data_1XBT
# 
_entry.id   1XBT 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1XBT         
RCSB  RCSB030179   
WWPDB D_1000030179 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1XBT 
_pdbx_database_status.recvd_initial_deposition_date   2004-08-31 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Welin, M.'          1 
'Kosinska, U.'       2 
'Mikkelsen, N.E.'    3 
'Carnrot, C.'        4 
'Zhu, C.'            5 
'Wang, L.'           6 
'Eriksson, S.'       7 
'Munch-Petersen, B.' 8 
'Eklund, H.'         9 
# 
_citation.id                        primary 
_citation.title                     'Structures of thymidine kinase 1 of human and mycoplasmic origin' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.Usa 
_citation.journal_volume            101 
_citation.page_first                17970 
_citation.page_last                 17975 
_citation.year                      2004 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15611477 
_citation.pdbx_database_id_DOI      10.1073/pnas.0406332102 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Welin, M.'          1 
primary 'Kosinska, U.'       2 
primary 'Mikkelsen, N.E.'    3 
primary 'Carnrot, C.'        4 
primary 'Zhu, C.'            5 
primary 'Wang, L.'           6 
primary 'Eriksson, S.'       7 
primary 'Munch-Petersen, B.' 8 
primary 'Eklund, H.'         9 
# 
_cell.entry_id           1XBT 
_cell.length_a           157.672 
_cell.length_b           123.177 
_cell.length_c           116.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         130.20 
_cell.angle_gamma        90.00 
_cell.Z_PDB              32 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1XBT 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Thymidine kinase, cytosolic' 21327.000 8   2.7.1.21 ? 'Truncation mutant(residues 1-193)' ? 
2 non-polymer syn 'ZINC ION'                    65.409    8   ?        ? ?                                   ? 
3 non-polymer syn 'MAGNESIUM ION'               24.305    8   ?        ? ?                                   ? 
4 non-polymer syn "THYMIDINE-5'-TRIPHOSPHATE"   482.168   8   ?        ? ?                                   ? 
5 water       nat water                         18.015    213 ?        ? ?                                   ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'DEOXYRIBONUCLEOSIDE KINASE' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MSCINLPTVLPGSPSKTRGQIQVILGPMFSGKSTELMRRVRRFQIAQYKCLVIKYAKDTRYSSSFCTHDRNTMEALPACL
LRDVAQEALGVAVIGIDEGQFFPDIVEFCEAMANAGKTVIVAALDGTFQRKPFGAILNLVPLAESVVKLTAVCMECFREA
AYTKRLGTEKEVEVIGGADKYHSVCRLCYFKKA
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MSCINLPTVLPGSPSKTRGQIQVILGPMFSGKSTELMRRVRRFQIAQYKCLVIKYAKDTRYSSSFCTHDRNTMEALPACL
LRDVAQEALGVAVIGIDEGQFFPDIVEFCEAMANAGKTVIVAALDGTFQRKPFGAILNLVPLAESVVKLTAVCMECFREA
AYTKRLGTEKEVEVIGGADKYHSVCRLCYFKKA
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F,G,H 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   CYS n 
1 4   ILE n 
1 5   ASN n 
1 6   LEU n 
1 7   PRO n 
1 8   THR n 
1 9   VAL n 
1 10  LEU n 
1 11  PRO n 
1 12  GLY n 
1 13  SER n 
1 14  PRO n 
1 15  SER n 
1 16  LYS n 
1 17  THR n 
1 18  ARG n 
1 19  GLY n 
1 20  GLN n 
1 21  ILE n 
1 22  GLN n 
1 23  VAL n 
1 24  ILE n 
1 25  LEU n 
1 26  GLY n 
1 27  PRO n 
1 28  MET n 
1 29  PHE n 
1 30  SER n 
1 31  GLY n 
1 32  LYS n 
1 33  SER n 
1 34  THR n 
1 35  GLU n 
1 36  LEU n 
1 37  MET n 
1 38  ARG n 
1 39  ARG n 
1 40  VAL n 
1 41  ARG n 
1 42  ARG n 
1 43  PHE n 
1 44  GLN n 
1 45  ILE n 
1 46  ALA n 
1 47  GLN n 
1 48  TYR n 
1 49  LYS n 
1 50  CYS n 
1 51  LEU n 
1 52  VAL n 
1 53  ILE n 
1 54  LYS n 
1 55  TYR n 
1 56  ALA n 
1 57  LYS n 
1 58  ASP n 
1 59  THR n 
1 60  ARG n 
1 61  TYR n 
1 62  SER n 
1 63  SER n 
1 64  SER n 
1 65  PHE n 
1 66  CYS n 
1 67  THR n 
1 68  HIS n 
1 69  ASP n 
1 70  ARG n 
1 71  ASN n 
1 72  THR n 
1 73  MET n 
1 74  GLU n 
1 75  ALA n 
1 76  LEU n 
1 77  PRO n 
1 78  ALA n 
1 79  CYS n 
1 80  LEU n 
1 81  LEU n 
1 82  ARG n 
1 83  ASP n 
1 84  VAL n 
1 85  ALA n 
1 86  GLN n 
1 87  GLU n 
1 88  ALA n 
1 89  LEU n 
1 90  GLY n 
1 91  VAL n 
1 92  ALA n 
1 93  VAL n 
1 94  ILE n 
1 95  GLY n 
1 96  ILE n 
1 97  ASP n 
1 98  GLU n 
1 99  GLY n 
1 100 GLN n 
1 101 PHE n 
1 102 PHE n 
1 103 PRO n 
1 104 ASP n 
1 105 ILE n 
1 106 VAL n 
1 107 GLU n 
1 108 PHE n 
1 109 CYS n 
1 110 GLU n 
1 111 ALA n 
1 112 MET n 
1 113 ALA n 
1 114 ASN n 
1 115 ALA n 
1 116 GLY n 
1 117 LYS n 
1 118 THR n 
1 119 VAL n 
1 120 ILE n 
1 121 VAL n 
1 122 ALA n 
1 123 ALA n 
1 124 LEU n 
1 125 ASP n 
1 126 GLY n 
1 127 THR n 
1 128 PHE n 
1 129 GLN n 
1 130 ARG n 
1 131 LYS n 
1 132 PRO n 
1 133 PHE n 
1 134 GLY n 
1 135 ALA n 
1 136 ILE n 
1 137 LEU n 
1 138 ASN n 
1 139 LEU n 
1 140 VAL n 
1 141 PRO n 
1 142 LEU n 
1 143 ALA n 
1 144 GLU n 
1 145 SER n 
1 146 VAL n 
1 147 VAL n 
1 148 LYS n 
1 149 LEU n 
1 150 THR n 
1 151 ALA n 
1 152 VAL n 
1 153 CYS n 
1 154 MET n 
1 155 GLU n 
1 156 CYS n 
1 157 PHE n 
1 158 ARG n 
1 159 GLU n 
1 160 ALA n 
1 161 ALA n 
1 162 TYR n 
1 163 THR n 
1 164 LYS n 
1 165 ARG n 
1 166 LEU n 
1 167 GLY n 
1 168 THR n 
1 169 GLU n 
1 170 LYS n 
1 171 GLU n 
1 172 VAL n 
1 173 GLU n 
1 174 VAL n 
1 175 ILE n 
1 176 GLY n 
1 177 GLY n 
1 178 ALA n 
1 179 ASP n 
1 180 LYS n 
1 181 TYR n 
1 182 HIS n 
1 183 SER n 
1 184 VAL n 
1 185 CYS n 
1 186 ARG n 
1 187 LEU n 
1 188 CYS n 
1 189 TYR n 
1 190 PHE n 
1 191 LYS n 
1 192 LYS n 
1 193 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 TK1 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pGEX-2T 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    KITH_HUMAN 
_struct_ref.pdbx_db_accession          P04183 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MSCINLPTVLPGSPSKTRGQIQVILGPMFSGKSTELMRRVRRFQIAQYKCLVIKYAKDTRYSSSFCTHDRNTMEALPACL
LRDVAQEALGVAVIGIDEGQFFPDIVEFCEAMANAGKTVIVAALDGTFQRKPFGAILNLVPLAESVVKLTAVCMECFREA
AYTKRLGTEKEVEVIGGADKYHSVCRLCYFKKA
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1XBT A 1 ? 193 ? P04183 1 ? 193 ? 1 193 
2 1 1XBT B 1 ? 193 ? P04183 1 ? 193 ? 1 193 
3 1 1XBT C 1 ? 193 ? P04183 1 ? 193 ? 1 193 
4 1 1XBT D 1 ? 193 ? P04183 1 ? 193 ? 1 193 
5 1 1XBT E 1 ? 193 ? P04183 1 ? 193 ? 1 193 
6 1 1XBT F 1 ? 193 ? P04183 1 ? 193 ? 1 193 
7 1 1XBT G 1 ? 193 ? P04183 1 ? 193 ? 1 193 
8 1 1XBT H 1 ? 193 ? P04183 1 ? 193 ? 1 193 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                     ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                    ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                  ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'             ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                    ? 'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                   ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'             ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                     ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                   ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                       ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                  ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                     ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                      ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                  ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'             ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE               ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                     ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                      ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                   ? 'C4 H9 N O3'        119.119 
TTP non-polymer         . "THYMIDINE-5'-TRIPHOSPHATE" ? 'C10 H17 N2 O14 P3' 482.168 
TYR 'L-peptide linking' y TYROSINE                    ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                      ? 'C5 H11 N O2'       117.146 
ZN  non-polymer         . 'ZINC ION'                  ? 'Zn 2'              65.409  
# 
_exptl.entry_id          1XBT 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.0 
_exptl_crystal.density_percent_sol   58.7 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            288.0 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.6 
_exptl_crystal_grow.pdbx_details    
'sodium citrate, 2-propanol, PEG 4000, pH 5.6, VAPOR DIFFUSION, HANGING DROP, temperature 288.0K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2003-12-02 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.933 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-2' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-2 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.933 
# 
_reflns.entry_id                     1XBT 
_reflns.observed_criterion_sigma_F   1.0 
_reflns.observed_criterion_sigma_I   1.0 
_reflns.d_resolution_high            2.25 
_reflns.d_resolution_low             87.7 
_reflns.number_all                   77566 
_reflns.number_obs                   77566 
_reflns.percent_possible_obs         28.4 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.101 
_reflns.pdbx_netI_over_sigmaI        4.9 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.5 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.25 
_reflns_shell.d_res_low              2.37 
_reflns_shell.percent_possible_all   98.6 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.434 
_reflns_shell.meanI_over_sigI_obs    1.5 
_reflns_shell.pdbx_redundancy        3.5 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      11361 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1XBT 
_refine.ls_number_reflns_obs                     62088 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             42.07 
_refine.ls_d_res_high                            2.40 
_refine.ls_percent_reflns_obs                    98.92 
_refine.ls_R_factor_obs                          0.20288 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.20133 
_refine.ls_R_factor_R_free                       0.23204 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  3317 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.933 
_refine.correlation_coeff_Fo_to_Fc_free          0.914 
_refine.B_iso_mean                               34.695 
_refine.aniso_B[1][1]                            2.86 
_refine.aniso_B[2][2]                            -0.50 
_refine.aniso_B[3][3]                            -0.07 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            1.78 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          SIRAS 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.354 
_refine.pdbx_overall_ESU_R_Free                  0.233 
_refine.overall_SU_ML                            0.160 
_refine.overall_SU_B                             6.798 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        9990 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         248 
_refine_hist.number_atoms_solvent             213 
_refine_hist.number_atoms_total               10451 
_refine_hist.d_res_high                       2.40 
_refine_hist.d_res_low                        42.07 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.009 0.022 ? 10377 'X-RAY DIFFRACTION' ? 
r_bond_other_d           ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.259 1.999 ? 14005 'X-RAY DIFFRACTION' ? 
r_angle_other_deg        ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   5.619 5.000 ? 1273  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.088 0.200 ? 1593  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.003 0.020 ? 7504  'X-RAY DIFFRACTION' ? 
r_gen_planes_other       ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.184 0.200 ? 4395  'X-RAY DIFFRACTION' ? 
r_nbd_other              ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_refined          ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_other            ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.143 0.200 ? 482   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other      ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined      0.235 0.200 ? 8     'X-RAY DIFFRACTION' ? 
r_metal_ion_other        ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.176 0.200 ? 55    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other     ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.110 0.200 ? 10    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other   ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it              0.519 1.500 ? 6373  'X-RAY DIFFRACTION' ? 
r_mcbond_other           ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_mcangle_it             1.024 2.000 ? 10216 'X-RAY DIFFRACTION' ? 
r_scbond_it              1.461 3.000 ? 4004  'X-RAY DIFFRACTION' ? 
r_scangle_it             2.541 4.500 ? 3789  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr       ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free        ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded      ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1 'tight positional'  A 632 0.03 0.05 1 'X-RAY DIFFRACTION' 1  ? ? ? 
2 'tight positional'  B 632 0.03 0.05 1 'X-RAY DIFFRACTION' 2  ? ? ? 
3 'tight positional'  C 632 0.03 0.05 1 'X-RAY DIFFRACTION' 3  ? ? ? 
4 'tight positional'  D 632 0.03 0.05 1 'X-RAY DIFFRACTION' 4  ? ? ? 
5 'tight positional'  E 632 0.03 0.05 1 'X-RAY DIFFRACTION' 5  ? ? ? 
6 'tight positional'  F 632 0.03 0.05 1 'X-RAY DIFFRACTION' 6  ? ? ? 
7 'tight positional'  G 632 0.03 0.05 1 'X-RAY DIFFRACTION' 7  ? ? ? 
8 'tight positional'  H 632 0.03 0.05 1 'X-RAY DIFFRACTION' 8  ? ? ? 
1 'medium positional' A 589 0.44 0.50 1 'X-RAY DIFFRACTION' 9  ? ? ? 
2 'medium positional' B 589 0.41 0.50 1 'X-RAY DIFFRACTION' 10 ? ? ? 
3 'medium positional' C 589 0.48 0.50 1 'X-RAY DIFFRACTION' 11 ? ? ? 
4 'medium positional' D 589 0.39 0.50 1 'X-RAY DIFFRACTION' 12 ? ? ? 
5 'medium positional' E 589 0.44 0.50 1 'X-RAY DIFFRACTION' 13 ? ? ? 
6 'medium positional' F 589 0.41 0.50 1 'X-RAY DIFFRACTION' 14 ? ? ? 
7 'medium positional' G 589 0.38 0.50 1 'X-RAY DIFFRACTION' 15 ? ? ? 
8 'medium positional' H 589 0.43 0.50 1 'X-RAY DIFFRACTION' 16 ? ? ? 
1 'tight thermal'     A 632 0.05 0.50 1 'X-RAY DIFFRACTION' 17 ? ? ? 
2 'tight thermal'     B 632 0.06 0.50 1 'X-RAY DIFFRACTION' 18 ? ? ? 
3 'tight thermal'     C 632 0.08 0.50 1 'X-RAY DIFFRACTION' 19 ? ? ? 
4 'tight thermal'     D 632 0.06 0.50 1 'X-RAY DIFFRACTION' 20 ? ? ? 
5 'tight thermal'     E 632 0.05 0.50 1 'X-RAY DIFFRACTION' 21 ? ? ? 
6 'tight thermal'     F 632 0.06 0.50 1 'X-RAY DIFFRACTION' 22 ? ? ? 
7 'tight thermal'     G 632 0.08 0.50 1 'X-RAY DIFFRACTION' 23 ? ? ? 
8 'tight thermal'     H 632 0.06 0.50 1 'X-RAY DIFFRACTION' 24 ? ? ? 
1 'medium thermal'    A 589 0.41 2.00 1 'X-RAY DIFFRACTION' 25 ? ? ? 
2 'medium thermal'    B 589 0.40 2.00 1 'X-RAY DIFFRACTION' 26 ? ? ? 
3 'medium thermal'    C 589 0.59 2.00 1 'X-RAY DIFFRACTION' 27 ? ? ? 
4 'medium thermal'    D 589 0.40 2.00 1 'X-RAY DIFFRACTION' 28 ? ? ? 
5 'medium thermal'    E 589 0.46 2.00 1 'X-RAY DIFFRACTION' 29 ? ? ? 
6 'medium thermal'    F 589 0.43 2.00 1 'X-RAY DIFFRACTION' 30 ? ? ? 
7 'medium thermal'    G 589 0.50 2.00 1 'X-RAY DIFFRACTION' 31 ? ? ? 
8 'medium thermal'    H 589 0.42 2.00 1 'X-RAY DIFFRACTION' 32 ? ? ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.400 
_refine_ls_shell.d_res_low                        2.462 
_refine_ls_shell.number_reflns_R_work             4560 
_refine_ls_shell.R_factor_R_work                  0.241 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.28 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             246 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.id 
_struct_ncs_dom.details 
1 1  A 
1 2  B 
1 3  C 
1 4  D 
1 5  E 
1 6  F 
1 7  G 
1 8  H 
1 9  A 
1 10 B 
1 11 C 
1 12 D 
1 13 E 
1 14 F 
1 15 G 
1 16 H 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1  1 2 A 18 A 58  A ARG 18 . A ASP 58  . 1 ? 
2  1 2 B 18 B 58  B ARG 18 . B ASP 58  . 1 ? 
3  1 2 C 18 C 58  C ARG 18 . C ASP 58  . 1 ? 
4  1 2 D 18 D 58  D ARG 18 . D ASP 58  . 1 ? 
5  1 2 E 18 E 58  E ARG 18 . E ASP 58  . 1 ? 
6  1 2 F 18 F 58  F ARG 18 . F ASP 58  . 1 ? 
7  1 2 G 18 G 58  G ARG 18 . G ASP 58  . 1 ? 
8  1 2 H 18 H 58  H ARG 18 . H ASP 58  . 1 ? 
9  2 2 A 75 A 191 A ALA 75 . A LYS 191 . 1 ? 
10 2 2 B 75 B 191 B ALA 75 . B LYS 191 . 1 ? 
11 2 2 C 75 C 191 C ALA 75 . C LYS 191 . 1 ? 
12 2 2 D 75 D 191 D ALA 75 . D LYS 191 . 1 ? 
13 2 2 E 75 E 191 E ALA 75 . E LYS 191 . 1 ? 
14 2 2 F 75 F 192 F ALA 75 . F LYS 192 . 1 ? 
15 2 2 G 75 G 191 G ALA 75 . G LYS 191 . 1 ? 
16 2 2 H 75 H 191 H ALA 75 . H LYS 191 . 1 ? 
# 
_struct_ncs_ens.id            1 
_struct_ncs_ens.details       ? 
_struct_ncs_ens.point_group   ? 
# 
_struct.entry_id                  1XBT 
_struct.title                     'Crystal Structure of Human Thymidine Kinase 1' 
_struct.pdbx_descriptor           'Thymidine kinase, cytosolic(E.C.2.7.1.21)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1XBT 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'DEOXYRIBONUCLEOSIDE KINASE, ZINC-BINDING DOMAIN, FEEDBACK INHIBITOR, Transferase' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 1 ? 
F  N N 1 ? 
G  N N 1 ? 
H  N N 1 ? 
I  N N 2 ? 
J  N N 3 ? 
K  N N 4 ? 
L  N N 2 ? 
M  N N 3 ? 
N  N N 4 ? 
O  N N 2 ? 
P  N N 3 ? 
Q  N N 4 ? 
R  N N 2 ? 
S  N N 3 ? 
T  N N 4 ? 
U  N N 2 ? 
V  N N 3 ? 
W  N N 4 ? 
X  N N 2 ? 
Y  N N 3 ? 
Z  N N 4 ? 
AA N N 2 ? 
BA N N 3 ? 
CA N N 4 ? 
DA N N 2 ? 
EA N N 3 ? 
FA N N 4 ? 
GA N N 5 ? 
HA N N 5 ? 
IA N N 5 ? 
JA N N 5 ? 
KA N N 5 ? 
LA N N 5 ? 
MA N N 5 ? 
NA N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY A 31  ? ILE A 45  ? GLY A 31  ILE A 45  1 ? 15 
HELX_P HELX_P2  2  LEU A 80  ? ASP A 83  ? LEU A 80  ASP A 83  5 ? 4  
HELX_P HELX_P3  3  VAL A 84  ? GLY A 90  ? VAL A 84  GLY A 90  1 ? 7  
HELX_P HELX_P4  4  GLU A 98  ? PHE A 102 ? GLU A 98  PHE A 102 5 ? 5  
HELX_P HELX_P5  5  ASP A 104 ? ALA A 115 ? ASP A 104 ALA A 115 1 ? 12 
HELX_P HELX_P6  6  ALA A 135 ? ALA A 143 ? ALA A 135 ALA A 143 5 ? 9  
HELX_P HELX_P7  7  CYS A 185 ? PHE A 190 ? CYS A 185 PHE A 190 1 ? 6  
HELX_P HELX_P8  8  GLY B 31  ? ILE B 45  ? GLY B 31  ILE B 45  1 ? 15 
HELX_P HELX_P9  9  LEU B 80  ? ASP B 83  ? LEU B 80  ASP B 83  5 ? 4  
HELX_P HELX_P10 10 VAL B 84  ? GLY B 90  ? VAL B 84  GLY B 90  1 ? 7  
HELX_P HELX_P11 11 GLU B 98  ? PHE B 102 ? GLU B 98  PHE B 102 5 ? 5  
HELX_P HELX_P12 12 ASP B 104 ? ALA B 115 ? ASP B 104 ALA B 115 1 ? 12 
HELX_P HELX_P13 13 ALA B 135 ? ALA B 143 ? ALA B 135 ALA B 143 5 ? 9  
HELX_P HELX_P14 14 CYS B 185 ? LYS B 191 ? CYS B 185 LYS B 191 1 ? 7  
HELX_P HELX_P15 15 GLY C 31  ? ILE C 45  ? GLY C 31  ILE C 45  1 ? 15 
HELX_P HELX_P16 16 LEU C 80  ? ASP C 83  ? LEU C 80  ASP C 83  5 ? 4  
HELX_P HELX_P17 17 VAL C 84  ? GLY C 90  ? VAL C 84  GLY C 90  1 ? 7  
HELX_P HELX_P18 18 GLU C 98  ? PHE C 102 ? GLU C 98  PHE C 102 5 ? 5  
HELX_P HELX_P19 19 ASP C 104 ? ALA C 115 ? ASP C 104 ALA C 115 1 ? 12 
HELX_P HELX_P20 20 ALA C 135 ? ALA C 143 ? ALA C 135 ALA C 143 5 ? 9  
HELX_P HELX_P21 21 CYS C 185 ? LYS C 191 ? CYS C 185 LYS C 191 1 ? 7  
HELX_P HELX_P22 22 GLY D 31  ? ILE D 45  ? GLY D 31  ILE D 45  1 ? 15 
HELX_P HELX_P23 23 LEU D 80  ? ASP D 83  ? LEU D 80  ASP D 83  5 ? 4  
HELX_P HELX_P24 24 VAL D 84  ? GLY D 90  ? VAL D 84  GLY D 90  1 ? 7  
HELX_P HELX_P25 25 GLY D 99  ? PHE D 102 ? GLY D 99  PHE D 102 5 ? 4  
HELX_P HELX_P26 26 ASP D 104 ? ALA D 115 ? ASP D 104 ALA D 115 1 ? 12 
HELX_P HELX_P27 27 ALA D 135 ? ALA D 143 ? ALA D 135 ALA D 143 5 ? 9  
HELX_P HELX_P28 28 CYS D 185 ? LYS D 191 ? CYS D 185 LYS D 191 1 ? 7  
HELX_P HELX_P29 29 GLY E 31  ? ILE E 45  ? GLY E 31  ILE E 45  1 ? 15 
HELX_P HELX_P30 30 LEU E 80  ? ASP E 83  ? LEU E 80  ASP E 83  5 ? 4  
HELX_P HELX_P31 31 VAL E 84  ? GLY E 90  ? VAL E 84  GLY E 90  1 ? 7  
HELX_P HELX_P32 32 GLU E 98  ? PHE E 102 ? GLU E 98  PHE E 102 5 ? 5  
HELX_P HELX_P33 33 ASP E 104 ? ALA E 115 ? ASP E 104 ALA E 115 1 ? 12 
HELX_P HELX_P34 34 ALA E 135 ? ALA E 143 ? ALA E 135 ALA E 143 5 ? 9  
HELX_P HELX_P35 35 CYS E 185 ? LYS E 191 ? CYS E 185 LYS E 191 1 ? 7  
HELX_P HELX_P36 36 GLY F 31  ? ILE F 45  ? GLY F 31  ILE F 45  1 ? 15 
HELX_P HELX_P37 37 LEU F 80  ? ASP F 83  ? LEU F 80  ASP F 83  5 ? 4  
HELX_P HELX_P38 38 VAL F 84  ? GLY F 90  ? VAL F 84  GLY F 90  1 ? 7  
HELX_P HELX_P39 39 GLY F 99  ? PHE F 102 ? GLY F 99  PHE F 102 5 ? 4  
HELX_P HELX_P40 40 ASP F 104 ? ALA F 115 ? ASP F 104 ALA F 115 1 ? 12 
HELX_P HELX_P41 41 ALA F 135 ? ALA F 143 ? ALA F 135 ALA F 143 5 ? 9  
HELX_P HELX_P42 42 CYS F 185 ? LYS F 191 ? CYS F 185 LYS F 191 1 ? 7  
HELX_P HELX_P43 43 GLY G 31  ? ILE G 45  ? GLY G 31  ILE G 45  1 ? 15 
HELX_P HELX_P44 44 LEU G 80  ? ASP G 83  ? LEU G 80  ASP G 83  5 ? 4  
HELX_P HELX_P45 45 VAL G 84  ? GLY G 90  ? VAL G 84  GLY G 90  1 ? 7  
HELX_P HELX_P46 46 GLY G 99  ? PHE G 102 ? GLY G 99  PHE G 102 5 ? 4  
HELX_P HELX_P47 47 ASP G 104 ? ALA G 115 ? ASP G 104 ALA G 115 1 ? 12 
HELX_P HELX_P48 48 ALA G 135 ? ALA G 143 ? ALA G 135 ALA G 143 5 ? 9  
HELX_P HELX_P49 49 CYS G 185 ? LYS G 191 ? CYS G 185 LYS G 191 1 ? 7  
HELX_P HELX_P50 50 GLY H 31  ? ILE H 45  ? GLY H 31  ILE H 45  1 ? 15 
HELX_P HELX_P51 51 LEU H 80  ? ASP H 83  ? LEU H 80  ASP H 83  5 ? 4  
HELX_P HELX_P52 52 VAL H 84  ? GLY H 90  ? VAL H 84  GLY H 90  1 ? 7  
HELX_P HELX_P53 53 GLY H 99  ? PHE H 102 ? GLY H 99  PHE H 102 5 ? 4  
HELX_P HELX_P54 54 ASP H 104 ? ALA H 115 ? ASP H 104 ALA H 115 1 ? 12 
HELX_P HELX_P55 55 ALA H 135 ? ALA H 143 ? ALA H 135 ALA H 143 5 ? 9  
HELX_P HELX_P56 56 CYS H 185 ? LYS H 191 ? CYS H 185 LYS H 191 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? I  ZN . ZN ? ? ? 1_555 A  CYS 153 SG  ? ? A ZN 1193 A CYS 153  1_555 ? ? ? ? ? ? ? 2.286 ? 
metalc2  metalc ? ? I  ZN . ZN ? ? ? 1_555 A  CYS 156 SG  ? ? A ZN 1193 A CYS 156  1_555 ? ? ? ? ? ? ? 2.378 ? 
metalc3  metalc ? ? I  ZN . ZN ? ? ? 1_555 A  CYS 185 SG  ? ? A ZN 1193 A CYS 185  1_555 ? ? ? ? ? ? ? 2.341 ? 
metalc4  metalc ? ? I  ZN . ZN ? ? ? 1_555 A  CYS 188 SG  ? ? A ZN 1193 A CYS 188  1_555 ? ? ? ? ? ? ? 2.423 ? 
metalc5  metalc ? ? L  ZN . ZN ? ? ? 1_555 B  CYS 153 SG  ? ? B ZN 2193 B CYS 153  1_555 ? ? ? ? ? ? ? 2.339 ? 
metalc6  metalc ? ? L  ZN . ZN ? ? ? 1_555 B  CYS 156 SG  ? ? B ZN 2193 B CYS 156  1_555 ? ? ? ? ? ? ? 2.179 ? 
metalc7  metalc ? ? L  ZN . ZN ? ? ? 1_555 B  CYS 185 SG  ? ? B ZN 2193 B CYS 185  1_555 ? ? ? ? ? ? ? 2.369 ? 
metalc8  metalc ? ? L  ZN . ZN ? ? ? 1_555 B  CYS 188 SG  ? ? B ZN 2193 B CYS 188  1_555 ? ? ? ? ? ? ? 2.213 ? 
metalc9  metalc ? ? O  ZN . ZN ? ? ? 1_555 C  CYS 153 SG  ? ? C ZN 3193 C CYS 153  1_555 ? ? ? ? ? ? ? 2.254 ? 
metalc10 metalc ? ? O  ZN . ZN ? ? ? 1_555 C  CYS 156 SG  ? ? C ZN 3193 C CYS 156  1_555 ? ? ? ? ? ? ? 2.037 ? 
metalc11 metalc ? ? O  ZN . ZN ? ? ? 1_555 C  CYS 185 SG  ? ? C ZN 3193 C CYS 185  1_555 ? ? ? ? ? ? ? 2.379 ? 
metalc12 metalc ? ? O  ZN . ZN ? ? ? 1_555 C  CYS 188 SG  ? ? C ZN 3193 C CYS 188  1_555 ? ? ? ? ? ? ? 2.458 ? 
metalc13 metalc ? ? R  ZN . ZN ? ? ? 1_555 D  CYS 153 SG  ? ? D ZN 4193 D CYS 153  1_555 ? ? ? ? ? ? ? 2.292 ? 
metalc14 metalc ? ? R  ZN . ZN ? ? ? 1_555 D  CYS 156 SG  ? ? D ZN 4193 D CYS 156  1_555 ? ? ? ? ? ? ? 2.373 ? 
metalc15 metalc ? ? R  ZN . ZN ? ? ? 1_555 D  CYS 185 SG  ? ? D ZN 4193 D CYS 185  1_555 ? ? ? ? ? ? ? 2.342 ? 
metalc16 metalc ? ? R  ZN . ZN ? ? ? 1_555 D  CYS 188 SG  ? ? D ZN 4193 D CYS 188  1_555 ? ? ? ? ? ? ? 2.351 ? 
metalc17 metalc ? ? U  ZN . ZN ? ? ? 1_555 E  CYS 153 SG  ? ? E ZN 5193 E CYS 153  1_555 ? ? ? ? ? ? ? 2.319 ? 
metalc18 metalc ? ? U  ZN . ZN ? ? ? 1_555 E  CYS 156 SG  ? ? E ZN 5193 E CYS 156  1_555 ? ? ? ? ? ? ? 2.302 ? 
metalc19 metalc ? ? U  ZN . ZN ? ? ? 1_555 E  CYS 185 SG  ? ? E ZN 5193 E CYS 185  1_555 ? ? ? ? ? ? ? 2.355 ? 
metalc20 metalc ? ? U  ZN . ZN ? ? ? 1_555 E  CYS 188 SG  ? ? E ZN 5193 E CYS 188  1_555 ? ? ? ? ? ? ? 2.261 ? 
metalc21 metalc ? ? X  ZN . ZN ? ? ? 1_555 F  CYS 153 SG  ? ? F ZN 6193 F CYS 153  1_555 ? ? ? ? ? ? ? 2.235 ? 
metalc22 metalc ? ? X  ZN . ZN ? ? ? 1_555 F  CYS 156 SG  ? ? F ZN 6193 F CYS 156  1_555 ? ? ? ? ? ? ? 2.274 ? 
metalc23 metalc ? ? X  ZN . ZN ? ? ? 1_555 F  CYS 185 SG  ? ? F ZN 6193 F CYS 185  1_555 ? ? ? ? ? ? ? 2.345 ? 
metalc24 metalc ? ? X  ZN . ZN ? ? ? 1_555 F  CYS 188 SG  ? ? F ZN 6193 F CYS 188  1_555 ? ? ? ? ? ? ? 2.406 ? 
metalc25 metalc ? ? AA ZN . ZN ? ? ? 1_555 G  CYS 153 SG  ? ? G ZN 7193 G CYS 153  1_555 ? ? ? ? ? ? ? 2.321 ? 
metalc26 metalc ? ? AA ZN . ZN ? ? ? 1_555 G  CYS 156 SG  ? ? G ZN 7193 G CYS 156  1_555 ? ? ? ? ? ? ? 2.309 ? 
metalc27 metalc ? ? AA ZN . ZN ? ? ? 1_555 G  CYS 185 SG  ? ? G ZN 7193 G CYS 185  1_555 ? ? ? ? ? ? ? 2.310 ? 
metalc28 metalc ? ? AA ZN . ZN ? ? ? 1_555 G  CYS 188 SG  ? ? G ZN 7193 G CYS 188  1_555 ? ? ? ? ? ? ? 2.270 ? 
metalc29 metalc ? ? DA ZN . ZN ? ? ? 1_555 H  CYS 153 SG  ? ? H ZN 8193 H CYS 153  1_555 ? ? ? ? ? ? ? 2.341 ? 
metalc30 metalc ? ? DA ZN . ZN ? ? ? 1_555 H  CYS 156 SG  ? ? H ZN 8193 H CYS 156  1_555 ? ? ? ? ? ? ? 2.154 ? 
metalc31 metalc ? ? DA ZN . ZN ? ? ? 1_555 H  CYS 185 SG  ? ? H ZN 8193 H CYS 185  1_555 ? ? ? ? ? ? ? 2.291 ? 
metalc32 metalc ? ? DA ZN . ZN ? ? ? 1_555 H  CYS 188 SG  ? ? H ZN 8193 H CYS 188  1_555 ? ? ? ? ? ? ? 2.341 ? 
metalc33 metalc ? ? J  MG . MG ? ? ? 1_555 K  TTP .   O1A ? ? A MG 1194 A TTP 1195 1_555 ? ? ? ? ? ? ? 2.025 ? 
metalc34 metalc ? ? J  MG . MG ? ? ? 1_555 K  TTP .   O1B ? ? A MG 1194 A TTP 1195 1_555 ? ? ? ? ? ? ? 2.399 ? 
metalc35 metalc ? ? J  MG . MG ? ? ? 1_555 K  TTP .   O1G ? ? A MG 1194 A TTP 1195 1_555 ? ? ? ? ? ? ? 2.974 ? 
metalc36 metalc ? ? M  MG . MG ? ? ? 1_555 N  TTP .   O1B ? ? B MG 2194 B TTP 2195 1_555 ? ? ? ? ? ? ? 2.565 ? 
metalc37 metalc ? ? M  MG . MG ? ? ? 1_555 N  TTP .   O1A ? ? B MG 2194 B TTP 2195 1_555 ? ? ? ? ? ? ? 2.100 ? 
metalc38 metalc ? ? M  MG . MG ? ? ? 1_555 B  SER 33  OG  ? ? B MG 2194 B SER 33   1_555 ? ? ? ? ? ? ? 2.736 ? 
metalc39 metalc ? ? M  MG . MG ? ? ? 1_555 N  TTP .   O3B ? ? B MG 2194 B TTP 2195 1_555 ? ? ? ? ? ? ? 2.825 ? 
metalc40 metalc ? ? M  MG . MG ? ? ? 1_555 N  TTP .   O1G ? ? B MG 2194 B TTP 2195 1_555 ? ? ? ? ? ? ? 2.770 ? 
metalc41 metalc ? ? P  MG . MG ? ? ? 1_555 Q  TTP .   O1A ? ? C MG 3194 C TTP 3195 1_555 ? ? ? ? ? ? ? 2.082 ? 
metalc42 metalc ? ? P  MG . MG ? ? ? 1_555 Q  TTP .   O3B ? ? C MG 3194 C TTP 3195 1_555 ? ? ? ? ? ? ? 2.833 ? 
metalc43 metalc ? ? P  MG . MG ? ? ? 1_555 Q  TTP .   O1G ? ? C MG 3194 C TTP 3195 1_555 ? ? ? ? ? ? ? 2.383 ? 
metalc44 metalc ? ? P  MG . MG ? ? ? 1_555 IA HOH .   O   ? ? C MG 3194 C HOH 3215 1_555 ? ? ? ? ? ? ? 2.891 ? 
metalc45 metalc ? ? P  MG . MG ? ? ? 1_555 C  SER 33  OG  ? ? C MG 3194 C SER 33   1_555 ? ? ? ? ? ? ? 2.642 ? 
metalc46 metalc ? ? P  MG . MG ? ? ? 1_555 Q  TTP .   O1B ? ? C MG 3194 C TTP 3195 1_555 ? ? ? ? ? ? ? 2.671 ? 
metalc47 metalc ? ? S  MG . MG ? ? ? 1_555 T  TTP .   O1G ? ? D MG 4194 D TTP 4195 1_555 ? ? ? ? ? ? ? 2.061 ? 
metalc48 metalc ? ? S  MG . MG ? ? ? 1_555 T  TTP .   O1A ? ? D MG 4194 D TTP 4195 1_555 ? ? ? ? ? ? ? 2.160 ? 
metalc49 metalc ? ? S  MG . MG ? ? ? 1_555 D  SER 33  OG  ? ? D MG 4194 D SER 33   1_555 ? ? ? ? ? ? ? 2.235 ? 
metalc50 metalc ? ? S  MG . MG ? ? ? 1_555 JA HOH .   O   ? ? D MG 4194 D HOH 4229 1_555 ? ? ? ? ? ? ? 2.035 ? 
metalc51 metalc ? ? S  MG . MG ? ? ? 1_555 T  TTP .   O1B ? ? D MG 4194 D TTP 4195 1_555 ? ? ? ? ? ? ? 2.399 ? 
metalc52 metalc ? ? V  MG . MG ? ? ? 1_555 E  SER 33  OG  ? ? E MG 5194 E SER 33   1_555 ? ? ? ? ? ? ? 2.291 ? 
metalc53 metalc ? ? V  MG . MG ? ? ? 1_555 W  TTP .   O1A ? ? E MG 5194 E TTP 5195 1_555 ? ? ? ? ? ? ? 2.116 ? 
metalc54 metalc ? ? V  MG . MG ? ? ? 1_555 W  TTP .   O1G ? ? E MG 5194 E TTP 5195 1_555 ? ? ? ? ? ? ? 2.491 ? 
metalc55 metalc ? ? V  MG . MG ? ? ? 1_555 W  TTP .   O1B ? ? E MG 5194 E TTP 5195 1_555 ? ? ? ? ? ? ? 2.995 ? 
metalc56 metalc ? ? Y  MG . MG ? ? ? 1_555 Z  TTP .   O1B ? ? F MG 6194 F TTP 6195 1_555 ? ? ? ? ? ? ? 2.687 ? 
metalc57 metalc ? ? Y  MG . MG ? ? ? 1_555 Z  TTP .   O1G ? ? F MG 6194 F TTP 6195 1_555 ? ? ? ? ? ? ? 2.238 ? 
metalc58 metalc ? ? Y  MG . MG ? ? ? 1_555 LA HOH .   O   ? ? F MG 6194 F HOH 6219 1_555 ? ? ? ? ? ? ? 3.134 ? 
metalc59 metalc ? ? Y  MG . MG ? ? ? 1_555 F  SER 33  OG  ? ? F MG 6194 F SER 33   1_555 ? ? ? ? ? ? ? 2.589 ? 
metalc60 metalc ? ? Y  MG . MG ? ? ? 1_555 Z  TTP .   O1A ? ? F MG 6194 F TTP 6195 1_555 ? ? ? ? ? ? ? 2.072 ? 
metalc61 metalc ? ? BA MG . MG ? ? ? 1_555 CA TTP .   O1G ? ? G MG 7194 G TTP 7195 1_555 ? ? ? ? ? ? ? 2.038 ? 
metalc62 metalc ? ? BA MG . MG ? ? ? 1_555 MA HOH .   O   ? ? G MG 7194 G HOH 7228 1_555 ? ? ? ? ? ? ? 2.078 ? 
metalc63 metalc ? ? BA MG . MG ? ? ? 1_555 CA TTP .   O1A ? ? G MG 7194 G TTP 7195 1_555 ? ? ? ? ? ? ? 2.035 ? 
metalc64 metalc ? ? BA MG . MG ? ? ? 1_555 CA TTP .   O1B ? ? G MG 7194 G TTP 7195 1_555 ? ? ? ? ? ? ? 2.258 ? 
metalc65 metalc ? ? BA MG . MG ? ? ? 1_555 G  SER 33  OG  ? ? G MG 7194 G SER 33   1_555 ? ? ? ? ? ? ? 2.245 ? 
metalc66 metalc ? ? EA MG . MG ? ? ? 1_555 FA TTP .   O1B ? ? H MG 8194 H TTP 8195 1_555 ? ? ? ? ? ? ? 2.317 ? 
metalc67 metalc ? ? EA MG . MG ? ? ? 1_555 FA TTP .   O1A ? ? H MG 8194 H TTP 8195 1_555 ? ? ? ? ? ? ? 2.327 ? 
metalc68 metalc ? ? EA MG . MG ? ? ? 1_555 NA HOH .   O   ? ? H MG 8194 H HOH 8217 1_555 ? ? ? ? ? ? ? 2.398 ? 
metalc69 metalc ? ? EA MG . MG ? ? ? 1_555 FA TTP .   O1G ? ? H MG 8194 H TTP 8195 1_555 ? ? ? ? ? ? ? 2.121 ? 
metalc70 metalc ? ? EA MG . MG ? ? ? 1_555 H  SER 33  OG  ? ? H MG 8194 H SER 33   1_555 ? ? ? ? ? ? ? 2.467 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 2 ? 
C ? 2 ? 
D ? 6 ? 
E ? 2 ? 
F ? 2 ? 
G ? 6 ? 
H ? 2 ? 
I ? 2 ? 
J ? 6 ? 
K ? 2 ? 
L ? 2 ? 
M ? 6 ? 
N ? 2 ? 
O ? 2 ? 
P ? 6 ? 
Q ? 2 ? 
R ? 2 ? 
S ? 6 ? 
T ? 2 ? 
U ? 2 ? 
V ? 6 ? 
W ? 2 ? 
X ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? parallel      
D 2 3 ? parallel      
D 3 4 ? parallel      
D 4 5 ? parallel      
D 5 6 ? parallel      
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? parallel      
G 2 3 ? parallel      
G 3 4 ? parallel      
G 4 5 ? parallel      
G 5 6 ? parallel      
H 1 2 ? anti-parallel 
I 1 2 ? anti-parallel 
J 1 2 ? parallel      
J 2 3 ? parallel      
J 3 4 ? parallel      
J 4 5 ? parallel      
J 5 6 ? parallel      
K 1 2 ? anti-parallel 
L 1 2 ? anti-parallel 
M 1 2 ? parallel      
M 2 3 ? parallel      
M 3 4 ? parallel      
M 4 5 ? parallel      
M 5 6 ? parallel      
N 1 2 ? anti-parallel 
O 1 2 ? anti-parallel 
P 1 2 ? parallel      
P 2 3 ? parallel      
P 3 4 ? parallel      
P 4 5 ? parallel      
P 5 6 ? parallel      
Q 1 2 ? anti-parallel 
R 1 2 ? anti-parallel 
S 1 2 ? parallel      
S 2 3 ? parallel      
S 3 4 ? parallel      
S 4 5 ? parallel      
S 5 6 ? parallel      
T 1 2 ? anti-parallel 
U 1 2 ? anti-parallel 
V 1 2 ? parallel      
V 2 3 ? parallel      
V 3 4 ? parallel      
V 4 5 ? parallel      
V 5 6 ? parallel      
W 1 2 ? anti-parallel 
X 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 76  ? ALA A 78  ? LEU A 76  ALA A 78  
A 2 CYS A 50  ? TYR A 55  ? CYS A 50  TYR A 55  
A 3 VAL A 93  ? ILE A 96  ? VAL A 93  ILE A 96  
A 4 THR A 118 ? ALA A 122 ? THR A 118 ALA A 122 
A 5 GLN A 20  ? LEU A 25  ? GLN A 20  LEU A 25  
A 6 SER A 145 ? LYS A 148 ? SER A 145 LYS A 148 
B 1 ALA A 151 ? VAL A 152 ? ALA A 151 VAL A 152 
B 2 GLU A 159 ? ALA A 160 ? GLU A 159 ALA A 160 
C 1 TYR A 162 ? ARG A 165 ? TYR A 162 ARG A 165 
C 2 TYR A 181 ? VAL A 184 ? TYR A 181 VAL A 184 
D 1 LEU B 76  ? ALA B 78  ? LEU B 76  ALA B 78  
D 2 CYS B 50  ? TYR B 55  ? CYS B 50  TYR B 55  
D 3 VAL B 93  ? ILE B 96  ? VAL B 93  ILE B 96  
D 4 THR B 118 ? ALA B 122 ? THR B 118 ALA B 122 
D 5 GLN B 20  ? LEU B 25  ? GLN B 20  LEU B 25  
D 6 SER B 145 ? LYS B 148 ? SER B 145 LYS B 148 
E 1 ALA B 151 ? VAL B 152 ? ALA B 151 VAL B 152 
E 2 GLU B 159 ? ALA B 160 ? GLU B 159 ALA B 160 
F 1 TYR B 162 ? ARG B 165 ? TYR B 162 ARG B 165 
F 2 TYR B 181 ? VAL B 184 ? TYR B 181 VAL B 184 
G 1 LEU C 76  ? ALA C 78  ? LEU C 76  ALA C 78  
G 2 CYS C 50  ? TYR C 55  ? CYS C 50  TYR C 55  
G 3 VAL C 93  ? ILE C 96  ? VAL C 93  ILE C 96  
G 4 THR C 118 ? ALA C 122 ? THR C 118 ALA C 122 
G 5 GLN C 20  ? LEU C 25  ? GLN C 20  LEU C 25  
G 6 SER C 145 ? LYS C 148 ? SER C 145 LYS C 148 
H 1 ALA C 151 ? VAL C 152 ? ALA C 151 VAL C 152 
H 2 GLU C 159 ? ALA C 160 ? GLU C 159 ALA C 160 
I 1 TYR C 162 ? ARG C 165 ? TYR C 162 ARG C 165 
I 2 TYR C 181 ? VAL C 184 ? TYR C 181 VAL C 184 
J 1 LEU D 76  ? ALA D 78  ? LEU D 76  ALA D 78  
J 2 CYS D 50  ? TYR D 55  ? CYS D 50  TYR D 55  
J 3 VAL D 93  ? ASP D 97  ? VAL D 93  ASP D 97  
J 4 THR D 118 ? ALA D 122 ? THR D 118 ALA D 122 
J 5 GLN D 20  ? LEU D 25  ? GLN D 20  LEU D 25  
J 6 SER D 145 ? LYS D 148 ? SER D 145 LYS D 148 
K 1 ALA D 151 ? VAL D 152 ? ALA D 151 VAL D 152 
K 2 GLU D 159 ? ALA D 160 ? GLU D 159 ALA D 160 
L 1 TYR D 162 ? ARG D 165 ? TYR D 162 ARG D 165 
L 2 TYR D 181 ? VAL D 184 ? TYR D 181 VAL D 184 
M 1 LEU E 76  ? ALA E 78  ? LEU E 76  ALA E 78  
M 2 CYS E 50  ? TYR E 55  ? CYS E 50  TYR E 55  
M 3 VAL E 93  ? ILE E 96  ? VAL E 93  ILE E 96  
M 4 THR E 118 ? ALA E 122 ? THR E 118 ALA E 122 
M 5 GLN E 20  ? LEU E 25  ? GLN E 20  LEU E 25  
M 6 SER E 145 ? LYS E 148 ? SER E 145 LYS E 148 
N 1 ALA E 151 ? VAL E 152 ? ALA E 151 VAL E 152 
N 2 GLU E 159 ? ALA E 160 ? GLU E 159 ALA E 160 
O 1 TYR E 162 ? ARG E 165 ? TYR E 162 ARG E 165 
O 2 TYR E 181 ? VAL E 184 ? TYR E 181 VAL E 184 
P 1 LEU F 76  ? ALA F 78  ? LEU F 76  ALA F 78  
P 2 CYS F 50  ? TYR F 55  ? CYS F 50  TYR F 55  
P 3 VAL F 93  ? ASP F 97  ? VAL F 93  ASP F 97  
P 4 THR F 118 ? ALA F 122 ? THR F 118 ALA F 122 
P 5 GLN F 20  ? LEU F 25  ? GLN F 20  LEU F 25  
P 6 SER F 145 ? LYS F 148 ? SER F 145 LYS F 148 
Q 1 ALA F 151 ? VAL F 152 ? ALA F 151 VAL F 152 
Q 2 GLU F 159 ? ALA F 160 ? GLU F 159 ALA F 160 
R 1 TYR F 162 ? ARG F 165 ? TYR F 162 ARG F 165 
R 2 TYR F 181 ? VAL F 184 ? TYR F 181 VAL F 184 
S 1 ALA G 75  ? ALA G 78  ? ALA G 75  ALA G 78  
S 2 CYS G 50  ? TYR G 55  ? CYS G 50  TYR G 55  
S 3 VAL G 93  ? ASP G 97  ? VAL G 93  ASP G 97  
S 4 THR G 118 ? LEU G 124 ? THR G 118 LEU G 124 
S 5 GLN G 20  ? GLY G 26  ? GLN G 20  GLY G 26  
S 6 SER G 145 ? LYS G 148 ? SER G 145 LYS G 148 
T 1 ALA G 151 ? VAL G 152 ? ALA G 151 VAL G 152 
T 2 GLU G 159 ? ALA G 160 ? GLU G 159 ALA G 160 
U 1 TYR G 162 ? ARG G 165 ? TYR G 162 ARG G 165 
U 2 TYR G 181 ? VAL G 184 ? TYR G 181 VAL G 184 
V 1 LEU H 76  ? ALA H 78  ? LEU H 76  ALA H 78  
V 2 CYS H 50  ? TYR H 55  ? CYS H 50  TYR H 55  
V 3 VAL H 93  ? ASP H 97  ? VAL H 93  ASP H 97  
V 4 THR H 118 ? LEU H 124 ? THR H 118 LEU H 124 
V 5 GLN H 20  ? GLY H 26  ? GLN H 20  GLY H 26  
V 6 SER H 145 ? LYS H 148 ? SER H 145 LYS H 148 
W 1 ALA H 151 ? VAL H 152 ? ALA H 151 VAL H 152 
W 2 GLU H 159 ? ALA H 160 ? GLU H 159 ALA H 160 
X 1 TYR H 162 ? ARG H 165 ? TYR H 162 ARG H 165 
X 2 TYR H 181 ? VAL H 184 ? TYR H 181 VAL H 184 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O LEU A 76  ? O LEU A 76  N LYS A 54  ? N LYS A 54  
A 2 3 N ILE A 53  ? N ILE A 53  O GLY A 95  ? O GLY A 95  
A 3 4 N ILE A 96  ? N ILE A 96  O ILE A 120 ? O ILE A 120 
A 4 5 O VAL A 121 ? O VAL A 121 N ILE A 24  ? N ILE A 24  
A 5 6 N LEU A 25  ? N LEU A 25  O VAL A 147 ? O VAL A 147 
B 1 2 N ALA A 151 ? N ALA A 151 O ALA A 160 ? O ALA A 160 
C 1 2 N LYS A 164 ? N LYS A 164 O HIS A 182 ? O HIS A 182 
D 1 2 O LEU B 76  ? O LEU B 76  N LYS B 54  ? N LYS B 54  
D 2 3 N LEU B 51  ? N LEU B 51  O GLY B 95  ? O GLY B 95  
D 3 4 N ILE B 96  ? N ILE B 96  O ALA B 122 ? O ALA B 122 
D 4 5 O VAL B 121 ? O VAL B 121 N ILE B 24  ? N ILE B 24  
D 5 6 N LEU B 25  ? N LEU B 25  O VAL B 147 ? O VAL B 147 
E 1 2 N ALA B 151 ? N ALA B 151 O ALA B 160 ? O ALA B 160 
F 1 2 N LYS B 164 ? N LYS B 164 O HIS B 182 ? O HIS B 182 
G 1 2 O LEU C 76  ? O LEU C 76  N LYS C 54  ? N LYS C 54  
G 2 3 N ILE C 53  ? N ILE C 53  O GLY C 95  ? O GLY C 95  
G 3 4 N ILE C 96  ? N ILE C 96  O ILE C 120 ? O ILE C 120 
G 4 5 O VAL C 121 ? O VAL C 121 N ILE C 24  ? N ILE C 24  
G 5 6 N LEU C 25  ? N LEU C 25  O VAL C 147 ? O VAL C 147 
H 1 2 N ALA C 151 ? N ALA C 151 O ALA C 160 ? O ALA C 160 
I 1 2 N LYS C 164 ? N LYS C 164 O HIS C 182 ? O HIS C 182 
J 1 2 O LEU D 76  ? O LEU D 76  N LYS D 54  ? N LYS D 54  
J 2 3 N LEU D 51  ? N LEU D 51  O GLY D 95  ? O GLY D 95  
J 3 4 N ILE D 94  ? N ILE D 94  O THR D 118 ? O THR D 118 
J 4 5 O VAL D 121 ? O VAL D 121 N ILE D 24  ? N ILE D 24  
J 5 6 N LEU D 25  ? N LEU D 25  O VAL D 147 ? O VAL D 147 
K 1 2 N ALA D 151 ? N ALA D 151 O ALA D 160 ? O ALA D 160 
L 1 2 N LYS D 164 ? N LYS D 164 O HIS D 182 ? O HIS D 182 
M 1 2 O LEU E 76  ? O LEU E 76  N LYS E 54  ? N LYS E 54  
M 2 3 N LEU E 51  ? N LEU E 51  O GLY E 95  ? O GLY E 95  
M 3 4 N ILE E 94  ? N ILE E 94  O THR E 118 ? O THR E 118 
M 4 5 O VAL E 121 ? O VAL E 121 N ILE E 24  ? N ILE E 24  
M 5 6 N LEU E 25  ? N LEU E 25  O VAL E 147 ? O VAL E 147 
N 1 2 N ALA E 151 ? N ALA E 151 O ALA E 160 ? O ALA E 160 
O 1 2 N LYS E 164 ? N LYS E 164 O HIS E 182 ? O HIS E 182 
P 1 2 O LEU F 76  ? O LEU F 76  N LYS F 54  ? N LYS F 54  
P 2 3 N ILE F 53  ? N ILE F 53  O GLY F 95  ? O GLY F 95  
P 3 4 N ILE F 96  ? N ILE F 96  O ILE F 120 ? O ILE F 120 
P 4 5 O VAL F 121 ? O VAL F 121 N ILE F 24  ? N ILE F 24  
P 5 6 N LEU F 25  ? N LEU F 25  O VAL F 147 ? O VAL F 147 
Q 1 2 N ALA F 151 ? N ALA F 151 O ALA F 160 ? O ALA F 160 
R 1 2 N LYS F 164 ? N LYS F 164 O HIS F 182 ? O HIS F 182 
S 1 2 O LEU G 76  ? O LEU G 76  N LYS G 54  ? N LYS G 54  
S 2 3 N ILE G 53  ? N ILE G 53  O GLY G 95  ? O GLY G 95  
S 3 4 N ILE G 94  ? N ILE G 94  O ILE G 120 ? O ILE G 120 
S 4 5 O VAL G 121 ? O VAL G 121 N ILE G 24  ? N ILE G 24  
S 5 6 N LEU G 25  ? N LEU G 25  O VAL G 147 ? O VAL G 147 
T 1 2 N ALA G 151 ? N ALA G 151 O ALA G 160 ? O ALA G 160 
U 1 2 N LYS G 164 ? N LYS G 164 O HIS G 182 ? O HIS G 182 
V 1 2 O LEU H 76  ? O LEU H 76  N LYS H 54  ? N LYS H 54  
V 2 3 N LEU H 51  ? N LEU H 51  O GLY H 95  ? O GLY H 95  
V 3 4 N ILE H 94  ? N ILE H 94  O ILE H 120 ? O ILE H 120 
V 4 5 O VAL H 121 ? O VAL H 121 N ILE H 24  ? N ILE H 24  
V 5 6 N LEU H 25  ? N LEU H 25  O VAL H 147 ? O VAL H 147 
W 1 2 N ALA H 151 ? N ALA H 151 O ALA H 160 ? O ALA H 160 
X 1 2 N LYS H 164 ? N LYS H 164 O HIS H 182 ? O HIS H 182 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN A 1193'  
AC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN B 2193'  
AC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN C 3193'  
AC4 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN D 4193'  
AC5 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN E 5193'  
AC6 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN F 6193'  
AC7 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN G 7193'  
AC8 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN H 8193'  
AC9 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG A 1194'  
BC1 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG B 2194'  
BC2 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG C 3194'  
BC3 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG D 4194'  
BC4 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG E 5194'  
BC5 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG F 6194'  
BC6 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG G 7194'  
BC7 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG H 8194'  
BC8 Software ? ? ? ? 25 'BINDING SITE FOR RESIDUE TTP A 1195' 
BC9 Software ? ? ? ? 23 'BINDING SITE FOR RESIDUE TTP B 2195' 
CC1 Software ? ? ? ? 26 'BINDING SITE FOR RESIDUE TTP C 3195' 
CC2 Software ? ? ? ? 25 'BINDING SITE FOR RESIDUE TTP D 4195' 
CC3 Software ? ? ? ? 24 'BINDING SITE FOR RESIDUE TTP E 5195' 
CC4 Software ? ? ? ? 25 'BINDING SITE FOR RESIDUE TTP F 6195' 
CC5 Software ? ? ? ? 25 'BINDING SITE FOR RESIDUE TTP G 7195' 
CC6 Software ? ? ? ? 25 'BINDING SITE FOR RESIDUE TTP H 8195' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 4  CYS A  153 ? CYS A 153  . ? 1_555 ? 
2   AC1 4  CYS A  156 ? CYS A 156  . ? 1_555 ? 
3   AC1 4  CYS A  185 ? CYS A 185  . ? 1_555 ? 
4   AC1 4  CYS A  188 ? CYS A 188  . ? 1_555 ? 
5   AC2 4  CYS B  153 ? CYS B 153  . ? 1_555 ? 
6   AC2 4  CYS B  156 ? CYS B 156  . ? 1_555 ? 
7   AC2 4  CYS B  185 ? CYS B 185  . ? 1_555 ? 
8   AC2 4  CYS B  188 ? CYS B 188  . ? 1_555 ? 
9   AC3 4  CYS C  153 ? CYS C 153  . ? 1_555 ? 
10  AC3 4  CYS C  156 ? CYS C 156  . ? 1_555 ? 
11  AC3 4  CYS C  185 ? CYS C 185  . ? 1_555 ? 
12  AC3 4  CYS C  188 ? CYS C 188  . ? 1_555 ? 
13  AC4 4  CYS D  153 ? CYS D 153  . ? 1_555 ? 
14  AC4 4  CYS D  156 ? CYS D 156  . ? 1_555 ? 
15  AC4 4  CYS D  185 ? CYS D 185  . ? 1_555 ? 
16  AC4 4  CYS D  188 ? CYS D 188  . ? 1_555 ? 
17  AC5 4  CYS E  153 ? CYS E 153  . ? 1_555 ? 
18  AC5 4  CYS E  156 ? CYS E 156  . ? 1_555 ? 
19  AC5 4  CYS E  185 ? CYS E 185  . ? 1_555 ? 
20  AC5 4  CYS E  188 ? CYS E 188  . ? 1_555 ? 
21  AC6 4  CYS F  153 ? CYS F 153  . ? 1_555 ? 
22  AC6 4  CYS F  156 ? CYS F 156  . ? 1_555 ? 
23  AC6 4  CYS F  185 ? CYS F 185  . ? 1_555 ? 
24  AC6 4  CYS F  188 ? CYS F 188  . ? 1_555 ? 
25  AC7 4  CYS G  153 ? CYS G 153  . ? 1_555 ? 
26  AC7 4  CYS G  156 ? CYS G 156  . ? 1_555 ? 
27  AC7 4  CYS G  185 ? CYS G 185  . ? 1_555 ? 
28  AC7 4  CYS G  188 ? CYS G 188  . ? 1_555 ? 
29  AC8 4  CYS H  153 ? CYS H 153  . ? 1_555 ? 
30  AC8 4  CYS H  156 ? CYS H 156  . ? 1_555 ? 
31  AC8 4  CYS H  185 ? CYS H 185  . ? 1_555 ? 
32  AC8 4  CYS H  188 ? CYS H 188  . ? 1_555 ? 
33  AC9 3  SER A  33  ? SER A 33   . ? 1_555 ? 
34  AC9 3  ARG A  60  ? ARG A 60   . ? 1_555 ? 
35  AC9 3  TTP K  .   ? TTP A 1195 . ? 1_555 ? 
36  BC1 2  SER B  33  ? SER B 33   . ? 1_555 ? 
37  BC1 2  TTP N  .   ? TTP B 2195 . ? 1_555 ? 
38  BC2 3  SER C  33  ? SER C 33   . ? 1_555 ? 
39  BC2 3  TTP Q  .   ? TTP C 3195 . ? 1_555 ? 
40  BC2 3  HOH IA .   ? HOH C 3215 . ? 1_555 ? 
41  BC3 3  SER D  33  ? SER D 33   . ? 1_555 ? 
42  BC3 3  TTP T  .   ? TTP D 4195 . ? 1_555 ? 
43  BC3 3  HOH JA .   ? HOH D 4229 . ? 1_555 ? 
44  BC4 2  SER E  33  ? SER E 33   . ? 1_555 ? 
45  BC4 2  TTP W  .   ? TTP E 5195 . ? 1_555 ? 
46  BC5 2  SER F  33  ? SER F 33   . ? 1_555 ? 
47  BC5 2  TTP Z  .   ? TTP F 6195 . ? 1_555 ? 
48  BC6 3  SER G  33  ? SER G 33   . ? 1_555 ? 
49  BC6 3  TTP CA .   ? TTP G 7195 . ? 1_555 ? 
50  BC6 3  HOH MA .   ? HOH G 7228 . ? 1_555 ? 
51  BC7 3  SER H  33  ? SER H 33   . ? 1_555 ? 
52  BC7 3  TTP FA .   ? TTP H 8195 . ? 1_555 ? 
53  BC7 3  HOH NA .   ? HOH H 8217 . ? 1_555 ? 
54  BC8 25 MET A  28  ? MET A 28   . ? 1_555 ? 
55  BC8 25 PHE A  29  ? PHE A 29   . ? 1_555 ? 
56  BC8 25 SER A  30  ? SER A 30   . ? 1_555 ? 
57  BC8 25 GLY A  31  ? GLY A 31   . ? 1_555 ? 
58  BC8 25 LYS A  32  ? LYS A 32   . ? 1_555 ? 
59  BC8 25 SER A  33  ? SER A 33   . ? 1_555 ? 
60  BC8 25 ASP A  58  ? ASP A 58   . ? 1_555 ? 
61  BC8 25 ARG A  60  ? ARG A 60   . ? 1_555 ? 
62  BC8 25 GLU A  98  ? GLU A 98   . ? 1_555 ? 
63  BC8 25 PHE A  101 ? PHE A 101  . ? 1_555 ? 
64  BC8 25 LEU A  124 ? LEU A 124  . ? 1_555 ? 
65  BC8 25 THR A  127 ? THR A 127  . ? 1_555 ? 
66  BC8 25 PHE A  128 ? PHE A 128  . ? 1_555 ? 
67  BC8 25 PHE A  133 ? PHE A 133  . ? 1_555 ? 
68  BC8 25 ARG A  165 ? ARG A 165  . ? 1_555 ? 
69  BC8 25 VAL A  172 ? VAL A 172  . ? 1_555 ? 
70  BC8 25 GLU A  173 ? GLU A 173  . ? 1_555 ? 
71  BC8 25 VAL A  174 ? VAL A 174  . ? 1_555 ? 
72  BC8 25 ILE A  175 ? ILE A 175  . ? 1_555 ? 
73  BC8 25 GLY A  176 ? GLY A 176  . ? 1_555 ? 
74  BC8 25 TYR A  181 ? TYR A 181  . ? 1_555 ? 
75  BC8 25 MG  J  .   ? MG  A 1194 . ? 1_555 ? 
76  BC8 25 HOH GA .   ? HOH A 1202 . ? 1_555 ? 
77  BC8 25 HOH GA .   ? HOH A 1214 . ? 1_555 ? 
78  BC8 25 HOH GA .   ? HOH A 1218 . ? 1_555 ? 
79  BC9 23 MET B  28  ? MET B 28   . ? 1_555 ? 
80  BC9 23 PHE B  29  ? PHE B 29   . ? 1_555 ? 
81  BC9 23 SER B  30  ? SER B 30   . ? 1_555 ? 
82  BC9 23 GLY B  31  ? GLY B 31   . ? 1_555 ? 
83  BC9 23 LYS B  32  ? LYS B 32   . ? 1_555 ? 
84  BC9 23 SER B  33  ? SER B 33   . ? 1_555 ? 
85  BC9 23 ASP B  58  ? ASP B 58   . ? 1_555 ? 
86  BC9 23 ARG B  60  ? ARG B 60   . ? 1_555 ? 
87  BC9 23 GLU B  98  ? GLU B 98   . ? 1_555 ? 
88  BC9 23 PHE B  101 ? PHE B 101  . ? 1_555 ? 
89  BC9 23 LEU B  124 ? LEU B 124  . ? 1_555 ? 
90  BC9 23 THR B  127 ? THR B 127  . ? 1_555 ? 
91  BC9 23 PHE B  128 ? PHE B 128  . ? 1_555 ? 
92  BC9 23 PHE B  133 ? PHE B 133  . ? 1_555 ? 
93  BC9 23 THR B  163 ? THR B 163  . ? 1_555 ? 
94  BC9 23 VAL B  172 ? VAL B 172  . ? 1_555 ? 
95  BC9 23 GLU B  173 ? GLU B 173  . ? 1_555 ? 
96  BC9 23 VAL B  174 ? VAL B 174  . ? 1_555 ? 
97  BC9 23 ILE B  175 ? ILE B 175  . ? 1_555 ? 
98  BC9 23 GLY B  176 ? GLY B 176  . ? 1_555 ? 
99  BC9 23 TYR B  181 ? TYR B 181  . ? 1_555 ? 
100 BC9 23 MG  M  .   ? MG  B 2194 . ? 1_555 ? 
101 BC9 23 HOH HA .   ? HOH B 2226 . ? 1_555 ? 
102 CC1 26 MET C  28  ? MET C 28   . ? 1_555 ? 
103 CC1 26 PHE C  29  ? PHE C 29   . ? 1_555 ? 
104 CC1 26 SER C  30  ? SER C 30   . ? 1_555 ? 
105 CC1 26 GLY C  31  ? GLY C 31   . ? 1_555 ? 
106 CC1 26 LYS C  32  ? LYS C 32   . ? 1_555 ? 
107 CC1 26 SER C  33  ? SER C 33   . ? 1_555 ? 
108 CC1 26 ASP C  58  ? ASP C 58   . ? 1_555 ? 
109 CC1 26 ARG C  60  ? ARG C 60   . ? 1_555 ? 
110 CC1 26 GLU C  98  ? GLU C 98   . ? 1_555 ? 
111 CC1 26 PHE C  101 ? PHE C 101  . ? 1_555 ? 
112 CC1 26 LEU C  124 ? LEU C 124  . ? 1_555 ? 
113 CC1 26 THR C  127 ? THR C 127  . ? 1_555 ? 
114 CC1 26 PHE C  128 ? PHE C 128  . ? 1_555 ? 
115 CC1 26 PHE C  133 ? PHE C 133  . ? 1_555 ? 
116 CC1 26 THR C  163 ? THR C 163  . ? 1_555 ? 
117 CC1 26 ARG C  165 ? ARG C 165  . ? 1_555 ? 
118 CC1 26 VAL C  172 ? VAL C 172  . ? 1_555 ? 
119 CC1 26 GLU C  173 ? GLU C 173  . ? 1_555 ? 
120 CC1 26 VAL C  174 ? VAL C 174  . ? 1_555 ? 
121 CC1 26 ILE C  175 ? ILE C 175  . ? 1_555 ? 
122 CC1 26 GLY C  176 ? GLY C 176  . ? 1_555 ? 
123 CC1 26 TYR C  181 ? TYR C 181  . ? 1_555 ? 
124 CC1 26 MG  P  .   ? MG  C 3194 . ? 1_555 ? 
125 CC1 26 HOH IA .   ? HOH C 3200 . ? 1_555 ? 
126 CC1 26 HOH IA .   ? HOH C 3207 . ? 1_555 ? 
127 CC1 26 HOH IA .   ? HOH C 3215 . ? 1_555 ? 
128 CC2 25 MET D  28  ? MET D 28   . ? 1_555 ? 
129 CC2 25 PHE D  29  ? PHE D 29   . ? 1_555 ? 
130 CC2 25 SER D  30  ? SER D 30   . ? 1_555 ? 
131 CC2 25 GLY D  31  ? GLY D 31   . ? 1_555 ? 
132 CC2 25 LYS D  32  ? LYS D 32   . ? 1_555 ? 
133 CC2 25 SER D  33  ? SER D 33   . ? 1_555 ? 
134 CC2 25 ASP D  58  ? ASP D 58   . ? 1_555 ? 
135 CC2 25 ARG D  60  ? ARG D 60   . ? 1_555 ? 
136 CC2 25 GLU D  98  ? GLU D 98   . ? 1_555 ? 
137 CC2 25 PHE D  101 ? PHE D 101  . ? 1_555 ? 
138 CC2 25 LEU D  124 ? LEU D 124  . ? 1_555 ? 
139 CC2 25 THR D  127 ? THR D 127  . ? 1_555 ? 
140 CC2 25 PHE D  128 ? PHE D 128  . ? 1_555 ? 
141 CC2 25 PHE D  133 ? PHE D 133  . ? 1_555 ? 
142 CC2 25 ARG D  165 ? ARG D 165  . ? 1_555 ? 
143 CC2 25 VAL D  172 ? VAL D 172  . ? 1_555 ? 
144 CC2 25 GLU D  173 ? GLU D 173  . ? 1_555 ? 
145 CC2 25 VAL D  174 ? VAL D 174  . ? 1_555 ? 
146 CC2 25 GLY D  176 ? GLY D 176  . ? 1_555 ? 
147 CC2 25 TYR D  181 ? TYR D 181  . ? 1_555 ? 
148 CC2 25 MG  S  .   ? MG  D 4194 . ? 1_555 ? 
149 CC2 25 HOH JA .   ? HOH D 4212 . ? 1_555 ? 
150 CC2 25 HOH JA .   ? HOH D 4225 . ? 1_555 ? 
151 CC2 25 HOH JA .   ? HOH D 4229 . ? 1_555 ? 
152 CC2 25 HOH JA .   ? HOH D 4230 . ? 1_555 ? 
153 CC3 24 MET E  28  ? MET E 28   . ? 1_555 ? 
154 CC3 24 PHE E  29  ? PHE E 29   . ? 1_555 ? 
155 CC3 24 SER E  30  ? SER E 30   . ? 1_555 ? 
156 CC3 24 GLY E  31  ? GLY E 31   . ? 1_555 ? 
157 CC3 24 LYS E  32  ? LYS E 32   . ? 1_555 ? 
158 CC3 24 SER E  33  ? SER E 33   . ? 1_555 ? 
159 CC3 24 ASP E  58  ? ASP E 58   . ? 1_555 ? 
160 CC3 24 ARG E  60  ? ARG E 60   . ? 1_555 ? 
161 CC3 24 GLU E  98  ? GLU E 98   . ? 1_555 ? 
162 CC3 24 PHE E  101 ? PHE E 101  . ? 1_555 ? 
163 CC3 24 LEU E  124 ? LEU E 124  . ? 1_555 ? 
164 CC3 24 THR E  127 ? THR E 127  . ? 1_555 ? 
165 CC3 24 PHE E  128 ? PHE E 128  . ? 1_555 ? 
166 CC3 24 PHE E  133 ? PHE E 133  . ? 1_555 ? 
167 CC3 24 ARG E  165 ? ARG E 165  . ? 1_555 ? 
168 CC3 24 VAL E  172 ? VAL E 172  . ? 1_555 ? 
169 CC3 24 GLU E  173 ? GLU E 173  . ? 1_555 ? 
170 CC3 24 VAL E  174 ? VAL E 174  . ? 1_555 ? 
171 CC3 24 ILE E  175 ? ILE E 175  . ? 1_555 ? 
172 CC3 24 GLY E  176 ? GLY E 176  . ? 1_555 ? 
173 CC3 24 TYR E  181 ? TYR E 181  . ? 1_555 ? 
174 CC3 24 MG  V  .   ? MG  E 5194 . ? 1_555 ? 
175 CC3 24 HOH KA .   ? HOH E 5214 . ? 1_555 ? 
176 CC3 24 HOH KA .   ? HOH E 5215 . ? 1_555 ? 
177 CC4 25 MET F  28  ? MET F 28   . ? 1_555 ? 
178 CC4 25 PHE F  29  ? PHE F 29   . ? 1_555 ? 
179 CC4 25 SER F  30  ? SER F 30   . ? 1_555 ? 
180 CC4 25 GLY F  31  ? GLY F 31   . ? 1_555 ? 
181 CC4 25 LYS F  32  ? LYS F 32   . ? 1_555 ? 
182 CC4 25 SER F  33  ? SER F 33   . ? 1_555 ? 
183 CC4 25 ASP F  58  ? ASP F 58   . ? 1_555 ? 
184 CC4 25 ARG F  60  ? ARG F 60   . ? 1_555 ? 
185 CC4 25 PHE F  101 ? PHE F 101  . ? 1_555 ? 
186 CC4 25 LEU F  124 ? LEU F 124  . ? 1_555 ? 
187 CC4 25 THR F  127 ? THR F 127  . ? 1_555 ? 
188 CC4 25 PHE F  128 ? PHE F 128  . ? 1_555 ? 
189 CC4 25 PHE F  133 ? PHE F 133  . ? 1_555 ? 
190 CC4 25 THR F  163 ? THR F 163  . ? 1_555 ? 
191 CC4 25 ARG F  165 ? ARG F 165  . ? 1_555 ? 
192 CC4 25 VAL F  172 ? VAL F 172  . ? 1_555 ? 
193 CC4 25 GLU F  173 ? GLU F 173  . ? 1_555 ? 
194 CC4 25 VAL F  174 ? VAL F 174  . ? 1_555 ? 
195 CC4 25 ILE F  175 ? ILE F 175  . ? 1_555 ? 
196 CC4 25 GLY F  176 ? GLY F 176  . ? 1_555 ? 
197 CC4 25 TYR F  181 ? TYR F 181  . ? 1_555 ? 
198 CC4 25 MG  Y  .   ? MG  F 6194 . ? 1_555 ? 
199 CC4 25 HOH LA .   ? HOH F 6210 . ? 1_555 ? 
200 CC4 25 HOH LA .   ? HOH F 6219 . ? 1_555 ? 
201 CC4 25 HOH LA .   ? HOH F 6220 . ? 1_555 ? 
202 CC5 25 MET G  28  ? MET G 28   . ? 1_555 ? 
203 CC5 25 PHE G  29  ? PHE G 29   . ? 1_555 ? 
204 CC5 25 SER G  30  ? SER G 30   . ? 1_555 ? 
205 CC5 25 GLY G  31  ? GLY G 31   . ? 1_555 ? 
206 CC5 25 LYS G  32  ? LYS G 32   . ? 1_555 ? 
207 CC5 25 SER G  33  ? SER G 33   . ? 1_555 ? 
208 CC5 25 ASP G  58  ? ASP G 58   . ? 1_555 ? 
209 CC5 25 ARG G  60  ? ARG G 60   . ? 1_555 ? 
210 CC5 25 GLU G  98  ? GLU G 98   . ? 1_555 ? 
211 CC5 25 PHE G  101 ? PHE G 101  . ? 1_555 ? 
212 CC5 25 LEU G  124 ? LEU G 124  . ? 1_555 ? 
213 CC5 25 THR G  127 ? THR G 127  . ? 1_555 ? 
214 CC5 25 PHE G  128 ? PHE G 128  . ? 1_555 ? 
215 CC5 25 PHE G  133 ? PHE G 133  . ? 1_555 ? 
216 CC5 25 ARG G  165 ? ARG G 165  . ? 1_555 ? 
217 CC5 25 VAL G  172 ? VAL G 172  . ? 1_555 ? 
218 CC5 25 GLU G  173 ? GLU G 173  . ? 1_555 ? 
219 CC5 25 VAL G  174 ? VAL G 174  . ? 1_555 ? 
220 CC5 25 GLY G  176 ? GLY G 176  . ? 1_555 ? 
221 CC5 25 TYR G  181 ? TYR G 181  . ? 1_555 ? 
222 CC5 25 MG  BA .   ? MG  G 7194 . ? 1_555 ? 
223 CC5 25 HOH MA .   ? HOH G 7202 . ? 1_555 ? 
224 CC5 25 HOH MA .   ? HOH G 7214 . ? 1_555 ? 
225 CC5 25 HOH MA .   ? HOH G 7216 . ? 1_555 ? 
226 CC5 25 HOH MA .   ? HOH G 7228 . ? 1_555 ? 
227 CC6 25 MET H  28  ? MET H 28   . ? 1_555 ? 
228 CC6 25 PHE H  29  ? PHE H 29   . ? 1_555 ? 
229 CC6 25 SER H  30  ? SER H 30   . ? 1_555 ? 
230 CC6 25 GLY H  31  ? GLY H 31   . ? 1_555 ? 
231 CC6 25 LYS H  32  ? LYS H 32   . ? 1_555 ? 
232 CC6 25 SER H  33  ? SER H 33   . ? 1_555 ? 
233 CC6 25 ASP H  58  ? ASP H 58   . ? 1_555 ? 
234 CC6 25 ARG H  60  ? ARG H 60   . ? 1_555 ? 
235 CC6 25 GLU H  98  ? GLU H 98   . ? 1_555 ? 
236 CC6 25 PHE H  101 ? PHE H 101  . ? 1_555 ? 
237 CC6 25 LEU H  124 ? LEU H 124  . ? 1_555 ? 
238 CC6 25 THR H  127 ? THR H 127  . ? 1_555 ? 
239 CC6 25 PHE H  128 ? PHE H 128  . ? 1_555 ? 
240 CC6 25 PHE H  133 ? PHE H 133  . ? 1_555 ? 
241 CC6 25 ARG H  165 ? ARG H 165  . ? 1_555 ? 
242 CC6 25 VAL H  172 ? VAL H 172  . ? 1_555 ? 
243 CC6 25 GLU H  173 ? GLU H 173  . ? 1_555 ? 
244 CC6 25 VAL H  174 ? VAL H 174  . ? 1_555 ? 
245 CC6 25 ILE H  175 ? ILE H 175  . ? 1_555 ? 
246 CC6 25 GLY H  176 ? GLY H 176  . ? 1_555 ? 
247 CC6 25 TYR H  181 ? TYR H 181  . ? 1_555 ? 
248 CC6 25 MG  EA .   ? MG  H 8194 . ? 1_555 ? 
249 CC6 25 HOH NA .   ? HOH H 8204 . ? 1_555 ? 
250 CC6 25 HOH NA .   ? HOH H 8205 . ? 1_555 ? 
251 CC6 25 HOH NA .   ? HOH H 8208 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1XBT 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1XBT 
_atom_sites.fract_transf_matrix[1][1]   0.006342 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.005360 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008118 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011287 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . ARG A  1 18  ? 11.808  6.862   43.510  1.00 43.74 ? 18   ARG A N     1 
ATOM   2     C  CA    . ARG A  1 18  ? 11.377  8.259   43.838  1.00 43.46 ? 18   ARG A CA    1 
ATOM   3     C  C     . ARG A  1 18  ? 9.849   8.415   43.897  1.00 42.22 ? 18   ARG A C     1 
ATOM   4     O  O     . ARG A  1 18  ? 9.201   8.783   42.908  1.00 42.39 ? 18   ARG A O     1 
ATOM   5     C  CB    . ARG A  1 18  ? 11.997  9.258   42.858  1.00 44.07 ? 18   ARG A CB    1 
ATOM   6     C  CG    . ARG A  1 18  ? 12.309  10.608  43.480  1.00 46.43 ? 18   ARG A CG    1 
ATOM   7     C  CD    . ARG A  1 18  ? 13.697  11.133  43.145  1.00 50.28 ? 18   ARG A CD    1 
ATOM   8     N  NE    . ARG A  1 18  ? 14.359  11.703  44.316  1.00 54.05 ? 18   ARG A NE    1 
ATOM   9     C  CZ    . ARG A  1 18  ? 15.680  11.826  44.462  1.00 56.22 ? 18   ARG A CZ    1 
ATOM   10    N  NH1   . ARG A  1 18  ? 16.514  11.422  43.504  1.00 56.76 ? 18   ARG A NH1   1 
ATOM   11    N  NH2   . ARG A  1 18  ? 16.173  12.357  45.577  1.00 56.64 ? 18   ARG A NH2   1 
ATOM   12    N  N     . GLY A  1 19  ? 9.290   8.132   45.071  1.00 40.50 ? 19   GLY A N     1 
ATOM   13    C  CA    . GLY A  1 19  ? 7.856   8.203   45.285  1.00 38.12 ? 19   GLY A CA    1 
ATOM   14    C  C     . GLY A  1 19  ? 7.373   9.603   45.592  1.00 36.50 ? 19   GLY A C     1 
ATOM   15    O  O     . GLY A  1 19  ? 8.178   10.511  45.813  1.00 36.36 ? 19   GLY A O     1 
ATOM   16    N  N     . GLN A  1 20  ? 6.052   9.761   45.651  1.00 34.90 ? 20   GLN A N     1 
ATOM   17    C  CA    . GLN A  1 20  ? 5.427   11.072  45.660  1.00 33.32 ? 20   GLN A CA    1 
ATOM   18    C  C     . GLN A  1 20  ? 3.935   10.979  45.950  1.00 31.68 ? 20   GLN A C     1 
ATOM   19    O  O     . GLN A  1 20  ? 3.274   10.032  45.529  1.00 31.18 ? 20   GLN A O     1 
ATOM   20    C  CB    . GLN A  1 20  ? 5.608   11.668  44.275  1.00 33.80 ? 20   GLN A CB    1 
ATOM   21    C  CG    . GLN A  1 20  ? 5.815   13.128  44.234  1.00 35.24 ? 20   GLN A CG    1 
ATOM   22    C  CD    . GLN A  1 20  ? 5.422   13.670  42.895  1.00 37.54 ? 20   GLN A CD    1 
ATOM   23    O  OE1   . GLN A  1 20  ? 5.737   13.076  41.863  1.00 39.26 ? 20   GLN A OE1   1 
ATOM   24    N  NE2   . GLN A  1 20  ? 4.713   14.786  42.896  1.00 39.10 ? 20   GLN A NE2   1 
ATOM   25    N  N     . ILE A  1 21  ? 3.419   11.976  46.665  1.00 30.08 ? 21   ILE A N     1 
ATOM   26    C  CA    . ILE A  1 21  ? 1.985   12.158  46.858  1.00 28.51 ? 21   ILE A CA    1 
ATOM   27    C  C     . ILE A  1 21  ? 1.563   13.487  46.244  1.00 28.01 ? 21   ILE A C     1 
ATOM   28    O  O     . ILE A  1 21  ? 2.126   14.542  46.564  1.00 27.55 ? 21   ILE A O     1 
ATOM   29    C  CB    . ILE A  1 21  ? 1.598   12.113  48.358  1.00 28.50 ? 21   ILE A CB    1 
ATOM   30    C  CG1   . ILE A  1 21  ? 2.092   10.810  49.000  1.00 28.04 ? 21   ILE A CG1   1 
ATOM   31    C  CG2   . ILE A  1 21  ? 0.067   12.254  48.534  1.00 27.74 ? 21   ILE A CG2   1 
ATOM   32    C  CD1   . ILE A  1 21  ? 1.945   10.757  50.510  1.00 26.71 ? 21   ILE A CD1   1 
ATOM   33    N  N     . GLN A  1 22  ? 0.576   13.423  45.357  1.00 27.29 ? 22   GLN A N     1 
ATOM   34    C  CA    . GLN A  1 22  ? -0.075  14.615  44.812  1.00 26.85 ? 22   GLN A CA    1 
ATOM   35    C  C     . GLN A  1 22  ? -1.537  14.640  45.231  1.00 26.37 ? 22   GLN A C     1 
ATOM   36    O  O     . GLN A  1 22  ? -2.229  13.616  45.156  1.00 26.45 ? 22   GLN A O     1 
ATOM   37    C  CB    . GLN A  1 22  ? -0.001  14.623  43.300  1.00 26.61 ? 22   GLN A CB    1 
ATOM   38    C  CG    . GLN A  1 22  ? 1.394   14.739  42.741  1.00 28.03 ? 22   GLN A CG    1 
ATOM   39    C  CD    . GLN A  1 22  ? 1.446   14.515  41.243  1.00 29.04 ? 22   GLN A CD    1 
ATOM   40    O  OE1   . GLN A  1 22  ? 0.466   14.736  40.531  1.00 28.69 ? 22   GLN A OE1   1 
ATOM   41    N  NE2   . GLN A  1 22  ? 2.595   14.072  40.762  1.00 31.67 ? 22   GLN A NE2   1 
ATOM   42    N  N     . VAL A  1 23  ? -2.007  15.808  45.665  1.00 25.68 ? 23   VAL A N     1 
ATOM   43    C  CA    . VAL A  1 23  ? -3.363  15.932  46.183  1.00 24.93 ? 23   VAL A CA    1 
ATOM   44    C  C     . VAL A  1 23  ? -4.124  16.979  45.384  1.00 24.72 ? 23   VAL A C     1 
ATOM   45    O  O     . VAL A  1 23  ? -3.640  18.091  45.200  1.00 24.69 ? 23   VAL A O     1 
ATOM   46    C  CB    . VAL A  1 23  ? -3.380  16.236  47.712  1.00 24.91 ? 23   VAL A CB    1 
ATOM   47    C  CG1   . VAL A  1 23  ? -4.805  16.467  48.217  1.00 24.15 ? 23   VAL A CG1   1 
ATOM   48    C  CG2   . VAL A  1 23  ? -2.746  15.086  48.489  1.00 24.19 ? 23   VAL A CG2   1 
ATOM   49    N  N     . ILE A  1 24  ? -5.300  16.584  44.894  1.00 24.19 ? 24   ILE A N     1 
ATOM   50    C  CA    . ILE A  1 24  ? -6.188  17.437  44.130  1.00 23.68 ? 24   ILE A CA    1 
ATOM   51    C  C     . ILE A  1 24  ? -7.444  17.655  44.969  1.00 23.86 ? 24   ILE A C     1 
ATOM   52    O  O     . ILE A  1 24  ? -8.262  16.747  45.123  1.00 23.95 ? 24   ILE A O     1 
ATOM   53    C  CB    . ILE A  1 24  ? -6.555  16.778  42.764  1.00 23.67 ? 24   ILE A CB    1 
ATOM   54    C  CG1   . ILE A  1 24  ? -5.290  16.409  41.966  1.00 23.07 ? 24   ILE A CG1   1 
ATOM   55    C  CG2   . ILE A  1 24  ? -7.477  17.692  41.948  1.00 22.16 ? 24   ILE A CG2   1 
ATOM   56    C  CD1   . ILE A  1 24  ? -5.524  15.354  40.894  1.00 21.04 ? 24   ILE A CD1   1 
ATOM   57    N  N     . LEU A  1 25  ? -7.577  18.861  45.510  1.00 23.79 ? 25   LEU A N     1 
ATOM   58    C  CA    . LEU A  1 25  ? -8.727  19.235  46.327  1.00 23.77 ? 25   LEU A CA    1 
ATOM   59    C  C     . LEU A  1 25  ? -9.681  20.133  45.541  1.00 23.67 ? 25   LEU A C     1 
ATOM   60    O  O     . LEU A  1 25  ? -9.352  20.590  44.448  1.00 23.64 ? 25   LEU A O     1 
ATOM   61    C  CB    . LEU A  1 25  ? -8.267  19.914  47.634  1.00 23.50 ? 25   LEU A CB    1 
ATOM   62    C  CG    . LEU A  1 25  ? -7.343  19.098  48.561  1.00 24.04 ? 25   LEU A CG    1 
ATOM   63    C  CD1   . LEU A  1 25  ? -6.652  19.979  49.591  1.00 23.62 ? 25   LEU A CD1   1 
ATOM   64    C  CD2   . LEU A  1 25  ? -8.080  17.947  49.266  1.00 23.18 ? 25   LEU A CD2   1 
ATOM   65    N  N     . GLY A  1 26  ? -10.864 20.369  46.100  1.00 23.69 ? 26   GLY A N     1 
ATOM   66    C  CA    . GLY A  1 26  ? -11.856 21.238  45.490  1.00 23.79 ? 26   GLY A CA    1 
ATOM   67    C  C     . GLY A  1 26  ? -13.251 20.847  45.946  1.00 23.98 ? 26   GLY A C     1 
ATOM   68    O  O     . GLY A  1 26  ? -13.432 19.765  46.512  1.00 23.94 ? 26   GLY A O     1 
ATOM   69    N  N     . PRO A  1 27  ? -14.244 21.698  45.690  1.00 23.82 ? 27   PRO A N     1 
ATOM   70    C  CA    . PRO A  1 27  ? -15.629 21.363  46.021  1.00 23.81 ? 27   PRO A CA    1 
ATOM   71    C  C     . PRO A  1 27  ? -16.148 20.373  44.989  1.00 24.17 ? 27   PRO A C     1 
ATOM   72    O  O     . PRO A  1 27  ? -15.399 19.950  44.106  1.00 24.46 ? 27   PRO A O     1 
ATOM   73    C  CB    . PRO A  1 27  ? -16.350 22.701  45.886  1.00 23.83 ? 27   PRO A CB    1 
ATOM   74    C  CG    . PRO A  1 27  ? -15.557 23.434  44.813  1.00 23.98 ? 27   PRO A CG    1 
ATOM   75    C  CD    . PRO A  1 27  ? -14.127 23.014  45.033  1.00 23.74 ? 27   PRO A CD    1 
ATOM   76    N  N     . MET A  1 28  ? -17.415 19.997  45.094  1.00 24.19 ? 28   MET A N     1 
ATOM   77    C  CA    . MET A  1 28  ? -18.041 19.177  44.079  1.00 24.19 ? 28   MET A CA    1 
ATOM   78    C  C     . MET A  1 28  ? -18.123 19.961  42.764  1.00 24.40 ? 28   MET A C     1 
ATOM   79    O  O     . MET A  1 28  ? -18.127 21.205  42.766  1.00 24.50 ? 28   MET A O     1 
ATOM   80    C  CB    . MET A  1 28  ? -19.435 18.762  44.543  1.00 23.96 ? 28   MET A CB    1 
ATOM   81    C  CG    . MET A  1 28  ? -19.411 17.702  45.645  1.00 24.87 ? 28   MET A CG    1 
ATOM   82    S  SD    . MET A  1 28  ? -21.039 17.021  46.053  1.00 24.92 ? 28   MET A SD    1 
ATOM   83    C  CE    . MET A  1 28  ? -21.339 16.107  44.535  1.00 23.55 ? 28   MET A CE    1 
ATOM   84    N  N     . PHE A  1 29  ? -18.184 19.233  41.652  1.00 24.20 ? 29   PHE A N     1 
ATOM   85    C  CA    . PHE A  1 29  ? -18.391 19.814  40.317  1.00 24.28 ? 29   PHE A CA    1 
ATOM   86    C  C     . PHE A  1 29  ? -17.217 20.655  39.798  1.00 24.03 ? 29   PHE A C     1 
ATOM   87    O  O     . PHE A  1 29  ? -17.385 21.461  38.884  1.00 23.97 ? 29   PHE A O     1 
ATOM   88    C  CB    . PHE A  1 29  ? -19.723 20.590  40.231  1.00 24.24 ? 29   PHE A CB    1 
ATOM   89    C  CG    . PHE A  1 29  ? -20.879 19.924  40.957  1.00 25.04 ? 29   PHE A CG    1 
ATOM   90    C  CD1   . PHE A  1 29  ? -21.434 20.515  42.096  1.00 25.41 ? 29   PHE A CD1   1 
ATOM   91    C  CD2   . PHE A  1 29  ? -21.416 18.725  40.500  1.00 25.63 ? 29   PHE A CD2   1 
ATOM   92    C  CE1   . PHE A  1 29  ? -22.504 19.926  42.765  1.00 26.23 ? 29   PHE A CE1   1 
ATOM   93    C  CE2   . PHE A  1 29  ? -22.492 18.107  41.168  1.00 25.91 ? 29   PHE A CE2   1 
ATOM   94    C  CZ    . PHE A  1 29  ? -23.037 18.708  42.300  1.00 26.79 ? 29   PHE A CZ    1 
ATOM   95    N  N     . SER A  1 30  ? -16.030 20.461  40.378  1.00 23.74 ? 30   SER A N     1 
ATOM   96    C  CA    . SER A  1 30  ? -14.838 21.199  39.955  1.00 23.42 ? 30   SER A CA    1 
ATOM   97    C  C     . SER A  1 30  ? -13.930 20.399  39.034  1.00 23.36 ? 30   SER A C     1 
ATOM   98    O  O     . SER A  1 30  ? -12.909 20.908  38.573  1.00 23.65 ? 30   SER A O     1 
ATOM   99    C  CB    . SER A  1 30  ? -14.051 21.703  41.160  1.00 23.20 ? 30   SER A CB    1 
ATOM   100   O  OG    . SER A  1 30  ? -13.836 20.674  42.097  1.00 23.80 ? 30   SER A OG    1 
ATOM   101   N  N     . GLY A  1 31  ? -14.290 19.145  38.779  1.00 23.24 ? 31   GLY A N     1 
ATOM   102   C  CA    . GLY A  1 31  ? -13.539 18.297  37.870  1.00 23.28 ? 31   GLY A CA    1 
ATOM   103   C  C     . GLY A  1 31  ? -12.316 17.607  38.462  1.00 23.60 ? 31   GLY A C     1 
ATOM   104   O  O     . GLY A  1 31  ? -11.345 17.340  37.739  1.00 23.63 ? 31   GLY A O     1 
ATOM   105   N  N     . LYS A  1 32  ? -12.372 17.296  39.761  1.00 23.61 ? 32   LYS A N     1 
ATOM   106   C  CA    . LYS A  1 32  ? -11.275 16.619  40.459  1.00 23.77 ? 32   LYS A CA    1 
ATOM   107   C  C     . LYS A  1 32  ? -10.940 15.263  39.843  1.00 24.26 ? 32   LYS A C     1 
ATOM   108   O  O     . LYS A  1 32  ? -9.762  14.952  39.630  1.00 24.20 ? 32   LYS A O     1 
ATOM   109   C  CB    . LYS A  1 32  ? -11.578 16.451  41.950  1.00 23.38 ? 32   LYS A CB    1 
ATOM   110   C  CG    . LYS A  1 32  ? -11.752 17.769  42.710  1.00 23.02 ? 32   LYS A CG    1 
ATOM   111   C  CD    . LYS A  1 32  ? -12.101 17.528  44.176  1.00 21.49 ? 32   LYS A CD    1 
ATOM   112   C  CE    . LYS A  1 32  ? -13.260 16.556  44.342  1.00 19.74 ? 32   LYS A CE    1 
ATOM   113   N  NZ    . LYS A  1 32  ? -14.555 17.272  44.173  1.00 20.03 ? 32   LYS A NZ    1 
ATOM   114   N  N     . SER A  1 33  ? -11.968 14.464  39.566  1.00 24.60 ? 33   SER A N     1 
ATOM   115   C  CA    . SER A  1 33  ? -11.786 13.156  38.929  1.00 25.44 ? 33   SER A CA    1 
ATOM   116   C  C     . SER A  1 33  ? -11.198 13.247  37.531  1.00 25.22 ? 33   SER A C     1 
ATOM   117   O  O     . SER A  1 33  ? -10.390 12.406  37.140  1.00 25.44 ? 33   SER A O     1 
ATOM   118   C  CB    . SER A  1 33  ? -13.109 12.404  38.844  1.00 25.48 ? 33   SER A CB    1 
ATOM   119   O  OG    . SER A  1 33  ? -13.623 12.199  40.140  1.00 28.64 ? 33   SER A OG    1 
ATOM   120   N  N     . THR A  1 34  ? -11.628 14.253  36.776  1.00 25.12 ? 34   THR A N     1 
ATOM   121   C  CA    . THR A  1 34  ? -11.105 14.495  35.439  1.00 25.13 ? 34   THR A CA    1 
ATOM   122   C  C     . THR A  1 34  ? -9.632  14.878  35.495  1.00 25.08 ? 34   THR A C     1 
ATOM   123   O  O     . THR A  1 34  ? -8.841  14.355  34.718  1.00 25.39 ? 34   THR A O     1 
ATOM   124   C  CB    . THR A  1 34  ? -11.934 15.578  34.744  1.00 25.01 ? 34   THR A CB    1 
ATOM   125   O  OG1   . THR A  1 34  ? -13.258 15.077  34.532  1.00 25.23 ? 34   THR A OG1   1 
ATOM   126   C  CG2   . THR A  1 34  ? -11.418 15.856  33.331  1.00 24.18 ? 34   THR A CG2   1 
ATOM   127   N  N     . GLU A  1 35  ? -9.265  15.767  36.419  1.00 24.92 ? 35   GLU A N     1 
ATOM   128   C  CA    . GLU A  1 35  ? -7.860  16.117  36.617  1.00 25.36 ? 35   GLU A CA    1 
ATOM   129   C  C     . GLU A  1 35  ? -7.008  14.916  37.069  1.00 25.32 ? 35   GLU A C     1 
ATOM   130   O  O     . GLU A  1 35  ? -5.873  14.756  36.621  1.00 25.09 ? 35   GLU A O     1 
ATOM   131   C  CB    . GLU A  1 35  ? -7.714  17.304  37.573  1.00 25.12 ? 35   GLU A CB    1 
ATOM   132   C  CG    . GLU A  1 35  ? -6.280  17.655  37.958  1.00 26.28 ? 35   GLU A CG    1 
ATOM   133   C  CD    . GLU A  1 35  ? -5.433  18.207  36.817  1.00 28.54 ? 35   GLU A CD    1 
ATOM   134   O  OE1   . GLU A  1 35  ? -5.921  18.313  35.682  1.00 29.22 ? 35   GLU A OE1   1 
ATOM   135   O  OE2   . GLU A  1 35  ? -4.254  18.548  37.063  1.00 30.32 ? 35   GLU A OE2   1 
ATOM   136   N  N     . LEU A  1 36  ? -7.567  14.080  37.944  1.00 25.46 ? 36   LEU A N     1 
ATOM   137   C  CA    . LEU A  1 36  ? -6.912  12.841  38.363  1.00 25.90 ? 36   LEU A CA    1 
ATOM   138   C  C     . LEU A  1 36  ? -6.577  11.975  37.144  1.00 26.06 ? 36   LEU A C     1 
ATOM   139   O  O     . LEU A  1 36  ? -5.436  11.537  36.975  1.00 25.78 ? 36   LEU A O     1 
ATOM   140   C  CB    . LEU A  1 36  ? -7.788  12.068  39.369  1.00 25.90 ? 36   LEU A CB    1 
ATOM   141   C  CG    . LEU A  1 36  ? -7.413  10.623  39.762  1.00 26.33 ? 36   LEU A CG    1 
ATOM   142   C  CD1   . LEU A  1 36  ? -6.099  10.574  40.486  1.00 25.81 ? 36   LEU A CD1   1 
ATOM   143   C  CD2   . LEU A  1 36  ? -8.491  9.981   40.643  1.00 27.07 ? 36   LEU A CD2   1 
ATOM   144   N  N     . MET A  1 37  ? -7.575  11.760  36.292  1.00 26.42 ? 37   MET A N     1 
ATOM   145   C  CA    . MET A  1 37  ? -7.394  10.935  35.104  1.00 27.28 ? 37   MET A CA    1 
ATOM   146   C  C     . MET A  1 37  ? -6.402  11.544  34.111  1.00 26.90 ? 37   MET A C     1 
ATOM   147   O  O     . MET A  1 37  ? -5.590  10.820  33.526  1.00 26.80 ? 37   MET A O     1 
ATOM   148   C  CB    . MET A  1 37  ? -8.739  10.650  34.435  1.00 27.79 ? 37   MET A CB    1 
ATOM   149   C  CG    . MET A  1 37  ? -9.689  9.825   35.280  1.00 30.60 ? 37   MET A CG    1 
ATOM   150   S  SD    . MET A  1 37  ? -8.960  8.332   36.010  1.00 38.03 ? 37   MET A SD    1 
ATOM   151   C  CE    . MET A  1 37  ? -8.617  7.300   34.546  1.00 36.83 ? 37   MET A CE    1 
ATOM   152   N  N     . ARG A  1 38  ? -6.457  12.864  33.930  1.00 26.50 ? 38   ARG A N     1 
ATOM   153   C  CA    . ARG A  1 38  ? -5.481  13.546  33.082  1.00 26.33 ? 38   ARG A CA    1 
ATOM   154   C  C     . ARG A  1 38  ? -4.058  13.241  33.549  1.00 26.49 ? 38   ARG A C     1 
ATOM   155   O  O     . ARG A  1 38  ? -3.190  12.907  32.742  1.00 26.57 ? 38   ARG A O     1 
ATOM   156   C  CB    . ARG A  1 38  ? -5.713  15.053  33.069  1.00 26.09 ? 38   ARG A CB    1 
ATOM   157   C  CG    . ARG A  1 38  ? -4.788  15.807  32.133  1.00 26.00 ? 38   ARG A CG    1 
ATOM   158   C  CD    . ARG A  1 38  ? -4.853  17.317  32.276  1.00 26.16 ? 38   ARG A CD    1 
ATOM   159   N  NE    . ARG A  1 38  ? -4.189  17.806  33.485  1.00 25.93 ? 38   ARG A NE    1 
ATOM   160   C  CZ    . ARG A  1 38  ? -2.871  17.980  33.614  1.00 26.20 ? 38   ARG A CZ    1 
ATOM   161   N  NH1   . ARG A  1 38  ? -2.050  17.696  32.605  1.00 25.73 ? 38   ARG A NH1   1 
ATOM   162   N  NH2   . ARG A  1 38  ? -2.371  18.437  34.761  1.00 24.44 ? 38   ARG A NH2   1 
ATOM   163   N  N     . ARG A  1 39  ? -3.829  13.343  34.857  1.00 26.48 ? 39   ARG A N     1 
ATOM   164   C  CA    . ARG A  1 39  ? -2.506  13.114  35.410  1.00 26.86 ? 39   ARG A CA    1 
ATOM   165   C  C     . ARG A  1 39  ? -2.073  11.659  35.254  1.00 27.30 ? 39   ARG A C     1 
ATOM   166   O  O     . ARG A  1 39  ? -0.911  11.395  34.923  1.00 27.48 ? 39   ARG A O     1 
ATOM   167   C  CB    . ARG A  1 39  ? -2.456  13.533  36.876  1.00 26.92 ? 39   ARG A CB    1 
ATOM   168   C  CG    . ARG A  1 39  ? -2.643  15.021  37.096  1.00 26.75 ? 39   ARG A CG    1 
ATOM   169   C  CD    . ARG A  1 39  ? -1.993  15.496  38.352  1.00 26.25 ? 39   ARG A CD    1 
ATOM   170   N  NE    . ARG A  1 39  ? -2.377  16.850  38.730  1.00 24.96 ? 39   ARG A NE    1 
ATOM   171   C  CZ    . ARG A  1 39  ? -2.247  17.320  39.959  1.00 25.30 ? 39   ARG A CZ    1 
ATOM   172   N  NH1   . ARG A  1 39  ? -1.766  16.528  40.922  1.00 22.83 ? 39   ARG A NH1   1 
ATOM   173   N  NH2   . ARG A  1 39  ? -2.615  18.568  40.238  1.00 23.38 ? 39   ARG A NH2   1 
ATOM   174   N  N     . VAL A  1 40  ? -3.004  10.732  35.484  1.00 27.47 ? 40   VAL A N     1 
ATOM   175   C  CA    . VAL A  1 40  ? -2.718  9.301   35.388  1.00 28.11 ? 40   VAL A CA    1 
ATOM   176   C  C     . VAL A  1 40  ? -2.429  8.889   33.939  1.00 28.82 ? 40   VAL A C     1 
ATOM   177   O  O     . VAL A  1 40  ? -1.476  8.145   33.688  1.00 28.89 ? 40   VAL A O     1 
ATOM   178   C  CB    . VAL A  1 40  ? -3.865  8.425   36.019  1.00 28.06 ? 40   VAL A CB    1 
ATOM   179   C  CG1   . VAL A  1 40  ? -3.672  6.945   35.717  1.00 27.17 ? 40   VAL A CG1   1 
ATOM   180   C  CG2   . VAL A  1 40  ? -3.964  8.652   37.530  1.00 27.09 ? 40   VAL A CG2   1 
ATOM   181   N  N     . ARG A  1 41  ? -3.238  9.388   32.999  1.00 29.65 ? 41   ARG A N     1 
ATOM   182   C  CA    . ARG A  1 41  ? -3.050  9.117   31.569  1.00 30.80 ? 41   ARG A CA    1 
ATOM   183   C  C     . ARG A  1 41  ? -1.687  9.565   31.035  1.00 30.76 ? 41   ARG A C     1 
ATOM   184   O  O     . ARG A  1 41  ? -1.148  8.937   30.133  1.00 30.66 ? 41   ARG A O     1 
ATOM   185   C  CB    . ARG A  1 41  ? -4.170  9.743   30.731  1.00 31.34 ? 41   ARG A CB    1 
ATOM   186   C  CG    . ARG A  1 41  ? -5.309  8.784   30.376  1.00 34.68 ? 41   ARG A CG    1 
ATOM   187   C  CD    . ARG A  1 41  ? -6.414  9.413   29.520  1.00 39.50 ? 41   ARG A CD    1 
ATOM   188   N  NE    . ARG A  1 41  ? -7.761  8.958   29.888  1.00 42.77 ? 41   ARG A NE    1 
ATOM   189   C  CZ    . ARG A  1 41  ? -8.717  9.736   30.417  1.00 44.51 ? 41   ARG A CZ    1 
ATOM   190   N  NH1   . ARG A  1 41  ? -8.489  11.022  30.662  1.00 44.11 ? 41   ARG A NH1   1 
ATOM   191   N  NH2   . ARG A  1 41  ? -9.908  9.221   30.712  1.00 44.42 ? 41   ARG A NH2   1 
ATOM   192   N  N     . ARG A  1 42  ? -1.138  10.641  31.596  1.00 30.93 ? 42   ARG A N     1 
ATOM   193   C  CA    . ARG A  1 42  ? 0.199   11.106  31.224  1.00 31.36 ? 42   ARG A CA    1 
ATOM   194   C  C     . ARG A  1 42  ? 1.278   10.037  31.446  1.00 31.33 ? 42   ARG A C     1 
ATOM   195   O  O     . ARG A  1 42  ? 2.155   9.852   30.605  1.00 30.98 ? 42   ARG A O     1 
ATOM   196   C  CB    . ARG A  1 42  ? 0.564   12.365  32.004  1.00 31.18 ? 42   ARG A CB    1 
ATOM   197   C  CG    . ARG A  1 42  ? -0.147  13.621  31.534  1.00 32.28 ? 42   ARG A CG    1 
ATOM   198   C  CD    . ARG A  1 42  ? -0.057  14.765  32.516  1.00 34.16 ? 42   ARG A CD    1 
ATOM   199   N  NE    . ARG A  1 42  ? 1.333   15.091  32.824  1.00 35.84 ? 42   ARG A NE    1 
ATOM   200   C  CZ    . ARG A  1 42  ? 1.958   14.763  33.948  1.00 37.21 ? 42   ARG A CZ    1 
ATOM   201   N  NH1   . ARG A  1 42  ? 1.323   14.085  34.908  1.00 37.51 ? 42   ARG A NH1   1 
ATOM   202   N  NH2   . ARG A  1 42  ? 3.231   15.111  34.105  1.00 37.03 ? 42   ARG A NH2   1 
ATOM   203   N  N     . PHE A  1 43  ? 1.209   9.354   32.588  1.00 31.62 ? 43   PHE A N     1 
ATOM   204   C  CA    . PHE A  1 43  ? 2.153   8.291   32.927  1.00 31.96 ? 43   PHE A CA    1 
ATOM   205   C  C     . PHE A  1 43  ? 1.865   7.037   32.110  1.00 32.79 ? 43   PHE A C     1 
ATOM   206   O  O     . PHE A  1 43  ? 2.785   6.396   31.619  1.00 32.81 ? 43   PHE A O     1 
ATOM   207   C  CB    . PHE A  1 43  ? 2.114   7.974   34.428  1.00 31.39 ? 43   PHE A CB    1 
ATOM   208   C  CG    . PHE A  1 43  ? 2.676   9.068   35.298  1.00 30.55 ? 43   PHE A CG    1 
ATOM   209   C  CD1   . PHE A  1 43  ? 1.827   9.938   35.973  1.00 28.82 ? 43   PHE A CD1   1 
ATOM   210   C  CD2   . PHE A  1 43  ? 4.055   9.223   35.448  1.00 29.33 ? 43   PHE A CD2   1 
ATOM   211   C  CE1   . PHE A  1 43  ? 2.331   10.944  36.783  1.00 28.81 ? 43   PHE A CE1   1 
ATOM   212   C  CE2   . PHE A  1 43  ? 4.579   10.231  36.251  1.00 29.23 ? 43   PHE A CE2   1 
ATOM   213   C  CZ    . PHE A  1 43  ? 3.714   11.098  36.927  1.00 29.04 ? 43   PHE A CZ    1 
ATOM   214   N  N     . GLN A  1 44  ? 0.586   6.706   31.952  1.00 33.67 ? 44   GLN A N     1 
ATOM   215   C  CA    . GLN A  1 44  ? 0.170   5.518   31.211  1.00 34.95 ? 44   GLN A CA    1 
ATOM   216   C  C     . GLN A  1 44  ? 0.630   5.546   29.750  1.00 35.36 ? 44   GLN A C     1 
ATOM   217   O  O     . GLN A  1 44  ? 1.145   4.553   29.229  1.00 35.31 ? 44   GLN A O     1 
ATOM   218   C  CB    . GLN A  1 44  ? -1.350  5.360   31.298  1.00 35.24 ? 44   GLN A CB    1 
ATOM   219   C  CG    . GLN A  1 44  ? -1.950  4.325   30.368  1.00 37.36 ? 44   GLN A CG    1 
ATOM   220   C  CD    . GLN A  1 44  ? -3.335  3.901   30.814  1.00 41.04 ? 44   GLN A CD    1 
ATOM   221   O  OE1   . GLN A  1 44  ? -4.233  4.738   30.970  1.00 42.84 ? 44   GLN A OE1   1 
ATOM   222   N  NE2   . GLN A  1 44  ? -3.511  2.606   31.038  1.00 42.15 ? 44   GLN A NE2   1 
ATOM   223   N  N     . ILE A  1 45  ? 0.451   6.693   29.103  1.00 35.89 ? 45   ILE A N     1 
ATOM   224   C  CA    . ILE A  1 45  ? 0.855   6.878   27.720  1.00 36.45 ? 45   ILE A CA    1 
ATOM   225   C  C     . ILE A  1 45  ? 2.388   6.757   27.555  1.00 36.70 ? 45   ILE A C     1 
ATOM   226   O  O     . ILE A  1 45  ? 2.885   6.494   26.467  1.00 36.55 ? 45   ILE A O     1 
ATOM   227   C  CB    . ILE A  1 45  ? 0.259   8.223   27.203  1.00 36.52 ? 45   ILE A CB    1 
ATOM   228   C  CG1   . ILE A  1 45  ? -0.474  8.031   25.862  1.00 37.30 ? 45   ILE A CG1   1 
ATOM   229   C  CG2   . ILE A  1 45  ? 1.276   9.359   27.247  1.00 36.60 ? 45   ILE A CG2   1 
ATOM   230   C  CD1   . ILE A  1 45  ? 0.362   8.252   24.631  1.00 38.77 ? 45   ILE A CD1   1 
ATOM   231   N  N     . ALA A  1 46  ? 3.115   6.918   28.659  1.00 37.04 ? 46   ALA A N     1 
ATOM   232   C  CA    . ALA A  1 46  ? 4.562   6.771   28.675  1.00 37.50 ? 46   ALA A CA    1 
ATOM   233   C  C     . ALA A  1 46  ? 4.981   5.393   29.187  1.00 38.02 ? 46   ALA A C     1 
ATOM   234   O  O     . ALA A  1 46  ? 6.121   5.197   29.597  1.00 38.19 ? 46   ALA A O     1 
ATOM   235   C  CB    . ALA A  1 46  ? 5.192   7.860   29.509  1.00 37.36 ? 46   ALA A CB    1 
ATOM   236   N  N     . GLN A  1 47  ? 4.040   4.449   29.167  1.00 38.95 ? 47   GLN A N     1 
ATOM   237   C  CA    . GLN A  1 47  ? 4.286   3.024   29.461  1.00 39.88 ? 47   GLN A CA    1 
ATOM   238   C  C     . GLN A  1 47  ? 4.423   2.641   30.950  1.00 39.73 ? 47   GLN A C     1 
ATOM   239   O  O     . GLN A  1 47  ? 4.812   1.519   31.264  1.00 39.96 ? 47   GLN A O     1 
ATOM   240   C  CB    . GLN A  1 47  ? 5.465   2.461   28.635  1.00 40.20 ? 47   GLN A CB    1 
ATOM   241   C  CG    . GLN A  1 47  ? 5.287   2.527   27.113  1.00 42.35 ? 47   GLN A CG    1 
ATOM   242   C  CD    . GLN A  1 47  ? 4.207   1.582   26.595  1.00 45.71 ? 47   GLN A CD    1 
ATOM   243   O  OE1   . GLN A  1 47  ? 3.047   1.978   26.431  1.00 46.76 ? 47   GLN A OE1   1 
ATOM   244   N  NE2   . GLN A  1 47  ? 4.587   0.336   26.329  1.00 46.69 ? 47   GLN A NE2   1 
ATOM   245   N  N     . TYR A  1 48  ? 4.095   3.561   31.854  1.00 39.51 ? 48   TYR A N     1 
ATOM   246   C  CA    . TYR A  1 48  ? 4.019   3.237   33.272  1.00 39.45 ? 48   TYR A CA    1 
ATOM   247   C  C     . TYR A  1 48  ? 2.812   2.338   33.537  1.00 39.06 ? 48   TYR A C     1 
ATOM   248   O  O     . TYR A  1 48  ? 1.770   2.495   32.902  1.00 38.90 ? 48   TYR A O     1 
ATOM   249   C  CB    . TYR A  1 48  ? 3.871   4.509   34.096  1.00 39.63 ? 48   TYR A CB    1 
ATOM   250   C  CG    . TYR A  1 48  ? 5.147   5.284   34.332  1.00 40.60 ? 48   TYR A CG    1 
ATOM   251   C  CD1   . TYR A  1 48  ? 5.841   5.154   35.526  1.00 42.12 ? 48   TYR A CD1   1 
ATOM   252   C  CD2   . TYR A  1 48  ? 5.634   6.180   33.382  1.00 41.23 ? 48   TYR A CD2   1 
ATOM   253   C  CE1   . TYR A  1 48  ? 7.000   5.872   35.768  1.00 42.92 ? 48   TYR A CE1   1 
ATOM   254   C  CE2   . TYR A  1 48  ? 6.796   6.908   33.613  1.00 42.52 ? 48   TYR A CE2   1 
ATOM   255   C  CZ    . TYR A  1 48  ? 7.473   6.745   34.812  1.00 43.69 ? 48   TYR A CZ    1 
ATOM   256   O  OH    . TYR A  1 48  ? 8.626   7.454   35.074  1.00 44.83 ? 48   TYR A OH    1 
ATOM   257   N  N     . LYS A  1 49  ? 2.959   1.399   34.470  1.00 38.85 ? 49   LYS A N     1 
ATOM   258   C  CA    . LYS A  1 49  ? 1.815   0.619   34.955  1.00 38.63 ? 49   LYS A CA    1 
ATOM   259   C  C     . LYS A  1 49  ? 0.998   1.447   35.946  1.00 37.63 ? 49   LYS A C     1 
ATOM   260   O  O     . LYS A  1 49  ? 1.543   2.012   36.893  1.00 37.41 ? 49   LYS A O     1 
ATOM   261   C  CB    . LYS A  1 49  ? 2.280   -0.691  35.585  1.00 38.90 ? 49   LYS A CB    1 
ATOM   262   C  CG    . LYS A  1 49  ? 2.289   -1.853  34.606  1.00 41.44 ? 49   LYS A CG    1 
ATOM   263   C  CD    . LYS A  1 49  ? 2.993   -3.073  35.184  1.00 45.21 ? 49   LYS A CD    1 
ATOM   264   C  CE    . LYS A  1 49  ? 4.479   -3.069  34.824  1.00 46.67 ? 49   LYS A CE    1 
ATOM   265   N  NZ    . LYS A  1 49  ? 5.094   -4.415  35.003  1.00 48.21 ? 49   LYS A NZ    1 
ATOM   266   N  N     . CYS A  1 50  ? -0.305  1.529   35.706  1.00 36.82 ? 50   CYS A N     1 
ATOM   267   C  CA    . CYS A  1 50  ? -1.188  2.386   36.496  1.00 36.26 ? 50   CYS A CA    1 
ATOM   268   C  C     . CYS A  1 50  ? -2.327  1.622   37.129  1.00 35.73 ? 50   CYS A C     1 
ATOM   269   O  O     . CYS A  1 50  ? -2.785  0.620   36.585  1.00 35.70 ? 50   CYS A O     1 
ATOM   270   C  CB    . CYS A  1 50  ? -1.797  3.480   35.623  1.00 36.21 ? 50   CYS A CB    1 
ATOM   271   S  SG    . CYS A  1 50  ? -0.613  4.646   34.947  1.00 37.78 ? 50   CYS A SG    1 
ATOM   272   N  N     . LEU A  1 51  ? -2.790  2.125   38.270  1.00 35.05 ? 51   LEU A N     1 
ATOM   273   C  CA    . LEU A  1 51  ? -3.989  1.616   38.922  1.00 34.49 ? 51   LEU A CA    1 
ATOM   274   C  C     . LEU A  1 51  ? -4.821  2.780   39.439  1.00 34.04 ? 51   LEU A C     1 
ATOM   275   O  O     . LEU A  1 51  ? -4.304  3.687   40.075  1.00 34.03 ? 51   LEU A O     1 
ATOM   276   C  CB    . LEU A  1 51  ? -3.611  0.680   40.075  1.00 34.64 ? 51   LEU A CB    1 
ATOM   277   C  CG    . LEU A  1 51  ? -4.689  0.150   41.026  1.00 34.91 ? 51   LEU A CG    1 
ATOM   278   C  CD1   . LEU A  1 51  ? -5.625  -0.811  40.309  1.00 34.82 ? 51   LEU A CD1   1 
ATOM   279   C  CD2   . LEU A  1 51  ? -4.036  -0.533  42.222  1.00 35.07 ? 51   LEU A CD2   1 
ATOM   280   N  N     . VAL A  1 52  ? -6.114  2.748   39.156  1.00 33.66 ? 52   VAL A N     1 
ATOM   281   C  CA    . VAL A  1 52  ? -7.040  3.727   39.707  1.00 33.59 ? 52   VAL A CA    1 
ATOM   282   C  C     . VAL A  1 52  ? -8.006  3.046   40.675  1.00 33.62 ? 52   VAL A C     1 
ATOM   283   O  O     . VAL A  1 52  ? -8.596  2.013   40.355  1.00 33.44 ? 52   VAL A O     1 
ATOM   284   C  CB    . VAL A  1 52  ? -7.817  4.474   38.602  1.00 33.43 ? 52   VAL A CB    1 
ATOM   285   C  CG1   . VAL A  1 52  ? -8.825  5.447   39.209  1.00 33.30 ? 52   VAL A CG1   1 
ATOM   286   C  CG2   . VAL A  1 52  ? -6.855  5.218   37.692  1.00 33.74 ? 52   VAL A CG2   1 
ATOM   287   N  N     . ILE A  1 53  ? -8.140  3.629   41.863  1.00 33.82 ? 53   ILE A N     1 
ATOM   288   C  CA    . ILE A  1 53  ? -9.049  3.129   42.892  1.00 33.95 ? 53   ILE A CA    1 
ATOM   289   C  C     . ILE A  1 53  ? -10.193 4.113   43.087  1.00 34.62 ? 53   ILE A C     1 
ATOM   290   O  O     . ILE A  1 53  ? -9.975  5.321   43.178  1.00 34.52 ? 53   ILE A O     1 
ATOM   291   C  CB    . ILE A  1 53  ? -8.301  2.920   44.226  1.00 33.63 ? 53   ILE A CB    1 
ATOM   292   C  CG1   . ILE A  1 53  ? -7.184  1.892   44.061  1.00 33.26 ? 53   ILE A CG1   1 
ATOM   293   C  CG2   . ILE A  1 53  ? -9.267  2.493   45.356  1.00 32.93 ? 53   ILE A CG2   1 
ATOM   294   C  CD1   . ILE A  1 53  ? -6.016  2.124   45.011  1.00 32.94 ? 53   ILE A CD1   1 
ATOM   295   N  N     . LYS A  1 54  ? -11.409 3.586   43.157  1.00 35.53 ? 54   LYS A N     1 
ATOM   296   C  CA    . LYS A  1 54  ? -12.589 4.401   43.418  1.00 36.77 ? 54   LYS A CA    1 
ATOM   297   C  C     . LYS A  1 54  ? -13.328 3.852   44.639  1.00 37.02 ? 54   LYS A C     1 
ATOM   298   O  O     . LYS A  1 54  ? -13.255 2.660   44.934  1.00 36.99 ? 54   LYS A O     1 
ATOM   299   C  CB    . LYS A  1 54  ? -13.499 4.433   42.176  1.00 37.03 ? 54   LYS A CB    1 
ATOM   300   C  CG    . LYS A  1 54  ? -14.834 5.168   42.370  1.00 40.00 ? 54   LYS A CG    1 
ATOM   301   C  CD    . LYS A  1 54  ? -15.370 5.804   41.079  1.00 43.47 ? 54   LYS A CD    1 
ATOM   302   C  CE    . LYS A  1 54  ? -16.012 7.161   41.373  1.00 44.65 ? 54   LYS A CE    1 
ATOM   303   N  NZ    . LYS A  1 54  ? -17.469 7.192   41.057  1.00 46.06 ? 54   LYS A NZ    1 
ATOM   304   N  N     . TYR A  1 55  ? -14.020 4.734   45.353  1.00 37.66 ? 55   TYR A N     1 
ATOM   305   C  CA    . TYR A  1 55  ? -14.815 4.357   46.508  1.00 38.51 ? 55   TYR A CA    1 
ATOM   306   C  C     . TYR A  1 55  ? -16.054 3.573   46.079  1.00 39.36 ? 55   TYR A C     1 
ATOM   307   O  O     . TYR A  1 55  ? -16.894 4.071   45.335  1.00 39.35 ? 55   TYR A O     1 
ATOM   308   C  CB    . TYR A  1 55  ? -15.187 5.605   47.317  1.00 38.41 ? 55   TYR A CB    1 
ATOM   309   C  CG    . TYR A  1 55  ? -15.998 5.347   48.567  1.00 37.91 ? 55   TYR A CG    1 
ATOM   310   C  CD1   . TYR A  1 55  ? -15.515 4.525   49.592  1.00 37.69 ? 55   TYR A CD1   1 
ATOM   311   C  CD2   . TYR A  1 55  ? -17.248 5.938   48.731  1.00 37.60 ? 55   TYR A CD2   1 
ATOM   312   C  CE1   . TYR A  1 55  ? -16.268 4.303   50.750  1.00 37.71 ? 55   TYR A CE1   1 
ATOM   313   C  CE2   . TYR A  1 55  ? -18.003 5.728   49.878  1.00 37.08 ? 55   TYR A CE2   1 
ATOM   314   C  CZ    . TYR A  1 55  ? -17.517 4.912   50.881  1.00 37.72 ? 55   TYR A CZ    1 
ATOM   315   O  OH    . TYR A  1 55  ? -18.286 4.707   52.007  1.00 37.70 ? 55   TYR A OH    1 
ATOM   316   N  N     . ALA A  1 56  ? -16.150 2.337   46.556  1.00 40.68 ? 56   ALA A N     1 
ATOM   317   C  CA    . ALA A  1 56  ? -17.156 1.385   46.080  1.00 42.12 ? 56   ALA A CA    1 
ATOM   318   C  C     . ALA A  1 56  ? -18.598 1.822   46.316  1.00 43.16 ? 56   ALA A C     1 
ATOM   319   O  O     . ALA A  1 56  ? -19.483 1.452   45.544  1.00 43.53 ? 56   ALA A O     1 
ATOM   320   C  CB    . ALA A  1 56  ? -16.913 -0.012  46.673  1.00 42.06 ? 56   ALA A CB    1 
ATOM   321   N  N     . LYS A  1 57  ? -18.837 2.599   47.369  1.00 44.44 ? 57   LYS A N     1 
ATOM   322   C  CA    . LYS A  1 57  ? -20.202 3.010   47.706  1.00 45.87 ? 57   LYS A CA    1 
ATOM   323   C  C     . LYS A  1 57  ? -20.735 4.221   46.913  1.00 46.67 ? 57   LYS A C     1 
ATOM   324   O  O     . LYS A  1 57  ? -21.919 4.558   47.015  1.00 46.89 ? 57   LYS A O     1 
ATOM   325   C  CB    . LYS A  1 57  ? -20.373 3.174   49.224  1.00 46.00 ? 57   LYS A CB    1 
ATOM   326   C  CG    . LYS A  1 57  ? -20.481 1.828   49.962  1.00 47.41 ? 57   LYS A CG    1 
ATOM   327   C  CD    . LYS A  1 57  ? -20.286 1.966   51.474  1.00 50.03 ? 57   LYS A CD    1 
ATOM   328   C  CE    . LYS A  1 57  ? -20.169 0.593   52.153  1.00 51.61 ? 57   LYS A CE    1 
ATOM   329   N  NZ    . LYS A  1 57  ? -19.020 0.493   53.115  1.00 51.96 ? 57   LYS A NZ    1 
ATOM   330   N  N     . ASP A  1 58  ? -19.879 4.861   46.113  1.00 47.66 ? 58   ASP A N     1 
ATOM   331   C  CA    . ASP A  1 58  ? -20.344 5.910   45.195  1.00 48.68 ? 58   ASP A CA    1 
ATOM   332   C  C     . ASP A  1 58  ? -20.524 5.344   43.782  1.00 49.37 ? 58   ASP A C     1 
ATOM   333   O  O     . ASP A  1 58  ? -19.547 5.129   43.065  1.00 49.37 ? 58   ASP A O     1 
ATOM   334   C  CB    . ASP A  1 58  ? -19.388 7.113   45.176  1.00 48.87 ? 58   ASP A CB    1 
ATOM   335   C  CG    . ASP A  1 58  ? -20.029 8.369   44.582  1.00 49.40 ? 58   ASP A CG    1 
ATOM   336   O  OD1   . ASP A  1 58  ? -20.859 8.243   43.654  1.00 49.63 ? 58   ASP A OD1   1 
ATOM   337   O  OD2   . ASP A  1 58  ? -19.760 9.527   44.977  1.00 49.31 ? 58   ASP A OD2   1 
ATOM   338   N  N     . THR A  1 59  ? -21.771 5.134   43.365  1.00 51.12 ? 59   THR A N     1 
ATOM   339   C  CA    . THR A  1 59  ? -22.032 4.406   42.113  1.00 52.42 ? 59   THR A CA    1 
ATOM   340   C  C     . THR A  1 59  ? -22.708 5.220   40.989  1.00 53.01 ? 59   THR A C     1 
ATOM   341   O  O     . THR A  1 59  ? -23.182 4.642   39.999  1.00 53.41 ? 59   THR A O     1 
ATOM   342   C  CB    . THR A  1 59  ? -22.835 3.108   42.410  1.00 52.55 ? 59   THR A CB    1 
ATOM   343   O  OG1   . THR A  1 59  ? -23.759 3.347   43.484  1.00 52.96 ? 59   THR A OG1   1 
ATOM   344   C  CG2   . THR A  1 59  ? -21.903 2.005   42.957  1.00 52.66 ? 59   THR A CG2   1 
ATOM   345   N  N     . ARG A  1 60  ? -22.725 6.546   41.130  1.00 53.31 ? 60   ARG A N     1 
ATOM   346   C  CA    . ARG A  1 60  ? -23.429 7.432   40.192  1.00 53.64 ? 60   ARG A CA    1 
ATOM   347   C  C     . ARG A  1 60  ? -23.060 7.212   38.716  1.00 53.72 ? 60   ARG A C     1 
ATOM   348   O  O     . ARG A  1 60  ? -21.896 7.325   38.322  1.00 53.98 ? 60   ARG A O     1 
ATOM   349   C  CB    . ARG A  1 60  ? -23.223 8.901   40.583  1.00 53.70 ? 60   ARG A CB    1 
ATOM   350   C  CG    . ARG A  1 60  ? -23.842 9.281   41.924  1.00 53.62 ? 60   ARG A CG    1 
ATOM   351   C  CD    . ARG A  1 60  ? -23.294 10.568  42.520  1.00 53.66 ? 60   ARG A CD    1 
ATOM   352   N  NE    . ARG A  1 60  ? -21.834 10.553  42.615  1.00 53.55 ? 60   ARG A NE    1 
ATOM   353   C  CZ    . ARG A  1 60  ? -21.054 11.617  42.459  1.00 53.23 ? 60   ARG A CZ    1 
ATOM   354   N  NH1   . ARG A  1 60  ? -21.580 12.812  42.201  1.00 52.53 ? 60   ARG A NH1   1 
ATOM   355   N  NH2   . ARG A  1 60  ? -19.738 11.485  42.566  1.00 53.01 ? 60   ARG A NH2   1 
ATOM   356   N  N     . ALA A  1 75  ? -10.113 0.368   36.926  1.00 48.16 ? 75   ALA A N     1 
ATOM   357   C  CA    . ALA A  1 75  ? -10.744 1.196   37.953  1.00 47.84 ? 75   ALA A CA    1 
ATOM   358   C  C     . ALA A  1 75  ? -11.366 0.346   39.075  1.00 47.53 ? 75   ALA A C     1 
ATOM   359   O  O     . ALA A  1 75  ? -12.573 0.076   39.074  1.00 47.63 ? 75   ALA A O     1 
ATOM   360   C  CB    . ALA A  1 75  ? -11.782 2.133   37.330  1.00 47.68 ? 75   ALA A CB    1 
ATOM   361   N  N     . LEU A  1 76  ? -10.525 -0.060  40.026  1.00 46.65 ? 76   LEU A N     1 
ATOM   362   C  CA    . LEU A  1 76  ? -10.899 -0.961  41.112  1.00 45.85 ? 76   LEU A CA    1 
ATOM   363   C  C     . LEU A  1 76  ? -11.755 -0.299  42.190  1.00 45.11 ? 76   LEU A C     1 
ATOM   364   O  O     . LEU A  1 76  ? -11.321 0.675   42.805  1.00 45.08 ? 76   LEU A O     1 
ATOM   365   C  CB    . LEU A  1 76  ? -9.632  -1.497  41.778  1.00 45.92 ? 76   LEU A CB    1 
ATOM   366   C  CG    . LEU A  1 76  ? -9.348  -2.988  41.672  1.00 46.73 ? 76   LEU A CG    1 
ATOM   367   C  CD1   . LEU A  1 76  ? -8.037  -3.315  42.370  1.00 46.73 ? 76   LEU A CD1   1 
ATOM   368   C  CD2   . LEU A  1 76  ? -10.496 -3.794  42.267  1.00 47.42 ? 76   LEU A CD2   1 
ATOM   369   N  N     . PRO A  1 77  ? -12.953 -0.827  42.446  1.00 44.43 ? 77   PRO A N     1 
ATOM   370   C  CA    . PRO A  1 77  ? -13.767 -0.348  43.572  1.00 43.90 ? 77   PRO A CA    1 
ATOM   371   C  C     . PRO A  1 77  ? -13.217 -0.874  44.893  1.00 43.30 ? 77   PRO A C     1 
ATOM   372   O  O     . PRO A  1 77  ? -12.736 -2.009  44.939  1.00 43.20 ? 77   PRO A O     1 
ATOM   373   C  CB    . PRO A  1 77  ? -15.160 -0.945  43.298  1.00 43.91 ? 77   PRO A CB    1 
ATOM   374   C  CG    . PRO A  1 77  ? -15.071 -1.589  41.949  1.00 44.23 ? 77   PRO A CG    1 
ATOM   375   C  CD    . PRO A  1 77  ? -13.631 -1.905  41.704  1.00 44.39 ? 77   PRO A CD    1 
ATOM   376   N  N     . ALA A  1 78  ? -13.273 -0.050  45.938  1.00 42.72 ? 78   ALA A N     1 
ATOM   377   C  CA    . ALA A  1 78  ? -12.804 -0.435  47.271  1.00 42.36 ? 78   ALA A CA    1 
ATOM   378   C  C     . ALA A  1 78  ? -13.491 0.375   48.382  1.00 42.28 ? 78   ALA A C     1 
ATOM   379   O  O     . ALA A  1 78  ? -13.982 1.482   48.141  1.00 42.13 ? 78   ALA A O     1 
ATOM   380   C  CB    . ALA A  1 78  ? -11.283 -0.299  47.361  1.00 42.01 ? 78   ALA A CB    1 
ATOM   381   N  N     . CYS A  1 79  ? -13.531 -0.195  49.584  1.00 42.21 ? 79   CYS A N     1 
ATOM   382   C  CA    . CYS A  1 79  ? -14.049 0.482   50.777  1.00 42.69 ? 79   CYS A CA    1 
ATOM   383   C  C     . CYS A  1 79  ? -12.919 0.829   51.739  1.00 42.00 ? 79   CYS A C     1 
ATOM   384   O  O     . CYS A  1 79  ? -13.005 1.785   52.509  1.00 41.95 ? 79   CYS A O     1 
ATOM   385   C  CB    . CYS A  1 79  ? -15.050 -0.416  51.499  1.00 42.86 ? 79   CYS A CB    1 
ATOM   386   S  SG    . CYS A  1 79  ? -16.718 -0.242  50.857  1.00 46.48 ? 79   CYS A SG    1 
ATOM   387   N  N     . LEU A  1 80  ? -11.879 0.004   51.703  1.00 41.53 ? 80   LEU A N     1 
ATOM   388   C  CA    . LEU A  1 80  ? -10.651 0.241   52.440  1.00 41.19 ? 80   LEU A CA    1 
ATOM   389   C  C     . LEU A  1 80  ? -9.515  0.055   51.456  1.00 40.62 ? 80   LEU A C     1 
ATOM   390   O  O     . LEU A  1 80  ? -9.548  -0.863  50.640  1.00 40.45 ? 80   LEU A O     1 
ATOM   391   C  CB    . LEU A  1 80  ? -10.509 -0.736  53.616  1.00 41.41 ? 80   LEU A CB    1 
ATOM   392   C  CG    . LEU A  1 80  ? -11.411 -0.582  54.848  1.00 42.18 ? 80   LEU A CG    1 
ATOM   393   C  CD1   . LEU A  1 80  ? -11.304 -1.817  55.749  1.00 42.64 ? 80   LEU A CD1   1 
ATOM   394   C  CD2   . LEU A  1 80  ? -11.072 0.684   55.639  1.00 42.79 ? 80   LEU A CD2   1 
ATOM   395   N  N     . LEU A  1 81  ? -8.520  0.931   51.523  1.00 40.14 ? 81   LEU A N     1 
ATOM   396   C  CA    . LEU A  1 81  ? -7.389  0.864   50.604  1.00 39.92 ? 81   LEU A CA    1 
ATOM   397   C  C     . LEU A  1 81  ? -6.529  -0.381  50.848  1.00 40.17 ? 81   LEU A C     1 
ATOM   398   O  O     . LEU A  1 81  ? -5.902  -0.912  49.930  1.00 40.12 ? 81   LEU A O     1 
ATOM   399   C  CB    . LEU A  1 81  ? -6.554  2.144   50.685  1.00 39.53 ? 81   LEU A CB    1 
ATOM   400   C  CG    . LEU A  1 81  ? -7.260  3.419   50.205  1.00 38.94 ? 81   LEU A CG    1 
ATOM   401   C  CD1   . LEU A  1 81  ? -6.499  4.664   50.621  1.00 37.34 ? 81   LEU A CD1   1 
ATOM   402   C  CD2   . LEU A  1 81  ? -7.484  3.411   48.698  1.00 37.73 ? 81   LEU A CD2   1 
ATOM   403   N  N     . ARG A  1 82  ? -6.527  -0.857  52.086  1.00 40.58 ? 82   ARG A N     1 
ATOM   404   C  CA    . ARG A  1 82  ? -5.809  -2.075  52.432  1.00 41.15 ? 82   ARG A CA    1 
ATOM   405   C  C     . ARG A  1 82  ? -6.311  -3.311  51.668  1.00 41.24 ? 82   ARG A C     1 
ATOM   406   O  O     . ARG A  1 82  ? -5.540  -4.239  51.428  1.00 41.11 ? 82   ARG A O     1 
ATOM   407   C  CB    . ARG A  1 82  ? -5.814  -2.299  53.950  1.00 41.26 ? 82   ARG A CB    1 
ATOM   408   C  CG    . ARG A  1 82  ? -7.124  -2.784  54.527  1.00 41.83 ? 82   ARG A CG    1 
ATOM   409   C  CD    . ARG A  1 82  ? -7.077  -4.221  54.993  1.00 43.40 ? 82   ARG A CD    1 
ATOM   410   N  NE    . ARG A  1 82  ? -8.411  -4.794  55.128  1.00 44.77 ? 82   ARG A NE    1 
ATOM   411   C  CZ    . ARG A  1 82  ? -9.142  -4.747  56.239  1.00 45.32 ? 82   ARG A CZ    1 
ATOM   412   N  NH1   . ARG A  1 82  ? -8.678  -4.150  57.330  1.00 45.64 ? 82   ARG A NH1   1 
ATOM   413   N  NH2   . ARG A  1 82  ? -10.343 -5.302  56.260  1.00 45.19 ? 82   ARG A NH2   1 
ATOM   414   N  N     . ASP A  1 83  ? -7.589  -3.311  51.275  1.00 41.47 ? 83   ASP A N     1 
ATOM   415   C  CA    . ASP A  1 83  ? -8.165  -4.428  50.516  1.00 41.98 ? 83   ASP A CA    1 
ATOM   416   C  C     . ASP A  1 83  ? -7.594  -4.528  49.109  1.00 42.12 ? 83   ASP A C     1 
ATOM   417   O  O     . ASP A  1 83  ? -7.804  -5.515  48.411  1.00 42.22 ? 83   ASP A O     1 
ATOM   418   C  CB    . ASP A  1 83  ? -9.687  -4.310  50.423  1.00 41.98 ? 83   ASP A CB    1 
ATOM   419   C  CG    . ASP A  1 83  ? -10.369 -4.396  51.770  1.00 42.66 ? 83   ASP A CG    1 
ATOM   420   O  OD1   . ASP A  1 83  ? -9.775  -4.944  52.726  1.00 43.56 ? 83   ASP A OD1   1 
ATOM   421   O  OD2   . ASP A  1 83  ? -11.511 -3.931  51.965  1.00 43.53 ? 83   ASP A OD2   1 
ATOM   422   N  N     . VAL A  1 84  ? -6.841  -3.509  48.724  1.00 42.45 ? 84   VAL A N     1 
ATOM   423   C  CA    . VAL A  1 84  ? -6.442  -3.299  47.353  1.00 42.55 ? 84   VAL A CA    1 
ATOM   424   C  C     . VAL A  1 84  ? -4.918  -3.099  47.299  1.00 42.83 ? 84   VAL A C     1 
ATOM   425   O  O     . VAL A  1 84  ? -4.329  -2.894  46.231  1.00 42.80 ? 84   VAL A O     1 
ATOM   426   C  CB    . VAL A  1 84  ? -7.289  -2.093  46.831  1.00 42.51 ? 84   VAL A CB    1 
ATOM   427   C  CG1   . VAL A  1 84  ? -6.470  -0.856  46.584  1.00 42.07 ? 84   VAL A CG1   1 
ATOM   428   C  CG2   . VAL A  1 84  ? -8.125  -2.488  45.639  1.00 42.47 ? 84   VAL A CG2   1 
ATOM   429   N  N     . ALA A  1 85  ? -4.281  -3.204  48.461  1.00 43.24 ? 85   ALA A N     1 
ATOM   430   C  CA    . ALA A  1 85  ? -2.857  -2.905  48.572  1.00 43.91 ? 85   ALA A CA    1 
ATOM   431   C  C     . ALA A  1 85  ? -1.926  -3.875  47.837  1.00 44.26 ? 85   ALA A C     1 
ATOM   432   O  O     . ALA A  1 85  ? -0.856  -3.461  47.404  1.00 44.40 ? 85   ALA A O     1 
ATOM   433   C  CB    . ALA A  1 85  ? -2.451  -2.708  50.020  1.00 43.70 ? 85   ALA A CB    1 
ATOM   434   N  N     . GLN A  1 86  ? -2.336  -5.132  47.663  1.00 44.77 ? 86   GLN A N     1 
ATOM   435   C  CA    . GLN A  1 86  ? -1.518  -6.075  46.897  1.00 45.27 ? 86   GLN A CA    1 
ATOM   436   C  C     . GLN A  1 86  ? -1.470  -5.738  45.407  1.00 45.21 ? 86   GLN A C     1 
ATOM   437   O  O     . GLN A  1 86  ? -0.406  -5.831  44.798  1.00 45.37 ? 86   GLN A O     1 
ATOM   438   C  CB    . GLN A  1 86  ? -1.901  -7.533  47.149  1.00 45.14 ? 86   GLN A CB    1 
ATOM   439   C  CG    . GLN A  1 86  ? -0.677  -8.437  47.169  1.00 46.06 ? 86   GLN A CG    1 
ATOM   440   C  CD    . GLN A  1 86  ? -0.882  -9.670  48.003  1.00 46.86 ? 86   GLN A CD    1 
ATOM   441   O  OE1   . GLN A  1 86  ? -0.730  -9.634  49.218  1.00 46.45 ? 86   GLN A OE1   1 
ATOM   442   N  NE2   . GLN A  1 86  ? -1.235  -10.770 47.352  1.00 47.75 ? 86   GLN A NE2   1 
ATOM   443   N  N     . GLU A  1 87  ? -2.607  -5.329  44.840  1.00 45.21 ? 87   GLU A N     1 
ATOM   444   C  CA    . GLU A  1 87  ? -2.660  -4.862  43.452  1.00 45.27 ? 87   GLU A CA    1 
ATOM   445   C  C     . GLU A  1 87  ? -1.810  -3.606  43.276  1.00 44.82 ? 87   GLU A C     1 
ATOM   446   O  O     . GLU A  1 87  ? -1.085  -3.478  42.289  1.00 44.89 ? 87   GLU A O     1 
ATOM   447   C  CB    . GLU A  1 87  ? -4.103  -4.596  43.024  1.00 45.51 ? 87   GLU A CB    1 
ATOM   448   C  CG    . GLU A  1 87  ? -4.933  -5.854  42.784  1.00 47.25 ? 87   GLU A CG    1 
ATOM   449   C  CD    . GLU A  1 87  ? -4.956  -6.779  43.991  1.00 49.95 ? 87   GLU A CD    1 
ATOM   450   O  OE1   . GLU A  1 87  ? -5.465  -6.354  45.056  1.00 50.74 ? 87   GLU A OE1   1 
ATOM   451   O  OE2   . GLU A  1 87  ? -4.444  -7.922  43.885  1.00 50.26 ? 87   GLU A OE2   1 
ATOM   452   N  N     . ALA A  1 88  ? -1.875  -2.704  44.257  1.00 44.31 ? 88   ALA A N     1 
ATOM   453   C  CA    . ALA A  1 88  ? -1.142  -1.437  44.216  1.00 43.79 ? 88   ALA A CA    1 
ATOM   454   C  C     . ALA A  1 88  ? 0.372   -1.619  44.268  1.00 43.51 ? 88   ALA A C     1 
ATOM   455   O  O     . ALA A  1 88  ? 1.123   -0.787  43.758  1.00 43.38 ? 88   ALA A O     1 
ATOM   456   C  CB    . ALA A  1 88  ? -1.603  -0.507  45.325  1.00 43.69 ? 88   ALA A CB    1 
ATOM   457   N  N     . LEU A  1 89  ? 0.811   -2.714  44.874  1.00 43.17 ? 89   LEU A N     1 
ATOM   458   C  CA    . LEU A  1 89  ? 2.233   -3.003  45.017  1.00 42.75 ? 89   LEU A CA    1 
ATOM   459   C  C     . LEU A  1 89  ? 2.913   -3.345  43.686  1.00 42.15 ? 89   LEU A C     1 
ATOM   460   O  O     . LEU A  1 89  ? 4.109   -3.107  43.525  1.00 42.24 ? 89   LEU A O     1 
ATOM   461   C  CB    . LEU A  1 89  ? 2.436   -4.118  46.040  1.00 42.70 ? 89   LEU A CB    1 
ATOM   462   C  CG    . LEU A  1 89  ? 3.377   -3.861  47.214  1.00 43.71 ? 89   LEU A CG    1 
ATOM   463   C  CD1   . LEU A  1 89  ? 3.322   -2.411  47.742  1.00 43.94 ? 89   LEU A CD1   1 
ATOM   464   C  CD2   . LEU A  1 89  ? 3.076   -4.849  48.318  1.00 43.80 ? 89   LEU A CD2   1 
ATOM   465   N  N     . GLY A  1 90  ? 2.151   -3.883  42.735  1.00 41.38 ? 90   GLY A N     1 
ATOM   466   C  CA    . GLY A  1 90  ? 2.699   -4.275  41.444  1.00 40.46 ? 90   GLY A CA    1 
ATOM   467   C  C     . GLY A  1 90  ? 2.607   -3.199  40.373  1.00 39.78 ? 90   GLY A C     1 
ATOM   468   O  O     . GLY A  1 90  ? 2.752   -3.481  39.178  1.00 40.10 ? 90   GLY A O     1 
ATOM   469   N  N     . VAL A  1 91  ? 2.389   -1.961  40.807  1.00 38.57 ? 91   VAL A N     1 
ATOM   470   C  CA    . VAL A  1 91  ? 2.086   -0.850  39.914  1.00 37.15 ? 91   VAL A CA    1 
ATOM   471   C  C     . VAL A  1 91  ? 3.032   0.318   40.241  1.00 36.01 ? 91   VAL A C     1 
ATOM   472   O  O     . VAL A  1 91  ? 3.559   0.397   41.351  1.00 36.03 ? 91   VAL A O     1 
ATOM   473   C  CB    . VAL A  1 91  ? 0.573   -0.490  40.060  1.00 37.70 ? 91   VAL A CB    1 
ATOM   474   C  CG1   . VAL A  1 91  ? 0.340   0.979   40.227  1.00 37.04 ? 91   VAL A CG1   1 
ATOM   475   C  CG2   . VAL A  1 91  ? -0.252  -1.063  38.894  1.00 37.42 ? 91   VAL A CG2   1 
ATOM   476   N  N     . ALA A  1 92  ? 3.290   1.197   39.278  1.00 34.44 ? 92   ALA A N     1 
ATOM   477   C  CA    . ALA A  1 92  ? 4.161   2.354   39.535  1.00 32.84 ? 92   ALA A CA    1 
ATOM   478   C  C     . ALA A  1 92  ? 3.398   3.643   39.880  1.00 31.93 ? 92   ALA A C     1 
ATOM   479   O  O     . ALA A  1 92  ? 3.925   4.507   40.592  1.00 31.59 ? 92   ALA A O     1 
ATOM   480   C  CB    . ALA A  1 92  ? 5.120   2.587   38.380  1.00 32.84 ? 92   ALA A CB    1 
ATOM   481   N  N     . VAL A  1 93  ? 2.166   3.757   39.384  1.00 30.60 ? 93   VAL A N     1 
ATOM   482   C  CA    . VAL A  1 93  ? 1.342   4.955   39.572  1.00 29.74 ? 93   VAL A CA    1 
ATOM   483   C  C     . VAL A  1 93  ? -0.053  4.574   40.084  1.00 29.30 ? 93   VAL A C     1 
ATOM   484   O  O     . VAL A  1 93  ? -0.740  3.751   39.470  1.00 28.92 ? 93   VAL A O     1 
ATOM   485   C  CB    . VAL A  1 93  ? 1.227   5.794   38.249  1.00 29.71 ? 93   VAL A CB    1 
ATOM   486   C  CG1   . VAL A  1 93  ? 0.325   7.016   38.435  1.00 28.74 ? 93   VAL A CG1   1 
ATOM   487   C  CG2   . VAL A  1 93  ? 2.610   6.211   37.740  1.00 28.86 ? 93   VAL A CG2   1 
ATOM   488   N  N     . ILE A  1 94  ? -0.453  5.174   41.208  1.00 28.65 ? 94   ILE A N     1 
ATOM   489   C  CA    . ILE A  1 94  ? -1.748  4.884   41.827  1.00 28.33 ? 94   ILE A CA    1 
ATOM   490   C  C     . ILE A  1 94  ? -2.610  6.145   41.918  1.00 28.11 ? 94   ILE A C     1 
ATOM   491   O  O     . ILE A  1 94  ? -2.204  7.136   42.507  1.00 28.02 ? 94   ILE A O     1 
ATOM   492   C  CB    . ILE A  1 94  ? -1.550  4.260   43.237  1.00 28.57 ? 94   ILE A CB    1 
ATOM   493   C  CG1   . ILE A  1 94  ? -0.759  2.952   43.140  1.00 28.35 ? 94   ILE A CG1   1 
ATOM   494   C  CG2   . ILE A  1 94  ? -2.901  4.030   43.952  1.00 27.73 ? 94   ILE A CG2   1 
ATOM   495   C  CD1   . ILE A  1 94  ? 0.136   2.697   44.331  1.00 29.15 ? 94   ILE A CD1   1 
ATOM   496   N  N     . GLY A  1 95  ? -3.799  6.091   41.333  1.00 27.91 ? 95   GLY A N     1 
ATOM   497   C  CA    . GLY A  1 95  ? -4.769  7.162   41.465  1.00 27.96 ? 95   GLY A CA    1 
ATOM   498   C  C     . GLY A  1 95  ? -5.880  6.775   42.423  1.00 28.14 ? 95   GLY A C     1 
ATOM   499   O  O     . GLY A  1 95  ? -6.391  5.656   42.356  1.00 28.24 ? 95   GLY A O     1 
ATOM   500   N  N     . ILE A  1 96  ? -6.246  7.682   43.326  1.00 28.13 ? 96   ILE A N     1 
ATOM   501   C  CA    . ILE A  1 96  ? -7.374  7.435   44.227  1.00 28.46 ? 96   ILE A CA    1 
ATOM   502   C  C     . ILE A  1 96  ? -8.436  8.516   44.090  1.00 29.09 ? 96   ILE A C     1 
ATOM   503   O  O     . ILE A  1 96  ? -8.170  9.700   44.305  1.00 29.10 ? 96   ILE A O     1 
ATOM   504   C  CB    . ILE A  1 96  ? -6.933  7.273   45.714  1.00 28.45 ? 96   ILE A CB    1 
ATOM   505   C  CG1   . ILE A  1 96  ? -5.878  6.175   45.869  1.00 27.88 ? 96   ILE A CG1   1 
ATOM   506   C  CG2   . ILE A  1 96  ? -8.121  6.941   46.605  1.00 27.98 ? 96   ILE A CG2   1 
ATOM   507   C  CD1   . ILE A  1 96  ? -5.098  6.285   47.151  1.00 27.28 ? 96   ILE A CD1   1 
ATOM   508   N  N     . ASP A  1 97  ? -9.635  8.084   43.720  1.00 29.92 ? 97   ASP A N     1 
ATOM   509   C  CA    . ASP A  1 97  ? -10.781 8.963   43.566  1.00 31.27 ? 97   ASP A CA    1 
ATOM   510   C  C     . ASP A  1 97  ? -11.613 8.978   44.838  1.00 31.50 ? 97   ASP A C     1 
ATOM   511   O  O     . ASP A  1 97  ? -11.859 7.922   45.435  1.00 31.52 ? 97   ASP A O     1 
ATOM   512   C  CB    . ASP A  1 97  ? -11.647 8.492   42.399  1.00 31.73 ? 97   ASP A CB    1 
ATOM   513   C  CG    . ASP A  1 97  ? -12.581 9.572   41.892  1.00 34.75 ? 97   ASP A CG    1 
ATOM   514   O  OD1   . ASP A  1 97  ? -12.363 10.770  42.218  1.00 37.51 ? 97   ASP A OD1   1 
ATOM   515   O  OD2   . ASP A  1 97  ? -13.560 9.323   41.147  1.00 38.29 ? 97   ASP A OD2   1 
ATOM   516   N  N     . GLU A  1 98  ? -12.042 10.178  45.240  1.00 31.71 ? 98   GLU A N     1 
ATOM   517   C  CA    . GLU A  1 98  ? -12.859 10.387  46.449  1.00 32.07 ? 98   GLU A CA    1 
ATOM   518   C  C     . GLU A  1 98  ? -12.148 9.889   47.714  1.00 31.75 ? 98   GLU A C     1 
ATOM   519   O  O     . GLU A  1 98  ? -12.701 9.115   48.511  1.00 31.62 ? 98   GLU A O     1 
ATOM   520   C  CB    . GLU A  1 98  ? -14.271 9.781   46.291  1.00 32.20 ? 98   GLU A CB    1 
ATOM   521   C  CG    . GLU A  1 98  ? -15.027 10.293  45.064  1.00 34.48 ? 98   GLU A CG    1 
ATOM   522   C  CD    . GLU A  1 98  ? -16.457 9.789   44.969  1.00 38.31 ? 98   GLU A CD    1 
ATOM   523   O  OE1   . GLU A  1 98  ? -17.072 9.518   46.018  1.00 40.59 ? 98   GLU A OE1   1 
ATOM   524   O  OE2   . GLU A  1 98  ? -16.980 9.658   43.835  1.00 41.00 ? 98   GLU A OE2   1 
ATOM   525   N  N     . GLY A  1 99  ? -10.913 10.355  47.882  1.00 31.49 ? 99   GLY A N     1 
ATOM   526   C  CA    . GLY A  1 99  ? -10.034 9.911   48.949  1.00 31.08 ? 99   GLY A CA    1 
ATOM   527   C  C     . GLY A  1 99  ? -10.545 10.177  50.348  1.00 30.95 ? 99   GLY A C     1 
ATOM   528   O  O     . GLY A  1 99  ? -10.129 9.502   51.294  1.00 31.01 ? 99   GLY A O     1 
ATOM   529   N  N     . GLN A  1 100 ? -11.443 11.150  50.473  1.00 30.66 ? 100  GLN A N     1 
ATOM   530   C  CA    . GLN A  1 100 ? -12.057 11.501  51.749  1.00 30.62 ? 100  GLN A CA    1 
ATOM   531   C  C     . GLN A  1 100 ? -12.809 10.348  52.429  1.00 30.84 ? 100  GLN A C     1 
ATOM   532   O  O     . GLN A  1 100 ? -12.932 10.333  53.648  1.00 30.79 ? 100  GLN A O     1 
ATOM   533   C  CB    . GLN A  1 100 ? -12.978 12.725  51.587  1.00 30.33 ? 100  GLN A CB    1 
ATOM   534   C  CG    . GLN A  1 100 ? -14.307 12.451  50.895  1.00 29.89 ? 100  GLN A CG    1 
ATOM   535   C  CD    . GLN A  1 100 ? -14.247 12.627  49.382  1.00 29.44 ? 100  GLN A CD    1 
ATOM   536   O  OE1   . GLN A  1 100 ? -13.182 12.857  48.819  1.00 28.74 ? 100  GLN A OE1   1 
ATOM   537   N  NE2   . GLN A  1 100 ? -15.399 12.522  48.728  1.00 27.83 ? 100  GLN A NE2   1 
ATOM   538   N  N     . PHE A  1 101 ? -13.300 9.391   51.642  1.00 31.07 ? 101  PHE A N     1 
ATOM   539   C  CA    . PHE A  1 101 ? -14.120 8.292   52.172  1.00 31.53 ? 101  PHE A CA    1 
ATOM   540   C  C     . PHE A  1 101 ? -13.307 7.094   52.672  1.00 32.06 ? 101  PHE A C     1 
ATOM   541   O  O     . PHE A  1 101 ? -13.876 6.169   53.247  1.00 32.37 ? 101  PHE A O     1 
ATOM   542   C  CB    . PHE A  1 101 ? -15.141 7.808   51.130  1.00 31.55 ? 101  PHE A CB    1 
ATOM   543   C  CG    . PHE A  1 101 ? -16.252 8.786   50.845  1.00 30.93 ? 101  PHE A CG    1 
ATOM   544   C  CD1   . PHE A  1 101 ? -16.429 9.297   49.554  1.00 30.96 ? 101  PHE A CD1   1 
ATOM   545   C  CD2   . PHE A  1 101 ? -17.143 9.175   51.848  1.00 29.63 ? 101  PHE A CD2   1 
ATOM   546   C  CE1   . PHE A  1 101 ? -17.476 10.196  49.271  1.00 29.52 ? 101  PHE A CE1   1 
ATOM   547   C  CE2   . PHE A  1 101 ? -18.173 10.072  51.578  1.00 29.31 ? 101  PHE A CE2   1 
ATOM   548   C  CZ    . PHE A  1 101 ? -18.340 10.582  50.287  1.00 29.53 ? 101  PHE A CZ    1 
ATOM   549   N  N     . PHE A  1 102 ? -11.991 7.105   52.449  1.00 32.40 ? 102  PHE A N     1 
ATOM   550   C  CA    . PHE A  1 102 ? -11.130 6.020   52.898  1.00 32.84 ? 102  PHE A CA    1 
ATOM   551   C  C     . PHE A  1 102 ? -10.513 6.352   54.252  1.00 33.50 ? 102  PHE A C     1 
ATOM   552   O  O     . PHE A  1 102 ? -9.704  7.282   54.343  1.00 33.70 ? 102  PHE A O     1 
ATOM   553   C  CB    . PHE A  1 102 ? -10.035 5.732   51.867  1.00 32.64 ? 102  PHE A CB    1 
ATOM   554   C  CG    . PHE A  1 102 ? -10.554 5.147   50.587  1.00 32.33 ? 102  PHE A CG    1 
ATOM   555   C  CD1   . PHE A  1 102 ? -10.882 3.793   50.505  1.00 31.52 ? 102  PHE A CD1   1 
ATOM   556   C  CD2   . PHE A  1 102 ? -10.723 5.952   49.457  1.00 31.39 ? 102  PHE A CD2   1 
ATOM   557   C  CE1   . PHE A  1 102 ? -11.367 3.237   49.313  1.00 31.05 ? 102  PHE A CE1   1 
ATOM   558   C  CE2   . PHE A  1 102 ? -11.209 5.412   48.260  1.00 31.01 ? 102  PHE A CE2   1 
ATOM   559   C  CZ    . PHE A  1 102 ? -11.534 4.046   48.191  1.00 31.04 ? 102  PHE A CZ    1 
ATOM   560   N  N     . PRO A  1 103 ? -10.875 5.595   55.295  1.00 33.85 ? 103  PRO A N     1 
ATOM   561   C  CA    . PRO A  1 103 ? -10.355 5.852   56.646  1.00 34.16 ? 103  PRO A CA    1 
ATOM   562   C  C     . PRO A  1 103 ? -8.840  5.645   56.737  1.00 34.43 ? 103  PRO A C     1 
ATOM   563   O  O     . PRO A  1 103 ? -8.211  6.232   57.619  1.00 34.62 ? 103  PRO A O     1 
ATOM   564   C  CB    . PRO A  1 103 ? -11.079 4.817   57.529  1.00 34.13 ? 103  PRO A CB    1 
ATOM   565   C  CG    . PRO A  1 103 ? -12.172 4.226   56.685  1.00 34.16 ? 103  PRO A CG    1 
ATOM   566   C  CD    . PRO A  1 103 ? -11.786 4.437   55.254  1.00 33.83 ? 103  PRO A CD    1 
ATOM   567   N  N     . ASP A  1 104 ? -8.274  4.833   55.842  1.00 34.36 ? 104  ASP A N     1 
ATOM   568   C  CA    . ASP A  1 104 ? -6.834  4.563   55.845  1.00 34.46 ? 104  ASP A CA    1 
ATOM   569   C  C     . ASP A  1 104 ? -6.042  5.318   54.758  1.00 34.24 ? 104  ASP A C     1 
ATOM   570   O  O     . ASP A  1 104 ? -4.928  4.914   54.395  1.00 34.23 ? 104  ASP A O     1 
ATOM   571   C  CB    . ASP A  1 104 ? -6.550  3.045   55.776  1.00 34.47 ? 104  ASP A CB    1 
ATOM   572   C  CG    . ASP A  1 104 ? -7.250  2.359   54.603  1.00 35.40 ? 104  ASP A CG    1 
ATOM   573   O  OD1   . ASP A  1 104 ? -7.051  1.135   54.431  1.00 36.25 ? 104  ASP A OD1   1 
ATOM   574   O  OD2   . ASP A  1 104 ? -8.027  2.940   53.810  1.00 35.77 ? 104  ASP A OD2   1 
ATOM   575   N  N     . ILE A  1 105 ? -6.609  6.412   54.254  1.00 34.04 ? 105  ILE A N     1 
ATOM   576   C  CA    . ILE A  1 105 ? -5.976  7.196   53.187  1.00 33.90 ? 105  ILE A CA    1 
ATOM   577   C  C     . ILE A  1 105 ? -4.528  7.607   53.496  1.00 33.99 ? 105  ILE A C     1 
ATOM   578   O  O     . ILE A  1 105 ? -3.644  7.475   52.644  1.00 33.95 ? 105  ILE A O     1 
ATOM   579   C  CB    . ILE A  1 105 ? -6.868  8.415   52.749  1.00 33.90 ? 105  ILE A CB    1 
ATOM   580   C  CG1   . ILE A  1 105 ? -6.258  9.153   51.553  1.00 33.97 ? 105  ILE A CG1   1 
ATOM   581   C  CG2   . ILE A  1 105 ? -7.118  9.394   53.902  1.00 33.68 ? 105  ILE A CG2   1 
ATOM   582   C  CD1   . ILE A  1 105 ? -6.527  8.530   50.212  1.00 31.85 ? 105  ILE A CD1   1 
ATOM   583   N  N     . VAL A  1 106 ? -4.287  8.070   54.720  1.00 34.23 ? 106  VAL A N     1 
ATOM   584   C  CA    . VAL A  1 106 ? -2.978  8.599   55.110  1.00 34.45 ? 106  VAL A CA    1 
ATOM   585   C  C     . VAL A  1 106 ? -1.887  7.524   55.133  1.00 34.76 ? 106  VAL A C     1 
ATOM   586   O  O     . VAL A  1 106 ? -0.848  7.683   54.476  1.00 34.93 ? 106  VAL A O     1 
ATOM   587   C  CB    . VAL A  1 106 ? -3.046  9.349   56.454  1.00 34.55 ? 106  VAL A CB    1 
ATOM   588   C  CG1   . VAL A  1 106 ? -1.694  9.926   56.816  1.00 34.86 ? 106  VAL A CG1   1 
ATOM   589   C  CG2   . VAL A  1 106 ? -4.087  10.462  56.384  1.00 34.61 ? 106  VAL A CG2   1 
ATOM   590   N  N     . GLU A  1 107 ? -2.128  6.433   55.863  1.00 34.70 ? 107  GLU A N     1 
ATOM   591   C  CA    . GLU A  1 107 ? -1.137  5.367   55.989  1.00 35.00 ? 107  GLU A CA    1 
ATOM   592   C  C     . GLU A  1 107 ? -0.851  4.689   54.649  1.00 34.43 ? 107  GLU A C     1 
ATOM   593   O  O     . GLU A  1 107 ? 0.295   4.351   54.360  1.00 34.55 ? 107  GLU A O     1 
ATOM   594   C  CB    . GLU A  1 107 ? -1.516  4.337   57.085  1.00 35.66 ? 107  GLU A CB    1 
ATOM   595   C  CG    . GLU A  1 107 ? -2.788  3.520   56.841  1.00 38.38 ? 107  GLU A CG    1 
ATOM   596   C  CD    . GLU A  1 107 ? -3.287  2.783   58.089  1.00 43.25 ? 107  GLU A CD    1 
ATOM   597   O  OE1   . GLU A  1 107 ? -4.398  3.117   58.593  1.00 44.07 ? 107  GLU A OE1   1 
ATOM   598   O  OE2   . GLU A  1 107 ? -2.578  1.852   58.568  1.00 44.49 ? 107  GLU A OE2   1 
ATOM   599   N  N     . PHE A  1 108 ? -1.889  4.506   53.833  1.00 33.75 ? 108  PHE A N     1 
ATOM   600   C  CA    . PHE A  1 108 ? -1.739  3.909   52.512  1.00 33.12 ? 108  PHE A CA    1 
ATOM   601   C  C     . PHE A  1 108 ? -0.848  4.761   51.603  1.00 33.10 ? 108  PHE A C     1 
ATOM   602   O  O     . PHE A  1 108 ? 0.112   4.253   51.017  1.00 33.04 ? 108  PHE A O     1 
ATOM   603   C  CB    . PHE A  1 108 ? -3.104  3.715   51.854  1.00 33.07 ? 108  PHE A CB    1 
ATOM   604   C  CG    . PHE A  1 108 ? -3.036  3.094   50.484  1.00 33.04 ? 108  PHE A CG    1 
ATOM   605   C  CD1   . PHE A  1 108 ? -2.990  1.707   50.335  1.00 32.78 ? 108  PHE A CD1   1 
ATOM   606   C  CD2   . PHE A  1 108 ? -3.011  3.894   49.339  1.00 32.45 ? 108  PHE A CD2   1 
ATOM   607   C  CE1   . PHE A  1 108 ? -2.923  1.128   49.065  1.00 32.49 ? 108  PHE A CE1   1 
ATOM   608   C  CE2   . PHE A  1 108 ? -2.942  3.322   48.067  1.00 32.32 ? 108  PHE A CE2   1 
ATOM   609   C  CZ    . PHE A  1 108 ? -2.898  1.939   47.931  1.00 32.52 ? 108  PHE A CZ    1 
ATOM   610   N  N     . CYS A  1 109 ? -1.167  6.048   51.484  1.00 32.86 ? 109  CYS A N     1 
ATOM   611   C  CA    . CYS A  1 109 ? -0.443  6.928   50.561  1.00 33.12 ? 109  CYS A CA    1 
ATOM   612   C  C     . CYS A  1 109 ? 1.006   7.080   50.978  1.00 33.07 ? 109  CYS A C     1 
ATOM   613   O  O     . CYS A  1 109 ? 1.911   7.028   50.143  1.00 32.74 ? 109  CYS A O     1 
ATOM   614   C  CB    . CYS A  1 109 ? -1.095  8.311   50.457  1.00 32.94 ? 109  CYS A CB    1 
ATOM   615   S  SG    . CYS A  1 109 ? -2.721  8.309   49.691  1.00 33.72 ? 109  CYS A SG    1 
ATOM   616   N  N     . GLU A  1 110 ? 1.142   7.238   52.265  1.00 33.49 ? 110  GLU A N     1 
ATOM   617   C  CA    . GLU A  1 110 ? 2.486   7.398   52.771  1.00 33.92 ? 110  GLU A CA    1 
ATOM   618   C  C     . GLU A  1 110 ? 3.358   6.169   52.557  1.00 33.72 ? 110  GLU A C     1 
ATOM   619   O  O     . GLU A  1 110 ? 4.514   6.299   52.153  1.00 33.90 ? 110  GLU A O     1 
ATOM   620   C  CB    . GLU A  1 110 ? 2.408   7.804   54.243  1.00 33.94 ? 110  GLU A CB    1 
ATOM   621   C  CG    . GLU A  1 110 ? 3.770   7.969   54.898  1.00 35.69 ? 110  GLU A CG    1 
ATOM   622   C  CD    . GLU A  1 110 ? 4.569   9.170   54.400  1.00 37.69 ? 110  GLU A CD    1 
ATOM   623   O  OE1   . GLU A  1 110 ? 5.587   9.502   55.047  1.00 38.41 ? 110  GLU A OE1   1 
ATOM   624   O  OE2   . GLU A  1 110 ? 4.183   9.776   53.375  1.00 38.26 ? 110  GLU A OE2   1 
ATOM   625   N  N     . ALA A  1 111 ? 2.816   4.994   52.841  1.00 33.39 ? 111  ALA A N     1 
ATOM   626   C  CA    . ALA A  1 111 ? 3.519   3.730   52.622  1.00 33.32 ? 111  ALA A CA    1 
ATOM   627   C  C     . ALA A  1 111 ? 3.820   3.485   51.139  1.00 33.17 ? 111  ALA A C     1 
ATOM   628   O  O     . ALA A  1 111 ? 4.899   3.002   50.793  1.00 33.42 ? 111  ALA A O     1 
ATOM   629   C  CB    . ALA A  1 111 ? 2.736   2.560   53.213  1.00 33.19 ? 111  ALA A CB    1 
ATOM   630   N  N     . MET A  1 112 ? 2.875   3.817   50.267  1.00 32.94 ? 112  MET A N     1 
ATOM   631   C  CA    . MET A  1 112 ? 3.078   3.627   48.832  1.00 32.81 ? 112  MET A CA    1 
ATOM   632   C  C     . MET A  1 112 ? 4.120   4.591   48.265  1.00 32.49 ? 112  MET A C     1 
ATOM   633   O  O     . MET A  1 112 ? 4.933   4.203   47.430  1.00 32.43 ? 112  MET A O     1 
ATOM   634   C  CB    . MET A  1 112 ? 1.749   3.702   48.074  1.00 32.54 ? 112  MET A CB    1 
ATOM   635   C  CG    . MET A  1 112 ? 0.815   2.530   48.373  1.00 33.74 ? 112  MET A CG    1 
ATOM   636   S  SD    . MET A  1 112 ? 1.417   0.893   47.853  1.00 36.11 ? 112  MET A SD    1 
ATOM   637   C  CE    . MET A  1 112 ? 0.592   -0.165  49.025  1.00 36.61 ? 112  MET A CE    1 
ATOM   638   N  N     . ALA A  1 113 ? 4.122   5.830   48.752  1.00 32.34 ? 113  ALA A N     1 
ATOM   639   C  CA    . ALA A  1 113 ? 5.107   6.823   48.316  1.00 32.72 ? 113  ALA A CA    1 
ATOM   640   C  C     . ALA A  1 113 ? 6.507   6.474   48.805  1.00 32.87 ? 113  ALA A C     1 
ATOM   641   O  O     . ALA A  1 113 ? 7.494   6.674   48.091  1.00 32.94 ? 113  ALA A O     1 
ATOM   642   C  CB    . ALA A  1 113 ? 4.724   8.238   48.767  1.00 32.52 ? 113  ALA A CB    1 
ATOM   643   N  N     . ASN A  1 114 ? 6.594   5.958   50.025  1.00 33.12 ? 114  ASN A N     1 
ATOM   644   C  CA    . ASN A  1 114 ? 7.884   5.537   50.572  1.00 33.53 ? 114  ASN A CA    1 
ATOM   645   C  C     . ASN A  1 114 ? 8.412   4.254   49.913  1.00 33.59 ? 114  ASN A C     1 
ATOM   646   O  O     . ASN A  1 114 ? 9.617   4.008   49.923  1.00 33.98 ? 114  ASN A O     1 
ATOM   647   C  CB    . ASN A  1 114 ? 7.840   5.423   52.101  1.00 33.47 ? 114  ASN A CB    1 
ATOM   648   C  CG    . ASN A  1 114 ? 7.719   6.783   52.785  1.00 34.64 ? 114  ASN A CG    1 
ATOM   649   O  OD1   . ASN A  1 114 ? 8.183   7.806   52.261  1.00 35.64 ? 114  ASN A OD1   1 
ATOM   650   N  ND2   . ASN A  1 114 ? 7.086   6.803   53.955  1.00 34.19 ? 114  ASN A ND2   1 
ATOM   651   N  N     . ALA A  1 115 ? 7.514   3.463   49.324  1.00 33.39 ? 115  ALA A N     1 
ATOM   652   C  CA    . ALA A  1 115 ? 7.911   2.321   48.485  1.00 33.40 ? 115  ALA A CA    1 
ATOM   653   C  C     . ALA A  1 115 ? 8.247   2.710   47.034  1.00 33.32 ? 115  ALA A C     1 
ATOM   654   O  O     . ALA A  1 115 ? 8.440   1.839   46.182  1.00 33.46 ? 115  ALA A O     1 
ATOM   655   C  CB    . ALA A  1 115 ? 6.827   1.232   48.501  1.00 33.21 ? 115  ALA A CB    1 
ATOM   656   N  N     . GLY A  1 116 ? 8.288   4.013   46.750  1.00 33.11 ? 116  GLY A N     1 
ATOM   657   C  CA    . GLY A  1 116 ? 8.665   4.510   45.435  1.00 32.51 ? 116  GLY A CA    1 
ATOM   658   C  C     . GLY A  1 116 ? 7.552   4.731   44.421  1.00 32.24 ? 116  GLY A C     1 
ATOM   659   O  O     . GLY A  1 116 ? 7.830   4.971   43.254  1.00 32.39 ? 116  GLY A O     1 
ATOM   660   N  N     . LYS A  1 117 ? 6.297   4.664   44.851  1.00 31.73 ? 117  LYS A N     1 
ATOM   661   C  CA    . LYS A  1 117 ? 5.171   4.863   43.947  1.00 31.21 ? 117  LYS A CA    1 
ATOM   662   C  C     . LYS A  1 117 ? 4.729   6.323   43.871  1.00 30.54 ? 117  LYS A C     1 
ATOM   663   O  O     . LYS A  1 117 ? 4.890   7.081   44.829  1.00 30.65 ? 117  LYS A O     1 
ATOM   664   C  CB    . LYS A  1 117 ? 3.997   3.982   44.373  1.00 31.35 ? 117  LYS A CB    1 
ATOM   665   C  CG    . LYS A  1 117 ? 4.071   2.570   43.793  1.00 32.45 ? 117  LYS A CG    1 
ATOM   666   C  CD    . LYS A  1 117 ? 3.810   1.495   44.849  1.00 34.12 ? 117  LYS A CD    1 
ATOM   667   C  CE    . LYS A  1 117 ? 4.845   0.354   44.780  1.00 34.24 ? 117  LYS A CE    1 
ATOM   668   N  NZ    . LYS A  1 117 ? 5.027   -0.218  43.413  1.00 34.04 ? 117  LYS A NZ    1 
ATOM   669   N  N     . THR A  1 118 ? 4.181   6.709   42.723  1.00 29.65 ? 118  THR A N     1 
ATOM   670   C  CA    . THR A  1 118 ? 3.521   7.999   42.556  1.00 28.63 ? 118  THR A CA    1 
ATOM   671   C  C     . THR A  1 118 ? 2.040   7.834   42.871  1.00 27.89 ? 118  THR A C     1 
ATOM   672   O  O     . THR A  1 118 ? 1.335   7.094   42.191  1.00 28.08 ? 118  THR A O     1 
ATOM   673   C  CB    . THR A  1 118 ? 3.719   8.523   41.118  1.00 28.70 ? 118  THR A CB    1 
ATOM   674   O  OG1   . THR A  1 118 ? 5.083   8.934   40.945  1.00 29.15 ? 118  THR A OG1   1 
ATOM   675   C  CG2   . THR A  1 118 ? 2.934   9.813   40.897  1.00 28.07 ? 118  THR A CG2   1 
ATOM   676   N  N     . VAL A  1 119 ? 1.587   8.514   43.916  1.00 27.20 ? 119  VAL A N     1 
ATOM   677   C  CA    . VAL A  1 119 ? 0.200   8.427   44.363  1.00 26.44 ? 119  VAL A CA    1 
ATOM   678   C  C     . VAL A  1 119 ? -0.499  9.764   44.126  1.00 26.16 ? 119  VAL A C     1 
ATOM   679   O  O     . VAL A  1 119 ? -0.038  10.802  44.593  1.00 26.04 ? 119  VAL A O     1 
ATOM   680   C  CB    . VAL A  1 119 ? 0.104   8.076   45.866  1.00 26.54 ? 119  VAL A CB    1 
ATOM   681   C  CG1   . VAL A  1 119 ? -1.342  7.726   46.260  1.00 25.58 ? 119  VAL A CG1   1 
ATOM   682   C  CG2   . VAL A  1 119 ? 1.078   6.946   46.225  1.00 26.44 ? 119  VAL A CG2   1 
ATOM   683   N  N     . ILE A  1 120 ? -1.614  9.716   43.403  1.00 25.55 ? 120  ILE A N     1 
ATOM   684   C  CA    . ILE A  1 120 ? -2.391  10.895  43.064  1.00 24.92 ? 120  ILE A CA    1 
ATOM   685   C  C     . ILE A  1 120 ? -3.792  10.749  43.658  1.00 24.71 ? 120  ILE A C     1 
ATOM   686   O  O     . ILE A  1 120 ? -4.487  9.763   43.399  1.00 24.73 ? 120  ILE A O     1 
ATOM   687   C  CB    . ILE A  1 120 ? -2.417  11.085  41.523  1.00 25.13 ? 120  ILE A CB    1 
ATOM   688   C  CG1   . ILE A  1 120 ? -0.971  11.102  40.990  1.00 25.09 ? 120  ILE A CG1   1 
ATOM   689   C  CG2   . ILE A  1 120 ? -3.161  12.387  41.145  1.00 24.26 ? 120  ILE A CG2   1 
ATOM   690   C  CD1   . ILE A  1 120 ? -0.814  11.268  39.498  1.00 25.13 ? 120  ILE A CD1   1 
ATOM   691   N  N     . VAL A  1 121 ? -4.190  11.726  44.472  1.00 24.34 ? 121  VAL A N     1 
ATOM   692   C  CA    . VAL A  1 121 ? -5.449  11.651  45.218  1.00 23.97 ? 121  VAL A CA    1 
ATOM   693   C  C     . VAL A  1 121 ? -6.377  12.811  44.882  1.00 23.98 ? 121  VAL A C     1 
ATOM   694   O  O     . VAL A  1 121 ? -6.008  13.973  45.032  1.00 24.22 ? 121  VAL A O     1 
ATOM   695   C  CB    . VAL A  1 121 ? -5.203  11.633  46.742  1.00 23.71 ? 121  VAL A CB    1 
ATOM   696   C  CG1   . VAL A  1 121 ? -6.506  11.435  47.494  1.00 23.72 ? 121  VAL A CG1   1 
ATOM   697   C  CG2   . VAL A  1 121 ? -4.209  10.550  47.115  1.00 24.08 ? 121  VAL A CG2   1 
ATOM   698   N  N     . ALA A  1 122 ? -7.576  12.476  44.419  1.00 23.96 ? 122  ALA A N     1 
ATOM   699   C  CA    . ALA A  1 122 ? -8.657  13.442  44.233  1.00 23.91 ? 122  ALA A CA    1 
ATOM   700   C  C     . ALA A  1 122 ? -9.577  13.358  45.441  1.00 24.14 ? 122  ALA A C     1 
ATOM   701   O  O     . ALA A  1 122 ? -9.978  12.267  45.848  1.00 23.83 ? 122  ALA A O     1 
ATOM   702   C  CB    . ALA A  1 122 ? -9.432  13.129  42.965  1.00 23.64 ? 122  ALA A CB    1 
ATOM   703   N  N     . ALA A  1 123 ? -9.908  14.507  46.021  1.00 24.48 ? 123  ALA A N     1 
ATOM   704   C  CA    . ALA A  1 123 ? -10.730 14.524  47.221  1.00 25.00 ? 123  ALA A CA    1 
ATOM   705   C  C     . ALA A  1 123 ? -11.360 15.872  47.509  1.00 25.60 ? 123  ALA A C     1 
ATOM   706   O  O     . ALA A  1 123 ? -10.786 16.928  47.227  1.00 25.56 ? 123  ALA A O     1 
ATOM   707   C  CB    . ALA A  1 123 ? -9.921  14.071  48.440  1.00 24.72 ? 123  ALA A CB    1 
ATOM   708   N  N     . LEU A  1 124 ? -12.513 15.809  48.137  1.00 26.54 ? 124  LEU A N     1 
ATOM   709   C  CA    . LEU A  1 124 ? -13.181 16.924  48.718  1.00 27.55 ? 124  LEU A CA    1 
ATOM   710   C  C     . LEU A  1 124 ? -12.349 17.359  49.926  1.00 28.43 ? 124  LEU A C     1 
ATOM   711   O  O     . LEU A  1 124 ? -11.971 16.514  50.738  1.00 28.81 ? 124  LEU A O     1 
ATOM   712   C  CB    . LEU A  1 124 ? -14.594 16.528  49.245  1.00 27.60 ? 124  LEU A CB    1 
ATOM   713   C  CG    . LEU A  1 124 ? -15.865 16.886  48.464  1.00 27.97 ? 124  LEU A CG    1 
ATOM   714   C  CD1   . LEU A  1 124 ? -15.499 17.326  47.058  1.00 27.15 ? 124  LEU A CD1   1 
ATOM   715   C  CD2   . LEU A  1 124 ? -16.824 15.713  48.423  1.00 27.33 ? 124  LEU A CD2   1 
ATOM   716   N  N     . ASP A  1 125 ? -12.037 18.638  50.049  1.00 29.32 ? 125  ASP A N     1 
ATOM   717   C  CA    . ASP A  1 125 ? -11.374 19.111  51.262  1.00 30.28 ? 125  ASP A CA    1 
ATOM   718   C  C     . ASP A  1 125 ? -12.389 19.359  52.385  1.00 30.16 ? 125  ASP A C     1 
ATOM   719   O  O     . ASP A  1 125 ? -12.083 19.143  53.564  1.00 30.41 ? 125  ASP A O     1 
ATOM   720   C  CB    . ASP A  1 125 ? -10.589 20.379  50.979  1.00 30.78 ? 125  ASP A CB    1 
ATOM   721   C  CG    . ASP A  1 125 ? -11.409 21.395  50.250  1.00 32.49 ? 125  ASP A CG    1 
ATOM   722   O  OD1   . ASP A  1 125 ? -11.679 22.453  50.838  1.00 35.14 ? 125  ASP A OD1   1 
ATOM   723   O  OD2   . ASP A  1 125 ? -11.856 21.210  49.095  1.00 35.68 ? 125  ASP A OD2   1 
ATOM   724   N  N     . GLY A  1 126 ? -13.594 19.791  52.012  1.00 29.63 ? 126  GLY A N     1 
ATOM   725   C  CA    . GLY A  1 126 ? -14.618 20.117  52.981  1.00 29.25 ? 126  GLY A CA    1 
ATOM   726   C  C     . GLY A  1 126 ? -15.923 19.366  52.802  1.00 29.12 ? 126  GLY A C     1 
ATOM   727   O  O     . GLY A  1 126 ? -16.314 19.033  51.681  1.00 29.14 ? 126  GLY A O     1 
ATOM   728   N  N     . THR A  1 127 ? -16.598 19.101  53.918  1.00 28.79 ? 127  THR A N     1 
ATOM   729   C  CA    . THR A  1 127 ? -17.974 18.604  53.890  1.00 28.68 ? 127  THR A CA    1 
ATOM   730   C  C     . THR A  1 127 ? -18.937 19.740  53.540  1.00 28.91 ? 127  THR A C     1 
ATOM   731   O  O     . THR A  1 127 ? -18.521 20.891  53.328  1.00 28.63 ? 127  THR A O     1 
ATOM   732   C  CB    . THR A  1 127 ? -18.392 18.019  55.267  1.00 28.60 ? 127  THR A CB    1 
ATOM   733   O  OG1   . THR A  1 127 ? -18.436 19.079  56.231  1.00 27.84 ? 127  THR A OG1   1 
ATOM   734   C  CG2   . THR A  1 127 ? -17.333 17.042  55.819  1.00 27.68 ? 127  THR A CG2   1 
ATOM   735   N  N     . PHE A  1 128 ? -20.225 19.405  53.521  1.00 29.17 ? 128  PHE A N     1 
ATOM   736   C  CA    . PHE A  1 128 ? -21.298 20.375  53.358  1.00 29.57 ? 128  PHE A CA    1 
ATOM   737   C  C     . PHE A  1 128 ? -21.329 21.436  54.470  1.00 30.06 ? 128  PHE A C     1 
ATOM   738   O  O     . PHE A  1 128 ? -21.982 22.463  54.317  1.00 30.31 ? 128  PHE A O     1 
ATOM   739   C  CB    . PHE A  1 128 ? -22.649 19.651  53.209  1.00 29.63 ? 128  PHE A CB    1 
ATOM   740   C  CG    . PHE A  1 128 ? -23.275 19.228  54.516  1.00 29.49 ? 128  PHE A CG    1 
ATOM   741   C  CD1   . PHE A  1 128 ? -24.317 19.968  55.076  1.00 30.02 ? 128  PHE A CD1   1 
ATOM   742   C  CD2   . PHE A  1 128 ? -22.832 18.092  55.180  1.00 29.33 ? 128  PHE A CD2   1 
ATOM   743   C  CE1   . PHE A  1 128 ? -24.901 19.586  56.285  1.00 29.91 ? 128  PHE A CE1   1 
ATOM   744   C  CE2   . PHE A  1 128 ? -23.397 17.707  56.392  1.00 30.46 ? 128  PHE A CE2   1 
ATOM   745   C  CZ    . PHE A  1 128 ? -24.441 18.450  56.944  1.00 30.07 ? 128  PHE A CZ    1 
ATOM   746   N  N     . GLN A  1 129 ? -20.609 21.193  55.566  1.00 30.59 ? 129  GLN A N     1 
ATOM   747   C  CA    . GLN A  1 129 ? -20.501 22.162  56.657  1.00 31.38 ? 129  GLN A CA    1 
ATOM   748   C  C     . GLN A  1 129 ? -19.188 22.951  56.627  1.00 31.52 ? 129  GLN A C     1 
ATOM   749   O  O     . GLN A  1 129 ? -18.881 23.706  57.553  1.00 31.39 ? 129  GLN A O     1 
ATOM   750   C  CB    . GLN A  1 129 ? -20.702 21.476  58.012  1.00 31.72 ? 129  GLN A CB    1 
ATOM   751   C  CG    . GLN A  1 129 ? -22.113 20.932  58.209  1.00 33.13 ? 129  GLN A CG    1 
ATOM   752   C  CD    . GLN A  1 129 ? -22.286 20.195  59.517  1.00 35.66 ? 129  GLN A CD    1 
ATOM   753   O  OE1   . GLN A  1 129 ? -23.137 20.567  60.331  1.00 36.72 ? 129  GLN A OE1   1 
ATOM   754   N  NE2   . GLN A  1 129 ? -21.491 19.146  59.727  1.00 35.36 ? 129  GLN A NE2   1 
ATOM   755   N  N     . ARG A  1 130 ? -18.428 22.781  55.541  1.00 31.73 ? 130  ARG A N     1 
ATOM   756   C  CA    . ARG A  1 130 ? -17.118 23.420  55.367  1.00 31.91 ? 130  ARG A CA    1 
ATOM   757   C  C     . ARG A  1 130 ? -16.132 23.046  56.486  1.00 31.92 ? 130  ARG A C     1 
ATOM   758   O  O     . ARG A  1 130 ? -15.327 23.867  56.931  1.00 32.10 ? 130  ARG A O     1 
ATOM   759   C  CB    . ARG A  1 130 ? -17.250 24.945  55.198  1.00 31.89 ? 130  ARG A CB    1 
ATOM   760   C  CG    . ARG A  1 130 ? -18.084 25.391  53.976  1.00 32.67 ? 130  ARG A CG    1 
ATOM   761   C  CD    . ARG A  1 130 ? -17.861 26.840  53.566  1.00 34.46 ? 130  ARG A CD    1 
ATOM   762   N  NE    . ARG A  1 130 ? -17.966 27.707  54.729  1.00 37.54 ? 130  ARG A NE    1 
ATOM   763   C  CZ    . ARG A  1 130 ? -17.188 28.747  54.997  1.00 38.24 ? 130  ARG A CZ    1 
ATOM   764   N  NH1   . ARG A  1 130 ? -16.217 29.118  54.176  1.00 38.51 ? 130  ARG A NH1   1 
ATOM   765   N  NH2   . ARG A  1 130 ? -17.401 29.434  56.108  1.00 38.91 ? 130  ARG A NH2   1 
ATOM   766   N  N     . LYS A  1 131 ? -16.215 21.799  56.932  1.00 31.92 ? 131  LYS A N     1 
ATOM   767   C  CA    . LYS A  1 131 ? -15.289 21.241  57.908  1.00 32.31 ? 131  LYS A CA    1 
ATOM   768   C  C     . LYS A  1 131 ? -14.404 20.230  57.179  1.00 31.98 ? 131  LYS A C     1 
ATOM   769   O  O     . LYS A  1 131 ? -14.799 19.727  56.126  1.00 31.69 ? 131  LYS A O     1 
ATOM   770   C  CB    . LYS A  1 131 ? -16.050 20.515  59.012  1.00 32.49 ? 131  LYS A CB    1 
ATOM   771   C  CG    . LYS A  1 131 ? -16.880 21.397  59.916  1.00 34.62 ? 131  LYS A CG    1 
ATOM   772   C  CD    . LYS A  1 131 ? -17.832 20.526  60.736  1.00 38.08 ? 131  LYS A CD    1 
ATOM   773   C  CE    . LYS A  1 131 ? -17.977 21.048  62.148  1.00 40.65 ? 131  LYS A CE    1 
ATOM   774   N  NZ    . LYS A  1 131 ? -18.986 22.131  62.182  1.00 41.18 ? 131  LYS A NZ    1 
ATOM   775   N  N     . PRO A  1 132 ? -13.222 19.923  57.726  1.00 31.81 ? 132  PRO A N     1 
ATOM   776   C  CA    . PRO A  1 132 ? -12.362 18.878  57.152  1.00 31.63 ? 132  PRO A CA    1 
ATOM   777   C  C     . PRO A  1 132 ? -13.137 17.585  56.926  1.00 31.75 ? 132  PRO A C     1 
ATOM   778   O  O     . PRO A  1 132 ? -13.903 17.149  57.794  1.00 31.47 ? 132  PRO A O     1 
ATOM   779   C  CB    . PRO A  1 132 ? -11.299 18.651  58.231  1.00 31.90 ? 132  PRO A CB    1 
ATOM   780   C  CG    . PRO A  1 132 ? -11.252 19.939  59.015  1.00 31.95 ? 132  PRO A CG    1 
ATOM   781   C  CD    . PRO A  1 132 ? -12.622 20.544  58.925  1.00 31.67 ? 132  PRO A CD    1 
ATOM   782   N  N     . PHE A  1 133 ? -12.949 16.994  55.754  1.00 31.86 ? 133  PHE A N     1 
ATOM   783   C  CA    . PHE A  1 133 ? -13.664 15.790  55.377  1.00 32.04 ? 133  PHE A CA    1 
ATOM   784   C  C     . PHE A  1 133 ? -12.823 14.572  55.711  1.00 32.61 ? 133  PHE A C     1 
ATOM   785   O  O     . PHE A  1 133 ? -11.889 14.235  54.981  1.00 32.90 ? 133  PHE A O     1 
ATOM   786   C  CB    . PHE A  1 133 ? -13.996 15.807  53.884  1.00 31.78 ? 133  PHE A CB    1 
ATOM   787   C  CG    . PHE A  1 133 ? -15.214 15.006  53.528  1.00 31.78 ? 133  PHE A CG    1 
ATOM   788   C  CD1   . PHE A  1 133 ? -16.094 15.459  52.558  1.00 30.66 ? 133  PHE A CD1   1 
ATOM   789   C  CD2   . PHE A  1 133 ? -15.488 13.797  54.172  1.00 31.45 ? 133  PHE A CD2   1 
ATOM   790   C  CE1   . PHE A  1 133 ? -17.222 14.727  52.227  1.00 31.51 ? 133  PHE A CE1   1 
ATOM   791   C  CE2   . PHE A  1 133 ? -16.612 13.054  53.841  1.00 30.95 ? 133  PHE A CE2   1 
ATOM   792   C  CZ    . PHE A  1 133 ? -17.484 13.518  52.870  1.00 31.23 ? 133  PHE A CZ    1 
ATOM   793   N  N     . GLY A  1 134 ? -13.154 13.914  56.818  1.00 33.03 ? 134  GLY A N     1 
ATOM   794   C  CA    . GLY A  1 134 ? -12.419 12.745  57.250  1.00 33.13 ? 134  GLY A CA    1 
ATOM   795   C  C     . GLY A  1 134 ? -10.991 13.110  57.601  1.00 33.19 ? 134  GLY A C     1 
ATOM   796   O  O     . GLY A  1 134 ? -10.739 14.151  58.206  1.00 33.33 ? 134  GLY A O     1 
ATOM   797   N  N     . ALA A  1 135 ? -10.062 12.257  57.191  1.00 33.11 ? 135  ALA A N     1 
ATOM   798   C  CA    . ALA A  1 135 ? -8.650  12.390  57.539  1.00 33.07 ? 135  ALA A CA    1 
ATOM   799   C  C     . ALA A  1 135 ? -7.843  13.060  56.424  1.00 32.90 ? 135  ALA A C     1 
ATOM   800   O  O     . ALA A  1 135 ? -6.626  13.217  56.521  1.00 32.85 ? 135  ALA A O     1 
ATOM   801   C  CB    . ALA A  1 135 ? -8.072  10.999  57.854  1.00 32.84 ? 135  ALA A CB    1 
ATOM   802   N  N     . ILE A  1 136 ? -8.534  13.467  55.370  1.00 32.82 ? 136  ILE A N     1 
ATOM   803   C  CA    . ILE A  1 136 ? -7.873  13.860  54.136  1.00 32.93 ? 136  ILE A CA    1 
ATOM   804   C  C     . ILE A  1 136 ? -6.842  14.995  54.237  1.00 32.60 ? 136  ILE A C     1 
ATOM   805   O  O     . ILE A  1 136 ? -5.847  14.979  53.514  1.00 32.57 ? 136  ILE A O     1 
ATOM   806   C  CB    . ILE A  1 136 ? -8.911  14.064  52.995  1.00 33.14 ? 136  ILE A CB    1 
ATOM   807   C  CG1   . ILE A  1 136 ? -8.319  13.591  51.656  1.00 33.77 ? 136  ILE A CG1   1 
ATOM   808   C  CG2   . ILE A  1 136 ? -9.464  15.482  52.983  1.00 33.42 ? 136  ILE A CG2   1 
ATOM   809   C  CD1   . ILE A  1 136 ? -7.470  14.633  50.935  1.00 35.92 ? 136  ILE A CD1   1 
ATOM   810   N  N     . LEU A  1 137 ? -7.052  15.947  55.144  1.00 32.16 ? 137  LEU A N     1 
ATOM   811   C  CA    . LEU A  1 137 ? -6.128  17.071  55.278  1.00 31.94 ? 137  LEU A CA    1 
ATOM   812   C  C     . LEU A  1 137 ? -4.781  16.693  55.902  1.00 31.78 ? 137  LEU A C     1 
ATOM   813   O  O     . LEU A  1 137 ? -3.786  17.409  55.727  1.00 31.61 ? 137  LEU A O     1 
ATOM   814   C  CB    . LEU A  1 137 ? -6.786  18.225  56.036  1.00 31.95 ? 137  LEU A CB    1 
ATOM   815   C  CG    . LEU A  1 137 ? -7.860  18.951  55.217  1.00 32.34 ? 137  LEU A CG    1 
ATOM   816   C  CD1   . LEU A  1 137 ? -8.545  20.006  56.057  1.00 32.45 ? 137  LEU A CD1   1 
ATOM   817   C  CD2   . LEU A  1 137 ? -7.273  19.550  53.947  1.00 32.61 ? 137  LEU A CD2   1 
ATOM   818   N  N     . ASN A  1 138 ? -4.750  15.563  56.607  1.00 31.36 ? 138  ASN A N     1 
ATOM   819   C  CA    . ASN A  1 138 ? -3.500  15.014  57.132  1.00 31.29 ? 138  ASN A CA    1 
ATOM   820   C  C     . ASN A  1 138 ? -2.515  14.605  56.023  1.00 30.75 ? 138  ASN A C     1 
ATOM   821   O  O     . ASN A  1 138 ? -1.332  14.384  56.291  1.00 30.50 ? 138  ASN A O     1 
ATOM   822   C  CB    . ASN A  1 138 ? -3.769  13.834  58.078  1.00 31.54 ? 138  ASN A CB    1 
ATOM   823   C  CG    . ASN A  1 138 ? -4.521  14.247  59.347  1.00 32.96 ? 138  ASN A CG    1 
ATOM   824   O  OD1   . ASN A  1 138 ? -4.174  15.227  60.009  1.00 34.53 ? 138  ASN A OD1   1 
ATOM   825   N  ND2   . ASN A  1 138 ? -5.557  13.492  59.688  1.00 34.60 ? 138  ASN A ND2   1 
ATOM   826   N  N     . LEU A  1 139 ? -3.015  14.517  54.788  1.00 30.19 ? 139  LEU A N     1 
ATOM   827   C  CA    . LEU A  1 139 ? -2.180  14.272  53.613  1.00 29.83 ? 139  LEU A CA    1 
ATOM   828   C  C     . LEU A  1 139 ? -1.345  15.479  53.208  1.00 29.56 ? 139  LEU A C     1 
ATOM   829   O  O     . LEU A  1 139 ? -0.261  15.311  52.642  1.00 29.57 ? 139  LEU A O     1 
ATOM   830   C  CB    . LEU A  1 139 ? -3.037  13.850  52.419  1.00 29.81 ? 139  LEU A CB    1 
ATOM   831   C  CG    . LEU A  1 139 ? -3.421  12.376  52.279  1.00 30.06 ? 139  LEU A CG    1 
ATOM   832   C  CD1   . LEU A  1 139 ? -4.195  12.168  50.990  1.00 30.04 ? 139  LEU A CD1   1 
ATOM   833   C  CD2   . LEU A  1 139 ? -2.196  11.460  52.331  1.00 30.22 ? 139  LEU A CD2   1 
ATOM   834   N  N     . VAL A  1 140 ? -1.852  16.684  53.486  1.00 29.16 ? 140  VAL A N     1 
ATOM   835   C  CA    . VAL A  1 140 ? -1.224  17.925  53.014  1.00 28.90 ? 140  VAL A CA    1 
ATOM   836   C  C     . VAL A  1 140 ? 0.243   18.076  53.454  1.00 29.16 ? 140  VAL A C     1 
ATOM   837   O  O     . VAL A  1 140 ? 1.100   18.338  52.601  1.00 29.44 ? 140  VAL A O     1 
ATOM   838   C  CB    . VAL A  1 140 ? -2.059  19.197  53.345  1.00 28.79 ? 140  VAL A CB    1 
ATOM   839   C  CG1   . VAL A  1 140 ? -1.313  20.452  52.940  1.00 28.32 ? 140  VAL A CG1   1 
ATOM   840   C  CG2   . VAL A  1 140 ? -3.422  19.145  52.658  1.00 27.86 ? 140  VAL A CG2   1 
ATOM   841   N  N     . PRO A  1 141 ? 0.554   17.897  54.747  1.00 29.11 ? 141  PRO A N     1 
ATOM   842   C  CA    . PRO A  1 141 ? 1.948   17.954  55.207  1.00 28.86 ? 141  PRO A CA    1 
ATOM   843   C  C     . PRO A  1 141 ? 2.806   16.823  54.649  1.00 29.06 ? 141  PRO A C     1 
ATOM   844   O  O     . PRO A  1 141 ? 4.044   16.899  54.719  1.00 29.23 ? 141  PRO A O     1 
ATOM   845   C  CB    . PRO A  1 141 ? 1.826   17.778  56.726  1.00 29.18 ? 141  PRO A CB    1 
ATOM   846   C  CG    . PRO A  1 141 ? 0.395   18.065  57.064  1.00 28.68 ? 141  PRO A CG    1 
ATOM   847   C  CD    . PRO A  1 141 ? -0.370  17.625  55.871  1.00 29.24 ? 141  PRO A CD    1 
ATOM   848   N  N     . LEU A  1 142 ? 2.166   15.783  54.116  1.00 28.97 ? 142  LEU A N     1 
ATOM   849   C  CA    . LEU A  1 142 ? 2.882   14.635  53.542  1.00 29.01 ? 142  LEU A CA    1 
ATOM   850   C  C     . LEU A  1 142 ? 3.086   14.739  52.030  1.00 28.95 ? 142  LEU A C     1 
ATOM   851   O  O     . LEU A  1 142 ? 3.842   13.959  51.442  1.00 28.99 ? 142  LEU A O     1 
ATOM   852   C  CB    . LEU A  1 142 ? 2.133   13.325  53.855  1.00 28.87 ? 142  LEU A CB    1 
ATOM   853   C  CG    . LEU A  1 142 ? 2.027   12.892  55.323  1.00 29.34 ? 142  LEU A CG    1 
ATOM   854   C  CD1   . LEU A  1 142 ? 1.049   11.754  55.459  1.00 29.68 ? 142  LEU A CD1   1 
ATOM   855   C  CD2   . LEU A  1 142 ? 3.379   12.486  55.909  1.00 29.00 ? 142  LEU A CD2   1 
ATOM   856   N  N     . ALA A  1 143 ? 2.403   15.694  51.406  1.00 28.95 ? 143  ALA A N     1 
ATOM   857   C  CA    . ALA A  1 143 ? 2.319   15.761  49.956  1.00 29.09 ? 143  ALA A CA    1 
ATOM   858   C  C     . ALA A  1 143 ? 3.365   16.692  49.332  1.00 29.35 ? 143  ALA A C     1 
ATOM   859   O  O     . ALA A  1 143 ? 3.671   17.755  49.879  1.00 29.26 ? 143  ALA A O     1 
ATOM   860   C  CB    . ALA A  1 143 ? 0.918   16.186  49.549  1.00 28.93 ? 143  ALA A CB    1 
ATOM   861   N  N     . GLU A  1 144 ? 3.890   16.293  48.178  1.00 29.60 ? 144  GLU A N     1 
ATOM   862   C  CA    . GLU A  1 144 ? 4.827   17.116  47.430  1.00 30.23 ? 144  GLU A CA    1 
ATOM   863   C  C     . GLU A  1 144 ? 4.086   18.132  46.557  1.00 29.99 ? 144  GLU A C     1 
ATOM   864   O  O     . GLU A  1 144 ? 4.656   19.134  46.132  1.00 30.35 ? 144  GLU A O     1 
ATOM   865   C  CB    . GLU A  1 144 ? 5.724   16.209  46.570  1.00 30.49 ? 144  GLU A CB    1 
ATOM   866   C  CG    . GLU A  1 144 ? 6.860   15.533  47.349  1.00 32.21 ? 144  GLU A CG    1 
ATOM   867   C  CD    . GLU A  1 144 ? 6.511   14.161  47.950  1.00 34.45 ? 144  GLU A CD    1 
ATOM   868   O  OE1   . GLU A  1 144 ? 5.317   13.862  48.198  1.00 34.26 ? 144  GLU A OE1   1 
ATOM   869   O  OE2   . GLU A  1 144 ? 7.452   13.368  48.210  1.00 34.37 ? 144  GLU A OE2   1 
ATOM   870   N  N     . SER A  1 145 ? 2.807   17.874  46.306  1.00 29.54 ? 145  SER A N     1 
ATOM   871   C  CA    . SER A  1 145 ? 1.997   18.715  45.439  1.00 29.16 ? 145  SER A CA    1 
ATOM   872   C  C     . SER A  1 145 ? 0.555   18.787  45.957  1.00 28.82 ? 145  SER A C     1 
ATOM   873   O  O     . SER A  1 145 ? -0.078  17.761  46.193  1.00 28.69 ? 145  SER A O     1 
ATOM   874   C  CB    . SER A  1 145 ? 2.033   18.149  44.020  1.00 29.33 ? 145  SER A CB    1 
ATOM   875   O  OG    . SER A  1 145 ? 1.129   18.823  43.168  1.00 30.74 ? 145  SER A OG    1 
ATOM   876   N  N     . VAL A  1 146 ? 0.056   19.999  46.166  1.00 28.37 ? 146  VAL A N     1 
ATOM   877   C  CA    . VAL A  1 146 ? -1.328  20.203  46.589  1.00 28.09 ? 146  VAL A CA    1 
ATOM   878   C  C     . VAL A  1 146 ? -1.943  21.329  45.770  1.00 28.01 ? 146  VAL A C     1 
ATOM   879   O  O     . VAL A  1 146 ? -1.377  22.422  45.660  1.00 28.08 ? 146  VAL A O     1 
ATOM   880   C  CB    . VAL A  1 146 ? -1.467  20.491  48.112  1.00 28.08 ? 146  VAL A CB    1 
ATOM   881   C  CG1   . VAL A  1 146 ? -2.924  20.750  48.497  1.00 27.92 ? 146  VAL A CG1   1 
ATOM   882   C  CG2   . VAL A  1 146 ? -0.946  19.325  48.938  1.00 28.16 ? 146  VAL A CG2   1 
ATOM   883   N  N     . VAL A  1 147 ? -3.094  21.043  45.173  1.00 27.92 ? 147  VAL A N     1 
ATOM   884   C  CA    . VAL A  1 147 ? -3.847  22.035  44.421  1.00 27.90 ? 147  VAL A CA    1 
ATOM   885   C  C     . VAL A  1 147 ? -5.316  22.013  44.862  1.00 27.88 ? 147  VAL A C     1 
ATOM   886   O  O     . VAL A  1 147 ? -5.831  20.968  45.273  1.00 27.48 ? 147  VAL A O     1 
ATOM   887   C  CB    . VAL A  1 147 ? -3.691  21.794  42.894  1.00 28.39 ? 147  VAL A CB    1 
ATOM   888   C  CG1   . VAL A  1 147 ? -4.738  20.823  42.349  1.00 27.85 ? 147  VAL A CG1   1 
ATOM   889   C  CG2   . VAL A  1 147 ? -3.710  23.104  42.124  1.00 29.76 ? 147  VAL A CG2   1 
ATOM   890   N  N     . LYS A  1 148 ? -5.969  23.175  44.815  1.00 27.85 ? 148  LYS A N     1 
ATOM   891   C  CA    . LYS A  1 148 ? -7.402  23.263  45.061  1.00 27.79 ? 148  LYS A CA    1 
ATOM   892   C  C     . LYS A  1 148 ? -8.118  23.803  43.821  1.00 27.83 ? 148  LYS A C     1 
ATOM   893   O  O     . LYS A  1 148 ? -7.912  24.951  43.415  1.00 27.81 ? 148  LYS A O     1 
ATOM   894   C  CB    . LYS A  1 148 ? -7.730  24.109  46.304  1.00 27.95 ? 148  LYS A CB    1 
ATOM   895   C  CG    . LYS A  1 148 ? -9.213  24.069  46.679  1.00 28.12 ? 148  LYS A CG    1 
ATOM   896   C  CD    . LYS A  1 148 ? -9.536  24.613  48.064  1.00 29.59 ? 148  LYS A CD    1 
ATOM   897   C  CE    . LYS A  1 148 ? -11.076 24.703  48.227  1.00 30.71 ? 148  LYS A CE    1 
ATOM   898   N  NZ    . LYS A  1 148 ? -11.540 25.130  49.590  1.00 31.70 ? 148  LYS A NZ    1 
ATOM   899   N  N     . LEU A  1 149 ? -8.947  22.956  43.221  1.00 27.66 ? 149  LEU A N     1 
ATOM   900   C  CA    . LEU A  1 149 ? -9.712  23.325  42.041  1.00 27.97 ? 149  LEU A CA    1 
ATOM   901   C  C     . LEU A  1 149 ? -10.925 24.158  42.397  1.00 28.37 ? 149  LEU A C     1 
ATOM   902   O  O     . LEU A  1 149 ? -11.324 24.269  43.561  1.00 28.74 ? 149  LEU A O     1 
ATOM   903   C  CB    . LEU A  1 149 ? -10.146 22.083  41.241  1.00 27.53 ? 149  LEU A CB    1 
ATOM   904   C  CG    . LEU A  1 149 ? -9.009  21.208  40.693  1.00 27.10 ? 149  LEU A CG    1 
ATOM   905   C  CD1   . LEU A  1 149 ? -9.542  20.132  39.784  1.00 25.79 ? 149  LEU A CD1   1 
ATOM   906   C  CD2   . LEU A  1 149 ? -7.916  22.048  39.988  1.00 26.16 ? 149  LEU A CD2   1 
ATOM   907   N  N     . THR A  1 150 ? -11.520 24.729  41.371  1.00 28.75 ? 150  THR A N     1 
ATOM   908   C  CA    . THR A  1 150 ? -12.607 25.661  41.540  1.00 29.34 ? 150  THR A CA    1 
ATOM   909   C  C     . THR A  1 150 ? -13.807 25.175  40.738  1.00 28.87 ? 150  THR A C     1 
ATOM   910   O  O     . THR A  1 150 ? -13.642 24.533  39.707  1.00 28.55 ? 150  THR A O     1 
ATOM   911   C  CB    . THR A  1 150 ? -12.091 27.065  41.116  1.00 29.70 ? 150  THR A CB    1 
ATOM   912   O  OG1   . THR A  1 150 ? -12.326 27.995  42.181  1.00 31.71 ? 150  THR A OG1   1 
ATOM   913   C  CG2   . THR A  1 150 ? -12.844 27.638  39.920  1.00 30.36 ? 150  THR A CG2   1 
ATOM   914   N  N     . ALA A  1 151 ? -15.009 25.441  41.239  1.00 28.79 ? 151  ALA A N     1 
ATOM   915   C  CA    . ALA A  1 151 ? -16.232 25.157  40.496  1.00 28.79 ? 151  ALA A CA    1 
ATOM   916   C  C     . ALA A  1 151 ? -16.950 26.455  40.123  1.00 29.01 ? 151  ALA A C     1 
ATOM   917   O  O     . ALA A  1 151 ? -16.496 27.550  40.463  1.00 28.89 ? 151  ALA A O     1 
ATOM   918   C  CB    . ALA A  1 151 ? -17.148 24.247  41.304  1.00 28.32 ? 151  ALA A CB    1 
ATOM   919   N  N     . VAL A  1 152 ? -18.065 26.333  39.414  1.00 29.38 ? 152  VAL A N     1 
ATOM   920   C  CA    . VAL A  1 152 ? -18.901 27.489  39.138  1.00 29.98 ? 152  VAL A CA    1 
ATOM   921   C  C     . VAL A  1 152 ? -20.081 27.492  40.116  1.00 30.44 ? 152  VAL A C     1 
ATOM   922   O  O     . VAL A  1 152 ? -20.718 26.455  40.320  1.00 30.37 ? 152  VAL A O     1 
ATOM   923   C  CB    . VAL A  1 152 ? -19.357 27.496  37.666  1.00 30.10 ? 152  VAL A CB    1 
ATOM   924   C  CG1   . VAL A  1 152 ? -20.394 28.606  37.407  1.00 29.92 ? 152  VAL A CG1   1 
ATOM   925   C  CG2   . VAL A  1 152 ? -18.138 27.660  36.743  1.00 29.32 ? 152  VAL A CG2   1 
ATOM   926   N  N     . CYS A  1 153 ? -20.340 28.639  40.748  1.00 31.17 ? 153  CYS A N     1 
ATOM   927   C  CA    . CYS A  1 153 ? -21.477 28.790  41.662  1.00 31.85 ? 153  CYS A CA    1 
ATOM   928   C  C     . CYS A  1 153 ? -22.766 28.561  40.907  1.00 32.77 ? 153  CYS A C     1 
ATOM   929   O  O     . CYS A  1 153 ? -23.069 29.274  39.966  1.00 32.76 ? 153  CYS A O     1 
ATOM   930   C  CB    . CYS A  1 153 ? -21.502 30.176  42.317  1.00 31.71 ? 153  CYS A CB    1 
ATOM   931   S  SG    . CYS A  1 153 ? -22.770 30.412  43.603  1.00 30.31 ? 153  CYS A SG    1 
ATOM   932   N  N     . MET A  1 154 ? -23.516 27.552  41.328  1.00 33.92 ? 154  MET A N     1 
ATOM   933   C  CA    . MET A  1 154 ? -24.766 27.187  40.674  1.00 35.03 ? 154  MET A CA    1 
ATOM   934   C  C     . MET A  1 154 ? -25.909 28.151  41.008  1.00 35.88 ? 154  MET A C     1 
ATOM   935   O  O     . MET A  1 154 ? -27.016 28.017  40.485  1.00 36.43 ? 154  MET A O     1 
ATOM   936   C  CB    . MET A  1 154 ? -25.151 25.752  41.032  1.00 34.99 ? 154  MET A CB    1 
ATOM   937   C  CG    . MET A  1 154 ? -24.333 24.712  40.296  1.00 35.15 ? 154  MET A CG    1 
ATOM   938   S  SD    . MET A  1 154 ? -24.433 23.118  41.103  1.00 36.54 ? 154  MET A SD    1 
ATOM   939   C  CE    . MET A  1 154 ? -23.604 22.043  39.907  1.00 36.16 ? 154  MET A CE    1 
ATOM   940   N  N     . GLU A  1 155 ? -25.635 29.131  41.859  1.00 36.68 ? 155  GLU A N     1 
ATOM   941   C  CA    . GLU A  1 155 ? -26.670 30.079  42.271  1.00 37.62 ? 155  GLU A CA    1 
ATOM   942   C  C     . GLU A  1 155 ? -26.428 31.512  41.772  1.00 37.76 ? 155  GLU A C     1 
ATOM   943   O  O     . GLU A  1 155 ? -27.382 32.221  41.457  1.00 37.96 ? 155  GLU A O     1 
ATOM   944   C  CB    . GLU A  1 155 ? -26.886 30.024  43.792  1.00 37.68 ? 155  GLU A CB    1 
ATOM   945   C  CG    . GLU A  1 155 ? -27.761 28.846  44.207  1.00 39.11 ? 155  GLU A CG    1 
ATOM   946   C  CD    . GLU A  1 155 ? -27.503 28.335  45.618  1.00 41.34 ? 155  GLU A CD    1 
ATOM   947   O  OE1   . GLU A  1 155 ? -27.552 27.101  45.809  1.00 42.65 ? 155  GLU A OE1   1 
ATOM   948   O  OE2   . GLU A  1 155 ? -27.289 29.148  46.547  1.00 42.78 ? 155  GLU A OE2   1 
ATOM   949   N  N     . CYS A  1 156 ? -25.162 31.923  41.684  1.00 37.85 ? 156  CYS A N     1 
ATOM   950   C  CA    . CYS A  1 156 ? -24.821 33.259  41.189  1.00 37.95 ? 156  CYS A CA    1 
ATOM   951   C  C     . CYS A  1 156 ? -23.817 33.243  40.037  1.00 38.13 ? 156  CYS A C     1 
ATOM   952   O  O     . CYS A  1 156 ? -23.522 34.289  39.459  1.00 38.13 ? 156  CYS A O     1 
ATOM   953   C  CB    . CYS A  1 156 ? -24.348 34.181  42.331  1.00 37.98 ? 156  CYS A CB    1 
ATOM   954   S  SG    . CYS A  1 156 ? -22.568 34.161  42.723  1.00 38.20 ? 156  CYS A SG    1 
ATOM   955   N  N     . PHE A  1 157 ? -23.296 32.058  39.719  1.00 38.43 ? 157  PHE A N     1 
ATOM   956   C  CA    . PHE A  1 157 ? -22.418 31.837  38.558  1.00 38.86 ? 157  PHE A CA    1 
ATOM   957   C  C     . PHE A  1 157 ? -21.026 32.476  38.617  1.00 38.92 ? 157  PHE A C     1 
ATOM   958   O  O     . PHE A  1 157 ? -20.329 32.559  37.604  1.00 39.39 ? 157  PHE A O     1 
ATOM   959   C  CB    . PHE A  1 157 ? -23.151 32.156  37.245  1.00 38.87 ? 157  PHE A CB    1 
ATOM   960   C  CG    . PHE A  1 157 ? -24.566 31.660  37.221  1.00 39.56 ? 157  PHE A CG    1 
ATOM   961   C  CD1   . PHE A  1 157 ? -25.632 32.553  37.315  1.00 40.19 ? 157  PHE A CD1   1 
ATOM   962   C  CD2   . PHE A  1 157 ? -24.835 30.295  37.142  1.00 39.49 ? 157  PHE A CD2   1 
ATOM   963   C  CE1   . PHE A  1 157 ? -26.951 32.090  37.311  1.00 40.67 ? 157  PHE A CE1   1 
ATOM   964   C  CE2   . PHE A  1 157 ? -26.144 29.823  37.138  1.00 40.40 ? 157  PHE A CE2   1 
ATOM   965   C  CZ    . PHE A  1 157 ? -27.206 30.722  37.219  1.00 40.71 ? 157  PHE A CZ    1 
ATOM   966   N  N     . ARG A  1 158 ? -20.620 32.915  39.803  1.00 38.81 ? 158  ARG A N     1 
ATOM   967   C  CA    . ARG A  1 158 ? -19.234 33.303  40.049  1.00 38.79 ? 158  ARG A CA    1 
ATOM   968   C  C     . ARG A  1 158 ? -18.417 32.052  40.439  1.00 37.94 ? 158  ARG A C     1 
ATOM   969   O  O     . ARG A  1 158 ? -18.928 30.928  40.383  1.00 37.71 ? 158  ARG A O     1 
ATOM   970   C  CB    . ARG A  1 158 ? -19.173 34.398  41.125  1.00 39.13 ? 158  ARG A CB    1 
ATOM   971   C  CG    . ARG A  1 158 ? -19.687 35.745  40.623  1.00 41.98 ? 158  ARG A CG    1 
ATOM   972   C  CD    . ARG A  1 158 ? -19.705 36.857  41.649  1.00 47.08 ? 158  ARG A CD    1 
ATOM   973   N  NE    . ARG A  1 158 ? -18.752 37.918  41.310  1.00 51.88 ? 158  ARG A NE    1 
ATOM   974   C  CZ    . ARG A  1 158 ? -18.860 39.196  41.685  1.00 54.14 ? 158  ARG A CZ    1 
ATOM   975   N  NH1   . ARG A  1 158 ? -19.897 39.601  42.418  1.00 55.14 ? 158  ARG A NH1   1 
ATOM   976   N  NH2   . ARG A  1 158 ? -17.928 40.076  41.328  1.00 54.61 ? 158  ARG A NH2   1 
ATOM   977   N  N     . GLU A  1 159 ? -17.155 32.235  40.814  1.00 37.10 ? 159  GLU A N     1 
ATOM   978   C  CA    . GLU A  1 159 ? -16.312 31.107  41.201  1.00 36.42 ? 159  GLU A CA    1 
ATOM   979   C  C     . GLU A  1 159 ? -16.773 30.495  42.525  1.00 34.99 ? 159  GLU A C     1 
ATOM   980   O  O     . GLU A  1 159 ? -17.063 31.214  43.475  1.00 34.62 ? 159  GLU A O     1 
ATOM   981   C  CB    . GLU A  1 159 ? -14.859 31.539  41.316  1.00 36.92 ? 159  GLU A CB    1 
ATOM   982   C  CG    . GLU A  1 159 ? -14.127 31.596  39.989  1.00 40.83 ? 159  GLU A CG    1 
ATOM   983   C  CD    . GLU A  1 159 ? -12.616 31.483  40.145  1.00 45.35 ? 159  GLU A CD    1 
ATOM   984   O  OE1   . GLU A  1 159 ? -12.072 31.993  41.160  1.00 46.07 ? 159  GLU A OE1   1 
ATOM   985   O  OE2   . GLU A  1 159 ? -11.975 30.878  39.244  1.00 46.83 ? 159  GLU A OE2   1 
ATOM   986   N  N     . ALA A  1 160 ? -16.829 29.165  42.570  1.00 33.38 ? 160  ALA A N     1 
ATOM   987   C  CA    . ALA A  1 160 ? -17.300 28.431  43.737  1.00 32.13 ? 160  ALA A CA    1 
ATOM   988   C  C     . ALA A  1 160 ? -16.171 27.637  44.389  1.00 31.49 ? 160  ALA A C     1 
ATOM   989   O  O     . ALA A  1 160 ? -15.437 26.900  43.714  1.00 31.21 ? 160  ALA A O     1 
ATOM   990   C  CB    . ALA A  1 160 ? -18.434 27.498  43.353  1.00 32.01 ? 160  ALA A CB    1 
ATOM   991   N  N     . ALA A  1 161 ? -16.055 27.782  45.706  1.00 30.47 ? 161  ALA A N     1 
ATOM   992   C  CA    . ALA A  1 161 ? -15.057 27.071  46.490  1.00 29.78 ? 161  ALA A CA    1 
ATOM   993   C  C     . ALA A  1 161 ? -15.660 25.997  47.400  1.00 29.42 ? 161  ALA A C     1 
ATOM   994   O  O     . ALA A  1 161 ? -14.934 25.162  47.931  1.00 29.13 ? 161  ALA A O     1 
ATOM   995   C  CB    . ALA A  1 161 ? -14.272 28.054  47.311  1.00 29.75 ? 161  ALA A CB    1 
ATOM   996   N  N     . TYR A  1 162 ? -16.982 26.017  47.575  1.00 29.26 ? 162  TYR A N     1 
ATOM   997   C  CA    . TYR A  1 162 ? -17.646 25.181  48.580  1.00 29.27 ? 162  TYR A CA    1 
ATOM   998   C  C     . TYR A  1 162 ? -18.807 24.377  48.033  1.00 29.36 ? 162  TYR A C     1 
ATOM   999   O  O     . TYR A  1 162 ? -19.290 24.637  46.931  1.00 29.21 ? 162  TYR A O     1 
ATOM   1000  C  CB    . TYR A  1 162 ? -18.116 26.039  49.761  1.00 29.12 ? 162  TYR A CB    1 
ATOM   1001  C  CG    . TYR A  1 162 ? -17.142 27.118  50.130  1.00 29.29 ? 162  TYR A CG    1 
ATOM   1002  C  CD1   . TYR A  1 162 ? -17.431 28.454  49.871  1.00 29.63 ? 162  TYR A CD1   1 
ATOM   1003  C  CD2   . TYR A  1 162 ? -15.903 26.804  50.709  1.00 29.03 ? 162  TYR A CD2   1 
ATOM   1004  C  CE1   . TYR A  1 162 ? -16.521 29.460  50.198  1.00 30.29 ? 162  TYR A CE1   1 
ATOM   1005  C  CE2   . TYR A  1 162 ? -14.994 27.795  51.034  1.00 29.35 ? 162  TYR A CE2   1 
ATOM   1006  C  CZ    . TYR A  1 162 ? -15.307 29.120  50.771  1.00 30.12 ? 162  TYR A CZ    1 
ATOM   1007  O  OH    . TYR A  1 162 ? -14.422 30.110  51.099  1.00 30.63 ? 162  TYR A OH    1 
ATOM   1008  N  N     . THR A  1 163 ? -19.243 23.393  48.814  1.00 29.76 ? 163  THR A N     1 
ATOM   1009  C  CA    . THR A  1 163 ? -20.398 22.574  48.469  1.00 30.45 ? 163  THR A CA    1 
ATOM   1010  C  C     . THR A  1 163 ? -21.522 22.767  49.482  1.00 31.37 ? 163  THR A C     1 
ATOM   1011  O  O     . THR A  1 163 ? -21.320 22.593  50.679  1.00 31.42 ? 163  THR A O     1 
ATOM   1012  C  CB    . THR A  1 163 ? -19.999 21.089  48.408  1.00 30.52 ? 163  THR A CB    1 
ATOM   1013  O  OG1   . THR A  1 163 ? -18.836 20.928  47.576  1.00 29.53 ? 163  THR A OG1   1 
ATOM   1014  C  CG2   . THR A  1 163 ? -21.091 20.261  47.703  1.00 29.94 ? 163  THR A CG2   1 
ATOM   1015  N  N     . LYS A  1 164 ? -22.706 23.115  48.990  1.00 32.39 ? 164  LYS A N     1 
ATOM   1016  C  CA    . LYS A  1 164 ? -23.884 23.272  49.831  1.00 33.64 ? 164  LYS A CA    1 
ATOM   1017  C  C     . LYS A  1 164 ? -24.793 22.049  49.670  1.00 34.22 ? 164  LYS A C     1 
ATOM   1018  O  O     . LYS A  1 164 ? -25.046 21.606  48.550  1.00 34.10 ? 164  LYS A O     1 
ATOM   1019  C  CB    . LYS A  1 164 ? -24.604 24.586  49.472  1.00 33.84 ? 164  LYS A CB    1 
ATOM   1020  C  CG    . LYS A  1 164 ? -26.137 24.565  49.518  1.00 35.36 ? 164  LYS A CG    1 
ATOM   1021  C  CD    . LYS A  1 164 ? -26.700 25.834  50.164  1.00 37.92 ? 164  LYS A CD    1 
ATOM   1022  C  CE    . LYS A  1 164 ? -27.532 26.645  49.172  1.00 40.60 ? 164  LYS A CE    1 
ATOM   1023  N  NZ    . LYS A  1 164 ? -27.259 28.126  49.259  1.00 41.90 ? 164  LYS A NZ    1 
ATOM   1024  N  N     . ARG A  1 165 ? -25.261 21.491  50.786  1.00 35.24 ? 165  ARG A N     1 
ATOM   1025  C  CA    . ARG A  1 165 ? -26.272 20.422  50.734  1.00 36.48 ? 165  ARG A CA    1 
ATOM   1026  C  C     . ARG A  1 165 ? -27.657 21.037  50.595  1.00 37.46 ? 165  ARG A C     1 
ATOM   1027  O  O     . ARG A  1 165 ? -27.998 21.979  51.308  1.00 37.54 ? 165  ARG A O     1 
ATOM   1028  C  CB    . ARG A  1 165 ? -26.222 19.527  51.975  1.00 36.40 ? 165  ARG A CB    1 
ATOM   1029  C  CG    . ARG A  1 165 ? -27.371 18.510  52.078  1.00 36.08 ? 165  ARG A CG    1 
ATOM   1030  C  CD    . ARG A  1 165 ? -27.149 17.398  53.106  1.00 34.79 ? 165  ARG A CD    1 
ATOM   1031  N  NE    . ARG A  1 165 ? -25.984 16.582  52.764  1.00 34.16 ? 165  ARG A NE    1 
ATOM   1032  C  CZ    . ARG A  1 165 ? -25.298 15.842  53.619  1.00 33.23 ? 165  ARG A CZ    1 
ATOM   1033  N  NH1   . ARG A  1 165 ? -25.656 15.783  54.899  1.00 33.29 ? 165  ARG A NH1   1 
ATOM   1034  N  NH2   . ARG A  1 165 ? -24.251 15.149  53.186  1.00 32.47 ? 165  ARG A NH2   1 
ATOM   1035  N  N     . LEU A  1 166 ? -28.454 20.511  49.674  1.00 38.82 ? 166  LEU A N     1 
ATOM   1036  C  CA    . LEU A  1 166 ? -29.785 21.071  49.440  1.00 40.47 ? 166  LEU A CA    1 
ATOM   1037  C  C     . LEU A  1 166 ? -30.827 20.606  50.461  1.00 41.60 ? 166  LEU A C     1 
ATOM   1038  O  O     . LEU A  1 166 ? -31.637 21.407  50.922  1.00 41.78 ? 166  LEU A O     1 
ATOM   1039  C  CB    . LEU A  1 166 ? -30.257 20.812  48.004  1.00 40.35 ? 166  LEU A CB    1 
ATOM   1040  C  CG    . LEU A  1 166 ? -29.432 21.513  46.911  1.00 40.41 ? 166  LEU A CG    1 
ATOM   1041  C  CD1   . LEU A  1 166 ? -29.886 21.060  45.529  1.00 40.39 ? 166  LEU A CD1   1 
ATOM   1042  C  CD2   . LEU A  1 166 ? -29.493 23.045  47.036  1.00 39.92 ? 166  LEU A CD2   1 
ATOM   1043  N  N     . GLY A  1 167 ? -30.784 19.322  50.820  1.00 42.94 ? 167  GLY A N     1 
ATOM   1044  C  CA    . GLY A  1 167 ? -31.721 18.739  51.770  1.00 44.48 ? 167  GLY A CA    1 
ATOM   1045  C  C     . GLY A  1 167 ? -31.416 19.046  53.230  1.00 45.61 ? 167  GLY A C     1 
ATOM   1046  O  O     . GLY A  1 167 ? -30.639 19.959  53.535  1.00 45.75 ? 167  GLY A O     1 
ATOM   1047  N  N     . THR A  1 168 ? -32.025 18.270  54.129  1.00 46.46 ? 168  THR A N     1 
ATOM   1048  C  CA    . THR A  1 168 ? -31.940 18.514  55.572  1.00 47.31 ? 168  THR A CA    1 
ATOM   1049  C  C     . THR A  1 168 ? -31.177 17.427  56.327  1.00 47.66 ? 168  THR A C     1 
ATOM   1050  O  O     . THR A  1 168 ? -30.973 17.538  57.536  1.00 47.87 ? 168  THR A O     1 
ATOM   1051  C  CB    . THR A  1 168 ? -33.361 18.685  56.193  1.00 47.47 ? 168  THR A CB    1 
ATOM   1052  O  OG1   . THR A  1 168 ? -34.224 17.637  55.726  1.00 47.94 ? 168  THR A OG1   1 
ATOM   1053  C  CG2   . THR A  1 168 ? -34.035 19.972  55.694  1.00 47.09 ? 168  THR A CG2   1 
ATOM   1054  N  N     . GLU A  1 169 ? -30.765 16.381  55.610  1.00 48.10 ? 169  GLU A N     1 
ATOM   1055  C  CA    . GLU A  1 169 ? -29.960 15.288  56.161  1.00 48.56 ? 169  GLU A CA    1 
ATOM   1056  C  C     . GLU A  1 169 ? -28.723 15.816  56.893  1.00 48.55 ? 169  GLU A C     1 
ATOM   1057  O  O     . GLU A  1 169 ? -28.078 16.762  56.429  1.00 48.51 ? 169  GLU A O     1 
ATOM   1058  C  CB    . GLU A  1 169 ? -29.520 14.352  55.026  1.00 48.75 ? 169  GLU A CB    1 
ATOM   1059  C  CG    . GLU A  1 169 ? -30.648 13.834  54.137  1.00 50.31 ? 169  GLU A CG    1 
ATOM   1060  C  CD    . GLU A  1 169 ? -30.585 14.344  52.695  1.00 52.20 ? 169  GLU A CD    1 
ATOM   1061  O  OE1   . GLU A  1 169 ? -30.644 15.574  52.474  1.00 52.65 ? 169  GLU A OE1   1 
ATOM   1062  O  OE2   . GLU A  1 169 ? -30.498 13.509  51.768  1.00 52.49 ? 169  GLU A OE2   1 
ATOM   1063  N  N     . LYS A  1 170 ? -28.385 15.191  58.019  1.00 48.51 ? 170  LYS A N     1 
ATOM   1064  C  CA    . LYS A  1 170 ? -27.365 15.725  58.919  1.00 48.49 ? 170  LYS A CA    1 
ATOM   1065  C  C     . LYS A  1 170 ? -26.059 14.922  58.948  1.00 47.87 ? 170  LYS A C     1 
ATOM   1066  O  O     . LYS A  1 170 ? -25.009 15.447  59.337  1.00 47.80 ? 170  LYS A O     1 
ATOM   1067  C  CB    . LYS A  1 170 ? -27.954 15.866  60.325  1.00 49.11 ? 170  LYS A CB    1 
ATOM   1068  C  CG    . LYS A  1 170 ? -28.894 17.074  60.476  1.00 50.80 ? 170  LYS A CG    1 
ATOM   1069  C  CD    . LYS A  1 170 ? -30.329 16.630  60.776  1.00 53.47 ? 170  LYS A CD    1 
ATOM   1070  C  CE    . LYS A  1 170 ? -31.265 17.832  60.946  1.00 54.67 ? 170  LYS A CE    1 
ATOM   1071  N  NZ    . LYS A  1 170 ? -32.044 17.759  62.219  1.00 55.04 ? 170  LYS A NZ    1 
ATOM   1072  N  N     . GLU A  1 171 ? -26.130 13.655  58.543  1.00 47.04 ? 171  GLU A N     1 
ATOM   1073  C  CA    . GLU A  1 171 ? -24.946 12.800  58.478  1.00 46.48 ? 171  GLU A CA    1 
ATOM   1074  C  C     . GLU A  1 171 ? -23.993 13.282  57.380  1.00 45.51 ? 171  GLU A C     1 
ATOM   1075  O  O     . GLU A  1 171 ? -24.422 13.885  56.400  1.00 45.36 ? 171  GLU A O     1 
ATOM   1076  C  CB    . GLU A  1 171 ? -25.330 11.320  58.299  1.00 46.67 ? 171  GLU A CB    1 
ATOM   1077  C  CG    . GLU A  1 171 ? -26.081 10.992  57.017  1.00 48.30 ? 171  GLU A CG    1 
ATOM   1078  C  CD    . GLU A  1 171 ? -27.596 10.965  57.182  1.00 51.09 ? 171  GLU A CD    1 
ATOM   1079  O  OE1   . GLU A  1 171 ? -28.107 11.439  58.227  1.00 52.35 ? 171  GLU A OE1   1 
ATOM   1080  O  OE2   . GLU A  1 171 ? -28.284 10.473  56.253  1.00 51.26 ? 171  GLU A OE2   1 
ATOM   1081  N  N     . VAL A  1 172 ? -22.702 13.035  57.566  1.00 44.45 ? 172  VAL A N     1 
ATOM   1082  C  CA    . VAL A  1 172 ? -21.682 13.498  56.628  1.00 43.46 ? 172  VAL A CA    1 
ATOM   1083  C  C     . VAL A  1 172 ? -21.782 12.767  55.285  1.00 42.88 ? 172  VAL A C     1 
ATOM   1084  O  O     . VAL A  1 172 ? -21.921 13.405  54.246  1.00 42.60 ? 172  VAL A O     1 
ATOM   1085  C  CB    . VAL A  1 172 ? -20.261 13.412  57.231  1.00 43.45 ? 172  VAL A CB    1 
ATOM   1086  C  CG1   . VAL A  1 172 ? -19.202 13.780  56.199  1.00 43.30 ? 172  VAL A CG1   1 
ATOM   1087  C  CG2   . VAL A  1 172 ? -20.148 14.332  58.444  1.00 43.72 ? 172  VAL A CG2   1 
ATOM   1088  N  N     . GLU A  1 173 ? -21.742 11.436  55.310  1.00 42.21 ? 173  GLU A N     1 
ATOM   1089  C  CA    . GLU A  1 173 ? -21.818 10.660  54.076  1.00 41.76 ? 173  GLU A CA    1 
ATOM   1090  C  C     . GLU A  1 173 ? -23.241 10.525  53.531  1.00 41.29 ? 173  GLU A C     1 
ATOM   1091  O  O     . GLU A  1 173 ? -24.035 9.721   54.021  1.00 41.35 ? 173  GLU A O     1 
ATOM   1092  C  CB    . GLU A  1 173 ? -21.166 9.280   54.223  1.00 41.80 ? 173  GLU A CB    1 
ATOM   1093  C  CG    . GLU A  1 173 ? -21.219 8.464   52.934  1.00 42.75 ? 173  GLU A CG    1 
ATOM   1094  C  CD    . GLU A  1 173 ? -20.345 7.224   52.965  1.00 44.79 ? 173  GLU A CD    1 
ATOM   1095  O  OE1   . GLU A  1 173 ? -20.435 6.415   52.007  1.00 45.55 ? 173  GLU A OE1   1 
ATOM   1096  O  OE2   . GLU A  1 173 ? -19.572 7.057   53.938  1.00 45.41 ? 173  GLU A OE2   1 
ATOM   1097  N  N     . VAL A  1 174 ? -23.548 11.321  52.511  1.00 40.69 ? 174  VAL A N     1 
ATOM   1098  C  CA    . VAL A  1 174 ? -24.764 11.157  51.712  1.00 40.12 ? 174  VAL A CA    1 
ATOM   1099  C  C     . VAL A  1 174 ? -24.381 11.284  50.234  1.00 39.86 ? 174  VAL A C     1 
ATOM   1100  O  O     . VAL A  1 174 ? -24.038 12.376  49.756  1.00 39.77 ? 174  VAL A O     1 
ATOM   1101  C  CB    . VAL A  1 174 ? -25.906 12.165  52.087  1.00 40.26 ? 174  VAL A CB    1 
ATOM   1102  C  CG1   . VAL A  1 174 ? -27.195 11.814  51.372  1.00 39.83 ? 174  VAL A CG1   1 
ATOM   1103  C  CG2   . VAL A  1 174 ? -26.152 12.210  53.591  1.00 40.14 ? 174  VAL A CG2   1 
ATOM   1104  N  N     . ILE A  1 175 ? -24.416 10.148  49.534  1.00 39.48 ? 175  ILE A N     1 
ATOM   1105  C  CA    . ILE A  1 175 ? -24.045 10.062  48.120  1.00 39.29 ? 175  ILE A CA    1 
ATOM   1106  C  C     . ILE A  1 175 ? -25.086 10.767  47.260  1.00 39.11 ? 175  ILE A C     1 
ATOM   1107  O  O     . ILE A  1 175 ? -26.288 10.627  47.484  1.00 39.29 ? 175  ILE A O     1 
ATOM   1108  C  CB    . ILE A  1 175 ? -23.910 8.568   47.673  1.00 39.22 ? 175  ILE A CB    1 
ATOM   1109  C  CG1   . ILE A  1 175 ? -22.874 7.802   48.519  1.00 39.39 ? 175  ILE A CG1   1 
ATOM   1110  C  CG2   . ILE A  1 175 ? -23.595 8.458   46.176  1.00 39.26 ? 175  ILE A CG2   1 
ATOM   1111  C  CD1   . ILE A  1 175 ? -21.473 8.425   48.595  1.00 39.40 ? 175  ILE A CD1   1 
ATOM   1112  N  N     . GLY A  1 176 ? -24.622 11.528  46.276  1.00 38.85 ? 176  GLY A N     1 
ATOM   1113  C  CA    . GLY A  1 176 ? -25.514 12.256  45.389  1.00 38.45 ? 176  GLY A CA    1 
ATOM   1114  C  C     . GLY A  1 176 ? -24.778 13.230  44.489  1.00 38.25 ? 176  GLY A C     1 
ATOM   1115  O  O     . GLY A  1 176 ? -23.585 13.474  44.673  1.00 38.37 ? 176  GLY A O     1 
ATOM   1116  N  N     . GLY A  1 177 ? -25.498 13.782  43.515  1.00 38.02 ? 177  GLY A N     1 
ATOM   1117  C  CA    . GLY A  1 177 ? -24.946 14.726  42.558  1.00 37.58 ? 177  GLY A CA    1 
ATOM   1118  C  C     . GLY A  1 177 ? -25.625 16.081  42.677  1.00 37.69 ? 177  GLY A C     1 
ATOM   1119  O  O     . GLY A  1 177 ? -25.947 16.530  43.783  1.00 37.34 ? 177  GLY A O     1 
ATOM   1120  N  N     . ALA A  1 178 ? -25.854 16.725  41.536  1.00 37.90 ? 178  ALA A N     1 
ATOM   1121  C  CA    . ALA A  1 178 ? -26.462 18.063  41.493  1.00 38.45 ? 178  ALA A CA    1 
ATOM   1122  C  C     . ALA A  1 178 ? -27.907 18.089  42.005  1.00 38.78 ? 178  ALA A C     1 
ATOM   1123  O  O     . ALA A  1 178 ? -28.461 19.160  42.269  1.00 38.95 ? 178  ALA A O     1 
ATOM   1124  C  CB    . ALA A  1 178 ? -26.387 18.651  40.084  1.00 38.32 ? 178  ALA A CB    1 
ATOM   1125  N  N     . ASP A  1 179 ? -28.505 16.907  42.133  1.00 39.18 ? 179  ASP A N     1 
ATOM   1126  C  CA    . ASP A  1 179 ? -29.816 16.746  42.759  1.00 39.59 ? 179  ASP A CA    1 
ATOM   1127  C  C     . ASP A  1 179 ? -29.765 17.034  44.264  1.00 39.12 ? 179  ASP A C     1 
ATOM   1128  O  O     . ASP A  1 179 ? -30.738 17.540  44.828  1.00 39.46 ? 179  ASP A O     1 
ATOM   1129  C  CB    . ASP A  1 179 ? -30.378 15.336  42.507  1.00 40.11 ? 179  ASP A CB    1 
ATOM   1130  C  CG    . ASP A  1 179 ? -29.285 14.256  42.454  1.00 42.27 ? 179  ASP A CG    1 
ATOM   1131  O  OD1   . ASP A  1 179 ? -28.418 14.314  41.548  1.00 44.05 ? 179  ASP A OD1   1 
ATOM   1132  O  OD2   . ASP A  1 179 ? -29.215 13.301  43.267  1.00 44.40 ? 179  ASP A OD2   1 
ATOM   1133  N  N     . LYS A  1 180 ? -28.635 16.724  44.909  1.00 38.13 ? 180  LYS A N     1 
ATOM   1134  C  CA    . LYS A  1 180 ? -28.515 16.871  46.364  1.00 36.91 ? 180  LYS A CA    1 
ATOM   1135  C  C     . LYS A  1 180 ? -27.562 17.973  46.813  1.00 35.64 ? 180  LYS A C     1 
ATOM   1136  O  O     . LYS A  1 180 ? -27.586 18.369  47.980  1.00 35.58 ? 180  LYS A O     1 
ATOM   1137  C  CB    . LYS A  1 180 ? -28.149 15.537  47.040  1.00 37.31 ? 180  LYS A CB    1 
ATOM   1138  C  CG    . LYS A  1 180 ? -28.785 14.292  46.396  1.00 38.85 ? 180  LYS A CG    1 
ATOM   1139  C  CD    . LYS A  1 180 ? -30.002 13.778  47.162  1.00 42.02 ? 180  LYS A CD    1 
ATOM   1140  C  CE    . LYS A  1 180 ? -29.693 12.507  47.969  1.00 44.21 ? 180  LYS A CE    1 
ATOM   1141  N  NZ    . LYS A  1 180 ? -29.199 11.344  47.155  1.00 45.59 ? 180  LYS A NZ    1 
ATOM   1142  N  N     . TYR A  1 181 ? -26.750 18.484  45.887  1.00 34.04 ? 181  TYR A N     1 
ATOM   1143  C  CA    . TYR A  1 181 ? -25.696 19.435  46.214  1.00 32.40 ? 181  TYR A CA    1 
ATOM   1144  C  C     . TYR A  1 181 ? -25.551 20.526  45.160  1.00 32.06 ? 181  TYR A C     1 
ATOM   1145  O  O     . TYR A  1 181 ? -25.758 20.282  43.974  1.00 31.77 ? 181  TYR A O     1 
ATOM   1146  C  CB    . TYR A  1 181 ? -24.358 18.715  46.311  1.00 31.96 ? 181  TYR A CB    1 
ATOM   1147  C  CG    . TYR A  1 181 ? -24.247 17.696  47.407  1.00 30.16 ? 181  TYR A CG    1 
ATOM   1148  C  CD1   . TYR A  1 181 ? -24.407 16.342  47.134  1.00 28.37 ? 181  TYR A CD1   1 
ATOM   1149  C  CD2   . TYR A  1 181 ? -23.948 18.080  48.719  1.00 28.74 ? 181  TYR A CD2   1 
ATOM   1150  C  CE1   . TYR A  1 181 ? -24.289 15.391  48.142  1.00 28.39 ? 181  TYR A CE1   1 
ATOM   1151  C  CE2   . TYR A  1 181 ? -23.825 17.133  49.737  1.00 28.04 ? 181  TYR A CE2   1 
ATOM   1152  C  CZ    . TYR A  1 181 ? -23.997 15.791  49.440  1.00 28.01 ? 181  TYR A CZ    1 
ATOM   1153  O  OH    . TYR A  1 181 ? -23.879 14.844  50.428  1.00 28.48 ? 181  TYR A OH    1 
ATOM   1154  N  N     . HIS A  1 182 ? -25.167 21.719  45.600  1.00 31.44 ? 182  HIS A N     1 
ATOM   1155  C  CA    . HIS A  1 182 ? -24.766 22.793  44.697  1.00 31.29 ? 182  HIS A CA    1 
ATOM   1156  C  C     . HIS A  1 182 ? -23.346 23.214  45.047  1.00 30.81 ? 182  HIS A C     1 
ATOM   1157  O  O     . HIS A  1 182 ? -23.016 23.340  46.228  1.00 30.79 ? 182  HIS A O     1 
ATOM   1158  C  CB    . HIS A  1 182 ? -25.668 24.025  44.857  1.00 31.38 ? 182  HIS A CB    1 
ATOM   1159  C  CG    . HIS A  1 182 ? -26.962 23.955  44.106  1.00 32.63 ? 182  HIS A CG    1 
ATOM   1160  N  ND1   . HIS A  1 182 ? -27.318 22.882  43.316  1.00 33.03 ? 182  HIS A ND1   1 
ATOM   1161  C  CD2   . HIS A  1 182 ? -27.994 24.834  44.035  1.00 32.82 ? 182  HIS A CD2   1 
ATOM   1162  C  CE1   . HIS A  1 182 ? -28.508 23.105  42.784  1.00 33.91 ? 182  HIS A CE1   1 
ATOM   1163  N  NE2   . HIS A  1 182 ? -28.939 24.284  43.203  1.00 33.39 ? 182  HIS A NE2   1 
ATOM   1164  N  N     . SER A  1 183 ? -22.509 23.417  44.034  1.00 30.12 ? 183  SER A N     1 
ATOM   1165  C  CA    . SER A  1 183 ? -21.262 24.146  44.235  1.00 29.76 ? 183  SER A CA    1 
ATOM   1166  C  C     . SER A  1 183 ? -21.617 25.614  44.392  1.00 29.27 ? 183  SER A C     1 
ATOM   1167  O  O     . SER A  1 183 ? -22.461 26.137  43.679  1.00 29.02 ? 183  SER A O     1 
ATOM   1168  C  CB    . SER A  1 183 ? -20.286 23.947  43.079  1.00 29.74 ? 183  SER A CB    1 
ATOM   1169  O  OG    . SER A  1 183 ? -20.855 24.329  41.837  1.00 29.99 ? 183  SER A OG    1 
ATOM   1170  N  N     . VAL A  1 184 ? -20.954 26.284  45.318  1.00 29.23 ? 184  VAL A N     1 
ATOM   1171  C  CA    . VAL A  1 184 ? -21.413 27.584  45.754  1.00 29.19 ? 184  VAL A CA    1 
ATOM   1172  C  C     . VAL A  1 184 ? -20.261 28.492  46.218  1.00 29.45 ? 184  VAL A C     1 
ATOM   1173  O  O     . VAL A  1 184 ? -19.243 28.008  46.716  1.00 29.31 ? 184  VAL A O     1 
ATOM   1174  C  CB    . VAL A  1 184 ? -22.509 27.339  46.837  1.00 29.49 ? 184  VAL A CB    1 
ATOM   1175  C  CG1   . VAL A  1 184 ? -22.101 27.810  48.202  1.00 29.49 ? 184  VAL A CG1   1 
ATOM   1176  C  CG2   . VAL A  1 184 ? -23.871 27.847  46.388  1.00 28.79 ? 184  VAL A CG2   1 
ATOM   1177  N  N     . CYS A  1 185 ? -20.403 29.803  46.024  1.00 29.64 ? 185  CYS A N     1 
ATOM   1178  C  CA    . CYS A  1 185 ? -19.433 30.761  46.555  1.00 29.99 ? 185  CYS A CA    1 
ATOM   1179  C  C     . CYS A  1 185 ? -19.731 31.045  48.035  1.00 30.36 ? 185  CYS A C     1 
ATOM   1180  O  O     . CYS A  1 185 ? -20.700 30.526  48.593  1.00 30.21 ? 185  CYS A O     1 
ATOM   1181  C  CB    . CYS A  1 185 ? -19.465 32.071  45.769  1.00 30.01 ? 185  CYS A CB    1 
ATOM   1182  S  SG    . CYS A  1 185 ? -20.995 33.002  46.049  1.00 29.38 ? 185  CYS A SG    1 
ATOM   1183  N  N     . ARG A  1 186 ? -18.905 31.882  48.658  1.00 30.65 ? 186  ARG A N     1 
ATOM   1184  C  CA    . ARG A  1 186 ? -19.075 32.233  50.064  1.00 31.39 ? 186  ARG A CA    1 
ATOM   1185  C  C     . ARG A  1 186 ? -20.447 32.860  50.364  1.00 32.16 ? 186  ARG A C     1 
ATOM   1186  O  O     . ARG A  1 186 ? -21.129 32.450  51.305  1.00 32.25 ? 186  ARG A O     1 
ATOM   1187  C  CB    . ARG A  1 186 ? -17.949 33.156  50.530  1.00 31.01 ? 186  ARG A CB    1 
ATOM   1188  C  CG    . ARG A  1 186 ? -18.027 33.545  52.004  1.00 31.22 ? 186  ARG A CG    1 
ATOM   1189  C  CD    . ARG A  1 186 ? -16.903 34.460  52.454  1.00 30.61 ? 186  ARG A CD    1 
ATOM   1190  N  NE    . ARG A  1 186 ? -15.622 33.760  52.408  1.00 31.20 ? 186  ARG A NE    1 
ATOM   1191  C  CZ    . ARG A  1 186 ? -15.130 33.033  53.401  1.00 30.33 ? 186  ARG A CZ    1 
ATOM   1192  N  NH1   . ARG A  1 186 ? -15.806 32.919  54.544  1.00 30.95 ? 186  ARG A NH1   1 
ATOM   1193  N  NH2   . ARG A  1 186 ? -13.951 32.434  53.264  1.00 29.17 ? 186  ARG A NH2   1 
ATOM   1194  N  N     . LEU A  1 187 ? -20.841 33.842  49.557  1.00 33.11 ? 187  LEU A N     1 
ATOM   1195  C  CA    . LEU A  1 187 ? -22.094 34.567  49.764  1.00 34.03 ? 187  LEU A CA    1 
ATOM   1196  C  C     . LEU A  1 187 ? -23.313 33.671  49.619  1.00 34.32 ? 187  LEU A C     1 
ATOM   1197  O  O     . LEU A  1 187 ? -24.215 33.707  50.457  1.00 34.67 ? 187  LEU A O     1 
ATOM   1198  C  CB    . LEU A  1 187 ? -22.182 35.776  48.821  1.00 34.18 ? 187  LEU A CB    1 
ATOM   1199  C  CG    . LEU A  1 187 ? -21.157 36.909  49.033  1.00 35.18 ? 187  LEU A CG    1 
ATOM   1200  C  CD1   . LEU A  1 187 ? -21.552 38.169  48.264  1.00 36.29 ? 187  LEU A CD1   1 
ATOM   1201  C  CD2   . LEU A  1 187 ? -20.943 37.244  50.514  1.00 36.05 ? 187  LEU A CD2   1 
ATOM   1202  N  N     . CYS A  1 188 ? -23.331 32.853  48.570  1.00 34.57 ? 188  CYS A N     1 
ATOM   1203  C  CA    . CYS A  1 188 ? -24.453 31.962  48.330  1.00 34.84 ? 188  CYS A CA    1 
ATOM   1204  C  C     . CYS A  1 188 ? -24.516 30.817  49.344  1.00 35.02 ? 188  CYS A C     1 
ATOM   1205  O  O     . CYS A  1 188 ? -25.607 30.333  49.662  1.00 35.11 ? 188  CYS A O     1 
ATOM   1206  C  CB    . CYS A  1 188 ? -24.440 31.468  46.890  1.00 34.63 ? 188  CYS A CB    1 
ATOM   1207  S  SG    . CYS A  1 188 ? -24.681 32.833  45.722  1.00 36.29 ? 188  CYS A SG    1 
ATOM   1208  N  N     . TYR A  1 189 ? -23.359 30.409  49.870  1.00 35.22 ? 189  TYR A N     1 
ATOM   1209  C  CA    . TYR A  1 189 ? -23.311 29.417  50.945  1.00 35.50 ? 189  TYR A CA    1 
ATOM   1210  C  C     . TYR A  1 189 ? -24.143 29.828  52.157  1.00 36.60 ? 189  TYR A C     1 
ATOM   1211  O  O     . TYR A  1 189 ? -24.826 28.998  52.755  1.00 36.34 ? 189  TYR A O     1 
ATOM   1212  C  CB    . TYR A  1 189 ? -21.873 29.130  51.408  1.00 35.05 ? 189  TYR A CB    1 
ATOM   1213  C  CG    . TYR A  1 189 ? -21.808 27.997  52.419  1.00 33.09 ? 189  TYR A CG    1 
ATOM   1214  C  CD1   . TYR A  1 189 ? -21.805 26.668  52.001  1.00 30.95 ? 189  TYR A CD1   1 
ATOM   1215  C  CD2   . TYR A  1 189 ? -21.792 28.255  53.792  1.00 31.24 ? 189  TYR A CD2   1 
ATOM   1216  C  CE1   . TYR A  1 189 ? -21.768 25.631  52.914  1.00 30.50 ? 189  TYR A CE1   1 
ATOM   1217  C  CE2   . TYR A  1 189 ? -21.760 27.220  54.714  1.00 30.22 ? 189  TYR A CE2   1 
ATOM   1218  C  CZ    . TYR A  1 189 ? -21.747 25.912  54.268  1.00 30.40 ? 189  TYR A CZ    1 
ATOM   1219  O  OH    . TYR A  1 189 ? -21.701 24.872  55.167  1.00 30.49 ? 189  TYR A OH    1 
ATOM   1220  N  N     . PHE A  1 190 ? -24.065 31.106  52.512  1.00 38.14 ? 190  PHE A N     1 
ATOM   1221  C  CA    . PHE A  1 190 ? -24.701 31.629  53.718  1.00 39.94 ? 190  PHE A CA    1 
ATOM   1222  C  C     . PHE A  1 190 ? -26.096 32.233  53.479  1.00 41.31 ? 190  PHE A C     1 
ATOM   1223  O  O     . PHE A  1 190 ? -26.744 32.686  54.424  1.00 41.76 ? 190  PHE A O     1 
ATOM   1224  C  CB    . PHE A  1 190 ? -23.783 32.664  54.386  1.00 39.63 ? 190  PHE A CB    1 
ATOM   1225  C  CG    . PHE A  1 190 ? -22.626 32.057  55.135  1.00 38.95 ? 190  PHE A CG    1 
ATOM   1226  C  CD1   . PHE A  1 190 ? -21.317 32.307  54.736  1.00 37.13 ? 190  PHE A CD1   1 
ATOM   1227  C  CD2   . PHE A  1 190 ? -22.848 31.230  56.241  1.00 38.34 ? 190  PHE A CD2   1 
ATOM   1228  C  CE1   . PHE A  1 190 ? -20.238 31.748  55.425  1.00 37.39 ? 190  PHE A CE1   1 
ATOM   1229  C  CE2   . PHE A  1 190 ? -21.777 30.653  56.940  1.00 38.19 ? 190  PHE A CE2   1 
ATOM   1230  C  CZ    . PHE A  1 190 ? -20.467 30.916  56.534  1.00 37.82 ? 190  PHE A CZ    1 
ATOM   1231  N  N     . LYS A  1 191 ? -26.553 32.226  52.230  1.00 42.91 ? 191  LYS A N     1 
ATOM   1232  C  CA    . LYS A  1 191 ? -27.833 32.852  51.867  1.00 44.45 ? 191  LYS A CA    1 
ATOM   1233  C  C     . LYS A  1 191 ? -29.036 32.122  52.464  1.00 45.07 ? 191  LYS A C     1 
ATOM   1234  O  O     . LYS A  1 191 ? -29.165 30.898  52.326  1.00 45.77 ? 191  LYS A O     1 
ATOM   1235  C  CB    . LYS A  1 191 ? -27.982 32.946  50.349  1.00 44.51 ? 191  LYS A CB    1 
ATOM   1236  C  CG    . LYS A  1 191 ? -27.483 34.258  49.778  1.00 46.16 ? 191  LYS A CG    1 
ATOM   1237  C  CD    . LYS A  1 191 ? -28.121 34.565  48.434  1.00 48.96 ? 191  LYS A CD    1 
ATOM   1238  C  CE    . LYS A  1 191 ? -28.064 36.065  48.141  1.00 50.87 ? 191  LYS A CE    1 
ATOM   1239  N  NZ    . LYS A  1 191 ? -28.698 36.429  46.827  1.00 51.86 ? 191  LYS A NZ    1 
ATOM   1240  N  N     . ARG B  1 18  ? -19.296 39.892  30.332  1.00 43.66 ? 18   ARG B N     1 
ATOM   1241  C  CA    . ARG B  1 18  ? -17.858 39.716  30.737  1.00 43.48 ? 18   ARG B CA    1 
ATOM   1242  C  C     . ARG B  1 18  ? -17.155 38.527  30.055  1.00 42.25 ? 18   ARG B C     1 
ATOM   1243  O  O     . ARG B  1 18  ? -17.104 37.406  30.579  1.00 42.44 ? 18   ARG B O     1 
ATOM   1244  C  CB    . ARG B  1 18  ? -17.713 39.641  32.256  1.00 44.18 ? 18   ARG B CB    1 
ATOM   1245  C  CG    . ARG B  1 18  ? -17.351 40.977  32.878  1.00 46.64 ? 18   ARG B CG    1 
ATOM   1246  C  CD    . ARG B  1 18  ? -16.561 40.886  34.184  1.00 50.68 ? 18   ARG B CD    1 
ATOM   1247  N  NE    . ARG B  1 18  ? -15.741 42.081  34.387  1.00 54.41 ? 18   ARG B NE    1 
ATOM   1248  C  CZ    . ARG B  1 18  ? -16.223 43.296  34.670  1.00 56.68 ? 18   ARG B CZ    1 
ATOM   1249  N  NH1   . ARG B  1 18  ? -17.535 43.495  34.804  1.00 57.15 ? 18   ARG B NH1   1 
ATOM   1250  N  NH2   . ARG B  1 18  ? -15.387 44.318  34.825  1.00 56.97 ? 18   ARG B NH2   1 
ATOM   1251  N  N     . GLY B  1 19  ? -16.607 38.805  28.878  1.00 40.51 ? 19   GLY B N     1 
ATOM   1252  C  CA    . GLY B  1 19  ? -15.904 37.822  28.083  1.00 38.08 ? 19   GLY B CA    1 
ATOM   1253  C  C     . GLY B  1 19  ? -14.477 37.619  28.522  1.00 36.43 ? 19   GLY B C     1 
ATOM   1254  O  O     . GLY B  1 19  ? -13.965 38.375  29.342  1.00 36.29 ? 19   GLY B O     1 
ATOM   1255  N  N     . GLN B  1 20  ? -13.831 36.609  27.938  1.00 34.83 ? 20   GLN B N     1 
ATOM   1256  C  CA    . GLN B  1 20  ? -12.606 36.035  28.476  1.00 33.31 ? 20   GLN B CA    1 
ATOM   1257  C  C     . GLN B  1 20  ? -11.954 35.089  27.473  1.00 31.68 ? 20   GLN B C     1 
ATOM   1258  O  O     . GLN B  1 20  ? -12.652 34.361  26.776  1.00 31.24 ? 20   GLN B O     1 
ATOM   1259  C  CB    . GLN B  1 20  ? -12.981 35.213  29.709  1.00 33.37 ? 20   GLN B CB    1 
ATOM   1260  C  CG    . GLN B  1 20  ? -12.113 35.428  30.899  1.00 34.98 ? 20   GLN B CG    1 
ATOM   1261  C  CD    . GLN B  1 20  ? -12.113 34.225  31.818  1.00 37.07 ? 20   GLN B CD    1 
ATOM   1262  O  OE1   . GLN B  1 20  ? -13.169 33.770  32.245  1.00 38.35 ? 20   GLN B OE1   1 
ATOM   1263  N  NE2   . GLN B  1 20  ? -10.928 33.706  32.123  1.00 38.54 ? 20   GLN B NE2   1 
ATOM   1264  N  N     . ILE B  1 21  ? -10.626 35.089  27.419  1.00 30.00 ? 21   ILE B N     1 
ATOM   1265  C  CA    . ILE B  1 21  ? -9.874  34.066  26.684  1.00 28.39 ? 21   ILE B CA    1 
ATOM   1266  C  C     . ILE B  1 21  ? -8.937  33.334  27.635  1.00 27.88 ? 21   ILE B C     1 
ATOM   1267  O  O     . ILE B  1 21  ? -8.114  33.950  28.313  1.00 27.46 ? 21   ILE B O     1 
ATOM   1268  C  CB    . ILE B  1 21  ? -9.057  34.666  25.500  1.00 28.46 ? 21   ILE B CB    1 
ATOM   1269  C  CG1   . ILE B  1 21  ? -9.969  35.370  24.488  1.00 27.15 ? 21   ILE B CG1   1 
ATOM   1270  C  CG2   . ILE B  1 21  ? -8.191  33.579  24.812  1.00 27.60 ? 21   ILE B CG2   1 
ATOM   1271  C  CD1   . ILE B  1 21  ? -9.224  36.201  23.479  1.00 26.09 ? 21   ILE B CD1   1 
ATOM   1272  N  N     . GLN B  1 22  ? -9.076  32.015  27.683  1.00 27.18 ? 22   GLN B N     1 
ATOM   1273  C  CA    . GLN B  1 22  ? -8.162  31.171  28.439  1.00 26.78 ? 22   GLN B CA    1 
ATOM   1274  C  C     . GLN B  1 22  ? -7.411  30.276  27.463  1.00 26.32 ? 22   GLN B C     1 
ATOM   1275  O  O     . GLN B  1 22  ? -8.006  29.715  26.539  1.00 26.40 ? 22   GLN B O     1 
ATOM   1276  C  CB    . GLN B  1 22  ? -8.920  30.319  29.446  1.00 26.68 ? 22   GLN B CB    1 
ATOM   1277  C  CG    . GLN B  1 22  ? -9.796  31.116  30.382  1.00 27.60 ? 22   GLN B CG    1 
ATOM   1278  C  CD    . GLN B  1 22  ? -10.624 30.238  31.301  1.00 29.75 ? 22   GLN B CD    1 
ATOM   1279  O  OE1   . GLN B  1 22  ? -10.434 29.014  31.358  1.00 30.27 ? 22   GLN B OE1   1 
ATOM   1280  N  NE2   . GLN B  1 22  ? -11.545 30.861  32.035  1.00 31.13 ? 22   GLN B NE2   1 
ATOM   1281  N  N     . VAL B  1 23  ? -6.105  30.153  27.670  1.00 25.62 ? 23   VAL B N     1 
ATOM   1282  C  CA    . VAL B  1 23  ? -5.256  29.381  26.779  1.00 24.91 ? 23   VAL B CA    1 
ATOM   1283  C  C     . VAL B  1 23  ? -4.543  28.273  27.555  1.00 24.78 ? 23   VAL B C     1 
ATOM   1284  O  O     . VAL B  1 23  ? -3.917  28.530  28.597  1.00 24.68 ? 23   VAL B O     1 
ATOM   1285  C  CB    . VAL B  1 23  ? -4.226  30.284  26.059  1.00 25.11 ? 23   VAL B CB    1 
ATOM   1286  C  CG1   . VAL B  1 23  ? -3.400  29.471  25.072  1.00 24.68 ? 23   VAL B CG1   1 
ATOM   1287  C  CG2   . VAL B  1 23  ? -4.925  31.439  25.342  1.00 24.46 ? 23   VAL B CG2   1 
ATOM   1288  N  N     . ILE B  1 24  ? -4.689  27.045  27.054  1.00 24.14 ? 24   ILE B N     1 
ATOM   1289  C  CA    . ILE B  1 24  ? -4.057  25.862  27.612  1.00 23.71 ? 24   ILE B CA    1 
ATOM   1290  C  C     . ILE B  1 24  ? -3.015  25.374  26.606  1.00 23.82 ? 24   ILE B C     1 
ATOM   1291  O  O     . ILE B  1 24  ? -3.353  24.887  25.530  1.00 23.80 ? 24   ILE B O     1 
ATOM   1292  C  CB    . ILE B  1 24  ? -5.104  24.741  27.898  1.00 23.73 ? 24   ILE B CB    1 
ATOM   1293  C  CG1   . ILE B  1 24  ? -6.303  25.274  28.691  1.00 23.34 ? 24   ILE B CG1   1 
ATOM   1294  C  CG2   . ILE B  1 24  ? -4.467  23.561  28.621  1.00 22.20 ? 24   ILE B CG2   1 
ATOM   1295  C  CD1   . ILE B  1 24  ? -7.528  24.356  28.628  1.00 20.96 ? 24   ILE B CD1   1 
ATOM   1296  N  N     . LEU B  1 25  ? -1.750  25.535  26.970  1.00 23.82 ? 25   LEU B N     1 
ATOM   1297  C  CA    . LEU B  1 25  ? -0.626  25.155  26.129  1.00 23.67 ? 25   LEU B CA    1 
ATOM   1298  C  C     . LEU B  1 25  ? 0.052   23.917  26.698  1.00 23.63 ? 25   LEU B C     1 
ATOM   1299  O  O     . LEU B  1 25  ? -0.241  23.493  27.812  1.00 23.58 ? 25   LEU B O     1 
ATOM   1300  C  CB    . LEU B  1 25  ? 0.365   26.311  26.030  1.00 23.78 ? 25   LEU B CB    1 
ATOM   1301  C  CG    . LEU B  1 25  ? -0.129  27.608  25.367  1.00 24.34 ? 25   LEU B CG    1 
ATOM   1302  C  CD1   . LEU B  1 25  ? 0.962   28.683  25.424  1.00 24.65 ? 25   LEU B CD1   1 
ATOM   1303  C  CD2   . LEU B  1 25  ? -0.585  27.389  23.921  1.00 23.29 ? 25   LEU B CD2   1 
ATOM   1304  N  N     . GLY B  1 26  ? 0.943   23.330  25.914  1.00 23.71 ? 26   GLY B N     1 
ATOM   1305  C  CA    . GLY B  1 26  ? 1.695   22.166  26.317  1.00 23.69 ? 26   GLY B CA    1 
ATOM   1306  C  C     . GLY B  1 26  ? 2.174   21.403  25.085  1.00 23.90 ? 26   GLY B C     1 
ATOM   1307  O  O     . GLY B  1 26  ? 1.720   21.672  23.975  1.00 23.71 ? 26   GLY B O     1 
ATOM   1308  N  N     . PRO B  1 27  ? 3.074   20.440  25.277  1.00 23.69 ? 27   PRO B N     1 
ATOM   1309  C  CA    . PRO B  1 27  ? 3.466   19.548  24.190  1.00 23.88 ? 27   PRO B CA    1 
ATOM   1310  C  C     . PRO B  1 27  ? 2.362   18.498  23.981  1.00 24.24 ? 27   PRO B C     1 
ATOM   1311  O  O     . PRO B  1 27  ? 1.318   18.548  24.656  1.00 24.27 ? 27   PRO B O     1 
ATOM   1312  C  CB    . PRO B  1 27  ? 4.750   18.912  24.715  1.00 23.65 ? 27   PRO B CB    1 
ATOM   1313  C  CG    . PRO B  1 27  ? 4.592   18.930  26.198  1.00 24.06 ? 27   PRO B CG    1 
ATOM   1314  C  CD    . PRO B  1 27  ? 3.746   20.105  26.543  1.00 23.27 ? 27   PRO B CD    1 
ATOM   1315  N  N     . MET B  1 28  ? 2.580   17.571  23.054  1.00 24.20 ? 28   MET B N     1 
ATOM   1316  C  CA    . MET B  1 28  ? 1.649   16.461  22.868  1.00 24.20 ? 28   MET B CA    1 
ATOM   1317  C  C     . MET B  1 28  ? 1.648   15.578  24.118  1.00 24.41 ? 28   MET B C     1 
ATOM   1318  O  O     . MET B  1 28  ? 2.628   15.576  24.881  1.00 24.50 ? 28   MET B O     1 
ATOM   1319  C  CB    . MET B  1 28  ? 2.033   15.652  21.622  1.00 24.29 ? 28   MET B CB    1 
ATOM   1320  C  CG    . MET B  1 28  ? 1.706   16.368  20.289  1.00 24.71 ? 28   MET B CG    1 
ATOM   1321  S  SD    . MET B  1 28  ? 2.076   15.388  18.831  1.00 24.69 ? 28   MET B SD    1 
ATOM   1322  C  CE    . MET B  1 28  ? 0.908   13.995  19.062  1.00 24.14 ? 28   MET B CE    1 
ATOM   1323  N  N     . PHE B  1 29  ? 0.545   14.855  24.329  1.00 24.28 ? 29   PHE B N     1 
ATOM   1324  C  CA    . PHE B  1 29  ? 0.405   13.876  25.415  1.00 24.24 ? 29   PHE B CA    1 
ATOM   1325  C  C     . PHE B  1 29  ? 0.393   14.481  26.822  1.00 24.03 ? 29   PHE B C     1 
ATOM   1326  O  O     . PHE B  1 29  ? 0.628   13.771  27.802  1.00 24.07 ? 29   PHE B O     1 
ATOM   1327  C  CB    . PHE B  1 29  ? 1.468   12.753  25.321  1.00 24.63 ? 29   PHE B CB    1 
ATOM   1328  C  CG    . PHE B  1 29  ? 1.784   12.313  23.909  1.00 24.93 ? 29   PHE B CG    1 
ATOM   1329  C  CD1   . PHE B  1 29  ? 3.008   12.642  23.327  1.00 25.26 ? 29   PHE B CD1   1 
ATOM   1330  C  CD2   . PHE B  1 29  ? 0.866   11.569  23.171  1.00 25.61 ? 29   PHE B CD2   1 
ATOM   1331  C  CE1   . PHE B  1 29  ? 3.324   12.241  22.017  1.00 25.46 ? 29   PHE B CE1   1 
ATOM   1332  C  CE2   . PHE B  1 29  ? 1.160   11.159  21.848  1.00 26.68 ? 29   PHE B CE2   1 
ATOM   1333  C  CZ    . PHE B  1 29  ? 2.395   11.501  21.271  1.00 26.04 ? 29   PHE B CZ    1 
ATOM   1334  N  N     . SER B  1 30  ? 0.117   15.785  26.919  1.00 23.59 ? 30   SER B N     1 
ATOM   1335  C  CA    . SER B  1 30  ? 0.042   16.461  28.211  1.00 23.40 ? 30   SER B CA    1 
ATOM   1336  C  C     . SER B  1 30  ? -1.392  16.601  28.754  1.00 23.33 ? 30   SER B C     1 
ATOM   1337  O  O     . SER B  1 30  ? -1.597  17.107  29.854  1.00 23.55 ? 30   SER B O     1 
ATOM   1338  C  CB    . SER B  1 30  ? 0.725   17.825  28.145  1.00 23.30 ? 30   SER B CB    1 
ATOM   1339  O  OG    . SER B  1 30  ? 0.106   18.666  27.185  1.00 23.85 ? 30   SER B OG    1 
ATOM   1340  N  N     . GLY B  1 31  ? -2.365  16.142  27.983  1.00 23.07 ? 31   GLY B N     1 
ATOM   1341  C  CA    . GLY B  1 31  ? -3.761  16.199  28.380  1.00 23.34 ? 31   GLY B CA    1 
ATOM   1342  C  C     . GLY B  1 31  ? -4.460  17.536  28.183  1.00 23.47 ? 31   GLY B C     1 
ATOM   1343  O  O     . GLY B  1 31  ? -5.379  17.865  28.932  1.00 23.79 ? 31   GLY B O     1 
ATOM   1344  N  N     . LYS B  1 32  ? -4.042  18.295  27.177  1.00 23.39 ? 32   LYS B N     1 
ATOM   1345  C  CA    . LYS B  1 32  ? -4.619  19.610  26.896  1.00 23.70 ? 32   LYS B CA    1 
ATOM   1346  C  C     . LYS B  1 32  ? -6.133  19.528  26.612  1.00 24.27 ? 32   LYS B C     1 
ATOM   1347  O  O     . LYS B  1 32  ? -6.909  20.311  27.165  1.00 24.10 ? 32   LYS B O     1 
ATOM   1348  C  CB    . LYS B  1 32  ? -3.889  20.274  25.727  1.00 23.23 ? 32   LYS B CB    1 
ATOM   1349  C  CG    . LYS B  1 32  ? -2.396  20.485  25.955  1.00 22.50 ? 32   LYS B CG    1 
ATOM   1350  C  CD    . LYS B  1 32  ? -1.727  21.221  24.770  1.00 21.91 ? 32   LYS B CD    1 
ATOM   1351  C  CE    . LYS B  1 32  ? -1.883  20.464  23.436  1.00 20.26 ? 32   LYS B CE    1 
ATOM   1352  N  NZ    . LYS B  1 32  ? -1.100  19.181  23.425  1.00 19.29 ? 32   LYS B NZ    1 
ATOM   1353  N  N     . SER B  1 33  ? -6.531  18.572  25.767  1.00 24.52 ? 33   SER B N     1 
ATOM   1354  C  CA    . SER B  1 33  ? -7.940  18.323  25.435  1.00 25.46 ? 33   SER B CA    1 
ATOM   1355  C  C     . SER B  1 33  ? -8.777  17.959  26.658  1.00 25.25 ? 33   SER B C     1 
ATOM   1356  O  O     . SER B  1 33  ? -9.924  18.390  26.778  1.00 25.19 ? 33   SER B O     1 
ATOM   1357  C  CB    . SER B  1 33  ? -8.078  17.177  24.426  1.00 25.20 ? 33   SER B CB    1 
ATOM   1358  O  OG    . SER B  1 33  ? -7.283  17.413  23.287  1.00 28.54 ? 33   SER B OG    1 
ATOM   1359  N  N     . THR B  1 34  ? -8.203  17.138  27.534  1.00 25.10 ? 34   THR B N     1 
ATOM   1360  C  CA    . THR B  1 34  ? -8.859  16.724  28.772  1.00 25.27 ? 34   THR B CA    1 
ATOM   1361  C  C     . THR B  1 34  ? -9.074  17.913  29.714  1.00 25.14 ? 34   THR B C     1 
ATOM   1362  O  O     . THR B  1 34  ? -10.155 18.063  30.283  1.00 25.19 ? 34   THR B O     1 
ATOM   1363  C  CB    . THR B  1 34  ? -8.037  15.609  29.448  1.00 25.18 ? 34   THR B CB    1 
ATOM   1364  O  OG1   . THR B  1 34  ? -8.023  14.466  28.586  1.00 26.38 ? 34   THR B OG1   1 
ATOM   1365  C  CG2   . THR B  1 34  ? -8.734  15.088  30.694  1.00 25.07 ? 34   THR B CG2   1 
ATOM   1366  N  N     . GLU B  1 35  ? -8.051  18.758  29.866  1.00 24.98 ? 35   GLU B N     1 
ATOM   1367  C  CA    . GLU B  1 35  ? -8.200  19.976  30.652  1.00 25.29 ? 35   GLU B CA    1 
ATOM   1368  C  C     . GLU B  1 35  ? -9.221  20.950  30.018  1.00 25.31 ? 35   GLU B C     1 
ATOM   1369  O  O     . GLU B  1 35  ? -9.999  21.583  30.742  1.00 25.06 ? 35   GLU B O     1 
ATOM   1370  C  CB    . GLU B  1 35  ? -6.847  20.653  30.917  1.00 25.09 ? 35   GLU B CB    1 
ATOM   1371  C  CG    . GLU B  1 35  ? -6.927  22.036  31.551  1.00 25.54 ? 35   GLU B CG    1 
ATOM   1372  C  CD    . GLU B  1 35  ? -7.455  22.045  32.980  1.00 28.34 ? 35   GLU B CD    1 
ATOM   1373  O  OE1   . GLU B  1 35  ? -7.727  20.965  33.555  1.00 30.34 ? 35   GLU B OE1   1 
ATOM   1374  O  OE2   . GLU B  1 35  ? -7.602  23.146  33.552  1.00 28.80 ? 35   GLU B OE2   1 
ATOM   1375  N  N     . LEU B  1 36  ? -9.235  21.052  28.686  1.00 25.28 ? 36   LEU B N     1 
ATOM   1376  C  CA    . LEU B  1 36  ? -10.267 21.848  28.010  1.00 25.89 ? 36   LEU B CA    1 
ATOM   1377  C  C     . LEU B  1 36  ? -11.678 21.367  28.395  1.00 26.09 ? 36   LEU B C     1 
ATOM   1378  O  O     . LEU B  1 36  ? -12.518 22.163  28.824  1.00 25.77 ? 36   LEU B O     1 
ATOM   1379  C  CB    . LEU B  1 36  ? -10.080 21.865  26.487  1.00 25.71 ? 36   LEU B CB    1 
ATOM   1380  C  CG    . LEU B  1 36  ? -11.231 22.412  25.622  1.00 26.46 ? 36   LEU B CG    1 
ATOM   1381  C  CD1   . LEU B  1 36  ? -11.368 23.906  25.770  1.00 26.82 ? 36   LEU B CD1   1 
ATOM   1382  C  CD2   . LEU B  1 36  ? -11.026 22.075  24.162  1.00 27.08 ? 36   LEU B CD2   1 
ATOM   1383  N  N     . MET B  1 37  ? -11.907 20.060  28.283  1.00 26.41 ? 37   MET B N     1 
ATOM   1384  C  CA    . MET B  1 37  ? -13.202 19.483  28.620  1.00 27.35 ? 37   MET B CA    1 
ATOM   1385  C  C     . MET B  1 37  ? -13.542 19.648  30.101  1.00 26.88 ? 37   MET B C     1 
ATOM   1386  O  O     . MET B  1 37  ? -14.678 19.963  30.442  1.00 26.83 ? 37   MET B O     1 
ATOM   1387  C  CB    . MET B  1 37  ? -13.294 18.018  28.176  1.00 28.08 ? 37   MET B CB    1 
ATOM   1388  C  CG    . MET B  1 37  ? -13.441 17.833  26.658  1.00 31.18 ? 37   MET B CG    1 
ATOM   1389  S  SD    . MET B  1 37  ? -14.700 18.938  25.878  1.00 39.86 ? 37   MET B SD    1 
ATOM   1390  C  CE    . MET B  1 37  ? -16.283 18.216  26.505  1.00 37.65 ? 37   MET B CE    1 
ATOM   1391  N  N     . ARG B  1 38  ? -12.563 19.456  30.982  1.00 26.59 ? 38   ARG B N     1 
ATOM   1392  C  CA    . ARG B  1 38  ? -12.783 19.724  32.406  1.00 26.34 ? 38   ARG B CA    1 
ATOM   1393  C  C     . ARG B  1 38  ? -13.338 21.132  32.607  1.00 26.44 ? 38   ARG B C     1 
ATOM   1394  O  O     . ARG B  1 38  ? -14.343 21.316  33.295  1.00 26.85 ? 38   ARG B O     1 
ATOM   1395  C  CB    . ARG B  1 38  ? -11.499 19.548  33.226  1.00 26.22 ? 38   ARG B CB    1 
ATOM   1396  C  CG    . ARG B  1 38  ? -11.690 19.783  34.717  1.00 25.84 ? 38   ARG B CG    1 
ATOM   1397  C  CD    . ARG B  1 38  ? -10.412 19.823  35.525  1.00 26.19 ? 38   ARG B CD    1 
ATOM   1398  N  NE    . ARG B  1 38  ? -9.702  21.093  35.365  1.00 27.15 ? 38   ARG B NE    1 
ATOM   1399  C  CZ    . ARG B  1 38  ? -9.988  22.219  36.018  1.00 26.53 ? 38   ARG B CZ    1 
ATOM   1400  N  NH1   . ARG B  1 38  ? -10.986 22.266  36.895  1.00 26.34 ? 38   ARG B NH1   1 
ATOM   1401  N  NH2   . ARG B  1 38  ? -9.276  23.311  35.781  1.00 25.94 ? 38   ARG B NH2   1 
ATOM   1402  N  N     . ARG B  1 39  ? -12.690 22.123  32.006  1.00 26.40 ? 39   ARG B N     1 
ATOM   1403  C  CA    . ARG B  1 39  ? -13.127 23.509  32.151  1.00 26.79 ? 39   ARG B CA    1 
ATOM   1404  C  C     . ARG B  1 39  ? -14.513 23.765  31.543  1.00 27.15 ? 39   ARG B C     1 
ATOM   1405  O  O     . ARG B  1 39  ? -15.318 24.461  32.140  1.00 27.44 ? 39   ARG B O     1 
ATOM   1406  C  CB    . ARG B  1 39  ? -12.098 24.479  31.577  1.00 26.30 ? 39   ARG B CB    1 
ATOM   1407  C  CG    . ARG B  1 39  ? -10.771 24.463  32.313  1.00 26.58 ? 39   ARG B CG    1 
ATOM   1408  C  CD    . ARG B  1 39  ? -9.968  25.726  32.113  1.00 26.67 ? 39   ARG B CD    1 
ATOM   1409  N  NE    . ARG B  1 39  ? -8.550  25.583  32.431  1.00 26.07 ? 39   ARG B NE    1 
ATOM   1410  C  CZ    . ARG B  1 39  ? -7.619  26.438  32.019  1.00 25.87 ? 39   ARG B CZ    1 
ATOM   1411  N  NH1   . ARG B  1 39  ? -7.961  27.479  31.259  1.00 23.75 ? 39   ARG B NH1   1 
ATOM   1412  N  NH2   . ARG B  1 39  ? -6.350  26.256  32.355  1.00 23.74 ? 39   ARG B NH2   1 
ATOM   1413  N  N     . VAL B  1 40  ? -14.787 23.195  30.371  1.00 27.51 ? 40   VAL B N     1 
ATOM   1414  C  CA    . VAL B  1 40  ? -16.086 23.369  29.722  1.00 28.11 ? 40   VAL B CA    1 
ATOM   1415  C  C     . VAL B  1 40  ? -17.226 22.717  30.527  1.00 28.87 ? 40   VAL B C     1 
ATOM   1416  O  O     . VAL B  1 40  ? -18.293 23.317  30.704  1.00 28.85 ? 40   VAL B O     1 
ATOM   1417  C  CB    . VAL B  1 40  ? -16.092 22.847  28.262  1.00 28.41 ? 40   VAL B CB    1 
ATOM   1418  C  CG1   . VAL B  1 40  ? -17.524 22.835  27.683  1.00 28.09 ? 40   VAL B CG1   1 
ATOM   1419  C  CG2   . VAL B  1 40  ? -15.174 23.690  27.371  1.00 27.49 ? 40   VAL B CG2   1 
ATOM   1420  N  N     . ARG B  1 41  ? -16.993 21.503  31.023  1.00 29.69 ? 41   ARG B N     1 
ATOM   1421  C  CA    . ARG B  1 41  ? -17.979 20.786  31.835  1.00 30.87 ? 41   ARG B CA    1 
ATOM   1422  C  C     . ARG B  1 41  ? -18.365 21.519  33.127  1.00 30.79 ? 41   ARG B C     1 
ATOM   1423  O  O     . ARG B  1 41  ? -19.492 21.393  33.605  1.00 30.68 ? 41   ARG B O     1 
ATOM   1424  C  CB    . ARG B  1 41  ? -17.487 19.379  32.176  1.00 31.46 ? 41   ARG B CB    1 
ATOM   1425  C  CG    . ARG B  1 41  ? -17.971 18.311  31.224  1.00 35.01 ? 41   ARG B CG    1 
ATOM   1426  C  CD    . ARG B  1 41  ? -17.669 16.876  31.675  1.00 40.12 ? 41   ARG B CD    1 
ATOM   1427  N  NE    . ARG B  1 41  ? -17.134 16.070  30.569  1.00 43.53 ? 41   ARG B NE    1 
ATOM   1428  C  CZ    . ARG B  1 41  ? -15.845 15.738  30.421  1.00 45.34 ? 41   ARG B CZ    1 
ATOM   1429  N  NH1   . ARG B  1 41  ? -14.931 16.137  31.309  1.00 45.13 ? 41   ARG B NH1   1 
ATOM   1430  N  NH2   . ARG B  1 41  ? -15.467 15.006  29.375  1.00 45.67 ? 41   ARG B NH2   1 
ATOM   1431  N  N     . ARG B  1 42  ? -17.430 22.280  33.685  1.00 30.98 ? 42   ARG B N     1 
ATOM   1432  C  CA    . ARG B  1 42  ? -17.709 23.131  34.846  1.00 31.42 ? 42   ARG B CA    1 
ATOM   1433  C  C     . ARG B  1 42  ? -18.843 24.130  34.586  1.00 31.38 ? 42   ARG B C     1 
ATOM   1434  O  O     . ARG B  1 42  ? -19.700 24.340  35.443  1.00 30.98 ? 42   ARG B O     1 
ATOM   1435  C  CB    . ARG B  1 42  ? -16.460 23.924  35.215  1.00 31.48 ? 42   ARG B CB    1 
ATOM   1436  C  CG    . ARG B  1 42  ? -15.563 23.279  36.244  1.00 33.05 ? 42   ARG B CG    1 
ATOM   1437  C  CD    . ARG B  1 42  ? -14.176 23.936  36.350  1.00 35.20 ? 42   ARG B CD    1 
ATOM   1438  N  NE    . ARG B  1 42  ? -14.242 25.296  36.892  1.00 36.35 ? 42   ARG B NE    1 
ATOM   1439  C  CZ    . ARG B  1 42  ? -14.269 26.400  36.151  1.00 38.57 ? 42   ARG B CZ    1 
ATOM   1440  N  NH1   . ARG B  1 42  ? -14.239 26.320  34.814  1.00 39.18 ? 42   ARG B NH1   1 
ATOM   1441  N  NH2   . ARG B  1 42  ? -14.328 27.589  36.743  1.00 38.25 ? 42   ARG B NH2   1 
ATOM   1442  N  N     . PHE B  1 43  ? -18.815 24.760  33.409  1.00 31.60 ? 43   PHE B N     1 
ATOM   1443  C  CA    . PHE B  1 43  ? -19.834 25.729  33.023  1.00 32.00 ? 43   PHE B CA    1 
ATOM   1444  C  C     . PHE B  1 43  ? -21.130 25.020  32.632  1.00 32.83 ? 43   PHE B C     1 
ATOM   1445  O  O     . PHE B  1 43  ? -22.216 25.470  32.984  1.00 32.75 ? 43   PHE B O     1 
ATOM   1446  C  CB    . PHE B  1 43  ? -19.347 26.600  31.859  1.00 31.66 ? 43   PHE B CB    1 
ATOM   1447  C  CG    . PHE B  1 43  ? -18.285 27.606  32.232  1.00 30.45 ? 43   PHE B CG    1 
ATOM   1448  C  CD1   . PHE B  1 43  ? -16.956 27.407  31.850  1.00 29.12 ? 43   PHE B CD1   1 
ATOM   1449  C  CD2   . PHE B  1 43  ? -18.616 28.776  32.915  1.00 29.56 ? 43   PHE B CD2   1 
ATOM   1450  C  CE1   . PHE B  1 43  ? -15.967 28.347  32.160  1.00 28.85 ? 43   PHE B CE1   1 
ATOM   1451  C  CE2   . PHE B  1 43  ? -17.631 29.725  33.241  1.00 29.81 ? 43   PHE B CE2   1 
ATOM   1452  C  CZ    . PHE B  1 43  ? -16.297 29.501  32.864  1.00 28.79 ? 43   PHE B CZ    1 
ATOM   1453  N  N     . GLN B  1 44  ? -21.005 23.907  31.909  1.00 33.75 ? 44   GLN B N     1 
ATOM   1454  C  CA    . GLN B  1 44  ? -22.153 23.155  31.425  1.00 34.84 ? 44   GLN B CA    1 
ATOM   1455  C  C     . GLN B  1 44  ? -23.018 22.629  32.567  1.00 35.39 ? 44   GLN B C     1 
ATOM   1456  O  O     . GLN B  1 44  ? -24.247 22.745  32.523  1.00 35.41 ? 44   GLN B O     1 
ATOM   1457  C  CB    . GLN B  1 44  ? -21.688 21.995  30.563  1.00 35.12 ? 44   GLN B CB    1 
ATOM   1458  C  CG    . GLN B  1 44  ? -22.790 21.357  29.743  1.00 37.09 ? 44   GLN B CG    1 
ATOM   1459  C  CD    . GLN B  1 44  ? -22.291 20.197  28.922  1.00 40.65 ? 44   GLN B CD    1 
ATOM   1460  O  OE1   . GLN B  1 44  ? -21.834 19.188  29.471  1.00 42.66 ? 44   GLN B OE1   1 
ATOM   1461  N  NE2   . GLN B  1 44  ? -22.366 20.330  27.598  1.00 42.16 ? 44   GLN B NE2   1 
ATOM   1462  N  N     . ILE B  1 45  ? -22.377 22.056  33.586  1.00 35.96 ? 45   ILE B N     1 
ATOM   1463  C  CA    . ILE B  1 45  ? -23.086 21.556  34.756  1.00 36.45 ? 45   ILE B CA    1 
ATOM   1464  C  C     . ILE B  1 45  ? -23.803 22.682  35.512  1.00 36.77 ? 45   ILE B C     1 
ATOM   1465  O  O     . ILE B  1 45  ? -24.744 22.440  36.268  1.00 36.70 ? 45   ILE B O     1 
ATOM   1466  C  CB    . ILE B  1 45  ? -22.142 20.765  35.695  1.00 36.86 ? 45   ILE B CB    1 
ATOM   1467  C  CG1   . ILE B  1 45  ? -22.954 19.877  36.647  1.00 37.25 ? 45   ILE B CG1   1 
ATOM   1468  C  CG2   . ILE B  1 45  ? -21.216 21.704  36.487  1.00 36.50 ? 45   ILE B CG2   1 
ATOM   1469  C  CD1   . ILE B  1 45  ? -22.889 18.389  36.333  1.00 38.70 ? 45   ILE B CD1   1 
ATOM   1470  N  N     . ALA B  1 46  ? -23.358 23.914  35.301  1.00 37.03 ? 46   ALA B N     1 
ATOM   1471  C  CA    . ALA B  1 46  ? -24.010 25.063  35.904  1.00 37.50 ? 46   ALA B CA    1 
ATOM   1472  C  C     . ALA B  1 46  ? -25.013 25.740  34.948  1.00 38.05 ? 46   ALA B C     1 
ATOM   1473  O  O     . ALA B  1 46  ? -25.398 26.894  35.159  1.00 37.99 ? 46   ALA B O     1 
ATOM   1474  C  CB    . ALA B  1 46  ? -22.967 26.051  36.384  1.00 37.29 ? 46   ALA B CB    1 
ATOM   1475  N  N     . GLN B  1 47  ? -25.419 25.018  33.898  1.00 38.93 ? 47   GLN B N     1 
ATOM   1476  C  CA    . GLN B  1 47  ? -26.499 25.449  32.992  1.00 39.88 ? 47   GLN B CA    1 
ATOM   1477  C  C     . GLN B  1 47  ? -26.101 26.427  31.868  1.00 39.80 ? 47   GLN B C     1 
ATOM   1478  O  O     . GLN B  1 47  ? -26.973 26.947  31.163  1.00 39.91 ? 47   GLN B O     1 
ATOM   1479  C  CB    . GLN B  1 47  ? -27.686 26.028  33.789  1.00 40.13 ? 47   GLN B CB    1 
ATOM   1480  C  CG    . GLN B  1 47  ? -28.272 25.076  34.832  1.00 42.42 ? 47   GLN B CG    1 
ATOM   1481  C  CD    . GLN B  1 47  ? -29.091 23.981  34.198  1.00 45.83 ? 47   GLN B CD    1 
ATOM   1482  O  OE1   . GLN B  1 47  ? -28.541 23.037  33.616  1.00 46.81 ? 47   GLN B OE1   1 
ATOM   1483  N  NE2   . GLN B  1 47  ? -30.415 24.109  34.284  1.00 47.03 ? 47   GLN B NE2   1 
ATOM   1484  N  N     . TYR B  1 48  ? -24.806 26.701  31.712  1.00 39.51 ? 48   TYR B N     1 
ATOM   1485  C  CA    . TYR B  1 48  ? -24.351 27.513  30.591  1.00 39.36 ? 48   TYR B CA    1 
ATOM   1486  C  C     . TYR B  1 48  ? -24.492 26.723  29.287  1.00 39.03 ? 48   TYR B C     1 
ATOM   1487  O  O     . TYR B  1 48  ? -24.278 25.510  29.266  1.00 38.91 ? 48   TYR B O     1 
ATOM   1488  C  CB    . TYR B  1 48  ? -22.890 27.895  30.769  1.00 39.47 ? 48   TYR B CB    1 
ATOM   1489  C  CG    . TYR B  1 48  ? -22.613 29.037  31.704  1.00 40.23 ? 48   TYR B CG    1 
ATOM   1490  C  CD1   . TYR B  1 48  ? -22.591 30.348  31.241  1.00 41.82 ? 48   TYR B CD1   1 
ATOM   1491  C  CD2   . TYR B  1 48  ? -22.316 28.806  33.046  1.00 41.22 ? 48   TYR B CD2   1 
ATOM   1492  C  CE1   . TYR B  1 48  ? -22.303 31.409  32.098  1.00 43.21 ? 48   TYR B CE1   1 
ATOM   1493  C  CE2   . TYR B  1 48  ? -22.027 29.856  33.915  1.00 41.92 ? 48   TYR B CE2   1 
ATOM   1494  C  CZ    . TYR B  1 48  ? -22.018 31.154  33.435  1.00 43.31 ? 48   TYR B CZ    1 
ATOM   1495  O  OH    . TYR B  1 48  ? -21.738 32.201  34.284  1.00 44.06 ? 48   TYR B OH    1 
ATOM   1496  N  N     . LYS B  1 49  ? -24.845 27.411  28.203  1.00 38.78 ? 49   LYS B N     1 
ATOM   1497  C  CA    . LYS B  1 49  ? -24.795 26.806  26.870  1.00 38.65 ? 49   LYS B CA    1 
ATOM   1498  C  C     . LYS B  1 49  ? -23.351 26.778  26.363  1.00 37.71 ? 49   LYS B C     1 
ATOM   1499  O  O     . LYS B  1 49  ? -22.657 27.798  26.373  1.00 37.39 ? 49   LYS B O     1 
ATOM   1500  C  CB    . LYS B  1 49  ? -25.698 27.549  25.879  1.00 39.12 ? 49   LYS B CB    1 
ATOM   1501  C  CG    . LYS B  1 49  ? -27.121 27.017  25.830  1.00 41.57 ? 49   LYS B CG    1 
ATOM   1502  C  CD    . LYS B  1 49  ? -27.882 27.567  24.633  1.00 45.35 ? 49   LYS B CD    1 
ATOM   1503  C  CE    . LYS B  1 49  ? -28.906 28.622  25.062  1.00 47.25 ? 49   LYS B CE    1 
ATOM   1504  N  NZ    . LYS B  1 49  ? -30.151 28.565  24.232  1.00 48.14 ? 49   LYS B NZ    1 
ATOM   1505  N  N     . CYS B  1 50  ? -22.920 25.603  25.919  1.00 36.68 ? 50   CYS B N     1 
ATOM   1506  C  CA    . CYS B  1 50  ? -21.533 25.375  25.544  1.00 36.25 ? 50   CYS B CA    1 
ATOM   1507  C  C     . CYS B  1 50  ? -21.391 24.856  24.122  1.00 35.82 ? 50   CYS B C     1 
ATOM   1508  O  O     . CYS B  1 50  ? -22.268 24.142  23.626  1.00 35.90 ? 50   CYS B O     1 
ATOM   1509  C  CB    . CYS B  1 50  ? -20.896 24.372  26.499  1.00 35.93 ? 50   CYS B CB    1 
ATOM   1510  S  SG    . CYS B  1 50  ? -20.844 24.949  28.205  1.00 37.21 ? 50   CYS B SG    1 
ATOM   1511  N  N     . LEU B  1 51  ? -20.285 25.216  23.473  1.00 35.06 ? 51   LEU B N     1 
ATOM   1512  C  CA    . LEU B  1 51  ? -19.929 24.633  22.189  1.00 34.51 ? 51   LEU B CA    1 
ATOM   1513  C  C     . LEU B  1 51  ? -18.441 24.304  22.174  1.00 34.10 ? 51   LEU B C     1 
ATOM   1514  O  O     . LEU B  1 51  ? -17.614 25.095  22.635  1.00 34.08 ? 51   LEU B O     1 
ATOM   1515  C  CB    . LEU B  1 51  ? -20.317 25.568  21.036  1.00 34.56 ? 51   LEU B CB    1 
ATOM   1516  C  CG    . LEU B  1 51  ? -19.812 25.285  19.615  1.00 35.03 ? 51   LEU B CG    1 
ATOM   1517  C  CD1   . LEU B  1 51  ? -20.550 24.097  18.977  1.00 35.18 ? 51   LEU B CD1   1 
ATOM   1518  C  CD2   . LEU B  1 51  ? -19.918 26.543  18.743  1.00 34.42 ? 51   LEU B CD2   1 
ATOM   1519  N  N     . VAL B  1 52  ? -18.116 23.122  21.662  1.00 33.68 ? 52   VAL B N     1 
ATOM   1520  C  CA    . VAL B  1 52  ? -16.732 22.698  21.504  1.00 33.57 ? 52   VAL B CA    1 
ATOM   1521  C  C     . VAL B  1 52  ? -16.442 22.535  20.016  1.00 33.66 ? 52   VAL B C     1 
ATOM   1522  O  O     . VAL B  1 52  ? -17.213 21.898  19.285  1.00 33.44 ? 52   VAL B O     1 
ATOM   1523  C  CB    . VAL B  1 52  ? -16.438 21.382  22.279  1.00 33.60 ? 52   VAL B CB    1 
ATOM   1524  C  CG1   . VAL B  1 52  ? -14.968 20.973  22.141  1.00 33.76 ? 52   VAL B CG1   1 
ATOM   1525  C  CG2   . VAL B  1 52  ? -16.809 21.538  23.758  1.00 33.31 ? 52   VAL B CG2   1 
ATOM   1526  N  N     . ILE B  1 53  ? -15.348 23.141  19.571  1.00 33.73 ? 53   ILE B N     1 
ATOM   1527  C  CA    . ILE B  1 53  ? -14.929 23.049  18.181  1.00 33.97 ? 53   ILE B CA    1 
ATOM   1528  C  C     . ILE B  1 53  ? -13.616 22.288  18.090  1.00 34.63 ? 53   ILE B C     1 
ATOM   1529  O  O     . ILE B  1 53  ? -12.685 22.531  18.864  1.00 34.50 ? 53   ILE B O     1 
ATOM   1530  C  CB    . ILE B  1 53  ? -14.795 24.443  17.553  1.00 33.74 ? 53   ILE B CB    1 
ATOM   1531  C  CG1   . ILE B  1 53  ? -16.139 25.168  17.568  1.00 33.44 ? 53   ILE B CG1   1 
ATOM   1532  C  CG2   . ILE B  1 53  ? -14.250 24.339  16.126  1.00 33.78 ? 53   ILE B CG2   1 
ATOM   1533  C  CD1   . ILE B  1 53  ? -16.024 26.658  17.826  1.00 32.82 ? 53   ILE B CD1   1 
ATOM   1534  N  N     . LYS B  1 54  ? -13.560 21.367  17.135  1.00 35.56 ? 54   LYS B N     1 
ATOM   1535  C  CA    . LYS B  1 54  ? -12.377 20.555  16.895  1.00 36.75 ? 54   LYS B CA    1 
ATOM   1536  C  C     . LYS B  1 54  ? -11.905 20.750  15.450  1.00 37.01 ? 54   LYS B C     1 
ATOM   1537  O  O     . LYS B  1 54  ? -12.706 21.047  14.568  1.00 36.88 ? 54   LYS B O     1 
ATOM   1538  C  CB    . LYS B  1 54  ? -12.712 19.088  17.229  1.00 37.10 ? 54   LYS B CB    1 
ATOM   1539  C  CG    . LYS B  1 54  ? -12.221 18.007  16.260  1.00 39.92 ? 54   LYS B CG    1 
ATOM   1540  C  CD    . LYS B  1 54  ? -11.733 16.747  17.006  1.00 43.49 ? 54   LYS B CD    1 
ATOM   1541  C  CE    . LYS B  1 54  ? -10.271 16.895  17.486  1.00 45.18 ? 54   LYS B CE    1 
ATOM   1542  N  NZ    . LYS B  1 54  ? -9.914  15.928  18.574  1.00 45.93 ? 54   LYS B NZ    1 
ATOM   1543  N  N     . TYR B  1 55  ? -10.600 20.611  15.221  1.00 37.79 ? 55   TYR B N     1 
ATOM   1544  C  CA    . TYR B  1 55  ? -10.031 20.712  13.882  1.00 38.47 ? 55   TYR B CA    1 
ATOM   1545  C  C     . TYR B  1 55  ? -10.403 19.488  13.053  1.00 39.33 ? 55   TYR B C     1 
ATOM   1546  O  O     . TYR B  1 55  ? -10.065 18.360  13.413  1.00 39.25 ? 55   TYR B O     1 
ATOM   1547  C  CB    . TYR B  1 55  ? -8.518  20.877  13.963  1.00 38.24 ? 55   TYR B CB    1 
ATOM   1548  C  CG    . TYR B  1 55  ? -7.835  21.121  12.636  1.00 37.90 ? 55   TYR B CG    1 
ATOM   1549  C  CD1   . TYR B  1 55  ? -8.183  22.214  11.835  1.00 37.39 ? 55   TYR B CD1   1 
ATOM   1550  C  CD2   . TYR B  1 55  ? -6.828  20.266  12.187  1.00 37.24 ? 55   TYR B CD2   1 
ATOM   1551  C  CE1   . TYR B  1 55  ? -7.551  22.437  10.617  1.00 37.26 ? 55   TYR B CE1   1 
ATOM   1552  C  CE2   . TYR B  1 55  ? -6.187  20.487  10.981  1.00 36.94 ? 55   TYR B CE2   1 
ATOM   1553  C  CZ    . TYR B  1 55  ? -6.552  21.570  10.204  1.00 37.09 ? 55   TYR B CZ    1 
ATOM   1554  O  OH    . TYR B  1 55  ? -5.915  21.790  9.014   1.00 38.25 ? 55   TYR B OH    1 
ATOM   1555  N  N     . ALA B  1 56  ? -11.099 19.733  11.943  1.00 40.67 ? 56   ALA B N     1 
ATOM   1556  C  CA    . ALA B  1 56  ? -11.706 18.685  11.112  1.00 42.06 ? 56   ALA B CA    1 
ATOM   1557  C  C     . ALA B  1 56  ? -10.717 17.659  10.558  1.00 43.17 ? 56   ALA B C     1 
ATOM   1558  O  O     . ALA B  1 56  ? -11.055 16.479  10.400  1.00 43.54 ? 56   ALA B O     1 
ATOM   1559  C  CB    . ALA B  1 56  ? -12.501 19.317  9.966   1.00 41.89 ? 56   ALA B CB    1 
ATOM   1560  N  N     . LYS B  1 57  ? -9.501  18.106  10.264  1.00 44.51 ? 57   LYS B N     1 
ATOM   1561  C  CA    . LYS B  1 57  ? -8.500  17.234  9.652   1.00 45.92 ? 57   LYS B CA    1 
ATOM   1562  C  C     . LYS B  1 57  ? -7.738  16.321  10.630  1.00 46.64 ? 57   LYS B C     1 
ATOM   1563  O  O     . LYS B  1 57  ? -6.959  15.468  10.199  1.00 46.92 ? 57   LYS B O     1 
ATOM   1564  C  CB    . LYS B  1 57  ? -7.541  18.055  8.788   1.00 46.29 ? 57   LYS B CB    1 
ATOM   1565  C  CG    . LYS B  1 57  ? -8.211  18.706  7.578   1.00 47.63 ? 57   LYS B CG    1 
ATOM   1566  C  CD    . LYS B  1 57  ? -7.172  19.265  6.610   1.00 50.01 ? 57   LYS B CD    1 
ATOM   1567  C  CE    . LYS B  1 57  ? -7.834  19.902  5.395   1.00 51.30 ? 57   LYS B CE    1 
ATOM   1568  N  NZ    . LYS B  1 57  ? -8.559  21.150  5.766   1.00 52.56 ? 57   LYS B NZ    1 
ATOM   1569  N  N     . ASP B  1 58  ? -7.957  16.488  11.933  1.00 47.62 ? 58   ASP B N     1 
ATOM   1570  C  CA    . ASP B  1 58  ? -7.412  15.543  12.908  1.00 48.70 ? 58   ASP B CA    1 
ATOM   1571  C  C     . ASP B  1 58  ? -8.489  14.536  13.289  1.00 49.44 ? 58   ASP B C     1 
ATOM   1572  O  O     . ASP B  1 58  ? -9.332  14.801  14.154  1.00 49.39 ? 58   ASP B O     1 
ATOM   1573  C  CB    . ASP B  1 58  ? -6.849  16.252  14.144  1.00 48.88 ? 58   ASP B CB    1 
ATOM   1574  C  CG    . ASP B  1 58  ? -5.855  15.380  14.923  1.00 49.50 ? 58   ASP B CG    1 
ATOM   1575  O  OD1   . ASP B  1 58  ? -6.032  14.136  14.970  1.00 50.39 ? 58   ASP B OD1   1 
ATOM   1576  O  OD2   . ASP B  1 58  ? -4.869  15.855  15.526  1.00 49.22 ? 58   ASP B OD2   1 
ATOM   1577  N  N     . THR B  1 59  ? -8.464  13.391  12.608  1.00 51.69 ? 59   THR B N     1 
ATOM   1578  C  CA    . THR B  1 59  ? -9.477  12.350  12.791  1.00 53.51 ? 59   THR B CA    1 
ATOM   1579  C  C     . THR B  1 59  ? -8.875  11.069  13.381  1.00 54.37 ? 59   THR B C     1 
ATOM   1580  O  O     . THR B  1 59  ? -8.957  9.992   12.778  1.00 54.93 ? 59   THR B O     1 
ATOM   1581  C  CB    . THR B  1 59  ? -10.245 12.058  11.460  1.00 53.69 ? 59   THR B CB    1 
ATOM   1582  O  OG1   . THR B  1 59  ? -9.337  12.070  10.347  1.00 54.51 ? 59   THR B OG1   1 
ATOM   1583  C  CG2   . THR B  1 59  ? -11.225 13.189  11.139  1.00 53.90 ? 59   THR B CG2   1 
ATOM   1584  N  N     . ARG B  1 60  ? -8.275  11.208  14.563  1.00 55.23 ? 60   ARG B N     1 
ATOM   1585  C  CA    . ARG B  1 60  ? -7.725  10.087  15.324  1.00 55.83 ? 60   ARG B CA    1 
ATOM   1586  C  C     . ARG B  1 60  ? -8.752  9.557   16.338  1.00 56.13 ? 60   ARG B C     1 
ATOM   1587  O  O     . ARG B  1 60  ? -9.467  10.330  16.988  1.00 56.16 ? 60   ARG B O     1 
ATOM   1588  C  CB    . ARG B  1 60  ? -6.437  10.503  16.047  1.00 55.94 ? 60   ARG B CB    1 
ATOM   1589  C  CG    . ARG B  1 60  ? -5.243  10.778  15.120  1.00 56.81 ? 60   ARG B CG    1 
ATOM   1590  C  CD    . ARG B  1 60  ? -4.035  11.420  15.802  1.00 57.81 ? 60   ARG B CD    1 
ATOM   1591  N  NE    . ARG B  1 60  ? -4.382  12.645  16.532  1.00 58.47 ? 60   ARG B NE    1 
ATOM   1592  C  CZ    . ARG B  1 60  ? -3.877  12.997  17.717  1.00 58.33 ? 60   ARG B CZ    1 
ATOM   1593  N  NH1   . ARG B  1 60  ? -2.983  12.229  18.333  1.00 57.88 ? 60   ARG B NH1   1 
ATOM   1594  N  NH2   . ARG B  1 60  ? -4.270  14.128  18.291  1.00 57.72 ? 60   ARG B NH2   1 
ATOM   1595  N  N     . ALA B  1 75  ? -19.642 18.661  19.645  1.00 48.13 ? 75   ALA B N     1 
ATOM   1596  C  CA    . ALA B  1 75  ? -18.250 18.723  19.213  1.00 47.87 ? 75   ALA B CA    1 
ATOM   1597  C  C     . ALA B  1 75  ? -18.129 18.950  17.696  1.00 47.50 ? 75   ALA B C     1 
ATOM   1598  O  O     . ALA B  1 75  ? -17.877 18.013  16.934  1.00 47.64 ? 75   ALA B O     1 
ATOM   1599  C  CB    . ALA B  1 75  ? -17.515 17.458  19.635  1.00 47.83 ? 75   ALA B CB    1 
ATOM   1600  N  N     . LEU B  1 76  ? -18.302 20.201  17.278  1.00 46.60 ? 76   LEU B N     1 
ATOM   1601  C  CA    . LEU B  1 76  ? -18.327 20.589  15.869  1.00 45.86 ? 76   LEU B CA    1 
ATOM   1602  C  C     . LEU B  1 76  ? -16.951 20.571  15.190  1.00 45.06 ? 76   LEU B C     1 
ATOM   1603  O  O     . LEU B  1 76  ? -16.044 21.269  15.631  1.00 44.91 ? 76   LEU B O     1 
ATOM   1604  C  CB    . LEU B  1 76  ? -18.907 22.000  15.744  1.00 45.86 ? 76   LEU B CB    1 
ATOM   1605  C  CG    . LEU B  1 76  ? -20.270 22.162  15.079  1.00 46.67 ? 76   LEU B CG    1 
ATOM   1606  C  CD1   . LEU B  1 76  ? -20.629 23.633  15.006  1.00 46.45 ? 76   LEU B CD1   1 
ATOM   1607  C  CD2   . LEU B  1 76  ? -20.299 21.522  13.689  1.00 46.98 ? 76   LEU B CD2   1 
ATOM   1608  N  N     . PRO B  1 77  ? -16.798 19.789  14.119  1.00 44.37 ? 77   PRO B N     1 
ATOM   1609  C  CA    . PRO B  1 77  ? -15.566 19.832  13.316  1.00 43.85 ? 77   PRO B CA    1 
ATOM   1610  C  C     . PRO B  1 77  ? -15.526 21.080  12.432  1.00 43.26 ? 77   PRO B C     1 
ATOM   1611  O  O     . PRO B  1 77  ? -16.563 21.498  11.924  1.00 43.14 ? 77   PRO B O     1 
ATOM   1612  C  CB    . PRO B  1 77  ? -15.648 18.560  12.457  1.00 43.84 ? 77   PRO B CB    1 
ATOM   1613  C  CG    . PRO B  1 77  ? -17.124 18.250  12.360  1.00 44.31 ? 77   PRO B CG    1 
ATOM   1614  C  CD    . PRO B  1 77  ? -17.768 18.799  13.606  1.00 44.24 ? 77   PRO B CD    1 
ATOM   1615  N  N     . ALA B  1 78  ? -14.346 21.671  12.273  1.00 42.68 ? 78   ALA B N     1 
ATOM   1616  C  CA    . ALA B  1 78  ? -14.169 22.842  11.410  1.00 42.32 ? 78   ALA B CA    1 
ATOM   1617  C  C     . ALA B  1 78  ? -12.729 22.974  10.916  1.00 42.25 ? 78   ALA B C     1 
ATOM   1618  O  O     . ALA B  1 78  ? -11.800 22.415  11.513  1.00 42.09 ? 78   ALA B O     1 
ATOM   1619  C  CB    . ALA B  1 78  ? -14.620 24.122  12.114  1.00 42.05 ? 78   ALA B CB    1 
ATOM   1620  N  N     . CYS B  1 79  ? -12.567 23.707  9.815   1.00 42.29 ? 79   CYS B N     1 
ATOM   1621  C  CA    . CYS B  1 79  ? -11.265 24.014  9.209   1.00 42.65 ? 79   CYS B CA    1 
ATOM   1622  C  C     . CYS B  1 79  ? -10.925 25.471  9.425   1.00 41.95 ? 79   CYS B C     1 
ATOM   1623  O  O     . CYS B  1 79  ? -9.760  25.850  9.495   1.00 41.90 ? 79   CYS B O     1 
ATOM   1624  C  CB    . CYS B  1 79  ? -11.329 23.797  7.703   1.00 42.58 ? 79   CYS B CB    1 
ATOM   1625  S  SG    . CYS B  1 79  ? -10.998 22.107  7.214   1.00 47.24 ? 79   CYS B SG    1 
ATOM   1626  N  N     . LEU B  1 80  ? -11.976 26.281  9.469   1.00 41.48 ? 80   LEU B N     1 
ATOM   1627  C  CA    . LEU B  1 80  ? -11.888 27.706  9.708   1.00 41.13 ? 80   LEU B CA    1 
ATOM   1628  C  C     . LEU B  1 80  ? -12.920 28.019  10.767  1.00 40.63 ? 80   LEU B C     1 
ATOM   1629  O  O     . LEU B  1 80  ? -14.051 27.528  10.695  1.00 40.47 ? 80   LEU B O     1 
ATOM   1630  C  CB    . LEU B  1 80  ? -12.229 28.481  8.432   1.00 41.20 ? 80   LEU B CB    1 
ATOM   1631  C  CG    . LEU B  1 80  ? -11.145 28.858  7.421   1.00 42.20 ? 80   LEU B CG    1 
ATOM   1632  C  CD1   . LEU B  1 80  ? -11.787 29.482  6.179   1.00 42.44 ? 80   LEU B CD1   1 
ATOM   1633  C  CD2   . LEU B  1 80  ? -10.104 29.804  8.021   1.00 42.42 ? 80   LEU B CD2   1 
ATOM   1634  N  N     . LEU B  1 81  ? -12.543 28.838  11.742  1.00 40.10 ? 81   LEU B N     1 
ATOM   1635  C  CA    . LEU B  1 81  ? -13.456 29.170  12.837  1.00 39.91 ? 81   LEU B CA    1 
ATOM   1636  C  C     . LEU B  1 81  ? -14.635 30.017  12.363  1.00 40.23 ? 81   LEU B C     1 
ATOM   1637  O  O     . LEU B  1 81  ? -15.728 29.959  12.943  1.00 40.17 ? 81   LEU B O     1 
ATOM   1638  C  CB    . LEU B  1 81  ? -12.708 29.839  13.990  1.00 39.26 ? 81   LEU B CB    1 
ATOM   1639  C  CG    . LEU B  1 81  ? -11.691 28.917  14.682  1.00 38.69 ? 81   LEU B CG    1 
ATOM   1640  C  CD1   . LEU B  1 81  ? -10.816 29.681  15.659  1.00 37.40 ? 81   LEU B CD1   1 
ATOM   1641  C  CD2   . LEU B  1 81  ? -12.381 27.740  15.372  1.00 37.91 ? 81   LEU B CD2   1 
ATOM   1642  N  N     . ARG B  1 82  ? -14.418 30.778  11.293  1.00 40.54 ? 82   ARG B N     1 
ATOM   1643  C  CA    . ARG B  1 82  ? -15.483 31.582  10.703  1.00 41.13 ? 82   ARG B CA    1 
ATOM   1644  C  C     . ARG B  1 82  ? -16.655 30.748  10.164  1.00 41.21 ? 82   ARG B C     1 
ATOM   1645  O  O     . ARG B  1 82  ? -17.782 31.234  10.135  1.00 41.13 ? 82   ARG B O     1 
ATOM   1646  C  CB    . ARG B  1 82  ? -14.944 32.569  9.658   1.00 41.06 ? 82   ARG B CB    1 
ATOM   1647  C  CG    . ARG B  1 82  ? -14.480 31.954  8.381   1.00 41.97 ? 82   ARG B CG    1 
ATOM   1648  C  CD    . ARG B  1 82  ? -15.199 32.477  7.181   1.00 43.60 ? 82   ARG B CD    1 
ATOM   1649  N  NE    . ARG B  1 82  ? -15.060 31.574  6.044   1.00 44.88 ? 82   ARG B NE    1 
ATOM   1650  C  CZ    . ARG B  1 82  ? -14.234 31.774  5.022   1.00 45.46 ? 82   ARG B CZ    1 
ATOM   1651  N  NH1   . ARG B  1 82  ? -13.452 32.847  4.994   1.00 46.04 ? 82   ARG B NH1   1 
ATOM   1652  N  NH2   . ARG B  1 82  ? -14.185 30.901  4.026   1.00 44.69 ? 82   ARG B NH2   1 
ATOM   1653  N  N     . ASP B  1 83  ? -16.389 29.499  9.779   1.00 41.47 ? 83   ASP B N     1 
ATOM   1654  C  CA    . ASP B  1 83  ? -17.426 28.603  9.269   1.00 41.96 ? 83   ASP B CA    1 
ATOM   1655  C  C     . ASP B  1 83  ? -18.406 28.189  10.357  1.00 42.15 ? 83   ASP B C     1 
ATOM   1656  O  O     . ASP B  1 83  ? -19.461 27.615  10.081  1.00 42.32 ? 83   ASP B O     1 
ATOM   1657  C  CB    . ASP B  1 83  ? -16.799 27.368  8.625   1.00 41.77 ? 83   ASP B CB    1 
ATOM   1658  C  CG    . ASP B  1 83  ? -16.048 27.694  7.345   1.00 42.62 ? 83   ASP B CG    1 
ATOM   1659  O  OD1   . ASP B  1 83  ? -16.310 28.750  6.725   1.00 42.81 ? 83   ASP B OD1   1 
ATOM   1660  O  OD2   . ASP B  1 83  ? -15.165 26.941  6.881   1.00 44.26 ? 83   ASP B OD2   1 
ATOM   1661  N  N     . VAL B  1 84  ? -18.065 28.537  11.589  1.00 42.38 ? 84   VAL B N     1 
ATOM   1662  C  CA    . VAL B  1 84  ? -18.728 28.016  12.759  1.00 42.56 ? 84   VAL B CA    1 
ATOM   1663  C  C     . VAL B  1 84  ? -19.178 29.179  13.657  1.00 42.78 ? 84   VAL B C     1 
ATOM   1664  O  O     . VAL B  1 84  ? -19.767 28.986  14.724  1.00 42.69 ? 84   VAL B O     1 
ATOM   1665  C  CB    . VAL B  1 84  ? -17.740 27.040  13.430  1.00 42.45 ? 84   VAL B CB    1 
ATOM   1666  C  CG1   . VAL B  1 84  ? -17.233 27.543  14.771  1.00 42.40 ? 84   VAL B CG1   1 
ATOM   1667  C  CG2   . VAL B  1 84  ? -18.341 25.668  13.512  1.00 42.79 ? 84   VAL B CG2   1 
ATOM   1668  N  N     . ALA B  1 85  ? -18.920 30.394  13.186  1.00 43.22 ? 85   ALA B N     1 
ATOM   1669  C  CA    . ALA B  1 85  ? -19.181 31.597  13.966  1.00 43.90 ? 85   ALA B CA    1 
ATOM   1670  C  C     . ALA B  1 85  ? -20.657 31.834  14.326  1.00 44.36 ? 85   ALA B C     1 
ATOM   1671  O  O     . ALA B  1 85  ? -20.939 32.367  15.404  1.00 44.37 ? 85   ALA B O     1 
ATOM   1672  C  CB    . ALA B  1 85  ? -18.587 32.816  13.297  1.00 43.69 ? 85   ALA B CB    1 
ATOM   1673  N  N     . GLN B  1 86  ? -21.587 31.442  13.450  1.00 44.82 ? 86   GLN B N     1 
ATOM   1674  C  CA    . GLN B  1 86  ? -23.016 31.602  13.759  1.00 45.32 ? 86   GLN B CA    1 
ATOM   1675  C  C     . GLN B  1 86  ? -23.463 30.721  14.927  1.00 45.28 ? 86   GLN B C     1 
ATOM   1676  O  O     . GLN B  1 86  ? -24.222 31.174  15.778  1.00 45.37 ? 86   GLN B O     1 
ATOM   1677  C  CB    . GLN B  1 86  ? -23.938 31.376  12.551  1.00 45.55 ? 86   GLN B CB    1 
ATOM   1678  C  CG    . GLN B  1 86  ? -25.398 31.833  12.826  1.00 46.77 ? 86   GLN B CG    1 
ATOM   1679  C  CD    . GLN B  1 86  ? -26.486 30.955  12.179  1.00 48.75 ? 86   GLN B CD    1 
ATOM   1680  O  OE1   . GLN B  1 86  ? -27.601 31.432  11.925  1.00 49.14 ? 86   GLN B OE1   1 
ATOM   1681  N  NE2   . GLN B  1 86  ? -26.172 29.684  11.927  1.00 49.02 ? 86   GLN B NE2   1 
ATOM   1682  N  N     . GLU B  1 87  ? -23.000 29.471  14.959  1.00 45.22 ? 87   GLU B N     1 
ATOM   1683  C  CA    . GLU B  1 87  ? -23.280 28.578  16.077  1.00 45.34 ? 87   GLU B CA    1 
ATOM   1684  C  C     . GLU B  1 87  ? -22.679 29.143  17.365  1.00 44.86 ? 87   GLU B C     1 
ATOM   1685  O  O     . GLU B  1 87  ? -23.317 29.125  18.409  1.00 44.89 ? 87   GLU B O     1 
ATOM   1686  C  CB    . GLU B  1 87  ? -22.722 27.176  15.808  1.00 45.81 ? 87   GLU B CB    1 
ATOM   1687  C  CG    . GLU B  1 87  ? -23.525 26.344  14.811  1.00 47.84 ? 87   GLU B CG    1 
ATOM   1688  C  CD    . GLU B  1 87  ? -23.589 26.970  13.421  1.00 50.59 ? 87   GLU B CD    1 
ATOM   1689  O  OE1   . GLU B  1 87  ? -22.550 27.503  12.940  1.00 51.02 ? 87   GLU B OE1   1 
ATOM   1690  O  OE2   . GLU B  1 87  ? -24.688 26.943  12.812  1.00 51.05 ? 87   GLU B OE2   1 
ATOM   1691  N  N     . ALA B  1 88  ? -21.458 29.664  17.270  1.00 44.35 ? 88   ALA B N     1 
ATOM   1692  C  CA    . ALA B  1 88  ? -20.744 30.205  18.422  1.00 43.82 ? 88   ALA B CA    1 
ATOM   1693  C  C     . ALA B  1 88  ? -21.413 31.440  19.027  1.00 43.47 ? 88   ALA B C     1 
ATOM   1694  O  O     . ALA B  1 88  ? -21.284 31.694  20.224  1.00 43.35 ? 88   ALA B O     1 
ATOM   1695  C  CB    . ALA B  1 88  ? -19.292 30.499  18.063  1.00 43.78 ? 88   ALA B CB    1 
ATOM   1696  N  N     . LEU B  1 89  ? -22.134 32.198  18.209  1.00 43.12 ? 89   LEU B N     1 
ATOM   1697  C  CA    . LEU B  1 89  ? -22.806 33.404  18.698  1.00 42.77 ? 89   LEU B CA    1 
ATOM   1698  C  C     . LEU B  1 89  ? -24.001 33.113  19.624  1.00 42.17 ? 89   LEU B C     1 
ATOM   1699  O  O     . LEU B  1 89  ? -24.341 33.936  20.466  1.00 42.18 ? 89   LEU B O     1 
ATOM   1700  C  CB    . LEU B  1 89  ? -23.210 34.324  17.544  1.00 42.94 ? 89   LEU B CB    1 
ATOM   1701  C  CG    . LEU B  1 89  ? -22.458 35.649  17.314  1.00 44.16 ? 89   LEU B CG    1 
ATOM   1702  C  CD1   . LEU B  1 89  ? -21.241 35.858  18.231  1.00 43.81 ? 89   LEU B CD1   1 
ATOM   1703  C  CD2   . LEU B  1 89  ? -22.044 35.770  15.847  1.00 44.55 ? 89   LEU B CD2   1 
ATOM   1704  N  N     . GLY B  1 90  ? -24.613 31.936  19.489  1.00 41.39 ? 90   GLY B N     1 
ATOM   1705  C  CA    . GLY B  1 90  ? -25.770 31.579  20.293  1.00 40.45 ? 90   GLY B CA    1 
ATOM   1706  C  C     . GLY B  1 90  ? -25.417 30.852  21.577  1.00 39.78 ? 90   GLY B C     1 
ATOM   1707  O  O     . GLY B  1 90  ? -26.285 30.276  22.239  1.00 40.10 ? 90   GLY B O     1 
ATOM   1708  N  N     . VAL B  1 91  ? -24.142 30.905  21.946  1.00 38.53 ? 91   VAL B N     1 
ATOM   1709  C  CA    . VAL B  1 91  ? -23.618 30.110  23.041  1.00 37.05 ? 91   VAL B CA    1 
ATOM   1710  C  C     . VAL B  1 91  ? -22.868 31.034  24.011  1.00 35.94 ? 91   VAL B C     1 
ATOM   1711  O  O     . VAL B  1 91  ? -22.435 32.112  23.621  1.00 35.95 ? 91   VAL B O     1 
ATOM   1712  C  CB    . VAL B  1 91  ? -22.760 28.943  22.436  1.00 37.45 ? 91   VAL B CB    1 
ATOM   1713  C  CG1   . VAL B  1 91  ? -21.328 28.921  22.937  1.00 36.62 ? 91   VAL B CG1   1 
ATOM   1714  C  CG2   . VAL B  1 91  ? -23.461 27.599  22.601  1.00 37.07 ? 91   VAL B CG2   1 
ATOM   1715  N  N     . ALA B  1 92  ? -22.741 30.629  25.274  1.00 34.40 ? 92   ALA B N     1 
ATOM   1716  C  CA    . ALA B  1 92  ? -22.035 31.434  26.274  1.00 32.90 ? 92   ALA B CA    1 
ATOM   1717  C  C     . ALA B  1 92  ? -20.555 31.044  26.451  1.00 31.97 ? 92   ALA B C     1 
ATOM   1718  O  O     . ALA B  1 92  ? -19.725 31.894  26.769  1.00 31.65 ? 92   ALA B O     1 
ATOM   1719  C  CB    . ALA B  1 92  ? -22.770 31.388  27.613  1.00 32.72 ? 92   ALA B CB    1 
ATOM   1720  N  N     . VAL B  1 93  ? -20.244 29.764  26.232  1.00 30.63 ? 93   VAL B N     1 
ATOM   1721  C  CA    . VAL B  1 93  ? -18.904 29.219  26.446  1.00 29.72 ? 93   VAL B CA    1 
ATOM   1722  C  C     . VAL B  1 93  ? -18.448 28.448  25.203  1.00 29.32 ? 93   VAL B C     1 
ATOM   1723  O  O     . VAL B  1 93  ? -19.144 27.529  24.744  1.00 29.07 ? 93   VAL B O     1 
ATOM   1724  C  CB    . VAL B  1 93  ? -18.849 28.303  27.726  1.00 29.49 ? 93   VAL B CB    1 
ATOM   1725  C  CG1   . VAL B  1 93  ? -17.497 27.611  27.856  1.00 28.56 ? 93   VAL B CG1   1 
ATOM   1726  C  CG2   . VAL B  1 93  ? -19.142 29.116  28.982  1.00 28.86 ? 93   VAL B CG2   1 
ATOM   1727  N  N     . ILE B  1 94  ? -17.288 28.827  24.665  1.00 28.68 ? 94   ILE B N     1 
ATOM   1728  C  CA    . ILE B  1 94  ? -16.726 28.161  23.492  1.00 28.19 ? 94   ILE B CA    1 
ATOM   1729  C  C     . ILE B  1 94  ? -15.385 27.518  23.811  1.00 28.13 ? 94   ILE B C     1 
ATOM   1730  O  O     . ILE B  1 94  ? -14.472 28.190  24.287  1.00 28.12 ? 94   ILE B O     1 
ATOM   1731  C  CB    . ILE B  1 94  ? -16.593 29.140  22.298  1.00 28.20 ? 94   ILE B CB    1 
ATOM   1732  C  CG1   . ILE B  1 94  ? -17.968 29.620  21.844  1.00 28.02 ? 94   ILE B CG1   1 
ATOM   1733  C  CG2   . ILE B  1 94  ? -15.890 28.474  21.108  1.00 27.38 ? 94   ILE B CG2   1 
ATOM   1734  C  CD1   . ILE B  1 94  ? -18.163 31.089  21.966  1.00 28.58 ? 94   ILE B CD1   1 
ATOM   1735  N  N     . GLY B  1 95  ? -15.280 26.214  23.546  1.00 27.96 ? 95   GLY B N     1 
ATOM   1736  C  CA    . GLY B  1 95  ? -14.019 25.504  23.640  1.00 27.93 ? 95   GLY B CA    1 
ATOM   1737  C  C     . GLY B  1 95  ? -13.438 25.230  22.268  1.00 28.18 ? 95   GLY B C     1 
ATOM   1738  O  O     . GLY B  1 95  ? -14.172 24.843  21.358  1.00 28.16 ? 95   GLY B O     1 
ATOM   1739  N  N     . ILE B  1 96  ? -12.129 25.441  22.114  1.00 28.20 ? 96   ILE B N     1 
ATOM   1740  C  CA    . ILE B  1 96  ? -11.435 25.155  20.864  1.00 28.43 ? 96   ILE B CA    1 
ATOM   1741  C  C     . ILE B  1 96  ? -10.265 24.200  21.082  1.00 29.16 ? 96   ILE B C     1 
ATOM   1742  O  O     . ILE B  1 96  ? -9.306  24.511  21.804  1.00 29.04 ? 96   ILE B O     1 
ATOM   1743  C  CB    . ILE B  1 96  ? -10.954 26.451  20.151  1.00 28.45 ? 96   ILE B CB    1 
ATOM   1744  C  CG1   . ILE B  1 96  ? -12.104 27.440  19.958  1.00 27.68 ? 96   ILE B CG1   1 
ATOM   1745  C  CG2   . ILE B  1 96  ? -10.334 26.117  18.773  1.00 28.35 ? 96   ILE B CG2   1 
ATOM   1746  C  CD1   . ILE B  1 96  ? -11.639 28.819  19.625  1.00 27.60 ? 96   ILE B CD1   1 
ATOM   1747  N  N     . ASP B  1 97  ? -10.360 23.037  20.442  1.00 30.02 ? 97   ASP B N     1 
ATOM   1748  C  CA    . ASP B  1 97  ? -9.328  22.014  20.499  1.00 31.29 ? 97   ASP B CA    1 
ATOM   1749  C  C     . ASP B  1 97  ? -8.377  22.147  19.315  1.00 31.48 ? 97   ASP B C     1 
ATOM   1750  O  O     . ASP B  1 97  ? -8.818  22.330  18.181  1.00 31.64 ? 97   ASP B O     1 
ATOM   1751  C  CB    . ASP B  1 97  ? -9.975  20.628  20.485  1.00 31.69 ? 97   ASP B CB    1 
ATOM   1752  C  CG    . ASP B  1 97  ? -8.992  19.519  20.805  1.00 33.97 ? 97   ASP B CG    1 
ATOM   1753  O  OD1   . ASP B  1 97  ? -8.227  19.655  21.786  1.00 36.14 ? 97   ASP B OD1   1 
ATOM   1754  O  OD2   . ASP B  1 97  ? -8.915  18.463  20.138  1.00 37.84 ? 97   ASP B OD2   1 
ATOM   1755  N  N     . GLU B  1 98  ? -7.078  22.043  19.584  1.00 31.70 ? 98   GLU B N     1 
ATOM   1756  C  CA    . GLU B  1 98  ? -6.039  22.137  18.548  1.00 32.07 ? 98   GLU B CA    1 
ATOM   1757  C  C     . GLU B  1 98  ? -6.062  23.481  17.828  1.00 31.65 ? 98   GLU B C     1 
ATOM   1758  O  O     . GLU B  1 98  ? -6.052  23.538  16.596  1.00 31.59 ? 98   GLU B O     1 
ATOM   1759  C  CB    . GLU B  1 98  ? -6.144  20.979  17.541  1.00 31.94 ? 98   GLU B CB    1 
ATOM   1760  C  CG    . GLU B  1 98  ? -6.101  19.605  18.182  1.00 34.47 ? 98   GLU B CG    1 
ATOM   1761  C  CD    . GLU B  1 98  ? -5.833  18.478  17.201  1.00 38.53 ? 98   GLU B CD    1 
ATOM   1762  O  OE1   . GLU B  1 98  ? -5.613  18.737  15.995  1.00 40.94 ? 98   GLU B OE1   1 
ATOM   1763  O  OE2   . GLU B  1 98  ? -5.840  17.308  17.639  1.00 40.61 ? 98   GLU B OE2   1 
ATOM   1764  N  N     . GLY B  1 99  ? -6.094  24.555  18.616  1.00 31.44 ? 99   GLY B N     1 
ATOM   1765  C  CA    . GLY B  1 99  ? -6.205  25.915  18.114  1.00 30.97 ? 99   GLY B CA    1 
ATOM   1766  C  C     . GLY B  1 99  ? -5.106  26.338  17.154  1.00 30.95 ? 99   GLY B C     1 
ATOM   1767  O  O     . GLY B  1 99  ? -5.309  27.251  16.350  1.00 31.12 ? 99   GLY B O     1 
ATOM   1768  N  N     . GLN B  1 100 ? -3.954  25.669  17.226  1.00 30.57 ? 100  GLN B N     1 
ATOM   1769  C  CA    . GLN B  1 100 ? -2.804  25.970  16.372  1.00 30.47 ? 100  GLN B CA    1 
ATOM   1770  C  C     . GLN B  1 100 ? -3.094  25.814  14.876  1.00 30.86 ? 100  GLN B C     1 
ATOM   1771  O  O     . GLN B  1 100 ? -2.415  26.431  14.049  1.00 30.82 ? 100  GLN B O     1 
ATOM   1772  C  CB    . GLN B  1 100 ? -1.579  25.118  16.782  1.00 30.04 ? 100  GLN B CB    1 
ATOM   1773  C  CG    . GLN B  1 100 ? -1.652  23.607  16.470  1.00 28.79 ? 100  GLN B CG    1 
ATOM   1774  C  CD    . GLN B  1 100 ? -2.292  22.774  17.585  1.00 28.70 ? 100  GLN B CD    1 
ATOM   1775  O  OE1   . GLN B  1 100 ? -2.834  23.319  18.537  1.00 28.37 ? 100  GLN B OE1   1 
ATOM   1776  N  NE2   . GLN B  1 100 ? -2.237  21.452  17.452  1.00 27.26 ? 100  GLN B NE2   1 
ATOM   1777  N  N     . PHE B  1 101 ? -4.099  25.001  14.543  1.00 30.96 ? 101  PHE B N     1 
ATOM   1778  C  CA    . PHE B  1 101 ? -4.403  24.669  13.152  1.00 31.49 ? 101  PHE B CA    1 
ATOM   1779  C  C     . PHE B  1 101 ? -5.388  25.631  12.480  1.00 32.01 ? 101  PHE B C     1 
ATOM   1780  O  O     . PHE B  1 101 ? -5.597  25.544  11.272  1.00 32.35 ? 101  PHE B O     1 
ATOM   1781  C  CB    . PHE B  1 101 ? -4.908  23.219  13.015  1.00 31.09 ? 101  PHE B CB    1 
ATOM   1782  C  CG    . PHE B  1 101 ? -3.821  22.164  13.141  1.00 30.97 ? 101  PHE B CG    1 
ATOM   1783  C  CD1   . PHE B  1 101 ? -3.971  21.098  14.035  1.00 30.29 ? 101  PHE B CD1   1 
ATOM   1784  C  CD2   . PHE B  1 101 ? -2.661  22.227  12.367  1.00 29.67 ? 101  PHE B CD2   1 
ATOM   1785  C  CE1   . PHE B  1 101 ? -2.985  20.124  14.164  1.00 29.37 ? 101  PHE B CE1   1 
ATOM   1786  C  CE2   . PHE B  1 101 ? -1.666  21.263  12.492  1.00 29.36 ? 101  PHE B CE2   1 
ATOM   1787  C  CZ    . PHE B  1 101 ? -1.824  20.208  13.389  1.00 29.66 ? 101  PHE B CZ    1 
ATOM   1788  N  N     . PHE B  1 102 ? -5.991  26.531  13.254  1.00 32.45 ? 102  PHE B N     1 
ATOM   1789  C  CA    . PHE B  1 102 ? -6.936  27.498  12.708  1.00 32.77 ? 102  PHE B CA    1 
ATOM   1790  C  C     . PHE B  1 102 ? -6.211  28.800  12.402  1.00 33.39 ? 102  PHE B C     1 
ATOM   1791  O  O     . PHE B  1 102 ? -5.714  29.450  13.317  1.00 33.67 ? 102  PHE B O     1 
ATOM   1792  C  CB    . PHE B  1 102 ? -8.067  27.761  13.700  1.00 32.60 ? 102  PHE B CB    1 
ATOM   1793  C  CG    . PHE B  1 102 ? -8.980  26.594  13.908  1.00 31.67 ? 102  PHE B CG    1 
ATOM   1794  C  CD1   . PHE B  1 102 ? -9.964  26.284  12.972  1.00 31.01 ? 102  PHE B CD1   1 
ATOM   1795  C  CD2   . PHE B  1 102 ? -8.875  25.816  15.053  1.00 30.79 ? 102  PHE B CD2   1 
ATOM   1796  C  CE1   . PHE B  1 102 ? -10.819 25.207  13.169  1.00 30.43 ? 102  PHE B CE1   1 
ATOM   1797  C  CE2   . PHE B  1 102 ? -9.720  24.736  15.261  1.00 29.87 ? 102  PHE B CE2   1 
ATOM   1798  C  CZ    . PHE B  1 102 ? -10.698 24.434  14.321  1.00 30.47 ? 102  PHE B CZ    1 
ATOM   1799  N  N     . PRO B  1 103 ? -6.130  29.182  11.126  1.00 33.97 ? 103  PRO B N     1 
ATOM   1800  C  CA    . PRO B  1 103 ? -5.444  30.428  10.751  1.00 34.19 ? 103  PRO B CA    1 
ATOM   1801  C  C     . PRO B  1 103 ? -6.135  31.673  11.285  1.00 34.38 ? 103  PRO B C     1 
ATOM   1802  O  O     . PRO B  1 103 ? -5.481  32.715  11.391  1.00 34.58 ? 103  PRO B O     1 
ATOM   1803  C  CB    . PRO B  1 103 ? -5.444  30.407  9.212   1.00 34.32 ? 103  PRO B CB    1 
ATOM   1804  C  CG    . PRO B  1 103 ? -6.476  29.408  8.814   1.00 34.32 ? 103  PRO B CG    1 
ATOM   1805  C  CD    . PRO B  1 103 ? -6.633  28.441  9.952   1.00 34.08 ? 103  PRO B CD    1 
ATOM   1806  N  N     . ASP B  1 104 ? -7.417  31.563  11.632  1.00 34.36 ? 104  ASP B N     1 
ATOM   1807  C  CA    . ASP B  1 104 ? -8.178  32.707  12.142  1.00 34.45 ? 104  ASP B CA    1 
ATOM   1808  C  C     . ASP B  1 104 ? -8.415  32.670  13.665  1.00 34.26 ? 104  ASP B C     1 
ATOM   1809  O  O     . ASP B  1 104 ? -9.330  33.333  14.173  1.00 34.29 ? 104  ASP B O     1 
ATOM   1810  C  CB    . ASP B  1 104 ? -9.496  32.882  11.364  1.00 34.49 ? 104  ASP B CB    1 
ATOM   1811  C  CG    . ASP B  1 104 ? -10.321 31.589  11.274  1.00 35.56 ? 104  ASP B CG    1 
ATOM   1812  O  OD1   . ASP B  1 104 ? -11.382 31.624  10.602  1.00 36.41 ? 104  ASP B OD1   1 
ATOM   1813  O  OD2   . ASP B  1 104 ? -9.999  30.500  11.823  1.00 35.98 ? 104  ASP B OD2   1 
ATOM   1814  N  N     . ILE B  1 105 ? -7.574  31.928  14.388  1.00 33.97 ? 105  ILE B N     1 
ATOM   1815  C  CA    . ILE B  1 105 ? -7.738  31.762  15.836  1.00 33.85 ? 105  ILE B CA    1 
ATOM   1816  C  C     . ILE B  1 105 ? -7.781  33.070  16.614  1.00 33.98 ? 105  ILE B C     1 
ATOM   1817  O  O     . ILE B  1 105 ? -8.615  33.240  17.513  1.00 34.04 ? 105  ILE B O     1 
ATOM   1818  C  CB    . ILE B  1 105 ? -6.684  30.769  16.441  1.00 33.90 ? 105  ILE B CB    1 
ATOM   1819  C  CG1   . ILE B  1 105 ? -6.965  30.512  17.933  1.00 34.15 ? 105  ILE B CG1   1 
ATOM   1820  C  CG2   . ILE B  1 105 ? -5.263  31.294  16.283  1.00 33.96 ? 105  ILE B CG2   1 
ATOM   1821  C  CD1   . ILE B  1 105 ? -7.975  29.397  18.228  1.00 33.41 ? 105  ILE B CD1   1 
ATOM   1822  N  N     . VAL B  1 106 ? -6.909  34.003  16.251  1.00 34.17 ? 106  VAL B N     1 
ATOM   1823  C  CA    . VAL B  1 106 ? -6.763  35.260  16.981  1.00 34.37 ? 106  VAL B CA    1 
ATOM   1824  C  C     . VAL B  1 106 ? -8.005  36.152  16.840  1.00 34.70 ? 106  VAL B C     1 
ATOM   1825  O  O     . VAL B  1 106 ? -8.595  36.548  17.852  1.00 34.91 ? 106  VAL B O     1 
ATOM   1826  C  CB    . VAL B  1 106 ? -5.438  35.991  16.582  1.00 34.44 ? 106  VAL B CB    1 
ATOM   1827  C  CG1   . VAL B  1 106 ? -5.337  37.360  17.214  1.00 34.30 ? 106  VAL B CG1   1 
ATOM   1828  C  CG2   . VAL B  1 106 ? -4.232  35.145  16.966  1.00 34.26 ? 106  VAL B CG2   1 
ATOM   1829  N  N     . GLU B  1 107 ? -8.414  36.437  15.600  1.00 34.68 ? 107  GLU B N     1 
ATOM   1830  C  CA    . GLU B  1 107 ? -9.566  37.311  15.351  1.00 35.03 ? 107  GLU B CA    1 
ATOM   1831  C  C     . GLU B  1 107 ? -10.884 36.731  15.880  1.00 34.38 ? 107  GLU B C     1 
ATOM   1832  O  O     . GLU B  1 107 ? -11.731 37.474  16.375  1.00 34.46 ? 107  GLU B O     1 
ATOM   1833  C  CB    . GLU B  1 107 ? -9.663  37.730  13.862  1.00 35.58 ? 107  GLU B CB    1 
ATOM   1834  C  CG    . GLU B  1 107 ? -10.389 36.775  12.925  1.00 38.00 ? 107  GLU B CG    1 
ATOM   1835  C  CD    . GLU B  1 107 ? -10.414 37.259  11.473  1.00 43.01 ? 107  GLU B CD    1 
ATOM   1836  O  OE1   . GLU B  1 107 ? -9.800  36.590  10.595  1.00 44.08 ? 107  GLU B OE1   1 
ATOM   1837  O  OE2   . GLU B  1 107 ? -11.057 38.306  11.195  1.00 43.87 ? 107  GLU B OE2   1 
ATOM   1838  N  N     . PHE B  1 108 ? -11.032 35.408  15.796  1.00 33.70 ? 108  PHE B N     1 
ATOM   1839  C  CA    . PHE B  1 108 ? -12.211 34.721  16.298  1.00 33.13 ? 108  PHE B CA    1 
ATOM   1840  C  C     . PHE B  1 108 ? -12.331 34.844  17.827  1.00 33.06 ? 108  PHE B C     1 
ATOM   1841  O  O     . PHE B  1 108 ? -13.374 35.253  18.350  1.00 32.95 ? 108  PHE B O     1 
ATOM   1842  C  CB    . PHE B  1 108 ? -12.198 33.242  15.869  1.00 33.11 ? 108  PHE B CB    1 
ATOM   1843  C  CG    . PHE B  1 108 ? -13.402 32.460  16.345  1.00 32.61 ? 108  PHE B CG    1 
ATOM   1844  C  CD1   . PHE B  1 108 ? -14.599 32.497  15.632  1.00 32.32 ? 108  PHE B CD1   1 
ATOM   1845  C  CD2   . PHE B  1 108 ? -13.340 31.704  17.510  1.00 32.47 ? 108  PHE B CD2   1 
ATOM   1846  C  CE1   . PHE B  1 108 ? -15.718 31.784  16.066  1.00 32.34 ? 108  PHE B CE1   1 
ATOM   1847  C  CE2   . PHE B  1 108 ? -14.460 30.996  17.964  1.00 32.90 ? 108  PHE B CE2   1 
ATOM   1848  C  CZ    . PHE B  1 108 ? -15.654 31.035  17.233  1.00 32.34 ? 108  PHE B CZ    1 
ATOM   1849  N  N     . CYS B  1 109 ? -11.263 34.491  18.539  1.00 32.89 ? 109  CYS B N     1 
ATOM   1850  C  CA    . CYS B  1 109 ? -11.291 34.493  20.002  1.00 33.03 ? 109  CYS B CA    1 
ATOM   1851  C  C     . CYS B  1 109 ? -11.493 35.895  20.544  1.00 33.06 ? 109  CYS B C     1 
ATOM   1852  O  O     . CYS B  1 109 ? -12.280 36.109  21.472  1.00 32.67 ? 109  CYS B O     1 
ATOM   1853  C  CB    . CYS B  1 109 ? -10.026 33.867  20.586  1.00 32.73 ? 109  CYS B CB    1 
ATOM   1854  S  SG    . CYS B  1 109 ? -9.831  32.117  20.187  1.00 33.51 ? 109  CYS B SG    1 
ATOM   1855  N  N     . GLU B  1 110 ? -10.793 36.848  19.938  1.00 33.44 ? 110  GLU B N     1 
ATOM   1856  C  CA    . GLU B  1 110 ? -10.877 38.241  20.342  1.00 33.95 ? 110  GLU B CA    1 
ATOM   1857  C  C     . GLU B  1 110 ? -12.301 38.779  20.129  1.00 33.66 ? 110  GLU B C     1 
ATOM   1858  O  O     . GLU B  1 110 ? -12.868 39.428  21.007  1.00 34.00 ? 110  GLU B O     1 
ATOM   1859  C  CB    . GLU B  1 110 ? -9.816  39.045  19.582  1.00 34.21 ? 110  GLU B CB    1 
ATOM   1860  C  CG    . GLU B  1 110 ? -9.847  40.544  19.811  1.00 36.54 ? 110  GLU B CG    1 
ATOM   1861  C  CD    . GLU B  1 110 ? -9.449  40.959  21.220  1.00 38.44 ? 110  GLU B CD    1 
ATOM   1862  O  OE1   . GLU B  1 110 ? -9.689  42.138  21.549  1.00 39.44 ? 110  GLU B OE1   1 
ATOM   1863  O  OE2   . GLU B  1 110 ? -8.901  40.134  21.995  1.00 38.86 ? 110  GLU B OE2   1 
ATOM   1864  N  N     . ALA B  1 111 ? -12.884 38.470  18.978  1.00 33.36 ? 111  ALA B N     1 
ATOM   1865  C  CA    . ALA B  1 111 ? -14.251 38.877  18.653  1.00 33.29 ? 111  ALA B CA    1 
ATOM   1866  C  C     . ALA B  1 111 ? -15.282 38.256  19.586  1.00 33.17 ? 111  ALA B C     1 
ATOM   1867  O  O     . ALA B  1 111 ? -16.203 38.943  20.039  1.00 33.53 ? 111  ALA B O     1 
ATOM   1868  C  CB    . ALA B  1 111 ? -14.579 38.512  17.206  1.00 33.42 ? 111  ALA B CB    1 
ATOM   1869  N  N     . MET B  1 112 ? -15.137 36.959  19.862  1.00 32.90 ? 112  MET B N     1 
ATOM   1870  C  CA    . MET B  1 112 ? -16.050 36.260  20.773  1.00 32.93 ? 112  MET B CA    1 
ATOM   1871  C  C     . MET B  1 112 ? -15.943 36.753  22.219  1.00 32.68 ? 112  MET B C     1 
ATOM   1872  O  O     . MET B  1 112 ? -16.969 36.928  22.893  1.00 32.62 ? 112  MET B O     1 
ATOM   1873  C  CB    . MET B  1 112 ? -15.842 34.741  20.728  1.00 33.18 ? 112  MET B CB    1 
ATOM   1874  C  CG    . MET B  1 112 ? -16.201 34.078  19.408  1.00 34.22 ? 112  MET B CG    1 
ATOM   1875  S  SD    . MET B  1 112 ? -17.957 34.224  18.964  1.00 37.24 ? 112  MET B SD    1 
ATOM   1876  C  CE    . MET B  1 112 ? -17.792 34.824  17.277  1.00 36.41 ? 112  MET B CE    1 
ATOM   1877  N  N     . ALA B  1 113 ? -14.718 36.985  22.690  1.00 32.34 ? 113  ALA B N     1 
ATOM   1878  C  CA    . ALA B  1 113 ? -14.515 37.488  24.045  1.00 32.69 ? 113  ALA B CA    1 
ATOM   1879  C  C     . ALA B  1 113 ? -15.068 38.911  24.214  1.00 32.91 ? 113  ALA B C     1 
ATOM   1880  O  O     . ALA B  1 113 ? -15.620 39.249  25.265  1.00 32.99 ? 113  ALA B O     1 
ATOM   1881  C  CB    . ALA B  1 113 ? -13.045 37.423  24.442  1.00 32.27 ? 113  ALA B CB    1 
ATOM   1882  N  N     . ASN B  1 114 ? -14.920 39.735  23.181  1.00 33.06 ? 114  ASN B N     1 
ATOM   1883  C  CA    . ASN B  1 114 ? -15.433 41.103  23.213  1.00 33.42 ? 114  ASN B CA    1 
ATOM   1884  C  C     . ASN B  1 114 ? -16.961 41.149  23.124  1.00 33.59 ? 114  ASN B C     1 
ATOM   1885  O  O     . ASN B  1 114 ? -17.585 42.117  23.558  1.00 33.90 ? 114  ASN B O     1 
ATOM   1886  C  CB    . ASN B  1 114 ? -14.779 41.961  22.121  1.00 33.24 ? 114  ASN B CB    1 
ATOM   1887  C  CG    . ASN B  1 114 ? -13.301 42.236  22.399  1.00 33.49 ? 114  ASN B CG    1 
ATOM   1888  O  OD1   . ASN B  1 114 ? -12.854 42.227  23.546  1.00 34.57 ? 114  ASN B OD1   1 
ATOM   1889  N  ND2   . ASN B  1 114 ? -12.541 42.483  21.346  1.00 34.29 ? 114  ASN B ND2   1 
ATOM   1890  N  N     . ALA B  1 115 ? -17.550 40.087  22.572  1.00 33.56 ? 115  ALA B N     1 
ATOM   1891  C  CA    . ALA B  1 115 ? -19.002 39.895  22.568  1.00 33.39 ? 115  ALA B CA    1 
ATOM   1892  C  C     . ALA B  1 115 ? -19.514 39.259  23.867  1.00 33.35 ? 115  ALA B C     1 
ATOM   1893  O  O     . ALA B  1 115 ? -20.689 38.890  23.962  1.00 33.66 ? 115  ALA B O     1 
ATOM   1894  C  CB    . ALA B  1 115 ? -19.427 39.048  21.373  1.00 33.04 ? 115  ALA B CB    1 
ATOM   1895  N  N     . GLY B  1 116 ? -18.641 39.109  24.858  1.00 33.08 ? 116  GLY B N     1 
ATOM   1896  C  CA    . GLY B  1 116 ? -19.042 38.605  26.163  1.00 32.50 ? 116  GLY B CA    1 
ATOM   1897  C  C     . GLY B  1 116 ? -18.986 37.095  26.372  1.00 32.28 ? 116  GLY B C     1 
ATOM   1898  O  O     . GLY B  1 116 ? -19.491 36.586  27.369  1.00 32.38 ? 116  GLY B O     1 
ATOM   1899  N  N     . LYS B  1 117 ? -18.369 36.370  25.450  1.00 31.81 ? 117  LYS B N     1 
ATOM   1900  C  CA    . LYS B  1 117 ? -18.252 34.922  25.586  1.00 31.33 ? 117  LYS B CA    1 
ATOM   1901  C  C     . LYS B  1 117 ? -16.963 34.497  26.309  1.00 30.60 ? 117  LYS B C     1 
ATOM   1902  O  O     . LYS B  1 117 ? -15.949 35.203  26.257  1.00 30.37 ? 117  LYS B O     1 
ATOM   1903  C  CB    . LYS B  1 117 ? -18.335 34.271  24.199  1.00 31.70 ? 117  LYS B CB    1 
ATOM   1904  C  CG    . LYS B  1 117 ? -19.771 34.078  23.696  1.00 32.55 ? 117  LYS B CG    1 
ATOM   1905  C  CD    . LYS B  1 117 ? -20.267 35.259  22.883  1.00 33.58 ? 117  LYS B CD    1 
ATOM   1906  C  CE    . LYS B  1 117 ? -21.604 34.956  22.221  1.00 33.84 ? 117  LYS B CE    1 
ATOM   1907  N  NZ    . LYS B  1 117 ? -22.668 34.612  23.207  1.00 32.99 ? 117  LYS B NZ    1 
ATOM   1908  N  N     . THR B  1 118 ? -17.022 33.344  26.983  1.00 29.60 ? 118  THR B N     1 
ATOM   1909  C  CA    . THR B  1 118 ? -15.840 32.706  27.558  1.00 28.44 ? 118  THR B CA    1 
ATOM   1910  C  C     . THR B  1 118 ? -15.254 31.742  26.536  1.00 27.90 ? 118  THR B C     1 
ATOM   1911  O  O     . THR B  1 118 ? -15.897 30.757  26.160  1.00 28.00 ? 118  THR B O     1 
ATOM   1912  C  CB    . THR B  1 118 ? -16.212 31.975  28.868  1.00 28.57 ? 118  THR B CB    1 
ATOM   1913  O  OG1   . THR B  1 118 ? -16.423 32.937  29.910  1.00 28.93 ? 118  THR B OG1   1 
ATOM   1914  C  CG2   . THR B  1 118 ? -15.038 31.140  29.405  1.00 27.50 ? 118  THR B CG2   1 
ATOM   1915  N  N     . VAL B  1 119 ? -14.037 32.030  26.084  1.00 27.13 ? 119  VAL B N     1 
ATOM   1916  C  CA    . VAL B  1 119 ? -13.370 31.213  25.076  1.00 26.32 ? 119  VAL B CA    1 
ATOM   1917  C  C     . VAL B  1 119 ? -12.188 30.479  25.692  1.00 26.12 ? 119  VAL B C     1 
ATOM   1918  O  O     . VAL B  1 119 ? -11.307 31.097  26.296  1.00 26.14 ? 119  VAL B O     1 
ATOM   1919  C  CB    . VAL B  1 119 ? -12.879 32.081  23.904  1.00 26.58 ? 119  VAL B CB    1 
ATOM   1920  C  CG1   . VAL B  1 119 ? -12.484 31.223  22.695  1.00 25.87 ? 119  VAL B CG1   1 
ATOM   1921  C  CG2   . VAL B  1 119 ? -13.943 33.116  23.523  1.00 26.44 ? 119  VAL B CG2   1 
ATOM   1922  N  N     . ILE B  1 120 ? -12.174 29.157  25.549  1.00 25.40 ? 120  ILE B N     1 
ATOM   1923  C  CA    . ILE B  1 120 ? -11.124 28.321  26.118  1.00 24.77 ? 120  ILE B CA    1 
ATOM   1924  C  C     . ILE B  1 120 ? -10.428 27.571  24.987  1.00 24.65 ? 120  ILE B C     1 
ATOM   1925  O  O     . ILE B  1 120 ? -11.079 26.880  24.202  1.00 24.66 ? 120  ILE B O     1 
ATOM   1926  C  CB    . ILE B  1 120 ? -11.713 27.348  27.176  1.00 24.81 ? 120  ILE B CB    1 
ATOM   1927  C  CG1   . ILE B  1 120 ? -12.603 28.106  28.177  1.00 24.68 ? 120  ILE B CG1   1 
ATOM   1928  C  CG2   . ILE B  1 120 ? -10.605 26.609  27.919  1.00 24.06 ? 120  ILE B CG2   1 
ATOM   1929  C  CD1   . ILE B  1 120 ? -13.510 27.215  29.001  1.00 24.82 ? 120  ILE B CD1   1 
ATOM   1930  N  N     . VAL B  1 121 ? -9.108  27.721  24.897  1.00 24.22 ? 121  VAL B N     1 
ATOM   1931  C  CA    . VAL B  1 121 ? -8.348  27.199  23.763  1.00 23.90 ? 121  VAL B CA    1 
ATOM   1932  C  C     . VAL B  1 121 ? -7.275  26.229  24.230  1.00 23.99 ? 121  VAL B C     1 
ATOM   1933  O  O     . VAL B  1 121 ? -6.432  26.582  25.044  1.00 24.23 ? 121  VAL B O     1 
ATOM   1934  C  CB    . VAL B  1 121 ? -7.658  28.343  22.966  1.00 23.87 ? 121  VAL B CB    1 
ATOM   1935  C  CG1   . VAL B  1 121 ? -7.006  27.815  21.670  1.00 23.10 ? 121  VAL B CG1   1 
ATOM   1936  C  CG2   . VAL B  1 121 ? -8.635  29.467  22.664  1.00 23.99 ? 121  VAL B CG2   1 
ATOM   1937  N  N     . ALA B  1 122 ? -7.315  25.006  23.705  1.00 23.96 ? 122  ALA B N     1 
ATOM   1938  C  CA    . ALA B  1 122 ? -6.242  24.031  23.896  1.00 23.84 ? 122  ALA B CA    1 
ATOM   1939  C  C     . ALA B  1 122 ? -5.390  24.030  22.641  1.00 24.10 ? 122  ALA B C     1 
ATOM   1940  O  O     . ALA B  1 122 ? -5.925  23.984  21.522  1.00 23.80 ? 122  ALA B O     1 
ATOM   1941  C  CB    . ALA B  1 122 ? -6.812  22.644  24.152  1.00 23.46 ? 122  ALA B CB    1 
ATOM   1942  N  N     . ALA B  1 123 ? -4.071  24.109  22.815  1.00 24.44 ? 123  ALA B N     1 
ATOM   1943  C  CA    . ALA B  1 123 ? -3.171  24.202  21.674  1.00 24.81 ? 123  ALA B CA    1 
ATOM   1944  C  C     . ALA B  1 123 ? -1.720  23.876  22.010  1.00 25.48 ? 123  ALA B C     1 
ATOM   1945  O  O     . ALA B  1 123 ? -1.245  24.115  23.121  1.00 25.47 ? 123  ALA B O     1 
ATOM   1946  C  CB    . ALA B  1 123 ? -3.275  25.570  21.033  1.00 24.48 ? 123  ALA B CB    1 
ATOM   1947  N  N     . LEU B  1 124 ? -1.034  23.392  21.005  1.00 26.39 ? 124  LEU B N     1 
ATOM   1948  C  CA    . LEU B  1 124 ? 0.380   23.179  21.058  1.00 27.57 ? 124  LEU B CA    1 
ATOM   1949  C  C     . LEU B  1 124 ? 1.005   24.582  20.985  1.00 28.37 ? 124  LEU B C     1 
ATOM   1950  O  O     . LEU B  1 124 ? 0.610   25.398  20.141  1.00 28.69 ? 124  LEU B O     1 
ATOM   1951  C  CB    . LEU B  1 124 ? 0.896   22.415  19.799  1.00 27.38 ? 124  LEU B CB    1 
ATOM   1952  C  CG    . LEU B  1 124 ? 1.249   20.937  19.860  1.00 28.01 ? 124  LEU B CG    1 
ATOM   1953  C  CD1   . LEU B  1 124 ? 0.638   20.301  21.100  1.00 25.64 ? 124  LEU B CD1   1 
ATOM   1954  C  CD2   . LEU B  1 124 ? 0.794   20.224  18.595  1.00 27.57 ? 124  LEU B CD2   1 
ATOM   1955  N  N     . ASP B  1 125 ? 1.966   24.871  21.848  1.00 29.20 ? 125  ASP B N     1 
ATOM   1956  C  CA    . ASP B  1 125 ? 2.737   26.107  21.745  1.00 30.28 ? 125  ASP B CA    1 
ATOM   1957  C  C     . ASP B  1 125 ? 3.825   25.988  20.670  1.00 30.23 ? 125  ASP B C     1 
ATOM   1958  O  O     . ASP B  1 125 ? 4.132   26.968  19.963  1.00 30.51 ? 125  ASP B O     1 
ATOM   1959  C  CB    . ASP B  1 125 ? 3.390   26.446  23.085  1.00 30.54 ? 125  ASP B CB    1 
ATOM   1960  C  CG    . ASP B  1 125 ? 4.111   25.254  23.707  1.00 33.29 ? 125  ASP B CG    1 
ATOM   1961  O  OD1   . ASP B  1 125 ? 5.132   25.475  24.404  1.00 36.51 ? 125  ASP B OD1   1 
ATOM   1962  O  OD2   . ASP B  1 125 ? 3.743   24.060  23.558  1.00 36.12 ? 125  ASP B OD2   1 
ATOM   1963  N  N     . GLY B  1 126 ? 4.404   24.790  20.553  1.00 29.65 ? 126  GLY B N     1 
ATOM   1964  C  CA    . GLY B  1 126 ? 5.526   24.575  19.664  1.00 29.25 ? 126  GLY B CA    1 
ATOM   1965  C  C     . GLY B  1 126 ? 5.340   23.450  18.670  1.00 29.08 ? 126  GLY B C     1 
ATOM   1966  O  O     . GLY B  1 126 ? 4.664   22.465  18.937  1.00 29.04 ? 126  GLY B O     1 
ATOM   1967  N  N     . THR B  1 127 ? 5.950   23.611  17.505  1.00 28.86 ? 127  THR B N     1 
ATOM   1968  C  CA    . THR B  1 127 ? 6.029   22.542  16.525  1.00 28.66 ? 127  THR B CA    1 
ATOM   1969  C  C     . THR B  1 127 ? 7.096   21.546  16.955  1.00 28.78 ? 127  THR B C     1 
ATOM   1970  O  O     . THR B  1 127 ? 7.698   21.687  18.009  1.00 28.39 ? 127  THR B O     1 
ATOM   1971  C  CB    . THR B  1 127 ? 6.354   23.099  15.119  1.00 28.68 ? 127  THR B CB    1 
ATOM   1972  O  OG1   . THR B  1 127 ? 7.690   23.612  15.102  1.00 28.22 ? 127  THR B OG1   1 
ATOM   1973  C  CG2   . THR B  1 127 ? 5.484   24.315  14.780  1.00 27.90 ? 127  THR B CG2   1 
ATOM   1974  N  N     . PHE B  1 128 ? 7.310   20.531  16.125  1.00 29.25 ? 128  PHE B N     1 
ATOM   1975  C  CA    . PHE B  1 128 ? 8.395   19.568  16.305  1.00 29.67 ? 128  PHE B CA    1 
ATOM   1976  C  C     . PHE B  1 128 ? 9.778   20.223  16.251  1.00 30.02 ? 128  PHE B C     1 
ATOM   1977  O  O     . PHE B  1 128 ? 10.775  19.611  16.621  1.00 30.31 ? 128  PHE B O     1 
ATOM   1978  C  CB    . PHE B  1 128 ? 8.286   18.452  15.254  1.00 29.71 ? 128  PHE B CB    1 
ATOM   1979  C  CG    . PHE B  1 128 ? 8.779   18.844  13.880  1.00 29.20 ? 128  PHE B CG    1 
ATOM   1980  C  CD1   . PHE B  1 128 ? 10.035  18.429  13.431  1.00 29.49 ? 128  PHE B CD1   1 
ATOM   1981  C  CD2   . PHE B  1 128 ? 7.984   19.607  13.031  1.00 28.68 ? 128  PHE B CD2   1 
ATOM   1982  C  CE1   . PHE B  1 128 ? 10.493  18.781  12.164  1.00 29.48 ? 128  PHE B CE1   1 
ATOM   1983  C  CE2   . PHE B  1 128 ? 8.428   19.966  11.764  1.00 29.30 ? 128  PHE B CE2   1 
ATOM   1984  C  CZ    . PHE B  1 128 ? 9.686   19.553  11.325  1.00 29.75 ? 128  PHE B CZ    1 
ATOM   1985  N  N     . GLN B  1 129 ? 9.839   21.465  15.790  1.00 30.57 ? 129  GLN B N     1 
ATOM   1986  C  CA    . GLN B  1 129 ? 11.105  22.194  15.745  1.00 31.41 ? 129  GLN B CA    1 
ATOM   1987  C  C     . GLN B  1 129 ? 11.256  23.176  16.904  1.00 31.54 ? 129  GLN B C     1 
ATOM   1988  O  O     . GLN B  1 129 ? 12.203  23.968  16.935  1.00 31.36 ? 129  GLN B O     1 
ATOM   1989  C  CB    . GLN B  1 129 ? 11.248  22.937  14.425  1.00 31.39 ? 129  GLN B CB    1 
ATOM   1990  C  CG    . GLN B  1 129 ? 11.482  22.042  13.234  1.00 32.91 ? 129  GLN B CG    1 
ATOM   1991  C  CD    . GLN B  1 129 ? 11.525  22.816  11.937  1.00 35.31 ? 129  GLN B CD    1 
ATOM   1992  O  OE1   . GLN B  1 129 ? 12.474  22.682  11.167  1.00 37.08 ? 129  GLN B OE1   1 
ATOM   1993  N  NE2   . GLN B  1 129 ? 10.507  23.632  11.691  1.00 35.14 ? 129  GLN B NE2   1 
ATOM   1994  N  N     . ARG B  1 130 ? 10.320  23.108  17.855  1.00 31.67 ? 130  ARG B N     1 
ATOM   1995  C  CA    . ARG B  1 130 ? 10.236  24.045  18.989  1.00 31.89 ? 130  ARG B CA    1 
ATOM   1996  C  C     . ARG B  1 130 ? 10.145  25.506  18.531  1.00 31.84 ? 130  ARG B C     1 
ATOM   1997  O  O     . ARG B  1 130 ? 10.719  26.400  19.141  1.00 31.78 ? 130  ARG B O     1 
ATOM   1998  C  CB    . ARG B  1 130 ? 11.373  23.834  20.002  1.00 31.76 ? 130  ARG B CB    1 
ATOM   1999  C  CG    . ARG B  1 130 ? 11.372  22.457  20.671  1.00 32.86 ? 130  ARG B CG    1 
ATOM   2000  C  CD    . ARG B  1 130 ? 12.377  22.292  21.818  1.00 34.29 ? 130  ARG B CD    1 
ATOM   2001  N  NE    . ARG B  1 130 ? 13.642  22.910  21.469  1.00 37.36 ? 130  ARG B NE    1 
ATOM   2002  C  CZ    . ARG B  1 130 ? 14.364  23.696  22.261  1.00 37.36 ? 130  ARG B CZ    1 
ATOM   2003  N  NH1   . ARG B  1 130 ? 13.985  23.969  23.511  1.00 36.37 ? 130  ARG B NH1   1 
ATOM   2004  N  NH2   . ARG B  1 130 ? 15.486  24.209  21.775  1.00 36.80 ? 130  ARG B NH2   1 
ATOM   2005  N  N     . LYS B  1 131 ? 9.402   25.719  17.450  1.00 31.89 ? 131  LYS B N     1 
ATOM   2006  C  CA    . LYS B  1 131 ? 9.105   27.049  16.928  1.00 32.37 ? 131  LYS B CA    1 
ATOM   2007  C  C     . LYS B  1 131 ? 7.624   27.334  17.192  1.00 31.87 ? 131  LYS B C     1 
ATOM   2008  O  O     . LYS B  1 131 ? 6.859   26.394  17.370  1.00 31.68 ? 131  LYS B O     1 
ATOM   2009  C  CB    . LYS B  1 131 ? 9.386   27.098  15.421  1.00 32.62 ? 131  LYS B CB    1 
ATOM   2010  C  CG    . LYS B  1 131 ? 10.864  26.971  15.041  1.00 34.82 ? 131  LYS B CG    1 
ATOM   2011  C  CD    . LYS B  1 131 ? 11.113  27.467  13.617  1.00 38.08 ? 131  LYS B CD    1 
ATOM   2012  C  CE    . LYS B  1 131 ? 12.368  26.841  13.032  1.00 40.68 ? 131  LYS B CE    1 
ATOM   2013  N  NZ    . LYS B  1 131 ? 13.595  27.391  13.690  1.00 42.12 ? 131  LYS B NZ    1 
ATOM   2014  N  N     . PRO B  1 132 ? 7.211   28.606  17.208  1.00 31.76 ? 132  PRO B N     1 
ATOM   2015  C  CA    . PRO B  1 132 ? 5.798   28.933  17.427  1.00 31.58 ? 132  PRO B CA    1 
ATOM   2016  C  C     . PRO B  1 132 ? 4.943   28.207  16.404  1.00 31.69 ? 132  PRO B C     1 
ATOM   2017  O  O     . PRO B  1 132 ? 5.297   28.157  15.225  1.00 31.41 ? 132  PRO B O     1 
ATOM   2018  C  CB    . PRO B  1 132 ? 5.743   30.445  17.208  1.00 31.37 ? 132  PRO B CB    1 
ATOM   2019  C  CG    . PRO B  1 132 ? 7.114   30.909  17.493  1.00 31.52 ? 132  PRO B CG    1 
ATOM   2020  C  CD    . PRO B  1 132 ? 8.020   29.825  16.988  1.00 31.67 ? 132  PRO B CD    1 
ATOM   2021  N  N     . PHE B  1 133 ? 3.848   27.614  16.868  1.00 31.84 ? 133  PHE B N     1 
ATOM   2022  C  CA    . PHE B  1 133 ? 2.957   26.856  16.000  1.00 32.05 ? 133  PHE B CA    1 
ATOM   2023  C  C     . PHE B  1 133 ? 1.855   27.769  15.467  1.00 32.49 ? 133  PHE B C     1 
ATOM   2024  O  O     . PHE B  1 133 ? 0.905   28.079  16.184  1.00 32.70 ? 133  PHE B O     1 
ATOM   2025  C  CB    . PHE B  1 133 ? 2.348   25.676  16.773  1.00 31.61 ? 133  PHE B CB    1 
ATOM   2026  C  CG    . PHE B  1 133 ? 1.949   24.509  15.910  1.00 31.27 ? 133  PHE B CG    1 
ATOM   2027  C  CD1   . PHE B  1 133 ? 2.174   23.207  16.345  1.00 30.53 ? 133  PHE B CD1   1 
ATOM   2028  C  CD2   . PHE B  1 133 ? 1.345   24.703  14.667  1.00 30.10 ? 133  PHE B CD2   1 
ATOM   2029  C  CE1   . PHE B  1 133 ? 1.801   22.122  15.566  1.00 30.72 ? 133  PHE B CE1   1 
ATOM   2030  C  CE2   . PHE B  1 133 ? 0.966   23.619  13.882  1.00 30.01 ? 133  PHE B CE2   1 
ATOM   2031  C  CZ    . PHE B  1 133 ? 1.200   22.329  14.327  1.00 30.56 ? 133  PHE B CZ    1 
ATOM   2032  N  N     . GLY B  1 134 ? 1.988   28.189  14.209  1.00 32.96 ? 134  GLY B N     1 
ATOM   2033  C  CA    . GLY B  1 134 ? 1.021   29.070  13.577  1.00 33.06 ? 134  GLY B CA    1 
ATOM   2034  C  C     . GLY B  1 134 ? 0.945   30.406  14.294  1.00 33.19 ? 134  GLY B C     1 
ATOM   2035  O  O     . GLY B  1 134 ? 1.967   30.960  14.690  1.00 33.21 ? 134  GLY B O     1 
ATOM   2036  N  N     . ALA B  1 135 ? -0.277  30.895  14.490  1.00 33.09 ? 135  ALA B N     1 
ATOM   2037  C  CA    . ALA B  1 135 ? -0.515  32.229  15.038  1.00 33.09 ? 135  ALA B CA    1 
ATOM   2038  C  C     . ALA B  1 135 ? -0.842  32.179  16.528  1.00 32.90 ? 135  ALA B C     1 
ATOM   2039  O  O     . ALA B  1 135 ? -1.161  33.195  17.140  1.00 32.81 ? 135  ALA B O     1 
ATOM   2040  C  CB    . ALA B  1 135 ? -1.651  32.914  14.265  1.00 32.75 ? 135  ALA B CB    1 
ATOM   2041  N  N     . ILE B  1 136 ? -0.730  30.993  17.107  1.00 32.84 ? 136  ILE B N     1 
ATOM   2042  C  CA    . ILE B  1 136 ? -1.267  30.718  18.432  1.00 32.84 ? 136  ILE B CA    1 
ATOM   2043  C  C     . ILE B  1 136 ? -0.715  31.583  19.573  1.00 32.59 ? 136  ILE B C     1 
ATOM   2044  O  O     . ILE B  1 136 ? -1.442  31.927  20.505  1.00 32.44 ? 136  ILE B O     1 
ATOM   2045  C  CB    . ILE B  1 136 ? -1.176  29.181  18.744  1.00 32.98 ? 136  ILE B CB    1 
ATOM   2046  C  CG1   . ILE B  1 136 ? -2.209  28.790  19.801  1.00 33.32 ? 136  ILE B CG1   1 
ATOM   2047  C  CG2   . ILE B  1 136 ? 0.241   28.750  19.148  1.00 32.76 ? 136  ILE B CG2   1 
ATOM   2048  C  CD1   . ILE B  1 136 ? -3.621  28.754  19.268  1.00 33.91 ? 136  ILE B CD1   1 
ATOM   2049  N  N     . LEU B  1 137 ? 0.556   31.962  19.482  1.00 32.32 ? 137  LEU B N     1 
ATOM   2050  C  CA    . LEU B  1 137 ? 1.186   32.760  20.532  1.00 31.93 ? 137  LEU B CA    1 
ATOM   2051  C  C     . LEU B  1 137 ? 0.687   34.211  20.574  1.00 31.73 ? 137  LEU B C     1 
ATOM   2052  O  O     . LEU B  1 137 ? 0.799   34.878  21.605  1.00 31.43 ? 137  LEU B O     1 
ATOM   2053  C  CB    . LEU B  1 137 ? 2.716   32.678  20.431  1.00 32.05 ? 137  LEU B CB    1 
ATOM   2054  C  CG    . LEU B  1 137 ? 3.347   31.290  20.707  1.00 32.72 ? 137  LEU B CG    1 
ATOM   2055  C  CD1   . LEU B  1 137 ? 4.868   31.377  20.841  1.00 31.86 ? 137  LEU B CD1   1 
ATOM   2056  C  CD2   . LEU B  1 137 ? 2.747   30.570  21.923  1.00 31.86 ? 137  LEU B CD2   1 
ATOM   2057  N  N     . ASN B  1 138 ? 0.113   34.685  19.465  1.00 31.43 ? 138  ASN B N     1 
ATOM   2058  C  CA    . ASN B  1 138 ? -0.530  36.004  19.437  1.00 31.22 ? 138  ASN B CA    1 
ATOM   2059  C  C     . ASN B  1 138 ? -1.759  36.078  20.344  1.00 30.61 ? 138  ASN B C     1 
ATOM   2060  O  O     . ASN B  1 138 ? -2.256  37.159  20.614  1.00 30.54 ? 138  ASN B O     1 
ATOM   2061  C  CB    . ASN B  1 138 ? -0.898  36.426  18.005  1.00 31.40 ? 138  ASN B CB    1 
ATOM   2062  C  CG    . ASN B  1 138 ? 0.322   36.577  17.093  1.00 32.41 ? 138  ASN B CG    1 
ATOM   2063  O  OD1   . ASN B  1 138 ? 1.232   37.352  17.367  1.00 33.50 ? 138  ASN B OD1   1 
ATOM   2064  N  ND2   . ASN B  1 138 ? 0.326   35.839  15.992  1.00 33.96 ? 138  ASN B ND2   1 
ATOM   2065  N  N     . LEU B  1 139 ? -2.245  34.928  20.806  1.00 30.06 ? 139  LEU B N     1 
ATOM   2066  C  CA    . LEU B  1 139 ? -3.340  34.892  21.781  1.00 29.76 ? 139  LEU B CA    1 
ATOM   2067  C  C     . LEU B  1 139 ? -2.893  35.277  23.179  1.00 29.41 ? 139  LEU B C     1 
ATOM   2068  O  O     . LEU B  1 139 ? -3.685  35.799  23.949  1.00 29.46 ? 139  LEU B O     1 
ATOM   2069  C  CB    . LEU B  1 139 ? -3.979  33.506  21.852  1.00 29.57 ? 139  LEU B CB    1 
ATOM   2070  C  CG    . LEU B  1 139 ? -5.122  33.133  20.917  1.00 29.87 ? 139  LEU B CG    1 
ATOM   2071  C  CD1   . LEU B  1 139 ? -5.683  31.818  21.411  1.00 30.17 ? 139  LEU B CD1   1 
ATOM   2072  C  CD2   . LEU B  1 139 ? -6.213  34.208  20.833  1.00 29.55 ? 139  LEU B CD2   1 
ATOM   2073  N  N     . VAL B  1 140 ? -1.629  34.998  23.502  1.00 29.15 ? 140  VAL B N     1 
ATOM   2074  C  CA    . VAL B  1 140 ? -1.094  35.206  24.852  1.00 28.99 ? 140  VAL B CA    1 
ATOM   2075  C  C     . VAL B  1 140 ? -1.288  36.635  25.407  1.00 29.17 ? 140  VAL B C     1 
ATOM   2076  O  O     . VAL B  1 140 ? -1.806  36.782  26.517  1.00 29.40 ? 140  VAL B O     1 
ATOM   2077  C  CB    . VAL B  1 140 ? 0.379   34.734  24.967  1.00 29.11 ? 140  VAL B CB    1 
ATOM   2078  C  CG1   . VAL B  1 140 ? 0.942   35.013  26.358  1.00 28.26 ? 140  VAL B CG1   1 
ATOM   2079  C  CG2   . VAL B  1 140 ? 0.501   33.240  24.604  1.00 28.25 ? 140  VAL B CG2   1 
ATOM   2080  N  N     . PRO B  1 141 ? -0.923  37.679  24.650  1.00 29.02 ? 141  PRO B N     1 
ATOM   2081  C  CA    . PRO B  1 141 ? -1.148  39.058  25.108  1.00 28.86 ? 141  PRO B CA    1 
ATOM   2082  C  C     . PRO B  1 141 ? -2.634  39.440  25.141  1.00 28.96 ? 141  PRO B C     1 
ATOM   2083  O  O     . PRO B  1 141 ? -2.980  40.475  25.716  1.00 28.95 ? 141  PRO B O     1 
ATOM   2084  C  CB    . PRO B  1 141 ? -0.392  39.914  24.072  1.00 28.91 ? 141  PRO B CB    1 
ATOM   2085  C  CG    . PRO B  1 141 ? 0.432   38.956  23.267  1.00 28.72 ? 141  PRO B CG    1 
ATOM   2086  C  CD    . PRO B  1 141 ? -0.288  37.648  23.317  1.00 28.71 ? 141  PRO B CD    1 
ATOM   2087  N  N     . LEU B  1 142 ? -3.494  38.618  24.545  1.00 28.86 ? 142  LEU B N     1 
ATOM   2088  C  CA    . LEU B  1 142 ? -4.941  38.874  24.559  1.00 28.86 ? 142  LEU B CA    1 
ATOM   2089  C  C     . LEU B  1 142 ? -5.680  38.089  25.629  1.00 28.91 ? 142  LEU B C     1 
ATOM   2090  O  O     . LEU B  1 142 ? -6.858  38.344  25.883  1.00 28.98 ? 142  LEU B O     1 
ATOM   2091  C  CB    . LEU B  1 142 ? -5.568  38.584  23.189  1.00 28.78 ? 142  LEU B CB    1 
ATOM   2092  C  CG    . LEU B  1 142 ? -4.903  39.222  21.964  1.00 28.81 ? 142  LEU B CG    1 
ATOM   2093  C  CD1   . LEU B  1 142 ? -5.350  38.520  20.696  1.00 28.62 ? 142  LEU B CD1   1 
ATOM   2094  C  CD2   . LEU B  1 142 ? -5.177  40.721  21.877  1.00 27.91 ? 142  LEU B CD2   1 
ATOM   2095  N  N     . ALA B  1 143 ? -4.985  37.150  26.271  1.00 28.99 ? 143  ALA B N     1 
ATOM   2096  C  CA    . ALA B  1 143 ? -5.635  36.188  27.161  1.00 29.04 ? 143  ALA B CA    1 
ATOM   2097  C  C     . ALA B  1 143 ? -5.575  36.602  28.620  1.00 29.31 ? 143  ALA B C     1 
ATOM   2098  O  O     . ALA B  1 143 ? -4.576  37.174  29.073  1.00 29.20 ? 143  ALA B O     1 
ATOM   2099  C  CB    . ALA B  1 143 ? -5.023  34.801  26.973  1.00 28.69 ? 143  ALA B CB    1 
ATOM   2100  N  N     . GLU B  1 144 ? -6.642  36.307  29.363  1.00 29.69 ? 144  GLU B N     1 
ATOM   2101  C  CA    . GLU B  1 144 ? -6.647  36.608  30.791  1.00 30.23 ? 144  GLU B CA    1 
ATOM   2102  C  C     . GLU B  1 144 ? -6.038  35.473  31.595  1.00 29.88 ? 144  GLU B C     1 
ATOM   2103  O  O     . GLU B  1 144 ? -5.671  35.651  32.745  1.00 30.10 ? 144  GLU B O     1 
ATOM   2104  C  CB    . GLU B  1 144 ? -8.047  36.995  31.303  1.00 30.67 ? 144  GLU B CB    1 
ATOM   2105  C  CG    . GLU B  1 144 ? -9.185  36.680  30.349  1.00 32.74 ? 144  GLU B CG    1 
ATOM   2106  C  CD    . GLU B  1 144 ? -9.476  37.777  29.332  1.00 34.22 ? 144  GLU B CD    1 
ATOM   2107  O  OE1   . GLU B  1 144 ? -9.943  38.867  29.742  1.00 34.62 ? 144  GLU B OE1   1 
ATOM   2108  O  OE2   . GLU B  1 144 ? -9.272  37.530  28.115  1.00 33.42 ? 144  GLU B OE2   1 
ATOM   2109  N  N     . SER B  1 145 ? -5.916  34.307  30.968  1.00 29.50 ? 145  SER B N     1 
ATOM   2110  C  CA    . SER B  1 145 ? -5.389  33.125  31.620  1.00 29.06 ? 145  SER B CA    1 
ATOM   2111  C  C     . SER B  1 145 ? -4.542  32.311  30.643  1.00 28.81 ? 145  SER B C     1 
ATOM   2112  O  O     . SER B  1 145 ? -4.976  31.999  29.534  1.00 28.78 ? 145  SER B O     1 
ATOM   2113  C  CB    . SER B  1 145 ? -6.541  32.282  32.161  1.00 29.18 ? 145  SER B CB    1 
ATOM   2114  O  OG    . SER B  1 145 ? -6.064  31.193  32.930  1.00 30.37 ? 145  SER B OG    1 
ATOM   2115  N  N     . VAL B  1 146 ? -3.321  31.989  31.047  1.00 28.30 ? 146  VAL B N     1 
ATOM   2116  C  CA    . VAL B  1 146 ? -2.423  31.209  30.205  1.00 28.02 ? 146  VAL B CA    1 
ATOM   2117  C  C     . VAL B  1 146 ? -1.701  30.195  31.075  1.00 27.93 ? 146  VAL B C     1 
ATOM   2118  O  O     . VAL B  1 146 ? -1.089  30.552  32.078  1.00 27.91 ? 146  VAL B O     1 
ATOM   2119  C  CB    . VAL B  1 146 ? -1.393  32.096  29.454  1.00 27.86 ? 146  VAL B CB    1 
ATOM   2120  C  CG1   . VAL B  1 146 ? -0.496  31.238  28.554  1.00 28.03 ? 146  VAL B CG1   1 
ATOM   2121  C  CG2   . VAL B  1 146 ? -2.091  33.149  28.620  1.00 27.22 ? 146  VAL B CG2   1 
ATOM   2122  N  N     . VAL B  1 147 ? -1.797  28.930  30.686  1.00 27.85 ? 147  VAL B N     1 
ATOM   2123  C  CA    . VAL B  1 147 ? -1.136  27.837  31.387  1.00 27.82 ? 147  VAL B CA    1 
ATOM   2124  C  C     . VAL B  1 147 ? -0.376  26.963  30.380  1.00 27.72 ? 147  VAL B C     1 
ATOM   2125  O  O     . VAL B  1 147 ? -0.794  26.831  29.222  1.00 27.30 ? 147  VAL B O     1 
ATOM   2126  C  CB    . VAL B  1 147 ? -2.171  27.014  32.210  1.00 27.83 ? 147  VAL B CB    1 
ATOM   2127  C  CG1   . VAL B  1 147 ? -2.909  26.006  31.349  1.00 27.58 ? 147  VAL B CG1   1 
ATOM   2128  C  CG2   . VAL B  1 147 ? -1.510  26.315  33.361  1.00 29.53 ? 147  VAL B CG2   1 
ATOM   2129  N  N     . LYS B  1 148 ? 0.752   26.402  30.808  1.00 27.75 ? 148  LYS B N     1 
ATOM   2130  C  CA    . LYS B  1 148 ? 1.470   25.419  30.008  1.00 27.70 ? 148  LYS B CA    1 
ATOM   2131  C  C     . LYS B  1 148 ? 1.571   24.098  30.757  1.00 27.83 ? 148  LYS B C     1 
ATOM   2132  O  O     . LYS B  1 148 ? 2.212   24.015  31.805  1.00 27.85 ? 148  LYS B O     1 
ATOM   2133  C  CB    . LYS B  1 148 ? 2.862   25.918  29.594  1.00 27.94 ? 148  LYS B CB    1 
ATOM   2134  C  CG    . LYS B  1 148 ? 3.556   24.977  28.597  1.00 27.64 ? 148  LYS B CG    1 
ATOM   2135  C  CD    . LYS B  1 148 ? 4.772   25.580  27.921  1.00 28.84 ? 148  LYS B CD    1 
ATOM   2136  C  CE    . LYS B  1 148 ? 5.711   24.451  27.460  1.00 29.80 ? 148  LYS B CE    1 
ATOM   2137  N  NZ    . LYS B  1 148 ? 6.587   24.807  26.320  1.00 29.81 ? 148  LYS B NZ    1 
ATOM   2138  N  N     . LEU B  1 149 ? 0.915   23.074  30.220  1.00 27.86 ? 149  LEU B N     1 
ATOM   2139  C  CA    . LEU B  1 149 ? 0.886   21.758  30.848  1.00 28.03 ? 149  LEU B CA    1 
ATOM   2140  C  C     . LEU B  1 149 ? 2.146   20.988  30.513  1.00 28.46 ? 149  LEU B C     1 
ATOM   2141  O  O     . LEU B  1 149 ? 2.914   21.361  29.628  1.00 28.82 ? 149  LEU B O     1 
ATOM   2142  C  CB    . LEU B  1 149 ? -0.353  20.952  30.422  1.00 27.76 ? 149  LEU B CB    1 
ATOM   2143  C  CG    . LEU B  1 149 ? -1.745  21.565  30.635  1.00 27.60 ? 149  LEU B CG    1 
ATOM   2144  C  CD1   . LEU B  1 149 ? -2.847  20.584  30.207  1.00 26.00 ? 149  LEU B CD1   1 
ATOM   2145  C  CD2   . LEU B  1 149 ? -1.943  22.018  32.085  1.00 26.14 ? 149  LEU B CD2   1 
ATOM   2146  N  N     . THR B  1 150 ? 2.347   19.894  31.222  1.00 28.89 ? 150  THR B N     1 
ATOM   2147  C  CA    . THR B  1 150 ? 3.547   19.103  31.054  1.00 29.29 ? 150  THR B CA    1 
ATOM   2148  C  C     . THR B  1 150 ? 3.188   17.650  30.731  1.00 28.98 ? 150  THR B C     1 
ATOM   2149  O  O     . THR B  1 150 ? 2.123   17.146  31.119  1.00 28.55 ? 150  THR B O     1 
ATOM   2150  C  CB    . THR B  1 150 ? 4.424   19.228  32.312  1.00 29.51 ? 150  THR B CB    1 
ATOM   2151  O  OG1   . THR B  1 150 ? 5.735   18.744  32.019  1.00 32.89 ? 150  THR B OG1   1 
ATOM   2152  C  CG2   . THR B  1 150 ? 3.940   18.299  33.429  1.00 29.31 ? 150  THR B CG2   1 
ATOM   2153  N  N     . ALA B  1 151 ? 4.075   16.989  30.001  1.00 28.85 ? 151  ALA B N     1 
ATOM   2154  C  CA    . ALA B  1 151 ? 3.903   15.575  29.702  1.00 28.87 ? 151  ALA B CA    1 
ATOM   2155  C  C     . ALA B  1 151 ? 5.018   14.781  30.362  1.00 29.03 ? 151  ALA B C     1 
ATOM   2156  O  O     . ALA B  1 151 ? 5.884   15.354  31.017  1.00 28.90 ? 151  ALA B O     1 
ATOM   2157  C  CB    . ALA B  1 151 ? 3.877   15.347  28.194  1.00 28.54 ? 151  ALA B CB    1 
ATOM   2158  N  N     . VAL B  1 152 ? 4.985   13.462  30.205  1.00 29.52 ? 152  VAL B N     1 
ATOM   2159  C  CA    . VAL B  1 152 ? 6.089   12.615  30.654  1.00 30.02 ? 152  VAL B CA    1 
ATOM   2160  C  C     . VAL B  1 152 ? 7.008   12.301  29.465  1.00 30.40 ? 152  VAL B C     1 
ATOM   2161  O  O     . VAL B  1 152 ? 6.532   11.945  28.387  1.00 30.27 ? 152  VAL B O     1 
ATOM   2162  C  CB    . VAL B  1 152 ? 5.580   11.316  31.349  1.00 29.97 ? 152  VAL B CB    1 
ATOM   2163  C  CG1   . VAL B  1 152 ? 6.750   10.382  31.694  1.00 29.85 ? 152  VAL B CG1   1 
ATOM   2164  C  CG2   . VAL B  1 152 ? 4.801   11.662  32.602  1.00 29.15 ? 152  VAL B CG2   1 
ATOM   2165  N  N     . CYS B  1 153 ? 8.317   12.451  29.664  1.00 31.05 ? 153  CYS B N     1 
ATOM   2166  C  CA    . CYS B  1 153 ? 9.295   12.113  28.627  1.00 31.83 ? 153  CYS B CA    1 
ATOM   2167  C  C     . CYS B  1 153 ? 9.224   10.629  28.316  1.00 32.70 ? 153  CYS B C     1 
ATOM   2168  O  O     . CYS B  1 153 ? 9.436   9.800   29.196  1.00 32.71 ? 153  CYS B O     1 
ATOM   2169  C  CB    . CYS B  1 153 ? 10.725  12.512  29.032  1.00 31.24 ? 153  CYS B CB    1 
ATOM   2170  S  SG    . CYS B  1 153 ? 11.966  12.156  27.755  1.00 30.34 ? 153  CYS B SG    1 
ATOM   2171  N  N     . MET B  1 154 ? 8.912   10.309  27.063  1.00 33.79 ? 154  MET B N     1 
ATOM   2172  C  CA    . MET B  1 154 ? 8.758   8.925   26.620  1.00 34.92 ? 154  MET B CA    1 
ATOM   2173  C  C     . MET B  1 154 ? 10.097  8.209   26.436  1.00 35.81 ? 154  MET B C     1 
ATOM   2174  O  O     . MET B  1 154 ? 10.127  7.022   26.130  1.00 36.30 ? 154  MET B O     1 
ATOM   2175  C  CB    . MET B  1 154 ? 7.937   8.866   25.331  1.00 34.62 ? 154  MET B CB    1 
ATOM   2176  C  CG    . MET B  1 154 ? 6.627   9.597   25.432  1.00 34.56 ? 154  MET B CG    1 
ATOM   2177  S  SD    . MET B  1 154 ? 5.581   9.492   23.994  1.00 35.49 ? 154  MET B SD    1 
ATOM   2178  C  CE    . MET B  1 154 ? 3.997   9.634   24.815  1.00 36.62 ? 154  MET B CE    1 
ATOM   2179  N  N     . GLU B  1 155 ? 11.198  8.929   26.642  1.00 36.68 ? 155  GLU B N     1 
ATOM   2180  C  CA    . GLU B  1 155 ? 12.536  8.368   26.455  1.00 37.49 ? 155  GLU B CA    1 
ATOM   2181  C  C     . GLU B  1 155 ? 13.337  8.241   27.762  1.00 37.71 ? 155  GLU B C     1 
ATOM   2182  O  O     . GLU B  1 155 ? 14.122  7.303   27.918  1.00 37.99 ? 155  GLU B O     1 
ATOM   2183  C  CB    . GLU B  1 155 ? 13.294  9.144   25.365  1.00 37.41 ? 155  GLU B CB    1 
ATOM   2184  C  CG    . GLU B  1 155 ? 12.609  9.035   24.000  1.00 38.75 ? 155  GLU B CG    1 
ATOM   2185  C  CD    . GLU B  1 155 ? 13.212  9.902   22.894  1.00 41.06 ? 155  GLU B CD    1 
ATOM   2186  O  OE1   . GLU B  1 155 ? 12.537  10.068  21.842  1.00 42.13 ? 155  GLU B OE1   1 
ATOM   2187  O  OE2   . GLU B  1 155 ? 14.349  10.403  23.041  1.00 41.70 ? 155  GLU B OE2   1 
ATOM   2188  N  N     . CYS B  1 156 ? 13.132  9.164   28.700  1.00 37.76 ? 156  CYS B N     1 
ATOM   2189  C  CA    . CYS B  1 156 ? 13.813  9.093   29.993  1.00 37.84 ? 156  CYS B CA    1 
ATOM   2190  C  C     . CYS B  1 156 ? 12.865  9.167   31.199  1.00 38.11 ? 156  CYS B C     1 
ATOM   2191  O  O     . CYS B  1 156 ? 13.295  8.981   32.339  1.00 37.98 ? 156  CYS B O     1 
ATOM   2192  C  CB    . CYS B  1 156 ? 14.925  10.143  30.097  1.00 37.55 ? 156  CYS B CB    1 
ATOM   2193  S  SG    . CYS B  1 156 ? 14.391  11.782  30.652  1.00 36.74 ? 156  CYS B SG    1 
ATOM   2194  N  N     . PHE B  1 157 ? 11.585  9.443   30.935  1.00 38.45 ? 157  PHE B N     1 
ATOM   2195  C  CA    . PHE B  1 157 ? 10.515  9.404   31.948  1.00 38.85 ? 157  PHE B CA    1 
ATOM   2196  C  C     . PHE B  1 157 ? 10.543  10.534  32.984  1.00 38.88 ? 157  PHE B C     1 
ATOM   2197  O  O     . PHE B  1 157 ? 9.880   10.457  34.014  1.00 39.13 ? 157  PHE B O     1 
ATOM   2198  C  CB    . PHE B  1 157 ? 10.430  8.009   32.612  1.00 38.77 ? 157  PHE B CB    1 
ATOM   2199  C  CG    . PHE B  1 157 ? 10.504  6.871   31.628  1.00 39.39 ? 157  PHE B CG    1 
ATOM   2200  C  CD1   . PHE B  1 157 ? 11.603  6.008   31.624  1.00 39.79 ? 157  PHE B CD1   1 
ATOM   2201  C  CD2   . PHE B  1 157 ? 9.492   6.683   30.678  1.00 39.41 ? 157  PHE B CD2   1 
ATOM   2202  C  CE1   . PHE B  1 157 ? 11.685  4.960   30.700  1.00 40.48 ? 157  PHE B CE1   1 
ATOM   2203  C  CE2   . PHE B  1 157 ? 9.563   5.643   29.748  1.00 40.18 ? 157  PHE B CE2   1 
ATOM   2204  C  CZ    . PHE B  1 157 ? 10.663  4.772   29.761  1.00 40.47 ? 157  PHE B CZ    1 
ATOM   2205  N  N     . ARG B  1 158 ? 11.312  11.581  32.702  1.00 38.83 ? 158  ARG B N     1 
ATOM   2206  C  CA    . ARG B  1 158 ? 11.238  12.819  33.476  1.00 38.83 ? 158  ARG B CA    1 
ATOM   2207  C  C     . ARG B  1 158 ? 10.146  13.727  32.873  1.00 37.88 ? 158  ARG B C     1 
ATOM   2208  O  O     . ARG B  1 158 ? 9.448   13.319  31.948  1.00 37.61 ? 158  ARG B O     1 
ATOM   2209  C  CB    . ARG B  1 158 ? 12.605  13.509  33.499  1.00 39.21 ? 158  ARG B CB    1 
ATOM   2210  C  CG    . ARG B  1 158 ? 13.512  12.974  34.580  1.00 42.23 ? 158  ARG B CG    1 
ATOM   2211  C  CD    . ARG B  1 158 ? 14.993  13.100  34.287  1.00 47.25 ? 158  ARG B CD    1 
ATOM   2212  N  NE    . ARG B  1 158 ? 15.796  12.585  35.395  1.00 51.61 ? 158  ARG B NE    1 
ATOM   2213  C  CZ    . ARG B  1 158 ? 16.222  13.313  36.429  1.00 54.03 ? 158  ARG B CZ    1 
ATOM   2214  N  NH1   . ARG B  1 158 ? 15.938  14.613  36.512  1.00 54.64 ? 158  ARG B NH1   1 
ATOM   2215  N  NH2   . ARG B  1 158 ? 16.941  12.738  37.388  1.00 54.84 ? 158  ARG B NH2   1 
ATOM   2216  N  N     . GLU B  1 159 ? 9.985   14.937  33.402  1.00 37.04 ? 159  GLU B N     1 
ATOM   2217  C  CA    . GLU B  1 159 ? 9.008   15.887  32.871  1.00 36.38 ? 159  GLU B CA    1 
ATOM   2218  C  C     . GLU B  1 159 ? 9.356   16.314  31.436  1.00 35.00 ? 159  GLU B C     1 
ATOM   2219  O  O     . GLU B  1 159 ? 10.502  16.651  31.146  1.00 34.57 ? 159  GLU B O     1 
ATOM   2220  C  CB    . GLU B  1 159 ? 8.928   17.116  33.774  1.00 36.93 ? 159  GLU B CB    1 
ATOM   2221  C  CG    . GLU B  1 159 ? 7.559   17.344  34.396  1.00 40.62 ? 159  GLU B CG    1 
ATOM   2222  C  CD    . GLU B  1 159 ? 7.547   18.479  35.417  1.00 45.09 ? 159  GLU B CD    1 
ATOM   2223  O  OE1   . GLU B  1 159 ? 8.110   19.567  35.131  1.00 45.73 ? 159  GLU B OE1   1 
ATOM   2224  O  OE2   . GLU B  1 159 ? 6.967   18.281  36.512  1.00 46.44 ? 159  GLU B OE2   1 
ATOM   2225  N  N     . ALA B  1 160 ? 8.361   16.293  30.553  1.00 33.37 ? 160  ALA B N     1 
ATOM   2226  C  CA    . ALA B  1 160 ? 8.541   16.686  29.161  1.00 32.12 ? 160  ALA B CA    1 
ATOM   2227  C  C     . ALA B  1 160 ? 7.816   17.988  28.831  1.00 31.40 ? 160  ALA B C     1 
ATOM   2228  O  O     . ALA B  1 160 ? 6.647   18.173  29.190  1.00 31.16 ? 160  ALA B O     1 
ATOM   2229  C  CB    . ALA B  1 160 ? 8.073   15.581  28.232  1.00 32.00 ? 160  ALA B CB    1 
ATOM   2230  N  N     . ALA B  1 161 ? 8.513   18.881  28.132  1.00 30.39 ? 161  ALA B N     1 
ATOM   2231  C  CA    . ALA B  1 161 ? 7.929   20.156  27.711  1.00 29.77 ? 161  ALA B CA    1 
ATOM   2232  C  C     . ALA B  1 161 ? 7.794   20.271  26.191  1.00 29.48 ? 161  ALA B C     1 
ATOM   2233  O  O     . ALA B  1 161 ? 7.132   21.184  25.696  1.00 29.00 ? 161  ALA B O     1 
ATOM   2234  C  CB    . ALA B  1 161 ? 8.733   21.337  28.272  1.00 29.37 ? 161  ALA B CB    1 
ATOM   2235  N  N     . TYR B  1 162 ? 8.409   19.336  25.462  1.00 29.27 ? 162  TYR B N     1 
ATOM   2236  C  CA    . TYR B  1 162 ? 8.503   19.416  24.003  1.00 29.30 ? 162  TYR B CA    1 
ATOM   2237  C  C     . TYR B  1 162 ? 7.991   18.177  23.281  1.00 29.42 ? 162  TYR B C     1 
ATOM   2238  O  O     . TYR B  1 162 ? 7.790   17.124  23.888  1.00 29.07 ? 162  TYR B O     1 
ATOM   2239  C  CB    . TYR B  1 162 ? 9.954   19.733  23.589  1.00 29.35 ? 162  TYR B CB    1 
ATOM   2240  C  CG    . TYR B  1 162 ? 10.613  20.710  24.542  1.00 29.50 ? 162  TYR B CG    1 
ATOM   2241  C  CD1   . TYR B  1 162 ? 11.605  20.284  25.424  1.00 29.73 ? 162  TYR B CD1   1 
ATOM   2242  C  CD2   . TYR B  1 162 ? 10.208  22.051  24.591  1.00 28.60 ? 162  TYR B CD2   1 
ATOM   2243  C  CE1   . TYR B  1 162 ? 12.194  21.166  26.313  1.00 30.53 ? 162  TYR B CE1   1 
ATOM   2244  C  CE2   . TYR B  1 162 ? 10.781  22.941  25.481  1.00 29.06 ? 162  TYR B CE2   1 
ATOM   2245  C  CZ    . TYR B  1 162 ? 11.774  22.494  26.339  1.00 30.55 ? 162  TYR B CZ    1 
ATOM   2246  O  OH    . TYR B  1 162 ? 12.354  23.357  27.233  1.00 30.66 ? 162  TYR B OH    1 
ATOM   2247  N  N     . THR B  1 163 ? 7.771   18.326  21.979  1.00 29.84 ? 163  THR B N     1 
ATOM   2248  C  CA    . THR B  1 163 ? 7.384   17.221  21.127  1.00 30.46 ? 163  THR B CA    1 
ATOM   2249  C  C     . THR B  1 163 ? 8.444   16.965  20.058  1.00 31.32 ? 163  THR B C     1 
ATOM   2250  O  O     . THR B  1 163 ? 8.804   17.861  19.306  1.00 31.38 ? 163  THR B O     1 
ATOM   2251  C  CB    . THR B  1 163 ? 6.025   17.494  20.475  1.00 30.56 ? 163  THR B CB    1 
ATOM   2252  O  OG1   . THR B  1 163 ? 5.073   17.877  21.479  1.00 29.36 ? 163  THR B OG1   1 
ATOM   2253  C  CG2   . THR B  1 163 ? 5.457   16.198  19.884  1.00 29.65 ? 163  THR B CG2   1 
ATOM   2254  N  N     . LYS B  1 164 ? 8.925   15.729  20.000  1.00 32.34 ? 164  LYS B N     1 
ATOM   2255  C  CA    . LYS B  1 164 ? 9.881   15.297  18.989  1.00 33.59 ? 164  LYS B CA    1 
ATOM   2256  C  C     . LYS B  1 164 ? 9.168   14.491  17.899  1.00 34.14 ? 164  LYS B C     1 
ATOM   2257  O  O     . LYS B  1 164 ? 8.370   13.608  18.197  1.00 33.95 ? 164  LYS B O     1 
ATOM   2258  C  CB    . LYS B  1 164 ? 10.974  14.449  19.653  1.00 33.73 ? 164  LYS B CB    1 
ATOM   2259  C  CG    . LYS B  1 164 ? 12.051  13.922  18.737  1.00 34.99 ? 164  LYS B CG    1 
ATOM   2260  C  CD    . LYS B  1 164 ? 13.337  13.703  19.520  1.00 38.25 ? 164  LYS B CD    1 
ATOM   2261  C  CE    . LYS B  1 164 ? 13.759  12.245  19.519  1.00 39.84 ? 164  LYS B CE    1 
ATOM   2262  N  NZ    . LYS B  1 164 ? 14.769  11.968  20.589  1.00 41.59 ? 164  LYS B NZ    1 
ATOM   2263  N  N     . ARG B  1 165 ? 9.446   14.818  16.639  1.00 35.24 ? 165  ARG B N     1 
ATOM   2264  C  CA    . ARG B  1 165 ? 8.949   14.035  15.508  1.00 36.42 ? 165  ARG B CA    1 
ATOM   2265  C  C     . ARG B  1 165 ? 9.875   12.848  15.290  1.00 37.36 ? 165  ARG B C     1 
ATOM   2266  O  O     . ARG B  1 165 ? 11.091  13.001  15.273  1.00 37.40 ? 165  ARG B O     1 
ATOM   2267  C  CB    . ARG B  1 165 ? 8.872   14.890  14.238  1.00 36.14 ? 165  ARG B CB    1 
ATOM   2268  C  CG    . ARG B  1 165 ? 8.401   14.134  13.004  1.00 36.03 ? 165  ARG B CG    1 
ATOM   2269  C  CD    . ARG B  1 165 ? 8.097   14.996  11.802  1.00 34.65 ? 165  ARG B CD    1 
ATOM   2270  N  NE    . ARG B  1 165 ? 6.824   15.694  11.954  1.00 34.42 ? 165  ARG B NE    1 
ATOM   2271  C  CZ    . ARG B  1 165 ? 6.453   16.753  11.240  1.00 33.85 ? 165  ARG B CZ    1 
ATOM   2272  N  NH1   . ARG B  1 165 ? 7.259   17.248  10.304  1.00 33.59 ? 165  ARG B NH1   1 
ATOM   2273  N  NH2   . ARG B  1 165 ? 5.278   17.327  11.469  1.00 32.27 ? 165  ARG B NH2   1 
ATOM   2274  N  N     . LEU B  1 166 ? 9.296   11.665  15.136  1.00 38.82 ? 166  LEU B N     1 
ATOM   2275  C  CA    . LEU B  1 166 ? 10.090  10.448  14.982  1.00 40.43 ? 166  LEU B CA    1 
ATOM   2276  C  C     . LEU B  1 166 ? 10.608  10.252  13.553  1.00 41.54 ? 166  LEU B C     1 
ATOM   2277  O  O     . LEU B  1 166 ? 11.759  9.874   13.365  1.00 41.71 ? 166  LEU B O     1 
ATOM   2278  C  CB    . LEU B  1 166 ? 9.299   9.225   15.460  1.00 40.28 ? 166  LEU B CB    1 
ATOM   2279  C  CG    . LEU B  1 166 ? 8.878   9.231   16.937  1.00 40.22 ? 166  LEU B CG    1 
ATOM   2280  C  CD1   . LEU B  1 166 ? 8.109   7.962   17.291  1.00 40.00 ? 166  LEU B CD1   1 
ATOM   2281  C  CD2   . LEU B  1 166 ? 10.077  9.416   17.865  1.00 39.96 ? 166  LEU B CD2   1 
ATOM   2282  N  N     . GLY B  1 167 ? 9.765   10.530  12.558  1.00 42.76 ? 167  GLY B N     1 
ATOM   2283  C  CA    . GLY B  1 167 ? 10.130  10.365  11.161  1.00 44.34 ? 167  GLY B CA    1 
ATOM   2284  C  C     . GLY B  1 167 ? 10.971  11.498  10.593  1.00 45.57 ? 167  GLY B C     1 
ATOM   2285  O  O     . GLY B  1 167 ? 11.557  12.289  11.340  1.00 45.75 ? 167  GLY B O     1 
ATOM   2286  N  N     . THR B  1 168 ? 11.028  11.586  9.265   1.00 46.42 ? 168  THR B N     1 
ATOM   2287  C  CA    . THR B  1 168 ? 11.892  12.565  8.602   1.00 47.28 ? 168  THR B CA    1 
ATOM   2288  C  C     . THR B  1 168 ? 11.121  13.636  7.832   1.00 47.64 ? 168  THR B C     1 
ATOM   2289  O  O     . THR B  1 168 ? 11.730  14.543  7.261   1.00 47.86 ? 168  THR B O     1 
ATOM   2290  C  CB    . THR B  1 168 ? 12.898  11.878  7.641   1.00 47.41 ? 168  THR B CB    1 
ATOM   2291  O  OG1   . THR B  1 168 ? 12.183  11.028  6.735   1.00 47.75 ? 168  THR B OG1   1 
ATOM   2292  C  CG2   . THR B  1 168 ? 13.838  10.934  8.394   1.00 47.47 ? 168  THR B CG2   1 
ATOM   2293  N  N     . GLU B  1 169 ? 9.794   13.544  7.808   1.00 48.07 ? 169  GLU B N     1 
ATOM   2294  C  CA    . GLU B  1 169 ? 9.001   14.539  7.091   1.00 48.55 ? 169  GLU B CA    1 
ATOM   2295  C  C     . GLU B  1 169 ? 9.236   15.946  7.647   1.00 48.54 ? 169  GLU B C     1 
ATOM   2296  O  O     . GLU B  1 169 ? 9.472   16.128  8.849   1.00 48.50 ? 169  GLU B O     1 
ATOM   2297  C  CB    . GLU B  1 169 ? 7.516   14.166  7.025   1.00 48.80 ? 169  GLU B CB    1 
ATOM   2298  C  CG    . GLU B  1 169 ? 6.876   13.817  8.353   1.00 50.36 ? 169  GLU B CG    1 
ATOM   2299  C  CD    . GLU B  1 169 ? 6.915   12.333  8.651   1.00 52.08 ? 169  GLU B CD    1 
ATOM   2300  O  OE1   . GLU B  1 169 ? 6.033   11.595  8.149   1.00 52.80 ? 169  GLU B OE1   1 
ATOM   2301  O  OE2   . GLU B  1 169 ? 7.825   11.911  9.398   1.00 52.27 ? 169  GLU B OE2   1 
ATOM   2302  N  N     . LYS B  1 170 ? 9.200   16.928  6.749   1.00 48.49 ? 170  LYS B N     1 
ATOM   2303  C  CA    . LYS B  1 170 ? 9.681   18.276  7.045   1.00 48.46 ? 170  LYS B CA    1 
ATOM   2304  C  C     . LYS B  1 170 ? 8.571   19.314  7.186   1.00 47.87 ? 170  LYS B C     1 
ATOM   2305  O  O     . LYS B  1 170 ? 8.785   20.370  7.786   1.00 47.78 ? 170  LYS B O     1 
ATOM   2306  C  CB    . LYS B  1 170 ? 10.664  18.737  5.966   1.00 48.93 ? 170  LYS B CB    1 
ATOM   2307  C  CG    . LYS B  1 170 ? 12.073  18.196  6.120   1.00 50.43 ? 170  LYS B CG    1 
ATOM   2308  C  CD    . LYS B  1 170 ? 12.807  18.203  4.776   1.00 53.27 ? 170  LYS B CD    1 
ATOM   2309  C  CE    . LYS B  1 170 ? 14.264  18.660  4.918   1.00 54.42 ? 170  LYS B CE    1 
ATOM   2310  N  NZ    . LYS B  1 170 ? 15.023  17.868  5.943   1.00 54.54 ? 170  LYS B NZ    1 
ATOM   2311  N  N     . GLU B  1 171 ? 7.401   19.022  6.621   1.00 47.04 ? 171  GLU B N     1 
ATOM   2312  C  CA    . GLU B  1 171 ? 6.260   19.931  6.714   1.00 46.54 ? 171  GLU B CA    1 
ATOM   2313  C  C     . GLU B  1 171 ? 5.751   20.007  8.158   1.00 45.58 ? 171  GLU B C     1 
ATOM   2314  O  O     . GLU B  1 171 ? 5.882   19.047  8.924   1.00 45.33 ? 171  GLU B O     1 
ATOM   2315  C  CB    . GLU B  1 171 ? 5.139   19.528  5.733   1.00 46.84 ? 171  GLU B CB    1 
ATOM   2316  C  CG    . GLU B  1 171 ? 4.534   18.145  5.959   1.00 48.64 ? 171  GLU B CG    1 
ATOM   2317  C  CD    . GLU B  1 171 ? 5.163   17.053  5.096   1.00 51.47 ? 171  GLU B CD    1 
ATOM   2318  O  OE1   . GLU B  1 171 ? 6.314   17.232  4.626   1.00 52.48 ? 171  GLU B OE1   1 
ATOM   2319  O  OE2   . GLU B  1 171 ? 4.506   16.000  4.887   1.00 51.82 ? 171  GLU B OE2   1 
ATOM   2320  N  N     . VAL B  1 172 ? 5.194   21.155  8.529   1.00 44.41 ? 172  VAL B N     1 
ATOM   2321  C  CA    . VAL B  1 172 ? 4.703   21.361  9.887   1.00 43.41 ? 172  VAL B CA    1 
ATOM   2322  C  C     . VAL B  1 172 ? 3.505   20.453  10.192  1.00 42.84 ? 172  VAL B C     1 
ATOM   2323  O  O     . VAL B  1 172 ? 3.551   19.676  11.139  1.00 42.64 ? 172  VAL B O     1 
ATOM   2324  C  CB    . VAL B  1 172 ? 4.359   22.853  10.167  1.00 43.53 ? 172  VAL B CB    1 
ATOM   2325  C  CG1   . VAL B  1 172 ? 3.566   23.005  11.462  1.00 43.04 ? 172  VAL B CG1   1 
ATOM   2326  C  CG2   . VAL B  1 172 ? 5.628   23.709  10.201  1.00 43.14 ? 172  VAL B CG2   1 
ATOM   2327  N  N     . GLU B  1 173 ? 2.450   20.535  9.385   1.00 42.13 ? 173  GLU B N     1 
ATOM   2328  C  CA    . GLU B  1 173 ? 1.249   19.748  9.631   1.00 41.74 ? 173  GLU B CA    1 
ATOM   2329  C  C     . GLU B  1 173 ? 1.390   18.283  9.201   1.00 41.31 ? 173  GLU B C     1 
ATOM   2330  O  O     . GLU B  1 173 ? 1.278   17.958  8.019   1.00 41.42 ? 173  GLU B O     1 
ATOM   2331  C  CB    . GLU B  1 173 ? 0.024   20.394  8.971   1.00 41.94 ? 173  GLU B CB    1 
ATOM   2332  C  CG    . GLU B  1 173 ? -1.281  19.647  9.224   1.00 42.83 ? 173  GLU B CG    1 
ATOM   2333  C  CD    . GLU B  1 173 ? -2.516  20.400  8.757   1.00 45.16 ? 173  GLU B CD    1 
ATOM   2334  O  OE1   . GLU B  1 173 ? -3.639  19.880  8.962   1.00 45.71 ? 173  GLU B OE1   1 
ATOM   2335  O  OE2   . GLU B  1 173 ? -2.378  21.510  8.188   1.00 46.37 ? 173  GLU B OE2   1 
ATOM   2336  N  N     . VAL B  1 174 ? 1.651   17.410  10.171  1.00 40.65 ? 174  VAL B N     1 
ATOM   2337  C  CA    . VAL B  1 174 ? 1.574   15.966  9.973   1.00 40.04 ? 174  VAL B CA    1 
ATOM   2338  C  C     . VAL B  1 174 ? 0.785   15.360  11.134  1.00 39.74 ? 174  VAL B C     1 
ATOM   2339  O  O     . VAL B  1 174 ? 1.267   15.299  12.264  1.00 39.81 ? 174  VAL B O     1 
ATOM   2340  C  CB    . VAL B  1 174 ? 2.975   15.302  9.847   1.00 40.04 ? 174  VAL B CB    1 
ATOM   2341  C  CG1   . VAL B  1 174 ? 2.850   13.793  9.664   1.00 39.44 ? 174  VAL B CG1   1 
ATOM   2342  C  CG2   . VAL B  1 174 ? 3.747   15.890  8.689   1.00 39.89 ? 174  VAL B CG2   1 
ATOM   2343  N  N     . ILE B  1 175 ? -0.437  14.928  10.847  1.00 39.50 ? 175  ILE B N     1 
ATOM   2344  C  CA    . ILE B  1 175 ? -1.324  14.369  11.867  1.00 39.36 ? 175  ILE B CA    1 
ATOM   2345  C  C     . ILE B  1 175 ? -0.832  12.988  12.308  1.00 39.12 ? 175  ILE B C     1 
ATOM   2346  O  O     . ILE B  1 175 ? -0.386  12.189  11.484  1.00 39.27 ? 175  ILE B O     1 
ATOM   2347  C  CB    . ILE B  1 175 ? -2.800  14.360  11.362  1.00 39.46 ? 175  ILE B CB    1 
ATOM   2348  C  CG1   . ILE B  1 175 ? -3.436  15.733  11.571  1.00 40.02 ? 175  ILE B CG1   1 
ATOM   2349  C  CG2   . ILE B  1 175 ? -3.658  13.317  12.098  1.00 39.71 ? 175  ILE B CG2   1 
ATOM   2350  C  CD1   . ILE B  1 175 ? -3.278  16.692  10.417  1.00 41.00 ? 175  ILE B CD1   1 
ATOM   2351  N  N     . GLY B  1 176 ? -0.883  12.732  13.614  1.00 38.84 ? 176  GLY B N     1 
ATOM   2352  C  CA    . GLY B  1 176 ? -0.412  11.474  14.168  1.00 38.40 ? 176  GLY B CA    1 
ATOM   2353  C  C     . GLY B  1 176 ? -0.386  11.473  15.683  1.00 38.23 ? 176  GLY B C     1 
ATOM   2354  O  O     . GLY B  1 176 ? -0.554  12.511  16.315  1.00 38.31 ? 176  GLY B O     1 
ATOM   2355  N  N     . GLY B  1 177 ? -0.175  10.295  16.263  1.00 38.00 ? 177  GLY B N     1 
ATOM   2356  C  CA    . GLY B  1 177 ? -0.074  10.141  17.701  1.00 37.55 ? 177  GLY B CA    1 
ATOM   2357  C  C     . GLY B  1 177 ? 1.303   9.664   18.109  1.00 37.65 ? 177  GLY B C     1 
ATOM   2358  O  O     . GLY B  1 177 ? 2.318   10.085  17.533  1.00 37.26 ? 177  GLY B O     1 
ATOM   2359  N  N     . ALA B  1 178 ? 1.332   8.775   19.098  1.00 37.96 ? 178  ALA B N     1 
ATOM   2360  C  CA    . ALA B  1 178 ? 2.574   8.252   19.666  1.00 38.47 ? 178  ALA B CA    1 
ATOM   2361  C  C     . ALA B  1 178 ? 3.379   7.415   18.662  1.00 38.78 ? 178  ALA B C     1 
ATOM   2362  O  O     . ALA B  1 178 ? 4.551   7.109   18.887  1.00 38.96 ? 178  ALA B O     1 
ATOM   2363  C  CB    . ALA B  1 178 ? 2.278   7.448   20.924  1.00 38.42 ? 178  ALA B CB    1 
ATOM   2364  N  N     . ASP B  1 179 ? 2.732   7.055   17.561  1.00 39.10 ? 179  ASP B N     1 
ATOM   2365  C  CA    . ASP B  1 179 ? 3.377   6.408   16.421  1.00 39.61 ? 179  ASP B CA    1 
ATOM   2366  C  C     . ASP B  1 179 ? 4.351   7.349   15.694  1.00 39.07 ? 179  ASP B C     1 
ATOM   2367  O  O     . ASP B  1 179 ? 5.367   6.905   15.148  1.00 39.36 ? 179  ASP B O     1 
ATOM   2368  C  CB    . ASP B  1 179 ? 2.306   5.924   15.437  1.00 40.05 ? 179  ASP B CB    1 
ATOM   2369  C  CG    . ASP B  1 179 ? 1.104   6.870   15.368  1.00 42.33 ? 179  ASP B CG    1 
ATOM   2370  O  OD1   . ASP B  1 179 ? 0.347   6.960   16.365  1.00 44.43 ? 179  ASP B OD1   1 
ATOM   2371  O  OD2   . ASP B  1 179 ? 0.830   7.567   14.362  1.00 45.05 ? 179  ASP B OD2   1 
ATOM   2372  N  N     . LYS B  1 180 ? 4.039   8.645   15.697  1.00 38.07 ? 180  LYS B N     1 
ATOM   2373  C  CA    . LYS B  1 180 ? 4.798   9.629   14.932  1.00 36.86 ? 180  LYS B CA    1 
ATOM   2374  C  C     . LYS B  1 180 ? 5.546   10.654  15.790  1.00 35.64 ? 180  LYS B C     1 
ATOM   2375  O  O     . LYS B  1 180 ? 6.428   11.364  15.294  1.00 35.52 ? 180  LYS B O     1 
ATOM   2376  C  CB    . LYS B  1 180 ? 3.867   10.335  13.942  1.00 37.47 ? 180  LYS B CB    1 
ATOM   2377  C  CG    . LYS B  1 180 ? 3.348   9.433   12.817  1.00 38.71 ? 180  LYS B CG    1 
ATOM   2378  C  CD    . LYS B  1 180 ? 3.363   10.170  11.481  1.00 42.05 ? 180  LYS B CD    1 
ATOM   2379  C  CE    . LYS B  1 180 ? 2.480   9.489   10.436  1.00 43.93 ? 180  LYS B CE    1 
ATOM   2380  N  NZ    . LYS B  1 180 ? 1.029   9.559   10.795  1.00 45.42 ? 180  LYS B NZ    1 
ATOM   2381  N  N     . TYR B  1 181 ? 5.204   10.723  17.075  1.00 34.11 ? 181  TYR B N     1 
ATOM   2382  C  CA    . TYR B  1 181 ? 5.748   11.741  17.971  1.00 32.46 ? 181  TYR B CA    1 
ATOM   2383  C  C     . TYR B  1 181 ? 6.016   11.199  19.375  1.00 32.10 ? 181  TYR B C     1 
ATOM   2384  O  O     . TYR B  1 181 ? 5.268   10.346  19.870  1.00 31.85 ? 181  TYR B O     1 
ATOM   2385  C  CB    . TYR B  1 181 ? 4.763   12.900  18.107  1.00 31.89 ? 181  TYR B CB    1 
ATOM   2386  C  CG    . TYR B  1 181 ? 4.439   13.668  16.849  1.00 30.38 ? 181  TYR B CG    1 
ATOM   2387  C  CD1   . TYR B  1 181 ? 3.303   13.377  16.106  1.00 29.12 ? 181  TYR B CD1   1 
ATOM   2388  C  CD2   . TYR B  1 181 ? 5.242   14.731  16.433  1.00 29.40 ? 181  TYR B CD2   1 
ATOM   2389  C  CE1   . TYR B  1 181 ? 2.985   14.118  14.965  1.00 28.49 ? 181  TYR B CE1   1 
ATOM   2390  C  CE2   . TYR B  1 181 ? 4.934   15.469  15.305  1.00 27.68 ? 181  TYR B CE2   1 
ATOM   2391  C  CZ    . TYR B  1 181 ? 3.814   15.162  14.576  1.00 28.22 ? 181  TYR B CZ    1 
ATOM   2392  O  OH    . TYR B  1 181 ? 3.527   15.900  13.453  1.00 28.61 ? 181  TYR B OH    1 
ATOM   2393  N  N     . HIS B  1 182 ? 7.074   11.705  20.013  1.00 31.44 ? 182  HIS B N     1 
ATOM   2394  C  CA    . HIS B  1 182 ? 7.305   11.493  21.449  1.00 31.25 ? 182  HIS B CA    1 
ATOM   2395  C  C     . HIS B  1 182 ? 7.279   12.832  22.195  1.00 30.83 ? 182  HIS B C     1 
ATOM   2396  O  O     . HIS B  1 182 ? 7.858   13.825  21.728  1.00 30.78 ? 182  HIS B O     1 
ATOM   2397  C  CB    . HIS B  1 182 ? 8.667   10.847  21.736  1.00 31.26 ? 182  HIS B CB    1 
ATOM   2398  C  CG    . HIS B  1 182 ? 8.736   9.376   21.456  1.00 32.62 ? 182  HIS B CG    1 
ATOM   2399  N  ND1   . HIS B  1 182 ? 7.635   8.618   21.121  1.00 32.92 ? 182  HIS B ND1   1 
ATOM   2400  C  CD2   . HIS B  1 182 ? 9.791   8.525   21.461  1.00 32.53 ? 182  HIS B CD2   1 
ATOM   2401  C  CE1   . HIS B  1 182 ? 8.008   7.365   20.935  1.00 32.78 ? 182  HIS B CE1   1 
ATOM   2402  N  NE2   . HIS B  1 182 ? 9.313   7.285   21.128  1.00 32.13 ? 182  HIS B NE2   1 
ATOM   2403  N  N     . SER B  1 183 ? 6.624   12.859  23.350  1.00 30.08 ? 183  SER B N     1 
ATOM   2404  C  CA    . SER B  1 183 ? 6.832   13.951  24.292  1.00 29.65 ? 183  SER B CA    1 
ATOM   2405  C  C     . SER B  1 183 ? 8.202   13.736  24.913  1.00 29.30 ? 183  SER B C     1 
ATOM   2406  O  O     . SER B  1 183 ? 8.545   12.620  25.296  1.00 29.09 ? 183  SER B O     1 
ATOM   2407  C  CB    . SER B  1 183 ? 5.742   14.002  25.370  1.00 29.52 ? 183  SER B CB    1 
ATOM   2408  O  OG    . SER B  1 183 ? 5.588   12.747  26.021  1.00 28.95 ? 183  SER B OG    1 
ATOM   2409  N  N     . VAL B  1 184 ? 8.999   14.801  24.980  1.00 29.24 ? 184  VAL B N     1 
ATOM   2410  C  CA    . VAL B  1 184 ? 10.405  14.698  25.402  1.00 29.10 ? 184  VAL B CA    1 
ATOM   2411  C  C     . VAL B  1 184 ? 10.881  15.868  26.273  1.00 29.32 ? 184  VAL B C     1 
ATOM   2412  O  O     . VAL B  1 184 ? 10.385  16.985  26.164  1.00 29.05 ? 184  VAL B O     1 
ATOM   2413  C  CB    . VAL B  1 184 ? 11.412  14.572  24.199  1.00 28.98 ? 184  VAL B CB    1 
ATOM   2414  C  CG1   . VAL B  1 184 ? 11.304  13.214  23.509  1.00 28.71 ? 184  VAL B CG1   1 
ATOM   2415  C  CG2   . VAL B  1 184 ? 11.264  15.737  23.202  1.00 28.25 ? 184  VAL B CG2   1 
ATOM   2416  N  N     . CYS B  1 185 ? 11.865  15.601  27.125  1.00 29.56 ? 185  CYS B N     1 
ATOM   2417  C  CA    . CYS B  1 185 ? 12.564  16.667  27.844  1.00 29.96 ? 185  CYS B CA    1 
ATOM   2418  C  C     . CYS B  1 185 ? 13.611  17.335  26.936  1.00 30.17 ? 185  CYS B C     1 
ATOM   2419  O  O     . CYS B  1 185 ? 13.811  16.916  25.797  1.00 30.07 ? 185  CYS B O     1 
ATOM   2420  C  CB    . CYS B  1 185 ? 13.215  16.145  29.139  1.00 29.73 ? 185  CYS B CB    1 
ATOM   2421  S  SG    . CYS B  1 185 ? 14.624  15.017  28.887  1.00 28.96 ? 185  CYS B SG    1 
ATOM   2422  N  N     . ARG B  1 186 ? 14.267  18.369  27.452  1.00 30.57 ? 186  ARG B N     1 
ATOM   2423  C  CA    . ARG B  1 186 ? 15.305  19.092  26.719  1.00 31.25 ? 186  ARG B CA    1 
ATOM   2424  C  C     . ARG B  1 186 ? 16.445  18.186  26.246  1.00 31.98 ? 186  ARG B C     1 
ATOM   2425  O  O     . ARG B  1 186 ? 16.840  18.230  25.082  1.00 32.07 ? 186  ARG B O     1 
ATOM   2426  C  CB    . ARG B  1 186 ? 15.858  20.244  27.569  1.00 30.96 ? 186  ARG B CB    1 
ATOM   2427  C  CG    . ARG B  1 186 ? 16.985  21.058  26.912  1.00 30.55 ? 186  ARG B CG    1 
ATOM   2428  C  CD    . ARG B  1 186 ? 17.471  22.251  27.741  1.00 29.87 ? 186  ARG B CD    1 
ATOM   2429  N  NE    . ARG B  1 186 ? 16.392  23.213  27.971  1.00 29.66 ? 186  ARG B NE    1 
ATOM   2430  C  CZ    . ARG B  1 186 ? 16.125  24.230  27.167  1.00 29.52 ? 186  ARG B CZ    1 
ATOM   2431  N  NH1   . ARG B  1 186 ? 16.882  24.431  26.098  1.00 29.65 ? 186  ARG B NH1   1 
ATOM   2432  N  NH2   . ARG B  1 186 ? 15.119  25.062  27.437  1.00 28.03 ? 186  ARG B NH2   1 
ATOM   2433  N  N     . LEU B  1 187 ? 16.967  17.368  27.152  1.00 32.96 ? 187  LEU B N     1 
ATOM   2434  C  CA    . LEU B  1 187 ? 18.098  16.489  26.839  1.00 33.99 ? 187  LEU B CA    1 
ATOM   2435  C  C     . LEU B  1 187 ? 17.750  15.435  25.788  1.00 34.29 ? 187  LEU B C     1 
ATOM   2436  O  O     . LEU B  1 187 ? 18.516  15.230  24.845  1.00 34.59 ? 187  LEU B O     1 
ATOM   2437  C  CB    . LEU B  1 187 ? 18.683  15.840  28.107  1.00 33.88 ? 187  LEU B CB    1 
ATOM   2438  C  CG    . LEU B  1 187 ? 19.470  16.788  29.031  1.00 35.25 ? 187  LEU B CG    1 
ATOM   2439  C  CD1   . LEU B  1 187 ? 19.936  16.082  30.299  1.00 36.57 ? 187  LEU B CD1   1 
ATOM   2440  C  CD2   . LEU B  1 187 ? 20.653  17.456  28.314  1.00 36.39 ? 187  LEU B CD2   1 
ATOM   2441  N  N     . CYS B  1 188 ? 16.593  14.790  25.941  1.00 34.49 ? 188  CYS B N     1 
ATOM   2442  C  CA    . CYS B  1 188 ? 16.158  13.765  24.998  1.00 34.73 ? 188  CYS B CA    1 
ATOM   2443  C  C     . CYS B  1 188 ? 15.807  14.364  23.630  1.00 34.97 ? 188  CYS B C     1 
ATOM   2444  O  O     . CYS B  1 188 ? 15.998  13.703  22.604  1.00 34.98 ? 188  CYS B O     1 
ATOM   2445  C  CB    . CYS B  1 188 ? 15.005  12.919  25.575  1.00 34.32 ? 188  CYS B CB    1 
ATOM   2446  S  SG    . CYS B  1 188 ? 15.376  12.026  27.137  1.00 34.43 ? 188  CYS B SG    1 
ATOM   2447  N  N     . TYR B  1 189 ? 15.327  15.612  23.617  1.00 35.12 ? 189  TYR B N     1 
ATOM   2448  C  CA    . TYR B  1 189 ? 15.026  16.311  22.370  1.00 35.38 ? 189  TYR B CA    1 
ATOM   2449  C  C     . TYR B  1 189 ? 16.260  16.436  21.461  1.00 36.50 ? 189  TYR B C     1 
ATOM   2450  O  O     . TYR B  1 189 ? 16.146  16.314  20.244  1.00 36.25 ? 189  TYR B O     1 
ATOM   2451  C  CB    . TYR B  1 189 ? 14.409  17.698  22.632  1.00 34.67 ? 189  TYR B CB    1 
ATOM   2452  C  CG    . TYR B  1 189 ? 14.048  18.443  21.355  1.00 32.64 ? 189  TYR B CG    1 
ATOM   2453  C  CD1   . TYR B  1 189 ? 12.802  18.270  20.757  1.00 30.40 ? 189  TYR B CD1   1 
ATOM   2454  C  CD2   . TYR B  1 189 ? 14.971  19.295  20.730  1.00 30.76 ? 189  TYR B CD2   1 
ATOM   2455  C  CE1   . TYR B  1 189 ? 12.470  18.929  19.580  1.00 30.59 ? 189  TYR B CE1   1 
ATOM   2456  C  CE2   . TYR B  1 189 ? 14.649  19.967  19.549  1.00 30.22 ? 189  TYR B CE2   1 
ATOM   2457  C  CZ    . TYR B  1 189 ? 13.395  19.786  18.983  1.00 30.70 ? 189  TYR B CZ    1 
ATOM   2458  O  OH    . TYR B  1 189 ? 13.060  20.438  17.811  1.00 30.61 ? 189  TYR B OH    1 
ATOM   2459  N  N     . PHE B  1 190 ? 17.421  16.681  22.063  1.00 37.96 ? 190  PHE B N     1 
ATOM   2460  C  CA    . PHE B  1 190 ? 18.654  16.930  21.323  1.00 39.82 ? 190  PHE B CA    1 
ATOM   2461  C  C     . PHE B  1 190 ? 19.543  15.683  21.149  1.00 41.32 ? 190  PHE B C     1 
ATOM   2462  O  O     . PHE B  1 190 ? 20.584  15.758  20.488  1.00 41.67 ? 190  PHE B O     1 
ATOM   2463  C  CB    . PHE B  1 190 ? 19.457  18.056  21.997  1.00 39.33 ? 190  PHE B CB    1 
ATOM   2464  C  CG    . PHE B  1 190 ? 18.902  19.437  21.766  1.00 38.51 ? 190  PHE B CG    1 
ATOM   2465  C  CD1   . PHE B  1 190 ? 18.365  20.172  22.827  1.00 37.55 ? 190  PHE B CD1   1 
ATOM   2466  C  CD2   . PHE B  1 190 ? 18.935  20.020  20.496  1.00 37.73 ? 190  PHE B CD2   1 
ATOM   2467  C  CE1   . PHE B  1 190 ? 17.850  21.461  22.622  1.00 37.01 ? 190  PHE B CE1   1 
ATOM   2468  C  CE2   . PHE B  1 190 ? 18.438  21.311  20.282  1.00 37.62 ? 190  PHE B CE2   1 
ATOM   2469  C  CZ    . PHE B  1 190 ? 17.890  22.032  21.347  1.00 37.13 ? 190  PHE B CZ    1 
ATOM   2470  N  N     . LYS B  1 191 ? 19.130  14.552  21.727  1.00 42.89 ? 191  LYS B N     1 
ATOM   2471  C  CA    . LYS B  1 191 ? 19.925  13.312  21.684  1.00 44.41 ? 191  LYS B CA    1 
ATOM   2472  C  C     . LYS B  1 191 ? 20.081  12.722  20.277  1.00 44.92 ? 191  LYS B C     1 
ATOM   2473  O  O     . LYS B  1 191 ? 19.108  12.597  19.530  1.00 45.63 ? 191  LYS B O     1 
ATOM   2474  C  CB    . LYS B  1 191 ? 19.353  12.257  22.637  1.00 44.67 ? 191  LYS B CB    1 
ATOM   2475  C  CG    . LYS B  1 191 ? 20.309  11.865  23.758  1.00 46.36 ? 191  LYS B CG    1 
ATOM   2476  C  CD    . LYS B  1 191 ? 19.747  10.725  24.606  1.00 49.47 ? 191  LYS B CD    1 
ATOM   2477  C  CE    . LYS B  1 191 ? 20.427  9.391   24.292  1.00 51.04 ? 191  LYS B CE    1 
ATOM   2478  N  NZ    . LYS B  1 191 ? 21.215  8.896   25.464  1.00 51.68 ? 191  LYS B NZ    1 
ATOM   2479  N  N     . ARG C  1 18  ? -17.385 41.437  49.335  1.00 43.68 ? 18   ARG C N     1 
ATOM   2480  C  CA    . ARG C  1 18  ? -16.876 40.171  48.730  1.00 43.45 ? 18   ARG C CA    1 
ATOM   2481  C  C     . ARG C  1 18  ? -15.542 39.711  49.358  1.00 42.24 ? 18   ARG C C     1 
ATOM   2482  O  O     . ARG C  1 18  ? -14.467 39.891  48.776  1.00 42.34 ? 18   ARG C O     1 
ATOM   2483  C  CB    . ARG C  1 18  ? -16.734 40.355  47.213  1.00 44.20 ? 18   ARG C CB    1 
ATOM   2484  C  CG    . ARG C  1 18  ? -16.881 39.082  46.396  1.00 46.54 ? 18   ARG C CG    1 
ATOM   2485  C  CD    . ARG C  1 18  ? -18.263 38.861  45.794  1.00 50.34 ? 18   ARG C CD    1 
ATOM   2486  N  NE    . ARG C  1 18  ? -18.470 37.439  45.516  1.00 54.16 ? 18   ARG C NE    1 
ATOM   2487  C  CZ    . ARG C  1 18  ? -19.635 36.877  45.210  1.00 55.67 ? 18   ARG C CZ    1 
ATOM   2488  N  NH1   . ARG C  1 18  ? -20.745 37.609  45.118  1.00 56.72 ? 18   ARG C NH1   1 
ATOM   2489  N  NH2   . ARG C  1 18  ? -19.684 35.570  44.989  1.00 55.43 ? 18   ARG C NH2   1 
ATOM   2490  N  N     . GLY C  1 19  ? -15.631 39.111  50.545  1.00 40.59 ? 19   GLY C N     1 
ATOM   2491  C  CA    . GLY C  1 19  ? -14.464 38.644  51.272  1.00 38.14 ? 19   GLY C CA    1 
ATOM   2492  C  C     . GLY C  1 19  ? -13.967 37.304  50.778  1.00 36.48 ? 19   GLY C C     1 
ATOM   2493  O  O     . GLY C  1 19  ? -14.639 36.631  49.989  1.00 36.26 ? 19   GLY C O     1 
ATOM   2494  N  N     . GLN C  1 20  ? -12.778 36.927  51.244  1.00 34.88 ? 20   GLN C N     1 
ATOM   2495  C  CA    . GLN C  1 20  ? -12.105 35.707  50.806  1.00 33.24 ? 20   GLN C CA    1 
ATOM   2496  C  C     . GLN C  1 20  ? -10.899 35.385  51.669  1.00 31.78 ? 20   GLN C C     1 
ATOM   2497  O  O     . GLN C  1 20  ? -10.327 36.265  52.315  1.00 31.42 ? 20   GLN C O     1 
ATOM   2498  C  CB    . GLN C  1 20  ? -11.715 35.767  49.334  1.00 33.47 ? 20   GLN C CB    1 
ATOM   2499  C  CG    . GLN C  1 20  ? -10.717 36.849  48.993  1.00 34.99 ? 20   GLN C CG    1 
ATOM   2500  C  CD    . GLN C  1 20  ? -10.225 36.760  47.567  1.00 36.44 ? 20   GLN C CD    1 
ATOM   2501  O  OE1   . GLN C  1 20  ? -10.129 37.775  46.886  1.00 38.51 ? 20   GLN C OE1   1 
ATOM   2502  N  NE2   . GLN C  1 20  ? -9.904  35.557  47.114  1.00 37.15 ? 20   GLN C NE2   1 
ATOM   2503  N  N     . ILE C  1 21  ? -10.549 34.101  51.691  1.00 30.25 ? 21   ILE C N     1 
ATOM   2504  C  CA    . ILE C  1 21  ? -9.334  33.622  52.331  1.00 28.52 ? 21   ILE C CA    1 
ATOM   2505  C  C     . ILE C  1 21  ? -8.460  32.938  51.292  1.00 27.95 ? 21   ILE C C     1 
ATOM   2506  O  O     . ILE C  1 21  ? -8.908  32.040  50.573  1.00 27.37 ? 21   ILE C O     1 
ATOM   2507  C  CB    . ILE C  1 21  ? -9.648  32.630  53.483  1.00 28.57 ? 21   ILE C CB    1 
ATOM   2508  C  CG1   . ILE C  1 21  ? -10.562 33.268  54.532  1.00 27.83 ? 21   ILE C CG1   1 
ATOM   2509  C  CG2   . ILE C  1 21  ? -8.351  32.144  54.144  1.00 27.77 ? 21   ILE C CG2   1 
ATOM   2510  C  CD1   . ILE C  1 21  ? -11.191 32.256  55.484  1.00 26.97 ? 21   ILE C CD1   1 
ATOM   2511  N  N     . GLN C  1 22  ? -7.205  33.370  51.227  1.00 27.30 ? 22   GLN C N     1 
ATOM   2512  C  CA    . GLN C  1 22  ? -6.206  32.715  50.392  1.00 26.87 ? 22   GLN C CA    1 
ATOM   2513  C  C     . GLN C  1 22  ? -5.122  32.167  51.294  1.00 26.33 ? 22   GLN C C     1 
ATOM   2514  O  O     . GLN C  1 22  ? -4.689  32.851  52.223  1.00 26.51 ? 22   GLN C O     1 
ATOM   2515  C  CB    . GLN C  1 22  ? -5.622  33.690  49.378  1.00 27.11 ? 22   GLN C CB    1 
ATOM   2516  C  CG    . GLN C  1 22  ? -6.669  34.385  48.506  1.00 27.86 ? 22   GLN C CG    1 
ATOM   2517  C  CD    . GLN C  1 22  ? -6.053  35.400  47.552  1.00 29.11 ? 22   GLN C CD    1 
ATOM   2518  O  OE1   . GLN C  1 22  ? -4.832  35.513  47.466  1.00 30.55 ? 22   GLN C OE1   1 
ATOM   2519  N  NE2   . GLN C  1 22  ? -6.897  36.149  46.849  1.00 30.43 ? 22   GLN C NE2   1 
ATOM   2520  N  N     . VAL C  1 23  ? -4.706  30.929  51.039  1.00 25.64 ? 23   VAL C N     1 
ATOM   2521  C  CA    . VAL C  1 23  ? -3.715  30.251  51.882  1.00 24.96 ? 23   VAL C CA    1 
ATOM   2522  C  C     . VAL C  1 23  ? -2.498  29.881  51.040  1.00 24.68 ? 23   VAL C C     1 
ATOM   2523  O  O     . VAL C  1 23  ? -2.633  29.285  49.976  1.00 24.68 ? 23   VAL C O     1 
ATOM   2524  C  CB    . VAL C  1 23  ? -4.322  28.982  52.572  1.00 25.19 ? 23   VAL C CB    1 
ATOM   2525  C  CG1   . VAL C  1 23  ? -3.295  28.277  53.436  1.00 25.03 ? 23   VAL C CG1   1 
ATOM   2526  C  CG2   . VAL C  1 23  ? -5.536  29.351  53.421  1.00 24.59 ? 23   VAL C CG2   1 
ATOM   2527  N  N     . ILE C  1 24  ? -1.321  30.275  51.515  1.00 24.30 ? 24   ILE C N     1 
ATOM   2528  C  CA    . ILE C  1 24  ? -0.047  29.941  50.894  1.00 23.72 ? 24   ILE C CA    1 
ATOM   2529  C  C     . ILE C  1 24  ? 0.709   29.009  51.832  1.00 23.88 ? 24   ILE C C     1 
ATOM   2530  O  O     . ILE C  1 24  ? 1.206   29.437  52.876  1.00 23.94 ? 24   ILE C O     1 
ATOM   2531  C  CB    . ILE C  1 24  ? 0.793   31.206  50.667  1.00 23.62 ? 24   ILE C CB    1 
ATOM   2532  C  CG1   . ILE C  1 24  ? 0.007   32.254  49.875  1.00 23.39 ? 24   ILE C CG1   1 
ATOM   2533  C  CG2   . ILE C  1 24  ? 2.119   30.853  49.999  1.00 22.83 ? 24   ILE C CG2   1 
ATOM   2534  C  CD1   . ILE C  1 24  ? 0.533   33.675  50.047  1.00 21.89 ? 24   ILE C CD1   1 
ATOM   2535  N  N     . LEU C  1 25  ? 0.785   27.739  51.446  1.00 23.81 ? 25   LEU C N     1 
ATOM   2536  C  CA    . LEU C  1 25  ? 1.471   26.705  52.208  1.00 23.81 ? 25   LEU C CA    1 
ATOM   2537  C  C     . LEU C  1 25  ? 2.837   26.390  51.609  1.00 23.67 ? 25   LEU C C     1 
ATOM   2538  O  O     . LEU C  1 25  ? 3.143   26.816  50.506  1.00 23.72 ? 25   LEU C O     1 
ATOM   2539  C  CB    . LEU C  1 25  ? 0.607   25.431  52.259  1.00 23.72 ? 25   LEU C CB    1 
ATOM   2540  C  CG    . LEU C  1 25  ? -0.755  25.521  52.971  1.00 24.48 ? 25   LEU C CG    1 
ATOM   2541  C  CD1   . LEU C  1 25  ? -1.586  24.259  52.766  1.00 22.88 ? 25   LEU C CD1   1 
ATOM   2542  C  CD2   . LEU C  1 25  ? -0.603  25.826  54.478  1.00 24.06 ? 25   LEU C CD2   1 
ATOM   2543  N  N     . GLY C  1 26  ? 3.656   25.651  52.351  1.00 23.74 ? 26   GLY C N     1 
ATOM   2544  C  CA    . GLY C  1 26  ? 4.945   25.184  51.858  1.00 23.84 ? 26   GLY C CA    1 
ATOM   2545  C  C     . GLY C  1 26  ? 5.900   24.900  53.005  1.00 24.07 ? 26   GLY C C     1 
ATOM   2546  O  O     . GLY C  1 26  ? 5.633   25.297  54.142  1.00 24.22 ? 26   GLY C O     1 
ATOM   2547  N  N     . PRO C  1 27  ? 7.009   24.214  52.741  1.00 24.02 ? 27   PRO C N     1 
ATOM   2548  C  CA    . PRO C  1 27  ? 8.046   24.053  53.766  1.00 24.00 ? 27   PRO C CA    1 
ATOM   2549  C  C     . PRO C  1 27  ? 8.769   25.385  53.981  1.00 24.33 ? 27   PRO C C     1 
ATOM   2550  O  O     . PRO C  1 27  ? 8.409   26.391  53.344  1.00 24.51 ? 27   PRO C O     1 
ATOM   2551  C  CB    . PRO C  1 27  ? 8.996   23.035  53.133  1.00 23.88 ? 27   PRO C CB    1 
ATOM   2552  C  CG    . PRO C  1 27  ? 8.837   23.272  51.653  1.00 23.80 ? 27   PRO C CG    1 
ATOM   2553  C  CD    . PRO C  1 27  ? 7.364   23.523  51.483  1.00 24.01 ? 27   PRO C CD    1 
ATOM   2554  N  N     . MET C  1 28  ? 9.774   25.384  54.855  1.00 24.25 ? 28   MET C N     1 
ATOM   2555  C  CA    . MET C  1 28  ? 10.630  26.542  55.041  1.00 24.38 ? 28   MET C CA    1 
ATOM   2556  C  C     . MET C  1 28  ? 11.444  26.773  53.769  1.00 24.49 ? 28   MET C C     1 
ATOM   2557  O  O     . MET C  1 28  ? 11.664  25.831  52.976  1.00 24.55 ? 28   MET C O     1 
ATOM   2558  C  CB    . MET C  1 28  ? 11.548  26.327  56.253  1.00 24.76 ? 28   MET C CB    1 
ATOM   2559  C  CG    . MET C  1 28  ? 10.818  26.402  57.590  1.00 25.40 ? 28   MET C CG    1 
ATOM   2560  S  SD    . MET C  1 28  ? 11.920  26.309  59.026  1.00 28.56 ? 28   MET C SD    1 
ATOM   2561  C  CE    . MET C  1 28  ? 12.727  27.970  58.903  1.00 24.55 ? 28   MET C CE    1 
ATOM   2562  N  N     . PHE C  1 29  ? 11.871  28.022  53.572  1.00 24.41 ? 29   PHE C N     1 
ATOM   2563  C  CA    . PHE C  1 29  ? 12.747  28.410  52.447  1.00 24.39 ? 29   PHE C CA    1 
ATOM   2564  C  C     . PHE C  1 29  ? 12.104  28.324  51.058  1.00 24.10 ? 29   PHE C C     1 
ATOM   2565  O  O     . PHE C  1 29  ? 12.810  28.275  50.041  1.00 24.18 ? 29   PHE C O     1 
ATOM   2566  C  CB    . PHE C  1 29  ? 14.088  27.642  52.497  1.00 24.77 ? 29   PHE C CB    1 
ATOM   2567  C  CG    . PHE C  1 29  ? 14.631  27.468  53.893  1.00 25.83 ? 29   PHE C CG    1 
ATOM   2568  C  CD1   . PHE C  1 29  ? 14.797  26.193  54.434  1.00 26.62 ? 29   PHE C CD1   1 
ATOM   2569  C  CD2   . PHE C  1 29  ? 14.956  28.583  54.678  1.00 27.43 ? 29   PHE C CD2   1 
ATOM   2570  C  CE1   . PHE C  1 29  ? 15.303  26.014  55.735  1.00 25.80 ? 29   PHE C CE1   1 
ATOM   2571  C  CE2   . PHE C  1 29  ? 15.453  28.419  55.990  1.00 27.89 ? 29   PHE C CE2   1 
ATOM   2572  C  CZ    . PHE C  1 29  ? 15.618  27.117  56.514  1.00 26.93 ? 29   PHE C CZ    1 
ATOM   2573  N  N     . SER C  1 30  ? 10.772  28.319  51.020  1.00 23.74 ? 30   SER C N     1 
ATOM   2574  C  CA    . SER C  1 30  ? 10.027  28.243  49.769  1.00 23.50 ? 30   SER C CA    1 
ATOM   2575  C  C     . SER C  1 30  ? 9.504   29.604  49.300  1.00 23.43 ? 30   SER C C     1 
ATOM   2576  O  O     . SER C  1 30  ? 8.870   29.706  48.245  1.00 23.71 ? 30   SER C O     1 
ATOM   2577  C  CB    . SER C  1 30  ? 8.883   27.222  49.873  1.00 23.45 ? 30   SER C CB    1 
ATOM   2578  O  OG    . SER C  1 30  ? 7.956   27.576  50.880  1.00 24.40 ? 30   SER C OG    1 
ATOM   2579  N  N     . GLY C  1 31  ? 9.777   30.645  50.075  1.00 23.25 ? 31   GLY C N     1 
ATOM   2580  C  CA    . GLY C  1 31  ? 9.357   31.990  49.732  1.00 23.31 ? 31   GLY C CA    1 
ATOM   2581  C  C     . GLY C  1 31  ? 7.901   32.338  50.012  1.00 23.58 ? 31   GLY C C     1 
ATOM   2582  O  O     . GLY C  1 31  ? 7.328   33.198  49.321  1.00 23.85 ? 31   GLY C O     1 
ATOM   2583  N  N     . LYS C  1 32  ? 7.307   31.708  51.024  1.00 23.44 ? 32   LYS C N     1 
ATOM   2584  C  CA    . LYS C  1 32  ? 5.911   31.977  51.395  1.00 23.79 ? 32   LYS C CA    1 
ATOM   2585  C  C     . LYS C  1 32  ? 5.662   33.458  51.717  1.00 24.37 ? 32   LYS C C     1 
ATOM   2586  O  O     . LYS C  1 32  ? 4.688   34.054  51.226  1.00 24.27 ? 32   LYS C O     1 
ATOM   2587  C  CB    . LYS C  1 32  ? 5.477   31.116  52.591  1.00 23.78 ? 32   LYS C CB    1 
ATOM   2588  C  CG    . LYS C  1 32  ? 5.469   29.600  52.329  1.00 23.01 ? 32   LYS C CG    1 
ATOM   2589  C  CD    . LYS C  1 32  ? 4.946   28.815  53.537  1.00 22.31 ? 32   LYS C CD    1 
ATOM   2590  C  CE    . LYS C  1 32  ? 5.735   29.119  54.824  1.00 21.63 ? 32   LYS C CE    1 
ATOM   2591  N  NZ    . LYS C  1 32  ? 7.202   28.768  54.720  1.00 20.41 ? 32   LYS C NZ    1 
ATOM   2592  N  N     . SER C  1 33  ? 6.534   34.040  52.543  1.00 24.71 ? 33   SER C N     1 
ATOM   2593  C  CA    . SER C  1 33  ? 6.448   35.461  52.911  1.00 25.49 ? 33   SER C CA    1 
ATOM   2594  C  C     . SER C  1 33  ? 6.562   36.384  51.701  1.00 25.29 ? 33   SER C C     1 
ATOM   2595  O  O     . SER C  1 33  ? 5.863   37.391  51.620  1.00 25.41 ? 33   SER C O     1 
ATOM   2596  C  CB    . SER C  1 33  ? 7.534   35.835  53.925  1.00 25.56 ? 33   SER C CB    1 
ATOM   2597  O  OG    . SER C  1 33  ? 7.299   35.199  55.176  1.00 28.89 ? 33   SER C OG    1 
ATOM   2598  N  N     . THR C  1 34  ? 7.456   36.041  50.774  1.00 25.27 ? 34   THR C N     1 
ATOM   2599  C  CA    . THR C  1 34  ? 7.646   36.815  49.552  1.00 25.23 ? 34   THR C CA    1 
ATOM   2600  C  C     . THR C  1 34  ? 6.392   36.772  48.682  1.00 25.10 ? 34   THR C C     1 
ATOM   2601  O  O     . THR C  1 34  ? 5.970   37.800  48.168  1.00 25.51 ? 34   THR C O     1 
ATOM   2602  C  CB    . THR C  1 34  ? 8.884   36.313  48.771  1.00 25.20 ? 34   THR C CB    1 
ATOM   2603  O  OG1   . THR C  1 34  ? 10.038  36.430  49.599  1.00 25.59 ? 34   THR C OG1   1 
ATOM   2604  C  CG2   . THR C  1 34  ? 9.221   37.234  47.612  1.00 24.29 ? 34   THR C CG2   1 
ATOM   2605  N  N     . GLU C  1 35  ? 5.798   35.593  48.526  1.00 25.09 ? 35   GLU C N     1 
ATOM   2606  C  CA    . GLU C  1 35  ? 4.540   35.457  47.788  1.00 25.33 ? 35   GLU C CA    1 
ATOM   2607  C  C     . GLU C  1 35  ? 3.383   36.200  48.481  1.00 25.32 ? 35   GLU C C     1 
ATOM   2608  O  O     . GLU C  1 35  ? 2.560   36.816  47.814  1.00 25.22 ? 35   GLU C O     1 
ATOM   2609  C  CB    . GLU C  1 35  ? 4.208   33.974  47.543  1.00 25.38 ? 35   GLU C CB    1 
ATOM   2610  C  CG    . GLU C  1 35  ? 2.837   33.682  46.925  1.00 26.87 ? 35   GLU C CG    1 
ATOM   2611  C  CD    . GLU C  1 35  ? 2.648   34.195  45.494  1.00 30.00 ? 35   GLU C CD    1 
ATOM   2612  O  OE1   . GLU C  1 35  ? 3.611   34.730  44.875  1.00 30.23 ? 35   GLU C OE1   1 
ATOM   2613  O  OE2   . GLU C  1 35  ? 1.511   34.053  44.972  1.00 30.21 ? 35   GLU C OE2   1 
ATOM   2614  N  N     . LEU C  1 36  ? 3.334   36.159  49.812  1.00 25.43 ? 36   LEU C N     1 
ATOM   2615  C  CA    . LEU C  1 36  ? 2.346   36.945  50.545  1.00 25.87 ? 36   LEU C CA    1 
ATOM   2616  C  C     . LEU C  1 36  ? 2.481   38.434  50.202  1.00 26.12 ? 36   LEU C C     1 
ATOM   2617  O  O     . LEU C  1 36  ? 1.485   39.089  49.884  1.00 25.88 ? 36   LEU C O     1 
ATOM   2618  C  CB    . LEU C  1 36  ? 2.431   36.705  52.061  1.00 26.00 ? 36   LEU C CB    1 
ATOM   2619  C  CG    . LEU C  1 36  ? 1.800   37.762  52.995  1.00 26.48 ? 36   LEU C CG    1 
ATOM   2620  C  CD1   . LEU C  1 36  ? 0.286   37.784  52.899  1.00 25.90 ? 36   LEU C CD1   1 
ATOM   2621  C  CD2   . LEU C  1 36  ? 2.227   37.573  54.439  1.00 26.65 ? 36   LEU C CD2   1 
ATOM   2622  N  N     . MET C  1 37  ? 3.712   38.947  50.241  1.00 26.45 ? 37   MET C N     1 
ATOM   2623  C  CA    . MET C  1 37  ? 3.980   40.353  49.955  1.00 27.22 ? 37   MET C CA    1 
ATOM   2624  C  C     . MET C  1 37  ? 3.649   40.699  48.518  1.00 26.79 ? 37   MET C C     1 
ATOM   2625  O  O     . MET C  1 37  ? 3.094   41.753  48.262  1.00 26.87 ? 37   MET C O     1 
ATOM   2626  C  CB    . MET C  1 37  ? 5.438   40.723  50.257  1.00 27.91 ? 37   MET C CB    1 
ATOM   2627  C  CG    . MET C  1 37  ? 5.802   40.799  51.752  1.00 31.17 ? 37   MET C CG    1 
ATOM   2628  S  SD    . MET C  1 37  ? 4.533   41.583  52.833  1.00 40.23 ? 37   MET C SD    1 
ATOM   2629  C  CE    . MET C  1 37  ? 4.472   43.319  52.190  1.00 37.44 ? 37   MET C CE    1 
ATOM   2630  N  N     . ARG C  1 38  ? 3.991   39.811  47.585  1.00 26.58 ? 38   ARG C N     1 
ATOM   2631  C  CA    . ARG C  1 38  ? 3.622   39.991  46.183  1.00 26.35 ? 38   ARG C CA    1 
ATOM   2632  C  C     . ARG C  1 38  ? 2.110   40.209  46.043  1.00 26.43 ? 38   ARG C C     1 
ATOM   2633  O  O     . ARG C  1 38  ? 1.666   41.149  45.385  1.00 26.61 ? 38   ARG C O     1 
ATOM   2634  C  CB    . ARG C  1 38  ? 4.076   38.800  45.322  1.00 26.09 ? 38   ARG C CB    1 
ATOM   2635  C  CG    . ARG C  1 38  ? 3.842   39.019  43.818  1.00 25.96 ? 38   ARG C CG    1 
ATOM   2636  C  CD    . ARG C  1 38  ? 4.066   37.811  42.902  1.00 25.94 ? 38   ARG C CD    1 
ATOM   2637  N  NE    . ARG C  1 38  ? 3.065   36.759  43.100  1.00 26.92 ? 38   ARG C NE    1 
ATOM   2638  C  CZ    . ARG C  1 38  ? 1.853   36.714  42.531  1.00 26.32 ? 38   ARG C CZ    1 
ATOM   2639  N  NH1   . ARG C  1 38  ? 1.453   37.669  41.692  1.00 25.33 ? 38   ARG C NH1   1 
ATOM   2640  N  NH2   . ARG C  1 38  ? 1.036   35.698  42.809  1.00 23.88 ? 38   ARG C NH2   1 
ATOM   2641  N  N     . ARG C  1 39  ? 1.325   39.340  46.668  1.00 26.44 ? 39   ARG C N     1 
ATOM   2642  C  CA    . ARG C  1 39  ? -0.125  39.432  46.568  1.00 26.74 ? 39   ARG C CA    1 
ATOM   2643  C  C     . ARG C  1 39  ? -0.670  40.686  47.234  1.00 27.20 ? 39   ARG C C     1 
ATOM   2644  O  O     . ARG C  1 39  ? -1.580  41.313  46.711  1.00 27.60 ? 39   ARG C O     1 
ATOM   2645  C  CB    . ARG C  1 39  ? -0.801  38.195  47.148  1.00 26.48 ? 39   ARG C CB    1 
ATOM   2646  C  CG    . ARG C  1 39  ? -0.560  36.937  46.365  1.00 26.47 ? 39   ARG C CG    1 
ATOM   2647  C  CD    . ARG C  1 39  ? -1.491  35.820  46.762  1.00 26.83 ? 39   ARG C CD    1 
ATOM   2648  N  NE    . ARG C  1 39  ? -1.035  34.505  46.316  1.00 25.78 ? 39   ARG C NE    1 
ATOM   2649  C  CZ    . ARG C  1 39  ? -1.672  33.376  46.600  1.00 26.63 ? 39   ARG C CZ    1 
ATOM   2650  N  NH1   . ARG C  1 39  ? -2.789  33.407  47.318  1.00 26.71 ? 39   ARG C NH1   1 
ATOM   2651  N  NH2   . ARG C  1 39  ? -1.208  32.215  46.168  1.00 25.57 ? 39   ARG C NH2   1 
ATOM   2652  N  N     . VAL C  1 40  ? -0.112  41.050  48.383  1.00 27.62 ? 40   VAL C N     1 
ATOM   2653  C  CA    . VAL C  1 40  ? -0.548  42.241  49.108  1.00 28.21 ? 40   VAL C CA    1 
ATOM   2654  C  C     . VAL C  1 40  ? -0.227  43.522  48.323  1.00 28.83 ? 40   VAL C C     1 
ATOM   2655  O  O     . VAL C  1 40  ? -1.070  44.412  48.212  1.00 28.87 ? 40   VAL C O     1 
ATOM   2656  C  CB    . VAL C  1 40  ? 0.048   42.276  50.544  1.00 28.27 ? 40   VAL C CB    1 
ATOM   2657  C  CG1   . VAL C  1 40  ? -0.094  43.659  51.170  1.00 28.06 ? 40   VAL C CG1   1 
ATOM   2658  C  CG2   . VAL C  1 40  ? -0.617  41.195  51.430  1.00 27.81 ? 40   VAL C CG2   1 
ATOM   2659  N  N     . ARG C  1 41  ? 0.979   43.600  47.764  1.00 29.54 ? 41   ARG C N     1 
ATOM   2660  C  CA    . ARG C  1 41  ? 1.384   44.770  46.979  1.00 30.84 ? 41   ARG C CA    1 
ATOM   2661  C  C     . ARG C  1 41  ? 0.508   45.022  45.746  1.00 30.78 ? 41   ARG C C     1 
ATOM   2662  O  O     . ARG C  1 41  ? 0.304   46.167  45.355  1.00 30.72 ? 41   ARG C O     1 
ATOM   2663  C  CB    . ARG C  1 41  ? 2.867   44.703  46.596  1.00 31.18 ? 41   ARG C CB    1 
ATOM   2664  C  CG    . ARG C  1 41  ? 3.770   45.043  47.772  1.00 34.90 ? 41   ARG C CG    1 
ATOM   2665  C  CD    . ARG C  1 41  ? 5.216   45.382  47.427  1.00 40.53 ? 41   ARG C CD    1 
ATOM   2666  N  NE    . ARG C  1 41  ? 6.100   45.024  48.539  1.00 43.19 ? 41   ARG C NE    1 
ATOM   2667  C  CZ    . ARG C  1 41  ? 6.753   43.865  48.635  1.00 45.12 ? 41   ARG C CZ    1 
ATOM   2668  N  NH1   . ARG C  1 41  ? 6.636   42.942  47.677  1.00 45.02 ? 41   ARG C NH1   1 
ATOM   2669  N  NH2   . ARG C  1 41  ? 7.525   43.626  49.692  1.00 45.16 ? 41   ARG C NH2   1 
ATOM   2670  N  N     . ARG C  1 42  ? -0.016  43.949  45.154  1.00 31.03 ? 42   ARG C N     1 
ATOM   2671  C  CA    . ARG C  1 42  ? -0.963  44.045  44.042  1.00 31.36 ? 42   ARG C CA    1 
ATOM   2672  C  C     . ARG C  1 42  ? -2.195  44.885  44.388  1.00 31.34 ? 42   ARG C C     1 
ATOM   2673  O  O     . ARG C  1 42  ? -2.639  45.692  43.572  1.00 31.06 ? 42   ARG C O     1 
ATOM   2674  C  CB    . ARG C  1 42  ? -1.433  42.655  43.619  1.00 31.00 ? 42   ARG C CB    1 
ATOM   2675  C  CG    . ARG C  1 42  ? -0.512  41.941  42.671  1.00 32.87 ? 42   ARG C CG    1 
ATOM   2676  C  CD    . ARG C  1 42  ? -0.791  40.446  42.529  1.00 34.43 ? 42   ARG C CD    1 
ATOM   2677  N  NE    . ARG C  1 42  ? -2.090  40.197  41.914  1.00 36.21 ? 42   ARG C NE    1 
ATOM   2678  C  CZ    . ARG C  1 42  ? -3.191  39.867  42.585  1.00 37.44 ? 42   ARG C CZ    1 
ATOM   2679  N  NH1   . ARG C  1 42  ? -3.161  39.743  43.913  1.00 37.90 ? 42   ARG C NH1   1 
ATOM   2680  N  NH2   . ARG C  1 42  ? -4.324  39.675  41.925  1.00 36.14 ? 42   ARG C NH2   1 
ATOM   2681  N  N     . PHE C  1 43  ? -2.758  44.656  45.576  1.00 31.48 ? 43   PHE C N     1 
ATOM   2682  C  CA    . PHE C  1 43  ? -3.907  45.425  46.045  1.00 31.96 ? 43   PHE C CA    1 
ATOM   2683  C  C     . PHE C  1 43  ? -3.505  46.842  46.438  1.00 32.76 ? 43   PHE C C     1 
ATOM   2684  O  O     . PHE C  1 43  ? -4.200  47.795  46.104  1.00 32.67 ? 43   PHE C O     1 
ATOM   2685  C  CB    . PHE C  1 43  ? -4.621  44.710  47.205  1.00 31.62 ? 43   PHE C CB    1 
ATOM   2686  C  CG    . PHE C  1 43  ? -5.342  43.451  46.784  1.00 30.96 ? 43   PHE C CG    1 
ATOM   2687  C  CD1   . PHE C  1 43  ? -4.781  42.200  47.034  1.00 29.86 ? 43   PHE C CD1   1 
ATOM   2688  C  CD2   . PHE C  1 43  ? -6.564  43.519  46.111  1.00 29.47 ? 43   PHE C CD2   1 
ATOM   2689  C  CE1   . PHE C  1 43  ? -5.435  41.032  46.631  1.00 30.47 ? 43   PHE C CE1   1 
ATOM   2690  C  CE2   . PHE C  1 43  ? -7.226  42.363  45.693  1.00 30.09 ? 43   PHE C CE2   1 
ATOM   2691  C  CZ    . PHE C  1 43  ? -6.663  41.112  45.952  1.00 30.29 ? 43   PHE C CZ    1 
ATOM   2692  N  N     . GLN C  1 44  ? -2.372  46.971  47.126  1.00 33.68 ? 44   GLN C N     1 
ATOM   2693  C  CA    . GLN C  1 44  ? -1.908  48.262  47.627  1.00 34.98 ? 44   GLN C CA    1 
ATOM   2694  C  C     . GLN C  1 44  ? -1.615  49.253  46.493  1.00 35.31 ? 44   GLN C C     1 
ATOM   2695  O  O     . GLN C  1 44  ? -2.025  50.408  46.548  1.00 35.24 ? 44   GLN C O     1 
ATOM   2696  C  CB    . GLN C  1 44  ? -0.704  48.053  48.533  1.00 35.31 ? 44   GLN C CB    1 
ATOM   2697  C  CG    . GLN C  1 44  ? -0.095  49.296  49.100  1.00 37.85 ? 44   GLN C CG    1 
ATOM   2698  C  CD    . GLN C  1 44  ? 1.389   49.117  49.306  1.00 41.41 ? 44   GLN C CD    1 
ATOM   2699  O  OE1   . GLN C  1 44  ? 2.184   49.378  48.393  1.00 43.02 ? 44   GLN C OE1   1 
ATOM   2700  N  NE2   . GLN C  1 44  ? 1.771   48.644  50.493  1.00 41.90 ? 44   GLN C NE2   1 
ATOM   2701  N  N     . ILE C  1 45  ? -0.948  48.772  45.448  1.00 36.03 ? 45   ILE C N     1 
ATOM   2702  C  CA    . ILE C  1 45  ? -0.666  49.560  44.247  1.00 36.52 ? 45   ILE C CA    1 
ATOM   2703  C  C     . ILE C  1 45  ? -1.955  50.039  43.550  1.00 36.68 ? 45   ILE C C     1 
ATOM   2704  O  O     . ILE C  1 45  ? -1.953  51.032  42.823  1.00 36.57 ? 45   ILE C O     1 
ATOM   2705  C  CB    . ILE C  1 45  ? 0.278   48.729  43.302  1.00 36.73 ? 45   ILE C CB    1 
ATOM   2706  C  CG1   . ILE C  1 45  ? 1.548   49.512  42.914  1.00 37.32 ? 45   ILE C CG1   1 
ATOM   2707  C  CG2   . ILE C  1 45  ? -0.470  48.091  42.112  1.00 36.64 ? 45   ILE C CG2   1 
ATOM   2708  C  CD1   . ILE C  1 45  ? 1.332   50.766  42.094  1.00 38.79 ? 45   ILE C CD1   1 
ATOM   2709  N  N     . ALA C  1 46  ? -3.056  49.334  43.795  1.00 37.00 ? 46   ALA C N     1 
ATOM   2710  C  CA    . ALA C  1 46  ? -4.361  49.732  43.267  1.00 37.48 ? 46   ALA C CA    1 
ATOM   2711  C  C     . ALA C  1 46  ? -5.213  50.512  44.280  1.00 37.99 ? 46   ALA C C     1 
ATOM   2712  O  O     . ALA C  1 46  ? -6.428  50.633  44.109  1.00 38.15 ? 46   ALA C O     1 
ATOM   2713  C  CB    . ALA C  1 46  ? -5.113  48.520  42.749  1.00 37.18 ? 46   ALA C CB    1 
ATOM   2714  N  N     . GLN C  1 47  ? -4.568  51.023  45.330  1.00 38.90 ? 47   GLN C N     1 
ATOM   2715  C  CA    . GLN C  1 47  ? -5.174  51.963  46.287  1.00 39.88 ? 47   GLN C CA    1 
ATOM   2716  C  C     . GLN C  1 47  ? -5.994  51.331  47.416  1.00 39.81 ? 47   GLN C C     1 
ATOM   2717  O  O     . GLN C  1 47  ? -6.662  52.048  48.163  1.00 40.08 ? 47   GLN C O     1 
ATOM   2718  C  CB    . GLN C  1 47  ? -5.996  53.054  45.566  1.00 40.31 ? 47   GLN C CB    1 
ATOM   2719  C  CG    . GLN C  1 47  ? -5.192  53.970  44.632  1.00 42.39 ? 47   GLN C CG    1 
ATOM   2720  C  CD    . GLN C  1 47  ? -4.335  54.956  45.402  1.00 46.30 ? 47   GLN C CD    1 
ATOM   2721  O  OE1   . GLN C  1 47  ? -3.197  54.639  45.786  1.00 47.10 ? 47   GLN C OE1   1 
ATOM   2722  N  NE2   . GLN C  1 47  ? -4.882  56.146  45.654  1.00 47.09 ? 47   GLN C NE2   1 
ATOM   2723  N  N     . TYR C  1 48  ? -5.937  50.004  47.547  1.00 39.59 ? 48   TYR C N     1 
ATOM   2724  C  CA    . TYR C  1 48  ? -6.552  49.310  48.681  1.00 39.40 ? 48   TYR C CA    1 
ATOM   2725  C  C     . TYR C  1 48  ? -5.780  49.605  49.961  1.00 39.09 ? 48   TYR C C     1 
ATOM   2726  O  O     . TYR C  1 48  ? -4.551  49.678  49.942  1.00 39.09 ? 48   TYR C O     1 
ATOM   2727  C  CB    . TYR C  1 48  ? -6.534  47.796  48.452  1.00 39.61 ? 48   TYR C CB    1 
ATOM   2728  C  CG    . TYR C  1 48  ? -7.606  47.265  47.523  1.00 40.24 ? 48   TYR C CG    1 
ATOM   2729  C  CD1   . TYR C  1 48  ? -8.820  46.802  48.026  1.00 41.60 ? 48   TYR C CD1   1 
ATOM   2730  C  CD2   . TYR C  1 48  ? -7.395  47.204  46.142  1.00 40.75 ? 48   TYR C CD2   1 
ATOM   2731  C  CE1   . TYR C  1 48  ? -9.806  46.300  47.176  1.00 43.03 ? 48   TYR C CE1   1 
ATOM   2732  C  CE2   . TYR C  1 48  ? -8.370  46.704  45.286  1.00 41.58 ? 48   TYR C CE2   1 
ATOM   2733  C  CZ    . TYR C  1 48  ? -9.572  46.250  45.809  1.00 42.90 ? 48   TYR C CZ    1 
ATOM   2734  O  OH    . TYR C  1 48  ? -10.546 45.752  44.975  1.00 43.92 ? 48   TYR C OH    1 
ATOM   2735  N  N     . LYS C  1 49  ? -6.489  49.753  51.076  1.00 38.89 ? 49   LYS C N     1 
ATOM   2736  C  CA    . LYS C  1 49  ? -5.834  49.823  52.379  1.00 38.63 ? 49   LYS C CA    1 
ATOM   2737  C  C     . LYS C  1 49  ? -5.446  48.413  52.836  1.00 37.73 ? 49   LYS C C     1 
ATOM   2738  O  O     . LYS C  1 49  ? -6.264  47.492  52.808  1.00 37.45 ? 49   LYS C O     1 
ATOM   2739  C  CB    . LYS C  1 49  ? -6.735  50.510  53.404  1.00 39.32 ? 49   LYS C CB    1 
ATOM   2740  C  CG    . LYS C  1 49  ? -6.920  52.003  53.146  1.00 41.44 ? 49   LYS C CG    1 
ATOM   2741  C  CD    . LYS C  1 49  ? -7.845  52.634  54.178  1.00 44.95 ? 49   LYS C CD    1 
ATOM   2742  C  CE    . LYS C  1 49  ? -9.173  53.042  53.535  1.00 46.40 ? 49   LYS C CE    1 
ATOM   2743  N  NZ    . LYS C  1 49  ? -9.894  54.069  54.339  1.00 47.94 ? 49   LYS C NZ    1 
ATOM   2744  N  N     . CYS C  1 50  ? -4.191  48.256  53.248  1.00 36.81 ? 50   CYS C N     1 
ATOM   2745  C  CA    . CYS C  1 50  ? -3.637  46.948  53.566  1.00 36.21 ? 50   CYS C CA    1 
ATOM   2746  C  C     . CYS C  1 50  ? -3.024  46.896  54.952  1.00 35.78 ? 50   CYS C C     1 
ATOM   2747  O  O     . CYS C  1 50  ? -2.526  47.897  55.467  1.00 35.89 ? 50   CYS C O     1 
ATOM   2748  C  CB    . CYS C  1 50  ? -2.582  46.547  52.523  1.00 36.06 ? 50   CYS C CB    1 
ATOM   2749  S  SG    . CYS C  1 50  ? -3.227  46.445  50.826  1.00 36.74 ? 50   CYS C SG    1 
ATOM   2750  N  N     . LEU C  1 51  ? -3.057  45.710  55.548  1.00 35.16 ? 51   LEU C N     1 
ATOM   2751  C  CA    . LEU C  1 51  ? -2.408  45.459  56.833  1.00 34.61 ? 51   LEU C CA    1 
ATOM   2752  C  C     . LEU C  1 51  ? -1.694  44.124  56.770  1.00 34.13 ? 51   LEU C C     1 
ATOM   2753  O  O     . LEU C  1 51  ? -2.275  43.134  56.334  1.00 34.21 ? 51   LEU C O     1 
ATOM   2754  C  CB    . LEU C  1 51  ? -3.441  45.421  57.971  1.00 34.78 ? 51   LEU C CB    1 
ATOM   2755  C  CG    . LEU C  1 51  ? -2.882  45.214  59.386  1.00 35.25 ? 51   LEU C CG    1 
ATOM   2756  C  CD1   . LEU C  1 51  ? -2.108  46.459  59.829  1.00 35.33 ? 51   LEU C CD1   1 
ATOM   2757  C  CD2   . LEU C  1 51  ? -3.967  44.842  60.407  1.00 34.55 ? 51   LEU C CD2   1 
ATOM   2758  N  N     . VAL C  1 52  ? -0.439  44.100  57.204  1.00 33.75 ? 52   VAL C N     1 
ATOM   2759  C  CA    . VAL C  1 52  ? 0.324   42.865  57.306  1.00 33.67 ? 52   VAL C CA    1 
ATOM   2760  C  C     . VAL C  1 52  ? 0.595   42.573  58.781  1.00 33.69 ? 52   VAL C C     1 
ATOM   2761  O  O     . VAL C  1 52  ? 1.066   43.444  59.509  1.00 33.65 ? 52   VAL C O     1 
ATOM   2762  C  CB    . VAL C  1 52  ? 1.664   42.954  56.517  1.00 33.75 ? 52   VAL C CB    1 
ATOM   2763  C  CG1   . VAL C  1 52  ? 2.526   41.719  56.749  1.00 33.76 ? 52   VAL C CG1   1 
ATOM   2764  C  CG2   . VAL C  1 52  ? 1.402   43.126  55.034  1.00 34.11 ? 52   VAL C CG2   1 
ATOM   2765  N  N     . ILE C  1 53  ? 0.284   41.350  59.208  1.00 33.85 ? 53   ILE C N     1 
ATOM   2766  C  CA    . ILE C  1 53  ? 0.501   40.898  60.580  1.00 34.06 ? 53   ILE C CA    1 
ATOM   2767  C  C     . ILE C  1 53  ? 1.593   39.833  60.601  1.00 34.67 ? 53   ILE C C     1 
ATOM   2768  O  O     . ILE C  1 53  ? 1.560   38.889  59.822  1.00 34.62 ? 53   ILE C O     1 
ATOM   2769  C  CB    . ILE C  1 53  ? -0.820  40.326  61.180  1.00 34.01 ? 53   ILE C CB    1 
ATOM   2770  C  CG1   . ILE C  1 53  ? -1.862  41.432  61.339  1.00 34.13 ? 53   ILE C CG1   1 
ATOM   2771  C  CG2   . ILE C  1 53  ? -0.566  39.659  62.529  1.00 33.67 ? 53   ILE C CG2   1 
ATOM   2772  C  CD1   . ILE C  1 53  ? -3.306  40.958  61.237  1.00 34.16 ? 53   ILE C CD1   1 
ATOM   2773  N  N     . LYS C  1 54  ? 2.557   39.996  61.499  1.00 35.65 ? 54   LYS C N     1 
ATOM   2774  C  CA    . LYS C  1 54  ? 3.641   39.035  61.675  1.00 36.86 ? 54   LYS C CA    1 
ATOM   2775  C  C     . LYS C  1 54  ? 3.646   38.485  63.114  1.00 37.10 ? 54   LYS C C     1 
ATOM   2776  O  O     . LYS C  1 54  ? 3.229   39.169  64.043  1.00 37.04 ? 54   LYS C O     1 
ATOM   2777  C  CB    . LYS C  1 54  ? 4.971   39.722  61.360  1.00 37.34 ? 54   LYS C CB    1 
ATOM   2778  C  CG    . LYS C  1 54  ? 6.041   38.796  60.809  1.00 39.88 ? 54   LYS C CG    1 
ATOM   2779  C  CD    . LYS C  1 54  ? 7.279   39.582  60.394  1.00 43.28 ? 54   LYS C CD    1 
ATOM   2780  C  CE    . LYS C  1 54  ? 8.476   38.661  60.187  1.00 45.29 ? 54   LYS C CE    1 
ATOM   2781  N  NZ    . LYS C  1 54  ? 9.776   39.411  60.289  1.00 46.73 ? 54   LYS C NZ    1 
ATOM   2782  N  N     . TYR C  1 55  ? 4.101   37.245  63.283  1.00 37.77 ? 55   TYR C N     1 
ATOM   2783  C  CA    . TYR C  1 55  ? 4.208   36.633  64.602  1.00 38.54 ? 55   TYR C CA    1 
ATOM   2784  C  C     . TYR C  1 55  ? 5.337   37.287  65.406  1.00 39.43 ? 55   TYR C C     1 
ATOM   2785  O  O     . TYR C  1 55  ? 6.505   37.227  65.011  1.00 39.30 ? 55   TYR C O     1 
ATOM   2786  C  CB    . TYR C  1 55  ? 4.471   35.137  64.474  1.00 38.17 ? 55   TYR C CB    1 
ATOM   2787  C  CG    . TYR C  1 55  ? 4.432   34.398  65.785  1.00 37.63 ? 55   TYR C CG    1 
ATOM   2788  C  CD1   . TYR C  1 55  ? 3.331   34.517  66.639  1.00 37.54 ? 55   TYR C CD1   1 
ATOM   2789  C  CD2   . TYR C  1 55  ? 5.491   33.576  66.177  1.00 36.86 ? 55   TYR C CD2   1 
ATOM   2790  C  CE1   . TYR C  1 55  ? 3.279   33.834  67.850  1.00 37.44 ? 55   TYR C CE1   1 
ATOM   2791  C  CE2   . TYR C  1 55  ? 5.446   32.882  67.384  1.00 37.28 ? 55   TYR C CE2   1 
ATOM   2792  C  CZ    . TYR C  1 55  ? 4.336   33.024  68.214  1.00 37.86 ? 55   TYR C CZ    1 
ATOM   2793  O  OH    . TYR C  1 55  ? 4.270   32.359  69.412  1.00 39.76 ? 55   TYR C OH    1 
ATOM   2794  N  N     . ALA C  1 56  ? 4.980   37.879  66.545  1.00 40.73 ? 56   ALA C N     1 
ATOM   2795  C  CA    . ALA C  1 56  ? 5.906   38.696  67.335  1.00 42.11 ? 56   ALA C CA    1 
ATOM   2796  C  C     . ALA C  1 56  ? 7.146   37.950  67.809  1.00 43.16 ? 56   ALA C C     1 
ATOM   2797  O  O     . ALA C  1 56  ? 8.222   38.544  67.925  1.00 43.52 ? 56   ALA C O     1 
ATOM   2798  C  CB    . ALA C  1 56  ? 5.180   39.328  68.526  1.00 42.25 ? 56   ALA C CB    1 
ATOM   2799  N  N     . LYS C  1 57  ? 7.003   36.651  68.060  1.00 44.46 ? 57   LYS C N     1 
ATOM   2800  C  CA    . LYS C  1 57  ? 8.087   35.851  68.627  1.00 45.82 ? 57   LYS C CA    1 
ATOM   2801  C  C     . LYS C  1 57  ? 9.105   35.364  67.600  1.00 46.57 ? 57   LYS C C     1 
ATOM   2802  O  O     . LYS C  1 57  ? 10.144  34.819  67.977  1.00 46.79 ? 57   LYS C O     1 
ATOM   2803  C  CB    . LYS C  1 57  ? 7.528   34.672  69.428  1.00 45.88 ? 57   LYS C CB    1 
ATOM   2804  C  CG    . LYS C  1 57  ? 7.128   35.008  70.863  1.00 46.99 ? 57   LYS C CG    1 
ATOM   2805  C  CD    . LYS C  1 57  ? 6.606   33.767  71.594  1.00 49.47 ? 57   LYS C CD    1 
ATOM   2806  C  CE    . LYS C  1 57  ? 5.902   34.128  72.901  1.00 50.70 ? 57   LYS C CE    1 
ATOM   2807  N  NZ    . LYS C  1 57  ? 4.439   33.850  72.851  1.00 51.77 ? 57   LYS C NZ    1 
ATOM   2808  N  N     . ASP C  1 58  ? 8.815   35.543  66.311  1.00 47.58 ? 58   ASP C N     1 
ATOM   2809  C  CA    . ASP C  1 58  ? 9.824   35.268  65.290  1.00 48.57 ? 58   ASP C CA    1 
ATOM   2810  C  C     . ASP C  1 58  ? 10.636  36.506  64.961  1.00 49.20 ? 58   ASP C C     1 
ATOM   2811  O  O     . ASP C  1 58  ? 10.221  37.382  64.179  1.00 49.32 ? 58   ASP C O     1 
ATOM   2812  C  CB    . ASP C  1 58  ? 9.277   34.602  64.030  1.00 48.58 ? 58   ASP C CB    1 
ATOM   2813  C  CG    . ASP C  1 58  ? 10.341  33.773  63.314  1.00 49.22 ? 58   ASP C CG    1 
ATOM   2814  O  OD1   . ASP C  1 58  ? 11.501  34.244  63.196  1.00 49.68 ? 58   ASP C OD1   1 
ATOM   2815  O  OD2   . ASP C  1 58  ? 10.123  32.631  62.861  1.00 48.91 ? 58   ASP C OD2   1 
ATOM   2816  N  N     . THR C  1 59  ? 11.817  36.486  65.584  1.00 50.36 ? 59   THR C N     1 
ATOM   2817  C  CA    . THR C  1 59  ? 12.770  37.586  65.697  1.00 51.46 ? 59   THR C CA    1 
ATOM   2818  C  C     . THR C  1 59  ? 13.789  37.602  64.565  1.00 52.11 ? 59   THR C C     1 
ATOM   2819  O  O     . THR C  1 59  ? 14.326  38.664  64.236  1.00 52.56 ? 59   THR C O     1 
ATOM   2820  C  CB    . THR C  1 59  ? 13.541  37.485  67.058  1.00 51.46 ? 59   THR C CB    1 
ATOM   2821  O  OG1   . THR C  1 59  ? 14.016  36.146  67.260  1.00 51.55 ? 59   THR C OG1   1 
ATOM   2822  C  CG2   . THR C  1 59  ? 12.608  37.688  68.246  1.00 51.42 ? 59   THR C CG2   1 
ATOM   2823  N  N     . ARG C  1 60  ? 14.055  36.427  63.988  1.00 52.55 ? 60   ARG C N     1 
ATOM   2824  C  CA    . ARG C  1 60  ? 15.121  36.228  62.995  1.00 53.02 ? 60   ARG C CA    1 
ATOM   2825  C  C     . ARG C  1 60  ? 15.603  37.502  62.285  1.00 53.18 ? 60   ARG C C     1 
ATOM   2826  O  O     . ARG C  1 60  ? 14.830  38.178  61.605  1.00 53.32 ? 60   ARG C O     1 
ATOM   2827  C  CB    . ARG C  1 60  ? 14.700  35.181  61.961  1.00 53.12 ? 60   ARG C CB    1 
ATOM   2828  C  CG    . ARG C  1 60  ? 14.868  33.748  62.430  1.00 53.18 ? 60   ARG C CG    1 
ATOM   2829  C  CD    . ARG C  1 60  ? 14.341  32.719  61.451  1.00 54.02 ? 60   ARG C CD    1 
ATOM   2830  N  NE    . ARG C  1 60  ? 12.908  32.884  61.199  1.00 54.66 ? 60   ARG C NE    1 
ATOM   2831  C  CZ    . ARG C  1 60  ? 12.344  32.862  59.994  1.00 54.64 ? 60   ARG C CZ    1 
ATOM   2832  N  NH1   . ARG C  1 60  ? 13.079  32.678  58.905  1.00 53.83 ? 60   ARG C NH1   1 
ATOM   2833  N  NH2   . ARG C  1 60  ? 11.033  33.025  59.879  1.00 55.01 ? 60   ARG C NH2   1 
ATOM   2834  N  N     . ALA C  1 75  ? 3.647   46.619  59.112  1.00 48.22 ? 75   ALA C N     1 
ATOM   2835  C  CA    . ALA C  1 75  ? 3.883   45.228  59.499  1.00 47.90 ? 75   ALA C CA    1 
ATOM   2836  C  C     . ALA C  1 75  ? 3.771   45.039  61.016  1.00 47.52 ? 75   ALA C C     1 
ATOM   2837  O  O     . ALA C  1 75  ? 4.784   45.005  61.717  1.00 47.69 ? 75   ALA C O     1 
ATOM   2838  C  CB    . ALA C  1 75  ? 5.252   44.749  58.984  1.00 47.96 ? 75   ALA C CB    1 
ATOM   2839  N  N     . LEU C  1 76  ? 2.536   44.907  61.506  1.00 46.67 ? 76   LEU C N     1 
ATOM   2840  C  CA    . LEU C  1 76  ? 2.255   44.799  62.943  1.00 45.94 ? 76   LEU C CA    1 
ATOM   2841  C  C     . LEU C  1 76  ? 2.613   43.444  63.554  1.00 45.11 ? 76   LEU C C     1 
ATOM   2842  O  O     . LEU C  1 76  ? 2.107   42.416  63.113  1.00 45.08 ? 76   LEU C O     1 
ATOM   2843  C  CB    . LEU C  1 76  ? 0.778   45.108  63.239  1.00 46.07 ? 76   LEU C CB    1 
ATOM   2844  C  CG    . LEU C  1 76  ? 0.211   46.513  62.994  1.00 46.95 ? 76   LEU C CG    1 
ATOM   2845  C  CD1   . LEU C  1 76  ? -1.158  46.628  63.639  1.00 47.34 ? 76   LEU C CD1   1 
ATOM   2846  C  CD2   . LEU C  1 76  ? 1.130   47.649  63.482  1.00 47.74 ? 76   LEU C CD2   1 
ATOM   2847  N  N     . PRO C  1 77  ? 3.468   43.439  64.578  1.00 44.50 ? 77   PRO C N     1 
ATOM   2848  C  CA    . PRO C  1 77  ? 3.749   42.209  65.331  1.00 43.88 ? 77   PRO C CA    1 
ATOM   2849  C  C     . PRO C  1 77  ? 2.595   41.859  66.270  1.00 43.35 ? 77   PRO C C     1 
ATOM   2850  O  O     . PRO C  1 77  ? 1.951   42.761  66.810  1.00 43.19 ? 77   PRO C O     1 
ATOM   2851  C  CB    . PRO C  1 77  ? 5.014   42.558  66.119  1.00 43.97 ? 77   PRO C CB    1 
ATOM   2852  C  CG    . PRO C  1 77  ? 5.487   43.881  65.560  1.00 44.36 ? 77   PRO C CG    1 
ATOM   2853  C  CD    . PRO C  1 77  ? 4.246   44.580  65.095  1.00 44.68 ? 77   PRO C CD    1 
ATOM   2854  N  N     . ALA C  1 78  ? 2.328   40.564  66.437  1.00 42.81 ? 78   ALA C N     1 
ATOM   2855  C  CA    . ALA C  1 78  ? 1.239   40.101  67.294  1.00 42.44 ? 78   ALA C CA    1 
ATOM   2856  C  C     . ALA C  1 78  ? 1.483   38.662  67.746  1.00 42.38 ? 78   ALA C C     1 
ATOM   2857  O  O     . ALA C  1 78  ? 2.240   37.929  67.098  1.00 42.34 ? 78   ALA C O     1 
ATOM   2858  C  CB    . ALA C  1 78  ? -0.095  40.227  66.564  1.00 42.43 ? 78   ALA C CB    1 
ATOM   2859  N  N     . CYS C  1 79  ? 0.871   38.277  68.868  1.00 42.40 ? 79   CYS C N     1 
ATOM   2860  C  CA    . CYS C  1 79  ? 0.944   36.903  69.385  1.00 42.73 ? 79   CYS C CA    1 
ATOM   2861  C  C     . CYS C  1 79  ? -0.429  36.255  69.305  1.00 42.03 ? 79   CYS C C     1 
ATOM   2862  O  O     . CYS C  1 79  ? -0.547  35.033  69.233  1.00 42.12 ? 79   CYS C O     1 
ATOM   2863  C  CB    . CYS C  1 79  ? 1.431   36.880  70.835  1.00 43.08 ? 79   CYS C CB    1 
ATOM   2864  S  SG    . CYS C  1 79  ? 3.204   37.185  71.086  1.00 47.80 ? 79   CYS C SG    1 
ATOM   2865  N  N     . LEU C  1 80  ? -1.461  37.090  69.342  1.00 41.56 ? 80   LEU C N     1 
ATOM   2866  C  CA    . LEU C  1 80  ? -2.832  36.665  69.117  1.00 41.29 ? 80   LEU C CA    1 
ATOM   2867  C  C     . LEU C  1 80  ? -3.425  37.634  68.118  1.00 40.77 ? 80   LEU C C     1 
ATOM   2868  O  O     . LEU C  1 80  ? -3.189  38.842  68.208  1.00 40.68 ? 80   LEU C O     1 
ATOM   2869  C  CB    . LEU C  1 80  ? -3.627  36.686  70.426  1.00 41.76 ? 80   LEU C CB    1 
ATOM   2870  C  CG    . LEU C  1 80  ? -3.641  35.374  71.229  1.00 42.82 ? 80   LEU C CG    1 
ATOM   2871  C  CD1   . LEU C  1 80  ? -3.669  35.625  72.743  1.00 43.48 ? 80   LEU C CD1   1 
ATOM   2872  C  CD2   . LEU C  1 80  ? -4.822  34.506  70.812  1.00 43.44 ? 80   LEU C CD2   1 
ATOM   2873  N  N     . LEU C  1 81  ? -4.182  37.112  67.159  1.00 40.40 ? 81   LEU C N     1 
ATOM   2874  C  CA    . LEU C  1 81  ? -4.754  37.961  66.120  1.00 40.01 ? 81   LEU C CA    1 
ATOM   2875  C  C     . LEU C  1 81  ? -5.823  38.895  66.681  1.00 40.32 ? 81   LEU C C     1 
ATOM   2876  O  O     . LEU C  1 81  ? -6.031  40.000  66.156  1.00 40.28 ? 81   LEU C O     1 
ATOM   2877  C  CB    . LEU C  1 81  ? -5.279  37.115  64.969  1.00 39.77 ? 81   LEU C CB    1 
ATOM   2878  C  CG    . LEU C  1 81  ? -4.193  36.368  64.194  1.00 39.29 ? 81   LEU C CG    1 
ATOM   2879  C  CD1   . LEU C  1 81  ? -4.806  35.194  63.444  1.00 38.15 ? 81   LEU C CD1   1 
ATOM   2880  C  CD2   . LEU C  1 81  ? -3.441  37.307  63.251  1.00 38.05 ? 81   LEU C CD2   1 
ATOM   2881  N  N     . ARG C  1 82  ? -6.477  38.462  67.765  1.00 40.79 ? 82   ARG C N     1 
ATOM   2882  C  CA    . ARG C  1 82  ? -7.492  39.283  68.438  1.00 41.31 ? 82   ARG C CA    1 
ATOM   2883  C  C     . ARG C  1 82  ? -6.926  40.606  68.938  1.00 41.33 ? 82   ARG C C     1 
ATOM   2884  O  O     . ARG C  1 82  ? -7.636  41.609  68.985  1.00 41.33 ? 82   ARG C O     1 
ATOM   2885  C  CB    . ARG C  1 82  ? -8.120  38.536  69.602  1.00 41.91 ? 82   ARG C CB    1 
ATOM   2886  C  CG    . ARG C  1 82  ? -9.654  38.631  69.660  1.00 43.62 ? 82   ARG C CG    1 
ATOM   2887  C  CD    . ARG C  1 82  ? -10.306 37.685  70.697  1.00 45.98 ? 82   ARG C CD    1 
ATOM   2888  N  NE    . ARG C  1 82  ? -9.529  36.453  70.919  1.00 47.75 ? 82   ARG C NE    1 
ATOM   2889  C  CZ    . ARG C  1 82  ? -8.634  36.270  71.899  1.00 48.13 ? 82   ARG C CZ    1 
ATOM   2890  N  NH1   . ARG C  1 82  ? -8.375  37.235  72.780  1.00 48.37 ? 82   ARG C NH1   1 
ATOM   2891  N  NH2   . ARG C  1 82  ? -7.992  35.108  71.995  1.00 48.10 ? 82   ARG C NH2   1 
ATOM   2892  N  N     . ASP C  1 83  ? -5.641  40.610  69.289  1.00 41.66 ? 83   ASP C N     1 
ATOM   2893  C  CA    . ASP C  1 83  ? -4.961  41.814  69.781  1.00 42.18 ? 83   ASP C CA    1 
ATOM   2894  C  C     . ASP C  1 83  ? -4.848  42.892  68.710  1.00 42.30 ? 83   ASP C C     1 
ATOM   2895  O  O     . ASP C  1 83  ? -4.523  44.043  69.010  1.00 42.49 ? 83   ASP C O     1 
ATOM   2896  C  CB    . ASP C  1 83  ? -3.546  41.468  70.287  1.00 42.54 ? 83   ASP C CB    1 
ATOM   2897  C  CG    . ASP C  1 83  ? -3.546  40.865  71.693  1.00 44.09 ? 83   ASP C CG    1 
ATOM   2898  O  OD1   . ASP C  1 83  ? -3.912  41.580  72.660  1.00 45.52 ? 83   ASP C OD1   1 
ATOM   2899  O  OD2   . ASP C  1 83  ? -3.190  39.685  71.931  1.00 45.17 ? 83   ASP C OD2   1 
ATOM   2900  N  N     . VAL C  1 84  ? -5.105  42.511  67.462  1.00 42.62 ? 84   VAL C N     1 
ATOM   2901  C  CA    . VAL C  1 84  ? -4.911  43.402  66.319  1.00 42.71 ? 84   VAL C CA    1 
ATOM   2902  C  C     . VAL C  1 84  ? -6.206  43.558  65.514  1.00 42.93 ? 84   VAL C C     1 
ATOM   2903  O  O     . VAL C  1 84  ? -6.222  44.213  64.461  1.00 42.96 ? 84   VAL C O     1 
ATOM   2904  C  CB    . VAL C  1 84  ? -3.748  42.885  65.423  1.00 42.91 ? 84   VAL C CB    1 
ATOM   2905  C  CG1   . VAL C  1 84  ? -3.892  43.371  63.999  1.00 43.09 ? 84   VAL C CG1   1 
ATOM   2906  C  CG2   . VAL C  1 84  ? -2.405  43.315  65.982  1.00 42.60 ? 84   VAL C CG2   1 
ATOM   2907  N  N     . ALA C  1 85  ? -7.288  42.971  66.024  1.00 43.35 ? 85   ALA C N     1 
ATOM   2908  C  CA    . ALA C  1 85  ? -8.588  42.950  65.338  1.00 44.02 ? 85   ALA C CA    1 
ATOM   2909  C  C     . ALA C  1 85  ? -9.134  44.334  65.000  1.00 44.41 ? 85   ALA C C     1 
ATOM   2910  O  O     . ALA C  1 85  ? -9.770  44.512  63.957  1.00 44.65 ? 85   ALA C O     1 
ATOM   2911  C  CB    . ALA C  1 85  ? -9.622  42.170  66.157  1.00 44.21 ? 85   ALA C CB    1 
ATOM   2912  N  N     . GLN C  1 86  ? -8.894  45.306  65.878  1.00 44.88 ? 86   GLN C N     1 
ATOM   2913  C  CA    . GLN C  1 86  ? -9.380  46.679  65.671  1.00 45.41 ? 86   GLN C CA    1 
ATOM   2914  C  C     . GLN C  1 86  ? -8.726  47.348  64.466  1.00 45.35 ? 86   GLN C C     1 
ATOM   2915  O  O     . GLN C  1 86  ? -9.404  47.998  63.666  1.00 45.52 ? 86   GLN C O     1 
ATOM   2916  C  CB    . GLN C  1 86  ? -9.138  47.545  66.913  1.00 45.74 ? 86   GLN C CB    1 
ATOM   2917  C  CG    . GLN C  1 86  ? -9.835  48.919  66.869  1.00 47.05 ? 86   GLN C CG    1 
ATOM   2918  C  CD    . GLN C  1 86  ? -11.157 48.945  67.643  1.00 48.75 ? 86   GLN C CD    1 
ATOM   2919  O  OE1   . GLN C  1 86  ? -11.951 48.001  67.565  1.00 49.23 ? 86   GLN C OE1   1 
ATOM   2920  N  NE2   . GLN C  1 86  ? -11.395 50.030  68.384  1.00 49.10 ? 86   GLN C NE2   1 
ATOM   2921  N  N     . GLU C  1 87  ? -7.405  47.206  64.356  1.00 45.32 ? 87   GLU C N     1 
ATOM   2922  C  CA    . GLU C  1 87  ? -6.666  47.701  63.192  1.00 45.37 ? 87   GLU C CA    1 
ATOM   2923  C  C     . GLU C  1 87  ? -7.096  46.994  61.900  1.00 44.89 ? 87   GLU C C     1 
ATOM   2924  O  O     . GLU C  1 87  ? -7.225  47.633  60.853  1.00 44.92 ? 87   GLU C O     1 
ATOM   2925  C  CB    . GLU C  1 87  ? -5.158  47.537  63.389  1.00 45.67 ? 87   GLU C CB    1 
ATOM   2926  C  CG    . GLU C  1 87  ? -4.524  48.565  64.311  1.00 47.63 ? 87   GLU C CG    1 
ATOM   2927  C  CD    . GLU C  1 87  ? -4.149  47.987  65.670  1.00 50.14 ? 87   GLU C CD    1 
ATOM   2928  O  OE1   . GLU C  1 87  ? -5.020  47.354  66.323  1.00 50.64 ? 87   GLU C OE1   1 
ATOM   2929  O  OE2   . GLU C  1 87  ? -2.979  48.173  66.089  1.00 50.57 ? 87   GLU C OE2   1 
ATOM   2930  N  N     . ALA C  1 88  ? -7.330  45.684  61.988  1.00 44.35 ? 88   ALA C N     1 
ATOM   2931  C  CA    . ALA C  1 88  ? -7.764  44.889  60.840  1.00 43.86 ? 88   ALA C CA    1 
ATOM   2932  C  C     . ALA C  1 88  ? -9.142  45.294  60.315  1.00 43.54 ? 88   ALA C C     1 
ATOM   2933  O  O     . ALA C  1 88  ? -9.414  45.152  59.124  1.00 43.59 ? 88   ALA C O     1 
ATOM   2934  C  CB    . ALA C  1 88  ? -7.725  43.402  61.175  1.00 43.75 ? 88   ALA C CB    1 
ATOM   2935  N  N     . LEU C  1 89  ? -9.994  45.818  61.196  1.00 43.20 ? 89   LEU C N     1 
ATOM   2936  C  CA    . LEU C  1 89  ? -11.359 46.187  60.825  1.00 42.88 ? 89   LEU C CA    1 
ATOM   2937  C  C     . LEU C  1 89  ? -11.427 47.414  59.909  1.00 42.25 ? 89   LEU C C     1 
ATOM   2938  O  O     . LEU C  1 89  ? -12.358 47.548  59.115  1.00 42.33 ? 89   LEU C O     1 
ATOM   2939  C  CB    . LEU C  1 89  ? -12.215 46.398  62.079  1.00 43.30 ? 89   LEU C CB    1 
ATOM   2940  C  CG    . LEU C  1 89  ? -13.305 45.377  62.475  1.00 44.18 ? 89   LEU C CG    1 
ATOM   2941  C  CD1   . LEU C  1 89  ? -13.416 44.154  61.555  1.00 44.25 ? 89   LEU C CD1   1 
ATOM   2942  C  CD2   . LEU C  1 89  ? -13.128 44.933  63.935  1.00 44.62 ? 89   LEU C CD2   1 
ATOM   2943  N  N     . GLY C  1 90  ? -10.436 48.298  60.009  1.00 41.52 ? 90   GLY C N     1 
ATOM   2944  C  CA    . GLY C  1 90  ? -10.393 49.494  59.178  1.00 40.45 ? 90   GLY C CA    1 
ATOM   2945  C  C     . GLY C  1 90  ? -9.635  49.345  57.862  1.00 39.77 ? 90   GLY C C     1 
ATOM   2946  O  O     . GLY C  1 90  ? -9.284  50.337  57.212  1.00 40.03 ? 90   GLY C O     1 
ATOM   2947  N  N     . VAL C  1 91  ? -9.401  48.103  57.453  1.00 38.50 ? 91   VAL C N     1 
ATOM   2948  C  CA    . VAL C  1 91  ? -8.567  47.818  56.294  1.00 37.16 ? 91   VAL C CA    1 
ATOM   2949  C  C     . VAL C  1 91  ? -9.319  46.874  55.356  1.00 36.03 ? 91   VAL C C     1 
ATOM   2950  O  O     . VAL C  1 91  ? -10.230 46.173  55.790  1.00 36.14 ? 91   VAL C O     1 
ATOM   2951  C  CB    . VAL C  1 91  ? -7.155  47.297  56.760  1.00 37.63 ? 91   VAL C CB    1 
ATOM   2952  C  CG1   . VAL C  1 91  ? -6.755  45.960  56.132  1.00 37.03 ? 91   VAL C CG1   1 
ATOM   2953  C  CG2   . VAL C  1 91  ? -6.080  48.362  56.553  1.00 37.38 ? 91   VAL C CG2   1 
ATOM   2954  N  N     . ALA C  1 92  ? -8.977  46.886  54.072  1.00 34.47 ? 92   ALA C N     1 
ATOM   2955  C  CA    . ALA C  1 92  ? -9.653  46.023  53.102  1.00 32.95 ? 92   ALA C CA    1 
ATOM   2956  C  C     . ALA C  1 92  ? -8.920  44.693  52.834  1.00 32.08 ? 92   ALA C C     1 
ATOM   2957  O  O     . ALA C  1 92  ? -9.560  43.688  52.477  1.00 31.95 ? 92   ALA C O     1 
ATOM   2958  C  CB    . ALA C  1 92  ? -9.892  46.773  51.800  1.00 33.20 ? 92   ALA C CB    1 
ATOM   2959  N  N     . VAL C  1 93  ? -7.595  44.696  52.988  1.00 30.63 ? 93   VAL C N     1 
ATOM   2960  C  CA    . VAL C  1 93  ? -6.757  43.521  52.717  1.00 29.67 ? 93   VAL C CA    1 
ATOM   2961  C  C     . VAL C  1 93  ? -5.850  43.216  53.909  1.00 29.32 ? 93   VAL C C     1 
ATOM   2962  O  O     . VAL C  1 93  ? -5.082  44.069  54.357  1.00 29.30 ? 93   VAL C O     1 
ATOM   2963  C  CB    . VAL C  1 93  ? -5.869  43.695  51.428  1.00 29.53 ? 93   VAL C CB    1 
ATOM   2964  C  CG1   . VAL C  1 93  ? -4.932  42.504  51.230  1.00 28.73 ? 93   VAL C CG1   1 
ATOM   2965  C  CG2   . VAL C  1 93  ? -6.720  43.869  50.203  1.00 28.63 ? 93   VAL C CG2   1 
ATOM   2966  N  N     . ILE C  1 94  ? -5.928  41.989  54.409  1.00 28.74 ? 94   ILE C N     1 
ATOM   2967  C  CA    . ILE C  1 94  ? -5.113  41.574  55.548  1.00 28.42 ? 94   ILE C CA    1 
ATOM   2968  C  C     . ILE C  1 94  ? -4.183  40.420  55.162  1.00 28.16 ? 94   ILE C C     1 
ATOM   2969  O  O     . ILE C  1 94  ? -4.650  39.374  54.725  1.00 28.07 ? 94   ILE C O     1 
ATOM   2970  C  CB    . ILE C  1 94  ? -6.025  41.150  56.742  1.00 28.46 ? 94   ILE C CB    1 
ATOM   2971  C  CG1   . ILE C  1 94  ? -7.032  42.255  57.078  1.00 28.48 ? 94   ILE C CG1   1 
ATOM   2972  C  CG2   . ILE C  1 94  ? -5.179  40.786  57.963  1.00 28.13 ? 94   ILE C CG2   1 
ATOM   2973  C  CD1   . ILE C  1 94  ? -8.226  41.784  57.875  1.00 29.32 ? 94   ILE C CD1   1 
ATOM   2974  N  N     . GLY C  1 95  ? -2.877  40.620  55.334  1.00 28.01 ? 95   GLY C N     1 
ATOM   2975  C  CA    . GLY C  1 95  ? -1.892  39.561  55.168  1.00 27.90 ? 95   GLY C CA    1 
ATOM   2976  C  C     . GLY C  1 95  ? -1.395  39.045  56.510  1.00 28.25 ? 95   GLY C C     1 
ATOM   2977  O  O     . GLY C  1 95  ? -1.139  39.829  57.442  1.00 28.34 ? 95   GLY C O     1 
ATOM   2978  N  N     . ILE C  1 96  ? -1.268  37.727  56.628  1.00 28.24 ? 96   ILE C N     1 
ATOM   2979  C  CA    . ILE C  1 96  ? -0.798  37.115  57.872  1.00 28.52 ? 96   ILE C CA    1 
ATOM   2980  C  C     . ILE C  1 96  ? 0.396   36.214  57.583  1.00 29.15 ? 96   ILE C C     1 
ATOM   2981  O  O     . ILE C  1 96  ? 0.290   35.225  56.851  1.00 29.14 ? 96   ILE C O     1 
ATOM   2982  C  CB    . ILE C  1 96  ? -1.930  36.314  58.580  1.00 28.18 ? 96   ILE C CB    1 
ATOM   2983  C  CG1   . ILE C  1 96  ? -3.069  37.249  59.028  1.00 27.88 ? 96   ILE C CG1   1 
ATOM   2984  C  CG2   . ILE C  1 96  ? -1.360  35.527  59.745  1.00 27.75 ? 96   ILE C CG2   1 
ATOM   2985  C  CD1   . ILE C  1 96  ? -4.398  36.526  59.407  1.00 26.83 ? 96   ILE C CD1   1 
ATOM   2986  N  N     . ASP C  1 97  ? 1.532   36.568  58.160  1.00 29.93 ? 97   ASP C N     1 
ATOM   2987  C  CA    . ASP C  1 97  ? 2.741   35.790  57.993  1.00 31.27 ? 97   ASP C CA    1 
ATOM   2988  C  C     . ASP C  1 97  ? 2.931   34.826  59.165  1.00 31.51 ? 97   ASP C C     1 
ATOM   2989  O  O     . ASP C  1 97  ? 2.717   35.192  60.324  1.00 31.72 ? 97   ASP C O     1 
ATOM   2990  C  CB    . ASP C  1 97  ? 3.936   36.732  57.863  1.00 31.76 ? 97   ASP C CB    1 
ATOM   2991  C  CG    . ASP C  1 97  ? 5.177   36.027  57.391  1.00 34.08 ? 97   ASP C CG    1 
ATOM   2992  O  OD1   . ASP C  1 97  ? 5.068   35.175  56.477  1.00 35.86 ? 97   ASP C OD1   1 
ATOM   2993  O  OD2   . ASP C  1 97  ? 6.309   36.268  57.869  1.00 37.87 ? 97   ASP C OD2   1 
ATOM   2994  N  N     . GLU C  1 98  ? 3.328   33.596  58.853  1.00 31.79 ? 98   GLU C N     1 
ATOM   2995  C  CA    . GLU C  1 98  ? 3.533   32.546  59.862  1.00 32.22 ? 98   GLU C CA    1 
ATOM   2996  C  C     . GLU C  1 98  ? 2.247   32.243  60.642  1.00 31.82 ? 98   GLU C C     1 
ATOM   2997  O  O     . GLU C  1 98  ? 2.236   32.214  61.879  1.00 31.82 ? 98   GLU C O     1 
ATOM   2998  C  CB    . GLU C  1 98  ? 4.723   32.894  60.789  1.00 32.52 ? 98   GLU C CB    1 
ATOM   2999  C  CG    . GLU C  1 98  ? 6.031   33.079  60.021  1.00 35.29 ? 98   GLU C CG    1 
ATOM   3000  C  CD    . GLU C  1 98  ? 7.237   33.358  60.898  1.00 38.65 ? 98   GLU C CD    1 
ATOM   3001  O  OE1   . GLU C  1 98  ? 7.475   32.601  61.860  1.00 40.76 ? 98   GLU C OE1   1 
ATOM   3002  O  OE2   . GLU C  1 98  ? 7.966   34.333  60.615  1.00 40.87 ? 98   GLU C OE2   1 
ATOM   3003  N  N     . GLY C  1 99  ? 1.165   32.011  59.897  1.00 31.62 ? 99   GLY C N     1 
ATOM   3004  C  CA    . GLY C  1 99  ? -0.160  31.802  60.463  1.00 31.09 ? 99   GLY C CA    1 
ATOM   3005  C  C     . GLY C  1 99  ? -0.288  30.607  61.388  1.00 30.92 ? 99   GLY C C     1 
ATOM   3006  O  O     . GLY C  1 99  ? -1.201  30.564  62.200  1.00 31.23 ? 99   GLY C O     1 
ATOM   3007  N  N     . GLN C  1 100 ? 0.621   29.643  61.272  1.00 30.73 ? 100  GLN C N     1 
ATOM   3008  C  CA    . GLN C  1 100 ? 0.588   28.438  62.105  1.00 30.66 ? 100  GLN C CA    1 
ATOM   3009  C  C     . GLN C  1 100 ? 0.776   28.728  63.601  1.00 30.91 ? 100  GLN C C     1 
ATOM   3010  O  O     . GLN C  1 100 ? 0.383   27.932  64.436  1.00 30.84 ? 100  GLN C O     1 
ATOM   3011  C  CB    . GLN C  1 100 ? 1.634   27.423  61.627  1.00 30.53 ? 100  GLN C CB    1 
ATOM   3012  C  CG    . GLN C  1 100 ? 3.081   27.831  61.881  1.00 29.98 ? 100  GLN C CG    1 
ATOM   3013  C  CD    . GLN C  1 100 ? 3.677   28.660  60.761  1.00 30.20 ? 100  GLN C CD    1 
ATOM   3014  O  OE1   . GLN C  1 100 ? 2.995   29.000  59.790  1.00 31.46 ? 100  GLN C OE1   1 
ATOM   3015  N  NE2   . GLN C  1 100 ? 4.955   28.984  60.887  1.00 29.60 ? 100  GLN C NE2   1 
ATOM   3016  N  N     . PHE C  1 101 ? 1.372   29.874  63.930  1.00 31.27 ? 101  PHE C N     1 
ATOM   3017  C  CA    . PHE C  1 101 ? 1.683   30.217  65.324  1.00 31.56 ? 101  PHE C CA    1 
ATOM   3018  C  C     . PHE C  1 101 ? 0.563   30.958  66.048  1.00 32.09 ? 101  PHE C C     1 
ATOM   3019  O  O     . PHE C  1 101 ? 0.649   31.170  67.259  1.00 32.36 ? 101  PHE C O     1 
ATOM   3020  C  CB    . PHE C  1 101 ? 2.975   31.024  65.417  1.00 31.29 ? 101  PHE C CB    1 
ATOM   3021  C  CG    . PHE C  1 101 ? 4.217   30.213  65.180  1.00 31.01 ? 101  PHE C CG    1 
ATOM   3022  C  CD1   . PHE C  1 101 ? 5.164   30.630  64.253  1.00 30.33 ? 101  PHE C CD1   1 
ATOM   3023  C  CD2   . PHE C  1 101 ? 4.449   29.042  65.884  1.00 30.59 ? 101  PHE C CD2   1 
ATOM   3024  C  CE1   . PHE C  1 101 ? 6.314   29.892  64.027  1.00 29.82 ? 101  PHE C CE1   1 
ATOM   3025  C  CE2   . PHE C  1 101 ? 5.606   28.296  65.659  1.00 30.70 ? 101  PHE C CE2   1 
ATOM   3026  C  CZ    . PHE C  1 101 ? 6.537   28.726  64.731  1.00 30.21 ? 101  PHE C CZ    1 
ATOM   3027  N  N     . PHE C  1 102 ? -0.483  31.350  65.324  1.00 32.44 ? 102  PHE C N     1 
ATOM   3028  C  CA    . PHE C  1 102 ? -1.628  31.984  65.967  1.00 32.84 ? 102  PHE C CA    1 
ATOM   3029  C  C     . PHE C  1 102 ? -2.715  30.963  66.288  1.00 33.55 ? 102  PHE C C     1 
ATOM   3030  O  O     . PHE C  1 102 ? -3.278  30.339  65.384  1.00 33.84 ? 102  PHE C O     1 
ATOM   3031  C  CB    . PHE C  1 102 ? -2.197  33.119  65.119  1.00 32.53 ? 102  PHE C CB    1 
ATOM   3032  C  CG    . PHE C  1 102 ? -1.208  34.193  64.809  1.00 32.18 ? 102  PHE C CG    1 
ATOM   3033  C  CD1   . PHE C  1 102 ? -1.024  35.262  65.684  1.00 32.24 ? 102  PHE C CD1   1 
ATOM   3034  C  CD2   . PHE C  1 102 ? -0.460  34.147  63.642  1.00 31.08 ? 102  PHE C CD2   1 
ATOM   3035  C  CE1   . PHE C  1 102 ? -0.113  36.272  65.397  1.00 31.33 ? 102  PHE C CE1   1 
ATOM   3036  C  CE2   . PHE C  1 102 ? 0.460   35.143  63.357  1.00 30.99 ? 102  PHE C CE2   1 
ATOM   3037  C  CZ    . PHE C  1 102 ? 0.629   36.212  64.236  1.00 31.49 ? 102  PHE C CZ    1 
ATOM   3038  N  N     . PRO C  1 103 ? -3.041  30.812  67.571  1.00 34.18 ? 103  PRO C N     1 
ATOM   3039  C  CA    . PRO C  1 103 ? -4.042  29.817  67.990  1.00 34.38 ? 103  PRO C CA    1 
ATOM   3040  C  C     . PRO C  1 103 ? -5.448  30.207  67.528  1.00 34.57 ? 103  PRO C C     1 
ATOM   3041  O  O     . PRO C  1 103 ? -6.316  29.332  67.425  1.00 34.94 ? 103  PRO C O     1 
ATOM   3042  C  CB    . PRO C  1 103 ? -3.949  29.836  69.525  1.00 34.78 ? 103  PRO C CB    1 
ATOM   3043  C  CG    . PRO C  1 103 ? -3.419  31.222  69.862  1.00 35.07 ? 103  PRO C CG    1 
ATOM   3044  C  CD    . PRO C  1 103 ? -2.527  31.612  68.704  1.00 34.58 ? 103  PRO C CD    1 
ATOM   3045  N  N     . ASP C  1 104 ? -5.653  31.491  67.223  1.00 34.51 ? 104  ASP C N     1 
ATOM   3046  C  CA    . ASP C  1 104 ? -6.955  31.988  66.771  1.00 34.54 ? 104  ASP C CA    1 
ATOM   3047  C  C     . ASP C  1 104 ? -7.045  32.231  65.255  1.00 34.33 ? 104  ASP C C     1 
ATOM   3048  O  O     . ASP C  1 104 ? -7.933  32.944  64.789  1.00 34.41 ? 104  ASP C O     1 
ATOM   3049  C  CB    . ASP C  1 104 ? -7.381  33.239  67.571  1.00 34.81 ? 104  ASP C CB    1 
ATOM   3050  C  CG    . ASP C  1 104 ? -6.369  34.387  67.487  1.00 36.45 ? 104  ASP C CG    1 
ATOM   3051  O  OD1   . ASP C  1 104 ? -6.807  35.569  67.474  1.00 38.53 ? 104  ASP C OD1   1 
ATOM   3052  O  OD2   . ASP C  1 104 ? -5.126  34.227  67.439  1.00 37.74 ? 104  ASP C OD2   1 
ATOM   3053  N  N     . ILE C  1 105 ? -6.152  31.607  64.489  1.00 34.14 ? 105  ILE C N     1 
ATOM   3054  C  CA    . ILE C  1 105 ? -6.077  31.826  63.043  1.00 33.93 ? 105  ILE C CA    1 
ATOM   3055  C  C     . ILE C  1 105 ? -7.393  31.562  62.300  1.00 34.05 ? 105  ILE C C     1 
ATOM   3056  O  O     . ILE C  1 105 ? -7.782  32.347  61.427  1.00 34.04 ? 105  ILE C O     1 
ATOM   3057  C  CB    . ILE C  1 105 ? -4.861  31.039  62.435  1.00 34.15 ? 105  ILE C CB    1 
ATOM   3058  C  CG1   . ILE C  1 105 ? -4.606  31.426  60.967  1.00 34.01 ? 105  ILE C CG1   1 
ATOM   3059  C  CG2   . ILE C  1 105 ? -5.030  29.527  62.627  1.00 33.52 ? 105  ILE C CG2   1 
ATOM   3060  C  CD1   . ILE C  1 105 ? -3.866  32.732  60.776  1.00 33.21 ? 105  ILE C CD1   1 
ATOM   3061  N  N     . VAL C  1 106 ? -8.083  30.479  62.662  1.00 34.23 ? 106  VAL C N     1 
ATOM   3062  C  CA    . VAL C  1 106 ? -9.305  30.062  61.958  1.00 34.44 ? 106  VAL C CA    1 
ATOM   3063  C  C     . VAL C  1 106 ? -10.468 31.043  62.178  1.00 34.70 ? 106  VAL C C     1 
ATOM   3064  O  O     . VAL C  1 106 ? -11.049 31.550  61.212  1.00 34.98 ? 106  VAL C O     1 
ATOM   3065  C  CB    . VAL C  1 106 ? -9.694  28.595  62.311  1.00 34.50 ? 106  VAL C CB    1 
ATOM   3066  C  CG1   . VAL C  1 106 ? -11.079 28.239  61.780  1.00 34.83 ? 106  VAL C CG1   1 
ATOM   3067  C  CG2   . VAL C  1 106 ? -8.668  27.624  61.762  1.00 34.42 ? 106  VAL C CG2   1 
ATOM   3068  N  N     . GLU C  1 107 ? -10.785 31.326  63.437  1.00 34.74 ? 107  GLU C N     1 
ATOM   3069  C  CA    . GLU C  1 107 ? -11.888 32.233  63.759  1.00 35.10 ? 107  GLU C CA    1 
ATOM   3070  C  C     . GLU C  1 107 ? -11.658 33.655  63.239  1.00 34.43 ? 107  GLU C C     1 
ATOM   3071  O  O     . GLU C  1 107 ? -12.593 34.301  62.768  1.00 34.58 ? 107  GLU C O     1 
ATOM   3072  C  CB    . GLU C  1 107 ? -12.172 32.260  65.274  1.00 35.36 ? 107  GLU C CB    1 
ATOM   3073  C  CG    . GLU C  1 107 ? -12.258 30.907  65.972  1.00 37.63 ? 107  GLU C CG    1 
ATOM   3074  C  CD    . GLU C  1 107 ? -13.068 29.865  65.218  1.00 42.01 ? 107  GLU C CD    1 
ATOM   3075  O  OE1   . GLU C  1 107 ? -14.029 30.224  64.491  1.00 43.55 ? 107  GLU C OE1   1 
ATOM   3076  O  OE2   . GLU C  1 107 ? -12.739 28.662  65.355  1.00 43.97 ? 107  GLU C OE2   1 
ATOM   3077  N  N     . PHE C  1 108 ? -10.418 34.130  63.333  1.00 33.76 ? 108  PHE C N     1 
ATOM   3078  C  CA    . PHE C  1 108 ? -10.055 35.452  62.837  1.00 33.28 ? 108  PHE C CA    1 
ATOM   3079  C  C     . PHE C  1 108 ? -10.286 35.582  61.326  1.00 33.12 ? 108  PHE C C     1 
ATOM   3080  O  O     . PHE C  1 108 ? -11.002 36.481  60.883  1.00 33.05 ? 108  PHE C O     1 
ATOM   3081  C  CB    . PHE C  1 108 ? -8.606  35.765  63.208  1.00 33.44 ? 108  PHE C CB    1 
ATOM   3082  C  CG    . PHE C  1 108 ? -8.168  37.161  62.844  1.00 33.87 ? 108  PHE C CG    1 
ATOM   3083  C  CD1   . PHE C  1 108 ? -8.488  38.242  63.659  1.00 33.92 ? 108  PHE C CD1   1 
ATOM   3084  C  CD2   . PHE C  1 108 ? -7.419  37.391  61.688  1.00 33.67 ? 108  PHE C CD2   1 
ATOM   3085  C  CE1   . PHE C  1 108 ? -8.070  39.541  63.317  1.00 34.13 ? 108  PHE C CE1   1 
ATOM   3086  C  CE2   . PHE C  1 108 ? -7.003  38.678  61.339  1.00 33.36 ? 108  PHE C CE2   1 
ATOM   3087  C  CZ    . PHE C  1 108 ? -7.327  39.754  62.155  1.00 33.19 ? 108  PHE C CZ    1 
ATOM   3088  N  N     . CYS C  1 109 ? -9.708  34.663  60.550  1.00 32.94 ? 109  CYS C N     1 
ATOM   3089  C  CA    . CYS C  1 109 ? -9.796  34.701  59.089  1.00 33.00 ? 109  CYS C CA    1 
ATOM   3090  C  C     . CYS C  1 109 ? -11.225 34.579  58.596  1.00 33.02 ? 109  CYS C C     1 
ATOM   3091  O  O     . CYS C  1 109 ? -11.659 35.323  57.711  1.00 32.68 ? 109  CYS C O     1 
ATOM   3092  C  CB    . CYS C  1 109 ? -8.929  33.604  58.467  1.00 32.64 ? 109  CYS C CB    1 
ATOM   3093  S  SG    . CYS C  1 109 ? -7.160  33.909  58.642  1.00 32.97 ? 109  CYS C SG    1 
ATOM   3094  N  N     . GLU C  1 110 ? -11.952 33.631  59.176  1.00 33.44 ? 110  GLU C N     1 
ATOM   3095  C  CA    . GLU C  1 110 ? -13.349 33.407  58.825  1.00 33.99 ? 110  GLU C CA    1 
ATOM   3096  C  C     . GLU C  1 110 ? -14.207 34.638  59.137  1.00 33.67 ? 110  GLU C C     1 
ATOM   3097  O  O     . GLU C  1 110 ? -15.022 35.042  58.309  1.00 33.85 ? 110  GLU C O     1 
ATOM   3098  C  CB    . GLU C  1 110 ? -13.877 32.141  59.522  1.00 34.60 ? 110  GLU C CB    1 
ATOM   3099  C  CG    . GLU C  1 110 ? -15.306 31.756  59.179  1.00 35.89 ? 110  GLU C CG    1 
ATOM   3100  C  CD    . GLU C  1 110 ? -15.508 31.417  57.710  1.00 38.81 ? 110  GLU C CD    1 
ATOM   3101  O  OE1   . GLU C  1 110 ? -16.671 31.487  57.240  1.00 38.41 ? 110  GLU C OE1   1 
ATOM   3102  O  OE2   . GLU C  1 110 ? -14.510 31.083  57.019  1.00 40.43 ? 110  GLU C OE2   1 
ATOM   3103  N  N     . ALA C  1 111 ? -13.990 35.249  60.303  1.00 33.35 ? 111  ALA C N     1 
ATOM   3104  C  CA    . ALA C  1 111 ? -14.699 36.487  60.676  1.00 33.30 ? 111  ALA C CA    1 
ATOM   3105  C  C     . ALA C  1 111 ? -14.377 37.665  59.745  1.00 33.08 ? 111  ALA C C     1 
ATOM   3106  O  O     . ALA C  1 111 ? -15.270 38.414  59.347  1.00 33.35 ? 111  ALA C O     1 
ATOM   3107  C  CB    . ALA C  1 111 ? -14.410 36.856  62.131  1.00 32.90 ? 111  ALA C CB    1 
ATOM   3108  N  N     . MET C  1 112 ? -13.104 37.818  59.393  1.00 32.90 ? 112  MET C N     1 
ATOM   3109  C  CA    . MET C  1 112 ? -12.675 38.925  58.538  1.00 32.82 ? 112  MET C CA    1 
ATOM   3110  C  C     . MET C  1 112 ? -13.171 38.752  57.096  1.00 32.66 ? 112  MET C C     1 
ATOM   3111  O  O     . MET C  1 112 ? -13.629 39.708  56.474  1.00 32.54 ? 112  MET C O     1 
ATOM   3112  C  CB    . MET C  1 112 ? -11.159 39.076  58.588  1.00 33.20 ? 112  MET C CB    1 
ATOM   3113  C  CG    . MET C  1 112 ? -10.626 39.651  59.889  1.00 33.83 ? 112  MET C CG    1 
ATOM   3114  S  SD    . MET C  1 112 ? -11.501 41.155  60.376  1.00 38.22 ? 112  MET C SD    1 
ATOM   3115  C  CE    . MET C  1 112 ? -10.797 41.442  62.030  1.00 36.27 ? 112  MET C CE    1 
ATOM   3116  N  N     . ALA C  1 113 ? -13.121 37.523  56.585  1.00 32.46 ? 113  ALA C N     1 
ATOM   3117  C  CA    . ALA C  1 113 ? -13.644 37.227  55.254  1.00 32.65 ? 113  ALA C CA    1 
ATOM   3118  C  C     . ALA C  1 113 ? -15.158 37.423  55.168  1.00 32.85 ? 113  ALA C C     1 
ATOM   3119  O  O     . ALA C  1 113 ? -15.661 37.927  54.165  1.00 33.02 ? 113  ALA C O     1 
ATOM   3120  C  CB    . ALA C  1 113 ? -13.255 35.809  54.812  1.00 32.43 ? 113  ALA C CB    1 
ATOM   3121  N  N     . ASN C  1 114 ? -15.886 37.017  56.208  1.00 33.11 ? 114  ASN C N     1 
ATOM   3122  C  CA    . ASN C  1 114 ? -17.341 37.229  56.249  1.00 33.45 ? 114  ASN C CA    1 
ATOM   3123  C  C     . ASN C  1 114 ? -17.723 38.702  56.415  1.00 33.55 ? 114  ASN C C     1 
ATOM   3124  O  O     . ASN C  1 114 ? -18.828 39.103  56.056  1.00 33.89 ? 114  ASN C O     1 
ATOM   3125  C  CB    . ASN C  1 114 ? -18.012 36.366  57.328  1.00 33.41 ? 114  ASN C CB    1 
ATOM   3126  C  CG    . ASN C  1 114 ? -17.987 34.879  56.989  1.00 33.47 ? 114  ASN C CG    1 
ATOM   3127  O  OD1   . ASN C  1 114 ? -18.175 34.485  55.837  1.00 34.37 ? 114  ASN C OD1   1 
ATOM   3128  N  ND2   . ASN C  1 114 ? -17.749 34.048  57.996  1.00 33.45 ? 114  ASN C ND2   1 
ATOM   3129  N  N     . ALA C  1 115 ? -16.796 39.496  56.949  1.00 33.51 ? 115  ALA C N     1 
ATOM   3130  C  CA    . ALA C  1 115 ? -16.955 40.948  57.030  1.00 33.44 ? 115  ALA C CA    1 
ATOM   3131  C  C     . ALA C  1 115 ? -16.536 41.659  55.735  1.00 33.35 ? 115  ALA C C     1 
ATOM   3132  O  O     . ALA C  1 115 ? -16.481 42.888  55.699  1.00 33.58 ? 115  ALA C O     1 
ATOM   3133  C  CB    . ALA C  1 115 ? -16.160 41.492  58.218  1.00 33.34 ? 115  ALA C CB    1 
ATOM   3134  N  N     . GLY C  1 116 ? -16.225 40.885  54.690  1.00 33.07 ? 116  GLY C N     1 
ATOM   3135  C  CA    . GLY C  1 116 ? -15.898 41.437  53.384  1.00 32.56 ? 116  GLY C CA    1 
ATOM   3136  C  C     . GLY C  1 116 ? -14.429 41.727  53.106  1.00 32.28 ? 116  GLY C C     1 
ATOM   3137  O  O     . GLY C  1 116 ? -14.105 42.354  52.102  1.00 32.41 ? 116  GLY C O     1 
ATOM   3138  N  N     . LYS C  1 117 ? -13.538 41.274  53.980  1.00 31.69 ? 117  LYS C N     1 
ATOM   3139  C  CA    . LYS C  1 117 ? -12.106 41.502  53.795  1.00 31.33 ? 117  LYS C CA    1 
ATOM   3140  C  C     . LYS C  1 117 ? -11.411 40.380  53.008  1.00 30.61 ? 117  LYS C C     1 
ATOM   3141  O  O     . LYS C  1 117 ? -11.848 39.221  53.040  1.00 30.51 ? 117  LYS C O     1 
ATOM   3142  C  CB    . LYS C  1 117 ? -11.433 41.706  55.158  1.00 31.68 ? 117  LYS C CB    1 
ATOM   3143  C  CG    . LYS C  1 117 ? -11.512 43.145  55.657  1.00 32.44 ? 117  LYS C CG    1 
ATOM   3144  C  CD    . LYS C  1 117 ? -12.020 43.237  57.082  1.00 33.47 ? 117  LYS C CD    1 
ATOM   3145  C  CE    . LYS C  1 117 ? -12.355 44.683  57.469  1.00 33.87 ? 117  LYS C CE    1 
ATOM   3146  N  NZ    . LYS C  1 117 ? -13.309 45.332  56.509  1.00 34.34 ? 117  LYS C NZ    1 
ATOM   3147  N  N     . THR C  1 118 ? -10.347 40.737  52.288  1.00 29.65 ? 118  THR C N     1 
ATOM   3148  C  CA    . THR C  1 118 ? -9.488  39.751  51.633  1.00 28.63 ? 118  THR C CA    1 
ATOM   3149  C  C     . THR C  1 118 ? -8.358  39.395  52.584  1.00 27.93 ? 118  THR C C     1 
ATOM   3150  O  O     . THR C  1 118 ? -7.535  40.249  52.921  1.00 28.00 ? 118  THR C O     1 
ATOM   3151  C  CB    . THR C  1 118 ? -8.958  40.306  50.287  1.00 29.00 ? 118  THR C CB    1 
ATOM   3152  O  OG1   . THR C  1 118 ? -10.021 40.284  49.325  1.00 30.25 ? 118  THR C OG1   1 
ATOM   3153  C  CG2   . THR C  1 118 ? -7.901  39.375  49.650  1.00 28.01 ? 118  THR C CG2   1 
ATOM   3154  N  N     . VAL C  1 119 ? -8.339  38.138  53.028  1.00 27.18 ? 119  VAL C N     1 
ATOM   3155  C  CA    . VAL C  1 119 ? -7.326  37.645  53.968  1.00 26.39 ? 119  VAL C CA    1 
ATOM   3156  C  C     . VAL C  1 119 ? -6.358  36.680  53.281  1.00 26.12 ? 119  VAL C C     1 
ATOM   3157  O  O     . VAL C  1 119 ? -6.778  35.687  52.680  1.00 26.07 ? 119  VAL C O     1 
ATOM   3158  C  CB    . VAL C  1 119 ? -7.960  36.946  55.191  1.00 26.56 ? 119  VAL C CB    1 
ATOM   3159  C  CG1   . VAL C  1 119 ? -6.893  36.657  56.262  1.00 25.57 ? 119  VAL C CG1   1 
ATOM   3160  C  CG2   . VAL C  1 119 ? -9.108  37.798  55.783  1.00 26.76 ? 119  VAL C CG2   1 
ATOM   3161  N  N     . ILE C  1 120 ? -5.066  36.991  53.371  1.00 25.51 ? 120  ILE C N     1 
ATOM   3162  C  CA    . ILE C  1 120 ? -4.017  36.194  52.752  1.00 24.90 ? 120  ILE C CA    1 
ATOM   3163  C  C     . ILE C  1 120 ? -3.073  35.666  53.826  1.00 24.69 ? 120  ILE C C     1 
ATOM   3164  O  O     . ILE C  1 120 ? -2.518  36.433  54.605  1.00 24.79 ? 120  ILE C O     1 
ATOM   3165  C  CB    . ILE C  1 120 ? -3.247  37.030  51.694  1.00 25.36 ? 120  ILE C CB    1 
ATOM   3166  C  CG1   . ILE C  1 120 ? -4.234  37.762  50.771  1.00 24.54 ? 120  ILE C CG1   1 
ATOM   3167  C  CG2   . ILE C  1 120 ? -2.262  36.133  50.907  1.00 24.25 ? 120  ILE C CG2   1 
ATOM   3168  C  CD1   . ILE C  1 120 ? -3.605  38.763  49.835  1.00 24.57 ? 120  ILE C CD1   1 
ATOM   3169  N  N     . VAL C  1 121 ? -2.909  34.348  53.867  1.00 24.32 ? 121  VAL C N     1 
ATOM   3170  C  CA    . VAL C  1 121 ? -2.186  33.680  54.944  1.00 23.93 ? 121  VAL C CA    1 
ATOM   3171  C  C     . VAL C  1 121 ? -1.013  32.878  54.406  1.00 23.99 ? 121  VAL C C     1 
ATOM   3172  O  O     . VAL C  1 121 ? -1.202  31.968  53.602  1.00 24.19 ? 121  VAL C O     1 
ATOM   3173  C  CB    . VAL C  1 121 ? -3.119  32.721  55.727  1.00 24.12 ? 121  VAL C CB    1 
ATOM   3174  C  CG1   . VAL C  1 121 ? -2.339  31.935  56.787  1.00 23.27 ? 121  VAL C CG1   1 
ATOM   3175  C  CG2   . VAL C  1 121 ? -4.289  33.494  56.375  1.00 23.78 ? 121  VAL C CG2   1 
ATOM   3176  N  N     . ALA C  1 122 ? 0.196   33.216  54.851  1.00 23.85 ? 122  ALA C N     1 
ATOM   3177  C  CA    . ALA C  1 122 ? 1.364   32.383  54.590  1.00 23.83 ? 122  ALA C CA    1 
ATOM   3178  C  C     . ALA C  1 122 ? 1.603   31.519  55.821  1.00 24.07 ? 122  ALA C C     1 
ATOM   3179  O  O     . ALA C  1 122 ? 1.574   32.008  56.941  1.00 23.83 ? 122  ALA C O     1 
ATOM   3180  C  CB    . ALA C  1 122 ? 2.593   33.230  54.271  1.00 23.70 ? 122  ALA C CB    1 
ATOM   3181  N  N     . ALA C  1 123 ? 1.836   30.230  55.609  1.00 24.44 ? 123  ALA C N     1 
ATOM   3182  C  CA    . ALA C  1 123 ? 1.954   29.295  56.712  1.00 25.08 ? 123  ALA C CA    1 
ATOM   3183  C  C     . ALA C  1 123 ? 2.657   28.007  56.329  1.00 25.59 ? 123  ALA C C     1 
ATOM   3184  O  O     . ALA C  1 123 ? 2.474   27.511  55.228  1.00 25.57 ? 123  ALA C O     1 
ATOM   3185  C  CB    . ALA C  1 123 ? 0.556   28.964  57.259  1.00 25.26 ? 123  ALA C CB    1 
ATOM   3186  N  N     . LEU C  1 124 ? 3.385   27.470  57.285  1.00 26.58 ? 124  LEU C N     1 
ATOM   3187  C  CA    . LEU C  1 124 ? 3.920   26.121  57.156  1.00 27.64 ? 124  LEU C CA    1 
ATOM   3188  C  C     . LEU C  1 124 ? 2.701   25.187  57.278  1.00 28.54 ? 124  LEU C C     1 
ATOM   3189  O  O     . LEU C  1 124 ? 1.832   25.381  58.129  1.00 28.75 ? 124  LEU C O     1 
ATOM   3190  C  CB    . LEU C  1 124 ? 4.863   25.735  58.339  1.00 27.60 ? 124  LEU C CB    1 
ATOM   3191  C  CG    . LEU C  1 124 ? 6.398   25.846  58.269  1.00 27.95 ? 124  LEU C CG    1 
ATOM   3192  C  CD1   . LEU C  1 124 ? 6.837   26.590  57.006  1.00 26.17 ? 124  LEU C CD1   1 
ATOM   3193  C  CD2   . LEU C  1 124 ? 6.938   26.537  59.525  1.00 27.53 ? 124  LEU C CD2   1 
ATOM   3194  N  N     . ASP C  1 125 ? 2.629   24.172  56.429  1.00 29.36 ? 125  ASP C N     1 
ATOM   3195  C  CA    . ASP C  1 125 ? 1.582   23.163  56.551  1.00 30.30 ? 125  ASP C CA    1 
ATOM   3196  C  C     . ASP C  1 125 ? 1.995   22.092  57.551  1.00 30.19 ? 125  ASP C C     1 
ATOM   3197  O  O     . ASP C  1 125 ? 1.148   21.565  58.288  1.00 30.46 ? 125  ASP C O     1 
ATOM   3198  C  CB    . ASP C  1 125 ? 1.277   22.525  55.191  1.00 30.84 ? 125  ASP C CB    1 
ATOM   3199  C  CG    . ASP C  1 125 ? 2.535   22.135  54.433  1.00 32.82 ? 125  ASP C CG    1 
ATOM   3200  O  OD1   . ASP C  1 125 ? 2.590   20.982  53.957  1.00 36.17 ? 125  ASP C OD1   1 
ATOM   3201  O  OD2   . ASP C  1 125 ? 3.519   22.902  54.267  1.00 35.30 ? 125  ASP C OD2   1 
ATOM   3202  N  N     . GLY C  1 126 ? 3.295   21.783  57.575  1.00 29.77 ? 126  GLY C N     1 
ATOM   3203  C  CA    . GLY C  1 126 ? 3.829   20.737  58.423  1.00 29.25 ? 126  GLY C CA    1 
ATOM   3204  C  C     . GLY C  1 126 ? 4.905   21.184  59.393  1.00 29.26 ? 126  GLY C C     1 
ATOM   3205  O  O     . GLY C  1 126 ? 5.675   22.107  59.110  1.00 29.33 ? 126  GLY C O     1 
ATOM   3206  N  N     . THR C  1 127 ? 4.955   20.518  60.546  1.00 29.03 ? 127  THR C N     1 
ATOM   3207  C  CA    . THR C  1 127 ? 6.063   20.658  61.481  1.00 28.79 ? 127  THR C CA    1 
ATOM   3208  C  C     . THR C  1 127 ? 7.277   19.882  60.965  1.00 29.04 ? 127  THR C C     1 
ATOM   3209  O  O     . THR C  1 127 ? 7.234   19.285  59.876  1.00 28.77 ? 127  THR C O     1 
ATOM   3210  C  CB    . THR C  1 127 ? 5.670   20.105  62.863  1.00 28.92 ? 127  THR C CB    1 
ATOM   3211  O  OG1   . THR C  1 127 ? 5.643   18.670  62.808  1.00 28.90 ? 127  THR C OG1   1 
ATOM   3212  C  CG2   . THR C  1 127 ? 4.239   20.493  63.222  1.00 28.30 ? 127  THR C CG2   1 
ATOM   3213  N  N     . PHE C  1 128 ? 8.350   19.883  61.761  1.00 29.32 ? 128  PHE C N     1 
ATOM   3214  C  CA    . PHE C  1 128 ? 9.543   19.083  61.485  1.00 29.75 ? 128  PHE C CA    1 
ATOM   3215  C  C     . PHE C  1 128 ? 9.248   17.575  61.517  1.00 30.14 ? 128  PHE C C     1 
ATOM   3216  O  O     . PHE C  1 128 ? 10.081  16.766  61.104  1.00 30.33 ? 128  PHE C O     1 
ATOM   3217  C  CB    . PHE C  1 128 ? 10.645  19.423  62.500  1.00 30.02 ? 128  PHE C CB    1 
ATOM   3218  C  CG    . PHE C  1 128 ? 10.459  18.764  63.843  1.00 29.96 ? 128  PHE C CG    1 
ATOM   3219  C  CD1   . PHE C  1 128 ? 11.201  17.626  64.187  1.00 30.55 ? 128  PHE C CD1   1 
ATOM   3220  C  CD2   . PHE C  1 128 ? 9.548   19.275  64.763  1.00 29.95 ? 128  PHE C CD2   1 
ATOM   3221  C  CE1   . PHE C  1 128 ? 11.038  17.006  65.430  1.00 30.14 ? 128  PHE C CE1   1 
ATOM   3222  C  CE2   . PHE C  1 128 ? 9.369   18.663  66.007  1.00 30.94 ? 128  PHE C CE2   1 
ATOM   3223  C  CZ    . PHE C  1 128 ? 10.123  17.528  66.345  1.00 30.78 ? 128  PHE C CZ    1 
ATOM   3224  N  N     . GLN C  1 129 ? 8.070   17.207  62.017  1.00 30.64 ? 129  GLN C N     1 
ATOM   3225  C  CA    . GLN C  1 129 ? 7.654   15.809  62.082  1.00 31.43 ? 129  GLN C CA    1 
ATOM   3226  C  C     . GLN C  1 129 ? 6.693   15.454  60.951  1.00 31.54 ? 129  GLN C C     1 
ATOM   3227  O  O     . GLN C  1 129 ? 6.187   14.332  60.890  1.00 31.46 ? 129  GLN C O     1 
ATOM   3228  C  CB    . GLN C  1 129 ? 6.985   15.519  63.431  1.00 31.66 ? 129  GLN C CB    1 
ATOM   3229  C  CG    . GLN C  1 129 ? 7.914   15.629  64.621  1.00 33.17 ? 129  GLN C CG    1 
ATOM   3230  C  CD    . GLN C  1 129 ? 7.297   15.095  65.901  1.00 36.11 ? 129  GLN C CD    1 
ATOM   3231  O  OE1   . GLN C  1 129 ? 7.596   13.969  66.315  1.00 37.65 ? 129  GLN C OE1   1 
ATOM   3232  N  NE2   . GLN C  1 129 ? 6.436   15.891  66.528  1.00 35.43 ? 129  GLN C NE2   1 
ATOM   3233  N  N     . ARG C  1 130 ? 6.443   16.425  60.068  1.00 31.83 ? 130  ARG C N     1 
ATOM   3234  C  CA    . ARG C  1 130 ? 5.504   16.289  58.949  1.00 31.89 ? 130  ARG C CA    1 
ATOM   3235  C  C     . ARG C  1 130 ? 4.086   16.000  59.449  1.00 31.95 ? 130  ARG C C     1 
ATOM   3236  O  O     . ARG C  1 130 ? 3.323   15.247  58.836  1.00 31.94 ? 130  ARG C O     1 
ATOM   3237  C  CB    . ARG C  1 130 ? 5.999   15.259  57.922  1.00 31.87 ? 130  ARG C CB    1 
ATOM   3238  C  CG    . ARG C  1 130 ? 7.288   15.698  57.224  1.00 33.15 ? 130  ARG C CG    1 
ATOM   3239  C  CD    . ARG C  1 130 ? 7.741   14.823  56.052  1.00 34.83 ? 130  ARG C CD    1 
ATOM   3240  N  NE    . ARG C  1 130 ? 7.417   13.427  56.277  1.00 36.90 ? 130  ARG C NE    1 
ATOM   3241  C  CZ    . ARG C  1 130 ? 6.835   12.629  55.396  1.00 37.40 ? 130  ARG C CZ    1 
ATOM   3242  N  NH1   . ARG C  1 130 ? 6.508   13.062  54.183  1.00 37.50 ? 130  ARG C NH1   1 
ATOM   3243  N  NH2   . ARG C  1 130 ? 6.577   11.379  55.745  1.00 37.78 ? 130  ARG C NH2   1 
ATOM   3244  N  N     . LYS C  1 131 ? 3.751   16.612  60.579  1.00 31.97 ? 131  LYS C N     1 
ATOM   3245  C  CA    . LYS C  1 131 ? 2.395   16.579  61.104  1.00 32.35 ? 131  LYS C CA    1 
ATOM   3246  C  C     . LYS C  1 131 ? 1.784   17.968  60.920  1.00 31.98 ? 131  LYS C C     1 
ATOM   3247  O  O     . LYS C  1 131 ? 2.528   18.937  60.722  1.00 31.90 ? 131  LYS C O     1 
ATOM   3248  C  CB    . LYS C  1 131 ? 2.398   16.139  62.572  1.00 32.76 ? 131  LYS C CB    1 
ATOM   3249  C  CG    . LYS C  1 131 ? 2.942   14.715  62.801  1.00 34.56 ? 131  LYS C CG    1 
ATOM   3250  C  CD    . LYS C  1 131 ? 2.392   14.123  64.095  1.00 39.00 ? 131  LYS C CD    1 
ATOM   3251  C  CE    . LYS C  1 131 ? 2.797   12.660  64.265  1.00 41.04 ? 131  LYS C CE    1 
ATOM   3252  N  NZ    . LYS C  1 131 ? 3.733   12.496  65.422  1.00 42.54 ? 131  LYS C NZ    1 
ATOM   3253  N  N     . PRO C  1 132 ? 0.451   18.078  60.960  1.00 31.78 ? 132  PRO C N     1 
ATOM   3254  C  CA    . PRO C  1 132 ? -0.204  19.384  60.815  1.00 31.60 ? 132  PRO C CA    1 
ATOM   3255  C  C     . PRO C  1 132 ? 0.326   20.362  61.854  1.00 31.77 ? 132  PRO C C     1 
ATOM   3256  O  O     . PRO C  1 132 ? 0.535   19.985  63.016  1.00 31.39 ? 132  PRO C O     1 
ATOM   3257  C  CB    . PRO C  1 132 ? -1.685  19.072  61.056  1.00 31.73 ? 132  PRO C CB    1 
ATOM   3258  C  CG    . PRO C  1 132 ? -1.828  17.619  60.722  1.00 31.74 ? 132  PRO C CG    1 
ATOM   3259  C  CD    . PRO C  1 132 ? -0.525  16.984  61.139  1.00 31.66 ? 132  PRO C CD    1 
ATOM   3260  N  N     . PHE C  1 133 ? 0.574   21.595  61.422  1.00 31.86 ? 133  PHE C N     1 
ATOM   3261  C  CA    . PHE C  1 133 ? 1.148   22.605  62.290  1.00 32.07 ? 133  PHE C CA    1 
ATOM   3262  C  C     . PHE C  1 133 ? 0.042   23.456  62.896  1.00 32.62 ? 133  PHE C C     1 
ATOM   3263  O  O     . PHE C  1 133 ? -0.509  24.347  62.241  1.00 32.84 ? 133  PHE C O     1 
ATOM   3264  C  CB    . PHE C  1 133 ? 2.152   23.468  61.526  1.00 31.86 ? 133  PHE C CB    1 
ATOM   3265  C  CG    . PHE C  1 133 ? 3.226   24.072  62.389  1.00 31.33 ? 133  PHE C CG    1 
ATOM   3266  C  CD1   . PHE C  1 133 ? 4.542   24.111  61.939  1.00 31.02 ? 133  PHE C CD1   1 
ATOM   3267  C  CD2   . PHE C  1 133 ? 2.927   24.614  63.643  1.00 30.97 ? 133  PHE C CD2   1 
ATOM   3268  C  CE1   . PHE C  1 133 ? 5.553   24.676  62.723  1.00 30.89 ? 133  PHE C CE1   1 
ATOM   3269  C  CE2   . PHE C  1 133 ? 3.928   25.185  64.429  1.00 30.48 ? 133  PHE C CE2   1 
ATOM   3270  C  CZ    . PHE C  1 133 ? 5.241   25.215  63.966  1.00 30.79 ? 133  PHE C CZ    1 
ATOM   3271  N  N     . GLY C  1 134 ? -0.276  23.177  64.157  1.00 33.04 ? 134  GLY C N     1 
ATOM   3272  C  CA    . GLY C  1 134 ? -1.329  23.897  64.846  1.00 33.19 ? 134  GLY C CA    1 
ATOM   3273  C  C     . GLY C  1 134 ? -2.670  23.648  64.182  1.00 33.22 ? 134  GLY C C     1 
ATOM   3274  O  O     . GLY C  1 134 ? -2.964  22.528  63.766  1.00 33.31 ? 134  GLY C O     1 
ATOM   3275  N  N     . ALA C  1 135 ? -3.472  24.702  64.062  1.00 33.22 ? 135  ALA C N     1 
ATOM   3276  C  CA    . ALA C  1 135 ? -4.838  24.584  63.551  1.00 33.07 ? 135  ALA C CA    1 
ATOM   3277  C  C     . ALA C  1 135 ? -4.925  24.980  62.082  1.00 32.96 ? 135  ALA C C     1 
ATOM   3278  O  O     . ALA C  1 135 ? -6.012  25.022  61.498  1.00 32.73 ? 135  ALA C O     1 
ATOM   3279  C  CB    . ALA C  1 135 ? -5.802  25.432  64.398  1.00 33.18 ? 135  ALA C CB    1 
ATOM   3280  N  N     . ILE C  1 136 ? -3.763  25.230  61.480  1.00 32.97 ? 136  ILE C N     1 
ATOM   3281  C  CA    . ILE C  1 136 ? -3.691  25.862  60.173  1.00 32.92 ? 136  ILE C CA    1 
ATOM   3282  C  C     . ILE C  1 136 ? -4.445  25.153  59.036  1.00 32.53 ? 136  ILE C C     1 
ATOM   3283  O  O     . ILE C  1 136 ? -5.010  25.813  58.168  1.00 32.45 ? 136  ILE C O     1 
ATOM   3284  C  CB    . ILE C  1 136 ? -2.219  26.204  59.835  1.00 33.11 ? 136  ILE C CB    1 
ATOM   3285  C  CG1   . ILE C  1 136 ? -2.074  27.718  59.592  1.00 33.65 ? 136  ILE C CG1   1 
ATOM   3286  C  CG2   . ILE C  1 136 ? -1.644  25.300  58.714  1.00 33.43 ? 136  ILE C CG2   1 
ATOM   3287  C  CD1   . ILE C  1 136 ? -2.920  28.294  58.468  1.00 34.99 ? 136  ILE C CD1   1 
ATOM   3288  N  N     . LEU C  1 137 ? -4.498  23.822  59.072  1.00 32.23 ? 137  LEU C N     1 
ATOM   3289  C  CA    . LEU C  1 137 ? -5.190  23.065  58.027  1.00 31.89 ? 137  LEU C CA    1 
ATOM   3290  C  C     . LEU C  1 137 ? -6.713  23.197  58.059  1.00 31.78 ? 137  LEU C C     1 
ATOM   3291  O  O     . LEU C  1 137 ? -7.369  22.952  57.043  1.00 31.66 ? 137  LEU C O     1 
ATOM   3292  C  CB    . LEU C  1 137 ? -4.770  21.594  58.016  1.00 32.02 ? 137  LEU C CB    1 
ATOM   3293  C  CG    . LEU C  1 137 ? -3.271  21.319  57.792  1.00 32.41 ? 137  LEU C CG    1 
ATOM   3294  C  CD1   . LEU C  1 137 ? -3.036  19.828  57.697  1.00 32.97 ? 137  LEU C CD1   1 
ATOM   3295  C  CD2   . LEU C  1 137 ? -2.699  22.037  56.567  1.00 31.54 ? 137  LEU C CD2   1 
ATOM   3296  N  N     . ASN C  1 138 ? -7.278  23.581  59.204  1.00 31.41 ? 138  ASN C N     1 
ATOM   3297  C  CA    . ASN C  1 138 ? -8.712  23.888  59.274  1.00 31.27 ? 138  ASN C CA    1 
ATOM   3298  C  C     . ASN C  1 138 ? -9.115  25.083  58.407  1.00 30.69 ? 138  ASN C C     1 
ATOM   3299  O  O     . ASN C  1 138 ? -10.299 25.293  58.140  1.00 30.41 ? 138  ASN C O     1 
ATOM   3300  C  CB    . ASN C  1 138 ? -9.195  24.089  60.720  1.00 31.60 ? 138  ASN C CB    1 
ATOM   3301  C  CG    . ASN C  1 138 ? -9.043  22.839  61.567  1.00 32.62 ? 138  ASN C CG    1 
ATOM   3302  O  OD1   . ASN C  1 138 ? -9.428  21.738  61.163  1.00 33.63 ? 138  ASN C OD1   1 
ATOM   3303  N  ND2   . ASN C  1 138 ? -8.470  23.003  62.749  1.00 34.05 ? 138  ASN C ND2   1 
ATOM   3304  N  N     . LEU C  1 139 ? -8.124  25.844  57.950  1.00 30.18 ? 139  LEU C N     1 
ATOM   3305  C  CA    . LEU C  1 139 ? -8.374  26.953  57.025  1.00 29.92 ? 139  LEU C CA    1 
ATOM   3306  C  C     . LEU C  1 139 ? -8.694  26.474  55.616  1.00 29.53 ? 139  LEU C C     1 
ATOM   3307  O  O     . LEU C  1 139 ? -9.435  27.142  54.891  1.00 29.49 ? 139  LEU C O     1 
ATOM   3308  C  CB    . LEU C  1 139 ? -7.182  27.912  56.978  1.00 30.19 ? 139  LEU C CB    1 
ATOM   3309  C  CG    . LEU C  1 139 ? -7.215  29.201  57.801  1.00 30.55 ? 139  LEU C CG    1 
ATOM   3310  C  CD1   . LEU C  1 139 ? -6.179  30.173  57.238  1.00 31.36 ? 139  LEU C CD1   1 
ATOM   3311  C  CD2   . LEU C  1 139 ? -8.598  29.845  57.814  1.00 30.19 ? 139  LEU C CD2   1 
ATOM   3312  N  N     . VAL C  1 140 ? -8.145  25.318  55.238  1.00 29.10 ? 140  VAL C N     1 
ATOM   3313  C  CA    . VAL C  1 140 ? -8.287  24.789  53.874  1.00 28.89 ? 140  VAL C CA    1 
ATOM   3314  C  C     . VAL C  1 140 ? -9.754  24.658  53.389  1.00 29.14 ? 140  VAL C C     1 
ATOM   3315  O  O     . VAL C  1 140 ? -10.077 25.175  52.314  1.00 29.37 ? 140  VAL C O     1 
ATOM   3316  C  CB    . VAL C  1 140 ? -7.424  23.507  53.636  1.00 28.73 ? 140  VAL C CB    1 
ATOM   3317  C  CG1   . VAL C  1 140 ? -7.696  22.892  52.271  1.00 28.53 ? 140  VAL C CG1   1 
ATOM   3318  C  CG2   . VAL C  1 140 ? -5.930  23.841  53.770  1.00 27.86 ? 140  VAL C CG2   1 
ATOM   3319  N  N     . PRO C  1 141 ? -10.637 23.994  54.151  1.00 28.92 ? 141  PRO C N     1 
ATOM   3320  C  CA    . PRO C  1 141 ? -12.059 23.919  53.777  1.00 28.89 ? 141  PRO C CA    1 
ATOM   3321  C  C     . PRO C  1 141 ? -12.789 25.279  53.785  1.00 29.01 ? 141  PRO C C     1 
ATOM   3322  O  O     . PRO C  1 141 ? -13.889 25.389  53.240  1.00 28.94 ? 141  PRO C O     1 
ATOM   3323  C  CB    . PRO C  1 141 ? -12.661 22.992  54.847  1.00 28.97 ? 141  PRO C CB    1 
ATOM   3324  C  CG    . PRO C  1 141 ? -11.500 22.267  55.432  1.00 28.70 ? 141  PRO C CG    1 
ATOM   3325  C  CD    . PRO C  1 141 ? -10.372 23.250  55.396  1.00 28.69 ? 141  PRO C CD    1 
ATOM   3326  N  N     . LEU C  1 142 ? -12.183 26.295  54.386  1.00 28.89 ? 142  LEU C N     1 
ATOM   3327  C  CA    . LEU C  1 142 ? -12.799 27.618  54.427  1.00 28.96 ? 142  LEU C CA    1 
ATOM   3328  C  C     . LEU C  1 142 ? -12.246 28.570  53.369  1.00 28.95 ? 142  LEU C C     1 
ATOM   3329  O  O     . LEU C  1 142 ? -12.802 29.643  53.167  1.00 28.96 ? 142  LEU C O     1 
ATOM   3330  C  CB    . LEU C  1 142 ? -12.667 28.247  55.818  1.00 28.75 ? 142  LEU C CB    1 
ATOM   3331  C  CG    . LEU C  1 142 ? -13.042 27.377  57.015  1.00 29.21 ? 142  LEU C CG    1 
ATOM   3332  C  CD1   . LEU C  1 142 ? -12.383 27.942  58.270  1.00 29.16 ? 142  LEU C CD1   1 
ATOM   3333  C  CD2   . LEU C  1 142 ? -14.550 27.265  57.181  1.00 28.51 ? 142  LEU C CD2   1 
ATOM   3334  N  N     . ALA C  1 143 ? -11.172 28.165  52.690  1.00 29.02 ? 143  ALA C N     1 
ATOM   3335  C  CA    . ALA C  1 143 ? -10.434 29.043  51.783  1.00 28.97 ? 143  ALA C CA    1 
ATOM   3336  C  C     . ALA C  1 143 ? -10.915 28.945  50.345  1.00 29.36 ? 143  ALA C C     1 
ATOM   3337  O  O     . ALA C  1 143 ? -11.288 27.860  49.871  1.00 29.47 ? 143  ALA C O     1 
ATOM   3338  C  CB    . ALA C  1 143 ? -8.957  28.716  51.849  1.00 28.87 ? 143  ALA C CB    1 
ATOM   3339  N  N     . GLU C  1 144 ? -10.891 30.063  49.626  1.00 29.65 ? 144  GLU C N     1 
ATOM   3340  C  CA    . GLU C  1 144 ? -11.230 29.992  48.204  1.00 30.36 ? 144  GLU C CA    1 
ATOM   3341  C  C     . GLU C  1 144 ? -10.018 29.678  47.338  1.00 30.01 ? 144  GLU C C     1 
ATOM   3342  O  O     . GLU C  1 144 ? -10.160 29.298  46.179  1.00 30.21 ? 144  GLU C O     1 
ATOM   3343  C  CB    . GLU C  1 144 ? -12.011 31.212  47.668  1.00 30.89 ? 144  GLU C CB    1 
ATOM   3344  C  CG    . GLU C  1 144 ? -12.003 32.457  48.527  1.00 32.81 ? 144  GLU C CG    1 
ATOM   3345  C  CD    . GLU C  1 144 ? -13.035 32.428  49.640  1.00 34.11 ? 144  GLU C CD    1 
ATOM   3346  O  OE1   . GLU C  1 144 ? -14.240 32.565  49.344  1.00 34.74 ? 144  GLU C OE1   1 
ATOM   3347  O  OE2   . GLU C  1 144 ? -12.623 32.297  50.818  1.00 33.89 ? 144  GLU C OE2   1 
ATOM   3348  N  N     . SER C  1 145 ? -8.832  29.818  47.914  1.00 29.64 ? 145  SER C N     1 
ATOM   3349  C  CA    . SER C  1 145 ? -7.603  29.596  47.179  1.00 29.16 ? 145  SER C CA    1 
ATOM   3350  C  C     . SER C  1 145 ? -6.575  28.983  48.108  1.00 28.87 ? 145  SER C C     1 
ATOM   3351  O  O     . SER C  1 145 ? -6.356  29.479  49.225  1.00 28.81 ? 145  SER C O     1 
ATOM   3352  C  CB    . SER C  1 145 ? -7.108  30.926  46.585  1.00 29.54 ? 145  SER C CB    1 
ATOM   3353  O  OG    . SER C  1 145 ? -5.769  30.840  46.122  1.00 29.95 ? 145  SER C OG    1 
ATOM   3354  N  N     . VAL C  1 146 ? -5.972  27.886  47.656  1.00 28.40 ? 146  VAL C N     1 
ATOM   3355  C  CA    . VAL C  1 146 ? -4.949  27.192  48.428  1.00 27.99 ? 146  VAL C CA    1 
ATOM   3356  C  C     . VAL C  1 146 ? -3.858  26.747  47.489  1.00 28.03 ? 146  VAL C C     1 
ATOM   3357  O  O     . VAL C  1 146 ? -4.120  26.115  46.465  1.00 28.06 ? 146  VAL C O     1 
ATOM   3358  C  CB    . VAL C  1 146 ? -5.500  25.967  49.183  1.00 27.78 ? 146  VAL C CB    1 
ATOM   3359  C  CG1   . VAL C  1 146 ? -4.407  25.339  50.056  1.00 27.89 ? 146  VAL C CG1   1 
ATOM   3360  C  CG2   . VAL C  1 146 ? -6.695  26.345  50.033  1.00 26.55 ? 146  VAL C CG2   1 
ATOM   3361  N  N     . VAL C  1 147 ? -2.626  27.070  47.856  1.00 28.01 ? 147  VAL C N     1 
ATOM   3362  C  CA    . VAL C  1 147 ? -1.460  26.765  47.053  1.00 27.85 ? 147  VAL C CA    1 
ATOM   3363  C  C     . VAL C  1 147 ? -0.387  26.199  47.991  1.00 27.84 ? 147  VAL C C     1 
ATOM   3364  O  O     . VAL C  1 147 ? -0.308  26.597  49.153  1.00 27.57 ? 147  VAL C O     1 
ATOM   3365  C  CB    . VAL C  1 147 ? -1.033  28.083  46.334  1.00 28.17 ? 147  VAL C CB    1 
ATOM   3366  C  CG1   . VAL C  1 147 ? 0.258   28.660  46.875  1.00 27.80 ? 147  VAL C CG1   1 
ATOM   3367  C  CG2   . VAL C  1 147 ? -1.024  27.927  44.808  1.00 28.55 ? 147  VAL C CG2   1 
ATOM   3368  N  N     . LYS C  1 148 ? 0.394   25.234  47.510  1.00 27.88 ? 148  LYS C N     1 
ATOM   3369  C  CA    . LYS C  1 148 ? 1.565   24.759  48.241  1.00 27.88 ? 148  LYS C CA    1 
ATOM   3370  C  C     . LYS C  1 148 ? 2.841   25.039  47.443  1.00 27.75 ? 148  LYS C C     1 
ATOM   3371  O  O     . LYS C  1 148 ? 3.036   24.490  46.368  1.00 27.68 ? 148  LYS C O     1 
ATOM   3372  C  CB    . LYS C  1 148 ? 1.454   23.266  48.564  1.00 27.90 ? 148  LYS C CB    1 
ATOM   3373  C  CG    . LYS C  1 148 ? 2.361   22.854  49.708  1.00 27.94 ? 148  LYS C CG    1 
ATOM   3374  C  CD    . LYS C  1 148 ? 2.501   21.344  49.862  1.00 29.89 ? 148  LYS C CD    1 
ATOM   3375  C  CE    . LYS C  1 148 ? 3.779   21.024  50.657  1.00 30.78 ? 148  LYS C CE    1 
ATOM   3376  N  NZ    . LYS C  1 148 ? 3.605   19.844  51.548  1.00 32.48 ? 148  LYS C NZ    1 
ATOM   3377  N  N     . LEU C  1 149 ? 3.695   25.899  47.986  1.00 27.82 ? 149  LEU C N     1 
ATOM   3378  C  CA    . LEU C  1 149 ? 4.963   26.247  47.354  1.00 27.98 ? 149  LEU C CA    1 
ATOM   3379  C  C     . LEU C  1 149 ? 6.008   25.187  47.608  1.00 28.40 ? 149  LEU C C     1 
ATOM   3380  O  O     . LEU C  1 149 ? 5.834   24.291  48.445  1.00 28.73 ? 149  LEU C O     1 
ATOM   3381  C  CB    . LEU C  1 149 ? 5.460   27.606  47.833  1.00 27.40 ? 149  LEU C CB    1 
ATOM   3382  C  CG    . LEU C  1 149 ? 4.498   28.785  47.684  1.00 27.56 ? 149  LEU C CG    1 
ATOM   3383  C  CD1   . LEU C  1 149 ? 5.160   30.068  48.183  1.00 25.89 ? 149  LEU C CD1   1 
ATOM   3384  C  CD2   . LEU C  1 149 ? 4.021   28.928  46.235  1.00 26.33 ? 149  LEU C CD2   1 
ATOM   3385  N  N     . THR C  1 150 ? 7.101   25.297  46.883  1.00 28.77 ? 150  THR C N     1 
ATOM   3386  C  CA    . THR C  1 150 ? 8.134   24.291  46.933  1.00 29.27 ? 150  THR C CA    1 
ATOM   3387  C  C     . THR C  1 150 ? 9.484   24.962  47.208  1.00 29.00 ? 150  THR C C     1 
ATOM   3388  O  O     . THR C  1 150 ? 9.687   26.126  46.852  1.00 28.70 ? 150  THR C O     1 
ATOM   3389  C  CB    . THR C  1 150 ? 8.070   23.483  45.626  1.00 29.51 ? 150  THR C CB    1 
ATOM   3390  O  OG1   . THR C  1 150 ? 8.042   22.082  45.941  1.00 32.54 ? 150  THR C OG1   1 
ATOM   3391  C  CG2   . THR C  1 150 ? 9.300   23.688  44.749  1.00 29.28 ? 150  THR C CG2   1 
ATOM   3392  N  N     . ALA C  1 151 ? 10.375  24.247  47.888  1.00 28.84 ? 151  ALA C N     1 
ATOM   3393  C  CA    . ALA C  1 151 ? 11.725  24.737  48.124  1.00 28.87 ? 151  ALA C CA    1 
ATOM   3394  C  C     . ALA C  1 151 ? 12.753  23.855  47.395  1.00 29.14 ? 151  ALA C C     1 
ATOM   3395  O  O     . ALA C  1 151 ? 12.378  22.892  46.721  1.00 29.04 ? 151  ALA C O     1 
ATOM   3396  C  CB    . ALA C  1 151 ? 12.006  24.809  49.614  1.00 28.38 ? 151  ALA C CB    1 
ATOM   3397  N  N     . VAL C  1 152 ? 14.037  24.201  47.511  1.00 29.48 ? 152  VAL C N     1 
ATOM   3398  C  CA    . VAL C  1 152 ? 15.123  23.371  46.986  1.00 30.04 ? 152  VAL C CA    1 
ATOM   3399  C  C     . VAL C  1 152 ? 15.673  22.507  48.123  1.00 30.42 ? 152  VAL C C     1 
ATOM   3400  O  O     . VAL C  1 152 ? 15.968  23.028  49.202  1.00 30.35 ? 152  VAL C O     1 
ATOM   3401  C  CB    . VAL C  1 152 ? 16.278  24.257  46.394  1.00 30.28 ? 152  VAL C CB    1 
ATOM   3402  C  CG1   . VAL C  1 152 ? 17.453  23.402  45.902  1.00 29.56 ? 152  VAL C CG1   1 
ATOM   3403  C  CG2   . VAL C  1 152 ? 15.772  25.153  45.265  1.00 30.06 ? 152  VAL C CG2   1 
ATOM   3404  N  N     . CYS C  1 153 ? 15.808  21.197  47.902  1.00 31.19 ? 153  CYS C N     1 
ATOM   3405  C  CA    . CYS C  1 153 ? 16.420  20.328  48.921  1.00 32.10 ? 153  CYS C CA    1 
ATOM   3406  C  C     . CYS C  1 153 ? 17.867  20.744  49.155  1.00 32.90 ? 153  CYS C C     1 
ATOM   3407  O  O     . CYS C  1 153 ? 18.674  20.791  48.232  1.00 32.78 ? 153  CYS C O     1 
ATOM   3408  C  CB    . CYS C  1 153 ? 16.345  18.838  48.569  1.00 32.22 ? 153  CYS C CB    1 
ATOM   3409  S  SG    . CYS C  1 153 ? 17.058  17.734  49.836  1.00 33.18 ? 153  CYS C SG    1 
ATOM   3410  N  N     . MET C  1 154 ? 18.170  21.061  50.408  1.00 34.02 ? 154  MET C N     1 
ATOM   3411  C  CA    . MET C  1 154 ? 19.488  21.538  50.795  1.00 35.04 ? 154  MET C CA    1 
ATOM   3412  C  C     . MET C  1 154 ? 20.514  20.410  50.901  1.00 35.96 ? 154  MET C C     1 
ATOM   3413  O  O     . MET C  1 154 ? 21.690  20.662  51.169  1.00 36.42 ? 154  MET C O     1 
ATOM   3414  C  CB    . MET C  1 154 ? 19.394  22.313  52.113  1.00 35.21 ? 154  MET C CB    1 
ATOM   3415  C  CG    . MET C  1 154 ? 18.801  23.709  51.951  1.00 35.21 ? 154  MET C CG    1 
ATOM   3416  S  SD    . MET C  1 154 ? 18.413  24.526  53.500  1.00 38.10 ? 154  MET C SD    1 
ATOM   3417  C  CE    . MET C  1 154 ? 17.861  26.089  52.889  1.00 37.13 ? 154  MET C CE    1 
ATOM   3418  N  N     . GLU C  1 155 ? 20.074  19.171  50.671  1.00 36.88 ? 155  GLU C N     1 
ATOM   3419  C  CA    . GLU C  1 155 ? 20.957  18.010  50.791  1.00 37.56 ? 155  GLU C CA    1 
ATOM   3420  C  C     . GLU C  1 155 ? 21.197  17.292  49.457  1.00 37.72 ? 155  GLU C C     1 
ATOM   3421  O  O     . GLU C  1 155 ? 22.279  16.755  49.241  1.00 38.09 ? 155  GLU C O     1 
ATOM   3422  C  CB    . GLU C  1 155 ? 20.469  17.061  51.906  1.00 37.69 ? 155  GLU C CB    1 
ATOM   3423  C  CG    . GLU C  1 155 ? 20.152  17.807  53.206  1.00 39.35 ? 155  GLU C CG    1 
ATOM   3424  C  CD    . GLU C  1 155 ? 19.839  16.924  54.409  1.00 41.84 ? 155  GLU C CD    1 
ATOM   3425  O  OE1   . GLU C  1 155 ? 19.752  17.480  55.531  1.00 42.11 ? 155  GLU C OE1   1 
ATOM   3426  O  OE2   . GLU C  1 155 ? 19.681  15.688  54.255  1.00 43.64 ? 155  GLU C OE2   1 
ATOM   3427  N  N     . CYS C  1 156 ? 20.215  17.299  48.559  1.00 37.88 ? 156  CYS C N     1 
ATOM   3428  C  CA    . CYS C  1 156 ? 20.384  16.678  47.240  1.00 38.03 ? 156  CYS C CA    1 
ATOM   3429  C  C     . CYS C  1 156 ? 20.032  17.619  46.075  1.00 38.23 ? 156  CYS C C     1 
ATOM   3430  O  O     . CYS C  1 156 ? 20.263  17.289  44.903  1.00 38.23 ? 156  CYS C O     1 
ATOM   3431  C  CB    . CYS C  1 156 ? 19.587  15.376  47.148  1.00 38.11 ? 156  CYS C CB    1 
ATOM   3432  S  SG    . CYS C  1 156 ? 17.807  15.618  46.909  1.00 39.70 ? 156  CYS C SG    1 
ATOM   3433  N  N     . PHE C  1 157 ? 19.465  18.780  46.406  1.00 38.50 ? 157  PHE C N     1 
ATOM   3434  C  CA    . PHE C  1 157 ? 19.184  19.853  45.439  1.00 38.88 ? 157  PHE C CA    1 
ATOM   3435  C  C     . PHE C  1 157 ? 18.052  19.589  44.434  1.00 38.93 ? 157  PHE C C     1 
ATOM   3436  O  O     . PHE C  1 157 ? 17.932  20.294  43.435  1.00 39.34 ? 157  PHE C O     1 
ATOM   3437  C  CB    . PHE C  1 157 ? 20.481  20.320  44.747  1.00 39.18 ? 157  PHE C CB    1 
ATOM   3438  C  CG    . PHE C  1 157 ? 21.632  20.529  45.705  1.00 39.91 ? 157  PHE C CG    1 
ATOM   3439  C  CD1   . PHE C  1 157 ? 22.691  19.621  45.749  1.00 40.57 ? 157  PHE C CD1   1 
ATOM   3440  C  CD2   . PHE C  1 157 ? 21.637  21.612  46.583  1.00 40.10 ? 157  PHE C CD2   1 
ATOM   3441  C  CE1   . PHE C  1 157 ? 23.744  19.790  46.647  1.00 40.67 ? 157  PHE C CE1   1 
ATOM   3442  C  CE2   . PHE C  1 157 ? 22.683  21.796  47.479  1.00 41.23 ? 157  PHE C CE2   1 
ATOM   3443  C  CZ    . PHE C  1 157 ? 23.747  20.878  47.510  1.00 41.62 ? 157  PHE C CZ    1 
ATOM   3444  N  N     . ARG C  1 158 ? 17.222  18.583  44.707  1.00 38.87 ? 158  ARG C N     1 
ATOM   3445  C  CA    . ARG C  1 158 ? 15.970  18.390  43.972  1.00 38.81 ? 158  ARG C CA    1 
ATOM   3446  C  C     . ARG C  1 158 ? 14.862  19.202  44.659  1.00 37.93 ? 158  ARG C C     1 
ATOM   3447  O  O     . ARG C  1 158 ? 15.140  19.943  45.603  1.00 37.69 ? 158  ARG C O     1 
ATOM   3448  C  CB    . ARG C  1 158 ? 15.615  16.905  43.908  1.00 39.27 ? 158  ARG C CB    1 
ATOM   3449  C  CG    . ARG C  1 158 ? 16.732  16.048  43.327  1.00 42.58 ? 158  ARG C CG    1 
ATOM   3450  C  CD    . ARG C  1 158 ? 16.270  14.773  42.643  1.00 48.17 ? 158  ARG C CD    1 
ATOM   3451  N  NE    . ARG C  1 158 ? 15.283  15.043  41.596  1.00 52.27 ? 158  ARG C NE    1 
ATOM   3452  C  CZ    . ARG C  1 158 ? 14.829  14.143  40.732  1.00 53.94 ? 158  ARG C CZ    1 
ATOM   3453  N  NH1   . ARG C  1 158 ? 15.272  12.890  40.768  1.00 54.63 ? 158  ARG C NH1   1 
ATOM   3454  N  NH2   . ARG C  1 158 ? 13.928  14.503  39.827  1.00 54.54 ? 158  ARG C NH2   1 
ATOM   3455  N  N     . GLU C  1 159 ? 13.620  19.085  44.190  1.00 37.10 ? 159  GLU C N     1 
ATOM   3456  C  CA    . GLU C  1 159 ? 12.509  19.820  44.806  1.00 36.43 ? 159  GLU C CA    1 
ATOM   3457  C  C     . GLU C  1 159 ? 12.239  19.333  46.228  1.00 34.93 ? 159  GLU C C     1 
ATOM   3458  O  O     . GLU C  1 159 ? 12.216  18.131  46.486  1.00 34.68 ? 159  GLU C O     1 
ATOM   3459  C  CB    . GLU C  1 159 ? 11.228  19.753  43.955  1.00 36.99 ? 159  GLU C CB    1 
ATOM   3460  C  CG    . GLU C  1 159 ? 11.220  20.714  42.768  1.00 40.40 ? 159  GLU C CG    1 
ATOM   3461  C  CD    . GLU C  1 159 ? 9.822   21.080  42.264  1.00 45.32 ? 159  GLU C CD    1 
ATOM   3462  O  OE1   . GLU C  1 159 ? 8.908   20.214  42.278  1.00 46.06 ? 159  GLU C OE1   1 
ATOM   3463  O  OE2   . GLU C  1 159 ? 9.640   22.248  41.827  1.00 47.04 ? 159  GLU C OE2   1 
ATOM   3464  N  N     . ALA C  1 160 ? 12.047  20.283  47.137  1.00 33.35 ? 160  ALA C N     1 
ATOM   3465  C  CA    . ALA C  1 160 ? 11.793  20.005  48.550  1.00 32.21 ? 160  ALA C CA    1 
ATOM   3466  C  C     . ALA C  1 160 ? 10.362  20.364  48.957  1.00 31.41 ? 160  ALA C C     1 
ATOM   3467  O  O     . ALA C  1 160 ? 9.879   21.460  48.670  1.00 31.25 ? 160  ALA C O     1 
ATOM   3468  C  CB    . ALA C  1 160 ? 12.782  20.779  49.419  1.00 31.87 ? 160  ALA C CB    1 
ATOM   3469  N  N     . ALA C  1 161 ? 9.698   19.451  49.647  1.00 30.49 ? 161  ALA C N     1 
ATOM   3470  C  CA    . ALA C  1 161 ? 8.351   19.709  50.135  1.00 29.82 ? 161  ALA C CA    1 
ATOM   3471  C  C     . ALA C  1 161 ? 8.277   19.767  51.661  1.00 29.50 ? 161  ALA C C     1 
ATOM   3472  O  O     . ALA C  1 161 ? 7.248   20.157  52.209  1.00 29.19 ? 161  ALA C O     1 
ATOM   3473  C  CB    . ALA C  1 161 ? 7.390   18.670  49.592  1.00 29.68 ? 161  ALA C CB    1 
ATOM   3474  N  N     . TYR C  1 162 ? 9.364   19.391  52.342  1.00 29.37 ? 162  TYR C N     1 
ATOM   3475  C  CA    . TYR C  1 162 ? 9.351   19.253  53.806  1.00 29.46 ? 162  TYR C CA    1 
ATOM   3476  C  C     . TYR C  1 162 ? 10.465  20.013  54.500  1.00 29.57 ? 162  TYR C C     1 
ATOM   3477  O  O     . TYR C  1 162 ? 11.423  20.456  53.855  1.00 29.26 ? 162  TYR C O     1 
ATOM   3478  C  CB    . TYR C  1 162 ? 9.396   17.774  54.215  1.00 29.60 ? 162  TYR C CB    1 
ATOM   3479  C  CG    . TYR C  1 162 ? 8.584   16.908  53.308  1.00 29.95 ? 162  TYR C CG    1 
ATOM   3480  C  CD1   . TYR C  1 162 ? 9.201   16.066  52.390  1.00 30.65 ? 162  TYR C CD1   1 
ATOM   3481  C  CD2   . TYR C  1 162 ? 7.186   16.961  53.333  1.00 30.51 ? 162  TYR C CD2   1 
ATOM   3482  C  CE1   . TYR C  1 162 ? 8.446   15.270  51.533  1.00 31.64 ? 162  TYR C CE1   1 
ATOM   3483  C  CE2   . TYR C  1 162 ? 6.422   16.169  52.478  1.00 30.95 ? 162  TYR C CE2   1 
ATOM   3484  C  CZ    . TYR C  1 162 ? 7.058   15.333  51.586  1.00 31.51 ? 162  TYR C CZ    1 
ATOM   3485  O  OH    . TYR C  1 162 ? 6.314   14.561  50.738  1.00 32.97 ? 162  TYR C OH    1 
ATOM   3486  N  N     . THR C  1 163 ? 10.312  20.170  55.818  1.00 29.94 ? 163  THR C N     1 
ATOM   3487  C  CA    . THR C  1 163 ? 11.339  20.767  56.664  1.00 30.66 ? 163  THR C CA    1 
ATOM   3488  C  C     . THR C  1 163 ? 11.891  19.743  57.661  1.00 31.49 ? 163  THR C C     1 
ATOM   3489  O  O     . THR C  1 163 ? 11.134  19.137  58.422  1.00 31.48 ? 163  THR C O     1 
ATOM   3490  C  CB    . THR C  1 163 ? 10.796  21.973  57.456  1.00 30.88 ? 163  THR C CB    1 
ATOM   3491  O  OG1   . THR C  1 163 ? 9.994   22.814  56.616  1.00 30.27 ? 163  THR C OG1   1 
ATOM   3492  C  CG2   . THR C  1 163 ? 11.962  22.882  57.866  1.00 30.93 ? 163  THR C CG2   1 
ATOM   3493  N  N     . LYS C  1 164 ? 13.212  19.576  57.654  1.00 32.52 ? 164  LYS C N     1 
ATOM   3494  C  CA    . LYS C  1 164 ? 13.924  18.724  58.609  1.00 33.66 ? 164  LYS C CA    1 
ATOM   3495  C  C     . LYS C  1 164 ? 14.560  19.596  59.698  1.00 34.21 ? 164  LYS C C     1 
ATOM   3496  O  O     . LYS C  1 164 ? 15.226  20.591  59.397  1.00 34.28 ? 164  LYS C O     1 
ATOM   3497  C  CB    . LYS C  1 164 ? 15.006  17.927  57.866  1.00 33.62 ? 164  LYS C CB    1 
ATOM   3498  C  CG    . LYS C  1 164 ? 15.970  17.121  58.726  1.00 35.40 ? 164  LYS C CG    1 
ATOM   3499  C  CD    . LYS C  1 164 ? 16.392  15.827  58.020  1.00 38.24 ? 164  LYS C CD    1 
ATOM   3500  C  CE    . LYS C  1 164 ? 17.839  15.436  58.333  1.00 40.29 ? 164  LYS C CE    1 
ATOM   3501  N  NZ    . LYS C  1 164 ? 18.501  14.760  57.152  1.00 42.30 ? 164  LYS C NZ    1 
ATOM   3502  N  N     . ARG C  1 165 ? 14.359  19.227  60.959  1.00 35.28 ? 165  ARG C N     1 
ATOM   3503  C  CA    . ARG C  1 165 ? 15.067  19.871  62.071  1.00 36.44 ? 165  ARG C CA    1 
ATOM   3504  C  C     . ARG C  1 165 ? 16.446  19.233  62.230  1.00 37.46 ? 165  ARG C C     1 
ATOM   3505  O  O     . ARG C  1 165 ? 16.573  18.008  62.238  1.00 37.46 ? 165  ARG C O     1 
ATOM   3506  C  CB    . ARG C  1 165 ? 14.265  19.771  63.372  1.00 36.33 ? 165  ARG C CB    1 
ATOM   3507  C  CG    . ARG C  1 165 ? 14.817  20.615  64.505  1.00 36.09 ? 165  ARG C CG    1 
ATOM   3508  C  CD    . ARG C  1 165 ? 13.962  20.627  65.749  1.00 35.11 ? 165  ARG C CD    1 
ATOM   3509  N  NE    . ARG C  1 165 ? 12.787  21.493  65.608  1.00 34.58 ? 165  ARG C NE    1 
ATOM   3510  C  CZ    . ARG C  1 165 ? 11.776  21.541  66.479  1.00 34.11 ? 165  ARG C CZ    1 
ATOM   3511  N  NH1   . ARG C  1 165 ? 11.781  20.777  67.570  1.00 33.58 ? 165  ARG C NH1   1 
ATOM   3512  N  NH2   . ARG C  1 165 ? 10.752  22.354  66.262  1.00 33.24 ? 165  ARG C NH2   1 
ATOM   3513  N  N     . LEU C  1 166 ? 17.475  20.070  62.340  1.00 38.94 ? 166  LEU C N     1 
ATOM   3514  C  CA    . LEU C  1 166 ? 18.856  19.585  62.403  1.00 40.47 ? 166  LEU C CA    1 
ATOM   3515  C  C     . LEU C  1 166 ? 19.224  19.077  63.802  1.00 41.59 ? 166  LEU C C     1 
ATOM   3516  O  O     . LEU C  1 166 ? 19.875  18.041  63.936  1.00 41.76 ? 166  LEU C O     1 
ATOM   3517  C  CB    . LEU C  1 166 ? 19.842  20.667  61.942  1.00 40.32 ? 166  LEU C CB    1 
ATOM   3518  C  CG    . LEU C  1 166 ? 19.763  21.220  60.508  1.00 40.48 ? 166  LEU C CG    1 
ATOM   3519  C  CD1   . LEU C  1 166 ? 20.823  22.300  60.282  1.00 40.17 ? 166  LEU C CD1   1 
ATOM   3520  C  CD2   . LEU C  1 166 ? 19.871  20.126  59.442  1.00 39.97 ? 166  LEU C CD2   1 
ATOM   3521  N  N     . GLY C  1 167 ? 18.785  19.802  64.830  1.00 42.84 ? 167  GLY C N     1 
ATOM   3522  C  CA    . GLY C  1 167 ? 19.092  19.468  66.208  1.00 44.46 ? 167  GLY C CA    1 
ATOM   3523  C  C     . GLY C  1 167 ? 18.238  18.356  66.786  1.00 45.57 ? 167  GLY C C     1 
ATOM   3524  O  O     . GLY C  1 167 ? 17.607  17.601  66.051  1.00 45.72 ? 167  GLY C O     1 
ATOM   3525  N  N     . THR C  1 168 ? 18.220  18.269  68.116  1.00 46.55 ? 168  THR C N     1 
ATOM   3526  C  CA    . THR C  1 168 ? 17.567  17.166  68.826  1.00 47.42 ? 168  THR C CA    1 
ATOM   3527  C  C     . THR C  1 168 ? 16.349  17.618  69.641  1.00 47.73 ? 168  THR C C     1 
ATOM   3528  O  O     . THR C  1 168 ? 15.632  16.780  70.204  1.00 47.92 ? 168  THR C O     1 
ATOM   3529  C  CB    . THR C  1 168 ? 18.594  16.428  69.754  1.00 47.69 ? 168  THR C CB    1 
ATOM   3530  O  OG1   . THR C  1 168 ? 19.246  17.377  70.611  1.00 48.16 ? 168  THR C OG1   1 
ATOM   3531  C  CG2   . THR C  1 168 ? 19.751  15.834  68.943  1.00 47.50 ? 168  THR C CG2   1 
ATOM   3532  N  N     . GLU C  1 169 ? 16.115  18.931  69.703  1.00 48.12 ? 169  GLU C N     1 
ATOM   3533  C  CA    . GLU C  1 169 ? 14.982  19.472  70.462  1.00 48.60 ? 169  GLU C CA    1 
ATOM   3534  C  C     . GLU C  1 169 ? 13.646  18.900  69.971  1.00 48.55 ? 169  GLU C C     1 
ATOM   3535  O  O     . GLU C  1 169 ? 13.475  18.629  68.780  1.00 48.61 ? 169  GLU C O     1 
ATOM   3536  C  CB    . GLU C  1 169 ? 14.987  21.009  70.476  1.00 48.87 ? 169  GLU C CB    1 
ATOM   3537  C  CG    . GLU C  1 169 ? 15.193  21.670  69.119  1.00 50.80 ? 169  GLU C CG    1 
ATOM   3538  C  CD    . GLU C  1 169 ? 16.583  22.263  68.932  1.00 52.54 ? 169  GLU C CD    1 
ATOM   3539  O  OE1   . GLU C  1 169 ? 16.961  23.167  69.716  1.00 53.18 ? 169  GLU C OE1   1 
ATOM   3540  O  OE2   . GLU C  1 169 ? 17.289  21.835  67.986  1.00 52.56 ? 169  GLU C OE2   1 
ATOM   3541  N  N     . LYS C  1 170 ? 12.719  18.688  70.900  1.00 48.52 ? 170  LYS C N     1 
ATOM   3542  C  CA    . LYS C  1 170 ? 11.512  17.908  70.628  1.00 48.48 ? 170  LYS C CA    1 
ATOM   3543  C  C     . LYS C  1 170 ? 10.233  18.736  70.598  1.00 47.86 ? 170  LYS C C     1 
ATOM   3544  O  O     . LYS C  1 170 ? 9.224   18.299  70.046  1.00 47.83 ? 170  LYS C O     1 
ATOM   3545  C  CB    . LYS C  1 170 ? 11.355  16.778  71.652  1.00 48.95 ? 170  LYS C CB    1 
ATOM   3546  C  CG    . LYS C  1 170 ? 12.294  15.595  71.447  1.00 50.55 ? 170  LYS C CG    1 
ATOM   3547  C  CD    . LYS C  1 170 ? 12.649  14.968  72.799  1.00 53.24 ? 170  LYS C CD    1 
ATOM   3548  C  CE    . LYS C  1 170 ? 12.244  13.504  72.857  1.00 54.29 ? 170  LYS C CE    1 
ATOM   3549  N  NZ    . LYS C  1 170 ? 13.422  12.621  72.621  1.00 55.16 ? 170  LYS C NZ    1 
ATOM   3550  N  N     . GLU C  1 171 ? 10.266  19.915  71.208  1.00 47.07 ? 171  GLU C N     1 
ATOM   3551  C  CA    . GLU C  1 171 ? 9.112   20.811  71.192  1.00 46.53 ? 171  GLU C CA    1 
ATOM   3552  C  C     . GLU C  1 171 ? 8.846   21.327  69.763  1.00 45.61 ? 171  GLU C C     1 
ATOM   3553  O  O     . GLU C  1 171 ? 9.774   21.447  68.954  1.00 45.38 ? 171  GLU C O     1 
ATOM   3554  C  CB    . GLU C  1 171 ? 9.308   21.961  72.193  1.00 46.79 ? 171  GLU C CB    1 
ATOM   3555  C  CG    . GLU C  1 171 ? 10.555  22.818  71.955  1.00 49.07 ? 171  GLU C CG    1 
ATOM   3556  C  CD    . GLU C  1 171 ? 11.779  22.391  72.766  1.00 51.59 ? 171  GLU C CD    1 
ATOM   3557  O  OE1   . GLU C  1 171 ? 11.888  21.195  73.136  1.00 53.12 ? 171  GLU C OE1   1 
ATOM   3558  O  OE2   . GLU C  1 171 ? 12.646  23.260  73.028  1.00 51.85 ? 171  GLU C OE2   1 
ATOM   3559  N  N     . VAL C  1 172 ? 7.581   21.609  69.458  1.00 44.46 ? 172  VAL C N     1 
ATOM   3560  C  CA    . VAL C  1 172 ? 7.193   22.068  68.124  1.00 43.53 ? 172  VAL C CA    1 
ATOM   3561  C  C     . VAL C  1 172 ? 7.772   23.455  67.801  1.00 42.93 ? 172  VAL C C     1 
ATOM   3562  O  O     . VAL C  1 172 ? 8.480   23.616  66.807  1.00 42.67 ? 172  VAL C O     1 
ATOM   3563  C  CB    . VAL C  1 172 ? 5.658   22.032  67.928  1.00 43.68 ? 172  VAL C CB    1 
ATOM   3564  C  CG1   . VAL C  1 172 ? 5.276   22.634  66.602  1.00 43.80 ? 172  VAL C CG1   1 
ATOM   3565  C  CG2   . VAL C  1 172 ? 5.146   20.606  68.013  1.00 43.43 ? 172  VAL C CG2   1 
ATOM   3566  N  N     . GLU C  1 173 ? 7.499   24.440  68.654  1.00 42.22 ? 173  GLU C N     1 
ATOM   3567  C  CA    . GLU C  1 173 ? 7.990   25.798  68.428  1.00 41.79 ? 173  GLU C CA    1 
ATOM   3568  C  C     . GLU C  1 173 ? 9.461   26.006  68.814  1.00 41.36 ? 173  GLU C C     1 
ATOM   3569  O  O     . GLU C  1 173 ? 9.797   26.156  69.992  1.00 41.44 ? 173  GLU C O     1 
ATOM   3570  C  CB    . GLU C  1 173 ? 7.108   26.816  69.142  1.00 41.95 ? 173  GLU C CB    1 
ATOM   3571  C  CG    . GLU C  1 173 ? 7.394   28.256  68.743  1.00 43.00 ? 173  GLU C CG    1 
ATOM   3572  C  CD    . GLU C  1 173 ? 6.326   29.206  69.241  1.00 45.13 ? 173  GLU C CD    1 
ATOM   3573  O  OE1   . GLU C  1 173 ? 6.661   30.368  69.572  1.00 46.21 ? 173  GLU C OE1   1 
ATOM   3574  O  OE2   . GLU C  1 173 ? 5.144   28.789  69.298  1.00 46.54 ? 173  GLU C OE2   1 
ATOM   3575  N  N     . VAL C  1 174 ? 10.326  26.005  67.805  1.00 40.69 ? 174  VAL C N     1 
ATOM   3576  C  CA    . VAL C  1 174 ? 11.719  26.417  67.947  1.00 40.12 ? 174  VAL C CA    1 
ATOM   3577  C  C     . VAL C  1 174 ? 12.058  27.346  66.776  1.00 39.89 ? 174  VAL C C     1 
ATOM   3578  O  O     . VAL C  1 174 ? 12.188  26.900  65.626  1.00 39.93 ? 174  VAL C O     1 
ATOM   3579  C  CB    . VAL C  1 174 ? 12.706  25.218  67.936  1.00 40.46 ? 174  VAL C CB    1 
ATOM   3580  C  CG1   . VAL C  1 174 ? 14.163  25.712  68.049  1.00 40.02 ? 174  VAL C CG1   1 
ATOM   3581  C  CG2   . VAL C  1 174 ? 12.384  24.227  69.036  1.00 39.97 ? 174  VAL C CG2   1 
ATOM   3582  N  N     . ILE C  1 175 ? 12.182  28.634  67.076  1.00 39.50 ? 175  ILE C N     1 
ATOM   3583  C  CA    . ILE C  1 175 ? 12.489  29.658  66.085  1.00 39.29 ? 175  ILE C CA    1 
ATOM   3584  C  C     . ILE C  1 175 ? 13.913  29.486  65.580  1.00 39.13 ? 175  ILE C C     1 
ATOM   3585  O  O     . ILE C  1 175 ? 14.822  29.218  66.369  1.00 39.32 ? 175  ILE C O     1 
ATOM   3586  C  CB    . ILE C  1 175 ? 12.316  31.059  66.712  1.00 39.26 ? 175  ILE C CB    1 
ATOM   3587  C  CG1   . ILE C  1 175 ? 10.923  31.221  67.345  1.00 39.28 ? 175  ILE C CG1   1 
ATOM   3588  C  CG2   . ILE C  1 175 ? 12.635  32.162  65.700  1.00 39.83 ? 175  ILE C CG2   1 
ATOM   3589  C  CD1   . ILE C  1 175 ? 9.729   30.913  66.434  1.00 39.65 ? 175  ILE C CD1   1 
ATOM   3590  N  N     . GLY C  1 176 ? 14.104  29.637  64.269  1.00 38.86 ? 176  GLY C N     1 
ATOM   3591  C  CA    . GLY C  1 176 ? 15.414  29.504  63.658  1.00 38.38 ? 176  GLY C CA    1 
ATOM   3592  C  C     . GLY C  1 176 ? 15.343  29.491  62.148  1.00 38.27 ? 176  GLY C C     1 
ATOM   3593  O  O     . GLY C  1 176 ? 14.250  29.420  61.579  1.00 38.47 ? 176  GLY C O     1 
ATOM   3594  N  N     . GLY C  1 177 ? 16.505  29.571  61.503  1.00 37.96 ? 177  GLY C N     1 
ATOM   3595  C  CA    . GLY C  1 177 ? 16.593  29.568  60.055  1.00 37.61 ? 177  GLY C CA    1 
ATOM   3596  C  C     . GLY C  1 177 ? 17.378  28.368  59.565  1.00 37.71 ? 177  GLY C C     1 
ATOM   3597  O  O     . GLY C  1 177 ? 17.256  27.272  60.118  1.00 37.42 ? 177  GLY C O     1 
ATOM   3598  N  N     . ALA C  1 178 ? 18.198  28.579  58.537  1.00 38.05 ? 178  ALA C N     1 
ATOM   3599  C  CA    . ALA C  1 178 ? 18.976  27.502  57.918  1.00 38.51 ? 178  ALA C CA    1 
ATOM   3600  C  C     . ALA C  1 178 ? 20.033  26.906  58.856  1.00 38.84 ? 178  ALA C C     1 
ATOM   3601  O  O     . ALA C  1 178 ? 20.598  25.841  58.581  1.00 38.97 ? 178  ALA C O     1 
ATOM   3602  C  CB    . ALA C  1 178 ? 19.612  27.981  56.618  1.00 38.47 ? 178  ALA C CB    1 
ATOM   3603  N  N     . ASP C  1 179 ? 20.293  27.599  59.962  1.00 39.29 ? 179  ASP C N     1 
ATOM   3604  C  CA    . ASP C  1 179 ? 21.150  27.069  61.025  1.00 39.66 ? 179  ASP C CA    1 
ATOM   3605  C  C     . ASP C  1 179 ? 20.479  25.913  61.790  1.00 39.14 ? 179  ASP C C     1 
ATOM   3606  O  O     . ASP C  1 179 ? 21.168  25.026  62.292  1.00 39.55 ? 179  ASP C O     1 
ATOM   3607  C  CB    . ASP C  1 179 ? 21.599  28.185  61.988  1.00 40.23 ? 179  ASP C CB    1 
ATOM   3608  C  CG    . ASP C  1 179 ? 20.428  29.002  62.548  1.00 42.39 ? 179  ASP C CG    1 
ATOM   3609  O  OD1   . ASP C  1 179 ? 19.558  29.450  61.760  1.00 43.61 ? 179  ASP C OD1   1 
ATOM   3610  O  OD2   . ASP C  1 179 ? 20.309  29.259  63.773  1.00 44.66 ? 179  ASP C OD2   1 
ATOM   3611  N  N     . LYS C  1 180 ? 19.145  25.913  61.850  1.00 38.13 ? 180  LYS C N     1 
ATOM   3612  C  CA    . LYS C  1 180 ? 18.397  24.914  62.619  1.00 36.93 ? 180  LYS C CA    1 
ATOM   3613  C  C     . LYS C  1 180 ? 17.553  23.965  61.757  1.00 35.73 ? 180  LYS C C     1 
ATOM   3614  O  O     . LYS C  1 180 ? 17.111  22.913  62.236  1.00 35.66 ? 180  LYS C O     1 
ATOM   3615  C  CB    . LYS C  1 180 ? 17.494  25.608  63.647  1.00 37.33 ? 180  LYS C CB    1 
ATOM   3616  C  CG    . LYS C  1 180 ? 18.237  26.277  64.797  1.00 39.20 ? 180  LYS C CG    1 
ATOM   3617  C  CD    . LYS C  1 180 ? 17.387  26.292  66.063  1.00 42.11 ? 180  LYS C CD    1 
ATOM   3618  C  CE    . LYS C  1 180 ? 18.197  26.740  67.280  1.00 43.76 ? 180  LYS C CE    1 
ATOM   3619  N  NZ    . LYS C  1 180 ? 17.409  27.661  68.143  1.00 44.81 ? 180  LYS C NZ    1 
ATOM   3620  N  N     . TYR C  1 181 ? 17.327  24.338  60.496  1.00 34.15 ? 181  TYR C N     1 
ATOM   3621  C  CA    . TYR C  1 181 ? 16.432  23.597  59.607  1.00 32.54 ? 181  TYR C CA    1 
ATOM   3622  C  C     . TYR C  1 181 ? 16.978  23.482  58.189  1.00 32.10 ? 181  TYR C C     1 
ATOM   3623  O  O     . TYR C  1 181 ? 17.674  24.377  57.706  1.00 31.84 ? 181  TYR C O     1 
ATOM   3624  C  CB    . TYR C  1 181 ? 15.069  24.285  59.527  1.00 32.25 ? 181  TYR C CB    1 
ATOM   3625  C  CG    . TYR C  1 181 ? 14.273  24.342  60.815  1.00 30.87 ? 181  TYR C CG    1 
ATOM   3626  C  CD1   . TYR C  1 181 ? 14.341  25.454  61.639  1.00 29.34 ? 181  TYR C CD1   1 
ATOM   3627  C  CD2   . TYR C  1 181 ? 13.434  23.291  61.193  1.00 29.55 ? 181  TYR C CD2   1 
ATOM   3628  C  CE1   . TYR C  1 181 ? 13.603  25.521  62.812  1.00 29.07 ? 181  TYR C CE1   1 
ATOM   3629  C  CE2   . TYR C  1 181 ? 12.686  23.350  62.366  1.00 27.70 ? 181  TYR C CE2   1 
ATOM   3630  C  CZ    . TYR C  1 181 ? 12.775  24.468  63.167  1.00 28.79 ? 181  TYR C CZ    1 
ATOM   3631  O  OH    . TYR C  1 181 ? 12.046  24.555  64.337  1.00 29.26 ? 181  TYR C OH    1 
ATOM   3632  N  N     . HIS C  1 182 ? 16.647  22.376  57.527  1.00 31.50 ? 182  HIS C N     1 
ATOM   3633  C  CA    . HIS C  1 182 ? 16.894  22.196  56.101  1.00 31.23 ? 182  HIS C CA    1 
ATOM   3634  C  C     . HIS C  1 182 ? 15.550  21.935  55.409  1.00 30.94 ? 182  HIS C C     1 
ATOM   3635  O  O     . HIS C  1 182 ? 14.720  21.151  55.905  1.00 30.81 ? 182  HIS C O     1 
ATOM   3636  C  CB    . HIS C  1 182 ? 17.781  20.969  55.851  1.00 31.48 ? 182  HIS C CB    1 
ATOM   3637  C  CG    . HIS C  1 182 ? 19.254  21.224  55.961  1.00 32.80 ? 182  HIS C CG    1 
ATOM   3638  N  ND1   . HIS C  1 182 ? 19.785  22.427  56.383  1.00 34.17 ? 182  HIS C ND1   1 
ATOM   3639  C  CD2   . HIS C  1 182 ? 20.313  20.414  55.713  1.00 32.92 ? 182  HIS C CD2   1 
ATOM   3640  C  CE1   . HIS C  1 182 ? 21.105  22.350  56.379  1.00 34.16 ? 182  HIS C CE1   1 
ATOM   3641  N  NE2   . HIS C  1 182 ? 21.451  21.140  55.977  1.00 33.47 ? 182  HIS C NE2   1 
ATOM   3642  N  N     . SER C  1 183 ? 15.328  22.599  54.275  1.00 30.33 ? 183  SER C N     1 
ATOM   3643  C  CA    . SER C  1 183 ? 14.266  22.187  53.367  1.00 29.84 ? 183  SER C CA    1 
ATOM   3644  C  C     . SER C  1 183 ? 14.774  20.930  52.687  1.00 29.49 ? 183  SER C C     1 
ATOM   3645  O  O     . SER C  1 183 ? 15.945  20.864  52.288  1.00 29.29 ? 183  SER C O     1 
ATOM   3646  C  CB    . SER C  1 183 ? 13.929  23.283  52.341  1.00 30.32 ? 183  SER C CB    1 
ATOM   3647  O  OG    . SER C  1 183 ? 15.076  23.777  51.642  1.00 29.96 ? 183  SER C OG    1 
ATOM   3648  N  N     . VAL C  1 184 ? 13.895  19.941  52.544  1.00 29.35 ? 184  VAL C N     1 
ATOM   3649  C  CA    . VAL C  1 184 ? 14.319  18.598  52.210  1.00 29.24 ? 184  VAL C CA    1 
ATOM   3650  C  C     . VAL C  1 184 ? 13.266  17.837  51.365  1.00 29.47 ? 184  VAL C C     1 
ATOM   3651  O  O     . VAL C  1 184 ? 12.059  18.078  51.490  1.00 29.31 ? 184  VAL C O     1 
ATOM   3652  C  CB    . VAL C  1 184 ? 14.700  17.899  53.558  1.00 29.58 ? 184  VAL C CB    1 
ATOM   3653  C  CG1   . VAL C  1 184 ? 13.682  16.874  53.992  1.00 29.49 ? 184  VAL C CG1   1 
ATOM   3654  C  CG2   . VAL C  1 184 ? 16.124  17.360  53.537  1.00 29.60 ? 184  VAL C CG2   1 
ATOM   3655  N  N     . CYS C  1 185 ? 13.728  16.957  50.478  1.00 29.65 ? 185  CYS C N     1 
ATOM   3656  C  CA    . CYS C  1 185 ? 12.838  16.050  49.754  1.00 30.14 ? 185  CYS C CA    1 
ATOM   3657  C  C     . CYS C  1 185 ? 12.449  14.856  50.640  1.00 30.36 ? 185  CYS C C     1 
ATOM   3658  O  O     . CYS C  1 185 ? 12.937  14.725  51.760  1.00 30.38 ? 185  CYS C O     1 
ATOM   3659  C  CB    . CYS C  1 185 ? 13.505  15.569  48.465  1.00 30.22 ? 185  CYS C CB    1 
ATOM   3660  S  SG    . CYS C  1 185 ? 14.948  14.498  48.719  1.00 32.54 ? 185  CYS C SG    1 
ATOM   3661  N  N     . ARG C  1 186 ? 11.570  13.997  50.134  1.00 30.79 ? 186  ARG C N     1 
ATOM   3662  C  CA    . ARG C  1 186 ? 11.144  12.785  50.837  1.00 31.37 ? 186  ARG C CA    1 
ATOM   3663  C  C     . ARG C  1 186 ? 12.326  11.889  51.240  1.00 32.11 ? 186  ARG C C     1 
ATOM   3664  O  O     . ARG C  1 186 ? 12.424  11.461  52.390  1.00 32.27 ? 186  ARG C O     1 
ATOM   3665  C  CB    . ARG C  1 186 ? 10.161  12.013  49.952  1.00 30.72 ? 186  ARG C CB    1 
ATOM   3666  C  CG    . ARG C  1 186 ? 9.617   10.740  50.542  1.00 30.52 ? 186  ARG C CG    1 
ATOM   3667  C  CD    . ARG C  1 186 ? 8.518   10.114  49.692  1.00 30.34 ? 186  ARG C CD    1 
ATOM   3668  N  NE    . ARG C  1 186 ? 7.319   10.950  49.702  1.00 29.66 ? 186  ARG C NE    1 
ATOM   3669  C  CZ    . ARG C  1 186 ? 6.360   10.870  50.617  1.00 29.61 ? 186  ARG C CZ    1 
ATOM   3670  N  NH1   . ARG C  1 186 ? 6.433   9.979   51.601  1.00 29.22 ? 186  ARG C NH1   1 
ATOM   3671  N  NH2   . ARG C  1 186 ? 5.315   11.682  50.546  1.00 30.60 ? 186  ARG C NH2   1 
ATOM   3672  N  N     . LEU C  1 187 ? 13.213  11.611  50.286  1.00 33.11 ? 187  LEU C N     1 
ATOM   3673  C  CA    . LEU C  1 187 ? 14.343  10.711  50.507  1.00 34.09 ? 187  LEU C CA    1 
ATOM   3674  C  C     . LEU C  1 187 ? 15.326  11.249  51.542  1.00 34.36 ? 187  LEU C C     1 
ATOM   3675  O  O     . LEU C  1 187 ? 15.730  10.527  52.454  1.00 34.84 ? 187  LEU C O     1 
ATOM   3676  C  CB    . LEU C  1 187 ? 15.069  10.438  49.192  1.00 34.32 ? 187  LEU C CB    1 
ATOM   3677  C  CG    . LEU C  1 187 ? 14.329  9.558   48.176  1.00 35.55 ? 187  LEU C CG    1 
ATOM   3678  C  CD1   . LEU C  1 187 ? 15.240  9.260   46.989  1.00 36.50 ? 187  LEU C CD1   1 
ATOM   3679  C  CD2   . LEU C  1 187 ? 13.814  8.265   48.806  1.00 36.59 ? 187  LEU C CD2   1 
ATOM   3680  N  N     . CYS C  1 188 ? 15.699  12.517  51.406  1.00 34.67 ? 188  CYS C N     1 
ATOM   3681  C  CA    . CYS C  1 188 ? 16.611  13.153  52.351  1.00 35.06 ? 188  CYS C CA    1 
ATOM   3682  C  C     . CYS C  1 188 ? 16.005  13.321  53.744  1.00 35.09 ? 188  CYS C C     1 
ATOM   3683  O  O     . CYS C  1 188 ? 16.734  13.316  54.744  1.00 35.13 ? 188  CYS C O     1 
ATOM   3684  C  CB    . CYS C  1 188 ? 17.074  14.507  51.825  1.00 35.24 ? 188  CYS C CB    1 
ATOM   3685  S  SG    . CYS C  1 188 ? 18.189  14.410  50.414  1.00 38.60 ? 188  CYS C SG    1 
ATOM   3686  N  N     . TYR C  1 189 ? 14.680  13.465  53.815  1.00 35.29 ? 189  TYR C N     1 
ATOM   3687  C  CA    . TYR C  1 189 ? 13.988  13.548  55.106  1.00 35.49 ? 189  TYR C CA    1 
ATOM   3688  C  C     . TYR C  1 189 ? 14.206  12.310  55.969  1.00 36.54 ? 189  TYR C C     1 
ATOM   3689  O  O     . TYR C  1 189 ? 14.330  12.418  57.182  1.00 36.34 ? 189  TYR C O     1 
ATOM   3690  C  CB    . TYR C  1 189 ? 12.477  13.789  54.928  1.00 35.09 ? 189  TYR C CB    1 
ATOM   3691  C  CG    . TYR C  1 189 ? 11.747  13.994  56.242  1.00 33.08 ? 189  TYR C CG    1 
ATOM   3692  C  CD1   . TYR C  1 189 ? 11.605  15.269  56.785  1.00 31.38 ? 189  TYR C CD1   1 
ATOM   3693  C  CD2   . TYR C  1 189 ? 11.219  12.909  56.951  1.00 31.24 ? 189  TYR C CD2   1 
ATOM   3694  C  CE1   . TYR C  1 189 ? 10.946  15.471  57.996  1.00 30.65 ? 189  TYR C CE1   1 
ATOM   3695  C  CE2   . TYR C  1 189 ? 10.565  13.094  58.166  1.00 30.76 ? 189  TYR C CE2   1 
ATOM   3696  C  CZ    . TYR C  1 189 ? 10.431  14.378  58.680  1.00 31.27 ? 189  TYR C CZ    1 
ATOM   3697  O  OH    . TYR C  1 189 ? 9.787   14.575  59.879  1.00 31.94 ? 189  TYR C OH    1 
ATOM   3698  N  N     . PHE C  1 190 ? 14.228  11.140  55.337  1.00 38.12 ? 190  PHE C N     1 
ATOM   3699  C  CA    . PHE C  1 190 ? 14.318  9.870   56.056  1.00 39.89 ? 190  PHE C CA    1 
ATOM   3700  C  C     . PHE C  1 190 ? 15.751  9.317   56.136  1.00 41.41 ? 190  PHE C C     1 
ATOM   3701  O  O     . PHE C  1 190 ? 15.979  8.270   56.756  1.00 41.80 ? 190  PHE C O     1 
ATOM   3702  C  CB    . PHE C  1 190 ? 13.387  8.824   55.421  1.00 39.64 ? 190  PHE C CB    1 
ATOM   3703  C  CG    . PHE C  1 190 ? 11.918  9.009   55.762  1.00 39.30 ? 190  PHE C CG    1 
ATOM   3704  C  CD1   . PHE C  1 190 ? 10.988  9.271   54.756  1.00 38.30 ? 190  PHE C CD1   1 
ATOM   3705  C  CD2   . PHE C  1 190 ? 11.467  8.904   57.077  1.00 38.16 ? 190  PHE C CD2   1 
ATOM   3706  C  CE1   . PHE C  1 190 ? 9.631   9.435   55.057  1.00 38.32 ? 190  PHE C CE1   1 
ATOM   3707  C  CE2   . PHE C  1 190 ? 10.118  9.065   57.389  1.00 37.96 ? 190  PHE C CE2   1 
ATOM   3708  C  CZ    . PHE C  1 190 ? 9.196   9.332   56.379  1.00 38.07 ? 190  PHE C CZ    1 
ATOM   3709  N  N     . LYS C  1 191 ? 16.702  10.022  55.516  1.00 42.99 ? 191  LYS C N     1 
ATOM   3710  C  CA    . LYS C  1 191 ? 18.121  9.618   55.470  1.00 44.48 ? 191  LYS C CA    1 
ATOM   3711  C  C     . LYS C  1 191 ? 18.751  9.495   56.860  1.00 45.00 ? 191  LYS C C     1 
ATOM   3712  O  O     . LYS C  1 191 ? 18.729  10.452  57.639  1.00 45.68 ? 191  LYS C O     1 
ATOM   3713  C  CB    . LYS C  1 191 ? 18.929  10.632  54.656  1.00 44.32 ? 191  LYS C CB    1 
ATOM   3714  C  CG    . LYS C  1 191 ? 19.610  10.047  53.437  1.00 46.44 ? 191  LYS C CG    1 
ATOM   3715  C  CD    . LYS C  1 191 ? 20.964  10.714  53.199  1.00 48.93 ? 191  LYS C CD    1 
ATOM   3716  C  CE    . LYS C  1 191 ? 22.037  9.692   52.822  1.00 51.00 ? 191  LYS C CE    1 
ATOM   3717  N  NZ    . LYS C  1 191 ? 22.868  9.254   53.990  1.00 50.88 ? 191  LYS C NZ    1 
ATOM   3718  N  N     . ARG D  1 18  ? 21.673  19.607  33.845  1.00 43.73 ? 18   ARG D N     1 
ATOM   3719  C  CA    . ARG D  1 18  ? 20.194  19.699  33.592  1.00 43.48 ? 18   ARG D CA    1 
ATOM   3720  C  C     . ARG D  1 18  ? 19.674  21.148  33.596  1.00 42.22 ? 18   ARG D C     1 
ATOM   3721  O  O     . ARG D  1 18  ? 19.191  21.663  34.615  1.00 42.28 ? 18   ARG D O     1 
ATOM   3722  C  CB    . ARG D  1 18  ? 19.414  18.835  34.589  1.00 44.15 ? 18   ARG D CB    1 
ATOM   3723  C  CG    . ARG D  1 18  ? 17.992  18.523  34.154  1.00 46.73 ? 18   ARG D CG    1 
ATOM   3724  C  CD    . ARG D  1 18  ? 17.441  17.195  34.681  1.00 51.08 ? 18   ARG D CD    1 
ATOM   3725  N  NE    . ARG D  1 18  ? 16.558  16.582  33.692  1.00 54.34 ? 18   ARG D NE    1 
ATOM   3726  C  CZ    . ARG D  1 18  ? 16.893  15.556  32.911  1.00 56.34 ? 18   ARG D CZ    1 
ATOM   3727  N  NH1   . ARG D  1 18  ? 18.096  14.993  33.014  1.00 57.18 ? 18   ARG D NH1   1 
ATOM   3728  N  NH2   . ARG D  1 18  ? 16.018  15.087  32.025  1.00 55.79 ? 18   ARG D NH2   1 
ATOM   3729  N  N     . GLY D  1 19  ? 19.776  21.788  32.431  1.00 40.57 ? 19   GLY D N     1 
ATOM   3730  C  CA    . GLY D  1 19  ? 19.351  23.164  32.254  1.00 38.15 ? 19   GLY D CA    1 
ATOM   3731  C  C     . GLY D  1 19  ? 17.861  23.299  32.026  1.00 36.47 ? 19   GLY D C     1 
ATOM   3732  O  O     . GLY D  1 19  ? 17.165  22.305  31.811  1.00 36.33 ? 19   GLY D O     1 
ATOM   3733  N  N     . GLN D  1 20  ? 17.385  24.542  32.036  1.00 34.78 ? 20   GLN D N     1 
ATOM   3734  C  CA    . GLN D  1 20  ? 15.962  24.841  32.131  1.00 33.31 ? 20   GLN D CA    1 
ATOM   3735  C  C     . GLN D  1 20  ? 15.692  26.303  31.811  1.00 31.73 ? 20   GLN D C     1 
ATOM   3736  O  O     . GLN D  1 20  ? 16.485  27.174  32.180  1.00 31.31 ? 20   GLN D O     1 
ATOM   3737  C  CB    . GLN D  1 20  ? 15.539  24.626  33.576  1.00 33.68 ? 20   GLN D CB    1 
ATOM   3738  C  CG    . GLN D  1 20  ? 14.314  23.827  33.780  1.00 35.27 ? 20   GLN D CG    1 
ATOM   3739  C  CD    . GLN D  1 20  ? 13.699  24.085  35.137  1.00 37.30 ? 20   GLN D CD    1 
ATOM   3740  O  OE1   . GLN D  1 20  ? 14.410  24.284  36.122  1.00 38.24 ? 20   GLN D OE1   1 
ATOM   3741  N  NE2   . GLN D  1 20  ? 12.375  24.089  35.193  1.00 38.77 ? 20   GLN D NE2   1 
ATOM   3742  N  N     . ILE D  1 21  ? 14.573  26.570  31.142  1.00 30.09 ? 21   ILE D N     1 
ATOM   3743  C  CA    . ILE D  1 21  ? 14.050  27.933  31.004  1.00 28.45 ? 21   ILE D CA    1 
ATOM   3744  C  C     . ILE D  1 21  ? 12.670  28.031  31.671  1.00 27.86 ? 21   ILE D C     1 
ATOM   3745  O  O     . ILE D  1 21  ? 11.761  27.265  31.360  1.00 27.34 ? 21   ILE D O     1 
ATOM   3746  C  CB    . ILE D  1 21  ? 13.972  28.397  29.510  1.00 28.14 ? 21   ILE D CB    1 
ATOM   3747  C  CG1   . ILE D  1 21  ? 15.365  28.460  28.854  1.00 27.53 ? 21   ILE D CG1   1 
ATOM   3748  C  CG2   . ILE D  1 21  ? 13.285  29.759  29.408  1.00 27.22 ? 21   ILE D CG2   1 
ATOM   3749  C  CD1   . ILE D  1 21  ? 15.333  28.634  27.329  1.00 25.80 ? 21   ILE D CD1   1 
ATOM   3750  N  N     . GLN D  1 22  ? 12.536  28.984  32.585  1.00 27.23 ? 22   GLN D N     1 
ATOM   3751  C  CA    . GLN D  1 22  ? 11.258  29.300  33.218  1.00 26.81 ? 22   GLN D CA    1 
ATOM   3752  C  C     . GLN D  1 22  ? 10.847  30.708  32.854  1.00 26.37 ? 22   GLN D C     1 
ATOM   3753  O  O     . GLN D  1 22  ? 11.661  31.636  32.920  1.00 26.36 ? 22   GLN D O     1 
ATOM   3754  C  CB    . GLN D  1 22  ? 11.379  29.209  34.728  1.00 26.70 ? 22   GLN D CB    1 
ATOM   3755  C  CG    . GLN D  1 22  ? 11.476  27.810  35.242  1.00 27.66 ? 22   GLN D CG    1 
ATOM   3756  C  CD    . GLN D  1 22  ? 11.886  27.761  36.692  1.00 29.40 ? 22   GLN D CD    1 
ATOM   3757  O  OE1   . GLN D  1 22  ? 11.499  28.621  37.491  1.00 29.50 ? 22   GLN D OE1   1 
ATOM   3758  N  NE2   . GLN D  1 22  ? 12.678  26.752  37.041  1.00 31.24 ? 22   GLN D NE2   1 
ATOM   3759  N  N     . VAL D  1 23  ? 9.580   30.874  32.486  1.00 25.70 ? 23   VAL D N     1 
ATOM   3760  C  CA    . VAL D  1 23  ? 9.103   32.169  32.024  1.00 24.94 ? 23   VAL D CA    1 
ATOM   3761  C  C     . VAL D  1 23  ? 7.945   32.652  32.898  1.00 24.76 ? 23   VAL D C     1 
ATOM   3762  O  O     . VAL D  1 23  ? 6.980   31.912  33.149  1.00 24.59 ? 23   VAL D O     1 
ATOM   3763  C  CB    . VAL D  1 23  ? 8.729   32.122  30.541  1.00 24.76 ? 23   VAL D CB    1 
ATOM   3764  C  CG1   . VAL D  1 23  ? 8.137   33.434  30.090  1.00 24.59 ? 23   VAL D CG1   1 
ATOM   3765  C  CG2   . VAL D  1 23  ? 9.963   31.788  29.704  1.00 24.66 ? 23   VAL D CG2   1 
ATOM   3766  N  N     . ILE D  1 24  ? 8.084   33.884  33.389  1.00 24.23 ? 24   ILE D N     1 
ATOM   3767  C  CA    . ILE D  1 24  ? 7.059   34.539  34.194  1.00 23.82 ? 24   ILE D CA    1 
ATOM   3768  C  C     . ILE D  1 24  ? 6.499   35.712  33.406  1.00 23.89 ? 24   ILE D C     1 
ATOM   3769  O  O     . ILE D  1 24  ? 7.180   36.727  33.219  1.00 23.98 ? 24   ILE D O     1 
ATOM   3770  C  CB    . ILE D  1 24  ? 7.622   35.033  35.564  1.00 23.93 ? 24   ILE D CB    1 
ATOM   3771  C  CG1   . ILE D  1 24  ? 8.384   33.912  36.282  1.00 23.72 ? 24   ILE D CG1   1 
ATOM   3772  C  CG2   . ILE D  1 24  ? 6.483   35.574  36.465  1.00 22.39 ? 24   ILE D CG2   1 
ATOM   3773  C  CD1   . ILE D  1 24  ? 9.410   34.412  37.288  1.00 22.27 ? 24   ILE D CD1   1 
ATOM   3774  N  N     . LEU D  1 25  ? 5.264   35.559  32.945  1.00 23.71 ? 25   LEU D N     1 
ATOM   3775  C  CA    . LEU D  1 25  ? 4.586   36.586  32.164  1.00 23.75 ? 25   LEU D CA    1 
ATOM   3776  C  C     . LEU D  1 25  ? 3.521   37.279  33.000  1.00 23.71 ? 25   LEU D C     1 
ATOM   3777  O  O     . LEU D  1 25  ? 3.190   36.833  34.094  1.00 23.43 ? 25   LEU D O     1 
ATOM   3778  C  CB    . LEU D  1 25  ? 3.946   35.986  30.903  1.00 23.46 ? 25   LEU D CB    1 
ATOM   3779  C  CG    . LEU D  1 25  ? 4.883   35.262  29.928  1.00 24.24 ? 25   LEU D CG    1 
ATOM   3780  C  CD1   . LEU D  1 25  ? 4.094   34.661  28.777  1.00 24.02 ? 25   LEU D CD1   1 
ATOM   3781  C  CD2   . LEU D  1 25  ? 5.988   36.191  29.406  1.00 24.40 ? 25   LEU D CD2   1 
ATOM   3782  N  N     . GLY D  1 26  ? 2.981   38.368  32.463  1.00 23.79 ? 26   GLY D N     1 
ATOM   3783  C  CA    . GLY D  1 26  ? 1.916   39.108  33.121  1.00 23.82 ? 26   GLY D CA    1 
ATOM   3784  C  C     . GLY D  1 26  ? 1.947   40.572  32.718  1.00 23.99 ? 26   GLY D C     1 
ATOM   3785  O  O     . GLY D  1 26  ? 2.936   41.033  32.125  1.00 24.02 ? 26   GLY D O     1 
ATOM   3786  N  N     . PRO D  1 27  ? 0.875   41.308  33.018  1.00 23.90 ? 27   PRO D N     1 
ATOM   3787  C  CA    . PRO D  1 27  ? 0.850   42.751  32.747  1.00 23.93 ? 27   PRO D CA    1 
ATOM   3788  C  C     . PRO D  1 27  ? 1.753   43.457  33.749  1.00 24.27 ? 27   PRO D C     1 
ATOM   3789  O  O     . PRO D  1 27  ? 2.343   42.786  34.609  1.00 24.43 ? 27   PRO D O     1 
ATOM   3790  C  CB    . PRO D  1 27  ? -0.615  43.127  32.988  1.00 23.74 ? 27   PRO D CB    1 
ATOM   3791  C  CG    . PRO D  1 27  ? -1.114  42.106  33.975  1.00 23.83 ? 27   PRO D CG    1 
ATOM   3792  C  CD    . PRO D  1 27  ? -0.389  40.828  33.618  1.00 23.67 ? 27   PRO D CD    1 
ATOM   3793  N  N     . MET D  1 28  ? 1.863   44.780  33.655  1.00 24.24 ? 28   MET D N     1 
ATOM   3794  C  CA    . MET D  1 28  ? 2.546   45.541  34.695  1.00 24.18 ? 28   MET D CA    1 
ATOM   3795  C  C     . MET D  1 28  ? 1.798   45.416  36.031  1.00 24.32 ? 28   MET D C     1 
ATOM   3796  O  O     . MET D  1 28  ? 0.602   45.120  36.055  1.00 24.20 ? 28   MET D O     1 
ATOM   3797  C  CB    . MET D  1 28  ? 2.682   46.997  34.276  1.00 24.24 ? 28   MET D CB    1 
ATOM   3798  C  CG    . MET D  1 28  ? 3.663   47.204  33.130  1.00 24.35 ? 28   MET D CG    1 
ATOM   3799  S  SD    . MET D  1 28  ? 3.842   48.932  32.698  1.00 24.25 ? 28   MET D SD    1 
ATOM   3800  C  CE    . MET D  1 28  ? 4.769   49.533  34.130  1.00 22.02 ? 28   MET D CE    1 
ATOM   3801  N  N     . PHE D  1 29  ? 2.527   45.626  37.133  1.00 24.32 ? 29   PHE D N     1 
ATOM   3802  C  CA    . PHE D  1 29  ? 1.977   45.623  38.505  1.00 24.34 ? 29   PHE D CA    1 
ATOM   3803  C  C     . PHE D  1 29  ? 1.425   44.282  38.976  1.00 24.07 ? 29   PHE D C     1 
ATOM   3804  O  O     . PHE D  1 29  ? 0.613   44.220  39.919  1.00 23.97 ? 29   PHE D O     1 
ATOM   3805  C  CB    . PHE D  1 29  ? 0.932   46.738  38.722  1.00 24.31 ? 29   PHE D CB    1 
ATOM   3806  C  CG    . PHE D  1 29  ? 1.210   47.978  37.943  1.00 24.87 ? 29   PHE D CG    1 
ATOM   3807  C  CD1   . PHE D  1 29  ? 0.416   48.318  36.861  1.00 24.81 ? 29   PHE D CD1   1 
ATOM   3808  C  CD2   . PHE D  1 29  ? 2.279   48.802  38.279  1.00 25.76 ? 29   PHE D CD2   1 
ATOM   3809  C  CE1   . PHE D  1 29  ? 0.677   49.469  36.125  1.00 25.83 ? 29   PHE D CE1   1 
ATOM   3810  C  CE2   . PHE D  1 29  ? 2.547   49.952  37.543  1.00 25.61 ? 29   PHE D CE2   1 
ATOM   3811  C  CZ    . PHE D  1 29  ? 1.741   50.280  36.459  1.00 24.91 ? 29   PHE D CZ    1 
ATOM   3812  N  N     . SER D  1 30  ? 1.894   43.208  38.344  1.00 23.62 ? 30   SER D N     1 
ATOM   3813  C  CA    . SER D  1 30  ? 1.472   41.857  38.708  1.00 23.38 ? 30   SER D CA    1 
ATOM   3814  C  C     . SER D  1 30  ? 2.481   41.145  39.599  1.00 23.43 ? 30   SER D C     1 
ATOM   3815  O  O     . SER D  1 30  ? 2.235   40.013  40.030  1.00 23.69 ? 30   SER D O     1 
ATOM   3816  C  CB    . SER D  1 30  ? 1.176   41.021  37.463  1.00 23.19 ? 30   SER D CB    1 
ATOM   3817  O  OG    . SER D  1 30  ? 2.344   40.816  36.683  1.00 22.90 ? 30   SER D OG    1 
ATOM   3818  N  N     . GLY D  1 31  ? 3.607   41.801  39.868  1.00 23.16 ? 31   GLY D N     1 
ATOM   3819  C  CA    . GLY D  1 31  ? 4.637   41.242  40.722  1.00 23.28 ? 31   GLY D CA    1 
ATOM   3820  C  C     . GLY D  1 31  ? 5.590   40.259  40.061  1.00 23.48 ? 31   GLY D C     1 
ATOM   3821  O  O     . GLY D  1 31  ? 6.151   39.400  40.735  1.00 23.73 ? 31   GLY D O     1 
ATOM   3822  N  N     . LYS D  1 32  ? 5.796   40.389  38.755  1.00 23.60 ? 32   LYS D N     1 
ATOM   3823  C  CA    . LYS D  1 32  ? 6.719   39.499  38.026  1.00 23.80 ? 32   LYS D CA    1 
ATOM   3824  C  C     . LYS D  1 32  ? 8.155   39.507  38.579  1.00 24.15 ? 32   LYS D C     1 
ATOM   3825  O  O     . LYS D  1 32  ? 8.759   38.444  38.724  1.00 23.99 ? 32   LYS D O     1 
ATOM   3826  C  CB    . LYS D  1 32  ? 6.726   39.807  36.531  1.00 23.42 ? 32   LYS D CB    1 
ATOM   3827  C  CG    . LYS D  1 32  ? 5.362   39.758  35.869  1.00 22.96 ? 32   LYS D CG    1 
ATOM   3828  C  CD    . LYS D  1 32  ? 5.434   40.083  34.368  1.00 21.48 ? 32   LYS D CD    1 
ATOM   3829  C  CE    . LYS D  1 32  ? 6.071   41.455  34.106  1.00 20.08 ? 32   LYS D CE    1 
ATOM   3830  N  NZ    . LYS D  1 32  ? 5.192   42.573  34.571  1.00 19.40 ? 32   LYS D NZ    1 
ATOM   3831  N  N     . SER D  1 33  ? 8.684   40.698  38.881  1.00 24.63 ? 33   SER D N     1 
ATOM   3832  C  CA    . SER D  1 33  ? 10.042  40.853  39.443  1.00 25.35 ? 33   SER D CA    1 
ATOM   3833  C  C     . SER D  1 33  ? 10.147  40.206  40.819  1.00 25.24 ? 33   SER D C     1 
ATOM   3834  O  O     . SER D  1 33  ? 11.164  39.600  41.154  1.00 25.28 ? 33   SER D O     1 
ATOM   3835  C  CB    . SER D  1 33  ? 10.436  42.328  39.584  1.00 25.11 ? 33   SER D CB    1 
ATOM   3836  O  OG    . SER D  1 33  ? 10.369  43.034  38.355  1.00 27.36 ? 33   SER D OG    1 
ATOM   3837  N  N     . THR D  1 34  ? 9.093   40.364  41.619  1.00 25.21 ? 34   THR D N     1 
ATOM   3838  C  CA    . THR D  1 34  ? 9.037   39.753  42.938  1.00 25.25 ? 34   THR D CA    1 
ATOM   3839  C  C     . THR D  1 34  ? 9.041   38.231  42.835  1.00 25.11 ? 34   THR D C     1 
ATOM   3840  O  O     . THR D  1 34  ? 9.772   37.569  43.571  1.00 25.41 ? 34   THR D O     1 
ATOM   3841  C  CB    . THR D  1 34  ? 7.813   40.265  43.717  1.00 25.34 ? 34   THR D CB    1 
ATOM   3842  O  OG1   . THR D  1 34  ? 8.018   41.642  44.055  1.00 25.68 ? 34   THR D OG1   1 
ATOM   3843  C  CG2   . THR D  1 34  ? 7.705   39.590  45.072  1.00 24.29 ? 34   THR D CG2   1 
ATOM   3844  N  N     . GLU D  1 35  ? 8.246   37.681  41.921  1.00 24.98 ? 35   GLU D N     1 
ATOM   3845  C  CA    . GLU D  1 35  ? 8.220   36.228  41.714  1.00 25.37 ? 35   GLU D CA    1 
ATOM   3846  C  C     . GLU D  1 35  ? 9.572   35.707  41.177  1.00 25.27 ? 35   GLU D C     1 
ATOM   3847  O  O     . GLU D  1 35  ? 10.022  34.623  41.546  1.00 25.03 ? 35   GLU D O     1 
ATOM   3848  C  CB    . GLU D  1 35  ? 7.047   35.821  40.818  1.00 25.12 ? 35   GLU D CB    1 
ATOM   3849  C  CG    . GLU D  1 35  ? 6.956   34.333  40.471  1.00 26.63 ? 35   GLU D CG    1 
ATOM   3850  C  CD    . GLU D  1 35  ? 6.881   33.411  41.687  1.00 29.97 ? 35   GLU D CD    1 
ATOM   3851  O  OE1   . GLU D  1 35  ? 6.431   33.848  42.775  1.00 31.06 ? 35   GLU D OE1   1 
ATOM   3852  O  OE2   . GLU D  1 35  ? 7.273   32.229  41.556  1.00 30.87 ? 35   GLU D OE2   1 
ATOM   3853  N  N     . LEU D  1 36  ? 10.215  36.497  40.323  1.00 25.36 ? 36   LEU D N     1 
ATOM   3854  C  CA    . LEU D  1 36  ? 11.568  36.193  39.857  1.00 25.95 ? 36   LEU D CA    1 
ATOM   3855  C  C     . LEU D  1 36  ? 12.522  36.038  41.037  1.00 26.04 ? 36   LEU D C     1 
ATOM   3856  O  O     . LEU D  1 36  ? 13.216  35.020  41.162  1.00 25.88 ? 36   LEU D O     1 
ATOM   3857  C  CB    . LEU D  1 36  ? 12.078  37.297  38.915  1.00 26.12 ? 36   LEU D CB    1 
ATOM   3858  C  CG    . LEU D  1 36  ? 13.553  37.273  38.472  1.00 26.69 ? 36   LEU D CG    1 
ATOM   3859  C  CD1   . LEU D  1 36  ? 13.907  35.964  37.789  1.00 25.57 ? 36   LEU D CD1   1 
ATOM   3860  C  CD2   . LEU D  1 36  ? 13.836  38.448  37.544  1.00 27.08 ? 36   LEU D CD2   1 
ATOM   3861  N  N     . MET D  1 37  ? 12.543  37.048  41.902  1.00 26.36 ? 37   MET D N     1 
ATOM   3862  C  CA    . MET D  1 37  ? 13.409  37.044  43.080  1.00 27.27 ? 37   MET D CA    1 
ATOM   3863  C  C     . MET D  1 37  ? 13.083  35.882  44.020  1.00 26.82 ? 37   MET D C     1 
ATOM   3864  O  O     . MET D  1 37  ? 13.996  35.228  44.517  1.00 26.77 ? 37   MET D O     1 
ATOM   3865  C  CB    . MET D  1 37  ? 13.317  38.377  43.837  1.00 27.90 ? 37   MET D CB    1 
ATOM   3866  C  CG    . MET D  1 37  ? 14.457  39.395  43.639  1.00 31.49 ? 37   MET D CG    1 
ATOM   3867  S  SD    . MET D  1 37  ? 15.744  39.090  42.365  1.00 38.85 ? 37   MET D SD    1 
ATOM   3868  C  CE    . MET D  1 37  ? 14.938  39.849  40.936  1.00 37.58 ? 37   MET D CE    1 
ATOM   3869  N  N     . ARG D  1 38  ? 11.795  35.618  44.245  1.00 26.46 ? 38   ARG D N     1 
ATOM   3870  C  CA    . ARG D  1 38  ? 11.378  34.481  45.075  1.00 26.38 ? 38   ARG D CA    1 
ATOM   3871  C  C     . ARG D  1 38  ? 11.995  33.178  44.570  1.00 26.44 ? 38   ARG D C     1 
ATOM   3872  O  O     . ARG D  1 38  ? 12.557  32.414  45.350  1.00 26.66 ? 38   ARG D O     1 
ATOM   3873  C  CB    . ARG D  1 38  ? 9.850   34.352  45.147  1.00 25.96 ? 38   ARG D CB    1 
ATOM   3874  C  CG    . ARG D  1 38  ? 9.387   33.232  46.054  1.00 25.93 ? 38   ARG D CG    1 
ATOM   3875  C  CD    . ARG D  1 38  ? 7.890   32.896  45.964  1.00 26.96 ? 38   ARG D CD    1 
ATOM   3876  N  NE    . ARG D  1 38  ? 7.571   32.156  44.743  1.00 27.45 ? 38   ARG D NE    1 
ATOM   3877  C  CZ    . ARG D  1 38  ? 7.669   30.836  44.601  1.00 26.17 ? 38   ARG D CZ    1 
ATOM   3878  N  NH1   . ARG D  1 38  ? 8.077   30.081  45.607  1.00 26.24 ? 38   ARG D NH1   1 
ATOM   3879  N  NH2   . ARG D  1 38  ? 7.357   30.274  43.441  1.00 24.30 ? 38   ARG D NH2   1 
ATOM   3880  N  N     . ARG D  1 39  ? 11.904  32.940  43.265  1.00 26.47 ? 39   ARG D N     1 
ATOM   3881  C  CA    . ARG D  1 39  ? 12.475  31.731  42.676  1.00 26.86 ? 39   ARG D CA    1 
ATOM   3882  C  C     . ARG D  1 39  ? 13.998  31.684  42.766  1.00 27.29 ? 39   ARG D C     1 
ATOM   3883  O  O     . ARG D  1 39  ? 14.563  30.625  43.040  1.00 27.65 ? 39   ARG D O     1 
ATOM   3884  C  CB    . ARG D  1 39  ? 12.061  31.571  41.229  1.00 26.52 ? 39   ARG D CB    1 
ATOM   3885  C  CG    . ARG D  1 39  ? 10.620  31.204  41.045  1.00 26.39 ? 39   ARG D CG    1 
ATOM   3886  C  CD    . ARG D  1 39  ? 10.249  31.151  39.591  1.00 26.89 ? 39   ARG D CD    1 
ATOM   3887  N  NE    . ARG D  1 39  ? 8.814   31.074  39.380  1.00 26.37 ? 39   ARG D NE    1 
ATOM   3888  C  CZ    . ARG D  1 39  ? 8.269   30.596  38.279  1.00 26.61 ? 39   ARG D CZ    1 
ATOM   3889  N  NH1   . ARG D  1 39  ? 9.044   30.148  37.284  1.00 24.72 ? 39   ARG D NH1   1 
ATOM   3890  N  NH2   . ARG D  1 39  ? 6.950   30.580  38.164  1.00 26.12 ? 39   ARG D NH2   1 
ATOM   3891  N  N     . VAL D  1 40  ? 14.656  32.816  42.527  1.00 27.61 ? 40   VAL D N     1 
ATOM   3892  C  CA    . VAL D  1 40  ? 16.115  32.866  42.555  1.00 28.14 ? 40   VAL D CA    1 
ATOM   3893  C  C     . VAL D  1 40  ? 16.636  32.640  43.980  1.00 28.86 ? 40   VAL D C     1 
ATOM   3894  O  O     . VAL D  1 40  ? 17.603  31.898  44.172  1.00 28.85 ? 40   VAL D O     1 
ATOM   3895  C  CB    . VAL D  1 40  ? 16.669  34.189  41.941  1.00 28.51 ? 40   VAL D CB    1 
ATOM   3896  C  CG1   . VAL D  1 40  ? 18.172  34.321  42.155  1.00 27.75 ? 40   VAL D CG1   1 
ATOM   3897  C  CG2   . VAL D  1 40  ? 16.327  34.282  40.434  1.00 27.59 ? 40   VAL D CG2   1 
ATOM   3898  N  N     . ARG D  1 41  ? 15.980  33.251  44.967  1.00 29.71 ? 41   ARG D N     1 
ATOM   3899  C  CA    . ARG D  1 41  ? 16.382  33.106  46.369  1.00 30.87 ? 41   ARG D CA    1 
ATOM   3900  C  C     . ARG D  1 41  ? 16.270  31.670  46.876  1.00 30.80 ? 41   ARG D C     1 
ATOM   3901  O  O     . ARG D  1 41  ? 17.044  31.273  47.742  1.00 30.76 ? 41   ARG D O     1 
ATOM   3902  C  CB    . ARG D  1 41  ? 15.594  34.045  47.283  1.00 31.35 ? 41   ARG D CB    1 
ATOM   3903  C  CG    . ARG D  1 41  ? 16.108  35.469  47.287  1.00 34.69 ? 41   ARG D CG    1 
ATOM   3904  C  CD    . ARG D  1 41  ? 15.383  36.390  48.279  1.00 40.09 ? 41   ARG D CD    1 
ATOM   3905  N  NE    . ARG D  1 41  ? 15.478  37.795  47.870  1.00 43.24 ? 41   ARG D NE    1 
ATOM   3906  C  CZ    . ARG D  1 41  ? 14.448  38.567  47.520  1.00 45.18 ? 41   ARG D CZ    1 
ATOM   3907  N  NH1   . ARG D  1 41  ? 13.201  38.093  47.522  1.00 45.64 ? 41   ARG D NH1   1 
ATOM   3908  N  NH2   . ARG D  1 41  ? 14.670  39.828  47.166  1.00 45.51 ? 41   ARG D NH2   1 
ATOM   3909  N  N     . ARG D  1 42  ? 15.324  30.897  46.341  1.00 30.97 ? 42   ARG D N     1 
ATOM   3910  C  CA    . ARG D  1 42  ? 15.203  29.484  46.701  1.00 31.37 ? 42   ARG D CA    1 
ATOM   3911  C  C     . ARG D  1 42  ? 16.493  28.720  46.390  1.00 31.36 ? 42   ARG D C     1 
ATOM   3912  O  O     . ARG D  1 42  ? 16.926  27.880  47.176  1.00 30.98 ? 42   ARG D O     1 
ATOM   3913  C  CB    . ARG D  1 42  ? 14.042  28.823  45.975  1.00 31.39 ? 42   ARG D CB    1 
ATOM   3914  C  CG    . ARG D  1 42  ? 12.665  29.173  46.514  1.00 32.78 ? 42   ARG D CG    1 
ATOM   3915  C  CD    . ARG D  1 42  ? 11.537  28.870  45.542  1.00 34.06 ? 42   ARG D CD    1 
ATOM   3916  N  NE    . ARG D  1 42  ? 11.493  27.465  45.140  1.00 35.47 ? 42   ARG D NE    1 
ATOM   3917  C  CZ    . ARG D  1 42  ? 11.970  26.980  43.995  1.00 37.18 ? 42   ARG D CZ    1 
ATOM   3918  N  NH1   . ARG D  1 42  ? 12.566  27.773  43.096  1.00 37.94 ? 42   ARG D NH1   1 
ATOM   3919  N  NH2   . ARG D  1 42  ? 11.868  25.684  43.751  1.00 36.63 ? 42   ARG D NH2   1 
ATOM   3920  N  N     . PHE D  1 43  ? 17.095  29.009  45.239  1.00 31.57 ? 43   PHE D N     1 
ATOM   3921  C  CA    . PHE D  1 43  ? 18.331  28.339  44.834  1.00 32.02 ? 43   PHE D CA    1 
ATOM   3922  C  C     . PHE D  1 43  ? 19.511  28.892  45.620  1.00 32.80 ? 43   PHE D C     1 
ATOM   3923  O  O     . PHE D  1 43  ? 20.395  28.145  46.028  1.00 32.77 ? 43   PHE D O     1 
ATOM   3924  C  CB    . PHE D  1 43  ? 18.592  28.491  43.330  1.00 31.62 ? 43   PHE D CB    1 
ATOM   3925  C  CG    . PHE D  1 43  ? 17.671  27.676  42.456  1.00 30.84 ? 43   PHE D CG    1 
ATOM   3926  C  CD1   . PHE D  1 43  ? 16.582  28.277  41.821  1.00 29.78 ? 43   PHE D CD1   1 
ATOM   3927  C  CD2   . PHE D  1 43  ? 17.908  26.317  42.237  1.00 30.06 ? 43   PHE D CD2   1 
ATOM   3928  C  CE1   . PHE D  1 43  ? 15.728  27.530  40.993  1.00 29.25 ? 43   PHE D CE1   1 
ATOM   3929  C  CE2   . PHE D  1 43  ? 17.058  25.561  41.413  1.00 30.12 ? 43   PHE D CE2   1 
ATOM   3930  C  CZ    . PHE D  1 43  ? 15.967  26.171  40.793  1.00 29.44 ? 43   PHE D CZ    1 
ATOM   3931  N  N     . GLN D  1 44  ? 19.517  30.202  45.831  1.00 33.67 ? 44   GLN D N     1 
ATOM   3932  C  CA    . GLN D  1 44  ? 20.609  30.864  46.522  1.00 34.92 ? 44   GLN D CA    1 
ATOM   3933  C  C     . GLN D  1 44  ? 20.739  30.386  47.974  1.00 35.35 ? 44   GLN D C     1 
ATOM   3934  O  O     . GLN D  1 44  ? 21.842  30.090  48.443  1.00 35.25 ? 44   GLN D O     1 
ATOM   3935  C  CB    . GLN D  1 44  ? 20.407  32.368  46.443  1.00 35.14 ? 44   GLN D CB    1 
ATOM   3936  C  CG    . GLN D  1 44  ? 21.628  33.197  46.732  1.00 37.14 ? 44   GLN D CG    1 
ATOM   3937  C  CD    . GLN D  1 44  ? 21.243  34.551  47.285  1.00 41.26 ? 44   GLN D CD    1 
ATOM   3938  O  OE1   . GLN D  1 44  ? 20.619  34.639  48.355  1.00 43.45 ? 44   GLN D OE1   1 
ATOM   3939  N  NE2   . GLN D  1 44  ? 21.584  35.610  46.560  1.00 41.52 ? 44   GLN D NE2   1 
ATOM   3940  N  N     . ILE D  1 45  ? 19.606  30.285  48.667  1.00 35.98 ? 45   ILE D N     1 
ATOM   3941  C  CA    . ILE D  1 45  ? 19.568  29.793  50.040  1.00 36.51 ? 45   ILE D CA    1 
ATOM   3942  C  C     . ILE D  1 45  ? 20.071  28.338  50.129  1.00 36.72 ? 45   ILE D C     1 
ATOM   3943  O  O     . ILE D  1 45  ? 20.520  27.883  51.187  1.00 36.68 ? 45   ILE D O     1 
ATOM   3944  C  CB    . ILE D  1 45  ? 18.132  29.977  50.618  1.00 36.70 ? 45   ILE D CB    1 
ATOM   3945  C  CG1   . ILE D  1 45  ? 18.146  30.783  51.927  1.00 37.98 ? 45   ILE D CG1   1 
ATOM   3946  C  CG2   . ILE D  1 45  ? 17.373  28.653  50.736  1.00 36.87 ? 45   ILE D CG2   1 
ATOM   3947  C  CD1   . ILE D  1 45  ? 18.984  30.190  53.071  1.00 40.27 ? 45   ILE D CD1   1 
ATOM   3948  N  N     . ALA D  1 46  ? 20.007  27.627  49.008  1.00 36.97 ? 46   ALA D N     1 
ATOM   3949  C  CA    . ALA D  1 46  ? 20.520  26.261  48.920  1.00 37.56 ? 46   ALA D CA    1 
ATOM   3950  C  C     . ALA D  1 46  ? 21.955  26.198  48.366  1.00 38.03 ? 46   ALA D C     1 
ATOM   3951  O  O     . ALA D  1 46  ? 22.400  25.149  47.906  1.00 38.21 ? 46   ALA D O     1 
ATOM   3952  C  CB    . ALA D  1 46  ? 19.587  25.407  48.084  1.00 37.23 ? 46   ALA D CB    1 
ATOM   3953  N  N     . GLN D  1 47  ? 22.665  27.327  48.411  1.00 38.93 ? 47   GLN D N     1 
ATOM   3954  C  CA    . GLN D  1 47  ? 24.097  27.414  48.054  1.00 39.93 ? 47   GLN D CA    1 
ATOM   3955  C  C     . GLN D  1 47  ? 24.437  27.439  46.552  1.00 39.77 ? 47   GLN D C     1 
ATOM   3956  O  O     . GLN D  1 47  ? 25.612  27.349  46.188  1.00 39.96 ? 47   GLN D O     1 
ATOM   3957  C  CB    . GLN D  1 47  ? 24.950  26.328  48.755  1.00 40.27 ? 47   GLN D CB    1 
ATOM   3958  C  CG    . GLN D  1 47  ? 24.667  26.111  50.247  1.00 42.90 ? 47   GLN D CG    1 
ATOM   3959  C  CD    . GLN D  1 47  ? 25.501  27.003  51.143  1.00 45.86 ? 47   GLN D CD    1 
ATOM   3960  O  OE1   . GLN D  1 47  ? 25.387  28.231  51.083  1.00 46.94 ? 47   GLN D OE1   1 
ATOM   3961  N  NE2   . GLN D  1 47  ? 26.343  26.391  51.982  1.00 46.58 ? 47   GLN D NE2   1 
ATOM   3962  N  N     . TYR D  1 48  ? 23.432  27.555  45.687  1.00 39.59 ? 48   TYR D N     1 
ATOM   3963  C  CA    . TYR D  1 48  ? 23.690  27.755  44.258  1.00 39.45 ? 48   TYR D CA    1 
ATOM   3964  C  C     . TYR D  1 48  ? 24.250  29.159  44.022  1.00 39.11 ? 48   TYR D C     1 
ATOM   3965  O  O     . TYR D  1 48  ? 23.841  30.116  44.686  1.00 39.07 ? 48   TYR D O     1 
ATOM   3966  C  CB    . TYR D  1 48  ? 22.410  27.612  43.442  1.00 39.58 ? 48   TYR D CB    1 
ATOM   3967  C  CG    . TYR D  1 48  ? 21.912  26.210  43.183  1.00 40.26 ? 48   TYR D CG    1 
ATOM   3968  C  CD1   . TYR D  1 48  ? 22.279  25.528  42.027  1.00 42.20 ? 48   TYR D CD1   1 
ATOM   3969  C  CD2   . TYR D  1 48  ? 21.028  25.587  44.060  1.00 40.99 ? 48   TYR D CD2   1 
ATOM   3970  C  CE1   . TYR D  1 48  ? 21.799  24.246  41.756  1.00 42.84 ? 48   TYR D CE1   1 
ATOM   3971  C  CE2   . TYR D  1 48  ? 20.541  24.302  43.803  1.00 42.24 ? 48   TYR D CE2   1 
ATOM   3972  C  CZ    . TYR D  1 48  ? 20.934  23.641  42.647  1.00 43.18 ? 48   TYR D CZ    1 
ATOM   3973  O  OH    . TYR D  1 48  ? 20.462  22.381  42.371  1.00 44.25 ? 48   TYR D OH    1 
ATOM   3974  N  N     . LYS D  1 49  ? 25.174  29.279  43.071  1.00 38.90 ? 49   LYS D N     1 
ATOM   3975  C  CA    . LYS D  1 49  ? 25.641  30.587  42.615  1.00 38.67 ? 49   LYS D CA    1 
ATOM   3976  C  C     . LYS D  1 49  ? 24.621  31.186  41.654  1.00 37.69 ? 49   LYS D C     1 
ATOM   3977  O  O     . LYS D  1 49  ? 24.209  30.535  40.692  1.00 37.41 ? 49   LYS D O     1 
ATOM   3978  C  CB    . LYS D  1 49  ? 27.003  30.466  41.935  1.00 39.28 ? 49   LYS D CB    1 
ATOM   3979  C  CG    . LYS D  1 49  ? 28.160  30.261  42.898  1.00 41.51 ? 49   LYS D CG    1 
ATOM   3980  C  CD    . LYS D  1 49  ? 29.474  30.058  42.139  1.00 45.22 ? 49   LYS D CD    1 
ATOM   3981  C  CE    . LYS D  1 49  ? 30.325  31.328  42.145  1.00 47.12 ? 49   LYS D CE    1 
ATOM   3982  N  NZ    . LYS D  1 49  ? 29.672  32.450  41.393  1.00 47.75 ? 49   LYS D NZ    1 
ATOM   3983  N  N     . CYS D  1 50  ? 24.224  32.426  41.924  1.00 36.82 ? 50   CYS D N     1 
ATOM   3984  C  CA    . CYS D  1 50  ? 23.148  33.080  41.186  1.00 36.22 ? 50   CYS D CA    1 
ATOM   3985  C  C     . CYS D  1 50  ? 23.579  34.398  40.579  1.00 35.80 ? 50   CYS D C     1 
ATOM   3986  O  O     . CYS D  1 50  ? 24.461  35.075  41.102  1.00 35.80 ? 50   CYS D O     1 
ATOM   3987  C  CB    . CYS D  1 50  ? 21.949  33.321  42.098  1.00 36.15 ? 50   CYS D CB    1 
ATOM   3988  S  SG    . CYS D  1 50  ? 21.288  31.799  42.798  1.00 36.96 ? 50   CYS D SG    1 
ATOM   3989  N  N     . LEU D  1 51  ? 22.940  34.754  39.470  1.00 35.08 ? 51   LEU D N     1 
ATOM   3990  C  CA    . LEU D  1 51  ? 23.131  36.049  38.846  1.00 34.44 ? 51   LEU D CA    1 
ATOM   3991  C  C     . LEU D  1 51  ? 21.783  36.600  38.399  1.00 34.04 ? 51   LEU D C     1 
ATOM   3992  O  O     . LEU D  1 51  ? 20.993  35.883  37.793  1.00 34.10 ? 51   LEU D O     1 
ATOM   3993  C  CB    . LEU D  1 51  ? 24.070  35.903  37.648  1.00 34.35 ? 51   LEU D CB    1 
ATOM   3994  C  CG    . LEU D  1 51  ? 24.229  37.133  36.777  1.00 34.35 ? 51   LEU D CG    1 
ATOM   3995  C  CD1   . LEU D  1 51  ? 24.945  38.247  37.568  1.00 34.28 ? 51   LEU D CD1   1 
ATOM   3996  C  CD2   . LEU D  1 51  ? 24.951  36.770  35.505  1.00 34.41 ? 51   LEU D CD2   1 
ATOM   3997  N  N     . VAL D  1 52  ? 21.523  37.865  38.706  1.00 33.61 ? 52   VAL D N     1 
ATOM   3998  C  CA    . VAL D  1 52  ? 20.316  38.537  38.243  1.00 33.56 ? 52   VAL D CA    1 
ATOM   3999  C  C     . VAL D  1 52  ? 20.694  39.674  37.300  1.00 33.58 ? 52   VAL D C     1 
ATOM   4000  O  O     . VAL D  1 52  ? 21.567  40.480  37.608  1.00 33.34 ? 52   VAL D O     1 
ATOM   4001  C  CB    . VAL D  1 52  ? 19.460  39.055  39.422  1.00 33.54 ? 52   VAL D CB    1 
ATOM   4002  C  CG1   . VAL D  1 52  ? 18.314  39.945  38.929  1.00 33.78 ? 52   VAL D CG1   1 
ATOM   4003  C  CG2   . VAL D  1 52  ? 18.898  37.890  40.209  1.00 33.84 ? 52   VAL D CG2   1 
ATOM   4004  N  N     . ILE D  1 53  ? 20.042  39.712  36.142  1.00 33.68 ? 53   ILE D N     1 
ATOM   4005  C  CA    . ILE D  1 53  ? 20.300  40.731  35.138  1.00 33.83 ? 53   ILE D CA    1 
ATOM   4006  C  C     . ILE D  1 53  ? 19.061  41.606  34.943  1.00 34.54 ? 53   ILE D C     1 
ATOM   4007  O  O     . ILE D  1 53  ? 17.949  41.105  34.809  1.00 34.42 ? 53   ILE D O     1 
ATOM   4008  C  CB    . ILE D  1 53  ? 20.754  40.080  33.810  1.00 33.62 ? 53   ILE D CB    1 
ATOM   4009  C  CG1   . ILE D  1 53  ? 22.036  39.265  34.014  1.00 33.31 ? 53   ILE D CG1   1 
ATOM   4010  C  CG2   . ILE D  1 53  ? 20.946  41.133  32.724  1.00 33.03 ? 53   ILE D CG2   1 
ATOM   4011  C  CD1   . ILE D  1 53  ? 22.123  38.012  33.145  1.00 33.58 ? 53   ILE D CD1   1 
ATOM   4012  N  N     . LYS D  1 54  ? 19.272  42.915  34.945  1.00 35.43 ? 54   LYS D N     1 
ATOM   4013  C  CA    . LYS D  1 54  ? 18.213  43.892  34.748  1.00 36.69 ? 54   LYS D CA    1 
ATOM   4014  C  C     . LYS D  1 54  ? 18.504  44.724  33.517  1.00 36.94 ? 54   LYS D C     1 
ATOM   4015  O  O     . LYS D  1 54  ? 19.661  44.921  33.157  1.00 36.78 ? 54   LYS D O     1 
ATOM   4016  C  CB    . LYS D  1 54  ? 18.134  44.841  35.947  1.00 36.89 ? 54   LYS D CB    1 
ATOM   4017  C  CG    . LYS D  1 54  ? 17.280  44.342  37.077  1.00 39.18 ? 54   LYS D CG    1 
ATOM   4018  C  CD    . LYS D  1 54  ? 17.140  45.388  38.185  1.00 43.54 ? 54   LYS D CD    1 
ATOM   4019  C  CE    . LYS D  1 54  ? 15.791  45.267  38.903  1.00 44.84 ? 54   LYS D CE    1 
ATOM   4020  N  NZ    . LYS D  1 54  ? 15.452  43.849  39.271  1.00 45.64 ? 54   LYS D NZ    1 
ATOM   4021  N  N     . TYR D  1 55  ? 17.445  45.223  32.890  1.00 37.67 ? 55   TYR D N     1 
ATOM   4022  C  CA    . TYR D  1 55  ? 17.555  46.123  31.756  1.00 38.39 ? 55   TYR D CA    1 
ATOM   4023  C  C     . TYR D  1 55  ? 18.052  47.495  32.211  1.00 39.35 ? 55   TYR D C     1 
ATOM   4024  O  O     . TYR D  1 55  ? 17.388  48.172  33.001  1.00 39.14 ? 55   TYR D O     1 
ATOM   4025  C  CB    . TYR D  1 55  ? 16.201  46.256  31.073  1.00 38.15 ? 55   TYR D CB    1 
ATOM   4026  C  CG    . TYR D  1 55  ? 16.217  47.098  29.822  1.00 37.46 ? 55   TYR D CG    1 
ATOM   4027  C  CD1   . TYR D  1 55  ? 17.139  46.850  28.803  1.00 37.34 ? 55   TYR D CD1   1 
ATOM   4028  C  CD2   . TYR D  1 55  ? 15.310  48.139  29.658  1.00 36.19 ? 55   TYR D CD2   1 
ATOM   4029  C  CE1   . TYR D  1 55  ? 17.151  47.613  27.652  1.00 37.81 ? 55   TYR D CE1   1 
ATOM   4030  C  CE2   . TYR D  1 55  ? 15.311  48.909  28.512  1.00 36.41 ? 55   TYR D CE2   1 
ATOM   4031  C  CZ    . TYR D  1 55  ? 16.233  48.650  27.518  1.00 37.43 ? 55   TYR D CZ    1 
ATOM   4032  O  OH    . TYR D  1 55  ? 16.241  49.414  26.380  1.00 38.24 ? 55   TYR D OH    1 
ATOM   4033  N  N     . ALA D  1 56  ? 19.212  47.896  31.689  1.00 40.60 ? 56   ALA D N     1 
ATOM   4034  C  CA    . ALA D  1 56  ? 19.915  49.099  32.144  1.00 42.06 ? 56   ALA D CA    1 
ATOM   4035  C  C     . ALA D  1 56  ? 19.121  50.390  31.982  1.00 43.05 ? 56   ALA D C     1 
ATOM   4036  O  O     . ALA D  1 56  ? 19.288  51.315  32.766  1.00 43.36 ? 56   ALA D O     1 
ATOM   4037  C  CB    . ALA D  1 56  ? 21.289  49.224  31.462  1.00 41.84 ? 56   ALA D CB    1 
ATOM   4038  N  N     . LYS D  1 57  ? 18.257  50.449  30.974  1.00 44.37 ? 57   LYS D N     1 
ATOM   4039  C  CA    . LYS D  1 57  ? 17.526  51.674  30.679  1.00 45.73 ? 57   LYS D CA    1 
ATOM   4040  C  C     . LYS D  1 57  ? 16.259  51.881  31.521  1.00 46.56 ? 57   LYS D C     1 
ATOM   4041  O  O     . LYS D  1 57  ? 15.648  52.951  31.460  1.00 46.78 ? 57   LYS D O     1 
ATOM   4042  C  CB    . LYS D  1 57  ? 17.228  51.768  29.188  1.00 45.57 ? 57   LYS D CB    1 
ATOM   4043  C  CG    . LYS D  1 57  ? 18.400  52.303  28.389  1.00 46.92 ? 57   LYS D CG    1 
ATOM   4044  C  CD    . LYS D  1 57  ? 18.121  52.284  26.896  1.00 49.11 ? 57   LYS D CD    1 
ATOM   4045  C  CE    . LYS D  1 57  ? 19.371  52.659  26.113  1.00 51.08 ? 57   LYS D CE    1 
ATOM   4046  N  NZ    . LYS D  1 57  ? 19.692  51.659  25.051  1.00 52.16 ? 57   LYS D NZ    1 
ATOM   4047  N  N     . ASP D  1 58  ? 15.868  50.867  32.298  1.00 47.48 ? 58   ASP D N     1 
ATOM   4048  C  CA    . ASP D  1 58  ? 14.784  51.016  33.262  1.00 48.31 ? 58   ASP D CA    1 
ATOM   4049  C  C     . ASP D  1 58  ? 15.383  51.368  34.610  1.00 48.78 ? 58   ASP D C     1 
ATOM   4050  O  O     . ASP D  1 58  ? 15.800  50.497  35.377  1.00 49.00 ? 58   ASP D O     1 
ATOM   4051  C  CB    . ASP D  1 58  ? 13.937  49.745  33.368  1.00 48.16 ? 58   ASP D CB    1 
ATOM   4052  C  CG    . ASP D  1 58  ? 12.552  50.008  33.962  1.00 48.38 ? 58   ASP D CG    1 
ATOM   4053  O  OD1   . ASP D  1 58  ? 12.433  50.771  34.947  1.00 47.96 ? 58   ASP D OD1   1 
ATOM   4054  O  OD2   . ASP D  1 58  ? 11.517  49.487  33.509  1.00 48.09 ? 58   ASP D OD2   1 
ATOM   4055  N  N     . THR D  1 59  ? 15.429  52.663  34.881  1.00 48.32 ? 59   THR D N     1 
ATOM   4056  C  CA    . THR D  1 59  ? 16.138  53.177  36.042  1.00 48.05 ? 59   THR D CA    1 
ATOM   4057  C  C     . THR D  1 59  ? 15.178  53.551  37.162  1.00 47.84 ? 59   THR D C     1 
ATOM   4058  O  O     . THR D  1 59  ? 15.573  54.207  38.130  1.00 47.96 ? 59   THR D O     1 
ATOM   4059  C  CB    . THR D  1 59  ? 17.041  54.384  35.639  1.00 48.20 ? 59   THR D CB    1 
ATOM   4060  O  OG1   . THR D  1 59  ? 16.328  55.256  34.751  1.00 47.75 ? 59   THR D OG1   1 
ATOM   4061  C  CG2   . THR D  1 59  ? 18.229  53.907  34.794  1.00 47.91 ? 59   THR D CG2   1 
ATOM   4062  N  N     . ARG D  1 60  ? 13.923  53.120  37.024  1.00 47.60 ? 60   ARG D N     1 
ATOM   4063  C  CA    . ARG D  1 60  ? 12.893  53.340  38.039  1.00 47.45 ? 60   ARG D CA    1 
ATOM   4064  C  C     . ARG D  1 60  ? 13.342  52.846  39.402  1.00 47.93 ? 60   ARG D C     1 
ATOM   4065  O  O     . ARG D  1 60  ? 13.981  51.797  39.514  1.00 47.58 ? 60   ARG D O     1 
ATOM   4066  C  CB    . ARG D  1 60  ? 11.581  52.649  37.660  1.00 46.93 ? 60   ARG D CB    1 
ATOM   4067  C  CG    . ARG D  1 60  ? 10.774  53.375  36.596  1.00 45.79 ? 60   ARG D CG    1 
ATOM   4068  C  CD    . ARG D  1 60  ? 9.545   52.623  36.100  1.00 42.94 ? 60   ARG D CD    1 
ATOM   4069  N  NE    . ARG D  1 60  ? 9.831   51.221  35.824  1.00 41.31 ? 60   ARG D NE    1 
ATOM   4070  C  CZ    . ARG D  1 60  ? 9.103   50.204  36.256  1.00 40.76 ? 60   ARG D CZ    1 
ATOM   4071  N  NH1   . ARG D  1 60  ? 8.017   50.415  36.987  1.00 41.31 ? 60   ARG D NH1   1 
ATOM   4072  N  NH2   . ARG D  1 60  ? 9.458   48.967  35.957  1.00 40.80 ? 60   ARG D NH2   1 
ATOM   4073  N  N     . TYR D  1 61  ? 13.011  53.629  40.425  1.00 48.70 ? 61   TYR D N     1 
ATOM   4074  C  CA    . TYR D  1 61  ? 13.282  53.289  41.815  1.00 49.78 ? 61   TYR D CA    1 
ATOM   4075  C  C     . TYR D  1 61  ? 12.679  51.917  42.144  1.00 50.05 ? 61   TYR D C     1 
ATOM   4076  O  O     . TYR D  1 61  ? 11.465  51.717  42.044  1.00 49.84 ? 61   TYR D O     1 
ATOM   4077  C  CB    . TYR D  1 61  ? 12.737  54.394  42.734  1.00 50.02 ? 61   TYR D CB    1 
ATOM   4078  C  CG    . TYR D  1 61  ? 13.240  54.347  44.158  1.00 51.79 ? 61   TYR D CG    1 
ATOM   4079  C  CD1   . TYR D  1 61  ? 14.604  54.451  44.448  1.00 53.21 ? 61   TYR D CD1   1 
ATOM   4080  C  CD2   . TYR D  1 61  ? 12.348  54.201  45.222  1.00 53.33 ? 61   TYR D CD2   1 
ATOM   4081  C  CE1   . TYR D  1 61  ? 15.064  54.399  45.768  1.00 54.54 ? 61   TYR D CE1   1 
ATOM   4082  C  CE2   . TYR D  1 61  ? 12.795  54.154  46.542  1.00 54.50 ? 61   TYR D CE2   1 
ATOM   4083  C  CZ    . TYR D  1 61  ? 14.151  54.251  46.808  1.00 55.01 ? 61   TYR D CZ    1 
ATOM   4084  O  OH    . TYR D  1 61  ? 14.588  54.206  48.113  1.00 56.10 ? 61   TYR D OH    1 
ATOM   4085  N  N     . SER D  1 62  ? 13.557  50.988  42.526  1.00 50.91 ? 62   SER D N     1 
ATOM   4086  C  CA    . SER D  1 62  ? 13.254  49.550  42.640  1.00 51.69 ? 62   SER D CA    1 
ATOM   4087  C  C     . SER D  1 62  ? 12.704  48.928  41.333  1.00 51.92 ? 62   SER D C     1 
ATOM   4088  O  O     . SER D  1 62  ? 11.530  49.099  40.969  1.00 51.75 ? 62   SER D O     1 
ATOM   4089  C  CB    . SER D  1 62  ? 12.345  49.252  43.847  1.00 51.81 ? 62   SER D CB    1 
ATOM   4090  O  OG    . SER D  1 62  ? 10.974  49.257  43.476  1.00 52.27 ? 62   SER D OG    1 
ATOM   4091  N  N     . ALA D  1 75  ? 22.937  42.209  41.045  1.00 48.11 ? 75   ALA D N     1 
ATOM   4092  C  CA    . ALA D  1 75  ? 21.947  42.679  40.078  1.00 47.89 ? 75   ALA D CA    1 
ATOM   4093  C  C     . ALA D  1 75  ? 22.589  43.513  38.949  1.00 47.54 ? 75   ALA D C     1 
ATOM   4094  O  O     . ALA D  1 75  ? 22.555  44.749  38.988  1.00 47.72 ? 75   ALA D O     1 
ATOM   4095  C  CB    . ALA D  1 75  ? 20.843  43.468  40.786  1.00 47.78 ? 75   ALA D CB    1 
ATOM   4096  N  N     . LEU D  1 76  ? 23.161  42.825  37.956  1.00 46.59 ? 76   LEU D N     1 
ATOM   4097  C  CA    . LEU D  1 76  ? 23.895  43.462  36.860  1.00 45.86 ? 76   LEU D CA    1 
ATOM   4098  C  C     . LEU D  1 76  ? 22.996  44.136  35.819  1.00 45.06 ? 76   LEU D C     1 
ATOM   4099  O  O     . LEU D  1 76  ? 22.136  43.480  35.226  1.00 44.95 ? 76   LEU D O     1 
ATOM   4100  C  CB    . LEU D  1 76  ? 24.798  42.440  36.157  1.00 45.94 ? 76   LEU D CB    1 
ATOM   4101  C  CG    . LEU D  1 76  ? 26.182  42.149  36.740  1.00 46.73 ? 76   LEU D CG    1 
ATOM   4102  C  CD1   . LEU D  1 76  ? 26.856  41.039  35.939  1.00 46.47 ? 76   LEU D CD1   1 
ATOM   4103  C  CD2   . LEU D  1 76  ? 27.068  43.409  36.795  1.00 46.97 ? 76   LEU D CD2   1 
ATOM   4104  N  N     . PRO D  1 77  ? 23.203  45.435  35.590  1.00 44.39 ? 77   PRO D N     1 
ATOM   4105  C  CA    . PRO D  1 77  ? 22.514  46.144  34.502  1.00 43.89 ? 77   PRO D CA    1 
ATOM   4106  C  C     . PRO D  1 77  ? 23.106  45.775  33.139  1.00 43.27 ? 77   PRO D C     1 
ATOM   4107  O  O     . PRO D  1 77  ? 24.315  45.580  33.039  1.00 43.07 ? 77   PRO D O     1 
ATOM   4108  C  CB    . PRO D  1 77  ? 22.757  47.626  34.830  1.00 43.89 ? 77   PRO D CB    1 
ATOM   4109  C  CG    . PRO D  1 77  ? 24.010  47.651  35.649  1.00 43.95 ? 77   PRO D CG    1 
ATOM   4110  C  CD    . PRO D  1 77  ? 24.100  46.325  36.354  1.00 44.28 ? 77   PRO D CD    1 
ATOM   4111  N  N     . ALA D  1 78  ? 22.253  45.657  32.120  1.00 42.73 ? 78   ALA D N     1 
ATOM   4112  C  CA    . ALA D  1 78  ? 22.687  45.341  30.762  1.00 42.27 ? 78   ALA D CA    1 
ATOM   4113  C  C     . ALA D  1 78  ? 21.682  45.836  29.728  1.00 42.21 ? 78   ALA D C     1 
ATOM   4114  O  O     . ALA D  1 78  ? 20.507  46.014  30.039  1.00 42.04 ? 78   ALA D O     1 
ATOM   4115  C  CB    . ALA D  1 78  ? 22.915  43.845  30.611  1.00 41.83 ? 78   ALA D CB    1 
ATOM   4116  N  N     . CYS D  1 79  ? 22.159  46.047  28.503  1.00 42.30 ? 79   CYS D N     1 
ATOM   4117  C  CA    . CYS D  1 79  ? 21.316  46.401  27.361  1.00 42.67 ? 79   CYS D CA    1 
ATOM   4118  C  C     . CYS D  1 79  ? 21.248  45.266  26.362  1.00 41.93 ? 79   CYS D C     1 
ATOM   4119  O  O     . CYS D  1 79  ? 20.291  45.166  25.591  1.00 41.96 ? 79   CYS D O     1 
ATOM   4120  C  CB    . CYS D  1 79  ? 21.863  47.639  26.660  1.00 42.99 ? 79   CYS D CB    1 
ATOM   4121  S  SG    . CYS D  1 79  ? 21.420  49.138  27.533  1.00 47.70 ? 79   CYS D SG    1 
ATOM   4122  N  N     . LEU D  1 80  ? 22.292  44.445  26.366  1.00 41.43 ? 80   LEU D N     1 
ATOM   4123  C  CA    . LEU D  1 80  ? 22.368  43.224  25.583  1.00 41.08 ? 80   LEU D CA    1 
ATOM   4124  C  C     . LEU D  1 80  ? 22.830  42.129  26.533  1.00 40.61 ? 80   LEU D C     1 
ATOM   4125  O  O     . LEU D  1 80  ? 23.735  42.350  27.333  1.00 40.36 ? 80   LEU D O     1 
ATOM   4126  C  CB    . LEU D  1 80  ? 23.391  43.365  24.459  1.00 41.04 ? 80   LEU D CB    1 
ATOM   4127  C  CG    . LEU D  1 80  ? 23.141  44.284  23.266  1.00 42.22 ? 80   LEU D CG    1 
ATOM   4128  C  CD1   . LEU D  1 80  ? 24.318  44.156  22.264  1.00 42.76 ? 80   LEU D CD1   1 
ATOM   4129  C  CD2   . LEU D  1 80  ? 21.810  43.971  22.584  1.00 42.16 ? 80   LEU D CD2   1 
ATOM   4130  N  N     . LEU D  1 81  ? 22.217  40.952  26.449  1.00 40.11 ? 81   LEU D N     1 
ATOM   4131  C  CA    . LEU D  1 81  ? 22.587  39.856  27.332  1.00 39.90 ? 81   LEU D CA    1 
ATOM   4132  C  C     . LEU D  1 81  ? 23.978  39.299  27.008  1.00 40.19 ? 81   LEU D C     1 
ATOM   4133  O  O     . LEU D  1 81  ? 24.656  38.766  27.884  1.00 40.00 ? 81   LEU D O     1 
ATOM   4134  C  CB    . LEU D  1 81  ? 21.513  38.760  27.341  1.00 39.54 ? 81   LEU D CB    1 
ATOM   4135  C  CG    . LEU D  1 81  ? 20.132  39.146  27.910  1.00 39.14 ? 81   LEU D CG    1 
ATOM   4136  C  CD1   . LEU D  1 81  ? 19.055  38.138  27.538  1.00 36.76 ? 81   LEU D CD1   1 
ATOM   4137  C  CD2   . LEU D  1 81  ? 20.149  39.367  29.420  1.00 37.51 ? 81   LEU D CD2   1 
ATOM   4138  N  N     . ARG D  1 82  ? 24.393  39.452  25.753  1.00 40.56 ? 82   ARG D N     1 
ATOM   4139  C  CA    . ARG D  1 82  ? 25.740  39.109  25.298  1.00 41.19 ? 82   ARG D CA    1 
ATOM   4140  C  C     . ARG D  1 82  ? 26.838  39.826  26.101  1.00 41.22 ? 82   ARG D C     1 
ATOM   4141  O  O     . ARG D  1 82  ? 27.901  39.255  26.337  1.00 41.04 ? 82   ARG D O     1 
ATOM   4142  C  CB    . ARG D  1 82  ? 25.860  39.463  23.813  1.00 41.31 ? 82   ARG D CB    1 
ATOM   4143  C  CG    . ARG D  1 82  ? 26.975  38.775  23.054  1.00 42.22 ? 82   ARG D CG    1 
ATOM   4144  C  CD    . ARG D  1 82  ? 27.078  39.238  21.598  1.00 43.98 ? 82   ARG D CD    1 
ATOM   4145  N  NE    . ARG D  1 82  ? 27.774  40.528  21.472  1.00 45.73 ? 82   ARG D NE    1 
ATOM   4146  C  CZ    . ARG D  1 82  ? 27.267  41.619  20.898  1.00 45.25 ? 82   ARG D CZ    1 
ATOM   4147  N  NH1   . ARG D  1 82  ? 26.042  41.623  20.394  1.00 45.34 ? 82   ARG D NH1   1 
ATOM   4148  N  NH2   . ARG D  1 82  ? 27.990  42.718  20.835  1.00 45.62 ? 82   ARG D NH2   1 
ATOM   4149  N  N     . ASP D  1 83  ? 26.567  41.065  26.520  1.00 41.42 ? 83   ASP D N     1 
ATOM   4150  C  CA    . ASP D  1 83  ? 27.537  41.871  27.272  1.00 41.98 ? 83   ASP D CA    1 
ATOM   4151  C  C     . ASP D  1 83  ? 27.820  41.299  28.653  1.00 42.10 ? 83   ASP D C     1 
ATOM   4152  O  O     . ASP D  1 83  ? 28.787  41.689  29.299  1.00 42.27 ? 83   ASP D O     1 
ATOM   4153  C  CB    . ASP D  1 83  ? 27.066  43.328  27.429  1.00 41.92 ? 83   ASP D CB    1 
ATOM   4154  C  CG    . ASP D  1 83  ? 26.982  44.071  26.112  1.00 43.07 ? 83   ASP D CG    1 
ATOM   4155  O  OD1   . ASP D  1 83  ? 27.789  43.785  25.195  1.00 44.41 ? 83   ASP D OD1   1 
ATOM   4156  O  OD2   . ASP D  1 83  ? 26.134  44.966  25.899  1.00 44.14 ? 83   ASP D OD2   1 
ATOM   4157  N  N     . VAL D  1 84  ? 26.958  40.400  29.120  1.00 42.44 ? 84   VAL D N     1 
ATOM   4158  C  CA    . VAL D  1 84  ? 27.130  39.794  30.445  1.00 42.52 ? 84   VAL D CA    1 
ATOM   4159  C  C     . VAL D  1 84  ? 27.257  38.277  30.392  1.00 42.78 ? 84   VAL D C     1 
ATOM   4160  O  O     . VAL D  1 84  ? 27.216  37.608  31.425  1.00 42.66 ? 84   VAL D O     1 
ATOM   4161  C  CB    . VAL D  1 84  ? 26.042  40.223  31.481  1.00 42.67 ? 84   VAL D CB    1 
ATOM   4162  C  CG1   . VAL D  1 84  ? 26.114  41.723  31.755  1.00 42.19 ? 84   VAL D CG1   1 
ATOM   4163  C  CG2   . VAL D  1 84  ? 24.638  39.799  31.045  1.00 42.53 ? 84   VAL D CG2   1 
ATOM   4164  N  N     . ALA D  1 85  ? 27.442  37.749  29.183  1.00 43.20 ? 85   ALA D N     1 
ATOM   4165  C  CA    . ALA D  1 85  ? 27.574  36.310  28.948  1.00 43.93 ? 85   ALA D CA    1 
ATOM   4166  C  C     . ALA D  1 85  ? 28.685  35.649  29.767  1.00 44.33 ? 85   ALA D C     1 
ATOM   4167  O  O     . ALA D  1 85  ? 28.514  34.530  30.257  1.00 44.35 ? 85   ALA D O     1 
ATOM   4168  C  CB    . ALA D  1 85  ? 27.801  36.033  27.466  1.00 43.79 ? 85   ALA D CB    1 
ATOM   4169  N  N     . GLN D  1 86  ? 29.817  36.337  29.902  1.00 44.71 ? 86   GLN D N     1 
ATOM   4170  C  CA    . GLN D  1 86  ? 30.957  35.794  30.632  1.00 45.32 ? 86   GLN D CA    1 
ATOM   4171  C  C     . GLN D  1 86  ? 30.665  35.602  32.128  1.00 45.27 ? 86   GLN D C     1 
ATOM   4172  O  O     . GLN D  1 86  ? 31.045  34.583  32.713  1.00 45.33 ? 86   GLN D O     1 
ATOM   4173  C  CB    . GLN D  1 86  ? 32.226  36.639  30.418  1.00 45.52 ? 86   GLN D CB    1 
ATOM   4174  C  CG    . GLN D  1 86  ? 33.444  36.114  31.192  1.00 46.59 ? 86   GLN D CG    1 
ATOM   4175  C  CD    . GLN D  1 86  ? 34.748  36.829  30.859  1.00 48.11 ? 86   GLN D CD    1 
ATOM   4176  O  OE1   . GLN D  1 86  ? 35.752  36.179  30.571  1.00 48.38 ? 86   GLN D OE1   1 
ATOM   4177  N  NE2   . GLN D  1 86  ? 34.740  38.158  30.916  1.00 48.09 ? 86   GLN D NE2   1 
ATOM   4178  N  N     . GLU D  1 87  ? 29.997  36.579  32.736  1.00 45.23 ? 87   GLU D N     1 
ATOM   4179  C  CA    . GLU D  1 87  ? 29.566  36.468  34.128  1.00 45.31 ? 87   GLU D CA    1 
ATOM   4180  C  C     . GLU D  1 87  ? 28.539  35.340  34.289  1.00 44.79 ? 87   GLU D C     1 
ATOM   4181  O  O     . GLU D  1 87  ? 28.594  34.581  35.254  1.00 44.88 ? 87   GLU D O     1 
ATOM   4182  C  CB    . GLU D  1 87  ? 29.012  37.801  34.640  1.00 45.41 ? 87   GLU D CB    1 
ATOM   4183  C  CG    . GLU D  1 87  ? 30.031  38.938  34.663  1.00 47.38 ? 87   GLU D CG    1 
ATOM   4184  C  CD    . GLU D  1 87  ? 30.063  39.766  33.376  1.00 49.40 ? 87   GLU D CD    1 
ATOM   4185  O  OE1   . GLU D  1 87  ? 29.935  39.197  32.268  1.00 49.62 ? 87   GLU D OE1   1 
ATOM   4186  O  OE2   . GLU D  1 87  ? 30.228  41.004  33.469  1.00 50.42 ? 87   GLU D OE2   1 
ATOM   4187  N  N     . ALA D  1 88  ? 27.638  35.212  33.319  1.00 44.25 ? 88   ALA D N     1 
ATOM   4188  C  CA    . ALA D  1 88  ? 26.585  34.193  33.350  1.00 43.82 ? 88   ALA D CA    1 
ATOM   4189  C  C     . ALA D  1 88  ? 27.134  32.772  33.270  1.00 43.50 ? 88   ALA D C     1 
ATOM   4190  O  O     . ALA D  1 88  ? 26.526  31.836  33.801  1.00 43.40 ? 88   ALA D O     1 
ATOM   4191  C  CB    . ALA D  1 88  ? 25.566  34.434  32.235  1.00 43.48 ? 88   ALA D CB    1 
ATOM   4192  N  N     . LEU D  1 89  ? 28.285  32.621  32.619  1.00 43.10 ? 89   LEU D N     1 
ATOM   4193  C  CA    . LEU D  1 89  ? 28.899  31.308  32.409  1.00 42.78 ? 89   LEU D CA    1 
ATOM   4194  C  C     . LEU D  1 89  ? 29.444  30.697  33.701  1.00 42.18 ? 89   LEU D C     1 
ATOM   4195  O  O     . LEU D  1 89  ? 29.493  29.472  33.828  1.00 42.25 ? 89   LEU D O     1 
ATOM   4196  C  CB    . LEU D  1 89  ? 29.997  31.380  31.328  1.00 43.06 ? 89   LEU D CB    1 
ATOM   4197  C  CG    . LEU D  1 89  ? 29.863  30.660  29.965  1.00 43.88 ? 89   LEU D CG    1 
ATOM   4198  C  CD1   . LEU D  1 89  ? 28.424  30.439  29.516  1.00 43.95 ? 89   LEU D CD1   1 
ATOM   4199  C  CD2   . LEU D  1 89  ? 30.624  31.385  28.854  1.00 44.09 ? 89   LEU D CD2   1 
ATOM   4200  N  N     . GLY D  1 90  ? 29.834  31.542  34.656  1.00 41.36 ? 90   GLY D N     1 
ATOM   4201  C  CA    . GLY D  1 90  ? 30.362  31.078  35.933  1.00 40.47 ? 90   GLY D CA    1 
ATOM   4202  C  C     . GLY D  1 90  ? 29.325  30.875  37.034  1.00 39.76 ? 90   GLY D C     1 
ATOM   4203  O  O     . GLY D  1 90  ? 29.670  30.752  38.214  1.00 40.09 ? 90   GLY D O     1 
ATOM   4204  N  N     . VAL D  1 91  ? 28.054  30.823  36.647  1.00 38.49 ? 91   VAL D N     1 
ATOM   4205  C  CA    . VAL D  1 91  ? 26.952  30.785  37.602  1.00 37.11 ? 91   VAL D CA    1 
ATOM   4206  C  C     . VAL D  1 91  ? 26.025  29.611  37.257  1.00 35.93 ? 91   VAL D C     1 
ATOM   4207  O  O     . VAL D  1 91  ? 26.015  29.146  36.122  1.00 35.91 ? 91   VAL D O     1 
ATOM   4208  C  CB    . VAL D  1 91  ? 26.244  32.171  37.615  1.00 37.36 ? 91   VAL D CB    1 
ATOM   4209  C  CG1   . VAL D  1 91  ? 24.779  32.082  37.264  1.00 37.12 ? 91   VAL D CG1   1 
ATOM   4210  C  CG2   . VAL D  1 91  ? 26.471  32.888  38.931  1.00 37.36 ? 91   VAL D CG2   1 
ATOM   4211  N  N     . ALA D  1 92  ? 25.279  29.110  38.238  1.00 34.46 ? 92   ALA D N     1 
ATOM   4212  C  CA    . ALA D  1 92  ? 24.340  28.007  38.000  1.00 32.89 ? 92   ALA D CA    1 
ATOM   4213  C  C     . ALA D  1 92  ? 22.907  28.466  37.674  1.00 32.01 ? 92   ALA D C     1 
ATOM   4214  O  O     . ALA D  1 92  ? 22.181  27.786  36.936  1.00 31.67 ? 92   ALA D O     1 
ATOM   4215  C  CB    . ALA D  1 92  ? 24.335  27.040  39.179  1.00 32.90 ? 92   ALA D CB    1 
ATOM   4216  N  N     . VAL D  1 93  ? 22.510  29.613  38.226  1.00 30.69 ? 93   VAL D N     1 
ATOM   4217  C  CA    . VAL D  1 93  ? 21.151  30.114  38.080  1.00 29.81 ? 93   VAL D CA    1 
ATOM   4218  C  C     . VAL D  1 93  ? 21.179  31.560  37.605  1.00 29.29 ? 93   VAL D C     1 
ATOM   4219  O  O     . VAL D  1 93  ? 21.825  32.402  38.217  1.00 29.21 ? 93   VAL D O     1 
ATOM   4220  C  CB    . VAL D  1 93  ? 20.344  29.983  39.414  1.00 29.96 ? 93   VAL D CB    1 
ATOM   4221  C  CG1   . VAL D  1 93  ? 18.950  30.577  39.283  1.00 29.00 ? 93   VAL D CG1   1 
ATOM   4222  C  CG2   . VAL D  1 93  ? 20.250  28.520  39.837  1.00 29.73 ? 93   VAL D CG2   1 
ATOM   4223  N  N     . ILE D  1 94  ? 20.488  31.839  36.504  1.00 28.76 ? 94   ILE D N     1 
ATOM   4224  C  CA    . ILE D  1 94  ? 20.405  33.199  35.972  1.00 28.32 ? 94   ILE D CA    1 
ATOM   4225  C  C     . ILE D  1 94  ? 18.968  33.698  35.968  1.00 28.17 ? 94   ILE D C     1 
ATOM   4226  O  O     . ILE D  1 94  ? 18.093  33.051  35.397  1.00 28.15 ? 94   ILE D O     1 
ATOM   4227  C  CB    . ILE D  1 94  ? 20.990  33.275  34.540  1.00 28.61 ? 94   ILE D CB    1 
ATOM   4228  C  CG1   . ILE D  1 94  ? 22.452  32.804  34.508  1.00 28.63 ? 94   ILE D CG1   1 
ATOM   4229  C  CG2   . ILE D  1 94  ? 20.883  34.687  33.991  1.00 28.08 ? 94   ILE D CG2   1 
ATOM   4230  C  CD1   . ILE D  1 94  ? 22.841  32.129  33.207  1.00 28.37 ? 94   ILE D CD1   1 
ATOM   4231  N  N     . GLY D  1 95  ? 18.740  34.849  36.601  1.00 27.92 ? 95   GLY D N     1 
ATOM   4232  C  CA    . GLY D  1 95  ? 17.470  35.547  36.527  1.00 27.94 ? 95   GLY D CA    1 
ATOM   4233  C  C     . GLY D  1 95  ? 17.546  36.743  35.583  1.00 28.22 ? 95   GLY D C     1 
ATOM   4234  O  O     . GLY D  1 95  ? 18.525  37.497  35.610  1.00 28.12 ? 95   GLY D O     1 
ATOM   4235  N  N     . ILE D  1 96  ? 16.519  36.914  34.746  1.00 28.23 ? 96   ILE D N     1 
ATOM   4236  C  CA    . ILE D  1 96  ? 16.439  38.051  33.832  1.00 28.38 ? 96   ILE D CA    1 
ATOM   4237  C  C     . ILE D  1 96  ? 15.146  38.813  34.051  1.00 29.07 ? 96   ILE D C     1 
ATOM   4238  O  O     . ILE D  1 96  ? 14.056  38.276  33.860  1.00 28.94 ? 96   ILE D O     1 
ATOM   4239  C  CB    . ILE D  1 96  ? 16.585  37.615  32.341  1.00 28.14 ? 96   ILE D CB    1 
ATOM   4240  C  CG1   . ILE D  1 96  ? 17.943  36.961  32.093  1.00 27.32 ? 96   ILE D CG1   1 
ATOM   4241  C  CG2   . ILE D  1 96  ? 16.419  38.824  31.400  1.00 27.48 ? 96   ILE D CG2   1 
ATOM   4242  C  CD1   . ILE D  1 96  ? 17.948  36.002  30.970  1.00 26.98 ? 96   ILE D CD1   1 
ATOM   4243  N  N     . ASP D  1 97  ? 15.292  40.071  34.456  1.00 30.02 ? 97   ASP D N     1 
ATOM   4244  C  CA    . ASP D  1 97  ? 14.172  40.977  34.685  1.00 31.30 ? 97   ASP D CA    1 
ATOM   4245  C  C     . ASP D  1 97  ? 13.916  41.827  33.443  1.00 31.47 ? 97   ASP D C     1 
ATOM   4246  O  O     . ASP D  1 97  ? 14.857  42.355  32.838  1.00 31.58 ? 97   ASP D O     1 
ATOM   4247  C  CB    . ASP D  1 97  ? 14.471  41.876  35.895  1.00 31.83 ? 97   ASP D CB    1 
ATOM   4248  C  CG    . ASP D  1 97  ? 13.221  42.592  36.441  1.00 34.20 ? 97   ASP D CG    1 
ATOM   4249  O  OD1   . ASP D  1 97  ? 12.079  42.242  36.057  1.00 35.54 ? 97   ASP D OD1   1 
ATOM   4250  O  OD2   . ASP D  1 97  ? 13.300  43.534  37.270  1.00 37.97 ? 97   ASP D OD2   1 
ATOM   4251  N  N     . GLU D  1 98  ? 12.638  41.955  33.079  1.00 31.74 ? 98   GLU D N     1 
ATOM   4252  C  CA    . GLU D  1 98  ? 12.204  42.714  31.898  1.00 32.06 ? 98   GLU D CA    1 
ATOM   4253  C  C     . GLU D  1 98  ? 12.826  42.176  30.598  1.00 31.77 ? 98   GLU D C     1 
ATOM   4254  O  O     . GLU D  1 98  ? 13.419  42.922  29.804  1.00 31.63 ? 98   GLU D O     1 
ATOM   4255  C  CB    . GLU D  1 98  ? 12.446  44.214  32.088  1.00 32.16 ? 98   GLU D CB    1 
ATOM   4256  C  CG    . GLU D  1 98  ? 11.758  44.763  33.330  1.00 34.53 ? 98   GLU D CG    1 
ATOM   4257  C  CD    . GLU D  1 98  ? 11.779  46.277  33.410  1.00 38.14 ? 98   GLU D CD    1 
ATOM   4258  O  OE1   . GLU D  1 98  ? 11.751  46.933  32.344  1.00 40.07 ? 98   GLU D OE1   1 
ATOM   4259  O  OE2   . GLU D  1 98  ? 11.808  46.813  34.544  1.00 39.49 ? 98   GLU D OE2   1 
ATOM   4260  N  N     . GLY D  1 99  ? 12.654  40.870  30.388  1.00 31.44 ? 99   GLY D N     1 
ATOM   4261  C  CA    . GLY D  1 99  ? 13.252  40.160  29.272  1.00 30.98 ? 99   GLY D CA    1 
ATOM   4262  C  C     . GLY D  1 99  ? 12.816  40.649  27.906  1.00 30.94 ? 99   GLY D C     1 
ATOM   4263  O  O     . GLY D  1 99  ? 13.530  40.449  26.912  1.00 30.92 ? 99   GLY D O     1 
ATOM   4264  N  N     . GLN D  1 100 ? 11.651  41.295  27.852  1.00 30.63 ? 100  GLN D N     1 
ATOM   4265  C  CA    . GLN D  1 100 ? 11.115  41.817  26.597  1.00 30.63 ? 100  GLN D CA    1 
ATOM   4266  C  C     . GLN D  1 100 ? 12.024  42.856  25.920  1.00 30.85 ? 100  GLN D C     1 
ATOM   4267  O  O     . GLN D  1 100 ? 11.946  43.043  24.704  1.00 30.84 ? 100  GLN D O     1 
ATOM   4268  C  CB    . GLN D  1 100 ? 9.688   42.358  26.796  1.00 30.64 ? 100  GLN D CB    1 
ATOM   4269  C  CG    . GLN D  1 100 ? 9.583   43.684  27.554  1.00 29.69 ? 100  GLN D CG    1 
ATOM   4270  C  CD    . GLN D  1 100 ? 9.502   43.497  29.061  1.00 29.44 ? 100  GLN D CD    1 
ATOM   4271  O  OE1   . GLN D  1 100 ? 9.705   42.395  29.572  1.00 28.78 ? 100  GLN D OE1   1 
ATOM   4272  N  NE2   . GLN D  1 100 ? 9.200   44.573  29.771  1.00 29.08 ? 100  GLN D NE2   1 
ATOM   4273  N  N     . PHE D  1 101 ? 12.888  43.502  26.708  1.00 31.04 ? 101  PHE D N     1 
ATOM   4274  C  CA    . PHE D  1 101 ? 13.744  44.593  26.233  1.00 31.42 ? 101  PHE D CA    1 
ATOM   4275  C  C     . PHE D  1 101 ? 15.081  44.140  25.646  1.00 31.98 ? 101  PHE D C     1 
ATOM   4276  O  O     . PHE D  1 101 ? 15.787  44.941  25.030  1.00 32.35 ? 101  PHE D O     1 
ATOM   4277  C  CB    . PHE D  1 101 ? 13.988  45.601  27.367  1.00 31.29 ? 101  PHE D CB    1 
ATOM   4278  C  CG    . PHE D  1 101 ? 12.821  46.519  27.637  1.00 30.27 ? 101  PHE D CG    1 
ATOM   4279  C  CD1   . PHE D  1 101 ? 12.279  46.617  28.917  1.00 29.73 ? 101  PHE D CD1   1 
ATOM   4280  C  CD2   . PHE D  1 101 ? 12.270  47.289  26.616  1.00 29.79 ? 101  PHE D CD2   1 
ATOM   4281  C  CE1   . PHE D  1 101 ? 11.195  47.465  29.181  1.00 28.74 ? 101  PHE D CE1   1 
ATOM   4282  C  CE2   . PHE D  1 101 ? 11.187  48.133  26.863  1.00 30.41 ? 101  PHE D CE2   1 
ATOM   4283  C  CZ    . PHE D  1 101 ? 10.648  48.218  28.155  1.00 29.75 ? 101  PHE D CZ    1 
ATOM   4284  N  N     . PHE D  1 102 ? 15.437  42.871  25.850  1.00 32.44 ? 102  PHE D N     1 
ATOM   4285  C  CA    . PHE D  1 102 ? 16.669  42.307  25.273  1.00 32.77 ? 102  PHE D CA    1 
ATOM   4286  C  C     . PHE D  1 102 ? 16.403  41.676  23.904  1.00 33.35 ? 102  PHE D C     1 
ATOM   4287  O  O     . PHE D  1 102 ? 15.628  40.716  23.800  1.00 33.55 ? 102  PHE D O     1 
ATOM   4288  C  CB    . PHE D  1 102 ? 17.325  41.284  26.216  1.00 32.19 ? 102  PHE D CB    1 
ATOM   4289  C  CG    . PHE D  1 102 ? 17.763  41.863  27.534  1.00 31.93 ? 102  PHE D CG    1 
ATOM   4290  C  CD1   . PHE D  1 102 ? 18.974  42.547  27.643  1.00 31.62 ? 102  PHE D CD1   1 
ATOM   4291  C  CD2   . PHE D  1 102 ? 16.958  41.736  28.667  1.00 30.69 ? 102  PHE D CD2   1 
ATOM   4292  C  CE1   . PHE D  1 102 ? 19.375  43.100  28.862  1.00 31.27 ? 102  PHE D CE1   1 
ATOM   4293  C  CE2   . PHE D  1 102 ? 17.346  42.274  29.887  1.00 29.92 ? 102  PHE D CE2   1 
ATOM   4294  C  CZ    . PHE D  1 102 ? 18.554  42.957  29.992  1.00 31.23 ? 102  PHE D CZ    1 
ATOM   4295  N  N     . PRO D  1 103 ? 17.058  42.194  22.863  1.00 33.86 ? 103  PRO D N     1 
ATOM   4296  C  CA    . PRO D  1 103 ? 16.863  41.686  21.496  1.00 34.24 ? 103  PRO D CA    1 
ATOM   4297  C  C     . PRO D  1 103 ? 17.404  40.268  21.353  1.00 34.36 ? 103  PRO D C     1 
ATOM   4298  O  O     . PRO D  1 103 ? 16.953  39.534  20.477  1.00 34.57 ? 103  PRO D O     1 
ATOM   4299  C  CB    . PRO D  1 103 ? 17.702  42.639  20.621  1.00 34.33 ? 103  PRO D CB    1 
ATOM   4300  C  CG    . PRO D  1 103 ? 18.132  43.771  21.527  1.00 34.35 ? 103  PRO D CG    1 
ATOM   4301  C  CD    . PRO D  1 103 ? 18.077  43.258  22.927  1.00 33.94 ? 103  PRO D CD    1 
ATOM   4302  N  N     . ASP D  1 104 ? 18.354  39.907  22.213  1.00 34.24 ? 104  ASP D N     1 
ATOM   4303  C  CA    . ASP D  1 104 ? 19.013  38.599  22.177  1.00 34.45 ? 104  ASP D CA    1 
ATOM   4304  C  C     . ASP D  1 104 ? 18.512  37.608  23.255  1.00 34.07 ? 104  ASP D C     1 
ATOM   4305  O  O     . ASP D  1 104 ? 19.189  36.634  23.567  1.00 33.83 ? 104  ASP D O     1 
ATOM   4306  C  CB    . ASP D  1 104 ? 20.553  38.768  22.231  1.00 34.07 ? 104  ASP D CB    1 
ATOM   4307  C  CG    . ASP D  1 104 ? 21.023  39.589  23.438  1.00 35.36 ? 104  ASP D CG    1 
ATOM   4308  O  OD1   . ASP D  1 104 ? 22.246  39.608  23.700  1.00 35.96 ? 104  ASP D OD1   1 
ATOM   4309  O  OD2   . ASP D  1 104 ? 20.255  40.252  24.184  1.00 35.19 ? 104  ASP D OD2   1 
ATOM   4310  N  N     . ILE D  1 105 ? 17.322  37.859  23.798  1.00 33.89 ? 105  ILE D N     1 
ATOM   4311  C  CA    . ILE D  1 105 ? 16.738  37.020  24.848  1.00 33.73 ? 105  ILE D CA    1 
ATOM   4312  C  C     . ILE D  1 105 ? 16.675  35.527  24.496  1.00 33.87 ? 105  ILE D C     1 
ATOM   4313  O  O     . ILE D  1 105 ? 17.036  34.691  25.317  1.00 33.85 ? 105  ILE D O     1 
ATOM   4314  C  CB    . ILE D  1 105 ? 15.330  37.560  25.292  1.00 33.74 ? 105  ILE D CB    1 
ATOM   4315  C  CG1   . ILE D  1 105 ? 14.754  36.736  26.458  1.00 33.08 ? 105  ILE D CG1   1 
ATOM   4316  C  CG2   . ILE D  1 105 ? 14.341  37.558  24.130  1.00 32.89 ? 105  ILE D CG2   1 
ATOM   4317  C  CD1   . ILE D  1 105 ? 15.212  37.166  27.822  1.00 31.45 ? 105  ILE D CD1   1 
ATOM   4318  N  N     . VAL D  1 106 ? 16.238  35.204  23.283  1.00 33.98 ? 106  VAL D N     1 
ATOM   4319  C  CA    . VAL D  1 106 ? 16.026  33.815  22.874  1.00 34.32 ? 106  VAL D CA    1 
ATOM   4320  C  C     . VAL D  1 106 ? 17.330  33.022  22.787  1.00 34.69 ? 106  VAL D C     1 
ATOM   4321  O  O     . VAL D  1 106 ? 17.462  31.963  23.421  1.00 34.72 ? 106  VAL D O     1 
ATOM   4322  C  CB    . VAL D  1 106 ? 15.265  33.721  21.534  1.00 34.22 ? 106  VAL D CB    1 
ATOM   4323  C  CG1   . VAL D  1 106 ? 15.353  32.305  20.961  1.00 33.91 ? 106  VAL D CG1   1 
ATOM   4324  C  CG2   . VAL D  1 106 ? 13.830  34.159  21.722  1.00 33.40 ? 106  VAL D CG2   1 
ATOM   4325  N  N     . GLU D  1 107 ? 18.293  33.537  22.019  1.00 34.65 ? 107  GLU D N     1 
ATOM   4326  C  CA    . GLU D  1 107 ? 19.561  32.829  21.832  1.00 35.00 ? 107  GLU D CA    1 
ATOM   4327  C  C     . GLU D  1 107 ? 20.375  32.712  23.126  1.00 34.35 ? 107  GLU D C     1 
ATOM   4328  O  O     . GLU D  1 107 ? 21.018  31.692  23.363  1.00 34.39 ? 107  GLU D O     1 
ATOM   4329  C  CB    . GLU D  1 107 ? 20.411  33.383  20.662  1.00 35.27 ? 107  GLU D CB    1 
ATOM   4330  C  CG    . GLU D  1 107 ? 20.300  34.870  20.381  1.00 37.55 ? 107  GLU D CG    1 
ATOM   4331  C  CD    . GLU D  1 107 ? 19.039  35.258  19.625  1.00 41.25 ? 107  GLU D CD    1 
ATOM   4332  O  OE1   . GLU D  1 107 ? 18.778  34.718  18.536  1.00 42.83 ? 107  GLU D OE1   1 
ATOM   4333  O  OE2   . GLU D  1 107 ? 18.293  36.118  20.127  1.00 42.67 ? 107  GLU D OE2   1 
ATOM   4334  N  N     . PHE D  1 108 ? 20.314  33.738  23.970  1.00 33.62 ? 108  PHE D N     1 
ATOM   4335  C  CA    . PHE D  1 108 ? 20.961  33.706  25.277  1.00 33.06 ? 108  PHE D CA    1 
ATOM   4336  C  C     . PHE D  1 108 ? 20.371  32.624  26.195  1.00 32.92 ? 108  PHE D C     1 
ATOM   4337  O  O     . PHE D  1 108 ? 21.102  31.793  26.729  1.00 32.88 ? 108  PHE D O     1 
ATOM   4338  C  CB    . PHE D  1 108 ? 20.884  35.091  25.947  1.00 32.87 ? 108  PHE D CB    1 
ATOM   4339  C  CG    . PHE D  1 108 ? 21.496  35.145  27.321  1.00 32.15 ? 108  PHE D CG    1 
ATOM   4340  C  CD1   . PHE D  1 108 ? 22.850  35.433  27.482  1.00 31.60 ? 108  PHE D CD1   1 
ATOM   4341  C  CD2   . PHE D  1 108 ? 20.717  34.919  28.460  1.00 31.65 ? 108  PHE D CD2   1 
ATOM   4342  C  CE1   . PHE D  1 108 ? 23.428  35.491  28.757  1.00 31.38 ? 108  PHE D CE1   1 
ATOM   4343  C  CE2   . PHE D  1 108 ? 21.286  34.966  29.742  1.00 31.71 ? 108  PHE D CE2   1 
ATOM   4344  C  CZ    . PHE D  1 108 ? 22.650  35.258  29.886  1.00 31.22 ? 108  PHE D CZ    1 
ATOM   4345  N  N     . CYS D  1 109 ? 19.056  32.643  26.386  1.00 32.78 ? 109  CYS D N     1 
ATOM   4346  C  CA    . CYS D  1 109 ? 18.392  31.682  27.280  1.00 33.02 ? 109  CYS D CA    1 
ATOM   4347  C  C     . CYS D  1 109 ? 18.575  30.240  26.810  1.00 32.94 ? 109  CYS D C     1 
ATOM   4348  O  O     . CYS D  1 109 ? 18.849  29.350  27.600  1.00 32.59 ? 109  CYS D O     1 
ATOM   4349  C  CB    . CYS D  1 109 ? 16.902  31.996  27.397  1.00 32.66 ? 109  CYS D CB    1 
ATOM   4350  S  SG    . CYS D  1 109 ? 16.548  33.540  28.248  1.00 33.22 ? 109  CYS D SG    1 
ATOM   4351  N  N     . GLU D  1 110 ? 18.425  30.034  25.511  1.00 33.35 ? 110  GLU D N     1 
ATOM   4352  C  CA    . GLU D  1 110 ? 18.565  28.721  24.919  1.00 33.92 ? 110  GLU D CA    1 
ATOM   4353  C  C     . GLU D  1 110 ? 20.003  28.192  25.077  1.00 33.67 ? 110  GLU D C     1 
ATOM   4354  O  O     . GLU D  1 110 ? 20.198  27.041  25.462  1.00 33.73 ? 110  GLU D O     1 
ATOM   4355  C  CB    . GLU D  1 110 ? 18.097  28.783  23.464  1.00 33.96 ? 110  GLU D CB    1 
ATOM   4356  C  CG    . GLU D  1 110 ? 18.046  27.464  22.722  1.00 36.18 ? 110  GLU D CG    1 
ATOM   4357  C  CD    . GLU D  1 110 ? 17.078  26.424  23.291  1.00 37.59 ? 110  GLU D CD    1 
ATOM   4358  O  OE1   . GLU D  1 110 ? 17.168  25.283  22.807  1.00 38.17 ? 110  GLU D OE1   1 
ATOM   4359  O  OE2   . GLU D  1 110 ? 16.246  26.710  24.187  1.00 37.91 ? 110  GLU D OE2   1 
ATOM   4360  N  N     . ALA D  1 111 ? 20.992  29.051  24.837  1.00 33.33 ? 111  ALA D N     1 
ATOM   4361  C  CA    . ALA D  1 111 ? 22.398  28.675  24.998  1.00 33.20 ? 111  ALA D CA    1 
ATOM   4362  C  C     . ALA D  1 111 ? 22.776  28.392  26.454  1.00 33.11 ? 111  ALA D C     1 
ATOM   4363  O  O     . ALA D  1 111 ? 23.512  27.443  26.732  1.00 33.27 ? 111  ALA D O     1 
ATOM   4364  C  CB    . ALA D  1 111 ? 23.311  29.737  24.409  1.00 32.97 ? 111  ALA D CB    1 
ATOM   4365  N  N     . MET D  1 112 ? 22.282  29.213  27.382  1.00 32.92 ? 112  MET D N     1 
ATOM   4366  C  CA    . MET D  1 112 ? 22.551  28.991  28.802  1.00 32.84 ? 112  MET D CA    1 
ATOM   4367  C  C     . MET D  1 112 ? 21.871  27.716  29.322  1.00 32.62 ? 112  MET D C     1 
ATOM   4368  O  O     . MET D  1 112 ? 22.474  26.963  30.088  1.00 32.41 ? 112  MET D O     1 
ATOM   4369  C  CB    . MET D  1 112 ? 22.150  30.209  29.650  1.00 33.10 ? 112  MET D CB    1 
ATOM   4370  C  CG    . MET D  1 112 ? 23.025  31.463  29.459  1.00 34.13 ? 112  MET D CG    1 
ATOM   4371  S  SD    . MET D  1 112 ? 24.824  31.228  29.738  1.00 35.48 ? 112  MET D SD    1 
ATOM   4372  C  CE    . MET D  1 112 ? 25.508  32.479  28.596  1.00 35.49 ? 112  MET D CE    1 
ATOM   4373  N  N     . ALA D  1 113 ? 20.635  27.466  28.890  1.00 32.37 ? 113  ALA D N     1 
ATOM   4374  C  CA    . ALA D  1 113 ? 19.899  26.270  29.320  1.00 32.69 ? 113  ALA D CA    1 
ATOM   4375  C  C     . ALA D  1 113 ? 20.536  24.997  28.776  1.00 32.75 ? 113  ALA D C     1 
ATOM   4376  O  O     . ALA D  1 113 ? 20.595  23.986  29.466  1.00 32.82 ? 113  ALA D O     1 
ATOM   4377  C  CB    . ALA D  1 113 ? 18.425  26.355  28.922  1.00 32.17 ? 113  ALA D CB    1 
ATOM   4378  N  N     . ASN D  1 114 ? 21.013  25.065  27.537  1.00 33.03 ? 114  ASN D N     1 
ATOM   4379  C  CA    . ASN D  1 114 ? 21.735  23.961  26.913  1.00 33.44 ? 114  ASN D CA    1 
ATOM   4380  C  C     . ASN D  1 114 ? 23.129  23.717  27.518  1.00 33.52 ? 114  ASN D C     1 
ATOM   4381  O  O     . ASN D  1 114 ? 23.667  22.621  27.410  1.00 33.92 ? 114  ASN D O     1 
ATOM   4382  C  CB    . ASN D  1 114 ? 21.802  24.170  25.397  1.00 33.17 ? 114  ASN D CB    1 
ATOM   4383  C  CG    . ASN D  1 114 ? 20.437  24.001  24.718  1.00 33.84 ? 114  ASN D CG    1 
ATOM   4384  O  OD1   . ASN D  1 114 ? 19.524  23.358  25.261  1.00 33.91 ? 114  ASN D OD1   1 
ATOM   4385  N  ND2   . ASN D  1 114 ? 20.293  24.580  23.525  1.00 32.93 ? 114  ASN D ND2   1 
ATOM   4386  N  N     . ALA D  1 115 ? 23.699  24.736  28.158  1.00 33.39 ? 115  ALA D N     1 
ATOM   4387  C  CA    . ALA D  1 115 ? 24.948  24.577  28.907  1.00 33.34 ? 115  ALA D CA    1 
ATOM   4388  C  C     . ALA D  1 115 ? 24.696  24.165  30.363  1.00 33.28 ? 115  ALA D C     1 
ATOM   4389  O  O     . ALA D  1 115 ? 25.616  24.170  31.184  1.00 33.46 ? 115  ALA D O     1 
ATOM   4390  C  CB    . ALA D  1 115 ? 25.808  25.846  28.832  1.00 32.93 ? 115  ALA D CB    1 
ATOM   4391  N  N     . GLY D  1 116 ? 23.446  23.818  30.681  1.00 33.07 ? 116  GLY D N     1 
ATOM   4392  C  CA    . GLY D  1 116 ? 23.094  23.275  31.984  1.00 32.45 ? 116  GLY D CA    1 
ATOM   4393  C  C     . GLY D  1 116 ? 22.695  24.266  33.062  1.00 32.22 ? 116  GLY D C     1 
ATOM   4394  O  O     . GLY D  1 116 ? 22.595  23.896  34.231  1.00 32.30 ? 116  GLY D O     1 
ATOM   4395  N  N     . LYS D  1 117 ? 22.464  25.518  32.689  1.00 31.59 ? 117  LYS D N     1 
ATOM   4396  C  CA    . LYS D  1 117 ? 22.018  26.515  33.653  1.00 31.21 ? 117  LYS D CA    1 
ATOM   4397  C  C     . LYS D  1 117 ? 20.488  26.601  33.786  1.00 30.50 ? 117  LYS D C     1 
ATOM   4398  O  O     . LYS D  1 117 ? 19.751  26.270  32.858  1.00 30.49 ? 117  LYS D O     1 
ATOM   4399  C  CB    . LYS D  1 117 ? 22.607  27.884  33.297  1.00 31.55 ? 117  LYS D CB    1 
ATOM   4400  C  CG    . LYS D  1 117 ? 24.057  28.070  33.724  1.00 32.04 ? 117  LYS D CG    1 
ATOM   4401  C  CD    . LYS D  1 117 ? 25.038  27.756  32.604  1.00 33.17 ? 117  LYS D CD    1 
ATOM   4402  C  CE    . LYS D  1 117 ? 26.421  28.333  32.891  1.00 33.50 ? 117  LYS D CE    1 
ATOM   4403  N  NZ    . LYS D  1 117 ? 27.009  27.833  34.159  1.00 32.84 ? 117  LYS D NZ    1 
ATOM   4404  N  N     . THR D  1 118 ? 20.024  27.041  34.951  1.00 29.53 ? 118  THR D N     1 
ATOM   4405  C  CA    . THR D  1 118 ? 18.613  27.370  35.156  1.00 28.51 ? 118  THR D CA    1 
ATOM   4406  C  C     . THR D  1 118 ? 18.404  28.851  34.876  1.00 27.94 ? 118  THR D C     1 
ATOM   4407  O  O     . THR D  1 118 ? 18.975  29.706  35.558  1.00 27.91 ? 118  THR D O     1 
ATOM   4408  C  CB    . THR D  1 118 ? 18.166  27.023  36.591  1.00 28.35 ? 118  THR D CB    1 
ATOM   4409  O  OG1   . THR D  1 118 ? 18.079  25.606  36.717  1.00 28.73 ? 118  THR D OG1   1 
ATOM   4410  C  CG2   . THR D  1 118 ? 16.726  27.465  36.849  1.00 27.45 ? 118  THR D CG2   1 
ATOM   4411  N  N     . VAL D  1 119 ? 17.592  29.143  33.860  1.00 27.25 ? 119  VAL D N     1 
ATOM   4412  C  CA    . VAL D  1 119 ? 17.305  30.517  33.448  1.00 26.32 ? 119  VAL D CA    1 
ATOM   4413  C  C     . VAL D  1 119 ? 15.849  30.864  33.754  1.00 26.05 ? 119  VAL D C     1 
ATOM   4414  O  O     . VAL D  1 119 ? 14.931  30.165  33.333  1.00 25.94 ? 119  VAL D O     1 
ATOM   4415  C  CB    . VAL D  1 119 ? 17.598  30.741  31.953  1.00 26.26 ? 119  VAL D CB    1 
ATOM   4416  C  CG1   . VAL D  1 119 ? 17.489  32.218  31.584  1.00 25.61 ? 119  VAL D CG1   1 
ATOM   4417  C  CG2   . VAL D  1 119 ? 18.983  30.202  31.589  1.00 26.73 ? 119  VAL D CG2   1 
ATOM   4418  N  N     . ILE D  1 120 ? 15.656  31.941  34.508  1.00 25.44 ? 120  ILE D N     1 
ATOM   4419  C  CA    . ILE D  1 120 ? 14.331  32.392  34.912  1.00 24.80 ? 120  ILE D CA    1 
ATOM   4420  C  C     . ILE D  1 120 ? 14.115  33.801  34.371  1.00 24.63 ? 120  ILE D C     1 
ATOM   4421  O  O     . ILE D  1 120 ? 14.933  34.687  34.606  1.00 24.78 ? 120  ILE D O     1 
ATOM   4422  C  CB    . ILE D  1 120 ? 14.176  32.336  36.462  1.00 24.91 ? 120  ILE D CB    1 
ATOM   4423  C  CG1   . ILE D  1 120 ? 14.571  30.942  36.975  1.00 24.20 ? 120  ILE D CG1   1 
ATOM   4424  C  CG2   . ILE D  1 120 ? 12.746  32.689  36.871  1.00 23.06 ? 120  ILE D CG2   1 
ATOM   4425  C  CD1   . ILE D  1 120 ? 14.789  30.844  38.450  1.00 24.73 ? 120  ILE D CD1   1 
ATOM   4426  N  N     . VAL D  1 121 ? 13.027  33.993  33.631  1.00 24.11 ? 121  VAL D N     1 
ATOM   4427  C  CA    . VAL D  1 121 ? 12.783  35.239  32.909  1.00 23.75 ? 121  VAL D CA    1 
ATOM   4428  C  C     . VAL D  1 121 ? 11.441  35.840  33.302  1.00 23.89 ? 121  VAL D C     1 
ATOM   4429  O  O     . VAL D  1 121 ? 10.401  35.205  33.153  1.00 24.12 ? 121  VAL D O     1 
ATOM   4430  C  CB    . VAL D  1 121 ? 12.792  35.034  31.371  1.00 23.84 ? 121  VAL D CB    1 
ATOM   4431  C  CG1   . VAL D  1 121 ? 12.420  36.340  30.635  1.00 22.97 ? 121  VAL D CG1   1 
ATOM   4432  C  CG2   . VAL D  1 121 ? 14.156  34.496  30.880  1.00 23.14 ? 121  VAL D CG2   1 
ATOM   4433  N  N     . ALA D  1 122 ? 11.479  37.062  33.819  1.00 23.75 ? 122  ALA D N     1 
ATOM   4434  C  CA    . ALA D  1 122 ? 10.279  37.842  34.062  1.00 23.80 ? 122  ALA D CA    1 
ATOM   4435  C  C     . ALA D  1 122 ? 10.120  38.821  32.903  1.00 24.11 ? 122  ALA D C     1 
ATOM   4436  O  O     . ALA D  1 122 ? 11.078  39.495  32.507  1.00 23.93 ? 122  ALA D O     1 
ATOM   4437  C  CB    . ALA D  1 122 ? 10.372  38.576  35.382  1.00 23.56 ? 122  ALA D CB    1 
ATOM   4438  N  N     . ALA D  1 123 ? 8.921   38.876  32.335  1.00 24.40 ? 123  ALA D N     1 
ATOM   4439  C  CA    . ALA D  1 123 ? 8.684   39.698  31.154  1.00 24.85 ? 123  ALA D CA    1 
ATOM   4440  C  C     . ALA D  1 123 ? 7.217   39.986  30.930  1.00 25.58 ? 123  ALA D C     1 
ATOM   4441  O  O     . ALA D  1 123 ? 6.349   39.174  31.265  1.00 25.49 ? 123  ALA D O     1 
ATOM   4442  C  CB    . ALA D  1 123 ? 9.263   39.043  29.929  1.00 24.54 ? 123  ALA D CB    1 
ATOM   4443  N  N     . LEU D  1 124 ? 6.993   41.128  30.299  1.00 26.49 ? 124  LEU D N     1 
ATOM   4444  C  CA    . LEU D  1 124 ? 5.668   41.514  29.826  1.00 27.57 ? 124  LEU D CA    1 
ATOM   4445  C  C     . LEU D  1 124 ? 5.417   40.649  28.593  1.00 28.43 ? 124  LEU D C     1 
ATOM   4446  O  O     . LEU D  1 124 ? 6.290   40.531  27.737  1.00 28.71 ? 124  LEU D O     1 
ATOM   4447  C  CB    . LEU D  1 124 ? 5.653   42.980  29.306  1.00 27.56 ? 124  LEU D CB    1 
ATOM   4448  C  CG    . LEU D  1 124 ? 4.993   44.104  30.102  1.00 27.62 ? 124  LEU D CG    1 
ATOM   4449  C  CD1   . LEU D  1 124 ? 4.901   43.751  31.582  1.00 25.98 ? 124  LEU D CD1   1 
ATOM   4450  C  CD2   . LEU D  1 124 ? 5.741   45.406  29.888  1.00 27.58 ? 124  LEU D CD2   1 
ATOM   4451  N  N     . ASP D  1 125 ? 4.239   40.035  28.500  1.00 29.34 ? 125  ASP D N     1 
ATOM   4452  C  CA    . ASP D  1 125 ? 3.882   39.310  27.281  1.00 30.31 ? 125  ASP D CA    1 
ATOM   4453  C  C     . ASP D  1 125 ? 3.360   40.255  26.205  1.00 30.17 ? 125  ASP D C     1 
ATOM   4454  O  O     . ASP D  1 125 ? 3.609   40.042  25.014  1.00 30.45 ? 125  ASP D O     1 
ATOM   4455  C  CB    . ASP D  1 125 ? 2.874   38.180  27.546  1.00 31.02 ? 125  ASP D CB    1 
ATOM   4456  C  CG    . ASP D  1 125 ? 1.660   38.641  28.335  1.00 32.62 ? 125  ASP D CG    1 
ATOM   4457  O  OD1   . ASP D  1 125 ? 0.611   38.913  27.710  1.00 35.00 ? 125  ASP D OD1   1 
ATOM   4458  O  OD2   . ASP D  1 125 ? 1.663   38.767  29.579  1.00 35.75 ? 125  ASP D OD2   1 
ATOM   4459  N  N     . GLY D  1 126 ? 2.645   41.299  26.630  1.00 29.71 ? 126  GLY D N     1 
ATOM   4460  C  CA    . GLY D  1 126 ? 2.071   42.261  25.709  1.00 29.17 ? 126  GLY D CA    1 
ATOM   4461  C  C     . GLY D  1 126 ? 2.496   43.704  25.908  1.00 29.11 ? 126  GLY D C     1 
ATOM   4462  O  O     . GLY D  1 126 ? 2.766   44.143  27.028  1.00 29.03 ? 126  GLY D O     1 
ATOM   4463  N  N     . THR D  1 127 ? 2.535   44.444  24.802  1.00 28.87 ? 127  THR D N     1 
ATOM   4464  C  CA    . THR D  1 127 ? 2.701   45.891  24.815  1.00 28.60 ? 127  THR D CA    1 
ATOM   4465  C  C     . THR D  1 127 ? 1.391   46.554  25.243  1.00 28.91 ? 127  THR D C     1 
ATOM   4466  O  O     . THR D  1 127 ? 0.390   45.878  25.528  1.00 28.70 ? 127  THR D O     1 
ATOM   4467  C  CB    . THR D  1 127 ? 3.095   46.408  23.408  1.00 28.53 ? 127  THR D CB    1 
ATOM   4468  O  OG1   . THR D  1 127 ? 1.998   46.227  22.507  1.00 28.32 ? 127  THR D OG1   1 
ATOM   4469  C  CG2   . THR D  1 127 ? 4.196   45.568  22.773  1.00 28.23 ? 127  THR D CG2   1 
ATOM   4470  N  N     . PHE D  1 128 ? 1.396   47.884  25.262  1.00 29.20 ? 128  PHE D N     1 
ATOM   4471  C  CA    . PHE D  1 128 ? 0.205   48.682  25.530  1.00 29.62 ? 128  PHE D CA    1 
ATOM   4472  C  C     . PHE D  1 128 ? -0.870  48.480  24.465  1.00 30.08 ? 128  PHE D C     1 
ATOM   4473  O  O     . PHE D  1 128 ? -2.023  48.875  24.648  1.00 30.22 ? 128  PHE D O     1 
ATOM   4474  C  CB    . PHE D  1 128 ? 0.590   50.165  25.629  1.00 29.75 ? 128  PHE D CB    1 
ATOM   4475  C  CG    . PHE D  1 128 ? 0.906   50.812  24.301  1.00 29.65 ? 128  PHE D CG    1 
ATOM   4476  C  CD1   . PHE D  1 128 ? -0.042  51.625  23.664  1.00 29.91 ? 128  PHE D CD1   1 
ATOM   4477  C  CD2   . PHE D  1 128 ? 2.150   50.623  23.693  1.00 29.24 ? 128  PHE D CD2   1 
ATOM   4478  C  CE1   . PHE D  1 128 ? 0.244   52.244  22.446  1.00 29.35 ? 128  PHE D CE1   1 
ATOM   4479  C  CE2   . PHE D  1 128 ? 2.447   51.225  22.467  1.00 29.59 ? 128  PHE D CE2   1 
ATOM   4480  C  CZ    . PHE D  1 128 ? 1.489   52.044  21.841  1.00 30.23 ? 128  PHE D CZ    1 
ATOM   4481  N  N     . GLN D  1 129 ? -0.481  47.867  23.350  1.00 30.62 ? 129  GLN D N     1 
ATOM   4482  C  CA    . GLN D  1 129 ? -1.402  47.571  22.257  1.00 31.44 ? 129  GLN D CA    1 
ATOM   4483  C  C     . GLN D  1 129 ? -1.923  46.125  22.277  1.00 31.49 ? 129  GLN D C     1 
ATOM   4484  O  O     . GLN D  1 129 ? -2.640  45.706  21.361  1.00 31.36 ? 129  GLN D O     1 
ATOM   4485  C  CB    . GLN D  1 129 ? -0.737  47.886  20.905  1.00 31.50 ? 129  GLN D CB    1 
ATOM   4486  C  CG    . GLN D  1 129 ? -0.874  49.357  20.491  1.00 33.31 ? 129  GLN D CG    1 
ATOM   4487  C  CD    . GLN D  1 129 ? -0.070  49.732  19.238  1.00 35.93 ? 129  GLN D CD    1 
ATOM   4488  O  OE1   . GLN D  1 129 ? -0.583  50.438  18.363  1.00 36.78 ? 129  GLN D OE1   1 
ATOM   4489  N  NE2   . GLN D  1 129 ? 1.179   49.274  19.156  1.00 35.18 ? 129  GLN D NE2   1 
ATOM   4490  N  N     . ARG D  1 130 ? -1.556  45.380  23.318  1.00 31.58 ? 130  ARG D N     1 
ATOM   4491  C  CA    . ARG D  1 130 ? -1.870  43.957  23.446  1.00 31.82 ? 130  ARG D CA    1 
ATOM   4492  C  C     . ARG D  1 130 ? -1.276  43.125  22.297  1.00 31.89 ? 130  ARG D C     1 
ATOM   4493  O  O     . ARG D  1 130 ? -1.863  42.137  21.856  1.00 31.90 ? 130  ARG D O     1 
ATOM   4494  C  CB    . ARG D  1 130 ? -3.385  43.723  23.590  1.00 31.41 ? 130  ARG D CB    1 
ATOM   4495  C  CG    . ARG D  1 130 ? -4.011  44.382  24.813  1.00 32.51 ? 130  ARG D CG    1 
ATOM   4496  C  CD    . ARG D  1 130 ? -5.332  43.759  25.283  1.00 34.12 ? 130  ARG D CD    1 
ATOM   4497  N  NE    . ARG D  1 130 ? -6.290  43.652  24.190  1.00 36.64 ? 130  ARG D NE    1 
ATOM   4498  C  CZ    . ARG D  1 130 ? -7.101  42.622  23.973  1.00 37.33 ? 130  ARG D CZ    1 
ATOM   4499  N  NH1   . ARG D  1 130 ? -7.116  41.564  24.778  1.00 37.89 ? 130  ARG D NH1   1 
ATOM   4500  N  NH2   . ARG D  1 130 ? -7.908  42.656  22.932  1.00 37.00 ? 130  ARG D NH2   1 
ATOM   4501  N  N     . LYS D  1 131 ? -0.106  43.539  21.825  1.00 31.98 ? 131  LYS D N     1 
ATOM   4502  C  CA    . LYS D  1 131 ? 0.636   42.798  20.812  1.00 32.33 ? 131  LYS D CA    1 
ATOM   4503  C  C     . LYS D  1 131 ? 1.859   42.167  21.467  1.00 31.84 ? 131  LYS D C     1 
ATOM   4504  O  O     . LYS D  1 131 ? 2.270   42.616  22.530  1.00 31.79 ? 131  LYS D O     1 
ATOM   4505  C  CB    . LYS D  1 131 ? 1.032   43.741  19.679  1.00 32.73 ? 131  LYS D CB    1 
ATOM   4506  C  CG    . LYS D  1 131 ? -0.139  44.136  18.788  1.00 34.81 ? 131  LYS D CG    1 
ATOM   4507  C  CD    . LYS D  1 131 ? 0.329   45.007  17.632  1.00 38.45 ? 131  LYS D CD    1 
ATOM   4508  C  CE    . LYS D  1 131 ? -0.852  45.456  16.779  1.00 41.19 ? 131  LYS D CE    1 
ATOM   4509  N  NZ    . LYS D  1 131 ? -0.536  46.709  16.018  1.00 42.78 ? 131  LYS D NZ    1 
ATOM   4510  N  N     . PRO D  1 132 ? 2.425   41.119  20.869  1.00 31.71 ? 132  PRO D N     1 
ATOM   4511  C  CA    . PRO D  1 132 ? 3.662   40.511  21.390  1.00 31.64 ? 132  PRO D CA    1 
ATOM   4512  C  C     . PRO D  1 132 ? 4.759   41.555  21.626  1.00 31.58 ? 132  PRO D C     1 
ATOM   4513  O  O     . PRO D  1 132 ? 4.995   42.405  20.774  1.00 31.27 ? 132  PRO D O     1 
ATOM   4514  C  CB    . PRO D  1 132 ? 4.065   39.539  20.277  1.00 31.43 ? 132  PRO D CB    1 
ATOM   4515  C  CG    . PRO D  1 132 ? 2.777   39.175  19.644  1.00 31.79 ? 132  PRO D CG    1 
ATOM   4516  C  CD    . PRO D  1 132 ? 1.932   40.419  19.668  1.00 31.52 ? 132  PRO D CD    1 
ATOM   4517  N  N     . PHE D  1 133 ? 5.397   41.494  22.787  1.00 31.81 ? 133  PHE D N     1 
ATOM   4518  C  CA    . PHE D  1 133 ? 6.419   42.465  23.159  1.00 32.00 ? 133  PHE D CA    1 
ATOM   4519  C  C     . PHE D  1 133 ? 7.796   41.947  22.775  1.00 32.49 ? 133  PHE D C     1 
ATOM   4520  O  O     . PHE D  1 133 ? 8.360   41.089  23.461  1.00 32.68 ? 133  PHE D O     1 
ATOM   4521  C  CB    . PHE D  1 133 ? 6.344   42.765  24.661  1.00 31.60 ? 133  PHE D CB    1 
ATOM   4522  C  CG    . PHE D  1 133 ? 6.861   44.134  25.054  1.00 31.31 ? 133  PHE D CG    1 
ATOM   4523  C  CD1   . PHE D  1 133 ? 6.209   44.869  26.044  1.00 30.55 ? 133  PHE D CD1   1 
ATOM   4524  C  CD2   . PHE D  1 133 ? 8.010   44.674  24.465  1.00 30.26 ? 133  PHE D CD2   1 
ATOM   4525  C  CE1   . PHE D  1 133 ? 6.683   46.121  26.438  1.00 30.39 ? 133  PHE D CE1   1 
ATOM   4526  C  CE2   . PHE D  1 133 ? 8.490   45.927  24.850  1.00 30.27 ? 133  PHE D CE2   1 
ATOM   4527  C  CZ    . PHE D  1 133 ? 7.825   46.652  25.842  1.00 30.32 ? 133  PHE D CZ    1 
ATOM   4528  N  N     . GLY D  1 134 ? 8.334   42.476  21.677  1.00 32.91 ? 134  GLY D N     1 
ATOM   4529  C  CA    . GLY D  1 134 ? 9.623   42.030  21.165  1.00 33.12 ? 134  GLY D CA    1 
ATOM   4530  C  C     . GLY D  1 134 ? 9.607   40.564  20.759  1.00 33.12 ? 134  GLY D C     1 
ATOM   4531  O  O     . GLY D  1 134 ? 8.655   40.087  20.140  1.00 33.25 ? 134  GLY D O     1 
ATOM   4532  N  N     . ALA D  1 135 ? 10.656  39.848  21.142  1.00 33.08 ? 135  ALA D N     1 
ATOM   4533  C  CA    . ALA D  1 135 ? 10.843  38.458  20.736  1.00 33.12 ? 135  ALA D CA    1 
ATOM   4534  C  C     . ALA D  1 135 ? 10.436  37.481  21.842  1.00 32.98 ? 135  ALA D C     1 
ATOM   4535  O  O     . ALA D  1 135 ? 10.598  36.268  21.706  1.00 32.94 ? 135  ALA D O     1 
ATOM   4536  C  CB    . ALA D  1 135 ? 12.304  38.231  20.331  1.00 33.02 ? 135  ALA D CB    1 
ATOM   4537  N  N     . ILE D  1 136 ? 9.890   38.013  22.929  1.00 32.83 ? 136  ILE D N     1 
ATOM   4538  C  CA    . ILE D  1 136 ? 9.731   37.246  24.159  1.00 32.80 ? 136  ILE D CA    1 
ATOM   4539  C  C     . ILE D  1 136 ? 8.850   35.993  24.061  1.00 32.59 ? 136  ILE D C     1 
ATOM   4540  O  O     . ILE D  1 136 ? 9.107   35.002  24.754  1.00 32.40 ? 136  ILE D O     1 
ATOM   4541  C  CB    . ILE D  1 136 ? 9.341   38.183  25.349  1.00 32.92 ? 136  ILE D CB    1 
ATOM   4542  C  CG1   . ILE D  1 136 ? 10.071  37.769  26.638  1.00 33.48 ? 136  ILE D CG1   1 
ATOM   4543  C  CG2   . ILE D  1 136 ? 7.817   38.349  25.500  1.00 33.02 ? 136  ILE D CG2   1 
ATOM   4544  C  CD1   . ILE D  1 136 ? 9.434   36.601  27.407  1.00 35.54 ? 136  ILE D CD1   1 
ATOM   4545  N  N     . LEU D  1 137 ? 7.842   36.009  23.190  1.00 32.23 ? 137  LEU D N     1 
ATOM   4546  C  CA    . LEU D  1 137 ? 6.975   34.837  23.037  1.00 31.94 ? 137  LEU D CA    1 
ATOM   4547  C  C     . LEU D  1 137 ? 7.668   33.641  22.338  1.00 31.75 ? 137  LEU D C     1 
ATOM   4548  O  O     . LEU D  1 137 ? 7.223   32.501  22.475  1.00 31.60 ? 137  LEU D O     1 
ATOM   4549  C  CB    . LEU D  1 137 ? 5.621   35.205  22.394  1.00 32.00 ? 137  LEU D CB    1 
ATOM   4550  C  CG    . LEU D  1 137 ? 4.732   36.238  23.145  1.00 32.58 ? 137  LEU D CG    1 
ATOM   4551  C  CD1   . LEU D  1 137 ? 3.408   36.443  22.454  1.00 31.94 ? 137  LEU D CD1   1 
ATOM   4552  C  CD2   . LEU D  1 137 ? 4.503   35.924  24.634  1.00 31.42 ? 137  LEU D CD2   1 
ATOM   4553  N  N     . ASN D  1 138 ? 8.767   33.900  21.631  1.00 31.30 ? 138  ASN D N     1 
ATOM   4554  C  CA    . ASN D  1 138 ? 9.594   32.829  21.060  1.00 31.26 ? 138  ASN D CA    1 
ATOM   4555  C  C     . ASN D  1 138 ? 10.210  31.917  22.117  1.00 30.71 ? 138  ASN D C     1 
ATOM   4556  O  O     . ASN D  1 138 ? 10.652  30.810  21.802  1.00 30.42 ? 138  ASN D O     1 
ATOM   4557  C  CB    . ASN D  1 138 ? 10.728  33.411  20.222  1.00 31.29 ? 138  ASN D CB    1 
ATOM   4558  C  CG    . ASN D  1 138 ? 10.244  34.033  18.941  1.00 32.65 ? 138  ASN D CG    1 
ATOM   4559  O  OD1   . ASN D  1 138 ? 9.366   33.494  18.272  1.00 33.73 ? 138  ASN D OD1   1 
ATOM   4560  N  ND2   . ASN D  1 138 ? 10.824  35.176  18.583  1.00 34.14 ? 138  ASN D ND2   1 
ATOM   4561  N  N     . LEU D  1 139 ? 10.259  32.406  23.358  1.00 30.09 ? 139  LEU D N     1 
ATOM   4562  C  CA    . LEU D  1 139 ? 10.746  31.625  24.487  1.00 29.72 ? 139  LEU D CA    1 
ATOM   4563  C  C     . LEU D  1 139 ? 9.768   30.529  24.893  1.00 29.43 ? 139  LEU D C     1 
ATOM   4564  O  O     . LEU D  1 139 ? 10.187  29.494  25.391  1.00 29.52 ? 139  LEU D O     1 
ATOM   4565  C  CB    . LEU D  1 139 ? 10.994  32.527  25.699  1.00 29.73 ? 139  LEU D CB    1 
ATOM   4566  C  CG    . LEU D  1 139 ? 12.347  33.195  25.937  1.00 29.90 ? 139  LEU D CG    1 
ATOM   4567  C  CD1   . LEU D  1 139 ? 12.416  33.629  27.390  1.00 29.96 ? 139  LEU D CD1   1 
ATOM   4568  C  CD2   . LEU D  1 139 ? 13.517  32.285  25.594  1.00 29.60 ? 139  LEU D CD2   1 
ATOM   4569  N  N     . VAL D  1 140 ? 8.471   30.764  24.663  1.00 29.12 ? 140  VAL D N     1 
ATOM   4570  C  CA    . VAL D  1 140 ? 7.393   29.848  25.171  1.00 29.10 ? 140  VAL D CA    1 
ATOM   4571  C  C     . VAL D  1 140 ? 7.573   28.382  24.680  1.00 29.13 ? 140  VAL D C     1 
ATOM   4572  O  O     . VAL D  1 140 ? 7.537   27.470  25.507  1.00 29.30 ? 140  VAL D O     1 
ATOM   4573  C  CB    . VAL D  1 140 ? 5.984   30.436  24.952  1.00 29.14 ? 140  VAL D CB    1 
ATOM   4574  C  CG1   . VAL D  1 140 ? 4.915   29.435  25.363  1.00 28.36 ? 140  VAL D CG1   1 
ATOM   4575  C  CG2   . VAL D  1 140 ? 5.822   31.748  25.705  1.00 28.81 ? 140  VAL D CG2   1 
ATOM   4576  N  N     . PRO D  1 141 ? 7.774   28.153  23.378  1.00 28.92 ? 141  PRO D N     1 
ATOM   4577  C  CA    . PRO D  1 141 ? 8.071   26.801  22.873  1.00 28.89 ? 141  PRO D CA    1 
ATOM   4578  C  C     . PRO D  1 141 ? 9.425   26.228  23.343  1.00 29.02 ? 141  PRO D C     1 
ATOM   4579  O  O     . PRO D  1 141 ? 9.644   25.021  23.201  1.00 28.97 ? 141  PRO D O     1 
ATOM   4580  C  CB    . PRO D  1 141 ? 8.072   26.986  21.346  1.00 28.68 ? 141  PRO D CB    1 
ATOM   4581  C  CG    . PRO D  1 141 ? 7.348   28.256  21.110  1.00 28.72 ? 141  PRO D CG    1 
ATOM   4582  C  CD    . PRO D  1 141 ? 7.684   29.133  22.280  1.00 28.74 ? 141  PRO D CD    1 
ATOM   4583  N  N     . LEU D  1 142 ? 10.299  27.077  23.886  1.00 28.85 ? 142  LEU D N     1 
ATOM   4584  C  CA    . LEU D  1 142 ? 11.610  26.644  24.394  1.00 28.94 ? 142  LEU D CA    1 
ATOM   4585  C  C     . LEU D  1 142 ? 11.624  26.397  25.895  1.00 28.78 ? 142  LEU D C     1 
ATOM   4586  O  O     . LEU D  1 142 ? 12.584  25.859  26.432  1.00 28.75 ? 142  LEU D O     1 
ATOM   4587  C  CB    . LEU D  1 142 ? 12.688  27.688  24.052  1.00 28.70 ? 142  LEU D CB    1 
ATOM   4588  C  CG    . LEU D  1 142 ? 12.795  28.082  22.577  1.00 28.98 ? 142  LEU D CG    1 
ATOM   4589  C  CD1   . LEU D  1 142 ? 13.585  29.363  22.416  1.00 28.35 ? 142  LEU D CD1   1 
ATOM   4590  C  CD2   . LEU D  1 142 ? 13.399  26.957  21.743  1.00 27.90 ? 142  LEU D CD2   1 
ATOM   4591  N  N     . ALA D  1 143 ? 10.554  26.802  26.568  1.00 28.94 ? 143  ALA D N     1 
ATOM   4592  C  CA    . ALA D  1 143 ? 10.526  26.832  28.025  1.00 29.00 ? 143  ALA D CA    1 
ATOM   4593  C  C     . ALA D  1 143 ? 9.904   25.577  28.631  1.00 29.21 ? 143  ALA D C     1 
ATOM   4594  O  O     . ALA D  1 143 ? 8.937   25.040  28.099  1.00 29.14 ? 143  ALA D O     1 
ATOM   4595  C  CB    . ALA D  1 143 ? 9.796   28.074  28.489  1.00 28.68 ? 143  ALA D CB    1 
ATOM   4596  N  N     . GLU D  1 144 ? 10.467  25.103  29.739  1.00 29.60 ? 144  GLU D N     1 
ATOM   4597  C  CA    . GLU D  1 144 ? 9.847   23.985  30.439  1.00 30.30 ? 144  GLU D CA    1 
ATOM   4598  C  C     . GLU D  1 144 ? 8.746   24.428  31.410  1.00 30.07 ? 144  GLU D C     1 
ATOM   4599  O  O     . GLU D  1 144 ? 7.911   23.618  31.815  1.00 30.22 ? 144  GLU D O     1 
ATOM   4600  C  CB    . GLU D  1 144 ? 10.871  23.031  31.078  1.00 30.67 ? 144  GLU D CB    1 
ATOM   4601  C  CG    . GLU D  1 144 ? 12.273  23.578  31.298  1.00 33.13 ? 144  GLU D CG    1 
ATOM   4602  C  CD    . GLU D  1 144 ? 13.190  23.482  30.083  1.00 34.42 ? 144  GLU D CD    1 
ATOM   4603  O  OE1   . GLU D  1 144 ? 13.835  22.431  29.871  1.00 34.93 ? 144  GLU D OE1   1 
ATOM   4604  O  OE2   . GLU D  1 144 ? 13.289  24.483  29.355  1.00 34.13 ? 144  GLU D OE2   1 
ATOM   4605  N  N     . SER D  1 145 ? 8.725   25.725  31.736  1.00 29.57 ? 145  SER D N     1 
ATOM   4606  C  CA    . SER D  1 145 ? 7.712   26.281  32.615  1.00 29.06 ? 145  SER D CA    1 
ATOM   4607  C  C     . SER D  1 145 ? 7.300   27.681  32.164  1.00 28.82 ? 145  SER D C     1 
ATOM   4608  O  O     . SER D  1 145 ? 8.144   28.550  31.909  1.00 28.65 ? 145  SER D O     1 
ATOM   4609  C  CB    . SER D  1 145 ? 8.210   26.294  34.063  1.00 29.22 ? 145  SER D CB    1 
ATOM   4610  O  OG    . SER D  1 145 ? 7.376   27.104  34.869  1.00 29.65 ? 145  SER D OG    1 
ATOM   4611  N  N     . VAL D  1 146 ? 5.995   27.889  32.054  1.00 28.34 ? 146  VAL D N     1 
ATOM   4612  C  CA    . VAL D  1 146 ? 5.451   29.179  31.651  1.00 28.05 ? 146  VAL D CA    1 
ATOM   4613  C  C     . VAL D  1 146 ? 4.233   29.475  32.507  1.00 27.98 ? 146  VAL D C     1 
ATOM   4614  O  O     . VAL D  1 146 ? 3.329   28.650  32.595  1.00 27.92 ? 146  VAL D O     1 
ATOM   4615  C  CB    . VAL D  1 146 ? 5.067   29.197  30.152  1.00 28.07 ? 146  VAL D CB    1 
ATOM   4616  C  CG1   . VAL D  1 146 ? 4.269   30.451  29.806  1.00 27.99 ? 146  VAL D CG1   1 
ATOM   4617  C  CG2   . VAL D  1 146 ? 6.301   29.084  29.285  1.00 27.74 ? 146  VAL D CG2   1 
ATOM   4618  N  N     . VAL D  1 147 ? 4.239   30.634  33.173  1.00 28.02 ? 147  VAL D N     1 
ATOM   4619  C  CA    . VAL D  1 147 ? 3.090   31.109  33.951  1.00 27.73 ? 147  VAL D CA    1 
ATOM   4620  C  C     . VAL D  1 147 ? 2.758   32.541  33.551  1.00 27.75 ? 147  VAL D C     1 
ATOM   4621  O  O     . VAL D  1 147 ? 3.639   33.293  33.136  1.00 27.50 ? 147  VAL D O     1 
ATOM   4622  C  CB    . VAL D  1 147 ? 3.291   31.041  35.511  1.00 27.79 ? 147  VAL D CB    1 
ATOM   4623  C  CG1   . VAL D  1 147 ? 3.635   29.637  35.990  1.00 27.49 ? 147  VAL D CG1   1 
ATOM   4624  C  CG2   . VAL D  1 147 ? 4.339   32.043  35.999  1.00 28.36 ? 147  VAL D CG2   1 
ATOM   4625  N  N     . LYS D  1 148 ? 1.478   32.897  33.655  1.00 27.77 ? 148  LYS D N     1 
ATOM   4626  C  CA    . LYS D  1 148 ? 1.039   34.274  33.469  1.00 27.82 ? 148  LYS D CA    1 
ATOM   4627  C  C     . LYS D  1 148 ? 0.396   34.801  34.745  1.00 27.85 ? 148  LYS D C     1 
ATOM   4628  O  O     . LYS D  1 148 ? -0.652  34.311  35.183  1.00 27.86 ? 148  LYS D O     1 
ATOM   4629  C  CB    . LYS D  1 148 ? 0.080   34.434  32.286  1.00 27.53 ? 148  LYS D CB    1 
ATOM   4630  C  CG    . LYS D  1 148 ? -0.101  35.899  31.897  1.00 28.04 ? 148  LYS D CG    1 
ATOM   4631  C  CD    . LYS D  1 148 ? -1.030  36.114  30.719  1.00 29.54 ? 148  LYS D CD    1 
ATOM   4632  C  CE    . LYS D  1 148 ? -1.443  37.581  30.645  1.00 30.33 ? 148  LYS D CE    1 
ATOM   4633  N  NZ    . LYS D  1 148 ? -1.714  38.042  29.246  1.00 31.77 ? 148  LYS D NZ    1 
ATOM   4634  N  N     . LEU D  1 149 ? 1.042   35.792  35.345  1.00 27.78 ? 149  LEU D N     1 
ATOM   4635  C  CA    . LEU D  1 149 ? 0.544   36.397  36.565  1.00 27.95 ? 149  LEU D CA    1 
ATOM   4636  C  C     . LEU D  1 149 ? -0.561  37.399  36.271  1.00 28.50 ? 149  LEU D C     1 
ATOM   4637  O  O     . LEU D  1 149 ? -0.795  37.791  35.127  1.00 28.79 ? 149  LEU D O     1 
ATOM   4638  C  CB    . LEU D  1 149 ? 1.676   37.060  37.341  1.00 27.87 ? 149  LEU D CB    1 
ATOM   4639  C  CG    . LEU D  1 149 ? 2.818   36.146  37.799  1.00 27.48 ? 149  LEU D CG    1 
ATOM   4640  C  CD1   . LEU D  1 149 ? 3.813   36.935  38.639  1.00 26.01 ? 149  LEU D CD1   1 
ATOM   4641  C  CD2   . LEU D  1 149 ? 2.285   34.926  38.566  1.00 25.94 ? 149  LEU D CD2   1 
ATOM   4642  N  N     . THR D  1 150 ? -1.245  37.810  37.324  1.00 28.90 ? 150  THR D N     1 
ATOM   4643  C  CA    . THR D  1 150 ? -2.405  38.663  37.196  1.00 29.30 ? 150  THR D CA    1 
ATOM   4644  C  C     . THR D  1 150 ? -2.201  39.902  38.063  1.00 28.93 ? 150  THR D C     1 
ATOM   4645  O  O     . THR D  1 150 ? -1.513  39.842  39.077  1.00 28.58 ? 150  THR D O     1 
ATOM   4646  C  CB    . THR D  1 150 ? -3.659  37.820  37.588  1.00 29.72 ? 150  THR D CB    1 
ATOM   4647  O  OG1   . THR D  1 150 ? -4.616  37.848  36.523  1.00 31.77 ? 150  THR D OG1   1 
ATOM   4648  C  CG2   . THR D  1 150 ? -4.397  38.385  38.795  1.00 29.86 ? 150  THR D CG2   1 
ATOM   4649  N  N     . ALA D  1 151 ? -2.769  41.026  37.635  1.00 28.79 ? 151  ALA D N     1 
ATOM   4650  C  CA    . ALA D  1 151 ? -2.734  42.256  38.406  1.00 28.82 ? 151  ALA D CA    1 
ATOM   4651  C  C     . ALA D  1 151 ? -4.159  42.640  38.836  1.00 29.13 ? 151  ALA D C     1 
ATOM   4652  O  O     . ALA D  1 151 ? -5.129  41.959  38.476  1.00 29.01 ? 151  ALA D O     1 
ATOM   4653  C  CB    . ALA D  1 151 ? -2.099  43.360  37.589  1.00 28.23 ? 151  ALA D CB    1 
ATOM   4654  N  N     . VAL D  1 152 ? -4.288  43.719  39.605  1.00 29.43 ? 152  VAL D N     1 
ATOM   4655  C  CA    . VAL D  1 152 ? -5.607  44.271  39.919  1.00 30.09 ? 152  VAL D CA    1 
ATOM   4656  C  C     . VAL D  1 152 ? -5.927  45.433  38.968  1.00 30.51 ? 152  VAL D C     1 
ATOM   4657  O  O     . VAL D  1 152 ? -5.091  46.319  38.759  1.00 30.38 ? 152  VAL D O     1 
ATOM   4658  C  CB    . VAL D  1 152 ? -5.712  44.722  41.402  1.00 30.23 ? 152  VAL D CB    1 
ATOM   4659  C  CG1   . VAL D  1 152 ? -7.071  45.342  41.701  1.00 30.57 ? 152  VAL D CG1   1 
ATOM   4660  C  CG2   . VAL D  1 152 ? -5.455  43.550  42.343  1.00 29.58 ? 152  VAL D CG2   1 
ATOM   4661  N  N     . CYS D  1 153 ? -7.122  45.412  38.377  1.00 31.16 ? 153  CYS D N     1 
ATOM   4662  C  CA    . CYS D  1 153 ? -7.566  46.509  37.510  1.00 32.05 ? 153  CYS D CA    1 
ATOM   4663  C  C     . CYS D  1 153 ? -7.607  47.803  38.301  1.00 32.87 ? 153  CYS D C     1 
ATOM   4664  O  O     . CYS D  1 153 ? -8.302  47.900  39.318  1.00 32.82 ? 153  CYS D O     1 
ATOM   4665  C  CB    . CYS D  1 153 ? -8.945  46.234  36.890  1.00 32.01 ? 153  CYS D CB    1 
ATOM   4666  S  SG    . CYS D  1 153 ? -9.491  47.510  35.713  1.00 31.66 ? 153  CYS D SG    1 
ATOM   4667  N  N     . MET D  1 154 ? -6.846  48.788  37.837  1.00 33.88 ? 154  MET D N     1 
ATOM   4668  C  CA    . MET D  1 154 ? -6.740  50.073  38.519  1.00 35.01 ? 154  MET D CA    1 
ATOM   4669  C  C     . MET D  1 154 ? -7.962  50.968  38.283  1.00 35.87 ? 154  MET D C     1 
ATOM   4670  O  O     . MET D  1 154 ? -8.069  52.051  38.855  1.00 36.42 ? 154  MET D O     1 
ATOM   4671  C  CB    . MET D  1 154 ? -5.447  50.777  38.108  1.00 34.66 ? 154  MET D CB    1 
ATOM   4672  C  CG    . MET D  1 154 ? -4.225  50.200  38.800  1.00 34.92 ? 154  MET D CG    1 
ATOM   4673  S  SD    . MET D  1 154 ? -2.661  50.653  38.022  1.00 35.68 ? 154  MET D SD    1 
ATOM   4674  C  CE    . MET D  1 154 ? -1.527  49.993  39.185  1.00 36.37 ? 154  MET D CE    1 
ATOM   4675  N  N     . GLU D  1 155 ? -8.888  50.504  37.454  1.00 36.73 ? 155  GLU D N     1 
ATOM   4676  C  CA    . GLU D  1 155 ? -10.066 51.287  37.110  1.00 37.57 ? 155  GLU D CA    1 
ATOM   4677  C  C     . GLU D  1 155 ? -11.385 50.686  37.626  1.00 37.77 ? 155  GLU D C     1 
ATOM   4678  O  O     . GLU D  1 155 ? -12.301 51.438  37.982  1.00 37.98 ? 155  GLU D O     1 
ATOM   4679  C  CB    . GLU D  1 155 ? -10.080 51.583  35.602  1.00 37.87 ? 155  GLU D CB    1 
ATOM   4680  C  CG    . GLU D  1 155 ? -8.737  52.146  35.113  1.00 39.30 ? 155  GLU D CG    1 
ATOM   4681  C  CD    . GLU D  1 155 ? -8.744  52.671  33.687  1.00 41.35 ? 155  GLU D CD    1 
ATOM   4682  O  OE1   . GLU D  1 155 ? -7.699  53.225  33.255  1.00 42.40 ? 155  GLU D OE1   1 
ATOM   4683  O  OE2   . GLU D  1 155 ? -9.772  52.529  32.992  1.00 42.18 ? 155  GLU D OE2   1 
ATOM   4684  N  N     . CYS D  1 156 ? -11.476 49.353  37.694  1.00 37.88 ? 156  CYS D N     1 
ATOM   4685  C  CA    . CYS D  1 156 ? -12.674 48.691  38.239  1.00 37.90 ? 156  CYS D CA    1 
ATOM   4686  C  C     . CYS D  1 156 ? -12.375 47.685  39.357  1.00 38.12 ? 156  CYS D C     1 
ATOM   4687  O  O     . CYS D  1 156 ? -13.295 47.144  39.967  1.00 38.02 ? 156  CYS D O     1 
ATOM   4688  C  CB    . CYS D  1 156 ? -13.508 48.047  37.132  1.00 37.73 ? 156  CYS D CB    1 
ATOM   4689  S  SG    . CYS D  1 156 ? -13.019 46.358  36.693  1.00 37.65 ? 156  CYS D SG    1 
ATOM   4690  N  N     . PHE D  1 157 ? -11.087 47.440  39.611  1.00 38.45 ? 157  PHE D N     1 
ATOM   4691  C  CA    . PHE D  1 157 ? -10.620 46.603  40.730  1.00 38.83 ? 157  PHE D CA    1 
ATOM   4692  C  C     . PHE D  1 157 ? -10.927 45.098  40.626  1.00 38.92 ? 157  PHE D C     1 
ATOM   4693  O  O     . PHE D  1 157 ? -10.818 44.360  41.608  1.00 39.32 ? 157  PHE D O     1 
ATOM   4694  C  CB    . PHE D  1 157 ? -11.053 47.201  42.086  1.00 38.91 ? 157  PHE D CB    1 
ATOM   4695  C  CG    . PHE D  1 157 ? -10.892 48.703  42.162  1.00 39.55 ? 157  PHE D CG    1 
ATOM   4696  C  CD1   . PHE D  1 157 ? -12.008 49.534  42.252  1.00 40.32 ? 157  PHE D CD1   1 
ATOM   4697  C  CD2   . PHE D  1 157 ? -9.627  49.286  42.106  1.00 39.73 ? 157  PHE D CD2   1 
ATOM   4698  C  CE1   . PHE D  1 157 ? -11.864 50.919  42.303  1.00 40.76 ? 157  PHE D CE1   1 
ATOM   4699  C  CE2   . PHE D  1 157 ? -9.473  50.673  42.152  1.00 40.33 ? 157  PHE D CE2   1 
ATOM   4700  C  CZ    . PHE D  1 157 ? -10.592 51.490  42.255  1.00 40.84 ? 157  PHE D CZ    1 
ATOM   4701  N  N     . ARG D  1 158 ? -11.295 44.642  39.435  1.00 38.83 ? 158  ARG D N     1 
ATOM   4702  C  CA    . ARG D  1 158 ? -11.342 43.209  39.147  1.00 38.87 ? 158  ARG D CA    1 
ATOM   4703  C  C     . ARG D  1 158 ? -9.957  42.734  38.700  1.00 37.89 ? 158  ARG D C     1 
ATOM   4704  O  O     . ARG D  1 158 ? -8.992  43.503  38.745  1.00 37.68 ? 158  ARG D O     1 
ATOM   4705  C  CB    . ARG D  1 158 ? -12.419 42.915  38.098  1.00 39.43 ? 158  ARG D CB    1 
ATOM   4706  C  CG    . ARG D  1 158 ? -13.834 42.979  38.682  1.00 42.22 ? 158  ARG D CG    1 
ATOM   4707  C  CD    . ARG D  1 158 ? -14.944 42.647  37.699  1.00 47.86 ? 158  ARG D CD    1 
ATOM   4708  N  NE    . ARG D  1 158 ? -15.443 41.277  37.880  1.00 52.27 ? 158  ARG D NE    1 
ATOM   4709  C  CZ    . ARG D  1 158 ? -16.638 40.957  38.381  1.00 54.16 ? 158  ARG D CZ    1 
ATOM   4710  N  NH1   . ARG D  1 158 ? -17.492 41.902  38.765  1.00 54.68 ? 158  ARG D NH1   1 
ATOM   4711  N  NH2   . ARG D  1 158 ? -16.979 39.679  38.497  1.00 55.07 ? 158  ARG D NH2   1 
ATOM   4712  N  N     . GLU D  1 159 ? -9.844  41.473  38.296  1.00 37.10 ? 159  GLU D N     1 
ATOM   4713  C  CA    . GLU D  1 159 ? -8.557  40.940  37.836  1.00 36.42 ? 159  GLU D CA    1 
ATOM   4714  C  C     . GLU D  1 159 ? -8.126  41.590  36.519  1.00 34.95 ? 159  GLU D C     1 
ATOM   4715  O  O     . GLU D  1 159 ? -8.929  41.728  35.598  1.00 34.52 ? 159  GLU D O     1 
ATOM   4716  C  CB    . GLU D  1 159 ? -8.612  39.425  37.692  1.00 36.59 ? 159  GLU D CB    1 
ATOM   4717  C  CG    . GLU D  1 159 ? -8.572  38.703  39.027  1.00 40.73 ? 159  GLU D CG    1 
ATOM   4718  C  CD    . GLU D  1 159 ? -7.860  37.360  38.959  1.00 45.12 ? 159  GLU D CD    1 
ATOM   4719  O  OE1   . GLU D  1 159 ? -7.792  36.770  37.844  1.00 45.94 ? 159  GLU D OE1   1 
ATOM   4720  O  OE2   . GLU D  1 159 ? -7.368  36.904  40.025  1.00 45.72 ? 159  GLU D OE2   1 
ATOM   4721  N  N     . ALA D  1 160 ? -6.859  41.990  36.450  1.00 33.35 ? 160  ALA D N     1 
ATOM   4722  C  CA    . ALA D  1 160 ? -6.298  42.620  35.259  1.00 32.14 ? 160  ALA D CA    1 
ATOM   4723  C  C     . ALA D  1 160 ? -5.281  41.722  34.552  1.00 31.39 ? 160  ALA D C     1 
ATOM   4724  O  O     . ALA D  1 160 ? -4.389  41.161  35.184  1.00 31.24 ? 160  ALA D O     1 
ATOM   4725  C  CB    . ALA D  1 160 ? -5.652  43.948  35.617  1.00 32.09 ? 160  ALA D CB    1 
ATOM   4726  N  N     . ALA D  1 161 ? -5.411  41.619  33.235  1.00 30.39 ? 161  ALA D N     1 
ATOM   4727  C  CA    . ALA D  1 161 ? -4.489  40.845  32.423  1.00 29.72 ? 161  ALA D CA    1 
ATOM   4728  C  C     . ALA D  1 161 ? -3.658  41.716  31.473  1.00 29.48 ? 161  ALA D C     1 
ATOM   4729  O  O     . ALA D  1 161 ? -2.688  41.235  30.872  1.00 29.06 ? 161  ALA D O     1 
ATOM   4730  C  CB    . ALA D  1 161 ? -5.250  39.803  31.643  1.00 29.79 ? 161  ALA D CB    1 
ATOM   4731  N  N     . TYR D  1 162 ? -4.034  42.992  31.342  1.00 29.27 ? 162  TYR D N     1 
ATOM   4732  C  CA    . TYR D  1 162 ? -3.428  43.885  30.342  1.00 29.33 ? 162  TYR D CA    1 
ATOM   4733  C  C     . TYR D  1 162 ? -2.870  45.162  30.931  1.00 29.39 ? 162  TYR D C     1 
ATOM   4734  O  O     . TYR D  1 162 ? -3.173  45.514  32.062  1.00 29.15 ? 162  TYR D O     1 
ATOM   4735  C  CB    . TYR D  1 162 ? -4.438  44.228  29.232  1.00 29.19 ? 162  TYR D CB    1 
ATOM   4736  C  CG    . TYR D  1 162 ? -5.283  43.057  28.802  1.00 29.36 ? 162  TYR D CG    1 
ATOM   4737  C  CD1   . TYR D  1 162 ? -6.650  43.027  29.075  1.00 29.40 ? 162  TYR D CD1   1 
ATOM   4738  C  CD2   . TYR D  1 162 ? -4.707  41.956  28.153  1.00 29.13 ? 162  TYR D CD2   1 
ATOM   4739  C  CE1   . TYR D  1 162 ? -7.428  41.937  28.696  1.00 30.94 ? 162  TYR D CE1   1 
ATOM   4740  C  CE2   . TYR D  1 162 ? -5.474  40.860  27.768  1.00 29.35 ? 162  TYR D CE2   1 
ATOM   4741  C  CZ    . TYR D  1 162 ? -6.831  40.856  28.042  1.00 31.38 ? 162  TYR D CZ    1 
ATOM   4742  O  OH    . TYR D  1 162 ? -7.600  39.775  27.676  1.00 32.63 ? 162  TYR D OH    1 
ATOM   4743  N  N     . THR D  1 163 ? -2.055  45.850  30.138  1.00 29.95 ? 163  THR D N     1 
ATOM   4744  C  CA    . THR D  1 163 ? -1.536  47.168  30.493  1.00 30.51 ? 163  THR D CA    1 
ATOM   4745  C  C     . THR D  1 163 ? -2.045  48.212  29.499  1.00 31.40 ? 163  THR D C     1 
ATOM   4746  O  O     . THR D  1 163 ? -1.883  48.062  28.284  1.00 31.29 ? 163  THR D O     1 
ATOM   4747  C  CB    . THR D  1 163 ? 0.005   47.173  30.509  1.00 30.44 ? 163  THR D CB    1 
ATOM   4748  O  OG1   . THR D  1 163 ? 0.496   46.052  31.258  1.00 29.88 ? 163  THR D OG1   1 
ATOM   4749  C  CG2   . THR D  1 163 ? 0.524   48.381  31.294  1.00 30.46 ? 163  THR D CG2   1 
ATOM   4750  N  N     . LYS D  1 164 ? -2.655  49.266  30.029  1.00 32.35 ? 164  LYS D N     1 
ATOM   4751  C  CA    . LYS D  1 164 ? -3.096  50.397  29.225  1.00 33.61 ? 164  LYS D CA    1 
ATOM   4752  C  C     . LYS D  1 164 ? -2.126  51.571  29.397  1.00 34.15 ? 164  LYS D C     1 
ATOM   4753  O  O     . LYS D  1 164 ? -1.735  51.904  30.511  1.00 34.09 ? 164  LYS D O     1 
ATOM   4754  C  CB    . LYS D  1 164 ? -4.535  50.777  29.609  1.00 33.79 ? 164  LYS D CB    1 
ATOM   4755  C  CG    . LYS D  1 164 ? -4.969  52.195  29.269  1.00 35.23 ? 164  LYS D CG    1 
ATOM   4756  C  CD    . LYS D  1 164 ? -6.321  52.200  28.582  1.00 38.32 ? 164  LYS D CD    1 
ATOM   4757  C  CE    . LYS D  1 164 ? -7.274  53.191  29.225  1.00 40.57 ? 164  LYS D CE    1 
ATOM   4758  N  NZ    . LYS D  1 164 ? -8.164  52.543  30.245  1.00 43.14 ? 164  LYS D NZ    1 
ATOM   4759  N  N     . ARG D  1 165 ? -1.718  52.174  28.287  1.00 35.20 ? 165  ARG D N     1 
ATOM   4760  C  CA    . ARG D  1 165 ? -0.915  53.397  28.328  1.00 36.40 ? 165  ARG D CA    1 
ATOM   4761  C  C     . ARG D  1 165 ? -1.851  54.592  28.530  1.00 37.39 ? 165  ARG D C     1 
ATOM   4762  O  O     . ARG D  1 165 ? -2.870  54.700  27.851  1.00 37.33 ? 165  ARG D O     1 
ATOM   4763  C  CB    . ARG D  1 165 ? -0.105  53.557  27.038  1.00 35.84 ? 165  ARG D CB    1 
ATOM   4764  C  CG    . ARG D  1 165 ? 0.780   54.790  27.002  1.00 35.40 ? 165  ARG D CG    1 
ATOM   4765  C  CD    . ARG D  1 165 ? 1.736   54.849  25.826  1.00 34.45 ? 165  ARG D CD    1 
ATOM   4766  N  NE    . ARG D  1 165 ? 2.872   53.951  26.012  1.00 33.88 ? 165  ARG D NE    1 
ATOM   4767  C  CZ    . ARG D  1 165 ? 3.670   53.527  25.043  1.00 33.04 ? 165  ARG D CZ    1 
ATOM   4768  N  NH1   . ARG D  1 165 ? 3.476   53.922  23.795  1.00 33.03 ? 165  ARG D NH1   1 
ATOM   4769  N  NH2   . ARG D  1 165 ? 4.675   52.711  25.326  1.00 32.26 ? 165  ARG D NH2   1 
ATOM   4770  N  N     . LEU D  1 166 ? -1.500  55.473  29.463  1.00 38.75 ? 166  LEU D N     1 
ATOM   4771  C  CA    . LEU D  1 166 ? -2.327  56.637  29.792  1.00 40.37 ? 166  LEU D CA    1 
ATOM   4772  C  C     . LEU D  1 166 ? -2.181  57.787  28.786  1.00 41.55 ? 166  LEU D C     1 
ATOM   4773  O  O     . LEU D  1 166 ? -3.180  58.376  28.369  1.00 41.72 ? 166  LEU D O     1 
ATOM   4774  C  CB    . LEU D  1 166 ? -2.032  57.118  31.221  1.00 40.09 ? 166  LEU D CB    1 
ATOM   4775  C  CG    . LEU D  1 166 ? -2.326  56.112  32.345  1.00 40.10 ? 166  LEU D CG    1 
ATOM   4776  C  CD1   . LEU D  1 166 ? -1.809  56.615  33.680  1.00 40.16 ? 166  LEU D CD1   1 
ATOM   4777  C  CD2   . LEU D  1 166 ? -3.820  55.759  32.431  1.00 39.57 ? 166  LEU D CD2   1 
ATOM   4778  N  N     . GLY D  1 167 ? -0.942  58.087  28.394  1.00 42.78 ? 167  GLY D N     1 
ATOM   4779  C  CA    . GLY D  1 167 ? -0.658  59.162  27.458  1.00 44.35 ? 167  GLY D CA    1 
ATOM   4780  C  C     . GLY D  1 167 ? -0.924  58.831  25.994  1.00 45.54 ? 167  GLY D C     1 
ATOM   4781  O  O     . GLY D  1 167 ? -1.611  57.851  25.670  1.00 45.59 ? 167  GLY D O     1 
ATOM   4782  N  N     . THR D  1 168 ? -0.366  59.652  25.104  1.00 46.42 ? 168  THR D N     1 
ATOM   4783  C  CA    . THR D  1 168 ? -0.616  59.519  23.665  1.00 47.26 ? 168  THR D CA    1 
ATOM   4784  C  C     . THR D  1 168 ? 0.593   59.043  22.865  1.00 47.56 ? 168  THR D C     1 
ATOM   4785  O  O     . THR D  1 168 ? 0.492   58.865  21.654  1.00 47.78 ? 168  THR D O     1 
ATOM   4786  C  CB    . THR D  1 168 ? -1.119  60.858  23.049  1.00 47.34 ? 168  THR D CB    1 
ATOM   4787  O  OG1   . THR D  1 168 ? -0.147  61.889  23.273  1.00 47.16 ? 168  THR D OG1   1 
ATOM   4788  C  CG2   . THR D  1 168 ? -2.391  61.367  23.745  1.00 47.34 ? 168  THR D CG2   1 
ATOM   4789  N  N     . GLU D  1 169 ? 1.732   58.858  23.527  1.00 48.05 ? 169  GLU D N     1 
ATOM   4790  C  CA    . GLU D  1 169 ? 2.951   58.430  22.835  1.00 48.57 ? 169  GLU D CA    1 
ATOM   4791  C  C     . GLU D  1 169 ? 2.764   57.072  22.132  1.00 48.53 ? 169  GLU D C     1 
ATOM   4792  O  O     . GLU D  1 169 ? 2.051   56.189  22.625  1.00 48.45 ? 169  GLU D O     1 
ATOM   4793  C  CB    . GLU D  1 169 ? 4.171   58.456  23.768  1.00 48.74 ? 169  GLU D CB    1 
ATOM   4794  C  CG    . GLU D  1 169 ? 3.981   57.769  25.113  1.00 50.78 ? 169  GLU D CG    1 
ATOM   4795  C  CD    . GLU D  1 169 ? 3.850   58.741  26.280  1.00 52.60 ? 169  GLU D CD    1 
ATOM   4796  O  OE1   . GLU D  1 169 ? 4.854   59.403  26.635  1.00 52.72 ? 169  GLU D OE1   1 
ATOM   4797  O  OE2   . GLU D  1 169 ? 2.739   58.827  26.854  1.00 53.06 ? 169  GLU D OE2   1 
ATOM   4798  N  N     . LYS D  1 170 ? 3.387   56.930  20.966  1.00 48.43 ? 170  LYS D N     1 
ATOM   4799  C  CA    . LYS D  1 170 ? 3.074   55.834  20.053  1.00 48.42 ? 170  LYS D CA    1 
ATOM   4800  C  C     . LYS D  1 170 ? 4.160   54.765  19.956  1.00 47.82 ? 170  LYS D C     1 
ATOM   4801  O  O     . LYS D  1 170 ? 3.884   53.637  19.544  1.00 47.78 ? 170  LYS D O     1 
ATOM   4802  C  CB    . LYS D  1 170 ? 2.752   56.389  18.660  1.00 48.90 ? 170  LYS D CB    1 
ATOM   4803  C  CG    . LYS D  1 170 ? 1.410   57.116  18.579  1.00 50.16 ? 170  LYS D CG    1 
ATOM   4804  C  CD    . LYS D  1 170 ? 1.365   58.064  17.392  1.00 52.95 ? 170  LYS D CD    1 
ATOM   4805  C  CE    . LYS D  1 170 ? 0.159   57.761  16.495  1.00 54.17 ? 170  LYS D CE    1 
ATOM   4806  N  NZ    . LYS D  1 170 ? -0.590  58.993  16.120  1.00 54.49 ? 170  LYS D NZ    1 
ATOM   4807  N  N     . GLU D  1 171 ? 5.388   55.122  20.329  1.00 47.09 ? 171  GLU D N     1 
ATOM   4808  C  CA    . GLU D  1 171 ? 6.497   54.166  20.331  1.00 46.48 ? 171  GLU D CA    1 
ATOM   4809  C  C     . GLU D  1 171 ? 6.305   53.107  21.425  1.00 45.54 ? 171  GLU D C     1 
ATOM   4810  O  O     . GLU D  1 171 ? 5.681   53.369  22.459  1.00 45.27 ? 171  GLU D O     1 
ATOM   4811  C  CB    . GLU D  1 171 ? 7.856   54.875  20.439  1.00 46.47 ? 171  GLU D CB    1 
ATOM   4812  C  CG    . GLU D  1 171 ? 8.081   55.668  21.720  1.00 48.60 ? 171  GLU D CG    1 
ATOM   4813  C  CD    . GLU D  1 171 ? 7.569   57.112  21.672  1.00 51.03 ? 171  GLU D CD    1 
ATOM   4814  O  OE1   . GLU D  1 171 ? 6.764   57.466  20.775  1.00 51.81 ? 171  GLU D OE1   1 
ATOM   4815  O  OE2   . GLU D  1 171 ? 7.976   57.906  22.556  1.00 51.58 ? 171  GLU D OE2   1 
ATOM   4816  N  N     . VAL D  1 172 ? 6.822   51.910  21.169  1.00 44.44 ? 172  VAL D N     1 
ATOM   4817  C  CA    . VAL D  1 172 ? 6.687   50.779  22.088  1.00 43.44 ? 172  VAL D CA    1 
ATOM   4818  C  C     . VAL D  1 172 ? 7.407   51.042  23.415  1.00 42.83 ? 172  VAL D C     1 
ATOM   4819  O  O     . VAL D  1 172 ? 6.781   51.011  24.475  1.00 42.59 ? 172  VAL D O     1 
ATOM   4820  C  CB    . VAL D  1 172 ? 7.171   49.444  21.425  1.00 43.46 ? 172  VAL D CB    1 
ATOM   4821  C  CG1   . VAL D  1 172 ? 7.194   48.292  22.424  1.00 43.16 ? 172  VAL D CG1   1 
ATOM   4822  C  CG2   . VAL D  1 172 ? 6.290   49.080  20.228  1.00 43.07 ? 172  VAL D CG2   1 
ATOM   4823  N  N     . GLU D  1 173 ? 8.707   51.324  23.344  1.00 42.07 ? 173  GLU D N     1 
ATOM   4824  C  CA    . GLU D  1 173 ? 9.515   51.547  24.541  1.00 41.77 ? 173  GLU D CA    1 
ATOM   4825  C  C     . GLU D  1 173 ? 9.326   52.940  25.174  1.00 41.23 ? 173  GLU D C     1 
ATOM   4826  O  O     . GLU D  1 173 ? 9.903   53.926  24.716  1.00 41.23 ? 173  GLU D O     1 
ATOM   4827  C  CB    . GLU D  1 173 ? 11.000  51.270  24.256  1.00 41.51 ? 173  GLU D CB    1 
ATOM   4828  C  CG    . GLU D  1 173 ? 11.867  51.346  25.508  1.00 42.48 ? 173  GLU D CG    1 
ATOM   4829  C  CD    . GLU D  1 173 ? 13.275  50.808  25.317  1.00 43.37 ? 173  GLU D CD    1 
ATOM   4830  O  OE1   . GLU D  1 173 ? 14.133  51.098  26.169  1.00 42.98 ? 173  GLU D OE1   1 
ATOM   4831  O  OE2   . GLU D  1 173 ? 13.527  50.090  24.327  1.00 44.73 ? 173  GLU D OE2   1 
ATOM   4832  N  N     . VAL D  1 174 ? 8.499   53.002  26.213  1.00 40.52 ? 174  VAL D N     1 
ATOM   4833  C  CA    . VAL D  1 174 ? 8.392   54.192  27.056  1.00 40.05 ? 174  VAL D CA    1 
ATOM   4834  C  C     . VAL D  1 174 ? 8.425   53.739  28.510  1.00 39.71 ? 174  VAL D C     1 
ATOM   4835  O  O     . VAL D  1 174 ? 7.481   53.117  29.004  1.00 39.73 ? 174  VAL D O     1 
ATOM   4836  C  CB    . VAL D  1 174 ? 7.115   55.042  26.769  1.00 39.84 ? 174  VAL D CB    1 
ATOM   4837  C  CG1   . VAL D  1 174 ? 7.081   56.258  27.667  1.00 39.31 ? 174  VAL D CG1   1 
ATOM   4838  C  CG2   . VAL D  1 174 ? 7.065   55.477  25.320  1.00 39.50 ? 174  VAL D CG2   1 
ATOM   4839  N  N     . ILE D  1 175 ? 9.530   54.041  29.178  1.00 39.31 ? 175  ILE D N     1 
ATOM   4840  C  CA    . ILE D  1 175 ? 9.723   53.649  30.561  1.00 39.25 ? 175  ILE D CA    1 
ATOM   4841  C  C     . ILE D  1 175 ? 8.870   54.506  31.505  1.00 39.07 ? 175  ILE D C     1 
ATOM   4842  O  O     . ILE D  1 175 ? 8.740   55.713  31.317  1.00 39.13 ? 175  ILE D O     1 
ATOM   4843  C  CB    . ILE D  1 175 ? 11.236  53.640  30.906  1.00 39.27 ? 175  ILE D CB    1 
ATOM   4844  C  CG1   . ILE D  1 175 ? 11.859  52.339  30.390  1.00 39.67 ? 175  ILE D CG1   1 
ATOM   4845  C  CG2   . ILE D  1 175 ? 11.480  53.731  32.400  1.00 38.97 ? 175  ILE D CG2   1 
ATOM   4846  C  CD1   . ILE D  1 175 ? 12.970  52.545  29.395  1.00 40.48 ? 175  ILE D CD1   1 
ATOM   4847  N  N     . GLY D  1 176 ? 8.261   53.855  32.492  1.00 38.80 ? 176  GLY D N     1 
ATOM   4848  C  CA    . GLY D  1 176 ? 7.371   54.515  33.428  1.00 38.37 ? 176  GLY D CA    1 
ATOM   4849  C  C     . GLY D  1 176 ? 6.643   53.533  34.326  1.00 38.24 ? 176  GLY D C     1 
ATOM   4850  O  O     . GLY D  1 176 ? 6.694   52.316  34.103  1.00 38.26 ? 176  GLY D O     1 
ATOM   4851  N  N     . GLY D  1 177 ? 5.972   54.064  35.346  1.00 37.96 ? 177  GLY D N     1 
ATOM   4852  C  CA    . GLY D  1 177 ? 5.217   53.261  36.289  1.00 37.54 ? 177  GLY D CA    1 
ATOM   4853  C  C     . GLY D  1 177 ? 3.740   53.585  36.216  1.00 37.64 ? 177  GLY D C     1 
ATOM   4854  O  O     . GLY D  1 177 ? 3.201   53.807  35.127  1.00 37.23 ? 177  GLY D O     1 
ATOM   4855  N  N     . ALA D  1 178 ? 3.089   53.627  37.378  1.00 37.95 ? 178  ALA D N     1 
ATOM   4856  C  CA    . ALA D  1 178 ? 1.654   53.873  37.441  1.00 38.41 ? 178  ALA D CA    1 
ATOM   4857  C  C     . ALA D  1 178 ? 1.257   55.299  37.047  1.00 38.69 ? 178  ALA D C     1 
ATOM   4858  O  O     . ALA D  1 178 ? 0.082   55.577  36.836  1.00 38.88 ? 178  ALA D O     1 
ATOM   4859  C  CB    . ALA D  1 178 ? 1.088   53.475  38.784  1.00 38.50 ? 178  ALA D CB    1 
ATOM   4860  N  N     . ASP D  1 179 ? 2.250   56.174  36.908  1.00 39.07 ? 179  ASP D N     1 
ATOM   4861  C  CA    . ASP D  1 179 ? 2.061   57.508  36.336  1.00 39.43 ? 179  ASP D CA    1 
ATOM   4862  C  C     . ASP D  1 179 ? 1.753   57.445  34.836  1.00 38.96 ? 179  ASP D C     1 
ATOM   4863  O  O     . ASP D  1 179 ? 1.018   58.290  34.311  1.00 39.35 ? 179  ASP D O     1 
ATOM   4864  C  CB    . ASP D  1 179 ? 3.289   58.399  36.609  1.00 39.65 ? 179  ASP D CB    1 
ATOM   4865  C  CG    . ASP D  1 179 ? 4.599   57.801  36.074  1.00 41.64 ? 179  ASP D CG    1 
ATOM   4866  O  OD1   . ASP D  1 179 ? 4.920   56.631  36.391  1.00 43.06 ? 179  ASP D OD1   1 
ATOM   4867  O  OD2   . ASP D  1 179 ? 5.390   58.438  35.342  1.00 43.72 ? 179  ASP D OD2   1 
ATOM   4868  N  N     . LYS D  1 180 ? 2.296   56.436  34.156  1.00 37.88 ? 180  LYS D N     1 
ATOM   4869  C  CA    . LYS D  1 180 ? 2.160   56.308  32.705  1.00 36.83 ? 180  LYS D CA    1 
ATOM   4870  C  C     . LYS D  1 180 ? 1.286   55.135  32.249  1.00 35.61 ? 180  LYS D C     1 
ATOM   4871  O  O     . LYS D  1 180 ? 0.841   55.096  31.102  1.00 35.45 ? 180  LYS D O     1 
ATOM   4872  C  CB    . LYS D  1 180 ? 3.545   56.187  32.057  1.00 37.02 ? 180  LYS D CB    1 
ATOM   4873  C  CG    . LYS D  1 180 ? 4.353   57.470  32.103  1.00 38.81 ? 180  LYS D CG    1 
ATOM   4874  C  CD    . LYS D  1 180 ? 5.390   57.526  30.994  1.00 41.56 ? 180  LYS D CD    1 
ATOM   4875  C  CE    . LYS D  1 180 ? 6.635   58.279  31.453  1.00 43.72 ? 180  LYS D CE    1 
ATOM   4876  N  NZ    . LYS D  1 180 ? 6.386   59.757  31.585  1.00 45.63 ? 180  LYS D NZ    1 
ATOM   4877  N  N     . TYR D  1 181 ? 1.063   54.174  33.139  1.00 34.00 ? 181  TYR D N     1 
ATOM   4878  C  CA    . TYR D  1 181 ? 0.336   52.956  32.790  1.00 32.43 ? 181  TYR D CA    1 
ATOM   4879  C  C     . TYR D  1 181 ? -0.632  52.518  33.882  1.00 32.00 ? 181  TYR D C     1 
ATOM   4880  O  O     . TYR D  1 181 ? -0.378  52.721  35.069  1.00 31.70 ? 181  TYR D O     1 
ATOM   4881  C  CB    . TYR D  1 181 ? 1.293   51.788  32.540  1.00 31.82 ? 181  TYR D CB    1 
ATOM   4882  C  CG    . TYR D  1 181 ? 2.298   51.943  31.427  1.00 30.30 ? 181  TYR D CG    1 
ATOM   4883  C  CD1   . TYR D  1 181 ? 3.591   52.384  31.693  1.00 28.39 ? 181  TYR D CD1   1 
ATOM   4884  C  CD2   . TYR D  1 181 ? 1.981   51.579  30.113  1.00 28.84 ? 181  TYR D CD2   1 
ATOM   4885  C  CE1   . TYR D  1 181 ? 4.532   52.495  30.686  1.00 27.84 ? 181  TYR D CE1   1 
ATOM   4886  C  CE2   . TYR D  1 181 ? 2.923   51.685  29.093  1.00 27.11 ? 181  TYR D CE2   1 
ATOM   4887  C  CZ    . TYR D  1 181 ? 4.195   52.147  29.389  1.00 28.26 ? 181  TYR D CZ    1 
ATOM   4888  O  OH    . TYR D  1 181 ? 5.143   52.270  28.396  1.00 28.44 ? 181  TYR D OH    1 
ATOM   4889  N  N     . HIS D  1 182 ? -1.726  51.892  33.458  1.00 31.36 ? 182  HIS D N     1 
ATOM   4890  C  CA    . HIS D  1 182 ? -2.663  51.224  34.353  1.00 31.19 ? 182  HIS D CA    1 
ATOM   4891  C  C     . HIS D  1 182 ? -2.745  49.741  33.998  1.00 30.81 ? 182  HIS D C     1 
ATOM   4892  O  O     . HIS D  1 182 ? -2.873  49.382  32.825  1.00 30.74 ? 182  HIS D O     1 
ATOM   4893  C  CB    . HIS D  1 182 ? -4.064  51.833  34.216  1.00 30.99 ? 182  HIS D CB    1 
ATOM   4894  C  CG    . HIS D  1 182 ? -4.276  53.075  35.024  1.00 31.99 ? 182  HIS D CG    1 
ATOM   4895  N  ND1   . HIS D  1 182 ? -3.289  53.640  35.806  1.00 32.64 ? 182  HIS D ND1   1 
ATOM   4896  C  CD2   . HIS D  1 182 ? -5.368  53.865  35.170  1.00 32.34 ? 182  HIS D CD2   1 
ATOM   4897  C  CE1   . HIS D  1 182 ? -3.764  54.722  36.399  1.00 33.17 ? 182  HIS D CE1   1 
ATOM   4898  N  NE2   . HIS D  1 182 ? -5.022  54.882  36.027  1.00 32.62 ? 182  HIS D NE2   1 
ATOM   4899  N  N     . SER D  1 183 ? -2.679  48.875  35.000  1.00 30.25 ? 183  SER D N     1 
ATOM   4900  C  CA    . SER D  1 183 ? -3.083  47.488  34.792  1.00 29.70 ? 183  SER D CA    1 
ATOM   4901  C  C     . SER D  1 183 ? -4.593  47.484  34.688  1.00 29.36 ? 183  SER D C     1 
ATOM   4902  O  O     . SER D  1 183 ? -5.277  48.181  35.442  1.00 29.13 ? 183  SER D O     1 
ATOM   4903  C  CB    . SER D  1 183 ? -2.626  46.589  35.934  1.00 29.42 ? 183  SER D CB    1 
ATOM   4904  O  OG    . SER D  1 183 ? -3.001  47.136  37.177  1.00 29.20 ? 183  SER D OG    1 
ATOM   4905  N  N     . VAL D  1 184 ? -5.119  46.688  33.765  1.00 29.29 ? 184  VAL D N     1 
ATOM   4906  C  CA    . VAL D  1 184 ? -6.503  46.849  33.356  1.00 29.23 ? 184  VAL D CA    1 
ATOM   4907  C  C     . VAL D  1 184 ? -7.158  45.523  32.877  1.00 29.46 ? 184  VAL D C     1 
ATOM   4908  O  O     . VAL D  1 184 ? -6.485  44.644  32.336  1.00 29.18 ? 184  VAL D O     1 
ATOM   4909  C  CB    . VAL D  1 184 ? -6.529  48.014  32.316  1.00 29.09 ? 184  VAL D CB    1 
ATOM   4910  C  CG1   . VAL D  1 184 ? -7.083  47.601  31.016  1.00 29.92 ? 184  VAL D CG1   1 
ATOM   4911  C  CG2   . VAL D  1 184 ? -7.210  49.257  32.879  1.00 28.81 ? 184  VAL D CG2   1 
ATOM   4912  N  N     . CYS D  1 185 ? -8.460  45.371  33.126  1.00 29.67 ? 185  CYS D N     1 
ATOM   4913  C  CA    . CYS D  1 185 ? -9.231  44.238  32.615  1.00 29.93 ? 185  CYS D CA    1 
ATOM   4914  C  C     . CYS D  1 185 ? -9.589  44.470  31.152  1.00 30.26 ? 185  CYS D C     1 
ATOM   4915  O  O     . CYS D  1 185 ? -9.342  45.551  30.619  1.00 30.24 ? 185  CYS D O     1 
ATOM   4916  C  CB    . CYS D  1 185 ? -10.509 44.030  33.444  1.00 29.86 ? 185  CYS D CB    1 
ATOM   4917  S  SG    . CYS D  1 185 ? -11.792 45.299  33.237  1.00 29.95 ? 185  CYS D SG    1 
ATOM   4918  N  N     . ARG D  1 186 ? -10.165 43.461  30.505  1.00 30.59 ? 186  ARG D N     1 
ATOM   4919  C  CA    . ARG D  1 186 ? -10.618 43.585  29.116  1.00 31.32 ? 186  ARG D CA    1 
ATOM   4920  C  C     . ARG D  1 186 ? -11.562 44.778  28.898  1.00 32.13 ? 186  ARG D C     1 
ATOM   4921  O  O     . ARG D  1 186 ? -11.361 45.567  27.973  1.00 32.33 ? 186  ARG D O     1 
ATOM   4922  C  CB    . ARG D  1 186 ? -11.301 42.290  28.647  1.00 30.93 ? 186  ARG D CB    1 
ATOM   4923  C  CG    . ARG D  1 186 ? -11.989 42.373  27.292  1.00 30.21 ? 186  ARG D CG    1 
ATOM   4924  C  CD    . ARG D  1 186 ? -12.489 41.042  26.743  1.00 29.63 ? 186  ARG D CD    1 
ATOM   4925  N  NE    . ARG D  1 186 ? -11.425 40.035  26.767  1.00 30.20 ? 186  ARG D NE    1 
ATOM   4926  C  CZ    . ARG D  1 186 ? -10.652 39.728  25.735  1.00 29.05 ? 186  ARG D CZ    1 
ATOM   4927  N  NH1   . ARG D  1 186 ? -10.830 40.324  24.564  1.00 28.73 ? 186  ARG D NH1   1 
ATOM   4928  N  NH2   . ARG D  1 186 ? -9.710  38.802  25.872  1.00 28.76 ? 186  ARG D NH2   1 
ATOM   4929  N  N     . LEU D  1 187 ? -12.588 44.900  29.737  1.00 32.97 ? 187  LEU D N     1 
ATOM   4930  C  CA    . LEU D  1 187 ? -13.590 45.944  29.549  1.00 34.00 ? 187  LEU D CA    1 
ATOM   4931  C  C     . LEU D  1 187 ? -13.022 47.344  29.753  1.00 34.25 ? 187  LEU D C     1 
ATOM   4932  O  O     . LEU D  1 187 ? -13.314 48.237  28.970  1.00 34.61 ? 187  LEU D O     1 
ATOM   4933  C  CB    . LEU D  1 187 ? -14.827 45.707  30.427  1.00 34.22 ? 187  LEU D CB    1 
ATOM   4934  C  CG    . LEU D  1 187 ? -15.783 44.601  29.953  1.00 35.11 ? 187  LEU D CG    1 
ATOM   4935  C  CD1   . LEU D  1 187 ? -16.849 44.370  31.002  1.00 36.60 ? 187  LEU D CD1   1 
ATOM   4936  C  CD2   . LEU D  1 187 ? -16.421 44.903  28.575  1.00 36.02 ? 187  LEU D CD2   1 
ATOM   4937  N  N     . CYS D  1 188 ? -12.200 47.528  30.787  1.00 34.56 ? 188  CYS D N     1 
ATOM   4938  C  CA    . CYS D  1 188 ? -11.572 48.826  31.043  1.00 34.83 ? 188  CYS D CA    1 
ATOM   4939  C  C     . CYS D  1 188 ? -10.522 49.191  30.000  1.00 35.05 ? 188  CYS D C     1 
ATOM   4940  O  O     . CYS D  1 188 ? -10.298 50.379  29.748  1.00 35.03 ? 188  CYS D O     1 
ATOM   4941  C  CB    . CYS D  1 188 ? -10.978 48.893  32.445  1.00 34.79 ? 188  CYS D CB    1 
ATOM   4942  S  SG    . CYS D  1 188 ? -12.233 48.845  33.744  1.00 35.37 ? 188  CYS D SG    1 
ATOM   4943  N  N     . TYR D  1 189 ? -9.899  48.177  29.388  1.00 35.23 ? 189  TYR D N     1 
ATOM   4944  C  CA    . TYR D  1 189 ? -8.935  48.402  28.307  1.00 35.48 ? 189  TYR D CA    1 
ATOM   4945  C  C     . TYR D  1 189 ? -9.568  49.120  27.117  1.00 36.55 ? 189  TYR D C     1 
ATOM   4946  O  O     . TYR D  1 189 ? -8.929  49.964  26.492  1.00 36.22 ? 189  TYR D O     1 
ATOM   4947  C  CB    . TYR D  1 189 ? -8.254  47.096  27.843  1.00 34.79 ? 189  TYR D CB    1 
ATOM   4948  C  CG    . TYR D  1 189 ? -7.221  47.324  26.745  1.00 32.97 ? 189  TYR D CG    1 
ATOM   4949  C  CD1   . TYR D  1 189 ? -5.888  47.614  27.054  1.00 30.77 ? 189  TYR D CD1   1 
ATOM   4950  C  CD2   . TYR D  1 189 ? -7.588  47.287  25.402  1.00 30.85 ? 189  TYR D CD2   1 
ATOM   4951  C  CE1   . TYR D  1 189 ? -4.950  47.847  26.046  1.00 30.79 ? 189  TYR D CE1   1 
ATOM   4952  C  CE2   . TYR D  1 189 ? -6.667  47.517  24.393  1.00 30.03 ? 189  TYR D CE2   1 
ATOM   4953  C  CZ    . TYR D  1 189 ? -5.352  47.795  24.711  1.00 30.73 ? 189  TYR D CZ    1 
ATOM   4954  O  OH    . TYR D  1 189 ? -4.445  48.008  23.693  1.00 30.64 ? 189  TYR D OH    1 
ATOM   4955  N  N     . PHE D  1 190 ? -10.818 48.769  26.808  1.00 38.15 ? 190  PHE D N     1 
ATOM   4956  C  CA    . PHE D  1 190 ? -11.507 49.287  25.620  1.00 39.86 ? 190  PHE D CA    1 
ATOM   4957  C  C     . PHE D  1 190 ? -12.419 50.486  25.912  1.00 41.33 ? 190  PHE D C     1 
ATOM   4958  O  O     . PHE D  1 190 ? -13.011 51.043  24.989  1.00 41.67 ? 190  PHE D O     1 
ATOM   4959  C  CB    . PHE D  1 190 ? -12.310 48.176  24.913  1.00 39.53 ? 190  PHE D CB    1 
ATOM   4960  C  CG    . PHE D  1 190 ? -11.461 47.226  24.095  1.00 38.89 ? 190  PHE D CG    1 
ATOM   4961  C  CD1   . PHE D  1 190 ? -11.317 45.897  24.481  1.00 37.59 ? 190  PHE D CD1   1 
ATOM   4962  C  CD2   . PHE D  1 190 ? -10.813 47.660  22.940  1.00 38.40 ? 190  PHE D CD2   1 
ATOM   4963  C  CE1   . PHE D  1 190 ? -10.538 45.013  23.737  1.00 37.41 ? 190  PHE D CE1   1 
ATOM   4964  C  CE2   . PHE D  1 190 ? -10.026 46.786  22.187  1.00 38.18 ? 190  PHE D CE2   1 
ATOM   4965  C  CZ    . PHE D  1 190 ? -9.891  45.457  22.585  1.00 37.89 ? 190  PHE D CZ    1 
ATOM   4966  N  N     . LYS D  1 191 ? -12.516 50.879  27.186  1.00 42.96 ? 191  LYS D N     1 
ATOM   4967  C  CA    . LYS D  1 191 ? -13.415 51.955  27.622  1.00 44.42 ? 191  LYS D CA    1 
ATOM   4968  C  C     . LYS D  1 191 ? -13.031 53.310  27.035  1.00 44.95 ? 191  LYS D C     1 
ATOM   4969  O  O     . LYS D  1 191 ? -11.871 53.723  27.119  1.00 45.74 ? 191  LYS D O     1 
ATOM   4970  C  CB    . LYS D  1 191 ? -13.435 52.045  29.152  1.00 44.83 ? 191  LYS D CB    1 
ATOM   4971  C  CG    . LYS D  1 191 ? -14.666 52.716  29.725  1.00 46.36 ? 191  LYS D CG    1 
ATOM   4972  C  CD    . LYS D  1 191 ? -14.840 52.372  31.192  1.00 49.18 ? 191  LYS D CD    1 
ATOM   4973  C  CE    . LYS D  1 191 ? -15.152 53.621  32.019  1.00 50.78 ? 191  LYS D CE    1 
ATOM   4974  N  NZ    . LYS D  1 191 ? -16.599 53.733  32.387  1.00 51.68 ? 191  LYS D NZ    1 
ATOM   4975  N  N     . ARG E  1 18  ? 35.203  61.023  -11.267 1.00 43.69 ? 18   ARG E N     1 
ATOM   4976  C  CA    . ARG E  1 18  ? 35.109  59.665  -10.645 1.00 43.42 ? 18   ARG E CA    1 
ATOM   4977  C  C     . ARG E  1 18  ? 35.471  59.676  -9.156  1.00 42.22 ? 18   ARG E C     1 
ATOM   4978  O  O     . ARG E  1 18  ? 36.634  59.485  -8.764  1.00 42.38 ? 18   ARG E O     1 
ATOM   4979  C  CB    . ARG E  1 18  ? 35.932  58.631  -11.418 1.00 43.85 ? 18   ARG E CB    1 
ATOM   4980  C  CG    . ARG E  1 18  ? 35.076  57.746  -12.306 1.00 46.33 ? 18   ARG E CG    1 
ATOM   4981  C  CD    . ARG E  1 18  ? 35.745  56.451  -12.755 1.00 50.61 ? 18   ARG E CD    1 
ATOM   4982  N  NE    . ARG E  1 18  ? 34.852  55.308  -12.566 1.00 54.31 ? 18   ARG E NE    1 
ATOM   4983  C  CZ    . ARG E  1 18  ? 33.951  54.890  -13.457 1.00 56.14 ? 18   ARG E CZ    1 
ATOM   4984  N  NH1   . ARG E  1 18  ? 33.822  55.504  -14.633 1.00 57.11 ? 18   ARG E NH1   1 
ATOM   4985  N  NH2   . ARG E  1 18  ? 33.183  53.845  -13.173 1.00 55.80 ? 18   ARG E NH2   1 
ATOM   4986  N  N     . GLY E  1 19  ? 34.447  59.903  -8.337  1.00 40.45 ? 19   GLY E N     1 
ATOM   4987  C  CA    . GLY E  1 19  ? 34.603  59.950  -6.899  1.00 38.18 ? 19   GLY E CA    1 
ATOM   4988  C  C     . GLY E  1 19  ? 34.626  58.582  -6.254  1.00 36.47 ? 19   GLY E C     1 
ATOM   4989  O  O     . GLY E  1 19  ? 34.327  57.580  -6.900  1.00 36.34 ? 19   GLY E O     1 
ATOM   4990  N  N     . GLN E  1 20  ? 34.944  58.562  -4.963  1.00 34.86 ? 20   GLN E N     1 
ATOM   4991  C  CA    . GLN E  1 20  ? 35.321  57.342  -4.260  1.00 33.46 ? 20   GLN E CA    1 
ATOM   4992  C  C     . GLN E  1 20  ? 35.349  57.575  -2.750  1.00 31.78 ? 20   GLN E C     1 
ATOM   4993  O  O     . GLN E  1 20  ? 35.737  58.648  -2.293  1.00 31.23 ? 20   GLN E O     1 
ATOM   4994  C  CB    . GLN E  1 20  ? 36.730  56.972  -4.715  1.00 33.84 ? 20   GLN E CB    1 
ATOM   4995  C  CG    . GLN E  1 20  ? 37.058  55.525  -4.707  1.00 35.53 ? 20   GLN E CG    1 
ATOM   4996  C  CD    . GLN E  1 20  ? 38.529  55.294  -4.941  1.00 36.84 ? 20   GLN E CD    1 
ATOM   4997  O  OE1   . GLN E  1 20  ? 39.155  56.020  -5.704  1.00 38.14 ? 20   GLN E OE1   1 
ATOM   4998  N  NE2   . GLN E  1 20  ? 39.087  54.296  -4.281  1.00 37.82 ? 20   GLN E NE2   1 
ATOM   4999  N  N     . ILE E  1 21  ? 34.938  56.561  -1.991  1.00 30.24 ? 21   ILE E N     1 
ATOM   5000  C  CA    . ILE E  1 21  ? 35.122  56.540  -0.541  1.00 28.49 ? 21   ILE E CA    1 
ATOM   5001  C  C     . ILE E  1 21  ? 35.959  55.327  -0.152  1.00 27.91 ? 21   ILE E C     1 
ATOM   5002  O  O     . ILE E  1 21  ? 35.622  54.187  -0.484  1.00 27.28 ? 21   ILE E O     1 
ATOM   5003  C  CB    . ILE E  1 21  ? 33.759  56.540  0.210   1.00 28.39 ? 21   ILE E CB    1 
ATOM   5004  C  CG1   . ILE E  1 21  ? 32.956  57.793  -0.153  1.00 27.97 ? 21   ILE E CG1   1 
ATOM   5005  C  CG2   . ILE E  1 21  ? 33.974  56.478  1.729   1.00 27.14 ? 21   ILE E CG2   1 
ATOM   5006  C  CD1   . ILE E  1 21  ? 31.603  57.879  0.492   1.00 27.48 ? 21   ILE E CD1   1 
ATOM   5007  N  N     . GLN E  1 22  ? 37.053  55.602  0.553   1.00 27.34 ? 22   GLN E N     1 
ATOM   5008  C  CA    . GLN E  1 22  ? 37.921  54.576  1.111   1.00 26.90 ? 22   GLN E CA    1 
ATOM   5009  C  C     . GLN E  1 22  ? 37.869  54.654  2.623   1.00 26.36 ? 22   GLN E C     1 
ATOM   5010  O  O     . GLN E  1 22  ? 37.960  55.737  3.192   1.00 26.62 ? 22   GLN E O     1 
ATOM   5011  C  CB    . GLN E  1 22  ? 39.344  54.806  0.642   1.00 27.03 ? 22   GLN E CB    1 
ATOM   5012  C  CG    . GLN E  1 22  ? 39.565  54.517  -0.821  1.00 27.87 ? 22   GLN E CG    1 
ATOM   5013  C  CD    . GLN E  1 22  ? 40.947  54.948  -1.266  1.00 29.35 ? 22   GLN E CD    1 
ATOM   5014  O  OE1   . GLN E  1 22  ? 41.884  54.965  -0.471  1.00 29.12 ? 22   GLN E OE1   1 
ATOM   5015  N  NE2   . GLN E  1 22  ? 41.069  55.323  -2.525  1.00 30.70 ? 22   GLN E NE2   1 
ATOM   5016  N  N     . VAL E  1 23  ? 37.728  53.506  3.276   1.00 25.73 ? 23   VAL E N     1 
ATOM   5017  C  CA    . VAL E  1 23  ? 37.621  53.461  4.724   1.00 24.96 ? 23   VAL E CA    1 
ATOM   5018  C  C     . VAL E  1 23  ? 38.746  52.617  5.314   1.00 24.73 ? 23   VAL E C     1 
ATOM   5019  O  O     . VAL E  1 23  ? 38.978  51.493  4.876   1.00 24.75 ? 23   VAL E O     1 
ATOM   5020  C  CB    . VAL E  1 23  ? 36.240  52.900  5.174   1.00 24.98 ? 23   VAL E CB    1 
ATOM   5021  C  CG1   . VAL E  1 23  ? 36.196  52.746  6.677   1.00 24.80 ? 23   VAL E CG1   1 
ATOM   5022  C  CG2   . VAL E  1 23  ? 35.108  53.806  4.713   1.00 24.31 ? 23   VAL E CG2   1 
ATOM   5023  N  N     . ILE E  1 24  ? 39.446  53.187  6.292   1.00 24.33 ? 24   ILE E N     1 
ATOM   5024  C  CA    . ILE E  1 24  ? 40.510  52.517  7.023   1.00 23.85 ? 24   ILE E CA    1 
ATOM   5025  C  C     . ILE E  1 24  ? 40.044  52.350  8.459   1.00 23.93 ? 24   ILE E C     1 
ATOM   5026  O  O     . ILE E  1 24  ? 39.936  53.323  9.200   1.00 24.05 ? 24   ILE E O     1 
ATOM   5027  C  CB    . ILE E  1 24  ? 41.809  53.357  7.011   1.00 23.96 ? 24   ILE E CB    1 
ATOM   5028  C  CG1   . ILE E  1 24  ? 42.341  53.542  5.590   1.00 23.42 ? 24   ILE E CG1   1 
ATOM   5029  C  CG2   . ILE E  1 24  ? 42.882  52.723  7.926   1.00 23.52 ? 24   ILE E CG2   1 
ATOM   5030  C  CD1   . ILE E  1 24  ? 43.246  54.782  5.453   1.00 22.33 ? 24   ILE E CD1   1 
ATOM   5031  N  N     . LEU E  1 25  ? 39.769  51.109  8.837   1.00 23.94 ? 25   LEU E N     1 
ATOM   5032  C  CA    . LEU E  1 25  ? 39.326  50.772  10.180  1.00 23.76 ? 25   LEU E CA    1 
ATOM   5033  C  C     . LEU E  1 25  ? 40.437  50.079  10.957  1.00 23.69 ? 25   LEU E C     1 
ATOM   5034  O  O     . LEU E  1 25  ? 41.462  49.706  10.383  1.00 23.58 ? 25   LEU E O     1 
ATOM   5035  C  CB    . LEU E  1 25  ? 38.097  49.874  10.105  1.00 24.02 ? 25   LEU E CB    1 
ATOM   5036  C  CG    . LEU E  1 25  ? 36.875  50.483  9.410   1.00 23.97 ? 25   LEU E CG    1 
ATOM   5037  C  CD1   . LEU E  1 25  ? 35.764  49.457  9.267   1.00 23.30 ? 25   LEU E CD1   1 
ATOM   5038  C  CD2   . LEU E  1 25  ? 36.403  51.702  10.179  1.00 22.99 ? 25   LEU E CD2   1 
ATOM   5039  N  N     . GLY E  1 26  ? 40.225  49.923  12.263  1.00 23.65 ? 26   GLY E N     1 
ATOM   5040  C  CA    . GLY E  1 26  ? 41.154  49.237  13.135  1.00 23.67 ? 26   GLY E CA    1 
ATOM   5041  C  C     . GLY E  1 26  ? 40.981  49.695  14.574  1.00 23.97 ? 26   GLY E C     1 
ATOM   5042  O  O     . GLY E  1 26  ? 40.302  50.697  14.828  1.00 23.94 ? 26   GLY E O     1 
ATOM   5043  N  N     . PRO E  1 27  ? 41.609  48.990  15.518  1.00 23.83 ? 27   PRO E N     1 
ATOM   5044  C  CA    . PRO E  1 27  ? 41.604  49.431  16.913  1.00 23.91 ? 27   PRO E CA    1 
ATOM   5045  C  C     . PRO E  1 27  ? 42.579  50.605  17.051  1.00 24.26 ? 27   PRO E C     1 
ATOM   5046  O  O     . PRO E  1 27  ? 43.185  51.007  16.045  1.00 24.46 ? 27   PRO E O     1 
ATOM   5047  C  CB    . PRO E  1 27  ? 42.124  48.202  17.671  1.00 23.75 ? 27   PRO E CB    1 
ATOM   5048  C  CG    . PRO E  1 27  ? 43.021  47.490  16.670  1.00 23.32 ? 27   PRO E CG    1 
ATOM   5049  C  CD    . PRO E  1 27  ? 42.402  47.756  15.326  1.00 23.60 ? 27   PRO E CD    1 
ATOM   5050  N  N     . MET E  1 28  ? 42.725  51.146  18.259  1.00 24.20 ? 28   MET E N     1 
ATOM   5051  C  CA    . MET E  1 28  ? 43.774  52.134  18.517  1.00 24.33 ? 28   MET E CA    1 
ATOM   5052  C  C     . MET E  1 28  ? 45.152  51.498  18.337  1.00 24.34 ? 28   MET E C     1 
ATOM   5053  O  O     . MET E  1 28  ? 45.295  50.279  18.440  1.00 24.46 ? 28   MET E O     1 
ATOM   5054  C  CB    . MET E  1 28  ? 43.631  52.723  19.920  1.00 24.19 ? 28   MET E CB    1 
ATOM   5055  C  CG    . MET E  1 28  ? 42.384  53.590  20.098  1.00 24.34 ? 28   MET E CG    1 
ATOM   5056  S  SD    . MET E  1 28  ? 42.242  54.296  21.767  1.00 25.78 ? 28   MET E SD    1 
ATOM   5057  C  CE    . MET E  1 28  ? 43.725  55.382  21.825  1.00 23.03 ? 28   MET E CE    1 
ATOM   5058  N  N     . PHE E  1 29  ? 46.150  52.333  18.056  1.00 24.30 ? 29   PHE E N     1 
ATOM   5059  C  CA    . PHE E  1 29  ? 47.555  51.916  17.935  1.00 24.27 ? 29   PHE E CA    1 
ATOM   5060  C  C     . PHE E  1 29  ? 47.859  51.000  16.741  1.00 24.06 ? 29   PHE E C     1 
ATOM   5061  O  O     . PHE E  1 29  ? 48.880  50.298  16.740  1.00 24.17 ? 29   PHE E O     1 
ATOM   5062  C  CB    . PHE E  1 29  ? 48.062  51.291  19.248  1.00 24.75 ? 29   PHE E CB    1 
ATOM   5063  C  CG    . PHE E  1 29  ? 47.579  52.001  20.498  1.00 25.68 ? 29   PHE E CG    1 
ATOM   5064  C  CD1   . PHE E  1 29  ? 46.750  51.343  21.406  1.00 25.98 ? 29   PHE E CD1   1 
ATOM   5065  C  CD2   . PHE E  1 29  ? 47.935  53.323  20.753  1.00 26.08 ? 29   PHE E CD2   1 
ATOM   5066  C  CE1   . PHE E  1 29  ? 46.286  51.981  22.551  1.00 26.08 ? 29   PHE E CE1   1 
ATOM   5067  C  CE2   . PHE E  1 29  ? 47.488  53.976  21.899  1.00 26.51 ? 29   PHE E CE2   1 
ATOM   5068  C  CZ    . PHE E  1 29  ? 46.660  53.296  22.807  1.00 26.95 ? 29   PHE E CZ    1 
ATOM   5069  N  N     . SER E  1 30  ? 46.985  51.016  15.731  1.00 23.66 ? 30   SER E N     1 
ATOM   5070  C  CA    . SER E  1 30  ? 47.170  50.216  14.518  1.00 23.49 ? 30   SER E CA    1 
ATOM   5071  C  C     . SER E  1 30  ? 47.725  51.013  13.330  1.00 23.38 ? 30   SER E C     1 
ATOM   5072  O  O     . SER E  1 30  ? 47.984  50.451  12.260  1.00 23.55 ? 30   SER E O     1 
ATOM   5073  C  CB    . SER E  1 30  ? 45.865  49.490  14.130  1.00 23.52 ? 30   SER E CB    1 
ATOM   5074  O  OG    . SER E  1 30  ? 44.786  50.394  13.946  1.00 23.73 ? 30   SER E OG    1 
ATOM   5075  N  N     . GLY E  1 31  ? 47.914  52.316  13.522  1.00 23.29 ? 31   GLY E N     1 
ATOM   5076  C  CA    . GLY E  1 31  ? 48.489  53.177  12.504  1.00 23.21 ? 31   GLY E CA    1 
ATOM   5077  C  C     . GLY E  1 31  ? 47.521  53.662  11.441  1.00 23.53 ? 31   GLY E C     1 
ATOM   5078  O  O     . GLY E  1 31  ? 47.926  53.933  10.310  1.00 23.81 ? 31   GLY E O     1 
ATOM   5079  N  N     . LYS E  1 32  ? 46.247  53.792  11.802  1.00 23.54 ? 32   LYS E N     1 
ATOM   5080  C  CA    . LYS E  1 32  ? 45.207  54.240  10.883  1.00 23.69 ? 32   LYS E CA    1 
ATOM   5081  C  C     . LYS E  1 32  ? 45.542  55.610  10.263  1.00 24.26 ? 32   LYS E C     1 
ATOM   5082  O  O     . LYS E  1 32  ? 45.424  55.784  9.042   1.00 24.04 ? 32   LYS E O     1 
ATOM   5083  C  CB    . LYS E  1 32  ? 43.860  54.306  11.603  1.00 23.16 ? 32   LYS E CB    1 
ATOM   5084  C  CG    . LYS E  1 32  ? 43.322  52.972  12.082  1.00 22.24 ? 32   LYS E CG    1 
ATOM   5085  C  CD    . LYS E  1 32  ? 41.901  53.115  12.652  1.00 20.83 ? 32   LYS E CD    1 
ATOM   5086  C  CE    . LYS E  1 32  ? 41.815  54.081  13.842  1.00 19.23 ? 32   LYS E CE    1 
ATOM   5087  N  NZ    . LYS E  1 32  ? 42.793  53.766  14.936  1.00 19.21 ? 32   LYS E NZ    1 
ATOM   5088  N  N     . SER E  1 33  ? 45.961  56.555  11.119  1.00 24.65 ? 33   SER E N     1 
ATOM   5089  C  CA    . SER E  1 33  ? 46.358  57.910  10.713  1.00 25.54 ? 33   SER E CA    1 
ATOM   5090  C  C     . SER E  1 33  ? 47.549  57.911  9.765   1.00 25.20 ? 33   SER E C     1 
ATOM   5091  O  O     . SER E  1 33  ? 47.584  58.685  8.822   1.00 25.29 ? 33   SER E O     1 
ATOM   5092  C  CB    . SER E  1 33  ? 46.711  58.760  11.937  1.00 25.56 ? 33   SER E CB    1 
ATOM   5093  O  OG    . SER E  1 33  ? 45.546  59.084  12.670  1.00 28.56 ? 33   SER E OG    1 
ATOM   5094  N  N     . THR E  1 34  ? 48.524  57.048  10.041  1.00 25.24 ? 34   THR E N     1 
ATOM   5095  C  CA    . THR E  1 34  ? 49.706  56.905  9.200   1.00 25.22 ? 34   THR E CA    1 
ATOM   5096  C  C     . THR E  1 34  ? 49.322  56.360  7.818   1.00 25.26 ? 34   THR E C     1 
ATOM   5097  O  O     . THR E  1 34  ? 49.814  56.862  6.801   1.00 25.47 ? 34   THR E O     1 
ATOM   5098  C  CB    . THR E  1 34  ? 50.741  55.992  9.883   1.00 25.39 ? 34   THR E CB    1 
ATOM   5099  O  OG1   . THR E  1 34  ? 51.243  56.634  11.062  1.00 25.79 ? 34   THR E OG1   1 
ATOM   5100  C  CG2   . THR E  1 34  ? 51.998  55.830  9.010   1.00 25.78 ? 34   THR E CG2   1 
ATOM   5101  N  N     . GLU E  1 35  ? 48.440  55.356  7.785   1.00 25.10 ? 35   GLU E N     1 
ATOM   5102  C  CA    . GLU E  1 35  ? 47.940  54.806  6.527   1.00 25.38 ? 35   GLU E CA    1 
ATOM   5103  C  C     . GLU E  1 35  ? 47.126  55.837  5.733   1.00 25.38 ? 35   GLU E C     1 
ATOM   5104  O  O     . GLU E  1 35  ? 47.245  55.903  4.501   1.00 25.36 ? 35   GLU E O     1 
ATOM   5105  C  CB    . GLU E  1 35  ? 47.139  53.505  6.752   1.00 25.36 ? 35   GLU E CB    1 
ATOM   5106  C  CG    . GLU E  1 35  ? 46.479  52.919  5.493   1.00 26.50 ? 35   GLU E CG    1 
ATOM   5107  C  CD    . GLU E  1 35  ? 47.452  52.554  4.366   1.00 29.10 ? 35   GLU E CD    1 
ATOM   5108  O  OE1   . GLU E  1 35  ? 48.686  52.562  4.590   1.00 29.96 ? 35   GLU E OE1   1 
ATOM   5109  O  OE2   . GLU E  1 35  ? 46.981  52.241  3.239   1.00 29.46 ? 35   GLU E OE2   1 
ATOM   5110  N  N     . LEU E  1 36  ? 46.324  56.641  6.431   1.00 25.31 ? 36   LEU E N     1 
ATOM   5111  C  CA    . LEU E  1 36  ? 45.613  57.749  5.801   1.00 25.81 ? 36   LEU E CA    1 
ATOM   5112  C  C     . LEU E  1 36  ? 46.596  58.697  5.092   1.00 26.06 ? 36   LEU E C     1 
ATOM   5113  O  O     . LEU E  1 36  ? 46.417  59.027  3.921   1.00 25.90 ? 36   LEU E O     1 
ATOM   5114  C  CB    . LEU E  1 36  ? 44.772  58.511  6.838   1.00 26.02 ? 36   LEU E CB    1 
ATOM   5115  C  CG    . LEU E  1 36  ? 44.082  59.832  6.453   1.00 26.03 ? 36   LEU E CG    1 
ATOM   5116  C  CD1   . LEU E  1 36  ? 42.848  59.562  5.632   1.00 26.18 ? 36   LEU E CD1   1 
ATOM   5117  C  CD2   . LEU E  1 36  ? 43.704  60.625  7.693   1.00 26.09 ? 36   LEU E CD2   1 
ATOM   5118  N  N     . MET E  1 37  ? 47.636  59.112  5.803   1.00 26.43 ? 37   MET E N     1 
ATOM   5119  C  CA    . MET E  1 37  ? 48.613  60.051  5.257   1.00 27.26 ? 37   MET E CA    1 
ATOM   5120  C  C     . MET E  1 37  ? 49.410  59.442  4.104   1.00 26.95 ? 37   MET E C     1 
ATOM   5121  O  O     . MET E  1 37  ? 49.667  60.123  3.119   1.00 26.82 ? 37   MET E O     1 
ATOM   5122  C  CB    . MET E  1 37  ? 49.551  60.569  6.347   1.00 27.64 ? 37   MET E CB    1 
ATOM   5123  C  CG    . MET E  1 37  ? 48.903  61.520  7.310   1.00 30.36 ? 37   MET E CG    1 
ATOM   5124  S  SD    . MET E  1 37  ? 48.091  62.937  6.507   1.00 38.29 ? 37   MET E SD    1 
ATOM   5125  C  CE    . MET E  1 37  ? 46.952  63.343  7.788   1.00 37.72 ? 37   MET E CE    1 
ATOM   5126  N  N     . ARG E  1 38  ? 49.770  58.161  4.217   1.00 26.63 ? 38   ARG E N     1 
ATOM   5127  C  CA    . ARG E  1 38  ? 50.414  57.451  3.116   1.00 26.38 ? 38   ARG E CA    1 
ATOM   5128  C  C     . ARG E  1 38  ? 49.572  57.553  1.849   1.00 26.45 ? 38   ARG E C     1 
ATOM   5129  O  O     . ARG E  1 38  ? 50.081  57.887  0.781   1.00 26.75 ? 38   ARG E O     1 
ATOM   5130  C  CB    . ARG E  1 38  ? 50.671  55.972  3.469   1.00 26.32 ? 38   ARG E CB    1 
ATOM   5131  C  CG    . ARG E  1 38  ? 51.445  55.218  2.383   1.00 25.65 ? 38   ARG E CG    1 
ATOM   5132  C  CD    . ARG E  1 38  ? 51.514  53.712  2.560   1.00 25.91 ? 38   ARG E CD    1 
ATOM   5133  N  NE    . ARG E  1 38  ? 50.252  53.046  2.242   1.00 25.59 ? 38   ARG E NE    1 
ATOM   5134  C  CZ    . ARG E  1 38  ? 49.862  52.691  1.027   1.00 26.02 ? 38   ARG E CZ    1 
ATOM   5135  N  NH1   . ARG E  1 38  ? 50.627  52.943  -0.030  1.00 26.75 ? 38   ARG E NH1   1 
ATOM   5136  N  NH2   . ARG E  1 38  ? 48.687  52.091  0.861   1.00 25.70 ? 38   ARG E NH2   1 
ATOM   5137  N  N     . ARG E  1 39  ? 48.281  57.278  1.976   1.00 26.56 ? 39   ARG E N     1 
ATOM   5138  C  CA    . ARG E  1 39  ? 47.367  57.320  0.842   1.00 26.84 ? 39   ARG E CA    1 
ATOM   5139  C  C     . ARG E  1 39  ? 47.229  58.729  0.260   1.00 27.23 ? 39   ARG E C     1 
ATOM   5140  O  O     . ARG E  1 39  ? 47.249  58.907  -0.960  1.00 27.57 ? 39   ARG E O     1 
ATOM   5141  C  CB    . ARG E  1 39  ? 46.001  56.796  1.268   1.00 26.53 ? 39   ARG E CB    1 
ATOM   5142  C  CG    . ARG E  1 39  ? 45.990  55.323  1.612   1.00 27.10 ? 39   ARG E CG    1 
ATOM   5143  C  CD    . ARG E  1 39  ? 44.629  54.689  1.456   1.00 26.51 ? 39   ARG E CD    1 
ATOM   5144  N  NE    . ARG E  1 39  ? 44.553  53.377  2.080   1.00 26.48 ? 39   ARG E NE    1 
ATOM   5145  C  CZ    . ARG E  1 39  ? 43.449  52.626  2.107   1.00 26.65 ? 39   ARG E CZ    1 
ATOM   5146  N  NH1   . ARG E  1 39  ? 42.324  53.065  1.529   1.00 25.03 ? 39   ARG E NH1   1 
ATOM   5147  N  NH2   . ARG E  1 39  ? 43.467  51.441  2.708   1.00 23.00 ? 39   ARG E NH2   1 
ATOM   5148  N  N     . VAL E  1 40  ? 47.098  59.723  1.136   1.00 27.59 ? 40   VAL E N     1 
ATOM   5149  C  CA    . VAL E  1 40  ? 46.932  61.108  0.713   1.00 28.13 ? 40   VAL E CA    1 
ATOM   5150  C  C     . VAL E  1 40  ? 48.198  61.615  0.016   1.00 28.80 ? 40   VAL E C     1 
ATOM   5151  O  O     . VAL E  1 40  ? 48.109  62.256  -1.031  1.00 28.90 ? 40   VAL E O     1 
ATOM   5152  C  CB    . VAL E  1 40  ? 46.531  62.013  1.900   1.00 28.18 ? 40   VAL E CB    1 
ATOM   5153  C  CG1   . VAL E  1 40  ? 46.696  63.495  1.554   1.00 28.42 ? 40   VAL E CG1   1 
ATOM   5154  C  CG2   . VAL E  1 40  ? 45.097  61.721  2.330   1.00 27.89 ? 40   VAL E CG2   1 
ATOM   5155  N  N     . ARG E  1 41  ? 49.364  61.308  0.583   1.00 29.58 ? 41   ARG E N     1 
ATOM   5156  C  CA    . ARG E  1 41  ? 50.647  61.729  0.008   1.00 30.83 ? 41   ARG E CA    1 
ATOM   5157  C  C     . ARG E  1 41  ? 50.891  61.180  -1.404  1.00 30.77 ? 41   ARG E C     1 
ATOM   5158  O  O     . ARG E  1 41  ? 51.530  61.848  -2.210  1.00 30.82 ? 41   ARG E O     1 
ATOM   5159  C  CB    . ARG E  1 41  ? 51.825  61.380  0.933   1.00 30.97 ? 41   ARG E CB    1 
ATOM   5160  C  CG    . ARG E  1 41  ? 51.918  62.251  2.185   1.00 34.31 ? 41   ARG E CG    1 
ATOM   5161  C  CD    . ARG E  1 41  ? 53.259  62.161  2.933   1.00 39.64 ? 41   ARG E CD    1 
ATOM   5162  N  NE    . ARG E  1 41  ? 53.146  62.616  4.322   1.00 42.74 ? 41   ARG E NE    1 
ATOM   5163  C  CZ    . ARG E  1 41  ? 53.121  61.814  5.397   1.00 45.19 ? 41   ARG E CZ    1 
ATOM   5164  N  NH1   . ARG E  1 41  ? 53.203  60.487  5.270   1.00 45.61 ? 41   ARG E NH1   1 
ATOM   5165  N  NH2   . ARG E  1 41  ? 53.009  62.345  6.613   1.00 45.55 ? 41   ARG E NH2   1 
ATOM   5166  N  N     . ARG E  1 42  ? 50.378  59.980  -1.694  1.00 30.94 ? 42   ARG E N     1 
ATOM   5167  C  CA    . ARG E  1 42  ? 50.434  59.398  -3.045  1.00 31.35 ? 42   ARG E CA    1 
ATOM   5168  C  C     . ARG E  1 42  ? 49.788  60.311  -4.097  1.00 31.36 ? 42   ARG E C     1 
ATOM   5169  O  O     . ARG E  1 42  ? 50.322  60.473  -5.193  1.00 31.14 ? 42   ARG E O     1 
ATOM   5170  C  CB    . ARG E  1 42  ? 49.728  58.037  -3.088  1.00 31.31 ? 42   ARG E CB    1 
ATOM   5171  C  CG    . ARG E  1 42  ? 50.574  56.833  -2.765  1.00 32.35 ? 42   ARG E CG    1 
ATOM   5172  C  CD    . ARG E  1 42  ? 49.765  55.547  -2.499  1.00 34.67 ? 42   ARG E CD    1 
ATOM   5173  N  NE    . ARG E  1 42  ? 49.053  55.089  -3.693  1.00 36.09 ? 42   ARG E NE    1 
ATOM   5174  C  CZ    . ARG E  1 42  ? 47.751  55.292  -3.919  1.00 38.43 ? 42   ARG E CZ    1 
ATOM   5175  N  NH1   . ARG E  1 42  ? 46.995  55.944  -3.018  1.00 38.46 ? 42   ARG E NH1   1 
ATOM   5176  N  NH2   . ARG E  1 42  ? 47.205  54.853  -5.052  1.00 36.91 ? 42   ARG E NH2   1 
ATOM   5177  N  N     . PHE E  1 43  ? 48.636  60.889  -3.760  1.00 31.52 ? 43   PHE E N     1 
ATOM   5178  C  CA    . PHE E  1 43  ? 47.938  61.794  -4.663  1.00 31.98 ? 43   PHE E CA    1 
ATOM   5179  C  C     . PHE E  1 43  ? 48.639  63.149  -4.728  1.00 32.83 ? 43   PHE E C     1 
ATOM   5180  O  O     . PHE E  1 43  ? 48.805  63.708  -5.812  1.00 32.74 ? 43   PHE E O     1 
ATOM   5181  C  CB    . PHE E  1 43  ? 46.475  61.960  -4.237  1.00 31.69 ? 43   PHE E CB    1 
ATOM   5182  C  CG    . PHE E  1 43  ? 45.624  60.733  -4.470  1.00 30.65 ? 43   PHE E CG    1 
ATOM   5183  C  CD1   . PHE E  1 43  ? 45.272  59.906  -3.412  1.00 29.14 ? 43   PHE E CD1   1 
ATOM   5184  C  CD2   . PHE E  1 43  ? 45.149  60.423  -5.743  1.00 30.34 ? 43   PHE E CD2   1 
ATOM   5185  C  CE1   . PHE E  1 43  ? 44.458  58.767  -3.616  1.00 29.78 ? 43   PHE E CE1   1 
ATOM   5186  C  CE2   . PHE E  1 43  ? 44.338  59.279  -5.962  1.00 30.17 ? 43   PHE E CE2   1 
ATOM   5187  C  CZ    . PHE E  1 43  ? 43.996  58.451  -4.892  1.00 28.71 ? 43   PHE E CZ    1 
ATOM   5188  N  N     . GLN E  1 44  ? 49.050  63.661  -3.564  1.00 33.69 ? 44   GLN E N     1 
ATOM   5189  C  CA    . GLN E  1 44  ? 49.721  64.958  -3.445  1.00 34.92 ? 44   GLN E CA    1 
ATOM   5190  C  C     . GLN E  1 44  ? 50.994  65.039  -4.289  1.00 35.40 ? 44   GLN E C     1 
ATOM   5191  O  O     . GLN E  1 44  ? 51.216  66.013  -5.018  1.00 35.34 ? 44   GLN E O     1 
ATOM   5192  C  CB    . GLN E  1 44  ? 50.058  65.232  -1.975  1.00 35.20 ? 44   GLN E CB    1 
ATOM   5193  C  CG    . GLN E  1 44  ? 50.730  66.573  -1.698  1.00 37.40 ? 44   GLN E CG    1 
ATOM   5194  C  CD    . GLN E  1 44  ? 50.391  67.115  -0.310  1.00 41.51 ? 44   GLN E CD    1 
ATOM   5195  O  OE1   . GLN E  1 44  ? 50.701  66.480  0.706   1.00 43.65 ? 44   GLN E OE1   1 
ATOM   5196  N  NE2   . GLN E  1 44  ? 49.753  68.283  -0.263  1.00 41.90 ? 44   GLN E NE2   1 
ATOM   5197  N  N     . ILE E  1 45  ? 51.823  64.001  -4.191  1.00 36.01 ? 45   ILE E N     1 
ATOM   5198  C  CA    . ILE E  1 45  ? 53.070  63.923  -4.943  1.00 36.52 ? 45   ILE E CA    1 
ATOM   5199  C  C     . ILE E  1 45  ? 52.802  63.861  -6.461  1.00 36.67 ? 45   ILE E C     1 
ATOM   5200  O  O     . ILE E  1 45  ? 53.676  64.164  -7.274  1.00 36.69 ? 45   ILE E O     1 
ATOM   5201  C  CB    . ILE E  1 45  ? 53.928  62.721  -4.408  1.00 36.86 ? 45   ILE E CB    1 
ATOM   5202  C  CG1   . ILE E  1 45  ? 55.396  63.129  -4.198  1.00 37.75 ? 45   ILE E CG1   1 
ATOM   5203  C  CG2   . ILE E  1 45  ? 53.732  61.440  -5.245  1.00 36.82 ? 45   ILE E CG2   1 
ATOM   5204  C  CD1   . ILE E  1 45  ? 56.224  63.285  -5.465  1.00 39.40 ? 45   ILE E CD1   1 
ATOM   5205  N  N     . ALA E  1 46  ? 51.585  63.486  -6.836  1.00 36.95 ? 46   ALA E N     1 
ATOM   5206  C  CA    . ALA E  1 46  ? 51.189  63.486  -8.242  1.00 37.49 ? 46   ALA E CA    1 
ATOM   5207  C  C     . ALA E  1 46  ? 50.401  64.748  -8.636  1.00 37.97 ? 46   ALA E C     1 
ATOM   5208  O  O     . ALA E  1 46  ? 49.728  64.763  -9.659  1.00 38.14 ? 46   ALA E O     1 
ATOM   5209  C  CB    . ALA E  1 46  ? 50.405  62.225  -8.573  1.00 37.15 ? 46   ALA E CB    1 
ATOM   5210  N  N     . GLN E  1 47  ? 50.491  65.796  -7.815  1.00 38.94 ? 47   GLN E N     1 
ATOM   5211  C  CA    . GLN E  1 47  ? 49.953  67.137  -8.131  1.00 39.88 ? 47   GLN E CA    1 
ATOM   5212  C  C     . GLN E  1 47  ? 48.459  67.350  -7.853  1.00 39.75 ? 47   GLN E C     1 
ATOM   5213  O  O     . GLN E  1 47  ? 47.908  68.392  -8.218  1.00 40.03 ? 47   GLN E O     1 
ATOM   5214  C  CB    . GLN E  1 47  ? 50.268  67.553  -9.576  1.00 39.97 ? 47   GLN E CB    1 
ATOM   5215  C  CG    . GLN E  1 47  ? 51.729  67.443  -9.963  1.00 42.65 ? 47   GLN E CG    1 
ATOM   5216  C  CD    . GLN E  1 47  ? 52.524  68.620  -9.483  1.00 45.92 ? 47   GLN E CD    1 
ATOM   5217  O  OE1   . GLN E  1 47  ? 52.959  68.656  -8.325  1.00 47.60 ? 47   GLN E OE1   1 
ATOM   5218  N  NE2   . GLN E  1 47  ? 52.709  69.602  -10.357 1.00 46.77 ? 47   GLN E NE2   1 
ATOM   5219  N  N     . TYR E  1 48  ? 47.804  66.379  -7.220  1.00 39.52 ? 48   TYR E N     1 
ATOM   5220  C  CA    . TYR E  1 48  ? 46.424  66.561  -6.769  1.00 39.39 ? 48   TYR E CA    1 
ATOM   5221  C  C     . TYR E  1 48  ? 46.365  67.551  -5.605  1.00 39.05 ? 48   TYR E C     1 
ATOM   5222  O  O     . TYR E  1 48  ? 47.243  67.554  -4.735  1.00 38.86 ? 48   TYR E O     1 
ATOM   5223  C  CB    . TYR E  1 48  ? 45.825  65.233  -6.307  1.00 39.71 ? 48   TYR E CB    1 
ATOM   5224  C  CG    . TYR E  1 48  ? 45.387  64.302  -7.412  1.00 40.62 ? 48   TYR E CG    1 
ATOM   5225  C  CD1   . TYR E  1 48  ? 44.070  64.304  -7.864  1.00 42.10 ? 48   TYR E CD1   1 
ATOM   5226  C  CD2   . TYR E  1 48  ? 46.283  63.404  -7.992  1.00 41.17 ? 48   TYR E CD2   1 
ATOM   5227  C  CE1   . TYR E  1 48  ? 43.655  63.440  -8.875  1.00 42.77 ? 48   TYR E CE1   1 
ATOM   5228  C  CE2   . TYR E  1 48  ? 45.878  62.539  -9.004  1.00 41.79 ? 48   TYR E CE2   1 
ATOM   5229  C  CZ    . TYR E  1 48  ? 44.564  62.565  -9.437  1.00 42.67 ? 48   TYR E CZ    1 
ATOM   5230  O  OH    . TYR E  1 48  ? 44.151  61.716  -10.431 1.00 44.27 ? 48   TYR E OH    1 
ATOM   5231  N  N     . LYS E  1 49  ? 45.329  68.384  -5.592  1.00 38.83 ? 49   LYS E N     1 
ATOM   5232  C  CA    . LYS E  1 49  ? 45.039  69.232  -4.434  1.00 38.66 ? 49   LYS E CA    1 
ATOM   5233  C  C     . LYS E  1 49  ? 44.406  68.377  -3.329  1.00 37.75 ? 49   LYS E C     1 
ATOM   5234  O  O     . LYS E  1 49  ? 43.419  67.677  -3.566  1.00 37.50 ? 49   LYS E O     1 
ATOM   5235  C  CB    . LYS E  1 49  ? 44.107  70.385  -4.817  1.00 39.08 ? 49   LYS E CB    1 
ATOM   5236  C  CG    . LYS E  1 49  ? 44.770  71.484  -5.641  1.00 41.41 ? 49   LYS E CG    1 
ATOM   5237  C  CD    . LYS E  1 49  ? 43.983  72.794  -5.558  1.00 44.78 ? 49   LYS E CD    1 
ATOM   5238  C  CE    . LYS E  1 49  ? 43.108  72.987  -6.804  1.00 46.90 ? 49   LYS E CE    1 
ATOM   5239  N  NZ    . LYS E  1 49  ? 43.059  74.411  -7.260  1.00 47.81 ? 49   LYS E NZ    1 
ATOM   5240  N  N     . CYS E  1 50  ? 44.980  68.443  -2.131  1.00 36.84 ? 50   CYS E N     1 
ATOM   5241  C  CA    . CYS E  1 50  ? 44.546  67.605  -1.017  1.00 36.25 ? 50   CYS E CA    1 
ATOM   5242  C  C     . CYS E  1 50  ? 44.144  68.417  0.211   1.00 35.77 ? 50   CYS E C     1 
ATOM   5243  O  O     . CYS E  1 50  ? 44.637  69.523  0.435   1.00 35.73 ? 50   CYS E O     1 
ATOM   5244  C  CB    . CYS E  1 50  ? 45.641  66.591  -0.640  1.00 36.31 ? 50   CYS E CB    1 
ATOM   5245  S  SG    . CYS E  1 50  ? 46.139  65.447  -1.968  1.00 36.44 ? 50   CYS E SG    1 
ATOM   5246  N  N     . LEU E  1 51  ? 43.239  67.853  1.000   1.00 35.06 ? 51   LEU E N     1 
ATOM   5247  C  CA    . LEU E  1 51  ? 42.831  68.452  2.260   1.00 34.49 ? 51   LEU E CA    1 
ATOM   5248  C  C     . LEU E  1 51  ? 42.702  67.346  3.286   1.00 34.05 ? 51   LEU E C     1 
ATOM   5249  O  O     . LEU E  1 51  ? 42.106  66.313  3.008   1.00 34.13 ? 51   LEU E O     1 
ATOM   5250  C  CB    . LEU E  1 51  ? 41.504  69.192  2.089   1.00 34.51 ? 51   LEU E CB    1 
ATOM   5251  C  CG    . LEU E  1 51  ? 40.657  69.554  3.310   1.00 34.33 ? 51   LEU E CG    1 
ATOM   5252  C  CD1   . LEU E  1 51  ? 41.403  70.501  4.229   1.00 34.99 ? 51   LEU E CD1   1 
ATOM   5253  C  CD2   . LEU E  1 51  ? 39.376  70.186  2.850   1.00 34.76 ? 51   LEU E CD2   1 
ATOM   5254  N  N     . VAL E  1 52  ? 43.275  67.558  4.464   1.00 33.75 ? 52   VAL E N     1 
ATOM   5255  C  CA    . VAL E  1 52  ? 43.106  66.627  5.575   1.00 33.62 ? 52   VAL E CA    1 
ATOM   5256  C  C     . VAL E  1 52  ? 42.348  67.294  6.715   1.00 33.65 ? 52   VAL E C     1 
ATOM   5257  O  O     . VAL E  1 52  ? 42.662  68.423  7.108   1.00 33.55 ? 52   VAL E O     1 
ATOM   5258  C  CB    . VAL E  1 52  ? 44.448  66.062  6.081   1.00 33.50 ? 52   VAL E CB    1 
ATOM   5259  C  CG1   . VAL E  1 52  ? 44.208  65.039  7.178   1.00 33.26 ? 52   VAL E CG1   1 
ATOM   5260  C  CG2   . VAL E  1 52  ? 45.217  65.427  4.936   1.00 33.70 ? 52   VAL E CG2   1 
ATOM   5261  N  N     . ILE E  1 53  ? 41.349  66.589  7.234   1.00 33.73 ? 53   ILE E N     1 
ATOM   5262  C  CA    . ILE E  1 53  ? 40.500  67.094  8.302   1.00 33.87 ? 53   ILE E CA    1 
ATOM   5263  C  C     . ILE E  1 53  ? 40.728  66.220  9.525   1.00 34.69 ? 53   ILE E C     1 
ATOM   5264  O  O     . ILE E  1 53  ? 40.720  64.990  9.431   1.00 34.59 ? 53   ILE E O     1 
ATOM   5265  C  CB    . ILE E  1 53  ? 38.989  67.060  7.877   1.00 33.67 ? 53   ILE E CB    1 
ATOM   5266  C  CG1   . ILE E  1 53  ? 38.729  67.985  6.684   1.00 33.58 ? 53   ILE E CG1   1 
ATOM   5267  C  CG2   . ILE E  1 53  ? 38.059  67.417  9.047   1.00 32.75 ? 53   ILE E CG2   1 
ATOM   5268  C  CD1   . ILE E  1 53  ? 37.540  67.568  5.820   1.00 33.02 ? 53   ILE E CD1   1 
ATOM   5269  N  N     . LYS E  1 54  ? 40.929  66.864  10.671  1.00 35.63 ? 54   LYS E N     1 
ATOM   5270  C  CA    . LYS E  1 54  ? 41.067  66.173  11.942  1.00 36.79 ? 54   LYS E CA    1 
ATOM   5271  C  C     . LYS E  1 54  ? 40.002  66.654  12.935  1.00 37.03 ? 54   LYS E C     1 
ATOM   5272  O  O     . LYS E  1 54  ? 39.498  67.777  12.837  1.00 36.90 ? 54   LYS E O     1 
ATOM   5273  C  CB    . LYS E  1 54  ? 42.470  66.403  12.510  1.00 37.37 ? 54   LYS E CB    1 
ATOM   5274  C  CG    . LYS E  1 54  ? 43.018  65.233  13.324  1.00 40.00 ? 54   LYS E CG    1 
ATOM   5275  C  CD    . LYS E  1 54  ? 43.721  65.719  14.598  1.00 43.79 ? 54   LYS E CD    1 
ATOM   5276  C  CE    . LYS E  1 54  ? 44.232  64.542  15.441  1.00 45.42 ? 54   LYS E CE    1 
ATOM   5277  N  NZ    . LYS E  1 54  ? 45.666  64.713  15.826  1.00 46.59 ? 54   LYS E NZ    1 
ATOM   5278  N  N     . TYR E  1 55  ? 39.663  65.787  13.881  1.00 37.60 ? 55   TYR E N     1 
ATOM   5279  C  CA    . TYR E  1 55  ? 38.696  66.093  14.918  1.00 38.42 ? 55   TYR E CA    1 
ATOM   5280  C  C     . TYR E  1 55  ? 39.305  67.071  15.929  1.00 39.32 ? 55   TYR E C     1 
ATOM   5281  O  O     . TYR E  1 55  ? 40.307  66.762  16.574  1.00 39.25 ? 55   TYR E O     1 
ATOM   5282  C  CB    . TYR E  1 55  ? 38.252  64.795  15.598  1.00 37.99 ? 55   TYR E CB    1 
ATOM   5283  C  CG    . TYR E  1 55  ? 37.199  64.970  16.663  1.00 37.36 ? 55   TYR E CG    1 
ATOM   5284  C  CD1   . TYR E  1 55  ? 35.998  65.628  16.390  1.00 36.91 ? 55   TYR E CD1   1 
ATOM   5285  C  CD2   . TYR E  1 55  ? 37.401  64.473  17.946  1.00 36.81 ? 55   TYR E CD2   1 
ATOM   5286  C  CE1   . TYR E  1 55  ? 35.034  65.793  17.371  1.00 36.65 ? 55   TYR E CE1   1 
ATOM   5287  C  CE2   . TYR E  1 55  ? 36.443  64.624  18.926  1.00 36.48 ? 55   TYR E CE2   1 
ATOM   5288  C  CZ    . TYR E  1 55  ? 35.267  65.287  18.634  1.00 36.68 ? 55   TYR E CZ    1 
ATOM   5289  O  OH    . TYR E  1 55  ? 34.317  65.423  19.608  1.00 37.95 ? 55   TYR E OH    1 
ATOM   5290  N  N     . ALA E  1 56  ? 38.689  68.244  16.051  1.00 40.67 ? 56   ALA E N     1 
ATOM   5291  C  CA    . ALA E  1 56  ? 39.237  69.367  16.813  1.00 42.05 ? 56   ALA E CA    1 
ATOM   5292  C  C     . ALA E  1 56  ? 39.460  69.054  18.289  1.00 43.15 ? 56   ALA E C     1 
ATOM   5293  O  O     . ALA E  1 56  ? 40.392  69.583  18.897  1.00 43.47 ? 56   ALA E O     1 
ATOM   5294  C  CB    . ALA E  1 56  ? 38.341  70.598  16.661  1.00 41.76 ? 56   ALA E CB    1 
ATOM   5295  N  N     . LYS E  1 57  ? 38.617  68.188  18.855  1.00 44.44 ? 57   LYS E N     1 
ATOM   5296  C  CA    . LYS E  1 57  ? 38.672  67.883  20.281  1.00 45.81 ? 57   LYS E CA    1 
ATOM   5297  C  C     . LYS E  1 57  ? 39.750  66.864  20.682  1.00 46.62 ? 57   LYS E C     1 
ATOM   5298  O  O     . LYS E  1 57  ? 39.977  66.640  21.872  1.00 46.86 ? 57   LYS E O     1 
ATOM   5299  C  CB    . LYS E  1 57  ? 37.291  67.452  20.798  1.00 45.88 ? 57   LYS E CB    1 
ATOM   5300  C  CG    . LYS E  1 57  ? 36.265  68.573  20.843  1.00 46.74 ? 57   LYS E CG    1 
ATOM   5301  C  CD    . LYS E  1 57  ? 34.968  68.102  21.465  1.00 49.27 ? 57   LYS E CD    1 
ATOM   5302  C  CE    . LYS E  1 57  ? 34.050  69.271  21.785  1.00 51.41 ? 57   LYS E CE    1 
ATOM   5303  N  NZ    . LYS E  1 57  ? 32.993  69.453  20.746  1.00 52.64 ? 57   LYS E NZ    1 
ATOM   5304  N  N     . ASP E  1 58  ? 40.402  66.235  19.707  1.00 47.62 ? 58   ASP E N     1 
ATOM   5305  C  CA    . ASP E  1 58  ? 41.540  65.355  20.009  1.00 48.58 ? 58   ASP E CA    1 
ATOM   5306  C  C     . ASP E  1 58  ? 42.861  66.103  19.784  1.00 49.22 ? 58   ASP E C     1 
ATOM   5307  O  O     . ASP E  1 58  ? 43.311  66.282  18.646  1.00 49.30 ? 58   ASP E O     1 
ATOM   5308  C  CB    . ASP E  1 58  ? 41.496  64.058  19.186  1.00 48.53 ? 58   ASP E CB    1 
ATOM   5309  C  CG    . ASP E  1 58  ? 42.409  62.958  19.748  1.00 49.22 ? 58   ASP E CG    1 
ATOM   5310  O  OD1   . ASP E  1 58  ? 43.434  63.263  20.404  1.00 49.45 ? 58   ASP E OD1   1 
ATOM   5311  O  OD2   . ASP E  1 58  ? 42.180  61.741  19.571  1.00 49.46 ? 58   ASP E OD2   1 
ATOM   5312  N  N     . THR E  1 59  ? 43.495  66.507  20.879  1.00 50.40 ? 59   THR E N     1 
ATOM   5313  C  CA    . THR E  1 59  ? 44.651  67.407  20.819  1.00 51.59 ? 59   THR E CA    1 
ATOM   5314  C  C     . THR E  1 59  ? 46.026  66.731  20.891  1.00 52.14 ? 59   THR E C     1 
ATOM   5315  O  O     . THR E  1 59  ? 47.043  67.371  20.586  1.00 52.46 ? 59   THR E O     1 
ATOM   5316  C  CB    . THR E  1 59  ? 44.547  68.478  21.932  1.00 51.82 ? 59   THR E CB    1 
ATOM   5317  O  OG1   . THR E  1 59  ? 44.196  67.848  23.179  1.00 52.18 ? 59   THR E OG1   1 
ATOM   5318  C  CG2   . THR E  1 59  ? 43.383  69.437  21.652  1.00 51.88 ? 59   THR E CG2   1 
ATOM   5319  N  N     . ARG E  1 60  ? 46.050  65.458  21.293  1.00 52.56 ? 60   ARG E N     1 
ATOM   5320  C  CA    . ARG E  1 60  ? 47.294  64.708  21.548  1.00 52.93 ? 60   ARG E CA    1 
ATOM   5321  C  C     . ARG E  1 60  ? 48.418  64.981  20.541  1.00 52.97 ? 60   ARG E C     1 
ATOM   5322  O  O     . ARG E  1 60  ? 48.204  64.945  19.327  1.00 53.03 ? 60   ARG E O     1 
ATOM   5323  C  CB    . ARG E  1 60  ? 47.016  63.195  21.614  1.00 53.05 ? 60   ARG E CB    1 
ATOM   5324  C  CG    . ARG E  1 60  ? 45.976  62.778  22.657  1.00 53.19 ? 60   ARG E CG    1 
ATOM   5325  C  CD    . ARG E  1 60  ? 45.463  61.348  22.504  1.00 53.50 ? 60   ARG E CD    1 
ATOM   5326  N  NE    . ARG E  1 60  ? 44.914  61.099  21.170  1.00 54.27 ? 60   ARG E NE    1 
ATOM   5327  C  CZ    . ARG E  1 60  ? 45.239  60.067  20.399  1.00 54.18 ? 60   ARG E CZ    1 
ATOM   5328  N  NH1   . ARG E  1 60  ? 46.111  59.158  20.818  1.00 54.84 ? 60   ARG E NH1   1 
ATOM   5329  N  NH2   . ARG E  1 60  ? 44.688  59.939  19.202  1.00 54.35 ? 60   ARG E NH2   1 
ATOM   5330  N  N     . ALA E  1 75  ? 46.116  70.599  7.490   1.00 48.15 ? 75   ALA E N     1 
ATOM   5331  C  CA    . ALA E  1 75  ? 45.392  69.735  8.419   1.00 47.88 ? 75   ALA E CA    1 
ATOM   5332  C  C     . ALA E  1 75  ? 44.374  70.521  9.269   1.00 47.52 ? 75   ALA E C     1 
ATOM   5333  O  O     . ALA E  1 75  ? 44.654  70.917  10.409  1.00 47.59 ? 75   ALA E O     1 
ATOM   5334  C  CB    . ALA E  1 75  ? 46.365  68.954  9.289   1.00 47.85 ? 75   ALA E CB    1 
ATOM   5335  N  N     . LEU E  1 76  ? 43.190  70.729  8.693   1.00 46.62 ? 76   LEU E N     1 
ATOM   5336  C  CA    . LEU E  1 76  ? 42.148  71.554  9.302   1.00 45.84 ? 76   LEU E CA    1 
ATOM   5337  C  C     . LEU E  1 76  ? 41.402  70.858  10.440  1.00 45.06 ? 76   LEU E C     1 
ATOM   5338  O  O     . LEU E  1 76  ? 40.839  69.786  10.248  1.00 44.99 ? 76   LEU E O     1 
ATOM   5339  C  CB    . LEU E  1 76  ? 41.143  72.034  8.249   1.00 45.80 ? 76   LEU E CB    1 
ATOM   5340  C  CG    . LEU E  1 76  ? 41.622  72.831  7.031   1.00 46.42 ? 76   LEU E CG    1 
ATOM   5341  C  CD1   . LEU E  1 76  ? 40.434  73.452  6.303   1.00 46.31 ? 76   LEU E CD1   1 
ATOM   5342  C  CD2   . LEU E  1 76  ? 42.651  73.901  7.402   1.00 47.35 ? 76   LEU E CD2   1 
ATOM   5343  N  N     . PRO E  1 77  ? 41.383  71.475  11.620  1.00 44.41 ? 77   PRO E N     1 
ATOM   5344  C  CA    . PRO E  1 77  ? 40.571  70.963  12.733  1.00 43.88 ? 77   PRO E CA    1 
ATOM   5345  C  C     . PRO E  1 77  ? 39.088  71.278  12.516  1.00 43.34 ? 77   PRO E C     1 
ATOM   5346  O  O     . PRO E  1 77  ? 38.763  72.338  11.979  1.00 43.30 ? 77   PRO E O     1 
ATOM   5347  C  CB    . PRO E  1 77  ? 41.111  71.728  13.948  1.00 43.89 ? 77   PRO E CB    1 
ATOM   5348  C  CG    . PRO E  1 77  ? 41.636  73.018  13.382  1.00 44.23 ? 77   PRO E CG    1 
ATOM   5349  C  CD    . PRO E  1 77  ? 42.123  72.698  11.988  1.00 44.29 ? 77   PRO E CD    1 
ATOM   5350  N  N     . ALA E  1 78  ? 38.210  70.362  12.915  1.00 42.77 ? 78   ALA E N     1 
ATOM   5351  C  CA    . ALA E  1 78  ? 36.772  70.557  12.783  1.00 42.34 ? 78   ALA E CA    1 
ATOM   5352  C  C     . ALA E  1 78  ? 36.009  69.700  13.793  1.00 42.28 ? 78   ALA E C     1 
ATOM   5353  O  O     . ALA E  1 78  ? 36.531  68.705  14.289  1.00 42.10 ? 78   ALA E O     1 
ATOM   5354  C  CB    . ALA E  1 78  ? 36.322  70.239  11.367  1.00 42.28 ? 78   ALA E CB    1 
ATOM   5355  N  N     . CYS E  1 79  ? 34.779  70.108  14.092  1.00 42.28 ? 79   CYS E N     1 
ATOM   5356  C  CA    . CYS E  1 79  ? 33.876  69.373  14.978  1.00 42.61 ? 79   CYS E CA    1 
ATOM   5357  C  C     . CYS E  1 79  ? 32.711  68.816  14.178  1.00 41.94 ? 79   CYS E C     1 
ATOM   5358  O  O     . CYS E  1 79  ? 32.113  67.812  14.543  1.00 41.97 ? 79   CYS E O     1 
ATOM   5359  C  CB    . CYS E  1 79  ? 33.335  70.296  16.075  1.00 42.68 ? 79   CYS E CB    1 
ATOM   5360  S  SG    . CYS E  1 79  ? 34.384  70.400  17.540  1.00 45.44 ? 79   CYS E SG    1 
ATOM   5361  N  N     . LEU E  1 80  ? 32.374  69.519  13.104  1.00 41.55 ? 80   LEU E N     1 
ATOM   5362  C  CA    . LEU E  1 80  ? 31.385  69.075  12.139  1.00 41.15 ? 80   LEU E CA    1 
ATOM   5363  C  C     . LEU E  1 80  ? 32.007  69.243  10.767  1.00 40.70 ? 80   LEU E C     1 
ATOM   5364  O  O     . LEU E  1 80  ? 32.686  70.238  10.498  1.00 40.52 ? 80   LEU E O     1 
ATOM   5365  C  CB    . LEU E  1 80  ? 30.105  69.904  12.240  1.00 41.27 ? 80   LEU E CB    1 
ATOM   5366  C  CG    . LEU E  1 80  ? 29.191  69.629  13.431  1.00 42.05 ? 80   LEU E CG    1 
ATOM   5367  C  CD1   . LEU E  1 80  ? 28.594  70.935  13.935  1.00 43.42 ? 80   LEU E CD1   1 
ATOM   5368  C  CD2   . LEU E  1 80  ? 28.096  68.651  13.041  1.00 42.34 ? 80   LEU E CD2   1 
ATOM   5369  N  N     . LEU E  1 81  ? 31.780  68.265  9.901   1.00 40.21 ? 81   LEU E N     1 
ATOM   5370  C  CA    . LEU E  1 81  ? 32.369  68.289  8.574   1.00 39.97 ? 81   LEU E CA    1 
ATOM   5371  C  C     . LEU E  1 81  ? 31.782  69.398  7.712   1.00 40.20 ? 81   LEU E C     1 
ATOM   5372  O  O     . LEU E  1 81  ? 32.461  69.936  6.830   1.00 40.06 ? 81   LEU E O     1 
ATOM   5373  C  CB    . LEU E  1 81  ? 32.231  66.918  7.915   1.00 39.87 ? 81   LEU E CB    1 
ATOM   5374  C  CG    . LEU E  1 81  ? 33.152  65.880  8.570   1.00 39.24 ? 81   LEU E CG    1 
ATOM   5375  C  CD1   . LEU E  1 81  ? 32.736  64.482  8.205   1.00 37.86 ? 81   LEU E CD1   1 
ATOM   5376  C  CD2   . LEU E  1 81  ? 34.617  66.135  8.193   1.00 38.42 ? 81   LEU E CD2   1 
ATOM   5377  N  N     . ARG E  1 82  ? 30.530  69.753  7.992   1.00 40.54 ? 82   ARG E N     1 
ATOM   5378  C  CA    . ARG E  1 82  ? 29.865  70.830  7.275   1.00 41.11 ? 82   ARG E CA    1 
ATOM   5379  C  C     . ARG E  1 82  ? 30.570  72.182  7.454   1.00 41.17 ? 82   ARG E C     1 
ATOM   5380  O  O     . ARG E  1 82  ? 30.515  73.027  6.568   1.00 41.10 ? 82   ARG E O     1 
ATOM   5381  C  CB    . ARG E  1 82  ? 28.376  70.900  7.630   1.00 41.19 ? 82   ARG E CB    1 
ATOM   5382  C  CG    . ARG E  1 82  ? 28.065  71.556  8.949   1.00 42.23 ? 82   ARG E CG    1 
ATOM   5383  C  CD    . ARG E  1 82  ? 27.700  73.027  8.826   1.00 44.59 ? 82   ARG E CD    1 
ATOM   5384  N  NE    . ARG E  1 82  ? 27.720  73.697  10.125  1.00 45.86 ? 82   ARG E NE    1 
ATOM   5385  C  CZ    . ARG E  1 82  ? 26.684  73.747  10.960  1.00 46.37 ? 82   ARG E CZ    1 
ATOM   5386  N  NH1   . ARG E  1 82  ? 25.530  73.163  10.643  1.00 46.58 ? 82   ARG E NH1   1 
ATOM   5387  N  NH2   . ARG E  1 82  ? 26.802  74.385  12.116  1.00 46.38 ? 82   ARG E NH2   1 
ATOM   5388  N  N     . ASP E  1 83  ? 31.249  72.354  8.587   1.00 41.42 ? 83   ASP E N     1 
ATOM   5389  C  CA    . ASP E  1 83  ? 32.012  73.559  8.899   1.00 42.00 ? 83   ASP E CA    1 
ATOM   5390  C  C     . ASP E  1 83  ? 33.189  73.761  7.954   1.00 42.17 ? 83   ASP E C     1 
ATOM   5391  O  O     . ASP E  1 83  ? 33.782  74.841  7.889   1.00 42.33 ? 83   ASP E O     1 
ATOM   5392  C  CB    . ASP E  1 83  ? 32.577  73.439  10.312  1.00 42.01 ? 83   ASP E CB    1 
ATOM   5393  C  CG    . ASP E  1 83  ? 31.511  73.554  11.394  1.00 42.80 ? 83   ASP E CG    1 
ATOM   5394  O  OD1   . ASP E  1 83  ? 30.458  74.195  11.159  1.00 43.53 ? 83   ASP E OD1   1 
ATOM   5395  O  OD2   . ASP E  1 83  ? 31.658  73.041  12.526  1.00 43.53 ? 83   ASP E OD2   1 
ATOM   5396  N  N     . VAL E  1 84  ? 33.520  72.704  7.226   1.00 42.39 ? 84   VAL E N     1 
ATOM   5397  C  CA    . VAL E  1 84  ? 34.726  72.656  6.429   1.00 42.60 ? 84   VAL E CA    1 
ATOM   5398  C  C     . VAL E  1 84  ? 34.395  72.311  4.968   1.00 42.84 ? 84   VAL E C     1 
ATOM   5399  O  O     . VAL E  1 84  ? 35.287  72.149  4.135   1.00 42.78 ? 84   VAL E O     1 
ATOM   5400  C  CB    . VAL E  1 84  ? 35.717  71.654  7.091   1.00 42.64 ? 84   VAL E CB    1 
ATOM   5401  C  CG1   . VAL E  1 84  ? 35.718  70.300  6.403   1.00 42.36 ? 84   VAL E CG1   1 
ATOM   5402  C  CG2   . VAL E  1 84  ? 37.097  72.235  7.186   1.00 42.51 ? 84   VAL E CG2   1 
ATOM   5403  N  N     . ALA E  1 85  ? 33.099  72.231  4.670   1.00 43.22 ? 85   ALA E N     1 
ATOM   5404  C  CA    . ALA E  1 85  ? 32.611  71.815  3.356   1.00 43.92 ? 85   ALA E CA    1 
ATOM   5405  C  C     . ALA E  1 85  ? 33.043  72.721  2.197   1.00 44.28 ? 85   ALA E C     1 
ATOM   5406  O  O     . ALA E  1 85  ? 33.285  72.239  1.092   1.00 44.36 ? 85   ALA E O     1 
ATOM   5407  C  CB    . ALA E  1 85  ? 31.088  71.650  3.377   1.00 43.83 ? 85   ALA E CB    1 
ATOM   5408  N  N     . GLN E  1 86  ? 33.145  74.021  2.456   1.00 44.73 ? 86   GLN E N     1 
ATOM   5409  C  CA    . GLN E  1 86  ? 33.557  74.984  1.442   1.00 45.26 ? 86   GLN E CA    1 
ATOM   5410  C  C     . GLN E  1 86  ? 35.014  74.772  0.999   1.00 45.20 ? 86   GLN E C     1 
ATOM   5411  O  O     . GLN E  1 86  ? 35.309  74.825  -0.194  1.00 45.30 ? 86   GLN E O     1 
ATOM   5412  C  CB    . GLN E  1 86  ? 33.334  76.407  1.955   1.00 45.17 ? 86   GLN E CB    1 
ATOM   5413  C  CG    . GLN E  1 86  ? 33.336  77.469  0.873   1.00 46.05 ? 86   GLN E CG    1 
ATOM   5414  C  CD    . GLN E  1 86  ? 32.830  78.802  1.390   1.00 47.03 ? 86   GLN E CD    1 
ATOM   5415  O  OE1   . GLN E  1 86  ? 31.624  79.012  1.496   1.00 46.57 ? 86   GLN E OE1   1 
ATOM   5416  N  NE2   . GLN E  1 86  ? 33.748  79.696  1.728   1.00 46.66 ? 86   GLN E NE2   1 
ATOM   5417  N  N     . GLU E  1 87  ? 35.906  74.539  1.962   1.00 45.12 ? 87   GLU E N     1 
ATOM   5418  C  CA    . GLU E  1 87  ? 37.307  74.205  1.682   1.00 45.28 ? 87   GLU E CA    1 
ATOM   5419  C  C     . GLU E  1 87  ? 37.399  72.895  0.907   1.00 44.80 ? 87   GLU E C     1 
ATOM   5420  O  O     . GLU E  1 87  ? 38.186  72.777  -0.031  1.00 44.76 ? 87   GLU E O     1 
ATOM   5421  C  CB    . GLU E  1 87  ? 38.108  74.070  2.986   1.00 45.41 ? 87   GLU E CB    1 
ATOM   5422  C  CG    . GLU E  1 87  ? 38.358  75.375  3.735   1.00 47.39 ? 87   GLU E CG    1 
ATOM   5423  C  CD    . GLU E  1 87  ? 37.077  76.138  4.071   1.00 50.09 ? 87   GLU E CD    1 
ATOM   5424  O  OE1   . GLU E  1 87  ? 36.094  75.513  4.557   1.00 50.64 ? 87   GLU E OE1   1 
ATOM   5425  O  OE2   . GLU E  1 87  ? 37.050  77.373  3.836   1.00 50.72 ? 87   GLU E OE2   1 
ATOM   5426  N  N     . ALA E  1 88  ? 36.574  71.923  1.304   1.00 44.27 ? 88   ALA E N     1 
ATOM   5427  C  CA    . ALA E  1 88  ? 36.553  70.592  0.697   1.00 43.85 ? 88   ALA E CA    1 
ATOM   5428  C  C     . ALA E  1 88  ? 36.139  70.619  -0.765  1.00 43.48 ? 88   ALA E C     1 
ATOM   5429  O  O     . ALA E  1 88  ? 36.571  69.787  -1.552  1.00 43.43 ? 88   ALA E O     1 
ATOM   5430  C  CB    . ALA E  1 88  ? 35.636  69.660  1.487   1.00 43.88 ? 88   ALA E CB    1 
ATOM   5431  N  N     . LEU E  1 89  ? 35.306  71.591  -1.117  1.00 43.13 ? 89   LEU E N     1 
ATOM   5432  C  CA    . LEU E  1 89  ? 34.786  71.751  -2.473  1.00 42.79 ? 89   LEU E CA    1 
ATOM   5433  C  C     . LEU E  1 89  ? 35.860  72.105  -3.505  1.00 42.22 ? 89   LEU E C     1 
ATOM   5434  O  O     . LEU E  1 89  ? 35.748  71.735  -4.677  1.00 42.30 ? 89   LEU E O     1 
ATOM   5435  C  CB    . LEU E  1 89  ? 33.705  72.840  -2.482  1.00 42.98 ? 89   LEU E CB    1 
ATOM   5436  C  CG    . LEU E  1 89  ? 32.261  72.543  -2.918  1.00 43.83 ? 89   LEU E CG    1 
ATOM   5437  C  CD1   . LEU E  1 89  ? 31.768  71.154  -2.518  1.00 44.39 ? 89   LEU E CD1   1 
ATOM   5438  C  CD2   . LEU E  1 89  ? 31.314  73.610  -2.374  1.00 44.41 ? 89   LEU E CD2   1 
ATOM   5439  N  N     . GLY E  1 90  ? 36.890  72.828  -3.076  1.00 41.44 ? 90   GLY E N     1 
ATOM   5440  C  CA    . GLY E  1 90  ? 37.943  73.268  -3.980  1.00 40.48 ? 90   GLY E CA    1 
ATOM   5441  C  C     . GLY E  1 90  ? 39.123  72.312  -4.080  1.00 39.80 ? 90   GLY E C     1 
ATOM   5442  O  O     . GLY E  1 90  ? 40.200  72.677  -4.560  1.00 40.11 ? 90   GLY E O     1 
ATOM   5443  N  N     . VAL E  1 91  ? 38.913  71.074  -3.649  1.00 38.54 ? 91   VAL E N     1 
ATOM   5444  C  CA    . VAL E  1 91  ? 39.994  70.111  -3.526  1.00 37.17 ? 91   VAL E CA    1 
ATOM   5445  C  C     . VAL E  1 91  ? 39.609  68.804  -4.232  1.00 35.96 ? 91   VAL E C     1 
ATOM   5446  O  O     . VAL E  1 91  ? 38.425  68.528  -4.417  1.00 35.95 ? 91   VAL E O     1 
ATOM   5447  C  CB    . VAL E  1 91  ? 40.326  69.931  -2.034  1.00 37.45 ? 91   VAL E CB    1 
ATOM   5448  C  CG1   . VAL E  1 91  ? 39.894  68.556  -1.507  1.00 37.62 ? 91   VAL E CG1   1 
ATOM   5449  C  CG2   . VAL E  1 91  ? 41.784  70.219  -1.773  1.00 37.68 ? 91   VAL E CG2   1 
ATOM   5450  N  N     . ALA E  1 92  ? 40.600  68.023  -4.655  1.00 34.40 ? 92   ALA E N     1 
ATOM   5451  C  CA    . ALA E  1 92  ? 40.335  66.753  -5.344  1.00 32.92 ? 92   ALA E CA    1 
ATOM   5452  C  C     . ALA E  1 92  ? 40.314  65.543  -4.413  1.00 31.97 ? 92   ALA E C     1 
ATOM   5453  O  O     . ALA E  1 92  ? 39.620  64.560  -4.691  1.00 31.73 ? 92   ALA E O     1 
ATOM   5454  C  CB    . ALA E  1 92  ? 41.346  66.523  -6.461  1.00 32.71 ? 92   ALA E CB    1 
ATOM   5455  N  N     . VAL E  1 93  ? 41.093  65.617  -3.331  1.00 30.64 ? 93   VAL E N     1 
ATOM   5456  C  CA    . VAL E  1 93  ? 41.300  64.497  -2.417  1.00 29.70 ? 93   VAL E CA    1 
ATOM   5457  C  C     . VAL E  1 93  ? 41.090  64.961  -0.969  1.00 29.47 ? 93   VAL E C     1 
ATOM   5458  O  O     . VAL E  1 93  ? 41.758  65.903  -0.510  1.00 29.42 ? 93   VAL E O     1 
ATOM   5459  C  CB    . VAL E  1 93  ? 42.737  63.890  -2.593  1.00 29.54 ? 93   VAL E CB    1 
ATOM   5460  C  CG1   . VAL E  1 93  ? 43.051  62.871  -1.499  1.00 28.68 ? 93   VAL E CG1   1 
ATOM   5461  C  CG2   . VAL E  1 93  ? 42.902  63.254  -3.967  1.00 27.47 ? 93   VAL E CG2   1 
ATOM   5462  N  N     . ILE E  1 94  ? 40.164  64.313  -0.258  1.00 28.75 ? 94   ILE E N     1 
ATOM   5463  C  CA    . ILE E  1 94  ? 39.885  64.658  1.138   1.00 28.31 ? 94   ILE E CA    1 
ATOM   5464  C  C     . ILE E  1 94  ? 40.237  63.497  2.078   1.00 28.19 ? 94   ILE E C     1 
ATOM   5465  O  O     . ILE E  1 94  ? 39.755  62.383  1.895   1.00 28.19 ? 94   ILE E O     1 
ATOM   5466  C  CB    . ILE E  1 94  ? 38.391  65.054  1.330   1.00 28.39 ? 94   ILE E CB    1 
ATOM   5467  C  CG1   . ILE E  1 94  ? 37.981  66.172  0.369   1.00 28.26 ? 94   ILE E CG1   1 
ATOM   5468  C  CG2   . ILE E  1 94  ? 38.118  65.479  2.775   1.00 28.08 ? 94   ILE E CG2   1 
ATOM   5469  C  CD1   . ILE E  1 94  ? 36.487  66.226  0.073   1.00 27.64 ? 94   ILE E CD1   1 
ATOM   5470  N  N     . GLY E  1 95  ? 41.070  63.767  3.082   1.00 27.99 ? 95   GLY E N     1 
ATOM   5471  C  CA    . GLY E  1 95  ? 41.360  62.802  4.128   1.00 27.96 ? 95   GLY E CA    1 
ATOM   5472  C  C     . GLY E  1 95  ? 40.661  63.189  5.415   1.00 28.20 ? 95   GLY E C     1 
ATOM   5473  O  O     . GLY E  1 95  ? 40.697  64.359  5.809   1.00 28.23 ? 95   GLY E O     1 
ATOM   5474  N  N     . ILE E  1 96  ? 40.013  62.224  6.067   1.00 28.24 ? 96   ILE E N     1 
ATOM   5475  C  CA    . ILE E  1 96  ? 39.378  62.475  7.362   1.00 28.51 ? 96   ILE E CA    1 
ATOM   5476  C  C     . ILE E  1 96  ? 39.932  61.553  8.443   1.00 29.12 ? 96   ILE E C     1 
ATOM   5477  O  O     . ILE E  1 96  ? 39.850  60.330  8.341   1.00 29.09 ? 96   ILE E O     1 
ATOM   5478  C  CB    . ILE E  1 96  ? 37.830  62.404  7.268   1.00 28.45 ? 96   ILE E CB    1 
ATOM   5479  C  CG1   . ILE E  1 96  ? 37.321  63.425  6.247   1.00 28.01 ? 96   ILE E CG1   1 
ATOM   5480  C  CG2   . ILE E  1 96  ? 37.181  62.643  8.656   1.00 28.51 ? 96   ILE E CG2   1 
ATOM   5481  C  CD1   . ILE E  1 96  ? 35.910  63.213  5.807   1.00 27.66 ? 96   ILE E CD1   1 
ATOM   5482  N  N     . ASP E  1 97  ? 40.516  62.156  9.470   1.00 30.00 ? 97   ASP E N     1 
ATOM   5483  C  CA    . ASP E  1 97  ? 41.075  61.409  10.583  1.00 31.20 ? 97   ASP E CA    1 
ATOM   5484  C  C     . ASP E  1 97  ? 40.077  61.374  11.735  1.00 31.49 ? 97   ASP E C     1 
ATOM   5485  O  O     . ASP E  1 97  ? 39.431  62.387  12.043  1.00 31.58 ? 97   ASP E O     1 
ATOM   5486  C  CB    . ASP E  1 97  ? 42.397  62.035  11.028  1.00 31.44 ? 97   ASP E CB    1 
ATOM   5487  C  CG    . ASP E  1 97  ? 43.177  61.148  11.966  1.00 33.40 ? 97   ASP E CG    1 
ATOM   5488  O  OD1   . ASP E  1 97  ? 43.105  59.913  11.814  1.00 35.88 ? 97   ASP E OD1   1 
ATOM   5489  O  OD2   . ASP E  1 97  ? 43.897  61.592  12.887  1.00 36.74 ? 97   ASP E OD2   1 
ATOM   5490  N  N     . GLU E  1 98  ? 39.963  60.202  12.362  1.00 31.74 ? 98   GLU E N     1 
ATOM   5491  C  CA    . GLU E  1 98  ? 39.035  59.965  13.470  1.00 32.17 ? 98   GLU E CA    1 
ATOM   5492  C  C     . GLU E  1 98  ? 37.581  60.242  13.071  1.00 31.70 ? 98   GLU E C     1 
ATOM   5493  O  O     . GLU E  1 98  ? 36.848  60.955  13.763  1.00 31.64 ? 98   GLU E O     1 
ATOM   5494  C  CB    . GLU E  1 98  ? 39.454  60.762  14.723  1.00 32.68 ? 98   GLU E CB    1 
ATOM   5495  C  CG    . GLU E  1 98  ? 40.861  60.426  15.210  1.00 35.30 ? 98   GLU E CG    1 
ATOM   5496  C  CD    . GLU E  1 98  ? 41.174  60.971  16.594  1.00 39.03 ? 98   GLU E CD    1 
ATOM   5497  O  OE1   . GLU E  1 98  ? 40.286  60.956  17.480  1.00 41.30 ? 98   GLU E OE1   1 
ATOM   5498  O  OE2   . GLU E  1 98  ? 42.324  61.408  16.805  1.00 41.08 ? 98   GLU E OE2   1 
ATOM   5499  N  N     . GLY E  1 99  ? 37.174  59.639  11.958  1.00 31.43 ? 99   GLY E N     1 
ATOM   5500  C  CA    . GLY E  1 99  ? 35.852  59.834  11.388  1.00 31.02 ? 99   GLY E CA    1 
ATOM   5501  C  C     . GLY E  1 99  ? 34.678  59.482  12.284  1.00 30.88 ? 99   GLY E C     1 
ATOM   5502  O  O     . GLY E  1 99  ? 33.567  59.978  12.073  1.00 31.00 ? 99   GLY E O     1 
ATOM   5503  N  N     . GLN E  1 100 ? 34.923  58.641  13.285  1.00 30.58 ? 100  GLN E N     1 
ATOM   5504  C  CA    . GLN E  1 100 ? 33.884  58.194  14.207  1.00 30.54 ? 100  GLN E CA    1 
ATOM   5505  C  C     . GLN E  1 100 ? 33.277  59.336  15.044  1.00 30.91 ? 100  GLN E C     1 
ATOM   5506  O  O     . GLN E  1 100 ? 32.159  59.210  15.552  1.00 30.85 ? 100  GLN E O     1 
ATOM   5507  C  CB    . GLN E  1 100 ? 34.418  57.067  15.105  1.00 30.22 ? 100  GLN E CB    1 
ATOM   5508  C  CG    . GLN E  1 100 ? 35.442  57.488  16.171  1.00 29.59 ? 100  GLN E CG    1 
ATOM   5509  C  CD    . GLN E  1 100 ? 36.875  57.527  15.667  1.00 28.99 ? 100  GLN E CD    1 
ATOM   5510  O  OE1   . GLN E  1 100 ? 37.137  57.366  14.480  1.00 29.34 ? 100  GLN E OE1   1 
ATOM   5511  N  NE2   . GLN E  1 100 ? 37.798  57.761  16.568  1.00 28.21 ? 100  GLN E NE2   1 
ATOM   5512  N  N     . PHE E  1 101 ? 34.004  60.447  15.162  1.00 31.07 ? 101  PHE E N     1 
ATOM   5513  C  CA    . PHE E  1 101 ? 33.579  61.565  16.006  1.00 31.56 ? 101  PHE E CA    1 
ATOM   5514  C  C     . PHE E  1 101 ? 32.732  62.603  15.282  1.00 32.03 ? 101  PHE E C     1 
ATOM   5515  O  O     . PHE E  1 101 ? 32.186  63.512  15.912  1.00 32.42 ? 101  PHE E O     1 
ATOM   5516  C  CB    . PHE E  1 101 ? 34.785  62.245  16.667  1.00 31.17 ? 101  PHE E CB    1 
ATOM   5517  C  CG    . PHE E  1 101 ? 35.375  61.457  17.802  1.00 30.74 ? 101  PHE E CG    1 
ATOM   5518  C  CD1   . PHE E  1 101 ? 36.732  61.127  17.807  1.00 29.90 ? 101  PHE E CD1   1 
ATOM   5519  C  CD2   . PHE E  1 101 ? 34.577  61.040  18.869  1.00 30.07 ? 101  PHE E CD2   1 
ATOM   5520  C  CE1   . PHE E  1 101 ? 37.288  60.393  18.849  1.00 28.89 ? 101  PHE E CE1   1 
ATOM   5521  C  CE2   . PHE E  1 101 ? 35.129  60.303  19.926  1.00 30.04 ? 101  PHE E CE2   1 
ATOM   5522  C  CZ    . PHE E  1 101 ? 36.490  59.981  19.909  1.00 29.42 ? 101  PHE E CZ    1 
ATOM   5523  N  N     . PHE E  1 102 ? 32.615  62.474  13.968  1.00 32.38 ? 102  PHE E N     1 
ATOM   5524  C  CA    . PHE E  1 102 ? 31.806  63.409  13.199  1.00 32.80 ? 102  PHE E CA    1 
ATOM   5525  C  C     . PHE E  1 102 ? 30.407  62.850  12.977  1.00 33.41 ? 102  PHE E C     1 
ATOM   5526  O  O     . PHE E  1 102 ? 30.253  61.847  12.280  1.00 33.67 ? 102  PHE E O     1 
ATOM   5527  C  CB    . PHE E  1 102 ? 32.458  63.713  11.859  1.00 32.21 ? 102  PHE E CB    1 
ATOM   5528  C  CG    . PHE E  1 102 ? 33.771  64.427  11.970  1.00 31.61 ? 102  PHE E CG    1 
ATOM   5529  C  CD1   . PHE E  1 102 ? 33.814  65.801  12.206  1.00 31.11 ? 102  PHE E CD1   1 
ATOM   5530  C  CD2   . PHE E  1 102 ? 34.963  63.730  11.824  1.00 30.49 ? 102  PHE E CD2   1 
ATOM   5531  C  CE1   . PHE E  1 102 ? 35.024  66.475  12.283  1.00 30.66 ? 102  PHE E CE1   1 
ATOM   5532  C  CE2   . PHE E  1 102 ? 36.181  64.384  11.907  1.00 30.53 ? 102  PHE E CE2   1 
ATOM   5533  C  CZ    . PHE E  1 102 ? 36.215  65.763  12.134  1.00 31.37 ? 102  PHE E CZ    1 
ATOM   5534  N  N     . PRO E  1 103 ? 29.390  63.496  13.556  1.00 33.96 ? 103  PRO E N     1 
ATOM   5535  C  CA    . PRO E  1 103 ? 28.002  63.028  13.405  1.00 34.24 ? 103  PRO E CA    1 
ATOM   5536  C  C     . PRO E  1 103 ? 27.507  63.079  11.962  1.00 34.48 ? 103  PRO E C     1 
ATOM   5537  O  O     . PRO E  1 103 ? 26.572  62.342  11.629  1.00 34.64 ? 103  PRO E O     1 
ATOM   5538  C  CB    . PRO E  1 103 ? 27.179  63.985  14.293  1.00 34.37 ? 103  PRO E CB    1 
ATOM   5539  C  CG    . PRO E  1 103 ? 28.067  65.160  14.581  1.00 34.21 ? 103  PRO E CG    1 
ATOM   5540  C  CD    . PRO E  1 103 ? 29.489  64.694  14.413  1.00 34.13 ? 103  PRO E CD    1 
ATOM   5541  N  N     . ASP E  1 104 ? 28.127  63.913  11.126  1.00 34.36 ? 104  ASP E N     1 
ATOM   5542  C  CA    . ASP E  1 104 ? 27.723  64.026  9.725   1.00 34.43 ? 104  ASP E CA    1 
ATOM   5543  C  C     . ASP E  1 104 ? 28.649  63.293  8.730   1.00 34.24 ? 104  ASP E C     1 
ATOM   5544  O  O     . ASP E  1 104 ? 28.642  63.597  7.533   1.00 34.11 ? 104  ASP E O     1 
ATOM   5545  C  CB    . ASP E  1 104 ? 27.504  65.500  9.319   1.00 34.60 ? 104  ASP E CB    1 
ATOM   5546  C  CG    . ASP E  1 104 ? 28.717  66.406  9.623   1.00 35.64 ? 104  ASP E CG    1 
ATOM   5547  O  OD1   . ASP E  1 104 ? 28.714  67.562  9.136   1.00 36.11 ? 104  ASP E OD1   1 
ATOM   5548  O  OD2   . ASP E  1 104 ? 29.698  66.070  10.334  1.00 35.03 ? 104  ASP E OD2   1 
ATOM   5549  N  N     . ILE E  1 105 ? 29.417  62.318  9.220   1.00 34.07 ? 105  ILE E N     1 
ATOM   5550  C  CA    . ILE E  1 105 ? 30.392  61.595  8.382   1.00 33.89 ? 105  ILE E CA    1 
ATOM   5551  C  C     . ILE E  1 105 ? 29.787  61.016  7.102   1.00 34.01 ? 105  ILE E C     1 
ATOM   5552  O  O     . ILE E  1 105 ? 30.378  61.126  6.029   1.00 33.97 ? 105  ILE E O     1 
ATOM   5553  C  CB    . ILE E  1 105 ? 31.136  60.484  9.194   1.00 34.00 ? 105  ILE E CB    1 
ATOM   5554  C  CG1   . ILE E  1 105 ? 32.320  59.904  8.404   1.00 33.80 ? 105  ILE E CG1   1 
ATOM   5555  C  CG2   . ILE E  1 105 ? 30.191  59.353  9.594   1.00 33.95 ? 105  ILE E CG2   1 
ATOM   5556  C  CD1   . ILE E  1 105 ? 33.531  60.801  8.339   1.00 32.83 ? 105  ILE E CD1   1 
ATOM   5557  N  N     . VAL E  1 106 ? 28.603  60.419  7.219   1.00 34.20 ? 106  VAL E N     1 
ATOM   5558  C  CA    . VAL E  1 106 ? 27.974  59.689  6.116   1.00 34.41 ? 106  VAL E CA    1 
ATOM   5559  C  C     . VAL E  1 106 ? 27.531  60.608  4.981   1.00 34.77 ? 106  VAL E C     1 
ATOM   5560  O  O     . VAL E  1 106 ? 27.897  60.402  3.811   1.00 35.01 ? 106  VAL E O     1 
ATOM   5561  C  CB    . VAL E  1 106 ? 26.766  58.858  6.624   1.00 34.75 ? 106  VAL E CB    1 
ATOM   5562  C  CG1   . VAL E  1 106 ? 25.957  58.279  5.462   1.00 34.30 ? 106  VAL E CG1   1 
ATOM   5563  C  CG2   . VAL E  1 106 ? 27.247  57.759  7.577   1.00 34.46 ? 106  VAL E CG2   1 
ATOM   5564  N  N     . GLU E  1 107 ? 26.755  61.630  5.329   1.00 34.74 ? 107  GLU E N     1 
ATOM   5565  C  CA    . GLU E  1 107 ? 26.243  62.588  4.362   1.00 34.99 ? 107  GLU E CA    1 
ATOM   5566  C  C     . GLU E  1 107 ? 27.361  63.361  3.656   1.00 34.36 ? 107  GLU E C     1 
ATOM   5567  O  O     . GLU E  1 107 ? 27.285  63.610  2.449   1.00 34.30 ? 107  GLU E O     1 
ATOM   5568  C  CB    . GLU E  1 107 ? 25.287  63.552  5.071   1.00 35.49 ? 107  GLU E CB    1 
ATOM   5569  C  CG    . GLU E  1 107 ? 24.981  64.819  4.301   1.00 38.03 ? 107  GLU E CG    1 
ATOM   5570  C  CD    . GLU E  1 107 ? 23.962  65.694  5.003   1.00 42.57 ? 107  GLU E CD    1 
ATOM   5571  O  OE1   . GLU E  1 107 ? 24.340  66.374  5.993   1.00 44.00 ? 107  GLU E OE1   1 
ATOM   5572  O  OE2   . GLU E  1 107 ? 22.785  65.700  4.558   1.00 43.75 ? 107  GLU E OE2   1 
ATOM   5573  N  N     . PHE E  1 108 ? 28.388  63.745  4.415   1.00 33.71 ? 108  PHE E N     1 
ATOM   5574  C  CA    . PHE E  1 108 ? 29.519  64.489  3.874   1.00 33.06 ? 108  PHE E CA    1 
ATOM   5575  C  C     . PHE E  1 108 ? 30.314  63.651  2.854   1.00 33.06 ? 108  PHE E C     1 
ATOM   5576  O  O     . PHE E  1 108 ? 30.569  64.100  1.734   1.00 32.95 ? 108  PHE E O     1 
ATOM   5577  C  CB    . PHE E  1 108 ? 30.419  64.989  5.008   1.00 32.67 ? 108  PHE E CB    1 
ATOM   5578  C  CG    . PHE E  1 108 ? 31.648  65.711  4.534   1.00 32.61 ? 108  PHE E CG    1 
ATOM   5579  C  CD1   . PHE E  1 108 ? 31.637  67.092  4.368   1.00 32.53 ? 108  PHE E CD1   1 
ATOM   5580  C  CD2   . PHE E  1 108 ? 32.821  65.012  4.253   1.00 32.45 ? 108  PHE E CD2   1 
ATOM   5581  C  CE1   . PHE E  1 108 ? 32.775  67.766  3.928   1.00 32.60 ? 108  PHE E CE1   1 
ATOM   5582  C  CE2   . PHE E  1 108 ? 33.964  65.673  3.809   1.00 31.88 ? 108  PHE E CE2   1 
ATOM   5583  C  CZ    . PHE E  1 108 ? 33.942  67.051  3.648   1.00 32.54 ? 108  PHE E CZ    1 
ATOM   5584  N  N     . CYS E  1 109 ? 30.687  62.434  3.237   1.00 32.86 ? 109  CYS E N     1 
ATOM   5585  C  CA    . CYS E  1 109 ? 31.485  61.574  2.371   1.00 33.02 ? 109  CYS E CA    1 
ATOM   5586  C  C     . CYS E  1 109 ? 30.735  61.210  1.102   1.00 32.98 ? 109  CYS E C     1 
ATOM   5587  O  O     . CYS E  1 109 ? 31.292  61.243  0.012   1.00 32.65 ? 109  CYS E O     1 
ATOM   5588  C  CB    . CYS E  1 109 ? 31.920  60.318  3.119   1.00 32.51 ? 109  CYS E CB    1 
ATOM   5589  S  SG    . CYS E  1 109 ? 33.074  60.685  4.437   1.00 33.26 ? 109  CYS E SG    1 
ATOM   5590  N  N     . GLU E  1 110 ? 29.462  60.873  1.260   1.00 33.45 ? 110  GLU E N     1 
ATOM   5591  C  CA    . GLU E  1 110 ? 28.617  60.501  0.134   1.00 33.97 ? 110  GLU E CA    1 
ATOM   5592  C  C     . GLU E  1 110 ? 28.463  61.672  -0.842  1.00 33.75 ? 110  GLU E C     1 
ATOM   5593  O  O     . GLU E  1 110 ? 28.611  61.483  -2.055  1.00 33.91 ? 110  GLU E O     1 
ATOM   5594  C  CB    . GLU E  1 110 ? 27.260  59.976  0.641   1.00 34.16 ? 110  GLU E CB    1 
ATOM   5595  C  CG    . GLU E  1 110 ? 26.225  59.655  -0.429  1.00 35.80 ? 110  GLU E CG    1 
ATOM   5596  C  CD    . GLU E  1 110 ? 26.552  58.432  -1.287  1.00 38.42 ? 110  GLU E CD    1 
ATOM   5597  O  OE1   . GLU E  1 110 ? 25.780  58.192  -2.242  1.00 39.17 ? 110  GLU E OE1   1 
ATOM   5598  O  OE2   . GLU E  1 110 ? 27.551  57.707  -1.035  1.00 38.68 ? 110  GLU E OE2   1 
ATOM   5599  N  N     . ALA E  1 111 ? 28.208  62.874  -0.312  1.00 33.32 ? 111  ALA E N     1 
ATOM   5600  C  CA    . ALA E  1 111 ? 28.090  64.077  -1.144  1.00 33.24 ? 111  ALA E CA    1 
ATOM   5601  C  C     . ALA E  1 111 ? 29.395  64.440  -1.852  1.00 33.09 ? 111  ALA E C     1 
ATOM   5602  O  O     . ALA E  1 111 ? 29.372  64.825  -3.018  1.00 33.30 ? 111  ALA E O     1 
ATOM   5603  C  CB    . ALA E  1 111 ? 27.562  65.277  -0.340  1.00 33.05 ? 111  ALA E CB    1 
ATOM   5604  N  N     . MET E  1 112 ? 30.523  64.325  -1.152  1.00 32.94 ? 112  MET E N     1 
ATOM   5605  C  CA    . MET E  1 112 ? 31.823  64.632  -1.756  1.00 32.89 ? 112  MET E CA    1 
ATOM   5606  C  C     . MET E  1 112 ? 32.240  63.604  -2.827  1.00 32.63 ? 112  MET E C     1 
ATOM   5607  O  O     . MET E  1 112 ? 32.759  63.979  -3.882  1.00 32.38 ? 112  MET E O     1 
ATOM   5608  C  CB    . MET E  1 112 ? 32.907  64.815  -0.687  1.00 33.02 ? 112  MET E CB    1 
ATOM   5609  C  CG    . MET E  1 112 ? 32.711  66.044  0.220   1.00 34.07 ? 112  MET E CG    1 
ATOM   5610  S  SD    . MET E  1 112 ? 32.834  67.646  -0.645  1.00 37.90 ? 112  MET E SD    1 
ATOM   5611  C  CE    . MET E  1 112 ? 31.617  68.661  0.310   1.00 36.66 ? 112  MET E CE    1 
ATOM   5612  N  N     . ALA E  1 113 ? 31.994  62.321  -2.568  1.00 32.31 ? 113  ALA E N     1 
ATOM   5613  C  CA    . ALA E  1 113 ? 32.282  61.283  -3.556  1.00 32.63 ? 113  ALA E CA    1 
ATOM   5614  C  C     . ALA E  1 113 ? 31.387  61.400  -4.798  1.00 32.84 ? 113  ALA E C     1 
ATOM   5615  O  O     . ALA E  1 113 ? 31.841  61.163  -5.921  1.00 32.96 ? 113  ALA E O     1 
ATOM   5616  C  CB    . ALA E  1 113 ? 32.194  59.888  -2.941  1.00 31.96 ? 113  ALA E CB    1 
ATOM   5617  N  N     . ASN E  1 114 ? 30.127  61.772  -4.597  1.00 33.02 ? 114  ASN E N     1 
ATOM   5618  C  CA    . ASN E  1 114 ? 29.212  61.994  -5.715  1.00 33.42 ? 114  ASN E CA    1 
ATOM   5619  C  C     . ASN E  1 114 ? 29.533  63.250  -6.519  1.00 33.54 ? 114  ASN E C     1 
ATOM   5620  O  O     . ASN E  1 114 ? 29.157  63.355  -7.679  1.00 33.99 ? 114  ASN E O     1 
ATOM   5621  C  CB    . ASN E  1 114 ? 27.757  61.980  -5.236  1.00 33.44 ? 114  ASN E CB    1 
ATOM   5622  C  CG    . ASN E  1 114 ? 27.291  60.579  -4.881  1.00 33.85 ? 114  ASN E CG    1 
ATOM   5623  O  OD1   . ASN E  1 114 ? 27.854  59.593  -5.365  1.00 34.83 ? 114  ASN E OD1   1 
ATOM   5624  N  ND2   . ASN E  1 114 ? 26.278  60.479  -4.033  1.00 33.12 ? 114  ASN E ND2   1 
ATOM   5625  N  N     . ALA E  1 115 ? 30.245  64.184  -5.901  1.00 33.43 ? 115  ALA E N     1 
ATOM   5626  C  CA    . ALA E  1 115 ? 30.731  65.373  -6.588  1.00 33.39 ? 115  ALA E CA    1 
ATOM   5627  C  C     . ALA E  1 115 ? 32.102  65.123  -7.231  1.00 33.35 ? 115  ALA E C     1 
ATOM   5628  O  O     . ALA E  1 115 ? 32.760  66.065  -7.697  1.00 33.52 ? 115  ALA E O     1 
ATOM   5629  C  CB    . ALA E  1 115 ? 30.789  66.561  -5.613  1.00 33.23 ? 115  ALA E CB    1 
ATOM   5630  N  N     . GLY E  1 116 ? 32.535  63.860  -7.239  1.00 33.02 ? 116  GLY E N     1 
ATOM   5631  C  CA    . GLY E  1 116 ? 33.759  63.466  -7.925  1.00 32.55 ? 116  GLY E CA    1 
ATOM   5632  C  C     . GLY E  1 116 ? 35.058  63.503  -7.129  1.00 32.32 ? 116  GLY E C     1 
ATOM   5633  O  O     . GLY E  1 116 ? 36.142  63.391  -7.707  1.00 32.40 ? 116  GLY E O     1 
ATOM   5634  N  N     . LYS E  1 117 ? 34.973  63.637  -5.809  1.00 31.84 ? 117  LYS E N     1 
ATOM   5635  C  CA    . LYS E  1 117 ? 36.186  63.656  -4.992  1.00 31.27 ? 117  LYS E CA    1 
ATOM   5636  C  C     . LYS E  1 117 ? 36.540  62.294  -4.415  1.00 30.62 ? 117  LYS E C     1 
ATOM   5637  O  O     . LYS E  1 117 ? 35.668  61.437  -4.228  1.00 30.44 ? 117  LYS E O     1 
ATOM   5638  C  CB    . LYS E  1 117 ? 36.078  64.684  -3.876  1.00 31.60 ? 117  LYS E CB    1 
ATOM   5639  C  CG    . LYS E  1 117 ? 36.157  66.105  -4.379  1.00 32.35 ? 117  LYS E CG    1 
ATOM   5640  C  CD    . LYS E  1 117 ? 34.843  66.816  -4.120  1.00 33.49 ? 117  LYS E CD    1 
ATOM   5641  C  CE    . LYS E  1 117 ? 35.080  68.269  -3.813  1.00 33.77 ? 117  LYS E CE    1 
ATOM   5642  N  NZ    . LYS E  1 117 ? 35.509  69.006  -5.027  1.00 33.28 ? 117  LYS E NZ    1 
ATOM   5643  N  N     . THR E  1 118 ? 37.833  62.105  -4.152  1.00 29.56 ? 118  THR E N     1 
ATOM   5644  C  CA    . THR E  1 118 ? 38.327  60.927  -3.457  1.00 28.55 ? 118  THR E CA    1 
ATOM   5645  C  C     . THR E  1 118 ? 38.364  61.203  -1.956  1.00 27.96 ? 118  THR E C     1 
ATOM   5646  O  O     . THR E  1 118 ? 39.098  62.081  -1.491  1.00 28.05 ? 118  THR E O     1 
ATOM   5647  C  CB    . THR E  1 118 ? 39.716  60.542  -3.993  1.00 28.90 ? 118  THR E CB    1 
ATOM   5648  O  OG1   . THR E  1 118 ? 39.558  59.903  -5.267  1.00 29.45 ? 118  THR E OG1   1 
ATOM   5649  C  CG2   . THR E  1 118 ? 40.392  59.472  -3.115  1.00 27.01 ? 118  THR E CG2   1 
ATOM   5650  N  N     . VAL E  1 119 ? 37.560  60.456  -1.207  1.00 27.14 ? 119  VAL E N     1 
ATOM   5651  C  CA    . VAL E  1 119 ? 37.443  60.644  0.236   1.00 26.39 ? 119  VAL E CA    1 
ATOM   5652  C  C     . VAL E  1 119 ? 38.044  59.446  0.967   1.00 26.16 ? 119  VAL E C     1 
ATOM   5653  O  O     . VAL E  1 119 ? 37.624  58.304  0.755   1.00 26.11 ? 119  VAL E O     1 
ATOM   5654  C  CB    . VAL E  1 119 ? 35.972  60.823  0.670   1.00 26.59 ? 119  VAL E CB    1 
ATOM   5655  C  CG1   . VAL E  1 119 ? 35.887  61.281  2.121   1.00 25.95 ? 119  VAL E CG1   1 
ATOM   5656  C  CG2   . VAL E  1 119 ? 35.251  61.808  -0.258  1.00 26.43 ? 119  VAL E CG2   1 
ATOM   5657  N  N     . ILE E  1 120 ? 39.029  59.710  1.822   1.00 25.40 ? 120  ILE E N     1 
ATOM   5658  C  CA    . ILE E  1 120 ? 39.701  58.653  2.567   1.00 24.80 ? 120  ILE E CA    1 
ATOM   5659  C  C     . ILE E  1 120 ? 39.477  58.881  4.051   1.00 24.66 ? 120  ILE E C     1 
ATOM   5660  O  O     . ILE E  1 120 ? 39.766  59.961  4.568   1.00 24.81 ? 120  ILE E O     1 
ATOM   5661  C  CB    . ILE E  1 120 ? 41.221  58.605  2.205   1.00 24.74 ? 120  ILE E CB    1 
ATOM   5662  C  CG1   . ILE E  1 120 ? 41.403  58.565  0.683   1.00 23.93 ? 120  ILE E CG1   1 
ATOM   5663  C  CG2   . ILE E  1 120 ? 41.909  57.410  2.870   1.00 23.60 ? 120  ILE E CG2   1 
ATOM   5664  C  CD1   . ILE E  1 120 ? 42.813  58.879  0.215   1.00 24.70 ? 120  ILE E CD1   1 
ATOM   5665  N  N     . VAL E  1 121 ? 38.942  57.872  4.730   1.00 24.26 ? 121  VAL E N     1 
ATOM   5666  C  CA    . VAL E  1 121 ? 38.527  58.028  6.120   1.00 23.90 ? 121  VAL E CA    1 
ATOM   5667  C  C     . VAL E  1 121 ? 39.232  57.021  7.023   1.00 24.01 ? 121  VAL E C     1 
ATOM   5668  O  O     . VAL E  1 121 ? 39.104  55.818  6.816   1.00 24.29 ? 121  VAL E O     1 
ATOM   5669  C  CB    . VAL E  1 121 ? 36.986  57.879  6.283   1.00 24.00 ? 121  VAL E CB    1 
ATOM   5670  C  CG1   . VAL E  1 121 ? 36.564  58.119  7.739   1.00 22.74 ? 121  VAL E CG1   1 
ATOM   5671  C  CG2   . VAL E  1 121 ? 36.230  58.826  5.329   1.00 23.89 ? 121  VAL E CG2   1 
ATOM   5672  N  N     . ALA E  1 122 ? 39.973  57.525  8.012   1.00 23.73 ? 122  ALA E N     1 
ATOM   5673  C  CA    . ALA E  1 122 ? 40.528  56.701  9.075   1.00 23.78 ? 122  ALA E CA    1 
ATOM   5674  C  C     . ALA E  1 122 ? 39.587  56.768  10.288  1.00 24.14 ? 122  ALA E C     1 
ATOM   5675  O  O     . ALA E  1 122 ? 39.168  57.866  10.701  1.00 23.94 ? 122  ALA E O     1 
ATOM   5676  C  CB    . ALA E  1 122 ? 41.930  57.174  9.439   1.00 23.13 ? 122  ALA E CB    1 
ATOM   5677  N  N     . ALA E  1 123 ? 39.232  55.609  10.839  1.00 24.33 ? 123  ALA E N     1 
ATOM   5678  C  CA    . ALA E  1 123 ? 38.295  55.567  11.962  1.00 24.96 ? 123  ALA E CA    1 
ATOM   5679  C  C     . ALA E  1 123 ? 38.351  54.278  12.756  1.00 25.47 ? 123  ALA E C     1 
ATOM   5680  O  O     . ALA E  1 123 ? 38.648  53.216  12.218  1.00 25.45 ? 123  ALA E O     1 
ATOM   5681  C  CB    . ALA E  1 123 ? 36.861  55.827  11.485  1.00 24.59 ? 123  ALA E CB    1 
ATOM   5682  N  N     . LEU E  1 124 ? 38.084  54.399  14.048  1.00 26.43 ? 124  LEU E N     1 
ATOM   5683  C  CA    . LEU E  1 124 ? 37.805  53.259  14.911  1.00 27.57 ? 124  LEU E CA    1 
ATOM   5684  C  C     . LEU E  1 124 ? 36.495  52.627  14.458  1.00 28.44 ? 124  LEU E C     1 
ATOM   5685  O  O     . LEU E  1 124 ? 35.512  53.334  14.216  1.00 28.84 ? 124  LEU E O     1 
ATOM   5686  C  CB    . LEU E  1 124 ? 37.633  53.742  16.353  1.00 27.36 ? 124  LEU E CB    1 
ATOM   5687  C  CG    . LEU E  1 124 ? 38.746  53.616  17.401  1.00 27.81 ? 124  LEU E CG    1 
ATOM   5688  C  CD1   . LEU E  1 124 ? 40.074  53.142  16.838  1.00 25.34 ? 124  LEU E CD1   1 
ATOM   5689  C  CD2   . LEU E  1 124 ? 38.904  54.923  18.122  1.00 27.34 ? 124  LEU E CD2   1 
ATOM   5690  N  N     . ASP E  1 125 ? 36.471  51.309  14.331  1.00 29.21 ? 125  ASP E N     1 
ATOM   5691  C  CA    . ASP E  1 125 ? 35.219  50.635  14.014  1.00 30.28 ? 125  ASP E CA    1 
ATOM   5692  C  C     . ASP E  1 125 ? 34.428  50.373  15.294  1.00 30.09 ? 125  ASP E C     1 
ATOM   5693  O  O     . ASP E  1 125 ? 33.193  50.404  15.282  1.00 30.40 ? 125  ASP E O     1 
ATOM   5694  C  CB    . ASP E  1 125 ? 35.471  49.334  13.243  1.00 30.62 ? 125  ASP E CB    1 
ATOM   5695  C  CG    . ASP E  1 125 ? 36.518  48.472  13.896  1.00 32.36 ? 125  ASP E CG    1 
ATOM   5696  O  OD1   . ASP E  1 125 ? 36.238  47.282  14.144  1.00 35.13 ? 125  ASP E OD1   1 
ATOM   5697  O  OD2   . ASP E  1 125 ? 37.648  48.901  14.216  1.00 34.93 ? 125  ASP E OD2   1 
ATOM   5698  N  N     . GLY E  1 126 ? 35.152  50.130  16.390  1.00 29.69 ? 126  GLY E N     1 
ATOM   5699  C  CA    . GLY E  1 126 ? 34.556  49.807  17.675  1.00 29.23 ? 126  GLY E CA    1 
ATOM   5700  C  C     . GLY E  1 126 ? 34.941  50.727  18.823  1.00 29.12 ? 126  GLY E C     1 
ATOM   5701  O  O     . GLY E  1 126 ? 36.062  51.237  18.890  1.00 29.02 ? 126  GLY E O     1 
ATOM   5702  N  N     . THR E  1 127 ? 33.995  50.937  19.731  1.00 28.79 ? 127  THR E N     1 
ATOM   5703  C  CA    . THR E  1 127 ? 34.266  51.593  20.998  1.00 28.58 ? 127  THR E CA    1 
ATOM   5704  C  C     . THR E  1 127 ? 34.991  50.620  21.925  1.00 28.86 ? 127  THR E C     1 
ATOM   5705  O  O     . THR E  1 127 ? 35.288  49.470  21.546  1.00 28.64 ? 127  THR E O     1 
ATOM   5706  C  CB    . THR E  1 127 ? 32.942  52.059  21.658  1.00 28.63 ? 127  THR E CB    1 
ATOM   5707  O  OG1   . THR E  1 127 ? 32.186  50.922  22.103  1.00 27.60 ? 127  THR E OG1   1 
ATOM   5708  C  CG2   . THR E  1 127 ? 32.023  52.732  20.642  1.00 27.28 ? 127  THR E CG2   1 
ATOM   5709  N  N     . PHE E  1 128 ? 35.262  51.085  23.139  1.00 29.06 ? 128  PHE E N     1 
ATOM   5710  C  CA    . PHE E  1 128 ? 35.847  50.276  24.195  1.00 29.52 ? 128  PHE E CA    1 
ATOM   5711  C  C     . PHE E  1 128 ? 34.940  49.105  24.612  1.00 30.00 ? 128  PHE E C     1 
ATOM   5712  O  O     . PHE E  1 128 ? 35.390  48.184  25.283  1.00 30.24 ? 128  PHE E O     1 
ATOM   5713  C  CB    . PHE E  1 128 ? 36.184  51.177  25.395  1.00 29.49 ? 128  PHE E CB    1 
ATOM   5714  C  CG    . PHE E  1 128 ? 34.986  51.571  26.230  1.00 29.16 ? 128  PHE E CG    1 
ATOM   5715  C  CD1   . PHE E  1 128 ? 34.713  50.914  27.432  1.00 29.88 ? 128  PHE E CD1   1 
ATOM   5716  C  CD2   . PHE E  1 128 ? 34.145  52.597  25.823  1.00 28.71 ? 128  PHE E CD2   1 
ATOM   5717  C  CE1   . PHE E  1 128 ? 33.614  51.276  28.220  1.00 30.14 ? 128  PHE E CE1   1 
ATOM   5718  C  CE2   . PHE E  1 128 ? 33.034  52.963  26.587  1.00 30.48 ? 128  PHE E CE2   1 
ATOM   5719  C  CZ    . PHE E  1 128 ? 32.766  52.305  27.795  1.00 30.78 ? 128  PHE E CZ    1 
ATOM   5720  N  N     . GLN E  1 129 ? 33.669  49.153  24.216  1.00 30.56 ? 129  GLN E N     1 
ATOM   5721  C  CA    . GLN E  1 129 ? 32.725  48.056  24.468  1.00 31.38 ? 129  GLN E CA    1 
ATOM   5722  C  C     . GLN E  1 129 ? 32.547  47.125  23.260  1.00 31.46 ? 129  GLN E C     1 
ATOM   5723  O  O     . GLN E  1 129 ? 31.706  46.220  23.281  1.00 31.34 ? 129  GLN E O     1 
ATOM   5724  C  CB    . GLN E  1 129 ? 31.359  48.592  24.926  1.00 31.25 ? 129  GLN E CB    1 
ATOM   5725  C  CG    . GLN E  1 129 ? 31.396  49.243  26.293  1.00 32.80 ? 129  GLN E CG    1 
ATOM   5726  C  CD    . GLN E  1 129 ? 30.129  49.996  26.640  1.00 35.17 ? 129  GLN E CD    1 
ATOM   5727  O  OE1   . GLN E  1 129 ? 29.754  50.068  27.811  1.00 35.91 ? 129  GLN E OE1   1 
ATOM   5728  N  NE2   . GLN E  1 129 ? 29.473  50.571  25.633  1.00 35.44 ? 129  GLN E NE2   1 
ATOM   5729  N  N     . ARG E  1 130 ? 33.351  47.348  22.218  1.00 31.61 ? 130  ARG E N     1 
ATOM   5730  C  CA    . ARG E  1 130 ? 33.279  46.588  20.966  1.00 31.83 ? 130  ARG E CA    1 
ATOM   5731  C  C     . ARG E  1 130 ? 31.900  46.735  20.287  1.00 31.89 ? 130  ARG E C     1 
ATOM   5732  O  O     . ARG E  1 130 ? 31.377  45.804  19.683  1.00 32.01 ? 130  ARG E O     1 
ATOM   5733  C  CB    . ARG E  1 130 ? 33.674  45.120  21.173  1.00 31.49 ? 130  ARG E CB    1 
ATOM   5734  C  CG    . ARG E  1 130 ? 35.148  44.904  21.504  1.00 32.28 ? 130  ARG E CG    1 
ATOM   5735  C  CD    . ARG E  1 130 ? 35.634  43.461  21.320  1.00 33.62 ? 130  ARG E CD    1 
ATOM   5736  N  NE    . ARG E  1 130 ? 34.666  42.555  21.908  1.00 36.65 ? 130  ARG E NE    1 
ATOM   5737  C  CZ    . ARG E  1 130 ? 34.313  41.374  21.430  1.00 36.47 ? 130  ARG E CZ    1 
ATOM   5738  N  NH1   . ARG E  1 130 ? 34.868  40.862  20.331  1.00 37.03 ? 130  ARG E NH1   1 
ATOM   5739  N  NH2   . ARG E  1 130 ? 33.392  40.695  22.081  1.00 36.80 ? 130  ARG E NH2   1 
ATOM   5740  N  N     . LYS E  1 131 ? 31.334  47.929  20.394  1.00 31.92 ? 131  LYS E N     1 
ATOM   5741  C  CA    . LYS E  1 131 ? 30.093  48.277  19.726  1.00 32.35 ? 131  LYS E CA    1 
ATOM   5742  C  C     . LYS E  1 131 ? 30.431  49.249  18.604  1.00 31.91 ? 131  LYS E C     1 
ATOM   5743  O  O     . LYS E  1 131 ? 31.497  49.865  18.639  1.00 31.72 ? 131  LYS E O     1 
ATOM   5744  C  CB    . LYS E  1 131 ? 29.120  48.917  20.723  1.00 32.52 ? 131  LYS E CB    1 
ATOM   5745  C  CG    . LYS E  1 131 ? 28.412  47.915  21.617  1.00 34.82 ? 131  LYS E CG    1 
ATOM   5746  C  CD    . LYS E  1 131 ? 27.596  48.623  22.700  1.00 38.87 ? 131  LYS E CD    1 
ATOM   5747  C  CE    . LYS E  1 131 ? 26.388  47.777  23.130  1.00 41.11 ? 131  LYS E CE    1 
ATOM   5748  N  NZ    . LYS E  1 131 ? 26.675  46.953  24.343  1.00 41.72 ? 131  LYS E NZ    1 
ATOM   5749  N  N     . PRO E  1 132 ? 29.553  49.390  17.607  1.00 31.73 ? 132  PRO E N     1 
ATOM   5750  C  CA    . PRO E  1 132 ? 29.791  50.345  16.518  1.00 31.62 ? 132  PRO E CA    1 
ATOM   5751  C  C     . PRO E  1 132 ? 30.017  51.752  17.075  1.00 31.70 ? 132  PRO E C     1 
ATOM   5752  O  O     . PRO E  1 132 ? 29.295  52.181  17.977  1.00 31.26 ? 132  PRO E O     1 
ATOM   5753  C  CB    . PRO E  1 132 ? 28.496  50.285  15.702  1.00 31.46 ? 132  PRO E CB    1 
ATOM   5754  C  CG    . PRO E  1 132 ? 27.942  48.962  15.987  1.00 31.47 ? 132  PRO E CG    1 
ATOM   5755  C  CD    . PRO E  1 132 ? 28.267  48.691  17.434  1.00 31.74 ? 132  PRO E CD    1 
ATOM   5756  N  N     . PHE E  1 133 ? 31.040  52.433  16.563  1.00 31.75 ? 133  PHE E N     1 
ATOM   5757  C  CA    . PHE E  1 133 ? 31.419  53.743  17.066  1.00 31.92 ? 133  PHE E CA    1 
ATOM   5758  C  C     . PHE E  1 133 ? 30.725  54.825  16.245  1.00 32.53 ? 133  PHE E C     1 
ATOM   5759  O  O     . PHE E  1 133 ? 31.146  55.142  15.121  1.00 32.77 ? 133  PHE E O     1 
ATOM   5760  C  CB    . PHE E  1 133 ? 32.941  53.910  17.016  1.00 31.68 ? 133  PHE E CB    1 
ATOM   5761  C  CG    . PHE E  1 133 ? 33.494  54.897  18.018  1.00 30.91 ? 133  PHE E CG    1 
ATOM   5762  C  CD1   . PHE E  1 133 ? 34.685  54.627  18.675  1.00 30.09 ? 133  PHE E CD1   1 
ATOM   5763  C  CD2   . PHE E  1 133 ? 32.831  56.095  18.298  1.00 30.88 ? 133  PHE E CD2   1 
ATOM   5764  C  CE1   . PHE E  1 133 ? 35.216  55.522  19.586  1.00 30.61 ? 133  PHE E CE1   1 
ATOM   5765  C  CE2   . PHE E  1 133 ? 33.342  57.005  19.216  1.00 30.44 ? 133  PHE E CE2   1 
ATOM   5766  C  CZ    . PHE E  1 133 ? 34.543  56.722  19.862  1.00 31.18 ? 133  PHE E CZ    1 
ATOM   5767  N  N     . GLY E  1 134 ? 29.656  55.385  16.803  1.00 32.89 ? 134  GLY E N     1 
ATOM   5768  C  CA    . GLY E  1 134 ? 28.879  56.398  16.108  1.00 33.15 ? 134  GLY E CA    1 
ATOM   5769  C  C     . GLY E  1 134 ? 28.227  55.853  14.852  1.00 33.20 ? 134  GLY E C     1 
ATOM   5770  O  O     . GLY E  1 134 ? 27.711  54.733  14.851  1.00 33.37 ? 134  GLY E O     1 
ATOM   5771  N  N     . ALA E  1 135 ? 28.281  56.638  13.783  1.00 33.06 ? 135  ALA E N     1 
ATOM   5772  C  CA    . ALA E  1 135 ? 27.600  56.318  12.537  1.00 33.05 ? 135  ALA E CA    1 
ATOM   5773  C  C     . ALA E  1 135 ? 28.554  55.717  11.507  1.00 32.92 ? 135  ALA E C     1 
ATOM   5774  O  O     . ALA E  1 135 ? 28.170  55.465  10.365  1.00 32.75 ? 135  ALA E O     1 
ATOM   5775  C  CB    . ALA E  1 135 ? 26.952  57.583  11.983  1.00 32.91 ? 135  ALA E CB    1 
ATOM   5776  N  N     . ILE E  1 136 ? 29.788  55.462  11.930  1.00 32.85 ? 136  ILE E N     1 
ATOM   5777  C  CA    . ILE E  1 136 ? 30.867  55.136  11.004  1.00 32.86 ? 136  ILE E CA    1 
ATOM   5778  C  C     . ILE E  1 136 ? 30.671  53.894  10.124  1.00 32.54 ? 136  ILE E C     1 
ATOM   5779  O  O     . ILE E  1 136 ? 31.097  53.892  8.970   1.00 32.48 ? 136  ILE E O     1 
ATOM   5780  C  CB    . ILE E  1 136 ? 32.239  55.159  11.734  1.00 33.24 ? 136  ILE E CB    1 
ATOM   5781  C  CG1   . ILE E  1 136 ? 33.342  55.600  10.761  1.00 33.79 ? 136  ILE E CG1   1 
ATOM   5782  C  CG2   . ILE E  1 136 ? 32.526  53.826  12.474  1.00 33.26 ? 136  ILE E CG2   1 
ATOM   5783  C  CD1   . ILE E  1 136 ? 33.925  54.464  9.926   1.00 35.40 ? 136  ILE E CD1   1 
ATOM   5784  N  N     . LEU E  1 137 ? 29.997  52.868  10.639  1.00 32.21 ? 137  LEU E N     1 
ATOM   5785  C  CA    . LEU E  1 137 ? 29.786  51.644  9.866   1.00 31.88 ? 137  LEU E CA    1 
ATOM   5786  C  C     . LEU E  1 137 ? 28.780  51.806  8.717   1.00 31.73 ? 137  LEU E C     1 
ATOM   5787  O  O     . LEU E  1 137 ? 28.779  51.009  7.772   1.00 31.47 ? 137  LEU E O     1 
ATOM   5788  C  CB    . LEU E  1 137 ? 29.418  50.475  10.785  1.00 32.00 ? 137  LEU E CB    1 
ATOM   5789  C  CG    . LEU E  1 137 ? 30.521  50.028  11.749  1.00 32.11 ? 137  LEU E CG    1 
ATOM   5790  C  CD1   . LEU E  1 137 ? 30.063  48.826  12.552  1.00 32.35 ? 137  LEU E CD1   1 
ATOM   5791  C  CD2   . LEU E  1 137 ? 31.852  49.742  11.029  1.00 32.32 ? 137  LEU E CD2   1 
ATOM   5792  N  N     . ASN E  1 138 ? 27.948  52.849  8.783   1.00 31.40 ? 138  ASN E N     1 
ATOM   5793  C  CA    . ASN E  1 138 ? 27.065  53.203  7.662   1.00 31.25 ? 138  ASN E CA    1 
ATOM   5794  C  C     . ASN E  1 138 ? 27.840  53.593  6.397   1.00 30.68 ? 138  ASN E C     1 
ATOM   5795  O  O     . ASN E  1 138 ? 27.276  53.610  5.305   1.00 30.53 ? 138  ASN E O     1 
ATOM   5796  C  CB    . ASN E  1 138 ? 26.082  54.322  8.041   1.00 31.39 ? 138  ASN E CB    1 
ATOM   5797  C  CG    . ASN E  1 138 ? 25.136  53.922  9.174   1.00 32.61 ? 138  ASN E CG    1 
ATOM   5798  O  OD1   . ASN E  1 138 ? 24.635  52.805  9.212   1.00 33.59 ? 138  ASN E OD1   1 
ATOM   5799  N  ND2   . ASN E  1 138 ? 24.889  54.850  10.097  1.00 33.85 ? 138  ASN E ND2   1 
ATOM   5800  N  N     . LEU E  1 139 ? 29.124  53.910  6.552   1.00 30.08 ? 139  LEU E N     1 
ATOM   5801  C  CA    . LEU E  1 139 ? 29.991  54.171  5.402   1.00 29.86 ? 139  LEU E CA    1 
ATOM   5802  C  C     . LEU E  1 139 ? 30.325  52.908  4.608   1.00 29.53 ? 139  LEU E C     1 
ATOM   5803  O  O     . LEU E  1 139 ? 30.540  52.979  3.397   1.00 29.45 ? 139  LEU E O     1 
ATOM   5804  C  CB    . LEU E  1 139 ? 31.299  54.844  5.826   1.00 29.85 ? 139  LEU E CB    1 
ATOM   5805  C  CG    . LEU E  1 139 ? 31.400  56.368  5.885   1.00 30.56 ? 139  LEU E CG    1 
ATOM   5806  C  CD1   . LEU E  1 139 ? 32.871  56.760  5.928   1.00 31.02 ? 139  LEU E CD1   1 
ATOM   5807  C  CD2   . LEU E  1 139 ? 30.674  57.084  4.727   1.00 30.06 ? 139  LEU E CD2   1 
ATOM   5808  N  N     . VAL E  1 140 ? 30.373  51.760  5.288   1.00 29.21 ? 140  VAL E N     1 
ATOM   5809  C  CA    . VAL E  1 140 ? 30.802  50.508  4.646   1.00 29.06 ? 140  VAL E CA    1 
ATOM   5810  C  C     . VAL E  1 140 ? 30.034  50.151  3.356   1.00 29.15 ? 140  VAL E C     1 
ATOM   5811  O  O     . VAL E  1 140 ? 30.672  49.900  2.331   1.00 29.51 ? 140  VAL E O     1 
ATOM   5812  C  CB    . VAL E  1 140 ? 30.855  49.323  5.636   1.00 28.82 ? 140  VAL E CB    1 
ATOM   5813  C  CG1   . VAL E  1 140 ? 31.186  48.013  4.899   1.00 28.84 ? 140  VAL E CG1   1 
ATOM   5814  C  CG2   . VAL E  1 140 ? 31.880  49.609  6.715   1.00 28.05 ? 140  VAL E CG2   1 
ATOM   5815  N  N     . PRO E  1 141 ? 28.695  50.126  3.380   1.00 29.04 ? 141  PRO E N     1 
ATOM   5816  C  CA    . PRO E  1 141 ? 27.932  49.872  2.147   1.00 28.87 ? 141  PRO E CA    1 
ATOM   5817  C  C     . PRO E  1 141 ? 28.054  50.975  1.088   1.00 28.96 ? 141  PRO E C     1 
ATOM   5818  O  O     . PRO E  1 141 ? 27.648  50.763  -0.052  1.00 29.00 ? 141  PRO E O     1 
ATOM   5819  C  CB    . PRO E  1 141 ? 26.478  49.723  2.630   1.00 28.89 ? 141  PRO E CB    1 
ATOM   5820  C  CG    . PRO E  1 141 ? 26.433  50.227  4.028   1.00 28.68 ? 141  PRO E CG    1 
ATOM   5821  C  CD    . PRO E  1 141 ? 27.813  50.272  4.558   1.00 28.86 ? 141  PRO E CD    1 
ATOM   5822  N  N     . LEU E  1 142 ? 28.607  52.125  1.459   1.00 28.91 ? 142  LEU E N     1 
ATOM   5823  C  CA    . LEU E  1 142 ? 28.814  53.221  0.522   1.00 28.83 ? 142  LEU E CA    1 
ATOM   5824  C  C     . LEU E  1 142 ? 30.244  53.299  -0.013  1.00 28.92 ? 142  LEU E C     1 
ATOM   5825  O  O     . LEU E  1 142 ? 30.520  54.058  -0.944  1.00 29.04 ? 142  LEU E O     1 
ATOM   5826  C  CB    . LEU E  1 142 ? 28.429  54.557  1.158   1.00 29.02 ? 142  LEU E CB    1 
ATOM   5827  C  CG    . LEU E  1 142 ? 27.054  54.712  1.828   1.00 29.33 ? 142  LEU E CG    1 
ATOM   5828  C  CD1   . LEU E  1 142 ? 27.071  55.917  2.745   1.00 29.02 ? 142  LEU E CD1   1 
ATOM   5829  C  CD2   . LEU E  1 142 ? 25.939  54.841  0.820   1.00 28.08 ? 142  LEU E CD2   1 
ATOM   5830  N  N     . ALA E  1 143 ? 31.148  52.508  0.552   1.00 28.95 ? 143  ALA E N     1 
ATOM   5831  C  CA    . ALA E  1 143 ? 32.565  52.620  0.230   1.00 29.05 ? 143  ALA E CA    1 
ATOM   5832  C  C     . ALA E  1 143 ? 33.034  51.632  -0.840  1.00 29.33 ? 143  ALA E C     1 
ATOM   5833  O  O     . ALA E  1 143 ? 32.561  50.483  -0.911  1.00 29.30 ? 143  ALA E O     1 
ATOM   5834  C  CB    . ALA E  1 143 ? 33.409  52.491  1.514   1.00 29.10 ? 143  ALA E CB    1 
ATOM   5835  N  N     . GLU E  1 144 ? 33.961  52.077  -1.681  1.00 29.66 ? 144  GLU E N     1 
ATOM   5836  C  CA    . GLU E  1 144 ? 34.519  51.182  -2.701  1.00 30.26 ? 144  GLU E CA    1 
ATOM   5837  C  C     . GLU E  1 144 ? 35.699  50.387  -2.164  1.00 29.98 ? 144  GLU E C     1 
ATOM   5838  O  O     . GLU E  1 144 ? 36.107  49.399  -2.766  1.00 30.26 ? 144  GLU E O     1 
ATOM   5839  C  CB    . GLU E  1 144 ? 34.899  51.906  -3.997  1.00 30.48 ? 144  GLU E CB    1 
ATOM   5840  C  CG    . GLU E  1 144 ? 34.994  53.417  -3.915  1.00 32.83 ? 144  GLU E CG    1 
ATOM   5841  C  CD    . GLU E  1 144 ? 33.644  54.117  -4.055  1.00 34.02 ? 144  GLU E CD    1 
ATOM   5842  O  OE1   . GLU E  1 144 ? 33.071  54.158  -5.174  1.00 34.64 ? 144  GLU E OE1   1 
ATOM   5843  O  OE2   . GLU E  1 144 ? 33.163  54.634  -3.035  1.00 32.75 ? 144  GLU E OE2   1 
ATOM   5844  N  N     . SER E  1 145 ? 36.231  50.813  -1.024  1.00 29.52 ? 145  SER E N     1 
ATOM   5845  C  CA    . SER E  1 145 ? 37.347  50.129  -0.396  1.00 29.13 ? 145  SER E CA    1 
ATOM   5846  C  C     . SER E  1 145 ? 37.225  50.203  1.126   1.00 28.92 ? 145  SER E C     1 
ATOM   5847  O  O     . SER E  1 145 ? 36.999  51.281  1.701   1.00 28.70 ? 145  SER E O     1 
ATOM   5848  C  CB    . SER E  1 145 ? 38.681  50.713  -0.873  1.00 29.43 ? 145  SER E CB    1 
ATOM   5849  O  OG    . SER E  1 145 ? 39.665  50.606  0.140   1.00 30.00 ? 145  SER E OG    1 
ATOM   5850  N  N     . VAL E  1 146 ? 37.348  49.044  1.768   1.00 28.41 ? 146  VAL E N     1 
ATOM   5851  C  CA    . VAL E  1 146 ? 37.290  48.945  3.217   1.00 27.99 ? 146  VAL E CA    1 
ATOM   5852  C  C     . VAL E  1 146 ? 38.390  47.998  3.659   1.00 28.02 ? 146  VAL E C     1 
ATOM   5853  O  O     . VAL E  1 146 ? 38.469  46.856  3.177   1.00 28.00 ? 146  VAL E O     1 
ATOM   5854  C  CB    . VAL E  1 146 ? 35.910  48.409  3.726   1.00 27.80 ? 146  VAL E CB    1 
ATOM   5855  C  CG1   . VAL E  1 146 ? 35.918  48.227  5.229   1.00 27.23 ? 146  VAL E CG1   1 
ATOM   5856  C  CG2   . VAL E  1 146 ? 34.779  49.344  3.351   1.00 27.98 ? 146  VAL E CG2   1 
ATOM   5857  N  N     . VAL E  1 147 ? 39.244  48.472  4.566   1.00 27.90 ? 147  VAL E N     1 
ATOM   5858  C  CA    . VAL E  1 147 ? 40.234  47.609  5.219   1.00 27.78 ? 147  VAL E CA    1 
ATOM   5859  C  C     . VAL E  1 147 ? 40.150  47.755  6.734   1.00 27.76 ? 147  VAL E C     1 
ATOM   5860  O  O     . VAL E  1 147 ? 39.723  48.798  7.252   1.00 27.42 ? 147  VAL E O     1 
ATOM   5861  C  CB    . VAL E  1 147 ? 41.716  47.836  4.737   1.00 27.97 ? 147  VAL E CB    1 
ATOM   5862  C  CG1   . VAL E  1 147 ? 41.856  47.646  3.219   1.00 28.09 ? 147  VAL E CG1   1 
ATOM   5863  C  CG2   . VAL E  1 147 ? 42.256  49.193  5.172   1.00 28.01 ? 147  VAL E CG2   1 
ATOM   5864  N  N     . LYS E  1 148 ? 40.537  46.696  7.439   1.00 27.66 ? 148  LYS E N     1 
ATOM   5865  C  CA    . LYS E  1 148 ? 40.688  46.765  8.881   1.00 27.78 ? 148  LYS E CA    1 
ATOM   5866  C  C     . LYS E  1 148 ? 42.129  46.437  9.283   1.00 27.85 ? 148  LYS E C     1 
ATOM   5867  O  O     . LYS E  1 148 ? 42.610  45.322  9.056   1.00 27.75 ? 148  LYS E O     1 
ATOM   5868  C  CB    . LYS E  1 148 ? 39.691  45.858  9.618   1.00 27.40 ? 148  LYS E CB    1 
ATOM   5869  C  CG    . LYS E  1 148 ? 39.764  46.049  11.125  1.00 27.89 ? 148  LYS E CG    1 
ATOM   5870  C  CD    . LYS E  1 148 ? 38.624  45.386  11.871  1.00 29.77 ? 148  LYS E CD    1 
ATOM   5871  C  CE    . LYS E  1 148 ? 38.903  45.374  13.367  1.00 30.60 ? 148  LYS E CE    1 
ATOM   5872  N  NZ    . LYS E  1 148 ? 37.680  45.051  14.164  1.00 32.21 ? 148  LYS E NZ    1 
ATOM   5873  N  N     . LEU E  1 149 ? 42.801  47.423  9.878   1.00 27.91 ? 149  LEU E N     1 
ATOM   5874  C  CA    . LEU E  1 149 ? 44.192  47.273  10.301  1.00 28.13 ? 149  LEU E CA    1 
ATOM   5875  C  C     . LEU E  1 149 ? 44.273  46.562  11.635  1.00 28.52 ? 149  LEU E C     1 
ATOM   5876  O  O     . LEU E  1 149 ? 43.278  46.411  12.345  1.00 28.94 ? 149  LEU E O     1 
ATOM   5877  C  CB    . LEU E  1 149 ? 44.904  48.630  10.393  1.00 27.76 ? 149  LEU E CB    1 
ATOM   5878  C  CG    . LEU E  1 149 ? 45.027  49.433  9.094   1.00 27.91 ? 149  LEU E CG    1 
ATOM   5879  C  CD1   . LEU E  1 149 ? 45.811  50.726  9.347   1.00 26.49 ? 149  LEU E CD1   1 
ATOM   5880  C  CD2   . LEU E  1 149 ? 45.634  48.603  7.928   1.00 26.62 ? 149  LEU E CD2   1 
ATOM   5881  N  N     . THR E  1 150 ? 45.483  46.146  11.974  1.00 28.88 ? 150  THR E N     1 
ATOM   5882  C  CA    . THR E  1 150 ? 45.732  45.357  13.159  1.00 29.28 ? 150  THR E CA    1 
ATOM   5883  C  C     . THR E  1 150 ? 46.746  46.076  14.059  1.00 29.01 ? 150  THR E C     1 
ATOM   5884  O  O     . THR E  1 150 ? 47.624  46.802  13.580  1.00 28.56 ? 150  THR E O     1 
ATOM   5885  C  CB    . THR E  1 150 ? 46.217  43.958  12.701  1.00 29.59 ? 150  THR E CB    1 
ATOM   5886  O  OG1   . THR E  1 150 ? 45.418  42.946  13.325  1.00 31.69 ? 150  THR E OG1   1 
ATOM   5887  C  CG2   . THR E  1 150 ? 47.619  43.651  13.180  1.00 30.38 ? 150  THR E CG2   1 
ATOM   5888  N  N     . ALA E  1 151 ? 46.599  45.899  15.366  1.00 28.92 ? 151  ALA E N     1 
ATOM   5889  C  CA    . ALA E  1 151 ? 47.585  46.397  16.317  1.00 28.88 ? 151  ALA E CA    1 
ATOM   5890  C  C     . ALA E  1 151 ? 48.280  45.228  17.015  1.00 29.10 ? 151  ALA E C     1 
ATOM   5891  O  O     . ALA E  1 151 ? 47.983  44.062  16.737  1.00 28.97 ? 151  ALA E O     1 
ATOM   5892  C  CB    . ALA E  1 151 ? 46.932  47.336  17.323  1.00 28.59 ? 151  ALA E CB    1 
ATOM   5893  N  N     . VAL E  1 152 ? 49.232  45.539  17.890  1.00 29.56 ? 152  VAL E N     1 
ATOM   5894  C  CA    . VAL E  1 152 ? 49.896  44.521  18.711  1.00 30.05 ? 152  VAL E CA    1 
ATOM   5895  C  C     . VAL E  1 152 ? 49.240  44.547  20.089  1.00 30.36 ? 152  VAL E C     1 
ATOM   5896  O  O     . VAL E  1 152 ? 49.045  45.622  20.658  1.00 30.32 ? 152  VAL E O     1 
ATOM   5897  C  CB    . VAL E  1 152 ? 51.447  44.769  18.793  1.00 30.15 ? 152  VAL E CB    1 
ATOM   5898  C  CG1   . VAL E  1 152 ? 52.139  43.767  19.711  1.00 29.41 ? 152  VAL E CG1   1 
ATOM   5899  C  CG2   . VAL E  1 152 ? 52.072  44.706  17.406  1.00 29.58 ? 152  VAL E CG2   1 
ATOM   5900  N  N     . CYS E  1 153 ? 48.867  43.377  20.608  1.00 31.07 ? 153  CYS E N     1 
ATOM   5901  C  CA    . CYS E  1 153 ? 48.263  43.306  21.937  1.00 31.82 ? 153  CYS E CA    1 
ATOM   5902  C  C     . CYS E  1 153 ? 49.292  43.732  22.980  1.00 32.87 ? 153  CYS E C     1 
ATOM   5903  O  O     . CYS E  1 153 ? 50.391  43.161  23.074  1.00 32.80 ? 153  CYS E O     1 
ATOM   5904  C  CB    . CYS E  1 153 ? 47.699  41.917  22.254  1.00 31.42 ? 153  CYS E CB    1 
ATOM   5905  S  SG    . CYS E  1 153 ? 46.930  41.827  23.890  1.00 29.44 ? 153  CYS E SG    1 
ATOM   5906  N  N     . MET E  1 154 ? 48.935  44.759  23.743  1.00 33.88 ? 154  MET E N     1 
ATOM   5907  C  CA    . MET E  1 154 ? 49.840  45.337  24.729  1.00 35.04 ? 154  MET E CA    1 
ATOM   5908  C  C     . MET E  1 154 ? 49.947  44.480  25.995  1.00 35.90 ? 154  MET E C     1 
ATOM   5909  O  O     . MET E  1 154 ? 50.708  44.807  26.903  1.00 36.40 ? 154  MET E O     1 
ATOM   5910  C  CB    . MET E  1 154 ? 49.416  46.772  25.071  1.00 34.83 ? 154  MET E CB    1 
ATOM   5911  C  CG    . MET E  1 154 ? 49.620  47.752  23.940  1.00 35.12 ? 154  MET E CG    1 
ATOM   5912  S  SD    . MET E  1 154 ? 48.757  49.324  24.143  1.00 38.32 ? 154  MET E SD    1 
ATOM   5913  C  CE    . MET E  1 154 ? 49.635  50.337  22.965  1.00 36.92 ? 154  MET E CE    1 
ATOM   5914  N  N     . GLU E  1 155 ? 49.203  43.378  26.046  1.00 36.67 ? 155  GLU E N     1 
ATOM   5915  C  CA    . GLU E  1 155 ? 49.198  42.521  27.225  1.00 37.44 ? 155  GLU E CA    1 
ATOM   5916  C  C     . GLU E  1 155 ? 49.758  41.120  26.961  1.00 37.63 ? 155  GLU E C     1 
ATOM   5917  O  O     . GLU E  1 155 ? 50.381  40.544  27.839  1.00 37.92 ? 155  GLU E O     1 
ATOM   5918  C  CB    . GLU E  1 155 ? 47.808  42.506  27.874  1.00 37.54 ? 155  GLU E CB    1 
ATOM   5919  C  CG    . GLU E  1 155 ? 47.401  43.895  28.370  1.00 39.01 ? 155  GLU E CG    1 
ATOM   5920  C  CD    . GLU E  1 155 ? 45.961  44.015  28.833  1.00 40.74 ? 155  GLU E CD    1 
ATOM   5921  O  OE1   . GLU E  1 155 ? 45.430  45.154  28.801  1.00 42.29 ? 155  GLU E OE1   1 
ATOM   5922  O  OE2   . GLU E  1 155 ? 45.357  42.998  29.242  1.00 42.05 ? 155  GLU E OE2   1 
ATOM   5923  N  N     . CYS E  1 156 ? 49.563  40.586  25.756  1.00 37.79 ? 156  CYS E N     1 
ATOM   5924  C  CA    . CYS E  1 156 ? 50.134  39.281  25.385  1.00 38.00 ? 156  CYS E CA    1 
ATOM   5925  C  C     . CYS E  1 156 ? 51.023  39.322  24.137  1.00 38.11 ? 156  CYS E C     1 
ATOM   5926  O  O     . CYS E  1 156 ? 51.676  38.334  23.810  1.00 38.12 ? 156  CYS E O     1 
ATOM   5927  C  CB    . CYS E  1 156 ? 49.034  38.225  25.204  1.00 37.85 ? 156  CYS E CB    1 
ATOM   5928  S  SG    . CYS E  1 156 ? 48.270  38.191  23.562  1.00 38.16 ? 156  CYS E SG    1 
ATOM   5929  N  N     . PHE E  1 157 ? 51.020  40.456  23.437  1.00 38.45 ? 157  PHE E N     1 
ATOM   5930  C  CA    . PHE E  1 157 ? 51.896  40.702  22.270  1.00 38.88 ? 157  PHE E CA    1 
ATOM   5931  C  C     . PHE E  1 157 ? 51.579  39.900  21.006  1.00 38.88 ? 157  PHE E C     1 
ATOM   5932  O  O     . PHE E  1 157 ? 52.388  39.850  20.082  1.00 39.19 ? 157  PHE E O     1 
ATOM   5933  C  CB    . PHE E  1 157 ? 53.396  40.631  22.646  1.00 38.90 ? 157  PHE E CB    1 
ATOM   5934  C  CG    . PHE E  1 157 ? 53.733  41.386  23.900  1.00 39.28 ? 157  PHE E CG    1 
ATOM   5935  C  CD1   . PHE E  1 157 ? 53.920  40.713  25.103  1.00 39.88 ? 157  PHE E CD1   1 
ATOM   5936  C  CD2   . PHE E  1 157 ? 53.825  42.772  23.888  1.00 39.69 ? 157  PHE E CD2   1 
ATOM   5937  C  CE1   . PHE E  1 157 ? 54.201  41.406  26.275  1.00 40.07 ? 157  PHE E CE1   1 
ATOM   5938  C  CE2   . PHE E  1 157 ? 54.115  43.474  25.057  1.00 40.50 ? 157  PHE E CE2   1 
ATOM   5939  C  CZ    . PHE E  1 157 ? 54.301  42.785  26.253  1.00 40.50 ? 157  PHE E CZ    1 
ATOM   5940  N  N     . ARG E  1 158 ? 50.395  39.289  20.959  1.00 38.90 ? 158  ARG E N     1 
ATOM   5941  C  CA    . ARG E  1 158 ? 49.861  38.728  19.707  1.00 38.81 ? 158  ARG E CA    1 
ATOM   5942  C  C     . ARG E  1 158 ? 49.117  39.828  18.940  1.00 37.87 ? 158  ARG E C     1 
ATOM   5943  O  O     . ARG E  1 158 ? 49.126  40.984  19.365  1.00 37.60 ? 158  ARG E O     1 
ATOM   5944  C  CB    . ARG E  1 158 ? 48.956  37.528  19.993  1.00 39.23 ? 158  ARG E CB    1 
ATOM   5945  C  CG    . ARG E  1 158 ? 49.653  36.416  20.769  1.00 42.28 ? 158  ARG E CG    1 
ATOM   5946  C  CD    . ARG E  1 158 ? 49.371  35.014  20.250  1.00 48.31 ? 158  ARG E CD    1 
ATOM   5947  N  NE    . ARG E  1 158 ? 50.119  34.730  19.020  1.00 51.77 ? 158  ARG E NE    1 
ATOM   5948  C  CZ    . ARG E  1 158 ? 49.626  34.082  17.962  1.00 53.88 ? 158  ARG E CZ    1 
ATOM   5949  N  NH1   . ARG E  1 158 ? 48.375  33.623  17.958  1.00 54.29 ? 158  ARG E NH1   1 
ATOM   5950  N  NH2   . ARG E  1 158 ? 50.393  33.888  16.897  1.00 54.66 ? 158  ARG E NH2   1 
ATOM   5951  N  N     . GLU E  1 159 ? 48.491  39.482  17.815  1.00 37.06 ? 159  GLU E N     1 
ATOM   5952  C  CA    . GLU E  1 159 ? 47.710  40.452  17.039  1.00 36.39 ? 159  GLU E CA    1 
ATOM   5953  C  C     . GLU E  1 159 ? 46.496  40.975  17.827  1.00 34.96 ? 159  GLU E C     1 
ATOM   5954  O  O     . GLU E  1 159 ? 45.774  40.211  18.460  1.00 34.46 ? 159  GLU E O     1 
ATOM   5955  C  CB    . GLU E  1 159 ? 47.259  39.859  15.694  1.00 37.12 ? 159  GLU E CB    1 
ATOM   5956  C  CG    . GLU E  1 159 ? 48.396  39.575  14.713  1.00 40.55 ? 159  GLU E CG    1 
ATOM   5957  C  CD    . GLU E  1 159 ? 48.042  39.896  13.262  1.00 45.51 ? 159  GLU E CD    1 
ATOM   5958  O  OE1   . GLU E  1 159 ? 47.041  39.334  12.733  1.00 46.19 ? 159  GLU E OE1   1 
ATOM   5959  O  OE2   . GLU E  1 159 ? 48.781  40.710  12.641  1.00 46.90 ? 159  GLU E OE2   1 
ATOM   5960  N  N     . ALA E  1 160 ? 46.295  42.288  17.782  1.00 33.37 ? 160  ALA E N     1 
ATOM   5961  C  CA    . ALA E  1 160 ? 45.194  42.937  18.480  1.00 32.11 ? 160  ALA E CA    1 
ATOM   5962  C  C     . ALA E  1 160 ? 44.169  43.522  17.508  1.00 31.40 ? 160  ALA E C     1 
ATOM   5963  O  O     . ALA E  1 160 ? 44.528  44.251  16.588  1.00 31.13 ? 160  ALA E O     1 
ATOM   5964  C  CB    . ALA E  1 160 ? 45.728  44.022  19.390  1.00 31.80 ? 160  ALA E CB    1 
ATOM   5965  N  N     . ALA E  1 161 ? 42.894  43.213  17.741  1.00 30.52 ? 161  ALA E N     1 
ATOM   5966  C  CA    . ALA E  1 161 ? 41.796  43.724  16.926  1.00 29.78 ? 161  ALA E CA    1 
ATOM   5967  C  C     . ALA E  1 161 ? 40.925  44.748  17.671  1.00 29.47 ? 161  ALA E C     1 
ATOM   5968  O  O     . ALA E  1 161 ? 40.109  45.447  17.060  1.00 29.04 ? 161  ALA E O     1 
ATOM   5969  C  CB    . ALA E  1 161 ? 40.939  42.562  16.452  1.00 29.78 ? 161  ALA E CB    1 
ATOM   5970  N  N     . TYR E  1 162 ? 41.108  44.842  18.989  1.00 29.29 ? 162  TYR E N     1 
ATOM   5971  C  CA    . TYR E  1 162 ? 40.208  45.640  19.844  1.00 29.34 ? 162  TYR E CA    1 
ATOM   5972  C  C     . TYR E  1 162 ? 40.910  46.638  20.743  1.00 29.37 ? 162  TYR E C     1 
ATOM   5973  O  O     . TYR E  1 162 ? 42.127  46.589  20.934  1.00 29.29 ? 162  TYR E O     1 
ATOM   5974  C  CB    . TYR E  1 162 ? 39.325  44.713  20.690  1.00 29.25 ? 162  TYR E CB    1 
ATOM   5975  C  CG    . TYR E  1 162 ? 38.901  43.492  19.924  1.00 29.17 ? 162  TYR E CG    1 
ATOM   5976  C  CD1   . TYR E  1 162 ? 39.414  42.236  20.245  1.00 28.76 ? 162  TYR E CD1   1 
ATOM   5977  C  CD2   . TYR E  1 162 ? 38.019  43.601  18.838  1.00 28.55 ? 162  TYR E CD2   1 
ATOM   5978  C  CE1   . TYR E  1 162 ? 39.047  41.103  19.507  1.00 30.07 ? 162  TYR E CE1   1 
ATOM   5979  C  CE2   . TYR E  1 162 ? 37.643  42.477  18.096  1.00 29.43 ? 162  TYR E CE2   1 
ATOM   5980  C  CZ    . TYR E  1 162 ? 38.157  41.234  18.443  1.00 29.72 ? 162  TYR E CZ    1 
ATOM   5981  O  OH    . TYR E  1 162 ? 37.781  40.131  17.735  1.00 29.61 ? 162  TYR E OH    1 
ATOM   5982  N  N     . THR E  1 163 ? 40.125  47.547  21.296  1.00 29.86 ? 163  THR E N     1 
ATOM   5983  C  CA    . THR E  1 163 ? 40.626  48.521  22.255  1.00 30.47 ? 163  THR E CA    1 
ATOM   5984  C  C     . THR E  1 163 ? 39.945  48.337  23.609  1.00 31.35 ? 163  THR E C     1 
ATOM   5985  O  O     . THR E  1 163 ? 38.719  48.349  23.715  1.00 31.25 ? 163  THR E O     1 
ATOM   5986  C  CB    . THR E  1 163 ? 40.416  49.960  21.754  1.00 30.01 ? 163  THR E CB    1 
ATOM   5987  O  OG1   . THR E  1 163 ? 40.790  50.056  20.382  1.00 29.08 ? 163  THR E OG1   1 
ATOM   5988  C  CG2   . THR E  1 163 ? 41.394  50.897  22.446  1.00 30.16 ? 163  THR E CG2   1 
ATOM   5989  N  N     . LYS E  1 164 ? 40.766  48.179  24.637  1.00 32.38 ? 164  LYS E N     1 
ATOM   5990  C  CA    . LYS E  1 164 ? 40.305  48.069  26.010  1.00 33.61 ? 164  LYS E CA    1 
ATOM   5991  C  C     . LYS E  1 164 ? 40.512  49.410  26.722  1.00 34.18 ? 164  LYS E C     1 
ATOM   5992  O  O     . LYS E  1 164 ? 41.597  49.995  26.648  1.00 34.05 ? 164  LYS E O     1 
ATOM   5993  C  CB    . LYS E  1 164 ? 41.101  46.955  26.702  1.00 33.87 ? 164  LYS E CB    1 
ATOM   5994  C  CG    . LYS E  1 164 ? 40.762  46.683  28.157  1.00 35.20 ? 164  LYS E CG    1 
ATOM   5995  C  CD    . LYS E  1 164 ? 40.984  45.212  28.483  1.00 38.23 ? 164  LYS E CD    1 
ATOM   5996  C  CE    . LYS E  1 164 ? 42.159  44.996  29.419  1.00 40.14 ? 164  LYS E CE    1 
ATOM   5997  N  NZ    . LYS E  1 164 ? 42.260  43.565  29.850  1.00 40.82 ? 164  LYS E NZ    1 
ATOM   5998  N  N     . ARG E  1 165 ? 39.473  49.897  27.398  1.00 35.23 ? 165  ARG E N     1 
ATOM   5999  C  CA    . ARG E  1 165 ? 39.609  51.061  28.282  1.00 36.42 ? 165  ARG E CA    1 
ATOM   6000  C  C     . ARG E  1 165 ? 40.172  50.620  29.640  1.00 37.43 ? 165  ARG E C     1 
ATOM   6001  O  O     . ARG E  1 165 ? 39.679  49.664  30.249  1.00 37.36 ? 165  ARG E O     1 
ATOM   6002  C  CB    . ARG E  1 165 ? 38.269  51.784  28.466  1.00 36.10 ? 165  ARG E CB    1 
ATOM   6003  C  CG    . ARG E  1 165 ? 38.377  53.053  29.298  1.00 35.37 ? 165  ARG E CG    1 
ATOM   6004  C  CD    . ARG E  1 165 ? 37.128  53.892  29.336  1.00 34.39 ? 165  ARG E CD    1 
ATOM   6005  N  NE    . ARG E  1 165 ? 36.946  54.641  28.094  1.00 33.70 ? 165  ARG E NE    1 
ATOM   6006  C  CZ    . ARG E  1 165 ? 35.790  55.139  27.692  1.00 33.11 ? 165  ARG E CZ    1 
ATOM   6007  N  NH1   . ARG E  1 165 ? 34.706  54.979  28.446  1.00 33.24 ? 165  ARG E NH1   1 
ATOM   6008  N  NH2   . ARG E  1 165 ? 35.711  55.795  26.540  1.00 32.05 ? 165  ARG E NH2   1 
ATOM   6009  N  N     . LEU E  1 166 ? 41.202  51.317  30.106  1.00 38.82 ? 166  LEU E N     1 
ATOM   6010  C  CA    . LEU E  1 166 ? 41.852  50.949  31.362  1.00 40.41 ? 166  LEU E CA    1 
ATOM   6011  C  C     . LEU E  1 166 ? 41.093  51.426  32.605  1.00 41.49 ? 166  LEU E C     1 
ATOM   6012  O  O     . LEU E  1 166 ? 40.983  50.688  33.574  1.00 41.67 ? 166  LEU E O     1 
ATOM   6013  C  CB    . LEU E  1 166 ? 43.317  51.398  31.372  1.00 40.15 ? 166  LEU E CB    1 
ATOM   6014  C  CG    . LEU E  1 166 ? 44.137  51.005  30.137  1.00 39.92 ? 166  LEU E CG    1 
ATOM   6015  C  CD1   . LEU E  1 166 ? 45.527  51.619  30.221  1.00 40.27 ? 166  LEU E CD1   1 
ATOM   6016  C  CD2   . LEU E  1 166 ? 44.222  49.494  29.965  1.00 38.89 ? 166  LEU E CD2   1 
ATOM   6017  N  N     . GLY E  1 167 ? 40.555  52.643  32.560  1.00 42.85 ? 167  GLY E N     1 
ATOM   6018  C  CA    . GLY E  1 167 ? 39.813  53.208  33.683  1.00 44.46 ? 167  GLY E CA    1 
ATOM   6019  C  C     . GLY E  1 167 ? 38.374  52.723  33.801  1.00 45.56 ? 167  GLY E C     1 
ATOM   6020  O  O     . GLY E  1 167 ? 37.993  51.710  33.206  1.00 45.69 ? 167  GLY E O     1 
ATOM   6021  N  N     . THR E  1 168 ? 37.564  53.449  34.567  1.00 46.45 ? 168  THR E N     1 
ATOM   6022  C  CA    . THR E  1 168 ? 36.187  53.024  34.811  1.00 47.35 ? 168  THR E CA    1 
ATOM   6023  C  C     . THR E  1 168 ? 35.130  53.961  34.234  1.00 47.63 ? 168  THR E C     1 
ATOM   6024  O  O     . THR E  1 168 ? 33.938  53.716  34.407  1.00 47.81 ? 168  THR E O     1 
ATOM   6025  C  CB    . THR E  1 168 ? 35.916  52.784  36.320  1.00 47.67 ? 168  THR E CB    1 
ATOM   6026  O  OG1   . THR E  1 168 ? 36.065  54.017  37.041  1.00 48.56 ? 168  THR E OG1   1 
ATOM   6027  C  CG2   . THR E  1 168 ? 36.968  51.843  36.935  1.00 47.76 ? 168  THR E CG2   1 
ATOM   6028  N  N     . GLU E  1 169 ? 35.557  55.020  33.548  1.00 48.06 ? 169  GLU E N     1 
ATOM   6029  C  CA    . GLU E  1 169 ? 34.606  55.951  32.935  1.00 48.58 ? 169  GLU E CA    1 
ATOM   6030  C  C     . GLU E  1 169 ? 33.716  55.242  31.907  1.00 48.52 ? 169  GLU E C     1 
ATOM   6031  O  O     . GLU E  1 169 ? 34.157  54.323  31.214  1.00 48.54 ? 169  GLU E O     1 
ATOM   6032  C  CB    . GLU E  1 169 ? 35.292  57.201  32.359  1.00 48.84 ? 169  GLU E CB    1 
ATOM   6033  C  CG    . GLU E  1 169 ? 36.548  56.953  31.537  1.00 50.63 ? 169  GLU E CG    1 
ATOM   6034  C  CD    . GLU E  1 169 ? 37.808  56.894  32.381  1.00 52.29 ? 169  GLU E CD    1 
ATOM   6035  O  OE1   . GLU E  1 169 ? 38.458  57.950  32.569  1.00 52.58 ? 169  GLU E OE1   1 
ATOM   6036  O  OE2   . GLU E  1 169 ? 38.149  55.784  32.849  1.00 52.77 ? 169  GLU E OE2   1 
ATOM   6037  N  N     . LYS E  1 170 ? 32.457  55.665  31.841  1.00 48.49 ? 170  LYS E N     1 
ATOM   6038  C  CA    . LYS E  1 170 ? 31.421  54.929  31.120  1.00 48.48 ? 170  LYS E CA    1 
ATOM   6039  C  C     . LYS E  1 170 ? 30.966  55.587  29.820  1.00 47.84 ? 170  LYS E C     1 
ATOM   6040  O  O     . LYS E  1 170 ? 30.396  54.915  28.952  1.00 47.78 ? 170  LYS E O     1 
ATOM   6041  C  CB    . LYS E  1 170 ? 30.213  54.674  32.033  1.00 48.95 ? 170  LYS E CB    1 
ATOM   6042  C  CG    . LYS E  1 170 ? 30.362  53.438  32.921  1.00 50.45 ? 170  LYS E CG    1 
ATOM   6043  C  CD    . LYS E  1 170 ? 30.111  53.762  34.393  1.00 53.26 ? 170  LYS E CD    1 
ATOM   6044  C  CE    . LYS E  1 170 ? 29.165  52.749  35.036  1.00 54.30 ? 170  LYS E CE    1 
ATOM   6045  N  NZ    . LYS E  1 170 ? 29.892  51.522  35.481  1.00 54.19 ? 170  LYS E NZ    1 
ATOM   6046  N  N     . GLU E  1 171 ? 31.208  56.890  29.691  1.00 47.02 ? 171  GLU E N     1 
ATOM   6047  C  CA    . GLU E  1 171 ? 30.883  57.623  28.460  1.00 46.53 ? 171  GLU E CA    1 
ATOM   6048  C  C     . GLU E  1 171 ? 31.752  57.139  27.290  1.00 45.58 ? 171  GLU E C     1 
ATOM   6049  O  O     . GLU E  1 171 ? 32.897  56.724  27.489  1.00 45.34 ? 171  GLU E O     1 
ATOM   6050  C  CB    . GLU E  1 171 ? 31.064  59.137  28.646  1.00 46.86 ? 171  GLU E CB    1 
ATOM   6051  C  CG    . GLU E  1 171 ? 30.930  59.643  30.082  1.00 48.98 ? 171  GLU E CG    1 
ATOM   6052  C  CD    . GLU E  1 171 ? 32.238  60.183  30.653  1.00 51.85 ? 171  GLU E CD    1 
ATOM   6053  O  OE1   . GLU E  1 171 ? 32.773  59.564  31.611  1.00 52.70 ? 171  GLU E OE1   1 
ATOM   6054  O  OE2   . GLU E  1 171 ? 32.729  61.232  30.155  1.00 52.11 ? 171  GLU E OE2   1 
ATOM   6055  N  N     . VAL E  1 172 ? 31.204  57.201  26.079  1.00 44.42 ? 172  VAL E N     1 
ATOM   6056  C  CA    . VAL E  1 172 ? 31.905  56.745  24.885  1.00 43.45 ? 172  VAL E CA    1 
ATOM   6057  C  C     . VAL E  1 172 ? 33.124  57.622  24.564  1.00 42.89 ? 172  VAL E C     1 
ATOM   6058  O  O     . VAL E  1 172 ? 34.245  57.113  24.475  1.00 42.61 ? 172  VAL E O     1 
ATOM   6059  C  CB    . VAL E  1 172 ? 30.941  56.599  23.669  1.00 43.48 ? 172  VAL E CB    1 
ATOM   6060  C  CG1   . VAL E  1 172 ? 31.708  56.300  22.387  1.00 43.49 ? 172  VAL E CG1   1 
ATOM   6061  C  CG2   . VAL E  1 172 ? 29.931  55.487  23.928  1.00 43.70 ? 172  VAL E CG2   1 
ATOM   6062  N  N     . GLU E  1 173 ? 32.909  58.930  24.420  1.00 42.21 ? 173  GLU E N     1 
ATOM   6063  C  CA    . GLU E  1 173 ? 33.997  59.857  24.111  1.00 41.78 ? 173  GLU E CA    1 
ATOM   6064  C  C     . GLU E  1 173 ? 34.866  60.217  25.318  1.00 41.28 ? 173  GLU E C     1 
ATOM   6065  O  O     . GLU E  1 173 ? 34.482  61.044  26.151  1.00 41.28 ? 173  GLU E O     1 
ATOM   6066  C  CB    . GLU E  1 173 ? 33.473  61.129  23.444  1.00 41.82 ? 173  GLU E CB    1 
ATOM   6067  C  CG    . GLU E  1 173 ? 34.581  62.124  23.110  1.00 43.19 ? 173  GLU E CG    1 
ATOM   6068  C  CD    . GLU E  1 173 ? 34.148  63.197  22.128  1.00 45.08 ? 173  GLU E CD    1 
ATOM   6069  O  OE1   . GLU E  1 173 ? 34.981  64.074  21.803  1.00 45.72 ? 173  GLU E OE1   1 
ATOM   6070  O  OE2   . GLU E  1 173 ? 32.983  63.167  21.677  1.00 45.70 ? 173  GLU E OE2   1 
ATOM   6071  N  N     . VAL E  1 174 ? 36.033  59.579  25.390  1.00 40.66 ? 174  VAL E N     1 
ATOM   6072  C  CA    . VAL E  1 174 ? 37.084  59.917  26.343  1.00 40.03 ? 174  VAL E CA    1 
ATOM   6073  C  C     . VAL E  1 174 ? 38.426  59.930  25.606  1.00 39.80 ? 174  VAL E C     1 
ATOM   6074  O  O     . VAL E  1 174 ? 38.963  58.881  25.230  1.00 39.69 ? 174  VAL E O     1 
ATOM   6075  C  CB    . VAL E  1 174 ? 37.138  58.926  27.531  1.00 40.17 ? 174  VAL E CB    1 
ATOM   6076  C  CG1   . VAL E  1 174 ? 38.331  59.239  28.457  1.00 39.65 ? 174  VAL E CG1   1 
ATOM   6077  C  CG2   . VAL E  1 174 ? 35.826  58.939  28.313  1.00 39.80 ? 174  VAL E CG2   1 
ATOM   6078  N  N     . ILE E  1 175 ? 38.952  61.131  25.401  1.00 39.52 ? 175  ILE E N     1 
ATOM   6079  C  CA    . ILE E  1 175 ? 40.190  61.345  24.655  1.00 39.28 ? 175  ILE E CA    1 
ATOM   6080  C  C     . ILE E  1 175 ? 41.380  60.866  25.463  1.00 39.07 ? 175  ILE E C     1 
ATOM   6081  O  O     . ILE E  1 175 ? 41.446  61.099  26.664  1.00 39.28 ? 175  ILE E O     1 
ATOM   6082  C  CB    . ILE E  1 175 ? 40.318  62.848  24.322  1.00 39.38 ? 175  ILE E CB    1 
ATOM   6083  C  CG1   . ILE E  1 175 ? 39.052  63.346  23.605  1.00 39.05 ? 175  ILE E CG1   1 
ATOM   6084  C  CG2   . ILE E  1 175 ? 41.603  63.147  23.522  1.00 39.77 ? 175  ILE E CG2   1 
ATOM   6085  C  CD1   . ILE E  1 175 ? 38.602  62.494  22.406  1.00 39.54 ? 175  ILE E CD1   1 
ATOM   6086  N  N     . GLY E  1 176 ? 42.309  60.176  24.809  1.00 38.78 ? 176  GLY E N     1 
ATOM   6087  C  CA    . GLY E  1 176 ? 43.480  59.645  25.486  1.00 38.38 ? 176  GLY E CA    1 
ATOM   6088  C  C     . GLY E  1 176 ? 44.289  58.702  24.626  1.00 38.17 ? 176  GLY E C     1 
ATOM   6089  O  O     . GLY E  1 176 ? 43.856  58.321  23.537  1.00 38.40 ? 176  GLY E O     1 
ATOM   6090  N  N     . GLY E  1 177 ? 45.467  58.330  25.115  1.00 37.92 ? 177  GLY E N     1 
ATOM   6091  C  CA    . GLY E  1 177 ? 46.358  57.424  24.411  1.00 37.58 ? 177  GLY E CA    1 
ATOM   6092  C  C     . GLY E  1 177 ? 46.605  56.155  25.204  1.00 37.67 ? 177  GLY E C     1 
ATOM   6093  O  O     . GLY E  1 177 ? 45.692  55.627  25.845  1.00 37.31 ? 177  GLY E O     1 
ATOM   6094  N  N     . ALA E  1 178 ? 47.846  55.672  25.164  1.00 37.96 ? 178  ALA E N     1 
ATOM   6095  C  CA    . ALA E  1 178 ? 48.248  54.441  25.849  1.00 38.41 ? 178  ALA E CA    1 
ATOM   6096  C  C     . ALA E  1 178 ? 48.120  54.524  27.371  1.00 38.77 ? 178  ALA E C     1 
ATOM   6097  O  O     . ALA E  1 178 ? 48.165  53.511  28.060  1.00 39.05 ? 178  ALA E O     1 
ATOM   6098  C  CB    . ALA E  1 178 ? 49.678  54.060  25.459  1.00 38.38 ? 178  ALA E CB    1 
ATOM   6099  N  N     . ASP E  1 179 ? 47.973  55.740  27.883  1.00 39.14 ? 179  ASP E N     1 
ATOM   6100  C  CA    . ASP E  1 179 ? 47.680  55.985  29.292  1.00 39.58 ? 179  ASP E CA    1 
ATOM   6101  C  C     . ASP E  1 179 ? 46.268  55.519  29.666  1.00 39.04 ? 179  ASP E C     1 
ATOM   6102  O  O     . ASP E  1 179 ? 46.028  55.095  30.801  1.00 39.40 ? 179  ASP E O     1 
ATOM   6103  C  CB    . ASP E  1 179 ? 47.808  57.488  29.598  1.00 39.97 ? 179  ASP E CB    1 
ATOM   6104  C  CG    . ASP E  1 179 ? 47.345  58.368  28.429  1.00 42.29 ? 179  ASP E CG    1 
ATOM   6105  O  OD1   . ASP E  1 179 ? 47.945  58.266  27.329  1.00 44.13 ? 179  ASP E OD1   1 
ATOM   6106  O  OD2   . ASP E  1 179 ? 46.394  59.185  28.502  1.00 44.55 ? 179  ASP E OD2   1 
ATOM   6107  N  N     . LYS E  1 180 ? 45.341  55.612  28.713  1.00 38.06 ? 180  LYS E N     1 
ATOM   6108  C  CA    . LYS E  1 180 ? 43.925  55.338  28.968  1.00 36.92 ? 180  LYS E CA    1 
ATOM   6109  C  C     . LYS E  1 180 ? 43.396  54.070  28.294  1.00 35.66 ? 180  LYS E C     1 
ATOM   6110  O  O     . LYS E  1 180 ? 42.345  53.548  28.682  1.00 35.51 ? 180  LYS E O     1 
ATOM   6111  C  CB    . LYS E  1 180 ? 43.073  56.533  28.535  1.00 37.31 ? 180  LYS E CB    1 
ATOM   6112  C  CG    . LYS E  1 180 ? 43.480  57.864  29.154  1.00 38.99 ? 180  LYS E CG    1 
ATOM   6113  C  CD    . LYS E  1 180 ? 42.725  58.148  30.442  1.00 42.06 ? 180  LYS E CD    1 
ATOM   6114  C  CE    . LYS E  1 180 ? 41.876  59.411  30.321  1.00 43.97 ? 180  LYS E CE    1 
ATOM   6115  N  NZ    . LYS E  1 180 ? 42.693  60.620  29.987  1.00 45.48 ? 180  LYS E NZ    1 
ATOM   6116  N  N     . TYR E  1 181 ? 44.126  53.580  27.293  1.00 34.12 ? 181  TYR E N     1 
ATOM   6117  C  CA    . TYR E  1 181 ? 43.664  52.474  26.453  1.00 32.42 ? 181  TYR E CA    1 
ATOM   6118  C  C     . TYR E  1 181 ? 44.794  51.502  26.105  1.00 32.03 ? 181  TYR E C     1 
ATOM   6119  O  O     . TYR E  1 181 ? 45.955  51.900  25.964  1.00 31.68 ? 181  TYR E O     1 
ATOM   6120  C  CB    . TYR E  1 181 ? 43.066  53.011  25.149  1.00 31.88 ? 181  TYR E CB    1 
ATOM   6121  C  CG    . TYR E  1 181 ? 41.843  53.899  25.268  1.00 29.53 ? 181  TYR E CG    1 
ATOM   6122  C  CD1   . TYR E  1 181 ? 41.962  55.295  25.271  1.00 29.03 ? 181  TYR E CD1   1 
ATOM   6123  C  CD2   . TYR E  1 181 ? 40.567  53.350  25.321  1.00 28.11 ? 181  TYR E CD2   1 
ATOM   6124  C  CE1   . TYR E  1 181 ? 40.826  56.124  25.365  1.00 27.85 ? 181  TYR E CE1   1 
ATOM   6125  C  CE2   . TYR E  1 181 ? 39.430  54.158  25.407  1.00 27.45 ? 181  TYR E CE2   1 
ATOM   6126  C  CZ    . TYR E  1 181 ? 39.563  55.538  25.426  1.00 28.16 ? 181  TYR E CZ    1 
ATOM   6127  O  OH    . TYR E  1 181 ? 38.430  56.319  25.516  1.00 28.93 ? 181  TYR E OH    1 
ATOM   6128  N  N     . HIS E  1 182 ? 44.438  50.227  25.977  1.00 31.40 ? 182  HIS E N     1 
ATOM   6129  C  CA    . HIS E  1 182 ? 45.338  49.206  25.449  1.00 31.27 ? 182  HIS E CA    1 
ATOM   6130  C  C     . HIS E  1 182 ? 44.727  48.580  24.199  1.00 30.92 ? 182  HIS E C     1 
ATOM   6131  O  O     . HIS E  1 182 ? 43.538  48.238  24.189  1.00 30.78 ? 182  HIS E O     1 
ATOM   6132  C  CB    . HIS E  1 182 ? 45.563  48.082  26.467  1.00 31.41 ? 182  HIS E CB    1 
ATOM   6133  C  CG    . HIS E  1 182 ? 46.608  48.374  27.496  1.00 32.30 ? 182  HIS E CG    1 
ATOM   6134  N  ND1   . HIS E  1 182 ? 47.271  49.581  27.575  1.00 33.26 ? 182  HIS E ND1   1 
ATOM   6135  C  CD2   . HIS E  1 182 ? 47.093  47.611  28.505  1.00 32.49 ? 182  HIS E CD2   1 
ATOM   6136  C  CE1   . HIS E  1 182 ? 48.122  49.546  28.587  1.00 33.83 ? 182  HIS E CE1   1 
ATOM   6137  N  NE2   . HIS E  1 182 ? 48.036  48.361  29.165  1.00 32.64 ? 182  HIS E NE2   1 
ATOM   6138  N  N     . SER E  1 183 ? 45.535  48.429  23.152  1.00 30.30 ? 183  SER E N     1 
ATOM   6139  C  CA    . SER E  1 183 ? 45.160  47.572  22.037  1.00 29.83 ? 183  SER E CA    1 
ATOM   6140  C  C     . SER E  1 183 ? 45.274  46.148  22.549  1.00 29.44 ? 183  SER E C     1 
ATOM   6141  O  O     . SER E  1 183 ? 46.222  45.829  23.255  1.00 29.28 ? 183  SER E O     1 
ATOM   6142  C  CB    . SER E  1 183 ? 46.083  47.794  20.841  1.00 29.63 ? 183  SER E CB    1 
ATOM   6143  O  OG    . SER E  1 183 ? 47.441  47.604  21.195  1.00 29.96 ? 183  SER E OG    1 
ATOM   6144  N  N     . VAL E  1 184 ? 44.327  45.292  22.185  1.00 29.38 ? 184  VAL E N     1 
ATOM   6145  C  CA    . VAL E  1 184 ? 44.164  44.030  22.882  1.00 29.21 ? 184  VAL E CA    1 
ATOM   6146  C  C     . VAL E  1 184 ? 43.578  42.930  21.962  1.00 29.40 ? 184  VAL E C     1 
ATOM   6147  O  O     . VAL E  1 184 ? 42.777  43.221  21.069  1.00 29.23 ? 184  VAL E O     1 
ATOM   6148  C  CB    . VAL E  1 184 ? 43.312  44.349  24.155  1.00 29.51 ? 184  VAL E CB    1 
ATOM   6149  C  CG1   . VAL E  1 184 ? 42.030  43.590  24.207  1.00 29.86 ? 184  VAL E CG1   1 
ATOM   6150  C  CG2   . VAL E  1 184 ? 44.136  44.243  25.438  1.00 29.13 ? 184  VAL E CG2   1 
ATOM   6151  N  N     . CYS E  1 185 ? 44.010  41.682  22.150  1.00 29.57 ? 185  CYS E N     1 
ATOM   6152  C  CA    . CYS E  1 185 ? 43.368  40.533  21.490  1.00 30.05 ? 185  CYS E CA    1 
ATOM   6153  C  C     . CYS E  1 185 ? 42.020  40.164  22.158  1.00 30.17 ? 185  CYS E C     1 
ATOM   6154  O  O     . CYS E  1 185 ? 41.650  40.740  23.179  1.00 29.97 ? 185  CYS E O     1 
ATOM   6155  C  CB    . CYS E  1 185 ? 44.309  39.330  21.451  1.00 29.34 ? 185  CYS E CB    1 
ATOM   6156  S  SG    . CYS E  1 185 ? 44.678  38.596  23.064  1.00 31.03 ? 185  CYS E SG    1 
ATOM   6157  N  N     . ARG E  1 186 ? 41.305  39.207  21.572  1.00 30.66 ? 186  ARG E N     1 
ATOM   6158  C  CA    . ARG E  1 186 ? 40.053  38.687  22.125  1.00 31.24 ? 186  ARG E CA    1 
ATOM   6159  C  C     . ARG E  1 186 ? 40.208  38.206  23.573  1.00 32.07 ? 186  ARG E C     1 
ATOM   6160  O  O     . ARG E  1 186 ? 39.436  38.617  24.445  1.00 32.18 ? 186  ARG E O     1 
ATOM   6161  C  CB    . ARG E  1 186 ? 39.520  37.565  21.225  1.00 31.05 ? 186  ARG E CB    1 
ATOM   6162  C  CG    . ARG E  1 186 ? 38.288  36.807  21.731  1.00 30.01 ? 186  ARG E CG    1 
ATOM   6163  C  CD    . ARG E  1 186 ? 37.706  35.835  20.721  1.00 28.48 ? 186  ARG E CD    1 
ATOM   6164  N  NE    . ARG E  1 186 ? 37.315  36.505  19.477  1.00 28.20 ? 186  ARG E NE    1 
ATOM   6165  C  CZ    . ARG E  1 186 ? 36.130  37.073  19.255  1.00 26.94 ? 186  ARG E CZ    1 
ATOM   6166  N  NH1   . ARG E  1 186 ? 35.183  37.066  20.196  1.00 26.25 ? 186  ARG E NH1   1 
ATOM   6167  N  NH2   . ARG E  1 186 ? 35.893  37.647  18.085  1.00 24.83 ? 186  ARG E NH2   1 
ATOM   6168  N  N     . LEU E  1 187 ? 41.211  37.363  23.823  1.00 32.92 ? 187  LEU E N     1 
ATOM   6169  C  CA    . LEU E  1 187 ? 41.411  36.764  25.147  1.00 34.05 ? 187  LEU E CA    1 
ATOM   6170  C  C     . LEU E  1 187 ? 41.751  37.799  26.214  1.00 34.31 ? 187  LEU E C     1 
ATOM   6171  O  O     . LEU E  1 187 ? 41.161  37.785  27.295  1.00 34.55 ? 187  LEU E O     1 
ATOM   6172  C  CB    . LEU E  1 187 ? 42.474  35.648  25.109  1.00 34.20 ? 187  LEU E CB    1 
ATOM   6173  C  CG    . LEU E  1 187 ? 42.114  34.417  24.258  1.00 35.74 ? 187  LEU E CG    1 
ATOM   6174  C  CD1   . LEU E  1 187 ? 43.295  33.454  24.184  1.00 36.28 ? 187  LEU E CD1   1 
ATOM   6175  C  CD2   . LEU E  1 187 ? 40.845  33.695  24.771  1.00 36.00 ? 187  LEU E CD2   1 
ATOM   6176  N  N     . CYS E  1 188 ? 42.683  38.702  25.900  1.00 34.56 ? 188  CYS E N     1 
ATOM   6177  C  CA    . CYS E  1 188 ? 43.061  39.769  26.828  1.00 34.81 ? 188  CYS E CA    1 
ATOM   6178  C  C     . CYS E  1 188 ? 41.934  40.768  27.069  1.00 34.91 ? 188  CYS E C     1 
ATOM   6179  O  O     . CYS E  1 188 ? 41.843  41.348  28.143  1.00 34.94 ? 188  CYS E O     1 
ATOM   6180  C  CB    . CYS E  1 188 ? 44.311  40.499  26.346  1.00 34.76 ? 188  CYS E CB    1 
ATOM   6181  S  SG    . CYS E  1 188 ? 45.783  39.462  26.300  1.00 35.16 ? 188  CYS E SG    1 
ATOM   6182  N  N     . TYR E  1 189 ? 41.078  40.964  26.069  1.00 35.19 ? 189  TYR E N     1 
ATOM   6183  C  CA    . TYR E  1 189 ? 39.920  41.839  26.215  1.00 35.48 ? 189  TYR E CA    1 
ATOM   6184  C  C     . TYR E  1 189 ? 38.996  41.388  27.348  1.00 36.51 ? 189  TYR E C     1 
ATOM   6185  O  O     . TYR E  1 189 ? 38.459  42.216  28.078  1.00 36.34 ? 189  TYR E O     1 
ATOM   6186  C  CB    . TYR E  1 189 ? 39.136  41.958  24.902  1.00 34.53 ? 189  TYR E CB    1 
ATOM   6187  C  CG    . TYR E  1 189 ? 37.981  42.917  25.013  1.00 32.80 ? 189  TYR E CG    1 
ATOM   6188  C  CD1   . TYR E  1 189 ? 38.156  44.285  24.777  1.00 30.56 ? 189  TYR E CD1   1 
ATOM   6189  C  CD2   . TYR E  1 189 ? 36.708  42.461  25.382  1.00 31.11 ? 189  TYR E CD2   1 
ATOM   6190  C  CE1   . TYR E  1 189 ? 37.100  45.165  24.906  1.00 29.47 ? 189  TYR E CE1   1 
ATOM   6191  C  CE2   . TYR E  1 189 ? 35.653  43.330  25.510  1.00 29.70 ? 189  TYR E CE2   1 
ATOM   6192  C  CZ    . TYR E  1 189 ? 35.853  44.677  25.273  1.00 29.82 ? 189  TYR E CZ    1 
ATOM   6193  O  OH    . TYR E  1 189 ? 34.790  45.531  25.399  1.00 30.60 ? 189  TYR E OH    1 
ATOM   6194  N  N     . PHE E  1 190 ? 38.826  40.078  27.487  1.00 38.07 ? 190  PHE E N     1 
ATOM   6195  C  CA    . PHE E  1 190 ? 37.884  39.519  28.451  1.00 39.84 ? 190  PHE E CA    1 
ATOM   6196  C  C     . PHE E  1 190 ? 38.524  39.114  29.786  1.00 41.31 ? 190  PHE E C     1 
ATOM   6197  O  O     . PHE E  1 190 ? 37.815  38.694  30.707  1.00 41.68 ? 190  PHE E O     1 
ATOM   6198  C  CB    . PHE E  1 190 ? 37.157  38.321  27.830  1.00 39.28 ? 190  PHE E CB    1 
ATOM   6199  C  CG    . PHE E  1 190 ? 36.055  38.700  26.868  1.00 38.95 ? 190  PHE E CG    1 
ATOM   6200  C  CD1   . PHE E  1 190 ? 36.201  38.475  25.494  1.00 37.70 ? 190  PHE E CD1   1 
ATOM   6201  C  CD2   . PHE E  1 190 ? 34.857  39.257  27.334  1.00 37.88 ? 190  PHE E CD2   1 
ATOM   6202  C  CE1   . PHE E  1 190 ? 35.177  38.808  24.599  1.00 37.34 ? 190  PHE E CE1   1 
ATOM   6203  C  CE2   . PHE E  1 190 ? 33.825  39.600  26.448  1.00 37.63 ? 190  PHE E CE2   1 
ATOM   6204  C  CZ    . PHE E  1 190 ? 33.981  39.372  25.079  1.00 37.41 ? 190  PHE E CZ    1 
ATOM   6205  N  N     . LYS E  1 191 ? 39.849  39.247  29.891  1.00 42.89 ? 191  LYS E N     1 
ATOM   6206  C  CA    . LYS E  1 191 ? 40.584  38.809  31.083  1.00 44.42 ? 191  LYS E CA    1 
ATOM   6207  C  C     . LYS E  1 191 ? 40.250  39.607  32.349  1.00 44.95 ? 191  LYS E C     1 
ATOM   6208  O  O     . LYS E  1 191 ? 40.199  40.840  32.322  1.00 45.70 ? 191  LYS E O     1 
ATOM   6209  C  CB    . LYS E  1 191 ? 42.097  38.793  30.828  1.00 44.82 ? 191  LYS E CB    1 
ATOM   6210  C  CG    . LYS E  1 191 ? 42.734  37.412  31.024  1.00 46.36 ? 191  LYS E CG    1 
ATOM   6211  C  CD    . LYS E  1 191 ? 44.095  37.320  30.338  1.00 49.28 ? 191  LYS E CD    1 
ATOM   6212  C  CE    . LYS E  1 191 ? 45.228  37.155  31.352  1.00 50.77 ? 191  LYS E CE    1 
ATOM   6213  N  NZ    . LYS E  1 191 ? 45.402  35.739  31.804  1.00 51.48 ? 191  LYS E NZ    1 
ATOM   6214  N  N     . ARG F  1 18  ? 60.184  33.241  17.831  1.00 43.77 ? 18   ARG F N     1 
ATOM   6215  C  CA    . ARG F  1 18  ? 59.343  33.224  16.587  1.00 43.49 ? 18   ARG F CA    1 
ATOM   6216  C  C     . ARG F  1 18  ? 59.682  34.375  15.631  1.00 42.26 ? 18   ARG F C     1 
ATOM   6217  O  O     . ARG F  1 18  ? 59.009  35.417  15.618  1.00 42.35 ? 18   ARG F O     1 
ATOM   6218  C  CB    . ARG F  1 18  ? 57.854  33.274  16.941  1.00 44.25 ? 18   ARG F CB    1 
ATOM   6219  C  CG    . ARG F  1 18  ? 56.954  32.492  15.992  1.00 46.44 ? 18   ARG F CG    1 
ATOM   6220  C  CD    . ARG F  1 18  ? 55.970  31.577  16.708  1.00 50.08 ? 18   ARG F CD    1 
ATOM   6221  N  NE    . ARG F  1 18  ? 55.999  30.222  16.162  1.00 53.77 ? 18   ARG F NE    1 
ATOM   6222  C  CZ    . ARG F  1 18  ? 55.599  29.130  16.810  1.00 55.75 ? 18   ARG F CZ    1 
ATOM   6223  N  NH1   . ARG F  1 18  ? 55.125  29.213  18.050  1.00 56.76 ? 18   ARG F NH1   1 
ATOM   6224  N  NH2   . ARG F  1 18  ? 55.663  27.944  16.212  1.00 56.20 ? 18   ARG F NH2   1 
ATOM   6225  N  N     . GLY F  1 19  ? 60.725  34.170  14.832  1.00 40.55 ? 19   GLY F N     1 
ATOM   6226  C  CA    . GLY F  1 19  ? 61.172  35.163  13.876  1.00 38.11 ? 19   GLY F CA    1 
ATOM   6227  C  C     . GLY F  1 19  ? 60.372  35.138  12.594  1.00 36.46 ? 19   GLY F C     1 
ATOM   6228  O  O     . GLY F  1 19  ? 59.580  34.225  12.369  1.00 36.33 ? 19   GLY F O     1 
ATOM   6229  N  N     . GLN F  1 20  ? 60.623  36.126  11.735  1.00 34.87 ? 20   GLN F N     1 
ATOM   6230  C  CA    . GLN F  1 20  ? 59.742  36.454  10.625  1.00 33.30 ? 20   GLN F CA    1 
ATOM   6231  C  C     . GLN F  1 20  ? 60.412  37.447  9.676   1.00 31.74 ? 20   GLN F C     1 
ATOM   6232  O  O     . GLN F  1 20  ? 61.104  38.357  10.129  1.00 31.32 ? 20   GLN F O     1 
ATOM   6233  C  CB    . GLN F  1 20  ? 58.507  37.140  11.214  1.00 33.48 ? 20   GLN F CB    1 
ATOM   6234  C  CG    . GLN F  1 20  ? 57.188  36.681  10.702  1.00 35.20 ? 20   GLN F CG    1 
ATOM   6235  C  CD    . GLN F  1 20  ? 56.154  37.799  10.709  1.00 37.60 ? 20   GLN F CD    1 
ATOM   6236  O  OE1   . GLN F  1 20  ? 56.160  38.650  11.598  1.00 38.36 ? 20   GLN F OE1   1 
ATOM   6237  N  NE2   . GLN F  1 20  ? 55.267  37.799  9.716   1.00 38.32 ? 20   GLN F NE2   1 
ATOM   6238  N  N     . ILE F  1 21  ? 60.194  37.275  8.371   1.00 30.15 ? 21   ILE F N     1 
ATOM   6239  C  CA    . ILE F  1 21  ? 60.542  38.295  7.375   1.00 28.51 ? 21   ILE F CA    1 
ATOM   6240  C  C     . ILE F  1 21  ? 59.273  38.802  6.684   1.00 28.11 ? 21   ILE F C     1 
ATOM   6241  O  O     . ILE F  1 21  ? 58.484  38.013  6.142   1.00 27.72 ? 21   ILE F O     1 
ATOM   6242  C  CB    . ILE F  1 21  ? 61.515  37.770  6.292   1.00 28.47 ? 21   ILE F CB    1 
ATOM   6243  C  CG1   . ILE F  1 21  ? 62.775  37.139  6.895   1.00 27.87 ? 21   ILE F CG1   1 
ATOM   6244  C  CG2   . ILE F  1 21  ? 61.889  38.901  5.321   1.00 27.86 ? 21   ILE F CG2   1 
ATOM   6245  C  CD1   . ILE F  1 21  ? 63.671  36.440  5.849   1.00 26.36 ? 21   ILE F CD1   1 
ATOM   6246  N  N     . GLN F  1 22  ? 59.086  40.119  6.698   1.00 27.29 ? 22   GLN F N     1 
ATOM   6247  C  CA    . GLN F  1 22  ? 58.020  40.761  5.940   1.00 26.85 ? 22   GLN F CA    1 
ATOM   6248  C  C     . GLN F  1 22  ? 58.637  41.650  4.883   1.00 26.33 ? 22   GLN F C     1 
ATOM   6249  O  O     . GLN F  1 22  ? 59.566  42.396  5.167   1.00 26.60 ? 22   GLN F O     1 
ATOM   6250  C  CB    . GLN F  1 22  ? 57.163  41.625  6.845   1.00 26.91 ? 22   GLN F CB    1 
ATOM   6251  C  CG    . GLN F  1 22  ? 56.326  40.870  7.841   1.00 27.94 ? 22   GLN F CG    1 
ATOM   6252  C  CD    . GLN F  1 22  ? 55.676  41.798  8.832   1.00 29.86 ? 22   GLN F CD    1 
ATOM   6253  O  OE1   . GLN F  1 22  ? 55.352  42.933  8.499   1.00 31.32 ? 22   GLN F OE1   1 
ATOM   6254  N  NE2   . GLN F  1 22  ? 55.495  41.330  10.060  1.00 31.75 ? 22   GLN F NE2   1 
ATOM   6255  N  N     . VAL F  1 23  ? 58.124  41.575  3.665   1.00 25.62 ? 23   VAL F N     1 
ATOM   6256  C  CA    . VAL F  1 23  ? 58.658  42.378  2.574   1.00 25.11 ? 23   VAL F CA    1 
ATOM   6257  C  C     . VAL F  1 23  ? 57.583  43.294  2.002   1.00 24.75 ? 23   VAL F C     1 
ATOM   6258  O  O     . VAL F  1 23  ? 56.472  42.847  1.706   1.00 24.73 ? 23   VAL F O     1 
ATOM   6259  C  CB    . VAL F  1 23  ? 59.261  41.505  1.436   1.00 25.50 ? 23   VAL F CB    1 
ATOM   6260  C  CG1   . VAL F  1 23  ? 60.033  42.365  0.474   1.00 25.42 ? 23   VAL F CG1   1 
ATOM   6261  C  CG2   . VAL F  1 23  ? 60.162  40.411  2.002   1.00 25.07 ? 23   VAL F CG2   1 
ATOM   6262  N  N     . ILE F  1 24  ? 57.923  44.576  1.878   1.00 24.31 ? 24   ILE F N     1 
ATOM   6263  C  CA    . ILE F  1 24  ? 57.037  45.581  1.299   1.00 23.74 ? 24   ILE F CA    1 
ATOM   6264  C  C     . ILE F  1 24  ? 57.678  46.062  0.016   1.00 23.87 ? 24   ILE F C     1 
ATOM   6265  O  O     . ILE F  1 24  ? 58.712  46.739  0.042   1.00 24.05 ? 24   ILE F O     1 
ATOM   6266  C  CB    . ILE F  1 24  ? 56.822  46.783  2.254   1.00 24.09 ? 24   ILE F CB    1 
ATOM   6267  C  CG1   . ILE F  1 24  ? 56.317  46.336  3.625   1.00 23.15 ? 24   ILE F CG1   1 
ATOM   6268  C  CG2   . ILE F  1 24  ? 55.874  47.825  1.636   1.00 23.30 ? 24   ILE F CG2   1 
ATOM   6269  C  CD1   . ILE F  1 24  ? 56.754  47.265  4.725   1.00 21.75 ? 24   ILE F CD1   1 
ATOM   6270  N  N     . LEU F  1 25  ? 57.057  45.696  -1.101  1.00 23.76 ? 25   LEU F N     1 
ATOM   6271  C  CA    . LEU F  1 25  ? 57.536  46.041  -2.427  1.00 23.75 ? 25   LEU F CA    1 
ATOM   6272  C  C     . LEU F  1 25  ? 56.664  47.132  -3.036  1.00 23.76 ? 25   LEU F C     1 
ATOM   6273  O  O     . LEU F  1 25  ? 55.596  47.457  -2.509  1.00 23.64 ? 25   LEU F O     1 
ATOM   6274  C  CB    . LEU F  1 25  ? 57.530  44.800  -3.334  1.00 23.96 ? 25   LEU F CB    1 
ATOM   6275  C  CG    . LEU F  1 25  ? 58.383  43.589  -2.927  1.00 24.58 ? 25   LEU F CG    1 
ATOM   6276  C  CD1   . LEU F  1 25  ? 58.075  42.389  -3.823  1.00 23.49 ? 25   LEU F CD1   1 
ATOM   6277  C  CD2   . LEU F  1 25  ? 59.886  43.917  -2.943  1.00 24.16 ? 25   LEU F CD2   1 
ATOM   6278  N  N     . GLY F  1 26  ? 57.123  47.691  -4.150  1.00 23.75 ? 26   GLY F N     1 
ATOM   6279  C  CA    . GLY F  1 26  ? 56.374  48.699  -4.878  1.00 23.75 ? 26   GLY F CA    1 
ATOM   6280  C  C     . GLY F  1 26  ? 57.304  49.580  -5.685  1.00 23.96 ? 26   GLY F C     1 
ATOM   6281  O  O     . GLY F  1 26  ? 58.520  49.533  -5.496  1.00 24.03 ? 26   GLY F O     1 
ATOM   6282  N  N     . PRO F  1 27  ? 56.747  50.407  -6.567  1.00 24.00 ? 27   PRO F N     1 
ATOM   6283  C  CA    . PRO F  1 27  ? 57.563  51.358  -7.327  1.00 24.01 ? 27   PRO F CA    1 
ATOM   6284  C  C     . PRO F  1 27  ? 57.909  52.523  -6.414  1.00 24.23 ? 27   PRO F C     1 
ATOM   6285  O  O     . PRO F  1 27  ? 57.535  52.505  -5.236  1.00 24.62 ? 27   PRO F O     1 
ATOM   6286  C  CB    . PRO F  1 27  ? 56.624  51.804  -8.452  1.00 24.12 ? 27   PRO F CB    1 
ATOM   6287  C  CG    . PRO F  1 27  ? 55.213  51.633  -7.882  1.00 24.15 ? 27   PRO F CG    1 
ATOM   6288  C  CD    . PRO F  1 27  ? 55.304  50.537  -6.865  1.00 24.20 ? 27   PRO F CD    1 
ATOM   6289  N  N     . MET F  1 28  ? 58.607  53.521  -6.935  1.00 24.17 ? 28   MET F N     1 
ATOM   6290  C  CA    . MET F  1 28  ? 58.834  54.740  -6.178  1.00 24.28 ? 28   MET F CA    1 
ATOM   6291  C  C     . MET F  1 28  ? 57.507  55.470  -5.939  1.00 24.35 ? 28   MET F C     1 
ATOM   6292  O  O     . MET F  1 28  ? 56.542  55.281  -6.689  1.00 24.42 ? 28   MET F O     1 
ATOM   6293  C  CB    . MET F  1 28  ? 59.818  55.629  -6.926  1.00 24.36 ? 28   MET F CB    1 
ATOM   6294  C  CG    . MET F  1 28  ? 61.255  55.150  -6.818  1.00 24.82 ? 28   MET F CG    1 
ATOM   6295  S  SD    . MET F  1 28  ? 62.363  56.286  -7.652  1.00 27.15 ? 28   MET F SD    1 
ATOM   6296  C  CE    . MET F  1 28  ? 62.514  57.561  -6.349  1.00 24.07 ? 28   MET F CE    1 
ATOM   6297  N  N     . PHE F  1 29  ? 57.469  56.285  -4.884  1.00 24.36 ? 29   PHE F N     1 
ATOM   6298  C  CA    . PHE F  1 29  ? 56.331  57.148  -4.558  1.00 24.22 ? 29   PHE F CA    1 
ATOM   6299  C  C     . PHE F  1 29  ? 55.067  56.402  -4.102  1.00 24.10 ? 29   PHE F C     1 
ATOM   6300  O  O     . PHE F  1 29  ? 53.964  56.968  -4.119  1.00 24.15 ? 29   PHE F O     1 
ATOM   6301  C  CB    . PHE F  1 29  ? 56.026  58.121  -5.714  1.00 24.46 ? 29   PHE F CB    1 
ATOM   6302  C  CG    . PHE F  1 29  ? 57.259  58.725  -6.357  1.00 25.41 ? 29   PHE F CG    1 
ATOM   6303  C  CD1   . PHE F  1 29  ? 57.574  58.443  -7.686  1.00 25.84 ? 29   PHE F CD1   1 
ATOM   6304  C  CD2   . PHE F  1 29  ? 58.109  59.567  -5.633  1.00 26.07 ? 29   PHE F CD2   1 
ATOM   6305  C  CE1   . PHE F  1 29  ? 58.709  59.003  -8.299  1.00 25.97 ? 29   PHE F CE1   1 
ATOM   6306  C  CE2   . PHE F  1 29  ? 59.248  60.132  -6.234  1.00 25.97 ? 29   PHE F CE2   1 
ATOM   6307  C  CZ    . PHE F  1 29  ? 59.543  59.846  -7.568  1.00 25.80 ? 29   PHE F CZ    1 
ATOM   6308  N  N     . SER F  1 30  ? 55.224  55.148  -3.666  1.00 23.73 ? 30   SER F N     1 
ATOM   6309  C  CA    . SER F  1 30  ? 54.072  54.348  -3.239  1.00 23.53 ? 30   SER F CA    1 
ATOM   6310  C  C     . SER F  1 30  ? 53.939  54.261  -1.716  1.00 23.47 ? 30   SER F C     1 
ATOM   6311  O  O     . SER F  1 30  ? 53.022  53.608  -1.194  1.00 23.57 ? 30   SER F O     1 
ATOM   6312  C  CB    . SER F  1 30  ? 54.102  52.959  -3.873  1.00 23.17 ? 30   SER F CB    1 
ATOM   6313  O  OG    . SER F  1 30  ? 55.262  52.270  -3.482  1.00 24.42 ? 30   SER F OG    1 
ATOM   6314  N  N     . GLY F  1 31  ? 54.848  54.932  -1.012  1.00 23.27 ? 31   GLY F N     1 
ATOM   6315  C  CA    . GLY F  1 31  ? 54.829  54.982  0.437   1.00 23.27 ? 31   GLY F CA    1 
ATOM   6316  C  C     . GLY F  1 31  ? 55.375  53.754  1.163   1.00 23.55 ? 31   GLY F C     1 
ATOM   6317  O  O     . GLY F  1 31  ? 54.949  53.461  2.291   1.00 23.71 ? 31   GLY F O     1 
ATOM   6318  N  N     . LYS F  1 32  ? 56.317  53.050  0.534   1.00 23.51 ? 32   LYS F N     1 
ATOM   6319  C  CA    . LYS F  1 32  ? 57.000  51.894  1.138   1.00 23.68 ? 32   LYS F CA    1 
ATOM   6320  C  C     . LYS F  1 32  ? 57.583  52.192  2.518   1.00 24.27 ? 32   LYS F C     1 
ATOM   6321  O  O     . LYS F  1 32  ? 57.334  51.444  3.471   1.00 24.29 ? 32   LYS F O     1 
ATOM   6322  C  CB    . LYS F  1 32  ? 58.120  51.380  0.216   1.00 23.05 ? 32   LYS F CB    1 
ATOM   6323  C  CG    . LYS F  1 32  ? 57.625  50.737  -1.076  1.00 21.70 ? 32   LYS F CG    1 
ATOM   6324  C  CD    . LYS F  1 32  ? 58.767  50.134  -1.912  1.00 22.44 ? 32   LYS F CD    1 
ATOM   6325  C  CE    . LYS F  1 32  ? 59.894  51.128  -2.249  1.00 19.17 ? 32   LYS F CE    1 
ATOM   6326  N  NZ    . LYS F  1 32  ? 59.396  52.303  -3.021  1.00 19.81 ? 32   LYS F NZ    1 
ATOM   6327  N  N     . SER F  1 33  ? 58.360  53.278  2.607   1.00 24.68 ? 33   SER F N     1 
ATOM   6328  C  CA    . SER F  1 33  ? 58.974  53.741  3.858   1.00 25.45 ? 33   SER F CA    1 
ATOM   6329  C  C     . SER F  1 33  ? 57.954  54.068  4.933   1.00 25.17 ? 33   SER F C     1 
ATOM   6330  O  O     . SER F  1 33  ? 58.172  53.769  6.103   1.00 25.29 ? 33   SER F O     1 
ATOM   6331  C  CB    . SER F  1 33  ? 59.834  54.989  3.612   1.00 25.36 ? 33   SER F CB    1 
ATOM   6332  O  OG    . SER F  1 33  ? 61.072  54.622  3.038   1.00 28.57 ? 33   SER F OG    1 
ATOM   6333  N  N     . THR F  1 34  ? 56.855  54.703  4.529   1.00 25.14 ? 34   THR F N     1 
ATOM   6334  C  CA    . THR F  1 34  ? 55.782  55.031  5.455   1.00 25.27 ? 34   THR F CA    1 
ATOM   6335  C  C     . THR F  1 34  ? 55.122  53.760  6.005   1.00 25.19 ? 34   THR F C     1 
ATOM   6336  O  O     . THR F  1 34  ? 54.892  53.668  7.212   1.00 25.39 ? 34   THR F O     1 
ATOM   6337  C  CB    . THR F  1 34  ? 54.761  55.959  4.787   1.00 25.41 ? 34   THR F CB    1 
ATOM   6338  O  OG1   . THR F  1 34  ? 55.418  57.174  4.402   1.00 25.57 ? 34   THR F OG1   1 
ATOM   6339  C  CG2   . THR F  1 34  ? 53.708  56.423  5.782   1.00 24.54 ? 34   THR F CG2   1 
ATOM   6340  N  N     . GLU F  1 35  ? 54.861  52.779  5.138   1.00 25.03 ? 35   GLU F N     1 
ATOM   6341  C  CA    . GLU F  1 35  ? 54.295  51.504  5.585   1.00 25.35 ? 35   GLU F CA    1 
ATOM   6342  C  C     . GLU F  1 35  ? 55.269  50.740  6.496   1.00 25.41 ? 35   GLU F C     1 
ATOM   6343  O  O     . GLU F  1 35  ? 54.845  50.105  7.467   1.00 25.23 ? 35   GLU F O     1 
ATOM   6344  C  CB    . GLU F  1 35  ? 53.820  50.637  4.402   1.00 25.50 ? 35   GLU F CB    1 
ATOM   6345  C  CG    . GLU F  1 35  ? 53.357  49.213  4.750   1.00 26.57 ? 35   GLU F CG    1 
ATOM   6346  C  CD    . GLU F  1 35  ? 52.075  49.138  5.589   1.00 29.75 ? 35   GLU F CD    1 
ATOM   6347  O  OE1   . GLU F  1 35  ? 51.446  50.184  5.861   1.00 31.50 ? 35   GLU F OE1   1 
ATOM   6348  O  OE2   . GLU F  1 35  ? 51.671  48.015  5.983   1.00 30.52 ? 35   GLU F OE2   1 
ATOM   6349  N  N     . LEU F  1 36  ? 56.565  50.822  6.203   1.00 25.43 ? 36   LEU F N     1 
ATOM   6350  C  CA    . LEU F  1 36  ? 57.561  50.202  7.071   1.00 25.90 ? 36   LEU F CA    1 
ATOM   6351  C  C     . LEU F  1 36  ? 57.506  50.810  8.484   1.00 26.17 ? 36   LEU F C     1 
ATOM   6352  O  O     . LEU F  1 36  ? 57.447  50.077  9.480   1.00 25.86 ? 36   LEU F O     1 
ATOM   6353  C  CB    . LEU F  1 36  ? 58.961  50.276  6.448   1.00 26.09 ? 36   LEU F CB    1 
ATOM   6354  C  CG    . LEU F  1 36  ? 60.201  50.040  7.320   1.00 26.94 ? 36   LEU F CG    1 
ATOM   6355  C  CD1   . LEU F  1 36  ? 60.316  48.574  7.675   1.00 26.75 ? 36   LEU F CD1   1 
ATOM   6356  C  CD2   . LEU F  1 36  ? 61.465  50.528  6.604   1.00 27.32 ? 36   LEU F CD2   1 
ATOM   6357  N  N     . MET F  1 37  ? 57.486  52.142  8.567   1.00 26.59 ? 37   MET F N     1 
ATOM   6358  C  CA    . MET F  1 37  ? 57.379  52.822  9.862   1.00 27.29 ? 37   MET F CA    1 
ATOM   6359  C  C     . MET F  1 37  ? 56.076  52.528  10.584  1.00 26.91 ? 37   MET F C     1 
ATOM   6360  O  O     . MET F  1 37  ? 56.087  52.312  11.800  1.00 26.77 ? 37   MET F O     1 
ATOM   6361  C  CB    . MET F  1 37  ? 57.563  54.327  9.721   1.00 28.01 ? 37   MET F CB    1 
ATOM   6362  C  CG    . MET F  1 37  ? 58.958  54.722  9.322   1.00 31.67 ? 37   MET F CG    1 
ATOM   6363  S  SD    . MET F  1 37  ? 60.243  53.946  10.340  1.00 41.15 ? 37   MET F SD    1 
ATOM   6364  C  CE    . MET F  1 37  ? 61.631  54.163  9.240   1.00 38.31 ? 37   MET F CE    1 
ATOM   6365  N  N     . ARG F  1 38  ? 54.959  52.503  9.848   1.00 26.62 ? 38   ARG F N     1 
ATOM   6366  C  CA    . ARG F  1 38  ? 53.679  52.103  10.443  1.00 26.39 ? 38   ARG F CA    1 
ATOM   6367  C  C     . ARG F  1 38  ? 53.794  50.756  11.144  1.00 26.38 ? 38   ARG F C     1 
ATOM   6368  O  O     . ARG F  1 38  ? 53.395  50.619  12.300  1.00 26.63 ? 38   ARG F O     1 
ATOM   6369  C  CB    . ARG F  1 38  ? 52.545  52.067  9.419   1.00 26.14 ? 38   ARG F CB    1 
ATOM   6370  C  CG    . ARG F  1 38  ? 51.179  51.814  10.063  1.00 25.56 ? 38   ARG F CG    1 
ATOM   6371  C  CD    . ARG F  1 38  ? 50.050  51.561  9.086   1.00 25.69 ? 38   ARG F CD    1 
ATOM   6372  N  NE    . ARG F  1 38  ? 50.140  50.241  8.458   1.00 26.60 ? 38   ARG F NE    1 
ATOM   6373  C  CZ    . ARG F  1 38  ? 49.749  49.093  9.022   1.00 26.52 ? 38   ARG F CZ    1 
ATOM   6374  N  NH1   . ARG F  1 38  ? 49.226  49.066  10.249  1.00 26.14 ? 38   ARG F NH1   1 
ATOM   6375  N  NH2   . ARG F  1 38  ? 49.883  47.962  8.349   1.00 25.20 ? 38   ARG F NH2   1 
ATOM   6376  N  N     . ARG F  1 39  ? 54.348  49.772  10.447  1.00 26.38 ? 39   ARG F N     1 
ATOM   6377  C  CA    . ARG F  1 39  ? 54.518  48.437  11.015  1.00 26.77 ? 39   ARG F CA    1 
ATOM   6378  C  C     . ARG F  1 39  ? 55.461  48.417  12.221  1.00 27.27 ? 39   ARG F C     1 
ATOM   6379  O  O     . ARG F  1 39  ? 55.152  47.769  13.225  1.00 27.63 ? 39   ARG F O     1 
ATOM   6380  C  CB    . ARG F  1 39  ? 55.008  47.457  9.961   1.00 26.41 ? 39   ARG F CB    1 
ATOM   6381  C  CG    . ARG F  1 39  ? 53.991  47.152  8.900   1.00 26.39 ? 39   ARG F CG    1 
ATOM   6382  C  CD    . ARG F  1 39  ? 54.351  45.961  8.073   1.00 26.18 ? 39   ARG F CD    1 
ATOM   6383  N  NE    . ARG F  1 39  ? 53.635  45.924  6.809   1.00 25.64 ? 39   ARG F NE    1 
ATOM   6384  C  CZ    . ARG F  1 39  ? 53.797  44.963  5.914   1.00 26.02 ? 39   ARG F CZ    1 
ATOM   6385  N  NH1   . ARG F  1 39  ? 54.654  43.973  6.161   1.00 24.97 ? 39   ARG F NH1   1 
ATOM   6386  N  NH2   . ARG F  1 39  ? 53.125  44.992  4.771   1.00 23.67 ? 39   ARG F NH2   1 
ATOM   6387  N  N     . VAL F  1 40  ? 56.588  49.125  12.124  1.00 27.53 ? 40   VAL F N     1 
ATOM   6388  C  CA    . VAL F  1 40  ? 57.568  49.183  13.213  1.00 28.16 ? 40   VAL F CA    1 
ATOM   6389  C  C     . VAL F  1 40  ? 56.998  49.878  14.459  1.00 28.82 ? 40   VAL F C     1 
ATOM   6390  O  O     . VAL F  1 40  ? 57.178  49.388  15.569  1.00 29.00 ? 40   VAL F O     1 
ATOM   6391  C  CB    . VAL F  1 40  ? 58.925  49.820  12.754  1.00 28.12 ? 40   VAL F CB    1 
ATOM   6392  C  CG1   . VAL F  1 40  ? 59.856  50.088  13.950  1.00 28.21 ? 40   VAL F CG1   1 
ATOM   6393  C  CG2   . VAL F  1 40  ? 59.614  48.914  11.735  1.00 27.15 ? 40   VAL F CG2   1 
ATOM   6394  N  N     . ARG F  1 41  ? 56.286  50.985  14.270  1.00 29.63 ? 41   ARG F N     1 
ATOM   6395  C  CA    . ARG F  1 41  ? 55.662  51.704  15.384  1.00 30.86 ? 41   ARG F CA    1 
ATOM   6396  C  C     . ARG F  1 41  ? 54.606  50.900  16.143  1.00 30.77 ? 41   ARG F C     1 
ATOM   6397  O  O     . ARG F  1 41  ? 54.392  51.133  17.333  1.00 30.75 ? 41   ARG F O     1 
ATOM   6398  C  CB    . ARG F  1 41  ? 55.078  53.051  14.930  1.00 31.35 ? 41   ARG F CB    1 
ATOM   6399  C  CG    . ARG F  1 41  ? 56.117  54.171  14.845  1.00 34.60 ? 41   ARG F CG    1 
ATOM   6400  C  CD    . ARG F  1 41  ? 55.544  55.521  14.404  1.00 40.52 ? 41   ARG F CD    1 
ATOM   6401  N  NE    . ARG F  1 41  ? 56.544  56.355  13.734  1.00 43.61 ? 41   ARG F NE    1 
ATOM   6402  C  CZ    . ARG F  1 41  ? 56.417  56.850  12.502  1.00 45.72 ? 41   ARG F CZ    1 
ATOM   6403  N  NH1   . ARG F  1 41  ? 55.324  56.601  11.782  1.00 45.42 ? 41   ARG F NH1   1 
ATOM   6404  N  NH2   . ARG F  1 41  ? 57.393  57.600  11.986  1.00 46.02 ? 41   ARG F NH2   1 
ATOM   6405  N  N     . ARG F  1 42  ? 53.951  49.961  15.463  1.00 31.08 ? 42   ARG F N     1 
ATOM   6406  C  CA    . ARG F  1 42  ? 52.995  49.061  16.122  1.00 31.42 ? 42   ARG F CA    1 
ATOM   6407  C  C     . ARG F  1 42  ? 53.673  48.240  17.213  1.00 31.33 ? 42   ARG F C     1 
ATOM   6408  O  O     . ARG F  1 42  ? 53.118  48.081  18.294  1.00 31.09 ? 42   ARG F O     1 
ATOM   6409  C  CB    . ARG F  1 42  ? 52.338  48.123  15.119  1.00 31.39 ? 42   ARG F CB    1 
ATOM   6410  C  CG    . ARG F  1 42  ? 51.238  48.752  14.290  1.00 32.52 ? 42   ARG F CG    1 
ATOM   6411  C  CD    . ARG F  1 42  ? 50.822  47.893  13.104  1.00 34.45 ? 42   ARG F CD    1 
ATOM   6412  N  NE    . ARG F  1 42  ? 50.357  46.565  13.515  1.00 35.66 ? 42   ARG F NE    1 
ATOM   6413  C  CZ    . ARG F  1 42  ? 51.041  45.437  13.351  1.00 37.06 ? 42   ARG F CZ    1 
ATOM   6414  N  NH1   . ARG F  1 42  ? 52.250  45.450  12.792  1.00 37.96 ? 42   ARG F NH1   1 
ATOM   6415  N  NH2   . ARG F  1 42  ? 50.523  44.290  13.765  1.00 36.69 ? 42   ARG F NH2   1 
ATOM   6416  N  N     . PHE F  1 43  ? 54.869  47.729  16.917  1.00 31.59 ? 43   PHE F N     1 
ATOM   6417  C  CA    . PHE F  1 43  ? 55.646  46.939  17.874  1.00 32.04 ? 43   PHE F CA    1 
ATOM   6418  C  C     . PHE F  1 43  ? 56.243  47.827  18.963  1.00 32.84 ? 43   PHE F C     1 
ATOM   6419  O  O     . PHE F  1 43  ? 56.238  47.470  20.144  1.00 32.85 ? 43   PHE F O     1 
ATOM   6420  C  CB    . PHE F  1 43  ? 56.748  46.158  17.154  1.00 31.81 ? 43   PHE F CB    1 
ATOM   6421  C  CG    . PHE F  1 43  ? 56.233  45.023  16.285  1.00 31.02 ? 43   PHE F CG    1 
ATOM   6422  C  CD1   . PHE F  1 43  ? 56.154  45.170  14.905  1.00 29.23 ? 43   PHE F CD1   1 
ATOM   6423  C  CD2   . PHE F  1 43  ? 55.836  43.806  16.854  1.00 30.21 ? 43   PHE F CD2   1 
ATOM   6424  C  CE1   . PHE F  1 43  ? 55.693  44.124  14.092  1.00 29.27 ? 43   PHE F CE1   1 
ATOM   6425  C  CE2   . PHE F  1 43  ? 55.369  42.755  16.052  1.00 29.82 ? 43   PHE F CE2   1 
ATOM   6426  C  CZ    . PHE F  1 43  ? 55.295  42.919  14.665  1.00 28.99 ? 43   PHE F CZ    1 
ATOM   6427  N  N     . GLN F  1 44  ? 56.732  48.996  18.558  1.00 33.74 ? 44   GLN F N     1 
ATOM   6428  C  CA    . GLN F  1 44  ? 57.360  49.939  19.471  1.00 34.98 ? 44   GLN F CA    1 
ATOM   6429  C  C     . GLN F  1 44  ? 56.400  50.443  20.548  1.00 35.35 ? 44   GLN F C     1 
ATOM   6430  O  O     . GLN F  1 44  ? 56.752  50.481  21.727  1.00 35.30 ? 44   GLN F O     1 
ATOM   6431  C  CB    . GLN F  1 44  ? 57.949  51.112  18.687  1.00 35.28 ? 44   GLN F CB    1 
ATOM   6432  C  CG    . GLN F  1 44  ? 58.982  51.900  19.456  1.00 37.26 ? 44   GLN F CG    1 
ATOM   6433  C  CD    . GLN F  1 44  ? 59.504  53.071  18.663  1.00 41.01 ? 44   GLN F CD    1 
ATOM   6434  O  OE1   . GLN F  1 44  ? 58.847  54.112  18.585  1.00 42.99 ? 44   GLN F OE1   1 
ATOM   6435  N  NE2   . GLN F  1 44  ? 60.682  52.907  18.059  1.00 41.86 ? 44   GLN F NE2   1 
ATOM   6436  N  N     . ILE F  1 45  ? 55.188  50.818  20.146  1.00 35.92 ? 45   ILE F N     1 
ATOM   6437  C  CA    . ILE F  1 45  ? 54.185  51.257  21.113  1.00 36.47 ? 45   ILE F CA    1 
ATOM   6438  C  C     . ILE F  1 45  ? 53.787  50.131  22.081  1.00 36.66 ? 45   ILE F C     1 
ATOM   6439  O  O     . ILE F  1 45  ? 53.272  50.383  23.175  1.00 36.65 ? 45   ILE F O     1 
ATOM   6440  C  CB    . ILE F  1 45  ? 52.962  51.937  20.423  1.00 36.73 ? 45   ILE F CB    1 
ATOM   6441  C  CG1   . ILE F  1 45  ? 52.140  52.721  21.446  1.00 37.56 ? 45   ILE F CG1   1 
ATOM   6442  C  CG2   . ILE F  1 45  ? 52.069  50.917  19.719  1.00 36.62 ? 45   ILE F CG2   1 
ATOM   6443  C  CD1   . ILE F  1 45  ? 52.250  54.222  21.312  1.00 39.46 ? 45   ILE F CD1   1 
ATOM   6444  N  N     . ALA F  1 46  ? 54.067  48.893  21.693  1.00 37.01 ? 46   ALA F N     1 
ATOM   6445  C  CA    . ALA F  1 46  ? 53.798  47.749  22.558  1.00 37.64 ? 46   ALA F CA    1 
ATOM   6446  C  C     . ALA F  1 46  ? 55.036  47.314  23.340  1.00 38.02 ? 46   ALA F C     1 
ATOM   6447  O  O     . ALA F  1 46  ? 55.077  46.212  23.872  1.00 38.21 ? 46   ALA F O     1 
ATOM   6448  C  CB    . ALA F  1 46  ? 53.226  46.598  21.747  1.00 37.55 ? 46   ALA F CB    1 
ATOM   6449  N  N     . GLN F  1 47  ? 56.040  48.190  23.389  1.00 38.93 ? 47   GLN F N     1 
ATOM   6450  C  CA    . GLN F  1 47  ? 57.235  48.029  24.241  1.00 39.91 ? 47   GLN F CA    1 
ATOM   6451  C  C     . GLN F  1 47  ? 58.347  47.130  23.685  1.00 39.75 ? 47   GLN F C     1 
ATOM   6452  O  O     . GLN F  1 47  ? 59.312  46.835  24.391  1.00 40.07 ? 47   GLN F O     1 
ATOM   6453  C  CB    . GLN F  1 47  ? 56.863  47.588  25.668  1.00 40.40 ? 47   GLN F CB    1 
ATOM   6454  C  CG    . GLN F  1 47  ? 55.915  48.530  26.398  1.00 42.84 ? 47   GLN F CG    1 
ATOM   6455  C  CD    . GLN F  1 47  ? 56.645  49.657  27.102  1.00 46.33 ? 47   GLN F CD    1 
ATOM   6456  O  OE1   . GLN F  1 47  ? 57.429  50.388  26.478  1.00 47.54 ? 47   GLN F OE1   1 
ATOM   6457  N  NE2   . GLN F  1 47  ? 56.393  49.806  28.402  1.00 46.39 ? 47   GLN F NE2   1 
ATOM   6458  N  N     . TYR F  1 48  ? 58.226  46.698  22.435  1.00 39.52 ? 48   TYR F N     1 
ATOM   6459  C  CA    . TYR F  1 48  ? 59.330  45.988  21.787  1.00 39.47 ? 48   TYR F CA    1 
ATOM   6460  C  C     . TYR F  1 48  ? 60.493  46.940  21.506  1.00 39.06 ? 48   TYR F C     1 
ATOM   6461  O  O     . TYR F  1 48  ? 60.279  48.105  21.170  1.00 39.02 ? 48   TYR F O     1 
ATOM   6462  C  CB    . TYR F  1 48  ? 58.891  45.391  20.454  1.00 39.67 ? 48   TYR F CB    1 
ATOM   6463  C  CG    . TYR F  1 48  ? 58.108  44.109  20.526  1.00 40.38 ? 48   TYR F CG    1 
ATOM   6464  C  CD1   . TYR F  1 48  ? 58.742  42.879  20.384  1.00 41.42 ? 48   TYR F CD1   1 
ATOM   6465  C  CD2   . TYR F  1 48  ? 56.722  44.126  20.681  1.00 41.39 ? 48   TYR F CD2   1 
ATOM   6466  C  CE1   . TYR F  1 48  ? 58.020  41.691  20.418  1.00 42.77 ? 48   TYR F CE1   1 
ATOM   6467  C  CE2   . TYR F  1 48  ? 55.987  42.943  20.722  1.00 42.21 ? 48   TYR F CE2   1 
ATOM   6468  C  CZ    . TYR F  1 48  ? 56.642  41.732  20.590  1.00 43.15 ? 48   TYR F CZ    1 
ATOM   6469  O  OH    . TYR F  1 48  ? 55.922  40.559  20.621  1.00 44.68 ? 48   TYR F OH    1 
ATOM   6470  N  N     . LYS F  1 49  ? 61.713  46.427  21.627  1.00 38.80 ? 49   LYS F N     1 
ATOM   6471  C  CA    . LYS F  1 49  ? 62.913  47.142  21.200  1.00 38.67 ? 49   LYS F CA    1 
ATOM   6472  C  C     . LYS F  1 49  ? 63.008  47.094  19.678  1.00 37.76 ? 49   LYS F C     1 
ATOM   6473  O  O     . LYS F  1 49  ? 62.973  46.007  19.084  1.00 37.51 ? 49   LYS F O     1 
ATOM   6474  C  CB    . LYS F  1 49  ? 64.169  46.490  21.805  1.00 39.16 ? 49   LYS F CB    1 
ATOM   6475  C  CG    . LYS F  1 49  ? 64.627  47.052  23.159  1.00 41.62 ? 49   LYS F CG    1 
ATOM   6476  C  CD    . LYS F  1 49  ? 65.404  48.382  23.022  1.00 45.37 ? 49   LYS F CD    1 
ATOM   6477  C  CE    . LYS F  1 49  ? 66.924  48.180  23.035  1.00 46.97 ? 49   LYS F CE    1 
ATOM   6478  N  NZ    . LYS F  1 49  ? 67.464  47.916  24.404  1.00 48.48 ? 49   LYS F NZ    1 
ATOM   6479  N  N     . CYS F  1 50  ? 63.145  48.260  19.051  1.00 36.84 ? 50   CYS F N     1 
ATOM   6480  C  CA    . CYS F  1 50  ? 63.193  48.339  17.590  1.00 36.34 ? 50   CYS F CA    1 
ATOM   6481  C  C     . CYS F  1 50  ? 64.442  49.014  17.061  1.00 35.79 ? 50   CYS F C     1 
ATOM   6482  O  O     . CYS F  1 50  ? 65.038  49.852  17.732  1.00 35.70 ? 50   CYS F O     1 
ATOM   6483  C  CB    . CYS F  1 50  ? 61.958  49.050  17.041  1.00 36.43 ? 50   CYS F CB    1 
ATOM   6484  S  SG    . CYS F  1 50  ? 60.414  48.347  17.645  1.00 37.74 ? 50   CYS F SG    1 
ATOM   6485  N  N     . LEU F  1 51  ? 64.822  48.638  15.845  1.00 35.09 ? 51   LEU F N     1 
ATOM   6486  C  CA    . LEU F  1 51  ? 65.905  49.301  15.132  1.00 34.54 ? 51   LEU F CA    1 
ATOM   6487  C  C     . LEU F  1 51  ? 65.519  49.471  13.666  1.00 34.08 ? 51   LEU F C     1 
ATOM   6488  O  O     . LEU F  1 51  ? 65.011  48.543  13.040  1.00 34.14 ? 51   LEU F O     1 
ATOM   6489  C  CB    . LEU F  1 51  ? 67.210  48.504  15.270  1.00 34.45 ? 51   LEU F CB    1 
ATOM   6490  C  CG    . LEU F  1 51  ? 68.379  48.865  14.347  1.00 34.95 ? 51   LEU F CG    1 
ATOM   6491  C  CD1   . LEU F  1 51  ? 69.028  50.187  14.770  1.00 35.69 ? 51   LEU F CD1   1 
ATOM   6492  C  CD2   . LEU F  1 51  ? 69.412  47.757  14.316  1.00 35.21 ? 51   LEU F CD2   1 
ATOM   6493  N  N     . VAL F  1 52  ? 65.753  50.660  13.131  1.00 33.67 ? 52   VAL F N     1 
ATOM   6494  C  CA    . VAL F  1 52  ? 65.526  50.920  11.719  1.00 33.62 ? 52   VAL F CA    1 
ATOM   6495  C  C     . VAL F  1 52  ? 66.852  51.236  11.033  1.00 33.62 ? 52   VAL F C     1 
ATOM   6496  O  O     . VAL F  1 52  ? 67.616  52.071  11.505  1.00 33.48 ? 52   VAL F O     1 
ATOM   6497  C  CB    . VAL F  1 52  ? 64.504  52.065  11.506  1.00 33.61 ? 52   VAL F CB    1 
ATOM   6498  C  CG1   . VAL F  1 52  ? 64.400  52.427  10.042  1.00 33.28 ? 52   VAL F CG1   1 
ATOM   6499  C  CG2   . VAL F  1 52  ? 63.129  51.660  12.050  1.00 34.13 ? 52   VAL F CG2   1 
ATOM   6500  N  N     . ILE F  1 53  ? 67.112  50.555  9.922   1.00 33.75 ? 53   ILE F N     1 
ATOM   6501  C  CA    . ILE F  1 53  ? 68.325  50.753  9.139   1.00 33.95 ? 53   ILE F CA    1 
ATOM   6502  C  C     . ILE F  1 53  ? 67.980  51.376  7.795   1.00 34.68 ? 53   ILE F C     1 
ATOM   6503  O  O     . ILE F  1 53  ? 67.040  50.953  7.125   1.00 34.75 ? 53   ILE F O     1 
ATOM   6504  C  CB    . ILE F  1 53  ? 69.073  49.401  8.942   1.00 34.01 ? 53   ILE F CB    1 
ATOM   6505  C  CG1   . ILE F  1 53  ? 69.521  48.835  10.294  1.00 33.40 ? 53   ILE F CG1   1 
ATOM   6506  C  CG2   . ILE F  1 53  ? 70.262  49.536  7.959   1.00 32.92 ? 53   ILE F CG2   1 
ATOM   6507  C  CD1   . ILE F  1 53  ? 69.381  47.336  10.410  1.00 33.11 ? 53   ILE F CD1   1 
ATOM   6508  N  N     . LYS F  1 54  ? 68.736  52.395  7.409   1.00 35.60 ? 54   LYS F N     1 
ATOM   6509  C  CA    . LYS F  1 54  ? 68.564  53.020  6.111   1.00 36.77 ? 54   LYS F CA    1 
ATOM   6510  C  C     . LYS F  1 54  ? 69.878  52.987  5.340   1.00 37.02 ? 54   LYS F C     1 
ATOM   6511  O  O     . LYS F  1 54  ? 70.955  52.930  5.920   1.00 36.97 ? 54   LYS F O     1 
ATOM   6512  C  CB    . LYS F  1 54  ? 68.071  54.458  6.266   1.00 37.50 ? 54   LYS F CB    1 
ATOM   6513  C  CG    . LYS F  1 54  ? 67.439  55.041  4.993   1.00 39.98 ? 54   LYS F CG    1 
ATOM   6514  C  CD    . LYS F  1 54  ? 66.924  56.464  5.231   1.00 43.58 ? 54   LYS F CD    1 
ATOM   6515  C  CE    . LYS F  1 54  ? 66.530  57.138  3.915   1.00 45.20 ? 54   LYS F CE    1 
ATOM   6516  N  NZ    . LYS F  1 54  ? 65.757  58.402  4.142   1.00 46.33 ? 54   LYS F NZ    1 
ATOM   6517  N  N     . TYR F  1 55  ? 69.771  53.004  4.022   1.00 37.69 ? 55   TYR F N     1 
ATOM   6518  C  CA    . TYR F  1 55  ? 70.925  53.028  3.141   1.00 38.50 ? 55   TYR F CA    1 
ATOM   6519  C  C     . TYR F  1 55  ? 71.629  54.394  3.180   1.00 39.39 ? 55   TYR F C     1 
ATOM   6520  O  O     . TYR F  1 55  ? 71.037  55.429  2.848   1.00 39.22 ? 55   TYR F O     1 
ATOM   6521  C  CB    . TYR F  1 55  ? 70.476  52.660  1.730   1.00 38.28 ? 55   TYR F CB    1 
ATOM   6522  C  CG    . TYR F  1 55  ? 71.570  52.604  0.689   1.00 37.94 ? 55   TYR F CG    1 
ATOM   6523  C  CD1   . TYR F  1 55  ? 72.704  51.795  0.859   1.00 37.71 ? 55   TYR F CD1   1 
ATOM   6524  C  CD2   . TYR F  1 55  ? 71.456  53.348  -0.482  1.00 37.18 ? 55   TYR F CD2   1 
ATOM   6525  C  CE1   . TYR F  1 55  ? 73.702  51.747  -0.122  1.00 37.26 ? 55   TYR F CE1   1 
ATOM   6526  C  CE2   . TYR F  1 55  ? 72.429  53.305  -1.450  1.00 37.78 ? 55   TYR F CE2   1 
ATOM   6527  C  CZ    . TYR F  1 55  ? 73.547  52.508  -1.272  1.00 37.82 ? 55   TYR F CZ    1 
ATOM   6528  O  OH    . TYR F  1 55  ? 74.493  52.500  -2.266  1.00 39.10 ? 55   TYR F OH    1 
ATOM   6529  N  N     . ALA F  1 56  ? 72.896  54.373  3.590   1.00 40.73 ? 56   ALA F N     1 
ATOM   6530  C  CA    . ALA F  1 56  ? 73.659  55.588  3.896   1.00 42.09 ? 56   ALA F CA    1 
ATOM   6531  C  C     . ALA F  1 56  ? 73.807  56.537  2.721   1.00 43.09 ? 56   ALA F C     1 
ATOM   6532  O  O     . ALA F  1 56  ? 73.872  57.754  2.914   1.00 43.42 ? 56   ALA F O     1 
ATOM   6533  C  CB    . ALA F  1 56  ? 75.032  55.234  4.455   1.00 42.10 ? 56   ALA F CB    1 
ATOM   6534  N  N     . LYS F  1 57  ? 73.852  55.989  1.511   1.00 44.37 ? 57   LYS F N     1 
ATOM   6535  C  CA    . LYS F  1 57  ? 74.074  56.799  0.318   1.00 45.80 ? 57   LYS F CA    1 
ATOM   6536  C  C     . LYS F  1 57  ? 72.824  57.517  -0.227  1.00 46.61 ? 57   LYS F C     1 
ATOM   6537  O  O     . LYS F  1 57  ? 72.926  58.330  -1.142  1.00 46.79 ? 57   LYS F O     1 
ATOM   6538  C  CB    . LYS F  1 57  ? 74.758  55.975  -0.775  1.00 46.03 ? 57   LYS F CB    1 
ATOM   6539  C  CG    . LYS F  1 57  ? 76.281  56.012  -0.699  1.00 47.14 ? 57   LYS F CG    1 
ATOM   6540  C  CD    . LYS F  1 57  ? 76.903  55.252  -1.846  1.00 49.51 ? 57   LYS F CD    1 
ATOM   6541  C  CE    . LYS F  1 57  ? 77.429  53.909  -1.375  1.00 51.19 ? 57   LYS F CE    1 
ATOM   6542  N  NZ    . LYS F  1 57  ? 77.458  52.911  -2.484  1.00 52.21 ? 57   LYS F NZ    1 
ATOM   6543  N  N     . ASP F  1 58  ? 71.650  57.217  0.326   1.00 47.58 ? 58   ASP F N     1 
ATOM   6544  C  CA    . ASP F  1 58  ? 70.434  57.959  -0.022  1.00 48.57 ? 58   ASP F CA    1 
ATOM   6545  C  C     . ASP F  1 58  ? 70.147  59.027  1.036   1.00 49.19 ? 58   ASP F C     1 
ATOM   6546  O  O     . ASP F  1 58  ? 69.639  58.705  2.112   1.00 49.27 ? 58   ASP F O     1 
ATOM   6547  C  CB    . ASP F  1 58  ? 69.230  57.013  -0.153  1.00 48.49 ? 58   ASP F CB    1 
ATOM   6548  C  CG    . ASP F  1 58  ? 68.016  57.683  -0.793  1.00 49.22 ? 58   ASP F CG    1 
ATOM   6549  O  OD1   . ASP F  1 58  ? 67.619  58.788  -0.351  1.00 50.08 ? 58   ASP F OD1   1 
ATOM   6550  O  OD2   . ASP F  1 58  ? 67.384  57.175  -1.747  1.00 49.03 ? 58   ASP F OD2   1 
ATOM   6551  N  N     . THR F  1 59  ? 70.435  60.294  0.733   1.00 50.31 ? 59   THR F N     1 
ATOM   6552  C  CA    . THR F  1 59  ? 70.327  61.362  1.745   1.00 51.46 ? 59   THR F CA    1 
ATOM   6553  C  C     . THR F  1 59  ? 69.246  62.425  1.473   1.00 51.94 ? 59   THR F C     1 
ATOM   6554  O  O     . THR F  1 59  ? 69.324  63.542  2.003   1.00 52.06 ? 59   THR F O     1 
ATOM   6555  C  CB    . THR F  1 59  ? 71.704  62.053  1.980   1.00 51.59 ? 59   THR F CB    1 
ATOM   6556  O  OG1   . THR F  1 59  ? 72.190  62.590  0.744   1.00 52.46 ? 59   THR F OG1   1 
ATOM   6557  C  CG2   . THR F  1 59  ? 72.786  61.036  2.380   1.00 52.04 ? 59   THR F CG2   1 
ATOM   6558  N  N     . ARG F  1 60  ? 68.236  62.071  0.676   1.00 52.40 ? 60   ARG F N     1 
ATOM   6559  C  CA    . ARG F  1 60  ? 67.174  63.007  0.285   1.00 52.67 ? 60   ARG F CA    1 
ATOM   6560  C  C     . ARG F  1 60  ? 66.480  63.696  1.471   1.00 52.72 ? 60   ARG F C     1 
ATOM   6561  O  O     . ARG F  1 60  ? 66.039  63.044  2.420   1.00 52.78 ? 60   ARG F O     1 
ATOM   6562  C  CB    . ARG F  1 60  ? 66.136  62.308  -0.603  1.00 52.82 ? 60   ARG F CB    1 
ATOM   6563  C  CG    . ARG F  1 60  ? 66.554  62.164  -2.074  1.00 53.24 ? 60   ARG F CG    1 
ATOM   6564  C  CD    . ARG F  1 60  ? 65.724  61.159  -2.882  1.00 53.19 ? 60   ARG F CD    1 
ATOM   6565  N  NE    . ARG F  1 60  ? 65.541  59.892  -2.170  1.00 54.18 ? 60   ARG F NE    1 
ATOM   6566  C  CZ    . ARG F  1 60  ? 64.395  59.215  -2.099  1.00 53.97 ? 60   ARG F CZ    1 
ATOM   6567  N  NH1   . ARG F  1 60  ? 63.304  59.667  -2.709  1.00 54.01 ? 60   ARG F NH1   1 
ATOM   6568  N  NH2   . ARG F  1 60  ? 64.341  58.080  -1.415  1.00 53.29 ? 60   ARG F NH2   1 
ATOM   6569  N  N     . ALA F  1 75  ? 67.372  55.522  13.707  1.00 48.17 ? 75   ALA F N     1 
ATOM   6570  C  CA    . ALA F  1 75  ? 67.479  55.296  12.267  1.00 47.89 ? 75   ALA F CA    1 
ATOM   6571  C  C     . ALA F  1 75  ? 68.946  55.256  11.793  1.00 47.57 ? 75   ALA F C     1 
ATOM   6572  O  O     . ALA F  1 75  ? 69.476  56.249  11.285  1.00 47.70 ? 75   ALA F O     1 
ATOM   6573  C  CB    . ALA F  1 75  ? 66.679  56.348  11.499  1.00 47.78 ? 75   ALA F CB    1 
ATOM   6574  N  N     . LEU F  1 76  ? 69.579  54.093  11.961  1.00 46.71 ? 76   LEU F N     1 
ATOM   6575  C  CA    . LEU F  1 76  ? 70.993  53.879  11.654  1.00 45.91 ? 76   LEU F CA    1 
ATOM   6576  C  C     . LEU F  1 76  ? 71.296  53.829  10.152  1.00 45.13 ? 76   LEU F C     1 
ATOM   6577  O  O     . LEU F  1 76  ? 70.755  52.980  9.447   1.00 45.10 ? 76   LEU F O     1 
ATOM   6578  C  CB    . LEU F  1 76  ? 71.452  52.564  12.290  1.00 45.97 ? 76   LEU F CB    1 
ATOM   6579  C  CG    . LEU F  1 76  ? 72.586  52.593  13.316  1.00 46.97 ? 76   LEU F CG    1 
ATOM   6580  C  CD1   . LEU F  1 76  ? 72.474  51.432  14.299  1.00 46.57 ? 76   LEU F CD1   1 
ATOM   6581  C  CD2   . LEU F  1 76  ? 73.940  52.575  12.628  1.00 47.90 ? 76   LEU F CD2   1 
ATOM   6582  N  N     . PRO F  1 77  ? 72.167  54.712  9.660   1.00 44.41 ? 77   PRO F N     1 
ATOM   6583  C  CA    . PRO F  1 77  ? 72.645  54.608  8.278   1.00 43.85 ? 77   PRO F CA    1 
ATOM   6584  C  C     . PRO F  1 77  ? 73.676  53.485  8.120   1.00 43.32 ? 77   PRO F C     1 
ATOM   6585  O  O     . PRO F  1 77  ? 74.464  53.239  9.033   1.00 43.29 ? 77   PRO F O     1 
ATOM   6586  C  CB    . PRO F  1 77  ? 73.270  55.980  8.014   1.00 43.94 ? 77   PRO F CB    1 
ATOM   6587  C  CG    . PRO F  1 77  ? 73.691  56.482  9.355   1.00 44.44 ? 77   PRO F CG    1 
ATOM   6588  C  CD    . PRO F  1 77  ? 72.742  55.875  10.362  1.00 44.50 ? 77   PRO F CD    1 
ATOM   6589  N  N     . ALA F  1 78  ? 73.646  52.796  6.983   1.00 42.74 ? 78   ALA F N     1 
ATOM   6590  C  CA    . ALA F  1 78  ? 74.581  51.712  6.706   1.00 42.34 ? 78   ALA F CA    1 
ATOM   6591  C  C     . ALA F  1 78  ? 74.725  51.477  5.212   1.00 42.29 ? 78   ALA F C     1 
ATOM   6592  O  O     . ALA F  1 78  ? 73.852  51.859  4.429   1.00 42.12 ? 78   ALA F O     1 
ATOM   6593  C  CB    . ALA F  1 78  ? 74.141  50.433  7.396   1.00 42.46 ? 78   ALA F CB    1 
ATOM   6594  N  N     . CYS F  1 79  ? 75.838  50.853  4.826   1.00 42.31 ? 79   CYS F N     1 
ATOM   6595  C  CA    . CYS F  1 79  ? 76.083  50.481  3.437   1.00 42.70 ? 79   CYS F CA    1 
ATOM   6596  C  C     . CYS F  1 79  ? 76.089  48.974  3.300   1.00 42.03 ? 79   CYS F C     1 
ATOM   6597  O  O     . CYS F  1 79  ? 75.825  48.430  2.227   1.00 41.99 ? 79   CYS F O     1 
ATOM   6598  C  CB    . CYS F  1 79  ? 77.411  51.051  2.963   1.00 43.06 ? 79   CYS F CB    1 
ATOM   6599  S  SG    . CYS F  1 79  ? 77.226  52.706  2.286   1.00 46.80 ? 79   CYS F SG    1 
ATOM   6600  N  N     . LEU F  1 80  ? 76.426  48.315  4.402   1.00 41.53 ? 80   LEU F N     1 
ATOM   6601  C  CA    . LEU F  1 80  ? 76.384  46.868  4.510   1.00 41.20 ? 80   LEU F CA    1 
ATOM   6602  C  C     . LEU F  1 80  ? 75.656  46.568  5.793   1.00 40.68 ? 80   LEU F C     1 
ATOM   6603  O  O     . LEU F  1 80  ? 75.927  47.202  6.814   1.00 40.56 ? 80   LEU F O     1 
ATOM   6604  C  CB    . LEU F  1 80  ? 77.792  46.303  4.626   1.00 41.34 ? 80   LEU F CB    1 
ATOM   6605  C  CG    . LEU F  1 80  ? 78.428  45.600  3.432   1.00 42.18 ? 80   LEU F CG    1 
ATOM   6606  C  CD1   . LEU F  1 80  ? 79.907  45.422  3.752   1.00 43.32 ? 80   LEU F CD1   1 
ATOM   6607  C  CD2   . LEU F  1 80  ? 77.771  44.256  3.111   1.00 41.48 ? 80   LEU F CD2   1 
ATOM   6608  N  N     . LEU F  1 81  ? 74.745  45.601  5.759   1.00 40.27 ? 81   LEU F N     1 
ATOM   6609  C  CA    . LEU F  1 81  ? 73.983  45.251  6.961   1.00 39.97 ? 81   LEU F CA    1 
ATOM   6610  C  C     . LEU F  1 81  ? 74.854  44.586  8.030   1.00 40.25 ? 81   LEU F C     1 
ATOM   6611  O  O     . LEU F  1 81  ? 74.573  44.680  9.226   1.00 40.17 ? 81   LEU F O     1 
ATOM   6612  C  CB    . LEU F  1 81  ? 72.777  44.389  6.612   1.00 39.70 ? 81   LEU F CB    1 
ATOM   6613  C  CG    . LEU F  1 81  ? 71.734  45.097  5.751   1.00 38.87 ? 81   LEU F CG    1 
ATOM   6614  C  CD1   . LEU F  1 81  ? 70.967  44.082  4.951   1.00 37.88 ? 81   LEU F CD1   1 
ATOM   6615  C  CD2   . LEU F  1 81  ? 70.793  45.939  6.596   1.00 38.04 ? 81   LEU F CD2   1 
ATOM   6616  N  N     . ARG F  1 82  ? 75.927  43.938  7.584   1.00 40.66 ? 82   ARG F N     1 
ATOM   6617  C  CA    . ARG F  1 82  ? 76.936  43.355  8.463   1.00 41.23 ? 82   ARG F CA    1 
ATOM   6618  C  C     . ARG F  1 82  ? 77.558  44.380  9.423   1.00 41.36 ? 82   ARG F C     1 
ATOM   6619  O  O     . ARG F  1 82  ? 77.915  44.034  10.556  1.00 41.30 ? 82   ARG F O     1 
ATOM   6620  C  CB    . ARG F  1 82  ? 78.045  42.731  7.614   1.00 41.63 ? 82   ARG F CB    1 
ATOM   6621  C  CG    . ARG F  1 82  ? 78.753  41.535  8.242   1.00 43.05 ? 82   ARG F CG    1 
ATOM   6622  C  CD    . ARG F  1 82  ? 79.952  41.036  7.439   1.00 44.90 ? 82   ARG F CD    1 
ATOM   6623  N  NE    . ARG F  1 82  ? 81.016  42.043  7.357   1.00 46.87 ? 82   ARG F NE    1 
ATOM   6624  C  CZ    . ARG F  1 82  ? 81.694  42.354  6.245   1.00 47.47 ? 82   ARG F CZ    1 
ATOM   6625  N  NH1   . ARG F  1 82  ? 81.432  41.739  5.089   1.00 46.84 ? 82   ARG F NH1   1 
ATOM   6626  N  NH2   . ARG F  1 82  ? 82.640  43.288  6.292   1.00 47.26 ? 82   ARG F NH2   1 
ATOM   6627  N  N     . ASP F  1 83  ? 77.687  45.630  8.974   1.00 41.58 ? 83   ASP F N     1 
ATOM   6628  C  CA    . ASP F  1 83  ? 78.281  46.687  9.804   1.00 42.12 ? 83   ASP F CA    1 
ATOM   6629  C  C     . ASP F  1 83  ? 77.389  47.108  10.962  1.00 42.26 ? 83   ASP F C     1 
ATOM   6630  O  O     . ASP F  1 83  ? 77.818  47.845  11.852  1.00 42.38 ? 83   ASP F O     1 
ATOM   6631  C  CB    . ASP F  1 83  ? 78.646  47.916  8.966   1.00 42.59 ? 83   ASP F CB    1 
ATOM   6632  C  CG    . ASP F  1 83  ? 79.661  47.602  7.876   1.00 43.79 ? 83   ASP F CG    1 
ATOM   6633  O  OD1   . ASP F  1 83  ? 80.451  46.630  8.040   1.00 44.21 ? 83   ASP F OD1   1 
ATOM   6634  O  OD2   . ASP F  1 83  ? 79.724  48.275  6.816   1.00 45.30 ? 83   ASP F OD2   1 
ATOM   6635  N  N     . VAL F  1 84  ? 76.151  46.624  10.951  1.00 42.59 ? 84   VAL F N     1 
ATOM   6636  C  CA    . VAL F  1 84  ? 75.166  47.031  11.936  1.00 42.67 ? 84   VAL F CA    1 
ATOM   6637  C  C     . VAL F  1 84  ? 74.572  45.805  12.643  1.00 42.92 ? 84   VAL F C     1 
ATOM   6638  O  O     . VAL F  1 84  ? 73.640  45.914  13.441  1.00 42.90 ? 84   VAL F O     1 
ATOM   6639  C  CB    . VAL F  1 84  ? 74.121  47.999  11.288  1.00 42.94 ? 84   VAL F CB    1 
ATOM   6640  C  CG1   . VAL F  1 84  ? 73.051  47.254  10.466  1.00 42.84 ? 84   VAL F CG1   1 
ATOM   6641  C  CG2   . VAL F  1 84  ? 73.498  48.899  12.331  1.00 43.46 ? 84   VAL F CG2   1 
ATOM   6642  N  N     . ALA F  1 85  ? 75.166  44.641  12.378  1.00 43.37 ? 85   ALA F N     1 
ATOM   6643  C  CA    . ALA F  1 85  ? 74.673  43.364  12.906  1.00 43.99 ? 85   ALA F CA    1 
ATOM   6644  C  C     . ALA F  1 85  ? 74.684  43.267  14.432  1.00 44.41 ? 85   ALA F C     1 
ATOM   6645  O  O     . ALA F  1 85  ? 73.789  42.648  15.024  1.00 44.52 ? 85   ALA F O     1 
ATOM   6646  C  CB    . ALA F  1 85  ? 75.440  42.194  12.284  1.00 44.02 ? 85   ALA F CB    1 
ATOM   6647  N  N     . GLN F  1 86  ? 75.682  43.882  15.065  1.00 44.87 ? 86   GLN F N     1 
ATOM   6648  C  CA    . GLN F  1 86  ? 75.792  43.860  16.526  1.00 45.36 ? 86   GLN F CA    1 
ATOM   6649  C  C     . GLN F  1 86  ? 74.663  44.627  17.202  1.00 45.26 ? 86   GLN F C     1 
ATOM   6650  O  O     . GLN F  1 86  ? 74.117  44.161  18.201  1.00 45.48 ? 86   GLN F O     1 
ATOM   6651  C  CB    . GLN F  1 86  ? 77.160  44.377  16.991  1.00 45.74 ? 86   GLN F CB    1 
ATOM   6652  C  CG    . GLN F  1 86  ? 77.675  43.703  18.265  1.00 47.10 ? 86   GLN F CG    1 
ATOM   6653  C  CD    . GLN F  1 86  ? 79.199  43.710  18.363  1.00 48.83 ? 86   GLN F CD    1 
ATOM   6654  O  OE1   . GLN F  1 86  ? 79.859  42.757  17.930  1.00 49.40 ? 86   GLN F OE1   1 
ATOM   6655  N  NE2   . GLN F  1 86  ? 79.758  44.780  18.935  1.00 48.42 ? 86   GLN F NE2   1 
ATOM   6656  N  N     . GLU F  1 87  ? 74.316  45.792  16.651  1.00 45.22 ? 87   GLU F N     1 
ATOM   6657  C  CA    . GLU F  1 87  ? 73.173  46.575  17.125  1.00 45.36 ? 87   GLU F CA    1 
ATOM   6658  C  C     . GLU F  1 87  ? 71.866  45.793  16.923  1.00 44.88 ? 87   GLU F C     1 
ATOM   6659  O  O     . GLU F  1 87  ? 70.996  45.783  17.792  1.00 44.89 ? 87   GLU F O     1 
ATOM   6660  C  CB    . GLU F  1 87  ? 73.103  47.925  16.391  1.00 45.73 ? 87   GLU F CB    1 
ATOM   6661  C  CG    . GLU F  1 87  ? 74.244  48.897  16.701  1.00 47.82 ? 87   GLU F CG    1 
ATOM   6662  C  CD    . GLU F  1 87  ? 75.426  48.792  15.733  1.00 50.11 ? 87   GLU F CD    1 
ATOM   6663  O  OE1   . GLU F  1 87  ? 75.634  47.714  15.123  1.00 50.79 ? 87   GLU F OE1   1 
ATOM   6664  O  OE2   . GLU F  1 87  ? 76.168  49.795  15.588  1.00 50.63 ? 87   GLU F OE2   1 
ATOM   6665  N  N     . ALA F  1 88  ? 71.750  45.134  15.771  1.00 44.34 ? 88   ALA F N     1 
ATOM   6666  C  CA    . ALA F  1 88  ? 70.552  44.377  15.415  1.00 43.92 ? 88   ALA F CA    1 
ATOM   6667  C  C     . ALA F  1 88  ? 70.304  43.181  16.336  1.00 43.54 ? 88   ALA F C     1 
ATOM   6668  O  O     . ALA F  1 88  ? 69.158  42.779  16.543  1.00 43.45 ? 88   ALA F O     1 
ATOM   6669  C  CB    . ALA F  1 88  ? 70.627  43.933  13.957  1.00 44.05 ? 88   ALA F CB    1 
ATOM   6670  N  N     . LEU F  1 89  ? 71.384  42.635  16.892  1.00 43.17 ? 89   LEU F N     1 
ATOM   6671  C  CA    . LEU F  1 89  ? 71.329  41.471  17.780  1.00 42.78 ? 89   LEU F CA    1 
ATOM   6672  C  C     . LEU F  1 89  ? 70.636  41.759  19.115  1.00 42.18 ? 89   LEU F C     1 
ATOM   6673  O  O     . LEU F  1 89  ? 70.028  40.863  19.701  1.00 42.26 ? 89   LEU F O     1 
ATOM   6674  C  CB    . LEU F  1 89  ? 72.747  40.931  18.037  1.00 42.96 ? 89   LEU F CB    1 
ATOM   6675  C  CG    . LEU F  1 89  ? 73.199  39.516  17.622  1.00 43.55 ? 89   LEU F CG    1 
ATOM   6676  C  CD1   . LEU F  1 89  ? 72.170  38.723  16.822  1.00 44.11 ? 89   LEU F CD1   1 
ATOM   6677  C  CD2   . LEU F  1 89  ? 74.515  39.584  16.849  1.00 44.41 ? 89   LEU F CD2   1 
ATOM   6678  N  N     . GLY F  1 90  ? 70.726  43.001  19.588  1.00 41.39 ? 90   GLY F N     1 
ATOM   6679  C  CA    . GLY F  1 90  ? 70.141  43.381  20.868  1.00 40.51 ? 90   GLY F CA    1 
ATOM   6680  C  C     . GLY F  1 90  ? 68.715  43.914  20.786  1.00 39.84 ? 90   GLY F C     1 
ATOM   6681  O  O     . GLY F  1 90  ? 68.197  44.525  21.734  1.00 40.08 ? 90   GLY F O     1 
ATOM   6682  N  N     . VAL F  1 91  ? 68.066  43.644  19.659  1.00 38.59 ? 91   VAL F N     1 
ATOM   6683  C  CA    . VAL F  1 91  ? 66.789  44.246  19.329  1.00 37.18 ? 91   VAL F CA    1 
ATOM   6684  C  C     . VAL F  1 91  ? 65.794  43.142  18.918  1.00 36.05 ? 91   VAL F C     1 
ATOM   6685  O  O     . VAL F  1 91  ? 66.211  42.071  18.474  1.00 36.08 ? 91   VAL F O     1 
ATOM   6686  C  CB    . VAL F  1 91  ? 67.050  45.316  18.241  1.00 37.49 ? 91   VAL F CB    1 
ATOM   6687  C  CG1   . VAL F  1 91  ? 66.150  45.162  17.039  1.00 37.17 ? 91   VAL F CG1   1 
ATOM   6688  C  CG2   . VAL F  1 91  ? 66.999  46.716  18.846  1.00 37.29 ? 91   VAL F CG2   1 
ATOM   6689  N  N     . ALA F  1 92  ? 64.494  43.377  19.096  1.00 34.51 ? 92   ALA F N     1 
ATOM   6690  C  CA    . ALA F  1 92  ? 63.483  42.366  18.744  1.00 32.94 ? 92   ALA F CA    1 
ATOM   6691  C  C     . ALA F  1 92  ? 62.903  42.552  17.347  1.00 31.98 ? 92   ALA F C     1 
ATOM   6692  O  O     . ALA F  1 92  ? 62.481  41.583  16.721  1.00 31.78 ? 92   ALA F O     1 
ATOM   6693  C  CB    . ALA F  1 92  ? 62.363  42.320  19.783  1.00 32.89 ? 92   ALA F CB    1 
ATOM   6694  N  N     . VAL F  1 93  ? 62.892  43.794  16.864  1.00 30.81 ? 93   VAL F N     1 
ATOM   6695  C  CA    . VAL F  1 93  ? 62.268  44.147  15.589  1.00 29.72 ? 93   VAL F CA    1 
ATOM   6696  C  C     . VAL F  1 93  ? 63.229  45.015  14.770  1.00 29.39 ? 93   VAL F C     1 
ATOM   6697  O  O     . VAL F  1 93  ? 63.714  46.044  15.244  1.00 29.18 ? 93   VAL F O     1 
ATOM   6698  C  CB    . VAL F  1 93  ? 60.923  44.905  15.801  1.00 29.83 ? 93   VAL F CB    1 
ATOM   6699  C  CG1   . VAL F  1 93  ? 60.279  45.305  14.451  1.00 29.03 ? 93   VAL F CG1   1 
ATOM   6700  C  CG2   . VAL F  1 93  ? 59.947  44.073  16.646  1.00 29.36 ? 93   VAL F CG2   1 
ATOM   6701  N  N     . ILE F  1 94  ? 63.495  44.591  13.538  1.00 28.78 ? 94   ILE F N     1 
ATOM   6702  C  CA    . ILE F  1 94  ? 64.421  45.290  12.654  1.00 28.34 ? 94   ILE F CA    1 
ATOM   6703  C  C     . ILE F  1 94  ? 63.707  45.736  11.388  1.00 28.18 ? 94   ILE F C     1 
ATOM   6704  O  O     . ILE F  1 94  ? 63.178  44.893  10.655  1.00 28.31 ? 94   ILE F O     1 
ATOM   6705  C  CB    . ILE F  1 94  ? 65.635  44.360  12.265  1.00 28.54 ? 94   ILE F CB    1 
ATOM   6706  C  CG1   . ILE F  1 94  ? 66.344  43.807  13.509  1.00 28.21 ? 94   ILE F CG1   1 
ATOM   6707  C  CG2   . ILE F  1 94  ? 66.636  45.100  11.368  1.00 27.68 ? 94   ILE F CG2   1 
ATOM   6708  C  CD1   . ILE F  1 94  ? 67.239  42.621  13.235  1.00 28.76 ? 94   ILE F CD1   1 
ATOM   6709  N  N     . GLY F  1 95  ? 63.706  47.043  11.120  1.00 27.84 ? 95   GLY F N     1 
ATOM   6710  C  CA    . GLY F  1 95  ? 63.206  47.578  9.863   1.00 27.87 ? 95   GLY F CA    1 
ATOM   6711  C  C     . GLY F  1 95  ? 64.340  47.975  8.921   1.00 28.26 ? 95   GLY F C     1 
ATOM   6712  O  O     . GLY F  1 95  ? 65.311  48.612  9.343   1.00 28.27 ? 95   GLY F O     1 
ATOM   6713  N  N     . ILE F  1 96  ? 64.240  47.580  7.651   1.00 28.23 ? 96   ILE F N     1 
ATOM   6714  C  CA    . ILE F  1 96  ? 65.225  47.977  6.655   1.00 28.61 ? 96   ILE F CA    1 
ATOM   6715  C  C     . ILE F  1 96  ? 64.597  48.776  5.520   1.00 29.21 ? 96   ILE F C     1 
ATOM   6716  O  O     . ILE F  1 96  ? 63.734  48.277  4.797   1.00 29.30 ? 96   ILE F O     1 
ATOM   6717  C  CB    . ILE F  1 96  ? 65.990  46.765  6.058   1.00 28.72 ? 96   ILE F CB    1 
ATOM   6718  C  CG1   . ILE F  1 96  ? 66.686  45.952  7.145   1.00 28.32 ? 96   ILE F CG1   1 
ATOM   6719  C  CG2   . ILE F  1 96  ? 67.003  47.253  5.006   1.00 28.43 ? 96   ILE F CG2   1 
ATOM   6720  C  CD1   . ILE F  1 96  ? 67.073  44.561  6.675   1.00 28.33 ? 96   ILE F CD1   1 
ATOM   6721  N  N     . ASP F  1 97  ? 65.055  50.008  5.350   1.00 30.03 ? 97   ASP F N     1 
ATOM   6722  C  CA    . ASP F  1 97  ? 64.564  50.843  4.268   1.00 31.23 ? 97   ASP F CA    1 
ATOM   6723  C  C     . ASP F  1 97  ? 65.509  50.780  3.076   1.00 31.47 ? 97   ASP F C     1 
ATOM   6724  O  O     . ASP F  1 97  ? 66.732  50.821  3.240   1.00 31.61 ? 97   ASP F O     1 
ATOM   6725  C  CB    . ASP F  1 97  ? 64.364  52.286  4.732   1.00 31.38 ? 97   ASP F CB    1 
ATOM   6726  C  CG    . ASP F  1 97  ? 63.647  53.140  3.690   1.00 34.23 ? 97   ASP F CG    1 
ATOM   6727  O  OD1   . ASP F  1 97  ? 62.944  52.577  2.809   1.00 35.65 ? 97   ASP F OD1   1 
ATOM   6728  O  OD2   . ASP F  1 97  ? 63.728  54.392  3.665   1.00 38.07 ? 97   ASP F OD2   1 
ATOM   6729  N  N     . GLU F  1 98  ? 64.925  50.677  1.880   1.00 31.80 ? 98   GLU F N     1 
ATOM   6730  C  CA    . GLU F  1 98  ? 65.675  50.599  0.624   1.00 32.16 ? 98   GLU F CA    1 
ATOM   6731  C  C     . GLU F  1 98  ? 66.574  49.359  0.595   1.00 31.79 ? 98   GLU F C     1 
ATOM   6732  O  O     . GLU F  1 98  ? 67.778  49.445  0.307   1.00 31.69 ? 98   GLU F O     1 
ATOM   6733  C  CB    . GLU F  1 98  ? 66.482  51.890  0.367   1.00 32.33 ? 98   GLU F CB    1 
ATOM   6734  C  CG    . GLU F  1 98  ? 65.651  53.171  0.372   1.00 34.83 ? 98   GLU F CG    1 
ATOM   6735  C  CD    . GLU F  1 98  ? 66.418  54.397  -0.119  1.00 38.48 ? 98   GLU F CD    1 
ATOM   6736  O  OE1   . GLU F  1 98  ? 67.418  54.239  -0.864  1.00 40.69 ? 98   GLU F OE1   1 
ATOM   6737  O  OE2   . GLU F  1 98  ? 66.021  55.529  0.234   1.00 38.99 ? 98   GLU F OE2   1 
ATOM   6738  N  N     . GLY F  1 99  ? 65.964  48.208  0.878   1.00 31.47 ? 99   GLY F N     1 
ATOM   6739  C  CA    . GLY F  1 99  ? 66.666  46.939  0.974   1.00 31.07 ? 99   GLY F CA    1 
ATOM   6740  C  C     . GLY F  1 99  ? 67.385  46.492  -0.282  1.00 30.86 ? 99   GLY F C     1 
ATOM   6741  O  O     . GLY F  1 99  ? 68.324  45.697  -0.212  1.00 31.07 ? 99   GLY F O     1 
ATOM   6742  N  N     . GLN F  1 100 ? 66.953  47.000  -1.430  1.00 30.61 ? 100  GLN F N     1 
ATOM   6743  C  CA    . GLN F  1 100 ? 67.567  46.636  -2.705  1.00 30.63 ? 100  GLN F CA    1 
ATOM   6744  C  C     . GLN F  1 100 ? 69.056  47.034  -2.826  1.00 30.94 ? 100  GLN F C     1 
ATOM   6745  O  O     . GLN F  1 100 ? 69.795  46.437  -3.610  1.00 30.87 ? 100  GLN F O     1 
ATOM   6746  C  CB    . GLN F  1 100 ? 66.737  47.166  -3.882  1.00 30.43 ? 100  GLN F CB    1 
ATOM   6747  C  CG    . GLN F  1 100 ? 66.836  48.665  -4.144  1.00 30.43 ? 100  GLN F CG    1 
ATOM   6748  C  CD    . GLN F  1 100 ? 65.880  49.492  -3.310  1.00 30.10 ? 100  GLN F CD    1 
ATOM   6749  O  OE1   . GLN F  1 100 ? 65.143  48.955  -2.478  1.00 31.46 ? 100  GLN F OE1   1 
ATOM   6750  N  NE2   . GLN F  1 100 ? 65.895  50.800  -3.520  1.00 28.08 ? 100  GLN F NE2   1 
ATOM   6751  N  N     . PHE F  1 101 ? 69.487  48.015  -2.032  1.00 31.09 ? 101  PHE F N     1 
ATOM   6752  C  CA    . PHE F  1 101 ? 70.856  48.536  -2.111  1.00 31.60 ? 101  PHE F CA    1 
ATOM   6753  C  C     . PHE F  1 101 ? 71.875  47.793  -1.240  1.00 32.13 ? 101  PHE F C     1 
ATOM   6754  O  O     . PHE F  1 101 ? 73.082  48.041  -1.337  1.00 32.40 ? 101  PHE F O     1 
ATOM   6755  C  CB    . PHE F  1 101 ? 70.878  50.018  -1.750  1.00 31.37 ? 101  PHE F CB    1 
ATOM   6756  C  CG    . PHE F  1 101 ? 70.312  50.912  -2.818  1.00 31.30 ? 101  PHE F CG    1 
ATOM   6757  C  CD1   . PHE F  1 101 ? 69.230  51.752  -2.536  1.00 29.78 ? 101  PHE F CD1   1 
ATOM   6758  C  CD2   . PHE F  1 101 ? 70.863  50.922  -4.100  1.00 30.17 ? 101  PHE F CD2   1 
ATOM   6759  C  CE1   . PHE F  1 101 ? 68.706  52.593  -3.514  1.00 29.60 ? 101  PHE F CE1   1 
ATOM   6760  C  CE2   . PHE F  1 101 ? 70.344  51.762  -5.090  1.00 30.69 ? 101  PHE F CE2   1 
ATOM   6761  C  CZ    . PHE F  1 101 ? 69.261  52.597  -4.793  1.00 30.66 ? 101  PHE F CZ    1 
ATOM   6762  N  N     . PHE F  1 102 ? 71.399  46.888  -0.394  1.00 32.42 ? 102  PHE F N     1 
ATOM   6763  C  CA    . PHE F  1 102 ? 72.296  46.112  0.439   1.00 32.85 ? 102  PHE F CA    1 
ATOM   6764  C  C     . PHE F  1 102 ? 72.611  44.775  -0.230  1.00 33.50 ? 102  PHE F C     1 
ATOM   6765  O  O     . PHE F  1 102 ? 71.712  43.964  -0.446  1.00 33.76 ? 102  PHE F O     1 
ATOM   6766  C  CB    . PHE F  1 102 ? 71.683  45.888  1.820   1.00 32.53 ? 102  PHE F CB    1 
ATOM   6767  C  CG    . PHE F  1 102 ? 71.506  47.143  2.622   1.00 31.83 ? 102  PHE F CG    1 
ATOM   6768  C  CD1   . PHE F  1 102 ? 72.576  47.698  3.324   1.00 31.38 ? 102  PHE F CD1   1 
ATOM   6769  C  CD2   . PHE F  1 102 ? 70.260  47.763  2.700   1.00 30.84 ? 102  PHE F CD2   1 
ATOM   6770  C  CE1   . PHE F  1 102 ? 72.409  48.848  4.093   1.00 30.46 ? 102  PHE F CE1   1 
ATOM   6771  C  CE2   . PHE F  1 102 ? 70.084  48.916  3.459   1.00 29.78 ? 102  PHE F CE2   1 
ATOM   6772  C  CZ    . PHE F  1 102 ? 71.158  49.459  4.156   1.00 30.75 ? 102  PHE F CZ    1 
ATOM   6773  N  N     . PRO F  1 103 ? 73.887  44.529  -0.541  1.00 34.12 ? 103  PRO F N     1 
ATOM   6774  C  CA    . PRO F  1 103 ? 74.300  43.278  -1.211  1.00 34.31 ? 103  PRO F CA    1 
ATOM   6775  C  C     . PRO F  1 103 ? 74.093  42.048  -0.324  1.00 34.44 ? 103  PRO F C     1 
ATOM   6776  O  O     . PRO F  1 103 ? 74.037  40.919  -0.793  1.00 34.74 ? 103  PRO F O     1 
ATOM   6777  C  CB    . PRO F  1 103 ? 75.800  43.488  -1.438  1.00 34.56 ? 103  PRO F CB    1 
ATOM   6778  C  CG    . PRO F  1 103 ? 76.215  44.483  -0.385  1.00 34.49 ? 103  PRO F CG    1 
ATOM   6779  C  CD    . PRO F  1 103 ? 75.034  45.416  -0.265  1.00 34.27 ? 103  PRO F CD    1 
ATOM   6780  N  N     . ASP F  1 104 ? 74.031  42.363  0.925   1.00 34.46 ? 104  ASP F N     1 
ATOM   6781  C  CA    . ASP F  1 104 ? 73.909  41.498  2.093   1.00 34.53 ? 104  ASP F CA    1 
ATOM   6782  C  C     . ASP F  1 104 ? 72.511  41.160  2.566   1.00 34.27 ? 104  ASP F C     1 
ATOM   6783  O  O     . ASP F  1 104 ? 72.355  40.485  3.586   1.00 34.19 ? 104  ASP F O     1 
ATOM   6784  C  CB    . ASP F  1 104 ? 74.528  42.334  3.203   1.00 34.50 ? 104  ASP F CB    1 
ATOM   6785  C  CG    . ASP F  1 104 ? 75.195  41.558  4.284   1.00 36.40 ? 104  ASP F CG    1 
ATOM   6786  O  OD1   . ASP F  1 104 ? 75.260  40.305  4.168   1.00 38.66 ? 104  ASP F OD1   1 
ATOM   6787  O  OD2   . ASP F  1 104 ? 75.655  42.163  5.272   1.00 36.57 ? 104  ASP F OD2   1 
ATOM   6788  N  N     . ILE F  1 105 ? 71.509  41.616  1.859   1.00 34.03 ? 105  ILE F N     1 
ATOM   6789  C  CA    . ILE F  1 105 ? 70.129  41.615  2.361   1.00 33.87 ? 105  ILE F CA    1 
ATOM   6790  C  C     . ILE F  1 105 ? 69.590  40.225  2.734   1.00 33.97 ? 105  ILE F C     1 
ATOM   6791  O  O     . ILE F  1 105 ? 68.982  40.051  3.792   1.00 33.95 ? 105  ILE F O     1 
ATOM   6792  C  CB    . ILE F  1 105 ? 69.177  42.394  1.385   1.00 33.87 ? 105  ILE F CB    1 
ATOM   6793  C  CG1   . ILE F  1 105 ? 67.772  42.559  1.983   1.00 33.36 ? 105  ILE F CG1   1 
ATOM   6794  C  CG2   . ILE F  1 105 ? 69.150  41.755  -0.009  1.00 32.99 ? 105  ILE F CG2   1 
ATOM   6795  C  CD1   . ILE F  1 105 ? 67.640  43.690  2.954   1.00 32.78 ? 105  ILE F CD1   1 
ATOM   6796  N  N     . VAL F  1 106 ? 69.857  39.239  1.884   1.00 34.13 ? 106  VAL F N     1 
ATOM   6797  C  CA    . VAL F  1 106 ? 69.305  37.897  2.046   1.00 34.39 ? 106  VAL F CA    1 
ATOM   6798  C  C     . VAL F  1 106 ? 69.855  37.190  3.285   1.00 34.78 ? 106  VAL F C     1 
ATOM   6799  O  O     . VAL F  1 106 ? 69.084  36.743  4.143   1.00 34.92 ? 106  VAL F O     1 
ATOM   6800  C  CB    . VAL F  1 106 ? 69.545  37.038  0.786   1.00 34.70 ? 106  VAL F CB    1 
ATOM   6801  C  CG1   . VAL F  1 106 ? 69.310  35.545  1.068   1.00 34.79 ? 106  VAL F CG1   1 
ATOM   6802  C  CG2   . VAL F  1 106 ? 68.658  37.516  -0.353  1.00 34.57 ? 106  VAL F CG2   1 
ATOM   6803  N  N     . GLU F  1 107 ? 71.180  37.101  3.391   1.00 34.76 ? 107  GLU F N     1 
ATOM   6804  C  CA    . GLU F  1 107 ? 71.791  36.385  4.505   1.00 35.05 ? 107  GLU F CA    1 
ATOM   6805  C  C     . GLU F  1 107 ? 71.529  37.074  5.842   1.00 34.45 ? 107  GLU F C     1 
ATOM   6806  O  O     . GLU F  1 107 ? 71.353  36.404  6.864   1.00 34.50 ? 107  GLU F O     1 
ATOM   6807  C  CB    . GLU F  1 107 ? 73.294  36.126  4.294   1.00 35.61 ? 107  GLU F CB    1 
ATOM   6808  C  CG    . GLU F  1 107 ? 73.998  37.073  3.324   1.00 38.50 ? 107  GLU F CG    1 
ATOM   6809  C  CD    . GLU F  1 107 ? 73.676  36.777  1.865   1.00 41.99 ? 107  GLU F CD    1 
ATOM   6810  O  OE1   . GLU F  1 107 ? 74.049  35.687  1.371   1.00 44.48 ? 107  GLU F OE1   1 
ATOM   6811  O  OE2   . GLU F  1 107 ? 73.041  37.627  1.209   1.00 42.30 ? 107  GLU F OE2   1 
ATOM   6812  N  N     . PHE F  1 108 ? 71.485  38.405  5.835   1.00 33.72 ? 108  PHE F N     1 
ATOM   6813  C  CA    . PHE F  1 108 ? 71.187  39.155  7.046   1.00 33.16 ? 108  PHE F CA    1 
ATOM   6814  C  C     . PHE F  1 108 ? 69.766  38.881  7.559   1.00 33.14 ? 108  PHE F C     1 
ATOM   6815  O  O     . PHE F  1 108 ? 69.574  38.576  8.741   1.00 33.11 ? 108  PHE F O     1 
ATOM   6816  C  CB    . PHE F  1 108 ? 71.389  40.646  6.804   1.00 33.15 ? 108  PHE F CB    1 
ATOM   6817  C  CG    . PHE F  1 108 ? 71.149  41.498  8.019   1.00 33.09 ? 108  PHE F CG    1 
ATOM   6818  C  CD1   . PHE F  1 108 ? 72.181  41.765  8.907   1.00 32.55 ? 108  PHE F CD1   1 
ATOM   6819  C  CD2   . PHE F  1 108 ? 69.892  42.045  8.266   1.00 32.69 ? 108  PHE F CD2   1 
ATOM   6820  C  CE1   . PHE F  1 108 ? 71.962  42.561  10.018  1.00 32.96 ? 108  PHE F CE1   1 
ATOM   6821  C  CE2   . PHE F  1 108 ? 69.664  42.833  9.382   1.00 32.47 ? 108  PHE F CE2   1 
ATOM   6822  C  CZ    . PHE F  1 108 ? 70.693  43.097  10.257  1.00 32.65 ? 108  PHE F CZ    1 
ATOM   6823  N  N     . CYS F  1 109 ? 68.775  38.989  6.679   1.00 32.94 ? 109  CYS F N     1 
ATOM   6824  C  CA    . CYS F  1 109 ? 67.378  38.828  7.094   1.00 33.18 ? 109  CYS F CA    1 
ATOM   6825  C  C     . CYS F  1 109 ? 67.105  37.404  7.541   1.00 33.06 ? 109  CYS F C     1 
ATOM   6826  O  O     . CYS F  1 109 ? 66.434  37.175  8.548   1.00 32.76 ? 109  CYS F O     1 
ATOM   6827  C  CB    . CYS F  1 109 ? 66.419  39.228  5.977   1.00 33.04 ? 109  CYS F CB    1 
ATOM   6828  S  SG    . CYS F  1 109 ? 66.454  40.994  5.644   1.00 34.00 ? 109  CYS F SG    1 
ATOM   6829  N  N     . GLU F  1 110 ? 67.657  36.453  6.800   1.00 33.43 ? 110  GLU F N     1 
ATOM   6830  C  CA    . GLU F  1 110 ? 67.461  35.044  7.104   1.00 33.92 ? 110  GLU F CA    1 
ATOM   6831  C  C     . GLU F  1 110 ? 68.091  34.703  8.456   1.00 33.80 ? 110  GLU F C     1 
ATOM   6832  O  O     . GLU F  1 110 ? 67.449  34.048  9.288   1.00 34.03 ? 110  GLU F O     1 
ATOM   6833  C  CB    . GLU F  1 110 ? 67.976  34.157  5.957   1.00 34.10 ? 110  GLU F CB    1 
ATOM   6834  C  CG    . GLU F  1 110 ? 67.963  32.648  6.219   1.00 36.14 ? 110  GLU F CG    1 
ATOM   6835  C  CD    . GLU F  1 110 ? 66.569  32.017  6.336   1.00 38.14 ? 110  GLU F CD    1 
ATOM   6836  O  OE1   . GLU F  1 110 ? 66.511  30.819  6.680   1.00 39.38 ? 110  GLU F OE1   1 
ATOM   6837  O  OE2   . GLU F  1 110 ? 65.535  32.682  6.100   1.00 38.72 ? 110  GLU F OE2   1 
ATOM   6838  N  N     . ALA F  1 111 ? 69.315  35.183  8.695   1.00 33.46 ? 111  ALA F N     1 
ATOM   6839  C  CA    . ALA F  1 111 ? 69.980  34.967  9.982   1.00 33.34 ? 111  ALA F CA    1 
ATOM   6840  C  C     . ALA F  1 111 ? 69.248  35.620  11.156  1.00 33.19 ? 111  ALA F C     1 
ATOM   6841  O  O     . ALA F  1 111 ? 69.125  35.015  12.225  1.00 33.32 ? 111  ALA F O     1 
ATOM   6842  C  CB    . ALA F  1 111 ? 71.448  35.415  9.931   1.00 33.57 ? 111  ALA F CB    1 
ATOM   6843  N  N     . MET F  1 112 ? 68.753  36.840  10.957  1.00 32.92 ? 112  MET F N     1 
ATOM   6844  C  CA    . MET F  1 112 ? 68.023  37.536  12.015  1.00 32.88 ? 112  MET F CA    1 
ATOM   6845  C  C     . MET F  1 112 ? 66.647  36.900  12.304  1.00 32.70 ? 112  MET F C     1 
ATOM   6846  O  O     . MET F  1 112 ? 66.237  36.804  13.461  1.00 32.52 ? 112  MET F O     1 
ATOM   6847  C  CB    . MET F  1 112 ? 67.896  39.032  11.709  1.00 33.10 ? 112  MET F CB    1 
ATOM   6848  C  CG    . MET F  1 112 ? 69.225  39.797  11.691  1.00 34.35 ? 112  MET F CG    1 
ATOM   6849  S  SD    . MET F  1 112 ? 70.150  39.762  13.259  1.00 38.84 ? 112  MET F SD    1 
ATOM   6850  C  CE    . MET F  1 112 ? 71.749  40.444  12.726  1.00 37.52 ? 112  MET F CE    1 
ATOM   6851  N  N     . ALA F  1 113 ? 65.948  36.445  11.262  1.00 32.50 ? 113  ALA F N     1 
ATOM   6852  C  CA    . ALA F  1 113 ? 64.661  35.768  11.465  1.00 32.73 ? 113  ALA F CA    1 
ATOM   6853  C  C     . ALA F  1 113 ? 64.833  34.414  12.155  1.00 32.93 ? 113  ALA F C     1 
ATOM   6854  O  O     . ALA F  1 113 ? 64.011  34.029  12.994  1.00 32.93 ? 113  ALA F O     1 
ATOM   6855  C  CB    . ALA F  1 113 ? 63.892  35.607  10.156  1.00 32.38 ? 113  ALA F CB    1 
ATOM   6856  N  N     . ASN F  1 114 ? 65.894  33.694  11.794  1.00 33.14 ? 114  ASN F N     1 
ATOM   6857  C  CA    . ASN F  1 114 ? 66.205  32.423  12.439  1.00 33.49 ? 114  ASN F CA    1 
ATOM   6858  C  C     . ASN F  1 114 ? 66.679  32.568  13.886  1.00 33.65 ? 114  ASN F C     1 
ATOM   6859  O  O     . ASN F  1 114 ? 66.565  31.627  14.671  1.00 34.04 ? 114  ASN F O     1 
ATOM   6860  C  CB    . ASN F  1 114 ? 67.208  31.623  11.611  1.00 33.55 ? 114  ASN F CB    1 
ATOM   6861  C  CG    . ASN F  1 114 ? 66.572  30.993  10.391  1.00 33.95 ? 114  ASN F CG    1 
ATOM   6862  O  OD1   . ASN F  1 114 ? 65.357  30.737  10.367  1.00 35.01 ? 114  ASN F OD1   1 
ATOM   6863  N  ND2   . ASN F  1 114 ? 67.381  30.737  9.368   1.00 32.81 ? 114  ASN F ND2   1 
ATOM   6864  N  N     . ALA F  1 115 ? 67.188  33.751  14.234  1.00 33.61 ? 115  ALA F N     1 
ATOM   6865  C  CA    . ALA F  1 115 ? 67.533  34.088  15.617  1.00 33.43 ? 115  ALA F CA    1 
ATOM   6866  C  C     . ALA F  1 115 ? 66.338  34.655  16.391  1.00 33.33 ? 115  ALA F C     1 
ATOM   6867  O  O     . ALA F  1 115 ? 66.495  35.141  17.512  1.00 33.41 ? 115  ALA F O     1 
ATOM   6868  C  CB    . ALA F  1 115 ? 68.713  35.073  15.651  1.00 33.50 ? 115  ALA F CB    1 
ATOM   6869  N  N     . GLY F  1 116 ? 65.148  34.607  15.789  1.00 33.15 ? 116  GLY F N     1 
ATOM   6870  C  CA    . GLY F  1 116 ? 63.918  35.000  16.470  1.00 32.49 ? 116  GLY F CA    1 
ATOM   6871  C  C     . GLY F  1 116 ? 63.469  36.448  16.325  1.00 32.24 ? 116  GLY F C     1 
ATOM   6872  O  O     . GLY F  1 116 ? 62.544  36.886  17.016  1.00 32.21 ? 116  GLY F O     1 
ATOM   6873  N  N     . LYS F  1 117 ? 64.112  37.200  15.435  1.00 31.69 ? 117  LYS F N     1 
ATOM   6874  C  CA    . LYS F  1 117 ? 63.737  38.600  15.200  1.00 31.33 ? 117  LYS F CA    1 
ATOM   6875  C  C     . LYS F  1 117 ? 62.653  38.765  14.130  1.00 30.61 ? 117  LYS F C     1 
ATOM   6876  O  O     . LYS F  1 117 ? 62.557  37.948  13.200  1.00 30.53 ? 117  LYS F O     1 
ATOM   6877  C  CB    . LYS F  1 117 ? 64.962  39.422  14.788  1.00 31.75 ? 117  LYS F CB    1 
ATOM   6878  C  CG    . LYS F  1 117 ? 65.795  39.917  15.963  1.00 33.32 ? 117  LYS F CG    1 
ATOM   6879  C  CD    . LYS F  1 117 ? 67.029  39.041  16.181  1.00 34.41 ? 117  LYS F CD    1 
ATOM   6880  C  CE    . LYS F  1 117 ? 68.061  39.742  17.082  1.00 34.84 ? 117  LYS F CE    1 
ATOM   6881  N  NZ    . LYS F  1 117 ? 67.690  39.776  18.526  1.00 34.10 ? 117  LYS F NZ    1 
ATOM   6882  N  N     . THR F  1 118 ? 61.841  39.816  14.268  1.00 29.50 ? 118  THR F N     1 
ATOM   6883  C  CA    . THR F  1 118 ? 60.923  40.231  13.208  1.00 28.53 ? 118  THR F CA    1 
ATOM   6884  C  C     . THR F  1 118 ? 61.649  41.234  12.320  1.00 27.93 ? 118  THR F C     1 
ATOM   6885  O  O     . THR F  1 118 ? 62.027  42.310  12.778  1.00 28.17 ? 118  THR F O     1 
ATOM   6886  C  CB    . THR F  1 118 ? 59.600  40.862  13.785  1.00 28.82 ? 118  THR F CB    1 
ATOM   6887  O  OG1   . THR F  1 118 ? 58.805  39.855  14.417  1.00 28.51 ? 118  THR F OG1   1 
ATOM   6888  C  CG2   . THR F  1 118 ? 58.666  41.349  12.666  1.00 27.59 ? 118  THR F CG2   1 
ATOM   6889  N  N     . VAL F  1 119 ? 61.845  40.877  11.054  1.00 27.20 ? 119  VAL F N     1 
ATOM   6890  C  CA    . VAL F  1 119 ? 62.534  41.746  10.099  1.00 26.45 ? 119  VAL F CA    1 
ATOM   6891  C  C     . VAL F  1 119 ? 61.545  42.244  9.057   1.00 26.17 ? 119  VAL F C     1 
ATOM   6892  O  O     . VAL F  1 119 ? 60.866  41.446  8.420   1.00 26.11 ? 119  VAL F O     1 
ATOM   6893  C  CB    . VAL F  1 119 ? 63.708  41.027  9.354   1.00 26.82 ? 119  VAL F CB    1 
ATOM   6894  C  CG1   . VAL F  1 119 ? 64.692  42.048  8.780   1.00 26.25 ? 119  VAL F CG1   1 
ATOM   6895  C  CG2   . VAL F  1 119 ? 64.434  40.044  10.257  1.00 26.30 ? 119  VAL F CG2   1 
ATOM   6896  N  N     . ILE F  1 120 ? 61.466  43.566  8.891   1.00 25.56 ? 120  ILE F N     1 
ATOM   6897  C  CA    . ILE F  1 120 ? 60.553  44.168  7.926   1.00 24.79 ? 120  ILE F CA    1 
ATOM   6898  C  C     . ILE F  1 120 ? 61.362  44.970  6.923   1.00 24.69 ? 120  ILE F C     1 
ATOM   6899  O  O     . ILE F  1 120 ? 62.133  45.858  7.298   1.00 24.79 ? 120  ILE F O     1 
ATOM   6900  C  CB    . ILE F  1 120 ? 59.473  45.058  8.617   1.00 24.89 ? 120  ILE F CB    1 
ATOM   6901  C  CG1   . ILE F  1 120 ? 58.735  44.282  9.704   1.00 24.63 ? 120  ILE F CG1   1 
ATOM   6902  C  CG2   . ILE F  1 120 ? 58.470  45.589  7.583   1.00 24.07 ? 120  ILE F CG2   1 
ATOM   6903  C  CD1   . ILE F  1 120 ? 58.216  45.161  10.844  1.00 25.43 ? 120  ILE F CD1   1 
ATOM   6904  N  N     . VAL F  1 121 ? 61.176  44.654  5.644   1.00 24.25 ? 121  VAL F N     1 
ATOM   6905  C  CA    . VAL F  1 121 ? 61.980  45.231  4.582   1.00 23.95 ? 121  VAL F CA    1 
ATOM   6906  C  C     . VAL F  1 121 ? 61.119  45.994  3.595   1.00 24.03 ? 121  VAL F C     1 
ATOM   6907  O  O     . VAL F  1 121 ? 60.207  45.420  3.004   1.00 24.37 ? 121  VAL F O     1 
ATOM   6908  C  CB    . VAL F  1 121 ? 62.775  44.137  3.800   1.00 23.88 ? 121  VAL F CB    1 
ATOM   6909  C  CG1   . VAL F  1 121 ? 63.784  44.772  2.853   1.00 22.85 ? 121  VAL F CG1   1 
ATOM   6910  C  CG2   . VAL F  1 121 ? 63.463  43.181  4.750   1.00 23.45 ? 121  VAL F CG2   1 
ATOM   6911  N  N     . ALA F  1 122 ? 61.416  47.281  3.417   1.00 23.89 ? 122  ALA F N     1 
ATOM   6912  C  CA    . ALA F  1 122 ? 60.852  48.072  2.322   1.00 23.88 ? 122  ALA F CA    1 
ATOM   6913  C  C     . ALA F  1 122 ? 61.862  48.133  1.183   1.00 24.07 ? 122  ALA F C     1 
ATOM   6914  O  O     . ALA F  1 122 ? 63.045  48.375  1.401   1.00 23.89 ? 122  ALA F O     1 
ATOM   6915  C  CB    . ALA F  1 122 ? 60.497  49.481  2.802   1.00 23.76 ? 122  ALA F CB    1 
ATOM   6916  N  N     . ALA F  1 123 ? 61.400  47.906  -0.038  1.00 24.56 ? 123  ALA F N     1 
ATOM   6917  C  CA    . ALA F  1 123 ? 62.315  47.822  -1.170  1.00 24.99 ? 123  ALA F CA    1 
ATOM   6918  C  C     . ALA F  1 123 ? 61.613  47.934  -2.503  1.00 25.65 ? 123  ALA F C     1 
ATOM   6919  O  O     . ALA F  1 123 ? 60.476  47.483  -2.652  1.00 25.87 ? 123  ALA F O     1 
ATOM   6920  C  CB    . ALA F  1 123 ? 63.103  46.525  -1.113  1.00 24.63 ? 123  ALA F CB    1 
ATOM   6921  N  N     . LEU F  1 124 ? 62.337  48.473  -3.466  1.00 26.50 ? 124  LEU F N     1 
ATOM   6922  C  CA    . LEU F  1 124 ? 61.901  48.505  -4.835  1.00 27.64 ? 124  LEU F CA    1 
ATOM   6923  C  C     . LEU F  1 124 ? 62.034  47.075  -5.368  1.00 28.53 ? 124  LEU F C     1 
ATOM   6924  O  O     . LEU F  1 124 ? 63.041  46.416  -5.133  1.00 28.97 ? 124  LEU F O     1 
ATOM   6925  C  CB    . LEU F  1 124 ? 62.881  49.370  -5.684  1.00 27.59 ? 124  LEU F CB    1 
ATOM   6926  C  CG    . LEU F  1 124 ? 62.499  50.751  -6.238  1.00 28.03 ? 124  LEU F CG    1 
ATOM   6927  C  CD1   . LEU F  1 124 ? 61.250  51.289  -5.557  1.00 25.91 ? 124  LEU F CD1   1 
ATOM   6928  C  CD2   . LEU F  1 124 ? 63.652  51.739  -6.091  1.00 27.63 ? 124  LEU F CD2   1 
ATOM   6929  N  N     . ASP F  1 125 ? 61.029  46.587  -6.082  1.00 29.33 ? 125  ASP F N     1 
ATOM   6930  C  CA    . ASP F  1 125 ? 61.123  45.262  -6.690  1.00 30.34 ? 125  ASP F CA    1 
ATOM   6931  C  C     . ASP F  1 125 ? 61.854  45.363  -8.031  1.00 30.20 ? 125  ASP F C     1 
ATOM   6932  O  O     . ASP F  1 125 ? 62.616  44.465  -8.399  1.00 30.46 ? 125  ASP F O     1 
ATOM   6933  C  CB    . ASP F  1 125 ? 59.737  44.634  -6.880  1.00 30.52 ? 125  ASP F CB    1 
ATOM   6934  C  CG    . ASP F  1 125 ? 58.740  45.598  -7.460  1.00 32.50 ? 125  ASP F CG    1 
ATOM   6935  O  OD1   . ASP F  1 125 ? 58.097  45.258  -8.481  1.00 35.89 ? 125  ASP F OD1   1 
ATOM   6936  O  OD2   . ASP F  1 125 ? 58.529  46.731  -6.972  1.00 35.91 ? 125  ASP F OD2   1 
ATOM   6937  N  N     . GLY F  1 126 ? 61.619  46.465  -8.742  1.00 29.78 ? 126  GLY F N     1 
ATOM   6938  C  CA    . GLY F  1 126 ? 62.202  46.669  -10.050 1.00 29.28 ? 126  GLY F CA    1 
ATOM   6939  C  C     . GLY F  1 126 ? 63.032  47.929  -10.194 1.00 29.16 ? 126  GLY F C     1 
ATOM   6940  O  O     . GLY F  1 126 ? 62.766  48.948  -9.540  1.00 29.07 ? 126  GLY F O     1 
ATOM   6941  N  N     . THR F  1 127 ? 64.037  47.863  -11.069 1.00 28.95 ? 127  THR F N     1 
ATOM   6942  C  CA    . THR F  1 127 ? 64.793  49.052  -11.459 1.00 28.74 ? 127  THR F CA    1 
ATOM   6943  C  C     . THR F  1 127 ? 63.993  49.831  -12.495 1.00 28.95 ? 127  THR F C     1 
ATOM   6944  O  O     . THR F  1 127 ? 62.868  49.453  -12.841 1.00 28.61 ? 127  THR F O     1 
ATOM   6945  C  CB    . THR F  1 127 ? 66.190  48.703  -12.039 1.00 28.75 ? 127  THR F CB    1 
ATOM   6946  O  OG1   . THR F  1 127 ? 66.034  48.134  -13.343 1.00 28.97 ? 127  THR F OG1   1 
ATOM   6947  C  CG2   . THR F  1 127 ? 66.882  47.591  -11.246 1.00 28.16 ? 127  THR F CG2   1 
ATOM   6948  N  N     . PHE F  1 128 ? 64.594  50.911  -12.997 1.00 29.28 ? 128  PHE F N     1 
ATOM   6949  C  CA    . PHE F  1 128 ? 64.015  51.727  -14.064 1.00 29.66 ? 128  PHE F CA    1 
ATOM   6950  C  C     . PHE F  1 128 ? 63.834  50.937  -15.370 1.00 30.15 ? 128  PHE F C     1 
ATOM   6951  O  O     . PHE F  1 128 ? 63.159  51.399  -16.299 1.00 30.26 ? 128  PHE F O     1 
ATOM   6952  C  CB    . PHE F  1 128 ? 64.864  53.004  -14.285 1.00 29.88 ? 128  PHE F CB    1 
ATOM   6953  C  CG    . PHE F  1 128 ? 66.189  52.759  -14.987 1.00 29.84 ? 128  PHE F CG    1 
ATOM   6954  C  CD1   . PHE F  1 128 ? 66.343  53.067  -16.342 1.00 30.55 ? 128  PHE F CD1   1 
ATOM   6955  C  CD2   . PHE F  1 128 ? 67.275  52.223  -14.298 1.00 29.89 ? 128  PHE F CD2   1 
ATOM   6956  C  CE1   . PHE F  1 128 ? 67.556  52.846  -17.004 1.00 29.90 ? 128  PHE F CE1   1 
ATOM   6957  C  CE2   . PHE F  1 128 ? 68.493  51.989  -14.945 1.00 30.76 ? 128  PHE F CE2   1 
ATOM   6958  C  CZ    . PHE F  1 128 ? 68.638  52.311  -16.304 1.00 30.39 ? 128  PHE F CZ    1 
ATOM   6959  N  N     . GLN F  1 129 ? 64.438  49.747  -15.435 1.00 30.74 ? 129  GLN F N     1 
ATOM   6960  C  CA    . GLN F  1 129 ? 64.317  48.875  -16.605 1.00 31.42 ? 129  GLN F CA    1 
ATOM   6961  C  C     . GLN F  1 129 ? 63.308  47.740  -16.379 1.00 31.56 ? 129  GLN F C     1 
ATOM   6962  O  O     . GLN F  1 129 ? 63.146  46.865  -17.239 1.00 31.53 ? 129  GLN F O     1 
ATOM   6963  C  CB    . GLN F  1 129 ? 65.697  48.330  -17.010 1.00 31.57 ? 129  GLN F CB    1 
ATOM   6964  C  CG    . GLN F  1 129 ? 66.738  49.420  -17.316 1.00 33.52 ? 129  GLN F CG    1 
ATOM   6965  C  CD    . GLN F  1 129 ? 68.078  48.877  -17.847 1.00 36.35 ? 129  GLN F CD    1 
ATOM   6966  O  OE1   . GLN F  1 129 ? 68.353  48.964  -19.045 1.00 37.78 ? 129  GLN F OE1   1 
ATOM   6967  N  NE2   . GLN F  1 129 ? 68.907  48.337  -16.957 1.00 35.98 ? 129  GLN F NE2   1 
ATOM   6968  N  N     . ARG F  1 130 ? 62.620  47.780  -15.230 1.00 31.76 ? 130  ARG F N     1 
ATOM   6969  C  CA    . ARG F  1 130 ? 61.655  46.751  -14.821 1.00 31.88 ? 130  ARG F CA    1 
ATOM   6970  C  C     . ARG F  1 130 ? 62.323  45.366  -14.698 1.00 32.02 ? 130  ARG F C     1 
ATOM   6971  O  O     . ARG F  1 130 ? 61.740  44.334  -15.034 1.00 32.10 ? 130  ARG F O     1 
ATOM   6972  C  CB    . ARG F  1 130 ? 60.443  46.745  -15.760 1.00 32.01 ? 130  ARG F CB    1 
ATOM   6973  C  CG    . ARG F  1 130 ? 59.668  48.088  -15.780 1.00 32.96 ? 130  ARG F CG    1 
ATOM   6974  C  CD    . ARG F  1 130 ? 58.253  48.015  -16.329 1.00 34.38 ? 130  ARG F CD    1 
ATOM   6975  N  NE    . ARG F  1 130 ? 58.191  47.185  -17.527 1.00 37.59 ? 130  ARG F NE    1 
ATOM   6976  C  CZ    . ARG F  1 130 ? 57.281  46.242  -17.765 1.00 38.28 ? 130  ARG F CZ    1 
ATOM   6977  N  NH1   . ARG F  1 130 ? 56.309  45.985  -16.899 1.00 38.29 ? 130  ARG F NH1   1 
ATOM   6978  N  NH2   . ARG F  1 130 ? 57.343  45.551  -18.894 1.00 38.59 ? 130  ARG F NH2   1 
ATOM   6979  N  N     . LYS F  1 131 ? 63.565  45.382  -14.222 1.00 32.02 ? 131  LYS F N     1 
ATOM   6980  C  CA    . LYS F  1 131 ? 64.356  44.191  -13.946 1.00 32.44 ? 131  LYS F CA    1 
ATOM   6981  C  C     . LYS F  1 131 ? 64.440  44.028  -12.429 1.00 32.01 ? 131  LYS F C     1 
ATOM   6982  O  O     . LYS F  1 131 ? 64.306  45.018  -11.704 1.00 31.77 ? 131  LYS F O     1 
ATOM   6983  C  CB    . LYS F  1 131 ? 65.787  44.393  -14.470 1.00 32.60 ? 131  LYS F CB    1 
ATOM   6984  C  CG    . LYS F  1 131 ? 65.909  44.524  -15.977 1.00 34.85 ? 131  LYS F CG    1 
ATOM   6985  C  CD    . LYS F  1 131 ? 67.270  44.011  -16.434 1.00 38.92 ? 131  LYS F CD    1 
ATOM   6986  C  CE    . LYS F  1 131 ? 68.077  45.084  -17.137 1.00 40.86 ? 131  LYS F CE    1 
ATOM   6987  N  NZ    . LYS F  1 131 ? 67.697  45.164  -18.592 1.00 43.87 ? 131  LYS F NZ    1 
ATOM   6988  N  N     . PRO F  1 132 ? 64.698  42.810  -11.937 1.00 31.86 ? 132  PRO F N     1 
ATOM   6989  C  CA    . PRO F  1 132 ? 64.957  42.612  -10.501 1.00 31.64 ? 132  PRO F CA    1 
ATOM   6990  C  C     . PRO F  1 132 ? 66.039  43.572  -9.990  1.00 31.77 ? 132  PRO F C     1 
ATOM   6991  O  O     . PRO F  1 132 ? 67.086  43.733  -10.625 1.00 31.49 ? 132  PRO F O     1 
ATOM   6992  C  CB    . PRO F  1 132 ? 65.468  41.172  -10.433 1.00 31.77 ? 132  PRO F CB    1 
ATOM   6993  C  CG    . PRO F  1 132 ? 64.805  40.488  -11.593 1.00 31.89 ? 132  PRO F CG    1 
ATOM   6994  C  CD    . PRO F  1 132 ? 64.773  41.540  -12.690 1.00 31.69 ? 132  PRO F CD    1 
ATOM   6995  N  N     . PHE F  1 133 ? 65.775  44.212  -8.857  1.00 31.90 ? 133  PHE F N     1 
ATOM   6996  C  CA    . PHE F  1 133 ? 66.690  45.186  -8.291  1.00 32.04 ? 133  PHE F CA    1 
ATOM   6997  C  C     . PHE F  1 133 ? 67.595  44.497  -7.278  1.00 32.58 ? 133  PHE F C     1 
ATOM   6998  O  O     . PHE F  1 133 ? 67.181  44.200  -6.157  1.00 32.69 ? 133  PHE F O     1 
ATOM   6999  C  CB    . PHE F  1 133 ? 65.904  46.328  -7.634  1.00 32.04 ? 133  PHE F CB    1 
ATOM   7000  C  CG    . PHE F  1 133 ? 66.648  47.641  -7.568  1.00 31.63 ? 133  PHE F CG    1 
ATOM   7001  C  CD1   . PHE F  1 133 ? 65.965  48.842  -7.738  1.00 31.56 ? 133  PHE F CD1   1 
ATOM   7002  C  CD2   . PHE F  1 133 ? 68.018  47.685  -7.327  1.00 31.10 ? 133  PHE F CD2   1 
ATOM   7003  C  CE1   . PHE F  1 133 ? 66.637  50.062  -7.679  1.00 31.42 ? 133  PHE F CE1   1 
ATOM   7004  C  CE2   . PHE F  1 133 ? 68.689  48.898  -7.262  1.00 30.62 ? 133  PHE F CE2   1 
ATOM   7005  C  CZ    . PHE F  1 133 ? 67.996  50.086  -7.437  1.00 30.57 ? 133  PHE F CZ    1 
ATOM   7006  N  N     . GLY F  1 134 ? 68.839  44.240  -7.683  1.00 33.18 ? 134  GLY F N     1 
ATOM   7007  C  CA    . GLY F  1 134 ? 69.791  43.532  -6.842  1.00 33.11 ? 134  GLY F CA    1 
ATOM   7008  C  C     . GLY F  1 134 ? 69.313  42.128  -6.501  1.00 33.25 ? 134  GLY F C     1 
ATOM   7009  O  O     . GLY F  1 134 ? 68.762  41.417  -7.347  1.00 33.30 ? 134  GLY F O     1 
ATOM   7010  N  N     . ALA F  1 135 ? 69.503  41.744  -5.242  1.00 33.21 ? 135  ALA F N     1 
ATOM   7011  C  CA    . ALA F  1 135 ? 69.201  40.394  -4.781  1.00 33.16 ? 135  ALA F CA    1 
ATOM   7012  C  C     . ALA F  1 135 ? 67.856  40.325  -4.041  1.00 32.98 ? 135  ALA F C     1 
ATOM   7013  O  O     . ALA F  1 135 ? 67.490  39.287  -3.495  1.00 32.88 ? 135  ALA F O     1 
ATOM   7014  C  CB    . ALA F  1 135 ? 70.339  39.885  -3.878  1.00 33.20 ? 135  ALA F CB    1 
ATOM   7015  N  N     . ILE F  1 136 ? 67.113  41.423  -4.058  1.00 32.87 ? 136  ILE F N     1 
ATOM   7016  C  CA    . ILE F  1 136 ? 65.928  41.560  -3.217  1.00 32.88 ? 136  ILE F CA    1 
ATOM   7017  C  C     . ILE F  1 136 ? 64.817  40.517  -3.430  1.00 32.50 ? 136  ILE F C     1 
ATOM   7018  O  O     . ILE F  1 136 ? 64.153  40.136  -2.478  1.00 32.42 ? 136  ILE F O     1 
ATOM   7019  C  CB    . ILE F  1 136 ? 65.404  43.041  -3.236  1.00 33.05 ? 136  ILE F CB    1 
ATOM   7020  C  CG1   . ILE F  1 136 ? 65.098  43.540  -1.808  1.00 33.64 ? 136  ILE F CG1   1 
ATOM   7021  C  CG2   . ILE F  1 136 ? 64.267  43.242  -4.228  1.00 33.07 ? 136  ILE F CG2   1 
ATOM   7022  C  CD1   . ILE F  1 136 ? 63.834  42.963  -1.145  1.00 35.12 ? 136  ILE F CD1   1 
ATOM   7023  N  N     . LEU F  1 137 ? 64.655  40.018  -4.651  1.00 32.20 ? 137  LEU F N     1 
ATOM   7024  C  CA    . LEU F  1 137 ? 63.608  39.033  -4.921  1.00 31.93 ? 137  LEU F CA    1 
ATOM   7025  C  C     . LEU F  1 137 ? 63.884  37.659  -4.306  1.00 31.84 ? 137  LEU F C     1 
ATOM   7026  O  O     . LEU F  1 137 ? 62.944  36.888  -4.091  1.00 31.61 ? 137  LEU F O     1 
ATOM   7027  C  CB    . LEU F  1 137 ? 63.293  38.936  -6.421  1.00 31.91 ? 137  LEU F CB    1 
ATOM   7028  C  CG    . LEU F  1 137 ? 62.734  40.220  -7.068  1.00 32.09 ? 137  LEU F CG    1 
ATOM   7029  C  CD1   . LEU F  1 137 ? 62.163  39.915  -8.438  1.00 32.36 ? 137  LEU F CD1   1 
ATOM   7030  C  CD2   . LEU F  1 137 ? 61.695  40.926  -6.203  1.00 31.27 ? 137  LEU F CD2   1 
ATOM   7031  N  N     . ASN F  1 138 ? 65.157  37.371  -3.998  1.00 31.52 ? 138  ASN F N     1 
ATOM   7032  C  CA    . ASN F  1 138 ? 65.521  36.142  -3.271  1.00 31.31 ? 138  ASN F CA    1 
ATOM   7033  C  C     . ASN F  1 138 ? 64.953  36.101  -1.857  1.00 30.71 ? 138  ASN F C     1 
ATOM   7034  O  O     . ASN F  1 138 ? 64.956  35.057  -1.208  1.00 30.60 ? 138  ASN F O     1 
ATOM   7035  C  CB    . ASN F  1 138 ? 67.035  35.938  -3.202  1.00 31.48 ? 138  ASN F CB    1 
ATOM   7036  C  CG    . ASN F  1 138 ? 67.684  35.909  -4.563  1.00 33.11 ? 138  ASN F CG    1 
ATOM   7037  O  OD1   . ASN F  1 138 ? 67.153  35.325  -5.514  1.00 34.88 ? 138  ASN F OD1   1 
ATOM   7038  N  ND2   . ASN F  1 138 ? 68.851  36.537  -4.668  1.00 34.27 ? 138  ASN F ND2   1 
ATOM   7039  N  N     . LEU F  1 139 ? 64.478  37.245  -1.375  1.00 30.30 ? 139  LEU F N     1 
ATOM   7040  C  CA    . LEU F  1 139 ? 63.801  37.314  -0.082  1.00 29.84 ? 139  LEU F CA    1 
ATOM   7041  C  C     . LEU F  1 139 ? 62.408  36.690  -0.125  1.00 29.57 ? 139  LEU F C     1 
ATOM   7042  O  O     . LEU F  1 139 ? 61.949  36.141  0.878   1.00 29.55 ? 139  LEU F O     1 
ATOM   7043  C  CB    . LEU F  1 139 ? 63.685  38.760  0.395   1.00 29.70 ? 139  LEU F CB    1 
ATOM   7044  C  CG    . LEU F  1 139 ? 64.708  39.296  1.400   1.00 30.03 ? 139  LEU F CG    1 
ATOM   7045  C  CD1   . LEU F  1 139 ? 64.295  40.686  1.865   1.00 29.73 ? 139  LEU F CD1   1 
ATOM   7046  C  CD2   . LEU F  1 139 ? 64.885  38.352  2.591   1.00 29.89 ? 139  LEU F CD2   1 
ATOM   7047  N  N     . VAL F  1 140 ? 61.751  36.778  -1.282  1.00 29.15 ? 140  VAL F N     1 
ATOM   7048  C  CA    . VAL F  1 140 ? 60.368  36.338  -1.437  1.00 29.03 ? 140  VAL F CA    1 
ATOM   7049  C  C     . VAL F  1 140 ? 60.103  34.880  -0.996  1.00 29.17 ? 140  VAL F C     1 
ATOM   7050  O  O     . VAL F  1 140 ? 59.169  34.647  -0.229  1.00 29.52 ? 140  VAL F O     1 
ATOM   7051  C  CB    . VAL F  1 140 ? 59.830  36.611  -2.874  1.00 28.98 ? 140  VAL F CB    1 
ATOM   7052  C  CG1   . VAL F  1 140 ? 58.429  36.037  -3.047  1.00 28.48 ? 140  VAL F CG1   1 
ATOM   7053  C  CG2   . VAL F  1 140 ? 59.849  38.110  -3.175  1.00 28.32 ? 140  VAL F CG2   1 
ATOM   7054  N  N     . PRO F  1 141 ? 60.895  33.901  -1.444  1.00 29.07 ? 141  PRO F N     1 
ATOM   7055  C  CA    . PRO F  1 141 ? 60.683  32.516  -0.988  1.00 28.88 ? 141  PRO F CA    1 
ATOM   7056  C  C     . PRO F  1 141 ? 61.043  32.319  0.485   1.00 29.10 ? 141  PRO F C     1 
ATOM   7057  O  O     . PRO F  1 141 ? 60.685  31.285  1.057   1.00 29.17 ? 141  PRO F O     1 
ATOM   7058  C  CB    . PRO F  1 141 ? 61.626  31.690  -1.878  1.00 28.81 ? 141  PRO F CB    1 
ATOM   7059  C  CG    . PRO F  1 141 ? 62.037  32.600  -2.976  1.00 28.95 ? 141  PRO F CG    1 
ATOM   7060  C  CD    . PRO F  1 141 ? 62.020  33.985  -2.397  1.00 28.92 ? 141  PRO F CD    1 
ATOM   7061  N  N     . LEU F  1 142 ? 61.727  33.289  1.090   1.00 28.90 ? 142  LEU F N     1 
ATOM   7062  C  CA    . LEU F  1 142 ? 62.088  33.210  2.508   1.00 28.93 ? 142  LEU F CA    1 
ATOM   7063  C  C     . LEU F  1 142 ? 61.126  33.966  3.426   1.00 28.82 ? 142  LEU F C     1 
ATOM   7064  O  O     . LEU F  1 142 ? 61.208  33.847  4.645   1.00 28.80 ? 142  LEU F O     1 
ATOM   7065  C  CB    . LEU F  1 142 ? 63.527  33.707  2.732   1.00 28.70 ? 142  LEU F CB    1 
ATOM   7066  C  CG    . LEU F  1 142 ? 64.605  33.196  1.766   1.00 29.15 ? 142  LEU F CG    1 
ATOM   7067  C  CD1   . LEU F  1 142 ? 65.885  34.013  1.919   1.00 29.07 ? 142  LEU F CD1   1 
ATOM   7068  C  CD2   . LEU F  1 142 ? 64.888  31.697  1.932   1.00 28.06 ? 142  LEU F CD2   1 
ATOM   7069  N  N     . ALA F  1 143 ? 60.215  34.736  2.838   1.00 28.95 ? 143  ALA F N     1 
ATOM   7070  C  CA    . ALA F  1 143 ? 59.368  35.660  3.600   1.00 29.14 ? 143  ALA F CA    1 
ATOM   7071  C  C     . ALA F  1 143 ? 58.013  35.067  3.975   1.00 29.24 ? 143  ALA F C     1 
ATOM   7072  O  O     . ALA F  1 143 ? 57.410  34.351  3.190   1.00 29.27 ? 143  ALA F O     1 
ATOM   7073  C  CB    . ALA F  1 143 ? 59.167  36.942  2.801   1.00 28.99 ? 143  ALA F CB    1 
ATOM   7074  N  N     . GLU F  1 144 ? 57.516  35.377  5.165   1.00 29.68 ? 144  GLU F N     1 
ATOM   7075  C  CA    . GLU F  1 144 ? 56.165  34.922  5.518   1.00 30.32 ? 144  GLU F CA    1 
ATOM   7076  C  C     . GLU F  1 144 ? 55.095  35.888  5.057   1.00 30.01 ? 144  GLU F C     1 
ATOM   7077  O  O     . GLU F  1 144 ? 53.924  35.533  4.997   1.00 30.31 ? 144  GLU F O     1 
ATOM   7078  C  CB    . GLU F  1 144 ? 55.981  34.572  7.002   1.00 30.61 ? 144  GLU F CB    1 
ATOM   7079  C  CG    . GLU F  1 144 ? 57.020  35.128  7.944   1.00 33.05 ? 144  GLU F CG    1 
ATOM   7080  C  CD    . GLU F  1 144 ? 58.284  34.286  7.997   1.00 34.60 ? 144  GLU F CD    1 
ATOM   7081  O  OE1   . GLU F  1 144 ? 58.244  33.159  8.550   1.00 35.95 ? 144  GLU F OE1   1 
ATOM   7082  O  OE2   . GLU F  1 144 ? 59.319  34.767  7.492   1.00 33.89 ? 144  GLU F OE2   1 
ATOM   7083  N  N     . SER F  1 145 ? 55.497  37.100  4.702   1.00 29.62 ? 145  SER F N     1 
ATOM   7084  C  CA    . SER F  1 145 ? 54.562  38.086  4.195   1.00 29.12 ? 145  SER F CA    1 
ATOM   7085  C  C     . SER F  1 145 ? 55.211  38.913  3.089   1.00 28.91 ? 145  SER F C     1 
ATOM   7086  O  O     . SER F  1 145 ? 56.321  39.442  3.246   1.00 28.81 ? 145  SER F O     1 
ATOM   7087  C  CB    . SER F  1 145 ? 54.057  38.981  5.330   1.00 29.32 ? 145  SER F CB    1 
ATOM   7088  O  OG    . SER F  1 145 ? 53.475  40.170  4.812   1.00 30.35 ? 145  SER F OG    1 
ATOM   7089  N  N     . VAL F  1 146 ? 54.519  39.015  1.960   1.00 28.43 ? 146  VAL F N     1 
ATOM   7090  C  CA    . VAL F  1 146 ? 54.985  39.845  0.849   1.00 28.11 ? 146  VAL F CA    1 
ATOM   7091  C  C     . VAL F  1 146 ? 53.821  40.635  0.300   1.00 28.03 ? 146  VAL F C     1 
ATOM   7092  O  O     . VAL F  1 146 ? 52.781  40.073  -0.030  1.00 28.09 ? 146  VAL F O     1 
ATOM   7093  C  CB    . VAL F  1 146 ? 55.621  39.021  -0.311  1.00 28.24 ? 146  VAL F CB    1 
ATOM   7094  C  CG1   . VAL F  1 146 ? 56.168  39.946  -1.384  1.00 27.45 ? 146  VAL F CG1   1 
ATOM   7095  C  CG2   . VAL F  1 146 ? 56.713  38.097  0.196   1.00 27.74 ? 146  VAL F CG2   1 
ATOM   7096  N  N     . VAL F  1 147 ? 54.000  41.947  0.207   1.00 28.01 ? 147  VAL F N     1 
ATOM   7097  C  CA    . VAL F  1 147 ? 52.990  42.811  -0.377  1.00 27.93 ? 147  VAL F CA    1 
ATOM   7098  C  C     . VAL F  1 147 ? 53.647  43.738  -1.409  1.00 27.83 ? 147  VAL F C     1 
ATOM   7099  O  O     . VAL F  1 147 ? 54.821  44.075  -1.282  1.00 27.51 ? 147  VAL F O     1 
ATOM   7100  C  CB    . VAL F  1 147 ? 52.181  43.545  0.732   1.00 28.27 ? 147  VAL F CB    1 
ATOM   7101  C  CG1   . VAL F  1 147 ? 52.834  44.864  1.153   1.00 28.25 ? 147  VAL F CG1   1 
ATOM   7102  C  CG2   . VAL F  1 147 ? 50.756  43.761  0.294   1.00 29.45 ? 147  VAL F CG2   1 
ATOM   7103  N  N     . LYS F  1 148 ? 52.908  44.089  -2.460  1.00 27.81 ? 148  LYS F N     1 
ATOM   7104  C  CA    . LYS F  1 148 ? 53.361  45.088  -3.411  1.00 27.79 ? 148  LYS F CA    1 
ATOM   7105  C  C     . LYS F  1 148 ? 52.425  46.299  -3.387  1.00 27.88 ? 148  LYS F C     1 
ATOM   7106  O  O     . LYS F  1 148 ? 51.239  46.185  -3.696  1.00 27.89 ? 148  LYS F O     1 
ATOM   7107  C  CB    . LYS F  1 148 ? 53.479  44.518  -4.823  1.00 27.85 ? 148  LYS F CB    1 
ATOM   7108  C  CG    . LYS F  1 148 ? 54.171  45.479  -5.777  1.00 27.93 ? 148  LYS F CG    1 
ATOM   7109  C  CD    . LYS F  1 148 ? 54.398  44.924  -7.174  1.00 29.70 ? 148  LYS F CD    1 
ATOM   7110  C  CE    . LYS F  1 148 ? 54.792  46.076  -8.123  1.00 30.90 ? 148  LYS F CE    1 
ATOM   7111  N  NZ    . LYS F  1 148 ? 55.557  45.651  -9.344  1.00 31.86 ? 148  LYS F NZ    1 
ATOM   7112  N  N     . LEU F  1 149 ? 52.966  47.448  -3.003  1.00 27.75 ? 149  LEU F N     1 
ATOM   7113  C  CA    . LEU F  1 149 ? 52.185  48.678  -2.941  1.00 28.07 ? 149  LEU F CA    1 
ATOM   7114  C  C     . LEU F  1 149 ? 52.064  49.311  -4.315  1.00 28.46 ? 149  LEU F C     1 
ATOM   7115  O  O     . LEU F  1 149 ? 52.776  48.949  -5.259  1.00 28.86 ? 149  LEU F O     1 
ATOM   7116  C  CB    . LEU F  1 149 ? 52.807  49.680  -1.964  1.00 27.64 ? 149  LEU F CB    1 
ATOM   7117  C  CG    . LEU F  1 149 ? 52.971  49.241  -0.512  1.00 27.77 ? 149  LEU F CG    1 
ATOM   7118  C  CD1   . LEU F  1 149 ? 53.409  50.446  0.322   1.00 26.73 ? 149  LEU F CD1   1 
ATOM   7119  C  CD2   . LEU F  1 149 ? 51.695  48.556  0.071   1.00 26.65 ? 149  LEU F CD2   1 
ATOM   7120  N  N     . THR F  1 150 ? 51.171  50.277  -4.408  1.00 28.73 ? 150  THR F N     1 
ATOM   7121  C  CA    . THR F  1 150 ? 50.868  50.921  -5.669  1.00 29.38 ? 150  THR F CA    1 
ATOM   7122  C  C     . THR F  1 150 ? 51.074  52.441  -5.551  1.00 29.01 ? 150  THR F C     1 
ATOM   7123  O  O     . THR F  1 150 ? 50.882  53.017  -4.478  1.00 28.60 ? 150  THR F O     1 
ATOM   7124  C  CB    . THR F  1 150 ? 49.420  50.528  -6.059  1.00 29.94 ? 150  THR F CB    1 
ATOM   7125  O  OG1   . THR F  1 150 ? 49.391  50.074  -7.420  1.00 32.53 ? 150  THR F OG1   1 
ATOM   7126  C  CG2   . THR F  1 150 ? 48.448  51.718  -5.999  1.00 29.74 ? 150  THR F CG2   1 
ATOM   7127  N  N     . ALA F  1 151 ? 51.498  53.075  -6.642  1.00 28.92 ? 151  ALA F N     1 
ATOM   7128  C  CA    . ALA F  1 151 ? 51.625  54.533  -6.682  1.00 28.89 ? 151  ALA F CA    1 
ATOM   7129  C  C     . ALA F  1 151 ? 50.612  55.117  -7.662  1.00 29.12 ? 151  ALA F C     1 
ATOM   7130  O  O     . ALA F  1 151 ? 49.856  54.368  -8.294  1.00 28.98 ? 151  ALA F O     1 
ATOM   7131  C  CB    . ALA F  1 151 ? 53.045  54.935  -7.057  1.00 28.83 ? 151  ALA F CB    1 
ATOM   7132  N  N     . VAL F  1 152 ? 50.577  56.444  -7.774  1.00 29.46 ? 152  VAL F N     1 
ATOM   7133  C  CA    . VAL F  1 152 ? 49.769  57.102  -8.807  1.00 30.01 ? 152  VAL F CA    1 
ATOM   7134  C  C     . VAL F  1 152 ? 50.638  57.447  -10.028 1.00 30.43 ? 152  VAL F C     1 
ATOM   7135  O  O     . VAL F  1 152 ? 51.725  58.007  -9.890  1.00 30.39 ? 152  VAL F O     1 
ATOM   7136  C  CB    . VAL F  1 152 ? 49.034  58.373  -8.274  1.00 29.98 ? 152  VAL F CB    1 
ATOM   7137  C  CG1   . VAL F  1 152 ? 48.185  59.008  -9.368  1.00 29.36 ? 152  VAL F CG1   1 
ATOM   7138  C  CG2   . VAL F  1 152 ? 48.157  58.026  -7.076  1.00 29.65 ? 152  VAL F CG2   1 
ATOM   7139  N  N     . CYS F  1 153 ? 50.162  57.099  -11.221 1.00 31.20 ? 153  CYS F N     1 
ATOM   7140  C  CA    . CYS F  1 153 ? 50.864  57.452  -12.457 1.00 32.02 ? 153  CYS F CA    1 
ATOM   7141  C  C     . CYS F  1 153 ? 50.948  58.960  -12.580 1.00 32.88 ? 153  CYS F C     1 
ATOM   7142  O  O     . CYS F  1 153 ? 49.924  59.645  -12.588 1.00 32.69 ? 153  CYS F O     1 
ATOM   7143  C  CB    . CYS F  1 153 ? 50.161  56.867  -13.685 1.00 32.01 ? 153  CYS F CB    1 
ATOM   7144  S  SG    . CYS F  1 153 ? 51.070  57.037  -15.247 1.00 31.87 ? 153  CYS F SG    1 
ATOM   7145  N  N     . MET F  1 154 ? 52.179  59.463  -12.662 1.00 34.02 ? 154  MET F N     1 
ATOM   7146  C  CA    . MET F  1 154 ? 52.443  60.898  -12.704 1.00 35.03 ? 154  MET F CA    1 
ATOM   7147  C  C     . MET F  1 154 ? 52.182  61.489  -14.092 1.00 35.98 ? 154  MET F C     1 
ATOM   7148  O  O     . MET F  1 154 ? 52.246  62.713  -14.282 1.00 36.42 ? 154  MET F O     1 
ATOM   7149  C  CB    . MET F  1 154 ? 53.873  61.181  -12.249 1.00 34.98 ? 154  MET F CB    1 
ATOM   7150  C  CG    . MET F  1 154 ? 54.040  61.124  -10.747 1.00 35.28 ? 154  MET F CG    1 
ATOM   7151  S  SD    . MET F  1 154 ? 55.754  61.161  -10.244 1.00 36.92 ? 154  MET F SD    1 
ATOM   7152  C  CE    . MET F  1 154 ? 55.585  61.066  -8.487  1.00 36.51 ? 154  MET F CE    1 
ATOM   7153  N  N     . GLU F  1 155 ? 51.857  60.623  -15.049 1.00 36.77 ? 155  GLU F N     1 
ATOM   7154  C  CA    . GLU F  1 155 ? 51.607  61.056  -16.418 1.00 37.52 ? 155  GLU F CA    1 
ATOM   7155  C  C     . GLU F  1 155 ? 50.144  60.935  -16.838 1.00 37.71 ? 155  GLU F C     1 
ATOM   7156  O  O     . GLU F  1 155 ? 49.660  61.757  -17.611 1.00 37.96 ? 155  GLU F O     1 
ATOM   7157  C  CB    . GLU F  1 155 ? 52.516  60.314  -17.402 1.00 37.71 ? 155  GLU F CB    1 
ATOM   7158  C  CG    . GLU F  1 155 ? 53.968  60.252  -16.960 1.00 38.80 ? 155  GLU F CG    1 
ATOM   7159  C  CD    . GLU F  1 155 ? 54.915  59.805  -18.055 1.00 41.01 ? 155  GLU F CD    1 
ATOM   7160  O  OE1   . GLU F  1 155 ? 56.146  59.955  -17.859 1.00 41.51 ? 155  GLU F OE1   1 
ATOM   7161  O  OE2   . GLU F  1 155 ? 54.439  59.307  -19.105 1.00 41.97 ? 155  GLU F OE2   1 
ATOM   7162  N  N     . CYS F  1 156 ? 49.441  59.917  -16.342 1.00 37.84 ? 156  CYS F N     1 
ATOM   7163  C  CA    . CYS F  1 156 ? 48.023  59.733  -16.683 1.00 37.91 ? 156  CYS F CA    1 
ATOM   7164  C  C     . CYS F  1 156 ? 47.106  59.630  -15.461 1.00 38.12 ? 156  CYS F C     1 
ATOM   7165  O  O     . CYS F  1 156 ? 45.883  59.626  -15.595 1.00 38.05 ? 156  CYS F O     1 
ATOM   7166  C  CB    . CYS F  1 156 ? 47.828  58.525  -17.613 1.00 37.80 ? 156  CYS F CB    1 
ATOM   7167  S  SG    . CYS F  1 156 ? 47.691  56.922  -16.780 1.00 36.99 ? 156  CYS F SG    1 
ATOM   7168  N  N     . PHE F  1 157 ? 47.706  59.529  -14.278 1.00 38.49 ? 157  PHE F N     1 
ATOM   7169  C  CA    . PHE F  1 157 ? 46.978  59.552  -12.997 1.00 38.94 ? 157  PHE F CA    1 
ATOM   7170  C  C     . PHE F  1 157 ? 46.136  58.316  -12.670 1.00 38.90 ? 157  PHE F C     1 
ATOM   7171  O  O     . PHE F  1 157 ? 45.319  58.337  -11.748 1.00 39.23 ? 157  PHE F O     1 
ATOM   7172  C  CB    . PHE F  1 157 ? 46.158  60.850  -12.847 1.00 38.87 ? 157  PHE F CB    1 
ATOM   7173  C  CG    . PHE F  1 157 ? 46.917  62.074  -13.246 1.00 39.68 ? 157  PHE F CG    1 
ATOM   7174  C  CD1   . PHE F  1 157 ? 46.575  62.772  -14.401 1.00 40.32 ? 157  PHE F CD1   1 
ATOM   7175  C  CD2   . PHE F  1 157 ? 48.003  62.508  -12.490 1.00 39.59 ? 157  PHE F CD2   1 
ATOM   7176  C  CE1   . PHE F  1 157 ? 47.297  63.899  -14.787 1.00 40.86 ? 157  PHE F CE1   1 
ATOM   7177  C  CE2   . PHE F  1 157 ? 48.727  63.632  -12.862 1.00 40.46 ? 157  PHE F CE2   1 
ATOM   7178  C  CZ    . PHE F  1 157 ? 48.373  64.332  -14.014 1.00 40.69 ? 157  PHE F CZ    1 
ATOM   7179  N  N     . ARG F  1 158 ? 46.356  57.234  -13.410 1.00 38.77 ? 158  ARG F N     1 
ATOM   7180  C  CA    . ARG F  1 158 ? 45.837  55.917  -13.020 1.00 38.85 ? 158  ARG F CA    1 
ATOM   7181  C  C     . ARG F  1 158 ? 46.813  55.244  -12.042 1.00 37.87 ? 158  ARG F C     1 
ATOM   7182  O  O     . ARG F  1 158 ? 47.814  55.846  -11.649 1.00 37.58 ? 158  ARG F O     1 
ATOM   7183  C  CB    . ARG F  1 158 ? 45.599  55.031  -14.254 1.00 39.31 ? 158  ARG F CB    1 
ATOM   7184  C  CG    . ARG F  1 158 ? 44.586  55.594  -15.248 1.00 42.25 ? 158  ARG F CG    1 
ATOM   7185  C  CD    . ARG F  1 158 ? 43.969  54.553  -16.176 1.00 47.97 ? 158  ARG F CD    1 
ATOM   7186  N  NE    . ARG F  1 158 ? 42.557  54.316  -15.842 1.00 52.23 ? 158  ARG F NE    1 
ATOM   7187  C  CZ    . ARG F  1 158 ? 42.003  53.110  -15.681 1.00 53.86 ? 158  ARG F CZ    1 
ATOM   7188  N  NH1   . ARG F  1 158 ? 42.729  52.004  -15.823 1.00 54.08 ? 158  ARG F NH1   1 
ATOM   7189  N  NH2   . ARG F  1 158 ? 40.714  53.009  -15.371 1.00 54.41 ? 158  ARG F NH2   1 
ATOM   7190  N  N     . GLU F  1 159 ? 46.519  54.006  -11.648 1.00 37.09 ? 159  GLU F N     1 
ATOM   7191  C  CA    . GLU F  1 159 ? 47.405  53.235  -10.763 1.00 36.45 ? 159  GLU F CA    1 
ATOM   7192  C  C     . GLU F  1 159 ? 48.762  52.969  -11.421 1.00 34.90 ? 159  GLU F C     1 
ATOM   7193  O  O     . GLU F  1 159 ? 48.825  52.557  -12.578 1.00 34.46 ? 159  GLU F O     1 
ATOM   7194  C  CB    . GLU F  1 159 ? 46.767  51.887  -10.404 1.00 36.97 ? 159  GLU F CB    1 
ATOM   7195  C  CG    . GLU F  1 159 ? 45.842  51.895  -9.198  1.00 40.77 ? 159  GLU F CG    1 
ATOM   7196  C  CD    . GLU F  1 159 ? 45.563  50.486  -8.683  1.00 45.43 ? 159  GLU F CD    1 
ATOM   7197  O  OE1   . GLU F  1 159 ? 45.179  49.614  -9.506  1.00 46.99 ? 159  GLU F OE1   1 
ATOM   7198  O  OE2   . GLU F  1 159 ? 45.743  50.240  -7.462  1.00 46.61 ? 159  GLU F OE2   1 
ATOM   7199  N  N     . ALA F  1 160 ? 49.837  53.189  -10.671 1.00 33.34 ? 160  ALA F N     1 
ATOM   7200  C  CA    . ALA F  1 160 ? 51.184  52.953  -11.178 1.00 32.17 ? 160  ALA F CA    1 
ATOM   7201  C  C     . ALA F  1 160 ? 51.875  51.803  -10.454 1.00 31.44 ? 160  ALA F C     1 
ATOM   7202  O  O     . ALA F  1 160 ? 51.882  51.742  -9.223  1.00 31.29 ? 160  ALA F O     1 
ATOM   7203  C  CB    . ALA F  1 160 ? 52.018  54.212  -11.087 1.00 32.07 ? 160  ALA F CB    1 
ATOM   7204  N  N     . ALA F  1 161 ? 52.469  50.906  -11.232 1.00 30.47 ? 161  ALA F N     1 
ATOM   7205  C  CA    . ALA F  1 161 ? 53.229  49.789  -10.691 1.00 29.85 ? 161  ALA F CA    1 
ATOM   7206  C  C     . ALA F  1 161 ? 54.740  49.888  -10.933 1.00 29.50 ? 161  ALA F C     1 
ATOM   7207  O  O     . ALA F  1 161 ? 55.502  49.125  -10.331 1.00 29.17 ? 161  ALA F O     1 
ATOM   7208  C  CB    . ALA F  1 161 ? 52.694  48.471  -11.258 1.00 29.96 ? 161  ALA F CB    1 
ATOM   7209  N  N     . TYR F  1 162 ? 55.168  50.809  -11.801 1.00 29.24 ? 162  TYR F N     1 
ATOM   7210  C  CA    . TYR F  1 162 ? 56.584  50.902  -12.196 1.00 29.38 ? 162  TYR F CA    1 
ATOM   7211  C  C     . TYR F  1 162 ? 57.226  52.279  -12.009 1.00 29.54 ? 162  TYR F C     1 
ATOM   7212  O  O     . TYR F  1 162 ? 56.544  53.285  -11.770 1.00 29.31 ? 162  TYR F O     1 
ATOM   7213  C  CB    . TYR F  1 162 ? 56.783  50.436  -13.650 1.00 29.57 ? 162  TYR F CB    1 
ATOM   7214  C  CG    . TYR F  1 162 ? 55.855  49.314  -14.050 1.00 29.67 ? 162  TYR F CG    1 
ATOM   7215  C  CD1   . TYR F  1 162 ? 54.726  49.572  -14.822 1.00 29.57 ? 162  TYR F CD1   1 
ATOM   7216  C  CD2   . TYR F  1 162 ? 56.092  48.000  -13.630 1.00 29.13 ? 162  TYR F CD2   1 
ATOM   7217  C  CE1   . TYR F  1 162 ? 53.857  48.558  -15.183 1.00 30.49 ? 162  TYR F CE1   1 
ATOM   7218  C  CE2   . TYR F  1 162 ? 55.226  46.968  -13.990 1.00 30.09 ? 162  TYR F CE2   1 
ATOM   7219  C  CZ    . TYR F  1 162 ? 54.112  47.261  -14.763 1.00 31.02 ? 162  TYR F CZ    1 
ATOM   7220  O  OH    . TYR F  1 162 ? 53.240  46.272  -15.121 1.00 31.93 ? 162  TYR F OH    1 
ATOM   7221  N  N     . THR F  1 163 ? 58.551  52.304  -12.114 1.00 29.85 ? 163  THR F N     1 
ATOM   7222  C  CA    . THR F  1 163 ? 59.314  53.540  -12.048 1.00 30.46 ? 163  THR F CA    1 
ATOM   7223  C  C     . THR F  1 163 ? 60.032  53.797  -13.369 1.00 31.48 ? 163  THR F C     1 
ATOM   7224  O  O     . THR F  1 163 ? 60.800  52.946  -13.852 1.00 31.39 ? 163  THR F O     1 
ATOM   7225  C  CB    . THR F  1 163 ? 60.349  53.486  -10.915 1.00 30.41 ? 163  THR F CB    1 
ATOM   7226  O  OG1   . THR F  1 163 ? 59.720  53.109  -9.686  1.00 29.09 ? 163  THR F OG1   1 
ATOM   7227  C  CG2   . THR F  1 163 ? 60.890  54.887  -10.631 1.00 30.39 ? 163  THR F CG2   1 
ATOM   7228  N  N     . LYS F  1 164 ? 59.785  54.975  -13.937 1.00 32.41 ? 164  LYS F N     1 
ATOM   7229  C  CA    . LYS F  1 164 ? 60.440  55.405  -15.163 1.00 33.68 ? 164  LYS F CA    1 
ATOM   7230  C  C     . LYS F  1 164 ? 61.552  56.413  -14.836 1.00 34.24 ? 164  LYS F C     1 
ATOM   7231  O  O     . LYS F  1 164 ? 61.333  57.359  -14.069 1.00 34.10 ? 164  LYS F O     1 
ATOM   7232  C  CB    . LYS F  1 164 ? 59.391  56.002  -16.105 1.00 33.88 ? 164  LYS F CB    1 
ATOM   7233  C  CG    . LYS F  1 164 ? 59.916  56.673  -17.365 1.00 35.82 ? 164  LYS F CG    1 
ATOM   7234  C  CD    . LYS F  1 164 ? 58.832  56.716  -18.441 1.00 38.27 ? 164  LYS F CD    1 
ATOM   7235  C  CE    . LYS F  1 164 ? 58.625  58.125  -18.982 1.00 40.27 ? 164  LYS F CE    1 
ATOM   7236  N  NZ    . LYS F  1 164 ? 57.419  58.219  -19.882 1.00 41.77 ? 164  LYS F NZ    1 
ATOM   7237  N  N     . ARG F  1 165 ? 62.745  56.202  -15.394 1.00 35.17 ? 165  ARG F N     1 
ATOM   7238  C  CA    . ARG F  1 165 ? 63.813  57.195  -15.262 1.00 36.46 ? 165  ARG F CA    1 
ATOM   7239  C  C     . ARG F  1 165 ? 63.634  58.277  -16.321 1.00 37.47 ? 165  ARG F C     1 
ATOM   7240  O  O     . ARG F  1 165 ? 63.419  57.972  -17.501 1.00 37.47 ? 165  ARG F O     1 
ATOM   7241  C  CB    . ARG F  1 165 ? 65.201  56.561  -15.378 1.00 36.42 ? 165  ARG F CB    1 
ATOM   7242  C  CG    . ARG F  1 165 ? 66.357  57.569  -15.269 1.00 35.85 ? 165  ARG F CG    1 
ATOM   7243  C  CD    . ARG F  1 165 ? 67.737  56.942  -15.177 1.00 34.19 ? 165  ARG F CD    1 
ATOM   7244  N  NE    . ARG F  1 165 ? 67.939  56.303  -13.882 1.00 33.76 ? 165  ARG F NE    1 
ATOM   7245  C  CZ    . ARG F  1 165 ? 68.831  55.352  -13.635 1.00 33.70 ? 165  ARG F CZ    1 
ATOM   7246  N  NH1   . ARG F  1 165 ? 69.632  54.916  -14.595 1.00 33.10 ? 165  ARG F NH1   1 
ATOM   7247  N  NH2   . ARG F  1 165 ? 68.922  54.829  -12.416 1.00 33.71 ? 165  ARG F NH2   1 
ATOM   7248  N  N     . LEU F  1 166 ? 63.708  59.537  -15.907 1.00 38.85 ? 166  LEU F N     1 
ATOM   7249  C  CA    . LEU F  1 166 ? 63.498  60.638  -16.853 1.00 40.44 ? 166  LEU F CA    1 
ATOM   7250  C  C     . LEU F  1 166 ? 64.737  60.947  -17.708 1.00 41.60 ? 166  LEU F C     1 
ATOM   7251  O  O     . LEU F  1 166 ? 64.605  61.203  -18.902 1.00 41.72 ? 166  LEU F O     1 
ATOM   7252  C  CB    . LEU F  1 166 ? 62.942  61.895  -16.173 1.00 40.26 ? 166  LEU F CB    1 
ATOM   7253  C  CG    . LEU F  1 166 ? 61.586  61.770  -15.448 1.00 40.33 ? 166  LEU F CG    1 
ATOM   7254  C  CD1   . LEU F  1 166 ? 61.320  63.027  -14.627 1.00 39.85 ? 166  LEU F CD1   1 
ATOM   7255  C  CD2   . LEU F  1 166 ? 60.416  61.478  -16.397 1.00 39.06 ? 166  LEU F CD2   1 
ATOM   7256  N  N     . GLY F  1 167 ? 65.927  60.901  -17.105 1.00 42.89 ? 167  GLY F N     1 
ATOM   7257  C  CA    . GLY F  1 167 ? 67.167  61.188  -17.814 1.00 44.48 ? 167  GLY F CA    1 
ATOM   7258  C  C     . GLY F  1 167 ? 67.669  60.053  -18.695 1.00 45.59 ? 167  GLY F C     1 
ATOM   7259  O  O     . GLY F  1 167 ? 66.918  59.129  -19.033 1.00 45.75 ? 167  GLY F O     1 
ATOM   7260  N  N     . THR F  1 168 ? 68.947  60.120  -19.061 1.00 46.48 ? 168  THR F N     1 
ATOM   7261  C  CA    . THR F  1 168 ? 69.537  59.152  -19.994 1.00 47.34 ? 168  THR F CA    1 
ATOM   7262  C  C     . THR F  1 168 ? 70.609  58.263  -19.363 1.00 47.66 ? 168  THR F C     1 
ATOM   7263  O  O     . THR F  1 168 ? 71.134  57.368  -20.033 1.00 47.90 ? 168  THR F O     1 
ATOM   7264  C  CB    . THR F  1 168 ? 70.116  59.866  -21.254 1.00 47.47 ? 168  THR F CB    1 
ATOM   7265  O  OG1   . THR F  1 168 ? 70.872  61.020  -20.857 1.00 47.81 ? 168  THR F OG1   1 
ATOM   7266  C  CG2   . THR F  1 168 ? 68.996  60.443  -22.124 1.00 47.60 ? 168  THR F CG2   1 
ATOM   7267  N  N     . GLU F  1 169 ? 70.933  58.501  -18.090 1.00 48.09 ? 169  GLU F N     1 
ATOM   7268  C  CA    . GLU F  1 169 ? 71.940  57.689  -17.397 1.00 48.60 ? 169  GLU F CA    1 
ATOM   7269  C  C     . GLU F  1 169 ? 71.568  56.209  -17.397 1.00 48.57 ? 169  GLU F C     1 
ATOM   7270  O  O     . GLU F  1 169 ? 70.385  55.857  -17.314 1.00 48.55 ? 169  GLU F O     1 
ATOM   7271  C  CB    . GLU F  1 169 ? 72.199  58.182  -15.976 1.00 48.86 ? 169  GLU F CB    1 
ATOM   7272  C  CG    . GLU F  1 169 ? 70.947  58.535  -15.196 1.00 50.54 ? 169  GLU F CG    1 
ATOM   7273  C  CD    . GLU F  1 169 ? 70.677  60.026  -15.176 1.00 52.29 ? 169  GLU F CD    1 
ATOM   7274  O  OE1   . GLU F  1 169 ? 71.535  60.776  -14.658 1.00 52.61 ? 169  GLU F OE1   1 
ATOM   7275  O  OE2   . GLU F  1 169 ? 69.609  60.440  -15.678 1.00 52.70 ? 169  GLU F OE2   1 
ATOM   7276  N  N     . LYS F  1 170 ? 72.588  55.356  -17.498 1.00 48.52 ? 170  LYS F N     1 
ATOM   7277  C  CA    . LYS F  1 170 ? 72.398  53.930  -17.773 1.00 48.48 ? 170  LYS F CA    1 
ATOM   7278  C  C     . LYS F  1 170 ? 72.696  53.015  -16.586 1.00 47.86 ? 170  LYS F C     1 
ATOM   7279  O  O     . LYS F  1 170 ? 72.245  51.863  -16.548 1.00 47.83 ? 170  LYS F O     1 
ATOM   7280  C  CB    . LYS F  1 170 ? 73.258  53.502  -18.971 1.00 48.92 ? 170  LYS F CB    1 
ATOM   7281  C  CG    . LYS F  1 170 ? 72.616  53.753  -20.326 1.00 50.33 ? 170  LYS F CG    1 
ATOM   7282  C  CD    . LYS F  1 170 ? 73.657  53.700  -21.446 1.00 53.34 ? 170  LYS F CD    1 
ATOM   7283  C  CE    . LYS F  1 170 ? 74.271  55.081  -21.728 1.00 54.32 ? 170  LYS F CE    1 
ATOM   7284  N  NZ    . LYS F  1 170 ? 73.312  55.997  -22.416 1.00 54.93 ? 170  LYS F NZ    1 
ATOM   7285  N  N     . GLU F  1 171 ? 73.475  53.519  -15.635 1.00 47.10 ? 171  GLU F N     1 
ATOM   7286  C  CA    . GLU F  1 171 ? 73.788  52.775  -14.418 1.00 46.53 ? 171  GLU F CA    1 
ATOM   7287  C  C     . GLU F  1 171 ? 72.531  52.581  -13.551 1.00 45.58 ? 171  GLU F C     1 
ATOM   7288  O  O     . GLU F  1 171 ? 71.624  53.417  -13.564 1.00 45.33 ? 171  GLU F O     1 
ATOM   7289  C  CB    . GLU F  1 171 ? 74.908  53.475  -13.639 1.00 46.65 ? 171  GLU F CB    1 
ATOM   7290  C  CG    . GLU F  1 171 ? 74.534  54.835  -13.066 1.00 48.54 ? 171  GLU F CG    1 
ATOM   7291  C  CD    . GLU F  1 171 ? 74.952  56.020  -13.933 1.00 51.16 ? 171  GLU F CD    1 
ATOM   7292  O  OE1   . GLU F  1 171 ? 75.015  55.883  -15.182 1.00 52.59 ? 171  GLU F OE1   1 
ATOM   7293  O  OE2   . GLU F  1 171 ? 75.202  57.109  -13.356 1.00 50.98 ? 171  GLU F OE2   1 
ATOM   7294  N  N     . VAL F  1 172 ? 72.482  51.473  -12.818 1.00 44.45 ? 172  VAL F N     1 
ATOM   7295  C  CA    . VAL F  1 172 ? 71.326  51.146  -11.987 1.00 43.47 ? 172  VAL F CA    1 
ATOM   7296  C  C     . VAL F  1 172 ? 71.166  52.144  -10.834 1.00 42.90 ? 172  VAL F C     1 
ATOM   7297  O  O     . VAL F  1 172 ? 70.121  52.782  -10.709 1.00 42.62 ? 172  VAL F O     1 
ATOM   7298  C  CB    . VAL F  1 172 ? 71.396  49.697  -11.441 1.00 43.53 ? 172  VAL F CB    1 
ATOM   7299  C  CG1   . VAL F  1 172 ? 70.237  49.425  -10.488 1.00 43.48 ? 172  VAL F CG1   1 
ATOM   7300  C  CG2   . VAL F  1 172 ? 71.390  48.689  -12.588 1.00 43.45 ? 172  VAL F CG2   1 
ATOM   7301  N  N     . GLU F  1 173 ? 72.204  52.286  -10.010 1.00 42.16 ? 173  GLU F N     1 
ATOM   7302  C  CA    . GLU F  1 173 ? 72.139  53.176  -8.856  1.00 41.68 ? 173  GLU F CA    1 
ATOM   7303  C  C     . GLU F  1 173 ? 72.320  54.657  -9.220  1.00 41.36 ? 173  GLU F C     1 
ATOM   7304  O  O     . GLU F  1 173 ? 73.442  55.127  -9.451  1.00 41.40 ? 173  GLU F O     1 
ATOM   7305  C  CB    . GLU F  1 173 ? 73.122  52.750  -7.757  1.00 41.67 ? 173  GLU F CB    1 
ATOM   7306  C  CG    . GLU F  1 173 ? 73.094  53.667  -6.539  1.00 42.46 ? 173  GLU F CG    1 
ATOM   7307  C  CD    . GLU F  1 173 ? 73.848  53.134  -5.332  1.00 44.31 ? 173  GLU F CD    1 
ATOM   7308  O  OE1   . GLU F  1 173 ? 74.056  53.926  -4.386  1.00 45.02 ? 173  GLU F OE1   1 
ATOM   7309  O  OE2   . GLU F  1 173 ? 74.218  51.935  -5.300  1.00 45.08 ? 173  GLU F OE2   1 
ATOM   7310  N  N     . VAL F  1 174 ? 71.199  55.375  -9.290  1.00 40.67 ? 174  VAL F N     1 
ATOM   7311  C  CA    . VAL F  1 174 ? 71.186  56.831  -9.395  1.00 40.03 ? 174  VAL F CA    1 
ATOM   7312  C  C     . VAL F  1 174 ? 70.154  57.370  -8.401  1.00 39.80 ? 174  VAL F C     1 
ATOM   7313  O  O     . VAL F  1 174 ? 68.943  57.233  -8.595  1.00 39.80 ? 174  VAL F O     1 
ATOM   7314  C  CB    . VAL F  1 174 ? 70.835  57.341  -10.816 1.00 40.14 ? 174  VAL F CB    1 
ATOM   7315  C  CG1   . VAL F  1 174 ? 70.892  58.855  -10.869 1.00 39.49 ? 174  VAL F CG1   1 
ATOM   7316  C  CG2   . VAL F  1 174 ? 71.759  56.753  -11.869 1.00 40.33 ? 174  VAL F CG2   1 
ATOM   7317  N  N     . ILE F  1 175 ? 70.656  57.972  -7.332  1.00 39.49 ? 175  ILE F N     1 
ATOM   7318  C  CA    . ILE F  1 175 ? 69.841  58.527  -6.263  1.00 39.27 ? 175  ILE F CA    1 
ATOM   7319  C  C     . ILE F  1 175 ? 69.095  59.773  -6.744  1.00 39.15 ? 175  ILE F C     1 
ATOM   7320  O  O     . ILE F  1 175 ? 69.659  60.605  -7.451  1.00 39.24 ? 175  ILE F O     1 
ATOM   7321  C  CB    . ILE F  1 175 ? 70.754  58.855  -5.058  1.00 39.26 ? 175  ILE F CB    1 
ATOM   7322  C  CG1   . ILE F  1 175 ? 71.588  57.621  -4.657  1.00 39.71 ? 175  ILE F CG1   1 
ATOM   7323  C  CG2   . ILE F  1 175 ? 69.963  59.449  -3.875  1.00 39.45 ? 175  ILE F CG2   1 
ATOM   7324  C  CD1   . ILE F  1 175 ? 70.785  56.389  -4.190  1.00 39.73 ? 175  ILE F CD1   1 
ATOM   7325  N  N     . GLY F  1 176 ? 67.825  59.888  -6.359  1.00 38.85 ? 176  GLY F N     1 
ATOM   7326  C  CA    . GLY F  1 176 ? 66.986  60.999  -6.776  1.00 38.39 ? 176  GLY F CA    1 
ATOM   7327  C  C     . GLY F  1 176 ? 65.519  60.788  -6.436  1.00 38.29 ? 176  GLY F C     1 
ATOM   7328  O  O     . GLY F  1 176 ? 65.112  59.696  -6.024  1.00 38.39 ? 176  GLY F O     1 
ATOM   7329  N  N     . GLY F  1 177 ? 64.721  61.841  -6.603  1.00 38.09 ? 177  GLY F N     1 
ATOM   7330  C  CA    . GLY F  1 177 ? 63.295  61.799  -6.327  1.00 37.55 ? 177  GLY F CA    1 
ATOM   7331  C  C     . GLY F  1 177 ? 62.500  62.067  -7.586  1.00 37.69 ? 177  GLY F C     1 
ATOM   7332  O  O     . GLY F  1 177 ? 62.877  61.608  -8.673  1.00 37.45 ? 177  GLY F O     1 
ATOM   7333  N  N     . ALA F  1 178 ? 61.412  62.826  -7.446  1.00 37.93 ? 178  ALA F N     1 
ATOM   7334  C  CA    . ALA F  1 178 ? 60.512  63.133  -8.560  1.00 38.39 ? 178  ALA F CA    1 
ATOM   7335  C  C     . ALA F  1 178 ? 61.161  63.988  -9.656  1.00 38.74 ? 178  ALA F C     1 
ATOM   7336  O  O     . ALA F  1 178 ? 60.618  64.129  -10.757 1.00 38.93 ? 178  ALA F O     1 
ATOM   7337  C  CB    . ALA F  1 178 ? 59.228  63.793  -8.045  1.00 38.46 ? 178  ALA F CB    1 
ATOM   7338  N  N     . ASP F  1 179 ? 62.318  64.566  -9.352  1.00 39.19 ? 179  ASP F N     1 
ATOM   7339  C  CA    . ASP F  1 179 ? 63.109  65.267  -10.366 1.00 39.62 ? 179  ASP F CA    1 
ATOM   7340  C  C     . ASP F  1 179 ? 63.761  64.297  -11.365 1.00 39.11 ? 179  ASP F C     1 
ATOM   7341  O  O     . ASP F  1 179 ? 63.981  64.664  -12.519 1.00 39.44 ? 179  ASP F O     1 
ATOM   7342  C  CB    . ASP F  1 179 ? 64.153  66.209  -9.738  1.00 39.99 ? 179  ASP F CB    1 
ATOM   7343  C  CG    . ASP F  1 179 ? 64.910  65.575  -8.566  1.00 42.72 ? 179  ASP F CG    1 
ATOM   7344  O  OD1   . ASP F  1 179 ? 64.342  64.697  -7.858  1.00 44.42 ? 179  ASP F OD1   1 
ATOM   7345  O  OD2   . ASP F  1 179 ? 66.086  65.908  -8.268  1.00 45.03 ? 179  ASP F OD2   1 
ATOM   7346  N  N     . LYS F  1 180 ? 64.037  63.064  -10.935 1.00 38.06 ? 180  LYS F N     1 
ATOM   7347  C  CA    . LYS F  1 180 ? 64.732  62.087  -11.787 1.00 36.98 ? 180  LYS F CA    1 
ATOM   7348  C  C     . LYS F  1 180 ? 63.869  60.887  -12.201 1.00 35.74 ? 180  LYS F C     1 
ATOM   7349  O  O     . LYS F  1 180 ? 64.236  60.142  -13.116 1.00 35.48 ? 180  LYS F O     1 
ATOM   7350  C  CB    . LYS F  1 180 ? 66.019  61.592  -11.115 1.00 37.32 ? 180  LYS F CB    1 
ATOM   7351  C  CG    . LYS F  1 180 ? 66.940  62.707  -10.596 1.00 38.99 ? 180  LYS F CG    1 
ATOM   7352  C  CD    . LYS F  1 180 ? 68.309  62.672  -11.265 1.00 41.82 ? 180  LYS F CD    1 
ATOM   7353  C  CE    . LYS F  1 180 ? 69.429  62.717  -10.224 1.00 43.91 ? 180  LYS F CE    1 
ATOM   7354  N  NZ    . LYS F  1 180 ? 70.612  63.498  -10.703 1.00 45.07 ? 180  LYS F NZ    1 
ATOM   7355  N  N     . TYR F  1 181 ? 62.731  60.703  -11.525 1.00 34.20 ? 181  TYR F N     1 
ATOM   7356  C  CA    . TYR F  1 181 ? 61.889  59.532  -11.734 1.00 32.51 ? 181  TYR F CA    1 
ATOM   7357  C  C     . TYR F  1 181 ? 60.408  59.871  -11.694 1.00 32.12 ? 181  TYR F C     1 
ATOM   7358  O  O     . TYR F  1 181 ? 59.989  60.756  -10.948 1.00 31.87 ? 181  TYR F O     1 
ATOM   7359  C  CB    . TYR F  1 181 ? 62.163  58.492  -10.652 1.00 32.32 ? 181  TYR F CB    1 
ATOM   7360  C  CG    . TYR F  1 181 ? 63.557  57.913  -10.609 1.00 30.33 ? 181  TYR F CG    1 
ATOM   7361  C  CD1   . TYR F  1 181 ? 64.492  58.380  -9.701  1.00 29.19 ? 181  TYR F CD1   1 
ATOM   7362  C  CD2   . TYR F  1 181 ? 63.921  56.865  -11.436 1.00 29.13 ? 181  TYR F CD2   1 
ATOM   7363  C  CE1   . TYR F  1 181 ? 65.756  57.835  -9.632  1.00 28.24 ? 181  TYR F CE1   1 
ATOM   7364  C  CE2   . TYR F  1 181 ? 65.192  56.310  -11.374 1.00 28.40 ? 181  TYR F CE2   1 
ATOM   7365  C  CZ    . TYR F  1 181 ? 66.104  56.802  -10.472 1.00 28.69 ? 181  TYR F CZ    1 
ATOM   7366  O  OH    . TYR F  1 181 ? 67.376  56.253  -10.408 1.00 29.74 ? 181  TYR F OH    1 
ATOM   7367  N  N     . HIS F  1 182 ? 59.619  59.144  -12.485 1.00 31.53 ? 182  HIS F N     1 
ATOM   7368  C  CA    . HIS F  1 182 ? 58.163  59.177  -12.398 1.00 31.18 ? 182  HIS F CA    1 
ATOM   7369  C  C     . HIS F  1 182 ? 57.635  57.777  -12.062 1.00 30.87 ? 182  HIS F C     1 
ATOM   7370  O  O     . HIS F  1 182 ? 58.074  56.788  -12.651 1.00 30.71 ? 182  HIS F O     1 
ATOM   7371  C  CB    . HIS F  1 182 ? 57.552  59.598  -13.734 1.00 31.35 ? 182  HIS F CB    1 
ATOM   7372  C  CG    . HIS F  1 182 ? 57.495  61.078  -13.959 1.00 32.22 ? 182  HIS F CG    1 
ATOM   7373  N  ND1   . HIS F  1 182 ? 57.947  62.001  -13.040 1.00 33.30 ? 182  HIS F ND1   1 
ATOM   7374  C  CD2   . HIS F  1 182 ? 57.042  61.794  -15.016 1.00 32.68 ? 182  HIS F CD2   1 
ATOM   7375  C  CE1   . HIS F  1 182 ? 57.767  63.220  -13.515 1.00 33.18 ? 182  HIS F CE1   1 
ATOM   7376  N  NE2   . HIS F  1 182 ? 57.226  63.122  -14.715 1.00 32.93 ? 182  HIS F NE2   1 
ATOM   7377  N  N     . SER F  1 183 ? 56.693  57.692  -11.124 1.00 30.26 ? 183  SER F N     1 
ATOM   7378  C  CA    . SER F  1 183 ? 55.875  56.482  -10.996 1.00 29.84 ? 183  SER F CA    1 
ATOM   7379  C  C     . SER F  1 183 ? 54.932  56.451  -12.189 1.00 29.38 ? 183  SER F C     1 
ATOM   7380  O  O     . SER F  1 183 ? 54.309  57.460  -12.508 1.00 29.21 ? 183  SER F O     1 
ATOM   7381  C  CB    . SER F  1 183 ? 55.069  56.484  -9.699  1.00 29.79 ? 183  SER F CB    1 
ATOM   7382  O  OG    . SER F  1 183 ? 54.302  57.676  -9.581  1.00 30.34 ? 183  SER F OG    1 
ATOM   7383  N  N     . VAL F  1 184 ? 54.842  55.302  -12.855 1.00 29.33 ? 184  VAL F N     1 
ATOM   7384  C  CA    . VAL F  1 184 ? 54.084  55.178  -14.107 1.00 29.11 ? 184  VAL F CA    1 
ATOM   7385  C  C     . VAL F  1 184 ? 53.314  53.864  -14.231 1.00 29.50 ? 184  VAL F C     1 
ATOM   7386  O  O     . VAL F  1 184 ? 53.709  52.839  -13.649 1.00 29.27 ? 184  VAL F O     1 
ATOM   7387  C  CB    . VAL F  1 184 ? 54.982  55.313  -15.391 1.00 29.22 ? 184  VAL F CB    1 
ATOM   7388  C  CG1   . VAL F  1 184 ? 55.540  56.743  -15.555 1.00 28.72 ? 184  VAL F CG1   1 
ATOM   7389  C  CG2   . VAL F  1 184 ? 56.100  54.260  -15.426 1.00 27.98 ? 184  VAL F CG2   1 
ATOM   7390  N  N     . CYS F  1 185 ? 52.221  53.902  -14.993 1.00 29.59 ? 185  CYS F N     1 
ATOM   7391  C  CA    . CYS F  1 185 ? 51.526  52.684  -15.400 1.00 30.12 ? 185  CYS F CA    1 
ATOM   7392  C  C     . CYS F  1 185 ? 52.249  51.980  -16.567 1.00 30.32 ? 185  CYS F C     1 
ATOM   7393  O  O     . CYS F  1 185 ? 53.253  52.477  -17.080 1.00 30.41 ? 185  CYS F O     1 
ATOM   7394  C  CB    . CYS F  1 185 ? 50.067  52.989  -15.778 1.00 30.22 ? 185  CYS F CB    1 
ATOM   7395  S  SG    . CYS F  1 185 ? 49.867  53.911  -17.328 1.00 31.67 ? 185  CYS F SG    1 
ATOM   7396  N  N     . ARG F  1 186 ? 51.733  50.827  -16.980 1.00 30.68 ? 186  ARG F N     1 
ATOM   7397  C  CA    . ARG F  1 186 ? 52.279  50.082  -18.114 1.00 31.38 ? 186  ARG F CA    1 
ATOM   7398  C  C     . ARG F  1 186 ? 52.337  50.911  -19.402 1.00 32.13 ? 186  ARG F C     1 
ATOM   7399  O  O     . ARG F  1 186 ? 53.368  50.946  -20.085 1.00 32.27 ? 186  ARG F O     1 
ATOM   7400  C  CB    . ARG F  1 186 ? 51.462  48.811  -18.363 1.00 30.94 ? 186  ARG F CB    1 
ATOM   7401  C  CG    . ARG F  1 186 ? 52.091  47.834  -19.342 1.00 30.67 ? 186  ARG F CG    1 
ATOM   7402  C  CD    . ARG F  1 186 ? 51.313  46.517  -19.496 1.00 30.26 ? 186  ARG F CD    1 
ATOM   7403  N  NE    . ARG F  1 186 ? 51.581  45.615  -18.377 1.00 29.84 ? 186  ARG F NE    1 
ATOM   7404  C  CZ    . ARG F  1 186 ? 52.625  44.795  -18.311 1.00 29.32 ? 186  ARG F CZ    1 
ATOM   7405  N  NH1   . ARG F  1 186 ? 53.507  44.740  -19.311 1.00 29.53 ? 186  ARG F NH1   1 
ATOM   7406  N  NH2   . ARG F  1 186 ? 52.787  44.024  -17.247 1.00 28.35 ? 186  ARG F NH2   1 
ATOM   7407  N  N     . LEU F  1 187 ? 51.224  51.561  -19.726 1.00 32.98 ? 187  LEU F N     1 
ATOM   7408  C  CA    . LEU F  1 187 ? 51.097  52.315  -20.962 1.00 34.03 ? 187  LEU F CA    1 
ATOM   7409  C  C     . LEU F  1 187 ? 52.057  53.504  -21.010 1.00 34.38 ? 187  LEU F C     1 
ATOM   7410  O  O     . LEU F  1 187 ? 52.754  53.699  -22.001 1.00 34.69 ? 187  LEU F O     1 
ATOM   7411  C  CB    . LEU F  1 187 ? 49.649  52.771  -21.140 1.00 34.12 ? 187  LEU F CB    1 
ATOM   7412  C  CG    . LEU F  1 187 ? 48.638  51.649  -21.422 1.00 35.70 ? 187  LEU F CG    1 
ATOM   7413  C  CD1   . LEU F  1 187 ? 47.287  52.229  -21.845 1.00 36.44 ? 187  LEU F CD1   1 
ATOM   7414  C  CD2   . LEU F  1 187 ? 49.149  50.629  -22.469 1.00 36.02 ? 187  LEU F CD2   1 
ATOM   7415  N  N     . CYS F  1 188 ? 52.102  54.281  -19.927 1.00 34.69 ? 188  CYS F N     1 
ATOM   7416  C  CA    . CYS F  1 188 ? 52.976  55.450  -19.847 1.00 34.94 ? 188  CYS F CA    1 
ATOM   7417  C  C     . CYS F  1 188 ? 54.456  55.070  -19.772 1.00 35.11 ? 188  CYS F C     1 
ATOM   7418  O  O     . CYS F  1 188 ? 55.316  55.834  -20.219 1.00 35.17 ? 188  CYS F O     1 
ATOM   7419  C  CB    . CYS F  1 188 ? 52.575  56.349  -18.681 1.00 34.68 ? 188  CYS F CB    1 
ATOM   7420  S  SG    . CYS F  1 188 ? 50.936  57.083  -18.898 1.00 36.67 ? 188  CYS F SG    1 
ATOM   7421  N  N     . TYR F  1 189 ? 54.752  53.890  -19.224 1.00 35.32 ? 189  TYR F N     1 
ATOM   7422  C  CA    . TYR F  1 189 ? 56.125  53.383  -19.195 1.00 35.49 ? 189  TYR F CA    1 
ATOM   7423  C  C     . TYR F  1 189 ? 56.718  53.232  -20.599 1.00 36.63 ? 189  TYR F C     1 
ATOM   7424  O  O     . TYR F  1 189 ? 57.908  53.510  -20.811 1.00 36.35 ? 189  TYR F O     1 
ATOM   7425  C  CB    . TYR F  1 189 ? 56.217  52.043  -18.448 1.00 35.05 ? 189  TYR F CB    1 
ATOM   7426  C  CG    . TYR F  1 189 ? 57.640  51.525  -18.360 1.00 32.78 ? 189  TYR F CG    1 
ATOM   7427  C  CD1   . TYR F  1 189 ? 58.466  51.893  -17.307 1.00 30.14 ? 189  TYR F CD1   1 
ATOM   7428  C  CD2   . TYR F  1 189 ? 58.168  50.697  -19.362 1.00 31.46 ? 189  TYR F CD2   1 
ATOM   7429  C  CE1   . TYR F  1 189 ? 59.781  51.441  -17.235 1.00 30.66 ? 189  TYR F CE1   1 
ATOM   7430  C  CE2   . TYR F  1 189 ? 59.487  50.239  -19.300 1.00 30.77 ? 189  TYR F CE2   1 
ATOM   7431  C  CZ    . TYR F  1 189 ? 60.281  50.618  -18.235 1.00 30.69 ? 189  TYR F CZ    1 
ATOM   7432  O  OH    . TYR F  1 189 ? 61.574  50.176  -18.169 1.00 32.02 ? 189  TYR F OH    1 
ATOM   7433  N  N     . PHE F  1 190 ? 55.892  52.790  -21.545 1.00 38.11 ? 190  PHE F N     1 
ATOM   7434  C  CA    . PHE F  1 190 ? 56.352  52.517  -22.906 1.00 39.88 ? 190  PHE F CA    1 
ATOM   7435  C  C     . PHE F  1 190 ? 56.136  53.668  -23.898 1.00 41.41 ? 190  PHE F C     1 
ATOM   7436  O  O     . PHE F  1 190 ? 56.543  53.569  -25.062 1.00 41.79 ? 190  PHE F O     1 
ATOM   7437  C  CB    . PHE F  1 190 ? 55.699  51.238  -23.431 1.00 39.58 ? 190  PHE F CB    1 
ATOM   7438  C  CG    . PHE F  1 190 ? 56.251  49.993  -22.815 1.00 39.26 ? 190  PHE F CG    1 
ATOM   7439  C  CD1   . PHE F  1 190 ? 55.474  49.233  -21.943 1.00 37.83 ? 190  PHE F CD1   1 
ATOM   7440  C  CD2   . PHE F  1 190 ? 57.563  49.591  -23.085 1.00 38.74 ? 190  PHE F CD2   1 
ATOM   7441  C  CE1   . PHE F  1 190 ? 55.980  48.089  -21.359 1.00 37.84 ? 190  PHE F CE1   1 
ATOM   7442  C  CE2   . PHE F  1 190 ? 58.090  48.436  -22.504 1.00 38.78 ? 190  PHE F CE2   1 
ATOM   7443  C  CZ    . PHE F  1 190 ? 57.295  47.679  -21.639 1.00 38.84 ? 190  PHE F CZ    1 
ATOM   7444  N  N     . LYS F  1 191 ? 55.510  54.753  -23.436 1.00 43.07 ? 191  LYS F N     1 
ATOM   7445  C  CA    . LYS F  1 191 ? 55.154  55.890  -24.298 1.00 44.56 ? 191  LYS F CA    1 
ATOM   7446  C  C     . LYS F  1 191 ? 56.374  56.613  -24.852 1.00 45.27 ? 191  LYS F C     1 
ATOM   7447  O  O     . LYS F  1 191 ? 57.324  56.887  -24.112 1.00 45.79 ? 191  LYS F O     1 
ATOM   7448  C  CB    . LYS F  1 191 ? 54.305  56.898  -23.522 1.00 44.69 ? 191  LYS F CB    1 
ATOM   7449  C  CG    . LYS F  1 191 ? 52.909  57.120  -24.071 1.00 46.19 ? 191  LYS F CG    1 
ATOM   7450  C  CD    . LYS F  1 191 ? 52.047  57.913  -23.084 1.00 48.86 ? 191  LYS F CD    1 
ATOM   7451  C  CE    . LYS F  1 191 ? 51.138  58.923  -23.797 1.00 50.99 ? 191  LYS F CE    1 
ATOM   7452  N  NZ    . LYS F  1 191 ? 49.686  58.551  -23.753 1.00 51.34 ? 191  LYS F NZ    1 
ATOM   7453  N  N     . LYS F  1 192 ? 56.315  56.938  -26.148 1.00 47.02 ? 192  LYS F N     1 
ATOM   7454  C  CA    . LYS F  1 192 ? 57.286  57.811  -26.846 1.00 48.02 ? 192  LYS F CA    1 
ATOM   7455  C  C     . LYS F  1 192 ? 58.756  57.588  -26.458 1.00 48.47 ? 192  LYS F C     1 
ATOM   7456  O  O     . LYS F  1 192 ? 59.279  58.226  -25.533 1.00 49.15 ? 192  LYS F O     1 
ATOM   7457  C  CB    . LYS F  1 192 ? 56.901  59.306  -26.726 1.00 48.32 ? 192  LYS F CB    1 
ATOM   7458  C  CG    . LYS F  1 192 ? 55.967  59.670  -25.549 1.00 49.71 ? 192  LYS F CG    1 
ATOM   7459  C  CD    . LYS F  1 192 ? 54.823  60.624  -25.946 1.00 51.81 ? 192  LYS F CD    1 
ATOM   7460  C  CE    . LYS F  1 192 ? 53.988  60.100  -27.131 1.00 53.17 ? 192  LYS F CE    1 
ATOM   7461  N  NZ    . LYS F  1 192 ? 52.884  59.184  -26.725 1.00 53.08 ? 192  LYS F NZ    1 
ATOM   7462  N  N     . ARG G  1 18  ? 41.832  29.457  21.162  1.00 43.72 ? 18   ARG G N     1 
ATOM   7463  C  CA    . ARG G  1 18  ? 41.998  30.769  20.457  1.00 43.50 ? 18   ARG G CA    1 
ATOM   7464  C  C     . ARG G  1 18  ? 41.020  30.980  19.283  1.00 42.19 ? 18   ARG G C     1 
ATOM   7465  O  O     . ARG G  1 18  ? 41.332  30.707  18.118  1.00 42.30 ? 18   ARG G O     1 
ATOM   7466  C  CB    . ARG G  1 18  ? 43.452  30.964  20.009  1.00 44.19 ? 18   ARG G CB    1 
ATOM   7467  C  CG    . ARG G  1 18  ? 43.908  32.411  20.053  1.00 46.28 ? 18   ARG G CG    1 
ATOM   7468  C  CD    . ARG G  1 18  ? 45.370  32.603  20.428  1.00 50.82 ? 18   ARG G CD    1 
ATOM   7469  N  NE    . ARG G  1 18  ? 45.576  33.864  21.139  1.00 54.08 ? 18   ARG G NE    1 
ATOM   7470  C  CZ    . ARG G  1 18  ? 46.206  33.978  22.306  1.00 55.97 ? 18   ARG G CZ    1 
ATOM   7471  N  NH1   . ARG G  1 18  ? 46.705  32.902  22.908  1.00 56.45 ? 18   ARG G NH1   1 
ATOM   7472  N  NH2   . ARG G  1 18  ? 46.333  35.173  22.877  1.00 56.44 ? 18   ARG G NH2   1 
ATOM   7473  N  N     . GLY G  1 19  ? 39.836  31.480  19.616  1.00 40.49 ? 19   GLY G N     1 
ATOM   7474  C  CA    . GLY G  1 19  ? 38.794  31.709  18.637  1.00 38.02 ? 19   GLY G CA    1 
ATOM   7475  C  C     . GLY G  1 19  ? 38.961  33.019  17.911  1.00 36.35 ? 19   GLY G C     1 
ATOM   7476  O  O     . GLY G  1 19  ? 39.755  33.867  18.313  1.00 36.26 ? 19   GLY G O     1 
ATOM   7477  N  N     . GLN G  1 20  ? 38.198  33.177  16.838  1.00 34.72 ? 20   GLN G N     1 
ATOM   7478  C  CA    . GLN G  1 20  ? 38.270  34.349  15.969  1.00 33.33 ? 20   GLN G CA    1 
ATOM   7479  C  C     . GLN G  1 20  ? 37.076  34.447  15.015  1.00 31.68 ? 20   GLN G C     1 
ATOM   7480  O  O     . GLN G  1 20  ? 36.440  33.452  14.687  1.00 31.09 ? 20   GLN G O     1 
ATOM   7481  C  CB    . GLN G  1 20  ? 39.624  34.458  15.222  1.00 33.46 ? 20   GLN G CB    1 
ATOM   7482  C  CG    . GLN G  1 20  ? 39.749  33.677  13.926  1.00 34.91 ? 20   GLN G CG    1 
ATOM   7483  C  CD    . GLN G  1 20  ? 41.047  33.980  13.157  1.00 37.21 ? 20   GLN G CD    1 
ATOM   7484  O  OE1   . GLN G  1 20  ? 41.877  33.098  12.972  1.00 38.97 ? 20   GLN G OE1   1 
ATOM   7485  N  NE2   . GLN G  1 20  ? 41.202  35.209  12.697  1.00 37.90 ? 20   GLN G NE2   1 
ATOM   7486  N  N     . ILE G  1 21  ? 36.772  35.676  14.617  1.00 30.12 ? 21   ILE G N     1 
ATOM   7487  C  CA    . ILE G  1 21  ? 35.796  35.952  13.579  1.00 28.43 ? 21   ILE G CA    1 
ATOM   7488  C  C     . ILE G  1 21  ? 36.488  36.654  12.414  1.00 27.97 ? 21   ILE G C     1 
ATOM   7489  O  O     . ILE G  1 21  ? 37.176  37.660  12.593  1.00 27.58 ? 21   ILE G O     1 
ATOM   7490  C  CB    . ILE G  1 21  ? 34.619  36.823  14.104  1.00 28.26 ? 21   ILE G CB    1 
ATOM   7491  C  CG1   . ILE G  1 21  ? 33.872  36.109  15.244  1.00 27.77 ? 21   ILE G CG1   1 
ATOM   7492  C  CG2   . ILE G  1 21  ? 33.658  37.170  12.965  1.00 26.84 ? 21   ILE G CG2   1 
ATOM   7493  C  CD1   . ILE G  1 21  ? 32.926  37.019  16.043  1.00 26.87 ? 21   ILE G CD1   1 
ATOM   7494  N  N     . GLN G  1 22  ? 36.295  36.105  11.224  1.00 27.22 ? 22   GLN G N     1 
ATOM   7495  C  CA    . GLN G  1 22  ? 36.753  36.720  9.991   1.00 26.82 ? 22   GLN G CA    1 
ATOM   7496  C  C     . GLN G  1 22  ? 35.544  37.034  9.141   1.00 26.22 ? 22   GLN G C     1 
ATOM   7497  O  O     . GLN G  1 22  ? 34.642  36.207  9.017   1.00 26.40 ? 22   GLN G O     1 
ATOM   7498  C  CB    . GLN G  1 22  ? 37.677  35.766  9.225   1.00 26.82 ? 22   GLN G CB    1 
ATOM   7499  C  CG    . GLN G  1 22  ? 38.947  35.415  9.957   1.00 27.81 ? 22   GLN G CG    1 
ATOM   7500  C  CD    . GLN G  1 22  ? 39.758  34.335  9.257   1.00 29.13 ? 22   GLN G CD    1 
ATOM   7501  O  OE1   . GLN G  1 22  ? 39.591  34.077  8.068   1.00 28.81 ? 22   GLN G OE1   1 
ATOM   7502  N  NE2   . GLN G  1 22  ? 40.634  33.696  10.007  1.00 31.70 ? 22   GLN G NE2   1 
ATOM   7503  N  N     . VAL G  1 23  ? 35.528  38.224  8.550   1.00 25.55 ? 23   VAL G N     1 
ATOM   7504  C  CA    . VAL G  1 23  ? 34.381  38.663  7.768   1.00 24.88 ? 23   VAL G CA    1 
ATOM   7505  C  C     . VAL G  1 23  ? 34.814  39.020  6.353   1.00 24.62 ? 23   VAL G C     1 
ATOM   7506  O  O     . VAL G  1 23  ? 35.774  39.758  6.153   1.00 24.45 ? 23   VAL G O     1 
ATOM   7507  C  CB    . VAL G  1 23  ? 33.633  39.838  8.455   1.00 24.80 ? 23   VAL G CB    1 
ATOM   7508  C  CG1   . VAL G  1 23  ? 32.419  40.267  7.637   1.00 24.19 ? 23   VAL G CG1   1 
ATOM   7509  C  CG2   . VAL G  1 23  ? 33.211  39.436  9.854   1.00 23.94 ? 23   VAL G CG2   1 
ATOM   7510  N  N     . ILE G  1 24  ? 34.103  38.455  5.382   1.00 24.25 ? 24   ILE G N     1 
ATOM   7511  C  CA    . ILE G  1 24  ? 34.343  38.702  3.968   1.00 23.72 ? 24   ILE G CA    1 
ATOM   7512  C  C     . ILE G  1 24  ? 33.128  39.418  3.401   1.00 23.89 ? 24   ILE G C     1 
ATOM   7513  O  O     . ILE G  1 24  ? 32.047  38.842  3.277   1.00 24.09 ? 24   ILE G O     1 
ATOM   7514  C  CB    . ILE G  1 24  ? 34.617  37.374  3.189   1.00 23.78 ? 24   ILE G CB    1 
ATOM   7515  C  CG1   . ILE G  1 24  ? 35.763  36.585  3.836   1.00 22.99 ? 24   ILE G CG1   1 
ATOM   7516  C  CG2   . ILE G  1 24  ? 34.916  37.658  1.703   1.00 22.82 ? 24   ILE G CG2   1 
ATOM   7517  C  CD1   . ILE G  1 24  ? 35.799  35.121  3.427   1.00 21.66 ? 24   ILE G CD1   1 
ATOM   7518  N  N     . LEU G  1 25  ? 33.323  40.688  3.079   1.00 23.81 ? 25   LEU G N     1 
ATOM   7519  C  CA    . LEU G  1 25  ? 32.269  41.548  2.567   1.00 23.77 ? 25   LEU G CA    1 
ATOM   7520  C  C     . LEU G  1 25  ? 32.475  41.805  1.084   1.00 23.63 ? 25   LEU G C     1 
ATOM   7521  O  O     . LEU G  1 25  ? 33.537  41.498  0.528   1.00 23.66 ? 25   LEU G O     1 
ATOM   7522  C  CB    . LEU G  1 25  ? 32.254  42.877  3.329   1.00 23.75 ? 25   LEU G CB    1 
ATOM   7523  C  CG    . LEU G  1 25  ? 31.977  42.832  4.833   1.00 23.83 ? 25   LEU G CG    1 
ATOM   7524  C  CD1   . LEU G  1 25  ? 32.155  44.203  5.443   1.00 23.76 ? 25   LEU G CD1   1 
ATOM   7525  C  CD2   . LEU G  1 25  ? 30.581  42.330  5.115   1.00 23.52 ? 25   LEU G CD2   1 
ATOM   7526  N  N     . GLY G  1 26  ? 31.450  42.352  0.442   1.00 23.66 ? 26   GLY G N     1 
ATOM   7527  C  CA    . GLY G  1 26  ? 31.515  42.695  -0.972  1.00 23.83 ? 26   GLY G CA    1 
ATOM   7528  C  C     . GLY G  1 26  ? 30.135  42.730  -1.607  1.00 24.00 ? 26   GLY G C     1 
ATOM   7529  O  O     . GLY G  1 26  ? 29.168  42.233  -1.016  1.00 24.00 ? 26   GLY G O     1 
ATOM   7530  N  N     . PRO G  1 27  ? 30.022  43.313  -2.799  1.00 23.76 ? 27   PRO G N     1 
ATOM   7531  C  CA    . PRO G  1 27  ? 28.761  43.265  -3.533  1.00 23.84 ? 27   PRO G CA    1 
ATOM   7532  C  C     . PRO G  1 27  ? 28.553  41.849  -4.079  1.00 24.20 ? 27   PRO G C     1 
ATOM   7533  O  O     . PRO G  1 27  ? 29.418  40.983  -3.887  1.00 24.41 ? 27   PRO G O     1 
ATOM   7534  C  CB    . PRO G  1 27  ? 28.995  44.240  -4.688  1.00 23.74 ? 27   PRO G CB    1 
ATOM   7535  C  CG    . PRO G  1 27  ? 30.496  44.178  -4.927  1.00 23.65 ? 27   PRO G CG    1 
ATOM   7536  C  CD    . PRO G  1 27  ? 31.075  44.034  -3.541  1.00 23.77 ? 27   PRO G CD    1 
ATOM   7537  N  N     . MET G  1 28  ? 27.434  41.623  -4.760  1.00 24.10 ? 28   MET G N     1 
ATOM   7538  C  CA    . MET G  1 28  ? 27.218  40.372  -5.480  1.00 24.17 ? 28   MET G CA    1 
ATOM   7539  C  C     . MET G  1 28  ? 28.282  40.204  -6.565  1.00 24.27 ? 28   MET G C     1 
ATOM   7540  O  O     . MET G  1 28  ? 28.872  41.194  -7.022  1.00 24.28 ? 28   MET G O     1 
ATOM   7541  C  CB    . MET G  1 28  ? 25.813  40.341  -6.075  1.00 23.54 ? 28   MET G CB    1 
ATOM   7542  C  CG    . MET G  1 28  ? 24.748  40.211  -5.014  1.00 23.33 ? 28   MET G CG    1 
ATOM   7543  S  SD    . MET G  1 28  ? 23.112  39.971  -5.640  1.00 22.30 ? 28   MET G SD    1 
ATOM   7544  C  CE    . MET G  1 28  ? 23.245  38.311  -6.340  1.00 22.24 ? 28   MET G CE    1 
ATOM   7545  N  N     . PHE G  1 29  ? 28.540  38.950  -6.940  1.00 24.19 ? 29   PHE G N     1 
ATOM   7546  C  CA    . PHE G  1 29  ? 29.443  38.605  -8.055  1.00 24.28 ? 29   PHE G CA    1 
ATOM   7547  C  C     . PHE G  1 29  ? 30.923  38.918  -7.804  1.00 23.99 ? 29   PHE G C     1 
ATOM   7548  O  O     . PHE G  1 29  ? 31.712  38.998  -8.742  1.00 24.11 ? 29   PHE G O     1 
ATOM   7549  C  CB    . PHE G  1 29  ? 28.961  39.207  -9.398  1.00 24.10 ? 29   PHE G CB    1 
ATOM   7550  C  CG    . PHE G  1 29  ? 27.458  39.181  -9.566  1.00 25.20 ? 29   PHE G CG    1 
ATOM   7551  C  CD1   . PHE G  1 29  ? 26.721  40.369  -9.555  1.00 24.75 ? 29   PHE G CD1   1 
ATOM   7552  C  CD2   . PHE G  1 29  ? 26.777  37.968  -9.694  1.00 25.18 ? 29   PHE G CD2   1 
ATOM   7553  C  CE1   . PHE G  1 29  ? 25.329  40.348  -9.695  1.00 25.82 ? 29   PHE G CE1   1 
ATOM   7554  C  CE2   . PHE G  1 29  ? 25.387  37.936  -9.834  1.00 25.65 ? 29   PHE G CE2   1 
ATOM   7555  C  CZ    . PHE G  1 29  ? 24.659  39.133  -9.831  1.00 25.76 ? 29   PHE G CZ    1 
ATOM   7556  N  N     . SER G  1 30  ? 31.299  39.069  -6.539  1.00 23.69 ? 30   SER G N     1 
ATOM   7557  C  CA    . SER G  1 30  ? 32.684  39.365  -6.186  1.00 23.39 ? 30   SER G CA    1 
ATOM   7558  C  C     . SER G  1 30  ? 33.438  38.127  -5.684  1.00 23.31 ? 30   SER G C     1 
ATOM   7559  O  O     . SER G  1 30  ? 34.623  38.205  -5.365  1.00 23.43 ? 30   SER G O     1 
ATOM   7560  C  CB    . SER G  1 30  ? 32.745  40.512  -5.167  1.00 23.10 ? 30   SER G CB    1 
ATOM   7561  O  OG    . SER G  1 30  ? 32.215  40.120  -3.915  1.00 23.64 ? 30   SER G OG    1 
ATOM   7562  N  N     . GLY G  1 31  ? 32.744  36.993  -5.606  1.00 23.22 ? 31   GLY G N     1 
ATOM   7563  C  CA    . GLY G  1 31  ? 33.365  35.735  -5.220  1.00 23.28 ? 31   GLY G CA    1 
ATOM   7564  C  C     . GLY G  1 31  ? 33.553  35.539  -3.726  1.00 23.50 ? 31   GLY G C     1 
ATOM   7565  O  O     . GLY G  1 31  ? 34.498  34.873  -3.312  1.00 23.63 ? 31   GLY G O     1 
ATOM   7566  N  N     . LYS G  1 32  ? 32.646  36.101  -2.925  1.00 23.54 ? 32   LYS G N     1 
ATOM   7567  C  CA    . LYS G  1 32  ? 32.677  35.966  -1.468  1.00 23.70 ? 32   LYS G CA    1 
ATOM   7568  C  C     . LYS G  1 32  ? 32.614  34.503  -1.010  1.00 24.21 ? 32   LYS G C     1 
ATOM   7569  O  O     . LYS G  1 32  ? 33.403  34.091  -0.149  1.00 24.14 ? 32   LYS G O     1 
ATOM   7570  C  CB    . LYS G  1 32  ? 31.530  36.755  -0.834  1.00 23.51 ? 32   LYS G CB    1 
ATOM   7571  C  CG    . LYS G  1 32  ? 31.580  38.267  -1.076  1.00 23.00 ? 32   LYS G CG    1 
ATOM   7572  C  CD    . LYS G  1 32  ? 30.482  38.999  -0.274  1.00 21.03 ? 32   LYS G CD    1 
ATOM   7573  C  CE    . LYS G  1 32  ? 29.055  38.587  -0.691  1.00 19.47 ? 32   LYS G CE    1 
ATOM   7574  N  NZ    . LYS G  1 32  ? 28.773  38.841  -2.147  1.00 18.17 ? 32   LYS G NZ    1 
ATOM   7575  N  N     . SER G  1 33  ? 31.682  33.736  -1.582  1.00 24.54 ? 33   SER G N     1 
ATOM   7576  C  CA    . SER G  1 33  ? 31.522  32.307  -1.277  1.00 25.35 ? 33   SER G CA    1 
ATOM   7577  C  C     . SER G  1 33  ? 32.755  31.481  -1.643  1.00 25.14 ? 33   SER G C     1 
ATOM   7578  O  O     . SER G  1 33  ? 33.120  30.558  -0.927  1.00 25.24 ? 33   SER G O     1 
ATOM   7579  C  CB    . SER G  1 33  ? 30.301  31.735  -1.996  1.00 25.10 ? 33   SER G CB    1 
ATOM   7580  O  OG    . SER G  1 33  ? 29.177  32.580  -1.821  1.00 27.32 ? 33   SER G OG    1 
ATOM   7581  N  N     . THR G  1 34  ? 33.383  31.825  -2.758  1.00 25.11 ? 34   THR G N     1 
ATOM   7582  C  CA    . THR G  1 34  ? 34.606  31.167  -3.203  1.00 25.33 ? 34   THR G CA    1 
ATOM   7583  C  C     . THR G  1 34  ? 35.755  31.450  -2.241  1.00 25.16 ? 34   THR G C     1 
ATOM   7584  O  O     . THR G  1 34  ? 36.510  30.539  -1.892  1.00 25.25 ? 34   THR G O     1 
ATOM   7585  C  CB    . THR G  1 34  ? 34.939  31.625  -4.650  1.00 25.83 ? 34   THR G CB    1 
ATOM   7586  O  OG1   . THR G  1 34  ? 33.903  31.163  -5.527  1.00 25.26 ? 34   THR G OG1   1 
ATOM   7587  C  CG2   . THR G  1 34  ? 36.238  30.960  -5.194  1.00 25.09 ? 34   THR G CG2   1 
ATOM   7588  N  N     . GLU G  1 35  ? 35.865  32.704  -1.800  1.00 25.05 ? 35   GLU G N     1 
ATOM   7589  C  CA    . GLU G  1 35  ? 36.876  33.083  -0.811  1.00 25.37 ? 35   GLU G CA    1 
ATOM   7590  C  C     . GLU G  1 35  ? 36.639  32.400  0.538   1.00 25.31 ? 35   GLU G C     1 
ATOM   7591  O  O     . GLU G  1 35  ? 37.592  31.976  1.184   1.00 25.12 ? 35   GLU G O     1 
ATOM   7592  C  CB    . GLU G  1 35  ? 36.962  34.605  -0.646  1.00 25.35 ? 35   GLU G CB    1 
ATOM   7593  C  CG    . GLU G  1 35  ? 38.041  35.067  0.340   1.00 26.65 ? 35   GLU G CG    1 
ATOM   7594  C  CD    . GLU G  1 35  ? 39.454  34.567  0.004   1.00 29.28 ? 35   GLU G CD    1 
ATOM   7595  O  OE1   . GLU G  1 35  ? 39.697  34.079  -1.137  1.00 29.14 ? 35   GLU G OE1   1 
ATOM   7596  O  OE2   . GLU G  1 35  ? 40.338  34.670  0.894   1.00 29.40 ? 35   GLU G OE2   1 
ATOM   7597  N  N     . LEU G  1 36  ? 35.372  32.293  0.942   1.00 25.30 ? 36   LEU G N     1 
ATOM   7598  C  CA    . LEU G  1 36  ? 34.997  31.544  2.137   1.00 25.79 ? 36   LEU G CA    1 
ATOM   7599  C  C     . LEU G  1 36  ? 35.505  30.101  2.070   1.00 25.96 ? 36   LEU G C     1 
ATOM   7600  O  O     . LEU G  1 36  ? 36.150  29.627  3.009   1.00 25.81 ? 36   LEU G O     1 
ATOM   7601  C  CB    . LEU G  1 36  ? 33.473  31.577  2.348   1.00 25.77 ? 36   LEU G CB    1 
ATOM   7602  C  CG    . LEU G  1 36  ? 32.826  30.647  3.388   1.00 26.32 ? 36   LEU G CG    1 
ATOM   7603  C  CD1   . LEU G  1 36  ? 33.331  30.940  4.795   1.00 26.66 ? 36   LEU G CD1   1 
ATOM   7604  C  CD2   . LEU G  1 36  ? 31.313  30.773  3.353   1.00 27.12 ? 36   LEU G CD2   1 
ATOM   7605  N  N     . MET G  1 37  ? 35.205  29.422  0.968   1.00 26.25 ? 37   MET G N     1 
ATOM   7606  C  CA    . MET G  1 37  ? 35.621  28.049  0.746   1.00 27.15 ? 37   MET G CA    1 
ATOM   7607  C  C     . MET G  1 37  ? 37.151  27.911  0.703   1.00 26.82 ? 37   MET G C     1 
ATOM   7608  O  O     . MET G  1 37  ? 37.698  26.981  1.297   1.00 26.62 ? 37   MET G O     1 
ATOM   7609  C  CB    . MET G  1 37  ? 35.006  27.512  -0.550  1.00 27.86 ? 37   MET G CB    1 
ATOM   7610  C  CG    . MET G  1 37  ? 33.522  27.148  -0.472  1.00 31.19 ? 37   MET G CG    1 
ATOM   7611  S  SD    . MET G  1 37  ? 33.087  26.348  1.081   1.00 39.15 ? 37   MET G SD    1 
ATOM   7612  C  CE    . MET G  1 37  ? 31.858  27.424  1.645   1.00 37.62 ? 37   MET G CE    1 
ATOM   7613  N  N     . ARG G  1 38  ? 37.835  28.829  0.009   1.00 26.41 ? 38   ARG G N     1 
ATOM   7614  C  CA    . ARG G  1 38  ? 39.302  28.845  0.019   1.00 26.28 ? 38   ARG G CA    1 
ATOM   7615  C  C     . ARG G  1 38  ? 39.848  28.819  1.449   1.00 26.42 ? 38   ARG G C     1 
ATOM   7616  O  O     . ARG G  1 38  ? 40.741  28.017  1.767   1.00 26.50 ? 38   ARG G O     1 
ATOM   7617  C  CB    . ARG G  1 38  ? 39.884  30.058  -0.734  1.00 25.98 ? 38   ARG G CB    1 
ATOM   7618  C  CG    . ARG G  1 38  ? 41.421  30.068  -0.774  1.00 25.35 ? 38   ARG G CG    1 
ATOM   7619  C  CD    . ARG G  1 38  ? 42.074  31.308  -1.379  1.00 25.18 ? 38   ARG G CD    1 
ATOM   7620  N  NE    . ARG G  1 38  ? 42.065  32.458  -0.475  1.00 25.94 ? 38   ARG G NE    1 
ATOM   7621  C  CZ    . ARG G  1 38  ? 42.906  32.651  0.542   1.00 25.43 ? 38   ARG G CZ    1 
ATOM   7622  N  NH1   . ARG G  1 38  ? 43.868  31.774  0.829   1.00 25.01 ? 38   ARG G NH1   1 
ATOM   7623  N  NH2   . ARG G  1 38  ? 42.777  33.737  1.283   1.00 24.03 ? 38   ARG G NH2   1 
ATOM   7624  N  N     . ARG G  1 39  ? 39.311  29.694  2.299   1.00 26.29 ? 39   ARG G N     1 
ATOM   7625  C  CA    . ARG G  1 39  ? 39.775  29.798  3.676   1.00 26.75 ? 39   ARG G CA    1 
ATOM   7626  C  C     . ARG G  1 39  ? 39.483  28.532  4.486   1.00 27.19 ? 39   ARG G C     1 
ATOM   7627  O  O     . ARG G  1 39  ? 40.355  28.045  5.214   1.00 27.33 ? 39   ARG G O     1 
ATOM   7628  C  CB    . ARG G  1 39  ? 39.166  31.014  4.359   1.00 26.28 ? 39   ARG G CB    1 
ATOM   7629  C  CG    . ARG G  1 39  ? 39.651  32.322  3.821   1.00 26.10 ? 39   ARG G CG    1 
ATOM   7630  C  CD    . ARG G  1 39  ? 39.198  33.472  4.649   1.00 26.43 ? 39   ARG G CD    1 
ATOM   7631  N  NE    . ARG G  1 39  ? 39.400  34.772  4.022   1.00 25.30 ? 39   ARG G NE    1 
ATOM   7632  C  CZ    . ARG G  1 39  ? 39.241  35.909  4.678   1.00 25.26 ? 39   ARG G CZ    1 
ATOM   7633  N  NH1   . ARG G  1 39  ? 38.896  35.870  5.963   1.00 24.17 ? 39   ARG G NH1   1 
ATOM   7634  N  NH2   . ARG G  1 39  ? 39.433  37.074  4.073   1.00 23.30 ? 39   ARG G NH2   1 
ATOM   7635  N  N     . VAL G  1 40  ? 38.270  27.998  4.336   1.00 27.44 ? 40   VAL G N     1 
ATOM   7636  C  CA    . VAL G  1 40  ? 37.858  26.807  5.068   1.00 28.04 ? 40   VAL G CA    1 
ATOM   7637  C  C     . VAL G  1 40  ? 38.675  25.577  4.641   1.00 28.71 ? 40   VAL G C     1 
ATOM   7638  O  O     . VAL G  1 40  ? 39.098  24.803  5.492   1.00 28.75 ? 40   VAL G O     1 
ATOM   7639  C  CB    . VAL G  1 40  ? 36.310  26.570  4.975   1.00 28.11 ? 40   VAL G CB    1 
ATOM   7640  C  CG1   . VAL G  1 40  ? 35.926  25.206  5.525   1.00 26.91 ? 40   VAL G CG1   1 
ATOM   7641  C  CG2   . VAL G  1 40  ? 35.541  27.688  5.705   1.00 26.65 ? 40   VAL G CG2   1 
ATOM   7642  N  N     . ARG G  1 41  ? 38.909  25.417  3.341   1.00 29.54 ? 41   ARG G N     1 
ATOM   7643  C  CA    . ARG G  1 41  ? 39.699  24.298  2.832   1.00 30.85 ? 41   ARG G CA    1 
ATOM   7644  C  C     . ARG G  1 41  ? 41.156  24.297  3.336   1.00 30.77 ? 41   ARG G C     1 
ATOM   7645  O  O     . ARG G  1 41  ? 41.757  23.234  3.470   1.00 30.68 ? 41   ARG G O     1 
ATOM   7646  C  CB    . ARG G  1 41  ? 39.641  24.229  1.301   1.00 31.28 ? 41   ARG G CB    1 
ATOM   7647  C  CG    . ARG G  1 41  ? 38.307  23.713  0.758   1.00 34.78 ? 41   ARG G CG    1 
ATOM   7648  C  CD    . ARG G  1 41  ? 38.346  23.304  -0.712  1.00 39.73 ? 41   ARG G CD    1 
ATOM   7649  N  NE    . ARG G  1 41  ? 37.050  23.494  -1.357  1.00 42.23 ? 41   ARG G NE    1 
ATOM   7650  C  CZ    . ARG G  1 41  ? 36.723  24.545  -2.103  1.00 44.19 ? 41   ARG G CZ    1 
ATOM   7651  N  NH1   . ARG G  1 41  ? 37.602  25.518  -2.318  1.00 44.62 ? 41   ARG G NH1   1 
ATOM   7652  N  NH2   . ARG G  1 41  ? 35.509  24.622  -2.640  1.00 44.67 ? 41   ARG G NH2   1 
ATOM   7653  N  N     . ARG G  1 42  ? 41.704  25.476  3.625   1.00 30.84 ? 42   ARG G N     1 
ATOM   7654  C  CA    . ARG G  1 42  ? 43.040  25.575  4.203   1.00 31.24 ? 42   ARG G CA    1 
ATOM   7655  C  C     . ARG G  1 42  ? 43.130  24.853  5.548   1.00 31.28 ? 42   ARG G C     1 
ATOM   7656  O  O     . ARG G  1 42  ? 44.115  24.154  5.814   1.00 30.98 ? 42   ARG G O     1 
ATOM   7657  C  CB    . ARG G  1 42  ? 43.464  27.030  4.372   1.00 30.98 ? 42   ARG G CB    1 
ATOM   7658  C  CG    . ARG G  1 42  ? 43.933  27.708  3.106   1.00 32.14 ? 42   ARG G CG    1 
ATOM   7659  C  CD    . ARG G  1 42  ? 43.897  29.227  3.171   1.00 34.50 ? 42   ARG G CD    1 
ATOM   7660  N  NE    . ARG G  1 42  ? 44.744  29.741  4.240   1.00 35.40 ? 42   ARG G NE    1 
ATOM   7661  C  CZ    . ARG G  1 42  ? 44.306  30.079  5.441   1.00 37.00 ? 42   ARG G CZ    1 
ATOM   7662  N  NH1   . ARG G  1 42  ? 43.010  29.967  5.743   1.00 36.88 ? 42   ARG G NH1   1 
ATOM   7663  N  NH2   . ARG G  1 42  ? 45.169  30.522  6.348   1.00 36.69 ? 42   ARG G NH2   1 
ATOM   7664  N  N     . PHE G  1 43  ? 42.111  25.028  6.391   1.00 31.44 ? 43   PHE G N     1 
ATOM   7665  C  CA    . PHE G  1 43  ? 42.057  24.343  7.682   1.00 31.89 ? 43   PHE G CA    1 
ATOM   7666  C  C     . PHE G  1 43  ? 41.745  22.854  7.504   1.00 32.78 ? 43   PHE G C     1 
ATOM   7667  O  O     . PHE G  1 43  ? 42.352  22.012  8.164   1.00 32.64 ? 43   PHE G O     1 
ATOM   7668  C  CB    . PHE G  1 43  ? 41.035  24.983  8.635   1.00 31.35 ? 43   PHE G CB    1 
ATOM   7669  C  CG    . PHE G  1 43  ? 41.403  26.371  9.094   1.00 30.10 ? 43   PHE G CG    1 
ATOM   7670  C  CD1   . PHE G  1 43  ? 40.852  27.490  8.477   1.00 28.73 ? 43   PHE G CD1   1 
ATOM   7671  C  CD2   . PHE G  1 43  ? 42.292  26.560  10.150  1.00 29.33 ? 43   PHE G CD2   1 
ATOM   7672  C  CE1   . PHE G  1 43  ? 41.194  28.778  8.894   1.00 28.63 ? 43   PHE G CE1   1 
ATOM   7673  C  CE2   . PHE G  1 43  ? 42.633  27.845  10.582  1.00 29.21 ? 43   PHE G CE2   1 
ATOM   7674  C  CZ    . PHE G  1 43  ? 42.082  28.958  9.949   1.00 28.13 ? 43   PHE G CZ    1 
ATOM   7675  N  N     . GLN G  1 44  ? 40.812  22.536  6.605   1.00 33.60 ? 44   GLN G N     1 
ATOM   7676  C  CA    . GLN G  1 44  ? 40.390  21.155  6.388   1.00 34.89 ? 44   GLN G CA    1 
ATOM   7677  C  C     . GLN G  1 44  ? 41.547  20.268  5.926   1.00 35.31 ? 44   GLN G C     1 
ATOM   7678  O  O     . GLN G  1 44  ? 41.724  19.154  6.433   1.00 35.14 ? 44   GLN G O     1 
ATOM   7679  C  CB    . GLN G  1 44  ? 39.219  21.076  5.401   1.00 35.10 ? 44   GLN G CB    1 
ATOM   7680  C  CG    . GLN G  1 44  ? 38.816  19.656  5.024   1.00 37.43 ? 44   GLN G CG    1 
ATOM   7681  C  CD    . GLN G  1 44  ? 37.390  19.566  4.516   1.00 41.46 ? 44   GLN G CD    1 
ATOM   7682  O  OE1   . GLN G  1 44  ? 37.135  19.689  3.307   1.00 43.78 ? 44   GLN G OE1   1 
ATOM   7683  N  NE2   . GLN G  1 44  ? 36.450  19.353  5.432   1.00 42.37 ? 44   GLN G NE2   1 
ATOM   7684  N  N     . ILE G  1 45  ? 42.334  20.778  4.980   1.00 35.92 ? 45   ILE G N     1 
ATOM   7685  C  CA    . ILE G  1 45  ? 43.498  20.068  4.463   1.00 36.45 ? 45   ILE G CA    1 
ATOM   7686  C  C     . ILE G  1 45  ? 44.542  19.829  5.562   1.00 36.65 ? 45   ILE G C     1 
ATOM   7687  O  O     . ILE G  1 45  ? 45.361  18.912  5.469   1.00 36.64 ? 45   ILE G O     1 
ATOM   7688  C  CB    . ILE G  1 45  ? 44.075  20.829  3.229   1.00 36.82 ? 45   ILE G CB    1 
ATOM   7689  C  CG1   . ILE G  1 45  ? 44.447  19.850  2.103   1.00 37.56 ? 45   ILE G CG1   1 
ATOM   7690  C  CG2   . ILE G  1 45  ? 45.190  21.820  3.616   1.00 36.40 ? 45   ILE G CG2   1 
ATOM   7691  C  CD1   . ILE G  1 45  ? 45.718  19.049  2.313   1.00 39.11 ? 45   ILE G CD1   1 
ATOM   7692  N  N     . ALA G  1 46  ? 44.487  20.642  6.614   1.00 36.96 ? 46   ALA G N     1 
ATOM   7693  C  CA    . ALA G  1 46  ? 45.371  20.481  7.758   1.00 37.48 ? 46   ALA G CA    1 
ATOM   7694  C  C     . ALA G  1 46  ? 44.718  19.690  8.904   1.00 37.95 ? 46   ALA G C     1 
ATOM   7695  O  O     . ALA G  1 46  ? 45.163  19.756  10.045  1.00 38.07 ? 46   ALA G O     1 
ATOM   7696  C  CB    . ALA G  1 46  ? 45.856  21.839  8.237   1.00 37.25 ? 46   ALA G CB    1 
ATOM   7697  N  N     . GLN G  1 47  ? 43.663  18.944  8.584   1.00 38.85 ? 47   GLN G N     1 
ATOM   7698  C  CA    . GLN G  1 47  ? 42.982  18.021  9.513   1.00 39.84 ? 47   GLN G CA    1 
ATOM   7699  C  C     . GLN G  1 47  ? 42.020  18.637  10.539  1.00 39.66 ? 47   GLN G C     1 
ATOM   7700  O  O     . GLN G  1 47  ? 41.542  17.933  11.428  1.00 39.92 ? 47   GLN G O     1 
ATOM   7701  C  CB    . GLN G  1 47  ? 43.952  17.056  10.235  1.00 39.94 ? 47   GLN G CB    1 
ATOM   7702  C  CG    . GLN G  1 47  ? 45.041  16.434  9.365   1.00 42.61 ? 47   GLN G CG    1 
ATOM   7703  C  CD    . GLN G  1 47  ? 44.560  15.244  8.580   1.00 45.26 ? 47   GLN G CD    1 
ATOM   7704  O  OE1   . GLN G  1 47  ? 43.684  15.372  7.723   1.00 46.50 ? 47   GLN G OE1   1 
ATOM   7705  N  NE2   . GLN G  1 47  ? 45.140  14.079  8.857   1.00 46.18 ? 47   GLN G NE2   1 
ATOM   7706  N  N     . TYR G  1 48  ? 41.732  19.931  10.436  1.00 39.45 ? 48   TYR G N     1 
ATOM   7707  C  CA    . TYR G  1 48  ? 40.684  20.525  11.276  1.00 39.36 ? 48   TYR G CA    1 
ATOM   7708  C  C     . TYR G  1 48  ? 39.295  20.014  10.878  1.00 39.02 ? 48   TYR G C     1 
ATOM   7709  O  O     . TYR G  1 48  ? 39.005  19.830  9.696   1.00 38.86 ? 48   TYR G O     1 
ATOM   7710  C  CB    . TYR G  1 48  ? 40.672  22.039  11.168  1.00 39.10 ? 48   TYR G CB    1 
ATOM   7711  C  CG    . TYR G  1 48  ? 41.766  22.748  11.907  1.00 40.25 ? 48   TYR G CG    1 
ATOM   7712  C  CD1   . TYR G  1 48  ? 41.555  23.232  13.198  1.00 41.58 ? 48   TYR G CD1   1 
ATOM   7713  C  CD2   . TYR G  1 48  ? 43.011  22.966  11.309  1.00 40.64 ? 48   TYR G CD2   1 
ATOM   7714  C  CE1   . TYR G  1 48  ? 42.559  23.906  13.884  1.00 42.53 ? 48   TYR G CE1   1 
ATOM   7715  C  CE2   . TYR G  1 48  ? 44.022  23.633  11.983  1.00 41.63 ? 48   TYR G CE2   1 
ATOM   7716  C  CZ    . TYR G  1 48  ? 43.789  24.099  13.269  1.00 42.90 ? 48   TYR G CZ    1 
ATOM   7717  O  OH    . TYR G  1 48  ? 44.777  24.775  13.942  1.00 44.35 ? 48   TYR G OH    1 
ATOM   7718  N  N     . LYS G  1 49  ? 38.435  19.798  11.868  1.00 38.77 ? 49   LYS G N     1 
ATOM   7719  C  CA    . LYS G  1 49  ? 37.017  19.532  11.607  1.00 38.63 ? 49   LYS G CA    1 
ATOM   7720  C  C     . LYS G  1 49  ? 36.307  20.829  11.212  1.00 37.68 ? 49   LYS G C     1 
ATOM   7721  O  O     . LYS G  1 49  ? 36.402  21.830  11.922  1.00 37.34 ? 49   LYS G O     1 
ATOM   7722  C  CB    . LYS G  1 49  ? 36.337  18.926  12.836  1.00 39.01 ? 49   LYS G CB    1 
ATOM   7723  C  CG    . LYS G  1 49  ? 36.816  17.524  13.202  1.00 41.49 ? 49   LYS G CG    1 
ATOM   7724  C  CD    . LYS G  1 49  ? 35.746  16.751  13.967  1.00 44.74 ? 49   LYS G CD    1 
ATOM   7725  C  CE    . LYS G  1 49  ? 36.372  15.708  14.886  1.00 46.75 ? 49   LYS G CE    1 
ATOM   7726  N  NZ    . LYS G  1 49  ? 36.078  15.981  16.334  1.00 48.02 ? 49   LYS G NZ    1 
ATOM   7727  N  N     . CYS G  1 50  ? 35.611  20.803  10.080  1.00 36.65 ? 50   CYS G N     1 
ATOM   7728  C  CA    . CYS G  1 50  ? 34.978  22.000  9.533   1.00 36.12 ? 50   CYS G CA    1 
ATOM   7729  C  C     . CYS G  1 50  ? 33.479  21.831  9.295   1.00 35.71 ? 50   CYS G C     1 
ATOM   7730  O  O     . CYS G  1 50  ? 32.991  20.733  9.040   1.00 35.67 ? 50   CYS G O     1 
ATOM   7731  C  CB    . CYS G  1 50  ? 35.665  22.439  8.234   1.00 35.96 ? 50   CYS G CB    1 
ATOM   7732  S  SG    . CYS G  1 50  ? 37.454  22.675  8.391   1.00 35.90 ? 50   CYS G SG    1 
ATOM   7733  N  N     . LEU G  1 51  ? 32.756  22.933  9.401   1.00 34.97 ? 51   LEU G N     1 
ATOM   7734  C  CA    . LEU G  1 51  ? 31.339  22.963  9.079   1.00 34.44 ? 51   LEU G CA    1 
ATOM   7735  C  C     . LEU G  1 51  ? 31.040  24.220  8.282   1.00 34.01 ? 51   LEU G C     1 
ATOM   7736  O  O     . LEU G  1 51  ? 31.474  25.306  8.655   1.00 33.95 ? 51   LEU G O     1 
ATOM   7737  C  CB    . LEU G  1 51  ? 30.500  22.945  10.360  1.00 34.36 ? 51   LEU G CB    1 
ATOM   7738  C  CG    . LEU G  1 51  ? 28.999  23.224  10.257  1.00 34.56 ? 51   LEU G CG    1 
ATOM   7739  C  CD1   . LEU G  1 51  ? 28.263  22.037  9.641   1.00 34.71 ? 51   LEU G CD1   1 
ATOM   7740  C  CD2   . LEU G  1 51  ? 28.416  23.567  11.616  1.00 34.05 ? 51   LEU G CD2   1 
ATOM   7741  N  N     . VAL G  1 52  ? 30.309  24.065  7.183   1.00 33.64 ? 52   VAL G N     1 
ATOM   7742  C  CA    . VAL G  1 52  ? 29.833  25.208  6.406   1.00 33.55 ? 52   VAL G CA    1 
ATOM   7743  C  C     . VAL G  1 52  ? 28.303  25.284  6.471   1.00 33.61 ? 52   VAL G C     1 
ATOM   7744  O  O     . VAL G  1 52  ? 27.608  24.283  6.266   1.00 33.40 ? 52   VAL G O     1 
ATOM   7745  C  CB    . VAL G  1 52  ? 30.319  25.177  4.934   1.00 33.42 ? 52   VAL G CB    1 
ATOM   7746  C  CG1   . VAL G  1 52  ? 29.773  26.360  4.163   1.00 33.44 ? 52   VAL G CG1   1 
ATOM   7747  C  CG2   . VAL G  1 52  ? 31.843  25.177  4.857   1.00 33.80 ? 52   VAL G CG2   1 
ATOM   7748  N  N     . ILE G  1 53  ? 27.802  26.474  6.789   1.00 33.62 ? 53   ILE G N     1 
ATOM   7749  C  CA    . ILE G  1 53  ? 26.377  26.739  6.870   1.00 33.78 ? 53   ILE G CA    1 
ATOM   7750  C  C     . ILE G  1 53  ? 25.961  27.679  5.745   1.00 34.58 ? 53   ILE G C     1 
ATOM   7751  O  O     . ILE G  1 53  ? 26.601  28.709  5.508   1.00 34.47 ? 53   ILE G O     1 
ATOM   7752  C  CB    . ILE G  1 53  ? 25.985  27.358  8.243   1.00 33.34 ? 53   ILE G CB    1 
ATOM   7753  C  CG1   . ILE G  1 53  ? 26.385  26.439  9.394   1.00 33.21 ? 53   ILE G CG1   1 
ATOM   7754  C  CG2   . ILE G  1 53  ? 24.477  27.649  8.306   1.00 31.69 ? 53   ILE G CG2   1 
ATOM   7755  C  CD1   . ILE G  1 53  ? 26.777  27.181  10.653  1.00 33.13 ? 53   ILE G CD1   1 
ATOM   7756  N  N     . LYS G  1 54  ? 24.881  27.315  5.064   1.00 35.41 ? 54   LYS G N     1 
ATOM   7757  C  CA    . LYS G  1 54  ? 24.290  28.142  4.026   1.00 36.73 ? 54   LYS G CA    1 
ATOM   7758  C  C     . LYS G  1 54  ? 22.860  28.504  4.385   1.00 36.92 ? 54   LYS G C     1 
ATOM   7759  O  O     . LYS G  1 54  ? 22.192  27.766  5.102   1.00 36.73 ? 54   LYS G O     1 
ATOM   7760  C  CB    . LYS G  1 54  ? 24.299  27.397  2.691   1.00 37.04 ? 54   LYS G CB    1 
ATOM   7761  C  CG    . LYS G  1 54  ? 25.652  27.375  2.029   1.00 39.11 ? 54   LYS G CG    1 
ATOM   7762  C  CD    . LYS G  1 54  ? 25.577  26.860  0.609   1.00 43.02 ? 54   LYS G CD    1 
ATOM   7763  C  CE    . LYS G  1 54  ? 26.764  27.379  -0.194  1.00 45.02 ? 54   LYS G CE    1 
ATOM   7764  N  NZ    . LYS G  1 54  ? 27.271  26.344  -1.132  1.00 46.41 ? 54   LYS G NZ    1 
ATOM   7765  N  N     . TYR G  1 55  ? 22.408  29.648  3.880   1.00 37.58 ? 55   TYR G N     1 
ATOM   7766  C  CA    . TYR G  1 55  ? 21.041  30.106  4.066   1.00 38.39 ? 55   TYR G CA    1 
ATOM   7767  C  C     . TYR G  1 55  ? 20.080  29.239  3.251   1.00 39.26 ? 55   TYR G C     1 
ATOM   7768  O  O     . TYR G  1 55  ? 20.176  29.181  2.029   1.00 39.04 ? 55   TYR G O     1 
ATOM   7769  C  CB    . TYR G  1 55  ? 20.935  31.569  3.651   1.00 38.15 ? 55   TYR G CB    1 
ATOM   7770  C  CG    . TYR G  1 55  ? 19.576  32.193  3.868   1.00 37.67 ? 55   TYR G CG    1 
ATOM   7771  C  CD1   . TYR G  1 55  ? 18.951  32.148  5.121   1.00 37.31 ? 55   TYR G CD1   1 
ATOM   7772  C  CD2   . TYR G  1 55  ? 18.920  32.843  2.827   1.00 36.68 ? 55   TYR G CD2   1 
ATOM   7773  C  CE1   . TYR G  1 55  ? 17.705  32.729  5.320   1.00 36.90 ? 55   TYR G CE1   1 
ATOM   7774  C  CE2   . TYR G  1 55  ? 17.676  33.430  3.018   1.00 36.89 ? 55   TYR G CE2   1 
ATOM   7775  C  CZ    . TYR G  1 55  ? 17.076  33.366  4.260   1.00 36.95 ? 55   TYR G CZ    1 
ATOM   7776  O  OH    . TYR G  1 55  ? 15.851  33.945  4.445   1.00 37.86 ? 55   TYR G OH    1 
ATOM   7777  N  N     . ALA G  1 56  ? 19.153  28.579  3.940   1.00 40.56 ? 56   ALA G N     1 
ATOM   7778  C  CA    . ALA G  1 56  ? 18.284  27.570  3.325   1.00 42.00 ? 56   ALA G CA    1 
ATOM   7779  C  C     . ALA G  1 56  ? 17.395  28.103  2.201   1.00 43.00 ? 56   ALA G C     1 
ATOM   7780  O  O     . ALA G  1 56  ? 17.099  27.380  1.257   1.00 43.28 ? 56   ALA G O     1 
ATOM   7781  C  CB    . ALA G  1 56  ? 17.445  26.851  4.384   1.00 41.53 ? 56   ALA G CB    1 
ATOM   7782  N  N     . LYS G  1 57  ? 16.997  29.367  2.291   1.00 44.33 ? 57   LYS G N     1 
ATOM   7783  C  CA    . LYS G  1 57  ? 16.092  29.957  1.311   1.00 45.74 ? 57   LYS G CA    1 
ATOM   7784  C  C     . LYS G  1 57  ? 16.773  30.433  0.013   1.00 46.52 ? 57   LYS G C     1 
ATOM   7785  O  O     . LYS G  1 57  ? 16.092  30.799  -0.944  1.00 46.77 ? 57   LYS G O     1 
ATOM   7786  C  CB    . LYS G  1 57  ? 15.242  31.063  1.950   1.00 45.69 ? 57   LYS G CB    1 
ATOM   7787  C  CG    . LYS G  1 57  ? 14.133  30.537  2.864   1.00 46.90 ? 57   LYS G CG    1 
ATOM   7788  C  CD    . LYS G  1 57  ? 13.141  31.628  3.238   1.00 49.22 ? 57   LYS G CD    1 
ATOM   7789  C  CE    . LYS G  1 57  ? 12.770  31.567  4.716   1.00 51.02 ? 57   LYS G CE    1 
ATOM   7790  N  NZ    . LYS G  1 57  ? 13.457  32.641  5.515   1.00 52.21 ? 57   LYS G NZ    1 
ATOM   7791  N  N     . ASP G  1 58  ? 18.103  30.439  -0.026  1.00 47.44 ? 58   ASP G N     1 
ATOM   7792  C  CA    . ASP G  1 58  ? 18.811  30.693  -1.281  1.00 48.34 ? 58   ASP G CA    1 
ATOM   7793  C  C     . ASP G  1 58  ? 19.128  29.371  -1.969  1.00 48.73 ? 58   ASP G C     1 
ATOM   7794  O  O     . ASP G  1 58  ? 20.115  28.704  -1.649  1.00 49.04 ? 58   ASP G O     1 
ATOM   7795  C  CB    . ASP G  1 58  ? 20.078  31.530  -1.085  1.00 48.14 ? 58   ASP G CB    1 
ATOM   7796  C  CG    . ASP G  1 58  ? 20.569  32.158  -2.388  1.00 48.60 ? 58   ASP G CG    1 
ATOM   7797  O  OD1   . ASP G  1 58  ? 20.502  31.483  -3.442  1.00 48.66 ? 58   ASP G OD1   1 
ATOM   7798  O  OD2   . ASP G  1 58  ? 21.034  33.320  -2.462  1.00 47.80 ? 58   ASP G OD2   1 
ATOM   7799  N  N     . THR G  1 59  ? 18.267  29.017  -2.920  1.00 48.05 ? 59   THR G N     1 
ATOM   7800  C  CA    . THR G  1 59  ? 18.266  27.705  -3.561  1.00 47.43 ? 59   THR G CA    1 
ATOM   7801  C  C     . THR G  1 59  ? 18.858  27.725  -4.969  1.00 47.13 ? 59   THR G C     1 
ATOM   7802  O  O     . THR G  1 59  ? 18.705  26.761  -5.713  1.00 47.17 ? 59   THR G O     1 
ATOM   7803  C  CB    . THR G  1 59  ? 16.824  27.134  -3.605  1.00 47.52 ? 59   THR G CB    1 
ATOM   7804  O  OG1   . THR G  1 59  ? 15.895  28.177  -3.941  1.00 46.19 ? 59   THR G OG1   1 
ATOM   7805  C  CG2   . THR G  1 59  ? 16.373  26.680  -2.210  1.00 47.61 ? 59   THR G CG2   1 
ATOM   7806  N  N     . ARG G  1 60  ? 19.524  28.820  -5.328  1.00 46.84 ? 60   ARG G N     1 
ATOM   7807  C  CA    . ARG G  1 60  ? 20.222  28.930  -6.610  1.00 46.98 ? 60   ARG G CA    1 
ATOM   7808  C  C     . ARG G  1 60  ? 21.250  27.816  -6.756  1.00 47.61 ? 60   ARG G C     1 
ATOM   7809  O  O     . ARG G  1 60  ? 21.934  27.466  -5.793  1.00 47.55 ? 60   ARG G O     1 
ATOM   7810  C  CB    . ARG G  1 60  ? 20.913  30.293  -6.747  1.00 46.44 ? 60   ARG G CB    1 
ATOM   7811  C  CG    . ARG G  1 60  ? 19.964  31.490  -6.825  1.00 45.06 ? 60   ARG G CG    1 
ATOM   7812  C  CD    . ARG G  1 60  ? 20.656  32.852  -6.777  1.00 41.92 ? 60   ARG G CD    1 
ATOM   7813  N  NE    . ARG G  1 60  ? 21.471  33.002  -5.575  1.00 39.66 ? 60   ARG G NE    1 
ATOM   7814  C  CZ    . ARG G  1 60  ? 22.669  33.576  -5.532  1.00 38.57 ? 60   ARG G CZ    1 
ATOM   7815  N  NH1   . ARG G  1 60  ? 23.223  34.088  -6.630  1.00 37.53 ? 60   ARG G NH1   1 
ATOM   7816  N  NH2   . ARG G  1 60  ? 23.320  33.637  -4.377  1.00 37.55 ? 60   ARG G NH2   1 
ATOM   7817  N  N     . TYR G  1 61  ? 21.356  27.256  -7.957  1.00 48.54 ? 61   TYR G N     1 
ATOM   7818  C  CA    . TYR G  1 61  ? 22.304  26.169  -8.198  1.00 49.88 ? 61   TYR G CA    1 
ATOM   7819  C  C     . TYR G  1 61  ? 23.744  26.672  -8.149  1.00 50.38 ? 61   TYR G C     1 
ATOM   7820  O  O     . TYR G  1 61  ? 24.637  25.950  -7.710  1.00 50.50 ? 61   TYR G O     1 
ATOM   7821  C  CB    . TYR G  1 61  ? 21.987  25.418  -9.505  1.00 50.05 ? 61   TYR G CB    1 
ATOM   7822  C  CG    . TYR G  1 61  ? 20.641  24.696  -9.474  1.00 51.50 ? 61   TYR G CG    1 
ATOM   7823  C  CD1   . TYR G  1 61  ? 19.815  24.759  -8.338  1.00 52.74 ? 61   TYR G CD1   1 
ATOM   7824  C  CD2   . TYR G  1 61  ? 20.185  23.968  -10.572 1.00 52.56 ? 61   TYR G CD2   1 
ATOM   7825  C  CE1   . TYR G  1 61  ? 18.583  24.121  -8.293  1.00 53.35 ? 61   TYR G CE1   1 
ATOM   7826  C  CE2   . TYR G  1 61  ? 18.941  23.315  -10.535 1.00 53.23 ? 61   TYR G CE2   1 
ATOM   7827  C  CZ    . TYR G  1 61  ? 18.150  23.404  -9.390  1.00 53.61 ? 61   TYR G CZ    1 
ATOM   7828  O  OH    . TYR G  1 61  ? 16.926  22.780  -9.323  1.00 54.27 ? 61   TYR G OH    1 
ATOM   7829  N  N     . SER G  1 62  ? 23.947  27.920  -8.568  1.00 51.16 ? 62   SER G N     1 
ATOM   7830  C  CA    . SER G  1 62  ? 25.243  28.589  -8.473  1.00 52.11 ? 62   SER G CA    1 
ATOM   7831  C  C     . SER G  1 62  ? 25.764  28.653  -7.033  1.00 52.70 ? 62   SER G C     1 
ATOM   7832  O  O     . SER G  1 62  ? 26.946  28.414  -6.795  1.00 52.99 ? 62   SER G O     1 
ATOM   7833  C  CB    . SER G  1 62  ? 25.173  29.999  -9.068  1.00 52.02 ? 62   SER G CB    1 
ATOM   7834  O  OG    . SER G  1 62  ? 24.254  30.821  -8.373  1.00 52.30 ? 62   SER G OG    1 
ATOM   7835  N  N     . SER G  1 63  ? 24.877  28.954  -6.084  1.00 53.23 ? 63   SER G N     1 
ATOM   7836  C  CA    . SER G  1 63  ? 25.256  29.081  -4.675  1.00 53.72 ? 63   SER G CA    1 
ATOM   7837  C  C     . SER G  1 63  ? 25.012  27.807  -3.848  1.00 54.18 ? 63   SER G C     1 
ATOM   7838  O  O     . SER G  1 63  ? 24.691  27.874  -2.658  1.00 54.24 ? 63   SER G O     1 
ATOM   7839  C  CB    . SER G  1 63  ? 24.558  30.295  -4.042  1.00 53.72 ? 63   SER G CB    1 
ATOM   7840  O  OG    . SER G  1 63  ? 23.249  29.971  -3.611  1.00 53.17 ? 63   SER G OG    1 
ATOM   7841  N  N     . SER G  1 64  ? 25.172  26.648  -4.487  1.00 54.70 ? 64   SER G N     1 
ATOM   7842  C  CA    . SER G  1 64  ? 25.070  25.363  -3.801  1.00 55.03 ? 64   SER G CA    1 
ATOM   7843  C  C     . SER G  1 64  ? 26.412  24.629  -3.826  1.00 55.11 ? 64   SER G C     1 
ATOM   7844  O  O     . SER G  1 64  ? 26.848  24.084  -2.811  1.00 55.27 ? 64   SER G O     1 
ATOM   7845  C  CB    . SER G  1 64  ? 23.963  24.497  -4.419  1.00 55.19 ? 64   SER G CB    1 
ATOM   7846  O  OG    . SER G  1 64  ? 24.376  23.932  -5.654  1.00 55.37 ? 64   SER G OG    1 
ATOM   7847  N  N     . GLU G  1 74  ? 30.190  18.912  4.285   1.00 50.80 ? 74   GLU G N     1 
ATOM   7848  C  CA    . GLU G  1 74  ? 29.182  19.228  5.296   1.00 51.02 ? 74   GLU G CA    1 
ATOM   7849  C  C     . GLU G  1 74  ? 28.611  20.642  5.128   1.00 50.18 ? 74   GLU G C     1 
ATOM   7850  O  O     . GLU G  1 74  ? 28.905  21.508  5.960   1.00 50.45 ? 74   GLU G O     1 
ATOM   7851  C  CB    . GLU G  1 74  ? 29.783  19.065  6.704   1.00 51.41 ? 74   GLU G CB    1 
ATOM   7852  C  CG    . GLU G  1 74  ? 28.744  18.832  7.797   1.00 53.51 ? 74   GLU G CG    1 
ATOM   7853  C  CD    . GLU G  1 74  ? 29.356  18.515  9.154   1.00 56.36 ? 74   GLU G CD    1 
ATOM   7854  O  OE1   . GLU G  1 74  ? 30.526  18.891  9.397   1.00 57.11 ? 74   GLU G OE1   1 
ATOM   7855  O  OE2   . GLU G  1 74  ? 28.661  17.892  9.990   1.00 58.05 ? 74   GLU G OE2   1 
ATOM   7856  N  N     . ALA G  1 75  ? 27.825  20.870  4.059   1.00 48.60 ? 75   ALA G N     1 
ATOM   7857  C  CA    . ALA G  1 75  ? 27.200  22.176  3.785   1.00 48.07 ? 75   ALA G CA    1 
ATOM   7858  C  C     . ALA G  1 75  ? 25.732  22.232  4.257   1.00 47.63 ? 75   ALA G C     1 
ATOM   7859  O  O     . ALA G  1 75  ? 24.793  22.089  3.450   1.00 47.74 ? 75   ALA G O     1 
ATOM   7860  C  CB    . ALA G  1 75  ? 27.323  22.547  2.297   1.00 48.12 ? 75   ALA G CB    1 
ATOM   7861  N  N     . LEU G  1 76  ? 25.550  22.445  5.563   1.00 46.58 ? 76   LEU G N     1 
ATOM   7862  C  CA    . LEU G  1 76  ? 24.222  22.441  6.185   1.00 45.85 ? 76   LEU G CA    1 
ATOM   7863  C  C     . LEU G  1 76  ? 23.374  23.680  5.872   1.00 45.04 ? 76   LEU G C     1 
ATOM   7864  O  O     . LEU G  1 76  ? 23.789  24.800  6.148   1.00 44.93 ? 76   LEU G O     1 
ATOM   7865  C  CB    . LEU G  1 76  ? 24.321  22.291  7.709   1.00 45.85 ? 76   LEU G CB    1 
ATOM   7866  C  CG    . LEU G  1 76  ? 24.538  20.932  8.391   1.00 46.71 ? 76   LEU G CG    1 
ATOM   7867  C  CD1   . LEU G  1 76  ? 24.612  21.146  9.898   1.00 46.55 ? 76   LEU G CD1   1 
ATOM   7868  C  CD2   . LEU G  1 76  ? 23.464  19.877  8.047   1.00 46.90 ? 76   LEU G CD2   1 
ATOM   7869  N  N     . PRO G  1 77  ? 22.178  23.472  5.320   1.00 44.35 ? 77   PRO G N     1 
ATOM   7870  C  CA    . PRO G  1 77  ? 21.211  24.564  5.152   1.00 43.79 ? 77   PRO G CA    1 
ATOM   7871  C  C     . PRO G  1 77  ? 20.571  24.943  6.484   1.00 43.17 ? 77   PRO G C     1 
ATOM   7872  O  O     . PRO G  1 77  ? 20.347  24.068  7.309   1.00 43.07 ? 77   PRO G O     1 
ATOM   7873  C  CB    . PRO G  1 77  ? 20.173  23.971  4.191   1.00 43.76 ? 77   PRO G CB    1 
ATOM   7874  C  CG    . PRO G  1 77  ? 20.261  22.495  4.377   1.00 44.06 ? 77   PRO G CG    1 
ATOM   7875  C  CD    . PRO G  1 77  ? 21.665  22.187  4.805   1.00 44.24 ? 77   PRO G CD    1 
ATOM   7876  N  N     . ALA G  1 78  ? 20.314  26.232  6.691   1.00 42.67 ? 78   ALA G N     1 
ATOM   7877  C  CA    . ALA G  1 78  ? 19.678  26.728  7.908   1.00 42.24 ? 78   ALA G CA    1 
ATOM   7878  C  C     . ALA G  1 78  ? 18.985  28.066  7.667   1.00 42.23 ? 78   ALA G C     1 
ATOM   7879  O  O     . ALA G  1 78  ? 19.326  28.789  6.723   1.00 42.00 ? 78   ALA G O     1 
ATOM   7880  C  CB    . ALA G  1 78  ? 20.692  26.861  9.010   1.00 41.92 ? 78   ALA G CB    1 
ATOM   7881  N  N     . CYS G  1 79  ? 18.015  28.384  8.527   1.00 42.23 ? 79   CYS G N     1 
ATOM   7882  C  CA    . CYS G  1 79  ? 17.330  29.680  8.516   1.00 42.60 ? 79   CYS G CA    1 
ATOM   7883  C  C     . CYS G  1 79  ? 17.685  30.498  9.740   1.00 41.88 ? 79   CYS G C     1 
ATOM   7884  O  O     . CYS G  1 79  ? 17.607  31.719  9.726   1.00 41.90 ? 79   CYS G O     1 
ATOM   7885  C  CB    . CYS G  1 79  ? 15.822  29.484  8.463   1.00 42.71 ? 79   CYS G CB    1 
ATOM   7886  S  SG    . CYS G  1 79  ? 15.245  29.260  6.783   1.00 46.93 ? 79   CYS G SG    1 
ATOM   7887  N  N     . LEU G  1 80  ? 18.039  29.793  10.806  1.00 41.55 ? 80   LEU G N     1 
ATOM   7888  C  CA    . LEU G  1 80  ? 18.506  30.379  12.053  1.00 41.17 ? 80   LEU G CA    1 
ATOM   7889  C  C     . LEU G  1 80  ? 19.752  29.601  12.423  1.00 40.62 ? 80   LEU G C     1 
ATOM   7890  O  O     . LEU G  1 80  ? 19.759  28.370  12.337  1.00 40.37 ? 80   LEU G O     1 
ATOM   7891  C  CB    . LEU G  1 80  ? 17.472  30.182  13.163  1.00 41.19 ? 80   LEU G CB    1 
ATOM   7892  C  CG    . LEU G  1 80  ? 16.403  31.217  13.531  1.00 42.41 ? 80   LEU G CG    1 
ATOM   7893  C  CD1   . LEU G  1 80  ? 15.658  30.713  14.764  1.00 42.55 ? 80   LEU G CD1   1 
ATOM   7894  C  CD2   . LEU G  1 80  ? 16.951  32.626  13.775  1.00 42.24 ? 80   LEU G CD2   1 
ATOM   7895  N  N     . LEU G  1 81  ? 20.800  30.306  12.839  1.00 40.08 ? 81   LEU G N     1 
ATOM   7896  C  CA    . LEU G  1 81  ? 22.056  29.645  13.187  1.00 39.88 ? 81   LEU G CA    1 
ATOM   7897  C  C     . LEU G  1 81  ? 21.929  28.802  14.464  1.00 40.12 ? 81   LEU G C     1 
ATOM   7898  O  O     . LEU G  1 81  ? 22.641  27.819  14.644  1.00 39.97 ? 81   LEU G O     1 
ATOM   7899  C  CB    . LEU G  1 81  ? 23.201  30.655  13.272  1.00 39.37 ? 81   LEU G CB    1 
ATOM   7900  C  CG    . LEU G  1 81  ? 23.656  31.238  11.924  1.00 38.62 ? 81   LEU G CG    1 
ATOM   7901  C  CD1   . LEU G  1 81  ? 24.386  32.542  12.114  1.00 36.46 ? 81   LEU G CD1   1 
ATOM   7902  C  CD2   . LEU G  1 81  ? 24.511  30.254  11.122  1.00 37.75 ? 81   LEU G CD2   1 
ATOM   7903  N  N     . ARG G  1 82  ? 20.988  29.190  15.318  1.00 40.49 ? 82   ARG G N     1 
ATOM   7904  C  CA    . ARG G  1 82  ? 20.634  28.464  16.526  1.00 41.10 ? 82   ARG G CA    1 
ATOM   7905  C  C     . ARG G  1 82  ? 20.227  27.009  16.246  1.00 41.16 ? 82   ARG G C     1 
ATOM   7906  O  O     . ARG G  1 82  ? 20.518  26.120  17.041  1.00 41.08 ? 82   ARG G O     1 
ATOM   7907  C  CB    . ARG G  1 82  ? 19.495  29.222  17.213  1.00 41.14 ? 82   ARG G CB    1 
ATOM   7908  C  CG    . ARG G  1 82  ? 19.197  28.851  18.646  1.00 41.75 ? 82   ARG G CG    1 
ATOM   7909  C  CD    . ARG G  1 82  ? 17.991  29.608  19.216  1.00 44.12 ? 82   ARG G CD    1 
ATOM   7910  N  NE    . ARG G  1 82  ? 16.745  28.847  19.075  1.00 45.92 ? 82   ARG G NE    1 
ATOM   7911  C  CZ    . ARG G  1 82  ? 15.616  29.331  18.579  1.00 45.94 ? 82   ARG G CZ    1 
ATOM   7912  N  NH1   . ARG G  1 82  ? 15.544  30.589  18.166  1.00 46.54 ? 82   ARG G NH1   1 
ATOM   7913  N  NH2   . ARG G  1 82  ? 14.547  28.554  18.493  1.00 46.83 ? 82   ARG G NH2   1 
ATOM   7914  N  N     . ASP G  1 83  ? 19.558  26.778  15.120  1.00 41.36 ? 83   ASP G N     1 
ATOM   7915  C  CA    . ASP G  1 83  ? 19.113  25.438  14.733  1.00 42.00 ? 83   ASP G CA    1 
ATOM   7916  C  C     . ASP G  1 83  ? 20.258  24.484  14.382  1.00 42.17 ? 83   ASP G C     1 
ATOM   7917  O  O     . ASP G  1 83  ? 20.054  23.279  14.219  1.00 42.24 ? 83   ASP G O     1 
ATOM   7918  C  CB    . ASP G  1 83  ? 18.143  25.511  13.555  1.00 42.19 ? 83   ASP G CB    1 
ATOM   7919  C  CG    . ASP G  1 83  ? 16.885  26.289  13.880  1.00 43.13 ? 83   ASP G CG    1 
ATOM   7920  O  OD1   . ASP G  1 83  ? 16.446  26.298  15.063  1.00 44.57 ? 83   ASP G OD1   1 
ATOM   7921  O  OD2   . ASP G  1 83  ? 16.267  26.921  13.000  1.00 43.80 ? 83   ASP G OD2   1 
ATOM   7922  N  N     . VAL G  1 84  ? 21.462  25.032  14.283  1.00 42.48 ? 84   VAL G N     1 
ATOM   7923  C  CA    . VAL G  1 84  ? 22.629  24.284  13.840  1.00 42.62 ? 84   VAL G CA    1 
ATOM   7924  C  C     . VAL G  1 84  ? 23.754  24.377  14.882  1.00 42.84 ? 84   VAL G C     1 
ATOM   7925  O  O     . VAL G  1 84  ? 24.860  23.862  14.683  1.00 42.68 ? 84   VAL G O     1 
ATOM   7926  C  CB    . VAL G  1 84  ? 23.054  24.787  12.442  1.00 42.75 ? 84   VAL G CB    1 
ATOM   7927  C  CG1   . VAL G  1 84  ? 24.557  24.823  12.271  1.00 42.82 ? 84   VAL G CG1   1 
ATOM   7928  C  CG2   . VAL G  1 84  ? 22.378  23.951  11.351  1.00 42.64 ? 84   VAL G CG2   1 
ATOM   7929  N  N     . ALA G  1 85  ? 23.435  25.006  16.010  1.00 43.18 ? 85   ALA G N     1 
ATOM   7930  C  CA    . ALA G  1 85  ? 24.384  25.260  17.095  1.00 43.89 ? 85   ALA G CA    1 
ATOM   7931  C  C     . ALA G  1 85  ? 25.067  24.006  17.642  1.00 44.28 ? 85   ALA G C     1 
ATOM   7932  O  O     . ALA G  1 85  ? 26.259  24.027  17.956  1.00 44.27 ? 85   ALA G O     1 
ATOM   7933  C  CB    . ALA G  1 85  ? 23.679  25.995  18.236  1.00 43.59 ? 85   ALA G CB    1 
ATOM   7934  N  N     . GLN G  1 86  ? 24.296  22.930  17.767  1.00 44.73 ? 86   GLN G N     1 
ATOM   7935  C  CA    . GLN G  1 86  ? 24.800  21.664  18.283  1.00 45.33 ? 86   GLN G CA    1 
ATOM   7936  C  C     . GLN G  1 86  ? 25.866  21.040  17.370  1.00 45.17 ? 86   GLN G C     1 
ATOM   7937  O  O     . GLN G  1 86  ? 26.888  20.564  17.855  1.00 45.26 ? 86   GLN G O     1 
ATOM   7938  C  CB    . GLN G  1 86  ? 23.636  20.694  18.545  1.00 45.40 ? 86   GLN G CB    1 
ATOM   7939  C  CG    . GLN G  1 86  ? 24.062  19.330  19.063  1.00 46.72 ? 86   GLN G CG    1 
ATOM   7940  C  CD    . GLN G  1 86  ? 22.890  18.406  19.368  1.00 48.16 ? 86   GLN G CD    1 
ATOM   7941  O  OE1   . GLN G  1 86  ? 22.903  17.702  20.377  1.00 48.12 ? 86   GLN G OE1   1 
ATOM   7942  N  NE2   . GLN G  1 86  ? 21.883  18.401  18.495  1.00 48.76 ? 86   GLN G NE2   1 
ATOM   7943  N  N     . GLU G  1 87  ? 25.622  21.053  16.060  1.00 45.15 ? 87   GLU G N     1 
ATOM   7944  C  CA    . GLU G  1 87  ? 26.606  20.589  15.080  1.00 45.25 ? 87   GLU G CA    1 
ATOM   7945  C  C     . GLU G  1 87  ? 27.865  21.468  15.108  1.00 44.74 ? 87   GLU G C     1 
ATOM   7946  O  O     . GLU G  1 87  ? 28.982  20.959  15.044  1.00 44.71 ? 87   GLU G O     1 
ATOM   7947  C  CB    . GLU G  1 87  ? 25.994  20.545  13.676  1.00 45.20 ? 87   GLU G CB    1 
ATOM   7948  C  CG    . GLU G  1 87  ? 24.992  19.412  13.468  1.00 47.13 ? 87   GLU G CG    1 
ATOM   7949  C  CD    . GLU G  1 87  ? 23.520  19.832  13.608  1.00 49.52 ? 87   GLU G CD    1 
ATOM   7950  O  OE1   . GLU G  1 87  ? 23.213  20.807  14.337  1.00 49.62 ? 87   GLU G OE1   1 
ATOM   7951  O  OE2   . GLU G  1 87  ? 22.651  19.167  12.990  1.00 50.29 ? 87   GLU G OE2   1 
ATOM   7952  N  N     . ALA G  1 88  ? 27.664  22.778  15.251  1.00 44.22 ? 88   ALA G N     1 
ATOM   7953  C  CA    . ALA G  1 88  ? 28.750  23.757  15.292  1.00 43.81 ? 88   ALA G CA    1 
ATOM   7954  C  C     . ALA G  1 88  ? 29.682  23.569  16.479  1.00 43.45 ? 88   ALA G C     1 
ATOM   7955  O  O     . ALA G  1 88  ? 30.872  23.863  16.392  1.00 43.26 ? 88   ALA G O     1 
ATOM   7956  C  CB    . ALA G  1 88  ? 28.184  25.168  15.292  1.00 43.63 ? 88   ALA G CB    1 
ATOM   7957  N  N     . LEU G  1 89  ? 29.127  23.075  17.581  1.00 43.12 ? 89   LEU G N     1 
ATOM   7958  C  CA    . LEU G  1 89  ? 29.875  22.887  18.823  1.00 42.81 ? 89   LEU G CA    1 
ATOM   7959  C  C     . LEU G  1 89  ? 30.925  21.769  18.740  1.00 42.14 ? 89   LEU G C     1 
ATOM   7960  O  O     . LEU G  1 89  ? 31.925  21.819  19.445  1.00 42.15 ? 89   LEU G O     1 
ATOM   7961  C  CB    . LEU G  1 89  ? 28.911  22.661  19.996  1.00 42.99 ? 89   LEU G CB    1 
ATOM   7962  C  CG    . LEU G  1 89  ? 28.894  23.611  21.208  1.00 43.93 ? 89   LEU G CG    1 
ATOM   7963  C  CD1   . LEU G  1 89  ? 29.391  25.025  20.909  1.00 43.98 ? 89   LEU G CD1   1 
ATOM   7964  C  CD2   . LEU G  1 89  ? 27.499  23.665  21.846  1.00 44.64 ? 89   LEU G CD2   1 
ATOM   7965  N  N     . GLY G  1 90  ? 30.702  20.782  17.871  1.00 41.38 ? 90   GLY G N     1 
ATOM   7966  C  CA    . GLY G  1 90  ? 31.623  19.662  17.722  1.00 40.43 ? 90   GLY G CA    1 
ATOM   7967  C  C     . GLY G  1 90  ? 32.686  19.868  16.655  1.00 39.64 ? 90   GLY G C     1 
ATOM   7968  O  O     . GLY G  1 90  ? 33.346  18.924  16.235  1.00 39.97 ? 90   GLY G O     1 
ATOM   7969  N  N     . VAL G  1 91  ? 32.862  21.118  16.243  1.00 38.44 ? 91   VAL G N     1 
ATOM   7970  C  CA    . VAL G  1 91  ? 33.680  21.468  15.090  1.00 37.06 ? 91   VAL G CA    1 
ATOM   7971  C  C     . VAL G  1 91  ? 34.688  22.559  15.483  1.00 35.86 ? 91   VAL G C     1 
ATOM   7972  O  O     . VAL G  1 91  ? 34.451  23.304  16.424  1.00 35.93 ? 91   VAL G O     1 
ATOM   7973  C  CB    . VAL G  1 91  ? 32.728  21.871  13.921  1.00 37.35 ? 91   VAL G CB    1 
ATOM   7974  C  CG1   . VAL G  1 91  ? 33.003  23.270  13.382  1.00 36.64 ? 91   VAL G CG1   1 
ATOM   7975  C  CG2   . VAL G  1 91  ? 32.721  20.789  12.820  1.00 36.75 ? 91   VAL G CG2   1 
ATOM   7976  N  N     . ALA G  1 92  ? 35.820  22.634  14.790  1.00 34.38 ? 92   ALA G N     1 
ATOM   7977  C  CA    . ALA G  1 92  ? 36.839  23.651  15.082  1.00 32.81 ? 92   ALA G CA    1 
ATOM   7978  C  C     . ALA G  1 92  ? 36.687  24.916  14.228  1.00 31.82 ? 92   ALA G C     1 
ATOM   7979  O  O     . ALA G  1 92  ? 37.038  26.008  14.663  1.00 31.61 ? 92   ALA G O     1 
ATOM   7980  C  CB    . ALA G  1 92  ? 38.231  23.066  14.906  1.00 32.53 ? 92   ALA G CB    1 
ATOM   7981  N  N     . VAL G  1 93  ? 36.169  24.749  13.015  1.00 30.53 ? 93   VAL G N     1 
ATOM   7982  C  CA    . VAL G  1 93  ? 36.094  25.819  12.022  1.00 29.70 ? 93   VAL G CA    1 
ATOM   7983  C  C     . VAL G  1 93  ? 34.682  25.894  11.437  1.00 29.28 ? 93   VAL G C     1 
ATOM   7984  O  O     . VAL G  1 93  ? 34.166  24.906  10.915  1.00 29.09 ? 93   VAL G O     1 
ATOM   7985  C  CB    . VAL G  1 93  ? 37.118  25.598  10.859  1.00 29.71 ? 93   VAL G CB    1 
ATOM   7986  C  CG1   . VAL G  1 93  ? 36.970  26.673  9.770   1.00 28.66 ? 93   VAL G CG1   1 
ATOM   7987  C  CG2   . VAL G  1 93  ? 38.547  25.548  11.388  1.00 28.79 ? 93   VAL G CG2   1 
ATOM   7988  N  N     . ILE G  1 94  ? 34.065  27.067  11.521  1.00 28.62 ? 94   ILE G N     1 
ATOM   7989  C  CA    . ILE G  1 94  ? 32.723  27.264  10.983  1.00 28.25 ? 94   ILE G CA    1 
ATOM   7990  C  C     . ILE G  1 94  ? 32.708  28.333  9.897   1.00 28.07 ? 94   ILE G C     1 
ATOM   7991  O  O     . ILE G  1 94  ? 33.114  29.470  10.130  1.00 27.98 ? 94   ILE G O     1 
ATOM   7992  C  CB    . ILE G  1 94  ? 31.708  27.628  12.090  1.00 27.98 ? 94   ILE G CB    1 
ATOM   7993  C  CG1   . ILE G  1 94  ? 31.614  26.511  13.127  1.00 28.20 ? 94   ILE G CG1   1 
ATOM   7994  C  CG2   . ILE G  1 94  ? 30.332  27.872  11.489  1.00 27.76 ? 94   ILE G CG2   1 
ATOM   7995  C  CD1   . ILE G  1 94  ? 31.440  27.006  14.550  1.00 27.79 ? 94   ILE G CD1   1 
ATOM   7996  N  N     . GLY G  1 95  ? 32.226  27.955  8.714   1.00 27.88 ? 95   GLY G N     1 
ATOM   7997  C  CA    . GLY G  1 95  ? 31.986  28.895  7.628   1.00 27.90 ? 95   GLY G CA    1 
ATOM   7998  C  C     . GLY G  1 95  ? 30.497  29.216  7.498   1.00 28.18 ? 95   GLY G C     1 
ATOM   7999  O  O     . GLY G  1 95  ? 29.661  28.314  7.547   1.00 28.06 ? 95   GLY G O     1 
ATOM   8000  N  N     . ILE G  1 96  ? 30.164  30.497  7.353   1.00 28.10 ? 96   ILE G N     1 
ATOM   8001  C  CA    . ILE G  1 96  ? 28.785  30.919  7.138   1.00 28.40 ? 96   ILE G CA    1 
ATOM   8002  C  C     . ILE G  1 96  ? 28.668  31.698  5.835   1.00 29.04 ? 96   ILE G C     1 
ATOM   8003  O  O     . ILE G  1 96  ? 29.258  32.776  5.679   1.00 29.02 ? 96   ILE G O     1 
ATOM   8004  C  CB    . ILE G  1 96  ? 28.227  31.776  8.334   1.00 28.23 ? 96   ILE G CB    1 
ATOM   8005  C  CG1   . ILE G  1 96  ? 28.139  30.957  9.614   1.00 27.30 ? 96   ILE G CG1   1 
ATOM   8006  C  CG2   . ILE G  1 96  ? 26.855  32.372  8.001   1.00 27.51 ? 96   ILE G CG2   1 
ATOM   8007  C  CD1   . ILE G  1 96  ? 28.450  31.748  10.829  1.00 26.79 ? 96   ILE G CD1   1 
ATOM   8008  N  N     . ASP G  1 97  ? 27.894  31.141  4.909   1.00 29.89 ? 97   ASP G N     1 
ATOM   8009  C  CA    . ASP G  1 97  ? 27.601  31.804  3.653   1.00 31.21 ? 97   ASP G CA    1 
ATOM   8010  C  C     . ASP G  1 97  ? 26.313  32.621  3.727   1.00 31.40 ? 97   ASP G C     1 
ATOM   8011  O  O     . ASP G  1 97  ? 25.306  32.166  4.283   1.00 31.61 ? 97   ASP G O     1 
ATOM   8012  C  CB    . ASP G  1 97  ? 27.527  30.810  2.499   1.00 31.26 ? 97   ASP G CB    1 
ATOM   8013  C  CG    . ASP G  1 97  ? 27.641  31.496  1.152   1.00 33.71 ? 97   ASP G CG    1 
ATOM   8014  O  OD1   . ASP G  1 97  ? 28.365  32.515  1.080   1.00 35.57 ? 97   ASP G OD1   1 
ATOM   8015  O  OD2   . ASP G  1 97  ? 27.046  31.110  0.112   1.00 37.86 ? 97   ASP G OD2   1 
ATOM   8016  N  N     . GLU G  1 98  ? 26.363  33.819  3.153   1.00 31.65 ? 98   GLU G N     1 
ATOM   8017  C  CA    . GLU G  1 98  ? 25.243  34.766  3.137   1.00 32.08 ? 98   GLU G CA    1 
ATOM   8018  C  C     . GLU G  1 98  ? 24.770  35.110  4.539   1.00 31.65 ? 98   GLU G C     1 
ATOM   8019  O  O     . GLU G  1 98  ? 23.589  34.968  4.875   1.00 31.62 ? 98   GLU G O     1 
ATOM   8020  C  CB    . GLU G  1 98  ? 24.095  34.270  2.260   1.00 31.97 ? 98   GLU G CB    1 
ATOM   8021  C  CG    . GLU G  1 98  ? 24.471  34.101  0.800   1.00 34.58 ? 98   GLU G CG    1 
ATOM   8022  C  CD    . GLU G  1 98  ? 23.303  33.649  -0.050  1.00 37.53 ? 98   GLU G CD    1 
ATOM   8023  O  OE1   . GLU G  1 98  ? 22.156  33.675  0.446   1.00 39.91 ? 98   GLU G OE1   1 
ATOM   8024  O  OE2   . GLU G  1 98  ? 23.529  33.265  -1.210  1.00 38.72 ? 98   GLU G OE2   1 
ATOM   8025  N  N     . GLY G  1 99  ? 25.717  35.567  5.348   1.00 31.40 ? 99   GLY G N     1 
ATOM   8026  C  CA    . GLY G  1 99  ? 25.476  35.860  6.749   1.00 31.02 ? 99   GLY G CA    1 
ATOM   8027  C  C     . GLY G  1 99  ? 24.431  36.929  7.010   1.00 30.81 ? 99   GLY G C     1 
ATOM   8028  O  O     . GLY G  1 99  ? 23.835  36.945  8.079   1.00 30.93 ? 99   GLY G O     1 
ATOM   8029  N  N     . GLN G  1 100 ? 24.215  37.819  6.040   1.00 30.57 ? 100  GLN G N     1 
ATOM   8030  C  CA    . GLN G  1 100 ? 23.224  38.896  6.173   1.00 30.48 ? 100  GLN G CA    1 
ATOM   8031  C  C     . GLN G  1 100 ? 21.792  38.400  6.426   1.00 30.85 ? 100  GLN G C     1 
ATOM   8032  O  O     . GLN G  1 100 ? 20.973  39.138  6.960   1.00 30.85 ? 100  GLN G O     1 
ATOM   8033  C  CB    . GLN G  1 100 ? 23.242  39.841  4.967   1.00 30.02 ? 100  GLN G CB    1 
ATOM   8034  C  CG    . GLN G  1 100 ? 22.682  39.252  3.668   1.00 29.52 ? 100  GLN G CG    1 
ATOM   8035  C  CD    . GLN G  1 100 ? 23.727  38.478  2.860   1.00 28.16 ? 100  GLN G CD    1 
ATOM   8036  O  OE1   . GLN G  1 100 ? 24.855  38.293  3.307   1.00 27.76 ? 100  GLN G OE1   1 
ATOM   8037  N  NE2   . GLN G  1 100 ? 23.349  38.041  1.671   1.00 27.15 ? 100  GLN G NE2   1 
ATOM   8038  N  N     . PHE G  1 101 ? 21.506  37.152  6.062   1.00 30.96 ? 101  PHE G N     1 
ATOM   8039  C  CA    . PHE G  1 101 ? 20.156  36.617  6.151   1.00 31.46 ? 101  PHE G CA    1 
ATOM   8040  C  C     . PHE G  1 101 ? 19.822  35.962  7.484   1.00 32.07 ? 101  PHE G C     1 
ATOM   8041  O  O     . PHE G  1 101 ? 18.660  35.639  7.739   1.00 32.32 ? 101  PHE G O     1 
ATOM   8042  C  CB    . PHE G  1 101 ? 19.901  35.627  5.012   1.00 31.25 ? 101  PHE G CB    1 
ATOM   8043  C  CG    . PHE G  1 101 ? 19.685  36.287  3.679   1.00 30.77 ? 101  PHE G CG    1 
ATOM   8044  C  CD1   . PHE G  1 101 ? 20.468  35.939  2.587   1.00 29.66 ? 101  PHE G CD1   1 
ATOM   8045  C  CD2   . PHE G  1 101 ? 18.703  37.273  3.523   1.00 29.33 ? 101  PHE G CD2   1 
ATOM   8046  C  CE1   . PHE G  1 101 ? 20.275  36.552  1.364   1.00 29.00 ? 101  PHE G CE1   1 
ATOM   8047  C  CE2   . PHE G  1 101 ? 18.500  37.882  2.304   1.00 28.43 ? 101  PHE G CE2   1 
ATOM   8048  C  CZ    . PHE G  1 101 ? 19.288  37.530  1.228   1.00 29.40 ? 101  PHE G CZ    1 
ATOM   8049  N  N     . PHE G  1 102 ? 20.831  35.764  8.331   1.00 32.45 ? 102  PHE G N     1 
ATOM   8050  C  CA    . PHE G  1 102 ? 20.599  35.199  9.649   1.00 32.74 ? 102  PHE G CA    1 
ATOM   8051  C  C     . PHE G  1 102 ? 20.404  36.300  10.687  1.00 33.41 ? 102  PHE G C     1 
ATOM   8052  O  O     . PHE G  1 102 ? 21.321  37.093  10.931  1.00 33.66 ? 102  PHE G O     1 
ATOM   8053  C  CB    . PHE G  1 102 ? 21.745  34.274  10.062  1.00 32.47 ? 102  PHE G CB    1 
ATOM   8054  C  CG    . PHE G  1 102 ? 21.948  33.114  9.142   1.00 31.53 ? 102  PHE G CG    1 
ATOM   8055  C  CD1   . PHE G  1 102 ? 21.155  31.972  9.254   1.00 30.21 ? 102  PHE G CD1   1 
ATOM   8056  C  CD2   . PHE G  1 102 ? 22.934  33.158  8.158   1.00 29.15 ? 102  PHE G CD2   1 
ATOM   8057  C  CE1   . PHE G  1 102 ? 21.346  30.895  8.390   1.00 29.87 ? 102  PHE G CE1   1 
ATOM   8058  C  CE2   . PHE G  1 102 ? 23.127  32.087  7.302   1.00 28.75 ? 102  PHE G CE2   1 
ATOM   8059  C  CZ    . PHE G  1 102 ? 22.343  30.957  7.413   1.00 28.90 ? 102  PHE G CZ    1 
ATOM   8060  N  N     . PRO G  1 103 ? 19.230  36.330  11.325  1.00 33.90 ? 103  PRO G N     1 
ATOM   8061  C  CA    . PRO G  1 103 ? 18.928  37.372  12.317  1.00 34.20 ? 103  PRO G CA    1 
ATOM   8062  C  C     . PRO G  1 103 ? 19.787  37.205  13.574  1.00 34.38 ? 103  PRO G C     1 
ATOM   8063  O  O     . PRO G  1 103 ? 19.997  38.179  14.298  1.00 34.59 ? 103  PRO G O     1 
ATOM   8064  C  CB    . PRO G  1 103 ? 17.428  37.179  12.632  1.00 34.22 ? 103  PRO G CB    1 
ATOM   8065  C  CG    . PRO G  1 103 ? 16.942  36.018  11.813  1.00 34.25 ? 103  PRO G CG    1 
ATOM   8066  C  CD    . PRO G  1 103 ? 18.140  35.343  11.188  1.00 34.07 ? 103  PRO G CD    1 
ATOM   8067  N  N     . ASP G  1 104 ? 20.296  35.993  13.798  1.00 34.23 ? 104  ASP G N     1 
ATOM   8068  C  CA    . ASP G  1 104 ? 21.145  35.713  14.952  1.00 34.33 ? 104  ASP G CA    1 
ATOM   8069  C  C     . ASP G  1 104 ? 22.658  35.614  14.653  1.00 34.08 ? 104  ASP G C     1 
ATOM   8070  O  O     . ASP G  1 104 ? 23.404  35.036  15.436  1.00 33.92 ? 104  ASP G O     1 
ATOM   8071  C  CB    . ASP G  1 104 ? 20.624  34.497  15.756  1.00 33.97 ? 104  ASP G CB    1 
ATOM   8072  C  CG    . ASP G  1 104 ? 20.561  33.189  14.942  1.00 34.86 ? 104  ASP G CG    1 
ATOM   8073  O  OD1   . ASP G  1 104 ? 20.675  33.184  13.688  1.00 34.46 ? 104  ASP G OD1   1 
ATOM   8074  O  OD2   . ASP G  1 104 ? 20.386  32.090  15.508  1.00 34.75 ? 104  ASP G OD2   1 
ATOM   8075  N  N     . ILE G  1 105 ? 23.102  36.220  13.551  1.00 33.90 ? 105  ILE G N     1 
ATOM   8076  C  CA    . ILE G  1 105 ? 24.517  36.159  13.144  1.00 33.80 ? 105  ILE G CA    1 
ATOM   8077  C  C     . ILE G  1 105 ? 25.506  36.652  14.221  1.00 33.90 ? 105  ILE G C     1 
ATOM   8078  O  O     . ILE G  1 105 ? 26.527  36.014  14.452  1.00 33.71 ? 105  ILE G O     1 
ATOM   8079  C  CB    . ILE G  1 105 ? 24.762  36.855  11.749  1.00 33.68 ? 105  ILE G CB    1 
ATOM   8080  C  CG1   . ILE G  1 105 ? 26.172  36.584  11.216  1.00 33.54 ? 105  ILE G CG1   1 
ATOM   8081  C  CG2   . ILE G  1 105 ? 24.549  38.355  11.826  1.00 33.15 ? 105  ILE G CG2   1 
ATOM   8082  C  CD1   . ILE G  1 105 ? 26.420  35.185  10.743  1.00 32.22 ? 105  ILE G CD1   1 
ATOM   8083  N  N     . VAL G  1 106 ? 25.178  37.757  14.889  1.00 34.03 ? 106  VAL G N     1 
ATOM   8084  C  CA    . VAL G  1 106 ? 26.082  38.392  15.851  1.00 34.34 ? 106  VAL G CA    1 
ATOM   8085  C  C     . VAL G  1 106 ? 26.315  37.525  17.089  1.00 34.64 ? 106  VAL G C     1 
ATOM   8086  O  O     . VAL G  1 106 ? 27.458  37.233  17.446  1.00 34.68 ? 106  VAL G O     1 
ATOM   8087  C  CB    . VAL G  1 106 ? 25.566  39.792  16.293  1.00 34.23 ? 106  VAL G CB    1 
ATOM   8088  C  CG1   . VAL G  1 106 ? 26.480  40.391  17.331  1.00 33.88 ? 106  VAL G CG1   1 
ATOM   8089  C  CG2   . VAL G  1 106 ? 25.460  40.712  15.106  1.00 34.03 ? 106  VAL G CG2   1 
ATOM   8090  N  N     . GLU G  1 107 ? 25.226  37.108  17.727  1.00 34.60 ? 107  GLU G N     1 
ATOM   8091  C  CA    . GLU G  1 107 ? 25.308  36.315  18.945  1.00 35.01 ? 107  GLU G CA    1 
ATOM   8092  C  C     . GLU G  1 107 ? 25.928  34.940  18.700  1.00 34.30 ? 107  GLU G C     1 
ATOM   8093  O  O     . GLU G  1 107 ? 26.687  34.450  19.530  1.00 34.24 ? 107  GLU G O     1 
ATOM   8094  C  CB    . GLU G  1 107 ? 23.945  36.197  19.646  1.00 35.22 ? 107  GLU G CB    1 
ATOM   8095  C  CG    . GLU G  1 107 ? 22.739  36.365  18.737  1.00 37.92 ? 107  GLU G CG    1 
ATOM   8096  C  CD    . GLU G  1 107 ? 22.468  37.808  18.361  1.00 40.97 ? 107  GLU G CD    1 
ATOM   8097  O  OE1   . GLU G  1 107 ? 22.530  38.687  19.239  1.00 42.80 ? 107  GLU G OE1   1 
ATOM   8098  O  OE2   . GLU G  1 107 ? 22.204  38.063  17.175  1.00 41.62 ? 107  GLU G OE2   1 
ATOM   8099  N  N     . PHE G  1 108 ? 25.616  34.334  17.557  1.00 33.51 ? 108  PHE G N     1 
ATOM   8100  C  CA    . PHE G  1 108 ? 26.189  33.041  17.195  1.00 33.06 ? 108  PHE G CA    1 
ATOM   8101  C  C     . PHE G  1 108 ? 27.720  33.113  16.998  1.00 32.96 ? 108  PHE G C     1 
ATOM   8102  O  O     . PHE G  1 108 ? 28.471  32.320  17.567  1.00 32.75 ? 108  PHE G O     1 
ATOM   8103  C  CB    . PHE G  1 108 ? 25.506  32.480  15.937  1.00 32.84 ? 108  PHE G CB    1 
ATOM   8104  C  CG    . PHE G  1 108 ? 26.092  31.174  15.441  1.00 32.35 ? 108  PHE G CG    1 
ATOM   8105  C  CD1   . PHE G  1 108 ? 25.544  29.958  15.834  1.00 31.63 ? 108  PHE G CD1   1 
ATOM   8106  C  CD2   . PHE G  1 108 ? 27.186  31.165  14.569  1.00 32.25 ? 108  PHE G CD2   1 
ATOM   8107  C  CE1   . PHE G  1 108 ? 26.070  28.741  15.368  1.00 32.34 ? 108  PHE G CE1   1 
ATOM   8108  C  CE2   . PHE G  1 108 ? 27.733  29.950  14.104  1.00 33.21 ? 108  PHE G CE2   1 
ATOM   8109  C  CZ    . PHE G  1 108 ? 27.165  28.736  14.501  1.00 32.19 ? 108  PHE G CZ    1 
ATOM   8110  N  N     . CYS G  1 109 ? 28.170  34.068  16.196  1.00 32.73 ? 109  CYS G N     1 
ATOM   8111  C  CA    . CYS G  1 109 ? 29.589  34.203  15.894  1.00 33.03 ? 109  CYS G CA    1 
ATOM   8112  C  C     . CYS G  1 109 ? 30.410  34.528  17.141  1.00 33.08 ? 109  CYS G C     1 
ATOM   8113  O  O     . CYS G  1 109 ? 31.475  33.945  17.373  1.00 32.66 ? 109  CYS G O     1 
ATOM   8114  C  CB    . CYS G  1 109 ? 29.806  35.279  14.838  1.00 32.66 ? 109  CYS G CB    1 
ATOM   8115  S  SG    . CYS G  1 109 ? 29.298  34.764  13.203  1.00 32.37 ? 109  CYS G SG    1 
ATOM   8116  N  N     . GLU G  1 110 ? 29.893  35.451  17.938  1.00 33.33 ? 110  GLU G N     1 
ATOM   8117  C  CA    . GLU G  1 110 ? 30.554  35.866  19.157  1.00 33.83 ? 110  GLU G CA    1 
ATOM   8118  C  C     . GLU G  1 110 ? 30.657  34.690  20.133  1.00 33.68 ? 110  GLU G C     1 
ATOM   8119  O  O     . GLU G  1 110 ? 31.727  34.425  20.684  1.00 33.74 ? 110  GLU G O     1 
ATOM   8120  C  CB    . GLU G  1 110 ? 29.832  37.076  19.752  1.00 33.61 ? 110  GLU G CB    1 
ATOM   8121  C  CG    . GLU G  1 110 ? 30.488  37.711  20.965  1.00 36.01 ? 110  GLU G CG    1 
ATOM   8122  C  CD    . GLU G  1 110 ? 31.918  38.219  20.750  1.00 36.96 ? 110  GLU G CD    1 
ATOM   8123  O  OE1   . GLU G  1 110 ? 32.585  38.439  21.780  1.00 36.88 ? 110  GLU G OE1   1 
ATOM   8124  O  OE2   . GLU G  1 110 ? 32.380  38.407  19.594  1.00 37.15 ? 110  GLU G OE2   1 
ATOM   8125  N  N     . ALA G  1 111 ? 29.559  33.959  20.310  1.00 33.35 ? 111  ALA G N     1 
ATOM   8126  C  CA    . ALA G  1 111 ? 29.553  32.793  21.192  1.00 33.25 ? 111  ALA G CA    1 
ATOM   8127  C  C     . ALA G  1 111 ? 30.507  31.683  20.717  1.00 33.01 ? 111  ALA G C     1 
ATOM   8128  O  O     . ALA G  1 111 ? 31.202  31.077  21.524  1.00 33.11 ? 111  ALA G O     1 
ATOM   8129  C  CB    . ALA G  1 111 ? 28.133  32.247  21.370  1.00 32.60 ? 111  ALA G CB    1 
ATOM   8130  N  N     . MET G  1 112 ? 30.532  31.421  19.415  1.00 32.74 ? 112  MET G N     1 
ATOM   8131  C  CA    . MET G  1 112 ? 31.423  30.393  18.869  1.00 32.76 ? 112  MET G CA    1 
ATOM   8132  C  C     . MET G  1 112 ? 32.908  30.802  18.936  1.00 32.56 ? 112  MET G C     1 
ATOM   8133  O  O     . MET G  1 112 ? 33.758  29.974  19.248  1.00 32.27 ? 112  MET G O     1 
ATOM   8134  C  CB    . MET G  1 112 ? 31.022  29.972  17.443  1.00 32.60 ? 112  MET G CB    1 
ATOM   8135  C  CG    . MET G  1 112 ? 29.690  29.209  17.335  1.00 33.06 ? 112  MET G CG    1 
ATOM   8136  S  SD    . MET G  1 112 ? 29.626  27.657  18.269  1.00 35.69 ? 112  MET G SD    1 
ATOM   8137  C  CE    . MET G  1 112 ? 27.848  27.549  18.703  1.00 36.46 ? 112  MET G CE    1 
ATOM   8138  N  N     . ALA G  1 113 ? 33.215  32.074  18.672  1.00 32.41 ? 113  ALA G N     1 
ATOM   8139  C  CA    . ALA G  1 113 ? 34.601  32.552  18.780  1.00 32.68 ? 113  ALA G CA    1 
ATOM   8140  C  C     . ALA G  1 113 ? 35.095  32.555  20.223  1.00 32.83 ? 113  ALA G C     1 
ATOM   8141  O  O     . ALA G  1 113 ? 36.260  32.220  20.480  1.00 32.79 ? 113  ALA G O     1 
ATOM   8142  C  CB    . ALA G  1 113 ? 34.783  33.915  18.145  1.00 32.17 ? 113  ALA G CB    1 
ATOM   8143  N  N     . ASN G  1 114 ? 34.209  32.911  21.153  1.00 32.95 ? 114  ASN G N     1 
ATOM   8144  C  CA    . ASN G  1 114 ? 34.526  32.879  22.582  1.00 33.30 ? 114  ASN G CA    1 
ATOM   8145  C  C     . ASN G  1 114 ? 34.678  31.459  23.137  1.00 33.50 ? 114  ASN G C     1 
ATOM   8146  O  O     . ASN G  1 114 ? 35.348  31.253  24.146  1.00 33.88 ? 114  ASN G O     1 
ATOM   8147  C  CB    . ASN G  1 114 ? 33.511  33.707  23.382  1.00 32.87 ? 114  ASN G CB    1 
ATOM   8148  C  CG    . ASN G  1 114 ? 33.654  35.202  23.118  1.00 33.41 ? 114  ASN G CG    1 
ATOM   8149  O  OD1   . ASN G  1 114 ? 34.751  35.689  22.823  1.00 33.59 ? 114  ASN G OD1   1 
ATOM   8150  N  ND2   . ASN G  1 114 ? 32.547  35.933  23.197  1.00 32.35 ? 114  ASN G ND2   1 
ATOM   8151  N  N     . ALA G  1 115 ? 34.075  30.484  22.459  1.00 33.43 ? 115  ALA G N     1 
ATOM   8152  C  CA    . ALA G  1 115 ? 34.247  29.073  22.793  1.00 33.31 ? 115  ALA G CA    1 
ATOM   8153  C  C     . ALA G  1 115 ? 35.463  28.471  22.070  1.00 33.18 ? 115  ALA G C     1 
ATOM   8154  O  O     . ALA G  1 115 ? 35.656  27.258  22.077  1.00 33.36 ? 115  ALA G O     1 
ATOM   8155  C  CB    . ALA G  1 115 ? 32.961  28.278  22.482  1.00 32.87 ? 115  ALA G CB    1 
ATOM   8156  N  N     . GLY G  1 116 ? 36.272  29.322  21.443  1.00 32.94 ? 116  GLY G N     1 
ATOM   8157  C  CA    . GLY G  1 116 ? 37.506  28.889  20.806  1.00 32.47 ? 116  GLY G CA    1 
ATOM   8158  C  C     . GLY G  1 116 ? 37.449  28.452  19.343  1.00 32.17 ? 116  GLY G C     1 
ATOM   8159  O  O     . GLY G  1 116 ? 38.426  27.925  18.826  1.00 32.30 ? 116  GLY G O     1 
ATOM   8160  N  N     . LYS G  1 117 ? 36.325  28.671  18.671  1.00 31.63 ? 117  LYS G N     1 
ATOM   8161  C  CA    . LYS G  1 117 ? 36.188  28.314  17.253  1.00 31.18 ? 117  LYS G CA    1 
ATOM   8162  C  C     . LYS G  1 117 ? 36.630  29.439  16.298  1.00 30.57 ? 117  LYS G C     1 
ATOM   8163  O  O     . LYS G  1 117 ? 36.544  30.628  16.633  1.00 30.41 ? 117  LYS G O     1 
ATOM   8164  C  CB    . LYS G  1 117 ? 34.733  27.933  16.951  1.00 31.27 ? 117  LYS G CB    1 
ATOM   8165  C  CG    . LYS G  1 117 ? 34.349  26.520  17.385  1.00 31.87 ? 117  LYS G CG    1 
ATOM   8166  C  CD    . LYS G  1 117 ? 33.656  26.509  18.730  1.00 32.83 ? 117  LYS G CD    1 
ATOM   8167  C  CE    . LYS G  1 117 ? 32.914  25.185  18.985  1.00 32.75 ? 117  LYS G CE    1 
ATOM   8168  N  NZ    . LYS G  1 117 ? 33.825  24.002  19.073  1.00 31.12 ? 117  LYS G NZ    1 
ATOM   8169  N  N     . THR G  1 118 ? 37.101  29.053  15.111  1.00 29.54 ? 118  THR G N     1 
ATOM   8170  C  CA    . THR G  1 118 ? 37.348  30.004  14.028  1.00 28.48 ? 118  THR G CA    1 
ATOM   8171  C  C     . THR G  1 118 ? 36.082  30.108  13.192  1.00 27.93 ? 118  THR G C     1 
ATOM   8172  O  O     . THR G  1 118 ? 35.645  29.125  12.604  1.00 28.05 ? 118  THR G O     1 
ATOM   8173  C  CB    . THR G  1 118 ? 38.538  29.553  13.131  1.00 28.66 ? 118  THR G CB    1 
ATOM   8174  O  OG1   . THR G  1 118 ? 39.767  29.622  13.865  1.00 27.96 ? 118  THR G OG1   1 
ATOM   8175  C  CG2   . THR G  1 118 ? 38.754  30.535  11.993  1.00 27.16 ? 118  THR G CG2   1 
ATOM   8176  N  N     . VAL G  1 119 ? 35.500  31.304  13.147  1.00 27.16 ? 119  VAL G N     1 
ATOM   8177  C  CA    . VAL G  1 119 ? 34.278  31.558  12.393  1.00 26.34 ? 119  VAL G CA    1 
ATOM   8178  C  C     . VAL G  1 119 ? 34.566  32.485  11.210  1.00 26.10 ? 119  VAL G C     1 
ATOM   8179  O  O     . VAL G  1 119 ? 35.081  33.585  11.388  1.00 26.00 ? 119  VAL G O     1 
ATOM   8180  C  CB    . VAL G  1 119 ? 33.163  32.186  13.287  1.00 26.61 ? 119  VAL G CB    1 
ATOM   8181  C  CG1   . VAL G  1 119 ? 31.802  32.107  12.597  1.00 25.76 ? 119  VAL G CG1   1 
ATOM   8182  C  CG2   . VAL G  1 119 ? 33.106  31.504  14.646  1.00 25.86 ? 119  VAL G CG2   1 
ATOM   8183  N  N     . ILE G  1 120 ? 34.234  32.028  10.004  1.00 25.47 ? 120  ILE G N     1 
ATOM   8184  C  CA    . ILE G  1 120 ? 34.449  32.802  8.788   1.00 24.76 ? 120  ILE G CA    1 
ATOM   8185  C  C     . ILE G  1 120 ? 33.107  33.078  8.119   1.00 24.60 ? 120  ILE G C     1 
ATOM   8186  O  O     . ILE G  1 120 ? 32.322  32.158  7.860   1.00 24.66 ? 120  ILE G O     1 
ATOM   8187  C  CB    . ILE G  1 120 ? 35.443  32.085  7.812   1.00 24.85 ? 120  ILE G CB    1 
ATOM   8188  C  CG1   . ILE G  1 120 ? 36.752  31.731  8.528   1.00 24.97 ? 120  ILE G CG1   1 
ATOM   8189  C  CG2   . ILE G  1 120 ? 35.756  32.981  6.604   1.00 24.03 ? 120  ILE G CG2   1 
ATOM   8190  C  CD1   . ILE G  1 120 ? 37.627  30.735  7.767   1.00 25.31 ? 120  ILE G CD1   1 
ATOM   8191  N  N     . VAL G  1 121 ? 32.844  34.352  7.857   1.00 24.09 ? 121  VAL G N     1 
ATOM   8192  C  CA    . VAL G  1 121 ? 31.532  34.791  7.409   1.00 23.91 ? 121  VAL G CA    1 
ATOM   8193  C  C     . VAL G  1 121 ? 31.632  35.522  6.076   1.00 24.00 ? 121  VAL G C     1 
ATOM   8194  O  O     . VAL G  1 121 ? 32.328  36.532  5.971   1.00 24.14 ? 121  VAL G O     1 
ATOM   8195  C  CB    . VAL G  1 121 ? 30.868  35.730  8.452   1.00 24.18 ? 121  VAL G CB    1 
ATOM   8196  C  CG1   . VAL G  1 121 ? 29.528  36.288  7.929   1.00 23.65 ? 121  VAL G CG1   1 
ATOM   8197  C  CG2   . VAL G  1 121 ? 30.681  35.017  9.789   1.00 23.93 ? 121  VAL G CG2   1 
ATOM   8198  N  N     . ALA G  1 122 ? 30.951  34.995  5.059   1.00 23.91 ? 122  ALA G N     1 
ATOM   8199  C  CA    . ALA G  1 122 ? 30.795  35.701  3.789   1.00 23.86 ? 122  ALA G CA    1 
ATOM   8200  C  C     . ALA G  1 122 ? 29.425  36.375  3.789   1.00 24.06 ? 122  ALA G C     1 
ATOM   8201  O  O     . ALA G  1 122 ? 28.416  35.749  4.145   1.00 23.91 ? 122  ALA G O     1 
ATOM   8202  C  CB    . ALA G  1 122 ? 30.931  34.750  2.632   1.00 23.41 ? 122  ALA G CB    1 
ATOM   8203  N  N     . ALA G  1 123 ? 29.396  37.653  3.429   1.00 24.34 ? 123  ALA G N     1 
ATOM   8204  C  CA    . ALA G  1 123 ? 28.164  38.436  3.500   1.00 24.87 ? 123  ALA G CA    1 
ATOM   8205  C  C     . ALA G  1 123 ? 28.187  39.706  2.663   1.00 25.46 ? 123  ALA G C     1 
ATOM   8206  O  O     . ALA G  1 123 ? 29.223  40.343  2.480   1.00 25.30 ? 123  ALA G O     1 
ATOM   8207  C  CB    . ALA G  1 123 ? 27.835  38.778  4.945   1.00 24.69 ? 123  ALA G CB    1 
ATOM   8208  N  N     . LEU G  1 124 ? 27.013  40.047  2.152   1.00 26.41 ? 124  LEU G N     1 
ATOM   8209  C  CA    . LEU G  1 124 ? 26.748  41.338  1.552   1.00 27.57 ? 124  LEU G CA    1 
ATOM   8210  C  C     . LEU G  1 124 ? 26.845  42.386  2.643   1.00 28.41 ? 124  LEU G C     1 
ATOM   8211  O  O     . LEU G  1 124 ? 26.245  42.222  3.698   1.00 28.80 ? 124  LEU G O     1 
ATOM   8212  C  CB    . LEU G  1 124 ? 25.318  41.333  1.031   1.00 27.42 ? 124  LEU G CB    1 
ATOM   8213  C  CG    . LEU G  1 124 ? 25.007  41.443  -0.462  1.00 27.86 ? 124  LEU G CG    1 
ATOM   8214  C  CD1   . LEU G  1 124 ? 26.114  40.937  -1.360  1.00 25.64 ? 124  LEU G CD1   1 
ATOM   8215  C  CD2   . LEU G  1 124 ? 23.720  40.727  -0.729  1.00 27.26 ? 124  LEU G CD2   1 
ATOM   8216  N  N     . ASP G  1 125 ? 27.596  43.453  2.413   1.00 29.28 ? 125  ASP G N     1 
ATOM   8217  C  CA    . ASP G  1 125 ? 27.597  44.561  3.364   1.00 30.26 ? 125  ASP G CA    1 
ATOM   8218  C  C     . ASP G  1 125 ? 26.397  45.490  3.122   1.00 30.19 ? 125  ASP G C     1 
ATOM   8219  O  O     . ASP G  1 125 ? 25.831  46.034  4.072   1.00 30.50 ? 125  ASP G O     1 
ATOM   8220  C  CB    . ASP G  1 125 ? 28.914  45.340  3.303   1.00 30.74 ? 125  ASP G CB    1 
ATOM   8221  C  CG    . ASP G  1 125 ? 29.242  45.809  1.913   1.00 32.30 ? 125  ASP G CG    1 
ATOM   8222  O  OD1   . ASP G  1 125 ? 29.415  47.028  1.740   1.00 35.52 ? 125  ASP G OD1   1 
ATOM   8223  O  OD2   . ASP G  1 125 ? 29.325  45.045  0.927   1.00 34.74 ? 125  ASP G OD2   1 
ATOM   8224  N  N     . GLY G  1 126 ? 26.006  45.650  1.857   1.00 29.65 ? 126  GLY G N     1 
ATOM   8225  C  CA    . GLY G  1 126 ? 24.896  46.509  1.506   1.00 29.20 ? 126  GLY G CA    1 
ATOM   8226  C  C     . GLY G  1 126 ? 23.771  45.848  0.733   1.00 29.08 ? 126  GLY G C     1 
ATOM   8227  O  O     . GLY G  1 126 ? 23.984  44.893  -0.024  1.00 29.02 ? 126  GLY G O     1 
ATOM   8228  N  N     . THR G  1 127 ? 22.565  46.369  0.927   1.00 28.78 ? 127  THR G N     1 
ATOM   8229  C  CA    . THR G  1 127 ? 21.416  45.973  0.129   1.00 28.66 ? 127  THR G CA    1 
ATOM   8230  C  C     . THR G  1 127 ? 21.481  46.684  -1.218  1.00 28.83 ? 127  THR G C     1 
ATOM   8231  O  O     . THR G  1 127 ? 22.438  47.411  -1.500  1.00 28.56 ? 127  THR G O     1 
ATOM   8232  C  CB    . THR G  1 127 ? 20.080  46.338  0.833   1.00 28.76 ? 127  THR G CB    1 
ATOM   8233  O  OG1   . THR G  1 127 ? 19.939  47.764  0.866   1.00 28.80 ? 127  THR G OG1   1 
ATOM   8234  C  CG2   . THR G  1 127 ? 20.071  45.929  2.306   1.00 27.55 ? 127  THR G CG2   1 
ATOM   8235  N  N     . PHE G  1 128 ? 20.448  46.477  -2.035  1.00 29.09 ? 128  PHE G N     1 
ATOM   8236  C  CA    . PHE G  1 128 ? 20.285  47.171  -3.310  1.00 29.60 ? 128  PHE G CA    1 
ATOM   8237  C  C     . PHE G  1 128 ? 20.129  48.682  -3.151  1.00 30.10 ? 128  PHE G C     1 
ATOM   8238  O  O     . PHE G  1 128 ? 20.237  49.437  -4.124  1.00 30.18 ? 128  PHE G O     1 
ATOM   8239  C  CB    . PHE G  1 128 ? 19.095  46.593  -4.091  1.00 29.69 ? 128  PHE G CB    1 
ATOM   8240  C  CG    . PHE G  1 128 ? 17.735  46.973  -3.534  1.00 29.84 ? 128  PHE G CG    1 
ATOM   8241  C  CD1   . PHE G  1 128 ? 16.910  47.868  -4.231  1.00 30.25 ? 128  PHE G CD1   1 
ATOM   8242  C  CD2   . PHE G  1 128 ? 17.264  46.409  -2.345  1.00 28.72 ? 128  PHE G CD2   1 
ATOM   8243  C  CE1   . PHE G  1 128 ? 15.634  48.213  -3.742  1.00 29.90 ? 128  PHE G CE1   1 
ATOM   8244  C  CE2   . PHE G  1 128 ? 16.006  46.741  -1.843  1.00 29.94 ? 128  PHE G CE2   1 
ATOM   8245  C  CZ    . PHE G  1 128 ? 15.180  47.650  -2.547  1.00 30.61 ? 128  PHE G CZ    1 
ATOM   8246  N  N     . GLN G  1 129 ? 19.876  49.120  -1.921  1.00 30.69 ? 129  GLN G N     1 
ATOM   8247  C  CA    . GLN G  1 129 ? 19.761  50.545  -1.629  1.00 31.43 ? 129  GLN G CA    1 
ATOM   8248  C  C     . GLN G  1 129 ? 21.045  51.121  -1.016  1.00 31.51 ? 129  GLN G C     1 
ATOM   8249  O  O     . GLN G  1 129 ? 21.073  52.283  -0.613  1.00 31.49 ? 129  GLN G O     1 
ATOM   8250  C  CB    . GLN G  1 129 ? 18.544  50.813  -0.730  1.00 31.32 ? 129  GLN G CB    1 
ATOM   8251  C  CG    . GLN G  1 129 ? 17.218  50.370  -1.338  1.00 32.87 ? 129  GLN G CG    1 
ATOM   8252  C  CD    . GLN G  1 129 ? 16.014  50.689  -0.455  1.00 35.69 ? 129  GLN G CD    1 
ATOM   8253  O  OE1   . GLN G  1 129 ? 15.053  51.318  -0.915  1.00 36.85 ? 129  GLN G OE1   1 
ATOM   8254  N  NE2   . GLN G  1 129 ? 16.058  50.255  0.805   1.00 34.82 ? 129  GLN G NE2   1 
ATOM   8255  N  N     . ARG G  1 130 ? 22.098  50.302  -0.953  1.00 31.64 ? 130  ARG G N     1 
ATOM   8256  C  CA    . ARG G  1 130 ? 23.380  50.692  -0.357  1.00 31.85 ? 130  ARG G CA    1 
ATOM   8257  C  C     . ARG G  1 130 ? 23.226  51.047  1.130   1.00 31.93 ? 130  ARG G C     1 
ATOM   8258  O  O     . ARG G  1 130 ? 23.912  51.927  1.656   1.00 31.96 ? 130  ARG G O     1 
ATOM   8259  C  CB    . ARG G  1 130 ? 24.036  51.836  -1.152  1.00 31.58 ? 130  ARG G CB    1 
ATOM   8260  C  CG    . ARG G  1 130 ? 24.535  51.439  -2.549  1.00 32.58 ? 130  ARG G CG    1 
ATOM   8261  C  CD    . ARG G  1 130 ? 25.628  52.362  -3.117  1.00 35.03 ? 130  ARG G CD    1 
ATOM   8262  N  NE    . ARG G  1 130 ? 25.254  53.753  -2.924  1.00 37.42 ? 130  ARG G NE    1 
ATOM   8263  C  CZ    . ARG G  1 130 ? 26.074  54.749  -2.633  1.00 37.77 ? 130  ARG G CZ    1 
ATOM   8264  N  NH1   . ARG G  1 130 ? 27.385  54.567  -2.507  1.00 38.42 ? 130  ARG G NH1   1 
ATOM   8265  N  NH2   . ARG G  1 130 ? 25.559  55.950  -2.467  1.00 37.52 ? 130  ARG G NH2   1 
ATOM   8266  N  N     . LYS G  1 131 ? 22.314  50.340  1.792   1.00 31.98 ? 131  LYS G N     1 
ATOM   8267  C  CA    . LYS G  1 131 ? 22.105  50.449  3.231   1.00 32.39 ? 131  LYS G CA    1 
ATOM   8268  C  C     . LYS G  1 131 ? 22.646  49.179  3.891   1.00 31.93 ? 131  LYS G C     1 
ATOM   8269  O  O     . LYS G  1 131 ? 22.752  48.150  3.224   1.00 31.82 ? 131  LYS G O     1 
ATOM   8270  C  CB    . LYS G  1 131 ? 20.613  50.637  3.543   1.00 32.51 ? 131  LYS G CB    1 
ATOM   8271  C  CG    . LYS G  1 131 ? 20.050  51.958  2.999   1.00 35.16 ? 131  LYS G CG    1 
ATOM   8272  C  CD    . LYS G  1 131 ? 18.573  52.160  3.338   1.00 38.70 ? 131  LYS G CD    1 
ATOM   8273  C  CE    . LYS G  1 131 ? 18.407  53.296  4.345   1.00 41.31 ? 131  LYS G CE    1 
ATOM   8274  N  NZ    . LYS G  1 131 ? 17.022  53.866  4.361   1.00 42.75 ? 131  LYS G NZ    1 
ATOM   8275  N  N     . PRO G  1 132 ? 23.038  49.261  5.166   1.00 31.79 ? 132  PRO G N     1 
ATOM   8276  C  CA    . PRO G  1 132 ? 23.400  48.072  5.954   1.00 31.60 ? 132  PRO G CA    1 
ATOM   8277  C  C     . PRO G  1 132 ? 22.433  46.912  5.745   1.00 31.61 ? 132  PRO G C     1 
ATOM   8278  O  O     . PRO G  1 132 ? 21.223  47.101  5.829   1.00 31.39 ? 132  PRO G O     1 
ATOM   8279  C  CB    . PRO G  1 132 ? 23.297  48.566  7.401   1.00 31.59 ? 132  PRO G CB    1 
ATOM   8280  C  CG    . PRO G  1 132 ? 23.013  50.074  7.317   1.00 31.98 ? 132  PRO G CG    1 
ATOM   8281  C  CD    . PRO G  1 132 ? 23.236  50.512  5.925   1.00 31.33 ? 132  PRO G CD    1 
ATOM   8282  N  N     . PHE G  1 133 ? 22.967  45.728  5.478   1.00 31.70 ? 133  PHE G N     1 
ATOM   8283  C  CA    . PHE G  1 133 ? 22.135  44.567  5.222   1.00 31.96 ? 133  PHE G CA    1 
ATOM   8284  C  C     . PHE G  1 133 ? 21.942  43.780  6.510   1.00 32.53 ? 133  PHE G C     1 
ATOM   8285  O  O     . PHE G  1 133 ? 22.843  43.053  6.947   1.00 32.71 ? 133  PHE G O     1 
ATOM   8286  C  CB    . PHE G  1 133 ? 22.754  43.695  4.129   1.00 31.45 ? 133  PHE G CB    1 
ATOM   8287  C  CG    . PHE G  1 133 ? 21.764  42.845  3.398   1.00 30.86 ? 133  PHE G CG    1 
ATOM   8288  C  CD1   . PHE G  1 133 ? 21.944  42.564  2.049   1.00 29.99 ? 133  PHE G CD1   1 
ATOM   8289  C  CD2   . PHE G  1 133 ? 20.654  42.311  4.055   1.00 29.59 ? 133  PHE G CD2   1 
ATOM   8290  C  CE1   . PHE G  1 133 ? 21.035  41.772  1.368   1.00 30.47 ? 133  PHE G CE1   1 
ATOM   8291  C  CE2   . PHE G  1 133 ? 19.748  41.516  3.383   1.00 29.48 ? 133  PHE G CE2   1 
ATOM   8292  C  CZ    . PHE G  1 133 ? 19.931  41.249  2.039   1.00 29.85 ? 133  PHE G CZ    1 
ATOM   8293  N  N     . GLY G  1 134 ? 20.761  43.936  7.115   1.00 32.97 ? 134  GLY G N     1 
ATOM   8294  C  CA    . GLY G  1 134 ? 20.452  43.287  8.379   1.00 33.14 ? 134  GLY G CA    1 
ATOM   8295  C  C     . GLY G  1 134 ? 21.387  43.738  9.489   1.00 33.16 ? 134  GLY G C     1 
ATOM   8296  O  O     . GLY G  1 134 ? 21.696  44.926  9.594   1.00 33.18 ? 134  GLY G O     1 
ATOM   8297  N  N     . ALA G  1 135 ? 21.852  42.777  10.288  1.00 33.13 ? 135  ALA G N     1 
ATOM   8298  C  CA    . ALA G  1 135 ? 22.667  43.052  11.470  1.00 33.01 ? 135  ALA G CA    1 
ATOM   8299  C  C     . ALA G  1 135 ? 24.160  42.867  11.198  1.00 32.86 ? 135  ALA G C     1 
ATOM   8300  O  O     . ALA G  1 135 ? 24.986  42.999  12.100  1.00 32.82 ? 135  ALA G O     1 
ATOM   8301  C  CB    . ALA G  1 135 ? 22.224  42.150  12.619  1.00 32.66 ? 135  ALA G CB    1 
ATOM   8302  N  N     . ILE G  1 136 ? 24.501  42.585  9.950   1.00 32.83 ? 136  ILE G N     1 
ATOM   8303  C  CA    . ILE G  1 136 ? 25.836  42.097  9.609   1.00 32.83 ? 136  ILE G CA    1 
ATOM   8304  C  C     . ILE G  1 136 ? 27.011  43.029  9.958   1.00 32.51 ? 136  ILE G C     1 
ATOM   8305  O  O     . ILE G  1 136 ? 28.089  42.553  10.299  1.00 32.43 ? 136  ILE G O     1 
ATOM   8306  C  CB    . ILE G  1 136 ? 25.860  41.557  8.136   1.00 33.18 ? 136  ILE G CB    1 
ATOM   8307  C  CG1   . ILE G  1 136 ? 26.628  40.222  8.061   1.00 33.19 ? 136  ILE G CG1   1 
ATOM   8308  C  CG2   . ILE G  1 136 ? 26.287  42.617  7.112   1.00 32.59 ? 136  ILE G CG2   1 
ATOM   8309  C  CD1   . ILE G  1 136 ? 28.128  40.352  8.056   1.00 34.89 ? 136  ILE G CD1   1 
ATOM   8310  N  N     . LEU G  1 137 ? 26.788  44.341  9.935   1.00 32.20 ? 137  LEU G N     1 
ATOM   8311  C  CA    . LEU G  1 137 ? 27.849  45.299  10.244  1.00 31.85 ? 137  LEU G CA    1 
ATOM   8312  C  C     . LEU G  1 137 ? 28.230  45.337  11.725  1.00 31.74 ? 137  LEU G C     1 
ATOM   8313  O  O     . LEU G  1 137 ? 29.342  45.766  12.069  1.00 31.53 ? 137  LEU G O     1 
ATOM   8314  C  CB    . LEU G  1 137 ? 27.498  46.704  9.735   1.00 31.82 ? 137  LEU G CB    1 
ATOM   8315  C  CG    . LEU G  1 137 ? 27.328  46.867  8.218   1.00 32.41 ? 137  LEU G CG    1 
ATOM   8316  C  CD1   . LEU G  1 137 ? 26.996  48.306  7.867   1.00 32.12 ? 137  LEU G CD1   1 
ATOM   8317  C  CD2   . LEU G  1 137 ? 28.549  46.376  7.413   1.00 32.86 ? 137  LEU G CD2   1 
ATOM   8318  N  N     . ASN G  1 138 ? 27.320  44.887  12.594  1.00 31.41 ? 138  ASN G N     1 
ATOM   8319  C  CA    . ASN G  1 138 ? 27.622  44.701  14.024  1.00 31.23 ? 138  ASN G CA    1 
ATOM   8320  C  C     . ASN G  1 138 ? 28.751  43.695  14.276  1.00 30.65 ? 138  ASN G C     1 
ATOM   8321  O  O     . ASN G  1 138 ? 29.338  43.675  15.361  1.00 30.51 ? 138  ASN G O     1 
ATOM   8322  C  CB    . ASN G  1 138 ? 26.384  44.250  14.820  1.00 31.33 ? 138  ASN G CB    1 
ATOM   8323  C  CG    . ASN G  1 138 ? 25.299  45.317  14.904  1.00 32.94 ? 138  ASN G CG    1 
ATOM   8324  O  OD1   . ASN G  1 138 ? 25.571  46.501  15.110  1.00 33.82 ? 138  ASN G OD1   1 
ATOM   8325  N  ND2   . ASN G  1 138 ? 24.049  44.887  14.757  1.00 34.71 ? 138  ASN G ND2   1 
ATOM   8326  N  N     . LEU G  1 139 ? 29.034  42.859  13.279  1.00 30.11 ? 139  LEU G N     1 
ATOM   8327  C  CA    . LEU G  1 139 ? 30.147  41.920  13.337  1.00 29.78 ? 139  LEU G CA    1 
ATOM   8328  C  C     . LEU G  1 139 ? 31.505  42.609  13.251  1.00 29.47 ? 139  LEU G C     1 
ATOM   8329  O  O     . LEU G  1 139 ? 32.474  42.126  13.824  1.00 29.61 ? 139  LEU G O     1 
ATOM   8330  C  CB    . LEU G  1 139 ? 30.043  40.908  12.197  1.00 29.96 ? 139  LEU G CB    1 
ATOM   8331  C  CG    . LEU G  1 139 ? 29.401  39.533  12.385  1.00 29.96 ? 139  LEU G CG    1 
ATOM   8332  C  CD1   . LEU G  1 139 ? 29.999  38.607  11.354  1.00 30.39 ? 139  LEU G CD1   1 
ATOM   8333  C  CD2   . LEU G  1 139 ? 29.572  38.972  13.786  1.00 29.89 ? 139  LEU G CD2   1 
ATOM   8334  N  N     . VAL G  1 140 ? 31.571  43.732  12.538  1.00 29.13 ? 140  VAL G N     1 
ATOM   8335  C  CA    . VAL G  1 140 ? 32.845  44.399  12.255  1.00 29.05 ? 140  VAL G CA    1 
ATOM   8336  C  C     . VAL G  1 140 ? 33.668  44.749  13.513  1.00 29.21 ? 140  VAL G C     1 
ATOM   8337  O  O     . VAL G  1 140 ? 34.858  44.406  13.563  1.00 29.42 ? 140  VAL G O     1 
ATOM   8338  C  CB    . VAL G  1 140 ? 32.677  45.632  11.304  1.00 29.23 ? 140  VAL G CB    1 
ATOM   8339  C  CG1   . VAL G  1 140 ? 34.014  46.340  11.068  1.00 28.96 ? 140  VAL G CG1   1 
ATOM   8340  C  CG2   . VAL G  1 140 ? 32.050  45.211  9.981   1.00 28.57 ? 140  VAL G CG2   1 
ATOM   8341  N  N     . PRO G  1 141 ? 33.065  45.406  14.518  1.00 29.00 ? 141  PRO G N     1 
ATOM   8342  C  CA    . PRO G  1 141 ? 33.766  45.678  15.780  1.00 28.86 ? 141  PRO G CA    1 
ATOM   8343  C  C     . PRO G  1 141 ? 34.145  44.420  16.567  1.00 29.02 ? 141  PRO G C     1 
ATOM   8344  O  O     . PRO G  1 141 ? 34.982  44.520  17.472  1.00 29.07 ? 141  PRO G O     1 
ATOM   8345  C  CB    . PRO G  1 141 ? 32.745  46.508  16.570  1.00 28.81 ? 141  PRO G CB    1 
ATOM   8346  C  CG    . PRO G  1 141 ? 31.855  47.073  15.541  1.00 28.86 ? 141  PRO G CG    1 
ATOM   8347  C  CD    . PRO G  1 141 ? 31.700  45.964  14.541  1.00 28.89 ? 141  PRO G CD    1 
ATOM   8348  N  N     . LEU G  1 142 ? 33.542  43.275  16.239  1.00 28.88 ? 142  LEU G N     1 
ATOM   8349  C  CA    . LEU G  1 142 ? 33.814  42.019  16.941  1.00 28.88 ? 142  LEU G CA    1 
ATOM   8350  C  C     . LEU G  1 142 ? 34.819  41.137  16.194  1.00 28.92 ? 142  LEU G C     1 
ATOM   8351  O  O     . LEU G  1 142 ? 35.294  40.135  16.737  1.00 28.84 ? 142  LEU G O     1 
ATOM   8352  C  CB    . LEU G  1 142 ? 32.512  41.237  17.178  1.00 28.75 ? 142  LEU G CB    1 
ATOM   8353  C  CG    . LEU G  1 142 ? 31.353  41.949  17.892  1.00 28.53 ? 142  LEU G CG    1 
ATOM   8354  C  CD1   . LEU G  1 142 ? 30.047  41.279  17.580  1.00 28.01 ? 142  LEU G CD1   1 
ATOM   8355  C  CD2   . LEU G  1 142 ? 31.557  42.003  19.388  1.00 27.55 ? 142  LEU G CD2   1 
ATOM   8356  N  N     . ALA G  1 143 ? 35.140  41.514  14.957  1.00 28.78 ? 143  ALA G N     1 
ATOM   8357  C  CA    . ALA G  1 143 ? 35.961  40.681  14.086  1.00 28.99 ? 143  ALA G CA    1 
ATOM   8358  C  C     . ALA G  1 143 ? 37.459  40.999  14.149  1.00 29.20 ? 143  ALA G C     1 
ATOM   8359  O  O     . ALA G  1 143 ? 37.855  42.161  14.225  1.00 29.24 ? 143  ALA G O     1 
ATOM   8360  C  CB    . ALA G  1 143 ? 35.459  40.774  12.643  1.00 28.69 ? 143  ALA G CB    1 
ATOM   8361  N  N     . GLU G  1 144 ? 38.292  39.967  14.096  1.00 29.59 ? 144  GLU G N     1 
ATOM   8362  C  CA    . GLU G  1 144 ? 39.743  40.201  14.025  1.00 30.29 ? 144  GLU G CA    1 
ATOM   8363  C  C     . GLU G  1 144 ? 40.226  40.453  12.607  1.00 29.95 ? 144  GLU G C     1 
ATOM   8364  O  O     . GLU G  1 144 ? 41.301  41.007  12.414  1.00 30.17 ? 144  GLU G O     1 
ATOM   8365  C  CB    . GLU G  1 144 ? 40.614  39.130  14.725  1.00 30.26 ? 144  GLU G CB    1 
ATOM   8366  C  CG    . GLU G  1 144 ? 39.985  37.802  15.073  1.00 32.27 ? 144  GLU G CG    1 
ATOM   8367  C  CD    . GLU G  1 144 ? 38.997  37.874  16.231  1.00 33.07 ? 144  GLU G CD    1 
ATOM   8368  O  OE1   . GLU G  1 144 ? 39.405  37.728  17.408  1.00 33.09 ? 144  GLU G OE1   1 
ATOM   8369  O  OE2   . GLU G  1 144 ? 37.800  38.058  15.941  1.00 32.38 ? 144  GLU G OE2   1 
ATOM   8370  N  N     . SER G  1 145 ? 39.414  40.070  11.626  1.00 29.59 ? 145  SER G N     1 
ATOM   8371  C  CA    . SER G  1 145 ? 39.745  40.291  10.224  1.00 29.11 ? 145  SER G CA    1 
ATOM   8372  C  C     . SER G  1 145 ? 38.500  40.695  9.427   1.00 28.84 ? 145  SER G C     1 
ATOM   8373  O  O     . SER G  1 145 ? 37.461  40.029  9.494   1.00 28.61 ? 145  SER G O     1 
ATOM   8374  C  CB    . SER G  1 145 ? 40.397  39.041  9.615   1.00 28.89 ? 145  SER G CB    1 
ATOM   8375  O  OG    . SER G  1 145 ? 40.222  39.021  8.204   1.00 28.50 ? 145  SER G OG    1 
ATOM   8376  N  N     . VAL G  1 146 ? 38.618  41.792  8.681   1.00 28.40 ? 146  VAL G N     1 
ATOM   8377  C  CA    . VAL G  1 146 ? 37.537  42.274  7.822   1.00 28.06 ? 146  VAL G CA    1 
ATOM   8378  C  C     . VAL G  1 146 ? 38.106  42.680  6.480   1.00 27.89 ? 146  VAL G C     1 
ATOM   8379  O  O     . VAL G  1 146 ? 39.048  43.462  6.414   1.00 27.91 ? 146  VAL G O     1 
ATOM   8380  C  CB    . VAL G  1 146 ? 36.785  43.482  8.432   1.00 27.94 ? 146  VAL G CB    1 
ATOM   8381  C  CG1   . VAL G  1 146 ? 35.642  43.919  7.518   1.00 28.02 ? 146  VAL G CG1   1 
ATOM   8382  C  CG2   . VAL G  1 146 ? 36.256  43.153  9.812   1.00 27.91 ? 146  VAL G CG2   1 
ATOM   8383  N  N     . VAL G  1 147 ? 37.516  42.144  5.419   1.00 27.83 ? 147  VAL G N     1 
ATOM   8384  C  CA    . VAL G  1 147 ? 37.921  42.437  4.049   1.00 27.87 ? 147  VAL G CA    1 
ATOM   8385  C  C     . VAL G  1 147 ? 36.669  42.755  3.230   1.00 27.75 ? 147  VAL G C     1 
ATOM   8386  O  O     . VAL G  1 147 ? 35.588  42.219  3.496   1.00 27.33 ? 147  VAL G O     1 
ATOM   8387  C  CB    . VAL G  1 147 ? 38.709  41.216  3.449   1.00 28.19 ? 147  VAL G CB    1 
ATOM   8388  C  CG1   . VAL G  1 147 ? 37.776  40.181  2.801   1.00 27.50 ? 147  VAL G CG1   1 
ATOM   8389  C  CG2   . VAL G  1 147 ? 39.761  41.660  2.485   1.00 29.29 ? 147  VAL G CG2   1 
ATOM   8390  N  N     . LYS G  1 148 ? 36.803  43.654  2.261   1.00 27.77 ? 148  LYS G N     1 
ATOM   8391  C  CA    . LYS G  1 148 ? 35.739  43.885  1.293   1.00 27.78 ? 148  LYS G CA    1 
ATOM   8392  C  C     . LYS G  1 148 ? 36.232  43.587  -0.124  1.00 27.76 ? 148  LYS G C     1 
ATOM   8393  O  O     . LYS G  1 148 ? 37.141  44.248  -0.620  1.00 27.70 ? 148  LYS G O     1 
ATOM   8394  C  CB    . LYS G  1 148 ? 35.164  45.302  1.391   1.00 27.90 ? 148  LYS G CB    1 
ATOM   8395  C  CG    . LYS G  1 148 ? 33.777  45.420  0.778   1.00 27.79 ? 148  LYS G CG    1 
ATOM   8396  C  CD    . LYS G  1 148 ? 33.292  46.855  0.696   1.00 29.48 ? 148  LYS G CD    1 
ATOM   8397  C  CE    . LYS G  1 148 ? 32.163  46.967  -0.317  1.00 30.75 ? 148  LYS G CE    1 
ATOM   8398  N  NZ    . LYS G  1 148 ? 31.234  48.082  -0.009  1.00 32.57 ? 148  LYS G NZ    1 
ATOM   8399  N  N     . LEU G  1 149 ? 35.627  42.585  -0.757  1.00 27.83 ? 149  LEU G N     1 
ATOM   8400  C  CA    . LEU G  1 149 ? 36.009  42.187  -2.114  1.00 27.98 ? 149  LEU G CA    1 
ATOM   8401  C  C     . LEU G  1 149 ? 35.349  43.077  -3.155  1.00 28.43 ? 149  LEU G C     1 
ATOM   8402  O  O     . LEU G  1 149 ? 34.399  43.816  -2.871  1.00 28.73 ? 149  LEU G O     1 
ATOM   8403  C  CB    . LEU G  1 149 ? 35.674  40.723  -2.400  1.00 27.29 ? 149  LEU G CB    1 
ATOM   8404  C  CG    . LEU G  1 149 ? 36.276  39.625  -1.532  1.00 27.35 ? 149  LEU G CG    1 
ATOM   8405  C  CD1   . LEU G  1 149 ? 35.795  38.268  -2.015  1.00 25.40 ? 149  LEU G CD1   1 
ATOM   8406  C  CD2   . LEU G  1 149 ? 37.811  39.685  -1.489  1.00 26.62 ? 149  LEU G CD2   1 
ATOM   8407  N  N     . THR G  1 150 ? 35.859  42.985  -4.374  1.00 28.77 ? 150  THR G N     1 
ATOM   8408  C  CA    . THR G  1 150 ? 35.397  43.814  -5.473  1.00 29.28 ? 150  THR G CA    1 
ATOM   8409  C  C     . THR G  1 150 ? 34.823  42.944  -6.582  1.00 28.91 ? 150  THR G C     1 
ATOM   8410  O  O     . THR G  1 150 ? 35.243  41.801  -6.768  1.00 28.74 ? 150  THR G O     1 
ATOM   8411  C  CB    . THR G  1 150 ? 36.567  44.721  -5.993  1.00 29.93 ? 150  THR G CB    1 
ATOM   8412  O  OG1   . THR G  1 150 ? 36.053  45.732  -6.869  1.00 32.87 ? 150  THR G OG1   1 
ATOM   8413  C  CG2   . THR G  1 150 ? 37.539  43.956  -6.901  1.00 29.38 ? 150  THR G CG2   1 
ATOM   8414  N  N     . ALA G  1 151 ? 33.841  43.475  -7.298  1.00 28.73 ? 151  ALA G N     1 
ATOM   8415  C  CA    . ALA G  1 151 ? 33.320  42.811  -8.493  1.00 28.91 ? 151  ALA G CA    1 
ATOM   8416  C  C     . ALA G  1 151 ? 33.680  43.620  -9.745  1.00 29.06 ? 151  ALA G C     1 
ATOM   8417  O  O     . ALA G  1 151 ? 34.327  44.672  -9.657  1.00 28.99 ? 151  ALA G O     1 
ATOM   8418  C  CB    . ALA G  1 151 ? 31.794  42.605  -8.387  1.00 28.37 ? 151  ALA G CB    1 
ATOM   8419  N  N     . VAL G  1 152 ? 33.273  43.125  -10.908 1.00 29.44 ? 152  VAL G N     1 
ATOM   8420  C  CA    . VAL G  1 152 ? 33.390  43.899  -12.139 1.00 29.98 ? 152  VAL G CA    1 
ATOM   8421  C  C     . VAL G  1 152 ? 32.036  44.544  -12.461 1.00 30.38 ? 152  VAL G C     1 
ATOM   8422  O  O     . VAL G  1 152 ? 30.997  43.882  -12.373 1.00 30.09 ? 152  VAL G O     1 
ATOM   8423  C  CB    . VAL G  1 152 ? 33.927  43.027  -13.297 1.00 29.70 ? 152  VAL G CB    1 
ATOM   8424  C  CG1   . VAL G  1 152 ? 33.941  43.795  -14.610 1.00 29.36 ? 152  VAL G CG1   1 
ATOM   8425  C  CG2   . VAL G  1 152 ? 35.326  42.539  -12.963 1.00 29.35 ? 152  VAL G CG2   1 
ATOM   8426  N  N     . CYS G  1 153 ? 32.052  45.839  -12.800 1.00 31.14 ? 153  CYS G N     1 
ATOM   8427  C  CA    . CYS G  1 153 ? 30.820  46.545  -13.163 1.00 32.00 ? 153  CYS G CA    1 
ATOM   8428  C  C     . CYS G  1 153 ? 30.271  45.948  -14.445 1.00 32.86 ? 153  CYS G C     1 
ATOM   8429  O  O     . CYS G  1 153 ? 30.955  45.915  -15.465 1.00 32.78 ? 153  CYS G O     1 
ATOM   8430  C  CB    . CYS G  1 153 ? 31.036  48.060  -13.314 1.00 32.02 ? 153  CYS G CB    1 
ATOM   8431  S  SG    . CYS G  1 153 ? 29.534  48.996  -13.754 1.00 31.04 ? 153  CYS G SG    1 
ATOM   8432  N  N     . MET G  1 154 ? 29.039  45.458  -14.370 1.00 33.86 ? 154  MET G N     1 
ATOM   8433  C  CA    . MET G  1 154 ? 28.406  44.790  -15.494 1.00 34.97 ? 154  MET G CA    1 
ATOM   8434  C  C     . MET G  1 154 ? 27.897  45.780  -16.546 1.00 35.90 ? 154  MET G C     1 
ATOM   8435  O  O     . MET G  1 154 ? 27.405  45.369  -17.602 1.00 36.32 ? 154  MET G O     1 
ATOM   8436  C  CB    . MET G  1 154 ? 27.289  43.864  -14.999 1.00 34.84 ? 154  MET G CB    1 
ATOM   8437  C  CG    . MET G  1 154 ? 27.808  42.601  -14.308 1.00 34.58 ? 154  MET G CG    1 
ATOM   8438  S  SD    . MET G  1 154 ? 26.560  41.705  -13.350 1.00 34.76 ? 154  MET G SD    1 
ATOM   8439  C  CE    . MET G  1 154 ? 27.492  40.246  -12.908 1.00 36.83 ? 154  MET G CE    1 
ATOM   8440  N  N     . GLU G  1 155 ? 28.045  47.077  -16.271 1.00 36.71 ? 155  GLU G N     1 
ATOM   8441  C  CA    . GLU G  1 155 ? 27.574  48.112  -17.187 1.00 37.53 ? 155  GLU G CA    1 
ATOM   8442  C  C     . GLU G  1 155 ? 28.697  48.908  -17.842 1.00 37.68 ? 155  GLU G C     1 
ATOM   8443  O  O     . GLU G  1 155 ? 28.566  49.315  -18.997 1.00 37.96 ? 155  GLU G O     1 
ATOM   8444  C  CB    . GLU G  1 155 ? 26.549  49.029  -16.506 1.00 37.71 ? 155  GLU G CB    1 
ATOM   8445  C  CG    . GLU G  1 155 ? 25.104  48.594  -16.760 1.00 39.82 ? 155  GLU G CG    1 
ATOM   8446  C  CD    . GLU G  1 155 ? 24.143  48.924  -15.624 1.00 42.03 ? 155  GLU G CD    1 
ATOM   8447  O  OE1   . GLU G  1 155 ? 23.524  47.984  -15.076 1.00 42.97 ? 155  GLU G OE1   1 
ATOM   8448  O  OE2   . GLU G  1 155 ? 23.984  50.122  -15.286 1.00 42.93 ? 155  GLU G OE2   1 
ATOM   8449  N  N     . CYS G  1 156 ? 29.794  49.134  -17.120 1.00 37.80 ? 156  CYS G N     1 
ATOM   8450  C  CA    . CYS G  1 156 ? 30.937  49.878  -17.670 1.00 37.90 ? 156  CYS G CA    1 
ATOM   8451  C  C     . CYS G  1 156 ? 32.270  49.125  -17.562 1.00 38.16 ? 156  CYS G C     1 
ATOM   8452  O  O     . CYS G  1 156 ? 33.291  49.583  -18.085 1.00 38.06 ? 156  CYS G O     1 
ATOM   8453  C  CB    . CYS G  1 156 ? 31.048  51.281  -17.051 1.00 37.60 ? 156  CYS G CB    1 
ATOM   8454  S  SG    . CYS G  1 156 ? 31.981  51.400  -15.497 1.00 37.96 ? 156  CYS G SG    1 
ATOM   8455  N  N     . PHE G  1 157 ? 32.251  47.984  -16.869 1.00 38.48 ? 157  PHE G N     1 
ATOM   8456  C  CA    . PHE G  1 157 ? 33.404  47.071  -16.770 1.00 38.87 ? 157  PHE G CA    1 
ATOM   8457  C  C     . PHE G  1 157 ? 34.614  47.582  -15.967 1.00 38.85 ? 157  PHE G C     1 
ATOM   8458  O  O     . PHE G  1 157 ? 35.701  47.006  -16.043 1.00 39.14 ? 157  PHE G O     1 
ATOM   8459  C  CB    . PHE G  1 157 ? 33.803  46.525  -18.161 1.00 38.94 ? 157  PHE G CB    1 
ATOM   8460  C  CG    . PHE G  1 157 ? 32.630  46.028  -18.961 1.00 39.94 ? 157  PHE G CG    1 
ATOM   8461  C  CD1   . PHE G  1 157 ? 32.164  46.750  -20.059 1.00 40.53 ? 157  PHE G CD1   1 
ATOM   8462  C  CD2   . PHE G  1 157 ? 31.960  44.861  -18.590 1.00 39.92 ? 157  PHE G CD2   1 
ATOM   8463  C  CE1   . PHE G  1 157 ? 31.058  46.305  -20.788 1.00 40.86 ? 157  PHE G CE1   1 
ATOM   8464  C  CE2   . PHE G  1 157 ? 30.856  44.408  -19.307 1.00 40.37 ? 157  PHE G CE2   1 
ATOM   8465  C  CZ    . PHE G  1 157 ? 30.403  45.130  -20.411 1.00 40.93 ? 157  PHE G CZ    1 
ATOM   8466  N  N     . ARG G  1 158 ? 34.415  48.647  -15.193 1.00 38.75 ? 158  ARG G N     1 
ATOM   8467  C  CA    . ARG G  1 158 ? 35.389  49.055  -14.181 1.00 38.75 ? 158  ARG G CA    1 
ATOM   8468  C  C     . ARG G  1 158 ? 35.122  48.291  -12.880 1.00 37.85 ? 158  ARG G C     1 
ATOM   8469  O  O     . ARG G  1 158 ? 34.268  47.407  -12.843 1.00 37.70 ? 158  ARG G O     1 
ATOM   8470  C  CB    . ARG G  1 158 ? 35.329  50.567  -13.949 1.00 39.23 ? 158  ARG G CB    1 
ATOM   8471  C  CG    . ARG G  1 158 ? 35.979  51.385  -15.058 1.00 42.52 ? 158  ARG G CG    1 
ATOM   8472  C  CD    . ARG G  1 158 ? 36.231  52.840  -14.691 1.00 48.19 ? 158  ARG G CD    1 
ATOM   8473  N  NE    . ARG G  1 158 ? 37.519  53.334  -15.199 1.00 52.57 ? 158  ARG G NE    1 
ATOM   8474  C  CZ    . ARG G  1 158 ? 37.647  54.248  -16.165 1.00 54.08 ? 158  ARG G CZ    1 
ATOM   8475  N  NH1   . ARG G  1 158 ? 36.571  54.772  -16.743 1.00 54.34 ? 158  ARG G NH1   1 
ATOM   8476  N  NH2   . ARG G  1 158 ? 38.854  54.637  -16.561 1.00 54.75 ? 158  ARG G NH2   1 
ATOM   8477  N  N     . GLU G  1 159 ? 35.850  48.629  -11.817 1.00 37.08 ? 159  GLU G N     1 
ATOM   8478  C  CA    . GLU G  1 159 ? 35.668  47.998  -10.510 1.00 36.44 ? 159  GLU G CA    1 
ATOM   8479  C  C     . GLU G  1 159 ? 34.297  48.318  -9.898  1.00 34.94 ? 159  GLU G C     1 
ATOM   8480  O  O     . GLU G  1 159 ? 33.888  49.470  -9.862  1.00 34.59 ? 159  GLU G O     1 
ATOM   8481  C  CB    . GLU G  1 159 ? 36.773  48.448  -9.558  1.00 37.03 ? 159  GLU G CB    1 
ATOM   8482  C  CG    . GLU G  1 159 ? 37.882  47.425  -9.360  1.00 40.66 ? 159  GLU G CG    1 
ATOM   8483  C  CD    . GLU G  1 159 ? 38.591  47.560  -8.013  1.00 45.30 ? 159  GLU G CD    1 
ATOM   8484  O  OE1   . GLU G  1 159 ? 38.204  48.448  -7.208  1.00 46.11 ? 159  GLU G OE1   1 
ATOM   8485  O  OE2   . GLU G  1 159 ? 39.540  46.774  -7.754  1.00 46.56 ? 159  GLU G OE2   1 
ATOM   8486  N  N     . ALA G  1 160 ? 33.602  47.291  -9.416  1.00 33.35 ? 160  ALA G N     1 
ATOM   8487  C  CA    . ALA G  1 160 ? 32.277  47.453  -8.826  1.00 32.14 ? 160  ALA G CA    1 
ATOM   8488  C  C     . ALA G  1 160 ? 32.302  47.203  -7.319  1.00 31.37 ? 160  ALA G C     1 
ATOM   8489  O  O     . ALA G  1 160 ? 32.880  46.222  -6.843  1.00 31.12 ? 160  ALA G O     1 
ATOM   8490  C  CB    . ALA G  1 160 ? 31.288  46.518  -9.494  1.00 31.92 ? 160  ALA G CB    1 
ATOM   8491  N  N     . ALA G  1 161 ? 31.666  48.097  -6.574  1.00 30.45 ? 161  ALA G N     1 
ATOM   8492  C  CA    . ALA G  1 161 ? 31.568  47.950  -5.129  1.00 29.75 ? 161  ALA G CA    1 
ATOM   8493  C  C     . ALA G  1 161 ? 30.129  47.722  -4.654  1.00 29.43 ? 161  ALA G C     1 
ATOM   8494  O  O     . ALA G  1 161 ? 29.911  47.343  -3.503  1.00 29.14 ? 161  ALA G O     1 
ATOM   8495  C  CB    . ALA G  1 161 ? 32.179  49.137  -4.444  1.00 29.46 ? 161  ALA G CB    1 
ATOM   8496  N  N     . TYR G  1 162 ? 29.156  47.923  -5.543  1.00 29.27 ? 162  TYR G N     1 
ATOM   8497  C  CA    . TYR G  1 162 ? 27.742  47.874  -5.156  1.00 29.35 ? 162  TYR G CA    1 
ATOM   8498  C  C     . TYR G  1 162 ? 26.901  46.934  -5.997  1.00 29.43 ? 162  TYR G C     1 
ATOM   8499  O  O     . TYR G  1 162 ? 27.341  46.455  -7.038  1.00 29.14 ? 162  TYR G O     1 
ATOM   8500  C  CB    . TYR G  1 162 ? 27.117  49.275  -5.159  1.00 29.04 ? 162  TYR G CB    1 
ATOM   8501  C  CG    . TYR G  1 162 ? 28.077  50.330  -4.704  1.00 29.62 ? 162  TYR G CG    1 
ATOM   8502  C  CD1   . TYR G  1 162 ? 28.649  51.218  -5.619  1.00 29.47 ? 162  TYR G CD1   1 
ATOM   8503  C  CD2   . TYR G  1 162 ? 28.451  50.423  -3.366  1.00 29.09 ? 162  TYR G CD2   1 
ATOM   8504  C  CE1   . TYR G  1 162 ? 29.553  52.180  -5.209  1.00 30.47 ? 162  TYR G CE1   1 
ATOM   8505  C  CE2   . TYR G  1 162 ? 29.350  51.389  -2.947  1.00 30.28 ? 162  TYR G CE2   1 
ATOM   8506  C  CZ    . TYR G  1 162 ? 29.901  52.261  -3.876  1.00 30.60 ? 162  TYR G CZ    1 
ATOM   8507  O  OH    . TYR G  1 162 ? 30.790  53.219  -3.469  1.00 31.32 ? 162  TYR G OH    1 
ATOM   8508  N  N     . THR G  1 163 ? 25.686  46.679  -5.517  1.00 29.82 ? 163  THR G N     1 
ATOM   8509  C  CA    . THR G  1 163 ? 24.729  45.843  -6.215  1.00 30.43 ? 163  THR G CA    1 
ATOM   8510  C  C     . THR G  1 163 ? 23.488  46.652  -6.552  1.00 31.34 ? 163  THR G C     1 
ATOM   8511  O  O     . THR G  1 163 ? 22.857  47.239  -5.665  1.00 31.35 ? 163  THR G O     1 
ATOM   8512  C  CB    . THR G  1 163 ? 24.314  44.640  -5.352  1.00 30.24 ? 163  THR G CB    1 
ATOM   8513  O  OG1   . THR G  1 163 ? 25.469  44.018  -4.772  1.00 29.48 ? 163  THR G OG1   1 
ATOM   8514  C  CG2   . THR G  1 163 ? 23.710  43.571  -6.229  1.00 29.94 ? 163  THR G CG2   1 
ATOM   8515  N  N     . LYS G  1 164 ? 23.132  46.655  -7.831  1.00 32.34 ? 164  LYS G N     1 
ATOM   8516  C  CA    . LYS G  1 164 ? 21.925  47.319  -8.308  1.00 33.61 ? 164  LYS G CA    1 
ATOM   8517  C  C     . LYS G  1 164 ? 20.843  46.272  -8.568  1.00 34.18 ? 164  LYS G C     1 
ATOM   8518  O  O     . LYS G  1 164 ? 21.099  45.241  -9.197  1.00 33.96 ? 164  LYS G O     1 
ATOM   8519  C  CB    . LYS G  1 164 ? 22.246  48.113  -9.582  1.00 33.74 ? 164  LYS G CB    1 
ATOM   8520  C  CG    . LYS G  1 164 ? 21.060  48.697  -10.344 1.00 35.42 ? 164  LYS G CG    1 
ATOM   8521  C  CD    . LYS G  1 164 ? 21.450  50.021  -11.016 1.00 38.00 ? 164  LYS G CD    1 
ATOM   8522  C  CE    . LYS G  1 164 ? 21.342  49.953  -12.532 1.00 40.39 ? 164  LYS G CE    1 
ATOM   8523  N  NZ    . LYS G  1 164 ? 22.229  50.957  -13.221 1.00 41.36 ? 164  LYS G NZ    1 
ATOM   8524  N  N     . ARG G  1 165 ? 19.635  46.529  -8.075  1.00 35.28 ? 165  ARG G N     1 
ATOM   8525  C  CA    . ARG G  1 165 ? 18.484  45.682  -8.422  1.00 36.46 ? 165  ARG G CA    1 
ATOM   8526  C  C     . ARG G  1 165 ? 17.899  46.143  -9.761  1.00 37.39 ? 165  ARG G C     1 
ATOM   8527  O  O     . ARG G  1 165 ? 17.712  47.337  -9.988  1.00 37.41 ? 165  ARG G O     1 
ATOM   8528  C  CB    . ARG G  1 165 ? 17.425  45.714  -7.317  1.00 36.22 ? 165  ARG G CB    1 
ATOM   8529  C  CG    . ARG G  1 165 ? 16.171  44.920  -7.621  1.00 35.38 ? 165  ARG G CG    1 
ATOM   8530  C  CD    . ARG G  1 165 ? 15.219  44.824  -6.460  1.00 34.65 ? 165  ARG G CD    1 
ATOM   8531  N  NE    . ARG G  1 165 ? 15.754  43.973  -5.402  1.00 34.17 ? 165  ARG G NE    1 
ATOM   8532  C  CZ    . ARG G  1 165 ? 15.289  43.927  -4.163  1.00 33.97 ? 165  ARG G CZ    1 
ATOM   8533  N  NH1   . ARG G  1 165 ? 14.257  44.692  -3.807  1.00 33.56 ? 165  ARG G NH1   1 
ATOM   8534  N  NH2   . ARG G  1 165 ? 15.861  43.115  -3.272  1.00 32.23 ? 165  ARG G NH2   1 
ATOM   8535  N  N     . LEU G  1 166 ? 17.632  45.190  -10.645 1.00 38.84 ? 166  LEU G N     1 
ATOM   8536  C  CA    . LEU G  1 166 ? 17.151  45.504  -11.992 1.00 40.45 ? 166  LEU G CA    1 
ATOM   8537  C  C     . LEU G  1 166 ? 15.647  45.795  -12.029 1.00 41.55 ? 166  LEU G C     1 
ATOM   8538  O  O     . LEU G  1 166 ? 15.213  46.733  -12.698 1.00 41.79 ? 166  LEU G O     1 
ATOM   8539  C  CB    . LEU G  1 166 ? 17.547  44.405  -12.988 1.00 40.09 ? 166  LEU G CB    1 
ATOM   8540  C  CG    . LEU G  1 166 ? 19.067  44.225  -13.155 1.00 40.32 ? 166  LEU G CG    1 
ATOM   8541  C  CD1   . LEU G  1 166 ? 19.406  42.965  -13.945 1.00 40.55 ? 166  LEU G CD1   1 
ATOM   8542  C  CD2   . LEU G  1 166 ? 19.702  45.444  -13.814 1.00 40.01 ? 166  LEU G CD2   1 
ATOM   8543  N  N     . GLY G  1 167 ? 14.867  45.011  -11.285 1.00 42.83 ? 167  GLY G N     1 
ATOM   8544  C  CA    . GLY G  1 167 ? 13.420  45.177  -11.237 1.00 44.43 ? 167  GLY G CA    1 
ATOM   8545  C  C     . GLY G  1 167 ? 12.929  46.314  -10.354 1.00 45.56 ? 167  GLY G C     1 
ATOM   8546  O  O     . GLY G  1 167 ? 13.689  47.212  -9.987  1.00 45.68 ? 167  GLY G O     1 
ATOM   8547  N  N     . THR G  1 168 ? 11.644  46.270  -10.004 1.00 46.48 ? 168  THR G N     1 
ATOM   8548  C  CA    . THR G  1 168 ? 11.014  47.351  -9.241  1.00 47.30 ? 168  THR G CA    1 
ATOM   8549  C  C     . THR G  1 168 ? 10.576  46.936  -7.837  1.00 47.63 ? 168  THR G C     1 
ATOM   8550  O  O     . THR G  1 168 ? 10.078  47.767  -7.070  1.00 47.81 ? 168  THR G O     1 
ATOM   8551  C  CB    . THR G  1 168 ? 9.801   47.962  -10.019 1.00 47.42 ? 168  THR G CB    1 
ATOM   8552  O  OG1   . THR G  1 168 ? 8.897   46.922  -10.413 1.00 47.76 ? 168  THR G OG1   1 
ATOM   8553  C  CG2   . THR G  1 168 ? 10.244  48.581  -11.355 1.00 47.58 ? 168  THR G CG2   1 
ATOM   8554  N  N     . GLU G  1 169 ? 10.764  45.663  -7.498  1.00 48.02 ? 169  GLU G N     1 
ATOM   8555  C  CA    . GLU G  1 169 ? 10.398  45.170  -6.172  1.00 48.58 ? 169  GLU G CA    1 
ATOM   8556  C  C     . GLU G  1 169 ? 11.137  45.928  -5.057  1.00 48.54 ? 169  GLU G C     1 
ATOM   8557  O  O     . GLU G  1 169 ? 12.302  46.317  -5.214  1.00 48.48 ? 169  GLU G O     1 
ATOM   8558  C  CB    . GLU G  1 169 ? 10.568  43.644  -6.065  1.00 48.61 ? 169  GLU G CB    1 
ATOM   8559  C  CG    . GLU G  1 169 ? 11.921  43.110  -6.502  1.00 50.58 ? 169  GLU G CG    1 
ATOM   8560  C  CD    . GLU G  1 169 ? 11.893  42.400  -7.849  1.00 52.66 ? 169  GLU G CD    1 
ATOM   8561  O  OE1   . GLU G  1 169 ? 11.303  41.288  -7.942  1.00 52.65 ? 169  GLU G OE1   1 
ATOM   8562  O  OE2   . GLU G  1 169 ? 12.486  42.954  -8.810  1.00 53.11 ? 169  GLU G OE2   1 
ATOM   8563  N  N     . LYS G  1 170 ? 10.435  46.165  -3.952  1.00 48.50 ? 170  LYS G N     1 
ATOM   8564  C  CA    . LYS G  1 170 ? 10.908  47.096  -2.930  1.00 48.45 ? 170  LYS G CA    1 
ATOM   8565  C  C     . LYS G  1 170 ? 11.351  46.443  -1.622  1.00 47.82 ? 170  LYS G C     1 
ATOM   8566  O  O     . LYS G  1 170 ? 12.061  47.060  -0.837  1.00 47.80 ? 170  LYS G O     1 
ATOM   8567  C  CB    . LYS G  1 170 ? 9.859   48.187  -2.674  1.00 48.93 ? 170  LYS G CB    1 
ATOM   8568  C  CG    . LYS G  1 170 ? 10.099  49.468  -3.475  1.00 50.14 ? 170  LYS G CG    1 
ATOM   8569  C  CD    . LYS G  1 170 ? 8.834   50.323  -3.561  1.00 53.25 ? 170  LYS G CD    1 
ATOM   8570  C  CE    . LYS G  1 170 ? 9.099   51.782  -3.159  1.00 54.29 ? 170  LYS G CE    1 
ATOM   8571  N  NZ    . LYS G  1 170 ? 9.140   52.707  -4.340  1.00 54.55 ? 170  LYS G NZ    1 
ATOM   8572  N  N     . GLU G  1 171 ? 10.940  45.196  -1.402  1.00 47.03 ? 171  GLU G N     1 
ATOM   8573  C  CA    . GLU G  1 171 ? 11.363  44.435  -0.231  1.00 46.49 ? 171  GLU G CA    1 
ATOM   8574  C  C     . GLU G  1 171 ? 12.864  44.096  -0.308  1.00 45.58 ? 171  GLU G C     1 
ATOM   8575  O  O     . GLU G  1 171 ? 13.421  43.932  -1.402  1.00 45.26 ? 171  GLU G O     1 
ATOM   8576  C  CB    . GLU G  1 171 ? 10.500  43.173  -0.079  1.00 46.74 ? 171  GLU G CB    1 
ATOM   8577  C  CG    . GLU G  1 171 ? 10.696  42.122  -1.169  1.00 48.66 ? 171  GLU G CG    1 
ATOM   8578  C  CD    . GLU G  1 171 ? 9.736   42.245  -2.354  1.00 50.99 ? 171  GLU G CD    1 
ATOM   8579  O  OE1   . GLU G  1 171 ? 9.300   43.375  -2.689  1.00 52.03 ? 171  GLU G OE1   1 
ATOM   8580  O  OE2   . GLU G  1 171 ? 9.430   41.195  -2.972  1.00 51.02 ? 171  GLU G OE2   1 
ATOM   8581  N  N     . VAL G  1 172 ? 13.507  44.012  0.855   1.00 44.42 ? 172  VAL G N     1 
ATOM   8582  C  CA    . VAL G  1 172 ? 14.944  43.742  0.948   1.00 43.44 ? 172  VAL G CA    1 
ATOM   8583  C  C     . VAL G  1 172 ? 15.306  42.345  0.417   1.00 42.86 ? 172  VAL G C     1 
ATOM   8584  O  O     . VAL G  1 172 ? 16.130  42.215  -0.492  1.00 42.61 ? 172  VAL G O     1 
ATOM   8585  C  CB    . VAL G  1 172 ? 15.452  43.949  2.401   1.00 43.46 ? 172  VAL G CB    1 
ATOM   8586  C  CG1   . VAL G  1 172 ? 16.868  43.433  2.577   1.00 43.33 ? 172  VAL G CG1   1 
ATOM   8587  C  CG2   . VAL G  1 172 ? 15.387  45.432  2.781   1.00 43.41 ? 172  VAL G CG2   1 
ATOM   8588  N  N     . GLU G  1 173 ? 14.667  41.316  0.966   1.00 42.06 ? 173  GLU G N     1 
ATOM   8589  C  CA    . GLU G  1 173 ? 14.943  39.942  0.572   1.00 41.74 ? 173  GLU G CA    1 
ATOM   8590  C  C     . GLU G  1 173 ? 14.262  39.535  -0.741  1.00 41.24 ? 173  GLU G C     1 
ATOM   8591  O  O     . GLU G  1 173 ? 13.069  39.226  -0.773  1.00 41.34 ? 173  GLU G O     1 
ATOM   8592  C  CB    . GLU G  1 173 ? 14.593  38.962  1.704   1.00 41.62 ? 173  GLU G CB    1 
ATOM   8593  C  CG    . GLU G  1 173 ? 14.907  37.511  1.362   1.00 42.51 ? 173  GLU G CG    1 
ATOM   8594  C  CD    . GLU G  1 173 ? 15.020  36.594  2.570   1.00 44.15 ? 173  GLU G CD    1 
ATOM   8595  O  OE1   . GLU G  1 173 ? 15.026  35.363  2.353   1.00 44.46 ? 173  GLU G OE1   1 
ATOM   8596  O  OE2   . GLU G  1 173 ? 15.106  37.082  3.724   1.00 44.48 ? 173  GLU G OE2   1 
ATOM   8597  N  N     . VAL G  1 174 ? 15.035  39.556  -1.821  1.00 40.67 ? 174  VAL G N     1 
ATOM   8598  C  CA    . VAL G  1 174 ? 14.619  38.992  -3.107  1.00 40.09 ? 174  VAL G CA    1 
ATOM   8599  C  C     . VAL G  1 174 ? 15.769  38.147  -3.646  1.00 39.73 ? 174  VAL G C     1 
ATOM   8600  O  O     . VAL G  1 174 ? 16.800  38.679  -4.068  1.00 39.71 ? 174  VAL G O     1 
ATOM   8601  C  CB    . VAL G  1 174 ? 14.250  40.087  -4.140  1.00 40.10 ? 174  VAL G CB    1 
ATOM   8602  C  CG1   . VAL G  1 174 ? 13.826  39.458  -5.475  1.00 39.47 ? 174  VAL G CG1   1 
ATOM   8603  C  CG2   . VAL G  1 174 ? 13.148  40.986  -3.608  1.00 39.99 ? 174  VAL G CG2   1 
ATOM   8604  N  N     . ILE G  1 175 ? 15.595  36.832  -3.607  1.00 39.38 ? 175  ILE G N     1 
ATOM   8605  C  CA    . ILE G  1 175 ? 16.619  35.905  -4.079  1.00 39.25 ? 175  ILE G CA    1 
ATOM   8606  C  C     . ILE G  1 175 ? 16.714  35.924  -5.603  1.00 39.03 ? 175  ILE G C     1 
ATOM   8607  O  O     . ILE G  1 175 ? 15.701  35.996  -6.286  1.00 39.17 ? 175  ILE G O     1 
ATOM   8608  C  CB    . ILE G  1 175 ? 16.391  34.482  -3.503  1.00 39.20 ? 175  ILE G CB    1 
ATOM   8609  C  CG1   . ILE G  1 175 ? 16.836  34.455  -2.045  1.00 39.60 ? 175  ILE G CG1   1 
ATOM   8610  C  CG2   . ILE G  1 175 ? 17.218  33.439  -4.239  1.00 39.31 ? 175  ILE G CG2   1 
ATOM   8611  C  CD1   . ILE G  1 175 ? 15.754  34.186  -1.080  1.00 39.93 ? 175  ILE G CD1   1 
ATOM   8612  N  N     . GLY G  1 176 ? 17.944  35.895  -6.113  1.00 38.70 ? 176  GLY G N     1 
ATOM   8613  C  CA    . GLY G  1 176 ? 18.197  35.947  -7.536  1.00 38.34 ? 176  GLY G CA    1 
ATOM   8614  C  C     . GLY G  1 176 ? 19.665  36.129  -7.858  1.00 38.17 ? 176  GLY G C     1 
ATOM   8615  O  O     . GLY G  1 176 ? 20.472  36.377  -6.969  1.00 38.30 ? 176  GLY G O     1 
ATOM   8616  N  N     . GLY G  1 177 ? 20.009  35.996  -9.136  1.00 37.94 ? 177  GLY G N     1 
ATOM   8617  C  CA    . GLY G  1 177 ? 21.374  36.169  -9.600  1.00 37.51 ? 177  GLY G CA    1 
ATOM   8618  C  C     . GLY G  1 177 ? 21.485  37.329  -10.568 1.00 37.57 ? 177  GLY G C     1 
ATOM   8619  O  O     . GLY G  1 177 ? 20.843  38.361  -10.384 1.00 37.22 ? 177  GLY G O     1 
ATOM   8620  N  N     . ALA G  1 178 ? 22.284  37.145  -11.614 1.00 37.92 ? 178  ALA G N     1 
ATOM   8621  C  CA    . ALA G  1 178 ? 22.514  38.193  -12.608 1.00 38.46 ? 178  ALA G CA    1 
ATOM   8622  C  C     . ALA G  1 178 ? 21.276  38.527  -13.465 1.00 38.72 ? 178  ALA G C     1 
ATOM   8623  O  O     . ALA G  1 178 ? 21.259  39.528  -14.180 1.00 38.88 ? 178  ALA G O     1 
ATOM   8624  C  CB    . ALA G  1 178 ? 23.742  37.870  -13.466 1.00 38.42 ? 178  ALA G CB    1 
ATOM   8625  N  N     . ASP G  1 179 ? 20.246  37.690  -13.355 1.00 39.13 ? 179  ASP G N     1 
ATOM   8626  C  CA    . ASP G  1 179 ? 18.917  37.976  -13.897 1.00 39.52 ? 179  ASP G CA    1 
ATOM   8627  C  C     . ASP G  1 179 ? 18.227  39.135  -13.172 1.00 38.99 ? 179  ASP G C     1 
ATOM   8628  O  O     . ASP G  1 179 ? 17.467  39.881  -13.783 1.00 39.40 ? 179  ASP G O     1 
ATOM   8629  C  CB    . ASP G  1 179 ? 18.033  36.719  -13.833 1.00 39.92 ? 179  ASP G CB    1 
ATOM   8630  C  CG    . ASP G  1 179 ? 17.849  36.189  -12.406 1.00 42.07 ? 179  ASP G CG    1 
ATOM   8631  O  OD1   . ASP G  1 179 ? 18.858  35.861  -11.739 1.00 43.36 ? 179  ASP G OD1   1 
ATOM   8632  O  OD2   . ASP G  1 179 ? 16.724  36.044  -11.870 1.00 44.85 ? 179  ASP G OD2   1 
ATOM   8633  N  N     . LYS G  1 180 ? 18.494  39.281  -11.873 1.00 38.02 ? 180  LYS G N     1 
ATOM   8634  C  CA    . LYS G  1 180 ? 17.812  40.283  -11.048 1.00 36.86 ? 180  LYS G CA    1 
ATOM   8635  C  C     . LYS G  1 180 ? 18.714  41.410  -10.549 1.00 35.60 ? 180  LYS G C     1 
ATOM   8636  O  O     . LYS G  1 180 ? 18.220  42.441  -10.099 1.00 35.45 ? 180  LYS G O     1 
ATOM   8637  C  CB    . LYS G  1 180 ? 17.133  39.621  -9.851  1.00 37.08 ? 180  LYS G CB    1 
ATOM   8638  C  CG    . LYS G  1 180 ? 15.867  38.885  -10.190 1.00 38.85 ? 180  LYS G CG    1 
ATOM   8639  C  CD    . LYS G  1 180 ? 14.764  39.228  -9.194  1.00 42.15 ? 180  LYS G CD    1 
ATOM   8640  C  CE    . LYS G  1 180 ? 13.741  38.097  -9.069  1.00 43.60 ? 180  LYS G CE    1 
ATOM   8641  N  NZ    . LYS G  1 180 ? 14.372  36.762  -8.819  1.00 44.46 ? 180  LYS G NZ    1 
ATOM   8642  N  N     . TYR G  1 181 ? 20.028  41.204  -10.623 1.00 34.02 ? 181  TYR G N     1 
ATOM   8643  C  CA    . TYR G  1 181 ? 20.999  42.124  -10.036 1.00 32.37 ? 181  TYR G CA    1 
ATOM   8644  C  C     . TYR G  1 181 ? 22.215  42.318  -10.932 1.00 32.04 ? 181  TYR G C     1 
ATOM   8645  O  O     . TYR G  1 181 ? 22.655  41.388  -11.610 1.00 31.79 ? 181  TYR G O     1 
ATOM   8646  C  CB    . TYR G  1 181 ? 21.507  41.606  -8.677  1.00 31.68 ? 181  TYR G CB    1 
ATOM   8647  C  CG    . TYR G  1 181 ? 20.484  41.507  -7.576  1.00 29.83 ? 181  TYR G CG    1 
ATOM   8648  C  CD1   . TYR G  1 181 ? 19.844  40.295  -7.304  1.00 28.29 ? 181  TYR G CD1   1 
ATOM   8649  C  CD2   . TYR G  1 181 ? 20.169  42.615  -6.783  1.00 27.95 ? 181  TYR G CD2   1 
ATOM   8650  C  CE1   . TYR G  1 181 ? 18.910  40.196  -6.286  1.00 27.68 ? 181  TYR G CE1   1 
ATOM   8651  C  CE2   . TYR G  1 181 ? 19.237  42.530  -5.771  1.00 26.25 ? 181  TYR G CE2   1 
ATOM   8652  C  CZ    . TYR G  1 181 ? 18.609  41.319  -5.524  1.00 27.97 ? 181  TYR G CZ    1 
ATOM   8653  O  OH    . TYR G  1 181 ? 17.677  41.219  -4.514  1.00 28.46 ? 181  TYR G OH    1 
ATOM   8654  N  N     . HIS G  1 182 ? 22.760  43.527  -10.902 1.00 31.42 ? 182  HIS G N     1 
ATOM   8655  C  CA    . HIS G  1 182 ? 24.036  43.837  -11.529 1.00 31.31 ? 182  HIS G CA    1 
ATOM   8656  C  C     . HIS G  1 182 ? 25.008  44.336  -10.466 1.00 30.86 ? 182  HIS G C     1 
ATOM   8657  O  O     . HIS G  1 182 ? 24.650  45.191  -9.639  1.00 30.62 ? 182  HIS G O     1 
ATOM   8658  C  CB    . HIS G  1 182 ? 23.866  44.955  -12.577 1.00 31.58 ? 182  HIS G CB    1 
ATOM   8659  C  CG    . HIS G  1 182 ? 23.409  44.479  -13.922 1.00 32.24 ? 182  HIS G CG    1 
ATOM   8660  N  ND1   . HIS G  1 182 ? 23.187  43.149  -14.213 1.00 32.66 ? 182  HIS G ND1   1 
ATOM   8661  C  CD2   . HIS G  1 182 ? 23.126  45.164  -15.056 1.00 32.00 ? 182  HIS G CD2   1 
ATOM   8662  C  CE1   . HIS G  1 182 ? 22.789  43.037  -15.468 1.00 33.14 ? 182  HIS G CE1   1 
ATOM   8663  N  NE2   . HIS G  1 182 ? 22.743  44.246  -15.999 1.00 32.29 ? 182  HIS G NE2   1 
ATOM   8664  N  N     . SER G  1 183 ? 26.234  43.818  -10.491 1.00 30.22 ? 183  SER G N     1 
ATOM   8665  C  CA    . SER G  1 183 ? 27.321  44.457  -9.755  1.00 29.77 ? 183  SER G CA    1 
ATOM   8666  C  C     . SER G  1 183 ? 27.688  45.720  -10.513 1.00 29.38 ? 183  SER G C     1 
ATOM   8667  O  O     . SER G  1 183 ? 27.757  45.711  -11.740 1.00 29.17 ? 183  SER G O     1 
ATOM   8668  C  CB    . SER G  1 183 ? 28.533  43.542  -9.616  1.00 29.67 ? 183  SER G CB    1 
ATOM   8669  O  OG    . SER G  1 183 ? 28.868  42.944  -10.849 1.00 29.03 ? 183  SER G OG    1 
ATOM   8670  N  N     . VAL G  1 184 ? 27.935  46.801  -9.782  1.00 29.26 ? 184  VAL G N     1 
ATOM   8671  C  CA    . VAL G  1 184 ? 27.968  48.117  -10.391 1.00 29.21 ? 184  VAL G CA    1 
ATOM   8672  C  C     . VAL G  1 184 ? 28.922  49.079  -9.667  1.00 29.42 ? 184  VAL G C     1 
ATOM   8673  O  O     . VAL G  1 184 ? 29.123  48.967  -8.455  1.00 29.19 ? 184  VAL G O     1 
ATOM   8674  C  CB    . VAL G  1 184 ? 26.497  48.640  -10.460 1.00 29.50 ? 184  VAL G CB    1 
ATOM   8675  C  CG1   . VAL G  1 184 ? 26.322  49.933  -9.749  1.00 29.38 ? 184  VAL G CG1   1 
ATOM   8676  C  CG2   . VAL G  1 184 ? 25.991  48.684  -11.900 1.00 29.60 ? 184  VAL G CG2   1 
ATOM   8677  N  N     . CYS G  1 185 ? 29.531  50.001  -10.422 1.00 29.76 ? 185  CYS G N     1 
ATOM   8678  C  CA    . CYS G  1 185 ? 30.324  51.094  -9.851  1.00 30.07 ? 185  CYS G CA    1 
ATOM   8679  C  C     . CYS G  1 185 ? 29.409  52.210  -9.329  1.00 30.29 ? 185  CYS G C     1 
ATOM   8680  O  O     . CYS G  1 185 ? 28.193  52.154  -9.511  1.00 30.15 ? 185  CYS G O     1 
ATOM   8681  C  CB    . CYS G  1 185 ? 31.307  51.647  -10.888 1.00 29.91 ? 185  CYS G CB    1 
ATOM   8682  S  SG    . CYS G  1 185 ? 30.566  52.583  -12.267 1.00 31.52 ? 185  CYS G SG    1 
ATOM   8683  N  N     . ARG G  1 186 ? 29.997  53.222  -8.694  1.00 30.72 ? 186  ARG G N     1 
ATOM   8684  C  CA    . ARG G  1 186 ? 29.251  54.388  -8.198  1.00 31.37 ? 186  ARG G CA    1 
ATOM   8685  C  C     . ARG G  1 186 ? 28.455  55.103  -9.299  1.00 32.13 ? 186  ARG G C     1 
ATOM   8686  O  O     . ARG G  1 186 ? 27.265  55.377  -9.132  1.00 32.25 ? 186  ARG G O     1 
ATOM   8687  C  CB    . ARG G  1 186 ? 30.211  55.378  -7.522  1.00 31.39 ? 186  ARG G CB    1 
ATOM   8688  C  CG    . ARG G  1 186 ? 29.591  56.683  -7.012  1.00 30.49 ? 186  ARG G CG    1 
ATOM   8689  C  CD    . ARG G  1 186 ? 30.571  57.545  -6.212  1.00 29.79 ? 186  ARG G CD    1 
ATOM   8690  N  NE    . ARG G  1 186 ? 30.997  56.868  -4.985  1.00 29.46 ? 186  ARG G NE    1 
ATOM   8691  C  CZ    . ARG G  1 186 ? 30.336  56.915  -3.834  1.00 28.32 ? 186  ARG G CZ    1 
ATOM   8692  N  NH1   . ARG G  1 186 ? 29.224  57.631  -3.722  1.00 28.51 ? 186  ARG G NH1   1 
ATOM   8693  N  NH2   . ARG G  1 186 ? 30.799  56.260  -2.783  1.00 27.33 ? 186  ARG G NH2   1 
ATOM   8694  N  N     . LEU G  1 187 ? 29.116  55.410  -10.415 1.00 33.10 ? 187  LEU G N     1 
ATOM   8695  C  CA    . LEU G  1 187 ? 28.468  56.123  -11.522 1.00 34.05 ? 187  LEU G CA    1 
ATOM   8696  C  C     . LEU G  1 187 ? 27.311  55.335  -12.139 1.00 34.33 ? 187  LEU G C     1 
ATOM   8697  O  O     . LEU G  1 187 ? 26.221  55.881  -12.340 1.00 34.62 ? 187  LEU G O     1 
ATOM   8698  C  CB    . LEU G  1 187 ? 29.481  56.538  -12.597 1.00 34.24 ? 187  LEU G CB    1 
ATOM   8699  C  CG    . LEU G  1 187 ? 30.361  57.754  -12.242 1.00 35.43 ? 187  LEU G CG    1 
ATOM   8700  C  CD1   . LEU G  1 187 ? 31.406  58.008  -13.319 1.00 36.05 ? 187  LEU G CD1   1 
ATOM   8701  C  CD2   . LEU G  1 187 ? 29.549  59.037  -11.974 1.00 36.29 ? 187  LEU G CD2   1 
ATOM   8702  N  N     . CYS G  1 188 ? 27.535  54.050  -12.412 1.00 34.62 ? 188  CYS G N     1 
ATOM   8703  C  CA    . CYS G  1 188 ? 26.490  53.207  -12.997 1.00 34.82 ? 188  CYS G CA    1 
ATOM   8704  C  C     . CYS G  1 188 ? 25.329  52.953  -12.038 1.00 34.96 ? 188  CYS G C     1 
ATOM   8705  O  O     . CYS G  1 188 ? 24.198  52.744  -12.479 1.00 34.97 ? 188  CYS G O     1 
ATOM   8706  C  CB    . CYS G  1 188 ? 27.069  51.892  -13.497 1.00 34.68 ? 188  CYS G CB    1 
ATOM   8707  S  SG    . CYS G  1 188 ? 28.238  52.109  -14.854 1.00 36.35 ? 188  CYS G SG    1 
ATOM   8708  N  N     . TYR G  1 189 ? 25.607  52.978  -10.733 1.00 35.18 ? 189  TYR G N     1 
ATOM   8709  C  CA    . TYR G  1 189 ? 24.568  52.812  -9.718  1.00 35.48 ? 189  TYR G CA    1 
ATOM   8710  C  C     . TYR G  1 189 ? 23.508  53.905  -9.817  1.00 36.54 ? 189  TYR G C     1 
ATOM   8711  O  O     . TYR G  1 189 ? 22.322  53.632  -9.652  1.00 36.21 ? 189  TYR G O     1 
ATOM   8712  C  CB    . TYR G  1 189 ? 25.146  52.778  -8.284  1.00 34.88 ? 189  TYR G CB    1 
ATOM   8713  C  CG    . TYR G  1 189 ? 24.074  52.563  -7.232  1.00 32.61 ? 189  TYR G CG    1 
ATOM   8714  C  CD1   . TYR G  1 189 ? 23.717  51.280  -6.831  1.00 30.86 ? 189  TYR G CD1   1 
ATOM   8715  C  CD2   . TYR G  1 189 ? 23.381  53.649  -6.669  1.00 30.70 ? 189  TYR G CD2   1 
ATOM   8716  C  CE1   . TYR G  1 189 ? 22.702  51.074  -5.885  1.00 30.22 ? 189  TYR G CE1   1 
ATOM   8717  C  CE2   . TYR G  1 189 ? 22.373  53.455  -5.728  1.00 29.90 ? 189  TYR G CE2   1 
ATOM   8718  C  CZ    . TYR G  1 189 ? 22.041  52.163  -5.344  1.00 30.16 ? 189  TYR G CZ    1 
ATOM   8719  O  OH    . TYR G  1 189 ? 21.050  51.950  -4.415  1.00 31.33 ? 189  TYR G OH    1 
ATOM   8720  N  N     . PHE G  1 190 ? 23.952  55.134  -10.078 1.00 38.12 ? 190  PHE G N     1 
ATOM   8721  C  CA    . PHE G  1 190 ? 23.070  56.301  -10.104 1.00 39.84 ? 190  PHE G CA    1 
ATOM   8722  C  C     . PHE G  1 190 ? 22.565  56.687  -11.503 1.00 41.31 ? 190  PHE G C     1 
ATOM   8723  O  O     . PHE G  1 190 ? 21.773  57.621  -11.637 1.00 41.69 ? 190  PHE G O     1 
ATOM   8724  C  CB    . PHE G  1 190 ? 23.763  57.499  -9.441  1.00 39.37 ? 190  PHE G CB    1 
ATOM   8725  C  CG    . PHE G  1 190 ? 23.819  57.415  -7.941  1.00 38.93 ? 190  PHE G CG    1 
ATOM   8726  C  CD1   . PHE G  1 190 ? 25.039  57.331  -7.283  1.00 38.12 ? 190  PHE G CD1   1 
ATOM   8727  C  CD2   . PHE G  1 190 ? 22.649  57.431  -7.180  1.00 38.19 ? 190  PHE G CD2   1 
ATOM   8728  C  CE1   . PHE G  1 190 ? 25.090  57.257  -5.890  1.00 38.10 ? 190  PHE G CE1   1 
ATOM   8729  C  CE2   . PHE G  1 190 ? 22.697  57.357  -5.793  1.00 37.58 ? 190  PHE G CE2   1 
ATOM   8730  C  CZ    . PHE G  1 190 ? 23.916  57.269  -5.149  1.00 37.29 ? 190  PHE G CZ    1 
ATOM   8731  N  N     . LYS G  1 191 ? 23.012  55.970  -12.534 1.00 42.96 ? 191  LYS G N     1 
ATOM   8732  C  CA    . LYS G  1 191 ? 22.627  56.257  -13.924 1.00 44.36 ? 191  LYS G CA    1 
ATOM   8733  C  C     . LYS G  1 191 ? 21.128  56.101  -14.165 1.00 44.92 ? 191  LYS G C     1 
ATOM   8734  O  O     . LYS G  1 191 ? 20.544  55.059  -13.855 1.00 45.66 ? 191  LYS G O     1 
ATOM   8735  C  CB    . LYS G  1 191 ? 23.380  55.342  -14.884 1.00 44.52 ? 191  LYS G CB    1 
ATOM   8736  C  CG    . LYS G  1 191 ? 24.268  56.064  -15.874 1.00 46.29 ? 191  LYS G CG    1 
ATOM   8737  C  CD    . LYS G  1 191 ? 24.783  55.091  -16.934 1.00 49.16 ? 191  LYS G CD    1 
ATOM   8738  C  CE    . LYS G  1 191 ? 25.035  55.797  -18.269 1.00 50.89 ? 191  LYS G CE    1 
ATOM   8739  N  NZ    . LYS G  1 191 ? 26.348  56.523  -18.277 1.00 50.91 ? 191  LYS G NZ    1 
ATOM   8740  N  N     . ARG H  1 18  ? 44.235  47.995  -22.369 1.00 43.65 ? 18   ARG H N     1 
ATOM   8741  C  CA    . ARG H  1 18  ? 44.762  48.136  -20.980 1.00 43.50 ? 18   ARG H CA    1 
ATOM   8742  C  C     . ARG H  1 18  ? 45.112  46.781  -20.333 1.00 42.23 ? 18   ARG H C     1 
ATOM   8743  O  O     . ARG H  1 18  ? 44.341  46.241  -19.530 1.00 42.41 ? 18   ARG H O     1 
ATOM   8744  C  CB    . ARG H  1 18  ? 43.740  48.901  -20.131 1.00 44.22 ? 18   ARG H CB    1 
ATOM   8745  C  CG    . ARG H  1 18  ? 44.343  49.664  -18.965 1.00 46.60 ? 18   ARG H CG    1 
ATOM   8746  C  CD    . ARG H  1 18  ? 44.452  51.163  -19.180 1.00 50.63 ? 18   ARG H CD    1 
ATOM   8747  N  NE    . ARG H  1 18  ? 45.589  51.683  -18.424 1.00 54.35 ? 18   ARG H NE    1 
ATOM   8748  C  CZ    . ARG H  1 18  ? 46.100  52.900  -18.552 1.00 56.32 ? 18   ARG H CZ    1 
ATOM   8749  N  NH1   . ARG H  1 18  ? 45.584  53.772  -19.421 1.00 57.29 ? 18   ARG H NH1   1 
ATOM   8750  N  NH2   . ARG H  1 18  ? 47.136  53.245  -17.799 1.00 56.30 ? 18   ARG H NH2   1 
ATOM   8751  N  N     . GLY H  1 19  ? 46.284  46.251  -20.687 1.00 40.53 ? 19   GLY H N     1 
ATOM   8752  C  CA    . GLY H  1 19  ? 46.750  44.968  -20.193 1.00 38.03 ? 19   GLY H CA    1 
ATOM   8753  C  C     . GLY H  1 19  ? 47.367  45.027  -18.807 1.00 36.47 ? 19   GLY H C     1 
ATOM   8754  O  O     . GLY H  1 19  ? 47.628  46.110  -18.281 1.00 36.35 ? 19   GLY H O     1 
ATOM   8755  N  N     . GLN H  1 20  ? 47.638  43.849  -18.241 1.00 34.90 ? 20   GLN H N     1 
ATOM   8756  C  CA    . GLN H  1 20  ? 47.882  43.688  -16.813 1.00 33.33 ? 20   GLN H CA    1 
ATOM   8757  C  C     . GLN H  1 20  ? 48.470  42.318  -16.514 1.00 31.78 ? 20   GLN H C     1 
ATOM   8758  O  O     . GLN H  1 20  ? 48.050  41.328  -17.105 1.00 31.29 ? 20   GLN H O     1 
ATOM   8759  C  CB    . GLN H  1 20  ? 46.526  43.730  -16.109 1.00 33.46 ? 20   GLN H CB    1 
ATOM   8760  C  CG    . GLN H  1 20  ? 46.442  44.631  -14.936 1.00 35.21 ? 20   GLN H CG    1 
ATOM   8761  C  CD    . GLN H  1 20  ? 45.288  44.274  -14.038 1.00 37.05 ? 20   GLN H CD    1 
ATOM   8762  O  OE1   . GLN H  1 20  ? 44.169  44.086  -14.504 1.00 38.63 ? 20   GLN H OE1   1 
ATOM   8763  N  NE2   . GLN H  1 20  ? 45.554  44.174  -12.746 1.00 38.00 ? 20   GLN H NE2   1 
ATOM   8764  N  N     . ILE H  1 21  ? 49.412  42.257  -15.576 1.00 30.21 ? 21   ILE H N     1 
ATOM   8765  C  CA    . ILE H  1 21  ? 49.825  40.988  -14.986 1.00 28.55 ? 21   ILE H CA    1 
ATOM   8766  C  C     . ILE H  1 21  ? 49.562  40.993  -13.474 1.00 28.06 ? 21   ILE H C     1 
ATOM   8767  O  O     . ILE H  1 21  ? 50.001  41.906  -12.756 1.00 27.65 ? 21   ILE H O     1 
ATOM   8768  C  CB    . ILE H  1 21  ? 51.311  40.690  -15.265 1.00 28.60 ? 21   ILE H CB    1 
ATOM   8769  C  CG1   . ILE H  1 21  ? 51.567  40.549  -16.766 1.00 27.95 ? 21   ILE H CG1   1 
ATOM   8770  C  CG2   . ILE H  1 21  ? 51.764  39.425  -14.503 1.00 27.85 ? 21   ILE H CG2   1 
ATOM   8771  C  CD1   . ILE H  1 21  ? 53.034  40.642  -17.137 1.00 27.19 ? 21   ILE H CD1   1 
ATOM   8772  N  N     . GLN H  1 22  ? 48.853  39.968  -13.002 1.00 27.28 ? 22   GLN H N     1 
ATOM   8773  C  CA    . GLN H  1 22  ? 48.607  39.778  -11.574 1.00 26.72 ? 22   GLN H CA    1 
ATOM   8774  C  C     . GLN H  1 22  ? 49.223  38.466  -11.155 1.00 26.24 ? 22   GLN H C     1 
ATOM   8775  O  O     . GLN H  1 22  ? 49.076  37.459  -11.844 1.00 26.46 ? 22   GLN H O     1 
ATOM   8776  C  CB    . GLN H  1 22  ? 47.119  39.737  -11.278 1.00 26.79 ? 22   GLN H CB    1 
ATOM   8777  C  CG    . GLN H  1 22  ? 46.324  40.904  -11.810 1.00 27.27 ? 22   GLN H CG    1 
ATOM   8778  C  CD    . GLN H  1 22  ? 44.891  40.867  -11.337 1.00 28.88 ? 22   GLN H CD    1 
ATOM   8779  O  OE1   . GLN H  1 22  ? 44.515  39.999  -10.546 1.00 30.13 ? 22   GLN H OE1   1 
ATOM   8780  N  NE2   . GLN H  1 22  ? 44.081  41.791  -11.826 1.00 30.39 ? 22   GLN H NE2   1 
ATOM   8781  N  N     . VAL H  1 23  ? 49.914  38.473  -10.025 1.00 25.51 ? 23   VAL H N     1 
ATOM   8782  C  CA    . VAL H  1 23  ? 50.642  37.301  -9.572  1.00 24.95 ? 23   VAL H CA    1 
ATOM   8783  C  C     . VAL H  1 23  ? 50.138  36.874  -8.197  1.00 24.76 ? 23   VAL H C     1 
ATOM   8784  O  O     . VAL H  1 23  ? 50.067  37.691  -7.276  1.00 24.86 ? 23   VAL H O     1 
ATOM   8785  C  CB    . VAL H  1 23  ? 52.173  37.572  -9.539  1.00 25.37 ? 23   VAL H CB    1 
ATOM   8786  C  CG1   . VAL H  1 23  ? 52.945  36.333  -9.112  1.00 24.82 ? 23   VAL H CG1   1 
ATOM   8787  C  CG2   . VAL H  1 23  ? 52.656  38.039  -10.906 1.00 24.91 ? 23   VAL H CG2   1 
ATOM   8788  N  N     . ILE H  1 24  ? 49.755  35.604  -8.083  1.00 24.25 ? 24   ILE H N     1 
ATOM   8789  C  CA    . ILE H  1 24  ? 49.317  35.020  -6.825  1.00 23.71 ? 24   ILE H CA    1 
ATOM   8790  C  C     . ILE H  1 24  ? 50.346  33.988  -6.393  1.00 23.85 ? 24   ILE H C     1 
ATOM   8791  O  O     . ILE H  1 24  ? 50.482  32.922  -7.006  1.00 24.03 ? 24   ILE H O     1 
ATOM   8792  C  CB    . ILE H  1 24  ? 47.901  34.378  -6.952  1.00 23.72 ? 24   ILE H CB    1 
ATOM   8793  C  CG1   . ILE H  1 24  ? 46.881  35.392  -7.495  1.00 23.00 ? 24   ILE H CG1   1 
ATOM   8794  C  CG2   . ILE H  1 24  ? 47.444  33.807  -5.616  1.00 22.13 ? 24   ILE H CG2   1 
ATOM   8795  C  CD1   . ILE H  1 24  ? 45.719  34.733  -8.250  1.00 20.95 ? 24   ILE H CD1   1 
ATOM   8796  N  N     . LEU H  1 25  ? 51.077  34.326  -5.341  1.00 23.72 ? 25   LEU H N     1 
ATOM   8797  C  CA    . LEU H  1 25  ? 52.121  33.475  -4.795  1.00 23.77 ? 25   LEU H CA    1 
ATOM   8798  C  C     . LEU H  1 25  ? 51.658  32.805  -3.496  1.00 23.66 ? 25   LEU H C     1 
ATOM   8799  O  O     . LEU H  1 25  ? 50.633  33.173  -2.930  1.00 23.63 ? 25   LEU H O     1 
ATOM   8800  C  CB    . LEU H  1 25  ? 53.391  34.306  -4.550  1.00 23.68 ? 25   LEU H CB    1 
ATOM   8801  C  CG    . LEU H  1 25  ? 54.116  34.911  -5.762  1.00 24.18 ? 25   LEU H CG    1 
ATOM   8802  C  CD1   . LEU H  1 25  ? 55.302  35.755  -5.330  1.00 23.81 ? 25   LEU H CD1   1 
ATOM   8803  C  CD2   . LEU H  1 25  ? 54.591  33.820  -6.705  1.00 23.98 ? 25   LEU H CD2   1 
ATOM   8804  N  N     . GLY H  1 26  ? 52.421  31.823  -3.035  1.00 23.66 ? 26   GLY H N     1 
ATOM   8805  C  CA    . GLY H  1 26  ? 52.174  31.169  -1.761  1.00 23.81 ? 26   GLY H CA    1 
ATOM   8806  C  C     . GLY H  1 26  ? 52.777  29.770  -1.753  1.00 24.04 ? 26   GLY H C     1 
ATOM   8807  O  O     . GLY H  1 26  ? 53.200  29.284  -2.801  1.00 24.03 ? 26   GLY H O     1 
ATOM   8808  N  N     . PRO H  1 27  ? 52.805  29.110  -0.592  1.00 23.88 ? 27   PRO H N     1 
ATOM   8809  C  CA    . PRO H  1 27  ? 53.253  27.717  -0.526  1.00 23.85 ? 27   PRO H CA    1 
ATOM   8810  C  C     . PRO H  1 27  ? 52.130  26.827  -1.040  1.00 24.22 ? 27   PRO H C     1 
ATOM   8811  O  O     . PRO H  1 27  ? 51.074  27.340  -1.441  1.00 24.50 ? 27   PRO H O     1 
ATOM   8812  C  CB    . PRO H  1 27  ? 53.424  27.485  0.969   1.00 23.44 ? 27   PRO H CB    1 
ATOM   8813  C  CG    . PRO H  1 27  ? 52.348  28.344  1.569   1.00 23.44 ? 27   PRO H CG    1 
ATOM   8814  C  CD    . PRO H  1 27  ? 52.392  29.612  0.733   1.00 23.70 ? 27   PRO H CD    1 
ATOM   8815  N  N     . MET H  1 28  ? 52.343  25.517  -1.021  1.00 24.04 ? 28   MET H N     1 
ATOM   8816  C  CA    . MET H  1 28  ? 51.275  24.593  -1.342  1.00 24.21 ? 28   MET H CA    1 
ATOM   8817  C  C     . MET H  1 28  ? 50.163  24.705  -0.291  1.00 24.26 ? 28   MET H C     1 
ATOM   8818  O  O     . MET H  1 28  ? 50.402  25.150  0.835   1.00 24.32 ? 28   MET H O     1 
ATOM   8819  C  CB    . MET H  1 28  ? 51.810  23.158  -1.440  1.00 23.92 ? 28   MET H CB    1 
ATOM   8820  C  CG    . MET H  1 28  ? 52.679  22.917  -2.668  1.00 24.13 ? 28   MET H CG    1 
ATOM   8821  S  SD    . MET H  1 28  ? 53.244  21.220  -2.873  1.00 23.73 ? 28   MET H SD    1 
ATOM   8822  C  CE    . MET H  1 28  ? 51.711  20.364  -3.294  1.00 22.71 ? 28   MET H CE    1 
ATOM   8823  N  N     . PHE H  1 29  ? 48.955  24.303  -0.674  1.00 24.21 ? 29   PHE H N     1 
ATOM   8824  C  CA    . PHE H  1 29  ? 47.792  24.226  0.227   1.00 24.18 ? 29   PHE H CA    1 
ATOM   8825  C  C     . PHE H  1 29  ? 47.294  25.573  0.735   1.00 23.94 ? 29   PHE H C     1 
ATOM   8826  O  O     . PHE H  1 29  ? 46.589  25.637  1.749   1.00 24.05 ? 29   PHE H O     1 
ATOM   8827  C  CB    . PHE H  1 29  ? 48.024  23.250  1.399   1.00 24.04 ? 29   PHE H CB    1 
ATOM   8828  C  CG    . PHE H  1 29  ? 48.781  21.999  1.009   1.00 24.68 ? 29   PHE H CG    1 
ATOM   8829  C  CD1   . PHE H  1 29  ? 50.112  21.822  1.408   1.00 23.96 ? 29   PHE H CD1   1 
ATOM   8830  C  CD2   . PHE H  1 29  ? 48.173  21.010  0.239   1.00 24.76 ? 29   PHE H CD2   1 
ATOM   8831  C  CE1   . PHE H  1 29  ? 50.825  20.685  1.047   1.00 24.24 ? 29   PHE H CE1   1 
ATOM   8832  C  CE2   . PHE H  1 29  ? 48.892  19.855  -0.131  1.00 25.44 ? 29   PHE H CE2   1 
ATOM   8833  C  CZ    . PHE H  1 29  ? 50.215  19.698  0.273   1.00 24.13 ? 29   PHE H CZ    1 
ATOM   8834  N  N     . SER H  1 30  ? 47.647  26.641  0.021   1.00 23.62 ? 30   SER H N     1 
ATOM   8835  C  CA    . SER H  1 30  ? 47.235  27.997  0.373   1.00 23.45 ? 30   SER H CA    1 
ATOM   8836  C  C     . SER H  1 30  ? 46.040  28.497  -0.457  1.00 23.38 ? 30   SER H C     1 
ATOM   8837  O  O     . SER H  1 30  ? 45.554  29.608  -0.248  1.00 23.53 ? 30   SER H O     1 
ATOM   8838  C  CB    . SER H  1 30  ? 48.420  28.959  0.239   1.00 23.57 ? 30   SER H CB    1 
ATOM   8839  O  OG    . SER H  1 30  ? 48.770  29.165  -1.120  1.00 23.78 ? 30   SER H OG    1 
ATOM   8840  N  N     . GLY H  1 31  ? 45.572  27.671  -1.389  1.00 23.24 ? 31   GLY H N     1 
ATOM   8841  C  CA    . GLY H  1 31  ? 44.428  28.002  -2.223  1.00 23.31 ? 31   GLY H CA    1 
ATOM   8842  C  C     . GLY H  1 31  ? 44.715  28.945  -3.383  1.00 23.55 ? 31   GLY H C     1 
ATOM   8843  O  O     . GLY H  1 31  ? 43.819  29.696  -3.803  1.00 23.67 ? 31   GLY H O     1 
ATOM   8844  N  N     . LYS H  1 32  ? 45.942  28.902  -3.908  1.00 23.44 ? 32   LYS H N     1 
ATOM   8845  C  CA    . LYS H  1 32  ? 46.342  29.736  -5.045  1.00 23.71 ? 32   LYS H CA    1 
ATOM   8846  C  C     . LYS H  1 32  ? 45.423  29.556  -6.261  1.00 24.21 ? 32   LYS H C     1 
ATOM   8847  O  O     . LYS H  1 32  ? 44.965  30.545  -6.850  1.00 24.01 ? 32   LYS H O     1 
ATOM   8848  C  CB    . LYS H  1 32  ? 47.780  29.425  -5.464  1.00 23.51 ? 32   LYS H CB    1 
ATOM   8849  C  CG    . LYS H  1 32  ? 48.846  29.821  -4.465  1.00 22.40 ? 32   LYS H CG    1 
ATOM   8850  C  CD    . LYS H  1 32  ? 50.244  29.638  -5.074  1.00 22.35 ? 32   LYS H CD    1 
ATOM   8851  C  CE    . LYS H  1 32  ? 50.555  28.181  -5.417  1.00 19.92 ? 32   LYS H CE    1 
ATOM   8852  N  NZ    . LYS H  1 32  ? 50.378  27.260  -4.228  1.00 19.93 ? 32   LYS H NZ    1 
ATOM   8853  N  N     . SER H  1 33  ? 45.175  28.294  -6.624  1.00 24.65 ? 33   SER H N     1 
ATOM   8854  C  CA    . SER H  1 33  ? 44.316  27.946  -7.764  1.00 25.43 ? 33   SER H CA    1 
ATOM   8855  C  C     . SER H  1 33  ? 42.881  28.413  -7.579  1.00 25.19 ? 33   SER H C     1 
ATOM   8856  O  O     . SER H  1 33  ? 42.242  28.847  -8.537  1.00 25.28 ? 33   SER H O     1 
ATOM   8857  C  CB    . SER H  1 33  ? 44.353  26.441  -8.026  1.00 25.35 ? 33   SER H CB    1 
ATOM   8858  O  OG    . SER H  1 33  ? 45.675  26.061  -8.352  1.00 26.62 ? 33   SER H OG    1 
ATOM   8859  N  N     . THR H  1 34  ? 42.396  28.332  -6.341  1.00 25.23 ? 34   THR H N     1 
ATOM   8860  C  CA    . THR H  1 34  ? 41.057  28.787  -5.995  1.00 25.24 ? 34   THR H CA    1 
ATOM   8861  C  C     . THR H  1 34  ? 40.957  30.301  -6.157  1.00 25.15 ? 34   THR H C     1 
ATOM   8862  O  O     . THR H  1 34  ? 39.989  30.796  -6.728  1.00 25.40 ? 34   THR H O     1 
ATOM   8863  C  CB    . THR H  1 34  ? 40.706  28.328  -4.581  1.00 25.11 ? 34   THR H CB    1 
ATOM   8864  O  OG1   . THR H  1 34  ? 40.632  26.901  -4.584  1.00 25.40 ? 34   THR H OG1   1 
ATOM   8865  C  CG2   . THR H  1 34  ? 39.288  28.744  -4.192  1.00 24.76 ? 34   THR H CG2   1 
ATOM   8866  N  N     . GLU H  1 35  ? 41.975  31.023  -5.697  1.00 25.05 ? 35   GLU H N     1 
ATOM   8867  C  CA    . GLU H  1 35  ? 42.017  32.477  -5.843  1.00 25.36 ? 35   GLU H CA    1 
ATOM   8868  C  C     . GLU H  1 35  ? 42.102  32.886  -7.312  1.00 25.40 ? 35   GLU H C     1 
ATOM   8869  O  O     . GLU H  1 35  ? 41.454  33.862  -7.728  1.00 25.27 ? 35   GLU H O     1 
ATOM   8870  C  CB    . GLU H  1 35  ? 43.162  33.090  -5.017  1.00 25.49 ? 35   GLU H CB    1 
ATOM   8871  C  CG    . GLU H  1 35  ? 43.381  34.597  -5.186  1.00 26.78 ? 35   GLU H CG    1 
ATOM   8872  C  CD    . GLU H  1 35  ? 42.161  35.457  -4.839  1.00 30.39 ? 35   GLU H CD    1 
ATOM   8873  O  OE1   . GLU H  1 35  ? 41.195  34.959  -4.190  1.00 30.37 ? 35   GLU H OE1   1 
ATOM   8874  O  OE2   . GLU H  1 35  ? 42.168  36.656  -5.226  1.00 30.49 ? 35   GLU H OE2   1 
ATOM   8875  N  N     . LEU H  1 36  ? 42.891  32.142  -8.089  1.00 25.43 ? 36   LEU H N     1 
ATOM   8876  C  CA    . LEU H  1 36  ? 42.970  32.352  -9.527  1.00 25.93 ? 36   LEU H CA    1 
ATOM   8877  C  C     . LEU H  1 36  ? 41.580  32.239  -10.178 1.00 26.04 ? 36   LEU H C     1 
ATOM   8878  O  O     . LEU H  1 36  ? 41.180  33.126  -10.934 1.00 25.90 ? 36   LEU H O     1 
ATOM   8879  C  CB    . LEU H  1 36  ? 43.999  31.402  -10.175 1.00 26.13 ? 36   LEU H CB    1 
ATOM   8880  C  CG    . LEU H  1 36  ? 44.000  31.249  -11.708 1.00 26.76 ? 36   LEU H CG    1 
ATOM   8881  C  CD1   . LEU H  1 36  ? 44.451  32.528  -12.373 1.00 26.11 ? 36   LEU H CD1   1 
ATOM   8882  C  CD2   . LEU H  1 36  ? 44.886  30.074  -12.170 1.00 27.00 ? 36   LEU H CD2   1 
ATOM   8883  N  N     . MET H  1 37  ? 40.855  31.165  -9.877  1.00 26.44 ? 37   MET H N     1 
ATOM   8884  C  CA    . MET H  1 37  ? 39.502  30.968  -10.426 1.00 27.27 ? 37   MET H CA    1 
ATOM   8885  C  C     . MET H  1 37  ? 38.523  32.043  -9.961  1.00 26.84 ? 37   MET H C     1 
ATOM   8886  O  O     . MET H  1 37  ? 37.703  32.496  -10.748 1.00 26.75 ? 37   MET H O     1 
ATOM   8887  C  CB    . MET H  1 37  ? 38.929  29.591  -10.066 1.00 28.09 ? 37   MET H CB    1 
ATOM   8888  C  CG    . MET H  1 37  ? 39.228  28.428  -11.030 1.00 31.75 ? 37   MET H CG    1 
ATOM   8889  S  SD    . MET H  1 37  ? 39.533  28.835  -12.785 1.00 39.61 ? 37   MET H SD    1 
ATOM   8890  C  CE    . MET H  1 37  ? 41.266  28.925  -12.751 1.00 37.42 ? 37   MET H CE    1 
ATOM   8891  N  N     . ARG H  1 38  ? 38.597  32.435  -8.689  1.00 26.56 ? 38   ARG H N     1 
ATOM   8892  C  CA    . ARG H  1 38  ? 37.765  33.532  -8.178  1.00 26.38 ? 38   ARG H CA    1 
ATOM   8893  C  C     . ARG H  1 38  ? 37.935  34.785  -9.033  1.00 26.43 ? 38   ARG H C     1 
ATOM   8894  O  O     . ARG H  1 38  ? 36.950  35.407  -9.441  1.00 26.54 ? 38   ARG H O     1 
ATOM   8895  C  CB    . ARG H  1 38  ? 38.081  33.856  -6.711  1.00 25.98 ? 38   ARG H CB    1 
ATOM   8896  C  CG    . ARG H  1 38  ? 37.082  34.836  -6.074  1.00 25.66 ? 38   ARG H CG    1 
ATOM   8897  C  CD    . ARG H  1 38  ? 37.516  35.451  -4.748  1.00 25.38 ? 38   ARG H CD    1 
ATOM   8898  N  NE    . ARG H  1 38  ? 38.689  36.315  -4.885  1.00 25.91 ? 38   ARG H NE    1 
ATOM   8899  C  CZ    . ARG H  1 38  ? 38.657  37.621  -5.134  1.00 26.00 ? 38   ARG H CZ    1 
ATOM   8900  N  NH1   . ARG H  1 38  ? 37.496  38.257  -5.281  1.00 25.83 ? 38   ARG H NH1   1 
ATOM   8901  N  NH2   . ARG H  1 38  ? 39.798  38.301  -5.240  1.00 24.70 ? 38   ARG H NH2   1 
ATOM   8902  N  N     . ARG H  1 39  ? 39.185  35.144  -9.308  1.00 26.51 ? 39   ARG H N     1 
ATOM   8903  C  CA    . ARG H  1 39  ? 39.484  36.333  -10.086 1.00 26.82 ? 39   ARG H CA    1 
ATOM   8904  C  C     . ARG H  1 39  ? 39.020  36.194  -11.536 1.00 27.24 ? 39   ARG H C     1 
ATOM   8905  O  O     . ARG H  1 39  ? 38.469  37.140  -12.100 1.00 27.46 ? 39   ARG H O     1 
ATOM   8906  C  CB    . ARG H  1 39  ? 40.979  36.646  -10.041 1.00 26.97 ? 39   ARG H CB    1 
ATOM   8907  C  CG    . ARG H  1 39  ? 41.471  37.214  -8.725  1.00 26.65 ? 39   ARG H CG    1 
ATOM   8908  C  CD    . ARG H  1 39  ? 42.914  37.636  -8.799  1.00 26.52 ? 39   ARG H CD    1 
ATOM   8909  N  NE    . ARG H  1 39  ? 43.540  37.757  -7.493  1.00 25.56 ? 39   ARG H NE    1 
ATOM   8910  C  CZ    . ARG H  1 39  ? 44.746  38.273  -7.294  1.00 25.23 ? 39   ARG H CZ    1 
ATOM   8911  N  NH1   . ARG H  1 39  ? 45.459  38.741  -8.321  1.00 24.96 ? 39   ARG H NH1   1 
ATOM   8912  N  NH2   . ARG H  1 39  ? 45.241  38.324  -6.068  1.00 22.37 ? 39   ARG H NH2   1 
ATOM   8913  N  N     . VAL H  1 40  ? 39.241  35.024  -12.134 1.00 27.48 ? 40   VAL H N     1 
ATOM   8914  C  CA    . VAL H  1 40  ? 38.816  34.778  -13.511 1.00 28.07 ? 40   VAL H CA    1 
ATOM   8915  C  C     . VAL H  1 40  ? 37.279  34.803  -13.642 1.00 28.86 ? 40   VAL H C     1 
ATOM   8916  O  O     . VAL H  1 40  ? 36.741  35.393  -14.587 1.00 28.90 ? 40   VAL H O     1 
ATOM   8917  C  CB    . VAL H  1 40  ? 39.436  33.468  -14.091 1.00 28.04 ? 40   VAL H CB    1 
ATOM   8918  C  CG1   . VAL H  1 40  ? 38.745  33.050  -15.381 1.00 27.42 ? 40   VAL H CG1   1 
ATOM   8919  C  CG2   . VAL H  1 40  ? 40.931  33.646  -14.331 1.00 26.97 ? 40   VAL H CG2   1 
ATOM   8920  N  N     . ARG H  1 41  ? 36.579  34.184  -12.693 1.00 29.58 ? 41   ARG H N     1 
ATOM   8921  C  CA    . ARG H  1 41  ? 35.115  34.141  -12.724 1.00 30.79 ? 41   ARG H CA    1 
ATOM   8922  C  C     . ARG H  1 41  ? 34.470  35.520  -12.607 1.00 30.72 ? 41   ARG H C     1 
ATOM   8923  O  O     . ARG H  1 41  ? 33.378  35.727  -13.116 1.00 30.68 ? 41   ARG H O     1 
ATOM   8924  C  CB    . ARG H  1 41  ? 34.550  33.191  -11.661 1.00 31.12 ? 41   ARG H CB    1 
ATOM   8925  C  CG    . ARG H  1 41  ? 34.684  31.708  -12.040 1.00 34.58 ? 41   ARG H CG    1 
ATOM   8926  C  CD    . ARG H  1 41  ? 33.893  30.748  -11.147 1.00 39.81 ? 41   ARG H CD    1 
ATOM   8927  N  NE    . ARG H  1 41  ? 34.491  29.409  -11.068 1.00 42.98 ? 41   ARG H NE    1 
ATOM   8928  C  CZ    . ARG H  1 41  ? 35.211  28.955  -10.040 1.00 44.49 ? 41   ARG H CZ    1 
ATOM   8929  N  NH1   . ARG H  1 41  ? 35.448  29.728  -8.986  1.00 45.07 ? 41   ARG H NH1   1 
ATOM   8930  N  NH2   . ARG H  1 41  ? 35.699  27.721  -10.068 1.00 44.64 ? 41   ARG H NH2   1 
ATOM   8931  N  N     . ARG H  1 42  ? 35.154  36.452  -11.948 1.00 30.91 ? 42   ARG H N     1 
ATOM   8932  C  CA    . ARG H  1 42  ? 34.710  37.845  -11.865 1.00 31.36 ? 42   ARG H CA    1 
ATOM   8933  C  C     . ARG H  1 42  ? 34.566  38.484  -13.248 1.00 31.36 ? 42   ARG H C     1 
ATOM   8934  O  O     . ARG H  1 42  ? 33.586  39.180  -13.514 1.00 31.05 ? 42   ARG H O     1 
ATOM   8935  C  CB    . ARG H  1 42  ? 35.696  38.677  -11.042 1.00 31.27 ? 42   ARG H CB    1 
ATOM   8936  C  CG    . ARG H  1 42  ? 35.476  38.625  -9.557  1.00 32.50 ? 42   ARG H CG    1 
ATOM   8937  C  CD    . ARG H  1 42  ? 36.612  39.225  -8.744  1.00 34.51 ? 42   ARG H CD    1 
ATOM   8938  N  NE    . ARG H  1 42  ? 36.760  40.660  -8.988  1.00 36.74 ? 42   ARG H NE    1 
ATOM   8939  C  CZ    . ARG H  1 42  ? 37.702  41.204  -9.759  1.00 38.14 ? 42   ARG H CZ    1 
ATOM   8940  N  NH1   . ARG H  1 42  ? 38.602  40.433  -10.389 1.00 37.73 ? 42   ARG H NH1   1 
ATOM   8941  N  NH2   . ARG H  1 42  ? 37.734  42.523  -9.913  1.00 37.27 ? 42   ARG H NH2   1 
ATOM   8942  N  N     . PHE H  1 43  ? 35.551  38.240  -14.114 1.00 31.60 ? 43   PHE H N     1 
ATOM   8943  C  CA    . PHE H  1 43  ? 35.537  38.764  -15.475 1.00 32.05 ? 43   PHE H CA    1 
ATOM   8944  C  C     . PHE H  1 43  ? 34.540  38.027  -16.342 1.00 32.79 ? 43   PHE H C     1 
ATOM   8945  O  O     . PHE H  1 43  ? 33.807  38.640  -17.116 1.00 32.73 ? 43   PHE H O     1 
ATOM   8946  C  CB    . PHE H  1 43  ? 36.926  38.687  -16.096 1.00 31.65 ? 43   PHE H CB    1 
ATOM   8947  C  CG    . PHE H  1 43  ? 37.900  39.657  -15.503 1.00 30.99 ? 43   PHE H CG    1 
ATOM   8948  C  CD1   . PHE H  1 43  ? 38.909  39.212  -14.662 1.00 29.28 ? 43   PHE H CD1   1 
ATOM   8949  C  CD2   . PHE H  1 43  ? 37.804  41.021  -15.782 1.00 30.06 ? 43   PHE H CD2   1 
ATOM   8950  C  CE1   . PHE H  1 43  ? 39.818  40.100  -14.113 1.00 29.59 ? 43   PHE H CE1   1 
ATOM   8951  C  CE2   . PHE H  1 43  ? 38.705  41.922  -15.231 1.00 30.29 ? 43   PHE H CE2   1 
ATOM   8952  C  CZ    . PHE H  1 43  ? 39.716  41.461  -14.392 1.00 30.02 ? 43   PHE H CZ    1 
ATOM   8953  N  N     . GLN H  1 44  ? 34.518  36.709  -16.194 1.00 33.72 ? 44   GLN H N     1 
ATOM   8954  C  CA    . GLN H  1 44  ? 33.666  35.834  -16.986 1.00 34.95 ? 44   GLN H CA    1 
ATOM   8955  C  C     . GLN H  1 44  ? 32.186  36.172  -16.792 1.00 35.25 ? 44   GLN H C     1 
ATOM   8956  O  O     . GLN H  1 44  ? 31.437  36.280  -17.763 1.00 35.22 ? 44   GLN H O     1 
ATOM   8957  C  CB    . GLN H  1 44  ? 33.966  34.385  -16.606 1.00 35.15 ? 44   GLN H CB    1 
ATOM   8958  C  CG    . GLN H  1 44  ? 33.215  33.324  -17.374 1.00 37.42 ? 44   GLN H CG    1 
ATOM   8959  C  CD    . GLN H  1 44  ? 33.801  31.949  -17.119 1.00 40.94 ? 44   GLN H CD    1 
ATOM   8960  O  OE1   . GLN H  1 44  ? 33.729  31.432  -15.996 1.00 42.49 ? 44   GLN H OE1   1 
ATOM   8961  N  NE2   . GLN H  1 44  ? 34.403  31.360  -18.147 1.00 42.18 ? 44   GLN H NE2   1 
ATOM   8962  N  N     . ILE H  1 45  ? 31.780  36.361  -15.539 1.00 35.87 ? 45   ILE H N     1 
ATOM   8963  C  CA    . ILE H  1 45  ? 30.395  36.716  -15.222 1.00 36.46 ? 45   ILE H CA    1 
ATOM   8964  C  C     . ILE H  1 45  ? 30.006  38.097  -15.768 1.00 36.64 ? 45   ILE H C     1 
ATOM   8965  O  O     . ILE H  1 45  ? 28.826  38.400  -15.919 1.00 36.59 ? 45   ILE H O     1 
ATOM   8966  C  CB    . ILE H  1 45  ? 30.105  36.562  -13.699 1.00 36.64 ? 45   ILE H CB    1 
ATOM   8967  C  CG1   . ILE H  1 45  ? 28.596  36.443  -13.453 1.00 37.78 ? 45   ILE H CG1   1 
ATOM   8968  C  CG2   . ILE H  1 45  ? 30.734  37.688  -12.873 1.00 36.20 ? 45   ILE H CG2   1 
ATOM   8969  C  CD1   . ILE H  1 45  ? 28.209  35.288  -12.555 1.00 38.94 ? 45   ILE H CD1   1 
ATOM   8970  N  N     . ALA H  1 46  ? 31.006  38.913  -16.085 1.00 36.97 ? 46   ALA H N     1 
ATOM   8971  C  CA    . ALA H  1 46  ? 30.775  40.205  -16.726 1.00 37.48 ? 46   ALA H CA    1 
ATOM   8972  C  C     . ALA H  1 46  ? 30.949  40.155  -18.247 1.00 38.02 ? 46   ALA H C     1 
ATOM   8973  O  O     . ALA H  1 46  ? 31.112  41.191  -18.889 1.00 38.19 ? 46   ALA H O     1 
ATOM   8974  C  CB    . ALA H  1 46  ? 31.677  41.263  -16.126 1.00 37.32 ? 46   ALA H CB    1 
ATOM   8975  N  N     . GLN H  1 47  ? 30.916  38.949  -18.814 1.00 38.93 ? 47   GLN H N     1 
ATOM   8976  C  CA    . GLN H  1 47  ? 30.903  38.741  -20.273 1.00 39.92 ? 47   GLN H CA    1 
ATOM   8977  C  C     . GLN H  1 47  ? 32.271  38.780  -20.981 1.00 39.77 ? 47   GLN H C     1 
ATOM   8978  O  O     . GLN H  1 47  ? 32.324  38.749  -22.212 1.00 40.01 ? 47   GLN H O     1 
ATOM   8979  C  CB    . GLN H  1 47  ? 29.909  39.698  -20.974 1.00 40.36 ? 47   GLN H CB    1 
ATOM   8980  C  CG    . GLN H  1 47  ? 28.490  39.738  -20.365 1.00 42.81 ? 47   GLN H CG    1 
ATOM   8981  C  CD    . GLN H  1 47  ? 27.583  38.656  -20.925 1.00 46.22 ? 47   GLN H CD    1 
ATOM   8982  O  OE1   . GLN H  1 47  ? 27.806  37.459  -20.689 1.00 47.18 ? 47   GLN H OE1   1 
ATOM   8983  N  NE2   . GLN H  1 47  ? 26.565  39.068  -21.678 1.00 46.58 ? 47   GLN H NE2   1 
ATOM   8984  N  N     . TYR H  1 48  ? 33.366  38.862  -20.225 1.00 39.53 ? 48   TYR H N     1 
ATOM   8985  C  CA    . TYR H  1 48  ? 34.699  38.760  -20.824 1.00 39.45 ? 48   TYR H CA    1 
ATOM   8986  C  C     . TYR H  1 48  ? 34.976  37.336  -21.311 1.00 39.10 ? 48   TYR H C     1 
ATOM   8987  O  O     . TYR H  1 48  ? 34.554  36.361  -20.682 1.00 39.03 ? 48   TYR H O     1 
ATOM   8988  C  CB    . TYR H  1 48  ? 35.777  39.137  -19.818 1.00 39.51 ? 48   TYR H CB    1 
ATOM   8989  C  CG    . TYR H  1 48  ? 35.976  40.614  -19.601 1.00 40.34 ? 48   TYR H CG    1 
ATOM   8990  C  CD1   . TYR H  1 48  ? 36.953  41.316  -20.306 1.00 41.42 ? 48   TYR H CD1   1 
ATOM   8991  C  CD2   . TYR H  1 48  ? 35.213  41.305  -18.662 1.00 40.61 ? 48   TYR H CD2   1 
ATOM   8992  C  CE1   . TYR H  1 48  ? 37.157  42.677  -20.090 1.00 42.93 ? 48   TYR H CE1   1 
ATOM   8993  C  CE2   . TYR H  1 48  ? 35.402  42.656  -18.441 1.00 41.92 ? 48   TYR H CE2   1 
ATOM   8994  C  CZ    . TYR H  1 48  ? 36.375  43.338  -19.153 1.00 43.01 ? 48   TYR H CZ    1 
ATOM   8995  O  OH    . TYR H  1 48  ? 36.566  44.678  -18.925 1.00 43.87 ? 48   TYR H OH    1 
ATOM   8996  N  N     . LYS H  1 49  ? 35.691  37.222  -22.423 1.00 38.81 ? 49   LYS H N     1 
ATOM   8997  C  CA    . LYS H  1 49  ? 36.185  35.933  -22.886 1.00 38.67 ? 49   LYS H CA    1 
ATOM   8998  C  C     . LYS H  1 49  ? 37.412  35.528  -22.070 1.00 37.72 ? 49   LYS H C     1 
ATOM   8999  O  O     . LYS H  1 49  ? 38.368  36.299  -21.954 1.00 37.47 ? 49   LYS H O     1 
ATOM   9000  C  CB    . LYS H  1 49  ? 36.531  36.001  -24.374 1.00 39.17 ? 49   LYS H CB    1 
ATOM   9001  C  CG    . LYS H  1 49  ? 35.668  35.105  -25.238 1.00 41.40 ? 49   LYS H CG    1 
ATOM   9002  C  CD    . LYS H  1 49  ? 36.246  33.689  -25.299 1.00 44.72 ? 49   LYS H CD    1 
ATOM   9003  C  CE    . LYS H  1 49  ? 35.536  32.835  -26.357 1.00 46.93 ? 49   LYS H CE    1 
ATOM   9004  N  NZ    . LYS H  1 49  ? 36.295  32.782  -27.645 1.00 48.01 ? 49   LYS H NZ    1 
ATOM   9005  N  N     . CYS H  1 50  ? 37.376  34.323  -21.506 1.00 36.74 ? 50   CYS H N     1 
ATOM   9006  C  CA    . CYS H  1 50  ? 38.425  33.856  -20.608 1.00 36.11 ? 50   CYS H CA    1 
ATOM   9007  C  C     . CYS H  1 50  ? 39.079  32.558  -21.069 1.00 35.76 ? 50   CYS H C     1 
ATOM   9008  O  O     . CYS H  1 50  ? 38.441  31.717  -21.710 1.00 35.74 ? 50   CYS H O     1 
ATOM   9009  C  CB    . CYS H  1 50  ? 37.862  33.657  -19.201 1.00 35.89 ? 50   CYS H CB    1 
ATOM   9010  S  SG    . CYS H  1 50  ? 37.145  35.146  -18.475 1.00 36.12 ? 50   CYS H SG    1 
ATOM   9011  N  N     . LEU H  1 51  ? 40.355  32.405  -20.735 1.00 35.03 ? 51   LEU H N     1 
ATOM   9012  C  CA    . LEU H  1 51  ? 41.063  31.149  -20.933 1.00 34.48 ? 51   LEU H CA    1 
ATOM   9013  C  C     . LEU H  1 51  ? 41.865  30.818  -19.685 1.00 34.07 ? 51   LEU H C     1 
ATOM   9014  O  O     . LEU H  1 51  ? 42.539  31.686  -19.131 1.00 34.06 ? 51   LEU H O     1 
ATOM   9015  C  CB    . LEU H  1 51  ? 42.007  31.225  -22.140 1.00 34.44 ? 51   LEU H CB    1 
ATOM   9016  C  CG    . LEU H  1 51  ? 43.010  30.068  -22.297 1.00 34.62 ? 51   LEU H CG    1 
ATOM   9017  C  CD1   . LEU H  1 51  ? 42.301  28.745  -22.583 1.00 34.62 ? 51   LEU H CD1   1 
ATOM   9018  C  CD2   . LEU H  1 51  ? 44.051  30.352  -23.372 1.00 35.46 ? 51   LEU H CD2   1 
ATOM   9019  N  N     . VAL H  1 52  ? 41.790  29.566  -19.250 1.00 33.64 ? 52   VAL H N     1 
ATOM   9020  C  CA    . VAL H  1 52  ? 42.629  29.087  -18.163 1.00 33.53 ? 52   VAL H CA    1 
ATOM   9021  C  C     . VAL H  1 52  ? 43.595  28.015  -18.688 1.00 33.65 ? 52   VAL H C     1 
ATOM   9022  O  O     . VAL H  1 52  ? 43.188  27.083  -19.388 1.00 33.42 ? 52   VAL H O     1 
ATOM   9023  C  CB    . VAL H  1 52  ? 41.788  28.581  -16.955 1.00 33.68 ? 52   VAL H CB    1 
ATOM   9024  C  CG1   . VAL H  1 52  ? 42.701  28.061  -15.835 1.00 33.33 ? 52   VAL H CG1   1 
ATOM   9025  C  CG2   . VAL H  1 52  ? 40.890  29.698  -16.410 1.00 33.10 ? 52   VAL H CG2   1 
ATOM   9026  N  N     . ILE H  1 53  ? 44.875  28.175  -18.365 1.00 33.71 ? 53   ILE H N     1 
ATOM   9027  C  CA    . ILE H  1 53  ? 45.913  27.236  -18.771 1.00 33.86 ? 53   ILE H CA    1 
ATOM   9028  C  C     . ILE H  1 53  ? 46.485  26.542  -17.545 1.00 34.60 ? 53   ILE H C     1 
ATOM   9029  O  O     . ILE H  1 53  ? 46.812  27.192  -16.546 1.00 34.55 ? 53   ILE H O     1 
ATOM   9030  C  CB    . ILE H  1 53  ? 47.046  27.964  -19.537 1.00 33.73 ? 53   ILE H CB    1 
ATOM   9031  C  CG1   . ILE H  1 53  ? 46.495  28.659  -20.781 1.00 32.96 ? 53   ILE H CG1   1 
ATOM   9032  C  CG2   . ILE H  1 53  ? 48.191  26.993  -19.890 1.00 32.86 ? 53   ILE H CG2   1 
ATOM   9033  C  CD1   . ILE H  1 53  ? 47.245  29.912  -21.151 1.00 32.88 ? 53   ILE H CD1   1 
ATOM   9034  N  N     . LYS H  1 54  ? 46.591  25.221  -17.612 1.00 35.41 ? 54   LYS H N     1 
ATOM   9035  C  CA    . LYS H  1 54  ? 47.242  24.484  -16.546 1.00 36.68 ? 54   LYS H CA    1 
ATOM   9036  C  C     . LYS H  1 54  ? 48.401  23.645  -17.074 1.00 36.95 ? 54   LYS H C     1 
ATOM   9037  O  O     . LYS H  1 54  ? 48.463  23.324  -18.259 1.00 36.88 ? 54   LYS H O     1 
ATOM   9038  C  CB    . LYS H  1 54  ? 46.250  23.676  -15.700 1.00 36.87 ? 54   LYS H CB    1 
ATOM   9039  C  CG    . LYS H  1 54  ? 45.366  22.706  -16.450 1.00 39.21 ? 54   LYS H CG    1 
ATOM   9040  C  CD    . LYS H  1 54  ? 44.469  21.924  -15.477 1.00 43.04 ? 54   LYS H CD    1 
ATOM   9041  C  CE    . LYS H  1 54  ? 45.290  20.967  -14.600 1.00 45.32 ? 54   LYS H CE    1 
ATOM   9042  N  NZ    . LYS H  1 54  ? 45.708  19.747  -15.361 1.00 46.86 ? 54   LYS H NZ    1 
ATOM   9043  N  N     . TYR H  1 55  ? 49.339  23.338  -16.189 1.00 37.57 ? 55   TYR H N     1 
ATOM   9044  C  CA    . TYR H  1 55  ? 50.505  22.542  -16.534 1.00 38.46 ? 55   TYR H CA    1 
ATOM   9045  C  C     . TYR H  1 55  ? 50.105  21.088  -16.756 1.00 39.35 ? 55   TYR H C     1 
ATOM   9046  O  O     . TYR H  1 55  ? 49.567  20.434  -15.856 1.00 39.20 ? 55   TYR H O     1 
ATOM   9047  C  CB    . TYR H  1 55  ? 51.560  22.657  -15.436 1.00 38.25 ? 55   TYR H CB    1 
ATOM   9048  C  CG    . TYR H  1 55  ? 52.886  21.985  -15.724 1.00 37.83 ? 55   TYR H CG    1 
ATOM   9049  C  CD1   . TYR H  1 55  ? 53.621  22.276  -16.882 1.00 37.91 ? 55   TYR H CD1   1 
ATOM   9050  C  CD2   . TYR H  1 55  ? 53.425  21.084  -14.816 1.00 36.82 ? 55   TYR H CD2   1 
ATOM   9051  C  CE1   . TYR H  1 55  ? 54.859  21.657  -17.126 1.00 37.07 ? 55   TYR H CE1   1 
ATOM   9052  C  CE2   . TYR H  1 55  ? 54.644  20.472  -15.045 1.00 37.20 ? 55   TYR H CE2   1 
ATOM   9053  C  CZ    . TYR H  1 55  ? 55.357  20.755  -16.199 1.00 37.31 ? 55   TYR H CZ    1 
ATOM   9054  O  OH    . TYR H  1 55  ? 56.563  20.124  -16.396 1.00 37.77 ? 55   TYR H OH    1 
ATOM   9055  N  N     . ALA H  1 56  ? 50.382  20.603  -17.964 1.00 40.60 ? 56   ALA H N     1 
ATOM   9056  C  CA    . ALA H  1 56  ? 49.947  19.288  -18.433 1.00 42.05 ? 56   ALA H CA    1 
ATOM   9057  C  C     . ALA H  1 56  ? 50.424  18.127  -17.570 1.00 43.02 ? 56   ALA H C     1 
ATOM   9058  O  O     . ALA H  1 56  ? 49.720  17.132  -17.421 1.00 43.34 ? 56   ALA H O     1 
ATOM   9059  C  CB    . ALA H  1 56  ? 50.389  19.084  -19.871 1.00 41.80 ? 56   ALA H CB    1 
ATOM   9060  N  N     . LYS H  1 57  ? 51.614  18.267  -16.998 1.00 44.40 ? 57   LYS H N     1 
ATOM   9061  C  CA    . LYS H  1 57  ? 52.241  17.192  -16.230 1.00 45.86 ? 57   LYS H CA    1 
ATOM   9062  C  C     . LYS H  1 57  ? 51.738  17.047  -14.792 1.00 46.58 ? 57   LYS H C     1 
ATOM   9063  O  O     . LYS H  1 57  ? 52.073  16.073  -14.114 1.00 46.76 ? 57   LYS H O     1 
ATOM   9064  C  CB    . LYS H  1 57  ? 53.764  17.351  -16.236 1.00 46.00 ? 57   LYS H CB    1 
ATOM   9065  C  CG    . LYS H  1 57  ? 54.418  17.054  -17.577 1.00 47.23 ? 57   LYS H CG    1 
ATOM   9066  C  CD    . LYS H  1 57  ? 55.923  16.937  -17.415 1.00 49.70 ? 57   LYS H CD    1 
ATOM   9067  C  CE    . LYS H  1 57  ? 56.618  16.781  -18.765 1.00 51.58 ? 57   LYS H CE    1 
ATOM   9068  N  NZ    . LYS H  1 57  ? 56.840  18.099  -19.438 1.00 52.82 ? 57   LYS H NZ    1 
ATOM   9069  N  N     . ASP H  1 58  ? 50.957  18.016  -14.317 1.00 47.48 ? 58   ASP H N     1 
ATOM   9070  C  CA    . ASP H  1 58  ? 50.328  17.891  -13.008 1.00 48.30 ? 58   ASP H CA    1 
ATOM   9071  C  C     . ASP H  1 58  ? 48.896  17.422  -13.205 1.00 48.62 ? 58   ASP H C     1 
ATOM   9072  O  O     . ASP H  1 58  ? 47.998  18.211  -13.485 1.00 48.98 ? 58   ASP H O     1 
ATOM   9073  C  CB    . ASP H  1 58  ? 50.407  19.202  -12.216 1.00 48.19 ? 58   ASP H CB    1 
ATOM   9074  C  CG    . ASP H  1 58  ? 50.133  19.007  -10.726 1.00 48.35 ? 58   ASP H CG    1 
ATOM   9075  O  OD1   . ASP H  1 58  ? 49.355  18.091  -10.379 1.00 48.76 ? 58   ASP H OD1   1 
ATOM   9076  O  OD2   . ASP H  1 58  ? 50.643  19.716  -9.829  1.00 47.22 ? 58   ASP H OD2   1 
ATOM   9077  N  N     . THR H  1 59  ? 48.691  16.122  -13.088 1.00 47.42 ? 59   THR H N     1 
ATOM   9078  C  CA    . THR H  1 59  ? 47.400  15.553  -13.429 1.00 46.62 ? 59   THR H CA    1 
ATOM   9079  C  C     . THR H  1 59  ? 46.551  15.251  -12.195 1.00 45.82 ? 59   THR H C     1 
ATOM   9080  O  O     . THR H  1 59  ? 45.554  14.534  -12.285 1.00 45.68 ? 59   THR H O     1 
ATOM   9081  C  CB    . THR H  1 59  ? 47.583  14.316  -14.335 1.00 46.67 ? 59   THR H CB    1 
ATOM   9082  O  OG1   . THR H  1 59  ? 48.805  13.642  -13.998 1.00 46.98 ? 59   THR H OG1   1 
ATOM   9083  C  CG2   . THR H  1 59  ? 47.816  14.759  -15.771 1.00 47.01 ? 59   THR H CG2   1 
ATOM   9084  N  N     . ARG H  1 60  ? 46.949  15.820  -11.057 1.00 45.11 ? 60   ARG H N     1 
ATOM   9085  C  CA    . ARG H  1 60  ? 46.240  15.652  -9.788  1.00 44.77 ? 60   ARG H CA    1 
ATOM   9086  C  C     . ARG H  1 60  ? 44.793  16.109  -9.903  1.00 45.02 ? 60   ARG H C     1 
ATOM   9087  O  O     . ARG H  1 60  ? 44.510  17.131  -10.533 1.00 44.91 ? 60   ARG H O     1 
ATOM   9088  C  CB    . ARG H  1 60  ? 46.931  16.427  -8.659  1.00 44.49 ? 60   ARG H CB    1 
ATOM   9089  C  CG    . ARG H  1 60  ? 48.283  15.853  -8.200  1.00 43.13 ? 60   ARG H CG    1 
ATOM   9090  C  CD    . ARG H  1 60  ? 49.041  16.746  -7.218  1.00 40.39 ? 60   ARG H CD    1 
ATOM   9091  N  NE    . ARG H  1 60  ? 49.097  18.134  -7.675  1.00 39.54 ? 60   ARG H NE    1 
ATOM   9092  C  CZ    . ARG H  1 60  ? 48.736  19.201  -6.962  1.00 38.89 ? 60   ARG H CZ    1 
ATOM   9093  N  NH1   . ARG H  1 60  ? 48.295  19.081  -5.714  1.00 37.44 ? 60   ARG H NH1   1 
ATOM   9094  N  NH2   . ARG H  1 60  ? 48.828  20.407  -7.510  1.00 39.56 ? 60   ARG H NH2   1 
ATOM   9095  N  N     . TYR H  1 61  ? 43.883  15.346  -9.302  1.00 45.10 ? 61   TYR H N     1 
ATOM   9096  C  CA    . TYR H  1 61  ? 42.456  15.642  -9.378  1.00 45.69 ? 61   TYR H CA    1 
ATOM   9097  C  C     . TYR H  1 61  ? 42.129  17.029  -8.821  1.00 45.37 ? 61   TYR H C     1 
ATOM   9098  O  O     . TYR H  1 61  ? 42.782  17.496  -7.890  1.00 45.46 ? 61   TYR H O     1 
ATOM   9099  C  CB    . TYR H  1 61  ? 41.634  14.562  -8.658  1.00 45.86 ? 61   TYR H CB    1 
ATOM   9100  C  CG    . TYR H  1 61  ? 40.143  14.810  -8.718  1.00 47.33 ? 61   TYR H CG    1 
ATOM   9101  C  CD1   . TYR H  1 61  ? 39.415  14.499  -9.864  1.00 48.89 ? 61   TYR H CD1   1 
ATOM   9102  C  CD2   . TYR H  1 61  ? 39.464  15.379  -7.635  1.00 48.34 ? 61   TYR H CD2   1 
ATOM   9103  C  CE1   . TYR H  1 61  ? 38.045  14.739  -9.930  1.00 50.96 ? 61   TYR H CE1   1 
ATOM   9104  C  CE2   . TYR H  1 61  ? 38.099  15.628  -7.691  1.00 49.83 ? 61   TYR H CE2   1 
ATOM   9105  C  CZ    . TYR H  1 61  ? 37.390  15.303  -8.840  1.00 51.53 ? 61   TYR H CZ    1 
ATOM   9106  O  OH    . TYR H  1 61  ? 36.024  15.532  -8.907  1.00 52.55 ? 61   TYR H OH    1 
ATOM   9107  N  N     . ALA H  1 75  ? 39.746  24.871  -19.637 1.00 48.17 ? 75   ALA H N     1 
ATOM   9108  C  CA    . ALA H  1 75  ? 40.994  24.665  -18.905 1.00 47.94 ? 75   ALA H CA    1 
ATOM   9109  C  C     . ALA H  1 75  ? 42.012  23.852  -19.723 1.00 47.59 ? 75   ALA H C     1 
ATOM   9110  O  O     . ALA H  1 75  ? 42.142  22.630  -19.545 1.00 47.73 ? 75   ALA H O     1 
ATOM   9111  C  CB    . ALA H  1 75  ? 40.729  24.020  -17.538 1.00 47.89 ? 75   ALA H CB    1 
ATOM   9112  N  N     . LEU H  1 76  ? 42.731  24.550  -20.606 1.00 46.60 ? 76   LEU H N     1 
ATOM   9113  C  CA    . LEU H  1 76  ? 43.679  23.925  -21.524 1.00 45.82 ? 76   LEU H CA    1 
ATOM   9114  C  C     . LEU H  1 76  ? 44.977  23.475  -20.861 1.00 44.98 ? 76   LEU H C     1 
ATOM   9115  O  O     . LEU H  1 76  ? 45.651  24.268  -20.214 1.00 44.88 ? 76   LEU H O     1 
ATOM   9116  C  CB    . LEU H  1 76  ? 44.001  24.866  -22.682 1.00 45.87 ? 76   LEU H CB    1 
ATOM   9117  C  CG    . LEU H  1 76  ? 42.972  24.969  -23.803 1.00 46.69 ? 76   LEU H CG    1 
ATOM   9118  C  CD1   . LEU H  1 76  ? 43.421  26.013  -24.819 1.00 46.88 ? 76   LEU H CD1   1 
ATOM   9119  C  CD2   . LEU H  1 76  ? 42.745  23.613  -24.476 1.00 46.97 ? 76   LEU H CD2   1 
ATOM   9120  N  N     . PRO H  1 77  ? 45.332  22.205  -21.041 1.00 44.33 ? 77   PRO H N     1 
ATOM   9121  C  CA    . PRO H  1 77  ? 46.626  21.692  -20.569 1.00 43.84 ? 77   PRO H CA    1 
ATOM   9122  C  C     . PRO H  1 77  ? 47.757  22.110  -21.521 1.00 43.24 ? 77   PRO H C     1 
ATOM   9123  O  O     . PRO H  1 77  ? 47.551  22.160  -22.733 1.00 43.03 ? 77   PRO H O     1 
ATOM   9124  C  CB    . PRO H  1 77  ? 46.429  20.172  -20.591 1.00 43.77 ? 77   PRO H CB    1 
ATOM   9125  C  CG    . PRO H  1 77  ? 45.391  19.928  -21.660 1.00 43.96 ? 77   PRO H CG    1 
ATOM   9126  C  CD    . PRO H  1 77  ? 44.535  21.169  -21.729 1.00 44.26 ? 77   PRO H CD    1 
ATOM   9127  N  N     . ALA H  1 78  ? 48.924  22.431  -20.973 1.00 42.69 ? 78   ALA H N     1 
ATOM   9128  C  CA    . ALA H  1 78  ? 50.087  22.808  -21.779 1.00 42.29 ? 78   ALA H CA    1 
ATOM   9129  C  C     . ALA H  1 78  ? 51.393  22.552  -21.038 1.00 42.26 ? 78   ALA H C     1 
ATOM   9130  O  O     . ALA H  1 78  ? 51.417  22.489  -19.805 1.00 42.14 ? 78   ALA H O     1 
ATOM   9131  C  CB    . ALA H  1 78  ? 50.005  24.271  -22.213 1.00 41.80 ? 78   ALA H CB    1 
ATOM   9132  N  N     . CYS H  1 79  ? 52.471  22.407  -21.806 1.00 42.30 ? 79   CYS H N     1 
ATOM   9133  C  CA    . CYS H  1 79  ? 53.819  22.227  -21.271 1.00 42.71 ? 79   CYS H CA    1 
ATOM   9134  C  C     . CYS H  1 79  ? 54.649  23.466  -21.532 1.00 41.98 ? 79   CYS H C     1 
ATOM   9135  O  O     . CYS H  1 79  ? 55.603  23.768  -20.803 1.00 41.96 ? 79   CYS H O     1 
ATOM   9136  C  CB    . CYS H  1 79  ? 54.494  21.024  -21.933 1.00 42.76 ? 79   CYS H CB    1 
ATOM   9137  S  SG    . CYS H  1 79  ? 54.544  19.589  -20.842 1.00 48.00 ? 79   CYS H SG    1 
ATOM   9138  N  N     . LEU H  1 80  ? 54.289  24.154  -22.609 1.00 41.52 ? 80   LEU H N     1 
ATOM   9139  C  CA    . LEU H  1 80  ? 54.880  25.426  -22.990 1.00 41.19 ? 80   LEU H CA    1 
ATOM   9140  C  C     . LEU H  1 80  ? 53.718  26.345  -23.306 1.00 40.63 ? 80   LEU H C     1 
ATOM   9141  O  O     . LEU H  1 80  ? 52.761  25.924  -23.948 1.00 40.39 ? 80   LEU H O     1 
ATOM   9142  C  CB    . LEU H  1 80  ? 55.753  25.262  -24.233 1.00 41.13 ? 80   LEU H CB    1 
ATOM   9143  C  CG    . LEU H  1 80  ? 57.270  25.421  -24.129 1.00 42.21 ? 80   LEU H CG    1 
ATOM   9144  C  CD1   . LEU H  1 80  ? 57.905  25.174  -25.503 1.00 42.56 ? 80   LEU H CD1   1 
ATOM   9145  C  CD2   . LEU H  1 80  ? 57.673  26.793  -23.592 1.00 41.70 ? 80   LEU H CD2   1 
ATOM   9146  N  N     . LEU H  1 81  ? 53.792  27.591  -22.849 1.00 40.17 ? 81   LEU H N     1 
ATOM   9147  C  CA    . LEU H  1 81  ? 52.701  28.530  -23.070 1.00 39.86 ? 81   LEU H CA    1 
ATOM   9148  C  C     . LEU H  1 81  ? 52.597  28.925  -24.544 1.00 40.22 ? 81   LEU H C     1 
ATOM   9149  O  O     . LEU H  1 81  ? 51.512  29.240  -25.029 1.00 40.08 ? 81   LEU H O     1 
ATOM   9150  C  CB    . LEU H  1 81  ? 52.815  29.761  -22.159 1.00 39.43 ? 81   LEU H CB    1 
ATOM   9151  C  CG    . LEU H  1 81  ? 52.700  29.546  -20.645 1.00 38.67 ? 81   LEU H CG    1 
ATOM   9152  C  CD1   . LEU H  1 81  ? 53.347  30.691  -19.901 1.00 37.02 ? 81   LEU H CD1   1 
ATOM   9153  C  CD2   . LEU H  1 81  ? 51.261  29.333  -20.169 1.00 37.13 ? 81   LEU H CD2   1 
ATOM   9154  N  N     . ARG H  1 82  ? 53.729  28.894  -25.242 1.00 40.62 ? 82   ARG H N     1 
ATOM   9155  C  CA    . ARG H  1 82  ? 53.790  29.094  -26.689 1.00 41.25 ? 82   ARG H CA    1 
ATOM   9156  C  C     . ARG H  1 82  ? 52.820  28.183  -27.461 1.00 41.29 ? 82   ARG H C     1 
ATOM   9157  O  O     . ARG H  1 82  ? 52.256  28.592  -28.475 1.00 41.12 ? 82   ARG H O     1 
ATOM   9158  C  CB    . ARG H  1 82  ? 55.205  28.777  -27.157 1.00 41.38 ? 82   ARG H CB    1 
ATOM   9159  C  CG    . ARG H  1 82  ? 55.777  29.748  -28.133 1.00 42.53 ? 82   ARG H CG    1 
ATOM   9160  C  CD    . ARG H  1 82  ? 57.205  29.433  -28.487 1.00 44.04 ? 82   ARG H CD    1 
ATOM   9161  N  NE    . ARG H  1 82  ? 57.355  28.042  -28.904 1.00 45.85 ? 82   ARG H NE    1 
ATOM   9162  C  CZ    . ARG H  1 82  ? 58.318  27.227  -28.490 1.00 46.43 ? 82   ARG H CZ    1 
ATOM   9163  N  NH1   . ARG H  1 82  ? 59.242  27.660  -27.632 1.00 45.67 ? 82   ARG H NH1   1 
ATOM   9164  N  NH2   . ARG H  1 82  ? 58.358  25.971  -28.943 1.00 45.90 ? 82   ARG H NH2   1 
ATOM   9165  N  N     . ASP H  1 83  ? 52.653  26.947  -26.985 1.00 41.45 ? 83   ASP H N     1 
ATOM   9166  C  CA    . ASP H  1 83  ? 51.794  25.960  -27.642 1.00 42.01 ? 83   ASP H CA    1 
ATOM   9167  C  C     . ASP H  1 83  ? 50.324  26.341  -27.603 1.00 42.18 ? 83   ASP H C     1 
ATOM   9168  O  O     . ASP H  1 83  ? 49.501  25.747  -28.292 1.00 42.27 ? 83   ASP H O     1 
ATOM   9169  C  CB    . ASP H  1 83  ? 51.944  24.581  -26.996 1.00 42.24 ? 83   ASP H CB    1 
ATOM   9170  C  CG    . ASP H  1 83  ? 53.390  24.148  -26.854 1.00 42.84 ? 83   ASP H CG    1 
ATOM   9171  O  OD1   . ASP H  1 83  ? 54.207  24.429  -27.761 1.00 43.92 ? 83   ASP H OD1   1 
ATOM   9172  O  OD2   . ASP H  1 83  ? 53.795  23.513  -25.862 1.00 43.57 ? 83   ASP H OD2   1 
ATOM   9173  N  N     . VAL H  1 84  ? 50.003  27.339  -26.797 1.00 42.51 ? 84   VAL H N     1 
ATOM   9174  C  CA    . VAL H  1 84  ? 48.628  27.727  -26.565 1.00 42.59 ? 84   VAL H CA    1 
ATOM   9175  C  C     . VAL H  1 84  ? 48.420  29.217  -26.894 1.00 42.86 ? 84   VAL H C     1 
ATOM   9176  O  O     . VAL H  1 84  ? 47.332  29.769  -26.687 1.00 42.76 ? 84   VAL H O     1 
ATOM   9177  C  CB    . VAL H  1 84  ? 48.221  27.306  -25.114 1.00 42.83 ? 84   VAL H CB    1 
ATOM   9178  C  CG1   . VAL H  1 84  ? 47.760  28.477  -24.270 1.00 42.57 ? 84   VAL H CG1   1 
ATOM   9179  C  CG2   . VAL H  1 84  ? 47.188  26.201  -25.143 1.00 42.74 ? 84   VAL H CG2   1 
ATOM   9180  N  N     . ALA H  1 85  ? 49.460  29.839  -27.455 1.00 43.27 ? 85   ALA H N     1 
ATOM   9181  C  CA    . ALA H  1 85  ? 49.485  31.280  -27.752 1.00 43.94 ? 85   ALA H CA    1 
ATOM   9182  C  C     . ALA H  1 85  ? 48.342  31.732  -28.660 1.00 44.28 ? 85   ALA H C     1 
ATOM   9183  O  O     . ALA H  1 85  ? 47.783  32.811  -28.488 1.00 44.38 ? 85   ALA H O     1 
ATOM   9184  C  CB    . ALA H  1 85  ? 50.820  31.663  -28.372 1.00 43.75 ? 85   ALA H CB    1 
ATOM   9185  N  N     . GLN H  1 86  ? 48.011  30.885  -29.624 1.00 44.76 ? 86   GLN H N     1 
ATOM   9186  C  CA    . GLN H  1 86  ? 46.969  31.147  -30.607 1.00 45.34 ? 86   GLN H CA    1 
ATOM   9187  C  C     . GLN H  1 86  ? 45.591  31.285  -29.953 1.00 45.34 ? 86   GLN H C     1 
ATOM   9188  O  O     . GLN H  1 86  ? 44.835  32.213  -30.264 1.00 45.55 ? 86   GLN H O     1 
ATOM   9189  C  CB    . GLN H  1 86  ? 46.969  30.010  -31.649 1.00 45.52 ? 86   GLN H CB    1 
ATOM   9190  C  CG    . GLN H  1 86  ? 45.609  29.638  -32.248 1.00 47.03 ? 86   GLN H CG    1 
ATOM   9191  C  CD    . GLN H  1 86  ? 45.718  28.784  -33.518 1.00 49.09 ? 86   GLN H CD    1 
ATOM   9192  O  OE1   . GLN H  1 86  ? 46.588  27.907  -33.621 1.00 49.85 ? 86   GLN H OE1   1 
ATOM   9193  N  NE2   . GLN H  1 86  ? 44.831  29.038  -34.482 1.00 48.86 ? 86   GLN H NE2   1 
ATOM   9194  N  N     . GLU H  1 87  ? 45.266  30.352  -29.060 1.00 45.25 ? 87   GLU H N     1 
ATOM   9195  C  CA    . GLU H  1 87  ? 44.026  30.419  -28.286 1.00 45.28 ? 87   GLU H CA    1 
ATOM   9196  C  C     . GLU H  1 87  ? 44.004  31.648  -27.384 1.00 44.77 ? 87   GLU H C     1 
ATOM   9197  O  O     . GLU H  1 87  ? 42.977  32.312  -27.259 1.00 44.72 ? 87   GLU H O     1 
ATOM   9198  C  CB    . GLU H  1 87  ? 43.825  29.163  -27.426 1.00 45.40 ? 87   GLU H CB    1 
ATOM   9199  C  CG    . GLU H  1 87  ? 43.254  27.967  -28.166 1.00 47.03 ? 87   GLU H CG    1 
ATOM   9200  C  CD    . GLU H  1 87  ? 44.290  26.878  -28.419 1.00 49.96 ? 87   GLU H CD    1 
ATOM   9201  O  OE1   . GLU H  1 87  ? 45.513  27.167  -28.348 1.00 50.84 ? 87   GLU H OE1   1 
ATOM   9202  O  OE2   . GLU H  1 87  ? 43.884  25.723  -28.688 1.00 50.19 ? 87   GLU H OE2   1 
ATOM   9203  N  N     . ALA H  1 88  ? 45.148  31.946  -26.769 1.00 44.32 ? 88   ALA H N     1 
ATOM   9204  C  CA    . ALA H  1 88  ? 45.296  33.087  -25.863 1.00 43.82 ? 88   ALA H CA    1 
ATOM   9205  C  C     . ALA H  1 88  ? 45.036  34.430  -26.547 1.00 43.50 ? 88   ALA H C     1 
ATOM   9206  O  O     . ALA H  1 88  ? 44.544  35.370  -25.919 1.00 43.46 ? 88   ALA H O     1 
ATOM   9207  C  CB    . ALA H  1 88  ? 46.676  33.076  -25.234 1.00 43.55 ? 88   ALA H CB    1 
ATOM   9208  N  N     . LEU H  1 89  ? 45.358  34.497  -27.837 1.00 43.17 ? 89   LEU H N     1 
ATOM   9209  C  CA    . LEU H  1 89  ? 45.244  35.715  -28.639 1.00 42.83 ? 89   LEU H CA    1 
ATOM   9210  C  C     . LEU H  1 89  ? 43.800  36.166  -28.842 1.00 42.22 ? 89   LEU H C     1 
ATOM   9211  O  O     . LEU H  1 89  ? 43.533  37.362  -28.969 1.00 42.36 ? 89   LEU H O     1 
ATOM   9212  C  CB    . LEU H  1 89  ? 45.903  35.484  -30.003 1.00 43.08 ? 89   LEU H CB    1 
ATOM   9213  C  CG    . LEU H  1 89  ? 47.210  36.169  -30.437 1.00 44.01 ? 89   LEU H CG    1 
ATOM   9214  C  CD1   . LEU H  1 89  ? 47.766  37.192  -29.426 1.00 44.40 ? 89   LEU H CD1   1 
ATOM   9215  C  CD2   . LEU H  1 89  ? 48.267  35.119  -30.793 1.00 44.81 ? 89   LEU H CD2   1 
ATOM   9216  N  N     . GLY H  1 90  ? 42.875  35.208  -28.875 1.00 41.42 ? 90   GLY H N     1 
ATOM   9217  C  CA    . GLY H  1 90  ? 41.470  35.507  -29.113 1.00 40.50 ? 90   GLY H CA    1 
ATOM   9218  C  C     . GLY H  1 90  ? 40.647  35.726  -27.851 1.00 39.75 ? 90   GLY H C     1 
ATOM   9219  O  O     . GLY H  1 90  ? 39.416  35.711  -27.895 1.00 40.14 ? 90   GLY H O     1 
ATOM   9220  N  N     . VAL H  1 91  ? 41.334  35.956  -26.738 1.00 38.44 ? 91   VAL H N     1 
ATOM   9221  C  CA    . VAL H  1 91  ? 40.712  36.009  -25.424 1.00 37.10 ? 91   VAL H CA    1 
ATOM   9222  C  C     . VAL H  1 91  ? 41.110  37.313  -24.713 1.00 35.98 ? 91   VAL H C     1 
ATOM   9223  O  O     . VAL H  1 91  ? 42.156  37.887  -25.014 1.00 36.02 ? 91   VAL H O     1 
ATOM   9224  C  CB    . VAL H  1 91  ? 41.100  34.729  -24.639 1.00 37.33 ? 91   VAL H CB    1 
ATOM   9225  C  CG1   . VAL H  1 91  ? 41.685  35.036  -23.293 1.00 37.26 ? 91   VAL H CG1   1 
ATOM   9226  C  CG2   . VAL H  1 91  ? 39.915  33.759  -24.540 1.00 36.86 ? 91   VAL H CG2   1 
ATOM   9227  N  N     . ALA H  1 92  ? 40.269  37.800  -23.801 1.00 34.47 ? 92   ALA H N     1 
ATOM   9228  C  CA    . ALA H  1 92  ? 40.576  39.022  -23.042 1.00 32.95 ? 92   ALA H CA    1 
ATOM   9229  C  C     . ALA H  1 92  ? 41.307  38.772  -21.715 1.00 31.96 ? 92   ALA H C     1 
ATOM   9230  O  O     . ALA H  1 92  ? 42.104  39.603  -21.266 1.00 31.82 ? 92   ALA H O     1 
ATOM   9231  C  CB    . ALA H  1 92  ? 39.302  39.816  -22.788 1.00 33.03 ? 92   ALA H CB    1 
ATOM   9232  N  N     . VAL H  1 93  ? 41.016  37.636  -21.087 1.00 30.63 ? 93   VAL H N     1 
ATOM   9233  C  CA    . VAL H  1 93  ? 41.529  37.312  -19.757 1.00 29.84 ? 93   VAL H CA    1 
ATOM   9234  C  C     . VAL H  1 93  ? 42.183  35.931  -19.769 1.00 29.32 ? 93   VAL H C     1 
ATOM   9235  O  O     . VAL H  1 93  ? 41.551  34.948  -20.157 1.00 29.10 ? 93   VAL H O     1 
ATOM   9236  C  CB    . VAL H  1 93  ? 40.390  37.336  -18.679 1.00 29.98 ? 93   VAL H CB    1 
ATOM   9237  C  CG1   . VAL H  1 93  ? 40.918  36.979  -17.294 1.00 29.54 ? 93   VAL H CG1   1 
ATOM   9238  C  CG2   . VAL H  1 93  ? 39.714  38.699  -18.634 1.00 29.93 ? 93   VAL H CG2   1 
ATOM   9239  N  N     . ILE H  1 94  ? 43.444  35.862  -19.347 1.00 28.62 ? 94   ILE H N     1 
ATOM   9240  C  CA    . ILE H  1 94  ? 44.168  34.587  -19.303 1.00 28.27 ? 94   ILE H CA    1 
ATOM   9241  C  C     . ILE H  1 94  ? 44.587  34.240  -17.869 1.00 28.21 ? 94   ILE H C     1 
ATOM   9242  O  O     . ILE H  1 94  ? 45.304  35.013  -17.221 1.00 28.20 ? 94   ILE H O     1 
ATOM   9243  C  CB    . ILE H  1 94  ? 45.421  34.613  -20.215 1.00 28.20 ? 94   ILE H CB    1 
ATOM   9244  C  CG1   . ILE H  1 94  ? 45.040  34.825  -21.680 1.00 28.20 ? 94   ILE H CG1   1 
ATOM   9245  C  CG2   . ILE H  1 94  ? 46.228  33.330  -20.063 1.00 28.21 ? 94   ILE H CG2   1 
ATOM   9246  C  CD1   . ILE H  1 94  ? 46.087  35.565  -22.469 1.00 28.26 ? 94   ILE H CD1   1 
ATOM   9247  N  N     . GLY H  1 95  ? 44.137  33.084  -17.386 1.00 27.84 ? 95   GLY H N     1 
ATOM   9248  C  CA    . GLY H  1 95  ? 44.610  32.536  -16.127 1.00 27.93 ? 95   GLY H CA    1 
ATOM   9249  C  C     . GLY H  1 95  ? 45.640  31.438  -16.323 1.00 28.08 ? 95   GLY H C     1 
ATOM   9250  O  O     . GLY H  1 95  ? 45.455  30.555  -17.154 1.00 28.12 ? 95   GLY H O     1 
ATOM   9251  N  N     . ILE H  1 96  ? 46.732  31.500  -15.571 1.00 28.06 ? 96   ILE H N     1 
ATOM   9252  C  CA    . ILE H  1 96  ? 47.753  30.457  -15.629 1.00 28.44 ? 96   ILE H CA    1 
ATOM   9253  C  C     . ILE H  1 96  ? 47.955  29.800  -14.266 1.00 28.97 ? 96   ILE H C     1 
ATOM   9254  O  O     . ILE H  1 96  ? 48.325  30.461  -13.300 1.00 28.95 ? 96   ILE H O     1 
ATOM   9255  C  CB    . ILE H  1 96  ? 49.094  31.002  -16.181 1.00 28.05 ? 96   ILE H CB    1 
ATOM   9256  C  CG1   . ILE H  1 96  ? 48.896  31.616  -17.573 1.00 28.08 ? 96   ILE H CG1   1 
ATOM   9257  C  CG2   . ILE H  1 96  ? 50.124  29.884  -16.249 1.00 27.61 ? 96   ILE H CG2   1 
ATOM   9258  C  CD1   . ILE H  1 96  ? 50.060  32.456  -18.059 1.00 25.98 ? 96   ILE H CD1   1 
ATOM   9259  N  N     . ASP H  1 97  ? 47.697  28.500  -14.204 1.00 29.79 ? 97   ASP H N     1 
ATOM   9260  C  CA    . ASP H  1 97  ? 47.895  27.738  -12.980 1.00 31.14 ? 97   ASP H CA    1 
ATOM   9261  C  C     . ASP H  1 97  ? 49.255  27.048  -12.971 1.00 31.42 ? 97   ASP H C     1 
ATOM   9262  O  O     . ASP H  1 97  ? 49.666  26.449  -13.975 1.00 31.55 ? 97   ASP H O     1 
ATOM   9263  C  CB    . ASP H  1 97  ? 46.779  26.711  -12.790 1.00 31.29 ? 97   ASP H CB    1 
ATOM   9264  C  CG    . ASP H  1 97  ? 46.783  26.092  -11.398 1.00 33.50 ? 97   ASP H CG    1 
ATOM   9265  O  OD1   . ASP H  1 97  ? 47.038  26.817  -10.410 1.00 35.81 ? 97   ASP H OD1   1 
ATOM   9266  O  OD2   . ASP H  1 97  ? 46.537  24.882  -11.189 1.00 37.01 ? 97   ASP H OD2   1 
ATOM   9267  N  N     . GLU H  1 98  ? 49.940  27.139  -11.831 1.00 31.67 ? 98   GLU H N     1 
ATOM   9268  C  CA    . GLU H  1 98  ? 51.259  26.528  -11.617 1.00 32.05 ? 98   GLU H CA    1 
ATOM   9269  C  C     . GLU H  1 98  ? 52.312  27.103  -12.572 1.00 31.68 ? 98   GLU H C     1 
ATOM   9270  O  O     . GLU H  1 98  ? 53.060  26.370  -13.244 1.00 31.52 ? 98   GLU H O     1 
ATOM   9271  C  CB    . GLU H  1 98  ? 51.184  25.002  -11.701 1.00 32.15 ? 98   GLU H CB    1 
ATOM   9272  C  CG    . GLU H  1 98  ? 50.227  24.386  -10.692 1.00 35.05 ? 98   GLU H CG    1 
ATOM   9273  C  CD    . GLU H  1 98  ? 50.361  22.878  -10.586 1.00 38.26 ? 98   GLU H CD    1 
ATOM   9274  O  OE1   . GLU H  1 98  ? 51.464  22.355  -10.845 1.00 39.99 ? 98   GLU H OE1   1 
ATOM   9275  O  OE2   . GLU H  1 98  ? 49.364  22.215  -10.234 1.00 40.23 ? 98   GLU H OE2   1 
ATOM   9276  N  N     . GLY H  1 99  ? 52.360  28.432  -12.606 1.00 31.35 ? 99   GLY H N     1 
ATOM   9277  C  CA    . GLY H  1 99  ? 53.204  29.172  -13.529 1.00 31.04 ? 99   GLY H CA    1 
ATOM   9278  C  C     . GLY H  1 99  ? 54.692  28.871  -13.440 1.00 30.92 ? 99   GLY H C     1 
ATOM   9279  O  O     . GLY H  1 99  ? 55.416  29.064  -14.413 1.00 31.10 ? 99   GLY H O     1 
ATOM   9280  N  N     . GLN H  1 100 ? 55.145  28.387  -12.287 1.00 30.64 ? 100  GLN H N     1 
ATOM   9281  C  CA    . GLN H  1 100 ? 56.557  28.076  -12.079 1.00 30.55 ? 100  GLN H CA    1 
ATOM   9282  C  C     . GLN H  1 100 ? 57.096  26.978  -13.004 1.00 30.83 ? 100  GLN H C     1 
ATOM   9283  O  O     . GLN H  1 100 ? 58.304  26.879  -13.186 1.00 30.76 ? 100  GLN H O     1 
ATOM   9284  C  CB    . GLN H  1 100 ? 56.836  27.709  -10.614 1.00 30.22 ? 100  GLN H CB    1 
ATOM   9285  C  CG    . GLN H  1 100 ? 56.314  26.335  -10.205 1.00 29.27 ? 100  GLN H CG    1 
ATOM   9286  C  CD    . GLN H  1 100 ? 54.873  26.378  -9.745  1.00 29.03 ? 100  GLN H CD    1 
ATOM   9287  O  OE1   . GLN H  1 100 ? 54.232  27.426  -9.802  1.00 28.88 ? 100  GLN H OE1   1 
ATOM   9288  N  NE2   . GLN H  1 100 ? 54.363  25.247  -9.277  1.00 28.22 ? 100  GLN H NE2   1 
ATOM   9289  N  N     . PHE H  1 101 ? 56.209  26.169  -13.578 1.00 31.06 ? 101  PHE H N     1 
ATOM   9290  C  CA    . PHE H  1 101 ? 56.613  25.039  -14.422 1.00 31.48 ? 101  PHE H CA    1 
ATOM   9291  C  C     . PHE H  1 101 ? 56.767  25.379  -15.898 1.00 31.98 ? 101  PHE H C     1 
ATOM   9292  O  O     . PHE H  1 101 ? 57.258  24.559  -16.675 1.00 32.25 ? 101  PHE H O     1 
ATOM   9293  C  CB    . PHE H  1 101 ? 55.616  23.898  -14.275 1.00 31.22 ? 101  PHE H CB    1 
ATOM   9294  C  CG    . PHE H  1 101 ? 55.754  23.160  -12.992 1.00 30.88 ? 101  PHE H CG    1 
ATOM   9295  C  CD1   . PHE H  1 101 ? 54.665  23.011  -12.142 1.00 29.72 ? 101  PHE H CD1   1 
ATOM   9296  C  CD2   . PHE H  1 101 ? 56.984  22.631  -12.618 1.00 30.01 ? 101  PHE H CD2   1 
ATOM   9297  C  CE1   . PHE H  1 101 ? 54.792  22.329  -10.949 1.00 29.78 ? 101  PHE H CE1   1 
ATOM   9298  C  CE2   . PHE H  1 101 ? 57.121  21.947  -11.423 1.00 30.91 ? 101  PHE H CE2   1 
ATOM   9299  C  CZ    . PHE H  1 101 ? 56.020  21.792  -10.584 1.00 30.27 ? 101  PHE H CZ    1 
ATOM   9300  N  N     . PHE H  1 102 ? 56.339  26.579  -16.281 1.00 32.35 ? 102  PHE H N     1 
ATOM   9301  C  CA    . PHE H  1 102 ? 56.464  27.032  -17.658 1.00 32.85 ? 102  PHE H CA    1 
ATOM   9302  C  C     . PHE H  1 102 ? 57.771  27.810  -17.852 1.00 33.46 ? 102  PHE H C     1 
ATOM   9303  O  O     . PHE H  1 102 ? 57.961  28.875  -17.254 1.00 33.79 ? 102  PHE H O     1 
ATOM   9304  C  CB    . PHE H  1 102 ? 55.248  27.884  -18.068 1.00 32.57 ? 102  PHE H CB    1 
ATOM   9305  C  CG    . PHE H  1 102 ? 53.942  27.130  -18.055 1.00 31.67 ? 102  PHE H CG    1 
ATOM   9306  C  CD1   . PHE H  1 102 ? 53.600  26.283  -19.104 1.00 31.18 ? 102  PHE H CD1   1 
ATOM   9307  C  CD2   . PHE H  1 102 ? 53.053  27.266  -16.989 1.00 30.42 ? 102  PHE H CD2   1 
ATOM   9308  C  CE1   . PHE H  1 102 ? 52.387  25.579  -19.098 1.00 30.84 ? 102  PHE H CE1   1 
ATOM   9309  C  CE2   . PHE H  1 102 ? 51.841  26.566  -16.968 1.00 30.58 ? 102  PHE H CE2   1 
ATOM   9310  C  CZ    . PHE H  1 102 ? 51.502  25.726  -18.028 1.00 30.75 ? 102  PHE H CZ    1 
ATOM   9311  N  N     . PRO H  1 103 ? 58.669  27.283  -18.686 1.00 34.03 ? 103  PRO H N     1 
ATOM   9312  C  CA    . PRO H  1 103 ? 59.969  27.932  -18.957 1.00 34.24 ? 103  PRO H CA    1 
ATOM   9313  C  C     . PRO H  1 103 ? 59.800  29.304  -19.605 1.00 34.42 ? 103  PRO H C     1 
ATOM   9314  O  O     . PRO H  1 103 ? 60.672  30.161  -19.456 1.00 34.73 ? 103  PRO H O     1 
ATOM   9315  C  CB    . PRO H  1 103 ? 60.632  26.992  -19.984 1.00 34.27 ? 103  PRO H CB    1 
ATOM   9316  C  CG    . PRO H  1 103 ? 59.883  25.680  -19.880 1.00 34.79 ? 103  PRO H CG    1 
ATOM   9317  C  CD    . PRO H  1 103 ? 58.487  26.034  -19.452 1.00 34.15 ? 103  PRO H CD    1 
ATOM   9318  N  N     . ASP H  1 104 ? 58.691  29.493  -20.324 1.00 34.36 ? 104  ASP H N     1 
ATOM   9319  C  CA    . ASP H  1 104 ? 58.423  30.739  -21.039 1.00 34.40 ? 104  ASP H CA    1 
ATOM   9320  C  C     . ASP H  1 104 ? 57.418  31.671  -20.345 1.00 34.23 ? 104  ASP H C     1 
ATOM   9321  O  O     . ASP H  1 104 ? 56.847  32.555  -20.989 1.00 34.22 ? 104  ASP H O     1 
ATOM   9322  C  CB    . ASP H  1 104 ? 57.989  30.468  -22.495 1.00 34.45 ? 104  ASP H CB    1 
ATOM   9323  C  CG    . ASP H  1 104 ? 56.609  29.802  -22.605 1.00 35.40 ? 104  ASP H CG    1 
ATOM   9324  O  OD1   . ASP H  1 104 ? 56.211  29.025  -21.700 1.00 35.17 ? 104  ASP H OD1   1 
ATOM   9325  O  OD2   . ASP H  1 104 ? 55.860  29.982  -23.595 1.00 35.89 ? 104  ASP H OD2   1 
ATOM   9326  N  N     . ILE H  1 105 ? 57.228  31.495  -19.040 1.00 33.95 ? 105  ILE H N     1 
ATOM   9327  C  CA    . ILE H  1 105 ? 56.244  32.276  -18.280 1.00 33.87 ? 105  ILE H CA    1 
ATOM   9328  C  C     . ILE H  1 105 ? 56.408  33.795  -18.409 1.00 33.92 ? 105  ILE H C     1 
ATOM   9329  O  O     . ILE H  1 105 ? 55.420  34.514  -18.569 1.00 33.90 ? 105  ILE H O     1 
ATOM   9330  C  CB    . ILE H  1 105 ? 56.196  31.801  -16.782 1.00 33.93 ? 105  ILE H CB    1 
ATOM   9331  C  CG1   . ILE H  1 105 ? 55.029  32.443  -16.007 1.00 33.88 ? 105  ILE H CG1   1 
ATOM   9332  C  CG2   . ILE H  1 105 ? 57.533  32.031  -16.081 1.00 33.27 ? 105  ILE H CG2   1 
ATOM   9333  C  CD1   . ILE H  1 105 ? 53.638  31.866  -16.330 1.00 33.17 ? 105  ILE H CD1   1 
ATOM   9334  N  N     . VAL H  1 106 ? 57.651  34.266  -18.379 1.00 34.11 ? 106  VAL H N     1 
ATOM   9335  C  CA    . VAL H  1 106 ? 57.955  35.706  -18.385 1.00 34.39 ? 106  VAL H CA    1 
ATOM   9336  C  C     . VAL H  1 106 ? 57.606  36.368  -19.718 1.00 34.61 ? 106  VAL H C     1 
ATOM   9337  O  O     . VAL H  1 106 ? 56.845  37.333  -19.762 1.00 34.79 ? 106  VAL H O     1 
ATOM   9338  C  CB    . VAL H  1 106 ? 59.446  35.975  -17.991 1.00 34.38 ? 106  VAL H CB    1 
ATOM   9339  C  CG1   . VAL H  1 106 ? 59.809  37.461  -18.120 1.00 34.65 ? 106  VAL H CG1   1 
ATOM   9340  C  CG2   . VAL H  1 106 ? 59.715  35.500  -16.581 1.00 34.02 ? 106  VAL H CG2   1 
ATOM   9341  N  N     . GLU H  1 107 ? 58.152  35.826  -20.796 1.00 34.69 ? 107  GLU H N     1 
ATOM   9342  C  CA    . GLU H  1 107 ? 57.953  36.370  -22.132 1.00 35.04 ? 107  GLU H CA    1 
ATOM   9343  C  C     . GLU H  1 107 ? 56.489  36.289  -22.595 1.00 34.27 ? 107  GLU H C     1 
ATOM   9344  O  O     . GLU H  1 107 ? 55.973  37.216  -23.216 1.00 34.42 ? 107  GLU H O     1 
ATOM   9345  C  CB    . GLU H  1 107 ? 58.929  35.697  -23.114 1.00 35.56 ? 107  GLU H CB    1 
ATOM   9346  C  CG    . GLU H  1 107 ? 59.474  34.340  -22.656 1.00 38.35 ? 107  GLU H CG    1 
ATOM   9347  C  CD    . GLU H  1 107 ? 60.580  34.420  -21.598 1.00 42.45 ? 107  GLU H CD    1 
ATOM   9348  O  OE1   . GLU H  1 107 ? 61.620  35.070  -21.843 1.00 44.07 ? 107  GLU H OE1   1 
ATOM   9349  O  OE2   . GLU H  1 107 ? 60.423  33.805  -20.514 1.00 43.60 ? 107  GLU H OE2   1 
ATOM   9350  N  N     . PHE H  1 108 ? 55.817  35.194  -22.258 1.00 33.72 ? 108  PHE H N     1 
ATOM   9351  C  CA    . PHE H  1 108 ? 54.405  35.022  -22.587 1.00 33.18 ? 108  PHE H CA    1 
ATOM   9352  C  C     . PHE H  1 108 ? 53.506  36.052  -21.881 1.00 32.98 ? 108  PHE H C     1 
ATOM   9353  O  O     . PHE H  1 108 ? 52.710  36.717  -22.529 1.00 32.91 ? 108  PHE H O     1 
ATOM   9354  C  CB    . PHE H  1 108 ? 53.974  33.592  -22.273 1.00 32.99 ? 108  PHE H CB    1 
ATOM   9355  C  CG    . PHE H  1 108 ? 52.533  33.302  -22.596 1.00 33.05 ? 108  PHE H CG    1 
ATOM   9356  C  CD1   . PHE H  1 108 ? 52.159  32.903  -23.878 1.00 32.21 ? 108  PHE H CD1   1 
ATOM   9357  C  CD2   . PHE H  1 108 ? 51.552  33.401  -21.607 1.00 31.88 ? 108  PHE H CD2   1 
ATOM   9358  C  CE1   . PHE H  1 108 ? 50.827  32.613  -24.171 1.00 31.99 ? 108  PHE H CE1   1 
ATOM   9359  C  CE2   . PHE H  1 108 ? 50.221  33.122  -21.892 1.00 32.34 ? 108  PHE H CE2   1 
ATOM   9360  C  CZ    . PHE H  1 108 ? 49.856  32.726  -23.173 1.00 32.26 ? 108  PHE H CZ    1 
ATOM   9361  N  N     . CYS H  1 109 ? 53.665  36.196  -20.568 1.00 32.79 ? 109  CYS H N     1 
ATOM   9362  C  CA    . CYS H  1 109 ? 52.858  37.128  -19.790 1.00 33.22 ? 109  CYS H CA    1 
ATOM   9363  C  C     . CYS H  1 109 ? 53.069  38.573  -20.237 1.00 33.12 ? 109  CYS H C     1 
ATOM   9364  O  O     . CYS H  1 109 ? 52.109  39.327  -20.420 1.00 32.67 ? 109  CYS H O     1 
ATOM   9365  C  CB    . CYS H  1 109 ? 53.184  36.982  -18.306 1.00 33.31 ? 109  CYS H CB    1 
ATOM   9366  S  SG    . CYS H  1 109 ? 52.522  35.467  -17.584 1.00 36.24 ? 109  CYS H SG    1 
ATOM   9367  N  N     . GLU H  1 110 ? 54.337  38.938  -20.416 1.00 33.44 ? 110  GLU H N     1 
ATOM   9368  C  CA    . GLU H  1 110 ? 54.706  40.288  -20.818 1.00 33.95 ? 110  GLU H CA    1 
ATOM   9369  C  C     . GLU H  1 110 ? 54.120  40.628  -22.193 1.00 33.71 ? 110  GLU H C     1 
ATOM   9370  O  O     . GLU H  1 110 ? 53.510  41.685  -22.364 1.00 33.94 ? 110  GLU H O     1 
ATOM   9371  C  CB    . GLU H  1 110 ? 56.234  40.455  -20.749 1.00 34.21 ? 110  GLU H CB    1 
ATOM   9372  C  CG    . GLU H  1 110 ? 56.803  41.826  -21.102 1.00 35.71 ? 110  GLU H CG    1 
ATOM   9373  C  CD    . GLU H  1 110 ? 56.303  42.966  -20.226 1.00 37.62 ? 110  GLU H CD    1 
ATOM   9374  O  OE1   . GLU H  1 110 ? 56.401  44.132  -20.675 1.00 38.70 ? 110  GLU H OE1   1 
ATOM   9375  O  OE2   . GLU H  1 110 ? 55.816  42.723  -19.100 1.00 38.00 ? 110  GLU H OE2   1 
ATOM   9376  N  N     . ALA H  1 111 ? 54.248  39.704  -23.141 1.00 33.42 ? 111  ALA H N     1 
ATOM   9377  C  CA    . ALA H  1 111 ? 53.680  39.871  -24.482 1.00 33.34 ? 111  ALA H CA    1 
ATOM   9378  C  C     . ALA H  1 111 ? 52.149  39.951  -24.485 1.00 33.11 ? 111  ALA H C     1 
ATOM   9379  O  O     . ALA H  1 111 ? 51.572  40.759  -25.207 1.00 33.42 ? 111  ALA H O     1 
ATOM   9380  C  CB    . ALA H  1 111 ? 54.176  38.752  -25.437 1.00 33.10 ? 111  ALA H CB    1 
ATOM   9381  N  N     . MET H  1 112 ? 51.495  39.119  -23.679 1.00 32.91 ? 112  MET H N     1 
ATOM   9382  C  CA    . MET H  1 112 ? 50.035  39.132  -23.597 1.00 32.81 ? 112  MET H CA    1 
ATOM   9383  C  C     . MET H  1 112 ? 49.493  40.391  -22.913 1.00 32.54 ? 112  MET H C     1 
ATOM   9384  O  O     . MET H  1 112 ? 48.482  40.941  -23.351 1.00 32.42 ? 112  MET H O     1 
ATOM   9385  C  CB    . MET H  1 112 ? 49.515  37.850  -22.938 1.00 32.85 ? 112  MET H CB    1 
ATOM   9386  C  CG    . MET H  1 112 ? 49.746  36.577  -23.762 1.00 33.44 ? 112  MET H CG    1 
ATOM   9387  S  SD    . MET H  1 112 ? 48.963  36.619  -25.396 1.00 36.64 ? 112  MET H SD    1 
ATOM   9388  C  CE    . MET H  1 112 ? 49.612  35.140  -26.156 1.00 36.60 ? 112  MET H CE    1 
ATOM   9389  N  N     . ALA H  1 113 ? 50.172  40.847  -21.861 1.00 32.33 ? 113  ALA H N     1 
ATOM   9390  C  CA    . ALA H  1 113 ? 49.810  42.093  -21.179 1.00 32.70 ? 113  ALA H CA    1 
ATOM   9391  C  C     . ALA H  1 113 ? 50.017  43.323  -22.076 1.00 32.92 ? 113  ALA H C     1 
ATOM   9392  O  O     . ALA H  1 113 ? 49.180  44.230  -22.085 1.00 32.99 ? 113  ALA H O     1 
ATOM   9393  C  CB    . ALA H  1 113 ? 50.586  42.243  -19.893 1.00 32.32 ? 113  ALA H CB    1 
ATOM   9394  N  N     . ASN H  1 114 ? 51.116  43.341  -22.833 1.00 33.06 ? 114  ASN H N     1 
ATOM   9395  C  CA    . ASN H  1 114 ? 51.365  44.429  -23.785 1.00 33.47 ? 114  ASN H CA    1 
ATOM   9396  C  C     . ASN H  1 114 ? 50.407  44.441  -24.971 1.00 33.59 ? 114  ASN H C     1 
ATOM   9397  O  O     . ASN H  1 114 ? 50.179  45.487  -25.573 1.00 33.96 ? 114  ASN H O     1 
ATOM   9398  C  CB    . ASN H  1 114 ? 52.815  44.423  -24.261 1.00 33.42 ? 114  ASN H CB    1 
ATOM   9399  C  CG    . ASN H  1 114 ? 53.761  44.762  -23.156 1.00 34.15 ? 114  ASN H CG    1 
ATOM   9400  O  OD1   . ASN H  1 114 ? 53.390  45.474  -22.216 1.00 35.50 ? 114  ASN H OD1   1 
ATOM   9401  N  ND2   . ASN H  1 114 ? 54.983  44.246  -23.233 1.00 34.35 ? 114  ASN H ND2   1 
ATOM   9402  N  N     . ALA H  1 115 ? 49.844  43.276  -25.291 1.00 33.52 ? 115  ALA H N     1 
ATOM   9403  C  CA    . ALA H  1 115 ? 48.779  43.175  -26.286 1.00 33.37 ? 115  ALA H CA    1 
ATOM   9404  C  C     . ALA H  1 115 ? 47.396  43.496  -25.695 1.00 33.26 ? 115  ALA H C     1 
ATOM   9405  O  O     . ALA H  1 115 ? 46.377  43.280  -26.348 1.00 33.49 ? 115  ALA H O     1 
ATOM   9406  C  CB    . ALA H  1 115 ? 48.787  41.792  -26.922 1.00 33.38 ? 115  ALA H CB    1 
ATOM   9407  N  N     . GLY H  1 116 ? 47.359  43.995  -24.458 1.00 33.00 ? 116  GLY H N     1 
ATOM   9408  C  CA    . GLY H  1 116 ? 46.111  44.432  -23.842 1.00 32.55 ? 116  GLY H CA    1 
ATOM   9409  C  C     . GLY H  1 116 ? 45.290  43.388  -23.089 1.00 32.30 ? 116  GLY H C     1 
ATOM   9410  O  O     . GLY H  1 116 ? 44.140  43.649  -22.740 1.00 32.27 ? 116  GLY H O     1 
ATOM   9411  N  N     . LYS H  1 117 ? 45.866  42.211  -22.834 1.00 31.81 ? 117  LYS H N     1 
ATOM   9412  C  CA    . LYS H  1 117 ? 45.168  41.174  -22.060 1.00 31.34 ? 117  LYS H CA    1 
ATOM   9413  C  C     . LYS H  1 117 ? 45.446  41.264  -20.561 1.00 30.59 ? 117  LYS H C     1 
ATOM   9414  O  O     . LYS H  1 117 ? 46.511  41.725  -20.139 1.00 30.50 ? 117  LYS H O     1 
ATOM   9415  C  CB    . LYS H  1 117 ? 45.518  39.766  -22.556 1.00 31.45 ? 117  LYS H CB    1 
ATOM   9416  C  CG    . LYS H  1 117 ? 44.783  39.356  -23.813 1.00 32.26 ? 117  LYS H CG    1 
ATOM   9417  C  CD    . LYS H  1 117 ? 45.719  39.360  -25.007 1.00 33.49 ? 117  LYS H CD    1 
ATOM   9418  C  CE    . LYS H  1 117 ? 45.167  38.528  -26.150 1.00 33.75 ? 117  LYS H CE    1 
ATOM   9419  N  NZ    . LYS H  1 117 ? 43.935  39.114  -26.733 1.00 33.25 ? 117  LYS H NZ    1 
ATOM   9420  N  N     . THR H  1 118 ? 44.471  40.818  -19.769 1.00 29.62 ? 118  THR H N     1 
ATOM   9421  C  CA    . THR H  1 118 ? 44.644  40.645  -18.328 1.00 28.60 ? 118  THR H CA    1 
ATOM   9422  C  C     . THR H  1 118 ? 45.147  39.231  -18.069 1.00 27.91 ? 118  THR H C     1 
ATOM   9423  O  O     . THR H  1 118 ? 44.444  38.260  -18.353 1.00 28.14 ? 118  THR H O     1 
ATOM   9424  C  CB    . THR H  1 118 ? 43.298  40.883  -17.600 1.00 28.66 ? 118  THR H CB    1 
ATOM   9425  O  OG1   . THR H  1 118 ? 42.902  42.242  -17.783 1.00 28.82 ? 118  THR H OG1   1 
ATOM   9426  C  CG2   . THR H  1 118 ? 43.442  40.755  -16.083 1.00 27.72 ? 118  THR H CG2   1 
ATOM   9427  N  N     . VAL H  1 119 ? 46.356  39.128  -17.527 1.00 27.20 ? 119  VAL H N     1 
ATOM   9428  C  CA    . VAL H  1 119 ? 47.007  37.845  -17.248 1.00 26.41 ? 119  VAL H CA    1 
ATOM   9429  C  C     . VAL H  1 119 ? 47.125  37.620  -15.745 1.00 26.12 ? 119  VAL H C     1 
ATOM   9430  O  O     . VAL H  1 119 ? 47.707  38.441  -15.024 1.00 26.00 ? 119  VAL H O     1 
ATOM   9431  C  CB    . VAL H  1 119 ? 48.424  37.774  -17.880 1.00 26.41 ? 119  VAL H CB    1 
ATOM   9432  C  CG1   . VAL H  1 119 ? 49.007  36.377  -17.743 1.00 25.99 ? 119  VAL H CG1   1 
ATOM   9433  C  CG2   . VAL H  1 119 ? 48.386  38.183  -19.348 1.00 26.47 ? 119  VAL H CG2   1 
ATOM   9434  N  N     . ILE H  1 120 ? 46.567  36.504  -15.275 1.00 25.54 ? 120  ILE H N     1 
ATOM   9435  C  CA    . ILE H  1 120 ? 46.567  36.184  -13.850 1.00 24.86 ? 120  ILE H CA    1 
ATOM   9436  C  C     . ILE H  1 120 ? 47.288  34.871  -13.633 1.00 24.63 ? 120  ILE H C     1 
ATOM   9437  O  O     . ILE H  1 120 ? 46.940  33.858  -14.229 1.00 24.75 ? 120  ILE H O     1 
ATOM   9438  C  CB    . ILE H  1 120 ? 45.127  36.138  -13.279 1.00 24.93 ? 120  ILE H CB    1 
ATOM   9439  C  CG1   . ILE H  1 120 ? 44.379  37.427  -13.632 1.00 24.53 ? 120  ILE H CG1   1 
ATOM   9440  C  CG2   . ILE H  1 120 ? 45.154  35.918  -11.755 1.00 23.80 ? 120  ILE H CG2   1 
ATOM   9441  C  CD1   . ILE H  1 120 ? 42.865  37.379  -13.371 1.00 25.88 ? 120  ILE H CD1   1 
ATOM   9442  N  N     . VAL H  1 121 ? 48.302  34.901  -12.776 1.00 24.30 ? 121  VAL H N     1 
ATOM   9443  C  CA    . VAL H  1 121 ? 49.209  33.769  -12.605 1.00 23.87 ? 121  VAL H CA    1 
ATOM   9444  C  C     . VAL H  1 121 ? 49.191  33.295  -11.163 1.00 23.97 ? 121  VAL H C     1 
ATOM   9445  O  O     . VAL H  1 121 ? 49.480  34.078  -10.254 1.00 24.20 ? 121  VAL H O     1 
ATOM   9446  C  CB    . VAL H  1 121 ? 50.685  34.150  -12.968 1.00 23.40 ? 121  VAL H CB    1 
ATOM   9447  C  CG1   . VAL H  1 121 ? 51.585  32.929  -12.925 1.00 22.78 ? 121  VAL H CG1   1 
ATOM   9448  C  CG2   . VAL H  1 121 ? 50.765  34.810  -14.326 1.00 23.12 ? 121  VAL H CG2   1 
ATOM   9449  N  N     . ALA H  1 122 ? 48.857  32.021  -10.956 1.00 23.85 ? 122  ALA H N     1 
ATOM   9450  C  CA    . ALA H  1 122 ? 49.049  31.371  -9.651  1.00 23.77 ? 122  ALA H CA    1 
ATOM   9451  C  C     . ALA H  1 122 ? 50.316  30.547  -9.711  1.00 24.02 ? 122  ALA H C     1 
ATOM   9452  O  O     . ALA H  1 122 ? 50.527  29.796  -10.668 1.00 23.84 ? 122  ALA H O     1 
ATOM   9453  C  CB    . ALA H  1 122 ? 47.864  30.493  -9.288  1.00 23.60 ? 122  ALA H CB    1 
ATOM   9454  N  N     . ALA H  1 123 ? 51.165  30.688  -8.696  1.00 24.42 ? 123  ALA H N     1 
ATOM   9455  C  CA    . ALA H  1 123 ? 52.478  30.032  -8.703  1.00 24.94 ? 123  ALA H CA    1 
ATOM   9456  C  C     . ALA H  1 123 ? 53.108  29.912  -7.329  1.00 25.52 ? 123  ALA H C     1 
ATOM   9457  O  O     . ALA H  1 123 ? 52.936  30.784  -6.479  1.00 25.65 ? 123  ALA H O     1 
ATOM   9458  C  CB    . ALA H  1 123 ? 53.446  30.776  -9.637  1.00 24.46 ? 123  ALA H CB    1 
ATOM   9459  N  N     . LEU H  1 124 ? 53.854  28.832  -7.127  1.00 26.44 ? 124  LEU H N     1 
ATOM   9460  C  CA    . LEU H  1 124 ? 54.739  28.707  -5.979  1.00 27.54 ? 124  LEU H CA    1 
ATOM   9461  C  C     . LEU H  1 124 ? 55.860  29.723  -6.138  1.00 28.50 ? 124  LEU H C     1 
ATOM   9462  O  O     . LEU H  1 124 ? 56.445  29.847  -7.211  1.00 28.79 ? 124  LEU H O     1 
ATOM   9463  C  CB    . LEU H  1 124 ? 55.382  27.329  -5.955  1.00 27.39 ? 124  LEU H CB    1 
ATOM   9464  C  CG    . LEU H  1 124 ? 54.985  26.222  -4.979  1.00 27.36 ? 124  LEU H CG    1 
ATOM   9465  C  CD1   . LEU H  1 124 ? 53.606  26.391  -4.400  1.00 24.77 ? 124  LEU H CD1   1 
ATOM   9466  C  CD2   . LEU H  1 124 ? 55.109  24.915  -5.711  1.00 26.23 ? 124  LEU H CD2   1 
ATOM   9467  N  N     . ASP H  1 125 ? 56.175  30.446  -5.076  1.00 29.31 ? 125  ASP H N     1 
ATOM   9468  C  CA    . ASP H  1 125 ? 57.337  31.323  -5.117  1.00 30.31 ? 125  ASP H CA    1 
ATOM   9469  C  C     . ASP H  1 125 ? 58.614  30.535  -4.820  1.00 30.22 ? 125  ASP H C     1 
ATOM   9470  O  O     . ASP H  1 125 ? 59.680  30.838  -5.369  1.00 30.51 ? 125  ASP H O     1 
ATOM   9471  C  CB    . ASP H  1 125 ? 57.200  32.471  -4.117  1.00 30.71 ? 125  ASP H CB    1 
ATOM   9472  C  CG    . ASP H  1 125 ? 56.661  32.013  -2.794  1.00 33.07 ? 125  ASP H CG    1 
ATOM   9473  O  OD1   . ASP H  1 125 ? 57.289  32.316  -1.757  1.00 35.82 ? 125  ASP H OD1   1 
ATOM   9474  O  OD2   . ASP H  1 125 ? 55.613  31.329  -2.695  1.00 36.86 ? 125  ASP H OD2   1 
ATOM   9475  N  N     . GLY H  1 126 ? 58.498  29.533  -3.950  1.00 29.76 ? 126  GLY H N     1 
ATOM   9476  C  CA    . GLY H  1 126 ? 59.635  28.744  -3.527  1.00 29.30 ? 126  GLY H CA    1 
ATOM   9477  C  C     . GLY H  1 126 ? 59.519  27.248  -3.750  1.00 29.17 ? 126  GLY H C     1 
ATOM   9478  O  O     . GLY H  1 126 ? 58.427  26.678  -3.698  1.00 29.17 ? 126  GLY H O     1 
ATOM   9479  N  N     . THR H  1 127 ? 60.660  26.610  -4.000  1.00 28.91 ? 127  THR H N     1 
ATOM   9480  C  CA    . THR H  1 127 ? 60.737  25.153  -4.026  1.00 28.68 ? 127  THR H CA    1 
ATOM   9481  C  C     . THR H  1 127 ? 60.723  24.619  -2.592  1.00 28.87 ? 127  THR H C     1 
ATOM   9482  O  O     . THR H  1 127 ? 60.622  25.385  -1.622  1.00 28.47 ? 127  THR H O     1 
ATOM   9483  C  CB    . THR H  1 127 ? 62.050  24.665  -4.702  1.00 28.66 ? 127  THR H CB    1 
ATOM   9484  O  OG1   . THR H  1 127 ? 63.166  24.951  -3.840  1.00 28.63 ? 127  THR H OG1   1 
ATOM   9485  C  CG2   . THR H  1 127 ? 62.355  25.416  -5.987  1.00 27.64 ? 127  THR H CG2   1 
ATOM   9486  N  N     . PHE H  1 128 ? 60.872  23.302  -2.478  1.00 29.17 ? 128  PHE H N     1 
ATOM   9487  C  CA    . PHE H  1 128 ? 61.042  22.622  -1.192  1.00 29.69 ? 128  PHE H CA    1 
ATOM   9488  C  C     . PHE H  1 128 ? 62.304  23.067  -0.455  1.00 30.14 ? 128  PHE H C     1 
ATOM   9489  O  O     . PHE H  1 128 ? 62.447  22.809  0.734   1.00 30.30 ? 128  PHE H O     1 
ATOM   9490  C  CB    . PHE H  1 128 ? 61.054  21.093  -1.390  1.00 29.90 ? 128  PHE H CB    1 
ATOM   9491  C  CG    . PHE H  1 128 ? 62.349  20.541  -1.985  1.00 29.64 ? 128  PHE H CG    1 
ATOM   9492  C  CD1   . PHE H  1 128 ? 63.274  19.872  -1.176  1.00 30.58 ? 128  PHE H CD1   1 
ATOM   9493  C  CD2   . PHE H  1 128 ? 62.618  20.660  -3.348  1.00 29.73 ? 128  PHE H CD2   1 
ATOM   9494  C  CE1   . PHE H  1 128 ? 64.460  19.337  -1.710  1.00 30.41 ? 128  PHE H CE1   1 
ATOM   9495  C  CE2   . PHE H  1 128 ? 63.799  20.142  -3.902  1.00 30.54 ? 128  PHE H CE2   1 
ATOM   9496  C  CZ    . PHE H  1 128 ? 64.725  19.472  -3.077  1.00 30.94 ? 128  PHE H CZ    1 
ATOM   9497  N  N     . GLN H  1 129 ? 63.216  23.731  -1.166  1.00 30.73 ? 129  GLN H N     1 
ATOM   9498  C  CA    . GLN H  1 129 ? 64.446  24.237  -0.553  1.00 31.49 ? 129  GLN H CA    1 
ATOM   9499  C  C     . GLN H  1 129 ? 64.364  25.734  -0.242  1.00 31.62 ? 129  GLN H C     1 
ATOM   9500  O  O     . GLN H  1 129 ? 65.361  26.343  0.173   1.00 31.61 ? 129  GLN H O     1 
ATOM   9501  C  CB    . GLN H  1 129 ? 65.667  23.933  -1.442  1.00 31.87 ? 129  GLN H CB    1 
ATOM   9502  C  CG    . GLN H  1 129 ? 66.048  22.454  -1.463  1.00 33.34 ? 129  GLN H CG    1 
ATOM   9503  C  CD    . GLN H  1 129 ? 67.166  22.125  -2.449  1.00 36.48 ? 129  GLN H CD    1 
ATOM   9504  O  OE1   . GLN H  1 129 ? 68.086  21.370  -2.116  1.00 37.63 ? 129  GLN H OE1   1 
ATOM   9505  N  NE2   . GLN H  1 129 ? 67.083  22.669  -3.662  1.00 35.96 ? 129  GLN H NE2   1 
ATOM   9506  N  N     . ARG H  1 130 ? 63.174  26.312  -0.429  1.00 31.63 ? 130  ARG H N     1 
ATOM   9507  C  CA    . ARG H  1 130 ? 62.935  27.742  -0.236  1.00 31.86 ? 130  ARG H CA    1 
ATOM   9508  C  C     . ARG H  1 130 ? 63.846  28.598  -1.140  1.00 32.01 ? 130  ARG H C     1 
ATOM   9509  O  O     . ARG H  1 130 ? 64.328  29.661  -0.747  1.00 32.08 ? 130  ARG H O     1 
ATOM   9510  C  CB    . ARG H  1 130 ? 63.065  28.139  1.242   1.00 32.10 ? 130  ARG H CB    1 
ATOM   9511  C  CG    . ARG H  1 130 ? 62.155  27.364  2.196   1.00 32.67 ? 130  ARG H CG    1 
ATOM   9512  C  CD    . ARG H  1 130 ? 61.903  28.069  3.507   1.00 34.23 ? 130  ARG H CD    1 
ATOM   9513  N  NE    . ARG H  1 130 ? 63.153  28.414  4.168   1.00 37.22 ? 130  ARG H NE    1 
ATOM   9514  C  CZ    . ARG H  1 130 ? 63.390  29.548  4.814   1.00 37.59 ? 130  ARG H CZ    1 
ATOM   9515  N  NH1   . ARG H  1 130 ? 62.465  30.492  4.922   1.00 37.86 ? 130  ARG H NH1   1 
ATOM   9516  N  NH2   . ARG H  1 130 ? 64.569  29.729  5.369   1.00 37.99 ? 130  ARG H NH2   1 
ATOM   9517  N  N     . LYS H  1 131 ? 64.071  28.107  -2.356  1.00 32.02 ? 131  LYS H N     1 
ATOM   9518  C  CA    . LYS H  1 131 ? 64.765  28.846  -3.400  1.00 32.37 ? 131  LYS H CA    1 
ATOM   9519  C  C     . LYS H  1 131 ? 63.728  29.263  -4.432  1.00 31.94 ? 131  LYS H C     1 
ATOM   9520  O  O     . LYS H  1 131 ? 62.663  28.652  -4.500  1.00 31.82 ? 131  LYS H O     1 
ATOM   9521  C  CB    . LYS H  1 131 ? 65.818  27.961  -4.089  1.00 32.69 ? 131  LYS H CB    1 
ATOM   9522  C  CG    . LYS H  1 131 ? 67.033  27.607  -3.245  1.00 34.85 ? 131  LYS H CG    1 
ATOM   9523  C  CD    . LYS H  1 131 ? 67.738  26.385  -3.838  1.00 38.44 ? 131  LYS H CD    1 
ATOM   9524  C  CE    . LYS H  1 131 ? 69.247  26.390  -3.586  1.00 40.63 ? 131  LYS H CE    1 
ATOM   9525  N  NZ    . LYS H  1 131 ? 69.597  26.727  -2.170  1.00 42.37 ? 131  LYS H NZ    1 
ATOM   9526  N  N     . PRO H  1 132 ? 64.027  30.299  -5.224  1.00 31.81 ? 132  PRO H N     1 
ATOM   9527  C  CA    . PRO H  1 132 ? 63.155  30.709  -6.332  1.00 31.60 ? 132  PRO H CA    1 
ATOM   9528  C  C     . PRO H  1 132 ? 62.785  29.528  -7.211  1.00 31.77 ? 132  PRO H C     1 
ATOM   9529  O  O     . PRO H  1 132 ? 63.650  28.723  -7.568  1.00 31.47 ? 132  PRO H O     1 
ATOM   9530  C  CB    . PRO H  1 132 ? 64.031  31.683  -7.122  1.00 31.78 ? 132  PRO H CB    1 
ATOM   9531  C  CG    . PRO H  1 132 ? 64.946  32.278  -6.094  1.00 32.04 ? 132  PRO H CG    1 
ATOM   9532  C  CD    . PRO H  1 132 ? 65.211  31.176  -5.100  1.00 31.74 ? 132  PRO H CD    1 
ATOM   9533  N  N     . PHE H  1 133 ? 61.502  29.418  -7.545  1.00 31.90 ? 133  PHE H N     1 
ATOM   9534  C  CA    . PHE H  1 133 ? 61.024  28.303  -8.356  1.00 32.13 ? 133  PHE H CA    1 
ATOM   9535  C  C     . PHE H  1 133 ? 61.003  28.690  -9.824  1.00 32.49 ? 133  PHE H C     1 
ATOM   9536  O  O     . PHE H  1 133 ? 60.105  29.405  -10.274 1.00 32.59 ? 133  PHE H O     1 
ATOM   9537  C  CB    . PHE H  1 133 ? 59.627  27.849  -7.902  1.00 31.79 ? 133  PHE H CB    1 
ATOM   9538  C  CG    . PHE H  1 133 ? 59.332  26.396  -8.189  1.00 31.85 ? 133  PHE H CG    1 
ATOM   9539  C  CD1   . PHE H  1 133 ? 58.681  25.610  -7.243  1.00 31.13 ? 133  PHE H CD1   1 
ATOM   9540  C  CD2   . PHE H  1 133 ? 59.698  25.813  -9.402  1.00 30.54 ? 133  PHE H CD2   1 
ATOM   9541  C  CE1   . PHE H  1 133 ? 58.400  24.276  -7.499  1.00 30.87 ? 133  PHE H CE1   1 
ATOM   9542  C  CE2   . PHE H  1 133 ? 59.412  24.484  -9.662  1.00 30.59 ? 133  PHE H CE2   1 
ATOM   9543  C  CZ    . PHE H  1 133 ? 58.764  23.715  -8.711  1.00 30.58 ? 133  PHE H CZ    1 
ATOM   9544  N  N     . GLY H  1 134 ? 61.995  28.200  -10.567 1.00 33.01 ? 134  GLY H N     1 
ATOM   9545  C  CA    . GLY H  1 134 ? 62.142  28.522  -11.977 1.00 33.07 ? 134  GLY H CA    1 
ATOM   9546  C  C     . GLY H  1 134 ? 62.350  30.010  -12.184 1.00 33.16 ? 134  GLY H C     1 
ATOM   9547  O  O     . GLY H  1 134 ? 63.076  30.658  -11.424 1.00 33.18 ? 134  GLY H O     1 
ATOM   9548  N  N     . ALA H  1 135 ? 61.679  30.553  -13.195 1.00 33.17 ? 135  ALA H N     1 
ATOM   9549  C  CA    . ALA H  1 135 ? 61.837  31.955  -13.578 1.00 33.10 ? 135  ALA H CA    1 
ATOM   9550  C  C     . ALA H  1 135 ? 60.738  32.857  -13.007 1.00 32.99 ? 135  ALA H C     1 
ATOM   9551  O  O     . ALA H  1 135 ? 60.685  34.050  -13.319 1.00 32.84 ? 135  ALA H O     1 
ATOM   9552  C  CB    . ALA H  1 135 ? 61.871  32.071  -15.095 1.00 33.14 ? 135  ALA H CB    1 
ATOM   9553  N  N     . ILE H  1 136 ? 59.888  32.290  -12.152 1.00 32.85 ? 136  ILE H N     1 
ATOM   9554  C  CA    . ILE H  1 136 ? 58.648  32.947  -11.735 1.00 32.80 ? 136  ILE H CA    1 
ATOM   9555  C  C     . ILE H  1 136 ? 58.807  34.312  -11.056 1.00 32.48 ? 136  ILE H C     1 
ATOM   9556  O  O     . ILE H  1 136 ? 57.980  35.193  -11.250 1.00 32.44 ? 136  ILE H O     1 
ATOM   9557  C  CB    . ILE H  1 136 ? 57.744  31.959  -10.918 1.00 32.90 ? 136  ILE H CB    1 
ATOM   9558  C  CG1   . ILE H  1 136 ? 56.347  31.872  -11.558 1.00 32.85 ? 136  ILE H CG1   1 
ATOM   9559  C  CG2   . ILE H  1 136 ? 57.705  32.297  -9.430  1.00 32.25 ? 136  ILE H CG2   1 
ATOM   9560  C  CD1   . ILE H  1 136 ? 55.484  33.091  -11.369 1.00 34.36 ? 136  ILE H CD1   1 
ATOM   9561  N  N     . LEU H  1 137 ? 59.879  34.498  -10.296 1.00 32.24 ? 137  LEU H N     1 
ATOM   9562  C  CA    . LEU H  1 137 ? 60.100  35.764  -9.600  1.00 31.94 ? 137  LEU H CA    1 
ATOM   9563  C  C     . LEU H  1 137 ? 60.445  36.937  -10.526 1.00 31.85 ? 137  LEU H C     1 
ATOM   9564  O  O     . LEU H  1 137 ? 60.285  38.100  -10.138 1.00 31.70 ? 137  LEU H O     1 
ATOM   9565  C  CB    . LEU H  1 137 ? 61.141  35.612  -8.490  1.00 31.95 ? 137  LEU H CB    1 
ATOM   9566  C  CG    . LEU H  1 137 ? 60.748  34.693  -7.319  1.00 32.89 ? 137  LEU H CG    1 
ATOM   9567  C  CD1   . LEU H  1 137 ? 61.884  34.617  -6.319  1.00 33.37 ? 137  LEU H CD1   1 
ATOM   9568  C  CD2   . LEU H  1 137 ? 59.439  35.102  -6.616  1.00 32.56 ? 137  LEU H CD2   1 
ATOM   9569  N  N     . ASN H  1 138 ? 60.898  36.636  -11.744 1.00 31.50 ? 138  ASN H N     1 
ATOM   9570  C  CA    . ASN H  1 138 ? 61.115  37.671  -12.757 1.00 31.28 ? 138  ASN H CA    1 
ATOM   9571  C  C     . ASN H  1 138 ? 59.832  38.358  -13.200 1.00 30.70 ? 138  ASN H C     1 
ATOM   9572  O  O     . ASN H  1 138 ? 59.879  39.415  -13.823 1.00 30.55 ? 138  ASN H O     1 
ATOM   9573  C  CB    . ASN H  1 138 ? 61.889  37.113  -13.955 1.00 31.69 ? 138  ASN H CB    1 
ATOM   9574  C  CG    . ASN H  1 138 ? 63.295  36.672  -13.579 1.00 32.91 ? 138  ASN H CG    1 
ATOM   9575  O  OD1   . ASN H  1 138 ? 63.926  37.265  -12.717 1.00 34.44 ? 138  ASN H OD1   1 
ATOM   9576  N  ND2   . ASN H  1 138 ? 63.780  35.619  -14.218 1.00 35.34 ? 138  ASN H ND2   1 
ATOM   9577  N  N     . LEU H  1 139 ? 58.691  37.758  -12.863 1.00 30.19 ? 139  LEU H N     1 
ATOM   9578  C  CA    . LEU H  1 139 ? 57.387  38.357  -13.130 1.00 29.75 ? 139  LEU H CA    1 
ATOM   9579  C  C     . LEU H  1 139 ? 57.102  39.531  -12.206 1.00 29.40 ? 139  LEU H C     1 
ATOM   9580  O  O     . LEU H  1 139 ? 56.391  40.451  -12.578 1.00 29.50 ? 139  LEU H O     1 
ATOM   9581  C  CB    . LEU H  1 139 ? 56.267  37.323  -12.963 1.00 29.78 ? 139  LEU H CB    1 
ATOM   9582  C  CG    . LEU H  1 139 ? 55.860  36.491  -14.176 1.00 29.92 ? 139  LEU H CG    1 
ATOM   9583  C  CD1   . LEU H  1 139 ? 54.687  35.607  -13.786 1.00 30.44 ? 139  LEU H CD1   1 
ATOM   9584  C  CD2   . LEU H  1 139 ? 55.509  37.390  -15.363 1.00 29.49 ? 139  LEU H CD2   1 
ATOM   9585  N  N     . VAL H  1 140 ? 57.654  39.488  -11.001 1.00 29.10 ? 140  VAL H N     1 
ATOM   9586  C  CA    . VAL H  1 140 ? 57.340  40.469  -9.957  1.00 29.06 ? 140  VAL H CA    1 
ATOM   9587  C  C     . VAL H  1 140 ? 57.575  41.930  -10.393 1.00 29.28 ? 140  VAL H C     1 
ATOM   9588  O  O     . VAL H  1 140 ? 56.654  42.744  -10.263 1.00 29.47 ? 140  VAL H O     1 
ATOM   9589  C  CB    . VAL H  1 140 ? 58.052  40.127  -8.619  1.00 29.00 ? 140  VAL H CB    1 
ATOM   9590  C  CG1   . VAL H  1 140 ? 57.828  41.213  -7.564  1.00 29.21 ? 140  VAL H CG1   1 
ATOM   9591  C  CG2   . VAL H  1 140 ? 57.585  38.782  -8.118  1.00 28.22 ? 140  VAL H CG2   1 
ATOM   9592  N  N     . PRO H  1 141 ? 58.761  42.266  -10.931 1.00 29.15 ? 141  PRO H N     1 
ATOM   9593  C  CA    . PRO H  1 141 ? 59.001  43.632  -11.427 1.00 28.95 ? 141  PRO H CA    1 
ATOM   9594  C  C     . PRO H  1 141 ? 58.139  43.996  -12.647 1.00 29.13 ? 141  PRO H C     1 
ATOM   9595  O  O     . PRO H  1 141 ? 58.061  45.181  -13.006 1.00 29.07 ? 141  PRO H O     1 
ATOM   9596  C  CB    . PRO H  1 141 ? 60.485  43.614  -11.822 1.00 29.10 ? 141  PRO H CB    1 
ATOM   9597  C  CG    . PRO H  1 141 ? 61.065  42.397  -11.156 1.00 28.96 ? 141  PRO H CG    1 
ATOM   9598  C  CD    . PRO H  1 141 ? 59.951  41.407  -11.122 1.00 28.90 ? 141  PRO H CD    1 
ATOM   9599  N  N     . LEU H  1 142 ? 57.503  43.003  -13.265 1.00 28.93 ? 142  LEU H N     1 
ATOM   9600  C  CA    . LEU H  1 142 ? 56.652  43.241  -14.433 1.00 28.95 ? 142  LEU H CA    1 
ATOM   9601  C  C     . LEU H  1 142 ? 55.157  43.316  -14.088 1.00 28.99 ? 142  LEU H C     1 
ATOM   9602  O  O     . LEU H  1 142 ? 54.333  43.688  -14.929 1.00 28.98 ? 142  LEU H O     1 
ATOM   9603  C  CB    . LEU H  1 142 ? 56.896  42.155  -15.483 1.00 28.96 ? 142  LEU H CB    1 
ATOM   9604  C  CG    . LEU H  1 142 ? 58.365  41.950  -15.892 1.00 29.38 ? 142  LEU H CG    1 
ATOM   9605  C  CD1   . LEU H  1 142 ? 58.555  40.591  -16.534 1.00 29.30 ? 142  LEU H CD1   1 
ATOM   9606  C  CD2   . LEU H  1 142 ? 58.851  43.060  -16.837 1.00 28.91 ? 142  LEU H CD2   1 
ATOM   9607  N  N     . ALA H  1 143 ? 54.814  42.981  -12.848 1.00 28.93 ? 143  ALA H N     1 
ATOM   9608  C  CA    . ALA H  1 143 ? 53.423  42.824  -12.458 1.00 29.05 ? 143  ALA H CA    1 
ATOM   9609  C  C     . ALA H  1 143 ? 52.842  44.077  -11.815 1.00 29.35 ? 143  ALA H C     1 
ATOM   9610  O  O     . ALA H  1 143 ? 53.522  44.782  -11.065 1.00 29.26 ? 143  ALA H O     1 
ATOM   9611  C  CB    . ALA H  1 143 ? 53.285  41.650  -11.517 1.00 29.27 ? 143  ALA H CB    1 
ATOM   9612  N  N     . GLU H  1 144 ? 51.570  44.344  -12.084 1.00 29.70 ? 144  GLU H N     1 
ATOM   9613  C  CA    . GLU H  1 144 ? 50.911  45.456  -11.409 1.00 30.34 ? 144  GLU H CA    1 
ATOM   9614  C  C     . GLU H  1 144 ? 50.312  45.051  -10.068 1.00 30.04 ? 144  GLU H C     1 
ATOM   9615  O  O     . GLU H  1 144 ? 49.970  45.905  -9.254  1.00 30.16 ? 144  GLU H O     1 
ATOM   9616  C  CB    . GLU H  1 144 ? 49.877  46.180  -12.292 1.00 30.97 ? 144  GLU H CB    1 
ATOM   9617  C  CG    . GLU H  1 144 ? 49.380  45.443  -13.518 1.00 32.97 ? 144  GLU H CG    1 
ATOM   9618  C  CD    . GLU H  1 144 ? 50.329  45.536  -14.698 1.00 34.93 ? 144  GLU H CD    1 
ATOM   9619  O  OE1   . GLU H  1 144 ? 50.321  46.558  -15.437 1.00 36.09 ? 144  GLU H OE1   1 
ATOM   9620  O  OE2   . GLU H  1 144 ? 51.077  44.559  -14.893 1.00 34.84 ? 144  GLU H OE2   1 
ATOM   9621  N  N     . SER H  1 145 ? 50.220  43.743  -9.833  1.00 29.68 ? 145  SER H N     1 
ATOM   9622  C  CA    . SER H  1 145 ? 49.641  43.206  -8.610  1.00 29.14 ? 145  SER H CA    1 
ATOM   9623  C  C     . SER H  1 145 ? 50.378  41.941  -8.196  1.00 28.85 ? 145  SER H C     1 
ATOM   9624  O  O     . SER H  1 145 ? 50.548  41.013  -8.995  1.00 28.76 ? 145  SER H O     1 
ATOM   9625  C  CB    . SER H  1 145 ? 48.154  42.900  -8.828  1.00 29.43 ? 145  SER H CB    1 
ATOM   9626  O  OG    . SER H  1 145 ? 47.494  42.655  -7.592  1.00 30.77 ? 145  SER H OG    1 
ATOM   9627  N  N     . VAL H  1 146 ? 50.845  41.913  -6.955  1.00 28.46 ? 146  VAL H N     1 
ATOM   9628  C  CA    . VAL H  1 146 ? 51.511  40.729  -6.423  1.00 28.05 ? 146  VAL H CA    1 
ATOM   9629  C  C     . VAL H  1 146 ? 51.012  40.501  -5.015  1.00 28.01 ? 146  VAL H C     1 
ATOM   9630  O  O     . VAL H  1 146 ? 51.048  41.406  -4.182  1.00 28.10 ? 146  VAL H O     1 
ATOM   9631  C  CB    . VAL H  1 146 ? 53.061  40.863  -6.406  1.00 28.04 ? 146  VAL H CB    1 
ATOM   9632  C  CG1   . VAL H  1 146 ? 53.698  39.637  -5.776  1.00 27.42 ? 146  VAL H CG1   1 
ATOM   9633  C  CG2   . VAL H  1 146 ? 53.620  41.085  -7.809  1.00 27.34 ? 146  VAL H CG2   1 
ATOM   9634  N  N     . VAL H  1 147 ? 50.549  39.286  -4.757  1.00 27.88 ? 147  VAL H N     1 
ATOM   9635  C  CA    . VAL H  1 147 ? 50.126  38.898  -3.426  1.00 27.79 ? 147  VAL H CA    1 
ATOM   9636  C  C     . VAL H  1 147 ? 50.768  37.546  -3.063  1.00 27.81 ? 147  VAL H C     1 
ATOM   9637  O  O     . VAL H  1 147 ? 51.057  36.735  -3.948  1.00 27.51 ? 147  VAL H O     1 
ATOM   9638  C  CB    . VAL H  1 147 ? 48.570  38.917  -3.337  1.00 27.87 ? 147  VAL H CB    1 
ATOM   9639  C  CG1   . VAL H  1 147 ? 47.960  37.538  -3.527  1.00 27.32 ? 147  VAL H CG1   1 
ATOM   9640  C  CG2   . VAL H  1 147 ? 48.118  39.543  -2.051  1.00 29.31 ? 147  VAL H CG2   1 
ATOM   9641  N  N     . LYS H  1 148 ? 51.030  37.332  -1.776  1.00 27.74 ? 148  LYS H N     1 
ATOM   9642  C  CA    . LYS H  1 148 ? 51.458  36.024  -1.286  1.00 27.90 ? 148  LYS H CA    1 
ATOM   9643  C  C     . LYS H  1 148 ? 50.458  35.457  -0.274  1.00 27.78 ? 148  LYS H C     1 
ATOM   9644  O  O     . LYS H  1 148 ? 50.246  36.023  0.790   1.00 27.59 ? 148  LYS H O     1 
ATOM   9645  C  CB    . LYS H  1 148 ? 52.873  36.057  -0.688  1.00 28.10 ? 148  LYS H CB    1 
ATOM   9646  C  CG    . LYS H  1 148 ? 53.353  34.680  -0.258  1.00 27.91 ? 148  LYS H CG    1 
ATOM   9647  C  CD    . LYS H  1 148 ? 54.872  34.595  -0.113  1.00 30.38 ? 148  LYS H CD    1 
ATOM   9648  C  CE    . LYS H  1 148 ? 55.267  33.359  0.685   1.00 30.28 ? 148  LYS H CE    1 
ATOM   9649  N  NZ    . LYS H  1 148 ? 56.737  33.281  0.823   1.00 32.20 ? 148  LYS H NZ    1 
ATOM   9650  N  N     . LEU H  1 149 ? 49.854  34.329  -0.630  1.00 27.88 ? 149  LEU H N     1 
ATOM   9651  C  CA    . LEU H  1 149 ? 48.852  33.697  0.209   1.00 28.05 ? 149  LEU H CA    1 
ATOM   9652  C  C     . LEU H  1 149 ? 49.521  32.855  1.286   1.00 28.52 ? 149  LEU H C     1 
ATOM   9653  O  O     . LEU H  1 149 ? 50.724  32.564  1.228   1.00 28.94 ? 149  LEU H O     1 
ATOM   9654  C  CB    . LEU H  1 149 ? 47.889  32.849  -0.627  1.00 27.79 ? 149  LEU H CB    1 
ATOM   9655  C  CG    . LEU H  1 149 ? 47.092  33.497  -1.766  1.00 28.03 ? 149  LEU H CG    1 
ATOM   9656  C  CD1   . LEU H  1 149 ? 46.115  32.476  -2.338  1.00 26.19 ? 149  LEU H CD1   1 
ATOM   9657  C  CD2   . LEU H  1 149 ? 46.360  34.795  -1.349  1.00 26.74 ? 149  LEU H CD2   1 
ATOM   9658  N  N     . THR H  1 150 ? 48.718  32.446  2.255   1.00 28.82 ? 150  THR H N     1 
ATOM   9659  C  CA    . THR H  1 150 ? 49.189  31.765  3.445   1.00 29.36 ? 150  THR H CA    1 
ATOM   9660  C  C     . THR H  1 150 ? 48.494  30.408  3.544   1.00 28.97 ? 150  THR H C     1 
ATOM   9661  O  O     . THR H  1 150 ? 47.349  30.274  3.119   1.00 28.73 ? 150  THR H O     1 
ATOM   9662  C  CB    . THR H  1 150 ? 48.846  32.675  4.653   1.00 29.67 ? 150  THR H CB    1 
ATOM   9663  O  OG1   . THR H  1 150 ? 50.052  33.156  5.256   1.00 31.58 ? 150  THR H OG1   1 
ATOM   9664  C  CG2   . THR H  1 150 ? 48.129  31.940  5.764   1.00 29.66 ? 150  THR H CG2   1 
ATOM   9665  N  N     . ALA H  1 151 ? 49.191  29.408  4.076   1.00 28.81 ? 151  ALA H N     1 
ATOM   9666  C  CA    . ALA H  1 151 ? 48.586  28.113  4.378   1.00 28.83 ? 151  ALA H CA    1 
ATOM   9667  C  C     . ALA H  1 151 ? 48.567  27.887  5.886   1.00 29.05 ? 151  ALA H C     1 
ATOM   9668  O  O     . ALA H  1 151 ? 49.006  28.743  6.655   1.00 28.84 ? 151  ALA H O     1 
ATOM   9669  C  CB    . ALA H  1 151 ? 49.336  26.993  3.678   1.00 28.37 ? 151  ALA H CB    1 
ATOM   9670  N  N     . VAL H  1 152 ? 48.036  26.741  6.303   1.00 29.44 ? 152  VAL H N     1 
ATOM   9671  C  CA    . VAL H  1 152 ? 48.079  26.330  7.700   1.00 30.00 ? 152  VAL H CA    1 
ATOM   9672  C  C     . VAL H  1 152 ? 49.215  25.312  7.874   1.00 30.33 ? 152  VAL H C     1 
ATOM   9673  O  O     . VAL H  1 152 ? 49.323  24.362  7.100   1.00 30.23 ? 152  VAL H O     1 
ATOM   9674  C  CB    . VAL H  1 152 ? 46.706  25.745  8.153   1.00 30.14 ? 152  VAL H CB    1 
ATOM   9675  C  CG1   . VAL H  1 152 ? 46.764  25.220  9.585   1.00 29.76 ? 152  VAL H CG1   1 
ATOM   9676  C  CG2   . VAL H  1 152 ? 45.599  26.794  8.017   1.00 30.04 ? 152  VAL H CG2   1 
ATOM   9677  N  N     . CYS H  1 153 ? 50.074  25.523  8.868   1.00 31.07 ? 153  CYS H N     1 
ATOM   9678  C  CA    . CYS H  1 153 ? 51.151  24.571  9.150   1.00 31.84 ? 153  CYS H CA    1 
ATOM   9679  C  C     . CYS H  1 153 ? 50.563  23.211  9.552   1.00 32.82 ? 153  CYS H C     1 
ATOM   9680  O  O     . CYS H  1 153 ? 49.766  23.107  10.493  1.00 32.74 ? 153  CYS H O     1 
ATOM   9681  C  CB    . CYS H  1 153 ? 52.121  25.094  10.210  1.00 31.35 ? 153  CYS H CB    1 
ATOM   9682  S  SG    . CYS H  1 153 ? 53.529  23.988  10.525  1.00 30.18 ? 153  CYS H SG    1 
ATOM   9683  N  N     . MET H  1 154 ? 50.943  22.185  8.804   1.00 33.76 ? 154  MET H N     1 
ATOM   9684  C  CA    . MET H  1 154 ? 50.400  20.857  8.986   1.00 34.95 ? 154  MET H CA    1 
ATOM   9685  C  C     . MET H  1 154 ? 51.049  20.144  10.171  1.00 35.88 ? 154  MET H C     1 
ATOM   9686  O  O     . MET H  1 154 ? 50.652  19.035  10.524  1.00 36.40 ? 154  MET H O     1 
ATOM   9687  C  CB    . MET H  1 154 ? 50.551  20.052  7.691   1.00 34.83 ? 154  MET H CB    1 
ATOM   9688  C  CG    . MET H  1 154 ? 49.649  20.565  6.566   1.00 34.82 ? 154  MET H CG    1 
ATOM   9689  S  SD    . MET H  1 154 ? 49.845  19.746  4.968   1.00 34.67 ? 154  MET H SD    1 
ATOM   9690  C  CE    . MET H  1 154 ? 48.423  20.301  4.171   1.00 35.85 ? 154  MET H CE    1 
ATOM   9691  N  N     . GLU H  1 155 ? 52.022  20.799  10.798  1.00 36.74 ? 155  GLU H N     1 
ATOM   9692  C  CA    . GLU H  1 155 ? 52.762  20.212  11.912  1.00 37.59 ? 155  GLU H CA    1 
ATOM   9693  C  C     . GLU H  1 155 ? 52.505  20.902  13.259  1.00 37.76 ? 155  GLU H C     1 
ATOM   9694  O  O     . GLU H  1 155 ? 52.483  20.239  14.300  1.00 37.96 ? 155  GLU H O     1 
ATOM   9695  C  CB    . GLU H  1 155 ? 54.262  20.138  11.579  1.00 37.91 ? 155  GLU H CB    1 
ATOM   9696  C  CG    . GLU H  1 155 ? 54.611  18.940  10.693  1.00 39.28 ? 155  GLU H CG    1 
ATOM   9697  C  CD    . GLU H  1 155 ? 55.926  19.078  9.934   1.00 41.48 ? 155  GLU H CD    1 
ATOM   9698  O  OE1   . GLU H  1 155 ? 55.981  18.643  8.751   1.00 41.70 ? 155  GLU H OE1   1 
ATOM   9699  O  OE2   . GLU H  1 155 ? 56.912  19.591  10.520  1.00 42.04 ? 155  GLU H OE2   1 
ATOM   9700  N  N     . CYS H  1 156 ? 52.282  22.216  13.238  1.00 37.83 ? 156  CYS H N     1 
ATOM   9701  C  CA    . CYS H  1 156 ? 51.999  22.966  14.465  1.00 37.91 ? 156  CYS H CA    1 
ATOM   9702  C  C     . CYS H  1 156 ? 50.717  23.813  14.384  1.00 38.18 ? 156  CYS H C     1 
ATOM   9703  O  O     . CYS H  1 156 ? 50.290  24.404  15.379  1.00 38.02 ? 156  CYS H O     1 
ATOM   9704  C  CB    . CYS H  1 156 ? 53.189  23.853  14.825  1.00 37.89 ? 156  CYS H CB    1 
ATOM   9705  S  SG    . CYS H  1 156 ? 53.210  25.434  13.945  1.00 37.24 ? 156  CYS H SG    1 
ATOM   9706  N  N     . PHE H  1 157 ? 50.131  23.885  13.188  1.00 38.46 ? 157  PHE H N     1 
ATOM   9707  C  CA    . PHE H  1 157 ? 48.835  24.539  12.950  1.00 38.80 ? 157  PHE H CA    1 
ATOM   9708  C  C     . PHE H  1 157 ? 48.810  26.072  13.105  1.00 38.89 ? 157  PHE H C     1 
ATOM   9709  O  O     . PHE H  1 157 ? 47.743  26.679  13.219  1.00 39.31 ? 157  PHE H O     1 
ATOM   9710  C  CB    . PHE H  1 157 ? 47.711  23.839  13.733  1.00 38.65 ? 157  PHE H CB    1 
ATOM   9711  C  CG    . PHE H  1 157 ? 47.806  22.333  13.699  1.00 39.40 ? 157  PHE H CG    1 
ATOM   9712  C  CD1   . PHE H  1 157 ? 48.148  21.617  14.847  1.00 40.14 ? 157  PHE H CD1   1 
ATOM   9713  C  CD2   . PHE H  1 157 ? 47.581  21.632  12.515  1.00 39.50 ? 157  PHE H CD2   1 
ATOM   9714  C  CE1   . PHE H  1 157 ? 48.254  20.223  14.820  1.00 40.23 ? 157  PHE H CE1   1 
ATOM   9715  C  CE2   . PHE H  1 157 ? 47.680  20.243  12.470  1.00 39.98 ? 157  PHE H CE2   1 
ATOM   9716  C  CZ    . PHE H  1 157 ? 48.018  19.534  13.627  1.00 40.97 ? 157  PHE H CZ    1 
ATOM   9717  N  N     . ARG H  1 158 ? 49.983  26.693  13.082  1.00 38.79 ? 158  ARG H N     1 
ATOM   9718  C  CA    . ARG H  1 158 ? 50.084  28.143  12.927  1.00 38.81 ? 158  ARG H CA    1 
ATOM   9719  C  C     . ARG H  1 158 ? 50.104  28.482  11.431  1.00 37.88 ? 158  ARG H C     1 
ATOM   9720  O  O     . ARG H  1 158 ? 49.935  27.596  10.594  1.00 37.66 ? 158  ARG H O     1 
ATOM   9721  C  CB    . ARG H  1 158 ? 51.340  28.675  13.632  1.00 39.37 ? 158  ARG H CB    1 
ATOM   9722  C  CG    . ARG H  1 158 ? 51.283  28.598  15.159  1.00 42.25 ? 158  ARG H CG    1 
ATOM   9723  C  CD    . ARG H  1 158 ? 52.404  29.355  15.859  1.00 47.58 ? 158  ARG H CD    1 
ATOM   9724  N  NE    . ARG H  1 158 ? 52.083  29.667  17.258  1.00 52.18 ? 158  ARG H NE    1 
ATOM   9725  C  CZ    . ARG H  1 158 ? 52.129  30.888  17.803  1.00 53.88 ? 158  ARG H CZ    1 
ATOM   9726  N  NH1   . ARG H  1 158 ? 52.488  31.945  17.077  1.00 54.24 ? 158  ARG H NH1   1 
ATOM   9727  N  NH2   . ARG H  1 158 ? 51.820  31.051  19.086  1.00 54.75 ? 158  ARG H NH2   1 
ATOM   9728  N  N     . GLU H  1 159 ? 50.293  29.754  11.093  1.00 37.08 ? 159  GLU H N     1 
ATOM   9729  C  CA    . GLU H  1 159 ? 50.388  30.174  9.691   1.00 36.41 ? 159  GLU H CA    1 
ATOM   9730  C  C     . GLU H  1 159 ? 51.633  29.594  9.008   1.00 34.97 ? 159  GLU H C     1 
ATOM   9731  O  O     . GLU H  1 159 ? 52.733  29.633  9.561   1.00 34.51 ? 159  GLU H O     1 
ATOM   9732  C  CB    . GLU H  1 159 ? 50.403  31.695  9.579   1.00 36.89 ? 159  GLU H CB    1 
ATOM   9733  C  CG    . GLU H  1 159 ? 49.131  32.381  10.067  1.00 40.80 ? 159  GLU H CG    1 
ATOM   9734  C  CD    . GLU H  1 159 ? 48.864  33.701  9.351   1.00 45.05 ? 159  GLU H CD    1 
ATOM   9735  O  OE1   . GLU H  1 159 ? 49.825  34.500  9.174   1.00 46.07 ? 159  GLU H OE1   1 
ATOM   9736  O  OE2   . GLU H  1 159 ? 47.693  33.935  8.958   1.00 46.52 ? 159  GLU H OE2   1 
ATOM   9737  N  N     . ALA H  1 160 ? 51.442  29.060  7.807   1.00 33.36 ? 160  ALA H N     1 
ATOM   9738  C  CA    . ALA H  1 160 ? 52.524  28.472  7.032   1.00 32.11 ? 160  ALA H CA    1 
ATOM   9739  C  C     . ALA H  1 160 ? 52.853  29.304  5.791   1.00 31.39 ? 160  ALA H C     1 
ATOM   9740  O  O     . ALA H  1 160 ? 51.960  29.721  5.047   1.00 30.99 ? 160  ALA H O     1 
ATOM   9741  C  CB    . ALA H  1 160 ? 52.159  27.064  6.634   1.00 31.87 ? 160  ALA H CB    1 
ATOM   9742  N  N     . ALA H  1 161 ? 54.144  29.523  5.573   1.00 30.43 ? 161  ALA H N     1 
ATOM   9743  C  CA    . ALA H  1 161 ? 54.612  30.269  4.416   1.00 29.82 ? 161  ALA H CA    1 
ATOM   9744  C  C     . ALA H  1 161 ? 55.411  29.411  3.432   1.00 29.48 ? 161  ALA H C     1 
ATOM   9745  O  O     . ALA H  1 161 ? 55.660  29.832  2.298   1.00 29.32 ? 161  ALA H O     1 
ATOM   9746  C  CB    . ALA H  1 161 ? 55.430  31.449  4.873   1.00 30.09 ? 161  ALA H CB    1 
ATOM   9747  N  N     . TYR H  1 162 ? 55.794  28.209  3.856   1.00 29.29 ? 162  TYR H N     1 
ATOM   9748  C  CA    . TYR H  1 162 ? 56.709  27.362  3.077   1.00 29.38 ? 162  TYR H CA    1 
ATOM   9749  C  C     . TYR H  1 162 ? 56.183  25.953  2.838   1.00 29.45 ? 162  TYR H C     1 
ATOM   9750  O  O     . TYR H  1 162 ? 55.210  25.514  3.465   1.00 29.20 ? 162  TYR H O     1 
ATOM   9751  C  CB    . TYR H  1 162 ? 58.117  27.316  3.720   1.00 29.37 ? 162  TYR H CB    1 
ATOM   9752  C  CG    . TYR H  1 162 ? 58.516  28.632  4.339   1.00 29.25 ? 162  TYR H CG    1 
ATOM   9753  C  CD1   . TYR H  1 162 ? 58.454  28.821  5.716   1.00 29.89 ? 162  TYR H CD1   1 
ATOM   9754  C  CD2   . TYR H  1 162 ? 58.904  29.708  3.546   1.00 29.31 ? 162  TYR H CD2   1 
ATOM   9755  C  CE1   . TYR H  1 162 ? 58.791  30.040  6.288   1.00 30.48 ? 162  TYR H CE1   1 
ATOM   9756  C  CE2   . TYR H  1 162 ? 59.254  30.935  4.110   1.00 29.26 ? 162  TYR H CE2   1 
ATOM   9757  C  CZ    . TYR H  1 162 ? 59.196  31.091  5.473   1.00 30.05 ? 162  TYR H CZ    1 
ATOM   9758  O  OH    . TYR H  1 162 ? 59.531  32.293  6.038   1.00 30.71 ? 162  TYR H OH    1 
ATOM   9759  N  N     . THR H  1 163 ? 56.828  25.264  1.906   1.00 29.79 ? 163  THR H N     1 
ATOM   9760  C  CA    . THR H  1 163 ? 56.514  23.874  1.608   1.00 30.51 ? 163  THR H CA    1 
ATOM   9761  C  C     . THR H  1 163 ? 57.707  22.964  1.916   1.00 31.43 ? 163  THR H C     1 
ATOM   9762  O  O     . THR H  1 163 ? 58.821  23.173  1.422   1.00 31.27 ? 163  THR H O     1 
ATOM   9763  C  CB    . THR H  1 163 ? 56.082  23.709  0.139   1.00 30.34 ? 163  THR H CB    1 
ATOM   9764  O  OG1   . THR H  1 163 ? 55.194  24.771  -0.227  1.00 28.97 ? 163  THR H OG1   1 
ATOM   9765  C  CG2   . THR H  1 163 ? 55.235  22.471  -0.015  1.00 30.17 ? 163  THR H CG2   1 
ATOM   9766  N  N     . LYS H  1 164 ? 57.447  21.958  2.745   1.00 32.48 ? 164  LYS H N     1 
ATOM   9767  C  CA    . LYS H  1 164 ? 58.436  20.966  3.123   1.00 33.59 ? 164  LYS H CA    1 
ATOM   9768  C  C     . LYS H  1 164 ? 58.197  19.688  2.320   1.00 34.17 ? 164  LYS H C     1 
ATOM   9769  O  O     . LYS H  1 164 ? 57.065  19.200  2.249   1.00 34.01 ? 164  LYS H O     1 
ATOM   9770  C  CB    . LYS H  1 164 ? 58.317  20.706  4.628   1.00 33.39 ? 164  LYS H CB    1 
ATOM   9771  C  CG    . LYS H  1 164 ? 58.880  19.383  5.125   1.00 35.34 ? 164  LYS H CG    1 
ATOM   9772  C  CD    . LYS H  1 164 ? 59.753  19.580  6.342   1.00 38.22 ? 164  LYS H CD    1 
ATOM   9773  C  CE    . LYS H  1 164 ? 59.184  18.878  7.553   1.00 40.23 ? 164  LYS H CE    1 
ATOM   9774  N  NZ    . LYS H  1 164 ? 59.611  19.544  8.819   1.00 40.68 ? 164  LYS H NZ    1 
ATOM   9775  N  N     . ARG H  1 165 ? 59.254  19.150  1.714   1.00 35.21 ? 165  ARG H N     1 
ATOM   9776  C  CA    . ARG H  1 165 ? 59.163  17.840  1.072   1.00 36.44 ? 165  ARG H CA    1 
ATOM   9777  C  C     . ARG H  1 165 ? 59.364  16.741  2.117   1.00 37.50 ? 165  ARG H C     1 
ATOM   9778  O  O     . ARG H  1 165 ? 60.297  16.799  2.924   1.00 37.49 ? 165  ARG H O     1 
ATOM   9779  C  CB    . ARG H  1 165 ? 60.182  17.704  -0.054  1.00 36.39 ? 165  ARG H CB    1 
ATOM   9780  C  CG    . ARG H  1 165 ? 60.221  16.327  -0.674  1.00 35.49 ? 165  ARG H CG    1 
ATOM   9781  C  CD    . ARG H  1 165 ? 61.028  16.258  -1.945  1.00 34.80 ? 165  ARG H CD    1 
ATOM   9782  N  NE    . ARG H  1 165 ? 60.388  16.966  -3.047  1.00 33.81 ? 165  ARG H NE    1 
ATOM   9783  C  CZ    . ARG H  1 165 ? 61.027  17.380  -4.127  1.00 33.07 ? 165  ARG H CZ    1 
ATOM   9784  N  NH1   . ARG H  1 165 ? 62.331  17.153  -4.248  1.00 33.87 ? 165  ARG H NH1   1 
ATOM   9785  N  NH2   . ARG H  1 165 ? 60.371  18.020  -5.085  1.00 31.68 ? 165  ARG H NH2   1 
ATOM   9786  N  N     . LEU H  1 166 ? 58.477  15.748  2.100   1.00 38.85 ? 166  LEU H N     1 
ATOM   9787  C  CA    . LEU H  1 166 ? 58.512  14.662  3.076   1.00 40.41 ? 166  LEU H CA    1 
ATOM   9788  C  C     . LEU H  1 166 ? 59.574  13.594  2.763   1.00 41.53 ? 166  LEU H C     1 
ATOM   9789  O  O     . LEU H  1 166 ? 60.275  13.138  3.662   1.00 41.85 ? 166  LEU H O     1 
ATOM   9790  C  CB    . LEU H  1 166 ? 57.119  14.031  3.226   1.00 40.23 ? 166  LEU H CB    1 
ATOM   9791  C  CG    . LEU H  1 166 ? 55.960  14.968  3.597   1.00 40.28 ? 166  LEU H CG    1 
ATOM   9792  C  CD1   . LEU H  1 166 ? 54.624  14.269  3.432   1.00 40.02 ? 166  LEU H CD1   1 
ATOM   9793  C  CD2   . LEU H  1 166 ? 56.099  15.525  5.015   1.00 39.89 ? 166  LEU H CD2   1 
ATOM   9794  N  N     . GLY H  1 167 ? 59.690  13.211  1.493   1.00 42.80 ? 167  GLY H N     1 
ATOM   9795  C  CA    . GLY H  1 167 ? 60.652  12.208  1.063   1.00 44.42 ? 167  GLY H CA    1 
ATOM   9796  C  C     . GLY H  1 167 ? 62.087  12.705  0.935   1.00 45.56 ? 167  GLY H C     1 
ATOM   9797  O  O     . GLY H  1 167 ? 62.441  13.764  1.462   1.00 45.71 ? 167  GLY H O     1 
ATOM   9798  N  N     . THR H  1 168 ? 62.916  11.934  0.232   1.00 46.44 ? 168  THR H N     1 
ATOM   9799  C  CA    . THR H  1 168 ? 64.342  12.247  0.115   1.00 47.31 ? 168  THR H CA    1 
ATOM   9800  C  C     . THR H  1 168 ? 64.771  12.615  -1.305  1.00 47.67 ? 168  THR H C     1 
ATOM   9801  O  O     . THR H  1 168 ? 65.943  12.930  -1.532  1.00 47.85 ? 168  THR H O     1 
ATOM   9802  C  CB    . THR H  1 168 ? 65.228  11.088  0.652   1.00 47.40 ? 168  THR H CB    1 
ATOM   9803  O  OG1   . THR H  1 168 ? 64.901  9.877   -0.036  1.00 47.85 ? 168  THR H OG1   1 
ATOM   9804  C  CG2   . THR H  1 168 ? 64.923  10.778  2.129   1.00 47.29 ? 168  THR H CG2   1 
ATOM   9805  N  N     . GLU H  1 169 ? 63.834  12.586  -2.253  1.00 48.05 ? 169  GLU H N     1 
ATOM   9806  C  CA    . GLU H  1 169 ? 64.151  12.930  -3.640  1.00 48.53 ? 169  GLU H CA    1 
ATOM   9807  C  C     . GLU H  1 169 ? 64.696  14.362  -3.752  1.00 48.54 ? 169  GLU H C     1 
ATOM   9808  O  O     . GLU H  1 169 ? 64.275  15.257  -3.012  1.00 48.53 ? 169  GLU H O     1 
ATOM   9809  C  CB    . GLU H  1 169 ? 62.975  12.649  -4.589  1.00 48.49 ? 169  GLU H CB    1 
ATOM   9810  C  CG    . GLU H  1 169 ? 61.642  13.252  -4.173  1.00 50.68 ? 169  GLU H CG    1 
ATOM   9811  C  CD    . GLU H  1 169 ? 60.699  12.261  -3.505  1.00 52.00 ? 169  GLU H CD    1 
ATOM   9812  O  OE1   . GLU H  1 169 ? 59.934  11.579  -4.225  1.00 52.67 ? 169  GLU H OE1   1 
ATOM   9813  O  OE2   . GLU H  1 169 ? 60.703  12.189  -2.256  1.00 52.04 ? 169  GLU H OE2   1 
ATOM   9814  N  N     . LYS H  1 170 ? 65.653  14.551  -4.663  1.00 48.51 ? 170  LYS H N     1 
ATOM   9815  C  CA    . LYS H  1 170 ? 66.484  15.759  -4.715  1.00 48.43 ? 170  LYS H CA    1 
ATOM   9816  C  C     . LYS H  1 170 ? 66.155  16.696  -5.876  1.00 47.82 ? 170  LYS H C     1 
ATOM   9817  O  O     . LYS H  1 170 ? 66.467  17.885  -5.825  1.00 47.79 ? 170  LYS H O     1 
ATOM   9818  C  CB    . LYS H  1 170 ? 67.966  15.371  -4.799  1.00 48.87 ? 170  LYS H CB    1 
ATOM   9819  C  CG    . LYS H  1 170 ? 68.501  14.652  -3.567  1.00 50.49 ? 170  LYS H CG    1 
ATOM   9820  C  CD    . LYS H  1 170 ? 69.943  15.027  -3.301  1.00 52.95 ? 170  LYS H CD    1 
ATOM   9821  C  CE    . LYS H  1 170 ? 70.864  13.826  -3.481  1.00 54.60 ? 170  LYS H CE    1 
ATOM   9822  N  NZ    . LYS H  1 170 ? 71.300  13.273  -2.162  1.00 55.29 ? 170  LYS H NZ    1 
ATOM   9823  N  N     . GLU H  1 171 ? 65.551  16.149  -6.926  1.00 47.00 ? 171  GLU H N     1 
ATOM   9824  C  CA    . GLU H  1 171 ? 65.132  16.935  -8.078  1.00 46.45 ? 171  GLU H CA    1 
ATOM   9825  C  C     . GLU H  1 171 ? 64.016  17.925  -7.699  1.00 45.57 ? 171  GLU H C     1 
ATOM   9826  O  O     . GLU H  1 171 ? 63.223  17.668  -6.780  1.00 45.25 ? 171  GLU H O     1 
ATOM   9827  C  CB    . GLU H  1 171 ? 64.713  16.011  -9.238  1.00 46.65 ? 171  GLU H CB    1 
ATOM   9828  C  CG    . GLU H  1 171 ? 63.520  15.098  -8.966  1.00 48.32 ? 171  GLU H CG    1 
ATOM   9829  C  CD    . GLU H  1 171 ? 63.892  13.733  -8.391  1.00 51.20 ? 171  GLU H CD    1 
ATOM   9830  O  OE1   . GLU H  1 171 ? 64.780  13.659  -7.498  1.00 52.51 ? 171  GLU H OE1   1 
ATOM   9831  O  OE2   . GLU H  1 171 ? 63.278  12.722  -8.819  1.00 51.37 ? 171  GLU H OE2   1 
ATOM   9832  N  N     . VAL H  1 172 ? 63.974  19.060  -8.394  1.00 44.44 ? 172  VAL H N     1 
ATOM   9833  C  CA    . VAL H  1 172 ? 63.000  20.106  -8.097  1.00 43.49 ? 172  VAL H CA    1 
ATOM   9834  C  C     . VAL H  1 172 ? 61.568  19.665  -8.446  1.00 42.92 ? 172  VAL H C     1 
ATOM   9835  O  O     . VAL H  1 172 ? 60.687  19.690  -7.578  1.00 42.63 ? 172  VAL H O     1 
ATOM   9836  C  CB    . VAL H  1 172 ? 63.376  21.459  -8.755  1.00 43.60 ? 172  VAL H CB    1 
ATOM   9837  C  CG1   . VAL H  1 172 ? 62.245  22.468  -8.609  1.00 43.25 ? 172  VAL H CG1   1 
ATOM   9838  C  CG2   . VAL H  1 172 ? 64.646  22.016  -8.125  1.00 43.31 ? 172  VAL H CG2   1 
ATOM   9839  N  N     . GLU H  1 173 ? 61.351  19.236  -9.691  1.00 42.12 ? 173  GLU H N     1 
ATOM   9840  C  CA    . GLU H  1 173 ? 60.028  18.792  -10.117 1.00 41.73 ? 173  GLU H CA    1 
ATOM   9841  C  C     . GLU H  1 173 ? 59.675  17.377  -9.632  1.00 41.32 ? 173  GLU H C     1 
ATOM   9842  O  O     . GLU H  1 173 ? 60.145  16.378  -10.179 1.00 41.36 ? 173  GLU H O     1 
ATOM   9843  C  CB    . GLU H  1 173 ? 59.849  18.916  -11.636 1.00 41.63 ? 173  GLU H CB    1 
ATOM   9844  C  CG    . GLU H  1 173 ? 58.393  18.779  -12.082 1.00 42.89 ? 173  GLU H CG    1 
ATOM   9845  C  CD    . GLU H  1 173 ? 58.176  19.007  -13.573 1.00 44.90 ? 173  GLU H CD    1 
ATOM   9846  O  OE1   . GLU H  1 173 ? 57.452  18.197  -14.196 1.00 45.53 ? 173  GLU H OE1   1 
ATOM   9847  O  OE2   . GLU H  1 173 ? 58.716  19.995  -14.131 1.00 46.26 ? 173  GLU H OE2   1 
ATOM   9848  N  N     . VAL H  1 174 ? 58.855  17.311  -8.586  1.00 40.66 ? 174  VAL H N     1 
ATOM   9849  C  CA    . VAL H  1 174 ? 58.216  16.066  -8.165  1.00 40.02 ? 174  VAL H CA    1 
ATOM   9850  C  C     . VAL H  1 174 ? 56.757  16.377  -7.864  1.00 39.75 ? 174  VAL H C     1 
ATOM   9851  O  O     . VAL H  1 174 ? 56.432  17.040  -6.871  1.00 39.76 ? 174  VAL H O     1 
ATOM   9852  C  CB    . VAL H  1 174 ? 58.891  15.407  -6.936  1.00 39.90 ? 174  VAL H CB    1 
ATOM   9853  C  CG1   . VAL H  1 174 ? 58.167  14.127  -6.559  1.00 39.23 ? 174  VAL H CG1   1 
ATOM   9854  C  CG2   . VAL H  1 174 ? 60.357  15.115  -7.208  1.00 39.78 ? 174  VAL H CG2   1 
ATOM   9855  N  N     . ILE H  1 175 ? 55.881  15.909  -8.742  1.00 39.47 ? 175  ILE H N     1 
ATOM   9856  C  CA    . ILE H  1 175 ? 54.453  16.147  -8.610  1.00 39.29 ? 175  ILE H CA    1 
ATOM   9857  C  C     . ILE H  1 175 ? 53.876  15.302  -7.473  1.00 39.07 ? 175  ILE H C     1 
ATOM   9858  O  O     . ILE H  1 175 ? 54.287  14.156  -7.270  1.00 39.19 ? 175  ILE H O     1 
ATOM   9859  C  CB    . ILE H  1 175 ? 53.754  15.957  -9.988  1.00 39.22 ? 175  ILE H CB    1 
ATOM   9860  C  CG1   . ILE H  1 175 ? 53.808  17.275  -10.766 1.00 39.85 ? 175  ILE H CG1   1 
ATOM   9861  C  CG2   . ILE H  1 175 ? 52.292  15.542  -9.851  1.00 39.71 ? 175  ILE H CG2   1 
ATOM   9862  C  CD1   . ILE H  1 175 ? 54.850  17.329  -11.840 1.00 39.93 ? 175  ILE H CD1   1 
ATOM   9863  N  N     . GLY H  1 176 ? 52.965  15.905  -6.711  1.00 38.77 ? 176  GLY H N     1 
ATOM   9864  C  CA    . GLY H  1 176 ? 52.362  15.268  -5.551  1.00 38.37 ? 176  GLY H CA    1 
ATOM   9865  C  C     . GLY H  1 176 ? 51.574  16.248  -4.704  1.00 38.23 ? 176  GLY H C     1 
ATOM   9866  O  O     . GLY H  1 176 ? 51.657  17.467  -4.920  1.00 38.24 ? 176  GLY H O     1 
ATOM   9867  N  N     . GLY H  1 177 ? 50.806  15.721  -3.751  1.00 37.99 ? 177  GLY H N     1 
ATOM   9868  C  CA    . GLY H  1 177 ? 50.015  16.538  -2.846  1.00 37.52 ? 177  GLY H CA    1 
ATOM   9869  C  C     . GLY H  1 177 ? 50.473  16.370  -1.417  1.00 37.63 ? 177  GLY H C     1 
ATOM   9870  O  O     . GLY H  1 177 ? 51.675  16.289  -1.157  1.00 37.34 ? 177  GLY H O     1 
ATOM   9871  N  N     . ALA H  1 178 ? 49.509  16.283  -0.503  1.00 37.94 ? 178  ALA H N     1 
ATOM   9872  C  CA    . ALA H  1 178 ? 49.771  16.168  0.929   1.00 38.43 ? 178  ALA H CA    1 
ATOM   9873  C  C     . ALA H  1 178 ? 50.452  14.857  1.329   1.00 38.66 ? 178  ALA H C     1 
ATOM   9874  O  O     . ALA H  1 178 ? 50.974  14.733  2.437   1.00 39.01 ? 178  ALA H O     1 
ATOM   9875  C  CB    . ALA H  1 178 ? 48.477  16.401  1.723   1.00 38.27 ? 178  ALA H CB    1 
ATOM   9876  N  N     . ASP H  1 179 ? 50.460  13.899  0.410   1.00 39.06 ? 179  ASP H N     1 
ATOM   9877  C  CA    . ASP H  1 179 ? 51.231  12.660  0.558   1.00 39.52 ? 179  ASP H CA    1 
ATOM   9878  C  C     . ASP H  1 179 ? 52.746  12.885  0.471   1.00 38.97 ? 179  ASP H C     1 
ATOM   9879  O  O     . ASP H  1 179 ? 53.519  12.156  1.089   1.00 39.32 ? 179  ASP H O     1 
ATOM   9880  C  CB    . ASP H  1 179 ? 50.778  11.606  -0.472  1.00 39.79 ? 179  ASP H CB    1 
ATOM   9881  C  CG    . ASP H  1 179 ? 50.678  12.159  -1.907  1.00 41.76 ? 179  ASP H CG    1 
ATOM   9882  O  OD1   . ASP H  1 179 ? 50.314  13.343  -2.098  1.00 43.55 ? 179  ASP H OD1   1 
ATOM   9883  O  OD2   . ASP H  1 179 ? 50.926  11.465  -2.921  1.00 43.46 ? 179  ASP H OD2   1 
ATOM   9884  N  N     . LYS H  1 180 ? 53.157  13.905  -0.285  1.00 38.09 ? 180  LYS H N     1 
ATOM   9885  C  CA    . LYS H  1 180 ? 54.580  14.170  -0.551  1.00 36.83 ? 180  LYS H CA    1 
ATOM   9886  C  C     . LYS H  1 180 ? 55.090  15.477  0.061   1.00 35.59 ? 180  LYS H C     1 
ATOM   9887  O  O     . LYS H  1 180 ? 56.304  15.675  0.189   1.00 35.44 ? 180  LYS H O     1 
ATOM   9888  C  CB    . LYS H  1 180 ? 54.857  14.170  -2.061  1.00 37.10 ? 180  LYS H CB    1 
ATOM   9889  C  CG    . LYS H  1 180 ? 54.255  12.999  -2.844  1.00 38.46 ? 180  LYS H CG    1 
ATOM   9890  C  CD    . LYS H  1 180 ? 55.308  11.942  -3.168  1.00 42.22 ? 180  LYS H CD    1 
ATOM   9891  C  CE    . LYS H  1 180 ? 55.712  11.964  -4.637  1.00 43.92 ? 180  LYS H CE    1 
ATOM   9892  N  NZ    . LYS H  1 180 ? 54.753  11.214  -5.505  1.00 45.24 ? 180  LYS H NZ    1 
ATOM   9893  N  N     . TYR H  1 181 ? 54.164  16.358  0.443   1.00 34.04 ? 181  TYR H N     1 
ATOM   9894  C  CA    . TYR H  1 181 ? 54.512  17.696  0.916   1.00 32.44 ? 181  TYR H CA    1 
ATOM   9895  C  C     . TYR H  1 181 ? 53.661  18.137  2.097   1.00 32.00 ? 181  TYR H C     1 
ATOM   9896  O  O     . TYR H  1 181 ? 52.485  17.791  2.182   1.00 31.68 ? 181  TYR H O     1 
ATOM   9897  C  CB    . TYR H  1 181 ? 54.325  18.726  -0.214  1.00 32.00 ? 181  TYR H CB    1 
ATOM   9898  C  CG    . TYR H  1 181 ? 55.174  18.535  -1.456  1.00 30.10 ? 181  TYR H CG    1 
ATOM   9899  C  CD1   . TYR H  1 181 ? 54.659  17.899  -2.578  1.00 27.96 ? 181  TYR H CD1   1 
ATOM   9900  C  CD2   . TYR H  1 181 ? 56.485  19.018  -1.515  1.00 28.90 ? 181  TYR H CD2   1 
ATOM   9901  C  CE1   . TYR H  1 181 ? 55.416  17.738  -3.713  1.00 27.71 ? 181  TYR H CE1   1 
ATOM   9902  C  CE2   . TYR H  1 181 ? 57.255  18.866  -2.658  1.00 27.10 ? 181  TYR H CE2   1 
ATOM   9903  C  CZ    . TYR H  1 181 ? 56.715  18.225  -3.749  1.00 28.07 ? 181  TYR H CZ    1 
ATOM   9904  O  OH    . TYR H  1 181 ? 57.465  18.061  -4.887  1.00 27.42 ? 181  TYR H OH    1 
ATOM   9905  N  N     . HIS H  1 182 ? 54.252  18.936  2.976   1.00 31.38 ? 182  HIS H N     1 
ATOM   9906  C  CA    . HIS H  1 182 ? 53.505  19.619  4.024   1.00 31.15 ? 182  HIS H CA    1 
ATOM   9907  C  C     . HIS H  1 182 ? 53.727  21.123  3.906   1.00 30.78 ? 182  HIS H C     1 
ATOM   9908  O  O     . HIS H  1 182 ? 54.848  21.582  3.652   1.00 30.71 ? 182  HIS H O     1 
ATOM   9909  C  CB    . HIS H  1 182 ? 53.936  19.135  5.405   1.00 31.22 ? 182  HIS H CB    1 
ATOM   9910  C  CG    . HIS H  1 182 ? 53.289  17.857  5.837   1.00 31.84 ? 182  HIS H CG    1 
ATOM   9911  N  ND1   . HIS H  1 182 ? 52.347  17.196  5.076   1.00 31.89 ? 182  HIS H ND1   1 
ATOM   9912  C  CD2   . HIS H  1 182 ? 53.455  17.115  6.959   1.00 31.94 ? 182  HIS H CD2   1 
ATOM   9913  C  CE1   . HIS H  1 182 ? 51.957  16.105  5.712   1.00 32.66 ? 182  HIS H CE1   1 
ATOM   9914  N  NE2   . HIS H  1 182 ? 52.612  16.035  6.859   1.00 32.73 ? 182  HIS H NE2   1 
ATOM   9915  N  N     . SER H  1 183 ? 52.651  21.887  4.057   1.00 30.15 ? 183  SER H N     1 
ATOM   9916  C  CA    . SER H  1 183 ? 52.768  23.328  4.255   1.00 29.69 ? 183  SER H CA    1 
ATOM   9917  C  C     . SER H  1 183 ? 53.234  23.514  5.683   1.00 29.29 ? 183  SER H C     1 
ATOM   9918  O  O     . SER H  1 183 ? 52.747  22.842  6.588   1.00 29.04 ? 183  SER H O     1 
ATOM   9919  C  CB    . SER H  1 183 ? 51.430  24.036  4.035   1.00 29.43 ? 183  SER H CB    1 
ATOM   9920  O  OG    . SER H  1 183 ? 50.385  23.396  4.756   1.00 29.35 ? 183  SER H OG    1 
ATOM   9921  N  N     . VAL H  1 184 ? 54.168  24.436  5.883   1.00 29.31 ? 184  VAL H N     1 
ATOM   9922  C  CA    . VAL H  1 184 ? 54.915  24.496  7.125   1.00 29.20 ? 184  VAL H CA    1 
ATOM   9923  C  C     . VAL H  1 184 ? 55.329  25.935  7.495   1.00 29.45 ? 184  VAL H C     1 
ATOM   9924  O  O     . VAL H  1 184 ? 55.556  26.779  6.609   1.00 29.25 ? 184  VAL H O     1 
ATOM   9925  C  CB    . VAL H  1 184 ? 56.103  23.501  6.977   1.00 29.31 ? 184  VAL H CB    1 
ATOM   9926  C  CG1   . VAL H  1 184 ? 57.430  24.195  6.860   1.00 28.86 ? 184  VAL H CG1   1 
ATOM   9927  C  CG2   . VAL H  1 184 ? 56.060  22.425  8.042   1.00 29.02 ? 184  VAL H CG2   1 
ATOM   9928  N  N     . CYS H  1 185 ? 55.393  26.223  8.797   1.00 29.65 ? 185  CYS H N     1 
ATOM   9929  C  CA    . CYS H  1 185 ? 55.972  27.481  9.275   1.00 30.03 ? 185  CYS H CA    1 
ATOM   9930  C  C     . CYS H  1 185 ? 57.515  27.424  9.273   1.00 30.26 ? 185  CYS H C     1 
ATOM   9931  O  O     . CYS H  1 185 ? 58.101  26.390  8.946   1.00 30.23 ? 185  CYS H O     1 
ATOM   9932  C  CB    . CYS H  1 185 ? 55.418  27.836  10.657  1.00 29.82 ? 185  CYS H CB    1 
ATOM   9933  S  SG    . CYS H  1 185 ? 55.960  26.762  12.015  1.00 30.18 ? 185  CYS H SG    1 
ATOM   9934  N  N     . ARG H  1 186 ? 58.158  28.535  9.626   1.00 30.66 ? 186  ARG H N     1 
ATOM   9935  C  CA    . ARG H  1 186 ? 59.616  28.614  9.699   1.00 31.35 ? 186  ARG H CA    1 
ATOM   9936  C  C     . ARG H  1 186 ? 60.215  27.569  10.639  1.00 32.04 ? 186  ARG H C     1 
ATOM   9937  O  O     . ARG H  1 186 ? 61.145  26.848  10.267  1.00 32.15 ? 186  ARG H O     1 
ATOM   9938  C  CB    . ARG H  1 186 ? 60.040  30.016  10.142  1.00 31.15 ? 186  ARG H CB    1 
ATOM   9939  C  CG    . ARG H  1 186 ? 61.530  30.264  10.119  1.00 30.68 ? 186  ARG H CG    1 
ATOM   9940  C  CD    . ARG H  1 186 ? 61.902  31.705  10.422  1.00 30.02 ? 186  ARG H CD    1 
ATOM   9941  N  NE    . ARG H  1 186 ? 61.508  32.602  9.340   1.00 29.25 ? 186  ARG H NE    1 
ATOM   9942  C  CZ    . ARG H  1 186 ? 62.281  32.929  8.307   1.00 29.25 ? 186  ARG H CZ    1 
ATOM   9943  N  NH1   . ARG H  1 186 ? 63.515  32.431  8.195   1.00 29.10 ? 186  ARG H NH1   1 
ATOM   9944  N  NH2   . ARG H  1 186 ? 61.815  33.762  7.377   1.00 28.02 ? 186  ARG H NH2   1 
ATOM   9945  N  N     . LEU H  1 187 ? 59.676  27.499  11.855  1.00 33.00 ? 187  LEU H N     1 
ATOM   9946  C  CA    . LEU H  1 187 ? 60.193  26.600  12.887  1.00 34.04 ? 187  LEU H CA    1 
ATOM   9947  C  C     . LEU H  1 187 ? 60.058  25.142  12.493  1.00 34.28 ? 187  LEU H C     1 
ATOM   9948  O  O     . LEU H  1 187 ? 61.014  24.382  12.618  1.00 34.73 ? 187  LEU H O     1 
ATOM   9949  C  CB    . LEU H  1 187 ? 59.504  26.848  14.234  1.00 34.22 ? 187  LEU H CB    1 
ATOM   9950  C  CG    . LEU H  1 187 ? 59.830  28.157  14.964  1.00 35.52 ? 187  LEU H CG    1 
ATOM   9951  C  CD1   . LEU H  1 187 ? 59.100  28.202  16.306  1.00 36.19 ? 187  LEU H CD1   1 
ATOM   9952  C  CD2   . LEU H  1 187 ? 61.349  28.364  15.150  1.00 36.43 ? 187  LEU H CD2   1 
ATOM   9953  N  N     . CYS H  1 188 ? 58.881  24.758  12.005  1.00 34.50 ? 188  CYS H N     1 
ATOM   9954  C  CA    . CYS H  1 188 ? 58.638  23.378  11.594  1.00 34.87 ? 188  CYS H CA    1 
ATOM   9955  C  C     . CYS H  1 188 ? 59.423  22.994  10.335  1.00 34.99 ? 188  CYS H C     1 
ATOM   9956  O  O     . CYS H  1 188 ? 59.775  21.827  10.160  1.00 35.07 ? 188  CYS H O     1 
ATOM   9957  C  CB    . CYS H  1 188 ? 57.134  23.105  11.441  1.00 34.79 ? 188  CYS H CB    1 
ATOM   9958  S  SG    . CYS H  1 188 ? 56.190  23.346  12.976  1.00 35.89 ? 188  CYS H SG    1 
ATOM   9959  N  N     . TYR H  1 189 ? 59.717  23.975  9.480   1.00 35.18 ? 189  TYR H N     1 
ATOM   9960  C  CA    . TYR H  1 189 ? 60.564  23.748  8.306   1.00 35.48 ? 189  TYR H CA    1 
ATOM   9961  C  C     . TYR H  1 189 ? 61.946  23.205  8.681   1.00 36.50 ? 189  TYR H C     1 
ATOM   9962  O  O     . TYR H  1 189 ? 62.475  22.341  7.995   1.00 36.25 ? 189  TYR H O     1 
ATOM   9963  C  CB    . TYR H  1 189 ? 60.710  25.021  7.437   1.00 34.82 ? 189  TYR H CB    1 
ATOM   9964  C  CG    . TYR H  1 189 ? 61.500  24.767  6.169   1.00 32.74 ? 189  TYR H CG    1 
ATOM   9965  C  CD1   . TYR H  1 189 ? 60.873  24.300  5.012   1.00 30.76 ? 189  TYR H CD1   1 
ATOM   9966  C  CD2   . TYR H  1 189 ? 62.892  24.939  6.143   1.00 31.34 ? 189  TYR H CD2   1 
ATOM   9967  C  CE1   . TYR H  1 189 ? 61.605  24.036  3.854   1.00 30.14 ? 189  TYR H CE1   1 
ATOM   9968  C  CE2   . TYR H  1 189 ? 63.631  24.678  4.992   1.00 30.40 ? 189  TYR H CE2   1 
ATOM   9969  C  CZ    . TYR H  1 189 ? 62.983  24.230  3.858   1.00 30.54 ? 189  TYR H CZ    1 
ATOM   9970  O  OH    . TYR H  1 189 ? 63.714  23.971  2.731   1.00 31.55 ? 189  TYR H OH    1 
ATOM   9971  N  N     . PHE H  1 190 ? 62.517  23.728  9.763   1.00 38.10 ? 190  PHE H N     1 
ATOM   9972  C  CA    . PHE H  1 190 ? 63.894  23.415  10.156  1.00 39.86 ? 190  PHE H CA    1 
ATOM   9973  C  C     . PHE H  1 190 ? 63.981  22.302  11.207  1.00 41.38 ? 190  PHE H C     1 
ATOM   9974  O  O     . PHE H  1 190 ? 65.082  21.881  11.569  1.00 41.73 ? 190  PHE H O     1 
ATOM   9975  C  CB    . PHE H  1 190 ? 64.602  24.674  10.678  1.00 39.51 ? 190  PHE H CB    1 
ATOM   9976  C  CG    . PHE H  1 190 ? 65.053  25.620  9.595   1.00 39.14 ? 190  PHE H CG    1 
ATOM   9977  C  CD1   . PHE H  1 190 ? 64.526  26.907  9.518   1.00 38.31 ? 190  PHE H CD1   1 
ATOM   9978  C  CD2   . PHE H  1 190 ? 66.016  25.233  8.661   1.00 38.54 ? 190  PHE H CD2   1 
ATOM   9979  C  CE1   . PHE H  1 190 ? 64.943  27.797  8.521   1.00 38.27 ? 190  PHE H CE1   1 
ATOM   9980  C  CE2   . PHE H  1 190 ? 66.436  26.117  7.653   1.00 38.58 ? 190  PHE H CE2   1 
ATOM   9981  C  CZ    . PHE H  1 190 ? 65.897  27.403  7.586   1.00 37.88 ? 190  PHE H CZ    1 
ATOM   9982  N  N     . LYS H  1 191 ? 62.825  21.830  11.684  1.00 43.01 ? 191  LYS H N     1 
ATOM   9983  C  CA    . LYS H  1 191 ? 62.761  20.827  12.749  1.00 44.43 ? 191  LYS H CA    1 
ATOM   9984  C  C     . LYS H  1 191 ? 63.373  19.493  12.333  1.00 44.93 ? 191  LYS H C     1 
ATOM   9985  O  O     . LYS H  1 191 ? 63.067  18.971  11.262  1.00 45.67 ? 191  LYS H O     1 
ATOM   9986  C  CB    . LYS H  1 191 ? 61.311  20.626  13.208  1.00 44.72 ? 191  LYS H CB    1 
ATOM   9987  C  CG    . LYS H  1 191 ? 61.170  20.244  14.676  1.00 46.10 ? 191  LYS H CG    1 
ATOM   9988  C  CD    . LYS H  1 191 ? 60.570  21.367  15.498  1.00 48.53 ? 191  LYS H CD    1 
ATOM   9989  C  CE    . LYS H  1 191 ? 59.211  20.971  16.069  1.00 50.49 ? 191  LYS H CE    1 
ATOM   9990  N  NZ    . LYS H  1 191 ? 59.155  21.125  17.557  1.00 51.44 ? 191  LYS H NZ    1 
HETATM 9991  ZN ZN    . ZN  I  2 .   ? -22.640 32.530  44.452  1.00 31.46 ? 1193 ZN  A ZN    1 
HETATM 9992  MG MG    . MG  J  3 .   ? -16.612 12.429  41.171  1.00 36.02 ? 1194 MG  A MG    1 
HETATM 9993  P  PA    . TTP K  4 .   ? -16.944 14.148  44.009  1.00 37.96 ? 1195 TTP A PA    1 
HETATM 9994  O  O1A   . TTP K  4 .   ? -16.261 13.287  42.971  1.00 37.58 ? 1195 TTP A O1A   1 
HETATM 9995  O  O2A   . TTP K  4 .   ? -16.132 15.039  44.903  1.00 36.76 ? 1195 TTP A O2A   1 
HETATM 9996  O  O3A   . TTP K  4 .   ? -18.134 15.013  43.332  1.00 38.51 ? 1195 TTP A O3A   1 
HETATM 9997  P  PB    . TTP K  4 .   ? -18.160 15.485  41.789  1.00 39.30 ? 1195 TTP A PB    1 
HETATM 9998  O  O1B   . TTP K  4 .   ? -18.067 14.307  40.837  1.00 39.01 ? 1195 TTP A O1B   1 
HETATM 9999  O  O2B   . TTP K  4 .   ? -19.201 16.561  41.602  1.00 40.00 ? 1195 TTP A O2B   1 
HETATM 10000 O  O3B   . TTP K  4 .   ? -16.746 16.236  41.820  1.00 37.61 ? 1195 TTP A O3B   1 
HETATM 10001 P  PG    . TTP K  4 .   ? -15.690 16.297  40.625  1.00 31.74 ? 1195 TTP A PG    1 
HETATM 10002 O  O1G   . TTP K  4 .   ? -15.139 14.910  40.449  1.00 30.07 ? 1195 TTP A O1G   1 
HETATM 10003 O  O2G   . TTP K  4 .   ? -16.505 16.827  39.478  1.00 33.91 ? 1195 TTP A O2G   1 
HETATM 10004 O  O3G   . TTP K  4 .   ? -14.775 17.317  41.255  1.00 30.73 ? 1195 TTP A O3G   1 
HETATM 10005 O  "O5'" . TTP K  4 .   ? -17.808 13.168  44.955  1.00 37.21 ? 1195 TTP A "O5'" 1 
HETATM 10006 C  "C5'" . TTP K  4 .   ? -18.647 13.710  45.969  1.00 34.26 ? 1195 TTP A "C5'" 1 
HETATM 10007 C  "C4'" . TTP K  4 .   ? -19.417 12.607  46.687  1.00 33.03 ? 1195 TTP A "C4'" 1 
HETATM 10008 O  "O4'" . TTP K  4 .   ? -19.361 12.880  48.089  1.00 31.43 ? 1195 TTP A "O4'" 1 
HETATM 10009 C  "C3'" . TTP K  4 .   ? -20.887 12.647  46.297  1.00 32.49 ? 1195 TTP A "C3'" 1 
HETATM 10010 O  "O3'" . TTP K  4 .   ? -21.423 11.329  46.198  1.00 32.66 ? 1195 TTP A "O3'" 1 
HETATM 10011 C  "C2'" . TTP K  4 .   ? -21.592 13.359  47.431  1.00 31.11 ? 1195 TTP A "C2'" 1 
HETATM 10012 C  "C1'" . TTP K  4 .   ? -20.684 13.037  48.611  1.00 30.55 ? 1195 TTP A "C1'" 1 
HETATM 10013 N  N1    . TTP K  4 .   ? -20.694 14.040  49.681  1.00 28.66 ? 1195 TTP A N1    1 
HETATM 10014 C  C2    . TTP K  4 .   ? -20.999 13.612  50.936  1.00 27.63 ? 1195 TTP A C2    1 
HETATM 10015 O  O2    . TTP K  4 .   ? -21.269 12.406  51.144  1.00 26.99 ? 1195 TTP A O2    1 
HETATM 10016 N  N3    . TTP K  4 .   ? -21.012 14.452  51.978  1.00 27.01 ? 1195 TTP A N3    1 
HETATM 10017 C  C4    . TTP K  4 .   ? -20.725 15.747  51.836  1.00 26.98 ? 1195 TTP A C4    1 
HETATM 10018 O  O4    . TTP K  4 .   ? -20.764 16.503  52.839  1.00 27.61 ? 1195 TTP A O4    1 
HETATM 10019 C  C5    . TTP K  4 .   ? -20.385 16.248  50.474  1.00 26.47 ? 1195 TTP A C5    1 
HETATM 10020 C  C5M   . TTP K  4 .   ? -20.050 17.693  50.229  1.00 24.88 ? 1195 TTP A C5M   1 
HETATM 10021 C  C6    . TTP K  4 .   ? -20.389 15.329  49.429  1.00 27.40 ? 1195 TTP A C6    1 
HETATM 10022 ZN ZN    . ZN  L  2 .   ? 14.012  12.734  28.729  1.00 30.46 ? 2193 ZN  B ZN    1 
HETATM 10023 MG MG    . MG  M  3 .   ? -5.435  16.327  21.587  1.00 41.56 ? 2194 MG  B MG    1 
HETATM 10024 P  PA    . TTP N  4 .   ? -2.650  17.564  20.347  1.00 36.31 ? 2195 TTP B PA    1 
HETATM 10025 O  O1A   . TTP N  4 .   ? -4.147  17.615  20.542  1.00 35.92 ? 2195 TTP B O1A   1 
HETATM 10026 O  O2A   . TTP N  4 .   ? -1.703  18.410  21.130  1.00 37.13 ? 2195 TTP B O2A   1 
HETATM 10027 O  O3A   . TTP N  4 .   ? -2.136  16.048  20.535  1.00 38.32 ? 2195 TTP B O3A   1 
HETATM 10028 P  PB    . TTP N  4 .   ? -2.488  15.170  21.828  1.00 39.64 ? 2195 TTP B PB    1 
HETATM 10029 O  O1B   . TTP N  4 .   ? -3.749  14.396  21.512  1.00 40.94 ? 2195 TTP B O1B   1 
HETATM 10030 O  O2B   . TTP N  4 .   ? -1.227  14.474  22.267  1.00 38.73 ? 2195 TTP B O2B   1 
HETATM 10031 O  O3B   . TTP N  4 .   ? -2.901  16.374  22.835  1.00 39.78 ? 2195 TTP B O3B   1 
HETATM 10032 P  PG    . TTP N  4 .   ? -3.386  16.268  24.362  1.00 35.22 ? 2195 TTP B PG    1 
HETATM 10033 O  O1G   . TTP N  4 .   ? -4.847  16.595  24.281  1.00 34.26 ? 2195 TTP B O1G   1 
HETATM 10034 O  O2G   . TTP N  4 .   ? -3.079  14.852  24.794  1.00 37.38 ? 2195 TTP B O2G   1 
HETATM 10035 O  O3G   . TTP N  4 .   ? -2.500  17.307  25.002  1.00 35.08 ? 2195 TTP B O3G   1 
HETATM 10036 O  "O5'" . TTP N  4 .   ? -2.319  17.880  18.802  1.00 35.76 ? 2195 TTP B "O5'" 1 
HETATM 10037 C  "C5'" . TTP N  4 .   ? -1.571  16.892  18.094  1.00 32.74 ? 2195 TTP B "C5'" 1 
HETATM 10038 C  "C4'" . TTP N  4 .   ? -1.770  16.955  16.593  1.00 30.52 ? 2195 TTP B "C4'" 1 
HETATM 10039 O  "O4'" . TTP N  4 .   ? -0.838  17.891  16.057  1.00 29.60 ? 2195 TTP B "O4'" 1 
HETATM 10040 C  "C3'" . TTP N  4 .   ? -1.403  15.606  16.001  1.00 29.94 ? 2195 TTP B "C3'" 1 
HETATM 10041 O  "O3'" . TTP N  4 .   ? -2.332  15.271  14.971  1.00 29.80 ? 2195 TTP B "O3'" 1 
HETATM 10042 C  "C2'" . TTP N  4 .   ? -0.014  15.767  15.410  1.00 28.81 ? 2195 TTP B "C2'" 1 
HETATM 10043 C  "C1'" . TTP N  4 .   ? 0.006   17.250  15.089  1.00 27.94 ? 2195 TTP B "C1'" 1 
HETATM 10044 N  N1    . TTP N  4 .   ? 1.330   17.863  15.085  1.00 26.92 ? 2195 TTP B N1    1 
HETATM 10045 C  C2    . TTP N  4 .   ? 1.749   18.444  13.929  1.00 27.76 ? 2195 TTP B C2    1 
HETATM 10046 O  O2    . TTP N  4 .   ? 1.005   18.396  12.928  1.00 27.57 ? 2195 TTP B O2    1 
HETATM 10047 N  N3    . TTP N  4 .   ? 2.938   19.070  13.824  1.00 27.04 ? 2195 TTP B N3    1 
HETATM 10048 C  C4    . TTP N  4 .   ? 3.764   19.136  14.871  1.00 26.19 ? 2195 TTP B C4    1 
HETATM 10049 O  O4    . TTP N  4 .   ? 4.878   19.708  14.773  1.00 27.39 ? 2195 TTP B O4    1 
HETATM 10050 C  C5    . TTP N  4 .   ? 3.326   18.520  16.152  1.00 26.04 ? 2195 TTP B C5    1 
HETATM 10051 C  C5M   . TTP N  4 .   ? 4.212   18.572  17.372  1.00 24.24 ? 2195 TTP B C5M   1 
HETATM 10052 C  C6    . TTP N  4 .   ? 2.081   17.900  16.194  1.00 25.60 ? 2195 TTP B C6    1 
HETATM 10053 ZN ZN    . ZN  O  2 .   ? 16.967  15.756  48.760  1.00 41.28 ? 3193 ZN  C ZN    1 
HETATM 10054 MG MG    . MG  P  3 .   ? 8.815   33.334  56.274  1.00 44.82 ? 3194 MG  C MG    1 
HETATM 10055 P  PA    . TTP Q  4 .   ? 8.672   30.407  57.842  1.00 38.34 ? 3195 TTP C PA    1 
HETATM 10056 O  O1A   . TTP Q  4 .   ? 8.202   31.805  57.548  1.00 36.31 ? 3195 TTP C O1A   1 
HETATM 10057 O  O2A   . TTP Q  4 .   ? 7.923   29.224  57.313  1.00 38.20 ? 3195 TTP C O2A   1 
HETATM 10058 O  O3A   . TTP Q  4 .   ? 10.244  30.225  57.477  1.00 41.08 ? 3195 TTP C O3A   1 
HETATM 10059 P  PB    . TTP Q  4 .   ? 10.954  30.879  56.179  1.00 42.69 ? 3195 TTP C PB    1 
HETATM 10060 O  O1B   . TTP Q  4 .   ? 11.286  32.334  56.437  1.00 42.69 ? 3195 TTP C O1B   1 
HETATM 10061 O  O2B   . TTP Q  4 .   ? 11.964  29.901  55.622  1.00 42.34 ? 3195 TTP C O2B   1 
HETATM 10062 O  O3B   . TTP Q  4 .   ? 9.659   30.846  55.214  1.00 42.65 ? 3195 TTP C O3B   1 
HETATM 10063 P  PG    . TTP Q  4 .   ? 9.580   31.422  53.734  1.00 37.64 ? 3195 TTP C PG    1 
HETATM 10064 O  O1G   . TTP Q  4 .   ? 9.042   32.808  53.961  1.00 37.83 ? 3195 TTP C O1G   1 
HETATM 10065 O  O2G   . TTP Q  4 .   ? 10.983  31.361  53.170  1.00 40.46 ? 3195 TTP C O2G   1 
HETATM 10066 O  O3G   . TTP Q  4 .   ? 8.649   30.418  53.118  1.00 39.43 ? 3195 TTP C O3G   1 
HETATM 10067 O  "O5'" . TTP Q  4 .   ? 8.681   30.239  59.437  1.00 39.43 ? 3195 TTP C "O5'" 1 
HETATM 10068 C  "C5'" . TTP Q  4 .   ? 9.251   29.086  60.025  1.00 38.01 ? 3195 TTP C "C5'" 1 
HETATM 10069 C  "C4'" . TTP Q  4 .   ? 9.449   29.307  61.518  1.00 37.94 ? 3195 TTP C "C4'" 1 
HETATM 10070 O  "O4'" . TTP Q  4 .   ? 8.802   28.246  62.229  1.00 36.88 ? 3195 TTP C "O4'" 1 
HETATM 10071 C  "C3'" . TTP Q  4 .   ? 10.937  29.230  61.827  1.00 37.30 ? 3195 TTP C "C3'" 1 
HETATM 10072 O  "O3'" . TTP Q  4 .   ? 11.299  30.227  62.780  1.00 37.60 ? 3195 TTP C "O3'" 1 
HETATM 10073 C  "C2'" . TTP Q  4 .   ? 11.166  27.849  62.401  1.00 36.27 ? 3195 TTP C "C2'" 1 
HETATM 10074 C  "C1'" . TTP Q  4 .   ? 9.786   27.483  62.940  1.00 36.82 ? 3195 TTP C "C1'" 1 
HETATM 10075 N  N1    . TTP Q  4 .   ? 9.460   26.055  62.904  1.00 35.89 ? 3195 TTP C N1    1 
HETATM 10076 C  C2    . TTP Q  4 .   ? 8.978   25.497  64.049  1.00 36.16 ? 3195 TTP C C2    1 
HETATM 10077 O  O2    . TTP Q  4 .   ? 8.847   26.206  65.065  1.00 36.16 ? 3195 TTP C O2    1 
HETATM 10078 N  N3    . TTP Q  4 .   ? 8.635   24.206  64.132  1.00 36.25 ? 3195 TTP C N3    1 
HETATM 10079 C  C4    . TTP Q  4 .   ? 8.750   23.407  63.071  1.00 35.98 ? 3195 TTP C C4    1 
HETATM 10080 O  O4    . TTP Q  4 .   ? 8.417   22.206  63.171  1.00 35.90 ? 3195 TTP C O4    1 
HETATM 10081 C  C5    . TTP Q  4 .   ? 9.272   23.989  61.802  1.00 35.30 ? 3195 TTP C C5    1 
HETATM 10082 C  C5M   . TTP Q  4 .   ? 9.438   23.166  60.558  1.00 35.29 ? 3195 TTP C C5M   1 
HETATM 10083 C  C6    . TTP Q  4 .   ? 9.610   25.333  61.787  1.00 35.92 ? 3195 TTP C C6    1 
HETATM 10084 ZN ZN    . ZN  R  2 .   ? -11.556 46.920  34.911  1.00 36.06 ? 4193 ZN  D ZN    1 
HETATM 10085 MG MG    . MG  S  3 .   ? 9.078   44.674  37.556  1.00 35.14 ? 4194 MG  D MG    1 
HETATM 10086 P  PA    . TTP T  4 .   ? 7.544   45.593  34.514  1.00 27.96 ? 4195 TTP D PA    1 
HETATM 10087 O  O1A   . TTP T  4 .   ? 8.611   45.165  35.505  1.00 27.14 ? 4195 TTP D O1A   1 
HETATM 10088 O  O2A   . TTP T  4 .   ? 6.748   44.625  33.713  1.00 25.46 ? 4195 TTP D O2A   1 
HETATM 10089 O  O3A   . TTP T  4 .   ? 6.495   46.560  35.265  1.00 29.50 ? 4195 TTP D O3A   1 
HETATM 10090 P  PB    . TTP T  4 .   ? 6.285   46.507  36.859  1.00 30.73 ? 4195 TTP D PB    1 
HETATM 10091 O  O1B   . TTP T  4 .   ? 7.625   46.583  37.533  1.00 32.11 ? 4195 TTP D O1B   1 
HETATM 10092 O  O2B   . TTP T  4 .   ? 5.198   47.505  37.157  1.00 33.00 ? 4195 TTP D O2B   1 
HETATM 10093 O  O3B   . TTP T  4 .   ? 5.660   45.021  36.958  1.00 31.10 ? 4195 TTP D O3B   1 
HETATM 10094 P  PG    . TTP T  4 .   ? 5.881   43.884  38.069  1.00 28.22 ? 4195 TTP D PG    1 
HETATM 10095 O  O1G   . TTP T  4 .   ? 7.368   43.736  38.221  1.00 29.86 ? 4195 TTP D O1G   1 
HETATM 10096 O  O2G   . TTP T  4 .   ? 5.144   44.415  39.266  1.00 30.54 ? 4195 TTP D O2G   1 
HETATM 10097 O  O3G   . TTP T  4 .   ? 5.200   42.717  37.406  1.00 28.92 ? 4195 TTP D O3G   1 
HETATM 10098 O  "O5'" . TTP T  4 .   ? 8.284   46.571  33.460  1.00 27.30 ? 4195 TTP D "O5'" 1 
HETATM 10099 C  "C5'" . TTP T  4 .   ? 7.564   47.215  32.418  1.00 23.67 ? 4195 TTP D "C5'" 1 
HETATM 10100 C  "C4'" . TTP T  4 .   ? 8.453   48.260  31.755  1.00 22.56 ? 4195 TTP D "C4'" 1 
HETATM 10101 O  "O4'" . TTP T  4 .   ? 8.164   48.312  30.358  1.00 21.88 ? 4195 TTP D "O4'" 1 
HETATM 10102 C  "C3'" . TTP T  4 .   ? 8.134   49.639  32.283  1.00 22.54 ? 4195 TTP D "C3'" 1 
HETATM 10103 O  "O3'" . TTP T  4 .   ? 9.361   50.376  32.326  1.00 22.26 ? 4195 TTP D "O3'" 1 
HETATM 10104 C  "C2'" . TTP T  4 .   ? 7.167   50.237  31.273  1.00 20.26 ? 4195 TTP D "C2'" 1 
HETATM 10105 C  "C1'" . TTP T  4 .   ? 7.647   49.589  29.985  1.00 20.44 ? 4195 TTP D "C1'" 1 
HETATM 10106 N  N1    . TTP T  4 .   ? 6.613   49.415  28.955  1.00 20.71 ? 4195 TTP D N1    1 
HETATM 10107 C  C2    . TTP T  4 .   ? 6.883   49.879  27.703  1.00 21.00 ? 4195 TTP D C2    1 
HETATM 10108 O  O2    . TTP T  4 .   ? 7.982   50.445  27.474  1.00 22.74 ? 4195 TTP D O2    1 
HETATM 10109 N  N3    . TTP T  4 .   ? 5.996   49.748  26.705  1.00 19.30 ? 4195 TTP D N3    1 
HETATM 10110 C  C4    . TTP T  4 .   ? 4.812   49.144  26.894  1.00 18.89 ? 4195 TTP D C4    1 
HETATM 10111 O  O4    . TTP T  4 .   ? 3.998   49.027  25.938  1.00 19.88 ? 4195 TTP D O4    1 
HETATM 10112 C  C5    . TTP T  4 .   ? 4.501   48.619  28.249  1.00 17.63 ? 4195 TTP D C5    1 
HETATM 10113 C  C5M   . TTP T  4 .   ? 3.200   47.932  28.556  1.00 17.20 ? 4195 TTP D C5M   1 
HETATM 10114 C  C6    . TTP T  4 .   ? 5.450   48.792  29.242  1.00 18.90 ? 4195 TTP D C6    1 
HETATM 10115 ZN ZN    . ZN  U  2 .   ? 46.522  39.561  24.166  1.00 32.46 ? 5193 ZN  E ZN    1 
HETATM 10116 MG MG    . MG  V  3 .   ? 44.885  58.504  14.786  1.00 41.07 ? 5194 MG  E MG    1 
HETATM 10117 P  PA    . TTP W  4 .   ? 42.746  56.833  17.025  1.00 38.04 ? 5195 TTP E PA    1 
HETATM 10118 O  O1A   . TTP W  4 .   ? 43.294  57.739  15.952  1.00 38.92 ? 5195 TTP E O1A   1 
HETATM 10119 O  O2A   . TTP W  4 .   ? 42.167  55.493  16.676  1.00 37.79 ? 5195 TTP E O2A   1 
HETATM 10120 O  O3A   . TTP W  4 .   ? 43.903  56.611  18.124  1.00 40.77 ? 5195 TTP E O3A   1 
HETATM 10121 P  PB    . TTP W  4 .   ? 45.392  56.254  17.629  1.00 43.44 ? 5195 TTP E PB    1 
HETATM 10122 O  O1B   . TTP W  4 .   ? 46.135  57.548  17.334  1.00 44.70 ? 5195 TTP E O1B   1 
HETATM 10123 O  O2B   . TTP W  4 .   ? 45.952  55.195  18.531  1.00 42.72 ? 5195 TTP E O2B   1 
HETATM 10124 O  O3B   . TTP W  4 .   ? 45.039  55.582  16.208  1.00 43.10 ? 5195 TTP E O3B   1 
HETATM 10125 P  PG    . TTP W  4 .   ? 46.124  55.232  15.096  1.00 39.30 ? 5195 TTP E PG    1 
HETATM 10126 O  O1G   . TTP W  4 .   ? 46.074  56.406  14.160  1.00 39.60 ? 5195 TTP E O1G   1 
HETATM 10127 O  O2G   . TTP W  4 .   ? 47.401  55.061  15.862  1.00 41.38 ? 5195 TTP E O2G   1 
HETATM 10128 O  O3G   . TTP W  4 .   ? 45.586  53.928  14.562  1.00 41.74 ? 5195 TTP E O3G   1 
HETATM 10129 O  "O5'" . TTP W  4 .   ? 41.608  57.631  17.843  1.00 37.75 ? 5195 TTP E "O5'" 1 
HETATM 10130 C  "C5'" . TTP W  4 .   ? 41.417  57.296  19.207  1.00 34.05 ? 5195 TTP E "C5'" 1 
HETATM 10131 C  "C4'" . TTP W  4 .   ? 40.784  58.432  19.984  1.00 32.68 ? 5195 TTP E "C4'" 1 
HETATM 10132 O  "O4'" . TTP W  4 .   ? 39.429  58.095  20.311  1.00 31.43 ? 5195 TTP E "O4'" 1 
HETATM 10133 C  "C3'" . TTP W  4 .   ? 41.530  58.580  21.297  1.00 31.75 ? 5195 TTP E "C3'" 1 
HETATM 10134 O  "O3'" . TTP W  4 .   ? 41.641  59.965  21.623  1.00 31.62 ? 5195 TTP E "O3'" 1 
HETATM 10135 C  "C2'" . TTP W  4 .   ? 40.682  57.869  22.330  1.00 30.42 ? 5195 TTP E "C2'" 1 
HETATM 10136 C  "C1'" . TTP W  4 .   ? 39.284  57.983  21.730  1.00 30.33 ? 5195 TTP E "C1'" 1 
HETATM 10137 N  N1    . TTP W  4 .   ? 38.423  56.851  22.081  1.00 29.40 ? 5195 TTP E N1    1 
HETATM 10138 C  C2    . TTP W  4 .   ? 37.211  57.149  22.607  1.00 28.71 ? 5195 TTP E C2    1 
HETATM 10139 O  O2    . TTP W  4 .   ? 36.898  58.351  22.764  1.00 28.16 ? 5195 TTP E O2    1 
HETATM 10140 N  N3    . TTP W  4 .   ? 36.334  56.187  22.953  1.00 28.27 ? 5195 TTP E N3    1 
HETATM 10141 C  C4    . TTP W  4 .   ? 36.635  54.896  22.808  1.00 26.80 ? 5195 TTP E C4    1 
HETATM 10142 O  O4    . TTP W  4 .   ? 35.813  54.025  23.150  1.00 27.26 ? 5195 TTP E O4    1 
HETATM 10143 C  C5    . TTP W  4 .   ? 37.951  54.530  22.235  1.00 27.25 ? 5195 TTP E C5    1 
HETATM 10144 C  C5M   . TTP W  4 .   ? 38.327  53.082  22.044  1.00 26.25 ? 5195 TTP E C5M   1 
HETATM 10145 C  C6    . TTP W  4 .   ? 38.817  55.569  21.886  1.00 28.10 ? 5195 TTP E C6    1 
HETATM 10146 ZN ZN    . ZN  X  2 .   ? 49.849  56.222  -16.932 1.00 38.54 ? 6193 ZN  F ZN    1 
HETATM 10147 MG MG    . MG  Y  3 .   ? 61.506  55.589  0.676   1.00 48.60 ? 6194 MG  F MG    1 
HETATM 10148 P  PA    . TTP Z  4 .   ? 62.327  54.575  -2.574  1.00 35.24 ? 6195 TTP F PA    1 
HETATM 10149 O  O1A   . TTP Z  4 .   ? 62.141  54.700  -1.084  1.00 35.47 ? 6195 TTP F O1A   1 
HETATM 10150 O  O2A   . TTP Z  4 .   ? 61.886  53.340  -3.301  1.00 34.29 ? 6195 TTP F O2A   1 
HETATM 10151 O  O3A   . TTP Z  4 .   ? 61.651  55.855  -3.292  1.00 37.78 ? 6195 TTP F O3A   1 
HETATM 10152 P  PB    . TTP Z  4 .   ? 60.474  56.715  -2.601  1.00 36.83 ? 6195 TTP F PB    1 
HETATM 10153 O  O1B   . TTP Z  4 .   ? 61.007  57.309  -1.327  1.00 37.28 ? 6195 TTP F O1B   1 
HETATM 10154 O  O2B   . TTP Z  4 .   ? 59.813  57.532  -3.669  1.00 38.37 ? 6195 TTP F O2B   1 
HETATM 10155 O  O3B   . TTP Z  4 .   ? 59.448  55.522  -2.243  1.00 38.97 ? 6195 TTP F O3B   1 
HETATM 10156 P  PG    . TTP Z  4 .   ? 58.453  55.394  -0.982  1.00 35.15 ? 6195 TTP F PG    1 
HETATM 10157 O  O1G   . TTP Z  4 .   ? 59.331  55.302  0.234   1.00 36.98 ? 6195 TTP F O1G   1 
HETATM 10158 O  O2G   . TTP Z  4 .   ? 57.560  56.605  -1.014  1.00 38.20 ? 6195 TTP F O2G   1 
HETATM 10159 O  O3G   . TTP Z  4 .   ? 57.755  54.127  -1.406  1.00 36.98 ? 6195 TTP F O3G   1 
HETATM 10160 O  "O5'" . TTP Z  4 .   ? 63.887  54.796  -2.914  1.00 36.40 ? 6195 TTP F "O5'" 1 
HETATM 10161 C  "C5'" . TTP Z  4 .   ? 64.328  54.827  -4.269  1.00 34.94 ? 6195 TTP F "C5'" 1 
HETATM 10162 C  "C4'" . TTP Z  4 .   ? 65.790  55.246  -4.368  1.00 34.07 ? 6195 TTP F "C4'" 1 
HETATM 10163 O  "O4'" . TTP Z  4 .   ? 66.465  54.360  -5.266  1.00 33.17 ? 6195 TTP F "O4'" 1 
HETATM 10164 C  "C3'" . TTP Z  4 .   ? 65.923  56.639  -4.965  1.00 33.84 ? 6195 TTP F "C3'" 1 
HETATM 10165 O  "O3'" . TTP Z  4 .   ? 67.007  57.339  -4.349  1.00 35.42 ? 6195 TTP F "O3'" 1 
HETATM 10166 C  "C2'" . TTP Z  4 .   ? 66.272  56.433  -6.420  1.00 32.61 ? 6195 TTP F "C2'" 1 
HETATM 10167 C  "C1'" . TTP Z  4 .   ? 66.955  55.074  -6.404  1.00 31.45 ? 6195 TTP F "C1'" 1 
HETATM 10168 N  N1    . TTP Z  4 .   ? 66.716  54.318  -7.630  1.00 29.63 ? 6195 TTP F N1    1 
HETATM 10169 C  C2    . TTP Z  4 .   ? 67.808  53.849  -8.302  1.00 29.59 ? 6195 TTP F C2    1 
HETATM 10170 O  O2    . TTP Z  4 .   ? 68.965  54.073  -7.848  1.00 29.50 ? 6195 TTP F O2    1 
HETATM 10171 N  N3    . TTP Z  4 .   ? 67.677  53.129  -9.429  1.00 27.89 ? 6195 TTP F N3    1 
HETATM 10172 C  C4    . TTP Z  4 .   ? 66.472  52.859  -9.940  1.00 28.22 ? 6195 TTP F C4    1 
HETATM 10173 O  O4    . TTP Z  4 .   ? 66.362  52.200  -11.000 1.00 29.62 ? 6195 TTP F O4    1 
HETATM 10174 C  C5    . TTP Z  4 .   ? 65.269  53.363  -9.230  1.00 28.16 ? 6195 TTP F C5    1 
HETATM 10175 C  C5M   . TTP Z  4 .   ? 63.890  53.076  -9.755  1.00 26.56 ? 6195 TTP F C5M   1 
HETATM 10176 C  C6    . TTP Z  4 .   ? 65.462  54.090  -8.060  1.00 28.41 ? 6195 TTP F C6    1 
HETATM 10177 ZN ZN    . ZN  AA 2 .   ? 30.170  51.204  -14.078 1.00 35.83 ? 7193 ZN  G ZN    1 
HETATM 10178 MG MG    . MG  BA 3 .   ? 27.535  33.619  -2.945  1.00 34.85 ? 7194 MG  G MG    1 
HETATM 10179 P  PA    . TTP CA 4 .   ? 25.795  36.511  -2.681  1.00 28.57 ? 7195 TTP G PA    1 
HETATM 10180 O  O1A   . TTP CA 4 .   ? 26.489  35.237  -2.290  1.00 28.21 ? 7195 TTP G O1A   1 
HETATM 10181 O  O2A   . TTP CA 4 .   ? 26.116  37.809  -2.013  1.00 26.82 ? 7195 TTP G O2A   1 
HETATM 10182 O  O3A   . TTP CA 4 .   ? 25.829  36.743  -4.268  1.00 28.99 ? 7195 TTP G O3A   1 
HETATM 10183 P  PB    . TTP CA 4 .   ? 26.690  35.867  -5.302  1.00 30.18 ? 7195 TTP G PB    1 
HETATM 10184 O  O1B   . TTP CA 4 .   ? 26.710  34.421  -4.888  1.00 31.45 ? 7195 TTP G O1B   1 
HETATM 10185 O  O2B   . TTP CA 4 .   ? 26.241  36.268  -6.679  1.00 32.09 ? 7195 TTP G O2B   1 
HETATM 10186 O  O3B   . TTP CA 4 .   ? 28.143  36.533  -5.183  1.00 31.04 ? 7195 TTP G O3B   1 
HETATM 10187 P  PG    . TTP CA 4 .   ? 29.471  35.882  -4.576  1.00 28.92 ? 7195 TTP G PG    1 
HETATM 10188 O  O1G   . TTP CA 4 .   ? 29.063  34.772  -3.645  1.00 29.39 ? 7195 TTP G O1G   1 
HETATM 10189 O  O2G   . TTP CA 4 .   ? 30.189  35.455  -5.828  1.00 29.74 ? 7195 TTP G O2G   1 
HETATM 10190 O  O3G   . TTP CA 4 .