data_1X8B
# 
_entry.id   1X8B 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1X8B         
RCSB  RCSB030065   
WWPDB D_1000030065 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1X8B 
_pdbx_database_status.recvd_initial_deposition_date   2004-08-17 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Squire, C.J.'  1 
'Dickson, J.M.' 2 
'Ivanovic, I.'  3 
'Baker, E.N.'   4 
# 
_citation.id                        primary 
_citation.title                     
;Structure and inhibition of the human cell cycle checkpoint kinase, Wee1A kinase: an atypical tyrosine kinase with a key role in CDK1 regulation
;
_citation.journal_abbrev            Structure 
_citation.journal_volume            13 
_citation.page_first                541 
_citation.page_last                 550 
_citation.year                      2005 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15837193 
_citation.pdbx_database_id_DOI      10.1016/j.str.2004.12.017 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Squire, C.J.'  1 
primary 'Dickson, J.M.' 2 
primary 'Ivanovic, I.'  3 
primary 'Baker, E.N.'   4 
# 
_cell.entry_id           1X8B 
_cell.length_a           69.782 
_cell.length_b           69.782 
_cell.length_c           157.017 
_cell.angle_alpha        90 
_cell.angle_beta         90 
_cell.angle_gamma        90 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              8 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         1X8B 
_symmetry.space_group_name_H-M             'P 41 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                92 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Wee1-like protein kinase'                                   32485.018 1   2.7.1.112 ? 'kinase domain' ? 
2 non-polymer syn 'MAGNESIUM ION'                                              24.305    2   ?         ? ?               ? 
3 non-polymer syn '9-HYDROXY-4-PHENYLPYRROLO[3,4-C]CARBAZOLE-1,3(2H,6H)-DIONE' 328.321   1   ?         ? ?               ? 
4 water       nat water                                                        18.015    144 ?         ? ?               ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        WEE1hu 
# 
_entity_name_sys.entity_id   1 
_entity_name_sys.name        'Wee1A kinase' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GAMGMKSRYTTEFHELEKIGSGEFGSVFKCVKRLDGCIYAIKRSKKPLAGSVDEQNALREVYAHAVLGQHSHVVRYFSAW
AEDDHMLIQNEYCNGGSLADAISENYRIMSYFKEAELKDLLLQVGRGLRYIHSMSLVHMDIKPSNIFISRTSIPNAASEE
GDEDDWASNKVMFKIGDLGHVTRISSPQVEEGDSRFLANEVLQENYTHLPKADIFALALTVVCAAGAEPLPRNGDQWHEI
RQGRLPRIPQVLSQEFTELLKVMIHPDPERRPSAMALVKHSVLLSASRK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GAMGMKSRYTTEFHELEKIGSGEFGSVFKCVKRLDGCIYAIKRSKKPLAGSVDEQNALREVYAHAVLGQHSHVVRYFSAW
AEDDHMLIQNEYCNGGSLADAISENYRIMSYFKEAELKDLLLQVGRGLRYIHSMSLVHMDIKPSNIFISRTSIPNAASEE
GDEDDWASNKVMFKIGDLGHVTRISSPQVEEGDSRFLANEVLQENYTHLPKADIFALALTVVCAAGAEPLPRNGDQWHEI
RQGRLPRIPQVLSQEFTELLKVMIHPDPERRPSAMALVKHSVLLSASRK
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ALA n 
1 3   MET n 
1 4   GLY n 
1 5   MET n 
1 6   LYS n 
1 7   SER n 
1 8   ARG n 
1 9   TYR n 
1 10  THR n 
1 11  THR n 
1 12  GLU n 
1 13  PHE n 
1 14  HIS n 
1 15  GLU n 
1 16  LEU n 
1 17  GLU n 
1 18  LYS n 
1 19  ILE n 
1 20  GLY n 
1 21  SER n 
1 22  GLY n 
1 23  GLU n 
1 24  PHE n 
1 25  GLY n 
1 26  SER n 
1 27  VAL n 
1 28  PHE n 
1 29  LYS n 
1 30  CYS n 
1 31  VAL n 
1 32  LYS n 
1 33  ARG n 
1 34  LEU n 
1 35  ASP n 
1 36  GLY n 
1 37  CYS n 
1 38  ILE n 
1 39  TYR n 
1 40  ALA n 
1 41  ILE n 
1 42  LYS n 
1 43  ARG n 
1 44  SER n 
1 45  LYS n 
1 46  LYS n 
1 47  PRO n 
1 48  LEU n 
1 49  ALA n 
1 50  GLY n 
1 51  SER n 
1 52  VAL n 
1 53  ASP n 
1 54  GLU n 
1 55  GLN n 
1 56  ASN n 
1 57  ALA n 
1 58  LEU n 
1 59  ARG n 
1 60  GLU n 
1 61  VAL n 
1 62  TYR n 
1 63  ALA n 
1 64  HIS n 
1 65  ALA n 
1 66  VAL n 
1 67  LEU n 
1 68  GLY n 
1 69  GLN n 
1 70  HIS n 
1 71  SER n 
1 72  HIS n 
1 73  VAL n 
1 74  VAL n 
1 75  ARG n 
1 76  TYR n 
1 77  PHE n 
1 78  SER n 
1 79  ALA n 
1 80  TRP n 
1 81  ALA n 
1 82  GLU n 
1 83  ASP n 
1 84  ASP n 
1 85  HIS n 
1 86  MET n 
1 87  LEU n 
1 88  ILE n 
1 89  GLN n 
1 90  ASN n 
1 91  GLU n 
1 92  TYR n 
1 93  CYS n 
1 94  ASN n 
1 95  GLY n 
1 96  GLY n 
1 97  SER n 
1 98  LEU n 
1 99  ALA n 
1 100 ASP n 
1 101 ALA n 
1 102 ILE n 
1 103 SER n 
1 104 GLU n 
1 105 ASN n 
1 106 TYR n 
1 107 ARG n 
1 108 ILE n 
1 109 MET n 
1 110 SER n 
1 111 TYR n 
1 112 PHE n 
1 113 LYS n 
1 114 GLU n 
1 115 ALA n 
1 116 GLU n 
1 117 LEU n 
1 118 LYS n 
1 119 ASP n 
1 120 LEU n 
1 121 LEU n 
1 122 LEU n 
1 123 GLN n 
1 124 VAL n 
1 125 GLY n 
1 126 ARG n 
1 127 GLY n 
1 128 LEU n 
1 129 ARG n 
1 130 TYR n 
1 131 ILE n 
1 132 HIS n 
1 133 SER n 
1 134 MET n 
1 135 SER n 
1 136 LEU n 
1 137 VAL n 
1 138 HIS n 
1 139 MET n 
1 140 ASP n 
1 141 ILE n 
1 142 LYS n 
1 143 PRO n 
1 144 SER n 
1 145 ASN n 
1 146 ILE n 
1 147 PHE n 
1 148 ILE n 
1 149 SER n 
1 150 ARG n 
1 151 THR n 
1 152 SER n 
1 153 ILE n 
1 154 PRO n 
1 155 ASN n 
1 156 ALA n 
1 157 ALA n 
1 158 SER n 
1 159 GLU n 
1 160 GLU n 
1 161 GLY n 
1 162 ASP n 
1 163 GLU n 
1 164 ASP n 
1 165 ASP n 
1 166 TRP n 
1 167 ALA n 
1 168 SER n 
1 169 ASN n 
1 170 LYS n 
1 171 VAL n 
1 172 MET n 
1 173 PHE n 
1 174 LYS n 
1 175 ILE n 
1 176 GLY n 
1 177 ASP n 
1 178 LEU n 
1 179 GLY n 
1 180 HIS n 
1 181 VAL n 
1 182 THR n 
1 183 ARG n 
1 184 ILE n 
1 185 SER n 
1 186 SER n 
1 187 PRO n 
1 188 GLN n 
1 189 VAL n 
1 190 GLU n 
1 191 GLU n 
1 192 GLY n 
1 193 ASP n 
1 194 SER n 
1 195 ARG n 
1 196 PHE n 
1 197 LEU n 
1 198 ALA n 
1 199 ASN n 
1 200 GLU n 
1 201 VAL n 
1 202 LEU n 
1 203 GLN n 
1 204 GLU n 
1 205 ASN n 
1 206 TYR n 
1 207 THR n 
1 208 HIS n 
1 209 LEU n 
1 210 PRO n 
1 211 LYS n 
1 212 ALA n 
1 213 ASP n 
1 214 ILE n 
1 215 PHE n 
1 216 ALA n 
1 217 LEU n 
1 218 ALA n 
1 219 LEU n 
1 220 THR n 
1 221 VAL n 
1 222 VAL n 
1 223 CYS n 
1 224 ALA n 
1 225 ALA n 
1 226 GLY n 
1 227 ALA n 
1 228 GLU n 
1 229 PRO n 
1 230 LEU n 
1 231 PRO n 
1 232 ARG n 
1 233 ASN n 
1 234 GLY n 
1 235 ASP n 
1 236 GLN n 
1 237 TRP n 
1 238 HIS n 
1 239 GLU n 
1 240 ILE n 
1 241 ARG n 
1 242 GLN n 
1 243 GLY n 
1 244 ARG n 
1 245 LEU n 
1 246 PRO n 
1 247 ARG n 
1 248 ILE n 
1 249 PRO n 
1 250 GLN n 
1 251 VAL n 
1 252 LEU n 
1 253 SER n 
1 254 GLN n 
1 255 GLU n 
1 256 PHE n 
1 257 THR n 
1 258 GLU n 
1 259 LEU n 
1 260 LEU n 
1 261 LYS n 
1 262 VAL n 
1 263 MET n 
1 264 ILE n 
1 265 HIS n 
1 266 PRO n 
1 267 ASP n 
1 268 PRO n 
1 269 GLU n 
1 270 ARG n 
1 271 ARG n 
1 272 PRO n 
1 273 SER n 
1 274 ALA n 
1 275 MET n 
1 276 ALA n 
1 277 LEU n 
1 278 VAL n 
1 279 LYS n 
1 280 HIS n 
1 281 SER n 
1 282 VAL n 
1 283 LEU n 
1 284 LEU n 
1 285 SER n 
1 286 ALA n 
1 287 SER n 
1 288 ARG n 
1 289 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               'fall armyworm' 
_entity_src_gen.pdbx_host_org_scientific_name      'Spodoptera frugiperda' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7108 
_entity_src_gen.host_org_genus                     Spodoptera 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            Sf9 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          BACULOVIRUS 
_entity_src_gen.pdbx_host_org_vector               pFastBacHTb 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    WEE1_HUMAN 
_struct_ref.pdbx_db_accession          P30291 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MKSRYTTEFHELEKIGSGEFGSVFKCVKRLDGCIYAIKRSKKPLAGSVDEQNALREVYAHAVLGQHSHVVRYFSAWAEDD
HMLIQNEYCNGGSLADAISENYRIMSYFKEAELKDLLLQVGRGLRYIHSMSLVHMDIKPSNIFISRTSIPNAASEEGDED
DWASNKVMFKIGDLGHVTRISSPQVEEGDSRFLANEVLQENYTHLPKADIFALALTVVCAAGAEPLPRNGDQWHEIRQGR
LPRIPQVLSQEFTELLKVMIHPDPERRPSAMALVKHSVLLSASRK
;
_struct_ref.pdbx_align_begin           291 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1X8B 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 5 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 289 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P30291 
_struct_ref_seq.db_align_beg                  291 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  575 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       291 
_struct_ref_seq.pdbx_auth_seq_align_end       575 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1X8B GLY A 1 ? UNP P30291 ? ? 'CLONING ARTIFACT' 287 1 
1 1X8B ALA A 2 ? UNP P30291 ? ? 'CLONING ARTIFACT' 288 2 
1 1X8B MET A 3 ? UNP P30291 ? ? 'CLONING ARTIFACT' 289 3 
1 1X8B GLY A 4 ? UNP P30291 ? ? 'CLONING ARTIFACT' 290 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
824 non-polymer         . '9-HYDROXY-4-PHENYLPYRROLO[3,4-C]CARBAZOLE-1,3(2H,6H)-DIONE' 
'9-HYDROXY-4-PHENYL-6H-PYRROLO[3,4-C]CARBAZOLE-1,3-DIONE' 'C20 H12 N2 O3'  328.321 
ALA 'L-peptide linking' y ALANINE                                                      ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                                     ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                   ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                              ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                                                     ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                    ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                              ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                                      ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                                                    ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                                        ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                   ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                                      ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                                       ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                                                   ? 'C5 H11 N O2 S'  149.211 
MG  non-polymer         . 'MAGNESIUM ION'                                              ? 'Mg 2'           24.305  
PHE 'L-peptide linking' y PHENYLALANINE                                                ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                                      ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                                       ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                                                    ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                   ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                                     ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                                       ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1X8B 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.6 
_exptl_crystal.density_percent_sol   53 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    'HEPES, sodium chloride, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           173 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2001-11-29 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Pt/Pd ULE mirrors' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 17-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   17-ID 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0000 
# 
_reflns.entry_id                     1X8B 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.d_resolution_high            1.81 
_reflns.d_resolution_low             50 
_reflns.number_all                   34834 
_reflns.number_obs                   34834 
_reflns.percent_possible_obs         95 
_reflns.pdbx_Rmerge_I_obs            0.082 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        23 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              21 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.81 
_reflns_shell.d_res_low              1.87 
_reflns_shell.percent_possible_all   92.3 
_reflns_shell.Rmerge_I_obs           0.362 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.6 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1X8B 
_refine.ls_d_res_high                            1.81 
_refine.ls_d_res_low                             47.14 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     34800 
_refine.ls_number_reflns_obs                     34800 
_refine.ls_number_reflns_R_free                  1750 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_all                          0.219 
_refine.ls_R_factor_obs                          0.219 
_refine.ls_R_factor_R_work                       0.218 
_refine.ls_R_factor_R_free                       0.237 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          SIRAS 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.details                                  ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2041 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         27 
_refine_hist.number_atoms_solvent             144 
_refine_hist.number_atoms_total               2212 
_refine_hist.d_res_high                       1.81 
_refine_hist.d_res_low                        47.14 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d    0.022 ? ? ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg 2.099 ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1X8B 
_struct.title                     'Structure of human Wee1A kinase: kinase domain complexed with inhibitor PD0407824' 
_struct.pdbx_descriptor           'Wee1-like protein kinase (E.C.2.7.1.112)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1X8B 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'kinase, cell cycle, wee1, TRANSFERASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 7   ? GLU A 12  ? SER A 293 GLU A 298 1 ? 6  
HELX_P HELX_P2  2  SER A 51  ? LEU A 67  ? SER A 337 LEU A 353 1 ? 17 
HELX_P HELX_P3  3  SER A 97  ? MET A 109 ? SER A 383 MET A 395 1 ? 13 
HELX_P HELX_P4  4  LYS A 113 ? MET A 134 ? LYS A 399 MET A 420 1 ? 22 
HELX_P HELX_P5  5  LYS A 142 ? SER A 144 ? LYS A 428 SER A 430 5 ? 3  
HELX_P HELX_P6  6  ASP A 193 ? LEU A 197 ? ASP A 479 LEU A 483 5 ? 5  
HELX_P HELX_P7  7  ALA A 198 ? GLN A 203 ? ALA A 484 GLN A 489 1 ? 6  
HELX_P HELX_P8  8  HIS A 208 ? ALA A 225 ? HIS A 494 ALA A 511 1 ? 18 
HELX_P HELX_P9  9  GLY A 234 ? GLN A 242 ? GLY A 520 GLN A 528 1 ? 9  
HELX_P HELX_P10 10 SER A 253 ? ILE A 264 ? SER A 539 ILE A 550 1 ? 12 
HELX_P HELX_P11 11 ASP A 267 ? ARG A 271 ? ASP A 553 ARG A 557 5 ? 5  
HELX_P HELX_P12 12 SER A 273 ? LYS A 279 ? SER A 559 LYS A 565 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? B MG . MG ? ? ? 1_555 A ASN 145 OD1 ? ? A MG 601 A ASN 431 1_555 ? ? ? ? ? ? ? 2.222 ? 
metalc2  metalc ? ? B MG . MG ? ? ? 1_555 E HOH .   O   ? ? A MG 601 A HOH 676 1_555 ? ? ? ? ? ? ? 2.373 ? 
metalc3  metalc ? ? B MG . MG ? ? ? 1_555 E HOH .   O   ? ? A MG 601 A HOH 695 1_555 ? ? ? ? ? ? ? 2.849 ? 
metalc4  metalc ? ? B MG . MG ? ? ? 1_555 E HOH .   O   ? ? A MG 601 A HOH 725 1_555 ? ? ? ? ? ? ? 2.264 ? 
metalc5  metalc ? ? B MG . MG ? ? ? 1_555 A ASP 177 OD1 ? ? A MG 601 A ASP 463 1_555 ? ? ? ? ? ? ? 2.281 ? 
metalc6  metalc ? ? C MG . MG ? ? ? 1_555 A GLY 179 O   ? ? A MG 602 A GLY 465 1_555 ? ? ? ? ? ? ? 2.487 ? 
metalc7  metalc ? ? C MG . MG ? ? ? 1_555 E HOH .   O   ? ? A MG 602 A HOH 681 1_555 ? ? ? ? ? ? ? 2.562 ? 
metalc8  metalc ? ? C MG . MG ? ? ? 1_555 A ASN 56  O   ? ? A MG 602 A ASN 342 1_555 ? ? ? ? ? ? ? 2.688 ? 
metalc9  metalc ? ? C MG . MG ? ? ? 1_555 E HOH .   O   ? ? A MG 602 A HOH 641 1_555 ? ? ? ? ? ? ? 2.468 ? 
metalc10 metalc ? ? C MG . MG ? ? ? 1_555 A ASN 56  OD1 ? ? A MG 602 A ASN 342 1_555 ? ? ? ? ? ? ? 2.366 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 2 ? 
C ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 13  ? GLY A 22  ? PHE A 299 GLY A 308 
A 2 GLY A 25  ? LYS A 32  ? GLY A 311 LYS A 318 
A 3 ILE A 38  ? LYS A 45  ? ILE A 324 LYS A 331 
A 4 HIS A 85  ? GLU A 91  ? HIS A 371 GLU A 377 
A 5 TYR A 76  ? GLU A 82  ? TYR A 362 GLU A 368 
B 1 LEU A 136 ? VAL A 137 ? LEU A 422 VAL A 423 
B 2 THR A 182 ? ARG A 183 ? THR A 468 ARG A 469 
C 1 ILE A 146 ? SER A 149 ? ILE A 432 SER A 435 
C 2 MET A 172 ? ILE A 175 ? MET A 458 ILE A 461 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLU A 17  ? N GLU A 303 O LYS A 29  ? O LYS A 315 
A 2 3 N CYS A 30  ? N CYS A 316 O TYR A 39  ? O TYR A 325 
A 3 4 N ALA A 40  ? N ALA A 326 O ASN A 90  ? O ASN A 376 
A 4 5 O GLN A 89  ? O GLN A 375 N SER A 78  ? N SER A 364 
B 1 2 N VAL A 137 ? N VAL A 423 O THR A 182 ? O THR A 468 
C 1 2 N PHE A 147 ? N PHE A 433 O LYS A 174 ? O LYS A 460 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG A 601'  
AC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MG A 602'  
AC3 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE 824 A 901' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5  ASN A 145 ? ASN A 431 . ? 1_555 ? 
2  AC1 5  ASP A 177 ? ASP A 463 . ? 1_555 ? 
3  AC1 5  HOH E .   ? HOH A 676 . ? 1_555 ? 
4  AC1 5  HOH E .   ? HOH A 695 . ? 1_555 ? 
5  AC1 5  HOH E .   ? HOH A 725 . ? 1_555 ? 
6  AC2 4  ASN A 56  ? ASN A 342 . ? 1_555 ? 
7  AC2 4  GLY A 179 ? GLY A 465 . ? 1_555 ? 
8  AC2 4  HOH E .   ? HOH A 641 . ? 1_555 ? 
9  AC2 4  HOH E .   ? HOH A 681 . ? 1_555 ? 
10 AC3 13 ILE A 19  ? ILE A 305 . ? 1_555 ? 
11 AC3 13 ALA A 40  ? ALA A 326 . ? 1_555 ? 
12 AC3 13 LYS A 42  ? LYS A 328 . ? 1_555 ? 
13 AC3 13 GLU A 60  ? GLU A 346 . ? 1_555 ? 
14 AC3 13 VAL A 74  ? VAL A 360 . ? 1_555 ? 
15 AC3 13 ASN A 90  ? ASN A 376 . ? 1_555 ? 
16 AC3 13 GLU A 91  ? GLU A 377 . ? 1_555 ? 
17 AC3 13 TYR A 92  ? TYR A 378 . ? 1_555 ? 
18 AC3 13 CYS A 93  ? CYS A 379 . ? 1_555 ? 
19 AC3 13 GLY A 96  ? GLY A 382 . ? 1_555 ? 
20 AC3 13 PHE A 147 ? PHE A 433 . ? 1_555 ? 
21 AC3 13 ASP A 177 ? ASP A 463 . ? 1_555 ? 
22 AC3 13 HOH E .   ? HOH A 614 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1X8B 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1X8B 
_atom_sites.fract_transf_matrix[1][1]   0.014330 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014330 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006369 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . MET A 1 5   ? -11.787 76.079 32.455 1.00 46.95 ? 291 MET A N   1 
ATOM   2    C  CA  . MET A 1 5   ? -10.759 74.985 32.450 1.00 46.65 ? 291 MET A CA  1 
ATOM   3    C  C   . MET A 1 5   ? -9.337  75.415 32.821 1.00 45.29 ? 291 MET A C   1 
ATOM   4    O  O   . MET A 1 5   ? -9.056  75.720 33.979 1.00 45.72 ? 291 MET A O   1 
ATOM   5    C  CB  . MET A 1 5   ? -10.701 74.268 31.104 1.00 47.64 ? 291 MET A CB  1 
ATOM   6    C  CG  . MET A 1 5   ? -9.711  73.112 31.125 1.00 49.20 ? 291 MET A CG  1 
ATOM   7    S  SD  . MET A 1 5   ? -9.053  72.621 29.508 1.00 60.05 ? 291 MET A SD  1 
ATOM   8    C  CE  . MET A 1 5   ? -7.510  73.628 29.361 1.00 55.88 ? 291 MET A CE  1 
ATOM   9    N  N   . LYS A 1 6   ? -8.440  75.398 31.833 1.00 43.68 ? 292 LYS A N   1 
ATOM   10   C  CA  . LYS A 1 6   ? -7.034  75.742 32.056 1.00 40.85 ? 292 LYS A CA  1 
ATOM   11   C  C   . LYS A 1 6   ? -6.407  74.632 32.877 1.00 37.75 ? 292 LYS A C   1 
ATOM   12   O  O   . LYS A 1 6   ? -5.949  74.829 33.981 1.00 37.32 ? 292 LYS A O   1 
ATOM   13   C  CB  . LYS A 1 6   ? -6.921  77.104 32.743 1.00 41.58 ? 292 LYS A CB  1 
ATOM   14   C  CG  . LYS A 1 6   ? -7.454  78.234 31.862 1.00 43.51 ? 292 LYS A CG  1 
ATOM   15   C  CD  . LYS A 1 6   ? -6.991  77.999 30.419 1.00 47.17 ? 292 LYS A CD  1 
ATOM   16   C  CE  . LYS A 1 6   ? -7.434  79.097 29.452 1.00 50.60 ? 292 LYS A CE  1 
ATOM   17   N  NZ  . LYS A 1 6   ? -8.928  79.372 29.409 1.00 52.20 ? 292 LYS A NZ  1 
ATOM   18   N  N   . SER A 1 7   ? -6.419  73.454 32.277 1.00 34.71 ? 293 SER A N   1 
ATOM   19   C  CA  . SER A 1 7   ? -5.939  72.200 32.820 1.00 31.77 ? 293 SER A CA  1 
ATOM   20   C  C   . SER A 1 7   ? -4.524  72.267 33.390 1.00 29.47 ? 293 SER A C   1 
ATOM   21   O  O   . SER A 1 7   ? -3.694  73.056 32.927 1.00 26.53 ? 293 SER A O   1 
ATOM   22   C  CB  . SER A 1 7   ? -5.867  71.218 31.630 1.00 30.52 ? 293 SER A CB  1 
ATOM   23   O  OG  . SER A 1 7   ? -6.134  69.887 32.017 1.00 38.23 ? 293 SER A OG  1 
ATOM   24   N  N   . ARG A 1 8   ? -4.229  71.409 34.376 1.00 26.90 ? 294 ARG A N   1 
ATOM   25   C  CA  . ARG A 1 8   ? -2.835  71.227 34.766 1.00 24.15 ? 294 ARG A CA  1 
ATOM   26   C  C   . ARG A 1 8   ? -2.103  70.654 33.527 1.00 23.30 ? 294 ARG A C   1 
ATOM   27   O  O   . ARG A 1 8   ? -1.003  71.059 33.171 1.00 22.05 ? 294 ARG A O   1 
ATOM   28   C  CB  . ARG A 1 8   ? -2.724  70.259 35.933 1.00 24.91 ? 294 ARG A CB  1 
ATOM   29   C  CG  . ARG A 1 8   ? -1.309  69.752 36.146 1.00 22.62 ? 294 ARG A CG  1 
ATOM   30   C  CD  . ARG A 1 8   ? -1.118  69.040 37.482 1.00 23.86 ? 294 ARG A CD  1 
ATOM   31   N  NE  . ARG A 1 8   ? 0.099   68.246 37.457 1.00 26.72 ? 294 ARG A NE  1 
ATOM   32   C  CZ  . ARG A 1 8   ? 0.365   67.314 38.364 1.00 27.46 ? 294 ARG A CZ  1 
ATOM   33   N  NH1 . ARG A 1 8   ? -0.519  67.125 39.348 1.00 27.17 ? 294 ARG A NH1 1 
ATOM   34   N  NH2 . ARG A 1 8   ? 1.478   66.625 38.302 1.00 24.70 ? 294 ARG A NH2 1 
ATOM   35   N  N   . TYR A 1 9   ? -2.747  69.724 32.854 1.00 21.64 ? 295 TYR A N   1 
ATOM   36   C  CA  . TYR A 1 9   ? -2.165  69.121 31.659 1.00 21.72 ? 295 TYR A CA  1 
ATOM   37   C  C   . TYR A 1 9   ? -1.774  70.178 30.628 1.00 21.63 ? 295 TYR A C   1 
ATOM   38   O  O   . TYR A 1 9   ? -0.694  70.125 30.044 1.00 20.40 ? 295 TYR A O   1 
ATOM   39   C  CB  . TYR A 1 9   ? -3.165  68.147 31.046 1.00 21.29 ? 295 TYR A CB  1 
ATOM   40   C  CG  . TYR A 1 9   ? -2.705  67.418 29.823 1.00 22.51 ? 295 TYR A CG  1 
ATOM   41   C  CD1 . TYR A 1 9   ? -1.664  66.509 29.897 1.00 23.34 ? 295 TYR A CD1 1 
ATOM   42   C  CD2 . TYR A 1 9   ? -3.299  67.637 28.589 1.00 24.00 ? 295 TYR A CD2 1 
ATOM   43   C  CE1 . TYR A 1 9   ? -1.234  65.833 28.770 1.00 25.23 ? 295 TYR A CE1 1 
ATOM   44   C  CE2 . TYR A 1 9   ? -2.892  66.965 27.467 1.00 24.84 ? 295 TYR A CE2 1 
ATOM   45   C  CZ  . TYR A 1 9   ? -1.877  66.060 27.554 1.00 24.00 ? 295 TYR A CZ  1 
ATOM   46   O  OH  . TYR A 1 9   ? -1.460  65.410 26.418 1.00 25.25 ? 295 TYR A OH  1 
ATOM   47   N  N   . THR A 1 10  ? -2.685  71.106 30.358 1.00 19.73 ? 296 THR A N   1 
ATOM   48   C  CA  . THR A 1 10  ? -2.417  72.131 29.376 1.00 20.83 ? 296 THR A CA  1 
ATOM   49   C  C   . THR A 1 10  ? -1.396  73.130 29.811 1.00 19.95 ? 296 THR A C   1 
ATOM   50   O  O   . THR A 1 10  ? -0.560  73.560 28.989 1.00 20.37 ? 296 THR A O   1 
ATOM   51   C  CB  . THR A 1 10  ? -3.729  72.873 29.097 1.00 20.72 ? 296 THR A CB  1 
ATOM   52   O  OG1 . THR A 1 10  ? -4.499  71.971 28.299 1.00 25.46 ? 296 THR A OG1 1 
ATOM   53   C  CG2 . THR A 1 10  ? -3.451  74.061 28.200 1.00 24.51 ? 296 THR A CG2 1 
ATOM   54   N  N   . THR A 1 11  ? -1.445  73.507 31.087 1.00 19.46 ? 297 THR A N   1 
ATOM   55   C  CA  . THR A 1 11  ? -0.558  74.574 31.546 1.00 22.66 ? 297 THR A CA  1 
ATOM   56   C  C   . THR A 1 11  ? 0.882   74.069 31.778 1.00 22.36 ? 297 THR A C   1 
ATOM   57   O  O   . THR A 1 11  ? 1.853   74.794 31.490 1.00 21.63 ? 297 THR A O   1 
ATOM   58   C  CB  . THR A 1 11  ? -1.146  75.229 32.800 1.00 24.71 ? 297 THR A CB  1 
ATOM   59   O  OG1 . THR A 1 11  ? -0.226  76.149 33.407 1.00 32.62 ? 297 THR A OG1 1 
ATOM   60   C  CG2 . THR A 1 11  ? -1.346  74.276 33.822 1.00 21.69 ? 297 THR A CG2 1 
ATOM   61   N  N   . GLU A 1 12  ? 0.992   72.836 32.281 1.00 20.40 ? 298 GLU A N   1 
ATOM   62   C  CA  . GLU A 1 12  ? 2.327   72.277 32.588 1.00 21.35 ? 298 GLU A CA  1 
ATOM   63   C  C   . GLU A 1 12  ? 3.067   71.577 31.481 1.00 20.64 ? 298 GLU A C   1 
ATOM   64   O  O   . GLU A 1 12  ? 4.306   71.474 31.546 1.00 20.83 ? 298 GLU A O   1 
ATOM   65   C  CB  . GLU A 1 12  ? 2.278   71.398 33.852 1.00 22.15 ? 298 GLU A CB  1 
ATOM   66   C  CG  . GLU A 1 12  ? 1.856   72.222 35.072 1.00 24.61 ? 298 GLU A CG  1 
ATOM   67   C  CD  . GLU A 1 12  ? 2.755   73.425 35.500 1.00 30.34 ? 298 GLU A CD  1 
ATOM   68   O  OE1 . GLU A 1 12  ? 2.229   74.235 36.262 1.00 31.48 ? 298 GLU A OE1 1 
ATOM   69   O  OE2 . GLU A 1 12  ? 3.959   73.609 35.127 1.00 33.91 ? 298 GLU A OE2 1 
ATOM   70   N  N   . PHE A 1 13  ? 2.343   71.143 30.441 1.00 19.62 ? 299 PHE A N   1 
ATOM   71   C  CA  . PHE A 1 13  ? 2.905   70.378 29.360 1.00 19.33 ? 299 PHE A CA  1 
ATOM   72   C  C   . PHE A 1 13  ? 2.550   70.889 27.977 1.00 20.65 ? 299 PHE A C   1 
ATOM   73   O  O   . PHE A 1 13  ? 1.498   71.470 27.795 1.00 20.92 ? 299 PHE A O   1 
ATOM   74   C  CB  . PHE A 1 13  ? 2.442   68.944 29.457 1.00 19.17 ? 299 PHE A CB  1 
ATOM   75   C  CG  . PHE A 1 13  ? 2.866   68.273 30.773 1.00 19.30 ? 299 PHE A CG  1 
ATOM   76   C  CD1 . PHE A 1 13  ? 2.012   68.319 31.879 1.00 19.52 ? 299 PHE A CD1 1 
ATOM   77   C  CD2 . PHE A 1 13  ? 4.088   67.623 30.870 1.00 18.49 ? 299 PHE A CD2 1 
ATOM   78   C  CE1 . PHE A 1 13  ? 2.335   67.726 33.102 1.00 20.45 ? 299 PHE A CE1 1 
ATOM   79   C  CE2 . PHE A 1 13  ? 4.441   67.007 32.119 1.00 18.50 ? 299 PHE A CE2 1 
ATOM   80   C  CZ  . PHE A 1 13  ? 3.549   67.076 33.216 1.00 20.53 ? 299 PHE A CZ  1 
ATOM   81   N  N   . HIS A 1 14  ? 3.470   70.711 27.056 1.00 20.12 ? 300 HIS A N   1 
ATOM   82   C  CA  . HIS A 1 14  ? 3.236   70.944 25.628 1.00 21.90 ? 300 HIS A CA  1 
ATOM   83   C  C   . HIS A 1 14  ? 3.040   69.564 25.005 1.00 22.32 ? 300 HIS A C   1 
ATOM   84   O  O   . HIS A 1 14  ? 3.909   68.712 25.057 1.00 21.97 ? 300 HIS A O   1 
ATOM   85   C  CB  . HIS A 1 14  ? 4.397   71.688 24.987 1.00 22.91 ? 300 HIS A CB  1 
ATOM   86   C  CG  . HIS A 1 14  ? 4.307   71.775 23.487 1.00 26.82 ? 300 HIS A CG  1 
ATOM   87   N  ND1 . HIS A 1 14  ? 3.260   72.401 22.830 1.00 33.52 ? 300 HIS A ND1 1 
ATOM   88   C  CD2 . HIS A 1 14  ? 5.132   71.304 22.515 1.00 30.50 ? 300 HIS A CD2 1 
ATOM   89   C  CE1 . HIS A 1 14  ? 3.446   72.309 21.519 1.00 31.39 ? 300 HIS A CE1 1 
ATOM   90   N  NE2 . HIS A 1 14  ? 4.563   71.632 21.301 1.00 29.37 ? 300 HIS A NE2 1 
ATOM   91   N  N   . GLU A 1 15  ? 1.862   69.322 24.442 1.00 22.64 ? 301 GLU A N   1 
ATOM   92   C  CA  . GLU A 1 15  ? 1.575   68.028 23.853 1.00 23.38 ? 301 GLU A CA  1 
ATOM   93   C  C   . GLU A 1 15  ? 2.210   67.945 22.481 1.00 24.10 ? 301 GLU A C   1 
ATOM   94   O  O   . GLU A 1 15  ? 1.902   68.758 21.619 1.00 24.25 ? 301 GLU A O   1 
ATOM   95   C  CB  . GLU A 1 15  ? 0.045   67.869 23.751 1.00 25.08 ? 301 GLU A CB  1 
ATOM   96   C  CG  . GLU A 1 15  ? -0.464  66.478 23.395 1.00 27.23 ? 301 GLU A CG  1 
ATOM   97   C  CD  . GLU A 1 15  ? -1.988  66.473 23.248 1.00 29.53 ? 301 GLU A CD  1 
ATOM   98   O  OE1 . GLU A 1 15  ? -2.420  66.635 22.097 1.00 27.52 ? 301 GLU A OE1 1 
ATOM   99   O  OE2 . GLU A 1 15  ? -2.739  66.264 24.240 1.00 26.96 ? 301 GLU A OE2 1 
ATOM   100  N  N   . LEU A 1 16  ? 3.073   66.973 22.253 1.00 24.00 ? 302 LEU A N   1 
ATOM   101  C  CA  . LEU A 1 16  ? 3.741   66.815 20.947 1.00 25.76 ? 302 LEU A CA  1 
ATOM   102  C  C   . LEU A 1 16  ? 3.007   65.916 19.968 1.00 26.61 ? 302 LEU A C   1 
ATOM   103  O  O   . LEU A 1 16  ? 2.871   66.277 18.790 1.00 27.90 ? 302 LEU A O   1 
ATOM   104  C  CB  . LEU A 1 16  ? 5.199   66.316 21.106 1.00 25.12 ? 302 LEU A CB  1 
ATOM   105  C  CG  . LEU A 1 16  ? 6.175   67.183 21.901 1.00 22.46 ? 302 LEU A CG  1 
ATOM   106  C  CD1 . LEU A 1 16  ? 7.478   66.448 22.042 1.00 29.27 ? 302 LEU A CD1 1 
ATOM   107  C  CD2 . LEU A 1 16  ? 6.355   68.543 21.185 1.00 29.32 ? 302 LEU A CD2 1 
ATOM   108  N  N   . GLU A 1 17  ? 2.626   64.721 20.379 1.00 27.35 ? 303 GLU A N   1 
ATOM   109  C  CA  . GLU A 1 17  ? 1.901   63.824 19.485 1.00 28.49 ? 303 GLU A CA  1 
ATOM   110  C  C   . GLU A 1 17  ? 1.315   62.677 20.248 1.00 27.70 ? 303 GLU A C   1 
ATOM   111  O  O   . GLU A 1 17  ? 1.692   62.452 21.396 1.00 28.37 ? 303 GLU A O   1 
ATOM   112  C  CB  . GLU A 1 17  ? 2.795   63.272 18.378 1.00 29.61 ? 303 GLU A CB  1 
ATOM   113  C  CG  . GLU A 1 17  ? 3.951   62.518 18.897 1.00 31.98 ? 303 GLU A CG  1 
ATOM   114  C  CD  . GLU A 1 17  ? 4.879   62.019 17.818 1.00 41.55 ? 303 GLU A CD  1 
ATOM   115  O  OE1 . GLU A 1 17  ? 5.779   62.803 17.461 1.00 45.32 ? 303 GLU A OE1 1 
ATOM   116  O  OE2 . GLU A 1 17  ? 4.718   60.860 17.346 1.00 44.63 ? 303 GLU A OE2 1 
ATOM   117  N  N   . LYS A 1 18  ? 0.345   62.019 19.621 1.00 27.07 ? 304 LYS A N   1 
ATOM   118  C  CA  . LYS A 1 18  ? -0.300  60.863 20.187 1.00 26.94 ? 304 LYS A CA  1 
ATOM   119  C  C   . LYS A 1 18  ? 0.582   59.644 19.855 1.00 27.13 ? 304 LYS A C   1 
ATOM   120  O  O   . LYS A 1 18  ? 1.010   59.476 18.704 1.00 27.64 ? 304 LYS A O   1 
ATOM   121  C  CB  . LYS A 1 18  ? -1.760  60.720 19.673 1.00 27.67 ? 304 LYS A CB  1 
ATOM   122  C  CG  . LYS A 1 18  ? -2.530  59.568 20.396 1.00 28.28 ? 304 LYS A CG  1 
ATOM   123  C  CD  . LYS A 1 18  ? -3.906  59.305 19.832 1.00 34.02 ? 304 LYS A CD  1 
ATOM   124  C  CE  . LYS A 1 18  ? -4.856  60.386 20.270 1.00 37.24 ? 304 LYS A CE  1 
ATOM   125  N  NZ  . LYS A 1 18  ? -6.263  60.134 19.775 1.00 42.39 ? 304 LYS A NZ  1 
ATOM   126  N  N   . ILE A 1 19  ? 0.903   58.843 20.861 1.00 25.45 ? 305 ILE A N   1 
ATOM   127  C  CA  . ILE A 1 19  ? 1.736   57.689 20.674 1.00 25.38 ? 305 ILE A CA  1 
ATOM   128  C  C   . ILE A 1 19  ? 1.040   56.378 20.981 1.00 27.73 ? 305 ILE A C   1 
ATOM   129  O  O   . ILE A 1 19  ? 1.557   55.349 20.629 1.00 27.27 ? 305 ILE A O   1 
ATOM   130  C  CB  . ILE A 1 19  ? 3.029   57.784 21.471 1.00 24.61 ? 305 ILE A CB  1 
ATOM   131  C  CG1 . ILE A 1 19  ? 2.761   57.924 22.983 1.00 24.53 ? 305 ILE A CG1 1 
ATOM   132  C  CG2 . ILE A 1 19  ? 3.885   58.991 20.954 1.00 22.18 ? 305 ILE A CG2 1 
ATOM   133  C  CD1 . ILE A 1 19  ? 4.102   58.109 23.756 1.00 26.09 ? 305 ILE A CD1 1 
ATOM   134  N  N   . GLY A 1 20  ? -0.135  56.417 21.590 1.00 29.14 ? 306 GLY A N   1 
ATOM   135  C  CA  . GLY A 1 20  ? -0.856  55.184 21.848 1.00 32.28 ? 306 GLY A CA  1 
ATOM   136  C  C   . GLY A 1 20  ? -2.324  55.461 22.071 1.00 35.36 ? 306 GLY A C   1 
ATOM   137  O  O   . GLY A 1 20  ? -2.707  56.585 22.419 1.00 32.06 ? 306 GLY A O   1 
ATOM   138  N  N   . SER A 1 21  ? -3.156  54.445 21.813 1.00 38.22 ? 307 SER A N   1 
ATOM   139  C  CA  . SER A 1 21  ? -4.595  54.629 21.963 1.00 43.61 ? 307 SER A CA  1 
ATOM   140  C  C   . SER A 1 21  ? -5.244  53.304 22.267 1.00 46.03 ? 307 SER A C   1 
ATOM   141  O  O   . SER A 1 21  ? -4.709  52.229 21.953 1.00 46.73 ? 307 SER A O   1 
ATOM   142  C  CB  . SER A 1 21  ? -5.221  55.230 20.735 1.00 43.28 ? 307 SER A CB  1 
ATOM   143  O  OG  . SER A 1 21  ? -6.566  55.573 21.021 1.00 48.33 ? 307 SER A OG  1 
ATOM   144  N  N   . GLY A 1 22  ? -6.398  53.368 22.898 1.00 48.60 ? 308 GLY A N   1 
ATOM   145  C  CA  . GLY A 1 22  ? -7.065  52.143 23.256 1.00 50.76 ? 308 GLY A CA  1 
ATOM   146  C  C   . GLY A 1 22  ? -8.478  52.484 23.611 1.00 52.57 ? 308 GLY A C   1 
ATOM   147  O  O   . GLY A 1 22  ? -8.976  53.583 23.311 1.00 52.48 ? 308 GLY A O   1 
ATOM   148  N  N   . GLU A 1 23  ? -9.118  51.516 24.250 1.00 53.98 ? 309 GLU A N   1 
ATOM   149  C  CA  . GLU A 1 23  ? -10.486 51.633 24.705 1.00 54.72 ? 309 GLU A CA  1 
ATOM   150  C  C   . GLU A 1 23  ? -10.313 51.986 26.152 1.00 55.18 ? 309 GLU A C   1 
ATOM   151  O  O   . GLU A 1 23  ? -11.199 51.810 26.977 1.00 56.46 ? 309 GLU A O   1 
ATOM   152  C  CB  . GLU A 1 23  ? -11.166 50.301 24.579 1.00 55.21 ? 309 GLU A CB  1 
ATOM   153  N  N   . PHE A 1 24  ? -9.102  52.419 26.445 1.00 54.82 ? 310 PHE A N   1 
ATOM   154  C  CA  . PHE A 1 24  ? -8.695  52.822 27.773 1.00 54.02 ? 310 PHE A CA  1 
ATOM   155  C  C   . PHE A 1 24  ? -8.157  54.264 27.688 1.00 52.62 ? 310 PHE A C   1 
ATOM   156  O  O   . PHE A 1 24  ? -7.374  54.677 28.543 1.00 53.11 ? 310 PHE A O   1 
ATOM   157  C  CB  . PHE A 1 24  ? -7.563  51.895 28.263 1.00 54.57 ? 310 PHE A CB  1 
ATOM   158  N  N   . GLY A 1 25  ? -8.538  55.010 26.649 1.00 49.85 ? 311 GLY A N   1 
ATOM   159  C  CA  . GLY A 1 25  ? -7.966  56.331 26.454 1.00 46.11 ? 311 GLY A CA  1 
ATOM   160  C  C   . GLY A 1 25  ? -6.683  56.344 25.610 1.00 43.14 ? 311 GLY A C   1 
ATOM   161  O  O   . GLY A 1 25  ? -6.355  55.351 24.921 1.00 44.60 ? 311 GLY A O   1 
ATOM   162  N  N   . SER A 1 26  ? -5.947  57.463 25.666 1.00 38.02 ? 312 SER A N   1 
ATOM   163  C  CA  . SER A 1 26  ? -4.789  57.670 24.792 1.00 32.62 ? 312 SER A CA  1 
ATOM   164  C  C   . SER A 1 26  ? -3.549  58.105 25.559 1.00 29.60 ? 312 SER A C   1 
ATOM   165  O  O   . SER A 1 26  ? -3.675  58.648 26.639 1.00 26.20 ? 312 SER A O   1 
ATOM   166  C  CB  . SER A 1 26  ? -5.107  58.797 23.840 1.00 33.15 ? 312 SER A CB  1 
ATOM   167  O  OG  . SER A 1 26  ? -6.362  58.591 23.208 1.00 32.70 ? 312 SER A OG  1 
ATOM   168  N  N   . VAL A 1 27  ? -2.388  57.924 24.931 1.00 27.05 ? 313 VAL A N   1 
ATOM   169  C  CA  . VAL A 1 27  ? -1.092  58.287 25.544 1.00 24.88 ? 313 VAL A CA  1 
ATOM   170  C  C   . VAL A 1 27  ? -0.425  59.296 24.611 1.00 23.37 ? 313 VAL A C   1 
ATOM   171  O  O   . VAL A 1 27  ? -0.432  59.122 23.363 1.00 22.68 ? 313 VAL A O   1 
ATOM   172  C  CB  . VAL A 1 27  ? -0.197  57.060 25.660 1.00 25.33 ? 313 VAL A CB  1 
ATOM   173  C  CG1 . VAL A 1 27  ? 1.150   57.426 26.312 1.00 23.42 ? 313 VAL A CG1 1 
ATOM   174  C  CG2 . VAL A 1 27  ? -0.877  55.969 26.471 1.00 29.90 ? 313 VAL A CG2 1 
ATOM   175  N  N   . PHE A 1 28  ? 0.125   60.365 25.174 1.00 22.30 ? 314 PHE A N   1 
ATOM   176  C  CA  . PHE A 1 28  ? 0.721   61.424 24.357 1.00 21.74 ? 314 PHE A CA  1 
ATOM   177  C  C   . PHE A 1 28  ? 2.176   61.661 24.780 1.00 22.08 ? 314 PHE A C   1 
ATOM   178  O  O   . PHE A 1 28  ? 2.517   61.526 25.967 1.00 22.51 ? 314 PHE A O   1 
ATOM   179  C  CB  . PHE A 1 28  ? -0.050  62.719 24.570 1.00 22.19 ? 314 PHE A CB  1 
ATOM   180  C  CG  . PHE A 1 28  ? -1.501  62.629 24.158 1.00 25.96 ? 314 PHE A CG  1 
ATOM   181  C  CD1 . PHE A 1 28  ? -2.459  62.141 25.053 1.00 28.23 ? 314 PHE A CD1 1 
ATOM   182  C  CD2 . PHE A 1 28  ? -1.880  62.992 22.879 1.00 25.90 ? 314 PHE A CD2 1 
ATOM   183  C  CE1 . PHE A 1 28  ? -3.827  62.037 24.666 1.00 31.38 ? 314 PHE A CE1 1 
ATOM   184  C  CE2 . PHE A 1 28  ? -3.252  62.916 22.457 1.00 25.91 ? 314 PHE A CE2 1 
ATOM   185  C  CZ  . PHE A 1 28  ? -4.214  62.426 23.357 1.00 26.62 ? 314 PHE A CZ  1 
ATOM   186  N  N   . LYS A 1 29  ? 3.025   61.944 23.813 1.00 21.91 ? 315 LYS A N   1 
ATOM   187  C  CA  . LYS A 1 29  ? 4.428   62.311 24.093 1.00 21.49 ? 315 LYS A CA  1 
ATOM   188  C  C   . LYS A 1 29  ? 4.322   63.826 24.387 1.00 22.29 ? 315 LYS A C   1 
ATOM   189  O  O   . LYS A 1 29  ? 3.772   64.572 23.585 1.00 21.57 ? 315 LYS A O   1 
ATOM   190  C  CB  . LYS A 1 29  ? 5.265   62.050 22.843 1.00 22.09 ? 315 LYS A CB  1 
ATOM   191  C  CG  . LYS A 1 29  ? 6.671   62.576 22.923 1.00 23.33 ? 315 LYS A CG  1 
ATOM   192  C  CD  . LYS A 1 29  ? 7.385   62.314 21.540 1.00 25.77 ? 315 LYS A CD  1 
ATOM   193  C  CE  . LYS A 1 29  ? 8.843   62.741 21.594 1.00 32.36 ? 315 LYS A CE  1 
ATOM   194  N  NZ  . LYS A 1 29  ? 9.526   62.538 20.223 1.00 34.39 ? 315 LYS A NZ  1 
ATOM   195  N  N   . CYS A 1 30  ? 4.754   64.266 25.561 1.00 20.68 ? 316 CYS A N   1 
ATOM   196  C  CA  . CYS A 1 30  ? 4.636   65.672 25.953 1.00 22.08 ? 316 CYS A CA  1 
ATOM   197  C  C   . CYS A 1 30  ? 5.910   66.192 26.513 1.00 22.63 ? 316 CYS A C   1 
ATOM   198  O  O   . CYS A 1 30  ? 6.695   65.422 27.098 1.00 23.34 ? 316 CYS A O   1 
ATOM   199  C  CB  . CYS A 1 30  ? 3.615   65.860 27.062 1.00 23.59 ? 316 CYS A CB  1 
ATOM   200  S  SG  . CYS A 1 30  ? 1.938   65.274 26.688 1.00 25.04 ? 316 CYS A SG  1 
ATOM   201  N  N   . VAL A 1 31  ? 6.145   67.470 26.323 1.00 19.90 ? 317 VAL A N   1 
ATOM   202  C  CA  . VAL A 1 31  ? 7.276   68.122 26.965 1.00 21.17 ? 317 VAL A CA  1 
ATOM   203  C  C   . VAL A 1 31  ? 6.821   68.902 28.197 1.00 20.60 ? 317 VAL A C   1 
ATOM   204  O  O   . VAL A 1 31  ? 5.881   69.725 28.124 1.00 20.77 ? 317 VAL A O   1 
ATOM   205  C  CB  . VAL A 1 31  ? 8.006   69.091 26.012 1.00 22.88 ? 317 VAL A CB  1 
ATOM   206  C  CG1 . VAL A 1 31  ? 9.226   69.740 26.728 1.00 23.20 ? 317 VAL A CG1 1 
ATOM   207  C  CG2 . VAL A 1 31  ? 8.463   68.312 24.808 1.00 26.23 ? 317 VAL A CG2 1 
ATOM   208  N  N   . LYS A 1 32  ? 7.418   68.630 29.361 1.00 18.04 ? 318 LYS A N   1 
ATOM   209  C  CA  . LYS A 1 32  ? 7.084   69.425 30.526 1.00 16.89 ? 318 LYS A CA  1 
ATOM   210  C  C   . LYS A 1 32  ? 7.753   70.781 30.442 1.00 18.90 ? 318 LYS A C   1 
ATOM   211  O  O   . LYS A 1 32  ? 8.996   70.866 30.280 1.00 18.89 ? 318 LYS A O   1 
ATOM   212  C  CB  . LYS A 1 32  ? 7.526   68.674 31.843 1.00 18.02 ? 318 LYS A CB  1 
ATOM   213  C  CG  . LYS A 1 32  ? 7.264   69.531 33.093 1.00 16.05 ? 318 LYS A CG  1 
ATOM   214  C  CD  . LYS A 1 32  ? 7.339   68.578 34.369 1.00 18.80 ? 318 LYS A CD  1 
ATOM   215  C  CE  . LYS A 1 32  ? 7.365   69.403 35.665 1.00 18.91 ? 318 LYS A CE  1 
ATOM   216  N  NZ  . LYS A 1 32  ? 6.215   70.382 35.880 1.00 20.93 ? 318 LYS A NZ  1 
ATOM   217  N  N   . ARG A 1 33  ? 6.957   71.860 30.510 1.00 16.68 ? 319 ARG A N   1 
ATOM   218  C  CA  . ARG A 1 33  ? 7.502   73.165 30.256 1.00 18.20 ? 319 ARG A CA  1 
ATOM   219  C  C   . ARG A 1 33  ? 8.601   73.582 31.237 1.00 18.20 ? 319 ARG A C   1 
ATOM   220  O  O   . ARG A 1 33  ? 9.586   74.224 30.819 1.00 18.10 ? 319 ARG A O   1 
ATOM   221  C  CB  . ARG A 1 33  ? 6.359   74.216 30.265 1.00 19.07 ? 319 ARG A CB  1 
ATOM   222  C  CG  . ARG A 1 33  ? 5.186   73.839 29.297 1.00 23.55 ? 319 ARG A CG  1 
ATOM   223  C  CD  . ARG A 1 33  ? 3.963   74.865 29.385 1.00 29.11 ? 319 ARG A CD  1 
ATOM   224  N  NE  . ARG A 1 33  ? 2.818   74.438 28.570 1.00 29.75 ? 319 ARG A NE  1 
ATOM   225  C  CZ  . ARG A 1 33  ? 2.807   74.612 27.267 1.00 32.54 ? 319 ARG A CZ  1 
ATOM   226  N  NH1 . ARG A 1 33  ? 3.856   75.184 26.697 1.00 34.47 ? 319 ARG A NH1 1 
ATOM   227  N  NH2 . ARG A 1 33  ? 1.774   74.234 26.524 1.00 32.75 ? 319 ARG A NH2 1 
ATOM   228  N  N   . LEU A 1 34  ? 8.424   73.254 32.520 1.00 14.84 ? 320 LEU A N   1 
ATOM   229  C  CA  . LEU A 1 34  ? 9.339   73.743 33.536 1.00 18.19 ? 320 LEU A CA  1 
ATOM   230  C  C   . LEU A 1 34  ? 10.684  73.034 33.479 1.00 19.39 ? 320 LEU A C   1 
ATOM   231  O  O   . LEU A 1 34  ? 11.742  73.677 33.575 1.00 21.15 ? 320 LEU A O   1 
ATOM   232  C  CB  . LEU A 1 34  ? 8.753   73.589 34.926 1.00 18.85 ? 320 LEU A CB  1 
ATOM   233  C  CG  . LEU A 1 34  ? 9.594   74.201 36.065 1.00 19.30 ? 320 LEU A CG  1 
ATOM   234  C  CD1 . LEU A 1 34  ? 10.019  75.676 35.831 1.00 23.81 ? 320 LEU A CD1 1 
ATOM   235  C  CD2 . LEU A 1 34  ? 8.850   74.077 37.328 1.00 24.33 ? 320 LEU A CD2 1 
ATOM   236  N  N   . ASP A 1 35  ? 10.645  71.733 33.301 1.00 19.08 ? 321 ASP A N   1 
ATOM   237  C  CA  . ASP A 1 35  ? 11.905  70.985 33.302 1.00 20.98 ? 321 ASP A CA  1 
ATOM   238  C  C   . ASP A 1 35  ? 12.495  70.621 31.958 1.00 21.61 ? 321 ASP A C   1 
ATOM   239  O  O   . ASP A 1 35  ? 13.594  70.048 31.927 1.00 23.09 ? 321 ASP A O   1 
ATOM   240  C  CB  . ASP A 1 35  ? 11.825  69.757 34.277 1.00 20.06 ? 321 ASP A CB  1 
ATOM   241  C  CG  . ASP A 1 35  ? 11.018  68.631 33.736 1.00 19.38 ? 321 ASP A CG  1 
ATOM   242  O  OD1 . ASP A 1 35  ? 10.707  67.677 34.524 1.00 21.38 ? 321 ASP A OD1 1 
ATOM   243  O  OD2 . ASP A 1 35  ? 10.638  68.535 32.551 1.00 20.69 ? 321 ASP A OD2 1 
ATOM   244  N  N   . GLY A 1 36  ? 11.830  70.957 30.839 1.00 20.92 ? 322 GLY A N   1 
ATOM   245  C  CA  . GLY A 1 36  ? 12.315  70.600 29.511 1.00 21.28 ? 322 GLY A CA  1 
ATOM   246  C  C   . GLY A 1 36  ? 12.326  69.151 29.049 1.00 22.22 ? 322 GLY A C   1 
ATOM   247  O  O   . GLY A 1 36  ? 12.702  68.877 27.894 1.00 21.56 ? 322 GLY A O   1 
ATOM   248  N  N   . CYS A 1 37  ? 11.911  68.229 29.907 1.00 21.47 ? 323 CYS A N   1 
ATOM   249  C  CA  . CYS A 1 37  ? 11.980  66.804 29.634 1.00 22.49 ? 323 CYS A CA  1 
ATOM   250  C  C   . CYS A 1 37  ? 10.709  66.265 28.953 1.00 22.38 ? 323 CYS A C   1 
ATOM   251  O  O   . CYS A 1 37  ? 9.606   66.858 29.106 1.00 21.98 ? 323 CYS A O   1 
ATOM   252  C  CB  . CYS A 1 37  ? 12.295  65.987 30.930 1.00 24.21 ? 323 CYS A CB  1 
ATOM   253  S  SG  . CYS A 1 37  ? 13.988  66.349 31.537 1.00 32.63 ? 323 CYS A SG  1 
ATOM   254  N  N   . ILE A 1 38  ? 10.880  65.162 28.233 1.00 20.93 ? 324 ILE A N   1 
ATOM   255  C  CA  . ILE A 1 38  ? 9.781   64.545 27.498 1.00 20.97 ? 324 ILE A CA  1 
ATOM   256  C  C   . ILE A 1 38  ? 9.179   63.413 28.354 1.00 21.93 ? 324 ILE A C   1 
ATOM   257  O  O   . ILE A 1 38  ? 9.926   62.629 28.935 1.00 22.40 ? 324 ILE A O   1 
ATOM   258  C  CB  . ILE A 1 38  ? 10.269  64.003 26.154 1.00 22.28 ? 324 ILE A CB  1 
ATOM   259  C  CG1 . ILE A 1 38  ? 10.851  65.152 25.284 1.00 24.48 ? 324 ILE A CG1 1 
ATOM   260  C  CG2 . ILE A 1 38  ? 9.100   63.248 25.442 1.00 22.81 ? 324 ILE A CG2 1 
ATOM   261  C  CD1 . ILE A 1 38  ? 11.844  64.649 24.241 1.00 28.45 ? 324 ILE A CD1 1 
ATOM   262  N  N   . TYR A 1 39  ? 7.851   63.338 28.445 1.00 18.86 ? 325 TYR A N   1 
ATOM   263  C  CA  . TYR A 1 39  ? 7.229   62.279 29.213 1.00 18.83 ? 325 TYR A CA  1 
ATOM   264  C  C   . TYR A 1 39  ? 6.149   61.651 28.376 1.00 20.02 ? 325 TYR A C   1 
ATOM   265  O  O   . TYR A 1 39  ? 5.717   62.224 27.383 1.00 21.46 ? 325 TYR A O   1 
ATOM   266  C  CB  . TYR A 1 39  ? 6.605   62.865 30.485 1.00 18.58 ? 325 TYR A CB  1 
ATOM   267  C  CG  . TYR A 1 39  ? 7.631   63.464 31.459 1.00 17.81 ? 325 TYR A CG  1 
ATOM   268  C  CD1 . TYR A 1 39  ? 7.948   64.834 31.383 1.00 16.10 ? 325 TYR A CD1 1 
ATOM   269  C  CD2 . TYR A 1 39  ? 8.273   62.671 32.407 1.00 19.38 ? 325 TYR A CD2 1 
ATOM   270  C  CE1 . TYR A 1 39  ? 8.861   65.438 32.282 1.00 18.73 ? 325 TYR A CE1 1 
ATOM   271  C  CE2 . TYR A 1 39  ? 9.176   63.219 33.321 1.00 21.31 ? 325 TYR A CE2 1 
ATOM   272  C  CZ  . TYR A 1 39  ? 9.506   64.576 33.234 1.00 19.25 ? 325 TYR A CZ  1 
ATOM   273  O  OH  . TYR A 1 39  ? 10.382  65.106 34.124 1.00 19.60 ? 325 TYR A OH  1 
ATOM   274  N  N   . ALA A 1 40  ? 5.699   60.479 28.789 1.00 20.15 ? 326 ALA A N   1 
ATOM   275  C  CA  . ALA A 1 40  ? 4.564   59.851 28.155 1.00 21.07 ? 326 ALA A CA  1 
ATOM   276  C  C   . ALA A 1 40  ? 3.389   60.070 29.159 1.00 21.52 ? 326 ALA A C   1 
ATOM   277  O  O   . ALA A 1 40  ? 3.505   59.666 30.340 1.00 22.61 ? 326 ALA A O   1 
ATOM   278  C  CB  . ALA A 1 40  ? 4.850   58.387 28.030 1.00 20.75 ? 326 ALA A CB  1 
ATOM   279  N  N   . ILE A 1 41  ? 2.289   60.674 28.708 1.00 21.61 ? 327 ILE A N   1 
ATOM   280  C  CA  . ILE A 1 41  ? 1.184   60.946 29.626 1.00 20.92 ? 327 ILE A CA  1 
ATOM   281  C  C   . ILE A 1 41  ? -0.061  60.220 29.079 1.00 22.61 ? 327 ILE A C   1 
ATOM   282  O  O   . ILE A 1 41  ? -0.475  60.476 27.951 1.00 20.97 ? 327 ILE A O   1 
ATOM   283  C  CB  . ILE A 1 41  ? 0.918   62.419 29.781 1.00 21.64 ? 327 ILE A CB  1 
ATOM   284  C  CG1 . ILE A 1 41  ? 2.160   63.126 30.407 1.00 22.32 ? 327 ILE A CG1 1 
ATOM   285  C  CG2 . ILE A 1 41  ? -0.350  62.641 30.666 1.00 22.69 ? 327 ILE A CG2 1 
ATOM   286  C  CD1 . ILE A 1 41  ? 1.994   64.574 30.569 1.00 23.09 ? 327 ILE A CD1 1 
ATOM   287  N  N   . LYS A 1 42  ? -0.638  59.356 29.909 1.00 22.19 ? 328 LYS A N   1 
ATOM   288  C  CA  . LYS A 1 42  ? -1.857  58.632 29.543 1.00 23.26 ? 328 LYS A CA  1 
ATOM   289  C  C   . LYS A 1 42  ? -3.028  59.405 30.095 1.00 24.12 ? 328 LYS A C   1 
ATOM   290  O  O   . LYS A 1 42  ? -3.079  59.729 31.285 1.00 23.43 ? 328 LYS A O   1 
ATOM   291  C  CB  . LYS A 1 42  ? -1.854  57.203 30.078 1.00 24.05 ? 328 LYS A CB  1 
ATOM   292  C  CG  . LYS A 1 42  ? -2.828  56.307 29.358 1.00 29.73 ? 328 LYS A CG  1 
ATOM   293  C  CD  . LYS A 1 42  ? -3.785  55.519 30.181 1.00 33.90 ? 328 LYS A CD  1 
ATOM   294  C  CE  . LYS A 1 42  ? -3.236  54.842 31.409 1.00 32.58 ? 328 LYS A CE  1 
ATOM   295  N  NZ  . LYS A 1 42  ? -4.393  54.385 32.223 1.00 33.56 ? 328 LYS A NZ  1 
ATOM   296  N  N   . ARG A 1 43  ? -4.028  59.687 29.249 1.00 24.32 ? 329 ARG A N   1 
ATOM   297  C  CA  . ARG A 1 43  ? -5.145  60.548 29.685 1.00 26.07 ? 329 ARG A CA  1 
ATOM   298  C  C   . ARG A 1 43  ? -6.365  59.723 29.379 1.00 28.73 ? 329 ARG A C   1 
ATOM   299  O  O   . ARG A 1 43  ? -6.620  59.418 28.214 1.00 29.29 ? 329 ARG A O   1 
ATOM   300  C  CB  . ARG A 1 43  ? -5.165  61.841 28.838 1.00 26.33 ? 329 ARG A CB  1 
ATOM   301  C  CG  . ARG A 1 43  ? -6.235  62.897 29.172 1.00 33.04 ? 329 ARG A CG  1 
ATOM   302  C  CD  . ARG A 1 43  ? -6.134  64.145 28.270 1.00 37.03 ? 329 ARG A CD  1 
ATOM   303  N  NE  . ARG A 1 43  ? -7.277  65.070 28.380 1.00 47.96 ? 329 ARG A NE  1 
ATOM   304  C  CZ  . ARG A 1 43  ? -7.380  66.071 29.258 1.00 50.08 ? 329 ARG A CZ  1 
ATOM   305  N  NH1 . ARG A 1 43  ? -6.422  66.303 30.154 1.00 53.80 ? 329 ARG A NH1 1 
ATOM   306  N  NH2 . ARG A 1 43  ? -8.450  66.854 29.239 1.00 52.01 ? 329 ARG A NH2 1 
ATOM   307  N  N   . SER A 1 44  ? -7.112  59.354 30.416 1.00 29.05 ? 330 SER A N   1 
ATOM   308  C  CA  . SER A 1 44  ? -8.256  58.490 30.260 1.00 31.45 ? 330 SER A CA  1 
ATOM   309  C  C   . SER A 1 44  ? -9.517  59.075 30.952 1.00 31.49 ? 330 SER A C   1 
ATOM   310  O  O   . SER A 1 44  ? -9.421  59.923 31.830 1.00 30.35 ? 330 SER A O   1 
ATOM   311  C  CB  . SER A 1 44  ? -7.916  57.055 30.681 1.00 32.01 ? 330 SER A CB  1 
ATOM   312  O  OG  . SER A 1 44  ? -7.371  56.982 31.984 1.00 36.21 ? 330 SER A OG  1 
ATOM   313  N  N   . LYS A 1 45  ? -10.698 58.711 30.472 1.00 32.99 ? 331 LYS A N   1 
ATOM   314  C  CA  . LYS A 1 45  ? -11.929 59.204 31.129 1.00 32.57 ? 331 LYS A CA  1 
ATOM   315  C  C   . LYS A 1 45  ? -12.014 58.681 32.591 1.00 32.79 ? 331 LYS A C   1 
ATOM   316  O  O   . LYS A 1 45  ? -11.753 57.509 32.880 1.00 32.50 ? 331 LYS A O   1 
ATOM   317  C  CB  . LYS A 1 45  ? -13.201 58.844 30.302 1.00 33.76 ? 331 LYS A CB  1 
ATOM   318  N  N   . LYS A 1 46  ? -12.335 59.579 33.500 1.00 33.19 ? 332 LYS A N   1 
ATOM   319  C  CA  . LYS A 1 46  ? -12.414 59.290 34.935 1.00 33.87 ? 332 LYS A CA  1 
ATOM   320  C  C   . LYS A 1 46  ? -13.599 58.392 35.307 1.00 33.69 ? 332 LYS A C   1 
ATOM   321  O  O   . LYS A 1 46  ? -14.738 58.743 35.034 1.00 31.59 ? 332 LYS A O   1 
ATOM   322  C  CB  . LYS A 1 46  ? -12.540 60.620 35.675 1.00 34.41 ? 332 LYS A CB  1 
ATOM   323  C  CG  . LYS A 1 46  ? -12.523 60.485 37.200 1.00 36.54 ? 332 LYS A CG  1 
ATOM   324  C  CD  . LYS A 1 46  ? -11.798 61.649 37.874 1.00 39.03 ? 332 LYS A CD  1 
ATOM   325  C  CE  . LYS A 1 46  ? -12.508 62.977 37.719 1.00 40.36 ? 332 LYS A CE  1 
ATOM   326  N  NZ  . LYS A 1 46  ? -13.719 63.165 38.609 1.00 45.02 ? 332 LYS A NZ  1 
ATOM   327  N  N   . PRO A 1 47  ? -13.353 57.245 35.930 1.00 33.63 ? 333 PRO A N   1 
ATOM   328  C  CA  . PRO A 1 47  ? -14.453 56.336 36.277 1.00 34.34 ? 333 PRO A CA  1 
ATOM   329  C  C   . PRO A 1 47  ? -15.368 56.926 37.341 1.00 35.26 ? 333 PRO A C   1 
ATOM   330  O  O   . PRO A 1 47  ? -14.979 57.865 38.032 1.00 35.31 ? 333 PRO A O   1 
ATOM   331  C  CB  . PRO A 1 47  ? -13.726 55.101 36.834 1.00 34.75 ? 333 PRO A CB  1 
ATOM   332  C  CG  . PRO A 1 47  ? -12.366 55.216 36.292 1.00 32.75 ? 333 PRO A CG  1 
ATOM   333  C  CD  . PRO A 1 47  ? -12.034 56.699 36.309 1.00 33.83 ? 333 PRO A CD  1 
ATOM   334  N  N   . LEU A 1 48  ? -16.587 56.408 37.436 1.00 36.95 ? 334 LEU A N   1 
ATOM   335  C  CA  . LEU A 1 48  ? -17.488 56.815 38.509 1.00 38.01 ? 334 LEU A CA  1 
ATOM   336  C  C   . LEU A 1 48  ? -16.842 56.510 39.859 1.00 39.05 ? 334 LEU A C   1 
ATOM   337  O  O   . LEU A 1 48  ? -16.419 55.369 40.126 1.00 39.11 ? 334 LEU A O   1 
ATOM   338  C  CB  . LEU A 1 48  ? -18.809 56.100 38.383 1.00 38.65 ? 334 LEU A CB  1 
ATOM   339  N  N   . ALA A 1 49  ? -16.731 57.536 40.696 1.00 40.14 ? 335 ALA A N   1 
ATOM   340  C  CA  . ALA A 1 49  ? -16.140 57.390 42.030 1.00 41.07 ? 335 ALA A CA  1 
ATOM   341  C  C   . ALA A 1 49  ? -16.740 56.220 42.785 1.00 41.43 ? 335 ALA A C   1 
ATOM   342  O  O   . ALA A 1 49  ? -17.952 56.041 42.799 1.00 40.49 ? 335 ALA A O   1 
ATOM   343  C  CB  . ALA A 1 49  ? -16.338 58.647 42.833 1.00 41.87 ? 335 ALA A CB  1 
ATOM   344  N  N   . GLY A 1 50  ? -15.873 55.412 43.392 1.00 41.93 ? 336 GLY A N   1 
ATOM   345  C  CA  . GLY A 1 50  ? -16.334 54.283 44.183 1.00 42.00 ? 336 GLY A CA  1 
ATOM   346  C  C   . GLY A 1 50  ? -16.715 53.044 43.393 1.00 42.02 ? 336 GLY A C   1 
ATOM   347  O  O   . GLY A 1 50  ? -17.111 52.018 43.975 1.00 42.96 ? 336 GLY A O   1 
ATOM   348  N  N   . SER A 1 51  ? -16.619 53.124 42.073 1.00 40.70 ? 337 SER A N   1 
ATOM   349  C  CA  . SER A 1 51  ? -16.934 51.985 41.237 1.00 39.35 ? 337 SER A CA  1 
ATOM   350  C  C   . SER A 1 51  ? -15.780 51.002 41.163 1.00 39.77 ? 337 SER A C   1 
ATOM   351  O  O   . SER A 1 51  ? -14.611 51.347 41.422 1.00 38.76 ? 337 SER A O   1 
ATOM   352  C  CB  . SER A 1 51  ? -17.234 52.456 39.813 1.00 39.82 ? 337 SER A CB  1 
ATOM   353  O  OG  . SER A 1 51  ? -16.123 53.154 39.238 1.00 34.92 ? 337 SER A OG  1 
ATOM   354  N  N   . VAL A 1 52  ? -16.104 49.781 40.753 1.00 39.77 ? 338 VAL A N   1 
ATOM   355  C  CA  . VAL A 1 52  ? -15.088 48.772 40.506 1.00 39.29 ? 338 VAL A CA  1 
ATOM   356  C  C   . VAL A 1 52  ? -14.128 49.324 39.490 1.00 39.45 ? 338 VAL A C   1 
ATOM   357  O  O   . VAL A 1 52  ? -12.921 49.131 39.584 1.00 38.33 ? 338 VAL A O   1 
ATOM   358  C  CB  . VAL A 1 52  ? -15.716 47.517 39.912 1.00 39.54 ? 338 VAL A CB  1 
ATOM   359  C  CG1 . VAL A 1 52  ? -14.682 46.599 39.402 1.00 40.85 ? 338 VAL A CG1 1 
ATOM   360  C  CG2 . VAL A 1 52  ? -16.550 46.825 40.969 1.00 41.39 ? 338 VAL A CG2 1 
ATOM   361  N  N   . ASP A 1 53  ? -14.649 50.023 38.494 1.00 38.46 ? 339 ASP A N   1 
ATOM   362  C  CA  . ASP A 1 53  ? -13.729 50.538 37.493 1.00 38.06 ? 339 ASP A CA  1 
ATOM   363  C  C   . ASP A 1 53  ? -12.758 51.550 38.086 1.00 35.26 ? 339 ASP A C   1 
ATOM   364  O  O   . ASP A 1 53  ? -11.643 51.641 37.630 1.00 34.03 ? 339 ASP A O   1 
ATOM   365  C  CB  . ASP A 1 53  ? -14.474 51.136 36.299 1.00 40.59 ? 339 ASP A CB  1 
ATOM   366  C  CG  . ASP A 1 53  ? -15.101 50.055 35.386 1.00 47.10 ? 339 ASP A CG  1 
ATOM   367  O  OD1 . ASP A 1 53  ? -15.638 49.059 35.932 1.00 53.67 ? 339 ASP A OD1 1 
ATOM   368  O  OD2 . ASP A 1 53  ? -15.100 50.116 34.121 1.00 53.69 ? 339 ASP A OD2 1 
ATOM   369  N  N   . GLU A 1 54  ? -13.190 52.322 39.082 1.00 33.57 ? 340 GLU A N   1 
ATOM   370  C  CA  . GLU A 1 54  ? -12.287 53.303 39.687 1.00 31.60 ? 340 GLU A CA  1 
ATOM   371  C  C   . GLU A 1 54  ? -11.238 52.575 40.518 1.00 30.79 ? 340 GLU A C   1 
ATOM   372  O  O   . GLU A 1 54  ? -10.078 52.964 40.542 1.00 28.68 ? 340 GLU A O   1 
ATOM   373  C  CB  . GLU A 1 54  ? -13.037 54.302 40.551 1.00 31.42 ? 340 GLU A CB  1 
ATOM   374  C  CG  . GLU A 1 54  ? -12.121 55.346 41.150 1.00 32.61 ? 340 GLU A CG  1 
ATOM   375  C  CD  . GLU A 1 54  ? -12.823 56.319 42.050 1.00 39.60 ? 340 GLU A CD  1 
ATOM   376  O  OE1 . GLU A 1 54  ? -12.243 57.414 42.268 1.00 41.02 ? 340 GLU A OE1 1 
ATOM   377  O  OE2 . GLU A 1 54  ? -13.954 56.004 42.522 1.00 42.88 ? 340 GLU A OE2 1 
ATOM   378  N  N   . GLN A 1 55  ? -11.660 51.525 41.224 1.00 29.78 ? 341 GLN A N   1 
ATOM   379  C  CA  . GLN A 1 55  ? -10.682 50.713 41.948 1.00 30.26 ? 341 GLN A CA  1 
ATOM   380  C  C   . GLN A 1 55  ? -9.646  50.185 41.024 1.00 30.40 ? 341 GLN A C   1 
ATOM   381  O  O   . GLN A 1 55  ? -8.463  50.154 41.373 1.00 27.49 ? 341 GLN A O   1 
ATOM   382  C  CB  . GLN A 1 55  ? -11.349 49.561 42.693 1.00 30.68 ? 341 GLN A CB  1 
ATOM   383  C  CG  . GLN A 1 55  ? -12.509 50.051 43.473 1.00 29.81 ? 341 GLN A CG  1 
ATOM   384  C  CD  . GLN A 1 55  ? -13.320 48.922 44.149 1.00 32.70 ? 341 GLN A CD  1 
ATOM   385  O  OE1 . GLN A 1 55  ? -13.361 47.779 43.657 1.00 32.16 ? 341 GLN A OE1 1 
ATOM   386  N  NE2 . GLN A 1 55  ? -13.930 49.242 45.266 1.00 29.41 ? 341 GLN A NE2 1 
ATOM   387  N  N   . ASN A 1 56  ? -10.071 49.725 39.843 1.00 29.89 ? 342 ASN A N   1 
ATOM   388  C  CA  . ASN A 1 56  ? -9.127  49.218 38.890 1.00 30.03 ? 342 ASN A CA  1 
ATOM   389  C  C   . ASN A 1 56  ? -8.208  50.330 38.371 1.00 28.24 ? 342 ASN A C   1 
ATOM   390  O  O   . ASN A 1 56  ? -7.006  50.150 38.224 1.00 27.29 ? 342 ASN A O   1 
ATOM   391  C  CB  . ASN A 1 56  ? -9.870  48.446 37.745 1.00 31.94 ? 342 ASN A CB  1 
ATOM   392  C  CG  . ASN A 1 56  ? -8.895  47.723 36.798 1.00 37.98 ? 342 ASN A CG  1 
ATOM   393  O  OD1 . ASN A 1 56  ? -7.926  47.075 37.233 1.00 44.37 ? 342 ASN A OD1 1 
ATOM   394  N  ND2 . ASN A 1 56  ? -9.143  47.841 35.493 1.00 42.01 ? 342 ASN A ND2 1 
ATOM   395  N  N   . ALA A 1 57  ? -8.766  51.513 38.154 1.00 25.87 ? 343 ALA A N   1 
ATOM   396  C  CA  . ALA A 1 57  ? -7.956  52.579 37.619 1.00 25.27 ? 343 ALA A CA  1 
ATOM   397  C  C   . ALA A 1 57  ? -6.907  52.976 38.669 1.00 24.22 ? 343 ALA A C   1 
ATOM   398  O  O   . ALA A 1 57  ? -5.770  53.314 38.355 1.00 23.83 ? 343 ALA A O   1 
ATOM   399  C  CB  . ALA A 1 57  ? -8.853  53.773 37.326 1.00 25.32 ? 343 ALA A CB  1 
ATOM   400  N  N   . LEU A 1 58  ? -7.331  52.978 39.927 1.00 22.45 ? 344 LEU A N   1 
ATOM   401  C  CA  . LEU A 1 58  ? -6.400  53.403 40.981 1.00 22.21 ? 344 LEU A CA  1 
ATOM   402  C  C   . LEU A 1 58  ? -5.310  52.375 41.238 1.00 21.91 ? 344 LEU A C   1 
ATOM   403  O  O   . LEU A 1 58  ? -4.237  52.730 41.699 1.00 20.88 ? 344 LEU A O   1 
ATOM   404  C  CB  . LEU A 1 58  ? -7.143  53.722 42.281 1.00 21.59 ? 344 LEU A CB  1 
ATOM   405  C  CG  . LEU A 1 58  ? -8.125  54.906 42.183 1.00 23.08 ? 344 LEU A CG  1 
ATOM   406  C  CD1 . LEU A 1 58  ? -8.920  55.168 43.425 1.00 25.33 ? 344 LEU A CD1 1 
ATOM   407  C  CD2 . LEU A 1 58  ? -7.223  56.103 41.894 1.00 27.53 ? 344 LEU A CD2 1 
ATOM   408  N  N   . ARG A 1 59  ? -5.605  51.078 41.056 1.00 22.06 ? 345 ARG A N   1 
ATOM   409  C  CA  . ARG A 1 59  ? -4.535  50.087 41.179 1.00 22.06 ? 345 ARG A CA  1 
ATOM   410  C  C   . ARG A 1 59  ? -3.358  50.412 40.302 1.00 21.70 ? 345 ARG A C   1 
ATOM   411  O  O   . ARG A 1 59  ? -2.197  50.179 40.687 1.00 20.71 ? 345 ARG A O   1 
ATOM   412  C  CB  . ARG A 1 59  ? -5.010  48.669 40.816 1.00 24.18 ? 345 ARG A CB  1 
ATOM   413  C  CG  . ARG A 1 59  ? -5.092  47.815 42.083 1.00 29.05 ? 345 ARG A CG  1 
ATOM   414  C  CD  . ARG A 1 59  ? -5.829  46.498 42.056 1.00 25.96 ? 345 ARG A CD  1 
ATOM   415  N  NE  . ARG A 1 59  ? -6.704  46.236 40.883 1.00 26.59 ? 345 ARG A NE  1 
ATOM   416  C  CZ  . ARG A 1 59  ? -8.037  46.097 40.956 1.00 26.86 ? 345 ARG A CZ  1 
ATOM   417  N  NH1 . ARG A 1 59  ? -8.714  46.192 42.117 1.00 23.22 ? 345 ARG A NH1 1 
ATOM   418  N  NH2 . ARG A 1 59  ? -8.749  45.867 39.846 1.00 29.71 ? 345 ARG A NH2 1 
ATOM   419  N  N   . GLU A 1 60  ? -3.644  50.926 39.101 1.00 20.11 ? 346 GLU A N   1 
ATOM   420  C  CA  . GLU A 1 60  ? -2.553  51.253 38.217 1.00 20.92 ? 346 GLU A CA  1 
ATOM   421  C  C   . GLU A 1 60  ? -1.609  52.312 38.880 1.00 19.92 ? 346 GLU A C   1 
ATOM   422  O  O   . GLU A 1 60  ? -0.393  52.238 38.774 1.00 21.11 ? 346 GLU A O   1 
ATOM   423  C  CB  . GLU A 1 60  ? -3.081  51.720 36.849 1.00 20.86 ? 346 GLU A CB  1 
ATOM   424  C  CG  . GLU A 1 60  ? -1.928  52.163 35.878 1.00 21.38 ? 346 GLU A CG  1 
ATOM   425  C  CD  . GLU A 1 60  ? -2.469  52.544 34.465 1.00 26.21 ? 346 GLU A CD  1 
ATOM   426  O  OE1 . GLU A 1 60  ? -3.673  52.839 34.354 1.00 26.42 ? 346 GLU A OE1 1 
ATOM   427  O  OE2 . GLU A 1 60  ? -1.695  52.538 33.477 1.00 29.81 ? 346 GLU A OE2 1 
ATOM   428  N  N   . VAL A 1 61  ? -2.227  53.357 39.389 1.00 20.45 ? 347 VAL A N   1 
ATOM   429  C  CA  . VAL A 1 61  ? -1.512  54.416 40.055 1.00 21.24 ? 347 VAL A CA  1 
ATOM   430  C  C   . VAL A 1 61  ? -0.736  53.877 41.271 1.00 21.42 ? 347 VAL A C   1 
ATOM   431  O  O   . VAL A 1 61  ? 0.494   54.175 41.444 1.00 19.89 ? 347 VAL A O   1 
ATOM   432  C  CB  . VAL A 1 61  ? -2.502  55.413 40.541 1.00 22.47 ? 347 VAL A CB  1 
ATOM   433  C  CG1 . VAL A 1 61  ? -1.753  56.525 41.307 1.00 22.10 ? 347 VAL A CG1 1 
ATOM   434  C  CG2 . VAL A 1 61  ? -3.222  56.003 39.329 1.00 23.35 ? 347 VAL A CG2 1 
ATOM   435  N  N   . TYR A 1 62  ? -1.441  53.117 42.107 1.00 18.98 ? 348 TYR A N   1 
ATOM   436  C  CA  . TYR A 1 62  ? -0.789  52.550 43.323 1.00 20.31 ? 348 TYR A CA  1 
ATOM   437  C  C   . TYR A 1 62  ? 0.407   51.634 42.916 1.00 21.08 ? 348 TYR A C   1 
ATOM   438  O  O   . TYR A 1 62  ? 1.485   51.677 43.594 1.00 22.20 ? 348 TYR A O   1 
ATOM   439  C  CB  . TYR A 1 62  ? -1.805  51.748 44.150 1.00 20.24 ? 348 TYR A CB  1 
ATOM   440  C  CG  . TYR A 1 62  ? -2.961  52.541 44.692 1.00 20.90 ? 348 TYR A CG  1 
ATOM   441  C  CD1 . TYR A 1 62  ? -4.199  51.937 44.901 1.00 20.00 ? 348 TYR A CD1 1 
ATOM   442  C  CD2 . TYR A 1 62  ? -2.834  53.895 44.990 1.00 21.87 ? 348 TYR A CD2 1 
ATOM   443  C  CE1 . TYR A 1 62  ? -5.243  52.635 45.398 1.00 21.23 ? 348 TYR A CE1 1 
ATOM   444  C  CE2 . TYR A 1 62  ? -3.887  54.610 45.482 1.00 22.92 ? 348 TYR A CE2 1 
ATOM   445  C  CZ  . TYR A 1 62  ? -5.101  53.973 45.684 1.00 22.80 ? 348 TYR A CZ  1 
ATOM   446  O  OH  . TYR A 1 62  ? -6.164  54.684 46.186 1.00 22.19 ? 348 TYR A OH  1 
ATOM   447  N  N   . ALA A 1 63  ? 0.237   50.824 41.861 1.00 20.71 ? 349 ALA A N   1 
ATOM   448  C  CA  . ALA A 1 63  ? 1.324   49.943 41.346 1.00 21.46 ? 349 ALA A CA  1 
ATOM   449  C  C   . ALA A 1 63  ? 2.502   50.825 40.855 1.00 23.46 ? 349 ALA A C   1 
ATOM   450  O  O   . ALA A 1 63  ? 3.654   50.661 41.291 1.00 24.03 ? 349 ALA A O   1 
ATOM   451  C  CB  . ALA A 1 63  ? 0.855   49.072 40.185 1.00 21.42 ? 349 ALA A CB  1 
ATOM   452  N  N   . HIS A 1 64  ? 2.188   51.848 40.078 1.00 24.48 ? 350 HIS A N   1 
ATOM   453  C  CA  . HIS A 1 64  ? 3.255   52.775 39.686 1.00 28.97 ? 350 HIS A CA  1 
ATOM   454  C  C   . HIS A 1 64  ? 3.912   53.459 40.839 1.00 27.39 ? 350 HIS A C   1 
ATOM   455  O  O   . HIS A 1 64  ? 5.140   53.602 40.782 1.00 32.40 ? 350 HIS A O   1 
ATOM   456  C  CB  . HIS A 1 64  ? 2.753   53.900 38.771 1.00 27.47 ? 350 HIS A CB  1 
ATOM   457  C  CG  . HIS A 1 64  ? 2.899   53.565 37.365 1.00 26.98 ? 350 HIS A CG  1 
ATOM   458  N  ND1 . HIS A 1 64  ? 4.126   53.279 36.793 1.00 26.65 ? 350 HIS A ND1 1 
ATOM   459  C  CD2 . HIS A 1 64  ? 1.975   53.441 36.390 1.00 31.77 ? 350 HIS A CD2 1 
ATOM   460  C  CE1 . HIS A 1 64  ? 3.934   52.970 35.523 1.00 24.84 ? 350 HIS A CE1 1 
ATOM   461  N  NE2 . HIS A 1 64  ? 2.650   53.057 35.256 1.00 27.32 ? 350 HIS A NE2 1 
ATOM   462  N  N   . ALA A 1 65  ? 3.174   53.856 41.851 1.00 28.53 ? 351 ALA A N   1 
ATOM   463  C  CA  . ALA A 1 65  ? 3.737   54.578 43.004 1.00 28.06 ? 351 ALA A CA  1 
ATOM   464  C  C   . ALA A 1 65  ? 4.732   53.714 43.822 1.00 29.98 ? 351 ALA A C   1 
ATOM   465  O  O   . ALA A 1 65  ? 5.443   54.244 44.723 1.00 30.96 ? 351 ALA A O   1 
ATOM   466  C  CB  . ALA A 1 65  ? 2.673   55.095 43.903 1.00 29.75 ? 351 ALA A CB  1 
ATOM   467  N  N   . VAL A 1 66  ? 4.715   52.395 43.604 1.00 29.33 ? 352 VAL A N   1 
ATOM   468  C  CA  . VAL A 1 66  ? 5.642   51.512 44.323 1.00 28.37 ? 352 VAL A CA  1 
ATOM   469  C  C   . VAL A 1 66  ? 6.653   50.791 43.411 1.00 28.18 ? 352 VAL A C   1 
ATOM   470  O  O   . VAL A 1 66  ? 7.524   50.048 43.907 1.00 30.12 ? 352 VAL A O   1 
ATOM   471  C  CB  . VAL A 1 66  ? 4.898   50.486 45.235 1.00 29.92 ? 352 VAL A CB  1 
ATOM   472  C  CG1 . VAL A 1 66  ? 4.105   51.178 46.384 1.00 32.38 ? 352 VAL A CG1 1 
ATOM   473  C  CG2 . VAL A 1 66  ? 4.024   49.566 44.421 1.00 30.99 ? 352 VAL A CG2 1 
ATOM   474  N  N   . LEU A 1 67  ? 6.513   50.918 42.099 1.00 25.22 ? 353 LEU A N   1 
ATOM   475  C  CA  . LEU A 1 67  ? 7.402   50.229 41.211 1.00 26.73 ? 353 LEU A CA  1 
ATOM   476  C  C   . LEU A 1 67  ? 8.168   51.379 40.478 1.00 29.06 ? 353 LEU A C   1 
ATOM   477  O  O   . LEU A 1 67  ? 8.222   51.430 39.306 1.00 29.57 ? 353 LEU A O   1 
ATOM   478  C  CB  . LEU A 1 67  ? 6.615   49.331 40.279 1.00 26.00 ? 353 LEU A CB  1 
ATOM   479  C  CG  . LEU A 1 67  ? 5.869   48.140 40.967 1.00 25.24 ? 353 LEU A CG  1 
ATOM   480  C  CD1 . LEU A 1 67  ? 4.865   47.477 39.974 1.00 23.61 ? 353 LEU A CD1 1 
ATOM   481  C  CD2 . LEU A 1 67  ? 6.808   47.115 41.554 1.00 25.01 ? 353 LEU A CD2 1 
ATOM   482  N  N   . GLY A 1 68  ? 8.706   52.360 41.218 1.00 32.09 ? 354 GLY A N   1 
ATOM   483  C  CA  . GLY A 1 68  ? 9.371   53.447 40.484 1.00 33.76 ? 354 GLY A CA  1 
ATOM   484  C  C   . GLY A 1 68  ? 10.889  53.563 40.563 1.00 34.81 ? 354 GLY A C   1 
ATOM   485  O  O   . GLY A 1 68  ? 11.485  54.644 40.250 1.00 33.86 ? 354 GLY A O   1 
ATOM   486  N  N   . GLN A 1 69  ? 11.514  52.535 41.117 1.00 34.79 ? 355 GLN A N   1 
ATOM   487  C  CA  . GLN A 1 69  ? 12.927  52.582 41.300 1.00 35.61 ? 355 GLN A CA  1 
ATOM   488  C  C   . GLN A 1 69  ? 13.673  51.519 40.502 1.00 32.98 ? 355 GLN A C   1 
ATOM   489  O  O   . GLN A 1 69  ? 14.798  51.145 40.904 1.00 34.82 ? 355 GLN A O   1 
ATOM   490  C  CB  . GLN A 1 69  ? 13.272  52.377 42.744 1.00 37.28 ? 355 GLN A CB  1 
ATOM   491  C  CG  . GLN A 1 69  ? 12.585  51.238 43.440 1.00 45.77 ? 355 GLN A CG  1 
ATOM   492  C  CD  . GLN A 1 69  ? 11.142  51.561 43.884 1.00 53.94 ? 355 GLN A CD  1 
ATOM   493  O  OE1 . GLN A 1 69  ? 10.377  52.185 43.127 1.00 57.22 ? 355 GLN A OE1 1 
ATOM   494  N  NE2 . GLN A 1 69  ? 10.765  51.107 45.088 1.00 54.45 ? 355 GLN A NE2 1 
ATOM   495  N  N   . HIS A 1 70  ? 13.027  50.930 39.518 1.00 29.55 ? 356 HIS A N   1 
ATOM   496  C  CA  . HIS A 1 70  ? 13.743  49.809 38.818 1.00 27.37 ? 356 HIS A CA  1 
ATOM   497  C  C   . HIS A 1 70  ? 14.081  50.153 37.394 1.00 26.33 ? 356 HIS A C   1 
ATOM   498  O  O   . HIS A 1 70  ? 13.235  50.665 36.697 1.00 24.96 ? 356 HIS A O   1 
ATOM   499  C  CB  . HIS A 1 70  ? 12.939  48.489 38.850 1.00 27.93 ? 356 HIS A CB  1 
ATOM   500  C  CG  . HIS A 1 70  ? 13.806  47.275 38.603 1.00 27.49 ? 356 HIS A CG  1 
ATOM   501  N  ND1 . HIS A 1 70  ? 13.984  46.751 37.340 1.00 29.08 ? 356 HIS A ND1 1 
ATOM   502  C  CD2 . HIS A 1 70  ? 14.567  46.524 39.441 1.00 31.07 ? 356 HIS A CD2 1 
ATOM   503  C  CE1 . HIS A 1 70  ? 14.809  45.715 37.408 1.00 29.11 ? 356 HIS A CE1 1 
ATOM   504  N  NE2 . HIS A 1 70  ? 15.200  45.564 38.671 1.00 27.37 ? 356 HIS A NE2 1 
ATOM   505  N  N   . SER A 1 71  ? 15.284  49.778 36.925 1.00 24.93 ? 357 SER A N   1 
ATOM   506  C  CA  . SER A 1 71  ? 15.708  50.120 35.586 1.00 27.17 ? 357 SER A CA  1 
ATOM   507  C  C   . SER A 1 71  ? 14.946  49.424 34.481 1.00 25.11 ? 357 SER A C   1 
ATOM   508  O  O   . SER A 1 71  ? 15.026  49.844 33.351 1.00 27.61 ? 357 SER A O   1 
ATOM   509  C  CB  . SER A 1 71  ? 17.237  49.872 35.359 1.00 29.41 ? 357 SER A CB  1 
ATOM   510  O  OG  . SER A 1 71  ? 18.003  50.858 36.061 1.00 34.33 ? 357 SER A OG  1 
ATOM   511  N  N   . HIS A 1 72  ? 14.220  48.382 34.821 1.00 24.52 ? 358 HIS A N   1 
ATOM   512  C  CA  . HIS A 1 72  ? 13.461  47.642 33.788 1.00 23.17 ? 358 HIS A CA  1 
ATOM   513  C  C   . HIS A 1 72  ? 11.953  47.737 33.971 1.00 22.76 ? 358 HIS A C   1 
ATOM   514  O  O   . HIS A 1 72  ? 11.186  46.843 33.516 1.00 22.18 ? 358 HIS A O   1 
ATOM   515  C  CB  . HIS A 1 72  ? 13.983  46.194 33.765 1.00 24.23 ? 358 HIS A CB  1 
ATOM   516  C  CG  . HIS A 1 72  ? 15.405  46.142 33.295 1.00 23.97 ? 358 HIS A CG  1 
ATOM   517  N  ND1 . HIS A 1 72  ? 16.483  45.960 34.144 1.00 29.37 ? 358 HIS A ND1 1 
ATOM   518  C  CD2 . HIS A 1 72  ? 15.924  46.392 32.076 1.00 22.54 ? 358 HIS A CD2 1 
ATOM   519  C  CE1 . HIS A 1 72  ? 17.613  46.051 33.453 1.00 23.26 ? 358 HIS A CE1 1 
ATOM   520  N  NE2 . HIS A 1 72  ? 17.307  46.315 32.196 1.00 28.04 ? 358 HIS A NE2 1 
ATOM   521  N  N   . VAL A 1 73  ? 11.506  48.805 34.667 1.00 22.17 ? 359 VAL A N   1 
ATOM   522  C  CA  . VAL A 1 73  ? 10.082  49.113 34.731 1.00 21.37 ? 359 VAL A CA  1 
ATOM   523  C  C   . VAL A 1 73  ? 9.988   50.612 34.413 1.00 22.89 ? 359 VAL A C   1 
ATOM   524  O  O   . VAL A 1 73  ? 10.793  51.398 34.929 1.00 21.81 ? 359 VAL A O   1 
ATOM   525  C  CB  . VAL A 1 73  ? 9.439   48.832 36.132 1.00 23.56 ? 359 VAL A CB  1 
ATOM   526  C  CG1 . VAL A 1 73  ? 7.989   49.234 36.103 1.00 22.94 ? 359 VAL A CG1 1 
ATOM   527  C  CG2 . VAL A 1 73  ? 9.562   47.326 36.448 1.00 23.68 ? 359 VAL A CG2 1 
ATOM   528  N  N   . VAL A 1 74  ? 9.077   50.964 33.527 1.00 20.31 ? 360 VAL A N   1 
ATOM   529  C  CA  . VAL A 1 74  ? 8.872   52.379 33.143 1.00 23.40 ? 360 VAL A CA  1 
ATOM   530  C  C   . VAL A 1 74  ? 8.662   53.200 34.464 1.00 23.24 ? 360 VAL A C   1 
ATOM   531  O  O   . VAL A 1 74  ? 7.852   52.846 35.310 1.00 22.87 ? 360 VAL A O   1 
ATOM   532  C  CB  . VAL A 1 74  ? 7.640   52.493 32.244 1.00 24.68 ? 360 VAL A CB  1 
ATOM   533  C  CG1 . VAL A 1 74  ? 7.233   53.972 32.068 1.00 26.68 ? 360 VAL A CG1 1 
ATOM   534  C  CG2 . VAL A 1 74  ? 7.978   51.895 30.828 1.00 23.62 ? 360 VAL A CG2 1 
ATOM   535  N  N   . ARG A 1 75  ? 9.385   54.302 34.615 1.00 23.55 ? 361 ARG A N   1 
ATOM   536  C  CA  . ARG A 1 75  ? 9.243   55.095 35.867 1.00 23.20 ? 361 ARG A CA  1 
ATOM   537  C  C   . ARG A 1 75  ? 8.007   55.967 35.856 1.00 22.53 ? 361 ARG A C   1 
ATOM   538  O  O   . ARG A 1 75  ? 7.586   56.449 34.817 1.00 25.32 ? 361 ARG A O   1 
ATOM   539  C  CB  . ARG A 1 75  ? 10.447  56.047 36.013 1.00 23.97 ? 361 ARG A CB  1 
ATOM   540  C  CG  . ARG A 1 75  ? 11.543  55.587 36.980 1.00 32.19 ? 361 ARG A CG  1 
ATOM   541  C  CD  . ARG A 1 75  ? 12.601  54.756 36.381 1.00 35.87 ? 361 ARG A CD  1 
ATOM   542  N  NE  . ARG A 1 75  ? 13.721  54.488 37.300 1.00 42.71 ? 361 ARG A NE  1 
ATOM   543  C  CZ  . ARG A 1 75  ? 14.712  53.685 37.039 1.00 40.60 ? 361 ARG A CZ  1 
ATOM   544  N  NH1 . ARG A 1 75  ? 14.745  53.070 35.880 1.00 56.74 ? 361 ARG A NH1 1 
ATOM   545  N  NH2 . ARG A 1 75  ? 15.719  53.524 37.874 1.00 44.57 ? 361 ARG A NH2 1 
ATOM   546  N  N   . TYR A 1 76  ? 7.458   56.144 37.040 1.00 21.13 ? 362 TYR A N   1 
ATOM   547  C  CA  . TYR A 1 76  ? 6.307   56.994 37.239 1.00 20.87 ? 362 TYR A CA  1 
ATOM   548  C  C   . TYR A 1 76  ? 6.803   58.336 37.821 1.00 19.61 ? 362 TYR A C   1 
ATOM   549  O  O   . TYR A 1 76  ? 7.705   58.365 38.681 1.00 20.02 ? 362 TYR A O   1 
ATOM   550  C  CB  . TYR A 1 76  ? 5.473   56.297 38.295 1.00 22.63 ? 362 TYR A CB  1 
ATOM   551  C  CG  . TYR A 1 76  ? 4.459   57.123 39.059 1.00 20.90 ? 362 TYR A CG  1 
ATOM   552  C  CD1 . TYR A 1 76  ? 3.215   57.467 38.498 1.00 22.51 ? 362 TYR A CD1 1 
ATOM   553  C  CD2 . TYR A 1 76  ? 4.696   57.477 40.367 1.00 22.66 ? 362 TYR A CD2 1 
ATOM   554  C  CE1 . TYR A 1 76  ? 2.258   58.180 39.245 1.00 21.43 ? 362 TYR A CE1 1 
ATOM   555  C  CE2 . TYR A 1 76  ? 3.721   58.177 41.148 1.00 22.95 ? 362 TYR A CE2 1 
ATOM   556  C  CZ  . TYR A 1 76  ? 2.508   58.513 40.567 1.00 22.62 ? 362 TYR A CZ  1 
ATOM   557  O  OH  . TYR A 1 76  ? 1.614   59.190 41.357 1.00 21.15 ? 362 TYR A OH  1 
ATOM   558  N  N   . PHE A 1 77  ? 6.139   59.409 37.393 1.00 18.89 ? 363 PHE A N   1 
ATOM   559  C  CA  . PHE A 1 77  ? 6.384   60.743 37.873 1.00 17.20 ? 363 PHE A CA  1 
ATOM   560  C  C   . PHE A 1 77  ? 5.197   61.313 38.623 1.00 18.43 ? 363 PHE A C   1 
ATOM   561  O  O   . PHE A 1 77  ? 5.365   61.769 39.721 1.00 16.66 ? 363 PHE A O   1 
ATOM   562  C  CB  . PHE A 1 77  ? 6.839   61.685 36.724 1.00 18.37 ? 363 PHE A CB  1 
ATOM   563  C  CG  . PHE A 1 77  ? 8.209   61.353 36.229 1.00 18.50 ? 363 PHE A CG  1 
ATOM   564  C  CD1 . PHE A 1 77  ? 8.382   60.321 35.310 1.00 20.23 ? 363 PHE A CD1 1 
ATOM   565  C  CD2 . PHE A 1 77  ? 9.309   61.949 36.828 1.00 20.45 ? 363 PHE A CD2 1 
ATOM   566  C  CE1 . PHE A 1 77  ? 9.723   59.927 34.908 1.00 21.83 ? 363 PHE A CE1 1 
ATOM   567  C  CE2 . PHE A 1 77  ? 10.643  61.590 36.408 1.00 19.47 ? 363 PHE A CE2 1 
ATOM   568  C  CZ  . PHE A 1 77  ? 10.805  60.568 35.499 1.00 18.87 ? 363 PHE A CZ  1 
ATOM   569  N  N   . SER A 1 78  ? 3.985   61.284 38.045 1.00 19.10 ? 364 SER A N   1 
ATOM   570  C  CA  . SER A 1 78  ? 2.874   61.853 38.770 1.00 18.51 ? 364 SER A CA  1 
ATOM   571  C  C   . SER A 1 78  ? 1.571   61.352 38.180 1.00 18.49 ? 364 SER A C   1 
ATOM   572  O  O   . SER A 1 78  ? 1.534   60.719 37.123 1.00 19.96 ? 364 SER A O   1 
ATOM   573  C  CB  . SER A 1 78  ? 2.895   63.393 38.706 1.00 18.82 ? 364 SER A CB  1 
ATOM   574  O  OG  . SER A 1 78  ? 2.013   63.965 39.649 1.00 21.55 ? 364 SER A OG  1 
ATOM   575  N  N   . ALA A 1 79  ? 0.514   61.605 38.928 1.00 20.67 ? 365 ALA A N   1 
ATOM   576  C  CA  . ALA A 1 79  ? -0.844  61.270 38.432 1.00 20.73 ? 365 ALA A CA  1 
ATOM   577  C  C   . ALA A 1 79  ? -1.788  62.282 39.074 1.00 21.00 ? 365 ALA A C   1 
ATOM   578  O  O   . ALA A 1 79  ? -1.565  62.776 40.205 1.00 21.40 ? 365 ALA A O   1 
ATOM   579  C  CB  . ALA A 1 79  ? -1.206  59.884 38.827 1.00 20.37 ? 365 ALA A CB  1 
ATOM   580  N  N   . TRP A 1 80  ? -2.876  62.616 38.372 1.00 21.28 ? 366 TRP A N   1 
ATOM   581  C  CA  . TRP A 1 80  ? -3.826  63.574 38.921 1.00 21.50 ? 366 TRP A CA  1 
ATOM   582  C  C   . TRP A 1 80  ? -5.156  63.451 38.149 1.00 22.05 ? 366 TRP A C   1 
ATOM   583  O  O   . TRP A 1 80  ? -5.240  62.713 37.173 1.00 19.64 ? 366 TRP A O   1 
ATOM   584  C  CB  . TRP A 1 80  ? -3.299  65.006 38.823 1.00 21.99 ? 366 TRP A CB  1 
ATOM   585  C  CG  . TRP A 1 80  ? -3.095  65.541 37.389 1.00 22.14 ? 366 TRP A CG  1 
ATOM   586  C  CD1 . TRP A 1 80  ? -3.968  66.319 36.655 1.00 22.90 ? 366 TRP A CD1 1 
ATOM   587  C  CD2 . TRP A 1 80  ? -1.965  65.325 36.549 1.00 22.88 ? 366 TRP A CD2 1 
ATOM   588  N  NE1 . TRP A 1 80  ? -3.450  66.557 35.403 1.00 23.14 ? 366 TRP A NE1 1 
ATOM   589  C  CE2 . TRP A 1 80  ? -2.209  65.993 35.324 1.00 23.42 ? 366 TRP A CE2 1 
ATOM   590  C  CE3 . TRP A 1 80  ? -0.754  64.623 36.703 1.00 20.57 ? 366 TRP A CE3 1 
ATOM   591  C  CZ2 . TRP A 1 80  ? -1.300  65.979 34.268 1.00 22.80 ? 366 TRP A CZ2 1 
ATOM   592  C  CZ3 . TRP A 1 80  ? 0.164   64.617 35.654 1.00 23.09 ? 366 TRP A CZ3 1 
ATOM   593  C  CH2 . TRP A 1 80  ? -0.109  65.301 34.455 1.00 22.33 ? 366 TRP A CH2 1 
ATOM   594  N  N   . ALA A 1 81  ? -6.190  64.115 38.677 1.00 24.77 ? 367 ALA A N   1 
ATOM   595  C  CA  . ALA A 1 81  ? -7.483  64.101 38.001 1.00 26.12 ? 367 ALA A CA  1 
ATOM   596  C  C   . ALA A 1 81  ? -7.941  65.485 37.716 1.00 26.74 ? 367 ALA A C   1 
ATOM   597  O  O   . ALA A 1 81  ? -7.785  66.376 38.523 1.00 28.35 ? 367 ALA A O   1 
ATOM   598  C  CB  . ALA A 1 81  ? -8.503  63.397 38.815 1.00 25.25 ? 367 ALA A CB  1 
ATOM   599  N  N   . GLU A 1 82  ? -8.502  65.651 36.538 1.00 29.55 ? 368 GLU A N   1 
ATOM   600  C  CA  . GLU A 1 82  ? -9.074  66.925 36.163 1.00 32.16 ? 368 GLU A CA  1 
ATOM   601  C  C   . GLU A 1 82  ? -10.010 66.714 35.032 1.00 33.76 ? 368 GLU A C   1 
ATOM   602  O  O   . GLU A 1 82  ? -9.749  65.972 34.069 1.00 33.92 ? 368 GLU A O   1 
ATOM   603  C  CB  . GLU A 1 82  ? -8.047  67.970 35.794 1.00 31.83 ? 368 GLU A CB  1 
ATOM   604  C  CG  . GLU A 1 82  ? -7.056  67.519 34.760 1.00 33.84 ? 368 GLU A CG  1 
ATOM   605  C  CD  . GLU A 1 82  ? -5.991  68.568 34.553 1.00 34.95 ? 368 GLU A CD  1 
ATOM   606  O  OE1 . GLU A 1 82  ? -5.065  68.293 33.744 1.00 26.26 ? 368 GLU A OE1 1 
ATOM   607  O  OE2 . GLU A 1 82  ? -6.114  69.655 35.227 1.00 36.01 ? 368 GLU A OE2 1 
ATOM   608  N  N   . ASP A 1 83  ? -11.132 67.383 35.185 1.00 35.71 ? 369 ASP A N   1 
ATOM   609  C  CA  . ASP A 1 83  ? -12.170 67.296 34.207 1.00 38.20 ? 369 ASP A CA  1 
ATOM   610  C  C   . ASP A 1 83  ? -12.837 65.991 34.375 1.00 37.17 ? 369 ASP A C   1 
ATOM   611  O  O   . ASP A 1 83  ? -13.331 65.641 35.455 1.00 37.90 ? 369 ASP A O   1 
ATOM   612  C  CB  . ASP A 1 83  ? -11.591 67.461 32.792 1.00 38.08 ? 369 ASP A CB  1 
ATOM   613  C  CG  . ASP A 1 83  ? -11.487 68.951 32.400 1.00 45.22 ? 369 ASP A CG  1 
ATOM   614  O  OD1 . ASP A 1 83  ? -11.313 69.822 33.309 1.00 48.91 ? 369 ASP A OD1 1 
ATOM   615  O  OD2 . ASP A 1 83  ? -11.642 69.369 31.225 1.00 52.44 ? 369 ASP A OD2 1 
ATOM   616  N  N   . ASP A 1 84  ? -12.836 65.268 33.290 1.00 36.53 ? 370 ASP A N   1 
ATOM   617  C  CA  . ASP A 1 84  ? -13.553 64.047 33.283 1.00 35.97 ? 370 ASP A CA  1 
ATOM   618  C  C   . ASP A 1 84  ? -12.486 63.104 33.063 1.00 32.57 ? 370 ASP A C   1 
ATOM   619  O  O   . ASP A 1 84  ? -12.778 62.013 32.608 1.00 32.02 ? 370 ASP A O   1 
ATOM   620  C  CB  . ASP A 1 84  ? -14.561 63.996 32.095 1.00 37.24 ? 370 ASP A CB  1 
ATOM   621  C  CG  . ASP A 1 84  ? -14.927 62.543 31.678 1.00 41.50 ? 370 ASP A CG  1 
ATOM   622  O  OD1 . ASP A 1 84  ? -14.238 61.934 30.804 1.00 45.13 ? 370 ASP A OD1 1 
ATOM   623  O  OD2 . ASP A 1 84  ? -15.889 61.929 32.195 1.00 46.63 ? 370 ASP A OD2 1 
ATOM   624  N  N   . HIS A 1 85  ? -11.241 63.506 33.405 1.00 30.75 ? 371 HIS A N   1 
ATOM   625  C  CA  . HIS A 1 85  ? -10.099 62.665 33.131 1.00 29.17 ? 371 HIS A CA  1 
ATOM   626  C  C   . HIS A 1 85  ? -9.188  62.378 34.326 1.00 26.49 ? 371 HIS A C   1 
ATOM   627  O  O   . HIS A 1 85  ? -9.093  63.176 35.266 1.00 25.25 ? 371 HIS A O   1 
ATOM   628  C  CB  . HIS A 1 85  ? -9.213  63.326 32.082 1.00 30.58 ? 371 HIS A CB  1 
ATOM   629  C  CG  . HIS A 1 85  ? -9.942  63.638 30.828 1.00 34.83 ? 371 HIS A CG  1 
ATOM   630  N  ND1 . HIS A 1 85  ? -10.423 64.902 30.550 1.00 37.79 ? 371 HIS A ND1 1 
ATOM   631  C  CD2 . HIS A 1 85  ? -10.344 62.841 29.808 1.00 37.76 ? 371 HIS A CD2 1 
ATOM   632  C  CE1 . HIS A 1 85  ? -11.051 64.882 29.385 1.00 39.71 ? 371 HIS A CE1 1 
ATOM   633  N  NE2 . HIS A 1 85  ? -11.041 63.640 28.926 1.00 39.56 ? 371 HIS A NE2 1 
ATOM   634  N  N   . MET A 1 86  ? -8.561  61.215 34.233 1.00 26.53 ? 372 MET A N   1 
ATOM   635  C  CA  . MET A 1 86  ? -7.437  60.859 35.080 1.00 25.56 ? 372 MET A CA  1 
ATOM   636  C  C   . MET A 1 86  ? -6.186  60.887 34.175 1.00 22.72 ? 372 MET A C   1 
ATOM   637  O  O   . MET A 1 86  ? -6.212  60.436 33.010 1.00 23.80 ? 372 MET A O   1 
ATOM   638  C  CB  . MET A 1 86  ? -7.617  59.441 35.660 1.00 27.75 ? 372 MET A CB  1 
ATOM   639  C  CG  . MET A 1 86  ? -7.352  59.385 37.201 1.00 37.41 ? 372 MET A CG  1 
ATOM   640  S  SD  . MET A 1 86  ? -7.249  57.701 37.791 1.00 50.08 ? 372 MET A SD  1 
ATOM   641  C  CE  . MET A 1 86  ? -8.824  57.211 36.994 1.00 31.01 ? 372 MET A CE  1 
ATOM   642  N  N   . LEU A 1 87  ? -5.067  61.355 34.701 1.00 19.98 ? 373 LEU A N   1 
ATOM   643  C  CA  . LEU A 1 87  ? -3.835  61.382 33.913 1.00 18.77 ? 373 LEU A CA  1 
ATOM   644  C  C   . LEU A 1 87  ? -2.719  60.715 34.731 1.00 19.67 ? 373 LEU A C   1 
ATOM   645  O  O   . LEU A 1 87  ? -2.716  60.845 35.924 1.00 18.38 ? 373 LEU A O   1 
ATOM   646  C  CB  . LEU A 1 87  ? -3.468  62.823 33.678 1.00 20.19 ? 373 LEU A CB  1 
ATOM   647  C  CG  . LEU A 1 87  ? -4.455  63.462 32.654 1.00 22.55 ? 373 LEU A CG  1 
ATOM   648  C  CD1 . LEU A 1 87  ? -5.689  64.025 33.375 1.00 21.38 ? 373 LEU A CD1 1 
ATOM   649  C  CD2 . LEU A 1 87  ? -3.738  64.506 31.808 1.00 27.69 ? 373 LEU A CD2 1 
ATOM   650  N  N   . ILE A 1 88  ? -1.796  60.054 34.039 1.00 20.01 ? 374 ILE A N   1 
ATOM   651  C  CA  . ILE A 1 88  ? -0.593  59.433 34.642 1.00 21.17 ? 374 ILE A CA  1 
ATOM   652  C  C   . ILE A 1 88  ? 0.574   59.873 33.743 1.00 20.90 ? 374 ILE A C   1 
ATOM   653  O  O   . ILE A 1 88  ? 0.528   59.732 32.502 1.00 21.05 ? 374 ILE A O   1 
ATOM   654  C  CB  . ILE A 1 88  ? -0.752  57.910 34.755 1.00 22.51 ? 374 ILE A CB  1 
ATOM   655  C  CG1 . ILE A 1 88  ? 0.550   57.209 35.232 1.00 24.00 ? 374 ILE A CG1 1 
ATOM   656  C  CG2 . ILE A 1 88  ? -1.143  57.279 33.428 1.00 31.40 ? 374 ILE A CG2 1 
ATOM   657  C  CD1 . ILE A 1 88  ? 0.525   56.935 36.638 1.00 34.67 ? 374 ILE A CD1 1 
ATOM   658  N  N   . GLN A 1 89  ? 1.595   60.424 34.385 1.00 19.52 ? 375 GLN A N   1 
ATOM   659  C  CA  . GLN A 1 89  ? 2.768   60.934 33.696 1.00 18.45 ? 375 GLN A CA  1 
ATOM   660  C  C   . GLN A 1 89  ? 3.921   59.991 34.013 1.00 19.37 ? 375 GLN A C   1 
ATOM   661  O  O   . GLN A 1 89  ? 4.333   59.864 35.185 1.00 18.28 ? 375 GLN A O   1 
ATOM   662  C  CB  . GLN A 1 89  ? 3.028   62.349 34.215 1.00 19.70 ? 375 GLN A CB  1 
ATOM   663  C  CG  . GLN A 1 89  ? 4.410   62.902 33.757 1.00 17.98 ? 375 GLN A CG  1 
ATOM   664  C  CD  . GLN A 1 89  ? 4.891   64.025 34.673 1.00 18.30 ? 375 GLN A CD  1 
ATOM   665  O  OE1 . GLN A 1 89  ? 4.201   64.486 35.609 1.00 21.06 ? 375 GLN A OE1 1 
ATOM   666  N  NE2 . GLN A 1 89  ? 6.114   64.474 34.404 1.00 16.70 ? 375 GLN A NE2 1 
ATOM   667  N  N   . ASN A 1 90  ? 4.399   59.318 32.974 1.00 19.34 ? 376 ASN A N   1 
ATOM   668  C  CA  . ASN A 1 90  ? 5.490   58.355 33.101 1.00 19.11 ? 376 ASN A CA  1 
ATOM   669  C  C   . ASN A 1 90  ? 6.723   58.740 32.264 1.00 19.63 ? 376 ASN A C   1 
ATOM   670  O  O   . ASN A 1 90  ? 6.692   59.639 31.367 1.00 19.25 ? 376 ASN A O   1 
ATOM   671  C  CB  . ASN A 1 90  ? 5.000   57.019 32.594 1.00 20.23 ? 376 ASN A CB  1 
ATOM   672  C  CG  . ASN A 1 90  ? 4.005   56.323 33.589 1.00 20.67 ? 376 ASN A CG  1 
ATOM   673  O  OD1 . ASN A 1 90  ? 3.937   56.665 34.777 1.00 22.16 ? 376 ASN A OD1 1 
ATOM   674  N  ND2 . ASN A 1 90  ? 3.217   55.404 33.062 1.00 23.88 ? 376 ASN A ND2 1 
ATOM   675  N  N   . GLU A 1 91  ? 7.821   58.050 32.567 1.00 21.59 ? 377 GLU A N   1 
ATOM   676  C  CA  . GLU A 1 91  ? 9.019   58.122 31.721 1.00 21.81 ? 377 GLU A CA  1 
ATOM   677  C  C   . GLU A 1 91  ? 8.682   57.843 30.250 1.00 22.33 ? 377 GLU A C   1 
ATOM   678  O  O   . GLU A 1 91  ? 7.861   56.932 29.906 1.00 21.13 ? 377 GLU A O   1 
ATOM   679  C  CB  . GLU A 1 91  ? 9.985   57.017 32.241 1.00 22.35 ? 377 GLU A CB  1 
ATOM   680  C  CG  . GLU A 1 91  ? 11.148  56.674 31.305 1.00 26.99 ? 377 GLU A CG  1 
ATOM   681  C  CD  . GLU A 1 91  ? 12.028  55.569 31.926 1.00 31.42 ? 377 GLU A CD  1 
ATOM   682  O  OE1 . GLU A 1 91  ? 11.578  54.861 32.851 1.00 24.70 ? 377 GLU A OE1 1 
ATOM   683  O  OE2 . GLU A 1 91  ? 13.188  55.421 31.536 1.00 30.95 ? 377 GLU A OE2 1 
ATOM   684  N  N   . TYR A 1 92  ? 9.293   58.615 29.343 1.00 21.04 ? 378 TYR A N   1 
ATOM   685  C  CA  . TYR A 1 92  ? 9.078   58.379 27.936 1.00 21.52 ? 378 TYR A CA  1 
ATOM   686  C  C   . TYR A 1 92  ? 10.229  57.538 27.402 1.00 22.89 ? 378 TYR A C   1 
ATOM   687  O  O   . TYR A 1 92  ? 11.399  57.866 27.651 1.00 23.02 ? 378 TYR A O   1 
ATOM   688  C  CB  . TYR A 1 92  ? 9.088   59.718 27.199 1.00 22.48 ? 378 TYR A CB  1 
ATOM   689  C  CG  . TYR A 1 92  ? 9.086   59.535 25.673 1.00 20.03 ? 378 TYR A CG  1 
ATOM   690  C  CD1 . TYR A 1 92  ? 7.981   59.002 25.009 1.00 23.55 ? 378 TYR A CD1 1 
ATOM   691  C  CD2 . TYR A 1 92  ? 10.174  59.934 24.909 1.00 22.49 ? 378 TYR A CD2 1 
ATOM   692  C  CE1 . TYR A 1 92  ? 7.977   58.869 23.583 1.00 24.93 ? 378 TYR A CE1 1 
ATOM   693  C  CE2 . TYR A 1 92  ? 10.193  59.818 23.501 1.00 25.11 ? 378 TYR A CE2 1 
ATOM   694  C  CZ  . TYR A 1 92  ? 9.104   59.265 22.850 1.00 24.17 ? 378 TYR A CZ  1 
ATOM   695  O  OH  . TYR A 1 92  ? 9.129   59.164 21.454 1.00 24.76 ? 378 TYR A OH  1 
ATOM   696  N  N   . CYS A 1 93  ? 9.925   56.475 26.657 1.00 23.17 ? 379 CYS A N   1 
ATOM   697  C  CA  . CYS A 1 93  ? 10.965  55.594 26.072 1.00 23.12 ? 379 CYS A CA  1 
ATOM   698  C  C   . CYS A 1 93  ? 11.050  55.868 24.581 1.00 23.21 ? 379 CYS A C   1 
ATOM   699  O  O   . CYS A 1 93  ? 10.112  55.617 23.827 1.00 23.41 ? 379 CYS A O   1 
ATOM   700  C  CB  . CYS A 1 93  ? 10.569  54.124 26.311 1.00 22.00 ? 379 CYS A CB  1 
ATOM   701  S  SG  . CYS A 1 93  ? 10.457  53.733 28.104 1.00 26.95 ? 379 CYS A SG  1 
ATOM   702  N  N   . ASN A 1 94  ? 12.183  56.418 24.140 1.00 23.00 ? 380 ASN A N   1 
ATOM   703  C  CA  . ASN A 1 94  ? 12.229  56.943 22.767 1.00 23.83 ? 380 ASN A CA  1 
ATOM   704  C  C   . ASN A 1 94  ? 12.468  55.899 21.707 1.00 24.73 ? 380 ASN A C   1 
ATOM   705  O  O   . ASN A 1 94  ? 12.424  56.197 20.526 1.00 24.91 ? 380 ASN A O   1 
ATOM   706  C  CB  . ASN A 1 94  ? 13.234  58.044 22.663 1.00 28.60 ? 380 ASN A CB  1 
ATOM   707  C  CG  . ASN A 1 94  ? 14.564  57.569 22.539 1.00 33.59 ? 380 ASN A CG  1 
ATOM   708  O  OD1 . ASN A 1 94  ? 14.858  56.459 22.992 1.00 39.87 ? 380 ASN A OD1 1 
ATOM   709  N  ND2 . ASN A 1 94  ? 15.465  58.396 21.824 1.00 34.71 ? 380 ASN A ND2 1 
ATOM   710  N  N   . GLY A 1 95  ? 12.595  54.649 22.153 1.00 23.24 ? 381 GLY A N   1 
ATOM   711  C  CA  . GLY A 1 95  ? 12.803  53.556 21.187 1.00 24.91 ? 381 GLY A CA  1 
ATOM   712  C  C   . GLY A 1 95  ? 11.543  52.861 20.743 1.00 25.79 ? 381 GLY A C   1 
ATOM   713  O  O   . GLY A 1 95  ? 11.597  51.889 19.933 1.00 24.89 ? 381 GLY A O   1 
ATOM   714  N  N   . GLY A 1 96  ? 10.402  53.259 21.305 1.00 24.69 ? 382 GLY A N   1 
ATOM   715  C  CA  . GLY A 1 96  ? 9.114   52.709 20.882 1.00 25.25 ? 382 GLY A CA  1 
ATOM   716  C  C   . GLY A 1 96  ? 8.807   51.381 21.574 1.00 22.91 ? 382 GLY A C   1 
ATOM   717  O  O   . GLY A 1 96  ? 9.501   51.003 22.513 1.00 23.26 ? 382 GLY A O   1 
ATOM   718  N  N   . SER A 1 97  ? 7.769   50.673 21.098 1.00 23.97 ? 383 SER A N   1 
ATOM   719  C  CA  . SER A 1 97  ? 7.428   49.416 21.767 1.00 22.43 ? 383 SER A CA  1 
ATOM   720  C  C   . SER A 1 97  ? 8.195   48.217 21.156 1.00 21.29 ? 383 SER A C   1 
ATOM   721  O  O   . SER A 1 97  ? 8.624   48.248 19.978 1.00 20.91 ? 383 SER A O   1 
ATOM   722  C  CB  . SER A 1 97  ? 5.936   49.148 21.658 1.00 21.08 ? 383 SER A CB  1 
ATOM   723  O  OG  . SER A 1 97  ? 5.614   48.948 20.271 1.00 24.81 ? 383 SER A OG  1 
ATOM   724  N  N   . LEU A 1 98  ? 8.343   47.168 21.954 1.00 20.78 ? 384 LEU A N   1 
ATOM   725  C  CA  . LEU A 1 98  ? 8.894   45.915 21.395 1.00 21.89 ? 384 LEU A CA  1 
ATOM   726  C  C   . LEU A 1 98  ? 8.028   45.406 20.236 1.00 22.00 ? 384 LEU A C   1 
ATOM   727  O  O   . LEU A 1 98  ? 8.534   44.861 19.219 1.00 22.55 ? 384 LEU A O   1 
ATOM   728  C  CB  . LEU A 1 98  ? 9.083   44.873 22.503 1.00 21.65 ? 384 LEU A CB  1 
ATOM   729  C  CG  . LEU A 1 98  ? 9.526   43.472 22.024 1.00 23.02 ? 384 LEU A CG  1 
ATOM   730  C  CD1 . LEU A 1 98  ? 10.944  43.536 21.447 1.00 21.82 ? 384 LEU A CD1 1 
ATOM   731  C  CD2 . LEU A 1 98  ? 9.474   42.503 23.237 1.00 23.76 ? 384 LEU A CD2 1 
ATOM   732  N  N   . ALA A 1 99  ? 6.720   45.554 20.369 1.00 20.79 ? 385 ALA A N   1 
ATOM   733  C  CA  . ALA A 1 99  ? 5.817   45.153 19.294 1.00 22.25 ? 385 ALA A CA  1 
ATOM   734  C  C   . ALA A 1 99  ? 6.181   45.790 17.963 1.00 20.54 ? 385 ALA A C   1 
ATOM   735  O  O   . ALA A 1 99  ? 6.141   45.153 16.901 1.00 19.75 ? 385 ALA A O   1 
ATOM   736  C  CB  . ALA A 1 99  ? 4.335   45.534 19.704 1.00 23.55 ? 385 ALA A CB  1 
ATOM   737  N  N   . ASP A 1 100 ? 6.443   47.088 17.973 1.00 20.44 ? 386 ASP A N   1 
ATOM   738  C  CA  . ASP A 1 100 ? 6.800   47.750 16.746 1.00 21.46 ? 386 ASP A CA  1 
ATOM   739  C  C   . ASP A 1 100 ? 8.145   47.278 16.178 1.00 21.59 ? 386 ASP A C   1 
ATOM   740  O  O   . ASP A 1 100 ? 8.313   47.195 14.937 1.00 21.98 ? 386 ASP A O   1 
ATOM   741  C  CB  . ASP A 1 100 ? 6.800   49.246 16.966 1.00 24.06 ? 386 ASP A CB  1 
ATOM   742  C  CG  . ASP A 1 100 ? 5.325   49.826 16.954 1.00 30.00 ? 386 ASP A CG  1 
ATOM   743  O  OD1 . ASP A 1 100 ? 5.132   51.041 17.186 1.00 33.95 ? 386 ASP A OD1 1 
ATOM   744  O  OD2 . ASP A 1 100 ? 4.326   49.110 16.708 1.00 34.45 ? 386 ASP A OD2 1 
ATOM   745  N  N   . ALA A 1 101 ? 9.098   46.992 17.066 1.00 20.63 ? 387 ALA A N   1 
ATOM   746  C  CA  . ALA A 1 101 ? 10.408  46.488 16.584 1.00 20.41 ? 387 ALA A CA  1 
ATOM   747  C  C   . ALA A 1 101 ? 10.176  45.115 15.939 1.00 20.94 ? 387 ALA A C   1 
ATOM   748  O  O   . ALA A 1 101 ? 10.745  44.832 14.875 1.00 20.30 ? 387 ALA A O   1 
ATOM   749  C  CB  . ALA A 1 101 ? 11.325  46.297 17.737 1.00 21.24 ? 387 ALA A CB  1 
ATOM   750  N  N   . ILE A 1 102 ? 9.330   44.312 16.570 1.00 20.17 ? 388 ILE A N   1 
ATOM   751  C  CA  . ILE A 1 102 ? 9.064   42.939 16.039 1.00 20.07 ? 388 ILE A CA  1 
ATOM   752  C  C   . ILE A 1 102 ? 8.350   43.035 14.701 1.00 20.21 ? 388 ILE A C   1 
ATOM   753  O  O   . ILE A 1 102 ? 8.660   42.280 13.756 1.00 18.75 ? 388 ILE A O   1 
ATOM   754  C  CB  . ILE A 1 102 ? 8.232   42.147 17.084 1.00 20.52 ? 388 ILE A CB  1 
ATOM   755  C  CG1 . ILE A 1 102 ? 9.129   41.811 18.279 1.00 20.10 ? 388 ILE A CG1 1 
ATOM   756  C  CG2 . ILE A 1 102 ? 7.614   40.800 16.435 1.00 22.91 ? 388 ILE A CG2 1 
ATOM   757  C  CD1 . ILE A 1 102 ? 8.343   41.159 19.472 1.00 22.51 ? 388 ILE A CD1 1 
ATOM   758  N  N   . SER A 1 103 ? 7.382   43.960 14.572 1.00 19.99 ? 389 SER A N   1 
ATOM   759  C  CA  . SER A 1 103 ? 6.656   44.108 13.300 1.00 22.59 ? 389 SER A CA  1 
ATOM   760  C  C   . SER A 1 103 ? 7.651   44.530 12.142 1.00 20.83 ? 389 SER A C   1 
ATOM   761  O  O   . SER A 1 103 ? 7.593   44.029 11.013 1.00 21.62 ? 389 SER A O   1 
ATOM   762  C  CB  . SER A 1 103 ? 5.472   45.117 13.520 1.00 22.85 ? 389 SER A CB  1 
ATOM   763  O  OG  . SER A 1 103 ? 4.934   45.401 12.235 1.00 32.46 ? 389 SER A OG  1 
ATOM   764  N  N   . GLU A 1 104 ? 8.580   45.449 12.434 1.00 19.37 ? 390 GLU A N   1 
ATOM   765  C  CA  . GLU A 1 104 ? 9.538   45.876 11.444 1.00 20.95 ? 390 GLU A CA  1 
ATOM   766  C  C   . GLU A 1 104 ? 10.442  44.676 11.060 1.00 19.47 ? 390 GLU A C   1 
ATOM   767  O  O   . GLU A 1 104 ? 10.674  44.460 9.871  1.00 20.04 ? 390 GLU A O   1 
ATOM   768  C  CB  . GLU A 1 104 ? 10.422  46.987 11.999 1.00 22.04 ? 390 GLU A CB  1 
ATOM   769  C  CG  . GLU A 1 104 ? 11.470  47.466 10.972 1.00 29.29 ? 390 GLU A CG  1 
ATOM   770  C  CD  . GLU A 1 104 ? 12.164  48.770 11.419 1.00 42.87 ? 390 GLU A CD  1 
ATOM   771  O  OE1 . GLU A 1 104 ? 13.143  48.695 12.200 1.00 46.33 ? 390 GLU A OE1 1 
ATOM   772  O  OE2 . GLU A 1 104 ? 11.748  49.881 10.984 1.00 50.83 ? 390 GLU A OE2 1 
ATOM   773  N  N   . ASN A 1 105 ? 10.925  43.970 12.065 1.00 18.98 ? 391 ASN A N   1 
ATOM   774  C  CA  . ASN A 1 105 ? 11.754  42.784 11.835 1.00 18.88 ? 391 ASN A CA  1 
ATOM   775  C  C   . ASN A 1 105 ? 11.026  41.750 10.970 1.00 18.94 ? 391 ASN A C   1 
ATOM   776  O  O   . ASN A 1 105 ? 11.618  41.132 10.075 1.00 18.32 ? 391 ASN A O   1 
ATOM   777  C  CB  . ASN A 1 105 ? 12.089  42.116 13.130 1.00 17.41 ? 391 ASN A CB  1 
ATOM   778  C  CG  . ASN A 1 105 ? 13.161  42.871 13.914 1.00 23.04 ? 391 ASN A CG  1 
ATOM   779  O  OD1 . ASN A 1 105 ? 13.674  43.875 13.442 1.00 22.38 ? 391 ASN A OD1 1 
ATOM   780  N  ND2 . ASN A 1 105 ? 13.473  42.399 15.103 1.00 22.32 ? 391 ASN A ND2 1 
ATOM   781  N  N   . TYR A 1 106 ? 9.751   41.548 11.283 1.00 18.46 ? 392 TYR A N   1 
ATOM   782  C  CA  . TYR A 1 106 ? 8.952   40.595 10.488 1.00 19.45 ? 392 TYR A CA  1 
ATOM   783  C  C   . TYR A 1 106 ? 8.994   40.915 9.022  1.00 20.31 ? 392 TYR A C   1 
ATOM   784  O  O   . TYR A 1 106 ? 9.183   40.021 8.183  1.00 20.60 ? 392 TYR A O   1 
ATOM   785  C  CB  . TYR A 1 106 ? 7.494   40.621 10.982 1.00 20.03 ? 392 TYR A CB  1 
ATOM   786  C  CG  . TYR A 1 106 ? 6.637   39.486 10.408 1.00 21.68 ? 392 TYR A CG  1 
ATOM   787  C  CD1 . TYR A 1 106 ? 6.629   38.210 11.004 1.00 20.04 ? 392 TYR A CD1 1 
ATOM   788  C  CD2 . TYR A 1 106 ? 5.878   39.683 9.272  1.00 23.08 ? 392 TYR A CD2 1 
ATOM   789  C  CE1 . TYR A 1 106 ? 5.828   37.176 10.454 1.00 20.84 ? 392 TYR A CE1 1 
ATOM   790  C  CE2 . TYR A 1 106 ? 5.085   38.634 8.722  1.00 21.60 ? 392 TYR A CE2 1 
ATOM   791  C  CZ  . TYR A 1 106 ? 5.074   37.411 9.334  1.00 20.20 ? 392 TYR A CZ  1 
ATOM   792  O  OH  . TYR A 1 106 ? 4.307   36.361 8.781  1.00 20.56 ? 392 TYR A OH  1 
ATOM   793  N  N   . ARG A 1 107 ? 8.862   42.192 8.661  1.00 19.86 ? 393 ARG A N   1 
ATOM   794  C  CA  . ARG A 1 107 ? 8.745   42.561 7.290  1.00 22.82 ? 393 ARG A CA  1 
ATOM   795  C  C   . ARG A 1 107 ? 10.101  42.422 6.592  1.00 23.12 ? 393 ARG A C   1 
ATOM   796  O  O   . ARG A 1 107 ? 10.140  42.210 5.396  1.00 22.02 ? 393 ARG A O   1 
ATOM   797  C  CB  . ARG A 1 107 ? 8.359   44.025 7.218  1.00 25.17 ? 393 ARG A CB  1 
ATOM   798  C  CG  . ARG A 1 107 ? 8.065   44.579 5.847  1.00 31.31 ? 393 ARG A CG  1 
ATOM   799  C  CD  . ARG A 1 107 ? 8.582   45.980 5.549  1.00 39.54 ? 393 ARG A CD  1 
ATOM   800  N  NE  . ARG A 1 107 ? 8.186   46.998 6.506  1.00 45.81 ? 393 ARG A NE  1 
ATOM   801  C  CZ  . ARG A 1 107 ? 7.021   47.023 7.170  1.00 50.55 ? 393 ARG A CZ  1 
ATOM   802  N  NH1 . ARG A 1 107 ? 6.087   46.085 6.993  1.00 48.66 ? 393 ARG A NH1 1 
ATOM   803  N  NH2 . ARG A 1 107 ? 6.797   48.000 8.035  1.00 52.62 ? 393 ARG A NH2 1 
ATOM   804  N  N   . ILE A 1 108 ? 11.183  42.584 7.351  1.00 20.67 ? 394 ILE A N   1 
ATOM   805  C  CA  . ILE A 1 108 ? 12.538  42.620 6.774  1.00 22.46 ? 394 ILE A CA  1 
ATOM   806  C  C   . ILE A 1 108 ? 13.223  41.252 6.853  1.00 19.93 ? 394 ILE A C   1 
ATOM   807  O  O   . ILE A 1 108 ? 14.273  41.057 6.240  1.00 20.05 ? 394 ILE A O   1 
ATOM   808  C  CB  . ILE A 1 108 ? 13.328  43.660 7.592  1.00 26.24 ? 394 ILE A CB  1 
ATOM   809  C  CG1 . ILE A 1 108 ? 13.341  44.996 6.882  1.00 28.86 ? 394 ILE A CG1 1 
ATOM   810  C  CG2 . ILE A 1 108 ? 14.708  43.120 7.986  1.00 33.75 ? 394 ILE A CG2 1 
ATOM   811  C  CD1 . ILE A 1 108 ? 12.039  45.634 6.863  1.00 33.42 ? 394 ILE A CD1 1 
ATOM   812  N  N   . MET A 1 109 ? 12.550  40.299 7.471  1.00 18.29 ? 395 MET A N   1 
ATOM   813  C  CA  . MET A 1 109 ? 13.048  38.915 7.647  1.00 19.20 ? 395 MET A CA  1 
ATOM   814  C  C   . MET A 1 109 ? 14.386  38.856 8.425  1.00 20.73 ? 395 MET A C   1 
ATOM   815  O  O   . MET A 1 109 ? 15.251  38.014 8.120  1.00 20.71 ? 395 MET A O   1 
ATOM   816  C  CB  . MET A 1 109 ? 13.161  38.209 6.272  1.00 18.02 ? 395 MET A CB  1 
ATOM   817  C  CG  . MET A 1 109 ? 11.821  37.777 5.803  1.00 18.89 ? 395 MET A CG  1 
ATOM   818  S  SD  . MET A 1 109 ? 11.726  37.179 4.132  1.00 21.67 ? 395 MET A SD  1 
ATOM   819  C  CE  . MET A 1 109 ? 12.849  35.699 4.177  1.00 20.25 ? 395 MET A CE  1 
ATOM   820  N  N   . SER A 1 110 ? 14.528  39.747 9.417  1.00 19.96 ? 396 SER A N   1 
ATOM   821  C  CA  . SER A 1 110 ? 15.758  39.779 10.200 1.00 21.48 ? 396 SER A CA  1 
ATOM   822  C  C   . SER A 1 110 ? 15.290  39.968 11.647 1.00 21.00 ? 396 SER A C   1 
ATOM   823  O  O   . SER A 1 110 ? 14.811  41.034 11.989 1.00 20.06 ? 396 SER A O   1 
ATOM   824  C  CB  . SER A 1 110 ? 16.625  40.945 9.717  1.00 23.61 ? 396 SER A CB  1 
ATOM   825  O  OG  . SER A 1 110 ? 17.802  40.971 10.484 1.00 27.33 ? 396 SER A OG  1 
ATOM   826  N  N   . TYR A 1 111 ? 15.390  38.930 12.466 1.00 19.98 ? 397 TYR A N   1 
ATOM   827  C  CA  . TYR A 1 111 ? 14.742  38.899 13.800 1.00 20.63 ? 397 TYR A CA  1 
ATOM   828  C  C   . TYR A 1 111 ? 15.791  39.199 14.904 1.00 21.66 ? 397 TYR A C   1 
ATOM   829  O  O   . TYR A 1 111 ? 16.985  39.423 14.590 1.00 22.61 ? 397 TYR A O   1 
ATOM   830  C  CB  . TYR A 1 111 ? 14.082  37.510 14.022 1.00 21.86 ? 397 TYR A CB  1 
ATOM   831  C  CG  . TYR A 1 111 ? 13.373  37.093 12.730 1.00 20.77 ? 397 TYR A CG  1 
ATOM   832  C  CD1 . TYR A 1 111 ? 13.804  36.008 11.995 1.00 21.74 ? 397 TYR A CD1 1 
ATOM   833  C  CD2 . TYR A 1 111 ? 12.320  37.865 12.221 1.00 20.10 ? 397 TYR A CD2 1 
ATOM   834  C  CE1 . TYR A 1 111 ? 13.205  35.663 10.725 1.00 20.61 ? 397 TYR A CE1 1 
ATOM   835  C  CE2 . TYR A 1 111 ? 11.684  37.486 10.976 1.00 19.44 ? 397 TYR A CE2 1 
ATOM   836  C  CZ  . TYR A 1 111 ? 12.132  36.419 10.271 1.00 21.29 ? 397 TYR A CZ  1 
ATOM   837  O  OH  . TYR A 1 111 ? 11.494  36.127 9.085  1.00 18.13 ? 397 TYR A OH  1 
ATOM   838  N  N   . PHE A 1 112 ? 15.378  39.142 16.153 1.00 22.60 ? 398 PHE A N   1 
ATOM   839  C  CA  . PHE A 1 112 ? 16.338  39.251 17.260 1.00 22.96 ? 398 PHE A CA  1 
ATOM   840  C  C   . PHE A 1 112 ? 17.163  37.968 17.226 1.00 22.92 ? 398 PHE A C   1 
ATOM   841  O  O   . PHE A 1 112 ? 16.587  36.890 17.220 1.00 24.39 ? 398 PHE A O   1 
ATOM   842  C  CB  . PHE A 1 112 ? 15.602  39.249 18.581 1.00 21.76 ? 398 PHE A CB  1 
ATOM   843  C  CG  . PHE A 1 112 ? 15.016  40.580 18.975 1.00 25.94 ? 398 PHE A CG  1 
ATOM   844  C  CD1 . PHE A 1 112 ? 14.023  41.195 18.227 1.00 27.12 ? 398 PHE A CD1 1 
ATOM   845  C  CD2 . PHE A 1 112 ? 15.344  41.123 20.219 1.00 36.06 ? 398 PHE A CD2 1 
ATOM   846  C  CE1 . PHE A 1 112 ? 13.483  42.442 18.612 1.00 29.24 ? 398 PHE A CE1 1 
ATOM   847  C  CE2 . PHE A 1 112 ? 14.754  42.321 20.648 1.00 34.79 ? 398 PHE A CE2 1 
ATOM   848  C  CZ  . PHE A 1 112 ? 13.861  42.993 19.812 1.00 36.53 ? 398 PHE A CZ  1 
ATOM   849  N  N   . LYS A 1 113 ? 18.483  38.080 17.287 1.00 20.99 ? 399 LYS A N   1 
ATOM   850  C  CA  . LYS A 1 113 ? 19.336  36.884 17.277 1.00 22.70 ? 399 LYS A CA  1 
ATOM   851  C  C   . LYS A 1 113 ? 19.460  36.308 18.688 1.00 21.57 ? 399 LYS A C   1 
ATOM   852  O  O   . LYS A 1 113 ? 19.017  36.949 19.626 1.00 20.55 ? 399 LYS A O   1 
ATOM   853  C  CB  . LYS A 1 113 ? 20.725  37.279 16.785 1.00 23.26 ? 399 LYS A CB  1 
ATOM   854  C  CG  . LYS A 1 113 ? 20.779  37.559 15.277 1.00 28.51 ? 399 LYS A CG  1 
ATOM   855  C  CD  . LYS A 1 113 ? 20.619  39.068 14.993 1.00 35.72 ? 399 LYS A CD  1 
ATOM   856  C  CE  . LYS A 1 113 ? 19.939  39.325 13.591 1.00 41.40 ? 399 LYS A CE  1 
ATOM   857  N  NZ  . LYS A 1 113 ? 19.955  38.102 12.769 1.00 40.80 ? 399 LYS A NZ  1 
ATOM   858  N  N   . GLU A 1 114 ? 20.040  35.105 18.815 1.00 20.48 ? 400 GLU A N   1 
ATOM   859  C  CA  . GLU A 1 114 ? 20.029  34.450 20.147 1.00 21.09 ? 400 GLU A CA  1 
ATOM   860  C  C   . GLU A 1 114 ? 20.568  35.306 21.269 1.00 20.61 ? 400 GLU A C   1 
ATOM   861  O  O   . GLU A 1 114 ? 19.969  35.331 22.358 1.00 21.11 ? 400 GLU A O   1 
ATOM   862  C  CB  . GLU A 1 114 ? 20.733  33.078 20.132 1.00 22.53 ? 400 GLU A CB  1 
ATOM   863  C  CG  . GLU A 1 114 ? 20.672  32.409 21.526 1.00 23.73 ? 400 GLU A CG  1 
ATOM   864  C  CD  . GLU A 1 114 ? 20.897  30.903 21.507 1.00 26.82 ? 400 GLU A CD  1 
ATOM   865  O  OE1 . GLU A 1 114 ? 21.262  30.317 22.556 1.00 27.73 ? 400 GLU A OE1 1 
ATOM   866  O  OE2 . GLU A 1 114 ? 20.730  30.292 20.418 1.00 26.13 ? 400 GLU A OE2 1 
ATOM   867  N  N   . ALA A 1 115 ? 21.688  35.980 21.038 1.00 20.25 ? 401 ALA A N   1 
ATOM   868  C  CA  . ALA A 1 115 ? 22.239  36.845 22.077 1.00 20.90 ? 401 ALA A CA  1 
ATOM   869  C  C   . ALA A 1 115 ? 21.291  37.974 22.472 1.00 21.72 ? 401 ALA A C   1 
ATOM   870  O  O   . ALA A 1 115 ? 21.156  38.343 23.676 1.00 19.66 ? 401 ALA A O   1 
ATOM   871  C  CB  . ALA A 1 115 ? 23.636  37.424 21.623 1.00 21.35 ? 401 ALA A CB  1 
ATOM   872  N  N   . GLU A 1 116 ? 20.557  38.487 21.486 1.00 20.57 ? 402 GLU A N   1 
ATOM   873  C  CA  . GLU A 1 116 ? 19.617  39.568 21.738 1.00 21.78 ? 402 GLU A CA  1 
ATOM   874  C  C   . GLU A 1 116 ? 18.352  39.046 22.434 1.00 21.87 ? 402 GLU A C   1 
ATOM   875  O  O   . GLU A 1 116 ? 17.714  39.753 23.222 1.00 20.74 ? 402 GLU A O   1 
ATOM   876  C  CB  . GLU A 1 116 ? 19.253  40.192 20.380 1.00 23.15 ? 402 GLU A CB  1 
ATOM   877  C  CG  . GLU A 1 116 ? 20.346  41.076 19.798 1.00 27.64 ? 402 GLU A CG  1 
ATOM   878  C  CD  . GLU A 1 116 ? 20.195  41.400 18.299 1.00 37.55 ? 402 GLU A CD  1 
ATOM   879  O  OE1 . GLU A 1 116 ? 21.038  42.197 17.805 1.00 41.61 ? 402 GLU A OE1 1 
ATOM   880  O  OE2 . GLU A 1 116 ? 19.336  40.842 17.587 1.00 33.31 ? 402 GLU A OE2 1 
ATOM   881  N  N   . LEU A 1 117 ? 17.891  37.850 22.056 1.00 20.71 ? 403 LEU A N   1 
ATOM   882  C  CA  . LEU A 1 117 ? 16.765  37.240 22.772 1.00 20.35 ? 403 LEU A CA  1 
ATOM   883  C  C   . LEU A 1 117 ? 17.112  36.982 24.236 1.00 20.74 ? 403 LEU A C   1 
ATOM   884  O  O   . LEU A 1 117 ? 16.266  37.148 25.098 1.00 21.05 ? 403 LEU A O   1 
ATOM   885  C  CB  . LEU A 1 117 ? 16.427  35.882 22.179 1.00 21.49 ? 403 LEU A CB  1 
ATOM   886  C  CG  . LEU A 1 117 ? 15.733  36.064 20.825 1.00 24.84 ? 403 LEU A CG  1 
ATOM   887  C  CD1 . LEU A 1 117 ? 16.064  35.079 19.781 1.00 29.74 ? 403 LEU A CD1 1 
ATOM   888  C  CD2 . LEU A 1 117 ? 14.312  36.784 20.648 1.00 21.41 ? 403 LEU A CD2 1 
ATOM   889  N  N   . LYS A 1 118 ? 18.336  36.526 24.494 1.00 19.43 ? 404 LYS A N   1 
ATOM   890  C  CA  . LYS A 1 118 ? 18.773  36.267 25.877 1.00 21.24 ? 404 LYS A CA  1 
ATOM   891  C  C   . LYS A 1 118 ? 18.796  37.600 26.666 1.00 22.05 ? 404 LYS A C   1 
ATOM   892  O  O   . LYS A 1 118 ? 18.419  37.646 27.846 1.00 22.48 ? 404 LYS A O   1 
ATOM   893  C  CB  . LYS A 1 118 ? 20.192  35.637 25.857 1.00 22.21 ? 404 LYS A CB  1 
ATOM   894  C  CG  . LYS A 1 118 ? 20.137  34.159 25.549 1.00 20.85 ? 404 LYS A CG  1 
ATOM   895  C  CD  . LYS A 1 118 ? 21.532  33.496 25.687 1.00 21.72 ? 404 LYS A CD  1 
ATOM   896  C  CE  . LYS A 1 118 ? 21.417  31.990 25.367 1.00 25.57 ? 404 LYS A CE  1 
ATOM   897  N  NZ  . LYS A 1 118 ? 22.768  31.333 25.424 1.00 27.25 ? 404 LYS A NZ  1 
ATOM   898  N  N   . ASP A 1 119 ? 19.280  38.653 26.045 1.00 22.41 ? 405 ASP A N   1 
ATOM   899  C  CA  . ASP A 1 119 ? 19.292  39.985 26.663 1.00 23.21 ? 405 ASP A CA  1 
ATOM   900  C  C   . ASP A 1 119 ? 17.870  40.470 26.984 1.00 23.38 ? 405 ASP A C   1 
ATOM   901  O  O   . ASP A 1 119 ? 17.591  40.968 28.100 1.00 23.23 ? 405 ASP A O   1 
ATOM   902  C  CB  . ASP A 1 119 ? 19.985  40.921 25.677 1.00 25.36 ? 405 ASP A CB  1 
ATOM   903  C  CG  . ASP A 1 119 ? 20.053  42.337 26.161 1.00 32.32 ? 405 ASP A CG  1 
ATOM   904  O  OD1 . ASP A 1 119 ? 20.409  42.580 27.360 1.00 34.34 ? 405 ASP A OD1 1 
ATOM   905  O  OD2 . ASP A 1 119 ? 19.816  43.294 25.363 1.00 41.58 ? 405 ASP A OD2 1 
ATOM   906  N  N   . LEU A 1 120 ? 16.930  40.302 26.035 1.00 22.63 ? 406 LEU A N   1 
ATOM   907  C  CA  . LEU A 1 120 ? 15.523  40.674 26.267 1.00 21.83 ? 406 LEU A CA  1 
ATOM   908  C  C   . LEU A 1 120 ? 14.927  39.871 27.458 1.00 22.73 ? 406 LEU A C   1 
ATOM   909  O  O   . LEU A 1 120 ? 14.302  40.428 28.363 1.00 21.79 ? 406 LEU A O   1 
ATOM   910  C  CB  . LEU A 1 120 ? 14.708  40.388 25.003 1.00 21.13 ? 406 LEU A CB  1 
ATOM   911  C  CG  . LEU A 1 120 ? 13.194  40.448 25.180 1.00 22.93 ? 406 LEU A CG  1 
ATOM   912  C  CD1 . LEU A 1 120 ? 12.858  41.877 25.499 1.00 23.37 ? 406 LEU A CD1 1 
ATOM   913  C  CD2 . LEU A 1 120 ? 12.478  40.070 23.810 1.00 24.50 ? 406 LEU A CD2 1 
ATOM   914  N  N   . LEU A 1 121 ? 15.164  38.564 27.454 1.00 21.63 ? 407 LEU A N   1 
ATOM   915  C  CA  . LEU A 1 121 ? 14.641  37.680 28.450 1.00 22.05 ? 407 LEU A CA  1 
ATOM   916  C  C   . LEU A 1 121 ? 15.213  38.044 29.832 1.00 22.11 ? 407 LEU A C   1 
ATOM   917  O  O   . LEU A 1 121 ? 14.467  38.111 30.809 1.00 22.79 ? 407 LEU A O   1 
ATOM   918  C  CB  . LEU A 1 121 ? 15.014  36.224 28.057 1.00 22.12 ? 407 LEU A CB  1 
ATOM   919  C  CG  . LEU A 1 121 ? 14.460  35.171 28.981 1.00 25.26 ? 407 LEU A CG  1 
ATOM   920  C  CD1 . LEU A 1 121 ? 12.986  35.357 29.183 1.00 25.80 ? 407 LEU A CD1 1 
ATOM   921  C  CD2 . LEU A 1 121 ? 14.770  33.730 28.438 1.00 27.38 ? 407 LEU A CD2 1 
ATOM   922  N  N   . LEU A 1 122 ? 16.517  38.283 29.908 1.00 21.28 ? 408 LEU A N   1 
ATOM   923  C  CA  . LEU A 1 122 ? 17.160  38.677 31.176 1.00 21.31 ? 408 LEU A CA  1 
ATOM   924  C  C   . LEU A 1 122 ? 16.654  40.031 31.675 1.00 22.77 ? 408 LEU A C   1 
ATOM   925  O  O   . LEU A 1 122 ? 16.329  40.173 32.889 1.00 24.06 ? 408 LEU A O   1 
ATOM   926  C  CB  . LEU A 1 122 ? 18.661  38.718 30.995 1.00 21.50 ? 408 LEU A CB  1 
ATOM   927  C  CG  . LEU A 1 122 ? 19.480  39.110 32.251 1.00 22.38 ? 408 LEU A CG  1 
ATOM   928  C  CD1 . LEU A 1 122 ? 19.129  38.134 33.406 1.00 24.80 ? 408 LEU A CD1 1 
ATOM   929  C  CD2 . LEU A 1 122 ? 21.001  39.134 31.977 1.00 23.77 ? 408 LEU A CD2 1 
ATOM   930  N  N   . GLN A 1 123 ? 16.567  41.005 30.781 1.00 21.76 ? 409 GLN A N   1 
ATOM   931  C  CA  . GLN A 1 123 ? 16.142  42.324 31.193 1.00 22.72 ? 409 GLN A CA  1 
ATOM   932  C  C   . GLN A 1 123 ? 14.704  42.351 31.711 1.00 23.56 ? 409 GLN A C   1 
ATOM   933  O  O   . GLN A 1 123 ? 14.412  42.913 32.812 1.00 22.10 ? 409 GLN A O   1 
ATOM   934  C  CB  . GLN A 1 123 ? 16.341  43.349 30.054 1.00 21.32 ? 409 GLN A CB  1 
ATOM   935  C  CG  . GLN A 1 123 ? 17.820  43.653 29.780 1.00 22.74 ? 409 GLN A CG  1 
ATOM   936  C  CD  . GLN A 1 123 ? 17.939  44.912 28.922 1.00 26.70 ? 409 GLN A CD  1 
ATOM   937  O  OE1 . GLN A 1 123 ? 17.150  45.834 29.099 1.00 23.89 ? 409 GLN A OE1 1 
ATOM   938  N  NE2 . GLN A 1 123 ? 18.912  44.948 28.000 1.00 27.94 ? 409 GLN A NE2 1 
ATOM   939  N  N   . VAL A 1 124 ? 13.780  41.812 30.938 1.00 22.67 ? 410 VAL A N   1 
ATOM   940  C  CA  . VAL A 1 124 ? 12.397  41.786 31.411 1.00 23.07 ? 410 VAL A CA  1 
ATOM   941  C  C   . VAL A 1 124 ? 12.300  40.861 32.628 1.00 23.57 ? 410 VAL A C   1 
ATOM   942  O  O   . VAL A 1 124 ? 11.526  41.121 33.562 1.00 22.97 ? 410 VAL A O   1 
ATOM   943  C  CB  . VAL A 1 124 ? 11.428  41.377 30.244 1.00 22.61 ? 410 VAL A CB  1 
ATOM   944  C  CG1 . VAL A 1 124 ? 9.988   41.279 30.746 1.00 23.57 ? 410 VAL A CG1 1 
ATOM   945  C  CG2 . VAL A 1 124 ? 11.609  42.405 29.058 1.00 24.99 ? 410 VAL A CG2 1 
ATOM   946  N  N   . GLY A 1 125 ? 13.054  39.747 32.630 1.00 21.98 ? 411 GLY A N   1 
ATOM   947  C  CA  . GLY A 1 125 ? 13.109  38.876 33.776 1.00 21.85 ? 411 GLY A CA  1 
ATOM   948  C  C   . GLY A 1 125 ? 13.519  39.674 35.048 1.00 21.88 ? 411 GLY A C   1 
ATOM   949  O  O   . GLY A 1 125 ? 12.977  39.483 36.129 1.00 22.84 ? 411 GLY A O   1 
ATOM   950  N  N   . ARG A 1 126 ? 14.510  40.534 34.958 1.00 20.69 ? 412 ARG A N   1 
ATOM   951  C  CA  . ARG A 1 126 ? 14.853  41.363 36.142 1.00 22.82 ? 412 ARG A CA  1 
ATOM   952  C  C   . ARG A 1 126 ? 13.665  42.272 36.569 1.00 21.93 ? 412 ARG A C   1 
ATOM   953  O  O   . ARG A 1 126 ? 13.414  42.464 37.768 1.00 22.19 ? 412 ARG A O   1 
ATOM   954  C  CB  . ARG A 1 126 ? 16.045  42.259 35.819 1.00 23.33 ? 412 ARG A CB  1 
ATOM   955  C  CG  . ARG A 1 126 ? 17.404  41.518 35.628 1.00 25.50 ? 412 ARG A CG  1 
ATOM   956  C  CD  . ARG A 1 126 ? 18.537  42.558 35.293 1.00 29.02 ? 412 ARG A CD  1 
ATOM   957  N  NE  . ARG A 1 126 ? 19.809  41.908 34.942 1.00 34.19 ? 412 ARG A NE  1 
ATOM   958  C  CZ  . ARG A 1 126 ? 20.575  41.276 35.809 1.00 38.25 ? 412 ARG A CZ  1 
ATOM   959  N  NH1 . ARG A 1 126 ? 20.192  41.191 37.089 1.00 43.45 ? 412 ARG A NH1 1 
ATOM   960  N  NH2 . ARG A 1 126 ? 21.745  40.735 35.430 1.00 36.71 ? 412 ARG A NH2 1 
ATOM   961  N  N   . GLY A 1 127 ? 13.010  42.875 35.593 1.00 22.84 ? 413 GLY A N   1 
ATOM   962  C  CA  . GLY A 1 127 ? 11.834  43.677 35.837 1.00 22.84 ? 413 GLY A CA  1 
ATOM   963  C  C   . GLY A 1 127 ? 10.751  42.867 36.547 1.00 25.04 ? 413 GLY A C   1 
ATOM   964  O  O   . GLY A 1 127 ? 10.161  43.341 37.541 1.00 26.86 ? 413 GLY A O   1 
ATOM   965  N  N   . LEU A 1 128 ? 10.467  41.663 36.077 1.00 24.11 ? 414 LEU A N   1 
ATOM   966  C  CA  . LEU A 1 128 ? 9.561   40.736 36.766 1.00 24.15 ? 414 LEU A CA  1 
ATOM   967  C  C   . LEU A 1 128 ? 10.007  40.320 38.182 1.00 23.82 ? 414 LEU A C   1 
ATOM   968  O  O   . LEU A 1 128 ? 9.173   40.163 39.107 1.00 22.79 ? 414 LEU A O   1 
ATOM   969  C  CB  . LEU A 1 128 ? 9.385   39.431 35.935 1.00 23.75 ? 414 LEU A CB  1 
ATOM   970  C  CG  . LEU A 1 128 ? 8.390   39.546 34.802 1.00 29.23 ? 414 LEU A CG  1 
ATOM   971  C  CD1 . LEU A 1 128 ? 8.876   40.605 33.869 1.00 38.38 ? 414 LEU A CD1 1 
ATOM   972  C  CD2 . LEU A 1 128 ? 8.227   38.193 34.055 1.00 24.22 ? 414 LEU A CD2 1 
ATOM   973  N  N   . ARG A 1 129 ? 11.311  40.094 38.370 1.00 21.09 ? 415 ARG A N   1 
ATOM   974  C  CA  . ARG A 1 129 ? 11.794  39.724 39.674 1.00 23.38 ? 415 ARG A CA  1 
ATOM   975  C  C   . ARG A 1 129 ? 11.520  40.882 40.638 1.00 23.53 ? 415 ARG A C   1 
ATOM   976  O  O   . ARG A 1 129 ? 11.059  40.640 41.765 1.00 23.27 ? 415 ARG A O   1 
ATOM   977  C  CB  . ARG A 1 129 ? 13.302  39.396 39.638 1.00 21.62 ? 415 ARG A CB  1 
ATOM   978  C  CG  . ARG A 1 129 ? 13.869  38.994 40.987 1.00 23.03 ? 415 ARG A CG  1 
ATOM   979  C  CD  . ARG A 1 129 ? 15.394  38.952 41.057 1.00 28.26 ? 415 ARG A CD  1 
ATOM   980  N  NE  . ARG A 1 129 ? 16.047  40.028 40.301 1.00 35.19 ? 415 ARG A NE  1 
ATOM   981  C  CZ  . ARG A 1 129 ? 17.386  40.137 40.150 1.00 35.67 ? 415 ARG A CZ  1 
ATOM   982  N  NH1 . ARG A 1 129 ? 18.182  39.240 40.756 1.00 38.13 ? 415 ARG A NH1 1 
ATOM   983  N  NH2 . ARG A 1 129 ? 17.916  41.133 39.415 1.00 27.83 ? 415 ARG A NH2 1 
ATOM   984  N  N   . TYR A 1 130 ? 11.729  42.121 40.197 1.00 24.45 ? 416 TYR A N   1 
ATOM   985  C  CA  . TYR A 1 130 ? 11.392  43.297 41.050 1.00 24.78 ? 416 TYR A CA  1 
ATOM   986  C  C   . TYR A 1 130 ? 9.873   43.401 41.374 1.00 25.56 ? 416 TYR A C   1 
ATOM   987  O  O   . TYR A 1 130 ? 9.501   43.509 42.532 1.00 25.62 ? 416 TYR A O   1 
ATOM   988  C  CB  . TYR A 1 130 ? 11.791  44.546 40.332 1.00 25.39 ? 416 TYR A CB  1 
ATOM   989  C  CG  . TYR A 1 130 ? 11.417  45.913 40.930 1.00 27.51 ? 416 TYR A CG  1 
ATOM   990  C  CD1 . TYR A 1 130 ? 12.007  46.384 42.101 1.00 35.83 ? 416 TYR A CD1 1 
ATOM   991  C  CD2 . TYR A 1 130 ? 10.589  46.770 40.234 1.00 30.62 ? 416 TYR A CD2 1 
ATOM   992  C  CE1 . TYR A 1 130 ? 11.672  47.712 42.620 1.00 33.81 ? 416 TYR A CE1 1 
ATOM   993  C  CE2 . TYR A 1 130 ? 10.282  48.074 40.720 1.00 28.30 ? 416 TYR A CE2 1 
ATOM   994  C  CZ  . TYR A 1 130 ? 10.817  48.515 41.901 1.00 30.61 ? 416 TYR A CZ  1 
ATOM   995  O  OH  . TYR A 1 130 ? 10.534  49.808 42.320 1.00 29.69 ? 416 TYR A OH  1 
ATOM   996  N  N   . ILE A 1 131 ? 9.034   43.348 40.355 1.00 24.42 ? 417 ILE A N   1 
ATOM   997  C  CA  . ILE A 1 131 ? 7.574   43.388 40.581 1.00 24.37 ? 417 ILE A CA  1 
ATOM   998  C  C   . ILE A 1 131 ? 7.171   42.244 41.502 1.00 23.77 ? 417 ILE A C   1 
ATOM   999  O  O   . ILE A 1 131 ? 6.443   42.464 42.492 1.00 23.92 ? 417 ILE A O   1 
ATOM   1000 C  CB  . ILE A 1 131 ? 6.847   43.271 39.222 1.00 24.05 ? 417 ILE A CB  1 
ATOM   1001 C  CG1 . ILE A 1 131 ? 7.091   44.486 38.324 1.00 23.99 ? 417 ILE A CG1 1 
ATOM   1002 C  CG2 . ILE A 1 131 ? 5.238   43.046 39.415 1.00 24.02 ? 417 ILE A CG2 1 
ATOM   1003 C  CD1 . ILE A 1 131 ? 6.453   44.289 36.954 1.00 24.13 ? 417 ILE A CD1 1 
ATOM   1004 N  N   . HIS A 1 132 ? 7.622   41.020 41.258 1.00 23.31 ? 418 HIS A N   1 
ATOM   1005 C  CA  . HIS A 1 132 ? 7.259   39.895 42.100 1.00 23.02 ? 418 HIS A CA  1 
ATOM   1006 C  C   . HIS A 1 132 ? 7.783   40.020 43.551 1.00 25.09 ? 418 HIS A C   1 
ATOM   1007 O  O   . HIS A 1 132 ? 7.126   39.588 44.483 1.00 25.93 ? 418 HIS A O   1 
ATOM   1008 C  CB  . HIS A 1 132 ? 7.679   38.534 41.463 1.00 23.28 ? 418 HIS A CB  1 
ATOM   1009 C  CG  . HIS A 1 132 ? 6.972   38.231 40.163 1.00 23.85 ? 418 HIS A CG  1 
ATOM   1010 N  ND1 . HIS A 1 132 ? 7.243   37.112 39.413 1.00 23.51 ? 418 HIS A ND1 1 
ATOM   1011 C  CD2 . HIS A 1 132 ? 5.982   38.890 39.501 1.00 25.04 ? 418 HIS A CD2 1 
ATOM   1012 C  CE1 . HIS A 1 132 ? 6.501   37.108 38.319 1.00 21.20 ? 418 HIS A CE1 1 
ATOM   1013 N  NE2 . HIS A 1 132 ? 5.740   38.194 38.328 1.00 22.82 ? 418 HIS A NE2 1 
ATOM   1014 N  N   . SER A 1 133 ? 8.928   40.682 43.743 1.00 24.39 ? 419 SER A N   1 
ATOM   1015 C  CA  . SER A 1 133 ? 9.476   40.872 45.084 1.00 24.58 ? 419 SER A CA  1 
ATOM   1016 C  C   . SER A 1 133 ? 8.582   41.796 45.903 1.00 24.64 ? 419 SER A C   1 
ATOM   1017 O  O   . SER A 1 133 ? 8.632   41.764 47.154 1.00 25.06 ? 419 SER A O   1 
ATOM   1018 C  CB  . SER A 1 133 ? 10.906  41.461 45.018 1.00 23.37 ? 419 SER A CB  1 
ATOM   1019 O  OG  . SER A 1 133 ? 10.883  42.831 44.721 1.00 24.00 ? 419 SER A OG  1 
ATOM   1020 N  N   . MET A 1 134 ? 7.831   42.629 45.214 1.00 25.92 ? 420 MET A N   1 
ATOM   1021 C  CA  . MET A 1 134 ? 6.874   43.540 45.836 1.00 26.04 ? 420 MET A CA  1 
ATOM   1022 C  C   . MET A 1 134 ? 5.496   42.902 46.069 1.00 25.96 ? 420 MET A C   1 
ATOM   1023 O  O   . MET A 1 134 ? 4.567   43.632 46.397 1.00 25.62 ? 420 MET A O   1 
ATOM   1024 C  CB  . MET A 1 134 ? 6.734   44.813 45.050 1.00 27.72 ? 420 MET A CB  1 
ATOM   1025 C  CG  . MET A 1 134 ? 8.057   45.552 44.821 1.00 33.06 ? 420 MET A CG  1 
ATOM   1026 S  SD  . MET A 1 134 ? 8.764   46.164 46.338 1.00 35.24 ? 420 MET A SD  1 
ATOM   1027 C  CE  . MET A 1 134 ? 8.056   47.710 46.361 1.00 33.35 ? 420 MET A CE  1 
ATOM   1028 N  N   . SER A 1 135 ? 5.400   41.575 45.936 1.00 24.42 ? 421 SER A N   1 
ATOM   1029 C  CA  . SER A 1 135 ? 4.161   40.817 46.131 1.00 23.69 ? 421 SER A CA  1 
ATOM   1030 C  C   . SER A 1 135 ? 3.075   41.305 45.148 1.00 21.94 ? 421 SER A C   1 
ATOM   1031 O  O   . SER A 1 135 ? 1.867   41.308 45.480 1.00 21.89 ? 421 SER A O   1 
ATOM   1032 C  CB  . SER A 1 135 ? 3.648   40.995 47.582 1.00 24.58 ? 421 SER A CB  1 
ATOM   1033 O  OG  . SER A 1 135 ? 4.565   40.442 48.459 1.00 27.01 ? 421 SER A OG  1 
ATOM   1034 N  N   . LEU A 1 136 ? 3.506   41.624 43.942 1.00 21.41 ? 422 LEU A N   1 
ATOM   1035 C  CA  . LEU A 1 136 ? 2.595   42.057 42.902 1.00 22.61 ? 422 LEU A CA  1 
ATOM   1036 C  C   . LEU A 1 136 ? 2.871   41.196 41.676 1.00 22.80 ? 422 LEU A C   1 
ATOM   1037 O  O   . LEU A 1 136 ? 3.966   40.581 41.584 1.00 22.66 ? 422 LEU A O   1 
ATOM   1038 C  CB  . LEU A 1 136 ? 2.974   43.450 42.498 1.00 23.73 ? 422 LEU A CB  1 
ATOM   1039 C  CG  . LEU A 1 136 ? 2.371   44.703 43.122 1.00 29.07 ? 422 LEU A CG  1 
ATOM   1040 C  CD1 . LEU A 1 136 ? 1.063   44.613 43.813 1.00 23.28 ? 422 LEU A CD1 1 
ATOM   1041 C  CD2 . LEU A 1 136 ? 3.314   45.757 43.613 1.00 28.19 ? 422 LEU A CD2 1 
ATOM   1042 N  N   . VAL A 1 137 ? 1.901   41.163 40.760 1.00 20.37 ? 423 VAL A N   1 
ATOM   1043 C  CA  . VAL A 1 137 ? 2.037   40.470 39.468 1.00 21.32 ? 423 VAL A CA  1 
ATOM   1044 C  C   . VAL A 1 137 ? 1.565   41.414 38.360 1.00 21.04 ? 423 VAL A C   1 
ATOM   1045 O  O   . VAL A 1 137 ? 0.712   42.276 38.581 1.00 21.50 ? 423 VAL A O   1 
ATOM   1046 C  CB  . VAL A 1 137 ? 1.262   39.188 39.396 1.00 22.02 ? 423 VAL A CB  1 
ATOM   1047 C  CG1 . VAL A 1 137 ? 1.989   38.093 40.269 1.00 24.82 ? 423 VAL A CG1 1 
ATOM   1048 C  CG2 . VAL A 1 137 ? -0.138  39.391 39.913 1.00 20.34 ? 423 VAL A CG2 1 
ATOM   1049 N  N   . HIS A 1 138 ? 2.140   41.266 37.181 1.00 21.80 ? 424 HIS A N   1 
ATOM   1050 C  CA  . HIS A 1 138 ? 1.873   42.227 36.098 1.00 21.80 ? 424 HIS A CA  1 
ATOM   1051 C  C   . HIS A 1 138 ? 0.551   41.871 35.364 1.00 21.26 ? 424 HIS A C   1 
ATOM   1052 O  O   . HIS A 1 138 ? -0.305  42.761 35.104 1.00 20.82 ? 424 HIS A O   1 
ATOM   1053 C  CB  . HIS A 1 138 ? 3.074   42.300 35.137 1.00 22.02 ? 424 HIS A CB  1 
ATOM   1054 C  CG  . HIS A 1 138 ? 2.840   43.249 33.989 1.00 21.54 ? 424 HIS A CG  1 
ATOM   1055 N  ND1 . HIS A 1 138 ? 3.362   44.540 33.955 1.00 26.43 ? 424 HIS A ND1 1 
ATOM   1056 C  CD2 . HIS A 1 138 ? 2.084   43.117 32.879 1.00 18.20 ? 424 HIS A CD2 1 
ATOM   1057 C  CE1 . HIS A 1 138 ? 2.992   45.133 32.827 1.00 18.47 ? 424 HIS A CE1 1 
ATOM   1058 N  NE2 . HIS A 1 138 ? 2.198   44.295 32.173 1.00 27.18 ? 424 HIS A NE2 1 
ATOM   1059 N  N   . MET A 1 139 ? 0.439   40.597 34.974 1.00 20.11 ? 425 MET A N   1 
ATOM   1060 C  CA  . MET A 1 139 ? -0.792  39.991 34.372 1.00 20.62 ? 425 MET A CA  1 
ATOM   1061 C  C   . MET A 1 139 ? -1.081  40.427 32.940 1.00 19.89 ? 425 MET A C   1 
ATOM   1062 O  O   . MET A 1 139 ? -2.106  40.062 32.393 1.00 19.76 ? 425 MET A O   1 
ATOM   1063 C  CB  . MET A 1 139 ? -2.070  40.174 35.249 1.00 20.42 ? 425 MET A CB  1 
ATOM   1064 C  CG  . MET A 1 139 ? -1.867  39.561 36.628 1.00 22.29 ? 425 MET A CG  1 
ATOM   1065 S  SD  . MET A 1 139 ? -1.406  37.759 36.580 1.00 29.39 ? 425 MET A SD  1 
ATOM   1066 C  CE  . MET A 1 139 ? -2.723  37.230 35.992 1.00 24.35 ? 425 MET A CE  1 
ATOM   1067 N  N   . ASP A 1 140 ? -0.151  41.136 32.302 1.00 21.93 ? 426 ASP A N   1 
ATOM   1068 C  CA  . ASP A 1 140 ? -0.369  41.449 30.880 1.00 21.54 ? 426 ASP A CA  1 
ATOM   1069 C  C   . ASP A 1 140 ? 0.927   41.689 30.129 1.00 21.95 ? 426 ASP A C   1 
ATOM   1070 O  O   . ASP A 1 140 ? 1.088   42.645 29.348 1.00 22.23 ? 426 ASP A O   1 
ATOM   1071 C  CB  . ASP A 1 140 ? -1.283  42.664 30.765 1.00 23.42 ? 426 ASP A CB  1 
ATOM   1072 C  CG  . ASP A 1 140 ? -1.901  42.801 29.366 1.00 29.61 ? 426 ASP A CG  1 
ATOM   1073 O  OD1 . ASP A 1 140 ? -2.292  43.942 29.037 1.00 31.89 ? 426 ASP A OD1 1 
ATOM   1074 O  OD2 . ASP A 1 140 ? -2.069  41.817 28.581 1.00 27.14 ? 426 ASP A OD2 1 
ATOM   1075 N  N   . ILE A 1 141 ? 1.904   40.854 30.417 1.00 20.40 ? 427 ILE A N   1 
ATOM   1076 C  CA  . ILE A 1 141 ? 3.167   40.940 29.680 1.00 22.25 ? 427 ILE A CA  1 
ATOM   1077 C  C   . ILE A 1 141 ? 2.958   40.579 28.201 1.00 21.37 ? 427 ILE A C   1 
ATOM   1078 O  O   . ILE A 1 141 ? 2.363   39.527 27.885 1.00 22.70 ? 427 ILE A O   1 
ATOM   1079 C  CB  . ILE A 1 141 ? 4.217   40.012 30.390 1.00 21.17 ? 427 ILE A CB  1 
ATOM   1080 C  CG1 . ILE A 1 141 ? 4.494   40.529 31.844 1.00 24.04 ? 427 ILE A CG1 1 
ATOM   1081 C  CG2 . ILE A 1 141 ? 5.580   39.885 29.536 1.00 22.43 ? 427 ILE A CG2 1 
ATOM   1082 C  CD1 . ILE A 1 141 ? 5.289   41.890 31.821 1.00 22.33 ? 427 ILE A CD1 1 
ATOM   1083 N  N   . LYS A 1 142 ? 3.409   41.469 27.294 1.00 21.63 ? 428 LYS A N   1 
ATOM   1084 C  CA  . LYS A 1 142 ? 3.407   41.161 25.845 1.00 20.74 ? 428 LYS A CA  1 
ATOM   1085 C  C   . LYS A 1 142 ? 4.210   42.286 25.173 1.00 21.73 ? 428 LYS A C   1 
ATOM   1086 O  O   . LYS A 1 142 ? 4.545   43.277 25.806 1.00 20.87 ? 428 LYS A O   1 
ATOM   1087 C  CB  . LYS A 1 142 ? 2.009   41.185 25.269 1.00 20.42 ? 428 LYS A CB  1 
ATOM   1088 C  CG  . LYS A 1 142 ? 1.189   42.444 25.708 1.00 21.52 ? 428 LYS A CG  1 
ATOM   1089 C  CD  . LYS A 1 142 ? -0.212  42.460 24.992 1.00 21.84 ? 428 LYS A CD  1 
ATOM   1090 C  CE  . LYS A 1 142 ? -1.127  43.588 25.486 1.00 22.56 ? 428 LYS A CE  1 
ATOM   1091 N  NZ  . LYS A 1 142 ? -2.370  43.613 24.618 1.00 23.51 ? 428 LYS A NZ  1 
ATOM   1092 N  N   . PRO A 1 143 ? 4.586   42.098 23.915 1.00 22.39 ? 429 PRO A N   1 
ATOM   1093 C  CA  . PRO A 1 143 ? 5.441   43.070 23.224 1.00 21.52 ? 429 PRO A CA  1 
ATOM   1094 C  C   . PRO A 1 143 ? 4.884   44.501 23.221 1.00 21.33 ? 429 PRO A C   1 
ATOM   1095 O  O   . PRO A 1 143 ? 5.707   45.429 23.284 1.00 21.68 ? 429 PRO A O   1 
ATOM   1096 C  CB  . PRO A 1 143 ? 5.502   42.527 21.779 1.00 22.44 ? 429 PRO A CB  1 
ATOM   1097 C  CG  . PRO A 1 143 ? 5.496   40.975 22.018 1.00 24.11 ? 429 PRO A CG  1 
ATOM   1098 C  CD  . PRO A 1 143 ? 4.425   40.823 23.176 1.00 22.11 ? 429 PRO A CD  1 
ATOM   1099 N  N   . SER A 1 144 ? 3.582   44.692 23.145 1.00 21.60 ? 430 SER A N   1 
ATOM   1100 C  CA  . SER A 1 144 ? 3.117   46.089 23.116 1.00 22.75 ? 430 SER A CA  1 
ATOM   1101 C  C   . SER A 1 144 ? 3.228   46.784 24.505 1.00 21.61 ? 430 SER A C   1 
ATOM   1102 O  O   . SER A 1 144 ? 2.947   48.013 24.591 1.00 23.84 ? 430 SER A O   1 
ATOM   1103 C  CB  . SER A 1 144 ? 1.706   46.192 22.606 1.00 24.57 ? 430 SER A CB  1 
ATOM   1104 O  OG  . SER A 1 144 ? 0.827   45.441 23.419 1.00 24.15 ? 430 SER A OG  1 
ATOM   1105 N  N   . ASN A 1 145 ? 3.506   46.012 25.559 1.00 21.54 ? 431 ASN A N   1 
ATOM   1106 C  CA  . ASN A 1 145 ? 3.691   46.546 26.908 1.00 21.84 ? 431 ASN A CA  1 
ATOM   1107 C  C   . ASN A 1 145 ? 5.153   46.561 27.343 1.00 22.92 ? 431 ASN A C   1 
ATOM   1108 O  O   . ASN A 1 145 ? 5.474   46.778 28.550 1.00 24.11 ? 431 ASN A O   1 
ATOM   1109 C  CB  . ASN A 1 145 ? 2.773   45.796 27.947 1.00 20.30 ? 431 ASN A CB  1 
ATOM   1110 C  CG  . ASN A 1 145 ? 1.327   46.047 27.684 1.00 21.21 ? 431 ASN A CG  1 
ATOM   1111 O  OD1 . ASN A 1 145 ? 0.949   47.013 27.029 1.00 21.79 ? 431 ASN A OD1 1 
ATOM   1112 N  ND2 . ASN A 1 145 ? 0.482   45.180 28.203 1.00 20.37 ? 431 ASN A ND2 1 
ATOM   1113 N  N   . ILE A 1 146 ? 6.065   46.273 26.407 1.00 23.25 ? 432 ILE A N   1 
ATOM   1114 C  CA  . ILE A 1 146 ? 7.470   46.381 26.712 1.00 23.00 ? 432 ILE A CA  1 
ATOM   1115 C  C   . ILE A 1 146 ? 8.004   47.497 25.852 1.00 23.45 ? 432 ILE A C   1 
ATOM   1116 O  O   . ILE A 1 146 ? 7.778   47.493 24.652 1.00 22.42 ? 432 ILE A O   1 
ATOM   1117 C  CB  . ILE A 1 146 ? 8.206   45.066 26.427 1.00 24.89 ? 432 ILE A CB  1 
ATOM   1118 C  CG1 . ILE A 1 146 ? 7.690   43.998 27.425 1.00 25.70 ? 432 ILE A CG1 1 
ATOM   1119 C  CG2 . ILE A 1 146 ? 9.719   45.300 26.586 1.00 22.56 ? 432 ILE A CG2 1 
ATOM   1120 C  CD1 . ILE A 1 146 ? 7.967   42.595 26.931 1.00 29.96 ? 432 ILE A CD1 1 
ATOM   1121 N  N   . PHE A 1 147 ? 8.745   48.442 26.460 1.00 22.63 ? 433 PHE A N   1 
ATOM   1122 C  CA  . PHE A 1 147 ? 9.252   49.630 25.739 1.00 22.41 ? 433 PHE A CA  1 
ATOM   1123 C  C   . PHE A 1 147 ? 10.771  49.683 25.667 1.00 22.53 ? 433 PHE A C   1 
ATOM   1124 O  O   . PHE A 1 147 ? 11.503  49.123 26.514 1.00 24.54 ? 433 PHE A O   1 
ATOM   1125 C  CB  . PHE A 1 147 ? 8.685   50.924 26.397 1.00 23.23 ? 433 PHE A CB  1 
ATOM   1126 C  CG  . PHE A 1 147 ? 7.215   50.936 26.362 1.00 24.51 ? 433 PHE A CG  1 
ATOM   1127 C  CD1 . PHE A 1 147 ? 6.591   51.319 25.193 1.00 23.05 ? 433 PHE A CD1 1 
ATOM   1128 C  CD2 . PHE A 1 147 ? 6.463   50.433 27.453 1.00 26.76 ? 433 PHE A CD2 1 
ATOM   1129 C  CE1 . PHE A 1 147 ? 5.176   51.255 25.051 1.00 26.72 ? 433 PHE A CE1 1 
ATOM   1130 C  CE2 . PHE A 1 147 ? 5.002   50.390 27.321 1.00 24.07 ? 433 PHE A CE2 1 
ATOM   1131 C  CZ  . PHE A 1 147 ? 4.407   50.795 26.132 1.00 26.37 ? 433 PHE A CZ  1 
ATOM   1132 N  N   . ILE A 1 148 ? 11.273  50.370 24.649 1.00 22.93 ? 434 ILE A N   1 
ATOM   1133 C  CA  . ILE A 1 148 ? 12.716  50.328 24.411 1.00 23.45 ? 434 ILE A CA  1 
ATOM   1134 C  C   . ILE A 1 148 ? 13.297  51.704 24.623 1.00 24.15 ? 434 ILE A C   1 
ATOM   1135 O  O   . ILE A 1 148 ? 12.734  52.723 24.138 1.00 24.35 ? 434 ILE A O   1 
ATOM   1136 C  CB  . ILE A 1 148 ? 12.907  49.926 22.927 1.00 22.79 ? 434 ILE A CB  1 
ATOM   1137 C  CG1 . ILE A 1 148 ? 12.470  48.440 22.737 1.00 25.42 ? 434 ILE A CG1 1 
ATOM   1138 C  CG2 . ILE A 1 148 ? 14.422  50.040 22.532 1.00 24.81 ? 434 ILE A CG2 1 
ATOM   1139 C  CD1 . ILE A 1 148 ? 12.331  48.106 21.243 1.00 23.76 ? 434 ILE A CD1 1 
ATOM   1140 N  N   . SER A 1 149 ? 14.422  51.731 25.313 1.00 26.65 ? 435 SER A N   1 
ATOM   1141 C  CA  . SER A 1 149 ? 15.139  52.971 25.605 1.00 29.74 ? 435 SER A CA  1 
ATOM   1142 C  C   . SER A 1 149 ? 16.650  52.712 25.318 1.00 29.88 ? 435 SER A C   1 
ATOM   1143 O  O   . SER A 1 149 ? 17.061  51.545 25.109 1.00 29.33 ? 435 SER A O   1 
ATOM   1144 C  CB  . SER A 1 149 ? 14.905  53.294 27.082 1.00 29.65 ? 435 SER A CB  1 
ATOM   1145 O  OG  . SER A 1 149 ? 15.566  54.468 27.449 1.00 42.52 ? 435 SER A OG  1 
ATOM   1146 N  N   . LYS A 1 170 ? 23.657  50.915 24.391 1.00 41.28 ? 456 LYS A N   1 
ATOM   1147 C  CA  . LYS A 1 170 ? 22.994  49.672 24.854 1.00 39.83 ? 456 LYS A CA  1 
ATOM   1148 C  C   . LYS A 1 170 ? 21.484  49.774 24.933 1.00 37.61 ? 456 LYS A C   1 
ATOM   1149 O  O   . LYS A 1 170 ? 20.946  50.720 25.548 1.00 36.70 ? 456 LYS A O   1 
ATOM   1150 C  CB  . LYS A 1 170 ? 23.481  49.262 26.248 1.00 41.55 ? 456 LYS A CB  1 
ATOM   1151 C  CG  . LYS A 1 170 ? 22.669  48.104 26.782 1.00 45.56 ? 456 LYS A CG  1 
ATOM   1152 C  CD  . LYS A 1 170 ? 22.990  47.707 28.224 1.00 50.16 ? 456 LYS A CD  1 
ATOM   1153 C  CE  . LYS A 1 170 ? 22.266  46.400 28.600 1.00 48.85 ? 456 LYS A CE  1 
ATOM   1154 N  NZ  . LYS A 1 170 ? 22.780  45.192 27.813 1.00 48.95 ? 456 LYS A NZ  1 
ATOM   1155 N  N   . VAL A 1 171 ? 20.797  48.782 24.370 1.00 34.18 ? 457 VAL A N   1 
ATOM   1156 C  CA  . VAL A 1 171 ? 19.352  48.830 24.401 1.00 32.76 ? 457 VAL A CA  1 
ATOM   1157 C  C   . VAL A 1 171 ? 18.835  48.455 25.788 1.00 29.98 ? 457 VAL A C   1 
ATOM   1158 O  O   . VAL A 1 171 ? 19.411  47.579 26.460 1.00 28.93 ? 457 VAL A O   1 
ATOM   1159 C  CB  . VAL A 1 171 ? 18.707  47.907 23.330 1.00 33.02 ? 457 VAL A CB  1 
ATOM   1160 C  CG1 . VAL A 1 171 ? 19.202  48.365 21.948 1.00 39.02 ? 457 VAL A CG1 1 
ATOM   1161 C  CG2 . VAL A 1 171 ? 19.135  46.475 23.532 1.00 38.04 ? 457 VAL A CG2 1 
ATOM   1162 N  N   . MET A 1 172 ? 17.778  49.137 26.233 1.00 29.23 ? 458 MET A N   1 
ATOM   1163 C  CA  . MET A 1 172 ? 17.200  48.837 27.542 1.00 28.52 ? 458 MET A CA  1 
ATOM   1164 C  C   . MET A 1 172 ? 15.728  48.551 27.359 1.00 27.46 ? 458 MET A C   1 
ATOM   1165 O  O   . MET A 1 172 ? 15.027  49.361 26.732 1.00 29.19 ? 458 MET A O   1 
ATOM   1166 C  CB  . MET A 1 172 ? 17.271  50.066 28.503 1.00 28.61 ? 458 MET A CB  1 
ATOM   1167 C  CG  . MET A 1 172 ? 18.674  50.445 28.866 1.00 35.56 ? 458 MET A CG  1 
ATOM   1168 S  SD  . MET A 1 172 ? 19.291  49.376 30.103 1.00 42.38 ? 458 MET A SD  1 
ATOM   1169 C  CE  . MET A 1 172 ? 18.447  50.040 31.581 1.00 40.63 ? 458 MET A CE  1 
ATOM   1170 N  N   . PHE A 1 173 ? 15.266  47.406 27.867 1.00 24.90 ? 459 PHE A N   1 
ATOM   1171 C  CA  . PHE A 1 173 ? 13.852  47.071 27.773 1.00 23.46 ? 459 PHE A CA  1 
ATOM   1172 C  C   . PHE A 1 173 ? 13.179  47.364 29.100 1.00 22.76 ? 459 PHE A C   1 
ATOM   1173 O  O   . PHE A 1 173 ? 13.784  47.102 30.144 1.00 23.94 ? 459 PHE A O   1 
ATOM   1174 C  CB  . PHE A 1 173 ? 13.697  45.580 27.497 1.00 21.09 ? 459 PHE A CB  1 
ATOM   1175 C  CG  . PHE A 1 173 ? 14.308  45.184 26.162 1.00 21.79 ? 459 PHE A CG  1 
ATOM   1176 C  CD1 . PHE A 1 173 ? 15.538  44.508 26.152 1.00 23.37 ? 459 PHE A CD1 1 
ATOM   1177 C  CD2 . PHE A 1 173 ? 13.688  45.555 25.004 1.00 20.74 ? 459 PHE A CD2 1 
ATOM   1178 C  CE1 . PHE A 1 173 ? 16.096  44.123 24.923 1.00 28.67 ? 459 PHE A CE1 1 
ATOM   1179 C  CE2 . PHE A 1 173 ? 14.212  45.165 23.752 1.00 24.58 ? 459 PHE A CE2 1 
ATOM   1180 C  CZ  . PHE A 1 173 ? 15.442  44.475 23.732 1.00 27.96 ? 459 PHE A CZ  1 
ATOM   1181 N  N   . LYS A 1 174 ? 11.990  47.940 29.056 1.00 23.24 ? 460 LYS A N   1 
ATOM   1182 C  CA  . LYS A 1 174 ? 11.306  48.308 30.317 1.00 24.01 ? 460 LYS A CA  1 
ATOM   1183 C  C   . LYS A 1 174 ? 9.849   47.872 30.233 1.00 23.16 ? 460 LYS A C   1 
ATOM   1184 O  O   . LYS A 1 174 ? 9.186   48.125 29.220 1.00 23.14 ? 460 LYS A O   1 
ATOM   1185 C  CB  . LYS A 1 174 ? 11.335  49.839 30.470 1.00 24.48 ? 460 LYS A CB  1 
ATOM   1186 C  CG  . LYS A 1 174 ? 12.761  50.394 30.635 1.00 27.15 ? 460 LYS A CG  1 
ATOM   1187 C  CD  . LYS A 1 174 ? 12.824  51.885 30.664 1.00 29.50 ? 460 LYS A CD  1 
ATOM   1188 C  CE  . LYS A 1 174 ? 14.339  52.401 30.648 1.00 27.61 ? 460 LYS A CE  1 
ATOM   1189 N  NZ  . LYS A 1 174 ? 14.738  52.724 32.031 1.00 30.17 ? 460 LYS A NZ  1 
ATOM   1190 N  N   . ILE A 1 175 ? 9.336   47.276 31.315 1.00 21.24 ? 461 ILE A N   1 
ATOM   1191 C  CA  . ILE A 1 175 ? 7.960   46.839 31.384 1.00 21.38 ? 461 ILE A CA  1 
ATOM   1192 C  C   . ILE A 1 175 ? 7.083   48.086 31.650 1.00 22.49 ? 461 ILE A C   1 
ATOM   1193 O  O   . ILE A 1 175 ? 7.417   48.852 32.588 1.00 22.48 ? 461 ILE A O   1 
ATOM   1194 C  CB  . ILE A 1 175 ? 7.803   45.903 32.584 1.00 21.54 ? 461 ILE A CB  1 
ATOM   1195 C  CG1 . ILE A 1 175 ? 8.637   44.605 32.359 1.00 22.13 ? 461 ILE A CG1 1 
ATOM   1196 C  CG2 . ILE A 1 175 ? 6.288   45.514 32.686 1.00 21.36 ? 461 ILE A CG2 1 
ATOM   1197 C  CD1 . ILE A 1 175 ? 8.782   43.738 33.632 1.00 23.29 ? 461 ILE A CD1 1 
ATOM   1198 N  N   . GLY A 1 176 ? 6.036   48.267 30.850 1.00 22.08 ? 462 GLY A N   1 
ATOM   1199 C  CA  . GLY A 1 176 ? 5.074   49.322 31.083 1.00 24.78 ? 462 GLY A CA  1 
ATOM   1200 C  C   . GLY A 1 176 ? 3.674   48.741 31.135 1.00 23.74 ? 462 GLY A C   1 
ATOM   1201 O  O   . GLY A 1 176 ? 3.491   47.497 31.235 1.00 23.05 ? 462 GLY A O   1 
ATOM   1202 N  N   . ASP A 1 177 ? 2.711   49.658 31.077 1.00 22.17 ? 463 ASP A N   1 
ATOM   1203 C  CA  . ASP A 1 177 ? 1.300   49.360 31.141 1.00 23.19 ? 463 ASP A CA  1 
ATOM   1204 C  C   . ASP A 1 177 ? 0.962   48.503 32.383 1.00 23.21 ? 463 ASP A C   1 
ATOM   1205 O  O   . ASP A 1 177 ? 0.715   47.278 32.278 1.00 23.11 ? 463 ASP A O   1 
ATOM   1206 C  CB  . ASP A 1 177 ? 0.736   48.709 29.860 1.00 22.76 ? 463 ASP A CB  1 
ATOM   1207 C  CG  . ASP A 1 177 ? -0.799  48.775 29.870 1.00 26.07 ? 463 ASP A CG  1 
ATOM   1208 O  OD1 . ASP A 1 177 ? -1.403  48.724 28.769 1.00 25.25 ? 463 ASP A OD1 1 
ATOM   1209 O  OD2 . ASP A 1 177 ? -1.446  49.011 30.940 1.00 23.75 ? 463 ASP A OD2 1 
ATOM   1210 N  N   . LEU A 1 178 ? 0.839   49.182 33.529 1.00 22.61 ? 464 LEU A N   1 
ATOM   1211 C  CA  . LEU A 1 178 ? 0.583   48.483 34.804 1.00 23.18 ? 464 LEU A CA  1 
ATOM   1212 C  C   . LEU A 1 178 ? -0.931  48.342 35.053 1.00 22.33 ? 464 LEU A C   1 
ATOM   1213 O  O   . LEU A 1 178 ? -1.351  48.162 36.189 1.00 23.04 ? 464 LEU A O   1 
ATOM   1214 C  CB  . LEU A 1 178 ? 1.255   49.234 35.975 1.00 22.77 ? 464 LEU A CB  1 
ATOM   1215 C  CG  . LEU A 1 178 ? 2.768   49.414 35.830 1.00 27.03 ? 464 LEU A CG  1 
ATOM   1216 C  CD1 . LEU A 1 178 ? 3.382   49.845 37.194 1.00 25.95 ? 464 LEU A CD1 1 
ATOM   1217 C  CD2 . LEU A 1 178 ? 3.503   48.155 35.258 1.00 29.89 ? 464 LEU A CD2 1 
ATOM   1218 N  N   . GLY A 1 179 ? -1.737  48.479 34.001 1.00 22.47 ? 465 GLY A N   1 
ATOM   1219 C  CA  . GLY A 1 179 ? -3.202  48.466 34.144 1.00 22.13 ? 465 GLY A CA  1 
ATOM   1220 C  C   . GLY A 1 179 ? -3.845  47.137 34.604 1.00 21.23 ? 465 GLY A C   1 
ATOM   1221 O  O   . GLY A 1 179 ? -5.019  47.112 34.950 1.00 21.42 ? 465 GLY A O   1 
ATOM   1222 N  N   . HIS A 1 180 ? -3.100  46.033 34.600 1.00 20.84 ? 466 HIS A N   1 
ATOM   1223 C  CA  . HIS A 1 180 ? -3.605  44.755 35.071 1.00 20.95 ? 466 HIS A CA  1 
ATOM   1224 C  C   . HIS A 1 180 ? -2.891  44.292 36.372 1.00 20.49 ? 466 HIS A C   1 
ATOM   1225 O  O   . HIS A 1 180 ? -3.145  43.200 36.850 1.00 20.58 ? 466 HIS A O   1 
ATOM   1226 C  CB  . HIS A 1 180 ? -3.424  43.657 33.991 1.00 21.71 ? 466 HIS A CB  1 
ATOM   1227 C  CG  . HIS A 1 180 ? -4.290  43.876 32.780 1.00 22.48 ? 466 HIS A CG  1 
ATOM   1228 N  ND1 . HIS A 1 180 ? -5.294  43.007 32.404 1.00 27.20 ? 466 HIS A ND1 1 
ATOM   1229 C  CD2 . HIS A 1 180 ? -4.287  44.866 31.856 1.00 23.88 ? 466 HIS A CD2 1 
ATOM   1230 C  CE1 . HIS A 1 180 ? -5.886  43.460 31.305 1.00 24.26 ? 466 HIS A CE1 1 
ATOM   1231 N  NE2 . HIS A 1 180 ? -5.301  44.593 30.960 1.00 30.27 ? 466 HIS A NE2 1 
ATOM   1232 N  N   . VAL A 1 181 ? -2.001  45.132 36.902 1.00 21.11 ? 467 VAL A N   1 
ATOM   1233 C  CA  . VAL A 1 181 ? -1.257  44.777 38.124 1.00 21.18 ? 467 VAL A CA  1 
ATOM   1234 C  C   . VAL A 1 181 ? -2.209  44.472 39.276 1.00 20.92 ? 467 VAL A C   1 
ATOM   1235 O  O   . VAL A 1 181 ? -3.231  45.196 39.482 1.00 20.86 ? 467 VAL A O   1 
ATOM   1236 C  CB  . VAL A 1 181 ? -0.272  45.889 38.535 1.00 20.98 ? 467 VAL A CB  1 
ATOM   1237 C  CG1 . VAL A 1 181 ? 0.370   45.568 39.948 1.00 20.60 ? 467 VAL A CG1 1 
ATOM   1238 C  CG2 . VAL A 1 181 ? 0.877   45.947 37.478 1.00 23.85 ? 467 VAL A CG2 1 
ATOM   1239 N  N   . THR A 1 182 ? -1.944  43.380 40.007 1.00 19.86 ? 468 THR A N   1 
ATOM   1240 C  CA  . THR A 1 182 ? -2.696  43.153 41.231 1.00 20.48 ? 468 THR A CA  1 
ATOM   1241 C  C   . THR A 1 182 ? -1.784  42.414 42.222 1.00 20.18 ? 468 THR A C   1 
ATOM   1242 O  O   . THR A 1 182 ? -0.686  41.962 41.855 1.00 21.16 ? 468 THR A O   1 
ATOM   1243 C  CB  . THR A 1 182 ? -3.957  42.343 40.888 1.00 21.59 ? 468 THR A CB  1 
ATOM   1244 O  OG1 . THR A 1 182 ? -4.840  42.342 41.981 1.00 26.10 ? 468 THR A OG1 1 
ATOM   1245 C  CG2 . THR A 1 182 ? -3.608  40.867 40.709 1.00 22.39 ? 468 THR A CG2 1 
ATOM   1246 N  N   . ARG A 1 183 ? -2.192  42.354 43.478 1.00 19.91 ? 469 ARG A N   1 
ATOM   1247 C  CA  . ARG A 1 183 ? -1.369  41.611 44.465 1.00 19.87 ? 469 ARG A CA  1 
ATOM   1248 C  C   . ARG A 1 183 ? -1.294  40.115 44.128 1.00 21.86 ? 469 ARG A C   1 
ATOM   1249 O  O   . ARG A 1 183 ? -2.209  39.536 43.568 1.00 21.51 ? 469 ARG A O   1 
ATOM   1250 C  CB  . ARG A 1 183 ? -1.868  41.797 45.892 1.00 18.54 ? 469 ARG A CB  1 
ATOM   1251 C  CG  . ARG A 1 183 ? -1.661  43.212 46.404 1.00 19.47 ? 469 ARG A CG  1 
ATOM   1252 C  CD  . ARG A 1 183 ? -0.185  43.565 46.754 1.00 18.57 ? 469 ARG A CD  1 
ATOM   1253 N  NE  . ARG A 1 183 ? 0.434   42.695 47.770 1.00 18.14 ? 469 ARG A NE  1 
ATOM   1254 C  CZ  . ARG A 1 183 ? 0.349   42.902 49.075 1.00 15.98 ? 469 ARG A CZ  1 
ATOM   1255 N  NH1 . ARG A 1 183 ? -0.347  43.988 49.548 1.00 17.36 ? 469 ARG A NH1 1 
ATOM   1256 N  NH2 . ARG A 1 183 ? 0.937   42.062 49.958 1.00 18.22 ? 469 ARG A NH2 1 
ATOM   1257 N  N   . ILE A 1 184 ? -0.203  39.485 44.549 1.00 21.48 ? 470 ILE A N   1 
ATOM   1258 C  CA  . ILE A 1 184 ? 0.054   38.116 44.145 1.00 23.36 ? 470 ILE A CA  1 
ATOM   1259 C  C   . ILE A 1 184 ? -0.968  37.124 44.644 1.00 22.95 ? 470 ILE A C   1 
ATOM   1260 O  O   . ILE A 1 184 ? -1.196  36.129 43.981 1.00 23.82 ? 470 ILE A O   1 
ATOM   1261 C  CB  . ILE A 1 184 ? 1.517   37.739 44.584 1.00 23.47 ? 470 ILE A CB  1 
ATOM   1262 C  CG1 . ILE A 1 184 ? 1.995   36.402 44.027 1.00 24.66 ? 470 ILE A CG1 1 
ATOM   1263 C  CG2 . ILE A 1 184 ? 1.574   37.708 46.125 1.00 22.71 ? 470 ILE A CG2 1 
ATOM   1264 C  CD1 . ILE A 1 184 ? 1.228   35.951 42.853 1.00 35.04 ? 470 ILE A CD1 1 
ATOM   1265 N  N   . SER A 1 185 ? -1.610  37.375 45.794 1.00 23.12 ? 471 SER A N   1 
ATOM   1266 C  CA  . SER A 1 185 ? -2.559  36.423 46.353 1.00 22.33 ? 471 SER A CA  1 
ATOM   1267 C  C   . SER A 1 185 ? -4.007  36.887 46.097 1.00 21.89 ? 471 SER A C   1 
ATOM   1268 O  O   . SER A 1 185 ? -4.913  36.474 46.793 1.00 21.26 ? 471 SER A O   1 
ATOM   1269 C  CB  . SER A 1 185 ? -2.308  36.196 47.883 1.00 22.68 ? 471 SER A CB  1 
ATOM   1270 O  OG  . SER A 1 185 ? -0.956  35.712 48.088 1.00 23.87 ? 471 SER A OG  1 
ATOM   1271 N  N   . SER A 1 186 ? -4.202  37.747 45.109 1.00 22.25 ? 472 SER A N   1 
ATOM   1272 C  CA  . SER A 1 186 ? -5.559  38.261 44.828 1.00 24.34 ? 472 SER A CA  1 
ATOM   1273 C  C   . SER A 1 186 ? -6.496  37.116 44.423 1.00 24.54 ? 472 SER A C   1 
ATOM   1274 O  O   . SER A 1 186 ? -6.133  36.307 43.572 1.00 25.90 ? 472 SER A O   1 
ATOM   1275 C  CB  . SER A 1 186 ? -5.534  39.214 43.647 1.00 24.48 ? 472 SER A CB  1 
ATOM   1276 O  OG  . SER A 1 186 ? -4.773  40.356 43.946 1.00 30.92 ? 472 SER A OG  1 
ATOM   1277 N  N   . PRO A 1 187 ? -7.697  37.109 44.971 1.00 25.34 ? 473 PRO A N   1 
ATOM   1278 C  CA  . PRO A 1 187 ? -8.697  36.075 44.658 1.00 26.21 ? 473 PRO A CA  1 
ATOM   1279 C  C   . PRO A 1 187 ? -9.464  36.438 43.378 1.00 26.88 ? 473 PRO A C   1 
ATOM   1280 O  O   . PRO A 1 187 ? -10.180 35.609 42.836 1.00 27.00 ? 473 PRO A O   1 
ATOM   1281 C  CB  . PRO A 1 187 ? -9.608  36.113 45.889 1.00 26.83 ? 473 PRO A CB  1 
ATOM   1282 C  CG  . PRO A 1 187 ? -9.601  37.547 46.247 1.00 26.96 ? 473 PRO A CG  1 
ATOM   1283 C  CD  . PRO A 1 187 ? -8.177  38.043 46.004 1.00 25.38 ? 473 PRO A CD  1 
ATOM   1284 N  N   . GLN A 1 188 ? -9.331  37.681 42.944 1.00 27.75 ? 474 GLN A N   1 
ATOM   1285 C  CA  . GLN A 1 188 ? -9.928  38.145 41.702 1.00 30.06 ? 474 GLN A CA  1 
ATOM   1286 C  C   . GLN A 1 188 ? -8.881  38.737 40.803 1.00 30.14 ? 474 GLN A C   1 
ATOM   1287 O  O   . GLN A 1 188 ? -8.028  39.510 41.244 1.00 31.51 ? 474 GLN A O   1 
ATOM   1288 C  CB  . GLN A 1 188 ? -11.011 39.155 41.961 1.00 30.94 ? 474 GLN A CB  1 
ATOM   1289 N  N   . VAL A 1 189 ? -8.906  38.380 39.527 1.00 29.83 ? 475 VAL A N   1 
ATOM   1290 C  CA  . VAL A 1 189 ? -7.943  38.969 38.609 1.00 31.21 ? 475 VAL A CA  1 
ATOM   1291 C  C   . VAL A 1 189 ? -8.580  39.381 37.279 1.00 31.51 ? 475 VAL A C   1 
ATOM   1292 O  O   . VAL A 1 189 ? -9.535  38.792 36.814 1.00 31.71 ? 475 VAL A O   1 
ATOM   1293 C  CB  . VAL A 1 189 ? -6.755  37.977 38.331 1.00 31.62 ? 475 VAL A CB  1 
ATOM   1294 C  CG1 . VAL A 1 189 ? -5.741  38.613 37.415 1.00 35.98 ? 475 VAL A CG1 1 
ATOM   1295 C  CG2 . VAL A 1 189 ? -6.087  37.531 39.642 1.00 30.19 ? 475 VAL A CG2 1 
ATOM   1296 N  N   . GLU A 1 190 ? -8.035  40.392 36.664 1.00 32.80 ? 476 GLU A N   1 
ATOM   1297 C  CA  . GLU A 1 190 ? -8.485  40.698 35.330 1.00 34.00 ? 476 GLU A CA  1 
ATOM   1298 C  C   . GLU A 1 190 ? -7.478  40.070 34.337 1.00 31.97 ? 476 GLU A C   1 
ATOM   1299 O  O   . GLU A 1 190 ? -6.264  40.344 34.366 1.00 29.85 ? 476 GLU A O   1 
ATOM   1300 C  CB  . GLU A 1 190 ? -8.604  42.202 35.122 1.00 36.34 ? 476 GLU A CB  1 
ATOM   1301 C  CG  . GLU A 1 190 ? -9.319  42.539 33.815 1.00 43.46 ? 476 GLU A CG  1 
ATOM   1302 C  CD  . GLU A 1 190 ? -10.821 42.292 33.866 1.00 49.75 ? 476 GLU A CD  1 
ATOM   1303 O  OE1 . GLU A 1 190 ? -11.251 41.122 33.747 1.00 54.05 ? 476 GLU A OE1 1 
ATOM   1304 O  OE2 . GLU A 1 190 ? -11.588 43.271 34.032 1.00 54.92 ? 476 GLU A OE2 1 
ATOM   1305 N  N   . GLU A 1 191 ? -8.013  39.220 33.491 1.00 30.33 ? 477 GLU A N   1 
ATOM   1306 C  CA  . GLU A 1 191 ? -7.276  38.482 32.472 1.00 31.08 ? 477 GLU A CA  1 
ATOM   1307 C  C   . GLU A 1 191 ? -6.534  39.376 31.510 1.00 28.41 ? 477 GLU A C   1 
ATOM   1308 O  O   . GLU A 1 191 ? -7.120  40.301 30.993 1.00 26.43 ? 477 GLU A O   1 
ATOM   1309 C  CB  . GLU A 1 191 ? -8.345  37.735 31.643 1.00 32.99 ? 477 GLU A CB  1 
ATOM   1310 C  CG  . GLU A 1 191 ? -7.833  36.449 31.151 1.00 40.18 ? 477 GLU A CG  1 
ATOM   1311 C  CD  . GLU A 1 191 ? -6.361  36.576 30.935 1.00 51.10 ? 477 GLU A CD  1 
ATOM   1312 O  OE1 . GLU A 1 191 ? -5.625  36.620 31.963 1.00 54.44 ? 477 GLU A OE1 1 
ATOM   1313 O  OE2 . GLU A 1 191 ? -5.937  36.664 29.753 1.00 56.23 ? 477 GLU A OE2 1 
ATOM   1314 N  N   . GLY A 1 192 ? -5.257  39.079 31.242 1.00 25.62 ? 478 GLY A N   1 
ATOM   1315 C  CA  . GLY A 1 192 ? -4.486  39.839 30.252 1.00 24.72 ? 478 GLY A CA  1 
ATOM   1316 C  C   . GLY A 1 192 ? -4.767  39.281 28.831 1.00 24.62 ? 478 GLY A C   1 
ATOM   1317 O  O   . GLY A 1 192 ? -5.682  38.470 28.647 1.00 24.67 ? 478 GLY A O   1 
ATOM   1318 N  N   . ASP A 1 193 ? -4.015  39.773 27.845 1.00 22.00 ? 479 ASP A N   1 
ATOM   1319 C  CA  . ASP A 1 193 ? -4.202  39.438 26.418 1.00 22.18 ? 479 ASP A CA  1 
ATOM   1320 C  C   . ASP A 1 193 ? -4.299  37.922 26.204 1.00 21.96 ? 479 ASP A C   1 
ATOM   1321 O  O   . ASP A 1 193 ? -3.425  37.176 26.634 1.00 22.10 ? 479 ASP A O   1 
ATOM   1322 C  CB  . ASP A 1 193 ? -3.011  40.013 25.643 1.00 23.05 ? 479 ASP A CB  1 
ATOM   1323 C  CG  . ASP A 1 193 ? -3.244  40.064 24.139 1.00 24.83 ? 479 ASP A CG  1 
ATOM   1324 O  OD1 . ASP A 1 193 ? -3.441  38.973 23.553 1.00 25.94 ? 479 ASP A OD1 1 
ATOM   1325 O  OD2 . ASP A 1 193 ? -3.276  41.170 23.481 1.00 26.38 ? 479 ASP A OD2 1 
ATOM   1326 N  N   . SER A 1 194 ? -5.343  37.486 25.515 1.00 22.64 ? 480 SER A N   1 
ATOM   1327 C  CA  . SER A 1 194 ? -5.576  36.069 25.273 1.00 25.06 ? 480 SER A CA  1 
ATOM   1328 C  C   . SER A 1 194 ? -4.394  35.359 24.613 1.00 24.48 ? 480 SER A C   1 
ATOM   1329 O  O   . SER A 1 194 ? -4.150  34.164 24.884 1.00 24.74 ? 480 SER A O   1 
ATOM   1330 C  CB  . SER A 1 194 ? -6.807  35.911 24.388 1.00 25.74 ? 480 SER A CB  1 
ATOM   1331 O  OG  . SER A 1 194 ? -6.894  34.559 23.983 1.00 36.79 ? 480 SER A OG  1 
ATOM   1332 N  N   . ARG A 1 195 ? -3.634  36.096 23.796 1.00 22.93 ? 481 ARG A N   1 
ATOM   1333 C  CA  . ARG A 1 195 ? -2.550  35.455 23.063 1.00 23.03 ? 481 ARG A CA  1 
ATOM   1334 C  C   . ARG A 1 195 ? -1.416  35.034 24.002 1.00 24.07 ? 481 ARG A C   1 
ATOM   1335 O  O   . ARG A 1 195 ? -0.653  34.098 23.683 1.00 23.91 ? 481 ARG A O   1 
ATOM   1336 C  CB  . ARG A 1 195 ? -1.984  36.434 22.024 1.00 23.07 ? 481 ARG A CB  1 
ATOM   1337 C  CG  . ARG A 1 195 ? -2.927  36.776 20.895 1.00 22.51 ? 481 ARG A CG  1 
ATOM   1338 C  CD  . ARG A 1 195 ? -2.347  37.958 20.052 1.00 28.62 ? 481 ARG A CD  1 
ATOM   1339 N  NE  . ARG A 1 195 ? -2.299  39.197 20.814 1.00 29.29 ? 481 ARG A NE  1 
ATOM   1340 C  CZ  . ARG A 1 195 ? -1.413  40.189 20.664 1.00 36.40 ? 481 ARG A CZ  1 
ATOM   1341 N  NH1 . ARG A 1 195 ? -0.421  40.141 19.751 1.00 38.62 ? 481 ARG A NH1 1 
ATOM   1342 N  NH2 . ARG A 1 195 ? -1.532  41.277 21.425 1.00 35.15 ? 481 ARG A NH2 1 
ATOM   1343 N  N   . PHE A 1 196 ? -1.302  35.695 25.151 1.00 22.79 ? 482 PHE A N   1 
ATOM   1344 C  CA  . PHE A 1 196 ? -0.188  35.401 26.099 1.00 22.26 ? 482 PHE A CA  1 
ATOM   1345 C  C   . PHE A 1 196 ? -0.660  34.789 27.397 1.00 22.13 ? 482 PHE A C   1 
ATOM   1346 O  O   . PHE A 1 196 ? 0.116   34.620 28.342 1.00 22.17 ? 482 PHE A O   1 
ATOM   1347 C  CB  . PHE A 1 196 ? 0.622   36.671 26.369 1.00 23.17 ? 482 PHE A CB  1 
ATOM   1348 C  CG  . PHE A 1 196 ? 1.203   37.245 25.130 1.00 21.30 ? 482 PHE A CG  1 
ATOM   1349 C  CD1 . PHE A 1 196 ? 0.410   38.046 24.305 1.00 22.59 ? 482 PHE A CD1 1 
ATOM   1350 C  CD2 . PHE A 1 196 ? 2.534   36.952 24.754 1.00 22.37 ? 482 PHE A CD2 1 
ATOM   1351 C  CE1 . PHE A 1 196 ? 0.939   38.576 23.097 1.00 23.12 ? 482 PHE A CE1 1 
ATOM   1352 C  CE2 . PHE A 1 196 ? 3.053   37.443 23.521 1.00 21.20 ? 482 PHE A CE2 1 
ATOM   1353 C  CZ  . PHE A 1 196 ? 2.261   38.260 22.708 1.00 23.33 ? 482 PHE A CZ  1 
ATOM   1354 N  N   . LEU A 1 197 ? -1.928  34.413 27.429 1.00 20.87 ? 483 LEU A N   1 
ATOM   1355 C  CA  . LEU A 1 197 ? -2.546  33.984 28.673 1.00 22.72 ? 483 LEU A CA  1 
ATOM   1356 C  C   . LEU A 1 197 ? -2.320  32.533 29.003 1.00 22.10 ? 483 LEU A C   1 
ATOM   1357 O  O   . LEU A 1 197 ? -2.583  31.674 28.149 1.00 20.71 ? 483 LEU A O   1 
ATOM   1358 C  CB  . LEU A 1 197 ? -4.031  34.228 28.567 1.00 21.51 ? 483 LEU A CB  1 
ATOM   1359 C  CG  . LEU A 1 197 ? -4.823  33.988 29.871 1.00 25.30 ? 483 LEU A CG  1 
ATOM   1360 C  CD1 . LEU A 1 197 ? -4.310  34.966 30.996 1.00 27.37 ? 483 LEU A CD1 1 
ATOM   1361 C  CD2 . LEU A 1 197 ? -6.296  34.159 29.530 1.00 26.85 ? 483 LEU A CD2 1 
ATOM   1362 N  N   . ALA A 1 198 ? -1.819  32.259 30.222 1.00 22.44 ? 484 ALA A N   1 
ATOM   1363 C  CA  . ALA A 1 198 ? -1.671  30.849 30.644 1.00 21.03 ? 484 ALA A CA  1 
ATOM   1364 C  C   . ALA A 1 198 ? -3.047  30.226 30.931 1.00 21.52 ? 484 ALA A C   1 
ATOM   1365 O  O   . ALA A 1 198 ? -3.944  30.905 31.429 1.00 21.43 ? 484 ALA A O   1 
ATOM   1366 C  CB  . ALA A 1 198 ? -0.776  30.724 31.892 1.00 21.15 ? 484 ALA A CB  1 
ATOM   1367 N  N   . ASN A 1 199 ? -3.177  28.923 30.678 1.00 20.73 ? 485 ASN A N   1 
ATOM   1368 C  CA  . ASN A 1 199 ? -4.423  28.220 30.835 1.00 21.76 ? 485 ASN A CA  1 
ATOM   1369 C  C   . ASN A 1 199 ? -4.959  28.270 32.246 1.00 22.30 ? 485 ASN A C   1 
ATOM   1370 O  O   . ASN A 1 199 ? -6.184  28.374 32.477 1.00 22.13 ? 485 ASN A O   1 
ATOM   1371 C  CB  . ASN A 1 199 ? -4.262  26.757 30.454 1.00 21.62 ? 485 ASN A CB  1 
ATOM   1372 C  CG  . ASN A 1 199 ? -5.600  26.046 30.333 1.00 23.26 ? 485 ASN A CG  1 
ATOM   1373 O  OD1 . ASN A 1 199 ? -5.922  25.087 31.075 1.00 27.39 ? 485 ASN A OD1 1 
ATOM   1374 N  ND2 . ASN A 1 199 ? -6.407  26.521 29.422 1.00 20.82 ? 485 ASN A ND2 1 
ATOM   1375 N  N   . GLU A 1 200 ? -4.056  28.161 33.216 1.00 22.97 ? 486 GLU A N   1 
ATOM   1376 C  CA  . GLU A 1 200 ? -4.540  28.073 34.605 1.00 23.06 ? 486 GLU A CA  1 
ATOM   1377 C  C   . GLU A 1 200 ? -5.291  29.354 34.990 1.00 23.44 ? 486 GLU A C   1 
ATOM   1378 O  O   . GLU A 1 200 ? -6.295  29.285 35.714 1.00 23.69 ? 486 GLU A O   1 
ATOM   1379 C  CB  . GLU A 1 200 ? -3.399  27.770 35.578 1.00 23.21 ? 486 GLU A CB  1 
ATOM   1380 C  CG  . GLU A 1 200 ? -2.423  28.896 35.814 1.00 21.73 ? 486 GLU A CG  1 
ATOM   1381 C  CD  . GLU A 1 200 ? -1.222  28.823 34.838 1.00 26.32 ? 486 GLU A CD  1 
ATOM   1382 O  OE1 . GLU A 1 200 ? -0.259  29.594 35.035 1.00 25.83 ? 486 GLU A OE1 1 
ATOM   1383 O  OE2 . GLU A 1 200 ? -1.262  28.016 33.883 1.00 25.86 ? 486 GLU A OE2 1 
ATOM   1384 N  N   . VAL A 1 201 ? -4.827  30.496 34.457 1.00 23.30 ? 487 VAL A N   1 
ATOM   1385 C  CA  . VAL A 1 201 ? -5.474  31.774 34.734 1.00 23.69 ? 487 VAL A CA  1 
ATOM   1386 C  C   . VAL A 1 201 ? -6.826  31.785 34.073 1.00 24.52 ? 487 VAL A C   1 
ATOM   1387 O  O   . VAL A 1 201 ? -7.844  32.116 34.737 1.00 24.93 ? 487 VAL A O   1 
ATOM   1388 C  CB  . VAL A 1 201 ? -4.691  32.944 34.271 1.00 24.66 ? 487 VAL A CB  1 
ATOM   1389 C  CG1 . VAL A 1 201 ? -5.456  34.259 34.531 1.00 23.42 ? 487 VAL A CG1 1 
ATOM   1390 C  CG2 . VAL A 1 201 ? -3.321  32.970 34.971 1.00 24.95 ? 487 VAL A CG2 1 
ATOM   1391 N  N   . LEU A 1 202 ? -6.869  31.400 32.799 1.00 24.26 ? 488 LEU A N   1 
ATOM   1392 C  CA  . LEU A 1 202 ? -8.149  31.245 32.132 1.00 24.73 ? 488 LEU A CA  1 
ATOM   1393 C  C   . LEU A 1 202 ? -9.059  30.327 32.963 1.00 25.48 ? 488 LEU A C   1 
ATOM   1394 O  O   . LEU A 1 202 ? -10.272 30.530 33.016 1.00 25.35 ? 488 LEU A O   1 
ATOM   1395 C  CB  . LEU A 1 202 ? -7.972  30.626 30.750 1.00 25.43 ? 488 LEU A CB  1 
ATOM   1396 C  CG  . LEU A 1 202 ? -9.248  30.293 29.951 1.00 27.07 ? 488 LEU A CG  1 
ATOM   1397 C  CD1 . LEU A 1 202 ? -9.837  31.599 29.440 1.00 31.87 ? 488 LEU A CD1 1 
ATOM   1398 C  CD2 . LEU A 1 202 ? -8.903  29.413 28.783 1.00 31.97 ? 488 LEU A CD2 1 
ATOM   1399 N  N   . GLN A 1 203 ? -8.503  29.277 33.571 1.00 25.58 ? 489 GLN A N   1 
ATOM   1400 C  CA  . GLN A 1 203 ? -9.345  28.353 34.332 1.00 25.06 ? 489 GLN A CA  1 
ATOM   1401 C  C   . GLN A 1 203 ? -9.707  28.880 35.735 1.00 25.84 ? 489 GLN A C   1 
ATOM   1402 O  O   . GLN A 1 203 ? -10.323 28.187 36.525 1.00 24.78 ? 489 GLN A O   1 
ATOM   1403 C  CB  . GLN A 1 203 ? -8.689  26.969 34.471 1.00 26.09 ? 489 GLN A CB  1 
ATOM   1404 C  CG  . GLN A 1 203 ? -8.545  26.194 33.169 1.00 24.64 ? 489 GLN A CG  1 
ATOM   1405 C  CD  . GLN A 1 203 ? -9.774  26.328 32.284 1.00 31.11 ? 489 GLN A CD  1 
ATOM   1406 O  OE1 . GLN A 1 203 ? -10.906 26.057 32.707 1.00 30.62 ? 489 GLN A OE1 1 
ATOM   1407 N  NE2 . GLN A 1 203 ? -9.557  26.783 31.060 1.00 34.80 ? 489 GLN A NE2 1 
ATOM   1408 N  N   . GLU A 1 204 ? -9.313  30.106 36.035 1.00 26.14 ? 490 GLU A N   1 
ATOM   1409 C  CA  . GLU A 1 204 ? -9.629  30.743 37.313 1.00 26.33 ? 490 GLU A CA  1 
ATOM   1410 C  C   . GLU A 1 204 ? -8.875  30.158 38.505 1.00 26.06 ? 490 GLU A C   1 
ATOM   1411 O  O   . GLU A 1 204 ? -9.355  30.213 39.644 1.00 25.16 ? 490 GLU A O   1 
ATOM   1412 C  CB  . GLU A 1 204 ? -11.157 30.817 37.558 1.00 28.06 ? 490 GLU A CB  1 
ATOM   1413 C  CG  . GLU A 1 204 ? -11.858 31.827 36.643 1.00 31.43 ? 490 GLU A CG  1 
ATOM   1414 C  CD  . GLU A 1 204 ? -13.387 31.785 36.719 1.00 39.70 ? 490 GLU A CD  1 
ATOM   1415 O  OE1 . GLU A 1 204 ? -14.006 30.719 36.537 1.00 41.76 ? 490 GLU A OE1 1 
ATOM   1416 O  OE2 . GLU A 1 204 ? -13.984 32.844 36.941 1.00 42.89 ? 490 GLU A OE2 1 
ATOM   1417 N  N   . ASN A 1 205 ? -7.693  29.610 38.238 1.00 24.67 ? 491 ASN A N   1 
ATOM   1418 C  CA  . ASN A 1 205 ? -6.843  29.049 39.261 1.00 24.85 ? 491 ASN A CA  1 
ATOM   1419 C  C   . ASN A 1 205 ? -5.724  30.039 39.491 1.00 24.19 ? 491 ASN A C   1 
ATOM   1420 O  O   . ASN A 1 205 ? -4.833  30.146 38.679 1.00 25.39 ? 491 ASN A O   1 
ATOM   1421 C  CB  . ASN A 1 205 ? -6.250  27.747 38.770 1.00 26.52 ? 491 ASN A CB  1 
ATOM   1422 C  CG  . ASN A 1 205 ? -5.505  27.015 39.846 1.00 31.30 ? 491 ASN A CG  1 
ATOM   1423 O  OD1 . ASN A 1 205 ? -4.920  27.624 40.770 1.00 33.39 ? 491 ASN A OD1 1 
ATOM   1424 N  ND2 . ASN A 1 205 ? -5.576  25.693 39.788 1.00 37.81 ? 491 ASN A ND2 1 
ATOM   1425 N  N   . TYR A 1 206 ? -5.767  30.770 40.595 1.00 23.56 ? 492 TYR A N   1 
ATOM   1426 C  CA  . TYR A 1 206 ? -4.814  31.847 40.844 1.00 24.95 ? 492 TYR A CA  1 
ATOM   1427 C  C   . TYR A 1 206 ? -3.765  31.527 41.917 1.00 26.20 ? 492 TYR A C   1 
ATOM   1428 O  O   . TYR A 1 206 ? -3.231  32.449 42.568 1.00 25.49 ? 492 TYR A O   1 
ATOM   1429 C  CB  . TYR A 1 206 ? -5.587  33.103 41.267 1.00 25.37 ? 492 TYR A CB  1 
ATOM   1430 C  CG  . TYR A 1 206 ? -6.704  33.454 40.300 1.00 27.30 ? 492 TYR A CG  1 
ATOM   1431 C  CD1 . TYR A 1 206 ? -7.943  33.911 40.774 1.00 29.60 ? 492 TYR A CD1 1 
ATOM   1432 C  CD2 . TYR A 1 206 ? -6.526  33.324 38.910 1.00 26.08 ? 492 TYR A CD2 1 
ATOM   1433 C  CE1 . TYR A 1 206 ? -8.997  34.249 39.915 1.00 27.51 ? 492 TYR A CE1 1 
ATOM   1434 C  CE2 . TYR A 1 206 ? -7.573  33.680 38.028 1.00 28.95 ? 492 TYR A CE2 1 
ATOM   1435 C  CZ  . TYR A 1 206 ? -8.816  34.129 38.557 1.00 28.08 ? 492 TYR A CZ  1 
ATOM   1436 O  OH  . TYR A 1 206 ? -9.879  34.482 37.761 1.00 24.27 ? 492 TYR A OH  1 
ATOM   1437 N  N   . THR A 1 207 ? -3.474  30.235 42.082 1.00 24.76 ? 493 THR A N   1 
ATOM   1438 C  CA  . THR A 1 207 ? -2.541  29.788 43.093 1.00 27.14 ? 493 THR A CA  1 
ATOM   1439 C  C   . THR A 1 207 ? -1.063  30.110 42.787 1.00 25.84 ? 493 THR A C   1 
ATOM   1440 O  O   . THR A 1 207 ? -0.268  30.210 43.720 1.00 26.08 ? 493 THR A O   1 
ATOM   1441 C  CB  . THR A 1 207 ? -2.794  28.255 43.351 1.00 27.94 ? 493 THR A CB  1 
ATOM   1442 O  OG1 . THR A 1 207 ? -1.762  27.695 44.170 1.00 33.17 ? 493 THR A OG1 1 
ATOM   1443 C  CG2 . THR A 1 207 ? -2.647  27.515 42.066 1.00 31.14 ? 493 THR A CG2 1 
ATOM   1444 N  N   . HIS A 1 208 ? -0.734  30.382 41.525 1.00 23.93 ? 494 HIS A N   1 
ATOM   1445 C  CA  . HIS A 1 208 ? 0.661   30.636 41.143 1.00 23.64 ? 494 HIS A CA  1 
ATOM   1446 C  C   . HIS A 1 208 ? 0.731   31.771 40.144 1.00 22.99 ? 494 HIS A C   1 
ATOM   1447 O  O   . HIS A 1 208 ? 1.329   31.660 39.057 1.00 21.85 ? 494 HIS A O   1 
ATOM   1448 C  CB  . HIS A 1 208 ? 1.322   29.364 40.572 1.00 24.50 ? 494 HIS A CB  1 
ATOM   1449 C  CG  . HIS A 1 208 ? 1.255   28.163 41.471 1.00 26.96 ? 494 HIS A CG  1 
ATOM   1450 N  ND1 . HIS A 1 208 ? 1.919   28.088 42.683 1.00 32.25 ? 494 HIS A ND1 1 
ATOM   1451 C  CD2 . HIS A 1 208 ? 0.632   26.970 41.311 1.00 28.41 ? 494 HIS A CD2 1 
ATOM   1452 C  CE1 . HIS A 1 208 ? 1.682   26.908 43.244 1.00 33.20 ? 494 HIS A CE1 1 
ATOM   1453 N  NE2 . HIS A 1 208 ? 0.919   26.205 42.420 1.00 32.24 ? 494 HIS A NE2 1 
ATOM   1454 N  N   . LEU A 1 209 ? 0.082   32.890 40.493 1.00 22.61 ? 495 LEU A N   1 
ATOM   1455 C  CA  . LEU A 1 209 ? 0.084   34.012 39.572 1.00 23.50 ? 495 LEU A CA  1 
ATOM   1456 C  C   . LEU A 1 209 ? 1.390   34.464 38.950 1.00 21.59 ? 495 LEU A C   1 
ATOM   1457 O  O   . LEU A 1 209 ? 1.402   34.789 37.777 1.00 22.17 ? 495 LEU A O   1 
ATOM   1458 C  CB  . LEU A 1 209 ? -0.624  35.181 40.200 1.00 24.50 ? 495 LEU A CB  1 
ATOM   1459 C  CG  . LEU A 1 209 ? -2.053  35.555 39.806 1.00 29.47 ? 495 LEU A CG  1 
ATOM   1460 C  CD1 . LEU A 1 209 ? -2.906  34.574 38.980 1.00 23.06 ? 495 LEU A CD1 1 
ATOM   1461 C  CD2 . LEU A 1 209 ? -2.735  36.144 41.018 1.00 25.22 ? 495 LEU A CD2 1 
ATOM   1462 N  N   . PRO A 1 210 ? 2.478   34.508 39.703 1.00 21.07 ? 496 PRO A N   1 
ATOM   1463 C  CA  . PRO A 1 210 ? 3.759   34.977 39.143 1.00 21.80 ? 496 PRO A CA  1 
ATOM   1464 C  C   . PRO A 1 210 ? 4.177   34.134 37.925 1.00 21.37 ? 496 PRO A C   1 
ATOM   1465 O  O   . PRO A 1 210 ? 4.783   34.667 37.015 1.00 21.73 ? 496 PRO A O   1 
ATOM   1466 C  CB  . PRO A 1 210 ? 4.752   34.804 40.303 1.00 22.75 ? 496 PRO A CB  1 
ATOM   1467 C  CG  . PRO A 1 210 ? 3.825   34.923 41.590 1.00 21.58 ? 496 PRO A CG  1 
ATOM   1468 C  CD  . PRO A 1 210 ? 2.607   34.090 41.111 1.00 19.31 ? 496 PRO A CD  1 
ATOM   1469 N  N   . LYS A 1 211 ? 3.808   32.858 37.902 1.00 22.29 ? 497 LYS A N   1 
ATOM   1470 C  CA  . LYS A 1 211 ? 4.154   31.937 36.802 1.00 20.77 ? 497 LYS A CA  1 
ATOM   1471 C  C   . LYS A 1 211 ? 3.366   32.264 35.522 1.00 22.15 ? 497 LYS A C   1 
ATOM   1472 O  O   . LYS A 1 211 ? 3.743   31.869 34.409 1.00 20.46 ? 497 LYS A O   1 
ATOM   1473 C  CB  . LYS A 1 211 ? 3.910   30.469 37.256 1.00 21.60 ? 497 LYS A CB  1 
ATOM   1474 C  CG  . LYS A 1 211 ? 4.757   30.066 38.486 1.00 21.38 ? 497 LYS A CG  1 
ATOM   1475 C  CD  . LYS A 1 211 ? 6.288   30.415 38.197 1.00 22.56 ? 497 LYS A CD  1 
ATOM   1476 C  CE  . LYS A 1 211 ? 7.235   29.926 39.359 1.00 25.32 ? 497 LYS A CE  1 
ATOM   1477 N  NZ  . LYS A 1 211 ? 7.099   28.426 39.654 1.00 25.04 ? 497 LYS A NZ  1 
ATOM   1478 N  N   . ALA A 1 212 ? 2.237   32.967 35.683 1.00 22.05 ? 498 ALA A N   1 
ATOM   1479 C  CA  . ALA A 1 212 ? 1.527   33.462 34.516 1.00 22.98 ? 498 ALA A CA  1 
ATOM   1480 C  C   . ALA A 1 212 ? 2.390   34.543 33.803 1.00 22.68 ? 498 ALA A C   1 
ATOM   1481 O  O   . ALA A 1 212 ? 2.440   34.562 32.560 1.00 21.56 ? 498 ALA A O   1 
ATOM   1482 C  CB  . ALA A 1 212 ? 0.128   34.047 34.935 1.00 21.80 ? 498 ALA A CB  1 
ATOM   1483 N  N   . ASP A 1 213 ? 3.097   35.384 34.579 1.00 21.91 ? 499 ASP A N   1 
ATOM   1484 C  CA  . ASP A 1 213 ? 3.952   36.413 33.975 1.00 21.98 ? 499 ASP A CA  1 
ATOM   1485 C  C   . ASP A 1 213 ? 5.131   35.712 33.257 1.00 21.15 ? 499 ASP A C   1 
ATOM   1486 O  O   . ASP A 1 213 ? 5.557   36.160 32.188 1.00 20.55 ? 499 ASP A O   1 
ATOM   1487 C  CB  . ASP A 1 213 ? 4.538   37.362 35.018 1.00 21.66 ? 499 ASP A CB  1 
ATOM   1488 C  CG  . ASP A 1 213 ? 3.556   38.424 35.517 1.00 22.45 ? 499 ASP A CG  1 
ATOM   1489 O  OD1 . ASP A 1 213 ? 2.532   38.658 34.844 1.00 22.54 ? 499 ASP A OD1 1 
ATOM   1490 O  OD2 . ASP A 1 213 ? 3.763   39.037 36.617 1.00 23.59 ? 499 ASP A OD2 1 
ATOM   1491 N  N   . ILE A 1 214 ? 5.618   34.625 33.855 1.00 20.51 ? 500 ILE A N   1 
ATOM   1492 C  CA  . ILE A 1 214 ? 6.734   33.863 33.221 1.00 20.64 ? 500 ILE A CA  1 
ATOM   1493 C  C   . ILE A 1 214 ? 6.278   33.280 31.887 1.00 20.54 ? 500 ILE A C   1 
ATOM   1494 O  O   . ILE A 1 214 ? 6.989   33.340 30.904 1.00 20.71 ? 500 ILE A O   1 
ATOM   1495 C  CB  . ILE A 1 214 ? 7.225   32.714 34.193 1.00 21.33 ? 500 ILE A CB  1 
ATOM   1496 C  CG1 . ILE A 1 214 ? 7.789   33.351 35.484 1.00 22.59 ? 500 ILE A CG1 1 
ATOM   1497 C  CG2 . ILE A 1 214 ? 8.256   31.796 33.469 1.00 23.07 ? 500 ILE A CG2 1 
ATOM   1498 C  CD1 . ILE A 1 214 ? 9.153   34.041 35.234 1.00 25.44 ? 500 ILE A CD1 1 
ATOM   1499 N  N   . PHE A 1 215 ? 5.122   32.631 31.872 1.00 19.94 ? 501 PHE A N   1 
ATOM   1500 C  CA  . PHE A 1 215 ? 4.568   32.068 30.653 1.00 20.30 ? 501 PHE A CA  1 
ATOM   1501 C  C   . PHE A 1 215 ? 4.418   33.131 29.540 1.00 20.43 ? 501 PHE A C   1 
ATOM   1502 O  O   . PHE A 1 215 ? 4.803   32.911 28.391 1.00 21.10 ? 501 PHE A O   1 
ATOM   1503 C  CB  . PHE A 1 215 ? 3.187   31.468 31.021 1.00 20.90 ? 501 PHE A CB  1 
ATOM   1504 C  CG  . PHE A 1 215 ? 2.462   30.889 29.838 1.00 22.45 ? 501 PHE A CG  1 
ATOM   1505 C  CD1 . PHE A 1 215 ? 2.486   29.510 29.605 1.00 21.35 ? 501 PHE A CD1 1 
ATOM   1506 C  CD2 . PHE A 1 215 ? 1.723   31.694 28.979 1.00 21.26 ? 501 PHE A CD2 1 
ATOM   1507 C  CE1 . PHE A 1 215 ? 1.783   28.968 28.540 1.00 19.68 ? 501 PHE A CE1 1 
ATOM   1508 C  CE2 . PHE A 1 215 ? 0.981   31.129 27.915 1.00 20.19 ? 501 PHE A CE2 1 
ATOM   1509 C  CZ  . PHE A 1 215 ? 1.060   29.750 27.677 1.00 20.71 ? 501 PHE A CZ  1 
ATOM   1510 N  N   . ALA A 1 216 ? 3.873   34.292 29.880 1.00 19.45 ? 502 ALA A N   1 
ATOM   1511 C  CA  . ALA A 1 216 ? 3.719   35.368 28.882 1.00 20.06 ? 502 ALA A CA  1 
ATOM   1512 C  C   . ALA A 1 216 ? 5.077   35.913 28.402 1.00 19.49 ? 502 ALA A C   1 
ATOM   1513 O  O   . ALA A 1 216 ? 5.211   36.248 27.249 1.00 21.74 ? 502 ALA A O   1 
ATOM   1514 C  CB  . ALA A 1 216 ? 2.903   36.537 29.572 1.00 21.37 ? 502 ALA A CB  1 
ATOM   1515 N  N   . LEU A 1 217 ? 6.052   36.010 29.287 1.00 20.32 ? 503 LEU A N   1 
ATOM   1516 C  CA  . LEU A 1 217 ? 7.396   36.486 28.884 1.00 20.86 ? 503 LEU A CA  1 
ATOM   1517 C  C   . LEU A 1 217 ? 7.994   35.486 27.885 1.00 21.98 ? 503 LEU A C   1 
ATOM   1518 O  O   . LEU A 1 217 ? 8.635   35.901 26.927 1.00 20.73 ? 503 LEU A O   1 
ATOM   1519 C  CB  . LEU A 1 217 ? 8.287   36.477 30.109 1.00 22.07 ? 503 LEU A CB  1 
ATOM   1520 C  CG  . LEU A 1 217 ? 9.511   37.395 30.139 1.00 30.15 ? 503 LEU A CG  1 
ATOM   1521 C  CD1 . LEU A 1 217 ? 10.621  37.092 31.158 1.00 27.06 ? 503 LEU A CD1 1 
ATOM   1522 C  CD2 . LEU A 1 217 ? 9.981   38.144 28.885 1.00 23.65 ? 503 LEU A CD2 1 
ATOM   1523 N  N   . ALA A 1 218 ? 7.884   34.167 28.151 1.00 21.89 ? 504 ALA A N   1 
ATOM   1524 C  CA  . ALA A 1 218 ? 8.402   33.241 27.118 1.00 21.12 ? 504 ALA A CA  1 
ATOM   1525 C  C   . ALA A 1 218 ? 7.765   33.435 25.757 1.00 21.34 ? 504 ALA A C   1 
ATOM   1526 O  O   . ALA A 1 218 ? 8.450   33.459 24.744 1.00 20.18 ? 504 ALA A O   1 
ATOM   1527 C  CB  . ALA A 1 218 ? 8.268   31.707 27.554 1.00 21.60 ? 504 ALA A CB  1 
ATOM   1528 N  N   . LEU A 1 219 ? 6.445   33.576 25.701 1.00 20.75 ? 505 LEU A N   1 
ATOM   1529 C  CA  . LEU A 1 219 ? 5.811   33.793 24.419 1.00 21.67 ? 505 LEU A CA  1 
ATOM   1530 C  C   . LEU A 1 219 ? 6.217   35.148 23.839 1.00 20.24 ? 505 LEU A C   1 
ATOM   1531 O  O   . LEU A 1 219 ? 6.277   35.319 22.604 1.00 19.85 ? 505 LEU A O   1 
ATOM   1532 C  CB  . LEU A 1 219 ? 4.310   33.720 24.604 1.00 22.30 ? 505 LEU A CB  1 
ATOM   1533 C  CG  . LEU A 1 219 ? 3.620   32.367 24.348 1.00 27.66 ? 505 LEU A CG  1 
ATOM   1534 C  CD1 . LEU A 1 219 ? 4.516   31.149 24.049 1.00 27.96 ? 505 LEU A CD1 1 
ATOM   1535 C  CD2 . LEU A 1 219 ? 2.343   32.131 25.070 1.00 26.13 ? 505 LEU A CD2 1 
ATOM   1536 N  N   . THR A 1 220 ? 6.436   36.130 24.713 1.00 21.04 ? 506 THR A N   1 
ATOM   1537 C  CA  . THR A 1 220 ? 6.956   37.414 24.209 1.00 20.91 ? 506 THR A CA  1 
ATOM   1538 C  C   . THR A 1 220 ? 8.312   37.199 23.483 1.00 21.51 ? 506 THR A C   1 
ATOM   1539 O  O   . THR A 1 220 ? 8.589   37.760 22.417 1.00 21.67 ? 506 THR A O   1 
ATOM   1540 C  CB  . THR A 1 220 ? 7.109   38.397 25.412 1.00 21.92 ? 506 THR A CB  1 
ATOM   1541 O  OG1 . THR A 1 220 ? 5.768   38.753 25.857 1.00 20.75 ? 506 THR A OG1 1 
ATOM   1542 C  CG2 . THR A 1 220 ? 7.757   39.767 24.943 1.00 22.46 ? 506 THR A CG2 1 
ATOM   1543 N  N   . VAL A 1 221 ? 9.188   36.403 24.078 1.00 20.40 ? 507 VAL A N   1 
ATOM   1544 C  CA  . VAL A 1 221 ? 10.502  36.156 23.450 1.00 20.52 ? 507 VAL A CA  1 
ATOM   1545 C  C   . VAL A 1 221 ? 10.358  35.368 22.135 1.00 19.69 ? 507 VAL A C   1 
ATOM   1546 O  O   . VAL A 1 221 ? 11.085  35.577 21.220 1.00 19.90 ? 507 VAL A O   1 
ATOM   1547 C  CB  . VAL A 1 221 ? 11.398  35.401 24.443 1.00 20.59 ? 507 VAL A CB  1 
ATOM   1548 C  CG1 . VAL A 1 221 ? 12.728  34.889 23.803 1.00 21.86 ? 507 VAL A CG1 1 
ATOM   1549 C  CG2 . VAL A 1 221 ? 11.711  36.325 25.651 1.00 22.50 ? 507 VAL A CG2 1 
ATOM   1550 N  N   . VAL A 1 222 ? 9.397   34.455 22.092 1.00 19.79 ? 508 VAL A N   1 
ATOM   1551 C  CA  . VAL A 1 222 ? 9.103   33.723 20.873 1.00 20.87 ? 508 VAL A CA  1 
ATOM   1552 C  C   . VAL A 1 222 ? 8.694   34.671 19.759 1.00 20.45 ? 508 VAL A C   1 
ATOM   1553 O  O   . VAL A 1 222 ? 9.107   34.521 18.621 1.00 19.14 ? 508 VAL A O   1 
ATOM   1554 C  CB  . VAL A 1 222 ? 8.017   32.615 21.138 1.00 20.36 ? 508 VAL A CB  1 
ATOM   1555 C  CG1 . VAL A 1 222 ? 7.532   31.926 19.819 1.00 21.29 ? 508 VAL A CG1 1 
ATOM   1556 C  CG2 . VAL A 1 222 ? 8.604   31.501 22.077 1.00 22.64 ? 508 VAL A CG2 1 
ATOM   1557 N  N   . CYS A 1 223 ? 7.860   35.661 20.085 1.00 21.34 ? 509 CYS A N   1 
ATOM   1558 C  CA  . CYS A 1 223 ? 7.489   36.662 19.093 1.00 21.93 ? 509 CYS A CA  1 
ATOM   1559 C  C   . CYS A 1 223 ? 8.751   37.421 18.612 1.00 21.58 ? 509 CYS A C   1 
ATOM   1560 O  O   . CYS A 1 223 ? 8.930   37.639 17.396 1.00 20.89 ? 509 CYS A O   1 
ATOM   1561 C  CB  . CYS A 1 223 ? 6.496   37.698 19.666 1.00 22.29 ? 509 CYS A CB  1 
ATOM   1562 S  SG  . CYS A 1 223 ? 4.854   37.043 20.049 1.00 26.44 ? 509 CYS A SG  1 
ATOM   1563 N  N   . ALA A 1 224 ? 9.613   37.819 19.543 1.00 20.91 ? 510 ALA A N   1 
ATOM   1564 C  CA  . ALA A 1 224 ? 10.849  38.487 19.134 1.00 20.51 ? 510 ALA A CA  1 
ATOM   1565 C  C   . ALA A 1 224 ? 11.794  37.612 18.253 1.00 19.36 ? 510 ALA A C   1 
ATOM   1566 O  O   . ALA A 1 224 ? 12.561  38.113 17.464 1.00 21.04 ? 510 ALA A O   1 
ATOM   1567 C  CB  . ALA A 1 224 ? 11.602  38.955 20.403 1.00 21.03 ? 510 ALA A CB  1 
ATOM   1568 N  N   . ALA A 1 225 ? 11.715  36.306 18.428 1.00 20.89 ? 511 ALA A N   1 
ATOM   1569 C  CA  . ALA A 1 225 ? 12.546  35.365 17.678 1.00 21.22 ? 511 ALA A CA  1 
ATOM   1570 C  C   . ALA A 1 225 ? 12.040  35.197 16.237 1.00 20.62 ? 511 ALA A C   1 
ATOM   1571 O  O   . ALA A 1 225 ? 12.708  34.555 15.396 1.00 21.67 ? 511 ALA A O   1 
ATOM   1572 C  CB  . ALA A 1 225 ? 12.562  33.990 18.407 1.00 20.67 ? 511 ALA A CB  1 
ATOM   1573 N  N   . GLY A 1 226 ? 10.885  35.794 15.903 1.00 20.54 ? 512 GLY A N   1 
ATOM   1574 C  CA  . GLY A 1 226 ? 10.410  35.817 14.514 1.00 19.19 ? 512 GLY A CA  1 
ATOM   1575 C  C   . GLY A 1 226 ? 9.193   34.944 14.256 1.00 20.94 ? 512 GLY A C   1 
ATOM   1576 O  O   . GLY A 1 226 ? 8.809   34.724 13.135 1.00 20.71 ? 512 GLY A O   1 
ATOM   1577 N  N   . ALA A 1 227 ? 8.558   34.459 15.318 1.00 21.38 ? 513 ALA A N   1 
ATOM   1578 C  CA  . ALA A 1 227 ? 7.390   33.585 15.106 1.00 20.70 ? 513 ALA A CA  1 
ATOM   1579 C  C   . ALA A 1 227 ? 6.221   34.281 14.410 1.00 20.63 ? 513 ALA A C   1 
ATOM   1580 O  O   . ALA A 1 227 ? 6.102   35.516 14.398 1.00 21.38 ? 513 ALA A O   1 
ATOM   1581 C  CB  . ALA A 1 227 ? 6.914   32.990 16.442 1.00 20.05 ? 513 ALA A CB  1 
ATOM   1582 N  N   . GLU A 1 228 ? 5.369   33.478 13.787 1.00 20.61 ? 514 GLU A N   1 
ATOM   1583 C  CA  . GLU A 1 228 ? 4.120   33.998 13.256 1.00 22.68 ? 514 GLU A CA  1 
ATOM   1584 C  C   . GLU A 1 228 ? 3.291   34.589 14.428 1.00 23.03 ? 514 GLU A C   1 
ATOM   1585 O  O   . GLU A 1 228 ? 3.449   34.170 15.594 1.00 22.64 ? 514 GLU A O   1 
ATOM   1586 C  CB  . GLU A 1 228 ? 3.301   32.858 12.597 1.00 21.39 ? 514 GLU A CB  1 
ATOM   1587 C  CG  . GLU A 1 228 ? 3.760   32.491 11.209 1.00 22.09 ? 514 GLU A CG  1 
ATOM   1588 C  CD  . GLU A 1 228 ? 3.571   33.656 10.279 1.00 21.23 ? 514 GLU A CD  1 
ATOM   1589 O  OE1 . GLU A 1 228 ? 2.403   34.023 9.955  1.00 21.32 ? 514 GLU A OE1 1 
ATOM   1590 O  OE2 . GLU A 1 228 ? 4.581   34.208 9.826  1.00 21.99 ? 514 GLU A OE2 1 
ATOM   1591 N  N   . PRO A 1 229 ? 2.382   35.506 14.104 1.00 24.53 ? 515 PRO A N   1 
ATOM   1592 C  CA  . PRO A 1 229 ? 1.487   36.091 15.105 1.00 23.94 ? 515 PRO A CA  1 
ATOM   1593 C  C   . PRO A 1 229 ? 0.723   34.975 15.849 1.00 23.88 ? 515 PRO A C   1 
ATOM   1594 O  O   . PRO A 1 229 ? 0.213   34.014 15.278 1.00 22.43 ? 515 PRO A O   1 
ATOM   1595 C  CB  . PRO A 1 229 ? 0.516   36.906 14.276 1.00 26.30 ? 515 PRO A CB  1 
ATOM   1596 C  CG  . PRO A 1 229 ? 1.300   37.273 13.001 1.00 28.97 ? 515 PRO A CG  1 
ATOM   1597 C  CD  . PRO A 1 229 ? 2.104   35.994 12.737 1.00 24.57 ? 515 PRO A CD  1 
ATOM   1598 N  N   . LEU A 1 230 ? 0.653   35.120 17.156 1.00 23.14 ? 516 LEU A N   1 
ATOM   1599 C  CA  . LEU A 1 230 ? 0.131   34.094 18.042 1.00 22.03 ? 516 LEU A CA  1 
ATOM   1600 C  C   . LEU A 1 230 ? -1.375  33.967 17.963 1.00 21.96 ? 516 LEU A C   1 
ATOM   1601 O  O   . LEU A 1 230 ? -2.068  34.944 17.762 1.00 21.34 ? 516 LEU A O   1 
ATOM   1602 C  CB  . LEU A 1 230 ? 0.558   34.440 19.480 1.00 22.47 ? 516 LEU A CB  1 
ATOM   1603 C  CG  . LEU A 1 230 ? 2.047   34.374 19.799 1.00 22.42 ? 516 LEU A CG  1 
ATOM   1604 C  CD1 . LEU A 1 230 ? 2.184   34.815 21.233 1.00 22.96 ? 516 LEU A CD1 1 
ATOM   1605 C  CD2 . LEU A 1 230 ? 2.524   32.914 19.709 1.00 24.83 ? 516 LEU A CD2 1 
ATOM   1606 N  N   . PRO A 1 231 ? -1.883  32.751 18.150 1.00 22.51 ? 517 PRO A N   1 
ATOM   1607 C  CA  . PRO A 1 231 ? -3.312  32.498 18.080 1.00 22.92 ? 517 PRO A CA  1 
ATOM   1608 C  C   . PRO A 1 231 ? -4.057  33.043 19.295 1.00 24.66 ? 517 PRO A C   1 
ATOM   1609 O  O   . PRO A 1 231 ? -3.503  33.054 20.418 1.00 24.15 ? 517 PRO A O   1 
ATOM   1610 C  CB  . PRO A 1 231 ? -3.370  30.975 17.988 1.00 23.73 ? 517 PRO A CB  1 
ATOM   1611 C  CG  . PRO A 1 231 ? -2.279  30.576 18.851 1.00 23.81 ? 517 PRO A CG  1 
ATOM   1612 C  CD  . PRO A 1 231 ? -1.119  31.550 18.528 1.00 21.66 ? 517 PRO A CD  1 
ATOM   1613 N  N   . ARG A 1 232 ? -5.275  33.532 19.051 1.00 26.27 ? 518 ARG A N   1 
ATOM   1614 C  CA  . ARG A 1 232 ? -6.087  34.140 20.111 1.00 28.95 ? 518 ARG A CA  1 
ATOM   1615 C  C   . ARG A 1 232 ? -6.956  33.076 20.782 1.00 29.85 ? 518 ARG A C   1 
ATOM   1616 O  O   . ARG A 1 232 ? -7.402  33.260 21.942 1.00 31.27 ? 518 ARG A O   1 
ATOM   1617 C  CB  . ARG A 1 232 ? -6.973  35.277 19.578 1.00 29.94 ? 518 ARG A CB  1 
ATOM   1618 C  CG  . ARG A 1 232 ? -6.209  36.623 19.277 1.00 32.51 ? 518 ARG A CG  1 
ATOM   1619 C  CD  . ARG A 1 232 ? -7.106  37.883 19.134 1.00 41.13 ? 518 ARG A CD  1 
ATOM   1620 N  NE  . ARG A 1 232 ? -7.183  38.399 17.764 1.00 49.88 ? 518 ARG A NE  1 
ATOM   1621 C  CZ  . ARG A 1 232 ? -8.169  39.191 17.302 1.00 53.82 ? 518 ARG A CZ  1 
ATOM   1622 N  NH1 . ARG A 1 232 ? -9.154  39.585 18.116 1.00 54.04 ? 518 ARG A NH1 1 
ATOM   1623 N  NH2 . ARG A 1 232 ? -8.179  39.590 16.024 1.00 53.93 ? 518 ARG A NH2 1 
ATOM   1624 N  N   . ASN A 1 233 ? -7.200  31.995 20.049 1.00 30.01 ? 519 ASN A N   1 
ATOM   1625 C  CA  . ASN A 1 233 ? -7.997  30.883 20.510 1.00 31.13 ? 519 ASN A CA  1 
ATOM   1626 C  C   . ASN A 1 233 ? -7.880  29.732 19.501 1.00 30.50 ? 519 ASN A C   1 
ATOM   1627 O  O   . ASN A 1 233 ? -7.079  29.769 18.578 1.00 30.33 ? 519 ASN A O   1 
ATOM   1628 C  CB  . ASN A 1 233 ? -9.465  31.303 20.547 1.00 32.83 ? 519 ASN A CB  1 
ATOM   1629 C  CG  . ASN A 1 233 ? -9.869  32.095 19.299 1.00 36.22 ? 519 ASN A CG  1 
ATOM   1630 O  OD1 . ASN A 1 233 ? -9.683  31.638 18.155 1.00 36.49 ? 519 ASN A OD1 1 
ATOM   1631 N  ND2 . ASN A 1 233 ? -10.383 33.316 19.514 1.00 40.98 ? 519 ASN A ND2 1 
ATOM   1632 N  N   . GLY A 1 234 ? -8.704  28.723 19.666 1.00 29.45 ? 520 GLY A N   1 
ATOM   1633 C  CA  . GLY A 1 234 ? -8.708  27.610 18.733 1.00 29.48 ? 520 GLY A CA  1 
ATOM   1634 C  C   . GLY A 1 234 ? -7.651  26.561 18.984 1.00 28.68 ? 520 GLY A C   1 
ATOM   1635 O  O   . GLY A 1 234 ? -6.993  26.549 19.996 1.00 27.51 ? 520 GLY A O   1 
ATOM   1636 N  N   . ASP A 1 235 ? -7.509  25.646 18.042 1.00 28.22 ? 521 ASP A N   1 
ATOM   1637 C  CA  . ASP A 1 235 ? -6.577  24.539 18.205 1.00 28.76 ? 521 ASP A CA  1 
ATOM   1638 C  C   . ASP A 1 235 ? -5.089  24.917 18.444 1.00 27.65 ? 521 ASP A C   1 
ATOM   1639 O  O   . ASP A 1 235 ? -4.421  24.281 19.269 1.00 27.94 ? 521 ASP A O   1 
ATOM   1640 C  CB  . ASP A 1 235 ? -6.682  23.599 17.004 1.00 28.73 ? 521 ASP A CB  1 
ATOM   1641 C  CG  . ASP A 1 235 ? -8.057  22.957 16.879 1.00 32.92 ? 521 ASP A CG  1 
ATOM   1642 O  OD1 . ASP A 1 235 ? -8.690  22.716 17.934 1.00 33.59 ? 521 ASP A OD1 1 
ATOM   1643 O  OD2 . ASP A 1 235 ? -8.574  22.629 15.763 1.00 34.81 ? 521 ASP A OD2 1 
ATOM   1644 N  N   . GLN A 1 236 ? -4.564  25.932 17.758 1.00 26.76 ? 522 GLN A N   1 
ATOM   1645 C  CA  . GLN A 1 236 ? -3.167  26.290 17.949 1.00 27.06 ? 522 GLN A CA  1 
ATOM   1646 C  C   . GLN A 1 236 ? -2.973  26.888 19.351 1.00 25.75 ? 522 GLN A C   1 
ATOM   1647 O  O   . GLN A 1 236 ? -1.905  26.771 19.920 1.00 25.55 ? 522 GLN A O   1 
ATOM   1648 C  CB  . GLN A 1 236 ? -2.635  27.295 16.918 1.00 27.61 ? 522 GLN A CB  1 
ATOM   1649 C  CG  . GLN A 1 236 ? -2.615  26.840 15.466 1.00 37.16 ? 522 GLN A CG  1 
ATOM   1650 C  CD  . GLN A 1 236 ? -2.018  27.905 14.536 1.00 48.67 ? 522 GLN A CD  1 
ATOM   1651 O  OE1 . GLN A 1 236 ? -2.572  29.023 14.415 1.00 54.26 ? 522 GLN A OE1 1 
ATOM   1652 N  NE2 . GLN A 1 236 ? -0.873  27.578 13.898 1.00 50.32 ? 522 GLN A NE2 1 
ATOM   1653 N  N   . TRP A 1 237 ? -3.993  27.545 19.880 1.00 24.12 ? 523 TRP A N   1 
ATOM   1654 C  CA  . TRP A 1 237 ? -3.913  28.127 21.231 1.00 23.04 ? 523 TRP A CA  1 
ATOM   1655 C  C   . TRP A 1 237 ? -3.767  27.000 22.262 1.00 23.24 ? 523 TRP A C   1 
ATOM   1656 O  O   . TRP A 1 237 ? -2.874  27.012 23.087 1.00 21.59 ? 523 TRP A O   1 
ATOM   1657 C  CB  . TRP A 1 237 ? -5.192  28.915 21.492 1.00 22.32 ? 523 TRP A CB  1 
ATOM   1658 C  CG  . TRP A 1 237 ? -5.113  29.747 22.727 1.00 23.16 ? 523 TRP A CG  1 
ATOM   1659 C  CD1 . TRP A 1 237 ? -4.716  31.065 22.807 1.00 19.77 ? 523 TRP A CD1 1 
ATOM   1660 C  CD2 . TRP A 1 237 ? -5.411  29.323 24.058 1.00 23.50 ? 523 TRP A CD2 1 
ATOM   1661 N  NE1 . TRP A 1 237 ? -4.731  31.473 24.125 1.00 25.64 ? 523 TRP A NE1 1 
ATOM   1662 C  CE2 . TRP A 1 237 ? -5.184  30.436 24.912 1.00 26.01 ? 523 TRP A CE2 1 
ATOM   1663 C  CE3 . TRP A 1 237 ? -5.870  28.111 24.622 1.00 25.54 ? 523 TRP A CE3 1 
ATOM   1664 C  CZ2 . TRP A 1 237 ? -5.397  30.380 26.295 1.00 28.60 ? 523 TRP A CZ2 1 
ATOM   1665 C  CZ3 . TRP A 1 237 ? -6.078  28.059 25.983 1.00 26.42 ? 523 TRP A CZ3 1 
ATOM   1666 C  CH2 . TRP A 1 237 ? -5.824  29.190 26.811 1.00 26.90 ? 523 TRP A CH2 1 
ATOM   1667 N  N   . HIS A 1 238 ? -4.613  25.981 22.167 1.00 23.53 ? 524 HIS A N   1 
ATOM   1668 C  CA  . HIS A 1 238 ? -4.524  24.878 23.099 1.00 25.51 ? 524 HIS A CA  1 
ATOM   1669 C  C   . HIS A 1 238 ? -3.227  24.137 23.008 1.00 25.62 ? 524 HIS A C   1 
ATOM   1670 O  O   . HIS A 1 238 ? -2.704  23.702 24.024 1.00 25.66 ? 524 HIS A O   1 
ATOM   1671 C  CB  . HIS A 1 238 ? -5.724  23.935 22.967 1.00 26.01 ? 524 HIS A CB  1 
ATOM   1672 C  CG  . HIS A 1 238 ? -6.986  24.550 23.475 1.00 28.86 ? 524 HIS A CG  1 
ATOM   1673 N  ND1 . HIS A 1 238 ? -7.208  24.789 24.815 1.00 31.22 ? 524 HIS A ND1 1 
ATOM   1674 C  CD2 . HIS A 1 238 ? -8.049  25.075 22.821 1.00 31.76 ? 524 HIS A CD2 1 
ATOM   1675 C  CE1 . HIS A 1 238 ? -8.384  25.373 24.969 1.00 34.38 ? 524 HIS A CE1 1 
ATOM   1676 N  NE2 . HIS A 1 238 ? -8.913  25.563 23.774 1.00 33.36 ? 524 HIS A NE2 1 
ATOM   1677 N  N   . GLU A 1 239 ? -2.695  23.992 21.800 1.00 26.32 ? 525 GLU A N   1 
ATOM   1678 C  CA  . GLU A 1 239 ? -1.434  23.266 21.629 1.00 27.61 ? 525 GLU A CA  1 
ATOM   1679 C  C   . GLU A 1 239 ? -0.275  23.934 22.382 1.00 26.07 ? 525 GLU A C   1 
ATOM   1680 O  O   . GLU A 1 239 ? 0.546   23.274 23.032 1.00 25.09 ? 525 GLU A O   1 
ATOM   1681 C  CB  . GLU A 1 239 ? -1.111  23.144 20.139 1.00 29.61 ? 525 GLU A CB  1 
ATOM   1682 C  CG  . GLU A 1 239 ? 0.085   22.258 19.846 1.00 37.32 ? 525 GLU A CG  1 
ATOM   1683 C  CD  . GLU A 1 239 ? -0.268  20.788 19.921 1.00 45.78 ? 525 GLU A CD  1 
ATOM   1684 O  OE1 . GLU A 1 239 ? 0.533   20.002 20.507 1.00 51.22 ? 525 GLU A OE1 1 
ATOM   1685 O  OE2 . GLU A 1 239 ? -1.353  20.421 19.402 1.00 49.48 ? 525 GLU A OE2 1 
ATOM   1686 N  N   . ILE A 1 240 ? -0.207  25.259 22.309 1.00 24.97 ? 526 ILE A N   1 
ATOM   1687 C  CA  . ILE A 1 240 ? 0.854   25.972 23.000 1.00 24.22 ? 526 ILE A CA  1 
ATOM   1688 C  C   . ILE A 1 240 ? 0.714   25.732 24.497 1.00 24.76 ? 526 ILE A C   1 
ATOM   1689 O  O   . ILE A 1 240 ? 1.705   25.542 25.207 1.00 24.63 ? 526 ILE A O   1 
ATOM   1690 C  CB  . ILE A 1 240 ? 0.757   27.489 22.718 1.00 24.73 ? 526 ILE A CB  1 
ATOM   1691 C  CG1 . ILE A 1 240 ? 1.074   27.776 21.237 1.00 24.76 ? 526 ILE A CG1 1 
ATOM   1692 C  CG2 . ILE A 1 240 ? 1.716   28.282 23.635 1.00 23.69 ? 526 ILE A CG2 1 
ATOM   1693 C  CD1 . ILE A 1 240 ? 0.760   29.301 20.868 1.00 26.79 ? 526 ILE A CD1 1 
ATOM   1694 N  N   . ARG A 1 241 ? -0.533  25.702 24.982 1.00 24.51 ? 527 ARG A N   1 
ATOM   1695 C  CA  . ARG A 1 241 ? -0.792  25.527 26.397 1.00 25.95 ? 527 ARG A CA  1 
ATOM   1696 C  C   . ARG A 1 241 ? -0.438  24.110 26.872 1.00 26.37 ? 527 ARG A C   1 
ATOM   1697 O  O   . ARG A 1 241 ? -0.373  23.849 28.050 1.00 26.03 ? 527 ARG A O   1 
ATOM   1698 C  CB  . ARG A 1 241 ? -2.277  25.779 26.658 1.00 26.81 ? 527 ARG A CB  1 
ATOM   1699 C  CG  . ARG A 1 241 ? -2.699  27.164 27.252 1.00 28.99 ? 527 ARG A CG  1 
ATOM   1700 C  CD  . ARG A 1 241 ? -1.992  28.439 26.990 1.00 36.91 ? 527 ARG A CD  1 
ATOM   1701 N  NE  . ARG A 1 241 ? -1.971  28.840 25.609 1.00 38.63 ? 527 ARG A NE  1 
ATOM   1702 C  CZ  . ARG A 1 241 ? -1.832  30.078 25.047 1.00 33.18 ? 527 ARG A CZ  1 
ATOM   1703 N  NH1 . ARG A 1 241 ? -1.774  31.272 25.647 1.00 36.08 ? 527 ARG A NH1 1 
ATOM   1704 N  NH2 . ARG A 1 241 ? -1.721  30.093 23.745 1.00 23.68 ? 527 ARG A NH2 1 
ATOM   1705 N  N   . GLN A 1 242 ? -0.250  23.216 25.925 1.00 27.54 ? 528 GLN A N   1 
ATOM   1706 C  CA  . GLN A 1 242 ? 0.173   21.864 26.227 1.00 28.69 ? 528 GLN A CA  1 
ATOM   1707 C  C   . GLN A 1 242 ? 1.677   21.849 26.400 1.00 28.20 ? 528 GLN A C   1 
ATOM   1708 O  O   . GLN A 1 242 ? 2.265   20.776 26.601 1.00 25.79 ? 528 GLN A O   1 
ATOM   1709 C  CB  . GLN A 1 242 ? -0.137  20.972 25.044 1.00 29.99 ? 528 GLN A CB  1 
ATOM   1710 C  CG  . GLN A 1 242 ? -1.608  20.729 24.835 1.00 35.19 ? 528 GLN A CG  1 
ATOM   1711 C  CD  . GLN A 1 242 ? -2.304  20.511 26.132 1.00 42.13 ? 528 GLN A CD  1 
ATOM   1712 O  OE1 . GLN A 1 242 ? -2.135  19.460 26.769 1.00 43.34 ? 528 GLN A OE1 1 
ATOM   1713 N  NE2 . GLN A 1 242 ? -3.086  21.505 26.556 1.00 45.91 ? 528 GLN A NE2 1 
ATOM   1714 N  N   . GLY A 1 243 ? 2.288   23.032 26.261 1.00 27.15 ? 529 GLY A N   1 
ATOM   1715 C  CA  . GLY A 1 243 ? 3.723   23.217 26.404 1.00 27.16 ? 529 GLY A CA  1 
ATOM   1716 C  C   . GLY A 1 243 ? 4.533   23.106 25.119 1.00 27.77 ? 529 GLY A C   1 
ATOM   1717 O  O   . GLY A 1 243 ? 5.721   22.819 25.194 1.00 28.85 ? 529 GLY A O   1 
ATOM   1718 N  N   . ARG A 1 244 ? 3.900   23.272 23.961 1.00 26.85 ? 530 ARG A N   1 
ATOM   1719 C  CA  . ARG A 1 244 ? 4.590   23.173 22.673 1.00 28.23 ? 530 ARG A CA  1 
ATOM   1720 C  C   . ARG A 1 244 ? 4.892   24.564 22.130 1.00 26.69 ? 530 ARG A C   1 
ATOM   1721 O  O   . ARG A 1 244 ? 3.987   25.355 21.867 1.00 25.03 ? 530 ARG A O   1 
ATOM   1722 C  CB  . ARG A 1 244 ? 3.720   22.430 21.672 1.00 28.80 ? 530 ARG A CB  1 
ATOM   1723 C  CG  . ARG A 1 244 ? 3.257   21.095 22.243 1.00 36.02 ? 530 ARG A CG  1 
ATOM   1724 C  CD  . ARG A 1 244 ? 4.397   20.105 22.464 1.00 44.94 ? 530 ARG A CD  1 
ATOM   1725 N  NE  . ARG A 1 244 ? 4.958   19.682 21.176 1.00 52.37 ? 530 ARG A NE  1 
ATOM   1726 C  CZ  . ARG A 1 244 ? 6.021   18.892 21.028 1.00 54.72 ? 530 ARG A CZ  1 
ATOM   1727 N  NH1 . ARG A 1 244 ? 6.674   18.414 22.088 1.00 55.96 ? 530 ARG A NH1 1 
ATOM   1728 N  NH2 . ARG A 1 244 ? 6.429   18.578 19.804 1.00 56.24 ? 530 ARG A NH2 1 
ATOM   1729 N  N   . LEU A 1 245 ? 6.169   24.838 21.927 1.00 25.94 ? 531 LEU A N   1 
ATOM   1730 C  CA  . LEU A 1 245 ? 6.573   26.137 21.460 1.00 27.38 ? 531 LEU A CA  1 
ATOM   1731 C  C   . LEU A 1 245 ? 6.209   26.314 20.032 1.00 26.20 ? 531 LEU A C   1 
ATOM   1732 O  O   . LEU A 1 245 ? 6.366   25.401 19.246 1.00 26.84 ? 531 LEU A O   1 
ATOM   1733 C  CB  . LEU A 1 245 ? 8.083   26.258 21.621 1.00 28.63 ? 531 LEU A CB  1 
ATOM   1734 C  CG  . LEU A 1 245 ? 8.696   27.486 22.206 1.00 34.85 ? 531 LEU A CG  1 
ATOM   1735 C  CD1 . LEU A 1 245 ? 8.472   28.633 21.219 1.00 39.83 ? 531 LEU A CD1 1 
ATOM   1736 C  CD2 . LEU A 1 245 ? 8.221   27.848 23.610 1.00 28.70 ? 531 LEU A CD2 1 
ATOM   1737 N  N   . PRO A 1 246 ? 5.692   27.484 19.658 1.00 26.01 ? 532 PRO A N   1 
ATOM   1738 C  CA  . PRO A 1 246 ? 5.411   27.784 18.256 1.00 25.78 ? 532 PRO A CA  1 
ATOM   1739 C  C   . PRO A 1 246 ? 6.712   27.732 17.456 1.00 25.36 ? 532 PRO A C   1 
ATOM   1740 O  O   . PRO A 1 246 ? 7.817   27.910 18.003 1.00 24.38 ? 532 PRO A O   1 
ATOM   1741 C  CB  . PRO A 1 246 ? 5.004   29.278 18.318 1.00 26.55 ? 532 PRO A CB  1 
ATOM   1742 C  CG  . PRO A 1 246 ? 4.430   29.437 19.629 1.00 25.77 ? 532 PRO A CG  1 
ATOM   1743 C  CD  . PRO A 1 246 ? 5.262   28.574 20.532 1.00 25.86 ? 532 PRO A CD  1 
ATOM   1744 N  N   . ARG A 1 247 ? 6.567   27.529 16.157 1.00 25.12 ? 533 ARG A N   1 
ATOM   1745 C  CA  . ARG A 1 247 ? 7.741   27.455 15.274 1.00 26.08 ? 533 ARG A CA  1 
ATOM   1746 C  C   . ARG A 1 247 ? 8.514   28.781 15.293 1.00 25.06 ? 533 ARG A C   1 
ATOM   1747 O  O   . ARG A 1 247 ? 7.887   29.840 15.220 1.00 24.99 ? 533 ARG A O   1 
ATOM   1748 C  CB  . ARG A 1 247 ? 7.301   27.166 13.861 1.00 25.92 ? 533 ARG A CB  1 
ATOM   1749 C  CG  . ARG A 1 247 ? 8.465   27.227 12.833 1.00 33.38 ? 533 ARG A CG  1 
ATOM   1750 C  CD  . ARG A 1 247 ? 8.072   26.993 11.349 1.00 38.66 ? 533 ARG A CD  1 
ATOM   1751 N  NE  . ARG A 1 247 ? 7.159   25.859 11.161 1.00 49.29 ? 533 ARG A NE  1 
ATOM   1752 C  CZ  . ARG A 1 247 ? 5.818   25.934 11.224 1.00 54.11 ? 533 ARG A CZ  1 
ATOM   1753 N  NH1 . ARG A 1 247 ? 5.216   27.096 11.510 1.00 55.41 ? 533 ARG A NH1 1 
ATOM   1754 N  NH2 . ARG A 1 247 ? 5.077   24.845 11.009 1.00 55.42 ? 533 ARG A NH2 1 
ATOM   1755 N  N   . ILE A 1 248 ? 9.843   28.713 15.360 1.00 24.23 ? 534 ILE A N   1 
ATOM   1756 C  CA  . ILE A 1 248 ? 10.710  29.930 15.378 1.00 23.87 ? 534 ILE A CA  1 
ATOM   1757 C  C   . ILE A 1 248 ? 11.620  29.809 14.158 1.00 25.32 ? 534 ILE A C   1 
ATOM   1758 O  O   . ILE A 1 248 ? 12.300  28.784 14.023 1.00 24.63 ? 534 ILE A O   1 
ATOM   1759 C  CB  . ILE A 1 248 ? 11.540  29.908 16.654 1.00 24.51 ? 534 ILE A CB  1 
ATOM   1760 C  CG1 . ILE A 1 248 ? 10.632  30.230 17.870 1.00 25.49 ? 534 ILE A CG1 1 
ATOM   1761 C  CG2 . ILE A 1 248 ? 12.754  30.824 16.548 1.00 22.56 ? 534 ILE A CG2 1 
ATOM   1762 C  CD1 . ILE A 1 248 ? 11.327  30.008 19.219 1.00 25.59 ? 534 ILE A CD1 1 
ATOM   1763 N  N   . PRO A 1 249 ? 11.629  30.820 13.278 1.00 24.95 ? 535 PRO A N   1 
ATOM   1764 C  CA  . PRO A 1 249 ? 12.347  30.766 11.988 1.00 26.77 ? 535 PRO A CA  1 
ATOM   1765 C  C   . PRO A 1 249 ? 13.872  30.985 12.054 1.00 27.04 ? 535 PRO A C   1 
ATOM   1766 O  O   . PRO A 1 249 ? 14.409  31.677 11.215 1.00 27.62 ? 535 PRO A O   1 
ATOM   1767 C  CB  . PRO A 1 249 ? 11.752  31.950 11.250 1.00 27.60 ? 535 PRO A CB  1 
ATOM   1768 C  CG  . PRO A 1 249 ? 11.526  32.931 12.356 1.00 25.22 ? 535 PRO A CG  1 
ATOM   1769 C  CD  . PRO A 1 249 ? 10.915  32.109 13.455 1.00 25.17 ? 535 PRO A CD  1 
ATOM   1770 N  N   . GLN A 1 250 ? 14.535  30.465 13.068 1.00 26.42 ? 536 GLN A N   1 
ATOM   1771 C  CA  . GLN A 1 250 ? 15.955  30.605 13.166 1.00 25.91 ? 536 GLN A CA  1 
ATOM   1772 C  C   . GLN A 1 250 ? 16.405  29.465 14.081 1.00 25.61 ? 536 GLN A C   1 
ATOM   1773 O  O   . GLN A 1 250 ? 15.614  28.911 14.840 1.00 26.30 ? 536 GLN A O   1 
ATOM   1774 C  CB  . GLN A 1 250 ? 16.359  31.962 13.756 1.00 26.57 ? 536 GLN A CB  1 
ATOM   1775 C  CG  . GLN A 1 250 ? 15.793  32.348 15.027 1.00 24.34 ? 536 GLN A CG  1 
ATOM   1776 C  CD  . GLN A 1 250 ? 16.401  33.669 15.524 1.00 26.34 ? 536 GLN A CD  1 
ATOM   1777 O  OE1 . GLN A 1 250 ? 17.620  33.869 15.393 1.00 27.79 ? 536 GLN A OE1 1 
ATOM   1778 N  NE2 . GLN A 1 250 ? 15.549  34.610 15.977 1.00 20.20 ? 536 GLN A NE2 1 
ATOM   1779 N  N   . VAL A 1 251 ? 17.683  29.138 14.007 1.00 23.97 ? 537 VAL A N   1 
ATOM   1780 C  CA  . VAL A 1 251 ? 18.222  28.046 14.816 1.00 24.73 ? 537 VAL A CA  1 
ATOM   1781 C  C   . VAL A 1 251 ? 18.668  28.611 16.150 1.00 25.44 ? 537 VAL A C   1 
ATOM   1782 O  O   . VAL A 1 251 ? 19.420  29.600 16.225 1.00 27.21 ? 537 VAL A O   1 
ATOM   1783 C  CB  . VAL A 1 251 ? 19.371  27.360 14.096 1.00 25.59 ? 537 VAL A CB  1 
ATOM   1784 C  CG1 . VAL A 1 251 ? 20.078  26.257 14.985 1.00 25.53 ? 537 VAL A CG1 1 
ATOM   1785 C  CG2 . VAL A 1 251 ? 18.869  26.715 12.786 1.00 25.46 ? 537 VAL A CG2 1 
ATOM   1786 N  N   . LEU A 1 252 ? 18.152  28.035 17.224 1.00 23.75 ? 538 LEU A N   1 
ATOM   1787 C  CA  . LEU A 1 252 ? 18.507  28.480 18.576 1.00 23.93 ? 538 LEU A CA  1 
ATOM   1788 C  C   . LEU A 1 252 ? 19.199  27.299 19.304 1.00 22.71 ? 538 LEU A C   1 
ATOM   1789 O  O   . LEU A 1 252 ? 18.950  26.137 18.973 1.00 23.17 ? 538 LEU A O   1 
ATOM   1790 C  CB  . LEU A 1 252 ? 17.236  28.861 19.368 1.00 24.32 ? 538 LEU A CB  1 
ATOM   1791 C  CG  . LEU A 1 252 ? 16.435  30.072 18.853 1.00 27.49 ? 538 LEU A CG  1 
ATOM   1792 C  CD1 . LEU A 1 252 ? 15.201  30.383 19.796 1.00 27.65 ? 538 LEU A CD1 1 
ATOM   1793 C  CD2 . LEU A 1 252 ? 17.371  31.260 18.702 1.00 28.28 ? 538 LEU A CD2 1 
ATOM   1794 N  N   . SER A 1 253 ? 20.127  27.595 20.203 1.00 21.03 ? 539 SER A N   1 
ATOM   1795 C  CA  . SER A 1 253 ? 20.769  26.519 20.950 1.00 20.91 ? 539 SER A CA  1 
ATOM   1796 C  C   . SER A 1 253 ? 19.729  25.636 21.656 1.00 20.65 ? 539 SER A C   1 
ATOM   1797 O  O   . SER A 1 253 ? 18.692  26.122 22.127 1.00 20.09 ? 539 SER A O   1 
ATOM   1798 C  CB  . SER A 1 253 ? 21.746  27.062 21.993 1.00 21.07 ? 539 SER A CB  1 
ATOM   1799 O  OG  . SER A 1 253 ? 21.071  27.763 23.052 1.00 20.49 ? 539 SER A OG  1 
ATOM   1800 N  N   . GLN A 1 254 ? 20.012  24.352 21.797 1.00 19.65 ? 540 GLN A N   1 
ATOM   1801 C  CA  . GLN A 1 254 ? 19.042  23.492 22.473 1.00 22.24 ? 540 GLN A CA  1 
ATOM   1802 C  C   . GLN A 1 254 ? 18.761  23.935 23.924 1.00 22.98 ? 540 GLN A C   1 
ATOM   1803 O  O   . GLN A 1 254 ? 17.669  23.799 24.420 1.00 23.58 ? 540 GLN A O   1 
ATOM   1804 C  CB  . GLN A 1 254 ? 19.545  22.034 22.528 1.00 22.51 ? 540 GLN A CB  1 
ATOM   1805 C  CG  . GLN A 1 254 ? 19.413  21.316 21.209 1.00 27.23 ? 540 GLN A CG  1 
ATOM   1806 C  CD  . GLN A 1 254 ? 19.959  19.909 21.300 1.00 28.65 ? 540 GLN A CD  1 
ATOM   1807 O  OE1 . GLN A 1 254 ? 21.005  19.687 21.928 1.00 29.82 ? 540 GLN A OE1 1 
ATOM   1808 N  NE2 . GLN A 1 254 ? 19.267  18.954 20.667 1.00 30.67 ? 540 GLN A NE2 1 
ATOM   1809 N  N   . GLU A 1 255 ? 19.769  24.452 24.599 1.00 23.01 ? 541 GLU A N   1 
ATOM   1810 C  CA  . GLU A 1 255 ? 19.675  24.841 26.005 1.00 24.56 ? 541 GLU A CA  1 
ATOM   1811 C  C   . GLU A 1 255 ? 18.707  26.034 26.150 1.00 22.76 ? 541 GLU A C   1 
ATOM   1812 O  O   . GLU A 1 255 ? 17.916  26.133 27.100 1.00 22.10 ? 541 GLU A O   1 
ATOM   1813 C  CB  . GLU A 1 255 ? 21.092  25.265 26.398 1.00 26.18 ? 541 GLU A CB  1 
ATOM   1814 C  CG  . GLU A 1 255 ? 21.356  25.716 27.798 1.00 35.29 ? 541 GLU A CG  1 
ATOM   1815 C  CD  . GLU A 1 255 ? 22.866  25.912 28.035 1.00 45.15 ? 541 GLU A CD  1 
ATOM   1816 O  OE1 . GLU A 1 255 ? 23.489  26.881 27.462 1.00 44.30 ? 541 GLU A OE1 1 
ATOM   1817 O  OE2 . GLU A 1 255 ? 23.418  25.082 28.802 1.00 48.75 ? 541 GLU A OE2 1 
ATOM   1818 N  N   . PHE A 1 256 ? 18.795  26.934 25.196 1.00 20.98 ? 542 PHE A N   1 
ATOM   1819 C  CA  . PHE A 1 256 ? 17.927  28.129 25.239 1.00 21.78 ? 542 PHE A CA  1 
ATOM   1820 C  C   . PHE A 1 256 ? 16.472  27.721 24.888 1.00 22.09 ? 542 PHE A C   1 
ATOM   1821 O  O   . PHE A 1 256 ? 15.545  28.108 25.563 1.00 23.59 ? 542 PHE A O   1 
ATOM   1822 C  CB  . PHE A 1 256 ? 18.450  29.186 24.262 1.00 20.44 ? 542 PHE A CB  1 
ATOM   1823 C  CG  . PHE A 1 256 ? 17.676  30.513 24.333 1.00 22.96 ? 542 PHE A CG  1 
ATOM   1824 C  CD1 . PHE A 1 256 ? 17.407  31.099 25.543 1.00 24.70 ? 542 PHE A CD1 1 
ATOM   1825 C  CD2 . PHE A 1 256 ? 17.224  31.140 23.188 1.00 27.15 ? 542 PHE A CD2 1 
ATOM   1826 C  CE1 . PHE A 1 256 ? 16.702  32.321 25.619 1.00 26.65 ? 542 PHE A CE1 1 
ATOM   1827 C  CE2 . PHE A 1 256 ? 16.502  32.364 23.246 1.00 27.34 ? 542 PHE A CE2 1 
ATOM   1828 C  CZ  . PHE A 1 256 ? 16.236  32.944 24.454 1.00 25.23 ? 542 PHE A CZ  1 
ATOM   1829 N  N   . THR A 1 257 ? 16.303  26.890 23.853 1.00 22.52 ? 543 THR A N   1 
ATOM   1830 C  CA  . THR A 1 257 ? 14.980  26.387 23.474 1.00 23.58 ? 543 THR A CA  1 
ATOM   1831 C  C   . THR A 1 257 ? 14.357  25.634 24.656 1.00 23.39 ? 543 THR A C   1 
ATOM   1832 O  O   . THR A 1 257 ? 13.124  25.753 24.912 1.00 22.87 ? 543 THR A O   1 
ATOM   1833 C  CB  . THR A 1 257 ? 15.122  25.435 22.220 1.00 25.52 ? 543 THR A CB  1 
ATOM   1834 O  OG1 . THR A 1 257 ? 15.369  26.254 21.061 1.00 30.98 ? 543 THR A OG1 1 
ATOM   1835 C  CG2 . THR A 1 257 ? 13.802  24.818 21.888 1.00 29.26 ? 543 THR A CG2 1 
ATOM   1836 N  N   . GLU A 1 258 ? 15.157  24.811 25.346 1.00 22.40 ? 544 GLU A N   1 
ATOM   1837 C  CA  . GLU A 1 258 ? 14.610  24.115 26.538 1.00 23.24 ? 544 GLU A CA  1 
ATOM   1838 C  C   . GLU A 1 258 ? 14.147  25.057 27.630 1.00 22.23 ? 544 GLU A C   1 
ATOM   1839 O  O   . GLU A 1 258 ? 13.194  24.740 28.361 1.00 21.53 ? 544 GLU A O   1 
ATOM   1840 C  CB  . GLU A 1 258 ? 15.607  23.114 27.113 1.00 24.74 ? 544 GLU A CB  1 
ATOM   1841 C  CG  . GLU A 1 258 ? 15.846  22.023 26.050 1.00 28.73 ? 544 GLU A CG  1 
ATOM   1842 C  CD  . GLU A 1 258 ? 16.831  20.971 26.516 1.00 38.91 ? 544 GLU A CD  1 
ATOM   1843 O  OE1 . GLU A 1 258 ? 17.927  21.355 27.023 1.00 42.29 ? 544 GLU A OE1 1 
ATOM   1844 O  OE2 . GLU A 1 258 ? 16.494  19.763 26.385 1.00 45.20 ? 544 GLU A OE2 1 
ATOM   1845 N  N   . LEU A 1 259 ? 14.870  26.155 27.814 1.00 22.14 ? 545 LEU A N   1 
ATOM   1846 C  CA  . LEU A 1 259 ? 14.442  27.141 28.820 1.00 22.31 ? 545 LEU A CA  1 
ATOM   1847 C  C   . LEU A 1 259 ? 13.088  27.763 28.390 1.00 22.69 ? 545 LEU A C   1 
ATOM   1848 O  O   . LEU A 1 259 ? 12.150  27.885 29.217 1.00 22.13 ? 545 LEU A O   1 
ATOM   1849 C  CB  . LEU A 1 259 ? 15.539  28.201 29.041 1.00 22.67 ? 545 LEU A CB  1 
ATOM   1850 C  CG  . LEU A 1 259 ? 15.044  29.398 29.907 1.00 22.94 ? 545 LEU A CG  1 
ATOM   1851 C  CD1 . LEU A 1 259 ? 14.593  29.012 31.339 1.00 23.39 ? 545 LEU A CD1 1 
ATOM   1852 C  CD2 . LEU A 1 259 ? 16.135  30.444 30.005 1.00 26.03 ? 545 LEU A CD2 1 
ATOM   1853 N  N   . LEU A 1 260 ? 12.976  28.206 27.121 1.00 21.32 ? 546 LEU A N   1 
ATOM   1854 C  CA  . LEU A 1 260 ? 11.685  28.734 26.671 1.00 22.89 ? 546 LEU A CA  1 
ATOM   1855 C  C   . LEU A 1 260 ? 10.588  27.683 26.853 1.00 23.10 ? 546 LEU A C   1 
ATOM   1856 O  O   . LEU A 1 260 ? 9.500   27.985 27.319 1.00 22.25 ? 546 LEU A O   1 
ATOM   1857 C  CB  . LEU A 1 260 ? 11.738  29.171 25.191 1.00 22.41 ? 546 LEU A CB  1 
ATOM   1858 C  CG  . LEU A 1 260 ? 12.667  30.381 25.012 1.00 24.40 ? 546 LEU A CG  1 
ATOM   1859 C  CD1 . LEU A 1 260 ? 12.837  30.661 23.509 1.00 23.56 ? 546 LEU A CD1 1 
ATOM   1860 C  CD2 . LEU A 1 260 ? 12.146  31.669 25.733 1.00 22.87 ? 546 LEU A CD2 1 
ATOM   1861 N  N   . LYS A 1 261 ? 10.899  26.425 26.541 1.00 22.54 ? 547 LYS A N   1 
ATOM   1862 C  CA  . LYS A 1 261 ? 9.894   25.390 26.728 1.00 23.36 ? 547 LYS A CA  1 
ATOM   1863 C  C   . LYS A 1 261 ? 9.455   25.183 28.169 1.00 23.93 ? 547 LYS A C   1 
ATOM   1864 O  O   . LYS A 1 261 ? 8.261   24.962 28.466 1.00 24.04 ? 547 LYS A O   1 
ATOM   1865 C  CB  . LYS A 1 261 ? 10.455  24.051 26.206 1.00 23.68 ? 547 LYS A CB  1 
ATOM   1866 C  CG  . LYS A 1 261 ? 9.369   23.073 25.875 1.00 28.75 ? 547 LYS A CG  1 
ATOM   1867 C  CD  . LYS A 1 261 ? 9.954   21.833 25.128 1.00 34.27 ? 547 LYS A CD  1 
ATOM   1868 C  CE  . LYS A 1 261 ? 10.492  22.247 23.729 1.00 36.96 ? 547 LYS A CE  1 
ATOM   1869 N  NZ  . LYS A 1 261 ? 11.114  21.126 22.900 1.00 42.12 ? 547 LYS A NZ  1 
ATOM   1870 N  N   . VAL A 1 262 ? 10.406  25.187 29.104 1.00 23.40 ? 548 VAL A N   1 
ATOM   1871 C  CA  . VAL A 1 262 ? 9.977   24.969 30.459 1.00 22.01 ? 548 VAL A CA  1 
ATOM   1872 C  C   . VAL A 1 262 ? 9.155   26.168 30.982 1.00 22.02 ? 548 VAL A C   1 
ATOM   1873 O  O   . VAL A 1 262 ? 8.278   26.017 31.842 1.00 21.17 ? 548 VAL A O   1 
ATOM   1874 C  CB  . VAL A 1 262 ? 11.118  24.548 31.400 1.00 22.44 ? 548 VAL A CB  1 
ATOM   1875 C  CG1 . VAL A 1 262 ? 12.065  25.704 31.736 1.00 22.02 ? 548 VAL A CG1 1 
ATOM   1876 C  CG2 . VAL A 1 262 ? 10.522  23.930 32.667 1.00 25.47 ? 548 VAL A CG2 1 
ATOM   1877 N  N   . MET A 1 263 ? 9.433   27.347 30.433 1.00 21.10 ? 549 MET A N   1 
ATOM   1878 C  CA  . MET A 1 263 ? 8.710   28.545 30.829 1.00 22.53 ? 549 MET A CA  1 
ATOM   1879 C  C   . MET A 1 263 ? 7.247   28.471 30.421 1.00 22.12 ? 549 MET A C   1 
ATOM   1880 O  O   . MET A 1 263 ? 6.443   29.224 30.977 1.00 21.06 ? 549 MET A O   1 
ATOM   1881 C  CB  . MET A 1 263 ? 9.375   29.809 30.271 1.00 21.17 ? 549 MET A CB  1 
ATOM   1882 C  CG  . MET A 1 263 ? 10.718  30.118 30.912 1.00 24.17 ? 549 MET A CG  1 
ATOM   1883 S  SD  . MET A 1 263 ? 11.490  31.498 30.028 1.00 23.90 ? 549 MET A SD  1 
ATOM   1884 C  CE  . MET A 1 263 ? 10.510  32.955 30.632 1.00 20.84 ? 549 MET A CE  1 
ATOM   1885 N  N   . ILE A 1 264 ? 6.889   27.600 29.475 1.00 20.85 ? 550 ILE A N   1 
ATOM   1886 C  CA  . ILE A 1 264 ? 5.450   27.454 29.100 1.00 21.71 ? 550 ILE A CA  1 
ATOM   1887 C  C   . ILE A 1 264 ? 4.898   26.106 29.527 1.00 22.78 ? 550 ILE A C   1 
ATOM   1888 O  O   . ILE A 1 264 ? 3.941   25.570 28.924 1.00 23.72 ? 550 ILE A O   1 
ATOM   1889 C  CB  . ILE A 1 264 ? 5.150   27.716 27.598 1.00 20.52 ? 550 ILE A CB  1 
ATOM   1890 C  CG1 . ILE A 1 264 ? 5.945   26.776 26.653 1.00 21.93 ? 550 ILE A CG1 1 
ATOM   1891 C  CG2 . ILE A 1 264 ? 5.429   29.209 27.210 1.00 19.82 ? 550 ILE A CG2 1 
ATOM   1892 C  CD1 . ILE A 1 264 ? 5.392   26.719 25.148 1.00 24.92 ? 550 ILE A CD1 1 
ATOM   1893 N  N   . HIS A 1 265 ? 5.556   25.496 30.508 1.00 23.13 ? 551 HIS A N   1 
ATOM   1894 C  CA  . HIS A 1 265 ? 5.122   24.179 30.952 1.00 23.39 ? 551 HIS A CA  1 
ATOM   1895 C  C   . HIS A 1 265 ? 3.679   24.251 31.475 1.00 23.38 ? 551 HIS A C   1 
ATOM   1896 O  O   . HIS A 1 265 ? 3.345   25.185 32.169 1.00 23.20 ? 551 HIS A O   1 
ATOM   1897 C  CB  . HIS A 1 265 ? 6.012   23.668 32.087 1.00 22.56 ? 551 HIS A CB  1 
ATOM   1898 C  CG  . HIS A 1 265 ? 5.923   22.175 32.281 1.00 23.51 ? 551 HIS A CG  1 
ATOM   1899 N  ND1 . HIS A 1 265 ? 4.845   21.587 32.890 1.00 22.02 ? 551 HIS A ND1 1 
ATOM   1900 C  CD2 . HIS A 1 265 ? 6.748   21.162 31.917 1.00 26.42 ? 551 HIS A CD2 1 
ATOM   1901 C  CE1 . HIS A 1 265 ? 5.005   20.266 32.904 1.00 28.25 ? 551 HIS A CE1 1 
ATOM   1902 N  NE2 . HIS A 1 265 ? 6.159   19.983 32.322 1.00 25.49 ? 551 HIS A NE2 1 
ATOM   1903 N  N   . PRO A 1 266 ? 2.826   23.267 31.157 1.00 24.44 ? 552 PRO A N   1 
ATOM   1904 C  CA  . PRO A 1 266 ? 1.427   23.250 31.650 1.00 24.44 ? 552 PRO A CA  1 
ATOM   1905 C  C   . PRO A 1 266 ? 1.314   23.297 33.178 1.00 24.93 ? 552 PRO A C   1 
ATOM   1906 O  O   . PRO A 1 266 ? 0.272   23.735 33.736 1.00 24.14 ? 552 PRO A O   1 
ATOM   1907 C  CB  . PRO A 1 266 ? 0.867   21.900 31.136 1.00 25.03 ? 552 PRO A CB  1 
ATOM   1908 C  CG  . PRO A 1 266 ? 1.776   21.493 30.037 1.00 28.36 ? 552 PRO A CG  1 
ATOM   1909 C  CD  . PRO A 1 266 ? 3.136   22.108 30.305 1.00 24.36 ? 552 PRO A CD  1 
ATOM   1910 N  N   . ASP A 1 267 ? 2.363   22.842 33.856 1.00 24.39 ? 553 ASP A N   1 
ATOM   1911 C  CA  . ASP A 1 267 ? 2.387   22.892 35.301 1.00 24.99 ? 553 ASP A CA  1 
ATOM   1912 C  C   . ASP A 1 267 ? 3.121   24.124 35.740 1.00 24.76 ? 553 ASP A C   1 
ATOM   1913 O  O   . ASP A 1 267 ? 4.338   24.202 35.586 1.00 23.84 ? 553 ASP A O   1 
ATOM   1914 C  CB  . ASP A 1 267 ? 3.080   21.656 35.861 1.00 25.19 ? 553 ASP A CB  1 
ATOM   1915 C  CG  . ASP A 1 267 ? 3.031   21.605 37.358 1.00 27.38 ? 553 ASP A CG  1 
ATOM   1916 O  OD1 . ASP A 1 267 ? 2.544   22.572 37.979 1.00 26.06 ? 553 ASP A OD1 1 
ATOM   1917 O  OD2 . ASP A 1 267 ? 3.450   20.615 37.989 1.00 28.17 ? 553 ASP A OD2 1 
ATOM   1918 N  N   . PRO A 1 268 ? 2.396   25.107 36.287 1.00 25.09 ? 554 PRO A N   1 
ATOM   1919 C  CA  . PRO A 1 268 ? 3.024   26.388 36.637 1.00 24.60 ? 554 PRO A CA  1 
ATOM   1920 C  C   . PRO A 1 268 ? 4.177   26.209 37.594 1.00 24.33 ? 554 PRO A C   1 
ATOM   1921 O  O   . PRO A 1 268 ? 5.132   26.964 37.453 1.00 23.99 ? 554 PRO A O   1 
ATOM   1922 C  CB  . PRO A 1 268 ? 1.901   27.201 37.293 1.00 25.12 ? 554 PRO A CB  1 
ATOM   1923 C  CG  . PRO A 1 268 ? 0.594   26.530 36.859 1.00 26.76 ? 554 PRO A CG  1 
ATOM   1924 C  CD  . PRO A 1 268 ? 0.962   25.069 36.621 1.00 25.41 ? 554 PRO A CD  1 
ATOM   1925 N  N   . GLU A 1 269 ? 4.136   25.193 38.467 1.00 23.39 ? 555 GLU A N   1 
ATOM   1926 C  CA  . GLU A 1 269 ? 5.215   24.943 39.417 1.00 24.73 ? 555 GLU A CA  1 
ATOM   1927 C  C   . GLU A 1 269 ? 6.514   24.539 38.698 1.00 25.22 ? 555 GLU A C   1 
ATOM   1928 O  O   . GLU A 1 269 ? 7.620   24.697 39.259 1.00 26.84 ? 555 GLU A O   1 
ATOM   1929 C  CB  . GLU A 1 269 ? 4.828   23.843 40.436 1.00 24.96 ? 555 GLU A CB  1 
ATOM   1930 C  CG  . GLU A 1 269 ? 3.659   24.265 41.289 1.00 27.06 ? 555 GLU A CG  1 
ATOM   1931 C  CD  . GLU A 1 269 ? 3.194   23.204 42.290 1.00 30.43 ? 555 GLU A CD  1 
ATOM   1932 O  OE1 . GLU A 1 269 ? 2.204   23.508 42.952 1.00 36.31 ? 555 GLU A OE1 1 
ATOM   1933 O  OE2 . GLU A 1 269 ? 3.783   22.100 42.410 1.00 32.76 ? 555 GLU A OE2 1 
ATOM   1934 N  N   . ARG A 1 270 ? 6.402   24.012 37.494 1.00 24.61 ? 556 ARG A N   1 
ATOM   1935 C  CA  . ARG A 1 270 ? 7.629   23.664 36.767 1.00 24.69 ? 556 ARG A CA  1 
ATOM   1936 C  C   . ARG A 1 270 ? 8.309   24.872 36.162 1.00 24.76 ? 556 ARG A C   1 
ATOM   1937 O  O   . ARG A 1 270 ? 9.496   24.830 35.832 1.00 24.77 ? 556 ARG A O   1 
ATOM   1938 C  CB  . ARG A 1 270 ? 7.343   22.613 35.701 1.00 24.36 ? 556 ARG A CB  1 
ATOM   1939 C  CG  . ARG A 1 270 ? 6.962   21.290 36.324 1.00 28.45 ? 556 ARG A CG  1 
ATOM   1940 C  CD  . ARG A 1 270 ? 8.169   20.478 36.814 1.00 33.92 ? 556 ARG A CD  1 
ATOM   1941 N  NE  . ARG A 1 270 ? 9.073   20.281 35.684 1.00 39.56 ? 556 ARG A NE  1 
ATOM   1942 C  CZ  . ARG A 1 270 ? 8.810   19.458 34.685 1.00 43.39 ? 556 ARG A CZ  1 
ATOM   1943 N  NH1 . ARG A 1 270 ? 7.681   18.737 34.697 1.00 44.86 ? 556 ARG A NH1 1 
ATOM   1944 N  NH2 . ARG A 1 270 ? 9.679   19.342 33.680 1.00 46.90 ? 556 ARG A NH2 1 
ATOM   1945 N  N   . ARG A 1 271 ? 7.581   25.963 35.975 1.00 24.02 ? 557 ARG A N   1 
ATOM   1946 C  CA  . ARG A 1 271 ? 8.195   27.087 35.296 1.00 23.37 ? 557 ARG A CA  1 
ATOM   1947 C  C   . ARG A 1 271 ? 9.122   27.738 36.276 1.00 24.18 ? 557 ARG A C   1 
ATOM   1948 O  O   . ARG A 1 271 ? 8.865   27.746 37.509 1.00 22.68 ? 557 ARG A O   1 
ATOM   1949 C  CB  . ARG A 1 271 ? 7.103   28.070 34.897 1.00 24.10 ? 557 ARG A CB  1 
ATOM   1950 C  CG  . ARG A 1 271 ? 6.014   27.475 34.018 1.00 23.65 ? 557 ARG A CG  1 
ATOM   1951 C  CD  . ARG A 1 271 ? 4.862   28.470 33.688 1.00 26.77 ? 557 ARG A CD  1 
ATOM   1952 N  NE  . ARG A 1 271 ? 3.728   27.739 33.125 1.00 22.99 ? 557 ARG A NE  1 
ATOM   1953 C  CZ  . ARG A 1 271 ? 2.469   28.098 33.276 1.00 25.24 ? 557 ARG A CZ  1 
ATOM   1954 N  NH1 . ARG A 1 271 ? 2.173   29.256 33.901 1.00 22.65 ? 557 ARG A NH1 1 
ATOM   1955 N  NH2 . ARG A 1 271 ? 1.496   27.318 32.768 1.00 22.51 ? 557 ARG A NH2 1 
ATOM   1956 N  N   . PRO A 1 272 ? 10.180  28.355 35.789 1.00 24.99 ? 558 PRO A N   1 
ATOM   1957 C  CA  . PRO A 1 272 ? 11.094  29.041 36.722 1.00 24.67 ? 558 PRO A CA  1 
ATOM   1958 C  C   . PRO A 1 272 ? 10.494  30.293 37.359 1.00 25.33 ? 558 PRO A C   1 
ATOM   1959 O  O   . PRO A 1 272 ? 9.728   30.992 36.720 1.00 25.76 ? 558 PRO A O   1 
ATOM   1960 C  CB  . PRO A 1 272 ? 12.273  29.497 35.846 1.00 26.04 ? 558 PRO A CB  1 
ATOM   1961 C  CG  . PRO A 1 272 ? 11.918  29.154 34.467 1.00 28.62 ? 558 PRO A CG  1 
ATOM   1962 C  CD  . PRO A 1 272 ? 10.542  28.494 34.362 1.00 24.47 ? 558 PRO A CD  1 
ATOM   1963 N  N   . SER A 1 273 ? 10.854  30.579 38.610 1.00 24.25 ? 559 SER A N   1 
ATOM   1964 C  CA  . SER A 1 273 ? 10.489  31.881 39.136 1.00 24.74 ? 559 SER A CA  1 
ATOM   1965 C  C   . SER A 1 273 ? 11.310  32.946 38.393 1.00 24.33 ? 559 SER A C   1 
ATOM   1966 O  O   . SER A 1 273 ? 12.302  32.616 37.719 1.00 24.17 ? 559 SER A O   1 
ATOM   1967 C  CB  . SER A 1 273 ? 10.782  31.956 40.620 1.00 24.91 ? 559 SER A CB  1 
ATOM   1968 O  OG  . SER A 1 273 ? 12.193  31.833 40.901 1.00 26.93 ? 559 SER A OG  1 
ATOM   1969 N  N   . ALA A 1 274 ? 10.942  34.200 38.580 1.00 23.42 ? 560 ALA A N   1 
ATOM   1970 C  CA  . ALA A 1 274 ? 11.720  35.287 37.992 1.00 23.55 ? 560 ALA A CA  1 
ATOM   1971 C  C   . ALA A 1 274 ? 13.139  35.304 38.559 1.00 24.26 ? 560 ALA A C   1 
ATOM   1972 O  O   . ALA A 1 274 ? 14.111  35.530 37.808 1.00 24.91 ? 560 ALA A O   1 
ATOM   1973 C  CB  . ALA A 1 274 ? 10.972  36.651 38.158 1.00 21.75 ? 560 ALA A CB  1 
ATOM   1974 N  N   . MET A 1 275 ? 13.290  35.034 39.872 1.00 22.83 ? 561 MET A N   1 
ATOM   1975 C  CA  . MET A 1 275 ? 14.618  34.996 40.483 1.00 24.39 ? 561 MET A CA  1 
ATOM   1976 C  C   . MET A 1 275 ? 15.445  33.881 39.823 1.00 24.97 ? 561 MET A C   1 
ATOM   1977 O  O   . MET A 1 275 ? 16.599  34.097 39.404 1.00 26.47 ? 561 MET A O   1 
ATOM   1978 C  CB  . MET A 1 275 ? 14.490  34.758 42.017 1.00 24.43 ? 561 MET A CB  1 
ATOM   1979 C  CG  . MET A 1 275 ? 15.787  34.383 42.683 1.00 32.41 ? 561 MET A CG  1 
ATOM   1980 S  SD  . MET A 1 275 ? 16.981  35.746 42.458 1.00 50.73 ? 561 MET A SD  1 
ATOM   1981 C  CE  . MET A 1 275 ? 18.528  34.960 42.953 1.00 49.62 ? 561 MET A CE  1 
ATOM   1982 N  N   . ALA A 1 276 ? 14.842  32.713 39.639 1.00 24.13 ? 562 ALA A N   1 
ATOM   1983 C  CA  . ALA A 1 276 ? 15.551  31.565 39.036 1.00 24.46 ? 562 ALA A CA  1 
ATOM   1984 C  C   . ALA A 1 276 ? 15.921  31.813 37.548 1.00 24.65 ? 562 ALA A C   1 
ATOM   1985 O  O   . ALA A 1 276 ? 16.989  31.373 37.060 1.00 24.78 ? 562 ALA A O   1 
ATOM   1986 C  CB  . ALA A 1 276 ? 14.725  30.318 39.165 1.00 23.70 ? 562 ALA A CB  1 
ATOM   1987 N  N   . LEU A 1 277 ? 15.023  32.485 36.838 1.00 24.66 ? 563 LEU A N   1 
ATOM   1988 C  CA  . LEU A 1 277 ? 15.275  32.875 35.467 1.00 24.62 ? 563 LEU A CA  1 
ATOM   1989 C  C   . LEU A 1 277 ? 16.475  33.787 35.385 1.00 25.96 ? 563 LEU A C   1 
ATOM   1990 O  O   . LEU A 1 277 ? 17.408  33.509 34.619 1.00 25.51 ? 563 LEU A O   1 
ATOM   1991 C  CB  . LEU A 1 277 ? 14.029  33.571 34.897 1.00 26.26 ? 563 LEU A CB  1 
ATOM   1992 C  CG  . LEU A 1 277 ? 14.115  34.056 33.470 1.00 25.69 ? 563 LEU A CG  1 
ATOM   1993 C  CD1 . LEU A 1 277 ? 14.227  32.827 32.535 1.00 25.41 ? 563 LEU A CD1 1 
ATOM   1994 C  CD2 . LEU A 1 277 ? 12.881  34.975 33.132 1.00 26.95 ? 563 LEU A CD2 1 
ATOM   1995 N  N   . VAL A 1 278 ? 16.511  34.856 36.196 1.00 25.20 ? 564 VAL A N   1 
ATOM   1996 C  CA  . VAL A 1 278 ? 17.651  35.772 36.100 1.00 27.06 ? 564 VAL A CA  1 
ATOM   1997 C  C   . VAL A 1 278 ? 18.991  35.136 36.460 1.00 27.35 ? 564 VAL A C   1 
ATOM   1998 O  O   . VAL A 1 278 ? 20.008  35.580 35.934 1.00 28.49 ? 564 VAL A O   1 
ATOM   1999 C  CB  . VAL A 1 278 ? 17.500  37.103 36.885 1.00 27.01 ? 564 VAL A CB  1 
ATOM   2000 C  CG1 . VAL A 1 278 ? 16.215  37.840 36.453 1.00 29.32 ? 564 VAL A CG1 1 
ATOM   2001 C  CG2 . VAL A 1 278 ? 17.534  36.871 38.335 1.00 31.67 ? 564 VAL A CG2 1 
ATOM   2002 N  N   . LYS A 1 279 ? 18.996  34.135 37.351 1.00 26.40 ? 565 LYS A N   1 
ATOM   2003 C  CA  . LYS A 1 279 ? 20.229  33.407 37.704 1.00 27.45 ? 565 LYS A CA  1 
ATOM   2004 C  C   . LYS A 1 279 ? 20.520  32.152 36.844 1.00 26.43 ? 565 LYS A C   1 
ATOM   2005 O  O   . LYS A 1 279 ? 21.440  31.386 37.164 1.00 25.01 ? 565 LYS A O   1 
ATOM   2006 C  CB  . LYS A 1 279 ? 20.213  32.967 39.192 1.00 27.45 ? 565 LYS A CB  1 
ATOM   2007 C  CG  . LYS A 1 279 ? 20.288  34.130 40.177 1.00 31.95 ? 565 LYS A CG  1 
ATOM   2008 C  CD  . LYS A 1 279 ? 21.687  34.765 40.084 1.00 42.21 ? 565 LYS A CD  1 
ATOM   2009 C  CE  . LYS A 1 279 ? 21.691  36.291 40.337 1.00 46.22 ? 565 LYS A CE  1 
ATOM   2010 N  NZ  . LYS A 1 279 ? 23.117  36.808 40.203 1.00 49.61 ? 565 LYS A NZ  1 
ATOM   2011 N  N   . HIS A 1 280 ? 19.732  31.940 35.801 1.00 25.97 ? 566 HIS A N   1 
ATOM   2012 C  CA  . HIS A 1 280 ? 19.808  30.721 35.008 1.00 27.82 ? 566 HIS A CA  1 
ATOM   2013 C  C   . HIS A 1 280 ? 21.127  30.688 34.247 1.00 28.12 ? 566 HIS A C   1 
ATOM   2014 O  O   . HIS A 1 280 ? 21.578  31.707 33.738 1.00 27.90 ? 566 HIS A O   1 
ATOM   2015 C  CB  . HIS A 1 280 ? 18.624  30.640 34.007 1.00 26.69 ? 566 HIS A CB  1 
ATOM   2016 C  CG  . HIS A 1 280 ? 18.370  29.256 33.494 1.00 29.54 ? 566 HIS A CG  1 
ATOM   2017 N  ND1 . HIS A 1 280 ? 19.224  28.618 32.619 1.00 33.29 ? 566 HIS A ND1 1 
ATOM   2018 C  CD2 . HIS A 1 280 ? 17.370  28.379 33.746 1.00 31.80 ? 566 HIS A CD2 1 
ATOM   2019 C  CE1 . HIS A 1 280 ? 18.769  27.403 32.361 1.00 33.79 ? 566 HIS A CE1 1 
ATOM   2020 N  NE2 . HIS A 1 280 ? 17.643  27.235 33.031 1.00 35.26 ? 566 HIS A NE2 1 
ATOM   2021 N  N   . SER A 1 281 ? 21.740  29.514 34.185 1.00 28.83 ? 567 SER A N   1 
ATOM   2022 C  CA  . SER A 1 281 ? 23.031  29.364 33.504 1.00 29.83 ? 567 SER A CA  1 
ATOM   2023 C  C   . SER A 1 281 ? 22.989  29.789 32.055 1.00 30.77 ? 567 SER A C   1 
ATOM   2024 O  O   . SER A 1 281 ? 23.932  30.370 31.542 1.00 30.58 ? 567 SER A O   1 
ATOM   2025 C  CB  . SER A 1 281 ? 23.581  27.923 33.608 1.00 30.23 ? 567 SER A CB  1 
ATOM   2026 O  OG  . SER A 1 281 ? 22.713  26.968 32.996 1.00 31.00 ? 567 SER A OG  1 
ATOM   2027 N  N   . VAL A 1 282 ? 21.885  29.517 31.386 1.00 31.82 ? 568 VAL A N   1 
ATOM   2028 C  CA  . VAL A 1 282 ? 21.794  29.937 29.997 1.00 32.58 ? 568 VAL A CA  1 
ATOM   2029 C  C   . VAL A 1 282 ? 21.898  31.447 29.810 1.00 30.82 ? 568 VAL A C   1 
ATOM   2030 O  O   . VAL A 1 282 ? 22.299  31.927 28.747 1.00 29.87 ? 568 VAL A O   1 
ATOM   2031 C  CB  . VAL A 1 282 ? 20.511  29.442 29.339 1.00 34.00 ? 568 VAL A CB  1 
ATOM   2032 C  CG1 . VAL A 1 282 ? 19.344  30.001 30.010 1.00 37.15 ? 568 VAL A CG1 1 
ATOM   2033 C  CG2 . VAL A 1 282 ? 20.481  29.894 27.864 1.00 37.33 ? 568 VAL A CG2 1 
ATOM   2034 N  N   . LEU A 1 283 ? 21.530  32.217 30.827 1.00 29.47 ? 569 LEU A N   1 
ATOM   2035 C  CA  . LEU A 1 283 ? 21.573  33.662 30.694 1.00 29.32 ? 569 LEU A CA  1 
ATOM   2036 C  C   . LEU A 1 283 ? 22.821  34.258 31.295 1.00 29.48 ? 569 LEU A C   1 
ATOM   2037 O  O   . LEU A 1 283 ? 22.942  35.463 31.361 1.00 30.46 ? 569 LEU A O   1 
ATOM   2038 C  CB  . LEU A 1 283 ? 20.332  34.323 31.309 1.00 27.28 ? 569 LEU A CB  1 
ATOM   2039 C  CG  . LEU A 1 283 ? 19.044  33.804 30.727 1.00 27.15 ? 569 LEU A CG  1 
ATOM   2040 C  CD1 . LEU A 1 283 ? 17.900  34.526 31.427 1.00 25.64 ? 569 LEU A CD1 1 
ATOM   2041 C  CD2 . LEU A 1 283 ? 18.950  34.045 29.206 1.00 27.95 ? 569 LEU A CD2 1 
HETATM 2042 MG MG  . MG  B 2 .   ? -0.822  48.287 26.607 1.00 33.32 ? 601 MG  A MG  1 
HETATM 2043 MG MG  . MG  C 2 .   ? -5.762  48.028 37.140 1.00 37.75 ? 602 MG  A MG  1 
HETATM 2044 O  O3  . 824 D 3 .   ? 8.189   55.652 21.934 1.00 23.55 ? 901 824 A O3  1 
HETATM 2045 C  C19 . 824 D 3 .   ? 7.021   55.262 22.405 1.00 22.83 ? 901 824 A C19 1 
HETATM 2046 C  C20 . 824 D 3 .   ? 6.045   54.866 21.433 1.00 29.15 ? 901 824 A C20 1 
HETATM 2047 C  C18 . 824 D 3 .   ? 4.766   54.389 21.750 1.00 26.81 ? 901 824 A C18 1 
HETATM 2048 C  C16 . 824 D 3 .   ? 4.403   54.355 23.103 1.00 25.41 ? 901 824 A C16 1 
HETATM 2049 C  C15 . 824 D 3 .   ? 5.397   54.747 24.096 1.00 23.07 ? 901 824 A C15 1 
HETATM 2050 C  C17 . 824 D 3 .   ? 6.712   55.183 23.785 1.00 23.39 ? 901 824 A C17 1 
HETATM 2051 C  C13 . 824 D 3 .   ? 4.677   54.554 25.349 1.00 22.11 ? 901 824 A C13 1 
HETATM 2052 C  C14 . 824 D 3 .   ? 3.343   54.030 25.093 1.00 24.36 ? 901 824 A C14 1 
HETATM 2053 N  N2  . 824 D 3 .   ? 3.271   53.934 23.735 1.00 24.55 ? 901 824 A N2  1 
HETATM 2054 C  C4  . 824 D 3 .   ? 5.033   54.757 26.721 1.00 20.70 ? 901 824 A C4  1 
HETATM 2055 C  C5  . 824 D 3 .   ? 6.249   55.187 27.392 1.00 22.68 ? 901 824 A C5  1 
HETATM 2056 O  O1  . 824 D 3 .   ? 7.299   55.625 26.841 1.00 25.42 ? 901 824 A O1  1 
HETATM 2057 C  C3  . 824 D 3 .   ? 4.093   54.441 27.760 1.00 21.20 ? 901 824 A C3  1 
HETATM 2058 C  C6  . 824 D 3 .   ? 4.859   54.781 28.971 1.00 23.09 ? 901 824 A C6  1 
HETATM 2059 O  O2  . 824 D 3 .   ? 4.397   54.623 30.143 1.00 22.86 ? 901 824 A O2  1 
HETATM 2060 N  N1  . 824 D 3 .   ? 6.132   55.184 28.731 1.00 23.29 ? 901 824 A N1  1 
HETATM 2061 C  C2  . 824 D 3 .   ? 2.732   53.990 27.482 1.00 21.94 ? 901 824 A C2  1 
HETATM 2062 C  C1  . 824 D 3 .   ? 2.399   53.779 26.109 1.00 20.26 ? 901 824 A C1  1 
HETATM 2063 C  C7  . 824 D 3 .   ? 1.748   53.690 28.532 1.00 22.90 ? 901 824 A C7  1 
HETATM 2064 C  C8  . 824 D 3 .   ? 1.446   54.684 29.492 1.00 23.03 ? 901 824 A C8  1 
HETATM 2065 C  C9  . 824 D 3 .   ? 0.490   54.433 30.509 1.00 20.79 ? 901 824 A C9  1 
HETATM 2066 C  C10 . 824 D 3 .   ? -0.219  53.238 30.425 1.00 21.94 ? 901 824 A C10 1 
HETATM 2067 C  C11 . 824 D 3 .   ? 0.033   52.300 29.453 1.00 24.65 ? 901 824 A C11 1 
HETATM 2068 C  C12 . 824 D 3 .   ? 1.020   52.503 28.465 1.00 25.37 ? 901 824 A C12 1 
HETATM 2069 O  O   . HOH E 4 .   ? 1.657   42.664 21.438 1.00 16.45 ? 603 HOH A O   1 
HETATM 2070 O  O   . HOH E 4 .   ? 3.561   69.194 36.285 1.00 16.40 ? 604 HOH A O   1 
HETATM 2071 O  O   . HOH E 4 .   ? 1.374   38.031 18.220 1.00 22.24 ? 605 HOH A O   1 
HETATM 2072 O  O   . HOH E 4 .   ? -0.391  45.323 34.070 1.00 20.79 ? 606 HOH A O   1 
HETATM 2073 O  O   . HOH E 4 .   ? 11.756  40.092 15.703 1.00 21.12 ? 607 HOH A O   1 
HETATM 2074 O  O   . HOH E 4 .   ? 0.567   51.930 23.485 1.00 19.97 ? 608 HOH A O   1 
HETATM 2075 O  O   . HOH E 4 .   ? -0.343  39.729 27.882 1.00 24.44 ? 609 HOH A O   1 
HETATM 2076 O  O   . HOH E 4 .   ? 1.597   38.457 32.118 1.00 21.91 ? 610 HOH A O   1 
HETATM 2077 O  O   . HOH E 4 .   ? 2.744   35.554 49.198 1.00 45.72 ? 611 HOH A O   1 
HETATM 2078 O  O   . HOH E 4 .   ? 11.003  60.657 30.513 1.00 24.33 ? 612 HOH A O   1 
HETATM 2079 O  O   . HOH E 4 .   ? 7.366   32.713 41.883 1.00 26.25 ? 613 HOH A O   1 
HETATM 2080 O  O   . HOH E 4 .   ? 3.184   52.393 31.546 1.00 23.35 ? 614 HOH A O   1 
HETATM 2081 O  O   . HOH E 4 .   ? 8.714   35.007 40.255 1.00 24.18 ? 615 HOH A O   1 
HETATM 2082 O  O   . HOH E 4 .   ? -1.412  32.177 21.932 1.00 23.19 ? 616 HOH A O   1 
HETATM 2083 O  O   . HOH E 4 .   ? 12.649  61.104 32.487 1.00 27.92 ? 617 HOH A O   1 
HETATM 2084 O  O   . HOH E 4 .   ? 2.966   49.182 20.117 1.00 30.09 ? 618 HOH A O   1 
HETATM 2085 O  O   . HOH E 4 .   ? 1.162   25.633 29.378 1.00 25.47 ? 619 HOH A O   1 
HETATM 2086 O  O   . HOH E 4 .   ? 12.481  33.887 7.619  1.00 18.95 ? 620 HOH A O   1 
HETATM 2087 O  O   . HOH E 4 .   ? -0.789  36.802 31.531 1.00 27.04 ? 621 HOH A O   1 
HETATM 2088 O  O   . HOH E 4 .   ? -1.987  55.940 18.437 1.00 34.67 ? 622 HOH A O   1 
HETATM 2089 O  O   . HOH E 4 .   ? 12.435  75.997 32.558 1.00 18.64 ? 623 HOH A O   1 
HETATM 2090 O  O   . HOH E 4 .   ? 10.793  52.114 38.035 1.00 29.86 ? 624 HOH A O   1 
HETATM 2091 O  O   . HOH E 4 .   ? -5.623  24.865 36.052 1.00 20.18 ? 625 HOH A O   1 
HETATM 2092 O  O   . HOH E 4 .   ? 5.885   72.488 33.738 1.00 19.35 ? 626 HOH A O   1 
HETATM 2093 O  O   . HOH E 4 .   ? 12.080  28.250 40.216 1.00 23.54 ? 627 HOH A O   1 
HETATM 2094 O  O   . HOH E 4 .   ? -0.709  33.413 43.238 1.00 22.75 ? 628 HOH A O   1 
HETATM 2095 O  O   . HOH E 4 .   ? 9.535   39.502 13.908 1.00 22.25 ? 629 HOH A O   1 
HETATM 2096 O  O   . HOH E 4 .   ? 10.144  50.058 18.501 1.00 29.88 ? 630 HOH A O   1 
HETATM 2097 O  O   . HOH E 4 .   ? 6.448   51.769 18.971 1.00 39.34 ? 631 HOH A O   1 
HETATM 2098 O  O   . HOH E 4 .   ? -0.533  31.268 37.103 1.00 22.92 ? 632 HOH A O   1 
HETATM 2099 O  O   . HOH E 4 .   ? 8.625   39.464 5.316  1.00 21.41 ? 633 HOH A O   1 
HETATM 2100 O  O   . HOH E 4 .   ? 3.748   26.820 15.084 1.00 29.20 ? 634 HOH A O   1 
HETATM 2101 O  O   . HOH E 4 .   ? 3.995   61.785 42.193 1.00 22.03 ? 635 HOH A O   1 
HETATM 2102 O  O   . HOH E 4 .   ? -1.577  25.386 32.831 1.00 26.94 ? 636 HOH A O   1 
HETATM 2103 O  O   . HOH E 4 .   ? 23.646  35.437 18.725 1.00 22.59 ? 637 HOH A O   1 
HETATM 2104 O  O   . HOH E 4 .   ? 4.352   66.548 37.014 1.00 31.45 ? 638 HOH A O   1 
HETATM 2105 O  O   . HOH E 4 .   ? 22.737  23.978 23.957 1.00 28.21 ? 639 HOH A O   1 
HETATM 2106 O  O   . HOH E 4 .   ? 13.662  63.936 28.115 1.00 34.53 ? 640 HOH A O   1 
HETATM 2107 O  O   . HOH E 4 .   ? -3.451  47.944 38.001 1.00 26.01 ? 641 HOH A O   1 
HETATM 2108 O  O   . HOH E 4 .   ? 23.232  38.540 25.404 1.00 34.01 ? 642 HOH A O   1 
HETATM 2109 O  O   . HOH E 4 .   ? -10.076 52.052 45.413 1.00 30.64 ? 643 HOH A O   1 
HETATM 2110 O  O   . HOH E 4 .   ? 4.610   31.176 42.129 1.00 22.23 ? 644 HOH A O   1 
HETATM 2111 O  O   . HOH E 4 .   ? 22.507  23.470 20.688 1.00 20.55 ? 645 HOH A O   1 
HETATM 2112 O  O   . HOH E 4 .   ? 7.494   77.031 32.773 1.00 28.54 ? 646 HOH A O   1 
HETATM 2113 O  O   . HOH E 4 .   ? 6.199   57.028 44.182 1.00 26.55 ? 647 HOH A O   1 
HETATM 2114 O  O   . HOH E 4 .   ? -3.040  71.381 40.127 1.00 27.29 ? 648 HOH A O   1 
HETATM 2115 O  O   . HOH E 4 .   ? 3.266   54.858 18.461 1.00 32.18 ? 649 HOH A O   1 
HETATM 2116 O  O   . HOH E 4 .   ? -4.428  34.364 44.263 1.00 30.25 ? 650 HOH A O   1 
HETATM 2117 O  O   . HOH E 4 .   ? 11.123  38.000 42.950 1.00 26.11 ? 651 HOH A O   1 
HETATM 2118 O  O   . HOH E 4 .   ? 3.394   31.502 16.181 1.00 28.39 ? 652 HOH A O   1 
HETATM 2119 O  O   . HOH E 4 .   ? 4.588   36.294 17.303 1.00 32.96 ? 653 HOH A O   1 
HETATM 2120 O  O   . HOH E 4 .   ? 13.822  58.889 34.176 1.00 43.87 ? 654 HOH A O   1 
HETATM 2121 O  O   . HOH E 4 .   ? -1.588  44.508 21.777 1.00 30.23 ? 655 HOH A O   1 
HETATM 2122 O  O   . HOH E 4 .   ? -8.060  50.548 44.048 1.00 23.98 ? 656 HOH A O   1 
HETATM 2123 O  O   . HOH E 4 .   ? 16.613  43.154 12.753 1.00 30.87 ? 657 HOH A O   1 
HETATM 2124 O  O   . HOH E 4 .   ? 13.388  46.523 14.410 1.00 37.03 ? 658 HOH A O   1 
HETATM 2125 O  O   . HOH E 4 .   ? 6.647   22.890 28.050 1.00 32.50 ? 659 HOH A O   1 
HETATM 2126 O  O   . HOH E 4 .   ? -2.996  51.135 31.432 1.00 32.03 ? 660 HOH A O   1 
HETATM 2127 O  O   . HOH E 4 .   ? 14.796  43.379 42.350 1.00 38.04 ? 661 HOH A O   1 
HETATM 2128 O  O   . HOH E 4 .   ? 18.075  24.966 29.630 1.00 24.70 ? 662 HOH A O   1 
HETATM 2129 O  O   . HOH E 4 .   ? -0.676  69.510 27.212 1.00 34.42 ? 663 HOH A O   1 
HETATM 2130 O  O   . HOH E 4 .   ? 13.602  37.713 44.364 1.00 37.17 ? 664 HOH A O   1 
HETATM 2131 O  O   . HOH E 4 .   ? 10.343  25.911 39.130 1.00 32.01 ? 665 HOH A O   1 
HETATM 2132 O  O   . HOH E 4 .   ? 17.656  53.710 31.690 1.00 46.33 ? 666 HOH A O   1 
HETATM 2133 O  O   . HOH E 4 .   ? 12.479  22.191 28.767 1.00 28.20 ? 667 HOH A O   1 
HETATM 2134 O  O   . HOH E 4 .   ? -7.555  30.193 42.778 1.00 29.34 ? 668 HOH A O   1 
HETATM 2135 O  O   . HOH E 4 .   ? 15.503  42.708 39.735 1.00 27.18 ? 669 HOH A O   1 
HETATM 2136 O  O   . HOH E 4 .   ? 5.062   36.936 47.712 1.00 33.76 ? 670 HOH A O   1 
HETATM 2137 O  O   . HOH E 4 .   ? 2.485   49.864 22.681 1.00 29.83 ? 671 HOH A O   1 
HETATM 2138 O  O   . HOH E 4 .   ? 16.458  25.718 16.840 1.00 33.78 ? 672 HOH A O   1 
HETATM 2139 O  O   . HOH E 4 .   ? 18.372  45.700 37.290 1.00 36.17 ? 673 HOH A O   1 
HETATM 2140 O  O   . HOH E 4 .   ? 2.717   25.234 19.339 1.00 33.07 ? 674 HOH A O   1 
HETATM 2141 O  O   . HOH E 4 .   ? 11.066  35.616 41.796 1.00 27.33 ? 675 HOH A O   1 
HETATM 2142 O  O   . HOH E 4 .   ? -1.201  47.195 24.534 1.00 30.80 ? 676 HOH A O   1 
HETATM 2143 O  O   . HOH E 4 .   ? 24.045  33.558 22.971 1.00 30.48 ? 677 HOH A O   1 
HETATM 2144 O  O   . HOH E 4 .   ? -5.293  54.405 35.860 1.00 28.62 ? 678 HOH A O   1 
HETATM 2145 O  O   . HOH E 4 .   ? 19.642  38.552 9.899  1.00 35.13 ? 679 HOH A O   1 
HETATM 2146 O  O   . HOH E 4 .   ? 12.866  74.516 29.595 1.00 30.22 ? 680 HOH A O   1 
HETATM 2147 O  O   . HOH E 4 .   ? -5.561  45.672 38.125 1.00 25.94 ? 681 HOH A O   1 
HETATM 2148 O  O   . HOH E 4 .   ? -8.353  22.929 30.881 1.00 28.79 ? 682 HOH A O   1 
HETATM 2149 O  O   . HOH E 4 .   ? 5.291   43.646 9.504  1.00 29.03 ? 683 HOH A O   1 
HETATM 2150 O  O   . HOH E 4 .   ? -3.256  37.735 32.718 1.00 32.46 ? 684 HOH A O   1 
HETATM 2151 O  O   . HOH E 4 .   ? -8.463  53.684 47.084 1.00 24.91 ? 685 HOH A O   1 
HETATM 2152 O  O   . HOH E 4 .   ? 8.904   28.060 41.662 1.00 31.46 ? 686 HOH A O   1 
HETATM 2153 O  O   . HOH E 4 .   ? 11.016  26.029 15.603 1.00 28.19 ? 687 HOH A O   1 
HETATM 2154 O  O   . HOH E 4 .   ? 17.748  36.910 8.833  1.00 40.15 ? 688 HOH A O   1 
HETATM 2155 O  O   . HOH E 4 .   ? 4.898   18.415 36.806 1.00 35.04 ? 689 HOH A O   1 
HETATM 2156 O  O   . HOH E 4 .   ? -4.478  43.516 27.111 1.00 41.02 ? 690 HOH A O   1 
HETATM 2157 O  O   . HOH E 4 .   ? -5.556  50.568 31.996 1.00 38.93 ? 691 HOH A O   1 
HETATM 2158 O  O   . HOH E 4 .   ? 10.970  60.556 19.907 1.00 33.96 ? 692 HOH A O   1 
HETATM 2159 O  O   . HOH E 4 .   ? -1.901  37.540 29.047 1.00 24.85 ? 693 HOH A O   1 
HETATM 2160 O  O   . HOH E 4 .   ? -1.602  52.030 20.676 1.00 41.13 ? 694 HOH A O   1 
HETATM 2161 O  O   . HOH E 4 .   ? -2.827  50.149 25.815 1.00 43.11 ? 695 HOH A O   1 
HETATM 2162 O  O   . HOH E 4 .   ? 7.597   54.793 17.937 1.00 42.45 ? 696 HOH A O   1 
HETATM 2163 O  O   . HOH E 4 .   ? -0.351  63.201 16.874 1.00 26.31 ? 697 HOH A O   1 
HETATM 2164 O  O   . HOH E 4 .   ? 4.341   43.049 16.643 1.00 27.56 ? 698 HOH A O   1 
HETATM 2165 O  O   . HOH E 4 .   ? 9.828   21.203 29.923 1.00 30.25 ? 699 HOH A O   1 
HETATM 2166 O  O   . HOH E 4 .   ? 7.314   55.441 42.049 1.00 33.76 ? 700 HOH A O   1 
HETATM 2167 O  O   . HOH E 4 .   ? 18.305  42.675 22.821 1.00 30.52 ? 701 HOH A O   1 
HETATM 2168 O  O   . HOH E 4 .   ? -4.091  24.422 33.239 1.00 29.05 ? 702 HOH A O   1 
HETATM 2169 O  O   . HOH E 4 .   ? 14.581  27.141 16.604 1.00 35.74 ? 703 HOH A O   1 
HETATM 2170 O  O   . HOH E 4 .   ? 6.808   48.812 13.093 1.00 32.85 ? 704 HOH A O   1 
HETATM 2171 O  O   . HOH E 4 .   ? 19.820  32.220 15.222 1.00 39.56 ? 705 HOH A O   1 
HETATM 2172 O  O   . HOH E 4 .   ? 18.023  29.088 37.934 1.00 33.17 ? 706 HOH A O   1 
HETATM 2173 O  O   . HOH E 4 .   ? 3.481   46.241 47.079 1.00 36.41 ? 707 HOH A O   1 
HETATM 2174 O  O   . HOH E 4 .   ? 22.219  34.050 34.662 1.00 37.44 ? 708 HOH A O   1 
HETATM 2175 O  O   . HOH E 4 .   ? -5.081  41.247 36.839 1.00 34.86 ? 709 HOH A O   1 
HETATM 2176 O  O   . HOH E 4 .   ? -6.395  33.794 16.144 1.00 41.00 ? 710 HOH A O   1 
HETATM 2177 O  O   . HOH E 4 .   ? 12.633  61.997 27.983 1.00 37.27 ? 711 HOH A O   1 
HETATM 2178 O  O   . HOH E 4 .   ? 18.158  44.131 20.411 1.00 38.16 ? 712 HOH A O   1 
HETATM 2179 O  O   . HOH E 4 .   ? 11.305  49.966 16.312 1.00 32.68 ? 713 HOH A O   1 
HETATM 2180 O  O   . HOH E 4 .   ? -8.103  37.656 27.638 1.00 37.74 ? 714 HOH A O   1 
HETATM 2181 O  O   . HOH E 4 .   ? 10.834  73.592 28.412 1.00 39.30 ? 715 HOH A O   1 
HETATM 2182 O  O   . HOH E 4 .   ? 13.680  56.466 29.047 1.00 38.94 ? 716 HOH A O   1 
HETATM 2183 O  O   . HOH E 4 .   ? 17.502  48.660 38.360 1.00 36.37 ? 717 HOH A O   1 
HETATM 2184 O  O   . HOH E 4 .   ? 13.412  26.623 38.486 1.00 33.35 ? 718 HOH A O   1 
HETATM 2185 O  O   . HOH E 4 .   ? 24.497  35.651 25.244 1.00 36.40 ? 719 HOH A O   1 
HETATM 2186 O  O   . HOH E 4 .   ? -0.013  71.503 24.092 1.00 28.96 ? 720 HOH A O   1 
HETATM 2187 O  O   . HOH E 4 .   ? 15.957  43.557 16.231 1.00 37.23 ? 721 HOH A O   1 
HETATM 2188 O  O   . HOH E 4 .   ? 7.590   37.779 14.935 1.00 23.29 ? 722 HOH A O   1 
HETATM 2189 O  O   . HOH E 4 .   ? 10.385  59.312 39.318 0.50 35.74 ? 723 HOH A O   1 
HETATM 2190 O  O   . HOH E 4 .   ? 1.003   52.049 33.422 1.00 25.54 ? 724 HOH A O   1 
HETATM 2191 O  O   . HOH E 4 .   ? 0.863   49.642 25.935 1.00 29.06 ? 725 HOH A O   1 
HETATM 2192 O  O   . HOH E 4 .   ? 5.465   30.680 14.195 1.00 27.19 ? 726 HOH A O   1 
HETATM 2193 O  O   . HOH E 4 .   ? 0.093   34.376 31.185 1.00 26.87 ? 727 HOH A O   1 
HETATM 2194 O  O   . HOH E 4 .   ? -4.823  57.660 33.034 1.00 27.09 ? 728 HOH A O   1 
HETATM 2195 O  O   . HOH E 4 .   ? -2.236  30.319 39.131 1.00 29.46 ? 729 HOH A O   1 
HETATM 2196 O  O   . HOH E 4 .   ? 17.122  36.646 11.644 1.00 29.52 ? 730 HOH A O   1 
HETATM 2197 O  O   . HOH E 4 .   ? 6.616   53.204 37.782 1.00 30.38 ? 731 HOH A O   1 
HETATM 2198 O  O   . HOH E 4 .   ? 12.286  52.311 36.077 1.00 39.72 ? 732 HOH A O   1 
HETATM 2199 O  O   . HOH E 4 .   ? -0.953  27.155 30.377 1.00 31.80 ? 733 HOH A O   1 
HETATM 2200 O  O   . HOH E 4 .   ? -11.338 65.590 37.030 1.00 36.47 ? 734 HOH A O   1 
HETATM 2201 O  O   . HOH E 4 .   ? 21.245  45.698 25.767 1.00 45.04 ? 735 HOH A O   1 
HETATM 2202 O  O   . HOH E 4 .   ? -7.514  54.214 33.832 1.00 42.17 ? 736 HOH A O   1 
HETATM 2203 O  O   . HOH E 4 .   ? 16.365  54.263 34.764 1.00 49.88 ? 737 HOH A O   1 
HETATM 2204 O  O   . HOH E 4 .   ? -1.890  46.065 31.118 1.00 35.22 ? 738 HOH A O   1 
HETATM 2205 O  O   . HOH E 4 .   ? 8.298   22.491 21.917 1.00 27.38 ? 739 HOH A O   1 
HETATM 2206 O  O   . HOH E 4 .   ? 7.067   48.032 10.176 1.00 46.37 ? 740 HOH A O   1 
HETATM 2207 O  O   . HOH E 4 .   ? -6.261  65.519 40.947 1.00 33.35 ? 741 HOH A O   1 
HETATM 2208 O  O   . HOH E 4 .   ? -10.585 55.816 28.091 1.00 56.09 ? 742 HOH A O   1 
HETATM 2209 O  O   . HOH E 4 .   ? 15.069  34.846 8.053  1.00 31.57 ? 743 HOH A O   1 
HETATM 2210 O  O   . HOH E 4 .   ? 5.069   38.389 15.848 1.00 45.17 ? 744 HOH A O   1 
HETATM 2211 O  O   . HOH E 4 .   ? 17.998  43.781 38.822 1.00 37.80 ? 745 HOH A O   1 
HETATM 2212 O  O   . HOH E 4 .   ? 3.006   46.760 16.226 1.00 43.01 ? 746 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   287 ?   ?   ?   A . n 
A 1 2   ALA 2   288 ?   ?   ?   A . n 
A 1 3   MET 3   289 ?   ?   ?   A . n 
A 1 4   GLY 4   290 ?   ?   ?   A . n 
A 1 5   MET 5   291 291 MET MET A . n 
A 1 6   LYS 6   292 292 LYS LYS A . n 
A 1 7   SER 7   293 293 SER SER A . n 
A 1 8   ARG 8   294 294 ARG ARG A . n 
A 1 9   TYR 9   295 295 TYR TYR A . n 
A 1 10  THR 10  296 296 THR THR A . n 
A 1 11  THR 11  297 297 THR THR A . n 
A 1 12  GLU 12  298 298 GLU GLU A . n 
A 1 13  PHE 13  299 299 PHE PHE A . n 
A 1 14  HIS 14  300 300 HIS HIS A . n 
A 1 15  GLU 15  301 301 GLU GLU A . n 
A 1 16  LEU 16  302 302 LEU LEU A . n 
A 1 17  GLU 17  303 303 GLU GLU A . n 
A 1 18  LYS 18  304 304 LYS LYS A . n 
A 1 19  ILE 19  305 305 ILE ILE A . n 
A 1 20  GLY 20  306 306 GLY GLY A . n 
A 1 21  SER 21  307 307 SER SER A . n 
A 1 22  GLY 22  308 308 GLY GLY A . n 
A 1 23  GLU 23  309 309 GLU ALA A . n 
A 1 24  PHE 24  310 310 PHE ALA A . n 
A 1 25  GLY 25  311 311 GLY GLY A . n 
A 1 26  SER 26  312 312 SER SER A . n 
A 1 27  VAL 27  313 313 VAL VAL A . n 
A 1 28  PHE 28  314 314 PHE PHE A . n 
A 1 29  LYS 29  315 315 LYS LYS A . n 
A 1 30  CYS 30  316 316 CYS CYS A . n 
A 1 31  VAL 31  317 317 VAL VAL A . n 
A 1 32  LYS 32  318 318 LYS LYS A . n 
A 1 33  ARG 33  319 319 ARG ARG A . n 
A 1 34  LEU 34  320 320 LEU LEU A . n 
A 1 35  ASP 35  321 321 ASP ASP A . n 
A 1 36  GLY 36  322 322 GLY GLY A . n 
A 1 37  CYS 37  323 323 CYS CYS A . n 
A 1 38  ILE 38  324 324 ILE ILE A . n 
A 1 39  TYR 39  325 325 TYR TYR A . n 
A 1 40  ALA 40  326 326 ALA ALA A . n 
A 1 41  ILE 41  327 327 ILE ILE A . n 
A 1 42  LYS 42  328 328 LYS LYS A . n 
A 1 43  ARG 43  329 329 ARG ARG A . n 
A 1 44  SER 44  330 330 SER SER A . n 
A 1 45  LYS 45  331 331 LYS ALA A . n 
A 1 46  LYS 46  332 332 LYS LYS A . n 
A 1 47  PRO 47  333 333 PRO PRO A . n 
A 1 48  LEU 48  334 334 LEU ALA A . n 
A 1 49  ALA 49  335 335 ALA ALA A . n 
A 1 50  GLY 50  336 336 GLY GLY A . n 
A 1 51  SER 51  337 337 SER SER A . n 
A 1 52  VAL 52  338 338 VAL VAL A . n 
A 1 53  ASP 53  339 339 ASP ASP A . n 
A 1 54  GLU 54  340 340 GLU GLU A . n 
A 1 55  GLN 55  341 341 GLN GLN A . n 
A 1 56  ASN 56  342 342 ASN ASN A . n 
A 1 57  ALA 57  343 343 ALA ALA A . n 
A 1 58  LEU 58  344 344 LEU LEU A . n 
A 1 59  ARG 59  345 345 ARG ARG A . n 
A 1 60  GLU 60  346 346 GLU GLU A . n 
A 1 61  VAL 61  347 347 VAL VAL A . n 
A 1 62  TYR 62  348 348 TYR TYR A . n 
A 1 63  ALA 63  349 349 ALA ALA A . n 
A 1 64  HIS 64  350 350 HIS HIS A . n 
A 1 65  ALA 65  351 351 ALA ALA A . n 
A 1 66  VAL 66  352 352 VAL VAL A . n 
A 1 67  LEU 67  353 353 LEU LEU A . n 
A 1 68  GLY 68  354 354 GLY GLY A . n 
A 1 69  GLN 69  355 355 GLN GLN A . n 
A 1 70  HIS 70  356 356 HIS HIS A . n 
A 1 71  SER 71  357 357 SER SER A . n 
A 1 72  HIS 72  358 358 HIS HIS A . n 
A 1 73  VAL 73  359 359 VAL VAL A . n 
A 1 74  VAL 74  360 360 VAL VAL A . n 
A 1 75  ARG 75  361 361 ARG ARG A . n 
A 1 76  TYR 76  362 362 TYR TYR A . n 
A 1 77  PHE 77  363 363 PHE PHE A . n 
A 1 78  SER 78  364 364 SER SER A . n 
A 1 79  ALA 79  365 365 ALA ALA A . n 
A 1 80  TRP 80  366 366 TRP TRP A . n 
A 1 81  ALA 81  367 367 ALA ALA A . n 
A 1 82  GLU 82  368 368 GLU GLU A . n 
A 1 83  ASP 83  369 369 ASP ASP A . n 
A 1 84  ASP 84  370 370 ASP ASP A . n 
A 1 85  HIS 85  371 371 HIS HIS A . n 
A 1 86  MET 86  372 372 MET MET A . n 
A 1 87  LEU 87  373 373 LEU LEU A . n 
A 1 88  ILE 88  374 374 ILE ILE A . n 
A 1 89  GLN 89  375 375 GLN GLN A . n 
A 1 90  ASN 90  376 376 ASN ASN A . n 
A 1 91  GLU 91  377 377 GLU GLU A . n 
A 1 92  TYR 92  378 378 TYR TYR A . n 
A 1 93  CYS 93  379 379 CYS CYS A . n 
A 1 94  ASN 94  380 380 ASN ASN A . n 
A 1 95  GLY 95  381 381 GLY GLY A . n 
A 1 96  GLY 96  382 382 GLY GLY A . n 
A 1 97  SER 97  383 383 SER SER A . n 
A 1 98  LEU 98  384 384 LEU LEU A . n 
A 1 99  ALA 99  385 385 ALA ALA A . n 
A 1 100 ASP 100 386 386 ASP ASP A . n 
A 1 101 ALA 101 387 387 ALA ALA A . n 
A 1 102 ILE 102 388 388 ILE ILE A . n 
A 1 103 SER 103 389 389 SER SER A . n 
A 1 104 GLU 104 390 390 GLU GLU A . n 
A 1 105 ASN 105 391 391 ASN ASN A . n 
A 1 106 TYR 106 392 392 TYR TYR A . n 
A 1 107 ARG 107 393 393 ARG ARG A . n 
A 1 108 ILE 108 394 394 ILE ILE A . n 
A 1 109 MET 109 395 395 MET MET A . n 
A 1 110 SER 110 396 396 SER SER A . n 
A 1 111 TYR 111 397 397 TYR TYR A . n 
A 1 112 PHE 112 398 398 PHE PHE A . n 
A 1 113 LYS 113 399 399 LYS LYS A . n 
A 1 114 GLU 114 400 400 GLU GLU A . n 
A 1 115 ALA 115 401 401 ALA ALA A . n 
A 1 116 GLU 116 402 402 GLU GLU A . n 
A 1 117 LEU 117 403 403 LEU LEU A . n 
A 1 118 LYS 118 404 404 LYS LYS A . n 
A 1 119 ASP 119 405 405 ASP ASP A . n 
A 1 120 LEU 120 406 406 LEU LEU A . n 
A 1 121 LEU 121 407 407 LEU LEU A . n 
A 1 122 LEU 122 408 408 LEU LEU A . n 
A 1 123 GLN 123 409 409 GLN GLN A . n 
A 1 124 VAL 124 410 410 VAL VAL A . n 
A 1 125 GLY 125 411 411 GLY GLY A . n 
A 1 126 ARG 126 412 412 ARG ARG A . n 
A 1 127 GLY 127 413 413 GLY GLY A . n 
A 1 128 LEU 128 414 414 LEU LEU A . n 
A 1 129 ARG 129 415 415 ARG ARG A . n 
A 1 130 TYR 130 416 416 TYR TYR A . n 
A 1 131 ILE 131 417 417 ILE ILE A . n 
A 1 132 HIS 132 418 418 HIS HIS A . n 
A 1 133 SER 133 419 419 SER SER A . n 
A 1 134 MET 134 420 420 MET MET A . n 
A 1 135 SER 135 421 421 SER SER A . n 
A 1 136 LEU 136 422 422 LEU LEU A . n 
A 1 137 VAL 137 423 423 VAL VAL A . n 
A 1 138 HIS 138 424 424 HIS HIS A . n 
A 1 139 MET 139 425 425 MET MET A . n 
A 1 140 ASP 140 426 426 ASP ASP A . n 
A 1 141 ILE 141 427 427 ILE ILE A . n 
A 1 142 LYS 142 428 428 LYS LYS A . n 
A 1 143 PRO 143 429 429 PRO PRO A . n 
A 1 144 SER 144 430 430 SER SER A . n 
A 1 145 ASN 145 431 431 ASN ASN A . n 
A 1 146 ILE 146 432 432 ILE ILE A . n 
A 1 147 PHE 147 433 433 PHE PHE A . n 
A 1 148 ILE 148 434 434 ILE ILE A . n 
A 1 149 SER 149 435 435 SER SER A . n 
A 1 150 ARG 150 436 ?   ?   ?   A . n 
A 1 151 THR 151 437 ?   ?   ?   A . n 
A 1 152 SER 152 438 ?   ?   ?   A . n 
A 1 153 ILE 153 439 ?   ?   ?   A . n 
A 1 154 PRO 154 440 ?   ?   ?   A . n 
A 1 155 ASN 155 441 ?   ?   ?   A . n 
A 1 156 ALA 156 442 ?   ?   ?   A . n 
A 1 157 ALA 157 443 ?   ?   ?   A . n 
A 1 158 SER 158 444 ?   ?   ?   A . n 
A 1 159 GLU 159 445 ?   ?   ?   A . n 
A 1 160 GLU 160 446 ?   ?   ?   A . n 
A 1 161 GLY 161 447 ?   ?   ?   A . n 
A 1 162 ASP 162 448 ?   ?   ?   A . n 
A 1 163 GLU 163 449 ?   ?   ?   A . n 
A 1 164 ASP 164 450 ?   ?   ?   A . n 
A 1 165 ASP 165 451 ?   ?   ?   A . n 
A 1 166 TRP 166 452 ?   ?   ?   A . n 
A 1 167 ALA 167 453 ?   ?   ?   A . n 
A 1 168 SER 168 454 ?   ?   ?   A . n 
A 1 169 ASN 169 455 ?   ?   ?   A . n 
A 1 170 LYS 170 456 456 LYS LYS A . n 
A 1 171 VAL 171 457 457 VAL VAL A . n 
A 1 172 MET 172 458 458 MET MET A . n 
A 1 173 PHE 173 459 459 PHE PHE A . n 
A 1 174 LYS 174 460 460 LYS LYS A . n 
A 1 175 ILE 175 461 461 ILE ILE A . n 
A 1 176 GLY 176 462 462 GLY GLY A . n 
A 1 177 ASP 177 463 463 ASP ASP A . n 
A 1 178 LEU 178 464 464 LEU LEU A . n 
A 1 179 GLY 179 465 465 GLY GLY A . n 
A 1 180 HIS 180 466 466 HIS HIS A . n 
A 1 181 VAL 181 467 467 VAL VAL A . n 
A 1 182 THR 182 468 468 THR THR A . n 
A 1 183 ARG 183 469 469 ARG ARG A . n 
A 1 184 ILE 184 470 470 ILE ILE A . n 
A 1 185 SER 185 471 471 SER SER A . n 
A 1 186 SER 186 472 472 SER SER A . n 
A 1 187 PRO 187 473 473 PRO PRO A . n 
A 1 188 GLN 188 474 474 GLN ALA A . n 
A 1 189 VAL 189 475 475 VAL VAL A . n 
A 1 190 GLU 190 476 476 GLU GLU A . n 
A 1 191 GLU 191 477 477 GLU GLU A . n 
A 1 192 GLY 192 478 478 GLY GLY A . n 
A 1 193 ASP 193 479 479 ASP ASP A . n 
A 1 194 SER 194 480 480 SER SER A . n 
A 1 195 ARG 195 481 481 ARG ARG A . n 
A 1 196 PHE 196 482 482 PHE PHE A . n 
A 1 197 LEU 197 483 483 LEU LEU A . n 
A 1 198 ALA 198 484 484 ALA ALA A . n 
A 1 199 ASN 199 485 485 ASN ASN A . n 
A 1 200 GLU 200 486 486 GLU GLU A . n 
A 1 201 VAL 201 487 487 VAL VAL A . n 
A 1 202 LEU 202 488 488 LEU LEU A . n 
A 1 203 GLN 203 489 489 GLN GLN A . n 
A 1 204 GLU 204 490 490 GLU GLU A . n 
A 1 205 ASN 205 491 491 ASN ASN A . n 
A 1 206 TYR 206 492 492 TYR TYR A . n 
A 1 207 THR 207 493 493 THR THR A . n 
A 1 208 HIS 208 494 494 HIS HIS A . n 
A 1 209 LEU 209 495 495 LEU LEU A . n 
A 1 210 PRO 210 496 496 PRO PRO A . n 
A 1 211 LYS 211 497 497 LYS LYS A . n 
A 1 212 ALA 212 498 498 ALA ALA A . n 
A 1 213 ASP 213 499 499 ASP ASP A . n 
A 1 214 ILE 214 500 500 ILE ILE A . n 
A 1 215 PHE 215 501 501 PHE PHE A . n 
A 1 216 ALA 216 502 502 ALA ALA A . n 
A 1 217 LEU 217 503 503 LEU LEU A . n 
A 1 218 ALA 218 504 504 ALA ALA A . n 
A 1 219 LEU 219 505 505 LEU LEU A . n 
A 1 220 THR 220 506 506 THR THR A . n 
A 1 221 VAL 221 507 507 VAL VAL A . n 
A 1 222 VAL 222 508 508 VAL VAL A . n 
A 1 223 CYS 223 509 509 CYS CYS A . n 
A 1 224 ALA 224 510 510 ALA ALA A . n 
A 1 225 ALA 225 511 511 ALA ALA A . n 
A 1 226 GLY 226 512 512 GLY GLY A . n 
A 1 227 ALA 227 513 513 ALA ALA A . n 
A 1 228 GLU 228 514 514 GLU GLU A . n 
A 1 229 PRO 229 515 515 PRO PRO A . n 
A 1 230 LEU 230 516 516 LEU LEU A . n 
A 1 231 PRO 231 517 517 PRO PRO A . n 
A 1 232 ARG 232 518 518 ARG ARG A . n 
A 1 233 ASN 233 519 519 ASN ASN A . n 
A 1 234 GLY 234 520 520 GLY GLY A . n 
A 1 235 ASP 235 521 521 ASP ASP A . n 
A 1 236 GLN 236 522 522 GLN GLN A . n 
A 1 237 TRP 237 523 523 TRP TRP A . n 
A 1 238 HIS 238 524 524 HIS HIS A . n 
A 1 239 GLU 239 525 525 GLU GLU A . n 
A 1 240 ILE 240 526 526 ILE ILE A . n 
A 1 241 ARG 241 527 527 ARG ARG A . n 
A 1 242 GLN 242 528 528 GLN GLN A . n 
A 1 243 GLY 243 529 529 GLY GLY A . n 
A 1 244 ARG 244 530 530 ARG ARG A . n 
A 1 245 LEU 245 531 531 LEU LEU A . n 
A 1 246 PRO 246 532 532 PRO PRO A . n 
A 1 247 ARG 247 533 533 ARG ARG A . n 
A 1 248 ILE 248 534 534 ILE ILE A . n 
A 1 249 PRO 249 535 535 PRO PRO A . n 
A 1 250 GLN 250 536 536 GLN GLN A . n 
A 1 251 VAL 251 537 537 VAL VAL A . n 
A 1 252 LEU 252 538 538 LEU LEU A . n 
A 1 253 SER 253 539 539 SER SER A . n 
A 1 254 GLN 254 540 540 GLN GLN A . n 
A 1 255 GLU 255 541 541 GLU GLU A . n 
A 1 256 PHE 256 542 542 PHE PHE A . n 
A 1 257 THR 257 543 543 THR THR A . n 
A 1 258 GLU 258 544 544 GLU GLU A . n 
A 1 259 LEU 259 545 545 LEU LEU A . n 
A 1 260 LEU 260 546 546 LEU LEU A . n 
A 1 261 LYS 261 547 547 LYS LYS A . n 
A 1 262 VAL 262 548 548 VAL VAL A . n 
A 1 263 MET 263 549 549 MET MET A . n 
A 1 264 ILE 264 550 550 ILE ILE A . n 
A 1 265 HIS 265 551 551 HIS HIS A . n 
A 1 266 PRO 266 552 552 PRO PRO A . n 
A 1 267 ASP 267 553 553 ASP ASP A . n 
A 1 268 PRO 268 554 554 PRO PRO A . n 
A 1 269 GLU 269 555 555 GLU GLU A . n 
A 1 270 ARG 270 556 556 ARG ARG A . n 
A 1 271 ARG 271 557 557 ARG ARG A . n 
A 1 272 PRO 272 558 558 PRO PRO A . n 
A 1 273 SER 273 559 559 SER SER A . n 
A 1 274 ALA 274 560 560 ALA ALA A . n 
A 1 275 MET 275 561 561 MET MET A . n 
A 1 276 ALA 276 562 562 ALA ALA A . n 
A 1 277 LEU 277 563 563 LEU LEU A . n 
A 1 278 VAL 278 564 564 VAL VAL A . n 
A 1 279 LYS 279 565 565 LYS LYS A . n 
A 1 280 HIS 280 566 566 HIS HIS A . n 
A 1 281 SER 281 567 567 SER SER A . n 
A 1 282 VAL 282 568 568 VAL VAL A . n 
A 1 283 LEU 283 569 569 LEU LEU A . n 
A 1 284 LEU 284 570 ?   ?   ?   A . n 
A 1 285 SER 285 571 ?   ?   ?   A . n 
A 1 286 ALA 286 572 ?   ?   ?   A . n 
A 1 287 SER 287 573 ?   ?   ?   A . n 
A 1 288 ARG 288 574 ?   ?   ?   A . n 
A 1 289 LYS 289 575 ?   ?   ?   A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     723 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   E 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD1 ? A ASN 145 ? A ASN 431 ? 1_555 MG ? B MG . ? A MG 601 ? 1_555 O   ? E HOH .   ? A HOH 676 ? 1_555 91.7  ? 
2  OD1 ? A ASN 145 ? A ASN 431 ? 1_555 MG ? B MG . ? A MG 601 ? 1_555 O   ? E HOH .   ? A HOH 695 ? 1_555 171.3 ? 
3  O   ? E HOH .   ? A HOH 676 ? 1_555 MG ? B MG . ? A MG 601 ? 1_555 O   ? E HOH .   ? A HOH 695 ? 1_555 86.9  ? 
4  OD1 ? A ASN 145 ? A ASN 431 ? 1_555 MG ? B MG . ? A MG 601 ? 1_555 O   ? E HOH .   ? A HOH 725 ? 1_555 78.8  ? 
5  O   ? E HOH .   ? A HOH 676 ? 1_555 MG ? B MG . ? A MG 601 ? 1_555 O   ? E HOH .   ? A HOH 725 ? 1_555 97.8  ? 
6  O   ? E HOH .   ? A HOH 695 ? 1_555 MG ? B MG . ? A MG 601 ? 1_555 O   ? E HOH .   ? A HOH 725 ? 1_555 92.9  ? 
7  OD1 ? A ASN 145 ? A ASN 431 ? 1_555 MG ? B MG . ? A MG 601 ? 1_555 OD1 ? A ASP 177 ? A ASP 463 ? 1_555 97.6  ? 
8  O   ? E HOH .   ? A HOH 676 ? 1_555 MG ? B MG . ? A MG 601 ? 1_555 OD1 ? A ASP 177 ? A ASP 463 ? 1_555 151.1 ? 
9  O   ? E HOH .   ? A HOH 695 ? 1_555 MG ? B MG . ? A MG 601 ? 1_555 OD1 ? A ASP 177 ? A ASP 463 ? 1_555 87.7  ? 
10 O   ? E HOH .   ? A HOH 725 ? 1_555 MG ? B MG . ? A MG 601 ? 1_555 OD1 ? A ASP 177 ? A ASP 463 ? 1_555 110.9 ? 
11 O   ? A GLY 179 ? A GLY 465 ? 1_555 MG ? C MG . ? A MG 602 ? 1_555 O   ? E HOH .   ? A HOH 681 ? 1_555 88.6  ? 
12 O   ? A GLY 179 ? A GLY 465 ? 1_555 MG ? C MG . ? A MG 602 ? 1_555 O   ? A ASN 56  ? A ASN 342 ? 1_555 141.6 ? 
13 O   ? E HOH .   ? A HOH 681 ? 1_555 MG ? C MG . ? A MG 602 ? 1_555 O   ? A ASN 56  ? A ASN 342 ? 1_555 127.4 ? 
14 O   ? A GLY 179 ? A GLY 465 ? 1_555 MG ? C MG . ? A MG 602 ? 1_555 O   ? E HOH .   ? A HOH 641 ? 1_555 90.9  ? 
15 O   ? E HOH .   ? A HOH 681 ? 1_555 MG ? C MG . ? A MG 602 ? 1_555 O   ? E HOH .   ? A HOH 641 ? 1_555 76.2  ? 
16 O   ? A ASN 56  ? A ASN 342 ? 1_555 MG ? C MG . ? A MG 602 ? 1_555 O   ? E HOH .   ? A HOH 641 ? 1_555 108.6 ? 
17 O   ? A GLY 179 ? A GLY 465 ? 1_555 MG ? C MG . ? A MG 602 ? 1_555 OD1 ? A ASN 56  ? A ASN 342 ? 1_555 99.2  ? 
18 O   ? E HOH .   ? A HOH 681 ? 1_555 MG ? C MG . ? A MG 602 ? 1_555 OD1 ? A ASN 56  ? A ASN 342 ? 1_555 71.7  ? 
19 O   ? A ASN 56  ? A ASN 342 ? 1_555 MG ? C MG . ? A MG 602 ? 1_555 OD1 ? A ASN 56  ? A ASN 342 ? 1_555 83.0  ? 
20 O   ? E HOH .   ? A HOH 641 ? 1_555 MG ? C MG . ? A MG 602 ? 1_555 OD1 ? A ASN 56  ? A ASN 342 ? 1_555 146.0 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2005-06-07 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000  'data collection' .   ? 1 
SCALEPACK 'data scaling'    .   ? 2 
SOLVE     phasing           .   ? 3 
REFMAC    refinement        5.0 ? 4 
HKL-2000  'data reduction'  .   ? 5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O   A HIS 356 ? ? O   A HOH 732 ? ? 2.00 
2 1 O   A VAL 359 ? ? O   A HOH 732 ? ? 2.09 
3 1 NH2 A ARG 393 ? ? O   A HOH 740 ? ? 2.16 
4 1 N   A GLY 336 ? ? OE2 A GLU 340 ? ? 2.19 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CB A ASP 321 ? ? CG A ASP 321 ? ? OD2 A ASP 321 ? ? 124.67 118.30 6.37  0.90 N 
2 1 CB A ASP 339 ? ? CG A ASP 339 ? ? OD2 A ASP 339 ? ? 123.73 118.30 5.43  0.90 N 
3 1 CB A LEU 403 ? ? CG A LEU 403 ? ? CD2 A LEU 403 ? ? 123.54 111.00 12.54 1.70 N 
4 1 CB A LEU 503 ? ? CG A LEU 503 ? ? CD2 A LEU 503 ? ? 121.45 111.00 10.45 1.70 N 
5 1 NE A ARG 527 ? ? CZ A ARG 527 ? ? NH1 A ARG 527 ? ? 128.95 120.30 8.65  0.50 N 
6 1 NE A ARG 527 ? ? CZ A ARG 527 ? ? NH2 A ARG 527 ? ? 115.39 120.30 -4.91 0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LYS A 292 ? ? 69.98   61.85   
2 1 ASP A 369 ? ? 75.45   -123.46 
3 1 ASP A 426 ? ? -154.76 42.11   
4 1 ASP A 463 ? ? 52.99   80.97   
5 1 ASN A 519 ? ? -171.08 -169.90 
6 1 PRO A 535 ? ? -78.11  38.37   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLU 309 ? CG  ? A GLU 23  CG  
2  1 Y 1 A GLU 309 ? CD  ? A GLU 23  CD  
3  1 Y 1 A GLU 309 ? OE1 ? A GLU 23  OE1 
4  1 Y 1 A GLU 309 ? OE2 ? A GLU 23  OE2 
5  1 Y 1 A PHE 310 ? CG  ? A PHE 24  CG  
6  1 Y 1 A PHE 310 ? CD1 ? A PHE 24  CD1 
7  1 Y 1 A PHE 310 ? CD2 ? A PHE 24  CD2 
8  1 Y 1 A PHE 310 ? CE1 ? A PHE 24  CE1 
9  1 Y 1 A PHE 310 ? CE2 ? A PHE 24  CE2 
10 1 Y 1 A PHE 310 ? CZ  ? A PHE 24  CZ  
11 1 Y 1 A LYS 331 ? CG  ? A LYS 45  CG  
12 1 Y 1 A LYS 331 ? CD  ? A LYS 45  CD  
13 1 Y 1 A LYS 331 ? CE  ? A LYS 45  CE  
14 1 Y 1 A LYS 331 ? NZ  ? A LYS 45  NZ  
15 1 Y 1 A LEU 334 ? CG  ? A LEU 48  CG  
16 1 Y 1 A LEU 334 ? CD1 ? A LEU 48  CD1 
17 1 Y 1 A LEU 334 ? CD2 ? A LEU 48  CD2 
18 1 Y 1 A GLN 474 ? CG  ? A GLN 188 CG  
19 1 Y 1 A GLN 474 ? CD  ? A GLN 188 CD  
20 1 Y 1 A GLN 474 ? OE1 ? A GLN 188 OE1 
21 1 Y 1 A GLN 474 ? NE2 ? A GLN 188 NE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 287 ? A GLY 1   
2  1 Y 1 A ALA 288 ? A ALA 2   
3  1 Y 1 A MET 289 ? A MET 3   
4  1 Y 1 A GLY 290 ? A GLY 4   
5  1 Y 1 A ARG 436 ? A ARG 150 
6  1 Y 1 A THR 437 ? A THR 151 
7  1 Y 1 A SER 438 ? A SER 152 
8  1 Y 1 A ILE 439 ? A ILE 153 
9  1 Y 1 A PRO 440 ? A PRO 154 
10 1 Y 1 A ASN 441 ? A ASN 155 
11 1 Y 1 A ALA 442 ? A ALA 156 
12 1 Y 1 A ALA 443 ? A ALA 157 
13 1 Y 1 A SER 444 ? A SER 158 
14 1 Y 1 A GLU 445 ? A GLU 159 
15 1 Y 1 A GLU 446 ? A GLU 160 
16 1 Y 1 A GLY 447 ? A GLY 161 
17 1 Y 1 A ASP 448 ? A ASP 162 
18 1 Y 1 A GLU 449 ? A GLU 163 
19 1 Y 1 A ASP 450 ? A ASP 164 
20 1 Y 1 A ASP 451 ? A ASP 165 
21 1 Y 1 A TRP 452 ? A TRP 166 
22 1 Y 1 A ALA 453 ? A ALA 167 
23 1 Y 1 A SER 454 ? A SER 168 
24 1 Y 1 A ASN 455 ? A ASN 169 
25 1 Y 1 A LEU 570 ? A LEU 284 
26 1 Y 1 A SER 571 ? A SER 285 
27 1 Y 1 A ALA 572 ? A ALA 286 
28 1 Y 1 A SER 573 ? A SER 287 
29 1 Y 1 A ARG 574 ? A ARG 288 
30 1 Y 1 A LYS 575 ? A LYS 289 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'MAGNESIUM ION'                                              MG  
3 '9-HYDROXY-4-PHENYLPYRROLO[3,4-C]CARBAZOLE-1,3(2H,6H)-DIONE' 824 
4 water                                                        HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 MG  1   601 601 MG  MG2 A . 
C 2 MG  1   602 602 MG  MG2 A . 
D 3 824 1   901 901 824 824 A . 
E 4 HOH 1   603 603 HOH HOH A . 
E 4 HOH 2   604 604 HOH HOH A . 
E 4 HOH 3   605 605 HOH HOH A . 
E 4 HOH 4   606 606 HOH HOH A . 
E 4 HOH 5   607 607 HOH HOH A . 
E 4 HOH 6   608 608 HOH HOH A . 
E 4 HOH 7   609 609 HOH HOH A . 
E 4 HOH 8   610 610 HOH HOH A . 
E 4 HOH 9   611 611 HOH HOH A . 
E 4 HOH 10  612 612 HOH HOH A . 
E 4 HOH 11  613 613 HOH HOH A . 
E 4 HOH 12  614 614 HOH HOH A . 
E 4 HOH 13  615 615 HOH HOH A . 
E 4 HOH 14  616 616 HOH HOH A . 
E 4 HOH 15  617 617 HOH HOH A . 
E 4 HOH 16  618 618 HOH HOH A . 
E 4 HOH 17  619 619 HOH HOH A . 
E 4 HOH 18  620 620 HOH HOH A . 
E 4 HOH 19  621 621 HOH HOH A . 
E 4 HOH 20  622 622 HOH HOH A . 
E 4 HOH 21  623 623 HOH HOH A . 
E 4 HOH 22  624 624 HOH HOH A . 
E 4 HOH 23  625 625 HOH HOH A . 
E 4 HOH 24  626 626 HOH HOH A . 
E 4 HOH 25  627 627 HOH HOH A . 
E 4 HOH 26  628 628 HOH HOH A . 
E 4 HOH 27  629 629 HOH HOH A . 
E 4 HOH 28  630 630 HOH HOH A . 
E 4 HOH 29  631 631 HOH HOH A . 
E 4 HOH 30  632 632 HOH HOH A . 
E 4 HOH 31  633 633 HOH HOH A . 
E 4 HOH 32  634 634 HOH HOH A . 
E 4 HOH 33  635 635 HOH HOH A . 
E 4 HOH 34  636 636 HOH HOH A . 
E 4 HOH 35  637 637 HOH HOH A . 
E 4 HOH 36  638 638 HOH HOH A . 
E 4 HOH 37  639 639 HOH HOH A . 
E 4 HOH 38  640 640 HOH HOH A . 
E 4 HOH 39  641 641 HOH HOH A . 
E 4 HOH 40  642 642 HOH HOH A . 
E 4 HOH 41  643 643 HOH HOH A . 
E 4 HOH 42  644 644 HOH HOH A . 
E 4 HOH 43  645 645 HOH HOH A . 
E 4 HOH 44  646 646 HOH HOH A . 
E 4 HOH 45  647 647 HOH HOH A . 
E 4 HOH 46  648 648 HOH HOH A . 
E 4 HOH 47  649 649 HOH HOH A . 
E 4 HOH 48  650 650 HOH HOH A . 
E 4 HOH 49  651 651 HOH HOH A . 
E 4 HOH 50  652 652 HOH HOH A . 
E 4 HOH 51  653 653 HOH HOH A . 
E 4 HOH 52  654 654 HOH HOH A . 
E 4 HOH 53  655 655 HOH HOH A . 
E 4 HOH 54  656 656 HOH HOH A . 
E 4 HOH 55  657 657 HOH HOH A . 
E 4 HOH 56  658 658 HOH HOH A . 
E 4 HOH 57  659 659 HOH HOH A . 
E 4 HOH 58  660 660 HOH HOH A . 
E 4 HOH 59  661 661 HOH HOH A . 
E 4 HOH 60  662 662 HOH HOH A . 
E 4 HOH 61  663 663 HOH HOH A . 
E 4 HOH 62  664 664 HOH HOH A . 
E 4 HOH 63  665 665 HOH HOH A . 
E 4 HOH 64  666 666 HOH HOH A . 
E 4 HOH 65  667 667 HOH HOH A . 
E 4 HOH 66  668 668 HOH HOH A . 
E 4 HOH 67  669 669 HOH HOH A . 
E 4 HOH 68  670 670 HOH HOH A . 
E 4 HOH 69  671 671 HOH HOH A . 
E 4 HOH 70  672 672 HOH HOH A . 
E 4 HOH 71  673 673 HOH HOH A . 
E 4 HOH 72  674 674 HOH HOH A . 
E 4 HOH 73  675 675 HOH HOH A . 
E 4 HOH 74  676 676 HOH HOH A . 
E 4 HOH 75  677 677 HOH HOH A . 
E 4 HOH 76  678 678 HOH HOH A . 
E 4 HOH 77  679 679 HOH HOH A . 
E 4 HOH 78  680 680 HOH HOH A . 
E 4 HOH 79  681 681 HOH HOH A . 
E 4 HOH 80  682 682 HOH HOH A . 
E 4 HOH 81  683 683 HOH HOH A . 
E 4 HOH 82  684 684 HOH HOH A . 
E 4 HOH 83  685 685 HOH HOH A . 
E 4 HOH 84  686 686 HOH HOH A . 
E 4 HOH 85  687 687 HOH HOH A . 
E 4 HOH 86  688 688 HOH HOH A . 
E 4 HOH 87  689 689 HOH HOH A . 
E 4 HOH 88  690 690 HOH HOH A . 
E 4 HOH 89  691 691 HOH HOH A . 
E 4 HOH 90  692 692 HOH HOH A . 
E 4 HOH 91  693 693 HOH HOH A . 
E 4 HOH 92  694 694 HOH HOH A . 
E 4 HOH 93  695 695 HOH HOH A . 
E 4 HOH 94  696 696 HOH HOH A . 
E 4 HOH 95  697 697 HOH HOH A . 
E 4 HOH 96  698 698 HOH HOH A . 
E 4 HOH 97  699 699 HOH HOH A . 
E 4 HOH 98  700 700 HOH HOH A . 
E 4 HOH 99  701 701 HOH HOH A . 
E 4 HOH 100 702 702 HOH HOH A . 
E 4 HOH 101 703 703 HOH HOH A . 
E 4 HOH 102 704 704 HOH HOH A . 
E 4 HOH 103 705 705 HOH HOH A . 
E 4 HOH 104 706 706 HOH HOH A . 
E 4 HOH 105 707 707 HOH HOH A . 
E 4 HOH 106 708 708 HOH HOH A . 
E 4 HOH 107 709 709 HOH HOH A . 
E 4 HOH 108 710 710 HOH HOH A . 
E 4 HOH 109 711 711 HOH HOH A . 
E 4 HOH 110 712 712 HOH HOH A . 
E 4 HOH 111 713 713 HOH HOH A . 
E 4 HOH 112 714 714 HOH HOH A . 
E 4 HOH 113 715 715 HOH HOH A . 
E 4 HOH 114 716 716 HOH HOH A . 
E 4 HOH 115 717 717 HOH HOH A . 
E 4 HOH 116 718 718 HOH HOH A . 
E 4 HOH 117 719 719 HOH HOH A . 
E 4 HOH 118 720 720 HOH HOH A . 
E 4 HOH 119 721 721 HOH HOH A . 
E 4 HOH 120 722 722 HOH HOH A . 
E 4 HOH 121 723 723 HOH HOH A . 
E 4 HOH 122 724 724 HOH HOH A . 
E 4 HOH 123 725 725 HOH HOH A . 
E 4 HOH 124 726 726 HOH HOH A . 
E 4 HOH 125 727 727 HOH HOH A . 
E 4 HOH 126 728 728 HOH HOH A . 
E 4 HOH 127 729 729 HOH HOH A . 
E 4 HOH 128 730 730 HOH HOH A . 
E 4 HOH 129 731 731 HOH HOH A . 
E 4 HOH 130 732 732 HOH HOH A . 
E 4 HOH 131 733 733 HOH HOH A . 
E 4 HOH 132 734 734 HOH HOH A . 
E 4 HOH 133 735 735 HOH HOH A . 
E 4 HOH 134 736 736 HOH HOH A . 
E 4 HOH 135 737 737 HOH HOH A . 
E 4 HOH 136 738 738 HOH HOH A . 
E 4 HOH 137 739 739 HOH HOH A . 
E 4 HOH 138 740 740 HOH HOH A . 
E 4 HOH 139 741 741 HOH HOH A . 
E 4 HOH 140 742 742 HOH HOH A . 
E 4 HOH 141 743 743 HOH HOH A . 
E 4 HOH 142 744 744 HOH HOH A . 
E 4 HOH 143 745 745 HOH HOH A . 
E 4 HOH 144 746 746 HOH HOH A . 
#