1.678  1.00 0.00 ? 54  LEU A CG   6  
ATOM 9749  C CD1  . LEU A 1 54  ? 3.235   3.470   2.623  1.00 0.00 ? 54  LEU A CD1  6  
ATOM 9750  C CD2  . LEU A 1 54  ? 1.561   5.003   1.492  1.00 0.00 ? 54  LEU A CD2  6  
ATOM 9751  H H    . LEU A 1 54  ? 4.583   5.624   -0.220 1.00 0.00 ? 54  LEU A H    6  
ATOM 9752  H HA   . LEU A 1 54  ? 2.965   7.535   1.152  1.00 0.00 ? 54  LEU A HA   6  
ATOM 9753  H HB2  . LEU A 1 54  ? 4.841   5.550   2.410  1.00 0.00 ? 54  LEU A HB2  6  
ATOM 9754  H HB3  . LEU A 1 54  ? 3.375   6.244   3.073  1.00 0.00 ? 54  LEU A HB3  6  
ATOM 9755  H HG   . LEU A 1 54  ? 3.425   4.359   0.703  1.00 0.00 ? 54  LEU A HG   6  
ATOM 9756  H HD11 . LEU A 1 54  ? 2.333   3.327   3.218  1.00 0.00 ? 54  LEU A HD11 6  
ATOM 9757  H HD12 . LEU A 1 54  ? 3.434   2.570   2.041  1.00 0.00 ? 54  LEU A HD12 6  
ATOM 9758  H HD13 . LEU A 1 54  ? 4.079   3.668   3.285  1.00 0.00 ? 54  LEU A HD13 6  
ATOM 9759  H HD21 . LEU A 1 54  ? 1.390   6.038   1.790  1.00 0.00 ? 54  LEU A HD21 6  
ATOM 9760  H HD22 . LEU A 1 54  ? 1.287   4.877   0.445  1.00 0.00 ? 54  LEU A HD22 6  
ATOM 9761  H HD23 . LEU A 1 54  ? 0.952   4.342   2.109  1.00 0.00 ? 54  LEU A HD23 6  
ATOM 9762  N N    . THR A 1 55  ? 4.630   9.334   1.407  1.00 0.00 ? 55  THR A N    6  
ATOM 9763  C CA   . THR A 1 55  ? 5.541   10.419  1.725  1.00 0.00 ? 55  THR A CA   6  
ATOM 9764  C C    . THR A 1 55  ? 6.224   10.166  3.070  1.00 0.00 ? 55  THR A C    6  
ATOM 9765  O O    . THR A 1 55  ? 7.325   10.659  3.314  1.00 0.00 ? 55  THR A O    6  
ATOM 9766  C CB   . THR A 1 55  ? 4.751   11.729  1.681  1.00 0.00 ? 55  THR A CB   6  
ATOM 9767  O OG1  . THR A 1 55  ? 3.778   11.581  2.712  1.00 0.00 ? 55  THR A OG1  6  
ATOM 9768  C CG2  . THR A 1 55  ? 3.922   11.870  0.403  1.00 0.00 ? 55  THR A CG2  6  
ATOM 9769  H H    . THR A 1 55  ? 3.725   9.620   1.091  1.00 0.00 ? 55  THR A H    6  
ATOM 9770  H HA   . THR A 1 55  ? 6.325   10.442  0.968  1.00 0.00 ? 55  THR A HA   6  
ATOM 9771  H HB   . THR A 1 55  ? 5.410   12.586  1.815  1.00 0.00 ? 55  THR A HB   6  
ATOM 9772  H HG1  . THR A 1 55  ? 3.116   10.875  2.458  1.00 0.00 ? 55  THR A HG1  6  
ATOM 9773  H HG21 . THR A 1 55  ? 4.076   12.862  -0.022 1.00 0.00 ? 55  THR A HG21 6  
ATOM 9774  H HG22 . THR A 1 55  ? 4.233   11.114  -0.317 1.00 0.00 ? 55  THR A HG22 6  
ATOM 9775  H HG23 . THR A 1 55  ? 2.866   11.735  0.638  1.00 0.00 ? 55  THR A HG23 6  
ATOM 9776  N N    . ASP A 1 56  ? 5.543   9.399   3.908  1.00 0.00 ? 56  ASP A N    6  
ATOM 9777  C CA   . ASP A 1 56  ? 6.070   9.074   5.223  1.00 0.00 ? 56  ASP A CA   6  
ATOM 9778  C C    . ASP A 1 56  ? 5.375   7.818   5.750  1.00 0.00 ? 56  ASP A C    6  
ATOM 9779  O O    . ASP A 1 56  ? 4.147   7.755   5.794  1.00 0.00 ? 56  ASP A O    6  
ATOM 9780  C CB   . ASP A 1 56  ? 5.812   10.210  6.215  1.00 0.00 ? 56  ASP A CB   6  
ATOM 9781  C CG   . ASP A 1 56  ? 6.678   10.176  7.476  1.00 0.00 ? 56  ASP A CG   6  
ATOM 9782  O OD1  . ASP A 1 56  ? 6.314   9.409   8.394  1.00 0.00 ? 56  ASP A OD1  6  
ATOM 9783  O OD2  . ASP A 1 56  ? 7.684   10.917  7.494  1.00 0.00 ? 56  ASP A OD2  6  
ATOM 9784  H H    . ASP A 1 56  ? 4.648   9.002   3.702  1.00 0.00 ? 56  ASP A H    6  
ATOM 9785  H HA   . ASP A 1 56  ? 7.140   8.928   5.074  1.00 0.00 ? 56  ASP A HA   6  
ATOM 9786  H HB2  . ASP A 1 56  ? 5.974   11.160  5.707  1.00 0.00 ? 56  ASP A HB2  6  
ATOM 9787  H HB3  . ASP A 1 56  ? 4.763   10.181  6.512  1.00 0.00 ? 56  ASP A HB3  6  
ATOM 9788  N N    . CYS A 1 57  ? 6.190   6.848   6.137  1.00 0.00 ? 57  CYS A N    6  
ATOM 9789  C CA   . CYS A 1 57  ? 5.669   5.596   6.660  1.00 0.00 ? 57  CYS A CA   6  
ATOM 9790  C C    . CYS A 1 57  ? 6.349   5.316   8.002  1.00 0.00 ? 57  CYS A C    6  
ATOM 9791  O O    . CYS A 1 57  ? 7.566   5.146   8.061  1.00 0.00 ? 57  CYS A O    6  
ATOM 9792  C CB   . CYS A 1 57  ? 5.862   4.445   5.671  1.00 0.00 ? 57  CYS A CB   6  
ATOM 9793  S SG   . CYS A 1 57  ? 7.646   4.091   5.463  1.00 0.00 ? 57  CYS A SG   6  
ATOM 9794  H H    . CYS A 1 57  ? 7.188   6.907   6.098  1.00 0.00 ? 57  CYS A H    6  
ATOM 9795  H HA   . CYS A 1 57  ? 4.596   5.735   6.792  1.00 0.00 ? 57  CYS A HA   6  
ATOM 9796  H HB2  . CYS A 1 57  ? 5.346   3.555   6.030  1.00 0.00 ? 57  CYS A HB2  6  
ATOM 9797  H HB3  . CYS A 1 57  ? 5.420   4.704   4.709  1.00 0.00 ? 57  CYS A HB3  6  
ATOM 9798  H HG   . CYS A 1 57  ? 7.500   2.798   5.189  1.00 0.00 ? 57  CYS A HG   6  
ATOM 9799  N N    . VAL A 1 58  ? 5.534   5.275   9.045  1.00 0.00 ? 58  VAL A N    6  
ATOM 9800  C CA   . VAL A 1 58  ? 6.041   5.017   10.382 1.00 0.00 ? 58  VAL A CA   6  
ATOM 9801  C C    . VAL A 1 58  ? 5.469   3.694   10.894 1.00 0.00 ? 58  VAL A C    6  
ATOM 9802  O O    . VAL A 1 58  ? 4.310   3.374   10.637 1.00 0.00 ? 58  VAL A O    6  
ATOM 9803  C CB   . VAL A 1 58  ? 5.725   6.201   11.299 1.00 0.00 ? 58  VAL A CB   6  
ATOM 9804  C CG1  . VAL A 1 58  ? 5.775   5.783   12.770 1.00 0.00 ? 58  VAL A CG1  6  
ATOM 9805  C CG2  . VAL A 1 58  ? 6.671   7.372   11.029 1.00 0.00 ? 58  VAL A CG2  6  
ATOM 9806  H H    . VAL A 1 58  ? 4.545   5.413   8.988  1.00 0.00 ? 58  VAL A H    6  
ATOM 9807  H HA   . VAL A 1 58  ? 7.125   4.927   10.310 1.00 0.00 ? 58  VAL A HA   6  
ATOM 9808  H HB   . VAL A 1 58  ? 4.710   6.532   11.079 1.00 0.00 ? 58  VAL A HB   6  
ATOM 9809  H HG11 . VAL A 1 58  ? 6.465   4.947   12.887 1.00 0.00 ? 58  VAL A HG11 6  
ATOM 9810  H HG12 . VAL A 1 58  ? 6.116   6.623   13.375 1.00 0.00 ? 58  VAL A HG12 6  
ATOM 9811  H HG13 . VAL A 1 58  ? 4.779   5.481   13.096 1.00 0.00 ? 58  VAL A HG13 6  
ATOM 9812  H HG21 . VAL A 1 58  ? 6.321   7.929   10.159 1.00 0.00 ? 58  VAL A HG21 6  
ATOM 9813  H HG22 . VAL A 1 58  ? 6.691   8.031   11.897 1.00 0.00 ? 58  VAL A HG22 6  
ATOM 9814  H HG23 . VAL A 1 58  ? 7.674   6.992   10.837 1.00 0.00 ? 58  VAL A HG23 6  
ATOM 9815  N N    . VAL A 1 59  ? 6.309   2.961   11.610 1.00 0.00 ? 59  VAL A N    6  
ATOM 9816  C CA   . VAL A 1 59  ? 5.901   1.680   12.161 1.00 0.00 ? 59  VAL A CA   6  
ATOM 9817  C C    . VAL A 1 59  ? 6.121   1.687   13.675 1.00 0.00 ? 59  VAL A C    6  
ATOM 9818  O O    . VAL A 1 59  ? 7.239   1.897   14.143 1.00 0.00 ? 59  VAL A O    6  
ATOM 9819  C CB   . VAL A 1 59  ? 6.646   0.545   11.454 1.00 0.00 ? 59  VAL A CB   6  
ATOM 9820  C CG1  . VAL A 1 59  ? 8.132   0.554   11.819 1.00 0.00 ? 59  VAL A CG1  6  
ATOM 9821  C CG2  . VAL A 1 59  ? 6.011   -0.810  11.773 1.00 0.00 ? 59  VAL A CG2  6  
ATOM 9822  H H    . VAL A 1 59  ? 7.250   3.228   11.815 1.00 0.00 ? 59  VAL A H    6  
ATOM 9823  H HA   . VAL A 1 59  ? 4.836   1.560   11.961 1.00 0.00 ? 59  VAL A HA   6  
ATOM 9824  H HB   . VAL A 1 59  ? 6.564   0.709   10.380 1.00 0.00 ? 59  VAL A HB   6  
ATOM 9825  H HG11 . VAL A 1 59  ? 8.279   0.020   12.758 1.00 0.00 ? 59  VAL A HG11 6  
ATOM 9826  H HG12 . VAL A 1 59  ? 8.703   0.066   11.030 1.00 0.00 ? 59  VAL A HG12 6  
ATOM 9827  H HG13 . VAL A 1 59  ? 8.472   1.584   11.931 1.00 0.00 ? 59  VAL A HG13 6  
ATOM 9828  H HG21 . VAL A 1 59  ? 6.620   -1.606  11.345 1.00 0.00 ? 59  VAL A HG21 6  
ATOM 9829  H HG22 . VAL A 1 59  ? 5.953   -0.938  12.854 1.00 0.00 ? 59  VAL A HG22 6  
ATOM 9830  H HG23 . VAL A 1 59  ? 5.008   -0.851  11.348 1.00 0.00 ? 59  VAL A HG23 6  
ATOM 9831  N N    . MET A 1 60  ? 5.036   1.455   14.399 1.00 0.00 ? 60  MET A N    6  
ATOM 9832  C CA   . MET A 1 60  ? 5.096   1.433   15.851 1.00 0.00 ? 60  MET A CA   6  
ATOM 9833  C C    . MET A 1 60  ? 5.773   0.156   16.352 1.00 0.00 ? 60  MET A C    6  
ATOM 9834  O O    . MET A 1 60  ? 5.498   -0.934  15.852 1.00 0.00 ? 60  MET A O    6  
ATOM 9835  C CB   . MET A 1 60  ? 3.679   1.517   16.422 1.00 0.00 ? 60  MET A CB   6  
ATOM 9836  C CG   . MET A 1 60  ? 3.055   2.886   16.143 1.00 0.00 ? 60  MET A CG   6  
ATOM 9837  S SD   . MET A 1 60  ? 4.051   4.172   16.878 1.00 0.00 ? 60  MET A SD   6  
ATOM 9838  C CE   . MET A 1 60  ? 5.039   4.644   15.468 1.00 0.00 ? 60  MET A CE   6  
ATOM 9839  H H    . MET A 1 60  ? 4.130   1.286   14.011 1.00 0.00 ? 60  MET A H    6  
ATOM 9840  H HA   . MET A 1 60  ? 5.690   2.302   16.133 1.00 0.00 ? 60  MET A HA   6  
ATOM 9841  H HB2  . MET A 1 60  ? 3.059   0.735   15.984 1.00 0.00 ? 60  MET A HB2  6  
ATOM 9842  H HB3  . MET A 1 60  ? 3.705   1.338   17.497 1.00 0.00 ? 60  MET A HB3  6  
ATOM 9843  H HG2  . MET A 1 60  ? 2.976   3.046   15.067 1.00 0.00 ? 60  MET A HG2  6  
ATOM 9844  H HG3  . MET A 1 60  ? 2.043   2.923   16.546 1.00 0.00 ? 60  MET A HG3  6  
ATOM 9845  H HE1  . MET A 1 60  ? 6.096   4.558   15.720 1.00 0.00 ? 60  MET A HE1  6  
ATOM 9846  H HE2  . MET A 1 60  ? 4.811   3.987   14.629 1.00 0.00 ? 60  MET A HE2  6  
ATOM 9847  H HE3  . MET A 1 60  ? 4.813   5.674   15.195 1.00 0.00 ? 60  MET A HE3  6  
ATOM 9848  N N    . ARG A 1 61  ? 6.646   0.333   17.333 1.00 0.00 ? 61  ARG A N    6  
ATOM 9849  C CA   . ARG A 1 61  ? 7.365   -0.792  17.907 1.00 0.00 ? 61  ARG A CA   6  
ATOM 9850  C C    . ARG A 1 61  ? 7.359   -0.702  19.435 1.00 0.00 ? 61  ARG A C    6  
ATOM 9851  O O    . ARG A 1 61  ? 7.537   0.377   19.997 1.00 0.00 ? 61  ARG A O    6  
ATOM 9852  C CB   . ARG A 1 61  ? 8.812   -0.832  17.411 1.00 0.00 ? 61  ARG A CB   6  
ATOM 9853  C CG   . ARG A 1 61  ? 8.913   -0.317  15.974 1.00 0.00 ? 61  ARG A CG   6  
ATOM 9854  C CD   . ARG A 1 61  ? 10.374  -0.207  15.533 1.00 0.00 ? 61  ARG A CD   6  
ATOM 9855  N NE   . ARG A 1 61  ? 11.031  -1.530  15.626 1.00 0.00 ? 61  ARG A NE   6  
ATOM 9856  C CZ   . ARG A 1 61  ? 12.250  -1.799  15.139 1.00 0.00 ? 61  ARG A CZ   6  
ATOM 9857  N NH1  . ARG A 1 61  ? 12.951  -0.840  14.520 1.00 0.00 ? 61  ARG A NH1  6  
ATOM 9858  N NH2  . ARG A 1 61  ? 12.767  -3.029  15.269 1.00 0.00 ? 61  ARG A NH2  6  
ATOM 9859  H H    . ARG A 1 61  ? 6.864   1.223   17.734 1.00 0.00 ? 61  ARG A H    6  
ATOM 9860  H HA   . ARG A 1 61  ? 6.823   -1.673  17.564 1.00 0.00 ? 61  ARG A HA   6  
ATOM 9861  H HB2  . ARG A 1 61  ? 9.440   -0.226  18.064 1.00 0.00 ? 61  ARG A HB2  6  
ATOM 9862  H HB3  . ARG A 1 61  ? 9.190   -1.853  17.463 1.00 0.00 ? 61  ARG A HB3  6  
ATOM 9863  H HG2  . ARG A 1 61  ? 8.376   -0.989  15.305 1.00 0.00 ? 61  ARG A HG2  6  
ATOM 9864  H HG3  . ARG A 1 61  ? 8.433   0.659   15.899 1.00 0.00 ? 61  ARG A HG3  6  
ATOM 9865  H HD2  . ARG A 1 61  ? 10.426  0.162   14.509 1.00 0.00 ? 61  ARG A HD2  6  
ATOM 9866  H HD3  . ARG A 1 61  ? 10.899  0.514   16.159 1.00 0.00 ? 61  ARG A HD3  6  
ATOM 9867  H HE   . ARG A 1 61  ? 10.535  -2.269  16.082 1.00 0.00 ? 61  ARG A HE   6  
ATOM 9868  H HH11 . ARG A 1 61  ? 12.565  0.077   14.422 1.00 0.00 ? 61  ARG A HH11 6  
ATOM 9869  H HH12 . ARG A 1 61  ? 13.861  -1.041  14.156 1.00 0.00 ? 61  ARG A HH12 6  
ATOM 9870  H HH21 . ARG A 1 61  ? 12.244  -3.745  15.731 1.00 0.00 ? 61  ARG A HH21 6  
ATOM 9871  H HH22 . ARG A 1 61  ? 13.677  -3.230  14.905 1.00 0.00 ? 61  ARG A HH22 6  
ATOM 9872  N N    . ASP A 1 62  ? 7.152   -1.850  20.062 1.00 0.00 ? 62  ASP A N    6  
ATOM 9873  C CA   . ASP A 1 62  ? 7.120   -1.915  21.513 1.00 0.00 ? 62  ASP A CA   6  
ATOM 9874  C C    . ASP A 1 62  ? 8.337   -1.180  22.079 1.00 0.00 ? 62  ASP A C    6  
ATOM 9875  O O    . ASP A 1 62  ? 9.453   -1.355  21.594 1.00 0.00 ? 62  ASP A O    6  
ATOM 9876  C CB   . ASP A 1 62  ? 7.174   -3.364  22.002 1.00 0.00 ? 62  ASP A CB   6  
ATOM 9877  C CG   . ASP A 1 62  ? 6.339   -3.657  23.249 1.00 0.00 ? 62  ASP A CG   6  
ATOM 9878  O OD1  . ASP A 1 62  ? 6.872   -3.426  24.356 1.00 0.00 ? 62  ASP A OD1  6  
ATOM 9879  O OD2  . ASP A 1 62  ? 5.186   -4.106  23.068 1.00 0.00 ? 62  ASP A OD2  6  
ATOM 9880  H H    . ASP A 1 62  ? 7.008   -2.724  19.597 1.00 0.00 ? 62  ASP A H    6  
ATOM 9881  H HA   . ASP A 1 62  ? 6.179   -1.446  21.801 1.00 0.00 ? 62  ASP A HA   6  
ATOM 9882  H HB2  . ASP A 1 62  ? 6.837   -4.016  21.196 1.00 0.00 ? 62  ASP A HB2  6  
ATOM 9883  H HB3  . ASP A 1 62  ? 8.212   -3.623  22.209 1.00 0.00 ? 62  ASP A HB3  6  
ATOM 9884  N N    . PRO A 1 63  ? 8.073   -0.350  23.124 1.00 0.00 ? 63  PRO A N    6  
ATOM 9885  C CA   . PRO A 1 63  ? 9.133   0.412   23.761 1.00 0.00 ? 63  PRO A CA   6  
ATOM 9886  C C    . PRO A 1 63  ? 9.998   -0.486  24.647 1.00 0.00 ? 63  PRO A C    6  
ATOM 9887  O O    . PRO A 1 63  ? 11.141  -0.149  24.951 1.00 0.00 ? 63  PRO A O    6  
ATOM 9888  C CB   . PRO A 1 63  ? 8.419   1.505   24.539 1.00 0.00 ? 63  PRO A CB   6  
ATOM 9889  C CG   . PRO A 1 63  ? 6.980   1.038   24.688 1.00 0.00 ? 63  PRO A CG   6  
ATOM 9890  C CD   . PRO A 1 63  ? 6.763   -0.117  23.725 1.00 0.00 ? 63  PRO A CD   6  
ATOM 9891  H HA   . PRO A 1 63  ? 9.750   0.791   23.071 1.00 0.00 ? 63  PRO A HA   6  
ATOM 9892  H HB2  . PRO A 1 63  ? 8.883   1.658   25.514 1.00 0.00 ? 63  PRO A HB2  6  
ATOM 9893  H HB3  . PRO A 1 63  ? 8.468   2.457   24.011 1.00 0.00 ? 63  PRO A HB3  6  
ATOM 9894  H HG2  . PRO A 1 63  ? 6.785   0.723   25.713 1.00 0.00 ? 63  PRO A HG2  6  
ATOM 9895  H HG3  . PRO A 1 63  ? 6.290   1.853   24.469 1.00 0.00 ? 63  PRO A HG3  6  
ATOM 9896  H HD2  . PRO A 1 63  ? 6.402   -1.004  24.245 1.00 0.00 ? 63  PRO A HD2  6  
ATOM 9897  H HD3  . PRO A 1 63  ? 6.019   0.133   22.968 1.00 0.00 ? 63  PRO A HD3  6  
ATOM 9898  N N    . ALA A 1 64  ? 9.419   -1.612  25.038 1.00 0.00 ? 64  ALA A N    6  
ATOM 9899  C CA   . ALA A 1 64  ? 10.122  -2.561  25.884 1.00 0.00 ? 64  ALA A CA   6  
ATOM 9900  C C    . ALA A 1 64  ? 10.680  -3.692  25.018 1.00 0.00 ? 64  ALA A C    6  
ATOM 9901  O O    . ALA A 1 64  ? 11.848  -4.057  25.145 1.00 0.00 ? 64  ALA A O    6  
ATOM 9902  C CB   . ALA A 1 64  ? 9.177   -3.072  26.973 1.00 0.00 ? 64  ALA A CB   6  
ATOM 9903  H H    . ALA A 1 64  ? 8.488   -1.878  24.786 1.00 0.00 ? 64  ALA A H    6  
ATOM 9904  H HA   . ALA A 1 64  ? 10.951  -2.033  26.357 1.00 0.00 ? 64  ALA A HA   6  
ATOM 9905  H HB1  . ALA A 1 64  ? 8.145   -2.951  26.645 1.00 0.00 ? 64  ALA A HB1  6  
ATOM 9906  H HB2  . ALA A 1 64  ? 9.377   -4.127  27.162 1.00 0.00 ? 64  ALA A HB2  6  
ATOM 9907  H HB3  . ALA A 1 64  ? 9.336   -2.502  27.889 1.00 0.00 ? 64  ALA A HB3  6  
ATOM 9908  N N    . SER A 1 65  ? 9.820   -4.217  24.159 1.00 0.00 ? 65  SER A N    6  
ATOM 9909  C CA   . SER A 1 65  ? 10.212  -5.299  23.273 1.00 0.00 ? 65  SER A CA   6  
ATOM 9910  C C    . SER A 1 65  ? 11.169  -4.776  22.200 1.00 0.00 ? 65  SER A C    6  
ATOM 9911  O O    . SER A 1 65  ? 12.107  -5.469  21.809 1.00 0.00 ? 65  SER A O    6  
ATOM 9912  C CB   . SER A 1 65  ? 8.990   -5.950  22.622 1.00 0.00 ? 65  SER A CB   6  
ATOM 9913  O OG   . SER A 1 65  ? 9.156   -7.355  22.459 1.00 0.00 ? 65  SER A OG   6  
ATOM 9914  H H    . SER A 1 65  ? 8.871   -3.915  24.062 1.00 0.00 ? 65  SER A H    6  
ATOM 9915  H HA   . SER A 1 65  ? 10.714  -6.027  23.911 1.00 0.00 ? 65  SER A HA   6  
ATOM 9916  H HB2  . SER A 1 65  ? 8.108   -5.758  23.234 1.00 0.00 ? 65  SER A HB2  6  
ATOM 9917  H HB3  . SER A 1 65  ? 8.809   -5.490  21.650 1.00 0.00 ? 65  SER A HB3  6  
ATOM 9918  H HG   . SER A 1 65  ? 9.942   -7.671  22.990 1.00 0.00 ? 65  SER A HG   6  
ATOM 9919  N N    . LYS A 1 66  ? 10.899  -3.558  21.754 1.00 0.00 ? 66  LYS A N    6  
ATOM 9920  C CA   . LYS A 1 66  ? 11.724  -2.935  20.733 1.00 0.00 ? 66  LYS A CA   6  
ATOM 9921  C C    . LYS A 1 66  ? 11.396  -3.550  19.372 1.00 0.00 ? 66  LYS A C    6  
ATOM 9922  O O    . LYS A 1 66  ? 12.186  -3.448  18.434 1.00 0.00 ? 66  LYS A O    6  
ATOM 9923  C CB   . LYS A 1 66  ? 13.204  -3.029  21.110 1.00 0.00 ? 66  LYS A CB   6  
ATOM 9924  C CG   . LYS A 1 66  ? 13.924  -1.706  20.838 1.00 0.00 ? 66  LYS A CG   6  
ATOM 9925  C CD   . LYS A 1 66  ? 14.443  -1.650  19.400 1.00 0.00 ? 66  LYS A CD   6  
ATOM 9926  C CE   . LYS A 1 66  ? 15.829  -1.005  19.342 1.00 0.00 ? 66  LYS A CE   6  
ATOM 9927  N NZ   . LYS A 1 66  ? 15.837  0.121   18.381 1.00 0.00 ? 66  LYS A NZ   6  
ATOM 9928  H H    . LYS A 1 66  ? 10.134  -3.002  22.077 1.00 0.00 ? 66  LYS A H    6  
ATOM 9929  H HA   . LYS A 1 66  ? 11.465  -1.876  20.706 1.00 0.00 ? 66  LYS A HA   6  
ATOM 9930  H HB2  . LYS A 1 66  ? 13.300  -3.289  22.164 1.00 0.00 ? 66  LYS A HB2  6  
ATOM 9931  H HB3  . LYS A 1 66  ? 13.678  -3.829  20.541 1.00 0.00 ? 66  LYS A HB3  6  
ATOM 9932  H HG2  . LYS A 1 66  ? 13.243  -0.874  21.016 1.00 0.00 ? 66  LYS A HG2  6  
ATOM 9933  H HG3  . LYS A 1 66  ? 14.756  -1.591  21.534 1.00 0.00 ? 66  LYS A HG3  6  
ATOM 9934  H HD2  . LYS A 1 66  ? 14.489  -2.657  18.987 1.00 0.00 ? 66  LYS A HD2  6  
ATOM 9935  H HD3  . LYS A 1 66  ? 13.748  -1.083  18.781 1.00 0.00 ? 66  LYS A HD3  6  
ATOM 9936  H HE2  . LYS A 1 66  ? 16.112  -0.647  20.332 1.00 0.00 ? 66  LYS A HE2  6  
ATOM 9937  H HE3  . LYS A 1 66  ? 16.570  -1.747  19.048 1.00 0.00 ? 66  LYS A HE3  6  
ATOM 9938  H HZ1  . LYS A 1 66  ? 16.773  0.454   18.266 1.00 0.00 ? 66  LYS A HZ1  6  
ATOM 9939  H HZ2  . LYS A 1 66  ? 15.484  -0.191  17.499 1.00 0.00 ? 66  LYS A HZ2  6  
ATOM 9940  H HZ3  . LYS A 1 66  ? 15.260  0.860   18.729 1.00 0.00 ? 66  LYS A HZ3  6  
ATOM 9941  N N    . ARG A 1 67  ? 10.230  -4.175  19.306 1.00 0.00 ? 67  ARG A N    6  
ATOM 9942  C CA   . ARG A 1 67  ? 9.787   -4.807  18.074 1.00 0.00 ? 67  ARG A CA   6  
ATOM 9943  C C    . ARG A 1 67  ? 8.456   -4.206  17.618 1.00 0.00 ? 67  ARG A C    6  
ATOM 9944  O O    . ARG A 1 67  ? 7.642   -3.794  18.442 1.00 0.00 ? 67  ARG A O    6  
ATOM 9945  C CB   . ARG A 1 67  ? 9.621   -6.316  18.259 1.00 0.00 ? 67  ARG A CB   6  
ATOM 9946  C CG   . ARG A 1 67  ? 10.850  -6.925  18.937 1.00 0.00 ? 67  ARG A CG   6  
ATOM 9947  C CD   . ARG A 1 67  ? 10.773  -8.453  18.944 1.00 0.00 ? 67  ARG A CD   6  
ATOM 9948  N NE   . ARG A 1 67  ? 12.132  -9.029  18.836 1.00 0.00 ? 67  ARG A NE   6  
ATOM 9949  C CZ   . ARG A 1 67  ? 12.829  -9.101  17.694 1.00 0.00 ? 67  ARG A CZ   6  
ATOM 9950  N NH1  . ARG A 1 67  ? 12.299  -8.634  16.555 1.00 0.00 ? 67  ARG A NH1  6  
ATOM 9951  N NH2  . ARG A 1 67  ? 14.055  -9.640  17.691 1.00 0.00 ? 67  ARG A NH2  6  
ATOM 9952  H H    . ARG A 1 67  ? 9.593   -4.253  20.073 1.00 0.00 ? 67  ARG A H    6  
ATOM 9953  H HA   . ARG A 1 67  ? 10.579  -4.598  17.355 1.00 0.00 ? 67  ARG A HA   6  
ATOM 9954  H HB2  . ARG A 1 67  ? 8.733   -6.517  18.858 1.00 0.00 ? 67  ARG A HB2  6  
ATOM 9955  H HB3  . ARG A 1 67  ? 9.465   -6.790  17.289 1.00 0.00 ? 67  ARG A HB3  6  
ATOM 9956  H HG2  . ARG A 1 67  ? 11.753  -6.605  18.416 1.00 0.00 ? 67  ARG A HG2  6  
ATOM 9957  H HG3  . ARG A 1 67  ? 10.925  -6.556  19.960 1.00 0.00 ? 67  ARG A HG3  6  
ATOM 9958  H HD2  . ARG A 1 67  ? 10.294  -8.797  19.861 1.00 0.00 ? 67  ARG A HD2  6  
ATOM 9959  H HD3  . ARG A 1 67  ? 10.156  -8.797  18.114 1.00 0.00 ? 67  ARG A HD3  6  
ATOM 9960  H HE   . ARG A 1 67  ? 12.556  -9.386  19.668 1.00 0.00 ? 67  ARG A HE   6  
ATOM 9961  H HH11 . ARG A 1 67  ? 11.384  -8.232  16.558 1.00 0.00 ? 67  ARG A HH11 6  
ATOM 9962  H HH12 . ARG A 1 67  ? 12.819  -8.688  15.703 1.00 0.00 ? 67  ARG A HH12 6  
ATOM 9963  H HH21 . ARG A 1 67  ? 14.451  -9.989  18.541 1.00 0.00 ? 67  ARG A HH21 6  
ATOM 9964  H HH22 . ARG A 1 67  ? 14.576  -9.694  16.838 1.00 0.00 ? 67  ARG A HH22 6  
ATOM 9965  N N    . SER A 1 68  ? 8.277   -4.174  16.305 1.00 0.00 ? 68  SER A N    6  
ATOM 9966  C CA   . SER A 1 68  ? 7.059   -3.631  15.729 1.00 0.00 ? 68  SER A CA   6  
ATOM 9967  C C    . SER A 1 68  ? 5.845   -4.104  16.531 1.00 0.00 ? 68  SER A C    6  
ATOM 9968  O O    . SER A 1 68  ? 5.688   -5.299  16.779 1.00 0.00 ? 68  SER A O    6  
ATOM 9969  C CB   . SER A 1 68  ? 6.916   -4.034  14.261 1.00 0.00 ? 68  SER A CB   6  
ATOM 9970  O OG   . SER A 1 68  ? 7.985   -3.533  13.463 1.00 0.00 ? 68  SER A OG   6  
ATOM 9971  H H    . SER A 1 68  ? 8.945   -4.511  15.642 1.00 0.00 ? 68  SER A H    6  
ATOM 9972  H HA   . SER A 1 68  ? 7.165   -2.548  15.799 1.00 0.00 ? 68  SER A HA   6  
ATOM 9973  H HB2  . SER A 1 68  ? 6.886   -5.121  14.185 1.00 0.00 ? 68  SER A HB2  6  
ATOM 9974  H HB3  . SER A 1 68  ? 5.968   -3.661  13.872 1.00 0.00 ? 68  SER A HB3  6  
ATOM 9975  H HG   . SER A 1 68  ? 7.832   -3.763  12.502 1.00 0.00 ? 68  SER A HG   6  
ATOM 9976  N N    . ARG A 1 69  ? 5.016   -3.143  16.912 1.00 0.00 ? 69  ARG A N    6  
ATOM 9977  C CA   . ARG A 1 69  ? 3.820   -3.447  17.680 1.00 0.00 ? 69  ARG A CA   6  
ATOM 9978  C C    . ARG A 1 69  ? 2.831   -4.246  16.828 1.00 0.00 ? 69  ARG A C    6  
ATOM 9979  O O    . ARG A 1 69  ? 2.039   -5.024  17.357 1.00 0.00 ? 69  ARG A O    6  
ATOM 9980  C CB   . ARG A 1 69  ? 3.142   -2.167  18.172 1.00 0.00 ? 69  ARG A CB   6  
ATOM 9981  C CG   . ARG A 1 69  ? 3.758   -1.692  19.490 1.00 0.00 ? 69  ARG A CG   6  
ATOM 9982  C CD   . ARG A 1 69  ? 2.673   -1.265  20.480 1.00 0.00 ? 69  ARG A CD   6  
ATOM 9983  N NE   . ARG A 1 69  ? 2.848   0.160   20.840 1.00 0.00 ? 69  ARG A NE   6  
ATOM 9984  C CZ   . ARG A 1 69  ? 2.220   0.759   21.860 1.00 0.00 ? 69  ARG A CZ   6  
ATOM 9985  N NH1  . ARG A 1 69  ? 1.371   0.062   22.628 1.00 0.00 ? 69  ARG A NH1  6  
ATOM 9986  N NH2  . ARG A 1 69  ? 2.440   2.057   22.113 1.00 0.00 ? 69  ARG A NH2  6  
ATOM 9987  H H    . ARG A 1 69  ? 5.151   -2.174  16.706 1.00 0.00 ? 69  ARG A H    6  
ATOM 9988  H HA   . ARG A 1 69  ? 4.175   -4.037  18.526 1.00 0.00 ? 69  ARG A HA   6  
ATOM 9989  H HB2  . ARG A 1 69  ? 3.240   -1.387  17.418 1.00 0.00 ? 69  ARG A HB2  6  
ATOM 9990  H HB3  . ARG A 1 69  ? 2.076   -2.346  18.309 1.00 0.00 ? 69  ARG A HB3  6  
ATOM 9991  H HG2  . ARG A 1 69  ? 4.358   -2.492  19.924 1.00 0.00 ? 69  ARG A HG2  6  
ATOM 9992  H HG3  . ARG A 1 69  ? 4.431   -0.856  19.299 1.00 0.00 ? 69  ARG A HG3  6  
ATOM 9993  H HD2  . ARG A 1 69  ? 1.687   -1.419  20.041 1.00 0.00 ? 69  ARG A HD2  6  
ATOM 9994  H HD3  . ARG A 1 69  ? 2.723   -1.884  21.376 1.00 0.00 ? 69  ARG A HD3  6  
ATOM 9995  H HE   . ARG A 1 69  ? 3.475   0.709   20.288 1.00 0.00 ? 69  ARG A HE   6  
ATOM 9996  H HH11 . ARG A 1 69  ? 1.206   -0.906  22.439 1.00 0.00 ? 69  ARG A HH11 6  
ATOM 9997  H HH12 . ARG A 1 69  ? 0.902   0.510   23.389 1.00 0.00 ? 69  ARG A HH12 6  
ATOM 9998  H HH21 . ARG A 1 69  ? 3.074   2.577   21.541 1.00 0.00 ? 69  ARG A HH21 6  
ATOM 9999  H HH22 . ARG A 1 69  ? 1.971   2.504   22.875 1.00 0.00 ? 69  ARG A HH22 6  
ATOM 10000 N N    . GLY A 1 70  ? 2.909   -4.024  15.524 1.00 0.00 ? 70  GLY A N    6  
ATOM 10001 C CA   . GLY A 1 70  ? 2.031   -4.713  14.594 1.00 0.00 ? 70  GLY A CA   6  
ATOM 10002 C C    . GLY A 1 70  ? 1.129   -3.722  13.855 1.00 0.00 ? 70  GLY A C    6  
ATOM 10003 O O    . GLY A 1 70  ? 0.174   -4.122  13.192 1.00 0.00 ? 70  GLY A O    6  
ATOM 10004 H H    . GLY A 1 70  ? 3.556   -3.389  15.103 1.00 0.00 ? 70  GLY A H    6  
ATOM 10005 H HA2  . GLY A 1 70  ? 2.626   -5.276  13.875 1.00 0.00 ? 70  GLY A HA2  6  
ATOM 10006 H HA3  . GLY A 1 70  ? 1.418   -5.435  15.134 1.00 0.00 ? 70  GLY A HA3  6  
ATOM 10007 N N    . PHE A 1 71  ? 1.465   -2.448  13.994 1.00 0.00 ? 71  PHE A N    6  
ATOM 10008 C CA   . PHE A 1 71  ? 0.698   -1.397  13.348 1.00 0.00 ? 71  PHE A CA   6  
ATOM 10009 C C    . PHE A 1 71  ? 1.533   -0.124  13.195 1.00 0.00 ? 71  PHE A C    6  
ATOM 10010 O O    . PHE A 1 71  ? 2.468   0.105   13.961 1.00 0.00 ? 71  PHE A O    6  
ATOM 10011 C CB   . PHE A 1 71  ? -0.502  -1.101  14.249 1.00 0.00 ? 71  PHE A CB   6  
ATOM 10012 C CG   . PHE A 1 71  ? -0.193  -0.145  15.403 1.00 0.00 ? 71  PHE A CG   6  
ATOM 10013 C CD1  . PHE A 1 71  ? 0.307   -0.630  16.571 1.00 0.00 ? 71  PHE A CD1  6  
ATOM 10014 C CD2  . PHE A 1 71  ? -0.419  1.188   15.261 1.00 0.00 ? 71  PHE A CD2  6  
ATOM 10015 C CE1  . PHE A 1 71  ? 0.593   0.257   17.643 1.00 0.00 ? 71  PHE A CE1  6  
ATOM 10016 C CE2  . PHE A 1 71  ? -0.132  2.075   16.332 1.00 0.00 ? 71  PHE A CE2  6  
ATOM 10017 C CZ   . PHE A 1 71  ? 0.368   1.591   17.500 1.00 0.00 ? 71  PHE A CZ   6  
ATOM 10018 H H    . PHE A 1 71  ? 2.244   -2.131  14.535 1.00 0.00 ? 71  PHE A H    6  
ATOM 10019 H HA   . PHE A 1 71  ? 0.415   -1.764  12.361 1.00 0.00 ? 71  PHE A HA   6  
ATOM 10020 H HB2  . PHE A 1 71  ? -1.302  -0.676  13.643 1.00 0.00 ? 71  PHE A HB2  6  
ATOM 10021 H HB3  . PHE A 1 71  ? -0.877  -2.039  14.658 1.00 0.00 ? 71  PHE A HB3  6  
ATOM 10022 H HD1  . PHE A 1 71  ? 0.487   -1.699  16.685 1.00 0.00 ? 71  PHE A HD1  6  
ATOM 10023 H HD2  . PHE A 1 71  ? -0.820  1.576   14.324 1.00 0.00 ? 71  PHE A HD2  6  
ATOM 10024 H HE1  . PHE A 1 71  ? 0.994   -0.131  18.579 1.00 0.00 ? 71  PHE A HE1  6  
ATOM 10025 H HE2  . PHE A 1 71  ? -0.313  3.144   16.218 1.00 0.00 ? 71  PHE A HE2  6  
ATOM 10026 H HZ   . PHE A 1 71  ? 0.588   2.271   18.323 1.00 0.00 ? 71  PHE A HZ   6  
ATOM 10027 N N    . GLY A 1 72  ? 1.165   0.671   12.202 1.00 0.00 ? 72  GLY A N    6  
ATOM 10028 C CA   . GLY A 1 72  ? 1.867   1.916   11.939 1.00 0.00 ? 72  GLY A CA   6  
ATOM 10029 C C    . GLY A 1 72  ? 0.989   2.885   11.146 1.00 0.00 ? 72  GLY A C    6  
ATOM 10030 O O    . GLY A 1 72  ? -0.228  2.718   11.086 1.00 0.00 ? 72  GLY A O    6  
ATOM 10031 H H    . GLY A 1 72  ? 0.403   0.478   11.584 1.00 0.00 ? 72  GLY A H    6  
ATOM 10032 H HA2  . GLY A 1 72  ? 2.164   2.376   12.882 1.00 0.00 ? 72  GLY A HA2  6  
ATOM 10033 H HA3  . GLY A 1 72  ? 2.782   1.710   11.383 1.00 0.00 ? 72  GLY A HA3  6  
ATOM 10034 N N    . PHE A 1 73  ? 1.640   3.877   10.557 1.00 0.00 ? 73  PHE A N    6  
ATOM 10035 C CA   . PHE A 1 73  ? 0.933   4.874   9.770  1.00 0.00 ? 73  PHE A CA   6  
ATOM 10036 C C    . PHE A 1 73  ? 1.569   5.033   8.388  1.00 0.00 ? 73  PHE A C    6  
ATOM 10037 O O    . PHE A 1 73  ? 2.775   4.845   8.230  1.00 0.00 ? 73  PHE A O    6  
ATOM 10038 C CB   . PHE A 1 73  ? 1.043   6.200   10.525 1.00 0.00 ? 73  PHE A CB   6  
ATOM 10039 C CG   . PHE A 1 73  ? 0.884   6.069   12.041 1.00 0.00 ? 73  PHE A CG   6  
ATOM 10040 C CD1  . PHE A 1 73  ? -0.358  5.978   12.589 1.00 0.00 ? 73  PHE A CD1  6  
ATOM 10041 C CD2  . PHE A 1 73  ? 1.983   6.043   12.841 1.00 0.00 ? 73  PHE A CD2  6  
ATOM 10042 C CE1  . PHE A 1 73  ? -0.506  5.856   13.996 1.00 0.00 ? 73  PHE A CE1  6  
ATOM 10043 C CE2  . PHE A 1 73  ? 1.835   5.921   14.248 1.00 0.00 ? 73  PHE A CE2  6  
ATOM 10044 C CZ   . PHE A 1 73  ? 0.594   5.830   14.795 1.00 0.00 ? 73  PHE A CZ   6  
ATOM 10045 H H    . PHE A 1 73  ? 2.630   4.006   10.611 1.00 0.00 ? 73  PHE A H    6  
ATOM 10046 H HA   . PHE A 1 73  ? -0.094  4.528   9.658  1.00 0.00 ? 73  PHE A HA   6  
ATOM 10047 H HB2  . PHE A 1 73  ? 2.012   6.650   10.310 1.00 0.00 ? 73  PHE A HB2  6  
ATOM 10048 H HB3  . PHE A 1 73  ? 0.283   6.885   10.148 1.00 0.00 ? 73  PHE A HB3  6  
ATOM 10049 H HD1  . PHE A 1 73  ? -1.239  5.998   11.948 1.00 0.00 ? 73  PHE A HD1  6  
ATOM 10050 H HD2  . PHE A 1 73  ? 2.978   6.116   12.402 1.00 0.00 ? 73  PHE A HD2  6  
ATOM 10051 H HE1  . PHE A 1 73  ? -1.501  5.783   14.435 1.00 0.00 ? 73  PHE A HE1  6  
ATOM 10052 H HE2  . PHE A 1 73  ? 2.717   5.901   14.889 1.00 0.00 ? 73  PHE A HE2  6  
ATOM 10053 H HZ   . PHE A 1 73  ? 0.480   5.737   15.875 1.00 0.00 ? 73  PHE A HZ   6  
ATOM 10054 N N    . VAL A 1 74  ? 0.731   5.377   7.422  1.00 0.00 ? 74  VAL A N    6  
ATOM 10055 C CA   . VAL A 1 74  ? 1.196   5.563   6.058  1.00 0.00 ? 74  VAL A CA   6  
ATOM 10056 C C    . VAL A 1 74  ? 0.572   6.835   5.480  1.00 0.00 ? 74  VAL A C    6  
ATOM 10057 O O    . VAL A 1 74  ? -0.650  6.973   5.449  1.00 0.00 ? 74  VAL A O    6  
ATOM 10058 C CB   . VAL A 1 74  ? 0.890   4.316   5.226  1.00 0.00 ? 74  VAL A CB   6  
ATOM 10059 C CG1  . VAL A 1 74  ? 1.799   3.153   5.627  1.00 0.00 ? 74  VAL A CG1  6  
ATOM 10060 C CG2  . VAL A 1 74  ? -0.585  3.926   5.344  1.00 0.00 ? 74  VAL A CG2  6  
ATOM 10061 H H    . VAL A 1 74  ? -0.249  5.527   7.559  1.00 0.00 ? 74  VAL A H    6  
ATOM 10062 H HA   . VAL A 1 74  ? 2.278   5.688   6.094  1.00 0.00 ? 74  VAL A HA   6  
ATOM 10063 H HB   . VAL A 1 74  ? 1.091   4.553   4.181  1.00 0.00 ? 74  VAL A HB   6  
ATOM 10064 H HG11 . VAL A 1 74  ? 1.905   3.132   6.712  1.00 0.00 ? 74  VAL A HG11 6  
ATOM 10065 H HG12 . VAL A 1 74  ? 1.360   2.215   5.287  1.00 0.00 ? 74  VAL A HG12 6  
ATOM 10066 H HG13 . VAL A 1 74  ? 2.779   3.282   5.169  1.00 0.00 ? 74  VAL A HG13 6  
ATOM 10067 H HG21 . VAL A 1 74  ? -0.757  3.442   6.306  1.00 0.00 ? 74  VAL A HG21 6  
ATOM 10068 H HG22 . VAL A 1 74  ? -1.204  4.820   5.272  1.00 0.00 ? 74  VAL A HG22 6  
ATOM 10069 H HG23 . VAL A 1 74  ? -0.844  3.238   4.540  1.00 0.00 ? 74  VAL A HG23 6  
ATOM 10070 N N    . THR A 1 75  ? 1.440   7.733   5.038  1.00 0.00 ? 75  THR A N    6  
ATOM 10071 C CA   . THR A 1 75  ? 0.989   8.989   4.463  1.00 0.00 ? 75  THR A CA   6  
ATOM 10072 C C    . THR A 1 75  ? 1.263   9.016   2.958  1.00 0.00 ? 75  THR A C    6  
ATOM 10073 O O    . THR A 1 75  ? 2.387   9.279   2.532  1.00 0.00 ? 75  THR A O    6  
ATOM 10074 C CB   . THR A 1 75  ? 1.670   10.129  5.224  1.00 0.00 ? 75  THR A CB   6  
ATOM 10075 O OG1  . THR A 1 75  ? 1.680   9.684   6.578  1.00 0.00 ? 75  THR A OG1  6  
ATOM 10076 C CG2  . THR A 1 75  ? 0.821   11.401  5.255  1.00 0.00 ? 75  THR A CG2  6  
ATOM 10077 H H    . THR A 1 75  ? 2.432   7.614   5.067  1.00 0.00 ? 75  THR A H    6  
ATOM 10078 H HA   . THR A 1 75  ? -0.091  9.059   4.593  1.00 0.00 ? 75  THR A HA   6  
ATOM 10079 H HB   . THR A 1 75  ? 2.661   10.331  4.817  1.00 0.00 ? 75  THR A HB   6  
ATOM 10080 H HG1  . THR A 1 75  ? 0.761   9.398   6.850  1.00 0.00 ? 75  THR A HG1  6  
ATOM 10081 H HG21 . THR A 1 75  ? 1.214   12.082  6.011  1.00 0.00 ? 75  THR A HG21 6  
ATOM 10082 H HG22 . THR A 1 75  ? 0.854   11.884  4.279  1.00 0.00 ? 75  THR A HG22 6  
ATOM 10083 H HG23 . THR A 1 75  ? -0.210  11.144  5.499  1.00 0.00 ? 75  THR A HG23 6  
ATOM 10084 N N    . PHE A 1 76  ? 0.217   8.739   2.193  1.00 0.00 ? 76  PHE A N    6  
ATOM 10085 C CA   . PHE A 1 76  ? 0.330   8.728   0.745  1.00 0.00 ? 76  PHE A CA   6  
ATOM 10086 C C    . PHE A 1 76  ? 0.631   10.128  0.207  1.00 0.00 ? 76  PHE A C    6  
ATOM 10087 O O    . PHE A 1 76  ? 0.661   11.096  0.967  1.00 0.00 ? 76  PHE A O    6  
ATOM 10088 C CB   . PHE A 1 76  ? -1.019  8.262   0.194  1.00 0.00 ? 76  PHE A CB   6  
ATOM 10089 C CG   . PHE A 1 76  ? -1.164  6.742   0.104  1.00 0.00 ? 76  PHE A CG   6  
ATOM 10090 C CD1  . PHE A 1 76  ? -0.587  6.064   -0.925 1.00 0.00 ? 76  PHE A CD1  6  
ATOM 10091 C CD2  . PHE A 1 76  ? -1.868  6.068   1.053  1.00 0.00 ? 76  PHE A CD2  6  
ATOM 10092 C CE1  . PHE A 1 76  ? -0.721  4.653   -1.008 1.00 0.00 ? 76  PHE A CE1  6  
ATOM 10093 C CE2  . PHE A 1 76  ? -2.001  4.657   0.969  1.00 0.00 ? 76  PHE A CE2  6  
ATOM 10094 C CZ   . PHE A 1 76  ? -1.425  3.979   -0.060 1.00 0.00 ? 76  PHE A CZ   6  
ATOM 10095 H H    . PHE A 1 76  ? -0.694  8.526   2.548  1.00 0.00 ? 76  PHE A H    6  
ATOM 10096 H HA   . PHE A 1 76  ? 1.152   8.059   0.490  1.00 0.00 ? 76  PHE A HA   6  
ATOM 10097 H HB2  . PHE A 1 76  ? -1.814  8.655   0.828  1.00 0.00 ? 76  PHE A HB2  6  
ATOM 10098 H HB3  . PHE A 1 76  ? -1.162  8.690   -0.798 1.00 0.00 ? 76  PHE A HB3  6  
ATOM 10099 H HD1  . PHE A 1 76  ? -0.023  6.604   -1.685 1.00 0.00 ? 76  PHE A HD1  6  
ATOM 10100 H HD2  . PHE A 1 76  ? -2.329  6.611   1.877  1.00 0.00 ? 76  PHE A HD2  6  
ATOM 10101 H HE1  . PHE A 1 76  ? -0.259  4.109   -1.833 1.00 0.00 ? 76  PHE A HE1  6  
ATOM 10102 H HE2  . PHE A 1 76  ? -2.566  4.117   1.729  1.00 0.00 ? 76  PHE A HE2  6  
ATOM 10103 H HZ   . PHE A 1 76  ? -1.528  2.896   -0.124 1.00 0.00 ? 76  PHE A HZ   6  
ATOM 10104 N N    . SER A 1 77  ? 0.846   10.193  -1.098 1.00 0.00 ? 77  SER A N    6  
ATOM 10105 C CA   . SER A 1 77  ? 1.144   11.459  -1.746 1.00 0.00 ? 77  SER A CA   6  
ATOM 10106 C C    . SER A 1 77  ? -0.156  12.174  -2.120 1.00 0.00 ? 77  SER A C    6  
ATOM 10107 O O    . SER A 1 77  ? -0.321  13.359  -1.835 1.00 0.00 ? 77  SER A O    6  
ATOM 10108 C CB   . SER A 1 77  ? 2.011   11.251  -2.989 1.00 0.00 ? 77  SER A CB   6  
ATOM 10109 O OG   . SER A 1 77  ? 2.652   12.456  -3.400 1.00 0.00 ? 77  SER A OG   6  
ATOM 10110 H H    . SER A 1 77  ? 0.820   9.401   -1.709 1.00 0.00 ? 77  SER A H    6  
ATOM 10111 H HA   . SER A 1 77  ? 1.700   12.037  -1.008 1.00 0.00 ? 77  SER A HA   6  
ATOM 10112 H HB2  . SER A 1 77  ? 2.766   10.492  -2.782 1.00 0.00 ? 77  SER A HB2  6  
ATOM 10113 H HB3  . SER A 1 77  ? 1.394   10.872  -3.803 1.00 0.00 ? 77  SER A HB3  6  
ATOM 10114 H HG   . SER A 1 77  ? 2.905   12.396  -4.366 1.00 0.00 ? 77  SER A HG   6  
ATOM 10115 N N    . SER A 1 78  ? -1.046  11.423  -2.753 1.00 0.00 ? 78  SER A N    6  
ATOM 10116 C CA   . SER A 1 78  ? -2.326  11.970  -3.169 1.00 0.00 ? 78  SER A CA   6  
ATOM 10117 C C    . SER A 1 78  ? -3.461  11.282  -2.408 1.00 0.00 ? 78  SER A C    6  
ATOM 10118 O O    . SER A 1 78  ? -3.217  10.407  -1.579 1.00 0.00 ? 78  SER A O    6  
ATOM 10119 C CB   . SER A 1 78  ? -2.528  11.815  -4.677 1.00 0.00 ? 78  SER A CB   6  
ATOM 10120 O OG   . SER A 1 78  ? -2.771  13.066  -5.315 1.00 0.00 ? 78  SER A OG   6  
ATOM 10121 H H    . SER A 1 78  ? -0.904  10.460  -2.981 1.00 0.00 ? 78  SER A H    6  
ATOM 10122 H HA   . SER A 1 78  ? -2.283  13.029  -2.915 1.00 0.00 ? 78  SER A HA   6  
ATOM 10123 H HB2  . SER A 1 78  ? -1.644  11.351  -5.115 1.00 0.00 ? 78  SER A HB2  6  
ATOM 10124 H HB3  . SER A 1 78  ? -3.366  11.144  -4.864 1.00 0.00 ? 78  SER A HB3  6  
ATOM 10125 H HG   . SER A 1 78  ? -2.963  12.924  -6.286 1.00 0.00 ? 78  SER A HG   6  
ATOM 10126 N N    . MET A 1 79  ? -4.679  11.703  -2.717 1.00 0.00 ? 79  MET A N    6  
ATOM 10127 C CA   . MET A 1 79  ? -5.852  11.138  -2.073 1.00 0.00 ? 79  MET A CA   6  
ATOM 10128 C C    . MET A 1 79  ? -6.353  9.905   -2.829 1.00 0.00 ? 79  MET A C    6  
ATOM 10129 O O    . MET A 1 79  ? -6.893  8.979   -2.226 1.00 0.00 ? 79  MET A O    6  
ATOM 10130 C CB   . MET A 1 79  ? -6.962  12.190  -2.020 1.00 0.00 ? 79  MET A CB   6  
ATOM 10131 C CG   . MET A 1 79  ? -8.103  11.738  -1.106 1.00 0.00 ? 79  MET A CG   6  
ATOM 10132 S SD   . MET A 1 79  ? -8.380  12.953  0.171  1.00 0.00 ? 79  MET A SD   6  
ATOM 10133 C CE   . MET A 1 79  ? -7.117  12.471  1.337  1.00 0.00 ? 79  MET A CE   6  
ATOM 10134 H H    . MET A 1 79  ? -4.869  12.415  -3.393 1.00 0.00 ? 79  MET A H    6  
ATOM 10135 H HA   . MET A 1 79  ? -5.528  10.852  -1.073 1.00 0.00 ? 79  MET A HA   6  
ATOM 10136 H HB2  . MET A 1 79  ? -6.555  13.135  -1.660 1.00 0.00 ? 79  MET A HB2  6  
ATOM 10137 H HB3  . MET A 1 79  ? -7.346  12.370  -3.025 1.00 0.00 ? 79  MET A HB3  6  
ATOM 10138 H HG2  . MET A 1 79  ? -9.013  11.597  -1.689 1.00 0.00 ? 79  MET A HG2  6  
ATOM 10139 H HG3  . MET A 1 79  ? -7.860  10.775  -0.657 1.00 0.00 ? 79  MET A HG3  6  
ATOM 10140 H HE1  . MET A 1 79  ? -6.518  13.342  1.605  1.00 0.00 ? 79  MET A HE1  6  
ATOM 10141 H HE2  . MET A 1 79  ? -7.585  12.063  2.232  1.00 0.00 ? 79  MET A HE2  6  
ATOM 10142 H HE3  . MET A 1 79  ? -6.475  11.715  0.885  1.00 0.00 ? 79  MET A HE3  6  
ATOM 10143 N N    . ALA A 1 80  ? -6.155  9.934   -4.139 1.00 0.00 ? 80  ALA A N    6  
ATOM 10144 C CA   . ALA A 1 80  ? -6.579  8.830   -4.984 1.00 0.00 ? 80  ALA A CA   6  
ATOM 10145 C C    . ALA A 1 80  ? -5.889  7.545   -4.522 1.00 0.00 ? 80  ALA A C    6  
ATOM 10146 O O    . ALA A 1 80  ? -6.551  6.595   -4.109 1.00 0.00 ? 80  ALA A O    6  
ATOM 10147 C CB   . ALA A 1 80  ? -6.277  9.161   -6.447 1.00 0.00 ? 80  ALA A CB   6  
ATOM 10148 H H    . ALA A 1 80  ? -5.715  10.691  -4.622 1.00 0.00 ? 80  ALA A H    6  
ATOM 10149 H HA   . ALA A 1 80  ? -7.657  8.717   -4.865 1.00 0.00 ? 80  ALA A HA   6  
ATOM 10150 H HB1  . ALA A 1 80  ? -5.202  9.102   -6.618 1.00 0.00 ? 80  ALA A HB1  6  
ATOM 10151 H HB2  . ALA A 1 80  ? -6.788  8.448   -7.094 1.00 0.00 ? 80  ALA A HB2  6  
ATOM 10152 H HB3  . ALA A 1 80  ? -6.625  10.170  -6.671 1.00 0.00 ? 80  ALA A HB3  6  
ATOM 10153 N N    . GLU A 1 81  ? -4.567  7.558   -4.609 1.00 0.00 ? 81  GLU A N    6  
ATOM 10154 C CA   . GLU A 1 81  ? -3.780  6.405   -4.205 1.00 0.00 ? 81  GLU A CA   6  
ATOM 10155 C C    . GLU A 1 81  ? -4.307  5.839   -2.885 1.00 0.00 ? 81  GLU A C    6  
ATOM 10156 O O    . GLU A 1 81  ? -4.759  4.696   -2.832 1.00 0.00 ? 81  GLU A O    6  
ATOM 10157 C CB   . GLU A 1 81  ? -2.297  6.766   -4.093 1.00 0.00 ? 81  GLU A CB   6  
ATOM 10158 C CG   . GLU A 1 81  ? -1.757  7.284   -5.428 1.00 0.00 ? 81  GLU A CG   6  
ATOM 10159 C CD   . GLU A 1 81  ? -1.635  8.809   -5.415 1.00 0.00 ? 81  GLU A CD   6  
ATOM 10160 O OE1  . GLU A 1 81  ? -0.987  9.318   -4.475 1.00 0.00 ? 81  GLU A OE1  6  
ATOM 10161 O OE2  . GLU A 1 81  ? -2.192  9.431   -6.345 1.00 0.00 ? 81  GLU A OE2  6  
ATOM 10162 H H    . GLU A 1 81  ? -4.036  8.335   -4.946 1.00 0.00 ? 81  GLU A H    6  
ATOM 10163 H HA   . GLU A 1 81  ? -3.910  5.672   -5.001 1.00 0.00 ? 81  GLU A HA   6  
ATOM 10164 H HB2  . GLU A 1 81  ? -2.160  7.524   -3.323 1.00 0.00 ? 81  GLU A HB2  6  
ATOM 10165 H HB3  . GLU A 1 81  ? -1.728  5.890   -3.783 1.00 0.00 ? 81  GLU A HB3  6  
ATOM 10166 H HG2  . GLU A 1 81  ? -0.782  6.839   -5.627 1.00 0.00 ? 81  GLU A HG2  6  
ATOM 10167 H HG3  . GLU A 1 81  ? -2.420  6.976   -6.237 1.00 0.00 ? 81  GLU A HG3  6  
ATOM 10168 N N    . VAL A 1 82  ? -4.230  6.664   -1.851 1.00 0.00 ? 82  VAL A N    6  
ATOM 10169 C CA   . VAL A 1 82  ? -4.694  6.259   -0.535 1.00 0.00 ? 82  VAL A CA   6  
ATOM 10170 C C    . VAL A 1 82  ? -6.108  5.685   -0.651 1.00 0.00 ? 82  VAL A C    6  
ATOM 10171 O O    . VAL A 1 82  ? -6.462  4.750   0.065  1.00 0.00 ? 82  VAL A O    6  
ATOM 10172 C CB   . VAL A 1 82  ? -4.605  7.438   0.437  1.00 0.00 ? 82  VAL A CB   6  
ATOM 10173 C CG1  . VAL A 1 82  ? -5.391  8.641   -0.089 1.00 0.00 ? 82  VAL A CG1  6  
ATOM 10174 C CG2  . VAL A 1 82  ? -5.086  7.036   1.832  1.00 0.00 ? 82  VAL A CG2  6  
ATOM 10175 H H    . VAL A 1 82  ? -3.861  7.592   -1.902 1.00 0.00 ? 82  VAL A H    6  
ATOM 10176 H HA   . VAL A 1 82  ? -4.026  5.476   -0.177 1.00 0.00 ? 82  VAL A HA   6  
ATOM 10177 H HB   . VAL A 1 82  ? -3.558  7.730   0.515  1.00 0.00 ? 82  VAL A HB   6  
ATOM 10178 H HG11 . VAL A 1 82  ? -5.018  8.916   -1.075 1.00 0.00 ? 82  VAL A HG11 6  
ATOM 10179 H HG12 . VAL A 1 82  ? -6.448  8.383   -0.159 1.00 0.00 ? 82  VAL A HG12 6  
ATOM 10180 H HG13 . VAL A 1 82  ? -5.267  9.482   0.594  1.00 0.00 ? 82  VAL A HG13 6  
ATOM 10181 H HG21 . VAL A 1 82  ? -5.906  6.323   1.743  1.00 0.00 ? 82  VAL A HG21 6  
ATOM 10182 H HG22 . VAL A 1 82  ? -4.264  6.577   2.381  1.00 0.00 ? 82  VAL A HG22 6  
ATOM 10183 H HG23 . VAL A 1 82  ? -5.431  7.921   2.367  1.00 0.00 ? 82  VAL A HG23 6  
ATOM 10184 N N    . ASP A 1 83  ? -6.877  6.270   -1.558 1.00 0.00 ? 83  ASP A N    6  
ATOM 10185 C CA   . ASP A 1 83  ? -8.243  5.828   -1.777 1.00 0.00 ? 83  ASP A CA   6  
ATOM 10186 C C    . ASP A 1 83  ? -8.234  4.384   -2.281 1.00 0.00 ? 83  ASP A C    6  
ATOM 10187 O O    . ASP A 1 83  ? -9.127  3.603   -1.956 1.00 0.00 ? 83  ASP A O    6  
ATOM 10188 C CB   . ASP A 1 83  ? -8.939  6.692   -2.831 1.00 0.00 ? 83  ASP A CB   6  
ATOM 10189 C CG   . ASP A 1 83  ? -10.288 7.273   -2.403 1.00 0.00 ? 83  ASP A CG   6  
ATOM 10190 O OD1  . ASP A 1 83  ? -11.036 6.534   -1.727 1.00 0.00 ? 83  ASP A OD1  6  
ATOM 10191 O OD2  . ASP A 1 83  ? -10.541 8.444   -2.761 1.00 0.00 ? 83  ASP A OD2  6  
ATOM 10192 H H    . ASP A 1 83  ? -6.580  7.030   -2.136 1.00 0.00 ? 83  ASP A H    6  
ATOM 10193 H HA   . ASP A 1 83  ? -8.735  5.929   -0.809 1.00 0.00 ? 83  ASP A HA   6  
ATOM 10194 H HB2  . ASP A 1 83  ? -8.276  7.514   -3.101 1.00 0.00 ? 83  ASP A HB2  6  
ATOM 10195 H HB3  . ASP A 1 83  ? -9.087  6.093   -3.730 1.00 0.00 ? 83  ASP A HB3  6  
ATOM 10196 N N    . ALA A 1 84  ? -7.213  4.072   -3.066 1.00 0.00 ? 84  ALA A N    6  
ATOM 10197 C CA   . ALA A 1 84  ? -7.075  2.735   -3.618 1.00 0.00 ? 84  ALA A CA   6  
ATOM 10198 C C    . ALA A 1 84  ? -6.666  1.768   -2.505 1.00 0.00 ? 84  ALA A C    6  
ATOM 10199 O O    . ALA A 1 84  ? -7.123  0.626   -2.471 1.00 0.00 ? 84  ALA A O    6  
ATOM 10200 C CB   . ALA A 1 84  ? -6.067  2.758   -4.768 1.00 0.00 ? 84  ALA A CB   6  
ATOM 10201 H H    . ALA A 1 84  ? -6.490  4.712   -3.325 1.00 0.00 ? 84  ALA A H    6  
ATOM 10202 H HA   . ALA A 1 84  ? -8.047  2.435   -4.009 1.00 0.00 ? 84  ALA A HA   6  
ATOM 10203 H HB1  . ALA A 1 84  ? -5.062  2.896   -4.369 1.00 0.00 ? 84  ALA A HB1  6  
ATOM 10204 H HB2  . ALA A 1 84  ? -6.115  1.816   -5.313 1.00 0.00 ? 84  ALA A HB2  6  
ATOM 10205 H HB3  . ALA A 1 84  ? -6.305  3.581   -5.443 1.00 0.00 ? 84  ALA A HB3  6  
ATOM 10206 N N    . ALA A 1 85  ? -5.811  2.260   -1.621 1.00 0.00 ? 85  ALA A N    6  
ATOM 10207 C CA   . ALA A 1 85  ? -5.336  1.454   -0.509 1.00 0.00 ? 85  ALA A CA   6  
ATOM 10208 C C    . ALA A 1 85  ? -6.494  1.189   0.454  1.00 0.00 ? 85  ALA A C    6  
ATOM 10209 O O    . ALA A 1 85  ? -6.566  0.123   1.064  1.00 0.00 ? 85  ALA A O    6  
ATOM 10210 C CB   . ALA A 1 85  ? -4.162  2.163   0.170  1.00 0.00 ? 85  ALA A CB   6  
ATOM 10211 H H    . ALA A 1 85  ? -5.445  3.190   -1.656 1.00 0.00 ? 85  ALA A H    6  
ATOM 10212 H HA   . ALA A 1 85  ? -4.985  0.505   -0.914 1.00 0.00 ? 85  ALA A HA   6  
ATOM 10213 H HB1  . ALA A 1 85  ? -4.217  3.233   -0.033 1.00 0.00 ? 85  ALA A HB1  6  
ATOM 10214 H HB2  . ALA A 1 85  ? -4.210  1.995   1.246  1.00 0.00 ? 85  ALA A HB2  6  
ATOM 10215 H HB3  . ALA A 1 85  ? -3.224  1.767   -0.218 1.00 0.00 ? 85  ALA A HB3  6  
ATOM 10216 N N    . MET A 1 86  ? -7.371  2.176   0.561  1.00 0.00 ? 86  MET A N    6  
ATOM 10217 C CA   . MET A 1 86  ? -8.523  2.062   1.440  1.00 0.00 ? 86  MET A CA   6  
ATOM 10218 C C    . MET A 1 86  ? -9.476  0.968   0.956  1.00 0.00 ? 86  MET A C    6  
ATOM 10219 O O    . MET A 1 86  ? -10.108 0.288   1.763  1.00 0.00 ? 86  MET A O    6  
ATOM 10220 C CB   . MET A 1 86  ? -9.263  3.400   1.488  1.00 0.00 ? 86  MET A CB   6  
ATOM 10221 C CG   . MET A 1 86  ? -8.386  4.490   2.108  1.00 0.00 ? 86  MET A CG   6  
ATOM 10222 S SD   . MET A 1 86  ? -9.223  5.227   3.502  1.00 0.00 ? 86  MET A SD   6  
ATOM 10223 C CE   . MET A 1 86  ? -9.095  3.894   4.681  1.00 0.00 ? 86  MET A CE   6  
ATOM 10224 H H    . MET A 1 86  ? -7.305  3.039   0.061  1.00 0.00 ? 86  MET A H    6  
ATOM 10225 H HA   . MET A 1 86  ? -8.120  1.796   2.417  1.00 0.00 ? 86  MET A HA   6  
ATOM 10226 H HB2  . MET A 1 86  ? -9.556  3.694   0.480  1.00 0.00 ? 86  MET A HB2  6  
ATOM 10227 H HB3  . MET A 1 86  ? -10.180 3.292   2.068  1.00 0.00 ? 86  MET A HB3  6  
ATOM 10228 H HG2  . MET A 1 86  ? -7.435  4.065   2.428  1.00 0.00 ? 86  MET A HG2  6  
ATOM 10229 H HG3  . MET A 1 86  ? -8.160  5.253   1.364  1.00 0.00 ? 86  MET A HG3  6  
ATOM 10230 H HE1  . MET A 1 86  ? -8.171  3.999   5.250  1.00 0.00 ? 86  MET A HE1  6  
ATOM 10231 H HE2  . MET A 1 86  ? -9.947  3.927   5.361  1.00 0.00 ? 86  MET A HE2  6  
ATOM 10232 H HE3  . MET A 1 86  ? -9.089  2.940   4.153  1.00 0.00 ? 86  MET A HE3  6  
ATOM 10233 N N    . ALA A 1 87  ? -9.550  0.832   -0.360 1.00 0.00 ? 87  ALA A N    6  
ATOM 10234 C CA   . ALA A 1 87  ? -10.416 -0.168  -0.961 1.00 0.00 ? 87  ALA A CA   6  
ATOM 10235 C C    . ALA A 1 87  ? -9.559  -1.210  -1.685 1.00 0.00 ? 87  ALA A C    6  
ATOM 10236 O O    . ALA A 1 87  ? -9.789  -1.502  -2.857 1.00 0.00 ? 87  ALA A O    6  
ATOM 10237 C CB   . ALA A 1 87  ? -11.414 0.517   -1.897 1.00 0.00 ? 87  ALA A CB   6  
ATOM 10238 H H    . ALA A 1 87  ? -9.033  1.389   -1.010 1.00 0.00 ? 87  ALA A H    6  
ATOM 10239 H HA   . ALA A 1 87  ? -10.966 -0.657  -0.158 1.00 0.00 ? 87  ALA A HA   6  
ATOM 10240 H HB1  . ALA A 1 87  ? -12.144 1.070   -1.307 1.00 0.00 ? 87  ALA A HB1  6  
ATOM 10241 H HB2  . ALA A 1 87  ? -10.883 1.204   -2.555 1.00 0.00 ? 87  ALA A HB2  6  
ATOM 10242 H HB3  . ALA A 1 87  ? -11.927 -0.236  -2.496 1.00 0.00 ? 87  ALA A HB3  6  
ATOM 10243 N N    . ALA A 1 88  ? -8.590  -1.742  -0.955 1.00 0.00 ? 88  ALA A N    6  
ATOM 10244 C CA   . ALA A 1 88  ? -7.698  -2.745  -1.512 1.00 0.00 ? 88  ALA A CA   6  
ATOM 10245 C C    . ALA A 1 88  ? -7.457  -3.841  -0.472 1.00 0.00 ? 88  ALA A C    6  
ATOM 10246 O O    . ALA A 1 88  ? -6.313  -4.195  -0.192 1.00 0.00 ? 88  ALA A O    6  
ATOM 10247 C CB   . ALA A 1 88  ? -6.399  -2.076  -1.966 1.00 0.00 ? 88  ALA A CB   6  
ATOM 10248 H H    . ALA A 1 88  ? -8.410  -1.499  -0.002 1.00 0.00 ? 88  ALA A H    6  
ATOM 10249 H HA   . ALA A 1 88  ? -8.191  -3.181  -2.381 1.00 0.00 ? 88  ALA A HA   6  
ATOM 10250 H HB1  . ALA A 1 88  ? -6.277  -1.126  -1.446 1.00 0.00 ? 88  ALA A HB1  6  
ATOM 10251 H HB2  . ALA A 1 88  ? -5.555  -2.727  -1.735 1.00 0.00 ? 88  ALA A HB2  6  
ATOM 10252 H HB3  . ALA A 1 88  ? -6.437  -1.900  -3.041 1.00 0.00 ? 88  ALA A HB3  6  
ATOM 10253 N N    . ARG A 1 89  ? -8.554  -4.347  0.072  1.00 0.00 ? 89  ARG A N    6  
ATOM 10254 C CA   . ARG A 1 89  ? -8.477  -5.396  1.074  1.00 0.00 ? 89  ARG A CA   6  
ATOM 10255 C C    . ARG A 1 89  ? -9.027  -6.709  0.513  1.00 0.00 ? 89  ARG A C    6  
ATOM 10256 O O    . ARG A 1 89  ? -9.770  -6.706  -0.467 1.00 0.00 ? 89  ARG A O    6  
ATOM 10257 C CB   . ARG A 1 89  ? -9.264  -5.017  2.330  1.00 0.00 ? 89  ARG A CB   6  
ATOM 10258 C CG   . ARG A 1 89  ? -8.370  -4.298  3.342  1.00 0.00 ? 89  ARG A CG   6  
ATOM 10259 C CD   . ARG A 1 89  ? -9.144  -3.966  4.619  1.00 0.00 ? 89  ARG A CD   6  
ATOM 10260 N NE   . ARG A 1 89  ? -10.573 -3.746  4.303  1.00 0.00 ? 89  ARG A NE   6  
ATOM 10261 C CZ   . ARG A 1 89  ? -11.495 -4.718  4.277  1.00 0.00 ? 89  ARG A CZ   6  
ATOM 10262 N NH1  . ARG A 1 89  ? -11.144 -5.982  4.549  1.00 0.00 ? 89  ARG A NH1  6  
ATOM 10263 N NH2  . ARG A 1 89  ? -12.768 -4.425  3.979  1.00 0.00 ? 89  ARG A NH2  6  
ATOM 10264 H H    . ARG A 1 89  ? -9.481  -4.053  -0.162 1.00 0.00 ? 89  ARG A H    6  
ATOM 10265 H HA   . ARG A 1 89  ? -7.415  -5.483  1.306  1.00 0.00 ? 89  ARG A HA   6  
ATOM 10266 H HB2  . ARG A 1 89  ? -10.102 -4.374  2.058  1.00 0.00 ? 89  ARG A HB2  6  
ATOM 10267 H HB3  . ARG A 1 89  ? -9.685  -5.914  2.784  1.00 0.00 ? 89  ARG A HB3  6  
ATOM 10268 H HG2  . ARG A 1 89  ? -7.512  -4.925  3.585  1.00 0.00 ? 89  ARG A HG2  6  
ATOM 10269 H HG3  . ARG A 1 89  ? -7.979  -3.381  2.901  1.00 0.00 ? 89  ARG A HG3  6  
ATOM 10270 H HD2  . ARG A 1 89  ? -9.043  -4.780  5.337  1.00 0.00 ? 89  ARG A HD2  6  
ATOM 10271 H HD3  . ARG A 1 89  ? -8.725  -3.075  5.087  1.00 0.00 ? 89  ARG A HD3  6  
ATOM 10272 H HE   . ARG A 1 89  ? -10.868 -2.813  4.095  1.00 0.00 ? 89  ARG A HE   6  
ATOM 10273 H HH11 . ARG A 1 89  ? -10.193 -6.200  4.771  1.00 0.00 ? 89  ARG A HH11 6  
ATOM 10274 H HH12 . ARG A 1 89  ? -11.832 -6.707  4.529  1.00 0.00 ? 89  ARG A HH12 6  
ATOM 10275 H HH21 . ARG A 1 89  ? -13.030 -3.482  3.776  1.00 0.00 ? 89  ARG A HH21 6  
ATOM 10276 H HH22 . ARG A 1 89  ? -13.456 -5.150  3.960  1.00 0.00 ? 89  ARG A HH22 6  
ATOM 10277 N N    . PRO A 1 90  ? -8.630  -7.828  1.175  1.00 0.00 ? 90  PRO A N    6  
ATOM 10278 C CA   . PRO A 1 90  ? -7.748  -7.743  2.327  1.00 0.00 ? 90  PRO A CA   6  
ATOM 10279 C C    . PRO A 1 90  ? -6.310  -7.447  1.895  1.00 0.00 ? 90  PRO A C    6  
ATOM 10280 O O    . PRO A 1 90  ? -6.061  -7.113  0.738  1.00 0.00 ? 90  PRO A O    6  
ATOM 10281 C CB   . PRO A 1 90  ? -7.892  -9.082  3.032  1.00 0.00 ? 90  PRO A CB   6  
ATOM 10282 C CG   . PRO A 1 90  ? -8.486  -10.033 2.005  1.00 0.00 ? 90  PRO A CG   6  
ATOM 10283 C CD   . PRO A 1 90  ? -9.008  -9.199  0.846  1.00 0.00 ? 90  PRO A CD   6  
ATOM 10284 H HA   . PRO A 1 90  ? -8.019  -6.983  2.916  1.00 0.00 ? 90  PRO A HA   6  
ATOM 10285 H HB2  . PRO A 1 90  ? -6.926  -9.443  3.386  1.00 0.00 ? 90  PRO A HB2  6  
ATOM 10286 H HB3  . PRO A 1 90  ? -8.539  -8.996  3.905  1.00 0.00 ? 90  PRO A HB3  6  
ATOM 10287 H HG2  . PRO A 1 90  ? -7.732  -10.739 1.658  1.00 0.00 ? 90  PRO A HG2  6  
ATOM 10288 H HG3  . PRO A 1 90  ? -9.291  -10.618 2.448  1.00 0.00 ? 90  PRO A HG3  6  
ATOM 10289 H HD2  . PRO A 1 90  ? -8.568  -9.516  -0.099 1.00 0.00 ? 90  PRO A HD2  6  
ATOM 10290 H HD3  . PRO A 1 90  ? -10.089 -9.298  0.744  1.00 0.00 ? 90  PRO A HD3  6  
ATOM 10291 N N    . HIS A 1 91  ? -5.400  -7.579  2.850  1.00 0.00 ? 91  HIS A N    6  
ATOM 10292 C CA   . HIS A 1 91  ? -3.994  -7.329  2.583  1.00 0.00 ? 91  HIS A CA   6  
ATOM 10293 C C    . HIS A 1 91  ? -3.152  -8.471  3.157  1.00 0.00 ? 91  HIS A C    6  
ATOM 10294 O O    . HIS A 1 91  ? -3.430  -8.963  4.249  1.00 0.00 ? 91  HIS A O    6  
ATOM 10295 C CB   . HIS A 1 91  ? -3.575  -5.958  3.117  1.00 0.00 ? 91  HIS A CB   6  
ATOM 10296 C CG   . HIS A 1 91  ? -3.663  -4.848  2.096  1.00 0.00 ? 91  HIS A CG   6  
ATOM 10297 N ND1  . HIS A 1 91  ? -3.381  -3.528  2.399  1.00 0.00 ? 91  HIS A ND1  6  
ATOM 10298 C CD2  . HIS A 1 91  ? -4.003  -4.877  0.776  1.00 0.00 ? 91  HIS A CD2  6  
ATOM 10299 C CE1  . HIS A 1 91  ? -3.548  -2.803  1.302  1.00 0.00 ? 91  HIS A CE1  6  
ATOM 10300 N NE2  . HIS A 1 91  ? -3.934  -3.641  0.298  1.00 0.00 ? 91  HIS A NE2  6  
ATOM 10301 H H    . HIS A 1 91  ? -5.611  -7.850  3.789  1.00 0.00 ? 91  HIS A H    6  
ATOM 10302 H HA   . HIS A 1 91  ? -3.879  -7.313  1.500  1.00 0.00 ? 91  HIS A HA   6  
ATOM 10303 H HB2  . HIS A 1 91  ? -4.204  -5.703  3.970  1.00 0.00 ? 91  HIS A HB2  6  
ATOM 10304 H HB3  . HIS A 1 91  ? -2.551  -6.020  3.484  1.00 0.00 ? 91  HIS A HB3  6  
ATOM 10305 H HD1  . HIS A 1 91  ? -3.099  -3.179  3.293  1.00 0.00 ? 91  HIS A HD1  6  
ATOM 10306 H HD2  . HIS A 1 91  ? -4.284  -5.765  0.210  1.00 0.00 ? 91  HIS A HD2  6  
ATOM 10307 H HE1  . HIS A 1 91  ? -3.402  -1.726  1.217  1.00 0.00 ? 91  HIS A HE1  6  
ATOM 10308 N N    . SER A 1 92  ? -2.141  -8.858  2.394  1.00 0.00 ? 92  SER A N    6  
ATOM 10309 C CA   . SER A 1 92  ? -1.257  -9.933  2.812  1.00 0.00 ? 92  SER A CA   6  
ATOM 10310 C C    . SER A 1 92  ? 0.196   -9.454  2.790  1.00 0.00 ? 92  SER A C    6  
ATOM 10311 O O    . SER A 1 92  ? 0.755   -9.207  1.722  1.00 0.00 ? 92  SER A O    6  
ATOM 10312 C CB   . SER A 1 92  ? -1.424  -11.163 1.919  1.00 0.00 ? 92  SER A CB   6  
ATOM 10313 O OG   . SER A 1 92  ? -1.575  -10.810 0.547  1.00 0.00 ? 92  SER A OG   6  
ATOM 10314 H H    . SER A 1 92  ? -1.922  -8.452  1.507  1.00 0.00 ? 92  SER A H    6  
ATOM 10315 H HA   . SER A 1 92  ? -1.563  -10.179 3.829  1.00 0.00 ? 92  SER A HA   6  
ATOM 10316 H HB2  . SER A 1 92  ? -0.557  -11.814 2.032  1.00 0.00 ? 92  SER A HB2  6  
ATOM 10317 H HB3  . SER A 1 92  ? -2.295  -11.733 2.245  1.00 0.00 ? 92  SER A HB3  6  
ATOM 10318 H HG   . SER A 1 92  ? -1.147  -11.502 -0.034 1.00 0.00 ? 92  SER A HG   6  
ATOM 10319 N N    . ILE A 1 93  ? 0.766   -9.338  3.980  1.00 0.00 ? 93  ILE A N    6  
ATOM 10320 C CA   . ILE A 1 93  ? 2.143   -8.893  4.110  1.00 0.00 ? 93  ILE A CA   6  
ATOM 10321 C C    . ILE A 1 93  ? 2.857   -9.755  5.153  1.00 0.00 ? 93  ILE A C    6  
ATOM 10322 O O    . ILE A 1 93  ? 2.229   -10.252 6.088  1.00 0.00 ? 93  ILE A O    6  
ATOM 10323 C CB   . ILE A 1 93  ? 2.196   -7.394  4.411  1.00 0.00 ? 93  ILE A CB   6  
ATOM 10324 C CG1  . ILE A 1 93  ? 1.185   -6.627  3.556  1.00 0.00 ? 93  ILE A CG1  6  
ATOM 10325 C CG2  . ILE A 1 93  ? 3.617   -6.851  4.244  1.00 0.00 ? 93  ILE A CG2  6  
ATOM 10326 C CD1  . ILE A 1 93  ? 1.035   -5.185  4.045  1.00 0.00 ? 93  ILE A CD1  6  
ATOM 10327 H H    . ILE A 1 93  ? 0.304   -9.541  4.843  1.00 0.00 ? 93  ILE A H    6  
ATOM 10328 H HA   . ILE A 1 93  ? 2.628   -9.046  3.146  1.00 0.00 ? 93  ILE A HA   6  
ATOM 10329 H HB   . ILE A 1 93  ? 1.915   -7.245  5.453  1.00 0.00 ? 93  ILE A HB   6  
ATOM 10330 H HG12 . ILE A 1 93  ? 1.508   -6.630  2.515  1.00 0.00 ? 93  ILE A HG12 6  
ATOM 10331 H HG13 . ILE A 1 93  ? 0.218   -7.130  3.591  1.00 0.00 ? 93  ILE A HG13 6  
ATOM 10332 H HG21 . ILE A 1 93  ? 3.929   -6.965  3.206  1.00 0.00 ? 93  ILE A HG21 6  
ATOM 10333 H HG22 . ILE A 1 93  ? 3.636   -5.796  4.516  1.00 0.00 ? 93  ILE A HG22 6  
ATOM 10334 H HG23 . ILE A 1 93  ? 4.296   -7.406  4.891  1.00 0.00 ? 93  ILE A HG23 6  
ATOM 10335 H HD11 . ILE A 1 93  ? 1.955   -4.636  3.844  1.00 0.00 ? 93  ILE A HD11 6  
ATOM 10336 H HD12 . ILE A 1 93  ? 0.205   -4.709  3.523  1.00 0.00 ? 93  ILE A HD12 6  
ATOM 10337 H HD13 . ILE A 1 93  ? 0.838   -5.184  5.117  1.00 0.00 ? 93  ILE A HD13 6  
ATOM 10338 N N    . ASP A 1 94  ? 4.158   -9.907  4.959  1.00 0.00 ? 94  ASP A N    6  
ATOM 10339 C CA   . ASP A 1 94  ? 4.964   -10.701 5.872  1.00 0.00 ? 94  ASP A CA   6  
ATOM 10340 C C    . ASP A 1 94  ? 4.404   -12.123 5.934  1.00 0.00 ? 94  ASP A C    6  
ATOM 10341 O O    . ASP A 1 94  ? 4.541   -12.804 6.949  1.00 0.00 ? 94  ASP A O    6  
ATOM 10342 C CB   . ASP A 1 94  ? 4.931   -10.117 7.285  1.00 0.00 ? 94  ASP A CB   6  
ATOM 10343 C CG   . ASP A 1 94  ? 5.690   -10.927 8.337  1.00 0.00 ? 94  ASP A CG   6  
ATOM 10344 O OD1  . ASP A 1 94  ? 6.487   -11.795 7.919  1.00 0.00 ? 94  ASP A OD1  6  
ATOM 10345 O OD2  . ASP A 1 94  ? 5.457   -10.661 9.536  1.00 0.00 ? 94  ASP A OD2  6  
ATOM 10346 H H    . ASP A 1 94  ? 4.661   -9.500  4.196  1.00 0.00 ? 94  ASP A H    6  
ATOM 10347 H HA   . ASP A 1 94  ? 5.974   -10.668 5.464  1.00 0.00 ? 94  ASP A HA   6  
ATOM 10348 H HB2  . ASP A 1 94  ? 5.345   -9.109  7.256  1.00 0.00 ? 94  ASP A HB2  6  
ATOM 10349 H HB3  . ASP A 1 94  ? 3.891   -10.025 7.600  1.00 0.00 ? 94  ASP A HB3  6  
ATOM 10350 N N    . GLY A 1 95  ? 3.785   -12.530 4.835  1.00 0.00 ? 95  GLY A N    6  
ATOM 10351 C CA   . GLY A 1 95  ? 3.204   -13.859 4.752  1.00 0.00 ? 95  GLY A CA   6  
ATOM 10352 C C    . GLY A 1 95  ? 2.024   -14.003 5.716  1.00 0.00 ? 95  GLY A C    6  
ATOM 10353 O O    . GLY A 1 95  ? 1.638   -15.116 6.068  1.00 0.00 ? 95  GLY A O    6  
ATOM 10354 H H    . GLY A 1 95  ? 3.678   -11.970 4.014  1.00 0.00 ? 95  GLY A H    6  
ATOM 10355 H HA2  . GLY A 1 95  ? 2.870   -14.051 3.733  1.00 0.00 ? 95  GLY A HA2  6  
ATOM 10356 H HA3  . GLY A 1 95  ? 3.962   -14.607 4.986  1.00 0.00 ? 95  GLY A HA3  6  
ATOM 10357 N N    . ARG A 1 96  ? 1.486   -12.861 6.117  1.00 0.00 ? 96  ARG A N    6  
ATOM 10358 C CA   . ARG A 1 96  ? 0.359   -12.845 7.033  1.00 0.00 ? 96  ARG A CA   6  
ATOM 10359 C C    . ARG A 1 96  ? -0.770  -11.978 6.472  1.00 0.00 ? 96  ARG A C    6  
ATOM 10360 O O    . ARG A 1 96  ? -0.572  -11.246 5.504  1.00 0.00 ? 96  ARG A O    6  
ATOM 10361 C CB   . ARG A 1 96  ? 0.771   -12.308 8.405  1.00 0.00 ? 96  ARG A CB   6  
ATOM 10362 C CG   . ARG A 1 96  ? 1.028   -10.800 8.349  1.00 0.00 ? 96  ARG A CG   6  
ATOM 10363 C CD   . ARG A 1 96  ? 0.504   -10.108 9.609  1.00 0.00 ? 96  ARG A CD   6  
ATOM 10364 N NE   . ARG A 1 96  ? -0.946  -10.361 9.760  1.00 0.00 ? 96  ARG A NE   6  
ATOM 10365 C CZ   . ARG A 1 96  ? -1.465  -11.307 10.555 1.00 0.00 ? 96  ARG A CZ   6  
ATOM 10366 N NH1  . ARG A 1 96  ? -0.655  -12.094 11.276 1.00 0.00 ? 96  ARG A NH1  6  
ATOM 10367 N NH2  . ARG A 1 96  ? -2.794  -11.465 10.630 1.00 0.00 ? 96  ARG A NH2  6  
ATOM 10368 H H    . ARG A 1 96  ? 1.807   -11.959 5.826  1.00 0.00 ? 96  ARG A H    6  
ATOM 10369 H HA   . ARG A 1 96  ? 0.050   -13.888 7.113  1.00 0.00 ? 96  ARG A HA   6  
ATOM 10370 H HB2  . ARG A 1 96  ? -0.012  -12.520 9.133  1.00 0.00 ? 96  ARG A HB2  6  
ATOM 10371 H HB3  . ARG A 1 96  ? 1.671   -12.821 8.745  1.00 0.00 ? 96  ARG A HB3  6  
ATOM 10372 H HG2  . ARG A 1 96  ? 2.096   -10.613 8.244  1.00 0.00 ? 96  ARG A HG2  6  
ATOM 10373 H HG3  . ARG A 1 96  ? 0.542   -10.378 7.469  1.00 0.00 ? 96  ARG A HG3  6  
ATOM 10374 H HD2  . ARG A 1 96  ? 1.039   -10.475 10.484 1.00 0.00 ? 96  ARG A HD2  6  
ATOM 10375 H HD3  . ARG A 1 96  ? 0.690   -9.036  9.548  1.00 0.00 ? 96  ARG A HD3  6  
ATOM 10376 H HE   . ARG A 1 96  ? -1.579  -9.791  9.235  1.00 0.00 ? 96  ARG A HE   6  
ATOM 10377 H HH11 . ARG A 1 96  ? 0.336   -11.976 11.221 1.00 0.00 ? 96  ARG A HH11 6  
ATOM 10378 H HH12 . ARG A 1 96  ? -1.042  -12.799 11.870 1.00 0.00 ? 96  ARG A HH12 6  
ATOM 10379 H HH21 . ARG A 1 96  ? -3.398  -10.877 10.091 1.00 0.00 ? 96  ARG A HH21 6  
ATOM 10380 H HH22 . ARG A 1 96  ? -3.181  -12.170 11.223 1.00 0.00 ? 96  ARG A HH22 6  
ATOM 10381 N N    . VAL A 1 97  ? -1.929  -12.090 7.104  1.00 0.00 ? 97  VAL A N    6  
ATOM 10382 C CA   . VAL A 1 97  ? -3.090  -11.325 6.679  1.00 0.00 ? 97  VAL A CA   6  
ATOM 10383 C C    . VAL A 1 97  ? -3.211  -10.068 7.544  1.00 0.00 ? 97  VAL A C    6  
ATOM 10384 O O    . VAL A 1 97  ? -3.636  -10.141 8.696  1.00 0.00 ? 97  VAL A O    6  
ATOM 10385 C CB   . VAL A 1 97  ? -4.341  -12.204 6.725  1.00 0.00 ? 97  VAL A CB   6  
ATOM 10386 C CG1  . VAL A 1 97  ? -5.573  -11.429 6.254  1.00 0.00 ? 97  VAL A CG1  6  
ATOM 10387 C CG2  . VAL A 1 97  ? -4.146  -13.478 5.899  1.00 0.00 ? 97  VAL A CG2  6  
ATOM 10388 H H    . VAL A 1 97  ? -2.082  -12.688 7.891  1.00 0.00 ? 97  VAL A H    6  
ATOM 10389 H HA   . VAL A 1 97  ? -2.925  -11.025 5.645  1.00 0.00 ? 97  VAL A HA   6  
ATOM 10390 H HB   . VAL A 1 97  ? -4.506  -12.499 7.761  1.00 0.00 ? 97  VAL A HB   6  
ATOM 10391 H HG11 . VAL A 1 97  ? -5.643  -11.482 5.168  1.00 0.00 ? 97  VAL A HG11 6  
ATOM 10392 H HG12 . VAL A 1 97  ? -6.468  -11.866 6.698  1.00 0.00 ? 97  VAL A HG12 6  
ATOM 10393 H HG13 . VAL A 1 97  ? -5.486  -10.387 6.562  1.00 0.00 ? 97  VAL A HG13 6  
ATOM 10394 H HG21 . VAL A 1 97  ? -3.620  -13.235 4.976  1.00 0.00 ? 97  VAL A HG21 6  
ATOM 10395 H HG22 . VAL A 1 97  ? -3.561  -14.197 6.473  1.00 0.00 ? 97  VAL A HG22 6  
ATOM 10396 H HG23 . VAL A 1 97  ? -5.119  -13.909 5.661  1.00 0.00 ? 97  VAL A HG23 6  
ATOM 10397 N N    . VAL A 1 98  ? -2.829  -8.945  6.954  1.00 0.00 ? 98  VAL A N    6  
ATOM 10398 C CA   . VAL A 1 98  ? -2.890  -7.674  7.656  1.00 0.00 ? 98  VAL A CA   6  
ATOM 10399 C C    . VAL A 1 98  ? -4.257  -7.030  7.419  1.00 0.00 ? 98  VAL A C    6  
ATOM 10400 O O    . VAL A 1 98  ? -5.136  -7.637  6.810  1.00 0.00 ? 98  VAL A O    6  
ATOM 10401 C CB   . VAL A 1 98  ? -1.725  -6.781  7.223  1.00 0.00 ? 98  VAL A CB   6  
ATOM 10402 C CG1  . VAL A 1 98  ? -0.456  -7.605  6.998  1.00 0.00 ? 98  VAL A CG1  6  
ATOM 10403 C CG2  . VAL A 1 98  ? -2.087  -5.978  5.972  1.00 0.00 ? 98  VAL A CG2  6  
ATOM 10404 H H    . VAL A 1 98  ? -2.484  -8.894  6.017  1.00 0.00 ? 98  VAL A H    6  
ATOM 10405 H HA   . VAL A 1 98  ? -2.779  -7.880  8.721  1.00 0.00 ? 98  VAL A HA   6  
ATOM 10406 H HB   . VAL A 1 98  ? -1.527  -6.074  8.028  1.00 0.00 ? 98  VAL A HB   6  
ATOM 10407 H HG11 . VAL A 1 98  ? -0.601  -8.270  6.146  1.00 0.00 ? 98  VAL A HG11 6  
ATOM 10408 H HG12 . VAL A 1 98  ? 0.381   -6.936  6.798  1.00 0.00 ? 98  VAL A HG12 6  
ATOM 10409 H HG13 . VAL A 1 98  ? -0.245  -8.197  7.888  1.00 0.00 ? 98  VAL A HG13 6  
ATOM 10410 H HG21 . VAL A 1 98  ? -1.195  -5.834  5.362  1.00 0.00 ? 98  VAL A HG21 6  
ATOM 10411 H HG22 . VAL A 1 98  ? -2.837  -6.520  5.396  1.00 0.00 ? 98  VAL A HG22 6  
ATOM 10412 H HG23 . VAL A 1 98  ? -2.486  -5.007  6.266  1.00 0.00 ? 98  VAL A HG23 6  
ATOM 10413 N N    . GLU A 1 99  ? -4.394  -5.808  7.914  1.00 0.00 ? 99  GLU A N    6  
ATOM 10414 C CA   . GLU A 1 99  ? -5.640  -5.076  7.763  1.00 0.00 ? 99  GLU A CA   6  
ATOM 10415 C C    . GLU A 1 99  ? -5.395  -3.574  7.924  1.00 0.00 ? 99  GLU A C    6  
ATOM 10416 O O    . GLU A 1 99  ? -5.115  -3.101  9.025  1.00 0.00 ? 99  GLU A O    6  
ATOM 10417 C CB   . GLU A 1 99  ? -6.690  -5.570  8.760  1.00 0.00 ? 99  GLU A CB   6  
ATOM 10418 C CG   . GLU A 1 99  ? -6.056  -5.879  10.117 1.00 0.00 ? 99  GLU A CG   6  
ATOM 10419 C CD   . GLU A 1 99  ? -6.012  -7.387  10.371 1.00 0.00 ? 99  GLU A CD   6  
ATOM 10420 O OE1  . GLU A 1 99  ? -5.305  -8.072  9.601  1.00 0.00 ? 99  GLU A OE1  6  
ATOM 10421 O OE2  . GLU A 1 99  ? -6.686  -7.821  11.330 1.00 0.00 ? 99  GLU A OE2  6  
ATOM 10422 H H    . GLU A 1 99  ? -3.674  -5.321  8.408  1.00 0.00 ? 99  GLU A H    6  
ATOM 10423 H HA   . GLU A 1 99  ? -5.981  -5.288  6.750  1.00 0.00 ? 99  GLU A HA   6  
ATOM 10424 H HB2  . GLU A 1 99  ? -7.466  -4.814  8.881  1.00 0.00 ? 99  GLU A HB2  6  
ATOM 10425 H HB3  . GLU A 1 99  ? -7.175  -6.464  8.369  1.00 0.00 ? 99  GLU A HB3  6  
ATOM 10426 H HG2  . GLU A 1 99  ? -5.045  -5.471  10.152 1.00 0.00 ? 99  GLU A HG2  6  
ATOM 10427 H HG3  . GLU A 1 99  ? -6.624  -5.390  10.909 1.00 0.00 ? 99  GLU A HG3  6  
ATOM 10428 N N    . PRO A 1 100 ? -5.512  -2.847  6.781  1.00 0.00 ? 100 PRO A N    6  
ATOM 10429 C CA   . PRO A 1 100 ? -5.307  -1.408  6.785  1.00 0.00 ? 100 PRO A CA   6  
ATOM 10430 C C    . PRO A 1 100 ? -6.502  -0.685  7.408  1.00 0.00 ? 100 PRO A C    6  
ATOM 10431 O O    . PRO A 1 100 ? -7.632  -1.166  7.332  1.00 0.00 ? 100 PRO A O    6  
ATOM 10432 C CB   . PRO A 1 100 ? -5.084  -1.039  5.327  1.00 0.00 ? 100 PRO A CB   6  
ATOM 10433 C CG   . PRO A 1 100 ? -5.631  -2.201  4.514  1.00 0.00 ? 100 PRO A CG   6  
ATOM 10434 C CD   . PRO A 1 100 ? -5.842  -3.372  5.460  1.00 0.00 ? 100 PRO A CD   6  
ATOM 10435 H HA   . PRO A 1 100 ? -4.518  -1.172  7.352  1.00 0.00 ? 100 PRO A HA   6  
ATOM 10436 H HB2  . PRO A 1 100 ? -5.597  -0.111  5.076  1.00 0.00 ? 100 PRO A HB2  6  
ATOM 10437 H HB3  . PRO A 1 100 ? -4.025  -0.883  5.121  1.00 0.00 ? 100 PRO A HB3  6  
ATOM 10438 H HG2  . PRO A 1 100 ? -6.569  -1.923  4.035  1.00 0.00 ? 100 PRO A HG2  6  
ATOM 10439 H HG3  . PRO A 1 100 ? -4.935  -2.472  3.720  1.00 0.00 ? 100 PRO A HG3  6  
ATOM 10440 H HD2  . PRO A 1 100 ? -6.871  -3.731  5.422  1.00 0.00 ? 100 PRO A HD2  6  
ATOM 10441 H HD3  . PRO A 1 100 ? -5.202  -4.214  5.197  1.00 0.00 ? 100 PRO A HD3  6  
ATOM 10442 N N    . LYS A 1 101 ? -6.213  0.459   8.011  1.00 0.00 ? 101 LYS A N    6  
ATOM 10443 C CA   . LYS A 1 101 ? -7.250  1.253   8.647  1.00 0.00 ? 101 LYS A CA   6  
ATOM 10444 C C    . LYS A 1 101 ? -6.975  2.737   8.398  1.00 0.00 ? 101 LYS A C    6  
ATOM 10445 O O    . LYS A 1 101 ? -5.980  3.090   7.765  1.00 0.00 ? 101 LYS A O    6  
ATOM 10446 C CB   . LYS A 1 101 ? -7.370  0.890   10.128 1.00 0.00 ? 101 LYS A CB   6  
ATOM 10447 C CG   . LYS A 1 101 ? -7.141  -0.607  10.346 1.00 0.00 ? 101 LYS A CG   6  
ATOM 10448 C CD   . LYS A 1 101 ? -7.573  -1.029  11.752 1.00 0.00 ? 101 LYS A CD   6  
ATOM 10449 C CE   . LYS A 1 101 ? -8.922  -1.750  11.718 1.00 0.00 ? 101 LYS A CE   6  
ATOM 10450 N NZ   . LYS A 1 101 ? -9.714  -1.424  12.925 1.00 0.00 ? 101 LYS A NZ   6  
ATOM 10451 H H    . LYS A 1 101 ? -5.291  0.843   8.068  1.00 0.00 ? 101 LYS A H    6  
ATOM 10452 H HA   . LYS A 1 101 ? -8.197  0.993   8.174  1.00 0.00 ? 101 LYS A HA   6  
ATOM 10453 H HB2  . LYS A 1 101 ? -6.643  1.460   10.707 1.00 0.00 ? 101 LYS A HB2  6  
ATOM 10454 H HB3  . LYS A 1 101 ? -8.357  1.168   10.496 1.00 0.00 ? 101 LYS A HB3  6  
ATOM 10455 H HG2  . LYS A 1 101 ? -7.701  -1.176  9.604  1.00 0.00 ? 101 LYS A HG2  6  
ATOM 10456 H HG3  . LYS A 1 101 ? -6.087  -0.843  10.200 1.00 0.00 ? 101 LYS A HG3  6  
ATOM 10457 H HD2  . LYS A 1 101 ? -6.818  -1.683  12.188 1.00 0.00 ? 101 LYS A HD2  6  
ATOM 10458 H HD3  . LYS A 1 101 ? -7.642  -0.150  12.394 1.00 0.00 ? 101 LYS A HD3  6  
ATOM 10459 H HE2  . LYS A 1 101 ? -9.474  -1.459  10.824 1.00 0.00 ? 101 LYS A HE2  6  
ATOM 10460 H HE3  . LYS A 1 101 ? -8.764  -2.826  11.659 1.00 0.00 ? 101 LYS A HE3  6  
ATOM 10461 H HZ1  . LYS A 1 101 ? -10.550 -0.945  12.656 1.00 0.00 ? 101 LYS A HZ1  6  
ATOM 10462 H HZ2  . LYS A 1 101 ? -9.954  -2.269  13.404 1.00 0.00 ? 101 LYS A HZ2  6  
ATOM 10463 H HZ3  . LYS A 1 101 ? -9.174  -0.839  13.530 1.00 0.00 ? 101 LYS A HZ3  6  
ATOM 10464 N N    . ARG A 1 102 ? -7.873  3.567   8.908  1.00 0.00 ? 102 ARG A N    6  
ATOM 10465 C CA   . ARG A 1 102 ? -7.740  5.005   8.748  1.00 0.00 ? 102 ARG A CA   6  
ATOM 10466 C C    . ARG A 1 102 ? -7.327  5.650   10.073 1.00 0.00 ? 102 ARG A C    6  
ATOM 10467 O O    . ARG A 1 102 ? -7.548  5.080   11.140 1.00 0.00 ? 102 ARG A O    6  
ATOM 10468 C CB   . ARG A 1 102 ? -9.052  5.630   8.272  1.00 0.00 ? 102 ARG A CB   6  
ATOM 10469 C CG   . ARG A 1 102 ? -8.844  6.421   6.978  1.00 0.00 ? 102 ARG A CG   6  
ATOM 10470 C CD   . ARG A 1 102 ? -10.074 7.272   6.653  1.00 0.00 ? 102 ARG A CD   6  
ATOM 10471 N NE   . ARG A 1 102 ? -9.829  8.067   5.429  1.00 0.00 ? 102 ARG A NE   6  
ATOM 10472 C CZ   . ARG A 1 102 ? -10.613 9.073   5.017  1.00 0.00 ? 102 ARG A CZ   6  
ATOM 10473 N NH1  . ARG A 1 102 ? -11.696 9.413   5.729  1.00 0.00 ? 102 ARG A NH1  6  
ATOM 10474 N NH2  . ARG A 1 102 ? -10.314 9.739   3.893  1.00 0.00 ? 102 ARG A NH2  6  
ATOM 10475 H H    . ARG A 1 102 ? -8.679  3.271   9.421  1.00 0.00 ? 102 ARG A H    6  
ATOM 10476 H HA   . ARG A 1 102 ? -6.964  5.131   7.993  1.00 0.00 ? 102 ARG A HA   6  
ATOM 10477 H HB2  . ARG A 1 102 ? -9.794  4.848   8.109  1.00 0.00 ? 102 ARG A HB2  6  
ATOM 10478 H HB3  . ARG A 1 102 ? -9.447  6.289   9.045  1.00 0.00 ? 102 ARG A HB3  6  
ATOM 10479 H HG2  . ARG A 1 102 ? -7.969  7.063   7.077  1.00 0.00 ? 102 ARG A HG2  6  
ATOM 10480 H HG3  . ARG A 1 102 ? -8.645  5.734   6.156  1.00 0.00 ? 102 ARG A HG3  6  
ATOM 10481 H HD2  . ARG A 1 102 ? -10.943 6.631   6.512  1.00 0.00 ? 102 ARG A HD2  6  
ATOM 10482 H HD3  . ARG A 1 102 ? -10.298 7.936   7.488  1.00 0.00 ? 102 ARG A HD3  6  
ATOM 10483 H HE   . ARG A 1 102 ? -9.029  7.839   4.874  1.00 0.00 ? 102 ARG A HE   6  
ATOM 10484 H HH11 . ARG A 1 102 ? -11.919 8.916   6.568  1.00 0.00 ? 102 ARG A HH11 6  
ATOM 10485 H HH12 . ARG A 1 102 ? -12.281 10.163  5.422  1.00 0.00 ? 102 ARG A HH12 6  
ATOM 10486 H HH21 . ARG A 1 102 ? -9.506  9.485   3.361  1.00 0.00 ? 102 ARG A HH21 6  
ATOM 10487 H HH22 . ARG A 1 102 ? -10.899 10.489  3.586  1.00 0.00 ? 102 ARG A HH22 6  
ATOM 10488 N N    . ALA A 1 103 ? -6.734  6.829   9.961  1.00 0.00 ? 103 ALA A N    6  
ATOM 10489 C CA   . ALA A 1 103 ? -6.289  7.558   11.137 1.00 0.00 ? 103 ALA A CA   6  
ATOM 10490 C C    . ALA A 1 103 ? -7.263  8.702   11.422 1.00 0.00 ? 103 ALA A C    6  
ATOM 10491 O O    . ALA A 1 103 ? -6.862  9.863   11.485 1.00 0.00 ? 103 ALA A O    6  
ATOM 10492 C CB   . ALA A 1 103 ? -4.857  8.051   10.919 1.00 0.00 ? 103 ALA A CB   6  
ATOM 10493 H H    . ALA A 1 103 ? -6.558  7.286   9.089  1.00 0.00 ? 103 ALA A H    6  
ATOM 10494 H HA   . ALA A 1 103 ? -6.297  6.866   11.979 1.00 0.00 ? 103 ALA A HA   6  
ATOM 10495 H HB1  . ALA A 1 103 ? -4.236  7.748   11.763 1.00 0.00 ? 103 ALA A HB1  6  
ATOM 10496 H HB2  . ALA A 1 103 ? -4.459  7.619   10.001 1.00 0.00 ? 103 ALA A HB2  6  
ATOM 10497 H HB3  . ALA A 1 103 ? -4.856  9.138   10.839 1.00 0.00 ? 103 ALA A HB3  6  
ATOM 10498 N N    . VAL A 1 104 ? -8.526  8.335   11.587 1.00 0.00 ? 104 VAL A N    6  
ATOM 10499 C CA   . VAL A 1 104 ? -9.560  9.316   11.864 1.00 0.00 ? 104 VAL A CA   6  
ATOM 10500 C C    . VAL A 1 104 ? -10.647 8.675   12.730 1.00 0.00 ? 104 VAL A C    6  
ATOM 10501 O O    . VAL A 1 104 ? -10.729 7.452   12.823 1.00 0.00 ? 104 VAL A O    6  
ATOM 10502 C CB   . VAL A 1 104 ? -10.102 9.890   10.553 1.00 0.00 ? 104 VAL A CB   6  
ATOM 10503 C CG1  . VAL A 1 104 ? -10.485 11.362  10.716 1.00 0.00 ? 104 VAL A CG1  6  
ATOM 10504 C CG2  . VAL A 1 104 ? -9.094  9.708   9.417  1.00 0.00 ? 104 VAL A CG2  6  
ATOM 10505 H H    . VAL A 1 104 ? -8.844  7.388   11.534 1.00 0.00 ? 104 VAL A H    6  
ATOM 10506 H HA   . VAL A 1 104 ? -9.100  10.131  12.424 1.00 0.00 ? 104 VAL A HA   6  
ATOM 10507 H HB   . VAL A 1 104 ? -11.004 9.336   10.292 1.00 0.00 ? 104 VAL A HB   6  
ATOM 10508 H HG11 . VAL A 1 104 ? -11.191 11.465  11.540 1.00 0.00 ? 104 VAL A HG11 6  
ATOM 10509 H HG12 . VAL A 1 104 ? -9.592  11.949  10.928 1.00 0.00 ? 104 VAL A HG12 6  
ATOM 10510 H HG13 . VAL A 1 104 ? -10.947 11.721  9.796  1.00 0.00 ? 104 VAL A HG13 6  
ATOM 10511 H HG21 . VAL A 1 104 ? -9.524  10.078  8.487  1.00 0.00 ? 104 VAL A HG21 6  
ATOM 10512 H HG22 . VAL A 1 104 ? -8.186  10.267  9.645  1.00 0.00 ? 104 VAL A HG22 6  
ATOM 10513 H HG23 . VAL A 1 104 ? -8.853  8.651   9.311  1.00 0.00 ? 104 VAL A HG23 6  
ATOM 10514 N N    . ALA A 1 105 ? -11.452 9.531   13.342 1.00 0.00 ? 105 ALA A N    6  
ATOM 10515 C CA   . ALA A 1 105 ? -12.530 9.063   14.197 1.00 0.00 ? 105 ALA A CA   6  
ATOM 10516 C C    . ALA A 1 105 ? -11.949 8.599   15.534 1.00 0.00 ? 105 ALA A C    6  
ATOM 10517 O O    . ALA A 1 105 ? -12.193 9.216   16.570 1.00 0.00 ? 105 ALA A O    6  
ATOM 10518 C CB   . ALA A 1 105 ? -13.305 7.955   13.482 1.00 0.00 ? 105 ALA A CB   6  
ATOM 10519 H H    . ALA A 1 105 ? -11.378 10.525  13.261 1.00 0.00 ? 105 ALA A H    6  
ATOM 10520 H HA   . ALA A 1 105 ? -13.201 9.903   14.375 1.00 0.00 ? 105 ALA A HA   6  
ATOM 10521 H HB1  . ALA A 1 105 ? -13.057 6.992   13.928 1.00 0.00 ? 105 ALA A HB1  6  
ATOM 10522 H HB2  . ALA A 1 105 ? -14.375 8.137   13.583 1.00 0.00 ? 105 ALA A HB2  6  
ATOM 10523 H HB3  . ALA A 1 105 ? -13.036 7.947   12.426 1.00 0.00 ? 105 ALA A HB3  6  
ATOM 10524 N N    . ARG A 1 106 ? -11.191 7.514   15.469 1.00 0.00 ? 106 ARG A N    6  
ATOM 10525 C CA   . ARG A 1 106 ? -10.573 6.959   16.661 1.00 0.00 ? 106 ARG A CA   6  
ATOM 10526 C C    . ARG A 1 106 ? -9.671  8.002   17.326 1.00 0.00 ? 106 ARG A C    6  
ATOM 10527 O O    . ARG A 1 106 ? -9.812  8.283   18.515 1.00 0.00 ? 106 ARG A O    6  
ATOM 10528 C CB   . ARG A 1 106 ? -9.745  5.718   16.326 1.00 0.00 ? 106 ARG A CB   6  
ATOM 10529 C CG   . ARG A 1 106 ? -10.390 4.456   16.902 1.00 0.00 ? 106 ARG A CG   6  
ATOM 10530 C CD   . ARG A 1 106 ? -9.557  3.891   18.055 1.00 0.00 ? 106 ARG A CD   6  
ATOM 10531 N NE   . ARG A 1 106 ? -9.654  2.414   18.074 1.00 0.00 ? 106 ARG A NE   6  
ATOM 10532 C CZ   . ARG A 1 106 ? -9.226  1.621   17.083 1.00 0.00 ? 106 ARG A CZ   6  
ATOM 10533 N NH1  . ARG A 1 106 ? -8.669  2.157   15.988 1.00 0.00 ? 106 ARG A NH1  6  
ATOM 10534 N NH2  . ARG A 1 106 ? -9.355  0.291   17.186 1.00 0.00 ? 106 ARG A NH2  6  
ATOM 10535 H H    . ARG A 1 106 ? -10.997 7.017   14.623 1.00 0.00 ? 106 ARG A H    6  
ATOM 10536 H HA   . ARG A 1 106 ? -11.408 6.693   17.310 1.00 0.00 ? 106 ARG A HA   6  
ATOM 10537 H HB2  . ARG A 1 106 ? -9.650  5.621   15.244 1.00 0.00 ? 106 ARG A HB2  6  
ATOM 10538 H HB3  . ARG A 1 106 ? -8.737  5.830   16.725 1.00 0.00 ? 106 ARG A HB3  6  
ATOM 10539 H HG2  . ARG A 1 106 ? -11.396 4.686   17.254 1.00 0.00 ? 106 ARG A HG2  6  
ATOM 10540 H HG3  . ARG A 1 106 ? -10.490 3.704   16.119 1.00 0.00 ? 106 ARG A HG3  6  
ATOM 10541 H HD2  . ARG A 1 106 ? -8.516  4.194   17.944 1.00 0.00 ? 106 ARG A HD2  6  
ATOM 10542 H HD3  . ARG A 1 106 ? -9.908  4.299   19.002 1.00 0.00 ? 106 ARG A HD3  6  
ATOM 10543 H HE   . ARG A 1 106 ? -10.065 1.982   18.876 1.00 0.00 ? 106 ARG A HE   6  
ATOM 10544 H HH11 . ARG A 1 106 ? -8.572  3.149   15.911 1.00 0.00 ? 106 ARG A HH11 6  
ATOM 10545 H HH12 . ARG A 1 106 ? -8.349  1.564   15.249 1.00 0.00 ? 106 ARG A HH12 6  
ATOM 10546 H HH21 . ARG A 1 106 ? -9.771  -0.109  18.003 1.00 0.00 ? 106 ARG A HH21 6  
ATOM 10547 H HH22 . ARG A 1 106 ? -9.036  -0.301  16.446 1.00 0.00 ? 106 ARG A HH22 6  
ATOM 10548 N N    . GLU A 1 107 ? -8.764  8.547   16.528 1.00 0.00 ? 107 GLU A N    6  
ATOM 10549 C CA   . GLU A 1 107 ? -7.839  9.552   17.024 1.00 0.00 ? 107 GLU A CA   6  
ATOM 10550 C C    . GLU A 1 107 ? -7.513  9.293   18.496 1.00 0.00 ? 107 GLU A C    6  
ATOM 10551 O O    . GLU A 1 107 ? -7.746  10.150  19.347 1.00 0.00 ? 107 GLU A O    6  
ATOM 10552 C CB   . GLU A 1 107 ? -8.402  10.960  16.826 1.00 0.00 ? 107 GLU A CB   6  
ATOM 10553 C CG   . GLU A 1 107 ? -9.682  11.158  17.642 1.00 0.00 ? 107 GLU A CG   6  
ATOM 10554 C CD   . GLU A 1 107 ? -9.756  12.577  18.209 1.00 0.00 ? 107 GLU A CD   6  
ATOM 10555 O OE1  . GLU A 1 107 ? -9.931  13.507  17.392 1.00 0.00 ? 107 GLU A OE1  6  
ATOM 10556 O OE2  . GLU A 1 107 ? -9.637  12.701  19.447 1.00 0.00 ? 107 GLU A OE2  6  
ATOM 10557 H H    . GLU A 1 107 ? -8.655  8.312   15.562 1.00 0.00 ? 107 GLU A H    6  
ATOM 10558 H HA   . GLU A 1 107 ? -6.938  9.439   16.420 1.00 0.00 ? 107 GLU A HA   6  
ATOM 10559 H HB2  . GLU A 1 107 ? -7.658  11.699  17.126 1.00 0.00 ? 107 GLU A HB2  6  
ATOM 10560 H HB3  . GLU A 1 107 ? -8.611  11.128  15.770 1.00 0.00 ? 107 GLU A HB3  6  
ATOM 10561 H HG2  . GLU A 1 107 ? -10.551 10.968  17.012 1.00 0.00 ? 107 GLU A HG2  6  
ATOM 10562 H HG3  . GLU A 1 107 ? -9.714  10.435  18.456 1.00 0.00 ? 107 GLU A HG3  6  
ATOM 10563 N N    . GLU A 1 108 ? -6.979  8.108   18.752 1.00 0.00 ? 108 GLU A N    6  
ATOM 10564 C CA   . GLU A 1 108 ? -6.618  7.725   20.106 1.00 0.00 ? 108 GLU A CA   6  
ATOM 10565 C C    . GLU A 1 108 ? -5.096  7.678   20.258 1.00 0.00 ? 108 GLU A C    6  
ATOM 10566 O O    . GLU A 1 108 ? -4.366  7.999   19.322 1.00 0.00 ? 108 GLU A O    6  
ATOM 10567 C CB   . GLU A 1 108 ? -7.249  6.383   20.484 1.00 0.00 ? 108 GLU A CB   6  
ATOM 10568 C CG   . GLU A 1 108 ? -8.272  6.555   21.608 1.00 0.00 ? 108 GLU A CG   6  
ATOM 10569 C CD   . GLU A 1 108 ? -8.149  5.430   22.638 1.00 0.00 ? 108 GLU A CD   6  
ATOM 10570 O OE1  . GLU A 1 108 ? -7.003  5.178   23.069 1.00 0.00 ? 108 GLU A OE1  6  
ATOM 10571 O OE2  . GLU A 1 108 ? -9.203  4.846   22.970 1.00 0.00 ? 108 GLU A OE2  6  
ATOM 10572 H H    . GLU A 1 108 ? -6.792  7.416   18.054 1.00 0.00 ? 108 GLU A H    6  
ATOM 10573 H HA   . GLU A 1 108 ? -7.030  8.506   20.747 1.00 0.00 ? 108 GLU A HA   6  
ATOM 10574 H HB2  . GLU A 1 108 ? -7.733  5.947   19.610 1.00 0.00 ? 108 GLU A HB2  6  
ATOM 10575 H HB3  . GLU A 1 108 ? -6.471  5.687   20.798 1.00 0.00 ? 108 GLU A HB3  6  
ATOM 10576 H HG2  . GLU A 1 108 ? -8.122  7.518   22.097 1.00 0.00 ? 108 GLU A HG2  6  
ATOM 10577 H HG3  . GLU A 1 108 ? -9.279  6.563   21.191 1.00 0.00 ? 108 GLU A HG3  6  
ATOM 10578 N N    . SER A 1 109 ? -4.664  7.275   21.443 1.00 0.00 ? 109 SER A N    6  
ATOM 10579 C CA   . SER A 1 109 ? -3.242  7.182   21.729 1.00 0.00 ? 109 SER A CA   6  
ATOM 10580 C C    . SER A 1 109 ? -2.561  8.520   21.439 1.00 0.00 ? 109 SER A C    6  
ATOM 10581 O O    . SER A 1 109 ? -2.097  8.756   20.324 1.00 0.00 ? 109 SER A O    6  
ATOM 10582 C CB   . SER A 1 109 ? -2.589  6.065   20.913 1.00 0.00 ? 109 SER A CB   6  
ATOM 10583 O OG   . SER A 1 109 ? -1.166  6.135   20.955 1.00 0.00 ? 109 SER A OG   6  
ATOM 10584 H H    . SER A 1 109 ? -5.265  7.016   22.200 1.00 0.00 ? 109 SER A H    6  
ATOM 10585 H HA   . SER A 1 109 ? -3.176  6.941   22.790 1.00 0.00 ? 109 SER A HA   6  
ATOM 10586 H HB2  . SER A 1 109 ? -2.916  5.098   21.294 1.00 0.00 ? 109 SER A HB2  6  
ATOM 10587 H HB3  . SER A 1 109 ? -2.924  6.129   19.877 1.00 0.00 ? 109 SER A HB3  6  
ATOM 10588 H HG   . SER A 1 109 ? -0.784  5.226   21.120 1.00 0.00 ? 109 SER A HG   6  
ATOM 10589 N N    . GLY A 1 110 ? -2.522  9.363   22.461 1.00 0.00 ? 110 GLY A N    6  
ATOM 10590 C CA   . GLY A 1 110 ? -1.905  10.671  22.329 1.00 0.00 ? 110 GLY A CA   6  
ATOM 10591 C C    . GLY A 1 110 ? -1.626  11.287  23.702 1.00 0.00 ? 110 GLY A C    6  
ATOM 10592 O O    . GLY A 1 110 ? -2.335  12.194  24.135 1.00 0.00 ? 110 GLY A O    6  
ATOM 10593 H H    . GLY A 1 110 ? -2.902  9.163   23.364 1.00 0.00 ? 110 GLY A H    6  
ATOM 10594 H HA2  . GLY A 1 110 ? -0.974  10.584  21.770 1.00 0.00 ? 110 GLY A HA2  6  
ATOM 10595 H HA3  . GLY A 1 110 ? -2.560  11.330  21.758 1.00 0.00 ? 110 GLY A HA3  6  
ATOM 10596 N N    . SER A 1 111 ? -0.592  10.768  24.348 1.00 0.00 ? 111 SER A N    6  
ATOM 10597 C CA   . SER A 1 111 ? -0.211  11.255  25.663 1.00 0.00 ? 111 SER A CA   6  
ATOM 10598 C C    . SER A 1 111 ? 1.267   11.650  25.666 1.00 0.00 ? 111 SER A C    6  
ATOM 10599 O O    . SER A 1 111 ? 2.142   10.797  25.521 1.00 0.00 ? 111 SER A O    6  
ATOM 10600 C CB   . SER A 1 111 ? -0.481  10.202  26.740 1.00 0.00 ? 111 SER A CB   6  
ATOM 10601 O OG   . SER A 1 111 ? 0.322   9.038   26.562 1.00 0.00 ? 111 SER A OG   6  
ATOM 10602 H H    . SER A 1 111 ? -0.021  10.030  23.989 1.00 0.00 ? 111 SER A H    6  
ATOM 10603 H HA   . SER A 1 111 ? -0.840  12.127  25.842 1.00 0.00 ? 111 SER A HA   6  
ATOM 10604 H HB2  . SER A 1 111 ? -0.285  10.631  27.723 1.00 0.00 ? 111 SER A HB2  6  
ATOM 10605 H HB3  . SER A 1 111 ? -1.534  9.923   26.718 1.00 0.00 ? 111 SER A HB3  6  
ATOM 10606 H HG   . SER A 1 111 ? 0.654   8.993   25.620 1.00 0.00 ? 111 SER A HG   6  
ATOM 10607 N N    . GLY A 1 112 ? 1.501   12.944  25.832 1.00 0.00 ? 112 GLY A N    6  
ATOM 10608 C CA   . GLY A 1 112 ? 2.858   13.462  25.855 1.00 0.00 ? 112 GLY A CA   6  
ATOM 10609 C C    . GLY A 1 112 ? 3.306   13.762  27.288 1.00 0.00 ? 112 GLY A C    6  
ATOM 10610 O O    . GLY A 1 112 ? 2.475   13.949  28.175 1.00 0.00 ? 112 GLY A O    6  
ATOM 10611 H H    . GLY A 1 112 ? 0.784   13.631  25.949 1.00 0.00 ? 112 GLY A H    6  
ATOM 10612 H HA2  . GLY A 1 112 ? 3.536   12.739  25.402 1.00 0.00 ? 112 GLY A HA2  6  
ATOM 10613 H HA3  . GLY A 1 112 ? 2.915   14.371  25.256 1.00 0.00 ? 112 GLY A HA3  6  
ATOM 10614 N N    . PRO A 1 113 ? 4.653   13.798  27.473 1.00 0.00 ? 113 PRO A N    6  
ATOM 10615 C CA   . PRO A 1 113 ? 5.221   14.072  28.782 1.00 0.00 ? 113 PRO A CA   6  
ATOM 10616 C C    . PRO A 1 113 ? 5.097   15.555  29.134 1.00 0.00 ? 113 PRO A C    6  
ATOM 10617 O O    . PRO A 1 113 ? 5.386   16.419  28.308 1.00 0.00 ? 113 PRO A O    6  
ATOM 10618 C CB   . PRO A 1 113 ? 6.663   13.601  28.691 1.00 0.00 ? 113 PRO A CB   6  
ATOM 10619 C CG   . PRO A 1 113 ? 6.980   13.513  27.207 1.00 0.00 ? 113 PRO A CG   6  
ATOM 10620 C CD   . PRO A 1 113 ? 5.666   13.581  26.445 1.00 0.00 ? 113 PRO A CD   6  
ATOM 10621 H HA   . PRO A 1 113 ? 4.714   13.579  29.490 1.00 0.00 ? 113 PRO A HA   6  
ATOM 10622 H HB2  . PRO A 1 113 ? 7.334   14.298  29.192 1.00 0.00 ? 113 PRO A HB2  6  
ATOM 10623 H HB3  . PRO A 1 113 ? 6.789   12.633  29.175 1.00 0.00 ? 113 PRO A HB3  6  
ATOM 10624 H HG2  . PRO A 1 113 ? 7.638   14.329  26.908 1.00 0.00 ? 113 PRO A HG2  6  
ATOM 10625 H HG3  . PRO A 1 113 ? 7.503   12.583  26.983 1.00 0.00 ? 113 PRO A HG3  6  
ATOM 10626 H HD2  . PRO A 1 113 ? 5.672   14.393  25.717 1.00 0.00 ? 113 PRO A HD2  6  
ATOM 10627 H HD3  . PRO A 1 113 ? 5.480   12.660  25.893 1.00 0.00 ? 113 PRO A HD3  6  
ATOM 10628 N N    . SER A 1 114 ? 4.668   15.805  30.363 1.00 0.00 ? 114 SER A N    6  
ATOM 10629 C CA   . SER A 1 114 ? 4.503   17.169  30.835 1.00 0.00 ? 114 SER A CA   6  
ATOM 10630 C C    . SER A 1 114 ? 5.697   18.021  30.401 1.00 0.00 ? 114 SER A C    6  
ATOM 10631 O O    . SER A 1 114 ? 5.531   19.021  29.704 1.00 0.00 ? 114 SER A O    6  
ATOM 10632 C CB   . SER A 1 114 ? 4.345   17.211  32.356 1.00 0.00 ? 114 SER A CB   6  
ATOM 10633 O OG   . SER A 1 114 ? 3.178   17.926  32.753 1.00 0.00 ? 114 SER A OG   6  
ATOM 10634 H H    . SER A 1 114 ? 4.435   15.096  31.029 1.00 0.00 ? 114 SER A H    6  
ATOM 10635 H HA   . SER A 1 114 ? 3.587   17.528  30.365 1.00 0.00 ? 114 SER A HA   6  
ATOM 10636 H HB2  . SER A 1 114 ? 4.295   16.193  32.743 1.00 0.00 ? 114 SER A HB2  6  
ATOM 10637 H HB3  . SER A 1 114 ? 5.225   17.677  32.799 1.00 0.00 ? 114 SER A HB3  6  
ATOM 10638 H HG   . SER A 1 114 ? 2.365   17.363  32.604 1.00 0.00 ? 114 SER A HG   6  
ATOM 10639 N N    . SER A 1 115 ? 6.875   17.595  30.833 1.00 0.00 ? 115 SER A N    6  
ATOM 10640 C CA   . SER A 1 115 ? 8.097   18.306  30.498 1.00 0.00 ? 115 SER A CA   6  
ATOM 10641 C C    . SER A 1 115 ? 8.486   18.024  29.046 1.00 0.00 ? 115 SER A C    6  
ATOM 10642 O O    . SER A 1 115 ? 9.031   16.964  28.740 1.00 0.00 ? 115 SER A O    6  
ATOM 10643 C CB   . SER A 1 115 ? 9.238   17.913  31.439 1.00 0.00 ? 115 SER A CB   6  
ATOM 10644 O OG   . SER A 1 115 ? 9.615   18.986  32.298 1.00 0.00 ? 115 SER A OG   6  
ATOM 10645 H H    . SER A 1 115 ? 7.002   16.781  31.400 1.00 0.00 ? 115 SER A H    6  
ATOM 10646 H HA   . SER A 1 115 ? 7.863   19.362  30.634 1.00 0.00 ? 115 SER A HA   6  
ATOM 10647 H HB2  . SER A 1 115 ? 8.933   17.057  32.040 1.00 0.00 ? 115 SER A HB2  6  
ATOM 10648 H HB3  . SER A 1 115 ? 10.101  17.599  30.851 1.00 0.00 ? 115 SER A HB3  6  
ATOM 10649 H HG   . SER A 1 115 ? 9.893   19.778  31.755 1.00 0.00 ? 115 SER A HG   6  
ATOM 10650 N N    . GLY A 1 116 ? 8.191   18.991  28.189 1.00 0.00 ? 116 GLY A N    6  
ATOM 10651 C CA   . GLY A 1 116 ? 8.502   18.860  26.776 1.00 0.00 ? 116 GLY A CA   6  
ATOM 10652 C C    . GLY A 1 116 ? 8.478   20.222  26.081 1.00 0.00 ? 116 GLY A C    6  
ATOM 10653 O O    . GLY A 1 116 ? 9.495   20.672  25.554 1.00 0.00 ? 116 GLY A O    6  
ATOM 10654 H H    . GLY A 1 116 ? 7.747   19.850  28.446 1.00 0.00 ? 116 GLY A H    6  
ATOM 10655 H HA2  . GLY A 1 116 ? 9.486   18.404  26.658 1.00 0.00 ? 116 GLY A HA2  6  
ATOM 10656 H HA3  . GLY A 1 116 ? 7.783   18.193  26.302 1.00 0.00 ? 116 GLY A HA3  6  
ATOM 10657 N N    . GLY A 1 1   ? -23.751 -34.058 -7.448 1.00 0.00 ? 1   GLY A N    7  
ATOM 10658 C CA   . GLY A 1 1   ? -23.424 -32.692 -7.820 1.00 0.00 ? 1   GLY A CA   7  
ATOM 10659 C C    . GLY A 1 1   ? -23.460 -31.768 -6.601 1.00 0.00 ? 1   GLY A C    7  
ATOM 10660 O O    . GLY A 1 1   ? -24.428 -31.772 -5.843 1.00 0.00 ? 1   GLY A O    7  
ATOM 10661 H H1   . GLY A 1 1   ? -24.026 -34.182 -6.495 1.00 0.00 ? 1   GLY A H1   7  
ATOM 10662 H HA2  . GLY A 1 1   ? -22.434 -32.662 -8.275 1.00 0.00 ? 1   GLY A HA2  7  
ATOM 10663 H HA3  . GLY A 1 1   ? -24.130 -32.337 -8.571 1.00 0.00 ? 1   GLY A HA3  7  
ATOM 10664 N N    . SER A 1 2   ? -22.391 -30.999 -6.450 1.00 0.00 ? 2   SER A N    7  
ATOM 10665 C CA   . SER A 1 2   ? -22.288 -30.071 -5.336 1.00 0.00 ? 2   SER A CA   7  
ATOM 10666 C C    . SER A 1 2   ? -22.130 -28.642 -5.858 1.00 0.00 ? 2   SER A C    7  
ATOM 10667 O O    . SER A 1 2   ? -21.531 -28.424 -6.911 1.00 0.00 ? 2   SER A O    7  
ATOM 10668 C CB   . SER A 1 2   ? -21.116 -30.436 -4.423 1.00 0.00 ? 2   SER A CB   7  
ATOM 10669 O OG   . SER A 1 2   ? -21.472 -31.435 -3.472 1.00 0.00 ? 2   SER A OG   7  
ATOM 10670 H H    . SER A 1 2   ? -21.608 -31.002 -7.072 1.00 0.00 ? 2   SER A H    7  
ATOM 10671 H HA   . SER A 1 2   ? -23.223 -30.176 -4.786 1.00 0.00 ? 2   SER A HA   7  
ATOM 10672 H HB2  . SER A 1 2   ? -20.282 -30.792 -5.028 1.00 0.00 ? 2   SER A HB2  7  
ATOM 10673 H HB3  . SER A 1 2   ? -20.773 -29.543 -3.900 1.00 0.00 ? 2   SER A HB3  7  
ATOM 10674 H HG   . SER A 1 2   ? -21.585 -32.318 -3.928 1.00 0.00 ? 2   SER A HG   7  
ATOM 10675 N N    . SER A 1 3   ? -22.677 -27.704 -5.099 1.00 0.00 ? 3   SER A N    7  
ATOM 10676 C CA   . SER A 1 3   ? -22.604 -26.302 -5.471 1.00 0.00 ? 3   SER A CA   7  
ATOM 10677 C C    . SER A 1 3   ? -23.224 -25.436 -4.373 1.00 0.00 ? 3   SER A C    7  
ATOM 10678 O O    . SER A 1 3   ? -24.176 -25.850 -3.714 1.00 0.00 ? 3   SER A O    7  
ATOM 10679 C CB   . SER A 1 3   ? -23.307 -26.050 -6.807 1.00 0.00 ? 3   SER A CB   7  
ATOM 10680 O OG   . SER A 1 3   ? -22.658 -25.035 -7.568 1.00 0.00 ? 3   SER A OG   7  
ATOM 10681 H H    . SER A 1 3   ? -23.163 -27.890 -4.244 1.00 0.00 ? 3   SER A H    7  
ATOM 10682 H HA   . SER A 1 3   ? -21.541 -26.086 -5.574 1.00 0.00 ? 3   SER A HA   7  
ATOM 10683 H HB2  . SER A 1 3   ? -23.333 -26.975 -7.383 1.00 0.00 ? 3   SER A HB2  7  
ATOM 10684 H HB3  . SER A 1 3   ? -24.341 -25.759 -6.623 1.00 0.00 ? 3   SER A HB3  7  
ATOM 10685 H HG   . SER A 1 3   ? -22.553 -24.208 -7.017 1.00 0.00 ? 3   SER A HG   7  
ATOM 10686 N N    . GLY A 1 4   ? -22.659 -24.249 -4.210 1.00 0.00 ? 4   GLY A N    7  
ATOM 10687 C CA   . GLY A 1 4   ? -23.145 -23.320 -3.203 1.00 0.00 ? 4   GLY A CA   7  
ATOM 10688 C C    . GLY A 1 4   ? -22.490 -21.947 -3.363 1.00 0.00 ? 4   GLY A C    7  
ATOM 10689 O O    . GLY A 1 4   ? -21.521 -21.799 -4.106 1.00 0.00 ? 4   GLY A O    7  
ATOM 10690 H H    . GLY A 1 4   ? -21.885 -23.919 -4.751 1.00 0.00 ? 4   GLY A H    7  
ATOM 10691 H HA2  . GLY A 1 4   ? -24.227 -23.223 -3.285 1.00 0.00 ? 4   GLY A HA2  7  
ATOM 10692 H HA3  . GLY A 1 4   ? -22.934 -23.714 -2.209 1.00 0.00 ? 4   GLY A HA3  7  
ATOM 10693 N N    . SER A 1 5   ? -23.045 -20.976 -2.652 1.00 0.00 ? 5   SER A N    7  
ATOM 10694 C CA   . SER A 1 5   ? -22.527 -19.619 -2.706 1.00 0.00 ? 5   SER A CA   7  
ATOM 10695 C C    . SER A 1 5   ? -23.290 -18.729 -1.723 1.00 0.00 ? 5   SER A C    7  
ATOM 10696 O O    . SER A 1 5   ? -24.298 -19.147 -1.154 1.00 0.00 ? 5   SER A O    7  
ATOM 10697 C CB   . SER A 1 5   ? -22.622 -19.049 -4.122 1.00 0.00 ? 5   SER A CB   7  
ATOM 10698 O OG   . SER A 1 5   ? -21.383 -18.497 -4.559 1.00 0.00 ? 5   SER A OG   7  
ATOM 10699 H H    . SER A 1 5   ? -23.833 -21.104 -2.050 1.00 0.00 ? 5   SER A H    7  
ATOM 10700 H HA   . SER A 1 5   ? -21.480 -19.699 -2.416 1.00 0.00 ? 5   SER A HA   7  
ATOM 10701 H HB2  . SER A 1 5   ? -22.931 -19.836 -4.810 1.00 0.00 ? 5   SER A HB2  7  
ATOM 10702 H HB3  . SER A 1 5   ? -23.393 -18.279 -4.152 1.00 0.00 ? 5   SER A HB3  7  
ATOM 10703 H HG   . SER A 1 5   ? -21.151 -17.698 -4.005 1.00 0.00 ? 5   SER A HG   7  
ATOM 10704 N N    . SER A 1 6   ? -22.781 -17.518 -1.553 1.00 0.00 ? 6   SER A N    7  
ATOM 10705 C CA   . SER A 1 6   ? -23.402 -16.565 -0.649 1.00 0.00 ? 6   SER A CA   7  
ATOM 10706 C C    . SER A 1 6   ? -22.598 -15.263 -0.627 1.00 0.00 ? 6   SER A C    7  
ATOM 10707 O O    . SER A 1 6   ? -21.491 -15.205 -1.160 1.00 0.00 ? 6   SER A O    7  
ATOM 10708 C CB   . SER A 1 6   ? -23.517 -17.141 0.764  1.00 0.00 ? 6   SER A CB   7  
ATOM 10709 O OG   . SER A 1 6   ? -24.825 -17.641 1.031  1.00 0.00 ? 6   SER A OG   7  
ATOM 10710 H H    . SER A 1 6   ? -21.962 -17.185 -2.020 1.00 0.00 ? 6   SER A H    7  
ATOM 10711 H HA   . SER A 1 6   ? -24.400 -16.392 -1.052 1.00 0.00 ? 6   SER A HA   7  
ATOM 10712 H HB2  . SER A 1 6   ? -22.790 -17.943 0.889  1.00 0.00 ? 6   SER A HB2  7  
ATOM 10713 H HB3  . SER A 1 6   ? -23.269 -16.369 1.492  1.00 0.00 ? 6   SER A HB3  7  
ATOM 10714 H HG   . SER A 1 6   ? -24.916 -18.570 0.671  1.00 0.00 ? 6   SER A HG   7  
ATOM 10715 N N    . GLY A 1 7   ? -23.187 -14.252 -0.006 1.00 0.00 ? 7   GLY A N    7  
ATOM 10716 C CA   . GLY A 1 7   ? -22.539 -12.955 0.092  1.00 0.00 ? 7   GLY A CA   7  
ATOM 10717 C C    . GLY A 1 7   ? -23.286 -12.041 1.065  1.00 0.00 ? 7   GLY A C    7  
ATOM 10718 O O    . GLY A 1 7   ? -24.514 -11.974 1.041  1.00 0.00 ? 7   GLY A O    7  
ATOM 10719 H H    . GLY A 1 7   ? -24.087 -14.308 0.424  1.00 0.00 ? 7   GLY A H    7  
ATOM 10720 H HA2  . GLY A 1 7   ? -21.509 -13.083 0.425  1.00 0.00 ? 7   GLY A HA2  7  
ATOM 10721 H HA3  . GLY A 1 7   ? -22.499 -12.489 -0.893 1.00 0.00 ? 7   GLY A HA3  7  
ATOM 10722 N N    . MET A 1 8   ? -22.514 -11.359 1.898  1.00 0.00 ? 8   MET A N    7  
ATOM 10723 C CA   . MET A 1 8   ? -23.087 -10.452 2.878  1.00 0.00 ? 8   MET A CA   7  
ATOM 10724 C C    . MET A 1 8   ? -22.241 -9.184  3.012  1.00 0.00 ? 8   MET A C    7  
ATOM 10725 O O    . MET A 1 8   ? -21.170 -9.082  2.416  1.00 0.00 ? 8   MET A O    7  
ATOM 10726 C CB   . MET A 1 8   ? -23.175 -11.154 4.234  1.00 0.00 ? 8   MET A CB   7  
ATOM 10727 C CG   . MET A 1 8   ? -24.504 -11.896 4.382  1.00 0.00 ? 8   MET A CG   7  
ATOM 10728 S SD   . MET A 1 8   ? -24.245 -13.654 4.213  1.00 0.00 ? 8   MET A SD   7  
ATOM 10729 C CE   . MET A 1 8   ? -23.587 -14.028 5.830  1.00 0.00 ? 8   MET A CE   7  
ATOM 10730 H H    . MET A 1 8   ? -21.515 -11.419 1.911  1.00 0.00 ? 8   MET A H    7  
ATOM 10731 H HA   . MET A 1 8   ? -24.076 -10.198 2.497  1.00 0.00 ? 8   MET A HA   7  
ATOM 10732 H HB2  . MET A 1 8   ? -22.348 -11.857 4.338  1.00 0.00 ? 8   MET A HB2  7  
ATOM 10733 H HB3  . MET A 1 8   ? -23.072 -10.421 5.034  1.00 0.00 ? 8   MET A HB3  7  
ATOM 10734 H HG2  . MET A 1 8   ? -24.946 -11.678 5.355  1.00 0.00 ? 8   MET A HG2  7  
ATOM 10735 H HG3  . MET A 1 8   ? -25.210 -11.550 3.627  1.00 0.00 ? 8   MET A HG3  7  
ATOM 10736 H HE1  . MET A 1 8   ? -23.222 -15.055 5.846  1.00 0.00 ? 8   MET A HE1  7  
ATOM 10737 H HE2  . MET A 1 8   ? -22.766 -13.347 6.055  1.00 0.00 ? 8   MET A HE2  7  
ATOM 10738 H HE3  . MET A 1 8   ? -24.372 -13.910 6.577  1.00 0.00 ? 8   MET A HE3  7  
ATOM 10739 N N    . GLU A 1 9   ? -22.753 -8.250  3.800  1.00 0.00 ? 9   GLU A N    7  
ATOM 10740 C CA   . GLU A 1 9   ? -22.058 -6.994  4.021  1.00 0.00 ? 9   GLU A CA   7  
ATOM 10741 C C    . GLU A 1 9   ? -22.577 -6.315  5.290  1.00 0.00 ? 9   GLU A C    7  
ATOM 10742 O O    . GLU A 1 9   ? -23.654 -6.651  5.781  1.00 0.00 ? 9   GLU A O    7  
ATOM 10743 C CB   . GLU A 1 9   ? -22.197 -6.070  2.809  1.00 0.00 ? 9   GLU A CB   7  
ATOM 10744 C CG   . GLU A 1 9   ? -20.887 -5.995  2.023  1.00 0.00 ? 9   GLU A CG   7  
ATOM 10745 C CD   . GLU A 1 9   ? -20.914 -4.840  1.020  1.00 0.00 ? 9   GLU A CD   7  
ATOM 10746 O OE1  . GLU A 1 9   ? -21.184 -3.705  1.469  1.00 0.00 ? 9   GLU A OE1  7  
ATOM 10747 O OE2  . GLU A 1 9   ? -20.665 -5.118  -0.173 1.00 0.00 ? 9   GLU A OE2  7  
ATOM 10748 H H    . GLU A 1 9   ? -23.625 -8.341  4.281  1.00 0.00 ? 9   GLU A H    7  
ATOM 10749 H HA   . GLU A 1 9   ? -21.009 -7.261  4.147  1.00 0.00 ? 9   GLU A HA   7  
ATOM 10750 H HB2  . GLU A 1 9   ? -22.994 -6.433  2.160  1.00 0.00 ? 9   GLU A HB2  7  
ATOM 10751 H HB3  . GLU A 1 9   ? -22.485 -5.072  3.139  1.00 0.00 ? 9   GLU A HB3  7  
ATOM 10752 H HG2  . GLU A 1 9   ? -20.052 -5.863  2.712  1.00 0.00 ? 9   GLU A HG2  7  
ATOM 10753 H HG3  . GLU A 1 9   ? -20.720 -6.934  1.496  1.00 0.00 ? 9   GLU A HG3  7  
ATOM 10754 N N    . LYS A 1 10  ? -21.788 -5.373  5.784  1.00 0.00 ? 10  LYS A N    7  
ATOM 10755 C CA   . LYS A 1 10  ? -22.155 -4.644  6.987  1.00 0.00 ? 10  LYS A CA   7  
ATOM 10756 C C    . LYS A 1 10  ? -21.159 -3.505  7.211  1.00 0.00 ? 10  LYS A C    7  
ATOM 10757 O O    . LYS A 1 10  ? -20.037 -3.548  6.709  1.00 0.00 ? 10  LYS A O    7  
ATOM 10758 C CB   . LYS A 1 10  ? -22.275 -5.599  8.176  1.00 0.00 ? 10  LYS A CB   7  
ATOM 10759 C CG   . LYS A 1 10  ? -20.900 -6.115  8.605  1.00 0.00 ? 10  LYS A CG   7  
ATOM 10760 C CD   . LYS A 1 10  ? -20.587 -7.458  7.943  1.00 0.00 ? 10  LYS A CD   7  
ATOM 10761 C CE   . LYS A 1 10  ? -19.173 -7.927  8.295  1.00 0.00 ? 10  LYS A CE   7  
ATOM 10762 N NZ   . LYS A 1 10  ? -19.225 -9.155  9.120  1.00 0.00 ? 10  LYS A NZ   7  
ATOM 10763 H H    . LYS A 1 10  ? -20.914 -5.106  5.378  1.00 0.00 ? 10  LYS A H    7  
ATOM 10764 H HA   . LYS A 1 10  ? -23.142 -4.213  6.819  1.00 0.00 ? 10  LYS A HA   7  
ATOM 10765 H HB2  . LYS A 1 10  ? -22.752 -5.088  9.012  1.00 0.00 ? 10  LYS A HB2  7  
ATOM 10766 H HB3  . LYS A 1 10  ? -22.915 -6.440  7.909  1.00 0.00 ? 10  LYS A HB3  7  
ATOM 10767 H HG2  . LYS A 1 10  ? -20.134 -5.387  8.338  1.00 0.00 ? 10  LYS A HG2  7  
ATOM 10768 H HG3  . LYS A 1 10  ? -20.871 -6.225  9.689  1.00 0.00 ? 10  LYS A HG3  7  
ATOM 10769 H HD2  . LYS A 1 10  ? -21.312 -8.205  8.266  1.00 0.00 ? 10  LYS A HD2  7  
ATOM 10770 H HD3  . LYS A 1 10  ? -20.684 -7.366  6.861  1.00 0.00 ? 10  LYS A HD3  7  
ATOM 10771 H HE2  . LYS A 1 10  ? -18.609 -8.119  7.382  1.00 0.00 ? 10  LYS A HE2  7  
ATOM 10772 H HE3  . LYS A 1 10  ? -18.647 -7.141  8.836  1.00 0.00 ? 10  LYS A HE3  7  
ATOM 10773 H HZ1  . LYS A 1 10  ? -18.837 -9.919  8.605  1.00 0.00 ? 10  LYS A HZ1  7  
ATOM 10774 H HZ2  . LYS A 1 10  ? -18.698 -9.016  9.958  1.00 0.00 ? 10  LYS A HZ2  7  
ATOM 10775 H HZ3  . LYS A 1 10  ? -20.176 -9.359  9.354  1.00 0.00 ? 10  LYS A HZ3  7  
ATOM 10776 N N    . THR A 1 11  ? -21.606 -2.511  7.966  1.00 0.00 ? 11  THR A N    7  
ATOM 10777 C CA   . THR A 1 11  ? -20.768 -1.362  8.263  1.00 0.00 ? 11  THR A CA   7  
ATOM 10778 C C    . THR A 1 11  ? -21.256 -0.660  9.531  1.00 0.00 ? 11  THR A C    7  
ATOM 10779 O O    . THR A 1 11  ? -22.453 -0.641  9.813  1.00 0.00 ? 11  THR A O    7  
ATOM 10780 C CB   . THR A 1 11  ? -20.758 -0.454  7.031  1.00 0.00 ? 11  THR A CB   7  
ATOM 10781 O OG1  . THR A 1 11  ? -19.818 0.566   7.360  1.00 0.00 ? 11  THR A OG1  7  
ATOM 10782 C CG2  . THR A 1 11  ? -22.077 0.300   6.848  1.00 0.00 ? 11  THR A CG2  7  
ATOM 10783 H H    . THR A 1 11  ? -22.520 -2.484  8.370  1.00 0.00 ? 11  THR A H    7  
ATOM 10784 H HA   . THR A 1 11  ? -19.757 -1.716  8.462  1.00 0.00 ? 11  THR A HA   7  
ATOM 10785 H HB   . THR A 1 11  ? -20.504 -1.018  6.134  1.00 0.00 ? 11  THR A HB   7  
ATOM 10786 H HG1  . THR A 1 11  ? -20.139 1.083   8.154  1.00 0.00 ? 11  THR A HG1  7  
ATOM 10787 H HG21 . THR A 1 11  ? -22.586 -0.070  5.958  1.00 0.00 ? 11  THR A HG21 7  
ATOM 10788 H HG22 . THR A 1 11  ? -22.710 0.141   7.721  1.00 0.00 ? 11  THR A HG22 7  
ATOM 10789 H HG23 . THR A 1 11  ? -21.874 1.365   6.735  1.00 0.00 ? 11  THR A HG23 7  
ATOM 10790 N N    . LEU A 1 12  ? -20.304 -0.101  10.263 1.00 0.00 ? 12  LEU A N    7  
ATOM 10791 C CA   . LEU A 1 12  ? -20.621 0.601   11.495 1.00 0.00 ? 12  LEU A CA   7  
ATOM 10792 C C    . LEU A 1 12  ? -19.902 1.951   11.508 1.00 0.00 ? 12  LEU A C    7  
ATOM 10793 O O    . LEU A 1 12  ? -18.715 2.029   11.198 1.00 0.00 ? 12  LEU A O    7  
ATOM 10794 C CB   . LEU A 1 12  ? -20.304 -0.276  12.708 1.00 0.00 ? 12  LEU A CB   7  
ATOM 10795 C CG   . LEU A 1 12  ? -21.468 -0.545  13.665 1.00 0.00 ? 12  LEU A CG   7  
ATOM 10796 C CD1  . LEU A 1 12  ? -22.065 0.765   14.182 1.00 0.00 ? 12  LEU A CD1  7  
ATOM 10797 C CD2  . LEU A 1 12  ? -22.523 -1.436  13.008 1.00 0.00 ? 12  LEU A CD2  7  
ATOM 10798 H H    . LEU A 1 12  ? -19.332 -0.121  10.027 1.00 0.00 ? 12  LEU A H    7  
ATOM 10799 H HA   . LEU A 1 12  ? -21.696 0.781   11.501 1.00 0.00 ? 12  LEU A HA   7  
ATOM 10800 H HB2  . LEU A 1 12  ? -19.926 -1.234  12.350 1.00 0.00 ? 12  LEU A HB2  7  
ATOM 10801 H HB3  . LEU A 1 12  ? -19.498 0.194   13.271 1.00 0.00 ? 12  LEU A HB3  7  
ATOM 10802 H HG   . LEU A 1 12  ? -21.082 -1.086  14.529 1.00 0.00 ? 12  LEU A HG   7  
ATOM 10803 H HD11 . LEU A 1 12  ? -22.787 0.549   14.969 1.00 0.00 ? 12  LEU A HD11 7  
ATOM 10804 H HD12 . LEU A 1 12  ? -21.270 1.395   14.581 1.00 0.00 ? 12  LEU A HD12 7  
ATOM 10805 H HD13 . LEU A 1 12  ? -22.564 1.285   13.364 1.00 0.00 ? 12  LEU A HD13 7  
ATOM 10806 H HD21 . LEU A 1 12  ? -22.693 -1.104  11.984 1.00 0.00 ? 12  LEU A HD21 7  
ATOM 10807 H HD22 . LEU A 1 12  ? -22.174 -2.469  13.002 1.00 0.00 ? 12  LEU A HD22 7  
ATOM 10808 H HD23 . LEU A 1 12  ? -23.455 -1.371  13.570 1.00 0.00 ? 12  LEU A HD23 7  
ATOM 10809 N N    . GLU A 1 13  ? -20.653 2.981   11.871 1.00 0.00 ? 13  GLU A N    7  
ATOM 10810 C CA   . GLU A 1 13  ? -20.102 4.325   11.928 1.00 0.00 ? 13  GLU A CA   7  
ATOM 10811 C C    . GLU A 1 13  ? -20.755 5.118   13.062 1.00 0.00 ? 13  GLU A C    7  
ATOM 10812 O O    . GLU A 1 13  ? -21.942 5.437   12.997 1.00 0.00 ? 13  GLU A O    7  
ATOM 10813 C CB   . GLU A 1 13  ? -20.269 5.044   10.588 1.00 0.00 ? 13  GLU A CB   7  
ATOM 10814 C CG   . GLU A 1 13  ? -19.154 6.069   10.373 1.00 0.00 ? 13  GLU A CG   7  
ATOM 10815 C CD   . GLU A 1 13  ? -18.766 6.155   8.895  1.00 0.00 ? 13  GLU A CD   7  
ATOM 10816 O OE1  . GLU A 1 13  ? -19.494 6.852   8.157  1.00 0.00 ? 13  GLU A OE1  7  
ATOM 10817 O OE2  . GLU A 1 13  ? -17.749 5.521   8.538  1.00 0.00 ? 13  GLU A OE2  7  
ATOM 10818 H H    . GLU A 1 13  ? -21.618 2.909   12.122 1.00 0.00 ? 13  GLU A H    7  
ATOM 10819 H HA   . GLU A 1 13  ? -19.039 4.194   12.133 1.00 0.00 ? 13  GLU A HA   7  
ATOM 10820 H HB2  . GLU A 1 13  ? -20.260 4.316   9.777  1.00 0.00 ? 13  GLU A HB2  7  
ATOM 10821 H HB3  . GLU A 1 13  ? -21.238 5.543   10.557 1.00 0.00 ? 13  GLU A HB3  7  
ATOM 10822 H HG2  . GLU A 1 13  ? -19.482 7.048   10.724 1.00 0.00 ? 13  GLU A HG2  7  
ATOM 10823 H HG3  . GLU A 1 13  ? -18.282 5.793   10.966 1.00 0.00 ? 13  GLU A HG3  7  
ATOM 10824 N N    . THR A 1 14  ? -19.952 5.415   14.073 1.00 0.00 ? 14  THR A N    7  
ATOM 10825 C CA   . THR A 1 14  ? -20.438 6.165   15.219 1.00 0.00 ? 14  THR A CA   7  
ATOM 10826 C C    . THR A 1 14  ? -20.291 7.668   14.973 1.00 0.00 ? 14  THR A C    7  
ATOM 10827 O O    . THR A 1 14  ? -19.785 8.084   13.932 1.00 0.00 ? 14  THR A O    7  
ATOM 10828 C CB   . THR A 1 14  ? -19.685 5.676   16.457 1.00 0.00 ? 14  THR A CB   7  
ATOM 10829 O OG1  . THR A 1 14  ? -18.313 5.735   16.076 1.00 0.00 ? 14  THR A OG1  7  
ATOM 10830 C CG2  . THR A 1 14  ? -19.929 4.193   16.743 1.00 0.00 ? 14  THR A CG2  7  
ATOM 10831 H H    . THR A 1 14  ? -18.988 5.152   14.117 1.00 0.00 ? 14  THR A H    7  
ATOM 10832 H HA   . THR A 1 14  ? -21.502 5.962   15.336 1.00 0.00 ? 14  THR A HA   7  
ATOM 10833 H HB   . THR A 1 14  ? -19.929 6.286   17.327 1.00 0.00 ? 14  THR A HB   7  
ATOM 10834 H HG1  . THR A 1 14  ? -18.059 6.677   15.858 1.00 0.00 ? 14  THR A HG1  7  
ATOM 10835 H HG21 . THR A 1 14  ? -20.450 3.741   15.899 1.00 0.00 ? 14  THR A HG21 7  
ATOM 10836 H HG22 . THR A 1 14  ? -18.974 3.690   16.892 1.00 0.00 ? 14  THR A HG22 7  
ATOM 10837 H HG23 . THR A 1 14  ? -20.537 4.092   17.642 1.00 0.00 ? 14  THR A HG23 7  
ATOM 10838 N N    . VAL A 1 15  ? -20.744 8.442   15.949 1.00 0.00 ? 15  VAL A N    7  
ATOM 10839 C CA   . VAL A 1 15  ? -20.669 9.890   15.851 1.00 0.00 ? 15  VAL A CA   7  
ATOM 10840 C C    . VAL A 1 15  ? -19.262 10.295  15.409 1.00 0.00 ? 15  VAL A C    7  
ATOM 10841 O O    . VAL A 1 15  ? -18.282 9.988   16.086 1.00 0.00 ? 15  VAL A O    7  
ATOM 10842 C CB   . VAL A 1 15  ? -21.085 10.525  17.180 1.00 0.00 ? 15  VAL A CB   7  
ATOM 10843 C CG1  . VAL A 1 15  ? -22.608 10.618  17.290 1.00 0.00 ? 15  VAL A CG1  7  
ATOM 10844 C CG2  . VAL A 1 15  ? -20.495 9.757   18.364 1.00 0.00 ? 15  VAL A CG2  7  
ATOM 10845 H H    . VAL A 1 15  ? -21.154 8.095   16.792 1.00 0.00 ? 15  VAL A H    7  
ATOM 10846 H HA   . VAL A 1 15  ? -21.382 10.205  15.089 1.00 0.00 ? 15  VAL A HA   7  
ATOM 10847 H HB   . VAL A 1 15  ? -20.685 11.539  17.206 1.00 0.00 ? 15  VAL A HB   7  
ATOM 10848 H HG11 . VAL A 1 15  ? -22.881 11.559  17.768 1.00 0.00 ? 15  VAL A HG11 7  
ATOM 10849 H HG12 . VAL A 1 15  ? -23.048 10.576  16.294 1.00 0.00 ? 15  VAL A HG12 7  
ATOM 10850 H HG13 . VAL A 1 15  ? -22.981 9.786   17.887 1.00 0.00 ? 15  VAL A HG13 7  
ATOM 10851 H HG21 . VAL A 1 15  ? -20.397 10.426  19.219 1.00 0.00 ? 15  VAL A HG21 7  
ATOM 10852 H HG22 . VAL A 1 15  ? -21.154 8.929   18.624 1.00 0.00 ? 15  VAL A HG22 7  
ATOM 10853 H HG23 . VAL A 1 15  ? -19.514 9.368   18.092 1.00 0.00 ? 15  VAL A HG23 7  
ATOM 10854 N N    . PRO A 1 16  ? -19.206 10.997  14.245 1.00 0.00 ? 16  PRO A N    7  
ATOM 10855 C CA   . PRO A 1 16  ? -17.935 11.448  13.704 1.00 0.00 ? 16  PRO A CA   7  
ATOM 10856 C C    . PRO A 1 16  ? -17.397 12.644  14.492 1.00 0.00 ? 16  PRO A C    7  
ATOM 10857 O O    . PRO A 1 16  ? -17.880 13.764  14.335 1.00 0.00 ? 16  PRO A O    7  
ATOM 10858 C CB   . PRO A 1 16  ? -18.221 11.776  12.248 1.00 0.00 ? 16  PRO A CB   7  
ATOM 10859 C CG   . PRO A 1 16  ? -19.729 11.942  12.147 1.00 0.00 ? 16  PRO A CG   7  
ATOM 10860 C CD   . PRO A 1 16  ? -20.346 11.379  13.417 1.00 0.00 ? 16  PRO A CD   7  
ATOM 10861 H HA   . PRO A 1 16  ? -17.245 10.729  13.794 1.00 0.00 ? 16  PRO A HA   7  
ATOM 10862 H HB2  . PRO A 1 16  ? -17.707 12.688  11.945 1.00 0.00 ? 16  PRO A HB2  7  
ATOM 10863 H HB3  . PRO A 1 16  ? -17.870 10.980  11.592 1.00 0.00 ? 16  PRO A HB3  7  
ATOM 10864 H HG2  . PRO A 1 16  ? -19.990 12.993  12.029 1.00 0.00 ? 16  PRO A HG2  7  
ATOM 10865 H HG3  . PRO A 1 16  ? -20.112 11.418  11.271 1.00 0.00 ? 16  PRO A HG3  7  
ATOM 10866 H HD2  . PRO A 1 16  ? -20.968 12.120  13.917 1.00 0.00 ? 16  PRO A HD2  7  
ATOM 10867 H HD3  . PRO A 1 16  ? -20.983 10.521  13.201 1.00 0.00 ? 16  PRO A HD3  7  
ATOM 10868 N N    . LEU A 1 17  ? -16.403 12.366  15.324 1.00 0.00 ? 17  LEU A N    7  
ATOM 10869 C CA   . LEU A 1 17  ? -15.794 13.405  16.137 1.00 0.00 ? 17  LEU A CA   7  
ATOM 10870 C C    . LEU A 1 17  ? -14.701 14.105  15.327 1.00 0.00 ? 17  LEU A C    7  
ATOM 10871 O O    . LEU A 1 17  ? -14.830 15.281  14.989 1.00 0.00 ? 17  LEU A O    7  
ATOM 10872 C CB   . LEU A 1 17  ? -15.301 12.827  17.465 1.00 0.00 ? 17  LEU A CB   7  
ATOM 10873 C CG   . LEU A 1 17  ? -15.857 13.484  18.730 1.00 0.00 ? 17  LEU A CG   7  
ATOM 10874 C CD1  . LEU A 1 17  ? -17.307 13.062  18.975 1.00 0.00 ? 17  LEU A CD1  7  
ATOM 10875 C CD2  . LEU A 1 17  ? -14.964 13.192  19.937 1.00 0.00 ? 17  LEU A CD2  7  
ATOM 10876 H H    . LEU A 1 17  ? -16.016 11.452  15.446 1.00 0.00 ? 17  LEU A H    7  
ATOM 10877 H HA   . LEU A 1 17  ? -16.571 14.134  16.371 1.00 0.00 ? 17  LEU A HA   7  
ATOM 10878 H HB2  . LEU A 1 17  ? -15.550 11.766  17.491 1.00 0.00 ? 17  LEU A HB2  7  
ATOM 10879 H HB3  . LEU A 1 17  ? -14.214 12.900  17.489 1.00 0.00 ? 17  LEU A HB3  7  
ATOM 10880 H HG   . LEU A 1 17  ? -15.857 14.564  18.582 1.00 0.00 ? 17  LEU A HG   7  
ATOM 10881 H HD11 . LEU A 1 17  ? -17.808 13.817  19.580 1.00 0.00 ? 17  LEU A HD11 7  
ATOM 10882 H HD12 . LEU A 1 17  ? -17.823 12.961  18.020 1.00 0.00 ? 17  LEU A HD12 7  
ATOM 10883 H HD13 . LEU A 1 17  ? -17.324 12.106  19.499 1.00 0.00 ? 17  LEU A HD13 7  
ATOM 10884 H HD21 . LEU A 1 17  ? -15.065 12.144  20.219 1.00 0.00 ? 17  LEU A HD21 7  
ATOM 10885 H HD22 . LEU A 1 17  ? -13.925 13.400  19.679 1.00 0.00 ? 17  LEU A HD22 7  
ATOM 10886 H HD23 . LEU A 1 17  ? -15.264 13.824  20.772 1.00 0.00 ? 17  LEU A HD23 7  
ATOM 10887 N N    . GLU A 1 18  ? -13.649 13.353  15.039 1.00 0.00 ? 18  GLU A N    7  
ATOM 10888 C CA   . GLU A 1 18  ? -12.534 13.886  14.276 1.00 0.00 ? 18  GLU A CA   7  
ATOM 10889 C C    . GLU A 1 18  ? -11.896 15.061  15.019 1.00 0.00 ? 18  GLU A C    7  
ATOM 10890 O O    . GLU A 1 18  ? -12.563 16.052  15.310 1.00 0.00 ? 18  GLU A O    7  
ATOM 10891 C CB   . GLU A 1 18  ? -12.979 14.302  12.872 1.00 0.00 ? 18  GLU A CB   7  
ATOM 10892 C CG   . GLU A 1 18  ? -11.773 14.604  11.981 1.00 0.00 ? 18  GLU A CG   7  
ATOM 10893 C CD   . GLU A 1 18  ? -11.553 16.113  11.850 1.00 0.00 ? 18  GLU A CD   7  
ATOM 10894 O OE1  . GLU A 1 18  ? -12.284 16.725  11.041 1.00 0.00 ? 18  GLU A OE1  7  
ATOM 10895 O OE2  . GLU A 1 18  ? -10.659 16.620  12.561 1.00 0.00 ? 18  GLU A OE2  7  
ATOM 10896 H H    . GLU A 1 18  ? -13.552 12.397  15.318 1.00 0.00 ? 18  GLU A H    7  
ATOM 10897 H HA   . GLU A 1 18  ? -11.819 13.067  14.196 1.00 0.00 ? 18  GLU A HA   7  
ATOM 10898 H HB2  . GLU A 1 18  ? -13.575 13.506  12.425 1.00 0.00 ? 18  GLU A HB2  7  
ATOM 10899 H HB3  . GLU A 1 18  ? -13.619 15.182  12.935 1.00 0.00 ? 18  GLU A HB3  7  
ATOM 10900 H HG2  . GLU A 1 18  ? -10.881 14.138  12.400 1.00 0.00 ? 18  GLU A HG2  7  
ATOM 10901 H HG3  . GLU A 1 18  ? -11.927 14.168  10.994 1.00 0.00 ? 18  GLU A HG3  7  
ATOM 10902 N N    . ARG A 1 19  ? -10.610 14.912  15.304 1.00 0.00 ? 19  ARG A N    7  
ATOM 10903 C CA   . ARG A 1 19  ? -9.874  15.949  16.008 1.00 0.00 ? 19  ARG A CA   7  
ATOM 10904 C C    . ARG A 1 19  ? -8.500  15.429  16.432 1.00 0.00 ? 19  ARG A C    7  
ATOM 10905 O O    . ARG A 1 19  ? -8.345  14.895  17.530 1.00 0.00 ? 19  ARG A O    7  
ATOM 10906 C CB   . ARG A 1 19  ? -10.638 16.422  17.247 1.00 0.00 ? 19  ARG A CB   7  
ATOM 10907 C CG   . ARG A 1 19  ? -10.857 17.935  17.211 1.00 0.00 ? 19  ARG A CG   7  
ATOM 10908 C CD   . ARG A 1 19  ? -12.086 18.331  18.033 1.00 0.00 ? 19  ARG A CD   7  
ATOM 10909 N NE   . ARG A 1 19  ? -11.895 19.680  18.610 1.00 0.00 ? 19  ARG A NE   7  
ATOM 10910 C CZ   . ARG A 1 19  ? -12.784 20.289  19.407 1.00 0.00 ? 19  ARG A CZ   7  
ATOM 10911 N NH1  . ARG A 1 19  ? -13.930 19.672  19.726 1.00 0.00 ? 19  ARG A NH1  7  
ATOM 10912 N NH2  . ARG A 1 19  ? -12.527 21.514  19.884 1.00 0.00 ? 19  ARG A NH2  7  
ATOM 10913 H H    . ARG A 1 19  ? -10.075 14.103  15.064 1.00 0.00 ? 19  ARG A H    7  
ATOM 10914 H HA   . ARG A 1 19  ? -9.781  16.762  15.288 1.00 0.00 ? 19  ARG A HA   7  
ATOM 10915 H HB2  . ARG A 1 19  ? -11.600 15.912  17.302 1.00 0.00 ? 19  ARG A HB2  7  
ATOM 10916 H HB3  . ARG A 1 19  ? -10.083 16.152  18.145 1.00 0.00 ? 19  ARG A HB3  7  
ATOM 10917 H HG2  . ARG A 1 19  ? -9.975  18.444  17.600 1.00 0.00 ? 19  ARG A HG2  7  
ATOM 10918 H HG3  . ARG A 1 19  ? -10.985 18.263  16.179 1.00 0.00 ? 19  ARG A HG3  7  
ATOM 10919 H HD2  . ARG A 1 19  ? -12.975 18.318  17.403 1.00 0.00 ? 19  ARG A HD2  7  
ATOM 10920 H HD3  . ARG A 1 19  ? -12.249 17.605  18.830 1.00 0.00 ? 19  ARG A HD3  7  
ATOM 10921 H HE   . ARG A 1 19  ? -11.050 20.169  18.391 1.00 0.00 ? 19  ARG A HE   7  
ATOM 10922 H HH11 . ARG A 1 19  ? -14.122 18.758  19.370 1.00 0.00 ? 19  ARG A HH11 7  
ATOM 10923 H HH12 . ARG A 1 19  ? -14.593 20.126  20.321 1.00 0.00 ? 19  ARG A HH12 7  
ATOM 10924 H HH21 . ARG A 1 19  ? -11.672 21.975  19.646 1.00 0.00 ? 19  ARG A HH21 7  
ATOM 10925 H HH22 . ARG A 1 19  ? -13.190 21.969  20.479 1.00 0.00 ? 19  ARG A HH22 7  
ATOM 10926 N N    . LYS A 1 20  ? -7.535  15.602  15.540 1.00 0.00 ? 20  LYS A N    7  
ATOM 10927 C CA   . LYS A 1 20  ? -6.179  15.157  15.809 1.00 0.00 ? 20  LYS A CA   7  
ATOM 10928 C C    . LYS A 1 20  ? -5.266  15.596  14.661 1.00 0.00 ? 20  LYS A C    7  
ATOM 10929 O O    . LYS A 1 20  ? -5.379  15.091  13.546 1.00 0.00 ? 20  LYS A O    7  
ATOM 10930 C CB   . LYS A 1 20  ? -6.151  13.651  16.074 1.00 0.00 ? 20  LYS A CB   7  
ATOM 10931 C CG   . LYS A 1 20  ? -4.877  13.248  16.819 1.00 0.00 ? 20  LYS A CG   7  
ATOM 10932 C CD   . LYS A 1 20  ? -4.248  12.001  16.195 1.00 0.00 ? 20  LYS A CD   7  
ATOM 10933 C CE   . LYS A 1 20  ? -3.048  12.372  15.321 1.00 0.00 ? 20  LYS A CE   7  
ATOM 10934 N NZ   . LYS A 1 20  ? -1.911  11.463  15.590 1.00 0.00 ? 20  LYS A NZ   7  
ATOM 10935 H H    . LYS A 1 20  ? -7.669  16.037  14.650 1.00 0.00 ? 20  LYS A H    7  
ATOM 10936 H HA   . LYS A 1 20  ? -5.847  15.651  16.722 1.00 0.00 ? 20  LYS A HA   7  
ATOM 10937 H HB2  . LYS A 1 20  ? -7.025  13.365  16.659 1.00 0.00 ? 20  LYS A HB2  7  
ATOM 10938 H HB3  . LYS A 1 20  ? -6.210  13.110  15.129 1.00 0.00 ? 20  LYS A HB3  7  
ATOM 10939 H HG2  . LYS A 1 20  ? -4.163  14.071  16.796 1.00 0.00 ? 20  LYS A HG2  7  
ATOM 10940 H HG3  . LYS A 1 20  ? -5.110  13.057  17.867 1.00 0.00 ? 20  LYS A HG3  7  
ATOM 10941 H HD2  . LYS A 1 20  ? -3.931  11.316  16.982 1.00 0.00 ? 20  LYS A HD2  7  
ATOM 10942 H HD3  . LYS A 1 20  ? -4.990  11.476  15.595 1.00 0.00 ? 20  LYS A HD3  7  
ATOM 10943 H HE2  . LYS A 1 20  ? -3.325  12.316  14.269 1.00 0.00 ? 20  LYS A HE2  7  
ATOM 10944 H HE3  . LYS A 1 20  ? -2.751  13.403  15.518 1.00 0.00 ? 20  LYS A HE3  7  
ATOM 10945 H HZ1  . LYS A 1 20  ? -1.788  11.366  16.577 1.00 0.00 ? 20  LYS A HZ1  7  
ATOM 10946 H HZ2  . LYS A 1 20  ? -2.098  10.567  15.187 1.00 0.00 ? 20  LYS A HZ2  7  
ATOM 10947 H HZ3  . LYS A 1 20  ? -1.078  11.843  15.186 1.00 0.00 ? 20  LYS A HZ3  7  
ATOM 10948 N N    . LYS A 1 21  ? -4.383  16.533  14.975 1.00 0.00 ? 21  LYS A N    7  
ATOM 10949 C CA   . LYS A 1 21  ? -3.452  17.046  13.985 1.00 0.00 ? 21  LYS A CA   7  
ATOM 10950 C C    . LYS A 1 21  ? -4.228  17.491  12.744 1.00 0.00 ? 21  LYS A C    7  
ATOM 10951 O O    . LYS A 1 21  ? -5.448  17.343  12.684 1.00 0.00 ? 21  LYS A O    7  
ATOM 10952 C CB   . LYS A 1 21  ? -2.361  16.014  13.690 1.00 0.00 ? 21  LYS A CB   7  
ATOM 10953 C CG   . LYS A 1 21  ? -0.973  16.657  13.731 1.00 0.00 ? 21  LYS A CG   7  
ATOM 10954 C CD   . LYS A 1 21  ? -0.149  16.260  12.505 1.00 0.00 ? 21  LYS A CD   7  
ATOM 10955 C CE   . LYS A 1 21  ? 1.236   15.755  12.915 1.00 0.00 ? 21  LYS A CE   7  
ATOM 10956 N NZ   . LYS A 1 21  ? 2.268   16.773  12.617 1.00 0.00 ? 21  LYS A NZ   7  
ATOM 10957 H H    . LYS A 1 21  ? -4.298  16.939  15.885 1.00 0.00 ? 21  LYS A H    7  
ATOM 10958 H HA   . LYS A 1 21  ? -2.962  17.918  14.417 1.00 0.00 ? 21  LYS A HA   7  
ATOM 10959 H HB2  . LYS A 1 21  ? -2.413  15.206  14.419 1.00 0.00 ? 21  LYS A HB2  7  
ATOM 10960 H HB3  . LYS A 1 21  ? -2.531  15.570  12.710 1.00 0.00 ? 21  LYS A HB3  7  
ATOM 10961 H HG2  . LYS A 1 21  ? -1.072  17.742  13.772 1.00 0.00 ? 21  LYS A HG2  7  
ATOM 10962 H HG3  . LYS A 1 21  ? -0.453  16.350  14.639 1.00 0.00 ? 21  LYS A HG3  7  
ATOM 10963 H HD2  . LYS A 1 21  ? -0.672  15.484  11.946 1.00 0.00 ? 21  LYS A HD2  7  
ATOM 10964 H HD3  . LYS A 1 21  ? -0.045  17.117  11.839 1.00 0.00 ? 21  LYS A HD3  7  
ATOM 10965 H HE2  . LYS A 1 21  ? 1.244   15.521  13.980 1.00 0.00 ? 21  LYS A HE2  7  
ATOM 10966 H HE3  . LYS A 1 21  ? 1.465   14.831  12.385 1.00 0.00 ? 21  LYS A HE3  7  
ATOM 10967 H HZ1  . LYS A 1 21  ? 2.011   17.277  11.792 1.00 0.00 ? 21  LYS A HZ1  7  
ATOM 10968 H HZ2  . LYS A 1 21  ? 2.341   17.408  13.386 1.00 0.00 ? 21  LYS A HZ2  7  
ATOM 10969 H HZ3  . LYS A 1 21  ? 3.149   16.322  12.472 1.00 0.00 ? 21  LYS A HZ3  7  
ATOM 10970 N N    . ARG A 1 22  ? -3.490  18.028  11.784 1.00 0.00 ? 22  ARG A N    7  
ATOM 10971 C CA   . ARG A 1 22  ? -4.093  18.496  10.548 1.00 0.00 ? 22  ARG A CA   7  
ATOM 10972 C C    . ARG A 1 22  ? -5.144  17.498  10.059 1.00 0.00 ? 22  ARG A C    7  
ATOM 10973 O O    . ARG A 1 22  ? -5.161  16.347  10.493 1.00 0.00 ? 22  ARG A O    7  
ATOM 10974 C CB   . ARG A 1 22  ? -3.037  18.690  9.458  1.00 0.00 ? 22  ARG A CB   7  
ATOM 10975 C CG   . ARG A 1 22  ? -3.177  20.063  8.797  1.00 0.00 ? 22  ARG A CG   7  
ATOM 10976 C CD   . ARG A 1 22  ? -2.894  21.185  9.798  1.00 0.00 ? 22  ARG A CD   7  
ATOM 10977 N NE   . ARG A 1 22  ? -3.989  22.180  9.765  1.00 0.00 ? 22  ARG A NE   7  
ATOM 10978 C CZ   . ARG A 1 22  ? -4.280  22.942  8.702  1.00 0.00 ? 22  ARG A CZ   7  
ATOM 10979 N NH1  . ARG A 1 22  ? -3.560  22.827  7.578  1.00 0.00 ? 22  ARG A NH1  7  
ATOM 10980 N NH2  . ARG A 1 22  ? -5.292  23.819  8.763  1.00 0.00 ? 22  ARG A NH2  7  
ATOM 10981 H H    . ARG A 1 22  ? -2.498  18.146  11.841 1.00 0.00 ? 22  ARG A H    7  
ATOM 10982 H HA   . ARG A 1 22  ? -4.550  19.452  10.806 1.00 0.00 ? 22  ARG A HA   7  
ATOM 10983 H HB2  . ARG A 1 22  ? -2.042  18.590  9.890  1.00 0.00 ? 22  ARG A HB2  7  
ATOM 10984 H HB3  . ARG A 1 22  ? -3.139  17.908  8.706  1.00 0.00 ? 22  ARG A HB3  7  
ATOM 10985 H HG2  . ARG A 1 22  ? -2.487  20.138  7.957  1.00 0.00 ? 22  ARG A HG2  7  
ATOM 10986 H HG3  . ARG A 1 22  ? -4.184  20.176  8.394  1.00 0.00 ? 22  ARG A HG3  7  
ATOM 10987 H HD2  . ARG A 1 22  ? -2.797  20.772  10.802 1.00 0.00 ? 22  ARG A HD2  7  
ATOM 10988 H HD3  . ARG A 1 22  ? -1.946  21.667  9.558  1.00 0.00 ? 22  ARG A HD3  7  
ATOM 10989 H HE   . ARG A 1 22  ? -4.546  22.291  10.588 1.00 0.00 ? 22  ARG A HE   7  
ATOM 10990 H HH11 . ARG A 1 22  ? -2.805  22.173  7.533  1.00 0.00 ? 22  ARG A HH11 7  
ATOM 10991 H HH12 . ARG A 1 22  ? -3.777  23.396  6.785  1.00 0.00 ? 22  ARG A HH12 7  
ATOM 10992 H HH21 . ARG A 1 22  ? -5.829  23.904  9.602  1.00 0.00 ? 22  ARG A HH21 7  
ATOM 10993 H HH22 . ARG A 1 22  ? -5.509  24.387  7.970  1.00 0.00 ? 22  ARG A HH22 7  
ATOM 10994 N N    . GLU A 1 23  ? -5.996  17.974  9.163  1.00 0.00 ? 23  GLU A N    7  
ATOM 10995 C CA   . GLU A 1 23  ? -7.047  17.138  8.611  1.00 0.00 ? 23  GLU A CA   7  
ATOM 10996 C C    . GLU A 1 23  ? -6.572  16.474  7.317  1.00 0.00 ? 23  GLU A C    7  
ATOM 10997 O O    . GLU A 1 23  ? -6.907  15.321  7.047  1.00 0.00 ? 23  GLU A O    7  
ATOM 10998 C CB   . GLU A 1 23  ? -8.325  17.946  8.376  1.00 0.00 ? 23  GLU A CB   7  
ATOM 10999 C CG   . GLU A 1 23  ? -9.289  17.803  9.555  1.00 0.00 ? 23  GLU A CG   7  
ATOM 11000 C CD   . GLU A 1 23  ? -9.379  19.107  10.351 1.00 0.00 ? 23  GLU A CD   7  
ATOM 11001 O OE1  . GLU A 1 23  ? -10.049 20.034  9.848  1.00 0.00 ? 23  GLU A OE1  7  
ATOM 11002 O OE2  . GLU A 1 23  ? -8.775  19.147  11.445 1.00 0.00 ? 23  GLU A OE2  7  
ATOM 11003 H H    . GLU A 1 23  ? -5.976  18.912  8.816  1.00 0.00 ? 23  GLU A H    7  
ATOM 11004 H HA   . GLU A 1 23  ? -7.240  16.377  9.367  1.00 0.00 ? 23  GLU A HA   7  
ATOM 11005 H HB2  . GLU A 1 23  ? -8.073  18.997  8.232  1.00 0.00 ? 23  GLU A HB2  7  
ATOM 11006 H HB3  . GLU A 1 23  ? -8.811  17.607  7.461  1.00 0.00 ? 23  GLU A HB3  7  
ATOM 11007 H HG2  . GLU A 1 23  ? -10.278 17.527  9.190  1.00 0.00 ? 23  GLU A HG2  7  
ATOM 11008 H HG3  . GLU A 1 23  ? -8.954  16.997  10.208 1.00 0.00 ? 23  GLU A HG3  7  
ATOM 11009 N N    . LYS A 1 24  ? -5.800  17.230  6.550  1.00 0.00 ? 24  LYS A N    7  
ATOM 11010 C CA   . LYS A 1 24  ? -5.275  16.729  5.291  1.00 0.00 ? 24  LYS A CA   7  
ATOM 11011 C C    . LYS A 1 24  ? -4.276  15.605  5.571  1.00 0.00 ? 24  LYS A C    7  
ATOM 11012 O O    . LYS A 1 24  ? -4.041  14.751  4.717  1.00 0.00 ? 24  LYS A O    7  
ATOM 11013 C CB   . LYS A 1 24  ? -4.696  17.874  4.459  1.00 0.00 ? 24  LYS A CB   7  
ATOM 11014 C CG   . LYS A 1 24  ? -5.578  18.171  3.245  1.00 0.00 ? 24  LYS A CG   7  
ATOM 11015 C CD   . LYS A 1 24  ? -4.988  17.554  1.975  1.00 0.00 ? 24  LYS A CD   7  
ATOM 11016 C CE   . LYS A 1 24  ? -4.888  18.593  0.856  1.00 0.00 ? 24  LYS A CE   7  
ATOM 11017 N NZ   . LYS A 1 24  ? -4.631  17.932  -0.443 1.00 0.00 ? 24  LYS A NZ   7  
ATOM 11018 H H    . LYS A 1 24  ? -5.532  18.166  6.777  1.00 0.00 ? 24  LYS A H    7  
ATOM 11019 H HA   . LYS A 1 24  ? -6.113  16.315  4.730  1.00 0.00 ? 24  LYS A HA   7  
ATOM 11020 H HB2  . LYS A 1 24  ? -4.607  18.769  5.076  1.00 0.00 ? 24  LYS A HB2  7  
ATOM 11021 H HB3  . LYS A 1 24  ? -3.690  17.616  4.128  1.00 0.00 ? 24  LYS A HB3  7  
ATOM 11022 H HG2  . LYS A 1 24  ? -6.580  17.776  3.414  1.00 0.00 ? 24  LYS A HG2  7  
ATOM 11023 H HG3  . LYS A 1 24  ? -5.677  19.249  3.117  1.00 0.00 ? 24  LYS A HG3  7  
ATOM 11024 H HD2  . LYS A 1 24  ? -4.000  17.148  2.189  1.00 0.00 ? 24  LYS A HD2  7  
ATOM 11025 H HD3  . LYS A 1 24  ? -5.611  16.721  1.648  1.00 0.00 ? 24  LYS A HD3  7  
ATOM 11026 H HE2  . LYS A 1 24  ? -5.812  19.168  0.802  1.00 0.00 ? 24  LYS A HE2  7  
ATOM 11027 H HE3  . LYS A 1 24  ? -4.086  19.297  1.077  1.00 0.00 ? 24  LYS A HE3  7  
ATOM 11028 H HZ1  . LYS A 1 24  ? -3.647  17.806  -0.565 1.00 0.00 ? 24  LYS A HZ1  7  
ATOM 11029 H HZ2  . LYS A 1 24  ? -5.086  17.041  -0.460 1.00 0.00 ? 24  LYS A HZ2  7  
ATOM 11030 H HZ3  . LYS A 1 24  ? -4.988  18.502  -1.183 1.00 0.00 ? 24  LYS A HZ3  7  
ATOM 11031 N N    . GLU A 1 25  ? -3.713  15.641  6.770  1.00 0.00 ? 25  GLU A N    7  
ATOM 11032 C CA   . GLU A 1 25  ? -2.744  14.636  7.172  1.00 0.00 ? 25  GLU A CA   7  
ATOM 11033 C C    . GLU A 1 25  ? -3.451  13.318  7.498  1.00 0.00 ? 25  GLU A C    7  
ATOM 11034 O O    . GLU A 1 25  ? -3.171  12.291  6.882  1.00 0.00 ? 25  GLU A O    7  
ATOM 11035 C CB   . GLU A 1 25  ? -1.913  15.121  8.362  1.00 0.00 ? 25  GLU A CB   7  
ATOM 11036 C CG   . GLU A 1 25  ? -0.420  14.892  8.117  1.00 0.00 ? 25  GLU A CG   7  
ATOM 11037 C CD   . GLU A 1 25  ? 0.044   15.613  6.850  1.00 0.00 ? 25  GLU A CD   7  
ATOM 11038 O OE1  . GLU A 1 25  ? -0.514  16.697  6.576  1.00 0.00 ? 25  GLU A OE1  7  
ATOM 11039 O OE2  . GLU A 1 25  ? 0.947   15.063  6.183  1.00 0.00 ? 25  GLU A OE2  7  
ATOM 11040 H H    . GLU A 1 25  ? -3.910  16.339  7.459  1.00 0.00 ? 25  GLU A H    7  
ATOM 11041 H HA   . GLU A 1 25  ? -2.091  14.502  6.311  1.00 0.00 ? 25  GLU A HA   7  
ATOM 11042 H HB2  . GLU A 1 25  ? -2.099  16.182  8.531  1.00 0.00 ? 25  GLU A HB2  7  
ATOM 11043 H HB3  . GLU A 1 25  ? -2.222  14.595  9.265  1.00 0.00 ? 25  GLU A HB3  7  
ATOM 11044 H HG2  . GLU A 1 25  ? 0.151   15.250  8.973  1.00 0.00 ? 25  GLU A HG2  7  
ATOM 11045 H HG3  . GLU A 1 25  ? -0.223  13.824  8.025  1.00 0.00 ? 25  GLU A HG3  7  
ATOM 11046 N N    . GLN A 1 26  ? -4.353  13.391  8.466  1.00 0.00 ? 26  GLN A N    7  
ATOM 11047 C CA   . GLN A 1 26  ? -5.101  12.217  8.881  1.00 0.00 ? 26  GLN A CA   7  
ATOM 11048 C C    . GLN A 1 26  ? -5.901  11.654  7.705  1.00 0.00 ? 26  GLN A C    7  
ATOM 11049 O O    . GLN A 1 26  ? -6.232  10.469  7.684  1.00 0.00 ? 26  GLN A O    7  
ATOM 11050 C CB   . GLN A 1 26  ? -6.017  12.540  10.063 1.00 0.00 ? 26  GLN A CB   7  
ATOM 11051 C CG   . GLN A 1 26  ? -7.066  13.584  9.674  1.00 0.00 ? 26  GLN A CG   7  
ATOM 11052 C CD   . GLN A 1 26  ? -7.733  14.180  10.916 1.00 0.00 ? 26  GLN A CD   7  
ATOM 11053 O OE1  . GLN A 1 26  ? -7.190  14.171  12.008 1.00 0.00 ? 26  GLN A OE1  7  
ATOM 11054 N NE2  . GLN A 1 26  ? -8.937  14.696  10.688 1.00 0.00 ? 26  GLN A NE2  7  
ATOM 11055 H H    . GLN A 1 26  ? -4.575  14.230  8.962  1.00 0.00 ? 26  GLN A H    7  
ATOM 11056 H HA   . GLN A 1 26  ? -4.351  11.492  9.198  1.00 0.00 ? 26  GLN A HA   7  
ATOM 11057 H HB2  . GLN A 1 26  ? -6.513  11.630  10.402 1.00 0.00 ? 26  GLN A HB2  7  
ATOM 11058 H HB3  . GLN A 1 26  ? -5.423  12.909  10.898 1.00 0.00 ? 26  GLN A HB3  7  
ATOM 11059 H HG2  . GLN A 1 26  ? -6.596  14.378  9.094  1.00 0.00 ? 26  GLN A HG2  7  
ATOM 11060 H HG3  . GLN A 1 26  ? -7.821  13.127  9.036  1.00 0.00 ? 26  GLN A HG3  7  
ATOM 11061 H HE21 . GLN A 1 26  ? -9.326  14.670  9.767  1.00 0.00 ? 26  GLN A HE21 7  
ATOM 11062 H HE22 . GLN A 1 26  ? -9.454  15.109  11.438 1.00 0.00 ? 26  GLN A HE22 7  
ATOM 11063 N N    . PHE A 1 27  ? -6.190  12.530  6.753  1.00 0.00 ? 27  PHE A N    7  
ATOM 11064 C CA   . PHE A 1 27  ? -6.945  12.136  5.576  1.00 0.00 ? 27  PHE A CA   7  
ATOM 11065 C C    . PHE A 1 27  ? -6.113  11.226  4.671  1.00 0.00 ? 27  PHE A C    7  
ATOM 11066 O O    . PHE A 1 27  ? -6.641  10.291  4.071  1.00 0.00 ? 27  PHE A O    7  
ATOM 11067 C CB   . PHE A 1 27  ? -7.288  13.418  4.815  1.00 0.00 ? 27  PHE A CB   7  
ATOM 11068 C CG   . PHE A 1 27  ? -8.702  13.938  5.079  1.00 0.00 ? 27  PHE A CG   7  
ATOM 11069 C CD1  . PHE A 1 27  ? -9.322  13.657  6.256  1.00 0.00 ? 27  PHE A CD1  7  
ATOM 11070 C CD2  . PHE A 1 27  ? -9.340  14.682  4.135  1.00 0.00 ? 27  PHE A CD2  7  
ATOM 11071 C CE1  . PHE A 1 27  ? -10.634 14.141  6.501  1.00 0.00 ? 27  PHE A CE1  7  
ATOM 11072 C CE2  . PHE A 1 27  ? -10.652 15.166  4.380  1.00 0.00 ? 27  PHE A CE2  7  
ATOM 11073 C CZ   . PHE A 1 27  ? -11.272 14.885  5.558  1.00 0.00 ? 27  PHE A CZ   7  
ATOM 11074 H H    . PHE A 1 27  ? -5.917  13.492  6.778  1.00 0.00 ? 27  PHE A H    7  
ATOM 11075 H HA   . PHE A 1 27  ? -7.825  11.594  5.923  1.00 0.00 ? 27  PHE A HA   7  
ATOM 11076 H HB2  . PHE A 1 27  ? -6.570  14.192  5.085  1.00 0.00 ? 27  PHE A HB2  7  
ATOM 11077 H HB3  . PHE A 1 27  ? -7.173  13.235  3.746  1.00 0.00 ? 27  PHE A HB3  7  
ATOM 11078 H HD1  . PHE A 1 27  ? -8.811  13.061  7.012  1.00 0.00 ? 27  PHE A HD1  7  
ATOM 11079 H HD2  . PHE A 1 27  ? -8.843  14.907  3.192  1.00 0.00 ? 27  PHE A HD2  7  
ATOM 11080 H HE1  . PHE A 1 27  ? -11.131 13.916  7.445  1.00 0.00 ? 27  PHE A HE1  7  
ATOM 11081 H HE2  . PHE A 1 27  ? -11.164 15.762  3.624  1.00 0.00 ? 27  PHE A HE2  7  
ATOM 11082 H HZ   . PHE A 1 27  ? -12.280 15.256  5.746  1.00 0.00 ? 27  PHE A HZ   7  
ATOM 11083 N N    . ARG A 1 28  ? -4.826  11.531  4.600  1.00 0.00 ? 28  ARG A N    7  
ATOM 11084 C CA   . ARG A 1 28  ? -3.916  10.752  3.778  1.00 0.00 ? 28  ARG A CA   7  
ATOM 11085 C C    . ARG A 1 28  ? -3.140  9.756   4.642  1.00 0.00 ? 28  ARG A C    7  
ATOM 11086 O O    . ARG A 1 28  ? -2.510  8.837   4.122  1.00 0.00 ? 28  ARG A O    7  
ATOM 11087 C CB   . ARG A 1 28  ? -2.926  11.658  3.042  1.00 0.00 ? 28  ARG A CB   7  
ATOM 11088 C CG   . ARG A 1 28  ? -3.659  12.743  2.250  1.00 0.00 ? 28  ARG A CG   7  
ATOM 11089 C CD   . ARG A 1 28  ? -2.727  13.403  1.232  1.00 0.00 ? 28  ARG A CD   7  
ATOM 11090 N NE   . ARG A 1 28  ? -2.112  14.614  1.819  1.00 0.00 ? 28  ARG A NE   7  
ATOM 11091 C CZ   . ARG A 1 28  ? -0.999  14.605  2.565  1.00 0.00 ? 28  ARG A CZ   7  
ATOM 11092 N NH1  . ARG A 1 28  ? -0.372  13.448  2.819  1.00 0.00 ? 28  ARG A NH1  7  
ATOM 11093 N NH2  . ARG A 1 28  ? -0.513  15.753  3.057  1.00 0.00 ? 28  ARG A NH2  7  
ATOM 11094 H H    . ARG A 1 28  ? -4.404  12.293  5.091  1.00 0.00 ? 28  ARG A H    7  
ATOM 11095 H HA   . ARG A 1 28  ? -4.557  10.236  3.064  1.00 0.00 ? 28  ARG A HA   7  
ATOM 11096 H HB2  . ARG A 1 28  ? -2.249  12.122  3.760  1.00 0.00 ? 28  ARG A HB2  7  
ATOM 11097 H HB3  . ARG A 1 28  ? -2.313  11.061  2.367  1.00 0.00 ? 28  ARG A HB3  7  
ATOM 11098 H HG2  . ARG A 1 28  ? -4.515  12.306  1.736  1.00 0.00 ? 28  ARG A HG2  7  
ATOM 11099 H HG3  . ARG A 1 28  ? -4.049  13.497  2.934  1.00 0.00 ? 28  ARG A HG3  7  
ATOM 11100 H HD2  . ARG A 1 28  ? -1.951  12.701  0.929  1.00 0.00 ? 28  ARG A HD2  7  
ATOM 11101 H HD3  . ARG A 1 28  ? -3.286  13.667  0.334  1.00 0.00 ? 28  ARG A HD3  7  
ATOM 11102 H HE   . ARG A 1 28  ? -2.555  15.494  1.649  1.00 0.00 ? 28  ARG A HE   7  
ATOM 11103 H HH11 . ARG A 1 28  ? -0.735  12.592  2.452  1.00 0.00 ? 28  ARG A HH11 7  
ATOM 11104 H HH12 . ARG A 1 28  ? 0.458   13.441  3.376  1.00 0.00 ? 28  ARG A HH12 7  
ATOM 11105 H HH21 . ARG A 1 28  ? -0.981  16.616  2.867  1.00 0.00 ? 28  ARG A HH21 7  
ATOM 11106 H HH22 . ARG A 1 28  ? 0.318   15.746  3.613  1.00 0.00 ? 28  ARG A HH22 7  
ATOM 11107 N N    . LYS A 1 29  ? -3.210  9.973   5.947  1.00 0.00 ? 29  LYS A N    7  
ATOM 11108 C CA   . LYS A 1 29  ? -2.522  9.106   6.888  1.00 0.00 ? 29  LYS A CA   7  
ATOM 11109 C C    . LYS A 1 29  ? -3.465  7.981   7.321  1.00 0.00 ? 29  LYS A C    7  
ATOM 11110 O O    . LYS A 1 29  ? -4.499  8.235   7.937  1.00 0.00 ? 29  LYS A O    7  
ATOM 11111 C CB   . LYS A 1 29  ? -1.960  9.921   8.055  1.00 0.00 ? 29  LYS A CB   7  
ATOM 11112 C CG   . LYS A 1 29  ? -1.351  9.005   9.119  1.00 0.00 ? 29  LYS A CG   7  
ATOM 11113 C CD   . LYS A 1 29  ? -1.949  9.295   10.498 1.00 0.00 ? 29  LYS A CD   7  
ATOM 11114 C CE   . LYS A 1 29  ? -0.876  9.797   11.466 1.00 0.00 ? 29  LYS A CE   7  
ATOM 11115 N NZ   . LYS A 1 29  ? -1.487  10.198  12.753 1.00 0.00 ? 29  LYS A NZ   7  
ATOM 11116 H H    . LYS A 1 29  ? -3.725  10.724  6.362  1.00 0.00 ? 29  LYS A H    7  
ATOM 11117 H HA   . LYS A 1 29  ? -1.674  8.664   6.365  1.00 0.00 ? 29  LYS A HA   7  
ATOM 11118 H HB2  . LYS A 1 29  ? -1.202  10.613  7.689  1.00 0.00 ? 29  LYS A HB2  7  
ATOM 11119 H HB3  . LYS A 1 29  ? -2.753  10.523  8.498  1.00 0.00 ? 29  LYS A HB3  7  
ATOM 11120 H HG2  . LYS A 1 29  ? -1.529  7.964   8.853  1.00 0.00 ? 29  LYS A HG2  7  
ATOM 11121 H HG3  . LYS A 1 29  ? -0.271  9.146   9.151  1.00 0.00 ? 29  LYS A HG3  7  
ATOM 11122 H HD2  . LYS A 1 29  ? -2.739  10.040  10.407 1.00 0.00 ? 29  LYS A HD2  7  
ATOM 11123 H HD3  . LYS A 1 29  ? -2.409  8.390   10.896 1.00 0.00 ? 29  LYS A HD3  7  
ATOM 11124 H HE2  . LYS A 1 29  ? -0.136  9.014   11.636 1.00 0.00 ? 29  LYS A HE2  7  
ATOM 11125 H HE3  . LYS A 1 29  ? -0.349  10.644  11.027 1.00 0.00 ? 29  LYS A HE3  7  
ATOM 11126 H HZ1  . LYS A 1 29  ? -0.890  9.921   13.506 1.00 0.00 ? 29  LYS A HZ1  7  
ATOM 11127 H HZ2  . LYS A 1 29  ? -1.605  11.191  12.771 1.00 0.00 ? 29  LYS A HZ2  7  
ATOM 11128 H HZ3  . LYS A 1 29  ? -2.377  9.754   12.853 1.00 0.00 ? 29  LYS A HZ3  7  
ATOM 11129 N N    . LEU A 1 30  ? -3.074  6.761   6.982  1.00 0.00 ? 30  LEU A N    7  
ATOM 11130 C CA   . LEU A 1 30  ? -3.870  5.597   7.328  1.00 0.00 ? 30  LEU A CA   7  
ATOM 11131 C C    . LEU A 1 30  ? -3.138  4.781   8.395  1.00 0.00 ? 30  LEU A C    7  
ATOM 11132 O O    . LEU A 1 30  ? -1.909  4.722   8.401  1.00 0.00 ? 30  LEU A O    7  
ATOM 11133 C CB   . LEU A 1 30  ? -4.219  4.794   6.073  1.00 0.00 ? 30  LEU A CB   7  
ATOM 11134 C CG   . LEU A 1 30  ? -5.479  5.234   5.324  1.00 0.00 ? 30  LEU A CG   7  
ATOM 11135 C CD1  . LEU A 1 30  ? -5.548  6.758   5.215  1.00 0.00 ? 30  LEU A CD1  7  
ATOM 11136 C CD2  . LEU A 1 30  ? -5.567  4.557   3.955  1.00 0.00 ? 30  LEU A CD2  7  
ATOM 11137 H H    . LEU A 1 30  ? -2.231  6.563   6.481  1.00 0.00 ? 30  LEU A H    7  
ATOM 11138 H HA   . LEU A 1 30  ? -4.808  5.957   7.751  1.00 0.00 ? 30  LEU A HA   7  
ATOM 11139 H HB2  . LEU A 1 30  ? -3.375  4.847   5.386  1.00 0.00 ? 30  LEU A HB2  7  
ATOM 11140 H HB3  . LEU A 1 30  ? -4.335  3.748   6.356  1.00 0.00 ? 30  LEU A HB3  7  
ATOM 11141 H HG   . LEU A 1 30  ? -6.348  4.913   5.899  1.00 0.00 ? 30  LEU A HG   7  
ATOM 11142 H HD11 . LEU A 1 30  ? -6.474  7.045   4.718  1.00 0.00 ? 30  LEU A HD11 7  
ATOM 11143 H HD12 . LEU A 1 30  ? -5.521  7.195   6.213  1.00 0.00 ? 30  LEU A HD12 7  
ATOM 11144 H HD13 . LEU A 1 30  ? -4.698  7.120   4.637  1.00 0.00 ? 30  LEU A HD13 7  
ATOM 11145 H HD21 . LEU A 1 30  ? -5.935  3.538   4.077  1.00 0.00 ? 30  LEU A HD21 7  
ATOM 11146 H HD22 . LEU A 1 30  ? -6.251  5.116   3.317  1.00 0.00 ? 30  LEU A HD22 7  
ATOM 11147 H HD23 . LEU A 1 30  ? -4.579  4.534   3.497  1.00 0.00 ? 30  LEU A HD23 7  
ATOM 11148 N N    . PHE A 1 31  ? -3.923  4.174   9.273  1.00 0.00 ? 31  PHE A N    7  
ATOM 11149 C CA   . PHE A 1 31  ? -3.364  3.365   10.343 1.00 0.00 ? 31  PHE A CA   7  
ATOM 11150 C C    . PHE A 1 31  ? -3.396  1.879   9.980  1.00 0.00 ? 31  PHE A C    7  
ATOM 11151 O O    . PHE A 1 31  ? -4.449  1.245   10.039 1.00 0.00 ? 31  PHE A O    7  
ATOM 11152 C CB   . PHE A 1 31  ? -4.234  3.595   11.580 1.00 0.00 ? 31  PHE A CB   7  
ATOM 11153 C CG   . PHE A 1 31  ? -3.672  2.976   12.861 1.00 0.00 ? 31  PHE A CG   7  
ATOM 11154 C CD1  . PHE A 1 31  ? -3.821  1.644   13.094 1.00 0.00 ? 31  PHE A CD1  7  
ATOM 11155 C CD2  . PHE A 1 31  ? -3.024  3.756   13.766 1.00 0.00 ? 31  PHE A CD2  7  
ATOM 11156 C CE1  . PHE A 1 31  ? -3.300  1.069   14.283 1.00 0.00 ? 31  PHE A CE1  7  
ATOM 11157 C CE2  . PHE A 1 31  ? -2.502  3.181   14.954 1.00 0.00 ? 31  PHE A CE2  7  
ATOM 11158 C CZ   . PHE A 1 31  ? -2.651  1.850   15.188 1.00 0.00 ? 31  PHE A CZ   7  
ATOM 11159 H H    . PHE A 1 31  ? -4.921  4.228   9.261  1.00 0.00 ? 31  PHE A H    7  
ATOM 11160 H HA   . PHE A 1 31  ? -2.330  3.681   10.481 1.00 0.00 ? 31  PHE A HA   7  
ATOM 11161 H HB2  . PHE A 1 31  ? -4.357  4.668   11.730 1.00 0.00 ? 31  PHE A HB2  7  
ATOM 11162 H HB3  . PHE A 1 31  ? -5.227  3.184   11.394 1.00 0.00 ? 31  PHE A HB3  7  
ATOM 11163 H HD1  . PHE A 1 31  ? -4.341  1.018   12.369 1.00 0.00 ? 31  PHE A HD1  7  
ATOM 11164 H HD2  . PHE A 1 31  ? -2.904  4.823   13.578 1.00 0.00 ? 31  PHE A HD2  7  
ATOM 11165 H HE1  . PHE A 1 31  ? -3.419  0.002   14.470 1.00 0.00 ? 31  PHE A HE1  7  
ATOM 11166 H HE2  . PHE A 1 31  ? -1.982  3.807   15.680 1.00 0.00 ? 31  PHE A HE2  7  
ATOM 11167 H HZ   . PHE A 1 31  ? -2.251  1.408   16.101 1.00 0.00 ? 31  PHE A HZ   7  
ATOM 11168 N N    . ILE A 1 32  ? -2.231  1.366   9.614  1.00 0.00 ? 32  ILE A N    7  
ATOM 11169 C CA   . ILE A 1 32  ? -2.112  -0.033  9.242  1.00 0.00 ? 32  ILE A CA   7  
ATOM 11170 C C    . ILE A 1 32  ? -1.984  -0.884  10.507 1.00 0.00 ? 32  ILE A C    7  
ATOM 11171 O O    . ILE A 1 32  ? -1.215  -0.551  11.408 1.00 0.00 ? 32  ILE A O    7  
ATOM 11172 C CB   . ILE A 1 32  ? -0.963  -0.229  8.251  1.00 0.00 ? 32  ILE A CB   7  
ATOM 11173 C CG1  . ILE A 1 32  ? -0.854  0.962   7.296  1.00 0.00 ? 32  ILE A CG1  7  
ATOM 11174 C CG2  . ILE A 1 32  ? -1.107  -1.555  7.500  1.00 0.00 ? 32  ILE A CG2  7  
ATOM 11175 C CD1  . ILE A 1 32  ? -2.203  1.265   6.641  1.00 0.00 ? 32  ILE A CD1  7  
ATOM 11176 H H    . ILE A 1 32  ? -1.379  1.889   9.569  1.00 0.00 ? 32  ILE A H    7  
ATOM 11177 H HA   . ILE A 1 32  ? -3.032  -0.314  8.729  1.00 0.00 ? 32  ILE A HA   7  
ATOM 11178 H HB   . ILE A 1 32  ? -0.031  -0.277  8.813  1.00 0.00 ? 32  ILE A HB   7  
ATOM 11179 H HG12 . ILE A 1 32  ? -0.505  1.839   7.842  1.00 0.00 ? 32  ILE A HG12 7  
ATOM 11180 H HG13 . ILE A 1 32  ? -0.111  0.749   6.527  1.00 0.00 ? 32  ILE A HG13 7  
ATOM 11181 H HG21 . ILE A 1 32  ? -0.135  -1.858  7.109  1.00 0.00 ? 32  ILE A HG21 7  
ATOM 11182 H HG22 . ILE A 1 32  ? -1.479  -2.320  8.181  1.00 0.00 ? 32  ILE A HG22 7  
ATOM 11183 H HG23 . ILE A 1 32  ? -1.808  -1.430  6.674  1.00 0.00 ? 32  ILE A HG23 7  
ATOM 11184 H HD11 . ILE A 1 32  ? -2.907  0.465   6.871  1.00 0.00 ? 32  ILE A HD11 7  
ATOM 11185 H HD12 . ILE A 1 32  ? -2.588  2.210   7.023  1.00 0.00 ? 32  ILE A HD12 7  
ATOM 11186 H HD13 . ILE A 1 32  ? -2.074  1.335   5.560  1.00 0.00 ? 32  ILE A HD13 7  
ATOM 11187 N N    . GLY A 1 33  ? -2.750  -1.965  10.535 1.00 0.00 ? 33  GLY A N    7  
ATOM 11188 C CA   . GLY A 1 33  ? -2.731  -2.865  11.675 1.00 0.00 ? 33  GLY A CA   7  
ATOM 11189 C C    . GLY A 1 33  ? -2.557  -4.317  11.225 1.00 0.00 ? 33  GLY A C    7  
ATOM 11190 O O    . GLY A 1 33  ? -3.252  -4.778  10.320 1.00 0.00 ? 33  GLY A O    7  
ATOM 11191 H H    . GLY A 1 33  ? -3.372  -2.228  9.799  1.00 0.00 ? 33  GLY A H    7  
ATOM 11192 H HA2  . GLY A 1 33  ? -1.919  -2.590  12.348 1.00 0.00 ? 33  GLY A HA2  7  
ATOM 11193 H HA3  . GLY A 1 33  ? -3.660  -2.764  12.238 1.00 0.00 ? 33  GLY A HA3  7  
ATOM 11194 N N    . GLY A 1 34  ? -1.626  -4.998  11.877 1.00 0.00 ? 34  GLY A N    7  
ATOM 11195 C CA   . GLY A 1 34  ? -1.351  -6.388  11.554 1.00 0.00 ? 34  GLY A CA   7  
ATOM 11196 C C    . GLY A 1 34  ? -0.104  -6.511  10.677 1.00 0.00 ? 34  GLY A C    7  
ATOM 11197 O O    . GLY A 1 34  ? -0.168  -7.051  9.573  1.00 0.00 ? 34  GLY A O    7  
ATOM 11198 H H    . GLY A 1 34  ? -1.065  -4.616  12.611 1.00 0.00 ? 34  GLY A H    7  
ATOM 11199 H HA2  . GLY A 1 34  ? -1.212  -6.957  12.473 1.00 0.00 ? 34  GLY A HA2  7  
ATOM 11200 H HA3  . GLY A 1 34  ? -2.208  -6.821  11.038 1.00 0.00 ? 34  GLY A HA3  7  
ATOM 11201 N N    . LEU A 1 35  ? 1.001   -6.002  11.200 1.00 0.00 ? 35  LEU A N    7  
ATOM 11202 C CA   . LEU A 1 35  ? 2.261   -6.048  10.478 1.00 0.00 ? 35  LEU A CA   7  
ATOM 11203 C C    . LEU A 1 35  ? 3.103   -7.212  11.004 1.00 0.00 ? 35  LEU A C    7  
ATOM 11204 O O    . LEU A 1 35  ? 4.277   -7.340  10.659 1.00 0.00 ? 35  LEU A O    7  
ATOM 11205 C CB   . LEU A 1 35  ? 2.971   -4.694  10.551 1.00 0.00 ? 35  LEU A CB   7  
ATOM 11206 C CG   . LEU A 1 35  ? 2.191   -3.498  10.001 1.00 0.00 ? 35  LEU A CG   7  
ATOM 11207 C CD1  . LEU A 1 35  ? 3.139   -2.440  9.434  1.00 0.00 ? 35  LEU A CD1  7  
ATOM 11208 C CD2  . LEU A 1 35  ? 1.152   -3.947  8.972  1.00 0.00 ? 35  LEU A CD2  7  
ATOM 11209 H H    . LEU A 1 35  ? 1.045   -5.564  12.098 1.00 0.00 ? 35  LEU A H    7  
ATOM 11210 H HA   . LEU A 1 35  ? 2.030   -6.235  9.429  1.00 0.00 ? 35  LEU A HA   7  
ATOM 11211 H HB2  . LEU A 1 35  ? 3.220   -4.492  11.592 1.00 0.00 ? 35  LEU A HB2  7  
ATOM 11212 H HB3  . LEU A 1 35  ? 3.912   -4.770  10.007 1.00 0.00 ? 35  LEU A HB3  7  
ATOM 11213 H HG   . LEU A 1 35  ? 1.649   -3.036  10.826 1.00 0.00 ? 35  LEU A HG   7  
ATOM 11214 H HD11 . LEU A 1 35  ? 2.625   -1.869  8.660  1.00 0.00 ? 35  LEU A HD11 7  
ATOM 11215 H HD12 . LEU A 1 35  ? 3.453   -1.768  10.232 1.00 0.00 ? 35  LEU A HD12 7  
ATOM 11216 H HD13 . LEU A 1 35  ? 4.014   -2.928  9.004  1.00 0.00 ? 35  LEU A HD13 7  
ATOM 11217 H HD21 . LEU A 1 35  ? 0.328   -4.448  9.482  1.00 0.00 ? 35  LEU A HD21 7  
ATOM 11218 H HD22 . LEU A 1 35  ? 0.772   -3.077  8.436  1.00 0.00 ? 35  LEU A HD22 7  
ATOM 11219 H HD23 . LEU A 1 35  ? 1.614   -4.636  8.265  1.00 0.00 ? 35  LEU A HD23 7  
ATOM 11220 N N    . SER A 1 36  ? 2.471   -8.032  11.831 1.00 0.00 ? 36  SER A N    7  
ATOM 11221 C CA   . SER A 1 36  ? 3.147   -9.181  12.408 1.00 0.00 ? 36  SER A CA   7  
ATOM 11222 C C    . SER A 1 36  ? 4.120   -8.724  13.497 1.00 0.00 ? 36  SER A C    7  
ATOM 11223 O O    . SER A 1 36  ? 3.866   -8.921  14.684 1.00 0.00 ? 36  SER A O    7  
ATOM 11224 C CB   . SER A 1 36  ? 3.888   -9.980  11.335 1.00 0.00 ? 36  SER A CB   7  
ATOM 11225 O OG   . SER A 1 36  ? 5.257   -10.186 11.673 1.00 0.00 ? 36  SER A OG   7  
ATOM 11226 H H    . SER A 1 36  ? 1.516   -7.920  12.107 1.00 0.00 ? 36  SER A H    7  
ATOM 11227 H HA   . SER A 1 36  ? 2.355   -9.796  12.836 1.00 0.00 ? 36  SER A HA   7  
ATOM 11228 H HB2  . SER A 1 36  ? 3.399   -10.945 11.198 1.00 0.00 ? 36  SER A HB2  7  
ATOM 11229 H HB3  . SER A 1 36  ? 3.825   -9.454  10.383 1.00 0.00 ? 36  SER A HB3  7  
ATOM 11230 H HG   . SER A 1 36  ? 5.538   -11.110 11.413 1.00 0.00 ? 36  SER A HG   7  
ATOM 11231 N N    . PHE A 1 37  ? 5.213   -8.121  13.053 1.00 0.00 ? 37  PHE A N    7  
ATOM 11232 C CA   . PHE A 1 37  ? 6.226   -7.635  13.975 1.00 0.00 ? 37  PHE A CA   7  
ATOM 11233 C C    . PHE A 1 37  ? 7.536   -7.338  13.243 1.00 0.00 ? 37  PHE A C    7  
ATOM 11234 O O    . PHE A 1 37  ? 8.309   -6.482  13.669 1.00 0.00 ? 37  PHE A O    7  
ATOM 11235 C CB   . PHE A 1 37  ? 6.467   -8.744  15.000 1.00 0.00 ? 37  PHE A CB   7  
ATOM 11236 C CG   . PHE A 1 37  ? 5.771   -8.513  16.343 1.00 0.00 ? 37  PHE A CG   7  
ATOM 11237 C CD1  . PHE A 1 37  ? 5.720   -7.263  16.877 1.00 0.00 ? 37  PHE A CD1  7  
ATOM 11238 C CD2  . PHE A 1 37  ? 5.201   -9.557  17.002 1.00 0.00 ? 37  PHE A CD2  7  
ATOM 11239 C CE1  . PHE A 1 37  ? 5.074   -7.049  18.122 1.00 0.00 ? 37  PHE A CE1  7  
ATOM 11240 C CE2  . PHE A 1 37  ? 4.555   -9.343  18.248 1.00 0.00 ? 37  PHE A CE2  7  
ATOM 11241 C CZ   . PHE A 1 37  ? 4.504   -8.093  18.782 1.00 0.00 ? 37  PHE A CZ   7  
ATOM 11242 H H    . PHE A 1 37  ? 5.412   -7.965  12.086 1.00 0.00 ? 37  PHE A H    7  
ATOM 11243 H HA   . PHE A 1 37  ? 5.844   -6.715  14.419 1.00 0.00 ? 37  PHE A HA   7  
ATOM 11244 H HB2  . PHE A 1 37  ? 6.126   -9.691  14.583 1.00 0.00 ? 37  PHE A HB2  7  
ATOM 11245 H HB3  . PHE A 1 37  ? 7.540   -8.839  15.171 1.00 0.00 ? 37  PHE A HB3  7  
ATOM 11246 H HD1  . PHE A 1 37  ? 6.176   -6.426  16.348 1.00 0.00 ? 37  PHE A HD1  7  
ATOM 11247 H HD2  . PHE A 1 37  ? 5.242   -10.559 16.574 1.00 0.00 ? 37  PHE A HD2  7  
ATOM 11248 H HE1  . PHE A 1 37  ? 5.033   -6.047  18.550 1.00 0.00 ? 37  PHE A HE1  7  
ATOM 11249 H HE2  . PHE A 1 37  ? 4.098   -10.180 18.776 1.00 0.00 ? 37  PHE A HE2  7  
ATOM 11250 H HZ   . PHE A 1 37  ? 4.008   -7.929  19.738 1.00 0.00 ? 37  PHE A HZ   7  
ATOM 11251 N N    . GLU A 1 38  ? 7.746   -8.063  12.154 1.00 0.00 ? 38  GLU A N    7  
ATOM 11252 C CA   . GLU A 1 38  ? 8.950   -7.889  11.359 1.00 0.00 ? 38  GLU A CA   7  
ATOM 11253 C C    . GLU A 1 38  ? 8.739   -6.795  10.311 1.00 0.00 ? 38  GLU A C    7  
ATOM 11254 O O    . GLU A 1 38  ? 9.504   -5.832  10.251 1.00 0.00 ? 38  GLU A O    7  
ATOM 11255 C CB   . GLU A 1 38  ? 9.367   -9.206  10.701 1.00 0.00 ? 38  GLU A CB   7  
ATOM 11256 C CG   . GLU A 1 38  ? 10.883  -9.399  10.774 1.00 0.00 ? 38  GLU A CG   7  
ATOM 11257 C CD   . GLU A 1 38  ? 11.375  -10.312 9.649  1.00 0.00 ? 38  GLU A CD   7  
ATOM 11258 O OE1  . GLU A 1 38  ? 10.620  -11.248 9.307  1.00 0.00 ? 38  GLU A OE1  7  
ATOM 11259 O OE2  . GLU A 1 38  ? 12.494  -10.053 9.157  1.00 0.00 ? 38  GLU A OE2  7  
ATOM 11260 H H    . GLU A 1 38  ? 7.112   -8.758  11.814 1.00 0.00 ? 38  GLU A H    7  
ATOM 11261 H HA   . GLU A 1 38  ? 9.721   -7.582  12.065 1.00 0.00 ? 38  GLU A HA   7  
ATOM 11262 H HB2  . GLU A 1 38  ? 8.867   -10.038 11.195 1.00 0.00 ? 38  GLU A HB2  7  
ATOM 11263 H HB3  . GLU A 1 38  ? 9.046   -9.214  9.659  1.00 0.00 ? 38  GLU A HB3  7  
ATOM 11264 H HG2  . GLU A 1 38  ? 11.380  -8.431  10.705 1.00 0.00 ? 38  GLU A HG2  7  
ATOM 11265 H HG3  . GLU A 1 38  ? 11.153  -9.827  11.739 1.00 0.00 ? 38  GLU A HG3  7  
ATOM 11266 N N    . THR A 1 39  ? 7.700   -6.978  9.511  1.00 0.00 ? 39  THR A N    7  
ATOM 11267 C CA   . THR A 1 39  ? 7.380   -6.018  8.468  1.00 0.00 ? 39  THR A CA   7  
ATOM 11268 C C    . THR A 1 39  ? 7.660   -4.593  8.950  1.00 0.00 ? 39  THR A C    7  
ATOM 11269 O O    . THR A 1 39  ? 6.841   -3.997  9.648  1.00 0.00 ? 39  THR A O    7  
ATOM 11270 C CB   . THR A 1 39  ? 5.925   -6.242  8.049  1.00 0.00 ? 39  THR A CB   7  
ATOM 11271 O OG1  . THR A 1 39  ? 6.008   -7.221  7.017  1.00 0.00 ? 39  THR A OG1  7  
ATOM 11272 C CG2  . THR A 1 39  ? 5.320   -5.019  7.356  1.00 0.00 ? 39  THR A CG2  7  
ATOM 11273 H H    . THR A 1 39  ? 7.083   -7.763  9.566  1.00 0.00 ? 39  THR A H    7  
ATOM 11274 H HA   . THR A 1 39  ? 8.036   -6.202  7.617  1.00 0.00 ? 39  THR A HA   7  
ATOM 11275 H HB   . THR A 1 39  ? 5.317   -6.547  8.901  1.00 0.00 ? 39  THR A HB   7  
ATOM 11276 H HG1  . THR A 1 39  ? 5.134   -7.285  6.535  1.00 0.00 ? 39  THR A HG1  7  
ATOM 11277 H HG21 . THR A 1 39  ? 5.960   -4.719  6.526  1.00 0.00 ? 39  THR A HG21 7  
ATOM 11278 H HG22 . THR A 1 39  ? 4.329   -5.269  6.978  1.00 0.00 ? 39  THR A HG22 7  
ATOM 11279 H HG23 . THR A 1 39  ? 5.241   -4.199  8.069  1.00 0.00 ? 39  THR A HG23 7  
ATOM 11280 N N    . THR A 1 40  ? 8.821   -4.088  8.559  1.00 0.00 ? 40  THR A N    7  
ATOM 11281 C CA   . THR A 1 40  ? 9.220   -2.745  8.943  1.00 0.00 ? 40  THR A CA   7  
ATOM 11282 C C    . THR A 1 40  ? 8.569   -1.711  8.021  1.00 0.00 ? 40  THR A C    7  
ATOM 11283 O O    . THR A 1 40  ? 7.649   -2.035  7.272  1.00 0.00 ? 40  THR A O    7  
ATOM 11284 C CB   . THR A 1 40  ? 10.749  -2.686  8.937  1.00 0.00 ? 40  THR A CB   7  
ATOM 11285 O OG1  . THR A 1 40  ? 11.104  -2.993  7.592  1.00 0.00 ? 40  THR A OG1  7  
ATOM 11286 C CG2  . THR A 1 40  ? 11.381  -3.813  9.756  1.00 0.00 ? 40  THR A CG2  7  
ATOM 11287 H H    . THR A 1 40  ? 9.482   -4.579  7.991  1.00 0.00 ? 40  THR A H    7  
ATOM 11288 H HA   . THR A 1 40  ? 8.852   -2.551  9.950  1.00 0.00 ? 40  THR A HA   7  
ATOM 11289 H HB   . THR A 1 40  ? 11.102  -1.713  9.278  1.00 0.00 ? 40  THR A HB   7  
ATOM 11290 H HG1  . THR A 1 40  ? 10.748  -2.291  6.976  1.00 0.00 ? 40  THR A HG1  7  
ATOM 11291 H HG21 . THR A 1 40  ? 11.187  -4.769  9.269  1.00 0.00 ? 40  THR A HG21 7  
ATOM 11292 H HG22 . THR A 1 40  ? 12.457  -3.653  9.826  1.00 0.00 ? 40  THR A HG22 7  
ATOM 11293 H HG23 . THR A 1 40  ? 10.949  -3.822  10.757 1.00 0.00 ? 40  THR A HG23 7  
ATOM 11294 N N    . GLU A 1 41  ? 9.073   -0.489  8.106  1.00 0.00 ? 41  GLU A N    7  
ATOM 11295 C CA   . GLU A 1 41  ? 8.553   0.594   7.289  1.00 0.00 ? 41  GLU A CA   7  
ATOM 11296 C C    . GLU A 1 41  ? 8.699   0.256   5.804  1.00 0.00 ? 41  GLU A C    7  
ATOM 11297 O O    . GLU A 1 41  ? 7.720   0.274   5.060  1.00 0.00 ? 41  GLU A O    7  
ATOM 11298 C CB   . GLU A 1 41  ? 9.248   1.915   7.622  1.00 0.00 ? 41  GLU A CB   7  
ATOM 11299 C CG   . GLU A 1 41  ? 9.088   2.261   9.104  1.00 0.00 ? 41  GLU A CG   7  
ATOM 11300 C CD   . GLU A 1 41  ? 9.516   3.703   9.381  1.00 0.00 ? 41  GLU A CD   7  
ATOM 11301 O OE1  . GLU A 1 41  ? 10.373  4.197   8.616  1.00 0.00 ? 41  GLU A OE1  7  
ATOM 11302 O OE2  . GLU A 1 41  ? 8.977   4.280   10.350 1.00 0.00 ? 41  GLU A OE2  7  
ATOM 11303 H H    . GLU A 1 41  ? 9.822   -0.234  8.718  1.00 0.00 ? 41  GLU A H    7  
ATOM 11304 H HA   . GLU A 1 41  ? 7.497   0.671   7.549  1.00 0.00 ? 41  GLU A HA   7  
ATOM 11305 H HB2  . GLU A 1 41  ? 10.307  1.846   7.374  1.00 0.00 ? 41  GLU A HB2  7  
ATOM 11306 H HB3  . GLU A 1 41  ? 8.829   2.715   7.012  1.00 0.00 ? 41  GLU A HB3  7  
ATOM 11307 H HG2  . GLU A 1 41  ? 8.049   2.122   9.404  1.00 0.00 ? 41  GLU A HG2  7  
ATOM 11308 H HG3  . GLU A 1 41  ? 9.687   1.578   9.707  1.00 0.00 ? 41  GLU A HG3  7  
ATOM 11309 N N    . GLU A 1 42  ? 9.931   -0.044  5.417  1.00 0.00 ? 42  GLU A N    7  
ATOM 11310 C CA   . GLU A 1 42  ? 10.218  -0.385  4.034  1.00 0.00 ? 42  GLU A CA   7  
ATOM 11311 C C    . GLU A 1 42  ? 9.369   -1.579  3.594  1.00 0.00 ? 42  GLU A C    7  
ATOM 11312 O O    . GLU A 1 42  ? 8.501   -1.444  2.734  1.00 0.00 ? 42  GLU A O    7  
ATOM 11313 C CB   . GLU A 1 42  ? 11.709  -0.670  3.839  1.00 0.00 ? 42  GLU A CB   7  
ATOM 11314 C CG   . GLU A 1 42  ? 12.396  0.483   3.106  1.00 0.00 ? 42  GLU A CG   7  
ATOM 11315 C CD   . GLU A 1 42  ? 13.917  0.400   3.255  1.00 0.00 ? 42  GLU A CD   7  
ATOM 11316 O OE1  . GLU A 1 42  ? 14.412  0.888   4.294  1.00 0.00 ? 42  GLU A OE1  7  
ATOM 11317 O OE2  . GLU A 1 42  ? 14.549  -0.151  2.328  1.00 0.00 ? 42  GLU A OE2  7  
ATOM 11318 H H    . GLU A 1 42  ? 10.722  -0.056  6.029  1.00 0.00 ? 42  GLU A H    7  
ATOM 11319 H HA   . GLU A 1 42  ? 9.945   0.497   3.455  1.00 0.00 ? 42  GLU A HA   7  
ATOM 11320 H HB2  . GLU A 1 42  ? 12.183  -0.824  4.808  1.00 0.00 ? 42  GLU A HB2  7  
ATOM 11321 H HB3  . GLU A 1 42  ? 11.835  -1.593  3.272  1.00 0.00 ? 42  GLU A HB3  7  
ATOM 11322 H HG2  . GLU A 1 42  ? 12.129  0.458   2.049  1.00 0.00 ? 42  GLU A HG2  7  
ATOM 11323 H HG3  . GLU A 1 42  ? 12.040  1.434   3.502  1.00 0.00 ? 42  GLU A HG3  7  
ATOM 11324 N N    . SER A 1 43  ? 9.649   -2.721  4.205  1.00 0.00 ? 43  SER A N    7  
ATOM 11325 C CA   . SER A 1 43  ? 8.922   -3.938  3.888  1.00 0.00 ? 43  SER A CA   7  
ATOM 11326 C C    . SER A 1 43  ? 7.443   -3.619  3.658  1.00 0.00 ? 43  SER A C    7  
ATOM 11327 O O    . SER A 1 43  ? 6.811   -4.191  2.772  1.00 0.00 ? 43  SER A O    7  
ATOM 11328 C CB   . SER A 1 43  ? 9.074   -4.977  5.000  1.00 0.00 ? 43  SER A CB   7  
ATOM 11329 O OG   . SER A 1 43  ? 10.258  -5.755  4.845  1.00 0.00 ? 43  SER A OG   7  
ATOM 11330 H H    . SER A 1 43  ? 10.357  -2.822  4.904  1.00 0.00 ? 43  SER A H    7  
ATOM 11331 H HA   . SER A 1 43  ? 9.378   -4.316  2.973  1.00 0.00 ? 43  SER A HA   7  
ATOM 11332 H HB2  . SER A 1 43  ? 9.096   -4.473  5.966  1.00 0.00 ? 43  SER A HB2  7  
ATOM 11333 H HB3  . SER A 1 43  ? 8.206   -5.635  5.003  1.00 0.00 ? 43  SER A HB3  7  
ATOM 11334 H HG   . SER A 1 43  ? 11.021  -5.167  4.578  1.00 0.00 ? 43  SER A HG   7  
ATOM 11335 N N    . LEU A 1 44  ? 6.934   -2.706  4.473  1.00 0.00 ? 44  LEU A N    7  
ATOM 11336 C CA   . LEU A 1 44  ? 5.542   -2.304  4.370  1.00 0.00 ? 44  LEU A CA   7  
ATOM 11337 C C    . LEU A 1 44  ? 5.364   -1.407  3.143  1.00 0.00 ? 44  LEU A C    7  
ATOM 11338 O O    . LEU A 1 44  ? 4.599   -1.733  2.237  1.00 0.00 ? 44  LEU A O    7  
ATOM 11339 C CB   . LEU A 1 44  ? 5.072   -1.660  5.676  1.00 0.00 ? 44  LEU A CB   7  
ATOM 11340 C CG   . LEU A 1 44  ? 3.659   -1.072  5.664  1.00 0.00 ? 44  LEU A CG   7  
ATOM 11341 C CD1  . LEU A 1 44  ? 2.622   -2.131  6.045  1.00 0.00 ? 44  LEU A CD1  7  
ATOM 11342 C CD2  . LEU A 1 44  ? 3.572   0.165   6.560  1.00 0.00 ? 44  LEU A CD2  7  
ATOM 11343 H H    . LEU A 1 44  ? 7.455   -2.244  5.191  1.00 0.00 ? 44  LEU A H    7  
ATOM 11344 H HA   . LEU A 1 44  ? 4.951   -3.208  4.225  1.00 0.00 ? 44  LEU A HA   7  
ATOM 11345 H HB2  . LEU A 1 44  ? 5.126   -2.408  6.466  1.00 0.00 ? 44  LEU A HB2  7  
ATOM 11346 H HB3  . LEU A 1 44  ? 5.772   -0.866  5.939  1.00 0.00 ? 44  LEU A HB3  7  
ATOM 11347 H HG   . LEU A 1 44  ? 3.432   -0.750  4.647  1.00 0.00 ? 44  LEU A HG   7  
ATOM 11348 H HD11 . LEU A 1 44  ? 2.991   -2.713  6.889  1.00 0.00 ? 44  LEU A HD11 7  
ATOM 11349 H HD12 . LEU A 1 44  ? 1.688   -1.641  6.321  1.00 0.00 ? 44  LEU A HD12 7  
ATOM 11350 H HD13 . LEU A 1 44  ? 2.449   -2.792  5.195  1.00 0.00 ? 44  LEU A HD13 7  
ATOM 11351 H HD21 . LEU A 1 44  ? 2.539   0.509   6.604  1.00 0.00 ? 44  LEU A HD21 7  
ATOM 11352 H HD22 . LEU A 1 44  ? 3.914   -0.089  7.564  1.00 0.00 ? 44  LEU A HD22 7  
ATOM 11353 H HD23 . LEU A 1 44  ? 4.202   0.955   6.151  1.00 0.00 ? 44  LEU A HD23 7  
ATOM 11354 N N    . ARG A 1 45  ? 6.084   -0.294  3.153  1.00 0.00 ? 45  ARG A N    7  
ATOM 11355 C CA   . ARG A 1 45  ? 6.015   0.652   2.053  1.00 0.00 ? 45  ARG A CA   7  
ATOM 11356 C C    . ARG A 1 45  ? 6.105   -0.083  0.714  1.00 0.00 ? 45  ARG A C    7  
ATOM 11357 O O    . ARG A 1 45  ? 5.328   0.187   -0.200 1.00 0.00 ? 45  ARG A O    7  
ATOM 11358 C CB   . ARG A 1 45  ? 7.144   1.681   2.140  1.00 0.00 ? 45  ARG A CB   7  
ATOM 11359 C CG   . ARG A 1 45  ? 6.962   2.594   3.354  1.00 0.00 ? 45  ARG A CG   7  
ATOM 11360 C CD   . ARG A 1 45  ? 7.214   4.057   2.982  1.00 0.00 ? 45  ARG A CD   7  
ATOM 11361 N NE   . ARG A 1 45  ? 8.518   4.499   3.525  1.00 0.00 ? 45  ARG A NE   7  
ATOM 11362 C CZ   . ARG A 1 45  ? 9.698   4.247   2.943  1.00 0.00 ? 45  ARG A CZ   7  
ATOM 11363 N NH1  . ARG A 1 45  ? 9.746   3.554   1.797  1.00 0.00 ? 45  ARG A NH1  7  
ATOM 11364 N NH2  . ARG A 1 45  ? 10.831  4.687   3.508  1.00 0.00 ? 45  ARG A NH2  7  
ATOM 11365 H H    . ARG A 1 45  ? 6.704   -0.036  3.894  1.00 0.00 ? 45  ARG A H    7  
ATOM 11366 H HA   . ARG A 1 45  ? 5.048   1.142   2.167  1.00 0.00 ? 45  ARG A HA   7  
ATOM 11367 H HB2  . ARG A 1 45  ? 8.103   1.168   2.207  1.00 0.00 ? 45  ARG A HB2  7  
ATOM 11368 H HB3  . ARG A 1 45  ? 7.166   2.280   1.229  1.00 0.00 ? 45  ARG A HB3  7  
ATOM 11369 H HG2  . ARG A 1 45  ? 5.951   2.484   3.747  1.00 0.00 ? 45  ARG A HG2  7  
ATOM 11370 H HG3  . ARG A 1 45  ? 7.647   2.293   4.146  1.00 0.00 ? 45  ARG A HG3  7  
ATOM 11371 H HD2  . ARG A 1 45  ? 7.204   4.172   1.898  1.00 0.00 ? 45  ARG A HD2  7  
ATOM 11372 H HD3  . ARG A 1 45  ? 6.415   4.684   3.377  1.00 0.00 ? 45  ARG A HD3  7  
ATOM 11373 H HE   . ARG A 1 45  ? 8.518   5.018   4.380  1.00 0.00 ? 45  ARG A HE   7  
ATOM 11374 H HH11 . ARG A 1 45  ? 8.901   3.225   1.376  1.00 0.00 ? 45  ARG A HH11 7  
ATOM 11375 H HH12 . ARG A 1 45  ? 10.627  3.366   1.363  1.00 0.00 ? 45  ARG A HH12 7  
ATOM 11376 H HH21 . ARG A 1 45  ? 10.796  5.204   4.363  1.00 0.00 ? 45  ARG A HH21 7  
ATOM 11377 H HH22 . ARG A 1 45  ? 11.712  4.499   3.074  1.00 0.00 ? 45  ARG A HH22 7  
ATOM 11378 N N    . ASN A 1 46  ? 7.061   -0.998  0.641  1.00 0.00 ? 46  ASN A N    7  
ATOM 11379 C CA   . ASN A 1 46  ? 7.264   -1.774  -0.570 1.00 0.00 ? 46  ASN A CA   7  
ATOM 11380 C C    . ASN A 1 46  ? 5.914   -2.295  -1.068 1.00 0.00 ? 46  ASN A C    7  
ATOM 11381 O O    . ASN A 1 46  ? 5.747   -2.558  -2.258 1.00 0.00 ? 46  ASN A O    7  
ATOM 11382 C CB   . ASN A 1 46  ? 8.169   -2.979  -0.308 1.00 0.00 ? 46  ASN A CB   7  
ATOM 11383 C CG   . ASN A 1 46  ? 8.304   -3.847  -1.561 1.00 0.00 ? 46  ASN A CG   7  
ATOM 11384 O OD1  . ASN A 1 46  ? 9.072   -3.562  -2.465 1.00 0.00 ? 46  ASN A OD1  7  
ATOM 11385 N ND2  . ASN A 1 46  ? 7.516   -4.918  -1.564 1.00 0.00 ? 46  ASN A ND2  7  
ATOM 11386 H H    . ASN A 1 46  ? 7.689   -1.211  1.390  1.00 0.00 ? 46  ASN A H    7  
ATOM 11387 H HA   . ASN A 1 46  ? 7.731   -1.086  -1.276 1.00 0.00 ? 46  ASN A HA   7  
ATOM 11388 H HB2  . ASN A 1 46  ? 9.154   -2.636  0.009  1.00 0.00 ? 46  ASN A HB2  7  
ATOM 11389 H HB3  . ASN A 1 46  ? 7.761   -3.574  0.509  1.00 0.00 ? 46  ASN A HB3  7  
ATOM 11390 H HD21 . ASN A 1 46  ? 6.908   -5.094  -0.790 1.00 0.00 ? 46  ASN A HD21 7  
ATOM 11391 H HD22 . ASN A 1 46  ? 7.531   -5.548  -2.340 1.00 0.00 ? 46  ASN A HD22 7  
ATOM 11392 N N    . TYR A 1 47  ? 4.986   -2.430  -0.132 1.00 0.00 ? 47  TYR A N    7  
ATOM 11393 C CA   . TYR A 1 47  ? 3.657   -2.916  -0.460 1.00 0.00 ? 47  TYR A CA   7  
ATOM 11394 C C    . TYR A 1 47  ? 2.712   -1.755  -0.778 1.00 0.00 ? 47  TYR A C    7  
ATOM 11395 O O    . TYR A 1 47  ? 1.994   -1.790  -1.777 1.00 0.00 ? 47  TYR A O    7  
ATOM 11396 C CB   . TYR A 1 47  ? 3.152   -3.641  0.789  1.00 0.00 ? 47  TYR A CB   7  
ATOM 11397 C CG   . TYR A 1 47  ? 2.084   -4.699  0.505  1.00 0.00 ? 47  TYR A CG   7  
ATOM 11398 C CD1  . TYR A 1 47  ? 2.438   -5.900  -0.075 1.00 0.00 ? 47  TYR A CD1  7  
ATOM 11399 C CD2  . TYR A 1 47  ? 0.765   -4.452  0.829  1.00 0.00 ? 47  TYR A CD2  7  
ATOM 11400 C CE1  . TYR A 1 47  ? 1.433   -6.895  -0.342 1.00 0.00 ? 47  TYR A CE1  7  
ATOM 11401 C CE2  . TYR A 1 47  ? -0.241  -5.447  0.563  1.00 0.00 ? 47  TYR A CE2  7  
ATOM 11402 C CZ   . TYR A 1 47  ? 0.143   -6.620  -0.010 1.00 0.00 ? 47  TYR A CZ   7  
ATOM 11403 O OH   . TYR A 1 47  ? -0.807  -7.560  -0.262 1.00 0.00 ? 47  TYR A OH   7  
ATOM 11404 H H    . TYR A 1 47  ? 5.131   -2.214  0.834  1.00 0.00 ? 47  TYR A H    7  
ATOM 11405 H HA   . TYR A 1 47  ? 3.740   -3.557  -1.338 1.00 0.00 ? 47  TYR A HA   7  
ATOM 11406 H HB2  . TYR A 1 47  ? 3.997   -4.117  1.286  1.00 0.00 ? 47  TYR A HB2  7  
ATOM 11407 H HB3  . TYR A 1 47  ? 2.746   -2.906  1.484  1.00 0.00 ? 47  TYR A HB3  7  
ATOM 11408 H HD1  . TYR A 1 47  ? 3.480   -6.095  -0.331 1.00 0.00 ? 47  TYR A HD1  7  
ATOM 11409 H HD2  . TYR A 1 47  ? 0.485   -3.503  1.288  1.00 0.00 ? 47  TYR A HD2  7  
ATOM 11410 H HE1  . TYR A 1 47  ? 1.699   -7.848  -0.800 1.00 0.00 ? 47  TYR A HE1  7  
ATOM 11411 H HE2  . TYR A 1 47  ? -1.285  -5.265  0.814  1.00 0.00 ? 47  TYR A HE2  7  
ATOM 11412 H HH   . TYR A 1 47  ? -0.588  -8.406  0.224  1.00 0.00 ? 47  TYR A HH   7  
ATOM 11413 N N    . TYR A 1 48  ? 2.743   -0.754  0.089  1.00 0.00 ? 48  TYR A N    7  
ATOM 11414 C CA   . TYR A 1 48  ? 1.898   0.415   -0.087 1.00 0.00 ? 48  TYR A CA   7  
ATOM 11415 C C    . TYR A 1 48  ? 2.595   1.471   -0.947 1.00 0.00 ? 48  TYR A C    7  
ATOM 11416 O O    . TYR A 1 48  ? 2.269   2.654   -0.870 1.00 0.00 ? 48  TYR A O    7  
ATOM 11417 C CB   . TYR A 1 48  ? 1.671   0.985   1.315  1.00 0.00 ? 48  TYR A CB   7  
ATOM 11418 C CG   . TYR A 1 48  ? 0.576   0.269   2.108  1.00 0.00 ? 48  TYR A CG   7  
ATOM 11419 C CD1  . TYR A 1 48  ? -0.732  0.701   2.023  1.00 0.00 ? 48  TYR A CD1  7  
ATOM 11420 C CD2  . TYR A 1 48  ? 0.896   -0.808  2.908  1.00 0.00 ? 48  TYR A CD2  7  
ATOM 11421 C CE1  . TYR A 1 48  ? -1.763  0.027   2.769  1.00 0.00 ? 48  TYR A CE1  7  
ATOM 11422 C CE2  . TYR A 1 48  ? -0.134  -1.482  3.655  1.00 0.00 ? 48  TYR A CE2  7  
ATOM 11423 C CZ   . TYR A 1 48  ? -1.413  -1.031  3.549  1.00 0.00 ? 48  TYR A CZ   7  
ATOM 11424 O OH   . TYR A 1 48  ? -2.386  -1.668  4.254  1.00 0.00 ? 48  TYR A OH   7  
ATOM 11425 H H    . TYR A 1 48  ? 3.330   -0.734  0.899  1.00 0.00 ? 48  TYR A H    7  
ATOM 11426 H HA   . TYR A 1 48  ? 0.983   0.097   -0.586 1.00 0.00 ? 48  TYR A HA   7  
ATOM 11427 H HB2  . TYR A 1 48  ? 2.605   0.931   1.874  1.00 0.00 ? 48  TYR A HB2  7  
ATOM 11428 H HB3  . TYR A 1 48  ? 1.412   2.041   1.229  1.00 0.00 ? 48  TYR A HB3  7  
ATOM 11429 H HD1  . TYR A 1 48  ? -0.985  1.552   1.391  1.00 0.00 ? 48  TYR A HD1  7  
ATOM 11430 H HD2  . TYR A 1 48  ? 1.929   -1.149  2.975  1.00 0.00 ? 48  TYR A HD2  7  
ATOM 11431 H HE1  . TYR A 1 48  ? -2.800  0.358   2.711  1.00 0.00 ? 48  TYR A HE1  7  
ATOM 11432 H HE2  . TYR A 1 48  ? 0.105   -2.334  4.291  1.00 0.00 ? 48  TYR A HE2  7  
ATOM 11433 H HH   . TYR A 1 48  ? -1.983  -2.384  4.823  1.00 0.00 ? 48  TYR A HH   7  
ATOM 11434 N N    . GLU A 1 49  ? 3.543   1.004   -1.747 1.00 0.00 ? 49  GLU A N    7  
ATOM 11435 C CA   . GLU A 1 49  ? 4.289   1.893   -2.621 1.00 0.00 ? 49  GLU A CA   7  
ATOM 11436 C C    . GLU A 1 49  ? 3.716   1.848   -4.039 1.00 0.00 ? 49  GLU A C    7  
ATOM 11437 O O    . GLU A 1 49  ? 3.958   2.750   -4.840 1.00 0.00 ? 49  GLU A O    7  
ATOM 11438 C CB   . GLU A 1 49  ? 5.778   1.541   -2.620 1.00 0.00 ? 49  GLU A CB   7  
ATOM 11439 C CG   . GLU A 1 49  ? 6.562   2.476   -1.697 1.00 0.00 ? 49  GLU A CG   7  
ATOM 11440 C CD   . GLU A 1 49  ? 7.906   2.860   -2.319 1.00 0.00 ? 49  GLU A CD   7  
ATOM 11441 O OE1  . GLU A 1 49  ? 8.637   1.926   -2.712 1.00 0.00 ? 49  GLU A OE1  7  
ATOM 11442 O OE2  . GLU A 1 49  ? 8.172   4.080   -2.388 1.00 0.00 ? 49  GLU A OE2  7  
ATOM 11443 H H    . GLU A 1 49  ? 3.803   0.040   -1.804 1.00 0.00 ? 49  GLU A H    7  
ATOM 11444 H HA   . GLU A 1 49  ? 4.158   2.890   -2.201 1.00 0.00 ? 49  GLU A HA   7  
ATOM 11445 H HB2  . GLU A 1 49  ? 5.911   0.509   -2.296 1.00 0.00 ? 49  GLU A HB2  7  
ATOM 11446 H HB3  . GLU A 1 49  ? 6.172   1.610   -3.634 1.00 0.00 ? 49  GLU A HB3  7  
ATOM 11447 H HG2  . GLU A 1 49  ? 5.977   3.375   -1.502 1.00 0.00 ? 49  GLU A HG2  7  
ATOM 11448 H HG3  . GLU A 1 49  ? 6.728   1.989   -0.736 1.00 0.00 ? 49  GLU A HG3  7  
ATOM 11449 N N    . GLN A 1 50  ? 2.967   0.788   -4.307 1.00 0.00 ? 50  GLN A N    7  
ATOM 11450 C CA   . GLN A 1 50  ? 2.357   0.614   -5.614 1.00 0.00 ? 50  GLN A CA   7  
ATOM 11451 C C    . GLN A 1 50  ? 1.188   1.585   -5.789 1.00 0.00 ? 50  GLN A C    7  
ATOM 11452 O O    . GLN A 1 50  ? 1.203   2.424   -6.689 1.00 0.00 ? 50  GLN A O    7  
ATOM 11453 C CB   . GLN A 1 50  ? 1.902   -0.833  -5.818 1.00 0.00 ? 50  GLN A CB   7  
ATOM 11454 C CG   . GLN A 1 50  ? 3.036   -1.813  -5.510 1.00 0.00 ? 50  GLN A CG   7  
ATOM 11455 C CD   . GLN A 1 50  ? 2.506   -3.242  -5.383 1.00 0.00 ? 50  GLN A CD   7  
ATOM 11456 O OE1  . GLN A 1 50  ? 2.868   -4.135  -6.132 1.00 0.00 ? 50  GLN A OE1  7  
ATOM 11457 N NE2  . GLN A 1 50  ? 1.631   -3.409  -4.395 1.00 0.00 ? 50  GLN A NE2  7  
ATOM 11458 H H    . GLN A 1 50  ? 2.775   0.059   -3.650 1.00 0.00 ? 50  GLN A H    7  
ATOM 11459 H HA   . GLN A 1 50  ? 3.142   0.846   -6.333 1.00 0.00 ? 50  GLN A HA   7  
ATOM 11460 H HB2  . GLN A 1 50  ? 1.049   -1.044  -5.173 1.00 0.00 ? 50  GLN A HB2  7  
ATOM 11461 H HB3  . GLN A 1 50  ? 1.567   -0.971  -6.846 1.00 0.00 ? 50  GLN A HB3  7  
ATOM 11462 H HG2  . GLN A 1 50  ? 3.785   -1.768  -6.301 1.00 0.00 ? 50  GLN A HG2  7  
ATOM 11463 H HG3  . GLN A 1 50  ? 3.532   -1.521  -4.584 1.00 0.00 ? 50  GLN A HG3  7  
ATOM 11464 H HE21 . GLN A 1 50  ? 1.377   -2.634  -3.816 1.00 0.00 ? 50  GLN A HE21 7  
ATOM 11465 H HE22 . GLN A 1 50  ? 1.228   -4.309  -4.231 1.00 0.00 ? 50  GLN A HE22 7  
ATOM 11466 N N    . TRP A 1 51  ? 0.204   1.441   -4.914 1.00 0.00 ? 51  TRP A N    7  
ATOM 11467 C CA   . TRP A 1 51  ? -0.970  2.295   -4.960 1.00 0.00 ? 51  TRP A CA   7  
ATOM 11468 C C    . TRP A 1 51  ? -0.495  3.748   -5.029 1.00 0.00 ? 51  TRP A C    7  
ATOM 11469 O O    . TRP A 1 51  ? -1.110  4.575   -5.700 1.00 0.00 ? 51  TRP A O    7  
ATOM 11470 C CB   . TRP A 1 51  ? -1.894  2.024   -3.771 1.00 0.00 ? 51  TRP A CB   7  
ATOM 11471 C CG   . TRP A 1 51  ? -2.589  0.662   -3.821 1.00 0.00 ? 51  TRP A CG   7  
ATOM 11472 C CD1  . TRP A 1 51  ? -3.558  0.260   -4.655 1.00 0.00 ? 51  TRP A CD1  7  
ATOM 11473 C CD2  . TRP A 1 51  ? -2.326  -0.469  -2.964 1.00 0.00 ? 51  TRP A CD2  7  
ATOM 11474 N NE1  . TRP A 1 51  ? -3.938  -1.041  -4.399 1.00 0.00 ? 51  TRP A NE1  7  
ATOM 11475 C CE2  . TRP A 1 51  ? -3.166  -1.499  -3.338 1.00 0.00 ? 51  TRP A CE2  7  
ATOM 11476 C CE3  . TRP A 1 51  ? -1.411  -0.617  -1.908 1.00 0.00 ? 51  TRP A CE3  7  
ATOM 11477 C CZ2  . TRP A 1 51  ? -3.172  -2.749  -2.708 1.00 0.00 ? 51  TRP A CZ2  7  
ATOM 11478 C CZ3  . TRP A 1 51  ? -1.430  -1.873  -1.288 1.00 0.00 ? 51  TRP A CZ3  7  
ATOM 11479 C CH2  . TRP A 1 51  ? -2.268  -2.920  -1.653 1.00 0.00 ? 51  TRP A CH2  7  
ATOM 11480 H H    . TRP A 1 51  ? 0.200   0.756   -4.185 1.00 0.00 ? 51  TRP A H    7  
ATOM 11481 H HA   . TRP A 1 51  ? -1.530  2.044   -5.861 1.00 0.00 ? 51  TRP A HA   7  
ATOM 11482 H HB2  . TRP A 1 51  ? -1.313  2.090   -2.851 1.00 0.00 ? 51  TRP A HB2  7  
ATOM 11483 H HB3  . TRP A 1 51  ? -2.652  2.806   -3.727 1.00 0.00 ? 51  TRP A HB3  7  
ATOM 11484 H HD1  . TRP A 1 51  ? -3.991  0.883   -5.437 1.00 0.00 ? 51  TRP A HD1  7  
ATOM 11485 H HE1  . TRP A 1 51  ? -4.704  -1.606  -4.931 1.00 0.00 ? 51  TRP A HE1  7  
ATOM 11486 H HE3  . TRP A 1 51  ? -0.738  0.180   -1.593 1.00 0.00 ? 51  TRP A HE3  7  
ATOM 11487 H HZ2  . TRP A 1 51  ? -3.845  -3.547  -3.022 1.00 0.00 ? 51  TRP A HZ2  7  
ATOM 11488 H HZ3  . TRP A 1 51  ? -0.739  -2.041  -0.462 1.00 0.00 ? 51  TRP A HZ3  7  
ATOM 11489 H HH2  . TRP A 1 51  ? -2.222  -3.869  -1.119 1.00 0.00 ? 51  TRP A HH2  7  
ATOM 11490 N N    . GLY A 1 52  ? 0.596   4.014   -4.325 1.00 0.00 ? 52  GLY A N    7  
ATOM 11491 C CA   . GLY A 1 52  ? 1.160   5.353   -4.298 1.00 0.00 ? 52  GLY A CA   7  
ATOM 11492 C C    . GLY A 1 52  ? 2.411   5.402   -3.418 1.00 0.00 ? 52  GLY A C    7  
ATOM 11493 O O    . GLY A 1 52  ? 2.576   4.578   -2.520 1.00 0.00 ? 52  GLY A O    7  
ATOM 11494 H H    . GLY A 1 52  ? 1.090   3.336   -3.782 1.00 0.00 ? 52  GLY A H    7  
ATOM 11495 H HA2  . GLY A 1 52  ? 1.411   5.666   -5.311 1.00 0.00 ? 52  GLY A HA2  7  
ATOM 11496 H HA3  . GLY A 1 52  ? 0.418   6.057   -3.921 1.00 0.00 ? 52  GLY A HA3  7  
ATOM 11497 N N    . LYS A 1 53  ? 3.260   6.378   -3.706 1.00 0.00 ? 53  LYS A N    7  
ATOM 11498 C CA   . LYS A 1 53  ? 4.491   6.546   -2.952 1.00 0.00 ? 53  LYS A CA   7  
ATOM 11499 C C    . LYS A 1 53  ? 4.177   7.220   -1.615 1.00 0.00 ? 53  LYS A C    7  
ATOM 11500 O O    . LYS A 1 53  ? 3.663   8.337   -1.585 1.00 0.00 ? 53  LYS A O    7  
ATOM 11501 C CB   . LYS A 1 53  ? 5.533   7.291   -3.788 1.00 0.00 ? 53  LYS A CB   7  
ATOM 11502 C CG   . LYS A 1 53  ? 6.195   6.356   -4.802 1.00 0.00 ? 53  LYS A CG   7  
ATOM 11503 C CD   . LYS A 1 53  ? 6.167   6.962   -6.206 1.00 0.00 ? 53  LYS A CD   7  
ATOM 11504 C CE   . LYS A 1 53  ? 5.080   6.311   -7.063 1.00 0.00 ? 53  LYS A CE   7  
ATOM 11505 N NZ   . LYS A 1 53  ? 4.572   7.268   -8.072 1.00 0.00 ? 53  LYS A NZ   7  
ATOM 11506 H H    . LYS A 1 53  ? 3.119   7.044   -4.438 1.00 0.00 ? 53  LYS A H    7  
ATOM 11507 H HA   . LYS A 1 53  ? 4.890   5.551   -2.752 1.00 0.00 ? 53  LYS A HA   7  
ATOM 11508 H HB2  . LYS A 1 53  ? 5.060   8.123   -4.309 1.00 0.00 ? 53  LYS A HB2  7  
ATOM 11509 H HB3  . LYS A 1 53  ? 6.293   7.718   -3.132 1.00 0.00 ? 53  LYS A HB3  7  
ATOM 11510 H HG2  . LYS A 1 53  ? 7.226   6.163   -4.505 1.00 0.00 ? 53  LYS A HG2  7  
ATOM 11511 H HG3  . LYS A 1 53  ? 5.679   5.396   -4.806 1.00 0.00 ? 53  LYS A HG3  7  
ATOM 11512 H HD2  . LYS A 1 53  ? 5.988   8.036   -6.139 1.00 0.00 ? 53  LYS A HD2  7  
ATOM 11513 H HD3  . LYS A 1 53  ? 7.138   6.830   -6.682 1.00 0.00 ? 53  LYS A HD3  7  
ATOM 11514 H HE2  . LYS A 1 53  ? 5.481   5.428   -7.561 1.00 0.00 ? 53  LYS A HE2  7  
ATOM 11515 H HE3  . LYS A 1 53  ? 4.261   5.974   -6.428 1.00 0.00 ? 53  LYS A HE3  7  
ATOM 11516 H HZ1  . LYS A 1 53  ? 3.754   7.722   -7.718 1.00 0.00 ? 53  LYS A HZ1  7  
ATOM 11517 H HZ2  . LYS A 1 53  ? 5.275   7.952   -8.266 1.00 0.00 ? 53  LYS A HZ2  7  
ATOM 11518 H HZ3  . LYS A 1 53  ? 4.344   6.776   -8.912 1.00 0.00 ? 53  LYS A HZ3  7  
ATOM 11519 N N    . LEU A 1 54  ? 4.499   6.513   -0.542 1.00 0.00 ? 54  LEU A N    7  
ATOM 11520 C CA   . LEU A 1 54  ? 4.258   7.029   0.794  1.00 0.00 ? 54  LEU A CA   7  
ATOM 11521 C C    . LEU A 1 54  ? 5.307   8.093   1.123  1.00 0.00 ? 54  LEU A C    7  
ATOM 11522 O O    . LEU A 1 54  ? 6.507   7.838   1.024  1.00 0.00 ? 54  LEU A O    7  
ATOM 11523 C CB   . LEU A 1 54  ? 4.204   5.886   1.809  1.00 0.00 ? 54  LEU A CB   7  
ATOM 11524 C CG   . LEU A 1 54  ? 3.364   4.672   1.407  1.00 0.00 ? 54  LEU A CG   7  
ATOM 11525 C CD1  . LEU A 1 54  ? 3.659   3.476   2.316  1.00 0.00 ? 54  LEU A CD1  7  
ATOM 11526 C CD2  . LEU A 1 54  ? 1.874   5.019   1.383  1.00 0.00 ? 54  LEU A CD2  7  
ATOM 11527 H H    . LEU A 1 54  ? 4.917   5.605   -0.575 1.00 0.00 ? 54  LEU A H    7  
ATOM 11528 H HA   . LEU A 1 54  ? 3.276   7.503   0.790  1.00 0.00 ? 54  LEU A HA   7  
ATOM 11529 H HB2  . LEU A 1 54  ? 5.223   5.550   2.003  1.00 0.00 ? 54  LEU A HB2  7  
ATOM 11530 H HB3  . LEU A 1 54  ? 3.814   6.278   2.748  1.00 0.00 ? 54  LEU A HB3  7  
ATOM 11531 H HG   . LEU A 1 54  ? 3.644   4.383   0.394  1.00 0.00 ? 54  LEU A HG   7  
ATOM 11532 H HD11 . LEU A 1 54  ? 2.851   3.362   3.039  1.00 0.00 ? 54  LEU A HD11 7  
ATOM 11533 H HD12 . LEU A 1 54  ? 3.736   2.572   1.712  1.00 0.00 ? 54  LEU A HD12 7  
ATOM 11534 H HD13 . LEU A 1 54  ? 4.598   3.643   2.842  1.00 0.00 ? 54  LEU A HD13 7  
ATOM 11535 H HD21 . LEU A 1 54  ? 1.375   4.541   2.225  1.00 0.00 ? 54  LEU A HD21 7  
ATOM 11536 H HD22 . LEU A 1 54  ? 1.752   6.100   1.454  1.00 0.00 ? 54  LEU A HD22 7  
ATOM 11537 H HD23 . LEU A 1 54  ? 1.434   4.665   0.451  1.00 0.00 ? 54  LEU A HD23 7  
ATOM 11538 N N    . THR A 1 55  ? 4.818   9.263   1.506  1.00 0.00 ? 55  THR A N    7  
ATOM 11539 C CA   . THR A 1 55  ? 5.699   10.367  1.849  1.00 0.00 ? 55  THR A CA   7  
ATOM 11540 C C    . THR A 1 55  ? 6.118   10.278  3.317  1.00 0.00 ? 55  THR A C    7  
ATOM 11541 O O    . THR A 1 55  ? 7.192   10.749  3.690  1.00 0.00 ? 55  THR A O    7  
ATOM 11542 C CB   . THR A 1 55  ? 4.979   11.672  1.500  1.00 0.00 ? 55  THR A CB   7  
ATOM 11543 O OG1  . THR A 1 55  ? 3.912   11.742  2.442  1.00 0.00 ? 55  THR A OG1  7  
ATOM 11544 C CG2  . THR A 1 55  ? 4.276   11.608  0.143  1.00 0.00 ? 55  THR A CG2  7  
ATOM 11545 H H    . THR A 1 55  ? 3.841   9.463   1.583  1.00 0.00 ? 55  THR A H    7  
ATOM 11546 H HA   . THR A 1 55  ? 6.606   10.281  1.251  1.00 0.00 ? 55  THR A HA   7  
ATOM 11547 H HB   . THR A 1 55  ? 5.665   12.518  1.544  1.00 0.00 ? 55  THR A HB   7  
ATOM 11548 H HG1  . THR A 1 55  ? 3.152   11.166  2.141  1.00 0.00 ? 55  THR A HG1  7  
ATOM 11549 H HG21 . THR A 1 55  ? 5.005   11.760  -0.652 1.00 0.00 ? 55  THR A HG21 7  
ATOM 11550 H HG22 . THR A 1 55  ? 3.805   10.632  0.023  1.00 0.00 ? 55  THR A HG22 7  
ATOM 11551 H HG23 . THR A 1 55  ? 3.515   12.387  0.092  1.00 0.00 ? 55  THR A HG23 7  
ATOM 11552 N N    . ASP A 1 56  ? 5.249   9.670   4.112  1.00 0.00 ? 56  ASP A N    7  
ATOM 11553 C CA   . ASP A 1 56  ? 5.516   9.513   5.531  1.00 0.00 ? 56  ASP A CA   7  
ATOM 11554 C C    . ASP A 1 56  ? 4.974   8.162   6.002  1.00 0.00 ? 56  ASP A C    7  
ATOM 11555 O O    . ASP A 1 56  ? 3.763   7.946   6.015  1.00 0.00 ? 56  ASP A O    7  
ATOM 11556 C CB   . ASP A 1 56  ? 4.826   10.609  6.346  1.00 0.00 ? 56  ASP A CB   7  
ATOM 11557 C CG   . ASP A 1 56  ? 5.424   10.858  7.732  1.00 0.00 ? 56  ASP A CG   7  
ATOM 11558 O OD1  . ASP A 1 56  ? 6.620   11.218  7.779  1.00 0.00 ? 56  ASP A OD1  7  
ATOM 11559 O OD2  . ASP A 1 56  ? 4.671   10.682  8.715  1.00 0.00 ? 56  ASP A OD2  7  
ATOM 11560 H H    . ASP A 1 56  ? 4.378   9.290   3.801  1.00 0.00 ? 56  ASP A H    7  
ATOM 11561 H HA   . ASP A 1 56  ? 6.599   9.585   5.629  1.00 0.00 ? 56  ASP A HA   7  
ATOM 11562 H HB2  . ASP A 1 56  ? 4.862   11.540  5.779  1.00 0.00 ? 56  ASP A HB2  7  
ATOM 11563 H HB3  . ASP A 1 56  ? 3.774   10.347  6.462  1.00 0.00 ? 56  ASP A HB3  7  
ATOM 11564 N N    . CYS A 1 57  ? 5.896   7.288   6.376  1.00 0.00 ? 57  CYS A N    7  
ATOM 11565 C CA   . CYS A 1 57  ? 5.526   5.964   6.845  1.00 0.00 ? 57  CYS A CA   7  
ATOM 11566 C C    . CYS A 1 57  ? 6.207   5.724   8.194  1.00 0.00 ? 57  CYS A C    7  
ATOM 11567 O O    . CYS A 1 57  ? 7.431   5.787   8.296  1.00 0.00 ? 57  CYS A O    7  
ATOM 11568 C CB   . CYS A 1 57  ? 5.884   4.881   5.825  1.00 0.00 ? 57  CYS A CB   7  
ATOM 11569 S SG   . CYS A 1 57  ? 5.718   3.225   6.586  1.00 0.00 ? 57  CYS A SG   7  
ATOM 11570 H H    . CYS A 1 57  ? 6.879   7.472   6.362  1.00 0.00 ? 57  CYS A H    7  
ATOM 11571 H HA   . CYS A 1 57  ? 4.441   5.962   6.953  1.00 0.00 ? 57  CYS A HA   7  
ATOM 11572 H HB2  . CYS A 1 57  ? 5.231   4.958   4.956  1.00 0.00 ? 57  CYS A HB2  7  
ATOM 11573 H HB3  . CYS A 1 57  ? 6.904   5.027   5.471  1.00 0.00 ? 57  CYS A HB3  7  
ATOM 11574 H HG   . CYS A 1 57  ? 4.448   3.039   6.239  1.00 0.00 ? 57  CYS A HG   7  
ATOM 11575 N N    . VAL A 1 58  ? 5.383   5.456   9.197  1.00 0.00 ? 58  VAL A N    7  
ATOM 11576 C CA   . VAL A 1 58  ? 5.891   5.207   10.536 1.00 0.00 ? 58  VAL A CA   7  
ATOM 11577 C C    . VAL A 1 58  ? 5.391   3.845   11.021 1.00 0.00 ? 58  VAL A C    7  
ATOM 11578 O O    . VAL A 1 58  ? 4.239   3.482   10.786 1.00 0.00 ? 58  VAL A O    7  
ATOM 11579 C CB   . VAL A 1 58  ? 5.496   6.355   11.467 1.00 0.00 ? 58  VAL A CB   7  
ATOM 11580 C CG1  . VAL A 1 58  ? 5.548   5.915   12.932 1.00 0.00 ? 58  VAL A CG1  7  
ATOM 11581 C CG2  . VAL A 1 58  ? 6.379   7.581   11.231 1.00 0.00 ? 58  VAL A CG2  7  
ATOM 11582 H H    . VAL A 1 58  ? 4.389   5.407   9.106  1.00 0.00 ? 58  VAL A H    7  
ATOM 11583 H HA   . VAL A 1 58  ? 6.979   5.180   10.475 1.00 0.00 ? 58  VAL A HA   7  
ATOM 11584 H HB   . VAL A 1 58  ? 4.467   6.634   11.237 1.00 0.00 ? 58  VAL A HB   7  
ATOM 11585 H HG11 . VAL A 1 58  ? 6.202   5.049   13.028 1.00 0.00 ? 58  VAL A HG11 7  
ATOM 11586 H HG12 . VAL A 1 58  ? 5.934   6.732   13.542 1.00 0.00 ? 58  VAL A HG12 7  
ATOM 11587 H HG13 . VAL A 1 58  ? 4.545   5.653   13.268 1.00 0.00 ? 58  VAL A HG13 7  
ATOM 11588 H HG21 . VAL A 1 58  ? 7.388   7.258   10.973 1.00 0.00 ? 58  VAL A HG21 7  
ATOM 11589 H HG22 . VAL A 1 58  ? 5.968   8.173   10.413 1.00 0.00 ? 58  VAL A HG22 7  
ATOM 11590 H HG23 . VAL A 1 58  ? 6.412   8.186   12.137 1.00 0.00 ? 58  VAL A HG23 7  
ATOM 11591 N N    . VAL A 1 59  ? 6.282   3.127   11.689 1.00 0.00 ? 59  VAL A N    7  
ATOM 11592 C CA   . VAL A 1 59  ? 5.946   1.813   12.210 1.00 0.00 ? 59  VAL A CA   7  
ATOM 11593 C C    . VAL A 1 59  ? 6.219   1.779   13.715 1.00 0.00 ? 59  VAL A C    7  
ATOM 11594 O O    . VAL A 1 59  ? 7.373   1.785   14.140 1.00 0.00 ? 59  VAL A O    7  
ATOM 11595 C CB   . VAL A 1 59  ? 6.709   0.734   11.439 1.00 0.00 ? 59  VAL A CB   7  
ATOM 11596 C CG1  . VAL A 1 59  ? 8.215   0.842   11.692 1.00 0.00 ? 59  VAL A CG1  7  
ATOM 11597 C CG2  . VAL A 1 59  ? 6.193   -0.662  11.794 1.00 0.00 ? 59  VAL A CG2  7  
ATOM 11598 H H    . VAL A 1 59  ? 7.216   3.429   11.877 1.00 0.00 ? 59  VAL A H    7  
ATOM 11599 H HA   . VAL A 1 59  ? 4.880   1.656   12.043 1.00 0.00 ? 59  VAL A HA   7  
ATOM 11600 H HB   . VAL A 1 59  ? 6.536   0.895   10.376 1.00 0.00 ? 59  VAL A HB   7  
ATOM 11601 H HG11 . VAL A 1 59  ? 8.451   0.418   12.667 1.00 0.00 ? 59  VAL A HG11 7  
ATOM 11602 H HG12 . VAL A 1 59  ? 8.753   0.295   10.917 1.00 0.00 ? 59  VAL A HG12 7  
ATOM 11603 H HG13 . VAL A 1 59  ? 8.512   1.891   11.670 1.00 0.00 ? 59  VAL A HG13 7  
ATOM 11604 H HG21 . VAL A 1 59  ? 6.526   -1.375  11.039 1.00 0.00 ? 59  VAL A HG21 7  
ATOM 11605 H HG22 . VAL A 1 59  ? 6.582   -0.957  12.768 1.00 0.00 ? 59  VAL A HG22 7  
ATOM 11606 H HG23 . VAL A 1 59  ? 5.104   -0.649  11.826 1.00 0.00 ? 59  VAL A HG23 7  
ATOM 11607 N N    . MET A 1 60  ? 5.138   1.746   14.480 1.00 0.00 ? 60  MET A N    7  
ATOM 11608 C CA   . MET A 1 60  ? 5.246   1.711   15.928 1.00 0.00 ? 60  MET A CA   7  
ATOM 11609 C C    . MET A 1 60  ? 6.062   0.501   16.388 1.00 0.00 ? 60  MET A C    7  
ATOM 11610 O O    . MET A 1 60  ? 6.054   -0.542  15.736 1.00 0.00 ? 60  MET A O    7  
ATOM 11611 C CB   . MET A 1 60  ? 3.847   1.649   16.544 1.00 0.00 ? 60  MET A CB   7  
ATOM 11612 C CG   . MET A 1 60  ? 3.132   2.995   16.417 1.00 0.00 ? 60  MET A CG   7  
ATOM 11613 S SD   . MET A 1 60  ? 4.066   4.264   17.256 1.00 0.00 ? 60  MET A SD   7  
ATOM 11614 C CE   . MET A 1 60  ? 4.961   4.954   15.874 1.00 0.00 ? 60  MET A CE   7  
ATOM 11615 H H    . MET A 1 60  ? 4.202   1.741   14.126 1.00 0.00 ? 60  MET A H    7  
ATOM 11616 H HA   . MET A 1 60  ? 5.761   2.632   16.205 1.00 0.00 ? 60  MET A HA   7  
ATOM 11617 H HB2  . MET A 1 60  ? 3.262   0.874   16.048 1.00 0.00 ? 60  MET A HB2  7  
ATOM 11618 H HB3  . MET A 1 60  ? 3.921   1.370   17.595 1.00 0.00 ? 60  MET A HB3  7  
ATOM 11619 H HG2  . MET A 1 60  ? 3.012   3.255   15.365 1.00 0.00 ? 60  MET A HG2  7  
ATOM 11620 H HG3  . MET A 1 60  ? 2.131   2.926   16.844 1.00 0.00 ? 60  MET A HG3  7  
ATOM 11621 H HE1  . MET A 1 60  ? 4.978   4.234   15.056 1.00 0.00 ? 60  MET A HE1  7  
ATOM 11622 H HE2  . MET A 1 60  ? 4.470   5.869   15.543 1.00 0.00 ? 60  MET A HE2  7  
ATOM 11623 H HE3  . MET A 1 60  ? 5.983   5.180   16.180 1.00 0.00 ? 60  MET A HE3  7  
ATOM 11624 N N    . ARG A 1 61  ? 6.745   0.680   17.509 1.00 0.00 ? 61  ARG A N    7  
ATOM 11625 C CA   . ARG A 1 61  ? 7.564   -0.384  18.064 1.00 0.00 ? 61  ARG A CA   7  
ATOM 11626 C C    . ARG A 1 61  ? 7.347   -0.487  19.575 1.00 0.00 ? 61  ARG A C    7  
ATOM 11627 O O    . ARG A 1 61  ? 7.527   0.490   20.300 1.00 0.00 ? 61  ARG A O    7  
ATOM 11628 C CB   . ARG A 1 61  ? 9.048   -0.140  17.784 1.00 0.00 ? 61  ARG A CB   7  
ATOM 11629 C CG   . ARG A 1 61  ? 9.277   0.225   16.316 1.00 0.00 ? 61  ARG A CG   7  
ATOM 11630 C CD   . ARG A 1 61  ? 10.712  0.705   16.087 1.00 0.00 ? 61  ARG A CD   7  
ATOM 11631 N NE   . ARG A 1 61  ? 10.706  2.104   15.606 1.00 0.00 ? 61  ARG A NE   7  
ATOM 11632 C CZ   . ARG A 1 61  ? 10.564  2.456   14.321 1.00 0.00 ? 61  ARG A CZ   7  
ATOM 11633 N NH1  . ARG A 1 61  ? 10.415  1.514   13.380 1.00 0.00 ? 61  ARG A NH1  7  
ATOM 11634 N NH2  . ARG A 1 61  ? 10.572  3.751   13.976 1.00 0.00 ? 61  ARG A NH2  7  
ATOM 11635 H H    . ARG A 1 61  ? 6.746   1.532   18.034 1.00 0.00 ? 61  ARG A H    7  
ATOM 11636 H HA   . ARG A 1 61  ? 7.227   -1.288  17.557 1.00 0.00 ? 61  ARG A HA   7  
ATOM 11637 H HB2  . ARG A 1 61  ? 9.416   0.663   18.424 1.00 0.00 ? 61  ARG A HB2  7  
ATOM 11638 H HB3  . ARG A 1 61  ? 9.621   -1.034  18.034 1.00 0.00 ? 61  ARG A HB3  7  
ATOM 11639 H HG2  . ARG A 1 61  ? 9.075   -0.642  15.686 1.00 0.00 ? 61  ARG A HG2  7  
ATOM 11640 H HG3  . ARG A 1 61  ? 8.577   1.005   16.018 1.00 0.00 ? 61  ARG A HG3  7  
ATOM 11641 H HD2  . ARG A 1 61  ? 11.280  0.632   17.014 1.00 0.00 ? 61  ARG A HD2  7  
ATOM 11642 H HD3  . ARG A 1 61  ? 11.207  0.063   15.358 1.00 0.00 ? 61  ARG A HD3  7  
ATOM 11643 H HE   . ARG A 1 61  ? 10.816  2.833   16.282 1.00 0.00 ? 61  ARG A HE   7  
ATOM 11644 H HH11 . ARG A 1 61  ? 10.410  0.547   13.638 1.00 0.00 ? 61  ARG A HH11 7  
ATOM 11645 H HH12 . ARG A 1 61  ? 10.309  1.776   12.421 1.00 0.00 ? 61  ARG A HH12 7  
ATOM 11646 H HH21 . ARG A 1 61  ? 10.683  4.455   14.678 1.00 0.00 ? 61  ARG A HH21 7  
ATOM 11647 H HH22 . ARG A 1 61  ? 10.466  4.014   13.017 1.00 0.00 ? 61  ARG A HH22 7  
ATOM 11648 N N    . ASP A 1 62  ? 6.964   -1.680  20.006 1.00 0.00 ? 62  ASP A N    7  
ATOM 11649 C CA   . ASP A 1 62  ? 6.721   -1.924  21.418 1.00 0.00 ? 62  ASP A CA   7  
ATOM 11650 C C    . ASP A 1 62  ? 7.801   -1.224  22.245 1.00 0.00 ? 62  ASP A C    7  
ATOM 11651 O O    . ASP A 1 62  ? 8.992   -1.459  22.043 1.00 0.00 ? 62  ASP A O    7  
ATOM 11652 C CB   . ASP A 1 62  ? 6.776   -3.419  21.736 1.00 0.00 ? 62  ASP A CB   7  
ATOM 11653 C CG   . ASP A 1 62  ? 5.466   -4.019  22.250 1.00 0.00 ? 62  ASP A CG   7  
ATOM 11654 O OD1  . ASP A 1 62  ? 4.826   -3.350  23.089 1.00 0.00 ? 62  ASP A OD1  7  
ATOM 11655 O OD2  . ASP A 1 62  ? 5.134   -5.134  21.792 1.00 0.00 ? 62  ASP A OD2  7  
ATOM 11656 H H    . ASP A 1 62  ? 6.820   -2.470  19.410 1.00 0.00 ? 62  ASP A H    7  
ATOM 11657 H HA   . ASP A 1 62  ? 5.725   -1.525  21.610 1.00 0.00 ? 62  ASP A HA   7  
ATOM 11658 H HB2  . ASP A 1 62  ? 7.076   -3.956  20.836 1.00 0.00 ? 62  ASP A HB2  7  
ATOM 11659 H HB3  . ASP A 1 62  ? 7.553   -3.588  22.481 1.00 0.00 ? 62  ASP A HB3  7  
ATOM 11660 N N    . PRO A 1 63  ? 7.335   -0.357  23.183 1.00 0.00 ? 63  PRO A N    7  
ATOM 11661 C CA   . PRO A 1 63  ? 8.248   0.379   24.041 1.00 0.00 ? 63  PRO A CA   7  
ATOM 11662 C C    . PRO A 1 63  ? 8.835   -0.530  25.123 1.00 0.00 ? 63  PRO A C    7  
ATOM 11663 O O    . PRO A 1 63  ? 9.925   -0.272  25.632 1.00 0.00 ? 63  PRO A O    7  
ATOM 11664 C CB   . PRO A 1 63  ? 7.421   1.520   24.609 1.00 0.00 ? 63  PRO A CB   7  
ATOM 11665 C CG   . PRO A 1 63  ? 5.968   1.117   24.418 1.00 0.00 ? 63  PRO A CG   7  
ATOM 11666 C CD   . PRO A 1 63  ? 5.932   -0.054  23.450 1.00 0.00 ? 63  PRO A CD   7  
ATOM 11667 H HA