data_1XTR
# 
_entry.id   1XTR 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1XTR         
RCSB  RCSB030759   
WWPDB D_1000030759 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1XTQ 'the same protein in complex with GDP' unspecified 
PDB 1XTS 'the same protein in complex with GTP' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1XTR 
_pdbx_database_status.recvd_initial_deposition_date   2004-10-24 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Yu, Y.'   1 
'Ding, J.' 2 
# 
_citation.id                        primary 
_citation.title                     'Structural Basis for the Unique Biological Function of Small GTPase RHEB' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            280 
_citation.page_first                17093 
_citation.page_last                 17100 
_citation.year                      2005 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15728574 
_citation.pdbx_database_id_DOI      10.1074/jbc.M501253200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Yu, Y.'     1 
primary 'Li, S.'     2 
primary 'Xu, X.'     3 
primary 'Li, Y.'     4 
primary 'Guan, K.'   5 
primary 'Arnold, E.' 6 
primary 'Ding, J.'   7 
# 
_cell.entry_id           1XTR 
_cell.length_a           102.930 
_cell.length_b           99.160 
_cell.length_c           47.980 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1XTR 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'GTP-binding protein Rheb'                    20148.965 1  ? ? 'GTPase domain' ? 
2 non-polymer syn 'MAGNESIUM ION'                               24.305    1  ? ? ?               ? 
3 non-polymer syn 'PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER' 522.196   1  ? ? ?               ? 
4 non-polymer syn GLYCEROL                                      92.094    1  ? ? ?               ? 
5 water       nat water                                         18.015    55 ? ? ?               ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Ras homolog enriched in brain' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVDTAGQDEYSIFPQTYSIDING
YILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNKKDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVF
RRIILEAEKLEHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVDTAGQDEYSIFPQTYSIDING
YILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNKKDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVF
RRIILEAEKLEHHHHHH
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   PRO n 
1 3   GLN n 
1 4   SER n 
1 5   LYS n 
1 6   SER n 
1 7   ARG n 
1 8   LYS n 
1 9   ILE n 
1 10  ALA n 
1 11  ILE n 
1 12  LEU n 
1 13  GLY n 
1 14  TYR n 
1 15  ARG n 
1 16  SER n 
1 17  VAL n 
1 18  GLY n 
1 19  LYS n 
1 20  SER n 
1 21  SER n 
1 22  LEU n 
1 23  THR n 
1 24  ILE n 
1 25  GLN n 
1 26  PHE n 
1 27  VAL n 
1 28  GLU n 
1 29  GLY n 
1 30  GLN n 
1 31  PHE n 
1 32  VAL n 
1 33  ASP n 
1 34  SER n 
1 35  TYR n 
1 36  ASP n 
1 37  PRO n 
1 38  THR n 
1 39  ILE n 
1 40  GLU n 
1 41  ASN n 
1 42  THR n 
1 43  PHE n 
1 44  THR n 
1 45  LYS n 
1 46  LEU n 
1 47  ILE n 
1 48  THR n 
1 49  VAL n 
1 50  ASN n 
1 51  GLY n 
1 52  GLN n 
1 53  GLU n 
1 54  TYR n 
1 55  HIS n 
1 56  LEU n 
1 57  GLN n 
1 58  LEU n 
1 59  VAL n 
1 60  ASP n 
1 61  THR n 
1 62  ALA n 
1 63  GLY n 
1 64  GLN n 
1 65  ASP n 
1 66  GLU n 
1 67  TYR n 
1 68  SER n 
1 69  ILE n 
1 70  PHE n 
1 71  PRO n 
1 72  GLN n 
1 73  THR n 
1 74  TYR n 
1 75  SER n 
1 76  ILE n 
1 77  ASP n 
1 78  ILE n 
1 79  ASN n 
1 80  GLY n 
1 81  TYR n 
1 82  ILE n 
1 83  LEU n 
1 84  VAL n 
1 85  TYR n 
1 86  SER n 
1 87  VAL n 
1 88  THR n 
1 89  SER n 
1 90  ILE n 
1 91  LYS n 
1 92  SER n 
1 93  PHE n 
1 94  GLU n 
1 95  VAL n 
1 96  ILE n 
1 97  LYS n 
1 98  VAL n 
1 99  ILE n 
1 100 HIS n 
1 101 GLY n 
1 102 LYS n 
1 103 LEU n 
1 104 LEU n 
1 105 ASP n 
1 106 MET n 
1 107 VAL n 
1 108 GLY n 
1 109 LYS n 
1 110 VAL n 
1 111 GLN n 
1 112 ILE n 
1 113 PRO n 
1 114 ILE n 
1 115 MET n 
1 116 LEU n 
1 117 VAL n 
1 118 GLY n 
1 119 ASN n 
1 120 LYS n 
1 121 LYS n 
1 122 ASP n 
1 123 LEU n 
1 124 HIS n 
1 125 MET n 
1 126 GLU n 
1 127 ARG n 
1 128 VAL n 
1 129 ILE n 
1 130 SER n 
1 131 TYR n 
1 132 GLU n 
1 133 GLU n 
1 134 GLY n 
1 135 LYS n 
1 136 ALA n 
1 137 LEU n 
1 138 ALA n 
1 139 GLU n 
1 140 SER n 
1 141 TRP n 
1 142 ASN n 
1 143 ALA n 
1 144 ALA n 
1 145 PHE n 
1 146 LEU n 
1 147 GLU n 
1 148 SER n 
1 149 SER n 
1 150 ALA n 
1 151 LYS n 
1 152 GLU n 
1 153 ASN n 
1 154 GLN n 
1 155 THR n 
1 156 ALA n 
1 157 VAL n 
1 158 ASP n 
1 159 VAL n 
1 160 PHE n 
1 161 ARG n 
1 162 ARG n 
1 163 ILE n 
1 164 ILE n 
1 165 LEU n 
1 166 GLU n 
1 167 ALA n 
1 168 GLU n 
1 169 LYS n 
1 170 LEU n 
1 171 GLU n 
1 172 HIS n 
1 173 HIS n 
1 174 HIS n 
1 175 HIS n 
1 176 HIS n 
1 177 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 Rheb 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'pET22b(+)' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    RHEB_HUMAN 
_struct_ref.pdbx_db_accession          Q15382 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVDTAGQDEYSIFPQTYSIDING
YILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNKKDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVF
RRIILEAEK
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1XTR 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 169 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q15382 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  169 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       169 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1XTR LEU A 170 ? UNP Q15382 ? ? 'EXPRESSION TAG' 170 1 
1 1XTR GLU A 171 ? UNP Q15382 ? ? 'EXPRESSION TAG' 171 2 
1 1XTR HIS A 172 ? UNP Q15382 ? ? 'EXPRESSION TAG' 172 3 
1 1XTR HIS A 173 ? UNP Q15382 ? ? 'EXPRESSION TAG' 173 4 
1 1XTR HIS A 174 ? UNP Q15382 ? ? 'EXPRESSION TAG' 174 5 
1 1XTR HIS A 175 ? UNP Q15382 ? ? 'EXPRESSION TAG' 175 6 
1 1XTR HIS A 176 ? UNP Q15382 ? ? 'EXPRESSION TAG' 176 7 
1 1XTR HIS A 177 ? UNP Q15382 ? ? 'EXPRESSION TAG' 177 8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                       ?                               'C3 H7 N O2'        89.093 
ARG 'L-peptide linking' y ARGININE                                      ?                               'C6 H15 N4 O2 1'    
175.209 
ASN 'L-peptide linking' y ASPARAGINE                                    ?                               'C4 H8 N2 O3'       
132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                               ?                               'C4 H7 N O4'        
133.103 
GLN 'L-peptide linking' y GLUTAMINE                                     ?                               'C5 H10 N2 O3'      
146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                               ?                               'C5 H9 N O4'        
147.129 
GLY 'peptide linking'   y GLYCINE                                       ?                               'C2 H5 N O2'        75.067 
GNP non-polymer         . 'PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER' ?                               'C10 H17 N6 O13 P3' 
522.196 
GOL non-polymer         . GLYCEROL                                      'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'          92.094 
HIS 'L-peptide linking' y HISTIDINE                                     ?                               'C6 H10 N3 O2 1'    
156.162 
HOH non-polymer         . WATER                                         ?                               'H2 O'              18.015 
ILE 'L-peptide linking' y ISOLEUCINE                                    ?                               'C6 H13 N O2'       
131.173 
LEU 'L-peptide linking' y LEUCINE                                       ?                               'C6 H13 N O2'       
131.173 
LYS 'L-peptide linking' y LYSINE                                        ?                               'C6 H15 N2 O2 1'    
147.195 
MET 'L-peptide linking' y METHIONINE                                    ?                               'C5 H11 N O2 S'     
149.211 
MG  non-polymer         . 'MAGNESIUM ION'                               ?                               'Mg 2'              24.305 
PHE 'L-peptide linking' y PHENYLALANINE                                 ?                               'C9 H11 N O2'       
165.189 
PRO 'L-peptide linking' y PROLINE                                       ?                               'C5 H9 N O2'        
115.130 
SER 'L-peptide linking' y SERINE                                        ?                               'C3 H7 N O3'        
105.093 
THR 'L-peptide linking' y THREONINE                                     ?                               'C4 H9 N O3'        
119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                    ?                               'C11 H12 N2 O2'     
204.225 
TYR 'L-peptide linking' y TYROSINE                                      ?                               'C9 H11 N O3'       
181.189 
VAL 'L-peptide linking' y VALINE                                        ?                               'C5 H11 N O2'       
117.146 
# 
_exptl.entry_id          1XTR 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.1 
_exptl_crystal.density_percent_sol   59.8 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              4.6 
_exptl_crystal_grow.pdbx_details    
'potassium dihydrogenphosphate, PEG 8000, pH 4.6, VAPOR DIFFUSION, HANGING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   2004-05-17 
_diffrn_detector.details                'osmic mirrors' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Ni filter' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        RIGAKU 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.entry_id                     1XTR 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.d_resolution_high            2.65 
_reflns.d_resolution_low             12.0 
_reflns.number_all                   6973 
_reflns.number_obs                   6973 
_reflns.percent_possible_obs         94.8 
_reflns.pdbx_Rmerge_I_obs            0.163 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        4.9 
_reflns.B_iso_Wilson_estimate        44.6 
_reflns.pdbx_redundancy              2.6 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.65 
_reflns_shell.d_res_low              2.74 
_reflns_shell.percent_possible_all   91.7 
_reflns_shell.Rmerge_I_obs           0.412 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.2 
_reflns_shell.pdbx_redundancy        2.2 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      714 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1XTR 
_refine.ls_d_res_high                            2.65 
_refine.ls_d_res_low                             12.0 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_ls_sigma_I                          0.0 
_refine.ls_number_reflns_all                     6962 
_refine.ls_number_reflns_obs                     6962 
_refine.ls_number_reflns_R_free                  335 
_refine.ls_percent_reflns_obs                    94.8 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_work                       0.226 
_refine.ls_R_factor_R_free                       0.27 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'PDB entries 1KAO, 1GUA' 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             isotropic 
_refine.B_iso_mean                               31.1 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.details                                  ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1XTR 
_refine_analyze.Luzzati_coordinate_error_obs    0.35 
_refine_analyze.Luzzati_sigma_a_obs             0.62 
_refine_analyze.Luzzati_d_res_low_obs           6.00 
_refine_analyze.Luzzati_coordinate_error_free   0.40 
_refine_analyze.Luzzati_sigma_a_free            0.63 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1351 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         39 
_refine_hist.number_atoms_solvent             55 
_refine_hist.number_atoms_total               1445 
_refine_hist.d_res_high                       2.65 
_refine_hist.d_res_low                        12.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_improper_angle_d 0.77  ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 23.3  ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d           0.007 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.3   ? ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.R_factor_all 
6 2.65 2.81  . 0.371  . 0.4289 . . 53 1137 . . 'X-RAY DIFFRACTION' . 
6 2.81 3.03  . 0.329  . 0.352  . . 50 1188 . . 'X-RAY DIFFRACTION' . 
6 3.03 3.33  . 0.2649 . 0.3122 . . 76 1173 . . 'X-RAY DIFFRACTION' . 
6 3.33 3.79  . 0.2144 . 0.2683 . . 63 1154 . . 'X-RAY DIFFRACTION' . 
6 3.79 4.73  . 0.1431 . 0.1672 . . 57 1168 . . 'X-RAY DIFFRACTION' . 
6 4.73 12.00 . 0.1818 . 0.2251 . . 56 1142 . . 'X-RAY DIFFRACTION' . 
# 
_struct.entry_id                  1XTR 
_struct.title                     'Structure of small GTPase human Rheb in complex with GppNHp' 
_struct.pdbx_descriptor           'GTP-binding protein Rheb' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1XTR 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            'beta saddle, P-loop, SIGNALING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLY A 18  ? GLU A 28  ? GLY A 18  GLU A 28  1 ? 11 
HELX_P HELX_P2 2 PRO A 71  ? ILE A 76  ? PRO A 71  ILE A 76  5 ? 6  
HELX_P HELX_P3 3 SER A 89  ? GLY A 108 ? SER A 89  GLY A 108 1 ? 20 
HELX_P HELX_P4 4 LEU A 123 ? ARG A 127 ? LEU A 123 ARG A 127 5 ? 5  
HELX_P HELX_P5 5 SER A 130 ? TRP A 141 ? SER A 130 TRP A 141 1 ? 12 
HELX_P HELX_P6 6 GLU A 152 ? GLU A 171 ? GLU A 152 GLU A 171 1 ? 20 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? B MG . MG ? ? ? 1_555 C GNP .  O2G ? ? A MG 178 A GNP 179 1_555 ? ? ? ? ? ? ? 2.443 ? 
metalc2 metalc ? ? B MG . MG ? ? ? 1_555 C GNP .  O2B ? ? A MG 178 A GNP 179 1_555 ? ? ? ? ? ? ? 2.574 ? 
metalc3 metalc ? ? B MG . MG ? ? ? 1_555 E HOH .  O   ? ? A MG 178 A HOH 182 1_555 ? ? ? ? ? ? ? 2.523 ? 
metalc4 metalc ? ? B MG . MG ? ? ? 1_555 A SER 20 OG  ? ? A MG 178 A SER 20  1_555 ? ? ? ? ? ? ? 2.291 ? 
metalc5 metalc ? ? B MG . MG ? ? ? 1_555 E HOH .  O   ? ? A MG 178 A HOH 181 1_555 ? ? ? ? ? ? ? 2.233 ? 
metalc6 metalc ? ? B MG . MG ? ? ? 1_555 A THR 38 OG1 ? ? A MG 178 A THR 38  1_555 ? ? ? ? ? ? ? 2.582 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   6 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLU A 40  ? VAL A 49  ? GLU A 40  VAL A 49  
A 2 GLN A 52  ? THR A 61  ? GLN A 52  THR A 61  
A 3 SER A 4   ? LEU A 12  ? SER A 4   LEU A 12  
A 4 GLY A 80  ? SER A 86  ? GLY A 80  SER A 86  
A 5 ILE A 114 ? ASN A 119 ? ILE A 114 ASN A 119 
A 6 ALA A 144 ? SER A 148 ? ALA A 144 SER A 148 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 49  ? N VAL A 49  O GLN A 52  ? O GLN A 52  
A 2 3 O HIS A 55  ? O HIS A 55  N LYS A 5   ? N LYS A 5   
A 3 4 N LEU A 12  ? N LEU A 12  O ILE A 82  ? O ILE A 82  
A 4 5 N TYR A 85  ? N TYR A 85  O ASN A 119 ? O ASN A 119 
A 5 6 N LEU A 116 ? N LEU A 116 O ALA A 144 ? O ALA A 144 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 178'  
AC2 Software ? ? ? ? 22 'BINDING SITE FOR RESIDUE GNP A 179' 
AC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE GOL A 180' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6  SER A 20  ? SER A 20  . ? 1_555 ? 
2  AC1 6  THR A 38  ? THR A 38  . ? 1_555 ? 
3  AC1 6  ASP A 60  ? ASP A 60  . ? 1_555 ? 
4  AC1 6  GNP C .   ? GNP A 179 . ? 1_555 ? 
5  AC1 6  HOH E .   ? HOH A 181 . ? 1_555 ? 
6  AC1 6  HOH E .   ? HOH A 182 . ? 1_555 ? 
7  AC2 22 ARG A 15  ? ARG A 15  . ? 1_555 ? 
8  AC2 22 SER A 16  ? SER A 16  . ? 1_555 ? 
9  AC2 22 VAL A 17  ? VAL A 17  . ? 1_555 ? 
10 AC2 22 GLY A 18  ? GLY A 18  . ? 1_555 ? 
11 AC2 22 LYS A 19  ? LYS A 19  . ? 1_555 ? 
12 AC2 22 SER A 20  ? SER A 20  . ? 1_555 ? 
13 AC2 22 SER A 21  ? SER A 21  . ? 1_555 ? 
14 AC2 22 PHE A 31  ? PHE A 31  . ? 1_555 ? 
15 AC2 22 VAL A 32  ? VAL A 32  . ? 1_555 ? 
16 AC2 22 ASP A 33  ? ASP A 33  . ? 1_555 ? 
17 AC2 22 TYR A 35  ? TYR A 35  . ? 1_555 ? 
18 AC2 22 THR A 38  ? THR A 38  . ? 1_555 ? 
19 AC2 22 GLY A 63  ? GLY A 63  . ? 1_555 ? 
20 AC2 22 ASN A 119 ? ASN A 119 . ? 1_555 ? 
21 AC2 22 LYS A 120 ? LYS A 120 . ? 1_555 ? 
22 AC2 22 ASP A 122 ? ASP A 122 . ? 1_555 ? 
23 AC2 22 LEU A 123 ? LEU A 123 . ? 1_555 ? 
24 AC2 22 SER A 149 ? SER A 149 . ? 1_555 ? 
25 AC2 22 ALA A 150 ? ALA A 150 . ? 1_555 ? 
26 AC2 22 MG  B .   ? MG  A 178 . ? 1_555 ? 
27 AC2 22 HOH E .   ? HOH A 182 . ? 1_555 ? 
28 AC2 22 HOH E .   ? HOH A 186 . ? 1_555 ? 
29 AC3 5  ALA A 62  ? ALA A 62  . ? 1_555 ? 
30 AC3 5  GLY A 63  ? GLY A 63  . ? 1_555 ? 
31 AC3 5  GLN A 64  ? GLN A 64  . ? 1_555 ? 
32 AC3 5  ILE A 69  ? ILE A 69  . ? 1_555 ? 
33 AC3 5  PRO A 71  ? PRO A 71  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1XTR 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1XTR 
_atom_sites.fract_transf_matrix[1][1]   0.009715 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010085 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.020842 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . PRO A 1 2   ? 43.354 84.288  92.430 1.00 43.35 ? 2   PRO A N     1 
ATOM   2    C  CA    . PRO A 1 2   ? 43.461 85.734  92.112 1.00 42.03 ? 2   PRO A CA    1 
ATOM   3    C  C     . PRO A 1 2   ? 42.076 86.301  91.845 1.00 41.55 ? 2   PRO A C     1 
ATOM   4    O  O     . PRO A 1 2   ? 41.496 86.042  90.792 1.00 41.92 ? 2   PRO A O     1 
ATOM   5    C  CB    . PRO A 1 2   ? 44.342 85.848  90.879 1.00 42.57 ? 2   PRO A CB    1 
ATOM   6    C  CG    . PRO A 1 2   ? 44.131 84.486  90.224 1.00 43.66 ? 2   PRO A CG    1 
ATOM   7    C  CD    . PRO A 1 2   ? 44.023 83.488  91.388 1.00 42.69 ? 2   PRO A CD    1 
ATOM   8    N  N     . GLN A 1 3   ? 41.558 87.073  92.798 1.00 41.10 ? 3   GLN A N     1 
ATOM   9    C  CA    . GLN A 1 3   ? 40.222 87.674  92.704 1.00 41.90 ? 3   GLN A CA    1 
ATOM   10   C  C     . GLN A 1 3   ? 39.721 87.934  91.275 1.00 42.54 ? 3   GLN A C     1 
ATOM   11   O  O     . GLN A 1 3   ? 38.546 87.692  90.968 1.00 42.40 ? 3   GLN A O     1 
ATOM   12   C  CB    . GLN A 1 3   ? 40.184 88.964  93.531 1.00 41.74 ? 3   GLN A CB    1 
ATOM   13   C  CG    . GLN A 1 3   ? 38.814 89.609  93.681 1.00 42.36 ? 3   GLN A CG    1 
ATOM   14   C  CD    . GLN A 1 3   ? 38.505 90.596  92.564 1.00 45.65 ? 3   GLN A CD    1 
ATOM   15   O  OE1   . GLN A 1 3   ? 39.342 91.437  92.211 1.00 46.54 ? 3   GLN A OE1   1 
ATOM   16   N  NE2   . GLN A 1 3   ? 37.295 90.512  92.014 1.00 44.86 ? 3   GLN A NE2   1 
ATOM   17   N  N     . SER A 1 4   ? 40.607 88.416  90.405 1.00 42.22 ? 4   SER A N     1 
ATOM   18   C  CA    . SER A 1 4   ? 40.246 88.686  89.015 1.00 41.17 ? 4   SER A CA    1 
ATOM   19   C  C     . SER A 1 4   ? 41.352 88.336  88.016 1.00 40.61 ? 4   SER A C     1 
ATOM   20   O  O     . SER A 1 4   ? 42.535 88.559  88.281 1.00 41.11 ? 4   SER A O     1 
ATOM   21   C  CB    . SER A 1 4   ? 39.865 90.154  88.841 1.00 41.45 ? 4   SER A CB    1 
ATOM   22   O  OG    . SER A 1 4   ? 39.801 90.479  87.467 1.00 40.88 ? 4   SER A OG    1 
ATOM   23   N  N     . LYS A 1 5   ? 40.948 87.778  86.874 1.00 38.67 ? 5   LYS A N     1 
ATOM   24   C  CA    . LYS A 1 5   ? 41.866 87.396  85.801 1.00 36.72 ? 5   LYS A CA    1 
ATOM   25   C  C     . LYS A 1 5   ? 41.500 88.184  84.549 1.00 35.69 ? 5   LYS A C     1 
ATOM   26   O  O     . LYS A 1 5   ? 40.346 88.555  84.368 1.00 36.64 ? 5   LYS A O     1 
ATOM   27   C  CB    . LYS A 1 5   ? 41.757 85.905  85.480 1.00 35.28 ? 5   LYS A CB    1 
ATOM   28   C  CG    . LYS A 1 5   ? 42.188 84.973  86.588 1.00 35.16 ? 5   LYS A CG    1 
ATOM   29   C  CD    . LYS A 1 5   ? 42.145 83.527  86.112 1.00 34.54 ? 5   LYS A CD    1 
ATOM   30   C  CE    . LYS A 1 5   ? 42.537 82.560  87.220 1.00 36.29 ? 5   LYS A CE    1 
ATOM   31   N  NZ    . LYS A 1 5   ? 42.564 81.147  86.755 1.00 36.21 ? 5   LYS A NZ    1 
ATOM   32   N  N     . SER A 1 6   ? 42.477 88.439  83.688 1.00 33.27 ? 6   SER A N     1 
ATOM   33   C  CA    . SER A 1 6   ? 42.213 89.177  82.466 1.00 30.78 ? 6   SER A CA    1 
ATOM   34   C  C     . SER A 1 6   ? 42.478 88.305  81.257 1.00 29.63 ? 6   SER A C     1 
ATOM   35   O  O     . SER A 1 6   ? 43.526 87.669  81.137 1.00 28.72 ? 6   SER A O     1 
ATOM   36   C  CB    . SER A 1 6   ? 43.070 90.440  82.401 1.00 31.90 ? 6   SER A CB    1 
ATOM   37   O  OG    . SER A 1 6   ? 42.665 91.377  83.388 1.00 32.06 ? 6   SER A OG    1 
ATOM   38   N  N     . ARG A 1 7   ? 41.508 88.278  80.357 1.00 27.02 ? 7   ARG A N     1 
ATOM   39   C  CA    . ARG A 1 7   ? 41.617 87.477  79.159 1.00 23.92 ? 7   ARG A CA    1 
ATOM   40   C  C     . ARG A 1 7   ? 41.175 88.293  77.960 1.00 22.65 ? 7   ARG A C     1 
ATOM   41   O  O     . ARG A 1 7   ? 40.211 89.058  78.042 1.00 22.87 ? 7   ARG A O     1 
ATOM   42   C  CB    . ARG A 1 7   ? 40.744 86.238  79.299 1.00 24.14 ? 7   ARG A CB    1 
ATOM   43   C  CG    . ARG A 1 7   ? 41.199 85.290  80.381 1.00 24.72 ? 7   ARG A CG    1 
ATOM   44   C  CD    . ARG A 1 7   ? 42.510 84.668  79.982 1.00 28.72 ? 7   ARG A CD    1 
ATOM   45   N  NE    . ARG A 1 7   ? 42.952 83.616  80.895 1.00 31.18 ? 7   ARG A NE    1 
ATOM   46   C  CZ    . ARG A 1 7   ? 43.362 83.827  82.140 1.00 32.00 ? 7   ARG A CZ    1 
ATOM   47   N  NH1   . ARG A 1 7   ? 43.389 85.058  82.640 1.00 31.41 ? 7   ARG A NH1   1 
ATOM   48   N  NH2   . ARG A 1 7   ? 43.763 82.802  82.878 1.00 32.96 ? 7   ARG A NH2   1 
ATOM   49   N  N     . LYS A 1 8   ? 41.895 88.144  76.852 1.00 20.64 ? 8   LYS A N     1 
ATOM   50   C  CA    . LYS A 1 8   ? 41.559 88.855  75.634 1.00 19.15 ? 8   LYS A CA    1 
ATOM   51   C  C     . LYS A 1 8   ? 40.995 87.873  74.613 1.00 18.15 ? 8   LYS A C     1 
ATOM   52   O  O     . LYS A 1 8   ? 41.642 86.883  74.269 1.00 17.46 ? 8   LYS A O     1 
ATOM   53   C  CB    . LYS A 1 8   ? 42.789 89.574  75.061 1.00 17.87 ? 8   LYS A CB    1 
ATOM   54   C  CG    . LYS A 1 8   ? 42.501 90.237  73.722 1.00 20.16 ? 8   LYS A CG    1 
ATOM   55   C  CD    . LYS A 1 8   ? 43.180 91.584  73.554 1.00 23.11 ? 8   LYS A CD    1 
ATOM   56   C  CE    . LYS A 1 8   ? 44.637 91.453  73.123 1.00 26.98 ? 8   LYS A CE    1 
ATOM   57   N  NZ    . LYS A 1 8   ? 45.302 92.784  72.873 1.00 26.45 ? 8   LYS A NZ    1 
ATOM   58   N  N     . ILE A 1 9   ? 39.780 88.148  74.149 1.00 16.79 ? 9   ILE A N     1 
ATOM   59   C  CA    . ILE A 1 9   ? 39.110 87.303  73.165 1.00 17.57 ? 9   ILE A CA    1 
ATOM   60   C  C     . ILE A 1 9   ? 38.856 88.024  71.846 1.00 16.02 ? 9   ILE A C     1 
ATOM   61   O  O     . ILE A 1 9   ? 38.421 89.169  71.829 1.00 14.31 ? 9   ILE A O     1 
ATOM   62   C  CB    . ILE A 1 9   ? 37.739 86.799  73.683 1.00 19.57 ? 9   ILE A CB    1 
ATOM   63   C  CG1   . ILE A 1 9   ? 37.921 85.622  74.645 1.00 19.36 ? 9   ILE A CG1   1 
ATOM   64   C  CG2   . ILE A 1 9   ? 36.877 86.346  72.502 1.00 19.84 ? 9   ILE A CG2   1 
ATOM   65   C  CD1   . ILE A 1 9   ? 38.863 85.866  75.762 1.00 18.52 ? 9   ILE A CD1   1 
ATOM   66   N  N     . ALA A 1 10  ? 39.116 87.333  70.741 1.00 16.13 ? 10  ALA A N     1 
ATOM   67   C  CA    . ALA A 1 10  ? 38.899 87.892  69.410 1.00 14.41 ? 10  ALA A CA    1 
ATOM   68   C  C     . ALA A 1 10  ? 37.702 87.190  68.768 1.00 14.75 ? 10  ALA A C     1 
ATOM   69   O  O     . ALA A 1 10  ? 37.628 85.959  68.764 1.00 13.86 ? 10  ALA A O     1 
ATOM   70   C  CB    . ALA A 1 10  ? 40.145 87.697  68.550 1.00 11.30 ? 10  ALA A CB    1 
ATOM   71   N  N     . ILE A 1 11  ? 36.756 87.974  68.255 1.00 14.67 ? 11  ILE A N     1 
ATOM   72   C  CA    . ILE A 1 11  ? 35.580 87.424  67.596 1.00 15.06 ? 11  ILE A CA    1 
ATOM   73   C  C     . ILE A 1 11  ? 35.825 87.587  66.105 1.00 16.91 ? 11  ILE A C     1 
ATOM   74   O  O     . ILE A 1 11  ? 35.827 88.696  65.595 1.00 18.20 ? 11  ILE A O     1 
ATOM   75   C  CB    . ILE A 1 11  ? 34.290 88.177  67.992 1.00 14.57 ? 11  ILE A CB    1 
ATOM   76   C  CG1   . ILE A 1 11  ? 34.024 88.040  69.497 1.00 17.10 ? 11  ILE A CG1   1 
ATOM   77   C  CG2   . ILE A 1 11  ? 33.098 87.573  67.271 1.00 13.67 ? 11  ILE A CG2   1 
ATOM   78   C  CD1   . ILE A 1 11  ? 34.903 88.892  70.399 1.00 16.34 ? 11  ILE A CD1   1 
ATOM   79   N  N     . LEU A 1 12  ? 36.045 86.481  65.404 1.00 19.31 ? 12  LEU A N     1 
ATOM   80   C  CA    . LEU A 1 12  ? 36.331 86.539  63.979 1.00 19.38 ? 12  LEU A CA    1 
ATOM   81   C  C     . LEU A 1 12  ? 35.243 85.880  63.146 1.00 22.66 ? 12  LEU A C     1 
ATOM   82   O  O     . LEU A 1 12  ? 34.427 85.112  63.664 1.00 22.46 ? 12  LEU A O     1 
ATOM   83   C  CB    . LEU A 1 12  ? 37.657 85.841  63.699 1.00 17.88 ? 12  LEU A CB    1 
ATOM   84   C  CG    . LEU A 1 12  ? 38.851 86.205  64.579 1.00 16.28 ? 12  LEU A CG    1 
ATOM   85   C  CD1   . LEU A 1 12  ? 39.818 85.045  64.592 1.00 16.35 ? 12  LEU A CD1   1 
ATOM   86   C  CD2   . LEU A 1 12  ? 39.519 87.473  64.079 1.00 15.95 ? 12  LEU A CD2   1 
ATOM   87   N  N     . GLY A 1 13  ? 35.254 86.184  61.845 1.00 26.35 ? 13  GLY A N     1 
ATOM   88   C  CA    . GLY A 1 13  ? 34.288 85.622  60.914 1.00 26.35 ? 13  GLY A CA    1 
ATOM   89   C  C     . GLY A 1 13  ? 33.988 86.496  59.704 1.00 26.81 ? 13  GLY A C     1 
ATOM   90   O  O     . GLY A 1 13  ? 34.421 87.649  59.624 1.00 24.81 ? 13  GLY A O     1 
ATOM   91   N  N     . TYR A 1 14  ? 33.242 85.920  58.759 1.00 28.94 ? 14  TYR A N     1 
ATOM   92   C  CA    . TYR A 1 14  ? 32.811 86.586  57.530 1.00 29.46 ? 14  TYR A CA    1 
ATOM   93   C  C     . TYR A 1 14  ? 31.867 87.725  57.913 1.00 29.61 ? 14  TYR A C     1 
ATOM   94   O  O     . TYR A 1 14  ? 31.329 87.729  59.018 1.00 30.35 ? 14  TYR A O     1 
ATOM   95   C  CB    . TYR A 1 14  ? 32.082 85.579  56.644 1.00 30.77 ? 14  TYR A CB    1 
ATOM   96   C  CG    . TYR A 1 14  ? 31.674 86.094  55.277 1.00 34.14 ? 14  TYR A CG    1 
ATOM   97   C  CD1   . TYR A 1 14  ? 32.608 86.681  54.419 1.00 34.81 ? 14  TYR A CD1   1 
ATOM   98   C  CD2   . TYR A 1 14  ? 30.371 85.922  54.810 1.00 33.43 ? 14  TYR A CD2   1 
ATOM   99   C  CE1   . TYR A 1 14  ? 32.254 87.071  53.132 1.00 34.59 ? 14  TYR A CE1   1 
ATOM   100  C  CE2   . TYR A 1 14  ? 30.010 86.307  53.529 1.00 33.98 ? 14  TYR A CE2   1 
ATOM   101  C  CZ    . TYR A 1 14  ? 30.954 86.875  52.695 1.00 35.44 ? 14  TYR A CZ    1 
ATOM   102  O  OH    . TYR A 1 14  ? 30.603 87.206  51.406 1.00 38.74 ? 14  TYR A OH    1 
ATOM   103  N  N     . ARG A 1 15  ? 31.645 88.680  57.016 1.00 29.20 ? 15  ARG A N     1 
ATOM   104  C  CA    . ARG A 1 15  ? 30.777 89.806  57.354 1.00 30.83 ? 15  ARG A CA    1 
ATOM   105  C  C     . ARG A 1 15  ? 29.274 89.524  57.450 1.00 29.19 ? 15  ARG A C     1 
ATOM   106  O  O     . ARG A 1 15  ? 28.762 88.563  56.874 1.00 28.80 ? 15  ARG A O     1 
ATOM   107  C  CB    . ARG A 1 15  ? 31.042 90.985  56.401 1.00 33.30 ? 15  ARG A CB    1 
ATOM   108  C  CG    . ARG A 1 15  ? 31.156 90.608  54.949 1.00 37.14 ? 15  ARG A CG    1 
ATOM   109  C  CD    . ARG A 1 15  ? 32.251 91.397  54.250 1.00 41.06 ? 15  ARG A CD    1 
ATOM   110  N  NE    . ARG A 1 15  ? 32.599 90.756  52.982 1.00 46.09 ? 15  ARG A NE    1 
ATOM   111  C  CZ    . ARG A 1 15  ? 33.809 90.775  52.425 1.00 47.79 ? 15  ARG A CZ    1 
ATOM   112  N  NH1   . ARG A 1 15  ? 34.818 91.416  53.018 1.00 48.19 ? 15  ARG A NH1   1 
ATOM   113  N  NH2   . ARG A 1 15  ? 34.013 90.128  51.282 1.00 46.98 ? 15  ARG A NH2   1 
ATOM   114  N  N     . SER A 1 16  ? 28.586 90.368  58.217 1.00 27.57 ? 16  SER A N     1 
ATOM   115  C  CA    . SER A 1 16  ? 27.142 90.267  58.419 1.00 26.69 ? 16  SER A CA    1 
ATOM   116  C  C     . SER A 1 16  ? 26.674 89.082  59.253 1.00 23.78 ? 16  SER A C     1 
ATOM   117  O  O     . SER A 1 16  ? 25.486 88.957  59.517 1.00 24.76 ? 16  SER A O     1 
ATOM   118  C  CB    . SER A 1 16  ? 26.410 90.224  57.068 1.00 28.84 ? 16  SER A CB    1 
ATOM   119  O  OG    . SER A 1 16  ? 26.558 91.434  56.339 1.00 31.75 ? 16  SER A OG    1 
ATOM   120  N  N     . VAL A 1 17  ? 27.589 88.213  59.667 1.00 21.09 ? 17  VAL A N     1 
ATOM   121  C  CA    . VAL A 1 17  ? 27.203 87.036  60.447 1.00 18.07 ? 17  VAL A CA    1 
ATOM   122  C  C     . VAL A 1 17  ? 26.707 87.369  61.850 1.00 17.31 ? 17  VAL A C     1 
ATOM   123  O  O     . VAL A 1 17  ? 26.006 86.566  62.465 1.00 15.76 ? 17  VAL A O     1 
ATOM   124  C  CB    . VAL A 1 17  ? 28.362 86.023  60.543 1.00 17.80 ? 17  VAL A CB    1 
ATOM   125  C  CG1   . VAL A 1 17  ? 28.799 85.609  59.139 1.00 18.13 ? 17  VAL A CG1   1 
ATOM   126  C  CG2   . VAL A 1 17  ? 29.532 86.624  61.309 1.00 17.55 ? 17  VAL A CG2   1 
ATOM   127  N  N     . GLY A 1 18  ? 27.070 88.552  62.348 1.00 15.71 ? 18  GLY A N     1 
ATOM   128  C  CA    . GLY A 1 18  ? 26.625 88.970  63.663 1.00 14.99 ? 18  GLY A CA    1 
ATOM   129  C  C     . GLY A 1 18  ? 27.685 89.007  64.744 1.00 16.03 ? 18  GLY A C     1 
ATOM   130  O  O     . GLY A 1 18  ? 27.374 88.860  65.930 1.00 16.25 ? 18  GLY A O     1 
ATOM   131  N  N     . LYS A 1 19  ? 28.935 89.218  64.354 1.00 15.62 ? 19  LYS A N     1 
ATOM   132  C  CA    . LYS A 1 19  ? 30.016 89.258  65.326 1.00 16.50 ? 19  LYS A CA    1 
ATOM   133  C  C     . LYS A 1 19  ? 29.770 90.351  66.358 1.00 18.73 ? 19  LYS A C     1 
ATOM   134  O  O     . LYS A 1 19  ? 29.943 90.134  67.561 1.00 18.99 ? 19  LYS A O     1 
ATOM   135  C  CB    . LYS A 1 19  ? 31.359 89.494  64.625 1.00 13.65 ? 19  LYS A CB    1 
ATOM   136  C  CG    . LYS A 1 19  ? 31.768 88.373  63.688 1.00 13.83 ? 19  LYS A CG    1 
ATOM   137  C  CD    . LYS A 1 19  ? 33.163 88.587  63.094 1.00 14.89 ? 19  LYS A CD    1 
ATOM   138  C  CE    . LYS A 1 19  ? 33.205 89.737  62.091 1.00 13.60 ? 19  LYS A CE    1 
ATOM   139  N  NZ    . LYS A 1 19  ? 32.273 89.520  60.953 1.00 13.35 ? 19  LYS A NZ    1 
ATOM   140  N  N     . SER A 1 20  ? 29.365 91.523  65.873 1.00 20.11 ? 20  SER A N     1 
ATOM   141  C  CA    . SER A 1 20  ? 29.095 92.678  66.719 1.00 19.74 ? 20  SER A CA    1 
ATOM   142  C  C     . SER A 1 20  ? 27.812 92.495  67.497 1.00 21.90 ? 20  SER A C     1 
ATOM   143  O  O     . SER A 1 20  ? 27.793 92.628  68.719 1.00 24.65 ? 20  SER A O     1 
ATOM   144  C  CB    . SER A 1 20  ? 28.978 93.918  65.860 1.00 16.71 ? 20  SER A CB    1 
ATOM   145  O  OG    . SER A 1 20  ? 30.150 94.061  65.101 1.00 16.97 ? 20  SER A OG    1 
ATOM   146  N  N     . SER A 1 21  ? 26.737 92.197  66.778 1.00 21.89 ? 21  SER A N     1 
ATOM   147  C  CA    . SER A 1 21  ? 25.434 91.984  67.389 1.00 22.24 ? 21  SER A CA    1 
ATOM   148  C  C     . SER A 1 21  ? 25.575 91.041  68.581 1.00 22.45 ? 21  SER A C     1 
ATOM   149  O  O     . SER A 1 21  ? 25.103 91.326  69.685 1.00 22.36 ? 21  SER A O     1 
ATOM   150  C  CB    . SER A 1 21  ? 24.481 91.382  66.356 1.00 22.23 ? 21  SER A CB    1 
ATOM   151  O  OG    . SER A 1 21  ? 24.393 92.198  65.197 1.00 23.66 ? 21  SER A OG    1 
ATOM   152  N  N     . LEU A 1 22  ? 26.249 89.921  68.342 1.00 23.28 ? 22  LEU A N     1 
ATOM   153  C  CA    . LEU A 1 22  ? 26.473 88.908  69.361 1.00 22.42 ? 22  LEU A CA    1 
ATOM   154  C  C     . LEU A 1 22  ? 27.312 89.464  70.510 1.00 21.78 ? 22  LEU A C     1 
ATOM   155  O  O     . LEU A 1 22  ? 27.096 89.125  71.669 1.00 21.10 ? 22  LEU A O     1 
ATOM   156  C  CB    . LEU A 1 22  ? 27.166 87.698  68.727 1.00 21.62 ? 22  LEU A CB    1 
ATOM   157  C  CG    . LEU A 1 22  ? 26.697 86.336  69.236 1.00 22.55 ? 22  LEU A CG    1 
ATOM   158  C  CD1   . LEU A 1 22  ? 27.373 85.226  68.465 1.00 21.71 ? 22  LEU A CD1   1 
ATOM   159  C  CD2   . LEU A 1 22  ? 27.004 86.222  70.712 1.00 24.51 ? 22  LEU A CD2   1 
ATOM   160  N  N     . THR A 1 23  ? 28.262 90.326  70.172 1.00 22.22 ? 23  THR A N     1 
ATOM   161  C  CA    . THR A 1 23  ? 29.154 90.948  71.145 1.00 24.43 ? 23  THR A CA    1 
ATOM   162  C  C     . THR A 1 23  ? 28.452 92.009  72.002 1.00 25.60 ? 23  THR A C     1 
ATOM   163  O  O     . THR A 1 23  ? 28.623 92.056  73.226 1.00 24.27 ? 23  THR A O     1 
ATOM   164  C  CB    . THR A 1 23  ? 30.334 91.604  70.425 1.00 24.79 ? 23  THR A CB    1 
ATOM   165  O  OG1   . THR A 1 23  ? 31.071 90.600  69.722 1.00 27.16 ? 23  THR A OG1   1 
ATOM   166  C  CG2   . THR A 1 23  ? 31.243 92.302  71.408 1.00 26.32 ? 23  THR A CG2   1 
ATOM   167  N  N     . ILE A 1 24  ? 27.677 92.868  71.344 1.00 26.52 ? 24  ILE A N     1 
ATOM   168  C  CA    . ILE A 1 24  ? 26.941 93.930  72.016 1.00 26.76 ? 24  ILE A CA    1 
ATOM   169  C  C     . ILE A 1 24  ? 25.864 93.317  72.898 1.00 27.77 ? 24  ILE A C     1 
ATOM   170  O  O     . ILE A 1 24  ? 25.647 93.766  74.019 1.00 28.47 ? 24  ILE A O     1 
ATOM   171  C  CB    . ILE A 1 24  ? 26.278 94.897  70.981 1.00 26.95 ? 24  ILE A CB    1 
ATOM   172  C  CG1   . ILE A 1 24  ? 27.299 95.911  70.467 1.00 25.45 ? 24  ILE A CG1   1 
ATOM   173  C  CG2   . ILE A 1 24  ? 25.102 95.633  71.608 1.00 28.67 ? 24  ILE A CG2   1 
ATOM   174  C  CD1   . ILE A 1 24  ? 28.383 95.326  69.608 1.00 26.19 ? 24  ILE A CD1   1 
ATOM   175  N  N     . GLN A 1 25  ? 25.188 92.291  72.388 1.00 28.09 ? 25  GLN A N     1 
ATOM   176  C  CA    . GLN A 1 25  ? 24.133 91.623  73.146 1.00 29.55 ? 25  GLN A CA    1 
ATOM   177  C  C     . GLN A 1 25  ? 24.682 91.142  74.491 1.00 30.18 ? 25  GLN A C     1 
ATOM   178  O  O     . GLN A 1 25  ? 24.034 91.279  75.530 1.00 31.07 ? 25  GLN A O     1 
ATOM   179  C  CB    . GLN A 1 25  ? 23.578 90.442  72.331 1.00 28.75 ? 25  GLN A CB    1 
ATOM   180  C  CG    . GLN A 1 25  ? 22.579 89.525  73.059 1.00 27.90 ? 25  GLN A CG    1 
ATOM   181  C  CD    . GLN A 1 25  ? 21.323 90.242  73.535 1.00 28.18 ? 25  GLN A CD    1 
ATOM   182  O  OE1   . GLN A 1 25  ? 21.264 90.748  74.659 1.00 27.38 ? 25  GLN A OE1   1 
ATOM   183  N  NE2   . GLN A 1 25  ? 20.311 90.290  72.676 1.00 27.51 ? 25  GLN A NE2   1 
ATOM   184  N  N     . PHE A 1 26  ? 25.884 90.584  74.459 1.00 30.18 ? 26  PHE A N     1 
ATOM   185  C  CA    . PHE A 1 26  ? 26.537 90.091  75.659 1.00 30.83 ? 26  PHE A CA    1 
ATOM   186  C  C     . PHE A 1 26  ? 26.981 91.256  76.535 1.00 32.29 ? 26  PHE A C     1 
ATOM   187  O  O     . PHE A 1 26  ? 26.684 91.302  77.725 1.00 32.28 ? 26  PHE A O     1 
ATOM   188  C  CB    . PHE A 1 26  ? 27.753 89.253  75.266 1.00 31.09 ? 26  PHE A CB    1 
ATOM   189  C  CG    . PHE A 1 26  ? 28.691 88.968  76.403 1.00 31.65 ? 26  PHE A CG    1 
ATOM   190  C  CD1   . PHE A 1 26  ? 28.283 88.202  77.487 1.00 30.45 ? 26  PHE A CD1   1 
ATOM   191  C  CD2   . PHE A 1 26  ? 29.989 89.469  76.386 1.00 31.55 ? 26  PHE A CD2   1 
ATOM   192  C  CE1   . PHE A 1 26  ? 29.156 87.940  78.538 1.00 31.66 ? 26  PHE A CE1   1 
ATOM   193  C  CE2   . PHE A 1 26  ? 30.869 89.213  77.433 1.00 32.31 ? 26  PHE A CE2   1 
ATOM   194  C  CZ    . PHE A 1 26  ? 30.454 88.447  78.513 1.00 31.20 ? 26  PHE A CZ    1 
ATOM   195  N  N     . VAL A 1 27  ? 27.685 92.201  75.922 1.00 34.62 ? 27  VAL A N     1 
ATOM   196  C  CA    . VAL A 1 27  ? 28.214 93.374  76.616 1.00 35.98 ? 27  VAL A CA    1 
ATOM   197  C  C     . VAL A 1 27  ? 27.171 94.370  77.131 1.00 36.95 ? 27  VAL A C     1 
ATOM   198  O  O     . VAL A 1 27  ? 27.126 94.666  78.322 1.00 37.50 ? 27  VAL A O     1 
ATOM   199  C  CB    . VAL A 1 27  ? 29.205 94.135  75.707 1.00 35.32 ? 27  VAL A CB    1 
ATOM   200  C  CG1   . VAL A 1 27  ? 29.813 95.303  76.462 1.00 34.49 ? 27  VAL A CG1   1 
ATOM   201  C  CG2   . VAL A 1 27  ? 30.294 93.190  75.225 1.00 35.26 ? 27  VAL A CG2   1 
ATOM   202  N  N     . GLU A 1 28  ? 26.340 94.890  76.235 1.00 37.98 ? 28  GLU A N     1 
ATOM   203  C  CA    . GLU A 1 28  ? 25.327 95.868  76.615 1.00 38.95 ? 28  GLU A CA    1 
ATOM   204  C  C     . GLU A 1 28  ? 23.980 95.242  76.977 1.00 39.69 ? 28  GLU A C     1 
ATOM   205  O  O     . GLU A 1 28  ? 23.282 95.734  77.857 1.00 38.37 ? 28  GLU A O     1 
ATOM   206  C  CB    . GLU A 1 28  ? 25.165 96.884  75.487 1.00 39.18 ? 28  GLU A CB    1 
ATOM   207  C  CG    . GLU A 1 28  ? 26.487 97.521  75.079 1.00 40.80 ? 28  GLU A CG    1 
ATOM   208  C  CD    . GLU A 1 28  ? 26.379 98.309  73.796 1.00 42.74 ? 28  GLU A CD    1 
ATOM   209  O  OE1   . GLU A 1 28  ? 27.430 98.651  73.203 1.00 41.63 ? 28  GLU A OE1   1 
ATOM   210  O  OE2   . GLU A 1 28  ? 25.234 98.586  73.382 1.00 44.17 ? 28  GLU A OE2   1 
ATOM   211  N  N     . GLY A 1 29  ? 23.613 94.162  76.295 1.00 41.85 ? 29  GLY A N     1 
ATOM   212  C  CA    . GLY A 1 29  ? 22.360 93.496  76.606 1.00 44.67 ? 29  GLY A CA    1 
ATOM   213  C  C     . GLY A 1 29  ? 21.199 93.754  75.667 1.00 46.59 ? 29  GLY A C     1 
ATOM   214  O  O     . GLY A 1 29  ? 20.103 93.234  75.874 1.00 45.52 ? 29  GLY A O     1 
ATOM   215  N  N     . GLN A 1 30  ? 21.422 94.554  74.635 1.00 48.75 ? 30  GLN A N     1 
ATOM   216  C  CA    . GLN A 1 30  ? 20.359 94.846  73.690 1.00 51.83 ? 30  GLN A CA    1 
ATOM   217  C  C     . GLN A 1 30  ? 20.700 94.262  72.336 1.00 52.21 ? 30  GLN A C     1 
ATOM   218  O  O     . GLN A 1 30  ? 21.755 93.659  72.159 1.00 52.95 ? 30  GLN A O     1 
ATOM   219  C  CB    . GLN A 1 30  ? 20.166 96.352  73.544 1.00 55.39 ? 30  GLN A CB    1 
ATOM   220  C  CG    . GLN A 1 30  ? 19.740 97.070  74.808 1.00 60.21 ? 30  GLN A CG    1 
ATOM   221  C  CD    . GLN A 1 30  ? 19.553 98.558  74.576 1.00 63.76 ? 30  GLN A CD    1 
ATOM   222  O  OE1   . GLN A 1 30  ? 19.225 99.308  75.501 1.00 65.64 ? 30  GLN A OE1   1 
ATOM   223  N  NE2   . GLN A 1 30  ? 19.761 98.997  73.330 1.00 64.70 ? 30  GLN A NE2   1 
ATOM   224  N  N     . PHE A 1 31  ? 19.797 94.452  71.381 1.00 52.18 ? 31  PHE A N     1 
ATOM   225  C  CA    . PHE A 1 31  ? 19.999 93.964  70.031 1.00 51.54 ? 31  PHE A CA    1 
ATOM   226  C  C     . PHE A 1 31  ? 19.832 95.112  69.053 1.00 52.31 ? 31  PHE A C     1 
ATOM   227  O  O     . PHE A 1 31  ? 18.744 95.656  68.891 1.00 51.50 ? 31  PHE A O     1 
ATOM   228  C  CB    . PHE A 1 31  ? 18.995 92.861  69.700 1.00 51.80 ? 31  PHE A CB    1 
ATOM   229  C  CG    . PHE A 1 31  ? 19.091 92.365  68.287 1.00 51.36 ? 31  PHE A CG    1 
ATOM   230  C  CD1   . PHE A 1 31  ? 20.200 91.649  67.862 1.00 50.78 ? 31  PHE A CD1   1 
ATOM   231  C  CD2   . PHE A 1 31  ? 18.096 92.661  67.365 1.00 51.74 ? 31  PHE A CD2   1 
ATOM   232  C  CE1   . PHE A 1 31  ? 20.318 91.239  66.541 1.00 50.80 ? 31  PHE A CE1   1 
ATOM   233  C  CE2   . PHE A 1 31  ? 18.208 92.254  66.040 1.00 51.81 ? 31  PHE A CE2   1 
ATOM   234  C  CZ    . PHE A 1 31  ? 19.321 91.543  65.629 1.00 50.83 ? 31  PHE A CZ    1 
ATOM   235  N  N     . VAL A 1 32  ? 20.924 95.478  68.402 1.00 54.45 ? 32  VAL A N     1 
ATOM   236  C  CA    . VAL A 1 32  ? 20.909 96.559  67.431 1.00 56.69 ? 32  VAL A CA    1 
ATOM   237  C  C     . VAL A 1 32  ? 20.671 96.008  66.024 1.00 58.42 ? 32  VAL A C     1 
ATOM   238  O  O     . VAL A 1 32  ? 21.245 94.987  65.641 1.00 58.39 ? 32  VAL A O     1 
ATOM   239  C  CB    . VAL A 1 32  ? 22.252 97.336  67.467 1.00 56.22 ? 32  VAL A CB    1 
ATOM   240  C  CG1   . VAL A 1 32  ? 22.386 98.079  68.788 1.00 55.93 ? 32  VAL A CG1   1 
ATOM   241  C  CG2   . VAL A 1 32  ? 23.421 96.370  67.310 1.00 55.64 ? 32  VAL A CG2   1 
ATOM   242  N  N     . ASP A 1 33  ? 19.810 96.672  65.261 1.00 60.22 ? 33  ASP A N     1 
ATOM   243  C  CA    . ASP A 1 33  ? 19.536 96.235  63.900 1.00 62.70 ? 33  ASP A CA    1 
ATOM   244  C  C     . ASP A 1 33  ? 20.428 97.033  62.965 1.00 63.65 ? 33  ASP A C     1 
ATOM   245  O  O     . ASP A 1 33  ? 20.809 96.568  61.891 1.00 63.46 ? 33  ASP A O     1 
ATOM   246  C  CB    . ASP A 1 33  ? 18.078 96.487  63.529 1.00 64.83 ? 33  ASP A CB    1 
ATOM   247  C  CG    . ASP A 1 33  ? 17.697 95.844  62.204 1.00 67.45 ? 33  ASP A CG    1 
ATOM   248  O  OD1   . ASP A 1 33  ? 18.530 95.859  61.270 1.00 67.28 ? 33  ASP A OD1   1 
ATOM   249  O  OD2   . ASP A 1 33  ? 16.562 95.330  62.093 1.00 68.92 ? 33  ASP A OD2   1 
ATOM   250  N  N     . SER A 1 34  ? 20.756 98.245  63.399 1.00 65.25 ? 34  SER A N     1 
ATOM   251  C  CA    . SER A 1 34  ? 21.596 99.165  62.640 1.00 66.22 ? 34  SER A CA    1 
ATOM   252  C  C     . SER A 1 34  ? 22.883 98.521  62.135 1.00 66.36 ? 34  SER A C     1 
ATOM   253  O  O     . SER A 1 34  ? 23.911 98.559  62.818 1.00 67.17 ? 34  SER A O     1 
ATOM   254  C  CB    . SER A 1 34  ? 21.945 100.374 63.511 1.00 66.21 ? 34  SER A CB    1 
ATOM   255  O  OG    . SER A 1 34  ? 20.778 100.936 64.094 1.00 67.03 ? 34  SER A OG    1 
ATOM   256  N  N     . TYR A 1 35  ? 22.833 97.939  60.939 1.00 65.97 ? 35  TYR A N     1 
ATOM   257  C  CA    . TYR A 1 35  ? 24.016 97.302  60.372 1.00 65.67 ? 35  TYR A CA    1 
ATOM   258  C  C     . TYR A 1 35  ? 25.126 98.295  60.030 1.00 64.39 ? 35  TYR A C     1 
ATOM   259  O  O     . TYR A 1 35  ? 25.023 99.055  59.062 1.00 63.63 ? 35  TYR A O     1 
ATOM   260  C  CB    . TYR A 1 35  ? 23.680 96.514  59.104 1.00 67.19 ? 35  TYR A CB    1 
ATOM   261  C  CG    . TYR A 1 35  ? 24.918 95.891  58.490 1.00 68.26 ? 35  TYR A CG    1 
ATOM   262  C  CD1   . TYR A 1 35  ? 25.628 94.901  59.169 1.00 68.47 ? 35  TYR A CD1   1 
ATOM   263  C  CD2   . TYR A 1 35  ? 25.420 96.337  57.268 1.00 68.52 ? 35  TYR A CD2   1 
ATOM   264  C  CE1   . TYR A 1 35  ? 26.807 94.371  58.657 1.00 68.21 ? 35  TYR A CE1   1 
ATOM   265  C  CE2   . TYR A 1 35  ? 26.604 95.811  56.744 1.00 68.99 ? 35  TYR A CE2   1 
ATOM   266  C  CZ    . TYR A 1 35  ? 27.291 94.829  57.447 1.00 68.23 ? 35  TYR A CZ    1 
ATOM   267  O  OH    . TYR A 1 35  ? 28.461 94.304  56.947 1.00 66.86 ? 35  TYR A OH    1 
ATOM   268  N  N     . ASP A 1 36  ? 26.191 98.268  60.825 1.00 62.19 ? 36  ASP A N     1 
ATOM   269  C  CA    . ASP A 1 36  ? 27.335 99.141  60.613 1.00 59.41 ? 36  ASP A CA    1 
ATOM   270  C  C     . ASP A 1 36  ? 28.568 98.292  60.363 1.00 56.31 ? 36  ASP A C     1 
ATOM   271  O  O     . ASP A 1 36  ? 28.989 97.530  61.229 1.00 55.97 ? 36  ASP A O     1 
ATOM   272  C  CB    . ASP A 1 36  ? 27.559 100.020 61.841 1.00 61.16 ? 36  ASP A CB    1 
ATOM   273  C  CG    . ASP A 1 36  ? 26.478 101.062 62.011 1.00 63.21 ? 36  ASP A CG    1 
ATOM   274  O  OD1   . ASP A 1 36  ? 26.622 102.164 61.439 1.00 65.22 ? 36  ASP A OD1   1 
ATOM   275  O  OD2   . ASP A 1 36  ? 25.476 100.775 62.702 1.00 63.71 ? 36  ASP A OD2   1 
ATOM   276  N  N     . PRO A 1 37  ? 29.150 98.390  59.160 1.00 54.27 ? 37  PRO A N     1 
ATOM   277  C  CA    . PRO A 1 37  ? 30.348 97.593  58.881 1.00 51.72 ? 37  PRO A CA    1 
ATOM   278  C  C     . PRO A 1 37  ? 31.358 98.004  59.943 1.00 49.02 ? 37  PRO A C     1 
ATOM   279  O  O     . PRO A 1 37  ? 31.538 99.196  60.193 1.00 51.14 ? 37  PRO A O     1 
ATOM   280  C  CB    . PRO A 1 37  ? 30.747 98.051  57.483 1.00 52.67 ? 37  PRO A CB    1 
ATOM   281  C  CG    . PRO A 1 37  ? 29.424 98.443  56.865 1.00 53.67 ? 37  PRO A CG    1 
ATOM   282  C  CD    . PRO A 1 37  ? 28.762 99.196  57.989 1.00 54.35 ? 37  PRO A CD    1 
ATOM   283  N  N     . THR A 1 38  ? 32.010 97.037  60.572 1.00 44.33 ? 38  THR A N     1 
ATOM   284  C  CA    . THR A 1 38  ? 32.951 97.358  61.632 1.00 40.34 ? 38  THR A CA    1 
ATOM   285  C  C     . THR A 1 38  ? 34.405 97.460  61.219 1.00 38.56 ? 38  THR A C     1 
ATOM   286  O  O     . THR A 1 38  ? 34.875 96.687  60.392 1.00 38.10 ? 38  THR A O     1 
ATOM   287  C  CB    . THR A 1 38  ? 32.838 96.338  62.765 1.00 39.90 ? 38  THR A CB    1 
ATOM   288  O  OG1   . THR A 1 38  ? 31.588 96.522  63.438 1.00 38.23 ? 38  THR A OG1   1 
ATOM   289  C  CG2   . THR A 1 38  ? 33.980 96.493  63.753 1.00 40.40 ? 38  THR A CG2   1 
ATOM   290  N  N     . ILE A 1 39  ? 35.106 98.433  61.798 1.00 36.89 ? 39  ILE A N     1 
ATOM   291  C  CA    . ILE A 1 39  ? 36.528 98.634  61.529 1.00 36.73 ? 39  ILE A CA    1 
ATOM   292  C  C     . ILE A 1 39  ? 37.215 97.764  62.583 1.00 35.10 ? 39  ILE A C     1 
ATOM   293  O  O     . ILE A 1 39  ? 38.033 96.892  62.269 1.00 33.73 ? 39  ILE A O     1 
ATOM   294  C  CB    . ILE A 1 39  ? 36.954 100.112 61.738 1.00 37.68 ? 39  ILE A CB    1 
ATOM   295  C  CG1   . ILE A 1 39  ? 35.808 101.063 61.364 1.00 37.67 ? 39  ILE A CG1   1 
ATOM   296  C  CG2   . ILE A 1 39  ? 38.181 100.417 60.892 1.00 35.81 ? 39  ILE A CG2   1 
ATOM   297  C  CD1   . ILE A 1 39  ? 35.454 101.085 59.899 1.00 38.48 ? 39  ILE A CD1   1 
ATOM   298  N  N     . GLU A 1 40  ? 36.858 98.029  63.838 1.00 33.28 ? 40  GLU A N     1 
ATOM   299  C  CA    . GLU A 1 40  ? 37.342 97.286  64.996 1.00 31.30 ? 40  GLU A CA    1 
ATOM   300  C  C     . GLU A 1 40  ? 36.873 97.936  66.287 1.00 31.23 ? 40  GLU A C     1 
ATOM   301  O  O     . GLU A 1 40  ? 37.209 99.085  66.567 1.00 32.92 ? 40  GLU A O     1 
ATOM   302  C  CB    . GLU A 1 40  ? 38.863 97.182  65.033 1.00 28.01 ? 40  GLU A CB    1 
ATOM   303  C  CG    . GLU A 1 40  ? 39.309 95.973  65.833 1.00 26.08 ? 40  GLU A CG    1 
ATOM   304  C  CD    . GLU A 1 40  ? 40.697 96.104  66.388 1.00 26.96 ? 40  GLU A CD    1 
ATOM   305  O  OE1   . GLU A 1 40  ? 40.937 97.097  67.102 1.00 29.45 ? 40  GLU A OE1   1 
ATOM   306  O  OE2   . GLU A 1 40  ? 41.545 95.222  66.127 1.00 24.60 ? 40  GLU A OE2   1 
ATOM   307  N  N     . ASN A 1 41  ? 36.089 97.193  67.063 1.00 29.98 ? 41  ASN A N     1 
ATOM   308  C  CA    . ASN A 1 41  ? 35.583 97.674  68.340 1.00 28.67 ? 41  ASN A CA    1 
ATOM   309  C  C     . ASN A 1 41  ? 36.178 96.852  69.470 1.00 28.37 ? 41  ASN A C     1 
ATOM   310  O  O     . ASN A 1 41  ? 36.604 95.713  69.281 1.00 27.15 ? 41  ASN A O     1 
ATOM   311  C  CB    . ASN A 1 41  ? 34.063 97.578  68.388 1.00 29.31 ? 41  ASN A CB    1 
ATOM   312  C  CG    . ASN A 1 41  ? 33.398 98.475  67.376 1.00 30.21 ? 41  ASN A CG    1 
ATOM   313  O  OD1   . ASN A 1 41  ? 33.500 99.698  67.449 1.00 30.09 ? 41  ASN A OD1   1 
ATOM   314  N  ND2   . ASN A 1 41  ? 32.713 97.871  66.417 1.00 32.00 ? 41  ASN A ND2   1 
ATOM   315  N  N     . THR A 1 42  ? 36.198 97.439  70.655 1.00 29.36 ? 42  THR A N     1 
ATOM   316  C  CA    . THR A 1 42  ? 36.752 96.775  71.821 1.00 29.17 ? 42  THR A CA    1 
ATOM   317  C  C     . THR A 1 42  ? 35.966 97.141  73.059 1.00 29.09 ? 42  THR A C     1 
ATOM   318  O  O     . THR A 1 42  ? 35.833 98.317  73.392 1.00 29.38 ? 42  THR A O     1 
ATOM   319  C  CB    . THR A 1 42  ? 38.225 97.181  72.041 1.00 29.19 ? 42  THR A CB    1 
ATOM   320  O  OG1   . THR A 1 42  ? 39.066 96.429  71.156 1.00 28.88 ? 42  THR A OG1   1 
ATOM   321  C  CG2   . THR A 1 42  ? 38.638 96.944  73.486 1.00 30.17 ? 42  THR A CG2   1 
ATOM   322  N  N     . PHE A 1 43  ? 35.436 96.128  73.733 1.00 28.96 ? 43  PHE A N     1 
ATOM   323  C  CA    . PHE A 1 43  ? 34.685 96.352  74.956 1.00 28.70 ? 43  PHE A CA    1 
ATOM   324  C  C     . PHE A 1 43  ? 35.340 95.530  76.045 1.00 28.86 ? 43  PHE A C     1 
ATOM   325  O  O     . PHE A 1 43  ? 35.846 94.438  75.780 1.00 29.50 ? 43  PHE A O     1 
ATOM   326  C  CB    . PHE A 1 43  ? 33.235 95.900  74.806 1.00 28.04 ? 43  PHE A CB    1 
ATOM   327  C  CG    . PHE A 1 43  ? 32.589 96.342  73.533 1.00 28.16 ? 43  PHE A CG    1 
ATOM   328  C  CD1   . PHE A 1 43  ? 32.858 95.683  72.339 1.00 28.64 ? 43  PHE A CD1   1 
ATOM   329  C  CD2   . PHE A 1 43  ? 31.699 97.406  73.527 1.00 27.50 ? 43  PHE A CD2   1 
ATOM   330  C  CE1   . PHE A 1 43  ? 32.247 96.074  71.159 1.00 28.12 ? 43  PHE A CE1   1 
ATOM   331  C  CE2   . PHE A 1 43  ? 31.084 97.805  72.352 1.00 27.57 ? 43  PHE A CE2   1 
ATOM   332  C  CZ    . PHE A 1 43  ? 31.358 97.137  71.166 1.00 28.37 ? 43  PHE A CZ    1 
ATOM   333  N  N     . THR A 1 44  ? 35.354 96.063  77.262 1.00 28.70 ? 44  THR A N     1 
ATOM   334  C  CA    . THR A 1 44  ? 35.923 95.340  78.388 1.00 28.45 ? 44  THR A CA    1 
ATOM   335  C  C     . THR A 1 44  ? 34.769 94.965  79.294 1.00 29.08 ? 44  THR A C     1 
ATOM   336  O  O     . THR A 1 44  ? 34.259 95.792  80.049 1.00 30.41 ? 44  THR A O     1 
ATOM   337  C  CB    . THR A 1 44  ? 36.934 96.187  79.159 1.00 27.91 ? 44  THR A CB    1 
ATOM   338  O  OG1   . THR A 1 44  ? 38.037 96.491  78.299 1.00 29.17 ? 44  THR A OG1   1 
ATOM   339  C  CG2   . THR A 1 44  ? 37.451 95.429  80.370 1.00 27.20 ? 44  THR A CG2   1 
ATOM   340  N  N     . LYS A 1 45  ? 34.344 93.711  79.179 1.00 29.15 ? 45  LYS A N     1 
ATOM   341  C  CA    . LYS A 1 45  ? 33.238 93.184  79.962 1.00 27.56 ? 45  LYS A CA    1 
ATOM   342  C  C     . LYS A 1 45  ? 33.808 92.412  81.141 1.00 27.76 ? 45  LYS A C     1 
ATOM   343  O  O     . LYS A 1 45  ? 34.864 91.789  81.048 1.00 29.38 ? 45  LYS A O     1 
ATOM   344  C  CB    . LYS A 1 45  ? 32.382 92.256  79.097 1.00 27.49 ? 45  LYS A CB    1 
ATOM   345  C  CG    . LYS A 1 45  ? 31.120 91.728  79.759 1.00 25.65 ? 45  LYS A CG    1 
ATOM   346  C  CD    . LYS A 1 45  ? 30.146 92.851  80.001 1.00 27.70 ? 45  LYS A CD    1 
ATOM   347  C  CE    . LYS A 1 45  ? 28.833 92.333  80.536 1.00 29.52 ? 45  LYS A CE    1 
ATOM   348  N  NZ    . LYS A 1 45  ? 27.886 93.452  80.806 1.00 31.36 ? 45  LYS A NZ    1 
ATOM   349  N  N     . LEU A 1 46  ? 33.090 92.461  82.249 1.00 27.24 ? 46  LEU A N     1 
ATOM   350  C  CA    . LEU A 1 46  ? 33.482 91.791  83.474 1.00 26.13 ? 46  LEU A CA    1 
ATOM   351  C  C     . LEU A 1 46  ? 32.478 90.656  83.656 1.00 25.72 ? 46  LEU A C     1 
ATOM   352  O  O     . LEU A 1 46  ? 31.270 90.902  83.666 1.00 26.32 ? 46  LEU A O     1 
ATOM   353  C  CB    . LEU A 1 46  ? 33.369 92.804  84.622 1.00 28.28 ? 46  LEU A CB    1 
ATOM   354  C  CG    . LEU A 1 46  ? 33.946 92.628  86.026 1.00 28.83 ? 46  LEU A CG    1 
ATOM   355  C  CD1   . LEU A 1 46  ? 33.346 91.386  86.640 1.00 31.01 ? 46  LEU A CD1   1 
ATOM   356  C  CD2   . LEU A 1 46  ? 35.475 92.561  85.982 1.00 27.61 ? 46  LEU A CD2   1 
ATOM   357  N  N     . ILE A 1 47  ? 32.952 89.418  83.756 1.00 24.81 ? 47  ILE A N     1 
ATOM   358  C  CA    . ILE A 1 47  ? 32.039 88.291  83.964 1.00 24.57 ? 47  ILE A CA    1 
ATOM   359  C  C     . ILE A 1 47  ? 32.685 87.147  84.722 1.00 23.93 ? 47  ILE A C     1 
ATOM   360  O  O     . ILE A 1 47  ? 33.857 86.838  84.512 1.00 23.95 ? 47  ILE A O     1 
ATOM   361  C  CB    . ILE A 1 47  ? 31.498 87.709  82.647 1.00 25.24 ? 47  ILE A CB    1 
ATOM   362  C  CG1   . ILE A 1 47  ? 32.537 86.801  82.005 1.00 23.87 ? 47  ILE A CG1   1 
ATOM   363  C  CG2   . ILE A 1 47  ? 31.106 88.829  81.698 1.00 28.04 ? 47  ILE A CG2   1 
ATOM   364  C  CD1   . ILE A 1 47  ? 31.918 85.863  81.021 1.00 25.76 ? 47  ILE A CD1   1 
ATOM   365  N  N     . THR A 1 48  ? 31.916 86.504  85.595 1.00 23.21 ? 48  THR A N     1 
ATOM   366  C  CA    . THR A 1 48  ? 32.452 85.393  86.367 1.00 23.76 ? 48  THR A CA    1 
ATOM   367  C  C     . THR A 1 48  ? 32.036 84.023  85.838 1.00 24.31 ? 48  THR A C     1 
ATOM   368  O  O     . THR A 1 48  ? 30.892 83.815  85.423 1.00 23.16 ? 48  THR A O     1 
ATOM   369  C  CB    . THR A 1 48  ? 32.080 85.520  87.865 1.00 23.57 ? 48  THR A CB    1 
ATOM   370  O  OG1   . THR A 1 48  ? 32.146 84.231  88.489 1.00 21.25 ? 48  THR A OG1   1 
ATOM   371  C  CG2   . THR A 1 48  ? 30.703 86.120  88.026 1.00 23.15 ? 48  THR A CG2   1 
ATOM   372  N  N     . VAL A 1 49  ? 32.997 83.101  85.850 1.00 25.66 ? 49  VAL A N     1 
ATOM   373  C  CA    . VAL A 1 49  ? 32.812 81.730  85.372 1.00 26.51 ? 49  VAL A CA    1 
ATOM   374  C  C     . VAL A 1 49  ? 33.326 80.735  86.423 1.00 27.54 ? 49  VAL A C     1 
ATOM   375  O  O     . VAL A 1 49  ? 34.519 80.715  86.742 1.00 28.41 ? 49  VAL A O     1 
ATOM   376  C  CB    . VAL A 1 49  ? 33.587 81.503  84.048 1.00 24.93 ? 49  VAL A CB    1 
ATOM   377  C  CG1   . VAL A 1 49  ? 33.406 80.081  83.564 1.00 24.25 ? 49  VAL A CG1   1 
ATOM   378  C  CG2   . VAL A 1 49  ? 33.110 82.473  83.003 1.00 25.03 ? 49  VAL A CG2   1 
ATOM   379  N  N     . ASN A 1 50  ? 32.417 79.917  86.951 1.00 27.28 ? 50  ASN A N     1 
ATOM   380  C  CA    . ASN A 1 50  ? 32.746 78.922  87.964 1.00 26.32 ? 50  ASN A CA    1 
ATOM   381  C  C     . ASN A 1 50  ? 33.340 79.554  89.218 1.00 27.37 ? 50  ASN A C     1 
ATOM   382  O  O     . ASN A 1 50  ? 34.286 79.022  89.811 1.00 27.68 ? 50  ASN A O     1 
ATOM   383  C  CB    . ASN A 1 50  ? 33.727 77.896  87.404 1.00 26.03 ? 50  ASN A CB    1 
ATOM   384  C  CG    . ASN A 1 50  ? 33.177 77.164  86.210 1.00 26.57 ? 50  ASN A CG    1 
ATOM   385  O  OD1   . ASN A 1 50  ? 32.044 76.693  86.229 1.00 27.06 ? 50  ASN A OD1   1 
ATOM   386  N  ND2   . ASN A 1 50  ? 33.983 77.053  85.161 1.00 27.47 ? 50  ASN A ND2   1 
ATOM   387  N  N     . GLY A 1 51  ? 32.791 80.692  89.624 1.00 27.25 ? 51  GLY A N     1 
ATOM   388  C  CA    . GLY A 1 51  ? 33.302 81.346  90.812 1.00 30.47 ? 51  GLY A CA    1 
ATOM   389  C  C     . GLY A 1 51  ? 34.456 82.289  90.537 1.00 32.27 ? 51  GLY A C     1 
ATOM   390  O  O     . GLY A 1 51  ? 34.684 83.240  91.290 1.00 33.59 ? 51  GLY A O     1 
ATOM   391  N  N     . GLN A 1 52  ? 35.193 82.036  89.462 1.00 33.03 ? 52  GLN A N     1 
ATOM   392  C  CA    . GLN A 1 52  ? 36.309 82.900  89.112 1.00 33.70 ? 52  GLN A CA    1 
ATOM   393  C  C     . GLN A 1 52  ? 35.827 84.079  88.284 1.00 33.67 ? 52  GLN A C     1 
ATOM   394  O  O     . GLN A 1 52  ? 35.212 83.898  87.236 1.00 33.90 ? 52  GLN A O     1 
ATOM   395  C  CB    . GLN A 1 52  ? 37.360 82.137  88.310 1.00 33.47 ? 52  GLN A CB    1 
ATOM   396  C  CG    . GLN A 1 52  ? 38.551 83.000  87.919 1.00 33.29 ? 52  GLN A CG    1 
ATOM   397  C  CD    . GLN A 1 52  ? 39.270 83.573  89.123 1.00 33.61 ? 52  GLN A CD    1 
ATOM   398  O  OE1   . GLN A 1 52  ? 39.754 82.833  89.980 1.00 34.22 ? 52  GLN A OE1   1 
ATOM   399  N  NE2   . GLN A 1 52  ? 39.341 84.897  89.196 1.00 32.79 ? 52  GLN A NE2   1 
ATOM   400  N  N     . GLU A 1 53  ? 36.096 85.289  88.754 1.00 34.46 ? 53  GLU A N     1 
ATOM   401  C  CA    . GLU A 1 53  ? 35.692 86.469  88.004 1.00 35.69 ? 53  GLU A CA    1 
ATOM   402  C  C     . GLU A 1 53  ? 36.764 86.771  86.971 1.00 35.08 ? 53  GLU A C     1 
ATOM   403  O  O     . GLU A 1 53  ? 37.955 86.585  87.232 1.00 34.71 ? 53  GLU A O     1 
ATOM   404  C  CB    . GLU A 1 53  ? 35.508 87.684  88.918 1.00 36.57 ? 53  GLU A CB    1 
ATOM   405  C  CG    . GLU A 1 53  ? 35.258 88.964  88.135 1.00 40.16 ? 53  GLU A CG    1 
ATOM   406  C  CD    . GLU A 1 53  ? 34.896 90.142  89.014 1.00 43.26 ? 53  GLU A CD    1 
ATOM   407  O  OE1   . GLU A 1 53  ? 33.819 90.103  89.644 1.00 45.64 ? 53  GLU A OE1   1 
ATOM   408  O  OE2   . GLU A 1 53  ? 35.685 91.112  89.071 1.00 44.89 ? 53  GLU A OE2   1 
ATOM   409  N  N     . TYR A 1 54  ? 36.339 87.226  85.796 1.00 33.83 ? 54  TYR A N     1 
ATOM   410  C  CA    . TYR A 1 54  ? 37.274 87.556  84.731 1.00 32.14 ? 54  TYR A CA    1 
ATOM   411  C  C     . TYR A 1 54  ? 37.089 88.972  84.223 1.00 32.53 ? 54  TYR A C     1 
ATOM   412  O  O     . TYR A 1 54  ? 36.021 89.568  84.357 1.00 31.34 ? 54  TYR A O     1 
ATOM   413  C  CB    . TYR A 1 54  ? 37.113 86.598  83.551 1.00 29.19 ? 54  TYR A CB    1 
ATOM   414  C  CG    . TYR A 1 54  ? 37.591 85.191  83.808 1.00 26.82 ? 54  TYR A CG    1 
ATOM   415  C  CD1   . TYR A 1 54  ? 38.913 84.831  83.578 1.00 23.59 ? 54  TYR A CD1   1 
ATOM   416  C  CD2   . TYR A 1 54  ? 36.710 84.211  84.267 1.00 25.48 ? 54  TYR A CD2   1 
ATOM   417  C  CE1   . TYR A 1 54  ? 39.343 83.531  83.794 1.00 22.76 ? 54  TYR A CE1   1 
ATOM   418  C  CE2   . TYR A 1 54  ? 37.131 82.914  84.486 1.00 23.19 ? 54  TYR A CE2   1 
ATOM   419  C  CZ    . TYR A 1 54  ? 38.447 82.578  84.247 1.00 23.03 ? 54  TYR A CZ    1 
ATOM   420  O  OH    . TYR A 1 54  ? 38.863 81.281  84.459 1.00 24.85 ? 54  TYR A OH    1 
ATOM   421  N  N     . HIS A 1 55  ? 38.164 89.492  83.646 1.00 34.79 ? 55  HIS A N     1 
ATOM   422  C  CA    . HIS A 1 55  ? 38.205 90.814  83.049 1.00 36.59 ? 55  HIS A CA    1 
ATOM   423  C  C     . HIS A 1 55  ? 38.424 90.513  81.579 1.00 36.05 ? 55  HIS A C     1 
ATOM   424  O  O     . HIS A 1 55  ? 39.559 90.332  81.129 1.00 36.92 ? 55  HIS A O     1 
ATOM   425  C  CB    . HIS A 1 55  ? 39.373 91.623  83.616 1.00 39.64 ? 55  HIS A CB    1 
ATOM   426  C  CG    . HIS A 1 55  ? 38.973 92.573  84.701 1.00 44.43 ? 55  HIS A CG    1 
ATOM   427  N  ND1   . HIS A 1 55  ? 38.629 93.885  84.452 1.00 47.82 ? 55  HIS A ND1   1 
ATOM   428  C  CD2   . HIS A 1 55  ? 38.815 92.391  86.033 1.00 46.02 ? 55  HIS A CD2   1 
ATOM   429  C  CE1   . HIS A 1 55  ? 38.275 94.469  85.583 1.00 48.40 ? 55  HIS A CE1   1 
ATOM   430  N  NE2   . HIS A 1 55  ? 38.378 93.583  86.558 1.00 48.41 ? 55  HIS A NE2   1 
ATOM   431  N  N     . LEU A 1 56  ? 37.322 90.429  80.844 1.00 34.94 ? 56  LEU A N     1 
ATOM   432  C  CA    . LEU A 1 56  ? 37.363 90.122  79.426 1.00 34.78 ? 56  LEU A CA    1 
ATOM   433  C  C     . LEU A 1 56  ? 37.536 91.308  78.512 1.00 34.83 ? 56  LEU A C     1 
ATOM   434  O  O     . LEU A 1 56  ? 36.722 92.239  78.512 1.00 33.88 ? 56  LEU A O     1 
ATOM   435  C  CB    . LEU A 1 56  ? 36.090 89.411  79.003 1.00 35.43 ? 56  LEU A CB    1 
ATOM   436  C  CG    . LEU A 1 56  ? 35.867 88.057  79.638 1.00 38.16 ? 56  LEU A CG    1 
ATOM   437  C  CD1   . LEU A 1 56  ? 34.527 87.513  79.159 1.00 39.79 ? 56  LEU A CD1   1 
ATOM   438  C  CD2   . LEU A 1 56  ? 37.025 87.135  79.283 1.00 37.01 ? 56  LEU A CD2   1 
ATOM   439  N  N     . GLN A 1 57  ? 38.600 91.264  77.725 1.00 34.34 ? 57  GLN A N     1 
ATOM   440  C  CA    . GLN A 1 57  ? 38.843 92.303  76.750 1.00 34.37 ? 57  GLN A CA    1 
ATOM   441  C  C     . GLN A 1 57  ? 38.461 91.642  75.423 1.00 33.09 ? 57  GLN A C     1 
ATOM   442  O  O     . GLN A 1 57  ? 39.198 90.803  74.897 1.00 32.06 ? 57  GLN A O     1 
ATOM   443  C  CB    . GLN A 1 57  ? 40.311 92.723  76.751 1.00 35.25 ? 57  GLN A CB    1 
ATOM   444  C  CG    . GLN A 1 57  ? 40.581 93.910  75.853 1.00 38.38 ? 57  GLN A CG    1 
ATOM   445  C  CD    . GLN A 1 57  ? 41.993 94.442  75.992 1.00 41.02 ? 57  GLN A CD    1 
ATOM   446  O  OE1   . GLN A 1 57  ? 42.959 93.778  75.621 1.00 42.21 ? 57  GLN A OE1   1 
ATOM   447  N  NE2   . GLN A 1 57  ? 42.118 95.651  76.534 1.00 42.39 ? 57  GLN A NE2   1 
ATOM   448  N  N     . LEU A 1 58  ? 37.283 91.995  74.913 1.00 30.77 ? 58  LEU A N     1 
ATOM   449  C  CA    . LEU A 1 58  ? 36.783 91.438  73.664 1.00 28.41 ? 58  LEU A CA    1 
ATOM   450  C  C     . LEU A 1 58  ? 37.142 92.320  72.473 1.00 26.87 ? 58  LEU A C     1 
ATOM   451  O  O     . LEU A 1 58  ? 36.973 93.539  72.528 1.00 26.27 ? 58  LEU A O     1 
ATOM   452  C  CB    . LEU A 1 58  ? 35.261 91.290  73.724 1.00 29.11 ? 58  LEU A CB    1 
ATOM   453  C  CG    . LEU A 1 58  ? 34.661 90.513  74.897 1.00 31.94 ? 58  LEU A CG    1 
ATOM   454  C  CD1   . LEU A 1 58  ? 33.140 90.598  74.831 1.00 32.02 ? 58  LEU A CD1   1 
ATOM   455  C  CD2   . LEU A 1 58  ? 35.127 89.061  74.862 1.00 33.87 ? 58  LEU A CD2   1 
ATOM   456  N  N     . VAL A 1 59  ? 37.635 91.699  71.400 1.00 25.33 ? 59  VAL A N     1 
ATOM   457  C  CA    . VAL A 1 59  ? 37.988 92.424  70.181 1.00 24.55 ? 59  VAL A CA    1 
ATOM   458  C  C     . VAL A 1 59  ? 37.089 91.984  69.024 1.00 23.77 ? 59  VAL A C     1 
ATOM   459  O  O     . VAL A 1 59  ? 37.302 90.931  68.431 1.00 24.21 ? 59  VAL A O     1 
ATOM   460  C  CB    . VAL A 1 59  ? 39.462 92.187  69.769 1.00 23.94 ? 59  VAL A CB    1 
ATOM   461  C  CG1   . VAL A 1 59  ? 39.839 93.142  68.641 1.00 22.96 ? 59  VAL A CG1   1 
ATOM   462  C  CG2   . VAL A 1 59  ? 40.381 92.387  70.960 1.00 22.68 ? 59  VAL A CG2   1 
ATOM   463  N  N     . ASP A 1 60  ? 36.085 92.803  68.722 1.00 23.65 ? 60  ASP A N     1 
ATOM   464  C  CA    . ASP A 1 60  ? 35.128 92.554  67.642 1.00 23.83 ? 60  ASP A CA    1 
ATOM   465  C  C     . ASP A 1 60  ? 35.778 92.972  66.314 1.00 24.03 ? 60  ASP A C     1 
ATOM   466  O  O     . ASP A 1 60  ? 35.760 94.144  65.938 1.00 24.88 ? 60  ASP A O     1 
ATOM   467  C  CB    . ASP A 1 60  ? 33.858 93.366  67.924 1.00 23.87 ? 60  ASP A CB    1 
ATOM   468  C  CG    . ASP A 1 60  ? 32.847 93.285  66.813 1.00 25.17 ? 60  ASP A CG    1 
ATOM   469  O  OD1   . ASP A 1 60  ? 32.772 92.228  66.158 1.00 25.65 ? 60  ASP A OD1   1 
ATOM   470  O  OD2   . ASP A 1 60  ? 32.112 94.278  66.608 1.00 25.48 ? 60  ASP A OD2   1 
ATOM   471  N  N     . THR A 1 61  ? 36.351 92.004  65.609 1.00 23.54 ? 61  THR A N     1 
ATOM   472  C  CA    . THR A 1 61  ? 37.058 92.265  64.356 1.00 25.43 ? 61  THR A CA    1 
ATOM   473  C  C     . THR A 1 61  ? 36.209 92.594  63.128 1.00 26.56 ? 61  THR A C     1 
ATOM   474  O  O     . THR A 1 61  ? 35.016 92.312  63.090 1.00 27.40 ? 61  THR A O     1 
ATOM   475  C  CB    . THR A 1 61  ? 37.975 91.070  63.998 1.00 26.45 ? 61  THR A CB    1 
ATOM   476  O  OG1   . THR A 1 61  ? 37.179 89.932  63.638 1.00 26.49 ? 61  THR A OG1   1 
ATOM   477  C  CG2   . THR A 1 61  ? 38.851 90.706  65.186 1.00 25.95 ? 61  THR A CG2   1 
ATOM   478  N  N     . ALA A 1 62  ? 36.839 93.202  62.123 1.00 27.22 ? 62  ALA A N     1 
ATOM   479  C  CA    . ALA A 1 62  ? 36.158 93.550  60.874 1.00 27.93 ? 62  ALA A CA    1 
ATOM   480  C  C     . ALA A 1 62  ? 36.036 92.282  60.027 1.00 29.10 ? 62  ALA A C     1 
ATOM   481  O  O     . ALA A 1 62  ? 36.968 91.476  59.958 1.00 30.76 ? 62  ALA A O     1 
ATOM   482  C  CB    . ALA A 1 62  ? 36.954 94.599  60.123 1.00 27.37 ? 62  ALA A CB    1 
ATOM   483  N  N     . GLY A 1 63  ? 34.895 92.103  59.377 1.00 28.43 ? 63  GLY A N     1 
ATOM   484  C  CA    . GLY A 1 63  ? 34.703 90.909  58.574 1.00 28.44 ? 63  GLY A CA    1 
ATOM   485  C  C     . GLY A 1 63  ? 35.683 90.683  57.433 1.00 28.42 ? 63  GLY A C     1 
ATOM   486  O  O     . GLY A 1 63  ? 35.989 91.595  56.656 1.00 28.22 ? 63  GLY A O     1 
ATOM   487  N  N     . GLN A 1 64  ? 36.176 89.454  57.331 1.00 27.13 ? 64  GLN A N     1 
ATOM   488  C  CA    . GLN A 1 64  ? 37.100 89.100  56.266 1.00 27.47 ? 64  GLN A CA    1 
ATOM   489  C  C     . GLN A 1 64  ? 36.499 87.998  55.407 1.00 27.41 ? 64  GLN A C     1 
ATOM   490  O  O     . GLN A 1 64  ? 35.364 87.590  55.636 1.00 26.98 ? 64  GLN A O     1 
ATOM   491  C  CB    . GLN A 1 64  ? 38.455 88.668  56.842 1.00 26.58 ? 64  GLN A CB    1 
ATOM   492  C  CG    . GLN A 1 64  ? 38.397 88.032  58.208 1.00 25.88 ? 64  GLN A CG    1 
ATOM   493  C  CD    . GLN A 1 64  ? 39.775 87.826  58.818 1.00 25.72 ? 64  GLN A CD    1 
ATOM   494  O  OE1   . GLN A 1 64  ? 40.566 87.014  58.340 1.00 25.84 ? 64  GLN A OE1   1 
ATOM   495  N  NE2   . GLN A 1 64  ? 40.066 88.566  59.879 1.00 25.10 ? 64  GLN A NE2   1 
ATOM   496  N  N     . ASP A 1 65  ? 37.245 87.534  54.407 1.00 27.28 ? 65  ASP A N     1 
ATOM   497  C  CA    . ASP A 1 65  ? 36.754 86.479  53.535 1.00 29.13 ? 65  ASP A CA    1 
ATOM   498  C  C     . ASP A 1 65  ? 37.842 85.488  53.130 1.00 30.73 ? 65  ASP A C     1 
ATOM   499  O  O     . ASP A 1 65  ? 38.839 85.327  53.830 1.00 30.13 ? 65  ASP A O     1 
ATOM   500  C  CB    . ASP A 1 65  ? 36.106 87.077  52.284 1.00 30.88 ? 65  ASP A CB    1 
ATOM   501  C  CG    . ASP A 1 65  ? 37.043 87.979  51.515 1.00 32.03 ? 65  ASP A CG    1 
ATOM   502  O  OD1   . ASP A 1 65  ? 38.241 87.645  51.408 1.00 33.76 ? 65  ASP A OD1   1 
ATOM   503  O  OD2   . ASP A 1 65  ? 36.578 89.019  51.004 1.00 32.33 ? 65  ASP A OD2   1 
ATOM   504  N  N     . GLU A 1 66  ? 37.646 84.822  51.994 1.00 32.20 ? 66  GLU A N     1 
ATOM   505  C  CA    . GLU A 1 66  ? 38.603 83.834  51.516 1.00 33.17 ? 66  GLU A CA    1 
ATOM   506  C  C     . GLU A 1 66  ? 39.949 84.450  51.227 1.00 34.28 ? 66  GLU A C     1 
ATOM   507  O  O     . GLU A 1 66  ? 40.981 83.896  51.591 1.00 36.29 ? 66  GLU A O     1 
ATOM   508  C  CB    . GLU A 1 66  ? 38.094 83.173  50.248 1.00 32.66 ? 66  GLU A CB    1 
ATOM   509  C  CG    . GLU A 1 66  ? 36.629 82.929  50.272 1.00 34.99 ? 66  GLU A CG    1 
ATOM   510  C  CD    . GLU A 1 66  ? 35.942 83.664  49.171 1.00 34.88 ? 66  GLU A CD    1 
ATOM   511  O  OE1   . GLU A 1 66  ? 36.196 83.313  48.003 1.00 36.93 ? 66  GLU A OE1   1 
ATOM   512  O  OE2   . GLU A 1 66  ? 35.163 84.592  49.469 1.00 35.49 ? 66  GLU A OE2   1 
ATOM   513  N  N     . TYR A 1 67  ? 39.943 85.588  50.549 1.00 35.56 ? 67  TYR A N     1 
ATOM   514  C  CA    . TYR A 1 67  ? 41.192 86.246  50.225 1.00 38.11 ? 67  TYR A CA    1 
ATOM   515  C  C     . TYR A 1 67  ? 41.342 87.541  51.000 1.00 40.26 ? 67  TYR A C     1 
ATOM   516  O  O     . TYR A 1 67  ? 40.980 88.621  50.517 1.00 42.27 ? 67  TYR A O     1 
ATOM   517  C  CB    . TYR A 1 67  ? 41.301 86.538  48.725 1.00 38.36 ? 67  TYR A CB    1 
ATOM   518  C  CG    . TYR A 1 67  ? 40.202 85.980  47.848 1.00 38.96 ? 67  TYR A CG    1 
ATOM   519  C  CD1   . TYR A 1 67  ? 38.921 86.539  47.854 1.00 38.53 ? 67  TYR A CD1   1 
ATOM   520  C  CD2   . TYR A 1 67  ? 40.465 84.939  46.953 1.00 38.88 ? 67  TYR A CD2   1 
ATOM   521  C  CE1   . TYR A 1 67  ? 37.932 86.084  46.983 1.00 39.87 ? 67  TYR A CE1   1 
ATOM   522  C  CE2   . TYR A 1 67  ? 39.484 84.473  46.076 1.00 40.34 ? 67  TYR A CE2   1 
ATOM   523  C  CZ    . TYR A 1 67  ? 38.221 85.052  46.091 1.00 41.07 ? 67  TYR A CZ    1 
ATOM   524  O  OH    . TYR A 1 67  ? 37.265 84.627  45.190 1.00 41.51 ? 67  TYR A OH    1 
ATOM   525  N  N     . SER A 1 68  ? 41.861 87.423  52.216 1.00 40.23 ? 68  SER A N     1 
ATOM   526  C  CA    . SER A 1 68  ? 42.093 88.578  53.069 1.00 39.34 ? 68  SER A CA    1 
ATOM   527  C  C     . SER A 1 68  ? 43.161 88.168  54.057 1.00 39.57 ? 68  SER A C     1 
ATOM   528  O  O     . SER A 1 68  ? 43.095 87.084  54.636 1.00 40.61 ? 68  SER A O     1 
ATOM   529  C  CB    . SER A 1 68  ? 40.810 89.005  53.794 1.00 36.68 ? 68  SER A CB    1 
ATOM   530  O  OG    . SER A 1 68  ? 40.232 87.929  54.491 1.00 34.31 ? 68  SER A OG    1 
ATOM   531  N  N     . ILE A 1 69  ? 44.160 89.031  54.214 1.00 39.12 ? 69  ILE A N     1 
ATOM   532  C  CA    . ILE A 1 69  ? 45.285 88.787  55.109 1.00 38.11 ? 69  ILE A CA    1 
ATOM   533  C  C     . ILE A 1 69  ? 44.798 88.645  56.543 1.00 37.82 ? 69  ILE A C     1 
ATOM   534  O  O     . ILE A 1 69  ? 44.088 89.518  57.044 1.00 39.80 ? 69  ILE A O     1 
ATOM   535  C  CB    . ILE A 1 69  ? 46.291 89.963  55.068 1.00 38.10 ? 69  ILE A CB    1 
ATOM   536  C  CG1   . ILE A 1 69  ? 46.631 90.327  53.617 1.00 40.71 ? 69  ILE A CG1   1 
ATOM   537  C  CG2   . ILE A 1 69  ? 47.538 89.603  55.843 1.00 36.84 ? 69  ILE A CG2   1 
ATOM   538  C  CD1   . ILE A 1 69  ? 47.335 89.236  52.825 1.00 41.31 ? 69  ILE A CD1   1 
ATOM   539  N  N     . PHE A 1 70  ? 45.170 87.555  57.204 1.00 35.19 ? 70  PHE A N     1 
ATOM   540  C  CA    . PHE A 1 70  ? 44.770 87.372  58.586 1.00 33.90 ? 70  PHE A CA    1 
ATOM   541  C  C     . PHE A 1 70  ? 45.667 88.236  59.467 1.00 33.43 ? 70  PHE A C     1 
ATOM   542  O  O     . PHE A 1 70  ? 46.817 87.884  59.715 1.00 34.16 ? 70  PHE A O     1 
ATOM   543  C  CB    . PHE A 1 70  ? 44.901 85.910  58.998 1.00 35.42 ? 70  PHE A CB    1 
ATOM   544  C  CG    . PHE A 1 70  ? 44.473 85.650  60.411 1.00 36.11 ? 70  PHE A CG    1 
ATOM   545  C  CD1   . PHE A 1 70  ? 45.301 85.979  61.472 1.00 35.47 ? 70  PHE A CD1   1 
ATOM   546  C  CD2   . PHE A 1 70  ? 43.216 85.132  60.682 1.00 37.26 ? 70  PHE A CD2   1 
ATOM   547  C  CE1   . PHE A 1 70  ? 44.883 85.799  62.778 1.00 36.13 ? 70  PHE A CE1   1 
ATOM   548  C  CE2   . PHE A 1 70  ? 42.790 84.948  61.987 1.00 37.49 ? 70  PHE A CE2   1 
ATOM   549  C  CZ    . PHE A 1 70  ? 43.624 85.283  63.036 1.00 37.27 ? 70  PHE A CZ    1 
ATOM   550  N  N     . PRO A 1 71  ? 45.140 89.372  59.963 1.00 31.83 ? 71  PRO A N     1 
ATOM   551  C  CA    . PRO A 1 71  ? 45.822 90.347  60.822 1.00 30.57 ? 71  PRO A CA    1 
ATOM   552  C  C     . PRO A 1 71  ? 46.814 89.737  61.788 1.00 30.10 ? 71  PRO A C     1 
ATOM   553  O  O     . PRO A 1 71  ? 46.430 89.000  62.687 1.00 30.37 ? 71  PRO A O     1 
ATOM   554  C  CB    . PRO A 1 71  ? 44.672 91.019  61.553 1.00 31.22 ? 71  PRO A CB    1 
ATOM   555  C  CG    . PRO A 1 71  ? 43.616 91.039  60.531 1.00 31.15 ? 71  PRO A CG    1 
ATOM   556  C  CD    . PRO A 1 71  ? 43.693 89.653  59.932 1.00 32.04 ? 71  PRO A CD    1 
ATOM   557  N  N     . GLN A 1 72  ? 48.089 90.070  61.625 1.00 31.19 ? 72  GLN A N     1 
ATOM   558  C  CA    . GLN A 1 72  ? 49.104 89.508  62.495 1.00 32.50 ? 72  GLN A CA    1 
ATOM   559  C  C     . GLN A 1 72  ? 48.951 89.860  63.967 1.00 32.80 ? 72  GLN A C     1 
ATOM   560  O  O     . GLN A 1 72  ? 49.448 89.129  64.816 1.00 33.70 ? 72  GLN A O     1 
ATOM   561  C  CB    . GLN A 1 72  ? 50.505 89.884  62.015 1.00 33.98 ? 72  GLN A CB    1 
ATOM   562  C  CG    . GLN A 1 72  ? 51.604 89.244  62.862 1.00 36.63 ? 72  GLN A CG    1 
ATOM   563  C  CD    . GLN A 1 72  ? 52.972 89.281  62.209 1.00 37.68 ? 72  GLN A CD    1 
ATOM   564  O  OE1   . GLN A 1 72  ? 53.456 90.339  61.793 1.00 38.82 ? 72  GLN A OE1   1 
ATOM   565  N  NE2   . GLN A 1 72  ? 53.611 88.119  62.127 1.00 37.60 ? 72  GLN A NE2   1 
ATOM   566  N  N     . THR A 1 73  ? 48.278 90.962  64.286 1.00 33.19 ? 73  THR A N     1 
ATOM   567  C  CA    . THR A 1 73  ? 48.094 91.317  65.695 1.00 34.80 ? 73  THR A CA    1 
ATOM   568  C  C     . THR A 1 73  ? 47.086 90.388  66.379 1.00 35.43 ? 73  THR A C     1 
ATOM   569  O  O     . THR A 1 73  ? 47.125 90.207  67.603 1.00 36.38 ? 73  THR A O     1 
ATOM   570  C  CB    . THR A 1 73  ? 47.616 92.765  65.879 1.00 34.39 ? 73  THR A CB    1 
ATOM   571  O  OG1   . THR A 1 73  ? 46.491 93.012  65.029 1.00 34.53 ? 73  THR A OG1   1 
ATOM   572  C  CG2   . THR A 1 73  ? 48.738 93.733  65.564 1.00 35.39 ? 73  THR A CG2   1 
ATOM   573  N  N     . TYR A 1 74  ? 46.181 89.808  65.592 1.00 34.37 ? 74  TYR A N     1 
ATOM   574  C  CA    . TYR A 1 74  ? 45.197 88.881  66.132 1.00 33.08 ? 74  TYR A CA    1 
ATOM   575  C  C     . TYR A 1 74  ? 45.859 87.519  66.214 1.00 34.41 ? 74  TYR A C     1 
ATOM   576  O  O     . TYR A 1 74  ? 45.205 86.505  66.463 1.00 34.30 ? 74  TYR A O     1 
ATOM   577  C  CB    . TYR A 1 74  ? 43.973 88.788  65.229 1.00 29.36 ? 74  TYR A CB    1 
ATOM   578  C  CG    . TYR A 1 74  ? 43.221 90.082  65.068 1.00 27.00 ? 74  TYR A CG    1 
ATOM   579  C  CD1   . TYR A 1 74  ? 43.188 91.028  66.093 1.00 24.46 ? 74  TYR A CD1   1 
ATOM   580  C  CD2   . TYR A 1 74  ? 42.495 90.340  63.906 1.00 26.32 ? 74  TYR A CD2   1 
ATOM   581  C  CE1   . TYR A 1 74  ? 42.447 92.197  65.962 1.00 23.87 ? 74  TYR A CE1   1 
ATOM   582  C  CE2   . TYR A 1 74  ? 41.749 91.505  63.767 1.00 24.83 ? 74  TYR A CE2   1 
ATOM   583  C  CZ    . TYR A 1 74  ? 41.729 92.424  64.798 1.00 24.03 ? 74  TYR A CZ    1 
ATOM   584  O  OH    . TYR A 1 74  ? 40.972 93.557  64.663 1.00 23.87 ? 74  TYR A OH    1 
ATOM   585  N  N     . SER A 1 75  ? 47.170 87.516  65.992 1.00 35.79 ? 75  SER A N     1 
ATOM   586  C  CA    . SER A 1 75  ? 47.983 86.306  66.030 1.00 36.75 ? 75  SER A CA    1 
ATOM   587  C  C     . SER A 1 75  ? 48.696 86.183  67.381 1.00 38.01 ? 75  SER A C     1 
ATOM   588  O  O     . SER A 1 75  ? 49.051 85.079  67.814 1.00 38.27 ? 75  SER A O     1 
ATOM   589  C  CB    . SER A 1 75  ? 49.011 86.347  64.890 1.00 34.76 ? 75  SER A CB    1 
ATOM   590  O  OG    . SER A 1 75  ? 50.018 85.366  65.054 1.00 35.13 ? 75  SER A OG    1 
ATOM   591  N  N     . ILE A 1 76  ? 48.890 87.318  68.049 1.00 37.86 ? 76  ILE A N     1 
ATOM   592  C  CA    . ILE A 1 76  ? 49.574 87.336  69.335 1.00 39.32 ? 76  ILE A CA    1 
ATOM   593  C  C     . ILE A 1 76  ? 48.710 87.912  70.443 1.00 40.33 ? 76  ILE A C     1 
ATOM   594  O  O     . ILE A 1 76  ? 47.789 88.695  70.187 1.00 41.83 ? 76  ILE A O     1 
ATOM   595  C  CB    . ILE A 1 76  ? 50.864 88.171  69.269 1.00 39.40 ? 76  ILE A CB    1 
ATOM   596  C  CG1   . ILE A 1 76  ? 50.520 89.583  68.784 1.00 40.62 ? 76  ILE A CG1   1 
ATOM   597  C  CG2   . ILE A 1 76  ? 51.888 87.487  68.372 1.00 39.44 ? 76  ILE A CG2   1 
ATOM   598  C  CD1   . ILE A 1 76  ? 51.708 90.493  68.565 1.00 41.69 ? 76  ILE A CD1   1 
ATOM   599  N  N     . ASP A 1 77  ? 49.034 87.514  71.672 1.00 39.58 ? 77  ASP A N     1 
ATOM   600  C  CA    . ASP A 1 77  ? 48.351 87.956  72.885 1.00 38.09 ? 77  ASP A CA    1 
ATOM   601  C  C     . ASP A 1 77  ? 46.831 87.817  72.911 1.00 35.23 ? 77  ASP A C     1 
ATOM   602  O  O     . ASP A 1 77  ? 46.147 88.643  73.508 1.00 34.20 ? 77  ASP A O     1 
ATOM   603  C  CB    . ASP A 1 77  ? 48.728 89.409  73.204 1.00 42.18 ? 77  ASP A CB    1 
ATOM   604  C  CG    . ASP A 1 77  ? 50.236 89.611  73.339 1.00 45.75 ? 77  ASP A CG    1 
ATOM   605  O  OD1   . ASP A 1 77  ? 50.918 88.765  73.970 1.00 45.65 ? 77  ASP A OD1   1 
ATOM   606  O  OD2   . ASP A 1 77  ? 50.734 90.632  72.818 1.00 47.85 ? 77  ASP A OD2   1 
ATOM   607  N  N     . ILE A 1 78  ? 46.307 86.782  72.261 1.00 32.63 ? 78  ILE A N     1 
ATOM   608  C  CA    . ILE A 1 78  ? 44.869 86.528  72.260 1.00 30.55 ? 78  ILE A CA    1 
ATOM   609  C  C     . ILE A 1 78  ? 44.663 85.201  72.973 1.00 31.18 ? 78  ILE A C     1 
ATOM   610  O  O     . ILE A 1 78  ? 45.179 84.170  72.538 1.00 32.09 ? 78  ILE A O     1 
ATOM   611  C  CB    . ILE A 1 78  ? 44.294 86.412  70.842 1.00 27.98 ? 78  ILE A CB    1 
ATOM   612  C  CG1   . ILE A 1 78  ? 44.464 87.736  70.097 1.00 28.44 ? 78  ILE A CG1   1 
ATOM   613  C  CG2   . ILE A 1 78  ? 42.829 86.033  70.913 1.00 25.65 ? 78  ILE A CG2   1 
ATOM   614  C  CD1   . ILE A 1 78  ? 43.767 88.914  70.741 1.00 27.08 ? 78  ILE A CD1   1 
ATOM   615  N  N     . ASN A 1 79  ? 43.912 85.230  74.070 1.00 30.48 ? 79  ASN A N     1 
ATOM   616  C  CA    . ASN A 1 79  ? 43.669 84.029  74.861 1.00 28.98 ? 79  ASN A CA    1 
ATOM   617  C  C     . ASN A 1 79  ? 42.653 83.068  74.281 1.00 28.19 ? 79  ASN A C     1 
ATOM   618  O  O     . ASN A 1 79  ? 42.770 81.860  74.465 1.00 30.93 ? 79  ASN A O     1 
ATOM   619  C  CB    . ASN A 1 79  ? 43.241 84.418  76.269 1.00 27.59 ? 79  ASN A CB    1 
ATOM   620  C  CG    . ASN A 1 79  ? 44.241 85.310  76.932 1.00 25.98 ? 79  ASN A CG    1 
ATOM   621  O  OD1   . ASN A 1 79  ? 45.404 84.956  77.052 1.00 26.42 ? 79  ASN A OD1   1 
ATOM   622  N  ND2   . ASN A 1 79  ? 43.804 86.479  77.362 1.00 27.37 ? 79  ASN A ND2   1 
ATOM   623  N  N     . GLY A 1 80  ? 41.653 83.599  73.591 1.00 26.57 ? 80  GLY A N     1 
ATOM   624  C  CA    . GLY A 1 80  ? 40.637 82.743  73.014 1.00 23.20 ? 80  GLY A CA    1 
ATOM   625  C  C     . GLY A 1 80  ? 40.081 83.309  71.732 1.00 22.20 ? 80  GLY A C     1 
ATOM   626  O  O     . GLY A 1 80  ? 40.095 84.521  71.507 1.00 21.96 ? 80  GLY A O     1 
ATOM   627  N  N     . TYR A 1 81  ? 39.585 82.423  70.883 1.00 21.29 ? 81  TYR A N     1 
ATOM   628  C  CA    . TYR A 1 81  ? 39.021 82.838  69.615 1.00 20.68 ? 81  TYR A CA    1 
ATOM   629  C  C     . TYR A 1 81  ? 37.599 82.335  69.463 1.00 19.44 ? 81  TYR A C     1 
ATOM   630  O  O     . TYR A 1 81  ? 37.260 81.229  69.889 1.00 18.00 ? 81  TYR A O     1 
ATOM   631  C  CB    . TYR A 1 81  ? 39.857 82.305  68.444 1.00 23.45 ? 81  TYR A CB    1 
ATOM   632  C  CG    . TYR A 1 81  ? 41.256 82.872  68.345 1.00 27.51 ? 81  TYR A CG    1 
ATOM   633  C  CD1   . TYR A 1 81  ? 42.297 82.356  69.116 1.00 30.17 ? 81  TYR A CD1   1 
ATOM   634  C  CD2   . TYR A 1 81  ? 41.538 83.933  67.484 1.00 29.16 ? 81  TYR A CD2   1 
ATOM   635  C  CE1   . TYR A 1 81  ? 43.585 82.880  69.034 1.00 31.40 ? 81  TYR A CE1   1 
ATOM   636  C  CE2   . TYR A 1 81  ? 42.817 84.466  67.393 1.00 31.56 ? 81  TYR A CE2   1 
ATOM   637  C  CZ    . TYR A 1 81  ? 43.838 83.935  68.172 1.00 32.97 ? 81  TYR A CZ    1 
ATOM   638  O  OH    . TYR A 1 81  ? 45.107 84.462  68.090 1.00 34.30 ? 81  TYR A OH    1 
ATOM   639  N  N     . ILE A 1 82  ? 36.763 83.170  68.863 1.00 18.61 ? 82  ILE A N     1 
ATOM   640  C  CA    . ILE A 1 82  ? 35.387 82.802  68.600 1.00 15.95 ? 82  ILE A CA    1 
ATOM   641  C  C     . ILE A 1 82  ? 35.205 82.987  67.098 1.00 15.70 ? 82  ILE A C     1 
ATOM   642  O  O     . ILE A 1 82  ? 35.230 84.104  66.580 1.00 13.08 ? 82  ILE A O     1 
ATOM   643  C  CB    . ILE A 1 82  ? 34.400 83.674  69.395 1.00 13.86 ? 82  ILE A CB    1 
ATOM   644  C  CG1   . ILE A 1 82  ? 34.742 83.599  70.890 1.00 11.96 ? 82  ILE A CG1   1 
ATOM   645  C  CG2   . ILE A 1 82  ? 32.985 83.176  69.170 1.00 14.62 ? 82  ILE A CG2   1 
ATOM   646  C  CD1   . ILE A 1 82  ? 33.820 84.367  71.807 1.00 8.09  ? 82  ILE A CD1   1 
ATOM   647  N  N     . LEU A 1 83  ? 35.097 81.860  66.401 1.00 17.44 ? 83  LEU A N     1 
ATOM   648  C  CA    . LEU A 1 83  ? 34.915 81.835  64.953 1.00 17.82 ? 83  LEU A CA    1 
ATOM   649  C  C     . LEU A 1 83  ? 33.440 81.590  64.666 1.00 17.18 ? 83  LEU A C     1 
ATOM   650  O  O     . LEU A 1 83  ? 32.967 80.456  64.700 1.00 16.43 ? 83  LEU A O     1 
ATOM   651  C  CB    . LEU A 1 83  ? 35.786 80.732  64.340 1.00 18.49 ? 83  LEU A CB    1 
ATOM   652  C  CG    . LEU A 1 83  ? 37.185 81.143  63.846 1.00 18.36 ? 83  LEU A CG    1 
ATOM   653  C  CD1   . LEU A 1 83  ? 37.888 82.008  64.868 1.00 18.61 ? 83  LEU A CD1   1 
ATOM   654  C  CD2   . LEU A 1 83  ? 37.997 79.902  63.550 1.00 16.85 ? 83  LEU A CD2   1 
ATOM   655  N  N     . VAL A 1 84  ? 32.727 82.675  64.386 1.00 17.08 ? 84  VAL A N     1 
ATOM   656  C  CA    . VAL A 1 84  ? 31.294 82.627  64.139 1.00 17.72 ? 84  VAL A CA    1 
ATOM   657  C  C     . VAL A 1 84  ? 30.890 82.682  62.670 1.00 18.61 ? 84  VAL A C     1 
ATOM   658  O  O     . VAL A 1 84  ? 31.491 83.405  61.874 1.00 19.27 ? 84  VAL A O     1 
ATOM   659  C  CB    . VAL A 1 84  ? 30.573 83.789  64.913 1.00 15.88 ? 84  VAL A CB    1 
ATOM   660  C  CG1   . VAL A 1 84  ? 31.044 85.123  64.415 1.00 13.47 ? 84  VAL A CG1   1 
ATOM   661  C  CG2   . VAL A 1 84  ? 29.077 83.688  64.754 1.00 15.58 ? 84  VAL A CG2   1 
ATOM   662  N  N     . TYR A 1 85  ? 29.879 81.889  62.320 1.00 19.24 ? 85  TYR A N     1 
ATOM   663  C  CA    . TYR A 1 85  ? 29.334 81.863  60.966 1.00 19.63 ? 85  TYR A CA    1 
ATOM   664  C  C     . TYR A 1 85  ? 27.825 82.001  61.114 1.00 21.38 ? 85  TYR A C     1 
ATOM   665  O  O     . TYR A 1 85  ? 27.287 81.864  62.216 1.00 21.22 ? 85  TYR A O     1 
ATOM   666  C  CB    . TYR A 1 85  ? 29.675 80.553  60.243 1.00 17.86 ? 85  TYR A CB    1 
ATOM   667  C  CG    . TYR A 1 85  ? 29.054 79.306  60.834 1.00 18.62 ? 85  TYR A CG    1 
ATOM   668  C  CD1   . TYR A 1 85  ? 27.766 78.906  60.488 1.00 17.84 ? 85  TYR A CD1   1 
ATOM   669  C  CD2   . TYR A 1 85  ? 29.766 78.513  61.737 1.00 20.99 ? 85  TYR A CD2   1 
ATOM   670  C  CE1   . TYR A 1 85  ? 27.204 77.741  61.027 1.00 17.86 ? 85  TYR A CE1   1 
ATOM   671  C  CE2   . TYR A 1 85  ? 29.213 77.346  62.282 1.00 19.08 ? 85  TYR A CE2   1 
ATOM   672  C  CZ    . TYR A 1 85  ? 27.938 76.968  61.920 1.00 18.72 ? 85  TYR A CZ    1 
ATOM   673  O  OH    . TYR A 1 85  ? 27.409 75.811  62.438 1.00 20.08 ? 85  TYR A OH    1 
ATOM   674  N  N     . SER A 1 86  ? 27.147 82.298  60.014 1.00 23.10 ? 86  SER A N     1 
ATOM   675  C  CA    . SER A 1 86  ? 25.695 82.430  60.036 1.00 23.63 ? 86  SER A CA    1 
ATOM   676  C  C     . SER A 1 86  ? 25.090 81.170  59.435 1.00 24.55 ? 86  SER A C     1 
ATOM   677  O  O     . SER A 1 86  ? 25.452 80.773  58.322 1.00 24.75 ? 86  SER A O     1 
ATOM   678  C  CB    . SER A 1 86  ? 25.253 83.638  59.220 1.00 23.81 ? 86  SER A CB    1 
ATOM   679  O  OG    . SER A 1 86  ? 23.845 83.661  59.117 1.00 25.58 ? 86  SER A OG    1 
ATOM   680  N  N     . VAL A 1 87  ? 24.178 80.540  60.172 1.00 24.21 ? 87  VAL A N     1 
ATOM   681  C  CA    . VAL A 1 87  ? 23.533 79.318  59.705 1.00 23.43 ? 87  VAL A CA    1 
ATOM   682  C  C     . VAL A 1 87  ? 22.607 79.614  58.522 1.00 24.68 ? 87  VAL A C     1 
ATOM   683  O  O     . VAL A 1 87  ? 21.968 78.716  57.968 1.00 25.91 ? 87  VAL A O     1 
ATOM   684  C  CB    . VAL A 1 87  ? 22.712 78.671  60.826 1.00 21.41 ? 87  VAL A CB    1 
ATOM   685  C  CG1   . VAL A 1 87  ? 23.589 78.450  62.038 1.00 21.76 ? 87  VAL A CG1   1 
ATOM   686  C  CG2   . VAL A 1 87  ? 21.530 79.548  61.176 1.00 19.91 ? 87  VAL A CG2   1 
ATOM   687  N  N     . THR A 1 88  ? 22.537 80.883  58.141 1.00 24.17 ? 88  THR A N     1 
ATOM   688  C  CA    . THR A 1 88  ? 21.695 81.290  57.030 1.00 24.20 ? 88  THR A CA    1 
ATOM   689  C  C     . THR A 1 88  ? 22.569 81.691  55.849 1.00 23.49 ? 88  THR A C     1 
ATOM   690  O  O     . THR A 1 88  ? 22.118 82.384  54.948 1.00 24.11 ? 88  THR A O     1 
ATOM   691  C  CB    . THR A 1 88  ? 20.800 82.488  57.424 1.00 25.05 ? 88  THR A CB    1 
ATOM   692  O  OG1   . THR A 1 88  ? 21.583 83.687  57.478 1.00 24.32 ? 88  THR A OG1   1 
ATOM   693  C  CG2   . THR A 1 88  ? 20.169 82.248  58.792 1.00 25.72 ? 88  THR A CG2   1 
ATOM   694  N  N     . SER A 1 89  ? 23.820 81.245  55.862 1.00 24.02 ? 89  SER A N     1 
ATOM   695  C  CA    . SER A 1 89  ? 24.770 81.572  54.802 1.00 23.55 ? 89  SER A CA    1 
ATOM   696  C  C     . SER A 1 89  ? 25.840 80.502  54.583 1.00 23.37 ? 89  SER A C     1 
ATOM   697  O  O     . SER A 1 89  ? 26.738 80.328  55.404 1.00 21.59 ? 89  SER A O     1 
ATOM   698  C  CB    . SER A 1 89  ? 25.460 82.899  55.120 1.00 24.27 ? 89  SER A CB    1 
ATOM   699  O  OG    . SER A 1 89  ? 26.437 83.209  54.139 1.00 25.73 ? 89  SER A OG    1 
ATOM   700  N  N     . ILE A 1 90  ? 25.747 79.790  53.469 1.00 24.05 ? 90  ILE A N     1 
ATOM   701  C  CA    . ILE A 1 90  ? 26.736 78.768  53.162 1.00 25.61 ? 90  ILE A CA    1 
ATOM   702  C  C     . ILE A 1 90  ? 28.103 79.424  52.956 1.00 25.96 ? 90  ILE A C     1 
ATOM   703  O  O     . ILE A 1 90  ? 29.139 78.824  53.238 1.00 26.93 ? 90  ILE A O     1 
ATOM   704  C  CB    . ILE A 1 90  ? 26.332 77.978  51.907 1.00 25.28 ? 90  ILE A CB    1 
ATOM   705  C  CG1   . ILE A 1 90  ? 25.231 76.980  52.265 1.00 25.66 ? 90  ILE A CG1   1 
ATOM   706  C  CG2   . ILE A 1 90  ? 27.526 77.256  51.332 1.00 26.82 ? 90  ILE A CG2   1 
ATOM   707  C  CD1   . ILE A 1 90  ? 24.697 76.212  51.072 1.00 27.45 ? 90  ILE A CD1   1 
ATOM   708  N  N     . LYS A 1 91  ? 28.098 80.664  52.475 1.00 25.95 ? 91  LYS A N     1 
ATOM   709  C  CA    . LYS A 1 91  ? 29.332 81.410  52.251 1.00 24.62 ? 91  LYS A CA    1 
ATOM   710  C  C     . LYS A 1 91  ? 30.080 81.657  53.562 1.00 25.02 ? 91  LYS A C     1 
ATOM   711  O  O     . LYS A 1 91  ? 31.299 81.514  53.635 1.00 26.19 ? 91  LYS A O     1 
ATOM   712  C  CB    . LYS A 1 91  ? 29.029 82.752  51.599 1.00 22.92 ? 91  LYS A CB    1 
ATOM   713  C  CG    . LYS A 1 91  ? 30.276 83.550  51.283 1.00 21.66 ? 91  LYS A CG    1 
ATOM   714  C  CD    . LYS A 1 91  ? 31.183 82.779  50.343 1.00 19.40 ? 91  LYS A CD    1 
ATOM   715  C  CE    . LYS A 1 91  ? 32.341 83.635  49.859 1.00 21.02 ? 91  LYS A CE    1 
ATOM   716  N  NZ    . LYS A 1 91  ? 33.208 82.892  48.896 1.00 20.21 ? 91  LYS A NZ    1 
ATOM   717  N  N     . SER A 1 92  ? 29.357 82.046  54.600 1.00 23.22 ? 92  SER A N     1 
ATOM   718  C  CA    . SER A 1 92  ? 30.007 82.278  55.874 1.00 22.33 ? 92  SER A CA    1 
ATOM   719  C  C     . SER A 1 92  ? 30.657 80.976  56.339 1.00 22.04 ? 92  SER A C     1 
ATOM   720  O  O     . SER A 1 92  ? 31.791 80.977  56.833 1.00 21.37 ? 92  SER A O     1 
ATOM   721  C  CB    . SER A 1 92  ? 28.991 82.767  56.916 1.00 22.34 ? 92  SER A CB    1 
ATOM   722  O  OG    . SER A 1 92  ? 27.914 81.861  57.069 1.00 21.19 ? 92  SER A OG    1 
ATOM   723  N  N     . PHE A 1 93  ? 29.941 79.867  56.158 1.00 21.36 ? 93  PHE A N     1 
ATOM   724  C  CA    . PHE A 1 93  ? 30.433 78.557  56.575 1.00 19.82 ? 93  PHE A CA    1 
ATOM   725  C  C     . PHE A 1 93  ? 31.709 78.220  55.839 1.00 21.27 ? 93  PHE A C     1 
ATOM   726  O  O     . PHE A 1 93  ? 32.685 77.782  56.440 1.00 22.60 ? 93  PHE A O     1 
ATOM   727  C  CB    . PHE A 1 93  ? 29.393 77.471  56.302 1.00 18.04 ? 93  PHE A CB    1 
ATOM   728  C  CG    . PHE A 1 93  ? 29.633 76.203  57.073 1.00 16.80 ? 93  PHE A CG    1 
ATOM   729  C  CD1   . PHE A 1 93  ? 29.675 76.218  58.463 1.00 16.68 ? 93  PHE A CD1   1 
ATOM   730  C  CD2   . PHE A 1 93  ? 29.837 74.999  56.418 1.00 15.49 ? 93  PHE A CD2   1 
ATOM   731  C  CE1   . PHE A 1 93  ? 29.920 75.050  59.188 1.00 15.84 ? 93  PHE A CE1   1 
ATOM   732  C  CE2   . PHE A 1 93  ? 30.083 73.826  57.136 1.00 15.50 ? 93  PHE A CE2   1 
ATOM   733  C  CZ    . PHE A 1 93  ? 30.125 73.854  58.522 1.00 15.07 ? 93  PHE A CZ    1 
ATOM   734  N  N     . GLU A 1 94  ? 31.699 78.431  54.531 1.00 22.23 ? 94  GLU A N     1 
ATOM   735  C  CA    . GLU A 1 94  ? 32.869 78.150  53.722 1.00 22.90 ? 94  GLU A CA    1 
ATOM   736  C  C     . GLU A 1 94  ? 34.029 79.015  54.180 1.00 22.66 ? 94  GLU A C     1 
ATOM   737  O  O     . GLU A 1 94  ? 35.132 78.519  54.422 1.00 23.51 ? 94  GLU A O     1 
ATOM   738  C  CB    . GLU A 1 94  ? 32.555 78.417  52.255 1.00 24.67 ? 94  GLU A CB    1 
ATOM   739  C  CG    . GLU A 1 94  ? 31.411 77.572  51.748 1.00 30.10 ? 94  GLU A CG    1 
ATOM   740  C  CD    . GLU A 1 94  ? 30.942 77.984  50.375 1.00 33.96 ? 94  GLU A CD    1 
ATOM   741  O  OE1   . GLU A 1 94  ? 30.684 79.190  50.177 1.00 36.20 ? 94  GLU A OE1   1 
ATOM   742  O  OE2   . GLU A 1 94  ? 30.819 77.101  49.498 1.00 37.27 ? 94  GLU A OE2   1 
ATOM   743  N  N     . VAL A 1 95  ? 33.772 80.311  54.314 1.00 22.30 ? 95  VAL A N     1 
ATOM   744  C  CA    . VAL A 1 95  ? 34.805 81.247  54.731 1.00 21.37 ? 95  VAL A CA    1 
ATOM   745  C  C     . VAL A 1 95  ? 35.440 80.928  56.086 1.00 20.70 ? 95  VAL A C     1 
ATOM   746  O  O     . VAL A 1 95  ? 36.663 80.961  56.219 1.00 20.54 ? 95  VAL A O     1 
ATOM   747  C  CB    . VAL A 1 95  ? 34.257 82.699  54.726 1.00 22.53 ? 95  VAL A CB    1 
ATOM   748  C  CG1   . VAL A 1 95  ? 35.056 83.581  55.680 1.00 22.52 ? 95  VAL A CG1   1 
ATOM   749  C  CG2   . VAL A 1 95  ? 34.333 83.269  53.307 1.00 20.48 ? 95  VAL A CG2   1 
ATOM   750  N  N     . ILE A 1 96  ? 34.629 80.600  57.086 1.00 19.96 ? 96  ILE A N     1 
ATOM   751  C  CA    . ILE A 1 96  ? 35.179 80.311  58.404 1.00 18.71 ? 96  ILE A CA    1 
ATOM   752  C  C     . ILE A 1 96  ? 36.216 79.186  58.376 1.00 17.96 ? 96  ILE A C     1 
ATOM   753  O  O     . ILE A 1 96  ? 37.136 79.174  59.190 1.00 18.44 ? 96  ILE A O     1 
ATOM   754  C  CB    . ILE A 1 96  ? 34.064 79.961  59.417 1.00 20.24 ? 96  ILE A CB    1 
ATOM   755  C  CG1   . ILE A 1 96  ? 34.572 80.187  60.845 1.00 17.60 ? 96  ILE A CG1   1 
ATOM   756  C  CG2   . ILE A 1 96  ? 33.615 78.512  59.234 1.00 22.29 ? 96  ILE A CG2   1 
ATOM   757  C  CD1   . ILE A 1 96  ? 34.952 81.618  61.127 1.00 16.25 ? 96  ILE A CD1   1 
ATOM   758  N  N     . LYS A 1 97  ? 36.073 78.242  57.449 1.00 16.76 ? 97  LYS A N     1 
ATOM   759  C  CA    . LYS A 1 97  ? 37.037 77.146  57.340 1.00 15.73 ? 97  LYS A CA    1 
ATOM   760  C  C     . LYS A 1 97  ? 38.394 77.702  56.891 1.00 16.26 ? 97  LYS A C     1 
ATOM   761  O  O     . LYS A 1 97  ? 39.450 77.215  57.309 1.00 15.69 ? 97  LYS A O     1 
ATOM   762  C  CB    . LYS A 1 97  ? 36.541 76.102  56.346 1.00 13.43 ? 97  LYS A CB    1 
ATOM   763  C  CG    . LYS A 1 97  ? 35.257 75.417  56.774 1.00 15.53 ? 97  LYS A CG    1 
ATOM   764  C  CD    . LYS A 1 97  ? 34.646 74.603  55.637 1.00 16.67 ? 97  LYS A CD    1 
ATOM   765  C  CE    . LYS A 1 97  ? 33.459 73.779  56.114 1.00 19.37 ? 97  LYS A CE    1 
ATOM   766  N  NZ    . LYS A 1 97  ? 32.917 72.853  55.070 1.00 20.82 ? 97  LYS A NZ    1 
ATOM   767  N  N     . VAL A 1 98  ? 38.360 78.730  56.045 1.00 16.91 ? 98  VAL A N     1 
ATOM   768  C  CA    . VAL A 1 98  ? 39.583 79.371  55.565 1.00 16.92 ? 98  VAL A CA    1 
ATOM   769  C  C     . VAL A 1 98  ? 40.221 80.204  56.688 1.00 17.85 ? 98  VAL A C     1 
ATOM   770  O  O     . VAL A 1 98  ? 41.412 80.070  56.983 1.00 18.89 ? 98  VAL A O     1 
ATOM   771  C  CB    . VAL A 1 98  ? 39.299 80.305  54.378 1.00 15.29 ? 98  VAL A CB    1 
ATOM   772  C  CG1   . VAL A 1 98  ? 40.588 80.964  53.924 1.00 15.23 ? 98  VAL A CG1   1 
ATOM   773  C  CG2   . VAL A 1 98  ? 38.670 79.533  53.249 1.00 14.99 ? 98  VAL A CG2   1 
ATOM   774  N  N     . ILE A 1 99  ? 39.428 81.074  57.306 1.00 17.58 ? 99  ILE A N     1 
ATOM   775  C  CA    . ILE A 1 99  ? 39.933 81.899  58.392 1.00 16.45 ? 99  ILE A CA    1 
ATOM   776  C  C     . ILE A 1 99  ? 40.552 80.982  59.441 1.00 15.99 ? 99  ILE A C     1 
ATOM   777  O  O     . ILE A 1 99  ? 41.634 81.241  59.940 1.00 15.57 ? 99  ILE A O     1 
ATOM   778  C  CB    . ILE A 1 99  ? 38.803 82.740  59.026 1.00 15.57 ? 99  ILE A CB    1 
ATOM   779  C  CG1   . ILE A 1 99  ? 38.244 83.718  57.987 1.00 14.24 ? 99  ILE A CG1   1 
ATOM   780  C  CG2   . ILE A 1 99  ? 39.329 83.495  60.241 1.00 15.60 ? 99  ILE A CG2   1 
ATOM   781  C  CD1   . ILE A 1 99  ? 37.094 84.578  58.485 1.00 13.78 ? 99  ILE A CD1   1 
ATOM   782  N  N     . HIS A 1 100 ? 39.865 79.897  59.767 1.00 17.67 ? 100 HIS A N     1 
ATOM   783  C  CA    . HIS A 1 100 ? 40.393 78.962  60.741 1.00 20.78 ? 100 HIS A CA    1 
ATOM   784  C  C     . HIS A 1 100 ? 41.741 78.413  60.274 1.00 23.32 ? 100 HIS A C     1 
ATOM   785  O  O     . HIS A 1 100 ? 42.682 78.274  61.066 1.00 22.99 ? 100 HIS A O     1 
ATOM   786  C  CB    . HIS A 1 100 ? 39.428 77.801  60.967 1.00 19.67 ? 100 HIS A CB    1 
ATOM   787  C  CG    . HIS A 1 100 ? 40.007 76.715  61.817 1.00 22.97 ? 100 HIS A CG    1 
ATOM   788  N  ND1   . HIS A 1 100 ? 40.703 75.650  61.288 1.00 24.12 ? 100 HIS A ND1   1 
ATOM   789  C  CD2   . HIS A 1 100 ? 40.059 76.567  63.163 1.00 25.08 ? 100 HIS A CD2   1 
ATOM   790  C  CE1   . HIS A 1 100 ? 41.156 74.891  62.271 1.00 25.01 ? 100 HIS A CE1   1 
ATOM   791  N  NE2   . HIS A 1 100 ? 40.780 75.426  63.419 1.00 25.46 ? 100 HIS A NE2   1 
ATOM   792  N  N     . GLY A 1 101 ? 41.826 78.085  58.988 1.00 24.93 ? 101 GLY A N     1 
ATOM   793  C  CA    . GLY A 1 101 ? 43.064 77.561  58.454 1.00 26.55 ? 101 GLY A CA    1 
ATOM   794  C  C     . GLY A 1 101 ? 44.192 78.549  58.680 1.00 28.40 ? 101 GLY A C     1 
ATOM   795  O  O     . GLY A 1 101 ? 45.219 78.215  59.276 1.00 29.55 ? 101 GLY A O     1 
ATOM   796  N  N     . LYS A 1 102 ? 43.997 79.777  58.209 1.00 28.92 ? 102 LYS A N     1 
ATOM   797  C  CA    . LYS A 1 102 ? 45.005 80.818  58.349 1.00 28.50 ? 102 LYS A CA    1 
ATOM   798  C  C     . LYS A 1 102 ? 45.367 81.016  59.810 1.00 29.26 ? 102 LYS A C     1 
ATOM   799  O  O     . LYS A 1 102 ? 46.538 80.939  60.177 1.00 30.08 ? 102 LYS A O     1 
ATOM   800  C  CB    . LYS A 1 102 ? 44.489 82.119  57.740 1.00 28.16 ? 102 LYS A CB    1 
ATOM   801  C  CG    . LYS A 1 102 ? 44.160 81.988  56.260 1.00 28.08 ? 102 LYS A CG    1 
ATOM   802  C  CD    . LYS A 1 102 ? 43.609 83.277  55.700 1.00 30.22 ? 102 LYS A CD    1 
ATOM   803  C  CE    . LYS A 1 102 ? 43.209 83.117  54.246 1.00 30.27 ? 102 LYS A CE    1 
ATOM   804  N  NZ    . LYS A 1 102 ? 42.460 84.317  53.772 1.00 31.69 ? 102 LYS A NZ    1 
ATOM   805  N  N     . LEU A 1 103 ? 44.357 81.258  60.641 1.00 29.36 ? 103 LEU A N     1 
ATOM   806  C  CA    . LEU A 1 103 ? 44.562 81.452  62.070 1.00 29.26 ? 103 LEU A CA    1 
ATOM   807  C  C     . LEU A 1 103 ? 45.531 80.425  62.646 1.00 30.68 ? 103 LEU A C     1 
ATOM   808  O  O     . LEU A 1 103 ? 46.507 80.789  63.306 1.00 30.47 ? 103 LEU A O     1 
ATOM   809  C  CB    . LEU A 1 103 ? 43.228 81.371  62.806 1.00 28.83 ? 103 LEU A CB    1 
ATOM   810  C  CG    . LEU A 1 103 ? 43.291 81.267  64.332 1.00 30.41 ? 103 LEU A CG    1 
ATOM   811  C  CD1   . LEU A 1 103 ? 44.154 82.380  64.917 1.00 29.26 ? 103 LEU A CD1   1 
ATOM   812  C  CD2   . LEU A 1 103 ? 41.882 81.335  64.889 1.00 30.78 ? 103 LEU A CD2   1 
ATOM   813  N  N     . LEU A 1 104 ? 45.272 79.145  62.399 1.00 31.56 ? 104 LEU A N     1 
ATOM   814  C  CA    . LEU A 1 104 ? 46.152 78.106  62.911 1.00 33.63 ? 104 LEU A CA    1 
ATOM   815  C  C     . LEU A 1 104 ? 47.581 78.255  62.414 1.00 35.75 ? 104 LEU A C     1 
ATOM   816  O  O     . LEU A 1 104 ? 48.531 78.093  63.182 1.00 36.22 ? 104 LEU A O     1 
ATOM   817  C  CB    . LEU A 1 104 ? 45.631 76.713  62.552 1.00 33.53 ? 104 LEU A CB    1 
ATOM   818  C  CG    . LEU A 1 104 ? 44.533 76.157  63.467 1.00 35.27 ? 104 LEU A CG    1 
ATOM   819  C  CD1   . LEU A 1 104 ? 44.374 74.662  63.233 1.00 34.63 ? 104 LEU A CD1   1 
ATOM   820  C  CD2   . LEU A 1 104 ? 44.903 76.402  64.922 1.00 34.23 ? 104 LEU A CD2   1 
ATOM   821  N  N     . ASP A 1 105 ? 47.744 78.553  61.131 1.00 37.98 ? 105 ASP A N     1 
ATOM   822  C  CA    . ASP A 1 105 ? 49.086 78.717  60.584 1.00 41.19 ? 105 ASP A CA    1 
ATOM   823  C  C     . ASP A 1 105 ? 49.786 79.840  61.338 1.00 42.12 ? 105 ASP A C     1 
ATOM   824  O  O     . ASP A 1 105 ? 50.802 79.626  61.997 1.00 42.92 ? 105 ASP A O     1 
ATOM   825  C  CB    . ASP A 1 105 ? 49.021 79.050  59.088 1.00 42.30 ? 105 ASP A CB    1 
ATOM   826  C  CG    . ASP A 1 105 ? 48.699 77.834  58.227 1.00 43.24 ? 105 ASP A CG    1 
ATOM   827  O  OD1   . ASP A 1 105 ? 48.352 78.026  57.039 1.00 43.05 ? 105 ASP A OD1   1 
ATOM   828  O  OD2   . ASP A 1 105 ? 48.802 76.692  58.731 1.00 42.54 ? 105 ASP A OD2   1 
ATOM   829  N  N     . MET A 1 106 ? 49.217 81.034  61.245 1.00 43.02 ? 106 MET A N     1 
ATOM   830  C  CA    . MET A 1 106 ? 49.757 82.216  61.903 1.00 43.42 ? 106 MET A CA    1 
ATOM   831  C  C     . MET A 1 106 ? 50.273 81.904  63.310 1.00 44.84 ? 106 MET A C     1 
ATOM   832  O  O     . MET A 1 106 ? 51.474 81.934  63.560 1.00 44.87 ? 106 MET A O     1 
ATOM   833  C  CB    . MET A 1 106 ? 48.670 83.287  61.991 1.00 41.52 ? 106 MET A CB    1 
ATOM   834  C  CG    . MET A 1 106 ? 49.174 84.714  61.947 1.00 39.83 ? 106 MET A CG    1 
ATOM   835  S  SD    . MET A 1 106 ? 49.382 85.306  60.266 1.00 36.47 ? 106 MET A SD    1 
ATOM   836  C  CE    . MET A 1 106 ? 50.239 86.866  60.522 1.00 36.57 ? 106 MET A CE    1 
ATOM   837  N  N     . VAL A 1 107 ? 49.349 81.594  64.216 1.00 47.25 ? 107 VAL A N     1 
ATOM   838  C  CA    . VAL A 1 107 ? 49.667 81.300  65.616 1.00 48.33 ? 107 VAL A CA    1 
ATOM   839  C  C     . VAL A 1 107 ? 50.724 80.220  65.856 1.00 49.66 ? 107 VAL A C     1 
ATOM   840  O  O     . VAL A 1 107 ? 51.175 80.030  66.988 1.00 49.72 ? 107 VAL A O     1 
ATOM   841  C  CB    . VAL A 1 107 ? 48.384 80.908  66.408 1.00 46.62 ? 107 VAL A CB    1 
ATOM   842  C  CG1   . VAL A 1 107 ? 47.322 81.973  66.226 1.00 45.42 ? 107 VAL A CG1   1 
ATOM   843  C  CG2   . VAL A 1 107 ? 47.868 79.555  65.952 1.00 44.63 ? 107 VAL A CG2   1 
ATOM   844  N  N     . GLY A 1 108 ? 51.122 79.514  64.804 1.00 51.18 ? 108 GLY A N     1 
ATOM   845  C  CA    . GLY A 1 108 ? 52.114 78.469  64.976 1.00 53.83 ? 108 GLY A CA    1 
ATOM   846  C  C     . GLY A 1 108 ? 51.564 77.372  65.863 1.00 55.79 ? 108 GLY A C     1 
ATOM   847  O  O     . GLY A 1 108 ? 50.377 77.063  65.781 1.00 56.14 ? 108 GLY A O     1 
ATOM   848  N  N     . LYS A 1 109 ? 52.403 76.783  66.713 1.00 57.80 ? 109 LYS A N     1 
ATOM   849  C  CA    . LYS A 1 109 ? 51.922 75.720  67.587 1.00 60.55 ? 109 LYS A CA    1 
ATOM   850  C  C     . LYS A 1 109 ? 51.807 76.139  69.046 1.00 60.82 ? 109 LYS A C     1 
ATOM   851  O  O     . LYS A 1 109 ? 52.765 76.069  69.817 1.00 61.19 ? 109 LYS A O     1 
ATOM   852  C  CB    . LYS A 1 109 ? 52.795 74.457  67.468 1.00 62.71 ? 109 LYS A CB    1 
ATOM   853  C  CG    . LYS A 1 109 ? 54.199 74.539  68.069 1.00 65.73 ? 109 LYS A CG    1 
ATOM   854  C  CD    . LYS A 1 109 ? 54.820 73.139  68.169 1.00 67.50 ? 109 LYS A CD    1 
ATOM   855  C  CE    . LYS A 1 109 ? 56.221 73.159  68.781 1.00 68.46 ? 109 LYS A CE    1 
ATOM   856  N  NZ    . LYS A 1 109 ? 56.237 73.592  70.206 1.00 68.47 ? 109 LYS A NZ    1 
ATOM   857  N  N     . VAL A 1 110 ? 50.611 76.583  69.410 1.00 60.95 ? 110 VAL A N     1 
ATOM   858  C  CA    . VAL A 1 110 ? 50.320 77.006  70.769 1.00 61.11 ? 110 VAL A CA    1 
ATOM   859  C  C     . VAL A 1 110 ? 48.904 76.568  71.117 1.00 60.96 ? 110 VAL A C     1 
ATOM   860  O  O     . VAL A 1 110 ? 48.000 76.616  70.278 1.00 61.37 ? 110 VAL A O     1 
ATOM   861  C  CB    . VAL A 1 110 ? 50.444 78.544  70.933 1.00 61.11 ? 110 VAL A CB    1 
ATOM   862  C  CG1   . VAL A 1 110 ? 49.923 78.970  72.296 1.00 60.91 ? 110 VAL A CG1   1 
ATOM   863  C  CG2   . VAL A 1 110 ? 51.897 78.967  70.789 1.00 60.46 ? 110 VAL A CG2   1 
ATOM   864  N  N     . GLN A 1 111 ? 48.726 76.125  72.355 1.00 60.36 ? 111 GLN A N     1 
ATOM   865  C  CA    . GLN A 1 111 ? 47.430 75.669  72.828 1.00 59.45 ? 111 GLN A CA    1 
ATOM   866  C  C     . GLN A 1 111 ? 46.479 76.828  73.097 1.00 57.28 ? 111 GLN A C     1 
ATOM   867  O  O     . GLN A 1 111 ? 46.285 77.231  74.248 1.00 57.82 ? 111 GLN A O     1 
ATOM   868  C  CB    . GLN A 1 111 ? 47.598 74.833  74.102 1.00 62.78 ? 111 GLN A CB    1 
ATOM   869  C  CG    . GLN A 1 111 ? 48.068 73.402  73.865 1.00 65.53 ? 111 GLN A CG    1 
ATOM   870  C  CD    . GLN A 1 111 ? 47.012 72.552  73.177 1.00 67.71 ? 111 GLN A CD    1 
ATOM   871  O  OE1   . GLN A 1 111 ? 46.562 72.874  72.075 1.00 68.87 ? 111 GLN A OE1   1 
ATOM   872  N  NE2   . GLN A 1 111 ? 46.611 71.460  73.825 1.00 68.32 ? 111 GLN A NE2   1 
ATOM   873  N  N     . ILE A 1 112 ? 45.893 77.366  72.029 1.00 52.98 ? 112 ILE A N     1 
ATOM   874  C  CA    . ILE A 1 112 ? 44.938 78.462  72.153 1.00 47.76 ? 112 ILE A CA    1 
ATOM   875  C  C     . ILE A 1 112 ? 43.525 77.939  71.922 1.00 42.64 ? 112 ILE A C     1 
ATOM   876  O  O     . ILE A 1 112 ? 43.253 77.282  70.916 1.00 41.60 ? 112 ILE A O     1 
ATOM   877  C  CB    . ILE A 1 112 ? 45.242 79.606  71.152 1.00 49.38 ? 112 ILE A CB    1 
ATOM   878  C  CG1   . ILE A 1 112 ? 45.871 79.046  69.867 1.00 50.42 ? 112 ILE A CG1   1 
ATOM   879  C  CG2   . ILE A 1 112 ? 46.163 80.631  71.804 1.00 49.07 ? 112 ILE A CG2   1 
ATOM   880  C  CD1   . ILE A 1 112 ? 44.915 78.292  68.963 1.00 50.54 ? 112 ILE A CD1   1 
ATOM   881  N  N     . PRO A 1 113 ? 42.614 78.198  72.875 1.00 37.66 ? 113 PRO A N     1 
ATOM   882  C  CA    . PRO A 1 113 ? 41.221 77.756  72.784 1.00 33.60 ? 113 PRO A CA    1 
ATOM   883  C  C     . PRO A 1 113 ? 40.523 78.319  71.561 1.00 30.50 ? 113 PRO A C     1 
ATOM   884  O  O     . PRO A 1 113 ? 40.625 79.504  71.264 1.00 28.73 ? 113 PRO A O     1 
ATOM   885  C  CB    . PRO A 1 113 ? 40.607 78.273  74.079 1.00 32.88 ? 113 PRO A CB    1 
ATOM   886  C  CG    . PRO A 1 113 ? 41.745 78.221  75.023 1.00 35.33 ? 113 PRO A CG    1 
ATOM   887  C  CD    . PRO A 1 113 ? 42.883 78.775  74.202 1.00 36.65 ? 113 PRO A CD    1 
ATOM   888  N  N     . ILE A 1 114 ? 39.821 77.450  70.852 1.00 28.36 ? 114 ILE A N     1 
ATOM   889  C  CA    . ILE A 1 114 ? 39.087 77.846  69.665 1.00 28.66 ? 114 ILE A CA    1 
ATOM   890  C  C     . ILE A 1 114 ? 37.691 77.236  69.693 1.00 27.84 ? 114 ILE A C     1 
ATOM   891  O  O     . ILE A 1 114 ? 37.532 76.030  69.885 1.00 28.78 ? 114 ILE A O     1 
ATOM   892  C  CB    . ILE A 1 114 ? 39.821 77.401  68.382 1.00 29.17 ? 114 ILE A CB    1 
ATOM   893  C  CG1   . ILE A 1 114 ? 40.906 78.413  68.041 1.00 30.83 ? 114 ILE A CG1   1 
ATOM   894  C  CG2   . ILE A 1 114 ? 38.861 77.294  67.219 1.00 30.15 ? 114 ILE A CG2   1 
ATOM   895  C  CD1   . ILE A 1 114 ? 41.565 78.144  66.714 1.00 33.93 ? 114 ILE A CD1   1 
ATOM   896  N  N     . MET A 1 115 ? 36.678 78.076  69.519 1.00 24.79 ? 115 MET A N     1 
ATOM   897  C  CA    . MET A 1 115 ? 35.323 77.581  69.516 1.00 23.14 ? 115 MET A CA    1 
ATOM   898  C  C     . MET A 1 115 ? 34.598 78.103  68.291 1.00 22.04 ? 115 MET A C     1 
ATOM   899  O  O     . MET A 1 115 ? 34.838 79.220  67.847 1.00 20.80 ? 115 MET A O     1 
ATOM   900  C  CB    . MET A 1 115 ? 34.596 77.999  70.789 1.00 25.12 ? 115 MET A CB    1 
ATOM   901  C  CG    . MET A 1 115 ? 33.850 79.308  70.707 1.00 26.22 ? 115 MET A CG    1 
ATOM   902  S  SD    . MET A 1 115 ? 32.791 79.453  72.136 1.00 27.95 ? 115 MET A SD    1 
ATOM   903  C  CE    . MET A 1 115 ? 31.407 78.436  71.619 1.00 25.48 ? 115 MET A CE    1 
ATOM   904  N  N     . LEU A 1 116 ? 33.713 77.271  67.752 1.00 21.58 ? 116 LEU A N     1 
ATOM   905  C  CA    . LEU A 1 116 ? 32.948 77.597  66.556 1.00 19.43 ? 116 LEU A CA    1 
ATOM   906  C  C     . LEU A 1 116 ? 31.497 77.886  66.896 1.00 18.30 ? 116 LEU A C     1 
ATOM   907  O  O     . LEU A 1 116 ? 30.822 77.075  67.535 1.00 18.06 ? 116 LEU A O     1 
ATOM   908  C  CB    . LEU A 1 116 ? 33.033 76.431  65.562 1.00 18.98 ? 116 LEU A CB    1 
ATOM   909  C  CG    . LEU A 1 116 ? 32.177 76.465  64.294 1.00 17.02 ? 116 LEU A CG    1 
ATOM   910  C  CD1   . LEU A 1 116 ? 32.608 77.604  63.401 1.00 16.02 ? 116 LEU A CD1   1 
ATOM   911  C  CD2   . LEU A 1 116 ? 32.322 75.145  63.570 1.00 15.96 ? 116 LEU A CD2   1 
ATOM   912  N  N     . VAL A 1 117 ? 31.026 79.047  66.456 1.00 16.48 ? 117 VAL A N     1 
ATOM   913  C  CA    . VAL A 1 117 ? 29.658 79.462  66.708 1.00 15.22 ? 117 VAL A CA    1 
ATOM   914  C  C     . VAL A 1 117 ? 28.861 79.582  65.428 1.00 14.95 ? 117 VAL A C     1 
ATOM   915  O  O     . VAL A 1 117 ? 29.335 80.127  64.436 1.00 14.54 ? 117 VAL A O     1 
ATOM   916  C  CB    . VAL A 1 117 ? 29.602 80.825  67.439 1.00 15.44 ? 117 VAL A CB    1 
ATOM   917  C  CG1   . VAL A 1 117 ? 28.150 81.290  67.566 1.00 13.78 ? 117 VAL A CG1   1 
ATOM   918  C  CG2   . VAL A 1 117 ? 30.256 80.708  68.817 1.00 15.03 ? 117 VAL A CG2   1 
ATOM   919  N  N     . GLY A 1 118 ? 27.649 79.048  65.464 1.00 15.85 ? 118 GLY A N     1 
ATOM   920  C  CA    . GLY A 1 118 ? 26.756 79.123  64.328 1.00 18.11 ? 118 GLY A CA    1 
ATOM   921  C  C     . GLY A 1 118 ? 25.697 80.111  64.766 1.00 19.45 ? 118 GLY A C     1 
ATOM   922  O  O     . GLY A 1 118 ? 24.827 79.775  65.570 1.00 21.62 ? 118 GLY A O     1 
ATOM   923  N  N     . ASN A 1 119 ? 25.763 81.329  64.246 1.00 19.34 ? 119 ASN A N     1 
ATOM   924  C  CA    . ASN A 1 119 ? 24.826 82.361  64.655 1.00 20.61 ? 119 ASN A CA    1 
ATOM   925  C  C     . ASN A 1 119 ? 23.541 82.435  63.852 1.00 21.19 ? 119 ASN A C     1 
ATOM   926  O  O     . ASN A 1 119 ? 23.451 81.892  62.751 1.00 23.91 ? 119 ASN A O     1 
ATOM   927  C  CB    . ASN A 1 119 ? 25.527 83.718  64.636 1.00 19.94 ? 119 ASN A CB    1 
ATOM   928  C  CG    . ASN A 1 119 ? 24.718 84.791  65.313 1.00 20.95 ? 119 ASN A CG    1 
ATOM   929  O  OD1   . ASN A 1 119 ? 24.246 84.617  66.435 1.00 20.90 ? 119 ASN A OD1   1 
ATOM   930  N  ND2   . ASN A 1 119 ? 24.555 85.914  64.638 1.00 23.44 ? 119 ASN A ND2   1 
ATOM   931  N  N     . LYS A 1 120 ? 22.551 83.109  64.433 1.00 19.88 ? 120 LYS A N     1 
ATOM   932  C  CA    . LYS A 1 120 ? 21.238 83.313  63.829 1.00 19.68 ? 120 LYS A CA    1 
ATOM   933  C  C     . LYS A 1 120 ? 20.336 82.085  63.823 1.00 21.65 ? 120 LYS A C     1 
ATOM   934  O  O     . LYS A 1 120 ? 19.641 81.822  62.839 1.00 22.50 ? 120 LYS A O     1 
ATOM   935  C  CB    . LYS A 1 120 ? 21.392 83.845  62.407 1.00 16.28 ? 120 LYS A CB    1 
ATOM   936  C  CG    . LYS A 1 120 ? 22.211 85.106  62.339 1.00 16.44 ? 120 LYS A CG    1 
ATOM   937  C  CD    . LYS A 1 120 ? 22.227 85.674  60.946 1.00 16.81 ? 120 LYS A CD    1 
ATOM   938  C  CE    . LYS A 1 120 ? 23.106 86.902  60.853 1.00 15.34 ? 120 LYS A CE    1 
ATOM   939  N  NZ    . LYS A 1 120 ? 23.116 87.391  59.448 1.00 17.57 ? 120 LYS A NZ    1 
ATOM   940  N  N     . LYS A 1 121 ? 20.332 81.338  64.921 1.00 22.84 ? 121 LYS A N     1 
ATOM   941  C  CA    . LYS A 1 121 ? 19.496 80.150  65.005 1.00 26.10 ? 121 LYS A CA    1 
ATOM   942  C  C     . LYS A 1 121 ? 18.020 80.534  64.957 1.00 27.61 ? 121 LYS A C     1 
ATOM   943  O  O     . LYS A 1 121 ? 17.175 79.741  64.544 1.00 28.95 ? 121 LYS A O     1 
ATOM   944  C  CB    . LYS A 1 121 ? 19.805 79.373  66.292 1.00 27.73 ? 121 LYS A CB    1 
ATOM   945  C  CG    . LYS A 1 121 ? 19.712 80.207  67.556 1.00 31.21 ? 121 LYS A CG    1 
ATOM   946  C  CD    . LYS A 1 121 ? 20.370 79.528  68.747 1.00 31.99 ? 121 LYS A CD    1 
ATOM   947  C  CE    . LYS A 1 121 ? 19.606 78.301  69.203 1.00 34.51 ? 121 LYS A CE    1 
ATOM   948  N  NZ    . LYS A 1 121 ? 20.139 77.788  70.505 1.00 35.00 ? 121 LYS A NZ    1 
ATOM   949  N  N     . ASP A 1 122 ? 17.714 81.761  65.360 1.00 28.37 ? 122 ASP A N     1 
ATOM   950  C  CA    . ASP A 1 122 ? 16.334 82.236  65.365 1.00 29.26 ? 122 ASP A CA    1 
ATOM   951  C  C     . ASP A 1 122 ? 15.678 82.260  63.985 1.00 29.23 ? 122 ASP A C     1 
ATOM   952  O  O     . ASP A 1 122 ? 14.519 81.875  63.849 1.00 28.69 ? 122 ASP A O     1 
ATOM   953  C  CB    . ASP A 1 122 ? 16.263 83.632  65.990 1.00 30.25 ? 122 ASP A CB    1 
ATOM   954  C  CG    . ASP A 1 122 ? 17.114 84.650  65.253 1.00 30.79 ? 122 ASP A CG    1 
ATOM   955  O  OD1   . ASP A 1 122 ? 16.684 85.147  64.190 1.00 30.27 ? 122 ASP A OD1   1 
ATOM   956  O  OD2   . ASP A 1 122 ? 18.222 84.946  65.740 1.00 30.41 ? 122 ASP A OD2   1 
ATOM   957  N  N     . LEU A 1 123 ? 16.412 82.714  62.971 1.00 29.65 ? 123 LEU A N     1 
ATOM   958  C  CA    . LEU A 1 123 ? 15.886 82.794  61.609 1.00 30.92 ? 123 LEU A CA    1 
ATOM   959  C  C     . LEU A 1 123 ? 15.676 81.416  60.990 1.00 33.72 ? 123 LEU A C     1 
ATOM   960  O  O     . LEU A 1 123 ? 16.350 81.051  60.024 1.00 33.60 ? 123 LEU A O     1 
ATOM   961  C  CB    . LEU A 1 123 ? 16.832 83.606  60.722 1.00 29.26 ? 123 LEU A CB    1 
ATOM   962  C  CG    . LEU A 1 123 ? 17.025 85.088  61.036 1.00 28.23 ? 123 LEU A CG    1 
ATOM   963  C  CD1   . LEU A 1 123 ? 17.946 85.713  59.996 1.00 26.92 ? 123 LEU A CD1   1 
ATOM   964  C  CD2   . LEU A 1 123 ? 15.681 85.791  61.034 1.00 27.44 ? 123 LEU A CD2   1 
ATOM   965  N  N     . HIS A 1 124 ? 14.727 80.665  61.544 1.00 36.25 ? 124 HIS A N     1 
ATOM   966  C  CA    . HIS A 1 124 ? 14.411 79.318  61.078 1.00 38.63 ? 124 HIS A CA    1 
ATOM   967  C  C     . HIS A 1 124 ? 14.136 79.222  59.578 1.00 38.39 ? 124 HIS A C     1 
ATOM   968  O  O     . HIS A 1 124 ? 14.623 78.313  58.909 1.00 37.53 ? 124 HIS A O     1 
ATOM   969  C  CB    . HIS A 1 124 ? 13.195 78.768  61.831 1.00 42.42 ? 124 HIS A CB    1 
ATOM   970  C  CG    . HIS A 1 124 ? 13.388 78.666  63.312 1.00 47.51 ? 124 HIS A CG    1 
ATOM   971  N  ND1   . HIS A 1 124 ? 14.302 77.809  63.887 1.00 50.64 ? 124 HIS A ND1   1 
ATOM   972  C  CD2   . HIS A 1 124 ? 12.779 79.309  64.338 1.00 50.19 ? 124 HIS A CD2   1 
ATOM   973  C  CE1   . HIS A 1 124 ? 14.246 77.928  65.204 1.00 52.09 ? 124 HIS A CE1   1 
ATOM   974  N  NE2   . HIS A 1 124 ? 13.330 78.832  65.503 1.00 51.69 ? 124 HIS A NE2   1 
ATOM   975  N  N     . MET A 1 125 ? 13.355 80.155  59.047 1.00 38.17 ? 125 MET A N     1 
ATOM   976  C  CA    . MET A 1 125 ? 13.021 80.122  57.634 1.00 38.35 ? 125 MET A CA    1 
ATOM   977  C  C     . MET A 1 125 ? 14.198 80.357  56.706 1.00 37.74 ? 125 MET A C     1 
ATOM   978  O  O     . MET A 1 125 ? 14.066 80.193  55.495 1.00 37.64 ? 125 MET A O     1 
ATOM   979  C  CB    . MET A 1 125 ? 11.927 81.139  57.323 1.00 41.24 ? 125 MET A CB    1 
ATOM   980  C  CG    . MET A 1 125 ? 10.545 80.770  57.861 1.00 47.21 ? 125 MET A CG    1 
ATOM   981  S  SD    . MET A 1 125 ? 9.855  79.221  57.179 1.00 51.97 ? 125 MET A SD    1 
ATOM   982  C  CE    . MET A 1 125 ? 10.042 78.115  58.607 1.00 50.52 ? 125 MET A CE    1 
ATOM   983  N  N     . GLU A 1 126 ? 15.351 80.716  57.260 1.00 37.23 ? 126 GLU A N     1 
ATOM   984  C  CA    . GLU A 1 126 ? 16.523 80.987  56.430 1.00 36.68 ? 126 GLU A CA    1 
ATOM   985  C  C     . GLU A 1 126 ? 17.750 80.112  56.670 1.00 34.68 ? 126 GLU A C     1 
ATOM   986  O  O     . GLU A 1 126 ? 18.787 80.308  56.037 1.00 32.73 ? 126 GLU A O     1 
ATOM   987  C  CB    . GLU A 1 126 ? 16.905 82.457  56.576 1.00 38.47 ? 126 GLU A CB    1 
ATOM   988  C  CG    . GLU A 1 126 ? 15.833 83.384  56.060 1.00 41.35 ? 126 GLU A CG    1 
ATOM   989  C  CD    . GLU A 1 126 ? 16.109 84.830  56.382 1.00 43.87 ? 126 GLU A CD    1 
ATOM   990  O  OE1   . GLU A 1 126 ? 17.223 85.308  56.075 1.00 44.37 ? 126 GLU A OE1   1 
ATOM   991  O  OE2   . GLU A 1 126 ? 15.201 85.488  56.937 1.00 45.53 ? 126 GLU A OE2   1 
ATOM   992  N  N     . ARG A 1 127 ? 17.633 79.149  57.576 1.00 33.86 ? 127 ARG A N     1 
ATOM   993  C  CA    . ARG A 1 127 ? 18.743 78.251  57.883 1.00 33.14 ? 127 ARG A CA    1 
ATOM   994  C  C     . ARG A 1 127 ? 19.093 77.378  56.677 1.00 33.23 ? 127 ARG A C     1 
ATOM   995  O  O     . ARG A 1 127 ? 18.205 76.806  56.036 1.00 35.10 ? 127 ARG A O     1 
ATOM   996  C  CB    . ARG A 1 127 ? 18.383 77.345  59.070 1.00 31.22 ? 127 ARG A CB    1 
ATOM   997  C  CG    . ARG A 1 127 ? 19.397 76.232  59.323 1.00 30.16 ? 127 ARG A CG    1 
ATOM   998  C  CD    . ARG A 1 127 ? 18.888 75.208  60.326 1.00 28.60 ? 127 ARG A CD    1 
ATOM   999  N  NE    . ARG A 1 127 ? 18.860 75.731  61.684 1.00 27.66 ? 127 ARG A NE    1 
ATOM   1000 C  CZ    . ARG A 1 127 ? 19.943 75.957  62.417 1.00 29.28 ? 127 ARG A CZ    1 
ATOM   1001 N  NH1   . ARG A 1 127 ? 21.144 75.702  61.922 1.00 30.54 ? 127 ARG A NH1   1 
ATOM   1002 N  NH2   . ARG A 1 127 ? 19.827 76.437  63.647 1.00 31.48 ? 127 ARG A NH2   1 
ATOM   1003 N  N     . VAL A 1 128 ? 20.382 77.283  56.362 1.00 30.39 ? 128 VAL A N     1 
ATOM   1004 C  CA    . VAL A 1 128 ? 20.812 76.441  55.257 1.00 28.06 ? 128 VAL A CA    1 
ATOM   1005 C  C     . VAL A 1 128 ? 21.856 75.464  55.784 1.00 28.88 ? 128 VAL A C     1 
ATOM   1006 O  O     . VAL A 1 128 ? 22.100 74.420  55.191 1.00 31.90 ? 128 VAL A O     1 
ATOM   1007 C  CB    . VAL A 1 128 ? 21.407 77.260  54.102 1.00 25.32 ? 128 VAL A CB    1 
ATOM   1008 C  CG1   . VAL A 1 128 ? 20.485 78.408  53.760 1.00 24.84 ? 128 VAL A CG1   1 
ATOM   1009 C  CG2   . VAL A 1 128 ? 22.784 77.754  54.462 1.00 26.13 ? 128 VAL A CG2   1 
ATOM   1010 N  N     . ILE A 1 129 ? 22.480 75.802  56.904 1.00 27.32 ? 129 ILE A N     1 
ATOM   1011 C  CA    . ILE A 1 129 ? 23.466 74.907  57.484 1.00 25.68 ? 129 ILE A CA    1 
ATOM   1012 C  C     . ILE A 1 129 ? 22.764 74.234  58.669 1.00 25.69 ? 129 ILE A C     1 
ATOM   1013 O  O     . ILE A 1 129 ? 22.111 74.891  59.474 1.00 25.61 ? 129 ILE A O     1 
ATOM   1014 C  CB    . ILE A 1 129 ? 24.732 75.666  58.000 1.00 25.89 ? 129 ILE A CB    1 
ATOM   1015 C  CG1   . ILE A 1 129 ? 25.097 76.841  57.081 1.00 26.94 ? 129 ILE A CG1   1 
ATOM   1016 C  CG2   . ILE A 1 129 ? 25.910 74.717  58.047 1.00 24.03 ? 129 ILE A CG2   1 
ATOM   1017 C  CD1   . ILE A 1 129 ? 25.580 76.452  55.701 1.00 29.42 ? 129 ILE A CD1   1 
ATOM   1018 N  N     . SER A 1 130 ? 22.881 72.918  58.761 1.00 24.98 ? 130 SER A N     1 
ATOM   1019 C  CA    . SER A 1 130 ? 22.260 72.176  59.848 1.00 23.81 ? 130 SER A CA    1 
ATOM   1020 C  C     . SER A 1 130 ? 23.123 72.236  61.098 1.00 22.98 ? 130 SER A C     1 
ATOM   1021 O  O     . SER A 1 130 ? 24.295 72.591  61.032 1.00 22.59 ? 130 SER A O     1 
ATOM   1022 C  CB    . SER A 1 130 ? 22.072 70.717  59.431 1.00 24.17 ? 130 SER A CB    1 
ATOM   1023 O  OG    . SER A 1 130 ? 23.288 70.180  58.935 1.00 23.82 ? 130 SER A OG    1 
ATOM   1024 N  N     . TYR A 1 131 ? 22.547 71.885  62.239 1.00 22.11 ? 131 TYR A N     1 
ATOM   1025 C  CA    . TYR A 1 131 ? 23.311 71.886  63.478 1.00 23.33 ? 131 TYR A CA    1 
ATOM   1026 C  C     . TYR A 1 131 ? 24.437 70.863  63.339 1.00 24.85 ? 131 TYR A C     1 
ATOM   1027 O  O     . TYR A 1 131 ? 25.609 71.168  63.536 1.00 24.24 ? 131 TYR A O     1 
ATOM   1028 C  CB    . TYR A 1 131 ? 22.415 71.498  64.661 1.00 22.58 ? 131 TYR A CB    1 
ATOM   1029 C  CG    . TYR A 1 131 ? 23.171 71.330  65.960 1.00 21.88 ? 131 TYR A CG    1 
ATOM   1030 C  CD1   . TYR A 1 131 ? 23.299 72.388  66.855 1.00 21.22 ? 131 TYR A CD1   1 
ATOM   1031 C  CD2   . TYR A 1 131 ? 23.816 70.126  66.263 1.00 20.76 ? 131 TYR A CD2   1 
ATOM   1032 C  CE1   . TYR A 1 131 ? 24.055 72.255  68.021 1.00 22.23 ? 131 TYR A CE1   1 
ATOM   1033 C  CE2   . TYR A 1 131 ? 24.574 69.982  67.419 1.00 21.04 ? 131 TYR A CE2   1 
ATOM   1034 C  CZ    . TYR A 1 131 ? 24.692 71.050  68.299 1.00 22.56 ? 131 TYR A CZ    1 
ATOM   1035 O  OH    . TYR A 1 131 ? 25.438 70.915  69.452 1.00 20.13 ? 131 TYR A OH    1 
ATOM   1036 N  N     . GLU A 1 132 ? 24.047 69.643  62.986 1.00 28.86 ? 132 GLU A N     1 
ATOM   1037 C  CA    . GLU A 1 132 ? 24.954 68.509  62.813 1.00 29.99 ? 132 GLU A CA    1 
ATOM   1038 C  C     . GLU A 1 132 ? 26.144 68.745  61.888 1.00 30.38 ? 132 GLU A C     1 
ATOM   1039 O  O     . GLU A 1 132 ? 27.165 68.070  62.008 1.00 30.40 ? 132 GLU A O     1 
ATOM   1040 C  CB    . GLU A 1 132 ? 24.166 67.286  62.313 1.00 29.38 ? 132 GLU A CB    1 
ATOM   1041 C  CG    . GLU A 1 132 ? 23.119 66.772  63.291 1.00 27.94 ? 132 GLU A CG    1 
ATOM   1042 C  CD    . GLU A 1 132 ? 21.847 67.596  63.283 1.00 28.28 ? 132 GLU A CD    1 
ATOM   1043 O  OE1   . GLU A 1 132 ? 20.972 67.349  64.143 1.00 27.23 ? 132 GLU A OE1   1 
ATOM   1044 O  OE2   . GLU A 1 132 ? 21.717 68.484  62.412 1.00 28.04 ? 132 GLU A OE2   1 
ATOM   1045 N  N     . GLU A 1 133 ? 26.008 69.687  60.961 1.00 31.99 ? 133 GLU A N     1 
ATOM   1046 C  CA    . GLU A 1 133 ? 27.078 69.989  60.019 1.00 33.41 ? 133 GLU A CA    1 
ATOM   1047 C  C     . GLU A 1 133 ? 28.168 70.815  60.680 1.00 33.94 ? 133 GLU A C     1 
ATOM   1048 O  O     . GLU A 1 133 ? 29.330 70.397  60.728 1.00 34.52 ? 133 GLU A O     1 
ATOM   1049 C  CB    . GLU A 1 133 ? 26.520 70.741  58.813 1.00 35.34 ? 133 GLU A CB    1 
ATOM   1050 C  CG    . GLU A 1 133 ? 27.542 71.005  57.727 1.00 39.09 ? 133 GLU A CG    1 
ATOM   1051 C  CD    . GLU A 1 133 ? 26.896 71.356  56.403 1.00 43.16 ? 133 GLU A CD    1 
ATOM   1052 O  OE1   . GLU A 1 133 ? 27.635 71.559  55.415 1.00 43.79 ? 133 GLU A OE1   1 
ATOM   1053 O  OE2   . GLU A 1 133 ? 25.644 71.424  56.349 1.00 45.69 ? 133 GLU A OE2   1 
ATOM   1054 N  N     . GLY A 1 134 ? 27.789 71.987  61.186 1.00 33.23 ? 134 GLY A N     1 
ATOM   1055 C  CA    . GLY A 1 134 ? 28.749 72.850  61.852 1.00 32.17 ? 134 GLY A CA    1 
ATOM   1056 C  C     . GLY A 1 134 ? 29.373 72.084  63.000 1.00 32.17 ? 134 GLY A C     1 
ATOM   1057 O  O     . GLY A 1 134 ? 30.570 72.204  63.285 1.00 33.00 ? 134 GLY A O     1 
ATOM   1058 N  N     . LYS A 1 135 ? 28.547 71.279  63.656 1.00 30.76 ? 135 LYS A N     1 
ATOM   1059 C  CA    . LYS A 1 135 ? 28.997 70.471  64.776 1.00 29.95 ? 135 LYS A CA    1 
ATOM   1060 C  C     . LYS A 1 135 ? 30.195 69.641  64.332 1.00 29.04 ? 135 LYS A C     1 
ATOM   1061 O  O     . LYS A 1 135 ? 31.243 69.668  64.965 1.00 28.95 ? 135 LYS A O     1 
ATOM   1062 C  CB    . LYS A 1 135 ? 27.867 69.550  65.231 1.00 29.93 ? 135 LYS A CB    1 
ATOM   1063 C  CG    . LYS A 1 135 ? 27.862 69.234  66.708 1.00 30.71 ? 135 LYS A CG    1 
ATOM   1064 C  CD    . LYS A 1 135 ? 29.176 68.654  67.173 1.00 33.41 ? 135 LYS A CD    1 
ATOM   1065 C  CE    . LYS A 1 135 ? 29.030 68.059  68.562 1.00 36.62 ? 135 LYS A CE    1 
ATOM   1066 N  NZ    . LYS A 1 135 ? 28.391 69.007  69.519 1.00 40.07 ? 135 LYS A NZ    1 
ATOM   1067 N  N     . ALA A 1 136 ? 30.028 68.920  63.226 1.00 29.17 ? 136 ALA A N     1 
ATOM   1068 C  CA    . ALA A 1 136 ? 31.068 68.057  62.669 1.00 28.67 ? 136 ALA A CA    1 
ATOM   1069 C  C     . ALA A 1 136 ? 32.359 68.812  62.382 1.00 29.12 ? 136 ALA A C     1 
ATOM   1070 O  O     . ALA A 1 136 ? 33.457 68.266  62.517 1.00 28.14 ? 136 ALA A O     1 
ATOM   1071 C  CB    . ALA A 1 136 ? 30.562 67.393  61.393 1.00 27.35 ? 136 ALA A CB    1 
ATOM   1072 N  N     . LEU A 1 137 ? 32.230 70.067  61.972 1.00 29.17 ? 137 LEU A N     1 
ATOM   1073 C  CA    . LEU A 1 137 ? 33.409 70.862  61.684 1.00 28.95 ? 137 LEU A CA    1 
ATOM   1074 C  C     . LEU A 1 137 ? 34.133 71.117  62.998 1.00 29.32 ? 137 LEU A C     1 
ATOM   1075 O  O     . LEU A 1 137 ? 35.337 70.889  63.119 1.00 29.23 ? 137 LEU A O     1 
ATOM   1076 C  CB    . LEU A 1 137 ? 33.012 72.188  61.041 1.00 27.84 ? 137 LEU A CB    1 
ATOM   1077 C  CG    . LEU A 1 137 ? 34.178 72.928  60.387 1.00 27.66 ? 137 LEU A CG    1 
ATOM   1078 C  CD1   . LEU A 1 137 ? 34.811 72.041  59.318 1.00 26.35 ? 137 LEU A CD1   1 
ATOM   1079 C  CD2   . LEU A 1 137 ? 33.683 74.233  59.787 1.00 28.21 ? 137 LEU A CD2   1 
ATOM   1080 N  N     . ALA A 1 138 ? 33.378 71.580  63.990 1.00 30.29 ? 138 ALA A N     1 
ATOM   1081 C  CA    . ALA A 1 138 ? 33.927 71.875  65.309 1.00 30.24 ? 138 ALA A CA    1 
ATOM   1082 C  C     . ALA A 1 138 ? 34.657 70.663  65.887 1.00 29.86 ? 138 ALA A C     1 
ATOM   1083 O  O     . ALA A 1 138 ? 35.629 70.798  66.622 1.00 28.37 ? 138 ALA A O     1 
ATOM   1084 C  CB    . ALA A 1 138 ? 32.806 72.317  66.245 1.00 29.23 ? 138 ALA A CB    1 
ATOM   1085 N  N     . GLU A 1 139 ? 34.180 69.476  65.547 1.00 31.22 ? 139 GLU A N     1 
ATOM   1086 C  CA    . GLU A 1 139 ? 34.793 68.257  66.030 1.00 33.77 ? 139 GLU A CA    1 
ATOM   1087 C  C     . GLU A 1 139 ? 36.089 68.022  65.265 1.00 33.32 ? 139 GLU A C     1 
ATOM   1088 O  O     . GLU A 1 139 ? 37.092 67.612  65.837 1.00 34.46 ? 139 GLU A O     1 
ATOM   1089 C  CB    . GLU A 1 139 ? 33.839 67.081  65.828 1.00 37.09 ? 139 GLU A CB    1 
ATOM   1090 C  CG    . GLU A 1 139 ? 32.411 67.389  66.254 1.00 45.56 ? 139 GLU A CG    1 
ATOM   1091 C  CD    . GLU A 1 139 ? 31.451 66.228  66.027 1.00 51.42 ? 139 GLU A CD    1 
ATOM   1092 O  OE1   . GLU A 1 139 ? 31.345 65.352  66.920 1.00 54.80 ? 139 GLU A OE1   1 
ATOM   1093 O  OE2   . GLU A 1 139 ? 30.807 66.187  64.950 1.00 53.97 ? 139 GLU A OE2   1 
ATOM   1094 N  N     . SER A 1 140 ? 36.078 68.295  63.969 1.00 32.01 ? 140 SER A N     1 
ATOM   1095 C  CA    . SER A 1 140 ? 37.273 68.082  63.182 1.00 30.67 ? 140 SER A CA    1 
ATOM   1096 C  C     . SER A 1 140 ? 38.368 68.995  63.687 1.00 30.11 ? 140 SER A C     1 
ATOM   1097 O  O     . SER A 1 140 ? 39.540 68.657  63.605 1.00 30.44 ? 140 SER A O     1 
ATOM   1098 C  CB    . SER A 1 140 ? 37.009 68.356  61.704 1.00 32.54 ? 140 SER A CB    1 
ATOM   1099 O  OG    . SER A 1 140 ? 36.958 69.744  61.443 1.00 36.80 ? 140 SER A OG    1 
ATOM   1100 N  N     . TRP A 1 141 ? 37.995 70.159  64.206 1.00 30.68 ? 141 TRP A N     1 
ATOM   1101 C  CA    . TRP A 1 141 ? 38.999 71.087  64.728 1.00 31.84 ? 141 TRP A CA    1 
ATOM   1102 C  C     . TRP A 1 141 ? 39.247 70.778  66.193 1.00 32.70 ? 141 TRP A C     1 
ATOM   1103 O  O     . TRP A 1 141 ? 40.100 71.398  66.842 1.00 31.63 ? 141 TRP A O     1 
ATOM   1104 C  CB    . TRP A 1 141 ? 38.536 72.538  64.621 1.00 29.91 ? 141 TRP A CB    1 
ATOM   1105 C  CG    . TRP A 1 141 ? 38.207 72.991  63.254 1.00 28.36 ? 141 TRP A CG    1 
ATOM   1106 C  CD1   . TRP A 1 141 ? 38.531 72.379  62.073 1.00 28.56 ? 141 TRP A CD1   1 
ATOM   1107 C  CD2   . TRP A 1 141 ? 37.519 74.190  62.913 1.00 26.25 ? 141 TRP A CD2   1 
ATOM   1108 N  NE1   . TRP A 1 141 ? 38.082 73.133  61.012 1.00 27.71 ? 141 TRP A NE1   1 
ATOM   1109 C  CE2   . TRP A 1 141 ? 37.458 74.251  61.501 1.00 26.85 ? 141 TRP A CE2   1 
ATOM   1110 C  CE3   . TRP A 1 141 ? 36.950 75.224  63.664 1.00 23.78 ? 141 TRP A CE3   1 
ATOM   1111 C  CZ2   . TRP A 1 141 ? 36.848 75.308  60.826 1.00 26.18 ? 141 TRP A CZ2   1 
ATOM   1112 C  CZ3   . TRP A 1 141 ? 36.347 76.269  62.998 1.00 25.34 ? 141 TRP A CZ3   1 
ATOM   1113 C  CH2   . TRP A 1 141 ? 36.299 76.305  61.587 1.00 25.59 ? 141 TRP A CH2   1 
ATOM   1114 N  N     . ASN A 1 142 ? 38.481 69.816  66.700 1.00 33.99 ? 142 ASN A N     1 
ATOM   1115 C  CA    . ASN A 1 142 ? 38.572 69.408  68.090 1.00 35.13 ? 142 ASN A CA    1 
ATOM   1116 C  C     . ASN A 1 142 ? 38.244 70.640  68.920 1.00 34.13 ? 142 ASN A C     1 
ATOM   1117 O  O     . ASN A 1 142 ? 38.835 70.878  69.971 1.00 35.32 ? 142 ASN A O     1 
ATOM   1118 C  CB    . ASN A 1 142 ? 39.982 68.917  68.391 1.00 38.50 ? 142 ASN A CB    1 
ATOM   1119 C  CG    . ASN A 1 142 ? 40.012 67.905  69.502 1.00 42.63 ? 142 ASN A CG    1 
ATOM   1120 O  OD1   . ASN A 1 142 ? 39.871 68.247  70.683 1.00 43.99 ? 142 ASN A OD1   1 
ATOM   1121 N  ND2   . ASN A 1 142 ? 40.181 66.637  69.133 1.00 44.29 ? 142 ASN A ND2   1 
ATOM   1122 N  N     . ALA A 1 143 ? 37.291 71.422  68.422 1.00 31.52 ? 143 ALA A N     1 
ATOM   1123 C  CA    . ALA A 1 143 ? 36.875 72.648  69.075 1.00 30.00 ? 143 ALA A CA    1 
ATOM   1124 C  C     . ALA A 1 143 ? 35.449 72.558  69.608 1.00 29.91 ? 143 ALA A C     1 
ATOM   1125 O  O     . ALA A 1 143 ? 34.721 71.603  69.329 1.00 30.18 ? 143 ALA A O     1 
ATOM   1126 C  CB    . ALA A 1 143 ? 36.998 73.811  68.099 1.00 28.68 ? 143 ALA A CB    1 
ATOM   1127 N  N     . ALA A 1 144 ? 35.064 73.564  70.389 1.00 29.13 ? 144 ALA A N     1 
ATOM   1128 C  CA    . ALA A 1 144 ? 33.735 73.627  70.975 1.00 27.18 ? 144 ALA A CA    1 
ATOM   1129 C  C     . ALA A 1 144 ? 32.757 74.167  69.945 1.00 26.53 ? 144 ALA A C     1 
ATOM   1130 O  O     . ALA A 1 144 ? 33.127 74.937  69.056 1.00 27.05 ? 144 ALA A O     1 
ATOM   1131 C  CB    . ALA A 1 144 ? 33.746 74.522  72.214 1.00 25.93 ? 144 ALA A CB    1 
ATOM   1132 N  N     . PHE A 1 145 ? 31.503 73.758  70.065 1.00 24.56 ? 145 PHE A N     1 
ATOM   1133 C  CA    . PHE A 1 145 ? 30.485 74.203  69.137 1.00 22.69 ? 145 PHE A CA    1 
ATOM   1134 C  C     . PHE A 1 145 ? 29.256 74.634  69.902 1.00 23.20 ? 145 PHE A C     1 
ATOM   1135 O  O     . PHE A 1 145 ? 28.913 74.051  70.929 1.00 23.21 ? 145 PHE A O     1 
ATOM   1136 C  CB    . PHE A 1 145 ? 30.111 73.082  68.171 1.00 20.84 ? 145 PHE A CB    1 
ATOM   1137 C  CG    . PHE A 1 145 ? 29.071 73.477  67.179 1.00 19.57 ? 145 PHE A CG    1 
ATOM   1138 C  CD1   . PHE A 1 145 ? 29.331 74.470  66.245 1.00 19.29 ? 145 PHE A CD1   1 
ATOM   1139 C  CD2   . PHE A 1 145 ? 27.822 72.870  67.186 1.00 20.54 ? 145 PHE A CD2   1 
ATOM   1140 C  CE1   . PHE A 1 145 ? 28.367 74.851  65.333 1.00 19.80 ? 145 PHE A CE1   1 
ATOM   1141 C  CE2   . PHE A 1 145 ? 26.845 73.243  66.277 1.00 18.77 ? 145 PHE A CE2   1 
ATOM   1142 C  CZ    . PHE A 1 145 ? 27.117 74.234  65.349 1.00 20.70 ? 145 PHE A CZ    1 
ATOM   1143 N  N     . LEU A 1 146 ? 28.589 75.653  69.374 1.00 23.27 ? 146 LEU A N     1 
ATOM   1144 C  CA    . LEU A 1 146 ? 27.390 76.201  69.984 1.00 20.58 ? 146 LEU A CA    1 
ATOM   1145 C  C     . LEU A 1 146 ? 26.683 77.018  68.914 1.00 21.02 ? 146 LEU A C     1 
ATOM   1146 O  O     . LEU A 1 146 ? 27.333 77.617  68.067 1.00 21.32 ? 146 LEU A O     1 
ATOM   1147 C  CB    . LEU A 1 146 ? 27.792 77.103  71.154 1.00 16.92 ? 146 LEU A CB    1 
ATOM   1148 C  CG    . LEU A 1 146 ? 27.387 76.720  72.579 1.00 16.58 ? 146 LEU A CG    1 
ATOM   1149 C  CD1   . LEU A 1 146 ? 27.591 75.237  72.820 1.00 17.72 ? 146 LEU A CD1   1 
ATOM   1150 C  CD2   . LEU A 1 146 ? 28.200 77.531  73.566 1.00 14.93 ? 146 LEU A CD2   1 
ATOM   1151 N  N     . GLU A 1 147 ? 25.357 77.011  68.904 1.00 22.44 ? 147 GLU A N     1 
ATOM   1152 C  CA    . GLU A 1 147 ? 24.651 77.839  67.937 1.00 24.78 ? 147 GLU A CA    1 
ATOM   1153 C  C     . GLU A 1 147 ? 24.146 79.017  68.760 1.00 25.37 ? 147 GLU A C     1 
ATOM   1154 O  O     . GLU A 1 147 ? 24.123 78.936  69.987 1.00 25.68 ? 147 GLU A O     1 
ATOM   1155 C  CB    . GLU A 1 147 ? 23.518 77.061  67.257 1.00 25.10 ? 147 GLU A CB    1 
ATOM   1156 C  CG    . GLU A 1 147 ? 24.045 76.163  66.134 1.00 29.18 ? 147 GLU A CG    1 
ATOM   1157 C  CD    . GLU A 1 147 ? 22.972 75.648  65.183 1.00 31.31 ? 147 GLU A CD    1 
ATOM   1158 O  OE1   . GLU A 1 147 ? 23.335 75.171  64.083 1.00 32.76 ? 147 GLU A OE1   1 
ATOM   1159 O  OE2   . GLU A 1 147 ? 21.774 75.710  65.525 1.00 32.97 ? 147 GLU A OE2   1 
ATOM   1160 N  N     . SER A 1 148 ? 23.764 80.118  68.121 1.00 25.65 ? 148 SER A N     1 
ATOM   1161 C  CA    . SER A 1 148 ? 23.321 81.268  68.902 1.00 25.45 ? 148 SER A CA    1 
ATOM   1162 C  C     . SER A 1 148 ? 22.562 82.324  68.127 1.00 25.12 ? 148 SER A C     1 
ATOM   1163 O  O     . SER A 1 148 ? 22.587 82.357  66.896 1.00 24.25 ? 148 SER A O     1 
ATOM   1164 C  CB    . SER A 1 148 ? 24.531 81.940  69.546 1.00 26.71 ? 148 SER A CB    1 
ATOM   1165 O  OG    . SER A 1 148 ? 25.380 82.508  68.554 1.00 26.63 ? 148 SER A OG    1 
ATOM   1166 N  N     . SER A 1 149 ? 21.900 83.201  68.877 1.00 25.36 ? 149 SER A N     1 
ATOM   1167 C  CA    . SER A 1 149 ? 21.137 84.303  68.300 1.00 25.51 ? 149 SER A CA    1 
ATOM   1168 C  C     . SER A 1 149 ? 21.490 85.605  69.018 1.00 25.09 ? 149 SER A C     1 
ATOM   1169 O  O     . SER A 1 149 ? 21.386 85.702  70.245 1.00 24.65 ? 149 SER A O     1 
ATOM   1170 C  CB    . SER A 1 149 ? 19.636 84.046  68.419 1.00 25.43 ? 149 SER A CB    1 
ATOM   1171 O  OG    . SER A 1 149 ? 18.916 85.135  67.866 1.00 26.04 ? 149 SER A OG    1 
ATOM   1172 N  N     . ALA A 1 150 ? 21.913 86.603  68.249 1.00 24.01 ? 150 ALA A N     1 
ATOM   1173 C  CA    . ALA A 1 150 ? 22.286 87.885  68.816 1.00 24.63 ? 150 ALA A CA    1 
ATOM   1174 C  C     . ALA A 1 150 ? 21.075 88.595  69.425 1.00 27.08 ? 150 ALA A C     1 
ATOM   1175 O  O     . ALA A 1 150 ? 21.179 89.733  69.902 1.00 28.00 ? 150 ALA A O     1 
ATOM   1176 C  CB    . ALA A 1 150 ? 22.918 88.742  67.750 1.00 23.09 ? 150 ALA A CB    1 
ATOM   1177 N  N     . LYS A 1 151 ? 19.930 87.912  69.409 1.00 28.19 ? 151 LYS A N     1 
ATOM   1178 C  CA    . LYS A 1 151 ? 18.677 88.438  69.951 1.00 27.20 ? 151 LYS A CA    1 
ATOM   1179 C  C     . LYS A 1 151 ? 18.265 87.593  71.145 1.00 27.26 ? 151 LYS A C     1 
ATOM   1180 O  O     . LYS A 1 151 ? 17.249 87.848  71.784 1.00 28.90 ? 151 LYS A O     1 
ATOM   1181 C  CB    . LYS A 1 151 ? 17.569 88.385  68.892 1.00 26.10 ? 151 LYS A CB    1 
ATOM   1182 C  CG    . LYS A 1 151 ? 17.884 89.148  67.621 1.00 26.58 ? 151 LYS A CG    1 
ATOM   1183 C  CD    . LYS A 1 151 ? 16.780 89.019  66.572 1.00 27.64 ? 151 LYS A CD    1 
ATOM   1184 C  CE    . LYS A 1 151 ? 15.464 89.603  67.068 1.00 29.06 ? 151 LYS A CE    1 
ATOM   1185 N  NZ    . LYS A 1 151 ? 14.453 89.748  65.988 1.00 28.18 ? 151 LYS A NZ    1 
ATOM   1186 N  N     . GLU A 1 152 ? 19.058 86.576  71.441 1.00 27.29 ? 152 GLU A N     1 
ATOM   1187 C  CA    . GLU A 1 152 ? 18.761 85.702  72.555 1.00 28.32 ? 152 GLU A CA    1 
ATOM   1188 C  C     . GLU A 1 152 ? 19.908 85.743  73.547 1.00 29.25 ? 152 GLU A C     1 
ATOM   1189 O  O     . GLU A 1 152 ? 20.699 84.808  73.656 1.00 30.44 ? 152 GLU A O     1 
ATOM   1190 C  CB    . GLU A 1 152 ? 18.530 84.280  72.051 1.00 30.59 ? 152 GLU A CB    1 
ATOM   1191 C  CG    . GLU A 1 152 ? 17.285 84.131  71.177 1.00 33.24 ? 152 GLU A CG    1 
ATOM   1192 C  CD    . GLU A 1 152 ? 17.014 82.691  70.793 1.00 34.30 ? 152 GLU A CD    1 
ATOM   1193 O  OE1   . GLU A 1 152 ? 17.233 81.808  71.649 1.00 36.77 ? 152 GLU A OE1   1 
ATOM   1194 O  OE2   . GLU A 1 152 ? 16.576 82.440  69.650 1.00 33.53 ? 152 GLU A OE2   1 
ATOM   1195 N  N     . ASN A 1 153 ? 19.982 86.852  74.267 1.00 28.92 ? 153 ASN A N     1 
ATOM   1196 C  CA    . ASN A 1 153 ? 21.014 87.085  75.266 1.00 27.74 ? 153 ASN A CA    1 
ATOM   1197 C  C     . ASN A 1 153 ? 21.597 85.857  75.949 1.00 28.38 ? 153 ASN A C     1 
ATOM   1198 O  O     . ASN A 1 153 ? 22.806 85.661  75.930 1.00 30.63 ? 153 ASN A O     1 
ATOM   1199 C  CB    . ASN A 1 153 ? 20.489 88.038  76.334 1.00 25.43 ? 153 ASN A CB    1 
ATOM   1200 C  CG    . ASN A 1 153 ? 21.438 88.178  77.487 1.00 23.42 ? 153 ASN A CG    1 
ATOM   1201 O  OD1   . ASN A 1 153 ? 21.475 87.334  78.377 1.00 21.39 ? 153 ASN A OD1   1 
ATOM   1202 N  ND2   . ASN A 1 153 ? 22.234 89.241  77.471 1.00 24.48 ? 153 ASN A ND2   1 
ATOM   1203 N  N     . GLN A 1 154 ? 20.752 85.037  76.562 1.00 29.14 ? 154 GLN A N     1 
ATOM   1204 C  CA    . GLN A 1 154 ? 21.232 83.852  77.262 1.00 28.27 ? 154 GLN A CA    1 
ATOM   1205 C  C     . GLN A 1 154 ? 22.233 83.049  76.443 1.00 26.31 ? 154 GLN A C     1 
ATOM   1206 O  O     . GLN A 1 154 ? 23.216 82.545  76.985 1.00 25.31 ? 154 GLN A O     1 
ATOM   1207 C  CB    . GLN A 1 154 ? 20.058 82.959  77.662 1.00 33.46 ? 154 GLN A CB    1 
ATOM   1208 C  CG    . GLN A 1 154 ? 20.470 81.714  78.432 1.00 40.35 ? 154 GLN A CG    1 
ATOM   1209 C  CD    . GLN A 1 154 ? 21.432 82.032  79.567 1.00 45.83 ? 154 GLN A CD    1 
ATOM   1210 O  OE1   . GLN A 1 154 ? 21.106 82.798  80.480 1.00 49.31 ? 154 GLN A OE1   1 
ATOM   1211 N  NE2   . GLN A 1 154 ? 22.627 81.446  79.514 1.00 47.50 ? 154 GLN A NE2   1 
ATOM   1212 N  N     . THR A 1 155 ? 21.988 82.935  75.139 1.00 23.49 ? 155 THR A N     1 
ATOM   1213 C  CA    . THR A 1 155 ? 22.885 82.186  74.261 1.00 20.65 ? 155 THR A CA    1 
ATOM   1214 C  C     . THR A 1 155 ? 24.152 82.975  73.969 1.00 18.45 ? 155 THR A C     1 
ATOM   1215 O  O     . THR A 1 155 ? 25.222 82.401  73.805 1.00 18.97 ? 155 THR A O     1 
ATOM   1216 C  CB    . THR A 1 155 ? 22.218 81.835  72.912 1.00 21.23 ? 155 THR A CB    1 
ATOM   1217 O  OG1   . THR A 1 155 ? 22.057 83.023  72.123 1.00 21.53 ? 155 THR A OG1   1 
ATOM   1218 C  CG2   . THR A 1 155 ? 20.868 81.193  73.145 1.00 20.08 ? 155 THR A CG2   1 
ATOM   1219 N  N     . ALA A 1 156 ? 24.035 84.292  73.882 1.00 16.66 ? 156 ALA A N     1 
ATOM   1220 C  CA    . ALA A 1 156 ? 25.209 85.107  73.627 1.00 14.59 ? 156 ALA A CA    1 
ATOM   1221 C  C     . ALA A 1 156 ? 26.115 84.994  74.844 1.00 14.88 ? 156 ALA A C     1 
ATOM   1222 O  O     . ALA A 1 156 ? 27.338 84.889  74.708 1.00 14.72 ? 156 ALA A O     1 
ATOM   1223 C  CB    . ALA A 1 156 ? 24.815 86.530  73.397 1.00 12.87 ? 156 ALA A CB    1 
ATOM   1224 N  N     . VAL A 1 157 ? 25.513 84.999  76.033 1.00 14.16 ? 157 VAL A N     1 
ATOM   1225 C  CA    . VAL A 1 157 ? 26.276 84.872  77.276 1.00 15.55 ? 157 VAL A CA    1 
ATOM   1226 C  C     . VAL A 1 157 ? 26.934 83.494  77.356 1.00 16.22 ? 157 VAL A C     1 
ATOM   1227 O  O     . VAL A 1 157 ? 28.083 83.368  77.797 1.00 16.23 ? 157 VAL A O     1 
ATOM   1228 C  CB    . VAL A 1 157 ? 25.389 85.063  78.526 1.00 13.94 ? 157 VAL A CB    1 
ATOM   1229 C  CG1   . VAL A 1 157 ? 26.232 84.956  79.776 1.00 13.79 ? 157 VAL A CG1   1 
ATOM   1230 C  CG2   . VAL A 1 157 ? 24.722 86.409  78.484 1.00 13.64 ? 157 VAL A CG2   1 
ATOM   1231 N  N     . ASP A 1 158 ? 26.202 82.467  76.928 1.00 17.15 ? 158 ASP A N     1 
ATOM   1232 C  CA    . ASP A 1 158 ? 26.722 81.100  76.931 1.00 17.99 ? 158 ASP A CA    1 
ATOM   1233 C  C     . ASP A 1 158 ? 27.971 81.007  76.054 1.00 17.18 ? 158 ASP A C     1 
ATOM   1234 O  O     . ASP A 1 158 ? 28.887 80.237  76.346 1.00 17.99 ? 158 ASP A O     1 
ATOM   1235 C  CB    . ASP A 1 158 ? 25.666 80.109  76.412 1.00 18.84 ? 158 ASP A CB    1 
ATOM   1236 C  CG    . ASP A 1 158 ? 24.564 79.818  77.433 1.00 21.29 ? 158 ASP A CG    1 
ATOM   1237 O  OD1   . ASP A 1 158 ? 24.739 80.137  78.633 1.00 21.83 ? 158 ASP A OD1   1 
ATOM   1238 O  OD2   . ASP A 1 158 ? 23.523 79.248  77.032 1.00 21.32 ? 158 ASP A OD2   1 
ATOM   1239 N  N     . VAL A 1 159 ? 28.001 81.797  74.985 1.00 15.97 ? 159 VAL A N     1 
ATOM   1240 C  CA    . VAL A 1 159 ? 29.131 81.811  74.060 1.00 15.45 ? 159 VAL A CA    1 
ATOM   1241 C  C     . VAL A 1 159 ? 30.424 82.251  74.727 1.00 16.29 ? 159 VAL A C     1 
ATOM   1242 O  O     . VAL A 1 159 ? 31.437 81.551  74.657 1.00 15.21 ? 159 VAL A O     1 
ATOM   1243 C  CB    . VAL A 1 159 ? 28.880 82.769  72.857 1.00 14.32 ? 159 VAL A CB    1 
ATOM   1244 C  CG1   . VAL A 1 159 ? 30.192 83.050  72.133 1.00 10.47 ? 159 VAL A CG1   1 
ATOM   1245 C  CG2   . VAL A 1 159 ? 27.876 82.155  71.893 1.00 12.56 ? 159 VAL A CG2   1 
ATOM   1246 N  N     . PHE A 1 160 ? 30.376 83.418  75.371 1.00 18.15 ? 160 PHE A N     1 
ATOM   1247 C  CA    . PHE A 1 160 ? 31.540 83.998  76.034 1.00 17.88 ? 160 PHE A CA    1 
ATOM   1248 C  C     . PHE A 1 160 ? 31.947 83.269  77.289 1.00 18.56 ? 160 PHE A C     1 
ATOM   1249 O  O     . PHE A 1 160 ? 33.107 83.324  77.686 1.00 18.70 ? 160 PHE A O     1 
ATOM   1250 C  CB    . PHE A 1 160 ? 31.288 85.482  76.294 1.00 17.51 ? 160 PHE A CB    1 
ATOM   1251 C  CG    . PHE A 1 160 ? 31.223 86.290  75.028 1.00 16.56 ? 160 PHE A CG    1 
ATOM   1252 C  CD1   . PHE A 1 160 ? 32.387 86.670  74.373 1.00 16.11 ? 160 PHE A CD1   1 
ATOM   1253 C  CD2   . PHE A 1 160 ? 30.004 86.563  74.423 1.00 15.60 ? 160 PHE A CD2   1 
ATOM   1254 C  CE1   . PHE A 1 160 ? 32.336 87.300  73.133 1.00 15.19 ? 160 PHE A CE1   1 
ATOM   1255 C  CE2   . PHE A 1 160 ? 29.950 87.191  73.183 1.00 15.29 ? 160 PHE A CE2   1 
ATOM   1256 C  CZ    . PHE A 1 160 ? 31.118 87.557  72.539 1.00 13.07 ? 160 PHE A CZ    1 
ATOM   1257 N  N     . ARG A 1 161 ? 30.991 82.580  77.906 1.00 20.27 ? 161 ARG A N     1 
ATOM   1258 C  CA    . ARG A 1 161 ? 31.276 81.781  79.091 1.00 21.76 ? 161 ARG A CA    1 
ATOM   1259 C  C     . ARG A 1 161 ? 32.065 80.562  78.620 1.00 21.71 ? 161 ARG A C     1 
ATOM   1260 O  O     . ARG A 1 161 ? 33.128 80.247  79.149 1.00 21.73 ? 161 ARG A O     1 
ATOM   1261 C  CB    . ARG A 1 161 ? 29.987 81.289  79.761 1.00 22.54 ? 161 ARG A CB    1 
ATOM   1262 C  CG    . ARG A 1 161 ? 29.211 82.319  80.573 1.00 26.48 ? 161 ARG A CG    1 
ATOM   1263 C  CD    . ARG A 1 161 ? 28.827 81.740  81.947 1.00 30.06 ? 161 ARG A CD    1 
ATOM   1264 N  NE    . ARG A 1 161 ? 27.716 82.440  82.601 1.00 32.10 ? 161 ARG A NE    1 
ATOM   1265 C  CZ    . ARG A 1 161 ? 26.438 82.322  82.244 1.00 33.17 ? 161 ARG A CZ    1 
ATOM   1266 N  NH1   . ARG A 1 161 ? 26.094 81.527  81.237 1.00 32.92 ? 161 ARG A NH1   1 
ATOM   1267 N  NH2   . ARG A 1 161 ? 25.498 83.005  82.887 1.00 34.63 ? 161 ARG A NH2   1 
ATOM   1268 N  N     . ARG A 1 162 ? 31.533 79.890  77.604 1.00 22.08 ? 162 ARG A N     1 
ATOM   1269 C  CA    . ARG A 1 162 ? 32.146 78.685  77.058 1.00 23.78 ? 162 ARG A CA    1 
ATOM   1270 C  C     . ARG A 1 162 ? 33.600 78.828  76.629 1.00 23.97 ? 162 ARG A C     1 
ATOM   1271 O  O     . ARG A 1 162 ? 34.428 77.952  76.912 1.00 23.86 ? 162 ARG A O     1 
ATOM   1272 C  CB    . ARG A 1 162 ? 31.325 78.167  75.877 1.00 24.21 ? 162 ARG A CB    1 
ATOM   1273 C  CG    . ARG A 1 162 ? 31.803 76.830  75.326 1.00 25.02 ? 162 ARG A CG    1 
ATOM   1274 C  CD    . ARG A 1 162 ? 31.741 75.712  76.378 1.00 27.17 ? 162 ARG A CD    1 
ATOM   1275 N  NE    . ARG A 1 162 ? 31.900 74.388  75.772 1.00 27.76 ? 162 ARG A NE    1 
ATOM   1276 C  CZ    . ARG A 1 162 ? 30.953 73.762  75.075 1.00 27.15 ? 162 ARG A CZ    1 
ATOM   1277 N  NH1   . ARG A 1 162 ? 29.765 74.326  74.902 1.00 26.58 ? 162 ARG A NH1   1 
ATOM   1278 N  NH2   . ARG A 1 162 ? 31.206 72.586  74.520 1.00 26.58 ? 162 ARG A NH2   1 
ATOM   1279 N  N     . ILE A 1 163 ? 33.924 79.914  75.939 1.00 23.61 ? 163 ILE A N     1 
ATOM   1280 C  CA    . ILE A 1 163 ? 35.297 80.084  75.497 1.00 23.28 ? 163 ILE A CA    1 
ATOM   1281 C  C     . ILE A 1 163 ? 36.268 80.137  76.677 1.00 24.23 ? 163 ILE A C     1 
ATOM   1282 O  O     . ILE A 1 163 ? 37.353 79.556  76.618 1.00 24.75 ? 163 ILE A O     1 
ATOM   1283 C  CB    . ILE A 1 163 ? 35.474 81.351  74.639 1.00 21.01 ? 163 ILE A CB    1 
ATOM   1284 C  CG1   . ILE A 1 163 ? 36.914 81.412  74.125 1.00 17.21 ? 163 ILE A CG1   1 
ATOM   1285 C  CG2   . ILE A 1 163 ? 35.108 82.590  75.443 1.00 21.37 ? 163 ILE A CG2   1 
ATOM   1286 C  CD1   . ILE A 1 163 ? 37.284 80.220  73.257 1.00 12.33 ? 163 ILE A CD1   1 
ATOM   1287 N  N     . ILE A 1 164 ? 35.871 80.824  77.747 1.00 24.02 ? 164 ILE A N     1 
ATOM   1288 C  CA    . ILE A 1 164 ? 36.705 80.956  78.939 1.00 23.88 ? 164 ILE A CA    1 
ATOM   1289 C  C     . ILE A 1 164 ? 36.809 79.615  79.644 1.00 26.44 ? 164 ILE A C     1 
ATOM   1290 O  O     . ILE A 1 164 ? 37.838 79.276  80.228 1.00 27.87 ? 164 ILE A O     1 
ATOM   1291 C  CB    . ILE A 1 164 ? 36.116 81.986  79.910 1.00 21.62 ? 164 ILE A CB    1 
ATOM   1292 C  CG1   . ILE A 1 164 ? 36.226 83.388  79.300 1.00 19.36 ? 164 ILE A CG1   1 
ATOM   1293 C  CG2   . ILE A 1 164 ? 36.817 81.889  81.253 1.00 19.48 ? 164 ILE A CG2   1 
ATOM   1294 C  CD1   . ILE A 1 164 ? 35.389 84.424  79.992 1.00 17.12 ? 164 ILE A CD1   1 
ATOM   1295 N  N     . LEU A 1 165 ? 35.722 78.859  79.594 1.00 28.02 ? 165 LEU A N     1 
ATOM   1296 C  CA    . LEU A 1 165 ? 35.681 77.539  80.202 1.00 29.95 ? 165 LEU A CA    1 
ATOM   1297 C  C     . LEU A 1 165 ? 36.704 76.733  79.435 1.00 30.83 ? 165 LEU A C     1 
ATOM   1298 O  O     . LEU A 1 165 ? 37.535 76.026  80.007 1.00 30.81 ? 165 LEU A O     1 
ATOM   1299 C  CB    . LEU A 1 165 ? 34.298 76.920  79.996 1.00 29.77 ? 165 LEU A CB    1 
ATOM   1300 C  CG    . LEU A 1 165 ? 33.515 76.455  81.217 1.00 28.78 ? 165 LEU A CG    1 
ATOM   1301 C  CD1   . LEU A 1 165 ? 32.079 76.192  80.807 1.00 28.42 ? 165 LEU A CD1   1 
ATOM   1302 C  CD2   . LEU A 1 165 ? 34.172 75.217  81.806 1.00 28.96 ? 165 LEU A CD2   1 
ATOM   1303 N  N     . GLU A 1 166 ? 36.619 76.866  78.118 1.00 32.55 ? 166 GLU A N     1 
ATOM   1304 C  CA    . GLU A 1 166 ? 37.501 76.176  77.198 1.00 33.47 ? 166 GLU A CA    1 
ATOM   1305 C  C     . GLU A 1 166 ? 38.957 76.609  77.373 1.00 34.33 ? 166 GLU A C     1 
ATOM   1306 O  O     . GLU A 1 166 ? 39.875 75.819  77.152 1.00 35.30 ? 166 GLU A O     1 
ATOM   1307 C  CB    . GLU A 1 166 ? 37.022 76.433  75.766 1.00 31.62 ? 166 GLU A CB    1 
ATOM   1308 C  CG    . GLU A 1 166 ? 36.553 75.194  75.027 1.00 31.08 ? 166 GLU A CG    1 
ATOM   1309 C  CD    . GLU A 1 166 ? 35.947 74.154  75.950 1.00 31.70 ? 166 GLU A CD    1 
ATOM   1310 O  OE1   . GLU A 1 166 ? 36.708 73.554  76.735 1.00 32.70 ? 166 GLU A OE1   1 
ATOM   1311 O  OE2   . GLU A 1 166 ? 34.717 73.932  75.901 1.00 31.31 ? 166 GLU A OE2   1 
ATOM   1312 N  N     . ALA A 1 167 ? 39.161 77.855  77.789 1.00 34.99 ? 167 ALA A N     1 
ATOM   1313 C  CA    . ALA A 1 167 ? 40.503 78.391  77.980 1.00 35.76 ? 167 ALA A CA    1 
ATOM   1314 C  C     . ALA A 1 167 ? 41.145 77.945  79.283 1.00 36.76 ? 167 ALA A C     1 
ATOM   1315 O  O     . ALA A 1 167 ? 42.250 77.408  79.271 1.00 36.21 ? 167 ALA A O     1 
ATOM   1316 C  CB    . ALA A 1 167 ? 40.470 79.911  77.912 1.00 36.33 ? 167 ALA A CB    1 
ATOM   1317 N  N     . GLU A 1 168 ? 40.463 78.173  80.404 1.00 38.43 ? 168 GLU A N     1 
ATOM   1318 C  CA    . GLU A 1 168 ? 40.991 77.774  81.709 1.00 41.27 ? 168 GLU A CA    1 
ATOM   1319 C  C     . GLU A 1 168 ? 41.244 76.269  81.750 1.00 40.55 ? 168 GLU A C     1 
ATOM   1320 O  O     . GLU A 1 168 ? 41.776 75.736  82.723 1.00 40.71 ? 168 GLU A O     1 
ATOM   1321 C  CB    . GLU A 1 168 ? 40.015 78.146  82.827 1.00 44.07 ? 168 GLU A CB    1 
ATOM   1322 C  CG    . GLU A 1 168 ? 38.654 77.490  82.705 1.00 50.17 ? 168 GLU A CG    1 
ATOM   1323 C  CD    . GLU A 1 168 ? 37.778 77.716  83.928 1.00 54.10 ? 168 GLU A CD    1 
ATOM   1324 O  OE1   . GLU A 1 168 ? 37.568 78.891  84.318 1.00 54.95 ? 168 GLU A OE1   1 
ATOM   1325 O  OE2   . GLU A 1 168 ? 37.294 76.711  84.498 1.00 56.25 ? 168 GLU A OE2   1 
ATOM   1326 N  N     . LYS A 1 169 ? 40.864 75.594  80.676 1.00 39.63 ? 169 LYS A N     1 
ATOM   1327 C  CA    . LYS A 1 169 ? 41.021 74.159  80.580 1.00 39.33 ? 169 LYS A CA    1 
ATOM   1328 C  C     . LYS A 1 169 ? 42.399 73.811  80.032 1.00 41.49 ? 169 LYS A C     1 
ATOM   1329 O  O     . LYS A 1 169 ? 42.995 72.814  80.434 1.00 42.55 ? 169 LYS A O     1 
ATOM   1330 C  CB    . LYS A 1 169 ? 39.915 73.595  79.686 1.00 36.56 ? 169 LYS A CB    1 
ATOM   1331 C  CG    . LYS A 1 169 ? 39.470 72.210  80.065 1.00 32.47 ? 169 LYS A CG    1 
ATOM   1332 C  CD    . LYS A 1 169 ? 38.250 71.761  79.272 1.00 29.96 ? 169 LYS A CD    1 
ATOM   1333 C  CE    . LYS A 1 169 ? 36.955 72.335  79.818 1.00 27.23 ? 169 LYS A CE    1 
ATOM   1334 N  NZ    . LYS A 1 169 ? 35.768 71.728  79.145 1.00 22.42 ? 169 LYS A NZ    1 
ATOM   1335 N  N     . LEU A 1 170 ? 42.907 74.638  79.121 1.00 44.49 ? 170 LEU A N     1 
ATOM   1336 C  CA    . LEU A 1 170 ? 44.229 74.421  78.528 1.00 47.16 ? 170 LEU A CA    1 
ATOM   1337 C  C     . LEU A 1 170 ? 45.350 75.002  79.383 1.00 49.75 ? 170 LEU A C     1 
ATOM   1338 O  O     . LEU A 1 170 ? 46.520 74.667  79.192 1.00 50.01 ? 170 LEU A O     1 
ATOM   1339 C  CB    . LEU A 1 170 ? 44.317 75.036  77.124 1.00 46.33 ? 170 LEU A CB    1 
ATOM   1340 C  CG    . LEU A 1 170 ? 43.814 74.216  75.935 1.00 45.47 ? 170 LEU A CG    1 
ATOM   1341 C  CD1   . LEU A 1 170 ? 42.314 73.994  76.054 1.00 47.46 ? 170 LEU A CD1   1 
ATOM   1342 C  CD2   . LEU A 1 170 ? 44.139 74.946  74.647 1.00 43.97 ? 170 LEU A CD2   1 
ATOM   1343 N  N     . GLU A 1 171 ? 44.997 75.879  80.319 1.00 52.52 ? 171 GLU A N     1 
ATOM   1344 C  CA    . GLU A 1 171 ? 45.999 76.484  81.192 1.00 55.28 ? 171 GLU A CA    1 
ATOM   1345 C  C     . GLU A 1 171 ? 46.208 75.659  82.470 1.00 57.11 ? 171 GLU A C     1 
ATOM   1346 O  O     . GLU A 1 171 ? 45.456 74.674  82.674 1.00 58.56 ? 171 GLU A O     1 
ATOM   1347 C  CB    . GLU A 1 171 ? 45.590 77.915  81.555 1.00 54.83 ? 171 GLU A CB    1 
ATOM   1348 C  CG    . GLU A 1 171 ? 44.396 78.013  82.482 1.00 54.66 ? 171 GLU A CG    1 
ATOM   1349 C  CD    . GLU A 1 171 ? 44.068 79.446  82.849 1.00 55.63 ? 171 GLU A CD    1 
ATOM   1350 O  OE1   . GLU A 1 171 ? 43.612 80.205  81.964 1.00 56.65 ? 171 GLU A OE1   1 
ATOM   1351 O  OE2   . GLU A 1 171 ? 44.275 79.814  84.025 1.00 55.21 ? 171 GLU A OE2   1 
HETATM 1352 MG MG    . MG  B 2 .   ? 31.335 93.970  63.142 1.00 30.94 ? 178 MG  A MG    1 
HETATM 1353 P  PG    . GNP C 3 .   ? 30.732 93.104  59.717 1.00 33.73 ? 179 GNP A PG    1 
HETATM 1354 O  O1G   . GNP C 3 .   ? 30.585 93.850  58.452 1.00 35.06 ? 179 GNP A O1G   1 
HETATM 1355 O  O2G   . GNP C 3 .   ? 31.351 93.947  60.699 1.00 35.96 ? 179 GNP A O2G   1 
HETATM 1356 O  O3G   . GNP C 3 .   ? 31.731 91.960  59.567 1.00 34.56 ? 179 GNP A O3G   1 
HETATM 1357 N  N3B   . GNP C 3 .   ? 29.333 92.456  60.161 1.00 32.34 ? 179 GNP A N3B   1 
HETATM 1358 P  PB    . GNP C 3 .   ? 29.109 91.552  61.508 1.00 30.24 ? 179 GNP A PB    1 
HETATM 1359 O  O1B   . GNP C 3 .   ? 29.678 90.220  61.328 1.00 29.53 ? 179 GNP A O1B   1 
HETATM 1360 O  O2B   . GNP C 3 .   ? 29.530 92.179  62.741 1.00 28.19 ? 179 GNP A O2B   1 
HETATM 1361 O  O3A   . GNP C 3 .   ? 27.512 91.440  61.604 1.00 31.29 ? 179 GNP A O3A   1 
HETATM 1362 P  PA    . GNP C 3 .   ? 26.476 92.375  62.478 1.00 32.57 ? 179 GNP A PA    1 
HETATM 1363 O  O1A   . GNP C 3 .   ? 26.643 92.084  63.930 1.00 33.69 ? 179 GNP A O1A   1 
HETATM 1364 O  O2A   . GNP C 3 .   ? 26.571 93.776  62.042 1.00 33.92 ? 179 GNP A O2A   1 
HETATM 1365 O  "O5'" . GNP C 3 .   ? 25.082 91.722  62.040 1.00 32.85 ? 179 GNP A "O5'" 1 
HETATM 1366 C  "C5'" . GNP C 3 .   ? 24.651 91.856  60.646 1.00 30.76 ? 179 GNP A "C5'" 1 
HETATM 1367 C  "C4'" . GNP C 3 .   ? 23.120 91.879  60.534 1.00 28.74 ? 179 GNP A "C4'" 1 
HETATM 1368 O  "O4'" . GNP C 3 .   ? 22.595 90.579  60.921 1.00 29.08 ? 179 GNP A "O4'" 1 
HETATM 1369 C  "C3'" . GNP C 3 .   ? 22.441 92.934  61.451 1.00 28.13 ? 179 GNP A "C3'" 1 
HETATM 1370 O  "O3'" . GNP C 3 .   ? 21.397 93.618  60.729 1.00 29.15 ? 179 GNP A "O3'" 1 
HETATM 1371 C  "C2'" . GNP C 3 .   ? 21.961 92.080  62.612 1.00 28.91 ? 179 GNP A "C2'" 1 
HETATM 1372 O  "O2'" . GNP C 3 .   ? 20.799 92.592  63.258 1.00 28.16 ? 179 GNP A "O2'" 1 
HETATM 1373 C  "C1'" . GNP C 3 .   ? 21.662 90.722  61.995 1.00 29.43 ? 179 GNP A "C1'" 1 
HETATM 1374 N  N9    . GNP C 3 .   ? 21.852 89.638  62.999 1.00 30.17 ? 179 GNP A N9    1 
HETATM 1375 C  C8    . GNP C 3 .   ? 22.994 89.287  63.722 1.00 29.00 ? 179 GNP A C8    1 
HETATM 1376 N  N7    . GNP C 3 .   ? 22.847 88.291  64.534 1.00 26.82 ? 179 GNP A N7    1 
HETATM 1377 C  C5    . GNP C 3 .   ? 21.499 87.919  64.365 1.00 28.03 ? 179 GNP A C5    1 
HETATM 1378 C  C6    . GNP C 3 .   ? 20.709 86.871  64.990 1.00 28.51 ? 179 GNP A C6    1 
HETATM 1379 O  O6    . GNP C 3 .   ? 21.052 86.041  65.840 1.00 29.32 ? 179 GNP A O6    1 
HETATM 1380 N  N1    . GNP C 3 .   ? 19.388 86.852  64.528 1.00 29.23 ? 179 GNP A N1    1 
HETATM 1381 C  C2    . GNP C 3 .   ? 18.839 87.709  63.581 1.00 28.65 ? 179 GNP A C2    1 
HETATM 1382 N  N2    . GNP C 3 .   ? 17.540 87.540  63.261 1.00 28.27 ? 179 GNP A N2    1 
HETATM 1383 N  N3    . GNP C 3 .   ? 19.568 88.690  62.989 1.00 28.90 ? 179 GNP A N3    1 
HETATM 1384 C  C4    . GNP C 3 .   ? 20.882 88.745  63.419 1.00 29.21 ? 179 GNP A C4    1 
HETATM 1385 C  C1    . GOL D 4 .   ? 40.738 92.186  59.268 1.00 51.01 ? 180 GOL A C1    1 
HETATM 1386 O  O1    . GOL D 4 .   ? 39.495 91.621  59.765 1.00 51.95 ? 180 GOL A O1    1 
HETATM 1387 C  C2    . GOL D 4 .   ? 40.630 92.494  57.740 1.00 50.69 ? 180 GOL A C2    1 
HETATM 1388 O  O2    . GOL D 4 .   ? 41.633 91.814  57.002 1.00 49.31 ? 180 GOL A O2    1 
HETATM 1389 C  C3    . GOL D 4 .   ? 39.238 92.121  57.202 1.00 49.88 ? 180 GOL A C3    1 
HETATM 1390 O  O3    . GOL D 4 .   ? 39.038 92.420  55.825 1.00 47.90 ? 180 GOL A O3    1 
HETATM 1391 O  O     . HOH E 5 .   ? 32.730 92.309  63.673 1.00 25.97 ? 181 HOH A O     1 
HETATM 1392 O  O     . HOH E 5 .   ? 29.154 95.151  62.680 1.00 27.90 ? 182 HOH A O     1 
HETATM 1393 O  O     . HOH E 5 .   ? 33.457 94.661  50.609 1.00 25.51 ? 183 HOH A O     1 
HETATM 1394 O  O     . HOH E 5 .   ? 34.641 99.681  64.353 1.00 15.59 ? 184 HOH A O     1 
HETATM 1395 O  O     . HOH E 5 .   ? 32.192 83.298  58.792 1.00 8.43  ? 185 HOH A O     1 
HETATM 1396 O  O     . HOH E 5 .   ? 33.153 94.104  58.233 1.00 21.68 ? 186 HOH A O     1 
HETATM 1397 O  O     . HOH E 5 .   ? 29.209 71.949  72.933 1.00 20.03 ? 187 HOH A O     1 
HETATM 1398 O  O     . HOH E 5 .   ? 30.126 98.172  64.153 1.00 22.10 ? 188 HOH A O     1 
HETATM 1399 O  O     . HOH E 5 .   ? 36.899 88.687  61.397 1.00 25.15 ? 189 HOH A O     1 
HETATM 1400 O  O     . HOH E 5 .   ? 39.436 94.399  62.083 1.00 6.35  ? 190 HOH A O     1 
HETATM 1401 O  O     . HOH E 5 .   ? 37.876 74.077  72.014 1.00 33.90 ? 191 HOH A O     1 
HETATM 1402 O  O     . HOH E 5 .   ? 24.123 89.903  79.796 1.00 18.80 ? 192 HOH A O     1 
HETATM 1403 O  O     . HOH E 5 .   ? 43.314 91.004  78.575 1.00 28.51 ? 193 HOH A O     1 
HETATM 1404 O  O     . HOH E 5 .   ? 50.054 85.210  71.452 1.00 13.56 ? 194 HOH A O     1 
HETATM 1405 O  O     . HOH E 5 .   ? 23.503 102.494 61.442 1.00 27.79 ? 195 HOH A O     1 
HETATM 1406 O  O     . HOH E 5 .   ? 28.067 75.304  76.553 1.00 15.63 ? 196 HOH A O     1 
HETATM 1407 O  O     . HOH E 5 .   ? 23.144 93.624  69.785 1.00 30.55 ? 197 HOH A O     1 
HETATM 1408 O  O     . HOH E 5 .   ? 26.007 85.767  52.328 1.00 18.81 ? 198 HOH A O     1 
HETATM 1409 O  O     . HOH E 5 .   ? 19.298 81.537  53.016 1.00 44.98 ? 199 HOH A O     1 
HETATM 1410 O  O     . HOH E 5 .   ? 22.554 70.878  54.945 1.00 23.99 ? 200 HOH A O     1 
HETATM 1411 O  O     . HOH E 5 .   ? 39.949 74.851  58.560 1.00 40.11 ? 201 HOH A O     1 
HETATM 1412 O  O     . HOH E 5 .   ? 30.758 69.246  58.657 1.00 6.26  ? 202 HOH A O     1 
HETATM 1413 O  O     . HOH E 5 .   ? 43.112 97.205  63.219 1.00 23.32 ? 203 HOH A O     1 
HETATM 1414 O  O     . HOH E 5 .   ? 31.946 102.136 60.343 1.00 16.51 ? 204 HOH A O     1 
HETATM 1415 O  O     . HOH E 5 .   ? 29.192 88.055  86.021 1.00 21.15 ? 205 HOH A O     1 
HETATM 1416 O  O     . HOH E 5 .   ? 52.672 85.990  64.493 1.00 29.53 ? 206 HOH A O     1 
HETATM 1417 O  O     . HOH E 5 .   ? 45.427 81.226  85.892 1.00 30.60 ? 207 HOH A O     1 
HETATM 1418 O  O     . HOH E 5 .   ? 46.584 86.068  55.612 1.00 28.09 ? 208 HOH A O     1 
HETATM 1419 O  O     . HOH E 5 .   ? 33.756 68.715  58.923 1.00 21.15 ? 209 HOH A O     1 
HETATM 1420 O  O     . HOH E 5 .   ? 42.275 68.542  71.450 1.00 33.28 ? 210 HOH A O     1 
HETATM 1421 O  O     . HOH E 5 .   ? 20.678 85.597  80.151 1.00 31.77 ? 211 HOH A O     1 
HETATM 1422 O  O     . HOH E 5 .   ? 47.315 84.320  70.418 1.00 20.51 ? 212 HOH A O     1 
HETATM 1423 O  O     . HOH E 5 .   ? 26.971 73.381  53.403 1.00 35.82 ? 213 HOH A O     1 
HETATM 1424 O  O     . HOH E 5 .   ? 15.422 75.755  59.630 1.00 24.44 ? 214 HOH A O     1 
HETATM 1425 O  O     . HOH E 5 .   ? 17.558 78.340  62.145 1.00 37.01 ? 215 HOH A O     1 
HETATM 1426 O  O     . HOH E 5 .   ? 41.046 94.157  82.563 1.00 33.98 ? 216 HOH A O     1 
HETATM 1427 O  O     . HOH E 5 .   ? 41.658 95.766  56.274 1.00 32.67 ? 217 HOH A O     1 
HETATM 1428 O  O     . HOH E 5 .   ? 37.993 95.499  56.484 1.00 32.91 ? 218 HOH A O     1 
HETATM 1429 O  O     . HOH E 5 .   ? 33.486 87.700  49.188 1.00 21.44 ? 219 HOH A O     1 
HETATM 1430 O  O     . HOH E 5 .   ? 35.268 93.581  90.362 1.00 33.35 ? 220 HOH A O     1 
HETATM 1431 O  O     . HOH E 5 .   ? 38.192 93.490  90.139 1.00 14.46 ? 221 HOH A O     1 
HETATM 1432 O  O     . HOH E 5 .   ? 42.819 90.539  91.476 1.00 20.63 ? 222 HOH A O     1 
HETATM 1433 O  O     . HOH E 5 .   ? 25.014 91.931  53.596 1.00 24.97 ? 223 HOH A O     1 
HETATM 1434 O  O     . HOH E 5 .   ? 54.957 87.685  69.652 1.00 14.61 ? 224 HOH A O     1 
HETATM 1435 O  O     . HOH E 5 .   ? 25.125 81.157  51.018 1.00 26.40 ? 225 HOH A O     1 
HETATM 1436 O  O     . HOH E 5 .   ? 26.422 88.409  47.855 1.00 26.46 ? 226 HOH A O     1 
HETATM 1437 O  O     . HOH E 5 .   ? 27.634 85.034  47.765 1.00 24.98 ? 227 HOH A O     1 
HETATM 1438 O  O     . HOH E 5 .   ? 41.164 74.057  68.962 1.00 34.70 ? 228 HOH A O     1 
HETATM 1439 O  O     . HOH E 5 .   ? 15.118 79.801  68.681 1.00 18.25 ? 229 HOH A O     1 
HETATM 1440 O  O     . HOH E 5 .   ? 14.602 76.429  68.203 1.00 40.55 ? 230 HOH A O     1 
HETATM 1441 O  O     . HOH E 5 .   ? 14.081 87.957  55.060 1.00 35.26 ? 231 HOH A O     1 
HETATM 1442 O  O     . HOH E 5 .   ? 10.104 88.862  56.728 1.00 24.10 ? 232 HOH A O     1 
HETATM 1443 O  O     . HOH E 5 .   ? 39.200 66.128  73.083 1.00 34.92 ? 233 HOH A O     1 
HETATM 1444 O  O     . HOH E 5 .   ? 41.258 80.612  83.557 1.00 31.02 ? 234 HOH A O     1 
HETATM 1445 O  O     . HOH E 5 .   ? 40.664 74.444  71.683 1.00 22.66 ? 235 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   PRO 2   2   2   PRO PRO A . n 
A 1 3   GLN 3   3   3   GLN GLN A . n 
A 1 4   SER 4   4   4   SER SER A . n 
A 1 5   LYS 5   5   5   LYS LYS A . n 
A 1 6   SER 6   6   6   SER SER A . n 
A 1 7   ARG 7   7   7   ARG ARG A . n 
A 1 8   LYS 8   8   8   LYS LYS A . n 
A 1 9   ILE 9   9   9   ILE ILE A . n 
A 1 10  ALA 10  10  10  ALA ALA A . n 
A 1 11  ILE 11  11  11  ILE ILE A . n 
A 1 12  LEU 12  12  12  LEU LEU A . n 
A 1 13  GLY 13  13  13  GLY GLY A . n 
A 1 14  TYR 14  14  14  TYR TYR A . n 
A 1 15  ARG 15  15  15  ARG ARG A . n 
A 1 16  SER 16  16  16  SER SER A . n 
A 1 17  VAL 17  17  17  VAL VAL A . n 
A 1 18  GLY 18  18  18  GLY GLY A . n 
A 1 19  LYS 19  19  19  LYS LYS A . n 
A 1 20  SER 20  20  20  SER SER A . n 
A 1 21  SER 21  21  21  SER SER A . n 
A 1 22  LEU 22  22  22  LEU LEU A . n 
A 1 23  THR 23  23  23  THR THR A . n 
A 1 24  ILE 24  24  24  ILE ILE A . n 
A 1 25  GLN 25  25  25  GLN GLN A . n 
A 1 26  PHE 26  26  26  PHE PHE A . n 
A 1 27  VAL 27  27  27  VAL VAL A . n 
A 1 28  GLU 28  28  28  GLU GLU A . n 
A 1 29  GLY 29  29  29  GLY GLY A . n 
A 1 30  GLN 30  30  30  GLN GLN A . n 
A 1 31  PHE 31  31  31  PHE PHE A . n 
A 1 32  VAL 32  32  32  VAL VAL A . n 
A 1 33  ASP 33  33  33  ASP ASP A . n 
A 1 34  SER 34  34  34  SER SER A . n 
A 1 35  TYR 35  35  35  TYR TYR A . n 
A 1 36  ASP 36  36  36  ASP ASP A . n 
A 1 37  PRO 37  37  37  PRO PRO A . n 
A 1 38  THR 38  38  38  THR THR A . n 
A 1 39  ILE 39  39  39  ILE ILE A . n 
A 1 40  GLU 40  40  40  GLU GLU A . n 
A 1 41  ASN 41  41  41  ASN ASN A . n 
A 1 42  THR 42  42  42  THR THR A . n 
A 1 43  PHE 43  43  43  PHE PHE A . n 
A 1 44  THR 44  44  44  THR THR A . n 
A 1 45  LYS 45  45  45  LYS LYS A . n 
A 1 46  LEU 46  46  46  LEU LEU A . n 
A 1 47  ILE 47  47  47  ILE ILE A . n 
A 1 48  THR 48  48  48  THR THR A . n 
A 1 49  VAL 49  49  49  VAL VAL A . n 
A 1 50  ASN 50  50  50  ASN ASN A . n 
A 1 51  GLY 51  51  51  GLY GLY A . n 
A 1 52  GLN 52  52  52  GLN GLN A . n 
A 1 53  GLU 53  53  53  GLU GLU A . n 
A 1 54  TYR 54  54  54  TYR TYR A . n 
A 1 55  HIS 55  55  55  HIS HIS A . n 
A 1 56  LEU 56  56  56  LEU LEU A . n 
A 1 57  GLN 57  57  57  GLN GLN A . n 
A 1 58  LEU 58  58  58  LEU LEU A . n 
A 1 59  VAL 59  59  59  VAL VAL A . n 
A 1 60  ASP 60  60  60  ASP ASP A . n 
A 1 61  THR 61  61  61  THR THR A . n 
A 1 62  ALA 62  62  62  ALA ALA A . n 
A 1 63  GLY 63  63  63  GLY GLY A . n 
A 1 64  GLN 64  64  64  GLN GLN A . n 
A 1 65  ASP 65  65  65  ASP ASP A . n 
A 1 66  GLU 66  66  66  GLU GLU A . n 
A 1 67  TYR 67  67  67  TYR TYR A . n 
A 1 68  SER 68  68  68  SER SER A . n 
A 1 69  ILE 69  69  69  ILE ILE A . n 
A 1 70  PHE 70  70  70  PHE PHE A . n 
A 1 71  PRO 71  71  71  PRO PRO A . n 
A 1 72  GLN 72  72  72  GLN GLN A . n 
A 1 73  THR 73  73  73  THR THR A . n 
A 1 74  TYR 74  74  74  TYR TYR A . n 
A 1 75  SER 75  75  75  SER SER A . n 
A 1 76  ILE 76  76  76  ILE ILE A . n 
A 1 77  ASP 77  77  77  ASP ASP A . n 
A 1 78  ILE 78  78  78  ILE ILE A . n 
A 1 79  ASN 79  79  79  ASN ASN A . n 
A 1 80  GLY 80  80  80  GLY GLY A . n 
A 1 81  TYR 81  81  81  TYR TYR A . n 
A 1 82  ILE 82  82  82  ILE ILE A . n 
A 1 83  LEU 83  83  83  LEU LEU A . n 
A 1 84  VAL 84  84  84  VAL VAL A . n 
A 1 85  TYR 85  85  85  TYR TYR A . n 
A 1 86  SER 86  86  86  SER SER A . n 
A 1 87  VAL 87  87  87  VAL VAL A . n 
A 1 88  THR 88  88  88  THR THR A . n 
A 1 89  SER 89  89  89  SER SER A . n 
A 1 90  ILE 90  90  90  ILE ILE A . n 
A 1 91  LYS 91  91  91  LYS LYS A . n 
A 1 92  SER 92  92  92  SER SER A . n 
A 1 93  PHE 93  93  93  PHE PHE A . n 
A 1 94  GLU 94  94  94  GLU GLU A . n 
A 1 95  VAL 95  95  95  VAL VAL A . n 
A 1 96  ILE 96  96  96  ILE ILE A . n 
A 1 97  LYS 97  97  97  LYS LYS A . n 
A 1 98  VAL 98  98  98  VAL VAL A . n 
A 1 99  ILE 99  99  99  ILE ILE A . n 
A 1 100 HIS 100 100 100 HIS HIS A . n 
A 1 101 GLY 101 101 101 GLY GLY A . n 
A 1 102 LYS 102 102 102 LYS LYS A . n 
A 1 103 LEU 103 103 103 LEU LEU A . n 
A 1 104 LEU 104 104 104 LEU LEU A . n 
A 1 105 ASP 105 105 105 ASP ASP A . n 
A 1 106 MET 106 106 106 MET MET A . n 
A 1 107 VAL 107 107 107 VAL VAL A . n 
A 1 108 GLY 108 108 108 GLY GLY A . n 
A 1 109 LYS 109 109 109 LYS LYS A . n 
A 1 110 VAL 110 110 110 VAL VAL A . n 
A 1 111 GLN 111 111 111 GLN GLN A . n 
A 1 112 ILE 112 112 112 ILE ILE A . n 
A 1 113 PRO 113 113 113 PRO PRO A . n 
A 1 114 ILE 114 114 114 ILE ILE A . n 
A 1 115 MET 115 115 115 MET MET A . n 
A 1 116 LEU 116 116 116 LEU LEU A . n 
A 1 117 VAL 117 117 117 VAL VAL A . n 
A 1 118 GLY 118 118 118 GLY GLY A . n 
A 1 119 ASN 119 119 119 ASN ASN A . n 
A 1 120 LYS 120 120 120 LYS LYS A . n 
A 1 121 LYS 121 121 121 LYS LYS A . n 
A 1 122 ASP 122 122 122 ASP ASP A . n 
A 1 123 LEU 123 123 123 LEU LEU A . n 
A 1 124 HIS 124 124 124 HIS HIS A . n 
A 1 125 MET 125 125 125 MET MET A . n 
A 1 126 GLU 126 126 126 GLU GLU A . n 
A 1 127 ARG 127 127 127 ARG ARG A . n 
A 1 128 VAL 128 128 128 VAL VAL A . n 
A 1 129 ILE 129 129 129 ILE ILE A . n 
A 1 130 SER 130 130 130 SER SER A . n 
A 1 131 TYR 131 131 131 TYR TYR A . n 
A 1 132 GLU 132 132 132 GLU GLU A . n 
A 1 133 GLU 133 133 133 GLU GLU A . n 
A 1 134 GLY 134 134 134 GLY GLY A . n 
A 1 135 LYS 135 135 135 LYS LYS A . n 
A 1 136 ALA 136 136 136 ALA ALA A . n 
A 1 137 LEU 137 137 137 LEU LEU A . n 
A 1 138 ALA 138 138 138 ALA ALA A . n 
A 1 139 GLU 139 139 139 GLU GLU A . n 
A 1 140 SER 140 140 140 SER SER A . n 
A 1 141 TRP 141 141 141 TRP TRP A . n 
A 1 142 ASN 142 142 142 ASN ASN A . n 
A 1 143 ALA 143 143 143 ALA ALA A . n 
A 1 144 ALA 144 144 144 ALA ALA A . n 
A 1 145 PHE 145 145 145 PHE PHE A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 GLU 147 147 147 GLU GLU A . n 
A 1 148 SER 148 148 148 SER SER A . n 
A 1 149 SER 149 149 149 SER SER A . n 
A 1 150 ALA 150 150 150 ALA ALA A . n 
A 1 151 LYS 151 151 151 LYS LYS A . n 
A 1 152 GLU 152 152 152 GLU GLU A . n 
A 1 153 ASN 153 153 153 ASN ASN A . n 
A 1 154 GLN 154 154 154 GLN GLN A . n 
A 1 155 THR 155 155 155 THR THR A . n 
A 1 156 ALA 156 156 156 ALA ALA A . n 
A 1 157 VAL 157 157 157 VAL VAL A . n 
A 1 158 ASP 158 158 158 ASP ASP A . n 
A 1 159 VAL 159 159 159 VAL VAL A . n 
A 1 160 PHE 160 160 160 PHE PHE A . n 
A 1 161 ARG 161 161 161 ARG ARG A . n 
A 1 162 ARG 162 162 162 ARG ARG A . n 
A 1 163 ILE 163 163 163 ILE ILE A . n 
A 1 164 ILE 164 164 164 ILE ILE A . n 
A 1 165 LEU 165 165 165 LEU LEU A . n 
A 1 166 GLU 166 166 166 GLU GLU A . n 
A 1 167 ALA 167 167 167 ALA ALA A . n 
A 1 168 GLU 168 168 168 GLU GLU A . n 
A 1 169 LYS 169 169 169 LYS LYS A . n 
A 1 170 LEU 170 170 170 LEU LEU A . n 
A 1 171 GLU 171 171 171 GLU GLU A . n 
A 1 172 HIS 172 172 ?   ?   ?   A . n 
A 1 173 HIS 173 173 ?   ?   ?   A . n 
A 1 174 HIS 174 174 ?   ?   ?   A . n 
A 1 175 HIS 175 175 ?   ?   ?   A . n 
A 1 176 HIS 176 176 ?   ?   ?   A . n 
A 1 177 HIS 177 177 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 MG  1  178 2  MG  MG  A . 
C 3 GNP 1  179 1  GNP GNP A . 
D 4 GOL 1  180 1  GOL GOL A . 
E 5 HOH 1  181 2  HOH TIP A . 
E 5 HOH 2  182 3  HOH TIP A . 
E 5 HOH 3  183 4  HOH TIP A . 
E 5 HOH 4  184 5  HOH TIP A . 
E 5 HOH 5  185 6  HOH TIP A . 
E 5 HOH 6  186 7  HOH TIP A . 
E 5 HOH 7  187 8  HOH TIP A . 
E 5 HOH 8  188 9  HOH TIP A . 
E 5 HOH 9  189 10 HOH TIP A . 
E 5 HOH 10 190 11 HOH TIP A . 
E 5 HOH 11 191 12 HOH TIP A . 
E 5 HOH 12 192 13 HOH TIP A . 
E 5 HOH 13 193 14 HOH TIP A . 
E 5 HOH 14 194 15 HOH TIP A . 
E 5 HOH 15 195 16 HOH TIP A . 
E 5 HOH 16 196 17 HOH TIP A . 
E 5 HOH 17 197 18 HOH TIP A . 
E 5 HOH 18 198 19 HOH TIP A . 
E 5 HOH 19 199 20 HOH TIP A . 
E 5 HOH 20 200 21 HOH TIP A . 
E 5 HOH 21 201 22 HOH TIP A . 
E 5 HOH 22 202 23 HOH TIP A . 
E 5 HOH 23 203 24 HOH TIP A . 
E 5 HOH 24 204 25 HOH TIP A . 
E 5 HOH 25 205 26 HOH TIP A . 
E 5 HOH 26 206 27 HOH TIP A . 
E 5 HOH 27 207 28 HOH TIP A . 
E 5 HOH 28 208 29 HOH TIP A . 
E 5 HOH 29 209 30 HOH TIP A . 
E 5 HOH 30 210 31 HOH TIP A . 
E 5 HOH 31 211 32 HOH TIP A . 
E 5 HOH 32 212 33 HOH TIP A . 
E 5 HOH 33 213 34 HOH TIP A . 
E 5 HOH 34 214 35 HOH TIP A . 
E 5 HOH 35 215 36 HOH TIP A . 
E 5 HOH 36 216 37 HOH TIP A . 
E 5 HOH 37 217 38 HOH TIP A . 
E 5 HOH 38 218 39 HOH TIP A . 
E 5 HOH 39 219 40 HOH TIP A . 
E 5 HOH 40 220 41 HOH TIP A . 
E 5 HOH 41 221 42 HOH TIP A . 
E 5 HOH 42 222 43 HOH TIP A . 
E 5 HOH 43 223 44 HOH TIP A . 
E 5 HOH 44 224 45 HOH TIP A . 
E 5 HOH 45 225 46 HOH TIP A . 
E 5 HOH 46 226 47 HOH TIP A . 
E 5 HOH 47 227 48 HOH TIP A . 
E 5 HOH 48 228 49 HOH TIP A . 
E 5 HOH 49 229 50 HOH TIP A . 
E 5 HOH 50 230 51 HOH TIP A . 
E 5 HOH 51 231 52 HOH TIP A . 
E 5 HOH 52 232 53 HOH TIP A . 
E 5 HOH 53 233 54 HOH TIP A . 
E 5 HOH 54 234 55 HOH TIP A . 
E 5 HOH 55 235 56 HOH TIP A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O2G ? C GNP .  ? A GNP 179 ? 1_555 MG ? B MG . ? A MG 178 ? 1_555 O2B ? C GNP .  ? A GNP 179 ? 1_555 80.9  ? 
2  O2G ? C GNP .  ? A GNP 179 ? 1_555 MG ? B MG . ? A MG 178 ? 1_555 O   ? E HOH .  ? A HOH 182 ? 1_555 80.0  ? 
3  O2B ? C GNP .  ? A GNP 179 ? 1_555 MG ? B MG . ? A MG 178 ? 1_555 O   ? E HOH .  ? A HOH 182 ? 1_555 72.0  ? 
4  O2G ? C GNP .  ? A GNP 179 ? 1_555 MG ? B MG . ? A MG 178 ? 1_555 OG  ? A SER 20 ? A SER 20  ? 1_555 149.2 ? 
5  O2B ? C GNP .  ? A GNP 179 ? 1_555 MG ? B MG . ? A MG 178 ? 1_555 OG  ? A SER 20 ? A SER 20  ? 1_555 78.4  ? 
6  O   ? E HOH .  ? A HOH 182 ? 1_555 MG ? B MG . ? A MG 178 ? 1_555 OG  ? A SER 20 ? A SER 20  ? 1_555 72.0  ? 
7  O2G ? C GNP .  ? A GNP 179 ? 1_555 MG ? B MG . ? A MG 178 ? 1_555 O   ? E HOH .  ? A HOH 181 ? 1_555 103.1 ? 
8  O2B ? C GNP .  ? A GNP 179 ? 1_555 MG ? B MG . ? A MG 178 ? 1_555 O   ? E HOH .  ? A HOH 181 ? 1_555 87.6  ? 
9  O   ? E HOH .  ? A HOH 182 ? 1_555 MG ? B MG . ? A MG 178 ? 1_555 O   ? E HOH .  ? A HOH 181 ? 1_555 158.7 ? 
10 OG  ? A SER 20 ? A SER 20  ? 1_555 MG ? B MG . ? A MG 178 ? 1_555 O   ? E HOH .  ? A HOH 181 ? 1_555 98.6  ? 
11 O2G ? C GNP .  ? A GNP 179 ? 1_555 MG ? B MG . ? A MG 178 ? 1_555 OG1 ? A THR 38 ? A THR 38  ? 1_555 97.1  ? 
12 O2B ? C GNP .  ? A GNP 179 ? 1_555 MG ? B MG . ? A MG 178 ? 1_555 OG1 ? A THR 38 ? A THR 38  ? 1_555 140.7 ? 
13 O   ? E HOH .  ? A HOH 182 ? 1_555 MG ? B MG . ? A MG 178 ? 1_555 OG1 ? A THR 38 ? A THR 38  ? 1_555 69.1  ? 
14 OG  ? A SER 20 ? A SER 20  ? 1_555 MG ? B MG . ? A MG 178 ? 1_555 OG1 ? A THR 38 ? A THR 38  ? 1_555 85.0  ? 
15 O   ? E HOH .  ? A HOH 181 ? 1_555 MG ? B MG . ? A MG 178 ? 1_555 OG1 ? A THR 38 ? A THR 38  ? 1_555 130.3 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2005-03-08 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-11 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Non-polymer description'   
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
TRUNCATE 'data reduction' .            ? 1 
CNS      refinement       .            ? 2 
CCP4     'data scaling'   '(TRUNCATE)' ? 3 
CNS      phasing          .            ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 GLN A 3   ? ? -27.44  -41.17  
2  1 SER A 16  ? ? 70.22   -3.25   
3  1 SER A 34  ? ? -49.53  89.55   
4  1 GLU A 40  ? ? 173.50  118.18  
5  1 ASP A 65  ? ? -142.28 -155.58 
6  1 PRO A 71  ? ? -34.39  115.94  
7  1 VAL A 107 ? ? -53.25  -9.27   
8  1 LYS A 120 ? ? 74.16   41.22   
9  1 LEU A 123 ? ? -69.49  66.77   
10 1 ALA A 150 ? ? -66.17  3.74    
11 1 ASN A 153 ? ? -28.45  -56.10  
12 1 GLU A 168 ? ? -58.82  -4.67   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A MET 1   ? A MET 1   
2 1 Y 1 A HIS 172 ? A HIS 172 
3 1 Y 1 A HIS 173 ? A HIS 173 
4 1 Y 1 A HIS 174 ? A HIS 174 
5 1 Y 1 A HIS 175 ? A HIS 175 
6 1 Y 1 A HIS 176 ? A HIS 176 
7 1 Y 1 A HIS 177 ? A HIS 177 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'MAGNESIUM ION'                               MG  
3 'PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER' GNP 
4 GLYCEROL                                      GOL 
5 water                                         HOH 
#