data_1XXE
# 
_entry.id   1XXE 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1XXE         
RCSB  RCSB030875   
WWPDB D_1000030875 
# 
_pdbx_database_PDB_obs_spr.id               SPRSDE 
_pdbx_database_PDB_obs_spr.pdb_id           1XXE 
_pdbx_database_PDB_obs_spr.replace_pdb_id   1NZT 
_pdbx_database_PDB_obs_spr.date             2004-11-23 
_pdbx_database_PDB_obs_spr.details          ? 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1XXE 
_pdbx_database_status.recvd_initial_deposition_date   2004-11-04 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Coggins, B.E.'   1 
'McClerren, A.L.' 2 
'Jiang, L.'       3 
'Li, X.'          4 
'Rudolph, J.'     5 
'Hindsgaul, O.'   6 
'Raetz, C.R.H.'   7 
'Zhou, P.'        8 
# 
_citation.id                        primary 
_citation.title                     
;Refined Solution Structure of the LpxC-TU-514 Complex and pK(a) Analysis of an Active Site Histidine: Insights into the Mechanism and Inhibitor Design
;
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            44 
_citation.page_first                1114 
_citation.page_last                 1126 
_citation.year                      2005 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15667205 
_citation.pdbx_database_id_DOI      10.1021/bi047820z 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Coggins, B.E.'   1 
primary 'McClerren, A.L.' 2 
primary 'Jiang, L.'       3 
primary 'Li, X.'          4 
primary 'Rudolph, J.'     5 
primary 'Hindsgaul, O.'   6 
primary 'Raetz, C.R.H.'   7 
primary 'Zhou, P.'        8 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase'                    32193.916 1 3.5.1.- ? ? 
'complexed with TU-514' 
2 non-polymer syn 'ZINC ION'                                                                        65.409    1 ?       ? ? ? 
3 non-polymer syn '1,5-ANHYDRO-2-C-(CARBOXYMETHYL-N-HYDROXYAMIDE)-2-DEOXY-3-O-MYRISTOYL-D-GLUCITOL' 431.563   1 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'UDP-3-O-acyl-GlcNAc deacetylase' 
# 
_entity_name_sys.entity_id   1 
_entity_name_sys.name        E.C.3.5.1.- 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MGLEKTVKEKLSFEGVGIHTGEYSKLIIHPEKEGTGIRFFKNGVYIPARHEFVVHTNHSTDLGFKGQRIKTVEHILSVLH
LLEITNVTIEVIGNEIPILDGSGWEFYEAIRKNILNQNREIDYFVVEEPIIVEDEGRLIKAEPSDTLEVTYEGEFKNFLG
RQKFTFVEGNEEEIVLARTFCFDWEIEHIKKVGLGKGGSLKNTLVLGKDKVYNPEGLRYENEPVRHKVFDLIGDLYLLGS
PVKGKFYSFRGGHSLNVKLVKELAKKQKLTRDLPHLPSVQAL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGLEKTVKEKLSFEGVGIHTGEYSKLIIHPEKEGTGIRFFKNGVYIPARHEFVVHTNHSTDLGFKGQRIKTVEHILSVLH
LLEITNVTIEVIGNEIPILDGSGWEFYEAIRKNILNQNREIDYFVVEEPIIVEDEGRLIKAEPSDTLEVTYEGEFKNFLG
RQKFTFVEGNEEEIVLARTFCFDWEIEHIKKVGLGKGGSLKNTLVLGKDKVYNPEGLRYENEPVRHKVFDLIGDLYLLGS
PVKGKFYSFRGGHSLNVKLVKELAKKQKLTRDLPHLPSVQAL
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   LEU n 
1 4   GLU n 
1 5   LYS n 
1 6   THR n 
1 7   VAL n 
1 8   LYS n 
1 9   GLU n 
1 10  LYS n 
1 11  LEU n 
1 12  SER n 
1 13  PHE n 
1 14  GLU n 
1 15  GLY n 
1 16  VAL n 
1 17  GLY n 
1 18  ILE n 
1 19  HIS n 
1 20  THR n 
1 21  GLY n 
1 22  GLU n 
1 23  TYR n 
1 24  SER n 
1 25  LYS n 
1 26  LEU n 
1 27  ILE n 
1 28  ILE n 
1 29  HIS n 
1 30  PRO n 
1 31  GLU n 
1 32  LYS n 
1 33  GLU n 
1 34  GLY n 
1 35  THR n 
1 36  GLY n 
1 37  ILE n 
1 38  ARG n 
1 39  PHE n 
1 40  PHE n 
1 41  LYS n 
1 42  ASN n 
1 43  GLY n 
1 44  VAL n 
1 45  TYR n 
1 46  ILE n 
1 47  PRO n 
1 48  ALA n 
1 49  ARG n 
1 50  HIS n 
1 51  GLU n 
1 52  PHE n 
1 53  VAL n 
1 54  VAL n 
1 55  HIS n 
1 56  THR n 
1 57  ASN n 
1 58  HIS n 
1 59  SER n 
1 60  THR n 
1 61  ASP n 
1 62  LEU n 
1 63  GLY n 
1 64  PHE n 
1 65  LYS n 
1 66  GLY n 
1 67  GLN n 
1 68  ARG n 
1 69  ILE n 
1 70  LYS n 
1 71  THR n 
1 72  VAL n 
1 73  GLU n 
1 74  HIS n 
1 75  ILE n 
1 76  LEU n 
1 77  SER n 
1 78  VAL n 
1 79  LEU n 
1 80  HIS n 
1 81  LEU n 
1 82  LEU n 
1 83  GLU n 
1 84  ILE n 
1 85  THR n 
1 86  ASN n 
1 87  VAL n 
1 88  THR n 
1 89  ILE n 
1 90  GLU n 
1 91  VAL n 
1 92  ILE n 
1 93  GLY n 
1 94  ASN n 
1 95  GLU n 
1 96  ILE n 
1 97  PRO n 
1 98  ILE n 
1 99  LEU n 
1 100 ASP n 
1 101 GLY n 
1 102 SER n 
1 103 GLY n 
1 104 TRP n 
1 105 GLU n 
1 106 PHE n 
1 107 TYR n 
1 108 GLU n 
1 109 ALA n 
1 110 ILE n 
1 111 ARG n 
1 112 LYS n 
1 113 ASN n 
1 114 ILE n 
1 115 LEU n 
1 116 ASN n 
1 117 GLN n 
1 118 ASN n 
1 119 ARG n 
1 120 GLU n 
1 121 ILE n 
1 122 ASP n 
1 123 TYR n 
1 124 PHE n 
1 125 VAL n 
1 126 VAL n 
1 127 GLU n 
1 128 GLU n 
1 129 PRO n 
1 130 ILE n 
1 131 ILE n 
1 132 VAL n 
1 133 GLU n 
1 134 ASP n 
1 135 GLU n 
1 136 GLY n 
1 137 ARG n 
1 138 LEU n 
1 139 ILE n 
1 140 LYS n 
1 141 ALA n 
1 142 GLU n 
1 143 PRO n 
1 144 SER n 
1 145 ASP n 
1 146 THR n 
1 147 LEU n 
1 148 GLU n 
1 149 VAL n 
1 150 THR n 
1 151 TYR n 
1 152 GLU n 
1 153 GLY n 
1 154 GLU n 
1 155 PHE n 
1 156 LYS n 
1 157 ASN n 
1 158 PHE n 
1 159 LEU n 
1 160 GLY n 
1 161 ARG n 
1 162 GLN n 
1 163 LYS n 
1 164 PHE n 
1 165 THR n 
1 166 PHE n 
1 167 VAL n 
1 168 GLU n 
1 169 GLY n 
1 170 ASN n 
1 171 GLU n 
1 172 GLU n 
1 173 GLU n 
1 174 ILE n 
1 175 VAL n 
1 176 LEU n 
1 177 ALA n 
1 178 ARG n 
1 179 THR n 
1 180 PHE n 
1 181 CYS n 
1 182 PHE n 
1 183 ASP n 
1 184 TRP n 
1 185 GLU n 
1 186 ILE n 
1 187 GLU n 
1 188 HIS n 
1 189 ILE n 
1 190 LYS n 
1 191 LYS n 
1 192 VAL n 
1 193 GLY n 
1 194 LEU n 
1 195 GLY n 
1 196 LYS n 
1 197 GLY n 
1 198 GLY n 
1 199 SER n 
1 200 LEU n 
1 201 LYS n 
1 202 ASN n 
1 203 THR n 
1 204 LEU n 
1 205 VAL n 
1 206 LEU n 
1 207 GLY n 
1 208 LYS n 
1 209 ASP n 
1 210 LYS n 
1 211 VAL n 
1 212 TYR n 
1 213 ASN n 
1 214 PRO n 
1 215 GLU n 
1 216 GLY n 
1 217 LEU n 
1 218 ARG n 
1 219 TYR n 
1 220 GLU n 
1 221 ASN n 
1 222 GLU n 
1 223 PRO n 
1 224 VAL n 
1 225 ARG n 
1 226 HIS n 
1 227 LYS n 
1 228 VAL n 
1 229 PHE n 
1 230 ASP n 
1 231 LEU n 
1 232 ILE n 
1 233 GLY n 
1 234 ASP n 
1 235 LEU n 
1 236 TYR n 
1 237 LEU n 
1 238 LEU n 
1 239 GLY n 
1 240 SER n 
1 241 PRO n 
1 242 VAL n 
1 243 LYS n 
1 244 GLY n 
1 245 LYS n 
1 246 PHE n 
1 247 TYR n 
1 248 SER n 
1 249 PHE n 
1 250 ARG n 
1 251 GLY n 
1 252 GLY n 
1 253 HIS n 
1 254 SER n 
1 255 LEU n 
1 256 ASN n 
1 257 VAL n 
1 258 LYS n 
1 259 LEU n 
1 260 VAL n 
1 261 LYS n 
1 262 GLU n 
1 263 LEU n 
1 264 ALA n 
1 265 LYS n 
1 266 LYS n 
1 267 GLN n 
1 268 LYS n 
1 269 LEU n 
1 270 THR n 
1 271 ARG n 
1 272 ASP n 
1 273 LEU n 
1 274 PRO n 
1 275 HIS n 
1 276 LEU n 
1 277 PRO n 
1 278 SER n 
1 279 VAL n 
1 280 GLN n 
1 281 ALA n 
1 282 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Aquifex 
_entity_src_gen.pdbx_gene_src_gene                 LpxC 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Aquifex aeolicus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     63363 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)STAR' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET21a 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.entity_id                  1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    LPXC_AQUAE 
_struct_ref.pdbx_db_accession          O67648 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MGLEKTVKEKLSFEGVGIHTGEYSKLIIHPEKEGTGIRFFKNGVYIPARHEFVVHTNHSTDLGFKGQRIKTVEHILSVLH
LLEITNVTIEVIGNEIPILDGSGWEFYEAIRKNILNQNREIDYFVVEEPIIVEDEGRLIKAEPSDTLEVTYEGEFKNFLG
RQKFTFVEGNEEEIVLARTFCFDWEIEHIKKVGLGKGGSLKNTLVLGKDKVYNPEGLRYENEPVRHKVFDLIGDLYLLGS
PVKGKFYSFRGGHSLNVKLVKELAKKQKLTRDLPHLPSVQAL
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1XXE 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 282 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             O67648 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  282 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       282 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                                           ?      'C3 H7 N O2' 
89.093  
ARG 'L-peptide linking' y ARGININE                                                                          ?      
'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                        ?      'C4 H8 N2 O3' 
132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                   ?      'C4 H7 N O4' 
133.103 
CYS 'L-peptide linking' y CYSTEINE                                                                          ?      'C3 H7 N O2 S' 
121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                                         ?      'C5 H10 N2 O3' 
146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                   ?      'C5 H9 N O4' 
147.129 
GLY 'peptide linking'   y GLYCINE                                                                           ?      'C2 H5 N O2' 
75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                         ?      
'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE                                                                        ?      'C6 H13 N O2' 
131.173 
LEU 'L-peptide linking' y LEUCINE                                                                           ?      'C6 H13 N O2' 
131.173 
LYS 'L-peptide linking' y LYSINE                                                                            ?      
'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                                                                        ?      'C5 H11 N O2 S' 
149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                                     ?      'C9 H11 N O2' 
165.189 
PRO 'L-peptide linking' y PROLINE                                                                           ?      'C5 H9 N O2' 
115.130 
SER 'L-peptide linking' y SERINE                                                                            ?      'C3 H7 N O3' 
105.093 
THR 'L-peptide linking' y THREONINE                                                                         ?      'C4 H9 N O3' 
119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                        ?      'C11 H12 N2 O2' 
204.225 
TUX non-polymer         . '1,5-ANHYDRO-2-C-(CARBOXYMETHYL-N-HYDROXYAMIDE)-2-DEOXY-3-O-MYRISTOYL-D-GLUCITOL' TU-514 'C22 H41 N O7' 
431.563 
TYR 'L-peptide linking' y TYROSINE                                                                          ?      'C9 H11 N O3' 
181.189 
VAL 'L-peptide linking' y VALINE                                                                            ?      'C5 H11 N O2' 
117.146 
ZN  non-polymer         . 'ZINC ION'                                                                        ?      'Zn 2' 65.409  
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
1 4 4 3D_15N-separated_NOESY 
2 1 1 3D_13C-separated_NOESY 
3 3 3 3D_13C-separated_NOESY 
4 3 3 RDC                    
5 4 4 'HNCO-based RDC'       
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         323 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  6.5 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      '100 mM KCl' 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solvent_system 
1 '0.5 mM U-15N/13C AaLpxC/TU-514'                                       
'25 mM sodium phosphate, pH 6.5, 100 mM KCl, 2 mM DTT, 5% deuterated-DMSO and 5% D2O'  
2 '0.5 mM deuterated, 15N/13C, VIL-methyl protonated AaLpxC with TU-514' 
'25 mM sodium phosphate, pH 6.5, 100 mM KCl, 2 mM DTT, 5% deuterated-DMSO and 5% D2O'  
3 '13C-TU514/15N AaLpxC'                                                 
'25 mM sodium phosphate, pH 6.5, 100 mM KCl, 2 mM DTT, 5% deuterated-DMSO and 95% D2O' 
4 '0.5 mM U-15N AaLpxC/TU-514'                                           
'25 mM sodium phosphate, pH 6.5, 100 mM KCl, 2 mM DTT, 5% deuterated-DMSO and 5% D2O'  
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.field_strength 
1 ? Varian INOVA 600 
2 ? Varian INOVA 800 
# 
_pdbx_nmr_refine.entry_id           1XXE 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      1XXE 
_pdbx_nmr_ensemble.conformers_calculated_total_number            50 
_pdbx_nmr_ensemble.conformers_submitted_total_number             25 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             1XXE 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
DYANA     1.5   'structure solution' 'Guntert P., Mumenthaler C., Wuthrich K.'                      1 
XPLOR-NIH 2.9.7 refinement           'Schwieters C.D., Kuszewski J.J., Tjandra N., Marius Clore G.' 2 
# 
_exptl.entry_id          1XXE 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  1XXE 
_struct.title                     'RDC refined solution structure of the AaLpxC/TU-514 complex' 
_struct.pdbx_descriptor           'UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase (E.C.3.5.1.-)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1XXE 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
;LpxC; TU-514; LPS; lipid A; lipopolysaccharide UDP-3-O-acyl-N-acetylglucosamine deacetylase; metalloamidase; zinc metalloamidase, HYDROLASE
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLU A 73  ? LEU A 82  ? GLU A 73  LEU A 82  1 ? 10 
HELX_P HELX_P2 2 GLY A 103 ? LYS A 112 ? GLY A 103 LYS A 112 1 ? 10 
HELX_P HELX_P3 3 GLU A 171 ? ILE A 174 ? GLU A 171 ILE A 174 5 ? 4  
HELX_P HELX_P4 4 ASP A 183 ? LYS A 191 ? ASP A 183 LYS A 191 1 ? 9  
HELX_P HELX_P5 5 GLU A 222 ? LEU A 235 ? GLU A 222 LEU A 235 1 ? 14 
HELX_P HELX_P6 6 HIS A 253 ? LYS A 266 ? HIS A 253 LYS A 266 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? B ZN . ZN ? ? ? 1_555 C TUX .   OYH ? ? A ZN 319 A TUX 320 1_555 ? ? ? ? ? ? ? 2.626 ? 
metalc2 metalc ? ? B ZN . ZN ? ? ? 1_555 A HIS 74  NE2 ? ? A ZN 319 A HIS 74  1_555 ? ? ? ? ? ? ? 2.509 ? 
metalc3 metalc ? ? B ZN . ZN ? ? ? 1_555 A HIS 226 NE2 ? ? A ZN 319 A HIS 226 1_555 ? ? ? ? ? ? ? 2.512 ? 
metalc4 metalc ? ? B ZN . ZN ? ? ? 1_555 A ASP 230 OD2 ? ? A ZN 319 A ASP 230 1_555 ? ? ? ? ? ? ? 2.453 ? 
metalc5 metalc ? ? B ZN . ZN ? ? ? 1_555 C TUX .   OXH ? ? A ZN 319 A TUX 320 1_555 ? ? ? ? ? ? ? 2.670 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 5 ? 
C ? 3 ? 
D ? 2 ? 
E ? 5 ? 
F ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? parallel      
B 4 5 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? parallel      
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? parallel      
E 4 5 ? anti-parallel 
F 1 2 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LYS A 5   ? VAL A 7   ? LYS A 5   VAL A 7   
A 2 ILE A 114 ? ASN A 116 ? ILE A 114 ASN A 116 
B 1 LEU A 11  ? VAL A 16  ? LEU A 11  VAL A 16  
B 2 TYR A 23  ? PRO A 30  ? TYR A 23  PRO A 30  
B 3 ASN A 86  ? ILE A 92  ? ASN A 86  ILE A 92  
B 4 GLY A 36  ? LYS A 41  ? GLY A 36  LYS A 41  
B 5 VAL A 44  ? PRO A 47  ? VAL A 44  PRO A 47  
C 1 VAL A 53  ? THR A 56  ? VAL A 53  THR A 56  
C 2 THR A 60  ? PHE A 64  ? THR A 60  PHE A 64  
C 3 GLN A 67  ? ILE A 69  ? GLN A 67  ILE A 69  
D 1 PHE A 124 ? VAL A 125 ? PHE A 124 VAL A 125 
D 2 VAL A 242 ? LYS A 243 ? VAL A 242 LYS A 243 
E 1 ILE A 130 ? ASP A 134 ? ILE A 130 ASP A 134 
E 2 ARG A 137 ? GLU A 142 ? ARG A 137 GLU A 142 
E 3 LYS A 245 ? PHE A 249 ? LYS A 245 PHE A 249 
E 4 GLU A 148 ? GLU A 154 ? GLU A 148 GLU A 154 
E 5 ARG A 161 ? VAL A 167 ? ARG A 161 VAL A 167 
F 1 PHE A 180 ? PHE A 182 ? PHE A 180 PHE A 182 
F 2 LEU A 204 ? LEU A 206 ? LEU A 204 LEU A 206 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N THR A 6   ? N THR A 6   O LEU A 115 ? O LEU A 115 
B 1 2 N LEU A 11  ? N LEU A 11  O ILE A 28  ? O ILE A 28  
B 2 3 N ILE A 27  ? N ILE A 27  O GLU A 90  ? O GLU A 90  
B 3 4 O ILE A 89  ? O ILE A 89  N ARG A 38  ? N ARG A 38  
B 4 5 N PHE A 39  ? N PHE A 39  O ILE A 46  ? O ILE A 46  
C 1 2 N VAL A 54  ? N VAL A 54  O ASP A 61  ? O ASP A 61  
C 2 3 N LEU A 62  ? N LEU A 62  O ILE A 69  ? O ILE A 69  
D 1 2 N PHE A 124 ? N PHE A 124 O LYS A 243 ? O LYS A 243 
E 1 2 N ASP A 134 ? N ASP A 134 O ARG A 137 ? O ARG A 137 
E 2 3 N GLU A 142 ? N GLU A 142 O LYS A 245 ? O LYS A 245 
E 3 4 O PHE A 246 ? O PHE A 246 N GLU A 148 ? N GLU A 148 
E 4 5 N VAL A 149 ? N VAL A 149 O PHE A 166 ? O PHE A 166 
F 1 2 N CYS A 181 ? N CYS A 181 O LEU A 206 ? O LEU A 206 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE ZN A 319'  
AC2 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE TUX A 320' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5  HIS A 74  ? HIS A 74  . ? 1_555 ? 
2  AC1 5  THR A 179 ? THR A 179 . ? 1_555 ? 
3  AC1 5  HIS A 226 ? HIS A 226 . ? 1_555 ? 
4  AC1 5  ASP A 230 ? ASP A 230 . ? 1_555 ? 
5  AC1 5  TUX C .   ? TUX A 320 . ? 1_555 ? 
6  AC2 15 HIS A 58  ? HIS A 58  . ? 1_555 ? 
7  AC2 15 SER A 59  ? SER A 59  . ? 1_555 ? 
8  AC2 15 GLU A 73  ? GLU A 73  . ? 1_555 ? 
9  AC2 15 HIS A 74  ? HIS A 74  . ? 1_555 ? 
10 AC2 15 THR A 179 ? THR A 179 . ? 1_555 ? 
11 AC2 15 PHE A 180 ? PHE A 180 . ? 1_555 ? 
12 AC2 15 CYS A 181 ? CYS A 181 . ? 1_555 ? 
13 AC2 15 GLU A 185 ? GLU A 185 . ? 1_555 ? 
14 AC2 15 ILE A 186 ? ILE A 186 . ? 1_555 ? 
15 AC2 15 ILE A 189 ? ILE A 189 . ? 1_555 ? 
16 AC2 15 GLY A 195 ? GLY A 195 . ? 1_555 ? 
17 AC2 15 GLY A 198 ? GLY A 198 . ? 1_555 ? 
18 AC2 15 TYR A 212 ? TYR A 212 . ? 1_555 ? 
19 AC2 15 LYS A 227 ? LYS A 227 . ? 1_555 ? 
20 AC2 15 ZN  B .   ? ZN  A 319 . ? 1_555 ? 
# 
_atom_sites.entry_id                    1XXE 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
H  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1      N  N    . LEU A 1 3   ? 20.823  -8.474  0.137   1.00 0.00 ? 3   LEU A N    1  
ATOM   2      C  CA   . LEU A 1 3   ? 21.497  -7.623  1.158   1.00 0.00 ? 3   LEU A CA   1  
ATOM   3      C  C    . LEU A 1 3   ? 20.742  -6.300  1.299   1.00 0.00 ? 3   LEU A C    1  
ATOM   4      O  O    . LEU A 1 3   ? 19.863  -5.989  0.519   1.00 0.00 ? 3   LEU A O    1  
ATOM   5      C  CB   . LEU A 1 3   ? 22.937  -7.347  0.721   1.00 0.00 ? 3   LEU A CB   1  
ATOM   6      C  CG   . LEU A 1 3   ? 23.650  -8.673  0.460   1.00 0.00 ? 3   LEU A CG   1  
ATOM   7      C  CD1  . LEU A 1 3   ? 23.762  -8.906  -1.047  1.00 0.00 ? 3   LEU A CD1  1  
ATOM   8      C  CD2  . LEU A 1 3   ? 25.050  -8.627  1.075   1.00 0.00 ? 3   LEU A CD2  1  
ATOM   9      H  H    . LEU A 1 3   ? 20.852  -8.221  -0.809  1.00 0.00 ? 3   LEU A H    1  
ATOM   10     H  HA   . LEU A 1 3   ? 21.501  -8.136  2.107   1.00 0.00 ? 3   LEU A HA   1  
ATOM   11     H  HB2  . LEU A 1 3   ? 22.931  -6.755  -0.184  1.00 0.00 ? 3   LEU A HB2  1  
ATOM   12     H  HB3  . LEU A 1 3   ? 23.454  -6.808  1.500   1.00 0.00 ? 3   LEU A HB3  1  
ATOM   13     H  HG   . LEU A 1 3   ? 23.085  -9.478  0.908   1.00 0.00 ? 3   LEU A HG   1  
ATOM   14     H  HD11 . LEU A 1 3   ? 24.490  -8.225  -1.463  1.00 0.00 ? 3   LEU A HD11 1  
ATOM   15     H  HD12 . LEU A 1 3   ? 22.802  -8.733  -1.509  1.00 0.00 ? 3   LEU A HD12 1  
ATOM   16     H  HD13 . LEU A 1 3   ? 24.073  -9.923  -1.232  1.00 0.00 ? 3   LEU A HD13 1  
ATOM   17     H  HD21 . LEU A 1 3   ? 24.979  -8.752  2.146   1.00 0.00 ? 3   LEU A HD21 1  
ATOM   18     H  HD22 . LEU A 1 3   ? 25.509  -7.673  0.855   1.00 0.00 ? 3   LEU A HD22 1  
ATOM   19     H  HD23 . LEU A 1 3   ? 25.653  -9.421  0.659   1.00 0.00 ? 3   LEU A HD23 1  
ATOM   20     N  N    . GLU A 1 4   ? 21.079  -5.517  2.288   1.00 0.00 ? 4   GLU A N    1  
ATOM   21     C  CA   . GLU A 1 4   ? 20.382  -4.213  2.477   1.00 0.00 ? 4   GLU A CA   1  
ATOM   22     C  C    . GLU A 1 4   ? 20.401  -3.422  1.170   1.00 0.00 ? 4   GLU A C    1  
ATOM   23     O  O    . GLU A 1 4   ? 21.400  -3.365  0.481   1.00 0.00 ? 4   GLU A O    1  
ATOM   24     C  CB   . GLU A 1 4   ? 21.082  -3.407  3.575   1.00 0.00 ? 4   GLU A CB   1  
ATOM   25     C  CG   . GLU A 1 4   ? 20.438  -3.701  4.935   1.00 0.00 ? 4   GLU A CG   1  
ATOM   26     C  CD   . GLU A 1 4   ? 20.714  -5.150  5.341   1.00 0.00 ? 4   GLU A CD   1  
ATOM   27     O  OE1  . GLU A 1 4   ? 20.515  -6.024  4.516   1.00 0.00 ? 4   GLU A OE1  1  
ATOM   28     O  OE2  . GLU A 1 4   ? 21.120  -5.359  6.472   1.00 0.00 ? 4   GLU A OE2  1  
ATOM   29     H  H    . GLU A 1 4   ? 21.793  -5.785  2.904   1.00 0.00 ? 4   GLU A H    1  
ATOM   30     H  HA   . GLU A 1 4   ? 19.359  -4.395  2.764   1.00 0.00 ? 4   GLU A HA   1  
ATOM   31     H  HB2  . GLU A 1 4   ? 22.127  -3.679  3.609   1.00 0.00 ? 4   GLU A HB2  1  
ATOM   32     H  HB3  . GLU A 1 4   ? 20.994  -2.354  3.358   1.00 0.00 ? 4   GLU A HB3  1  
ATOM   33     H  HG2  . GLU A 1 4   ? 20.852  -3.036  5.678   1.00 0.00 ? 4   GLU A HG2  1  
ATOM   34     H  HG3  . GLU A 1 4   ? 19.372  -3.547  4.871   1.00 0.00 ? 4   GLU A HG3  1  
ATOM   35     N  N    . LYS A 1 5   ? 19.295  -2.822  0.824   1.00 0.00 ? 5   LYS A N    1  
ATOM   36     C  CA   . LYS A 1 5   ? 19.227  -2.037  -0.440  1.00 0.00 ? 5   LYS A CA   1  
ATOM   37     C  C    . LYS A 1 5   ? 18.931  -0.569  -0.114  1.00 0.00 ? 5   LYS A C    1  
ATOM   38     O  O    . LYS A 1 5   ? 18.063  -0.261  0.682   1.00 0.00 ? 5   LYS A O    1  
ATOM   39     C  CB   . LYS A 1 5   ? 18.111  -2.606  -1.318  1.00 0.00 ? 5   LYS A CB   1  
ATOM   40     C  CG   . LYS A 1 5   ? 18.459  -2.407  -2.792  1.00 0.00 ? 5   LYS A CG   1  
ATOM   41     C  CD   . LYS A 1 5   ? 19.447  -3.485  -3.242  1.00 0.00 ? 5   LYS A CD   1  
ATOM   42     C  CE   . LYS A 1 5   ? 18.687  -4.612  -3.944  1.00 0.00 ? 5   LYS A CE   1  
ATOM   43     N  NZ   . LYS A 1 5   ? 17.574  -5.079  -3.070  1.00 0.00 ? 5   LYS A NZ   1  
ATOM   44     H  H    . LYS A 1 5   ? 18.502  -2.897  1.394   1.00 0.00 ? 5   LYS A H    1  
ATOM   45     H  HA   . LYS A 1 5   ? 20.169  -2.106  -0.963  1.00 0.00 ? 5   LYS A HA   1  
ATOM   46     H  HB2  . LYS A 1 5   ? 17.996  -3.661  -1.116  1.00 0.00 ? 5   LYS A HB2  1  
ATOM   47     H  HB3  . LYS A 1 5   ? 17.188  -2.095  -1.099  1.00 0.00 ? 5   LYS A HB3  1  
ATOM   48     H  HG2  . LYS A 1 5   ? 17.558  -2.478  -3.382  1.00 0.00 ? 5   LYS A HG2  1  
ATOM   49     H  HG3  . LYS A 1 5   ? 18.906  -1.434  -2.927  1.00 0.00 ? 5   LYS A HG3  1  
ATOM   50     H  HD2  . LYS A 1 5   ? 20.163  -3.053  -3.925  1.00 0.00 ? 5   LYS A HD2  1  
ATOM   51     H  HD3  . LYS A 1 5   ? 19.963  -3.882  -2.382  1.00 0.00 ? 5   LYS A HD3  1  
ATOM   52     H  HE2  . LYS A 1 5   ? 18.284  -4.249  -4.878  1.00 0.00 ? 5   LYS A HE2  1  
ATOM   53     H  HE3  . LYS A 1 5   ? 19.361  -5.433  -4.139  1.00 0.00 ? 5   LYS A HE3  1  
ATOM   54     H  HZ1  . LYS A 1 5   ? 17.169  -4.268  -2.559  1.00 0.00 ? 5   LYS A HZ1  1  
ATOM   55     H  HZ2  . LYS A 1 5   ? 17.939  -5.773  -2.385  1.00 0.00 ? 5   LYS A HZ2  1  
ATOM   56     H  HZ3  . LYS A 1 5   ? 16.837  -5.521  -3.653  1.00 0.00 ? 5   LYS A HZ3  1  
ATOM   57     N  N    . THR A 1 6   ? 19.644  0.335   -0.733  1.00 0.00 ? 6   THR A N    1  
ATOM   58     C  CA   . THR A 1 6   ? 19.414  1.789   -0.476  1.00 0.00 ? 6   THR A CA   1  
ATOM   59     C  C    . THR A 1 6   ? 19.356  2.523   -1.819  1.00 0.00 ? 6   THR A C    1  
ATOM   60     O  O    . THR A 1 6   ? 19.638  1.952   -2.852  1.00 0.00 ? 6   THR A O    1  
ATOM   61     C  CB   . THR A 1 6   ? 20.562  2.349   0.367   1.00 0.00 ? 6   THR A CB   1  
ATOM   62     O  OG1  . THR A 1 6   ? 20.308  3.715   0.664   1.00 0.00 ? 6   THR A OG1  1  
ATOM   63     C  CG2  . THR A 1 6   ? 21.875  2.228   -0.409  1.00 0.00 ? 6   THR A CG2  1  
ATOM   64     H  H    . THR A 1 6   ? 20.329  0.053   -1.375  1.00 0.00 ? 6   THR A H    1  
ATOM   65     H  HA   . THR A 1 6   ? 18.479  1.922   0.048   1.00 0.00 ? 6   THR A HA   1  
ATOM   66     H  HB   . THR A 1 6   ? 20.640  1.790   1.286   1.00 0.00 ? 6   THR A HB   1  
ATOM   67     H  HG1  . THR A 1 6   ? 19.411  3.785   0.998   1.00 0.00 ? 6   THR A HG1  1  
ATOM   68     H  HG21 . THR A 1 6   ? 22.706  2.373   0.264   1.00 0.00 ? 6   THR A HG21 1  
ATOM   69     H  HG22 . THR A 1 6   ? 21.904  2.978   -1.186  1.00 0.00 ? 6   THR A HG22 1  
ATOM   70     H  HG23 . THR A 1 6   ? 21.940  1.246   -0.854  1.00 0.00 ? 6   THR A HG23 1  
ATOM   71     N  N    . VAL A 1 7   ? 18.984  3.777   -1.830  1.00 0.00 ? 7   VAL A N    1  
ATOM   72     C  CA   . VAL A 1 7   ? 18.908  4.508   -3.129  1.00 0.00 ? 7   VAL A CA   1  
ATOM   73     C  C    . VAL A 1 7   ? 20.293  5.003   -3.537  1.00 0.00 ? 7   VAL A C    1  
ATOM   74     O  O    . VAL A 1 7   ? 21.015  5.587   -2.754  1.00 0.00 ? 7   VAL A O    1  
ATOM   75     C  CB   . VAL A 1 7   ? 17.972  5.708   -2.993  1.00 0.00 ? 7   VAL A CB   1  
ATOM   76     C  CG1  . VAL A 1 7   ? 16.520  5.226   -2.949  1.00 0.00 ? 7   VAL A CG1  1  
ATOM   77     C  CG2  . VAL A 1 7   ? 18.299  6.463   -1.701  1.00 0.00 ? 7   VAL A CG2  1  
ATOM   78     H  H    . VAL A 1 7   ? 18.743  4.238   -0.997  1.00 0.00 ? 7   VAL A H    1  
ATOM   79     H  HA   . VAL A 1 7   ? 18.527  3.845   -3.891  1.00 0.00 ? 7   VAL A HA   1  
ATOM   80     H  HB   . VAL A 1 7   ? 18.111  6.366   -3.841  1.00 0.00 ? 7   VAL A HB   1  
ATOM   81     H  HG11 . VAL A 1 7   ? 16.404  4.504   -2.154  1.00 0.00 ? 7   VAL A HG11 1  
ATOM   82     H  HG12 . VAL A 1 7   ? 16.266  4.766   -3.893  1.00 0.00 ? 7   VAL A HG12 1  
ATOM   83     H  HG13 . VAL A 1 7   ? 15.867  6.067   -2.770  1.00 0.00 ? 7   VAL A HG13 1  
ATOM   84     H  HG21 . VAL A 1 7   ? 19.226  6.091   -1.292  1.00 0.00 ? 7   VAL A HG21 1  
ATOM   85     H  HG22 . VAL A 1 7   ? 17.503  6.314   -0.986  1.00 0.00 ? 7   VAL A HG22 1  
ATOM   86     H  HG23 . VAL A 1 7   ? 18.397  7.517   -1.917  1.00 0.00 ? 7   VAL A HG23 1  
ATOM   87     N  N    . LYS A 1 8   ? 20.662  4.781   -4.767  1.00 0.00 ? 8   LYS A N    1  
ATOM   88     C  CA   . LYS A 1 8   ? 21.994  5.244   -5.245  1.00 0.00 ? 8   LYS A CA   1  
ATOM   89     C  C    . LYS A 1 8   ? 22.076  6.767   -5.148  1.00 0.00 ? 8   LYS A C    1  
ATOM   90     O  O    . LYS A 1 8   ? 23.036  7.313   -4.642  1.00 0.00 ? 8   LYS A O    1  
ATOM   91     C  CB   . LYS A 1 8   ? 22.181  4.834   -6.706  1.00 0.00 ? 8   LYS A CB   1  
ATOM   92     C  CG   . LYS A 1 8   ? 23.602  5.195   -7.150  1.00 0.00 ? 8   LYS A CG   1  
ATOM   93     C  CD   . LYS A 1 8   ? 23.569  5.958   -8.478  1.00 0.00 ? 8   LYS A CD   1  
ATOM   94     C  CE   . LYS A 1 8   ? 23.232  4.992   -9.616  1.00 0.00 ? 8   LYS A CE   1  
ATOM   95     N  NZ   . LYS A 1 8   ? 21.801  4.590   -9.520  1.00 0.00 ? 8   LYS A NZ   1  
ATOM   96     H  H    . LYS A 1 8   ? 20.059  4.311   -5.380  1.00 0.00 ? 8   LYS A H    1  
ATOM   97     H  HA   . LYS A 1 8   ? 22.771  4.801   -4.642  1.00 0.00 ? 8   LYS A HA   1  
ATOM   98     H  HB2  . LYS A 1 8   ? 22.029  3.770   -6.806  1.00 0.00 ? 8   LYS A HB2  1  
ATOM   99     H  HB3  . LYS A 1 8   ? 21.465  5.357   -7.321  1.00 0.00 ? 8   LYS A HB3  1  
ATOM   100    H  HG2  . LYS A 1 8   ? 24.068  5.810   -6.395  1.00 0.00 ? 8   LYS A HG2  1  
ATOM   101    H  HG3  . LYS A 1 8   ? 24.170  4.290   -7.273  1.00 0.00 ? 8   LYS A HG3  1  
ATOM   102    H  HD2  . LYS A 1 8   ? 22.826  6.741   -8.434  1.00 0.00 ? 8   LYS A HD2  1  
ATOM   103    H  HD3  . LYS A 1 8   ? 24.539  6.397   -8.661  1.00 0.00 ? 8   LYS A HD3  1  
ATOM   104    H  HE2  . LYS A 1 8   ? 23.406  5.478   -10.565 1.00 0.00 ? 8   LYS A HE2  1  
ATOM   105    H  HE3  . LYS A 1 8   ? 23.858  4.115   -9.541  1.00 0.00 ? 8   LYS A HE3  1  
ATOM   106    H  HZ1  . LYS A 1 8   ? 21.626  4.148   -8.594  1.00 0.00 ? 8   LYS A HZ1  1  
ATOM   107    H  HZ2  . LYS A 1 8   ? 21.580  3.910   -10.276 1.00 0.00 ? 8   LYS A HZ2  1  
ATOM   108    H  HZ3  . LYS A 1 8   ? 21.196  5.429   -9.620  1.00 0.00 ? 8   LYS A HZ3  1  
ATOM   109    N  N    . GLU A 1 9   ? 21.085  7.454   -5.648  1.00 0.00 ? 9   GLU A N    1  
ATOM   110    C  CA   . GLU A 1 9   ? 21.114  8.947   -5.605  1.00 0.00 ? 9   GLU A CA   1  
ATOM   111    C  C    . GLU A 1 9   ? 19.816  9.490   -5.003  1.00 0.00 ? 9   GLU A C    1  
ATOM   112    O  O    . GLU A 1 9   ? 18.796  8.831   -4.987  1.00 0.00 ? 9   GLU A O    1  
ATOM   113    C  CB   . GLU A 1 9   ? 21.283  9.489   -7.026  1.00 0.00 ? 9   GLU A CB   1  
ATOM   114    C  CG   . GLU A 1 9   ? 20.277  8.807   -7.956  1.00 0.00 ? 9   GLU A CG   1  
ATOM   115    C  CD   . GLU A 1 9   ? 20.380  9.417   -9.355  1.00 0.00 ? 9   GLU A CD   1  
ATOM   116    O  OE1  . GLU A 1 9   ? 21.487  9.512   -9.860  1.00 0.00 ? 9   GLU A OE1  1  
ATOM   117    O  OE2  . GLU A 1 9   ? 19.349  9.779   -9.898  1.00 0.00 ? 9   GLU A OE2  1  
ATOM   118    H  H    . GLU A 1 9   ? 20.329  6.987   -6.062  1.00 0.00 ? 9   GLU A H    1  
ATOM   119    H  HA   . GLU A 1 9   ? 21.948  9.273   -5.001  1.00 0.00 ? 9   GLU A HA   1  
ATOM   120    H  HB2  . GLU A 1 9   ? 21.110  10.555  -7.028  1.00 0.00 ? 9   GLU A HB2  1  
ATOM   121    H  HB3  . GLU A 1 9   ? 22.285  9.286   -7.373  1.00 0.00 ? 9   GLU A HB3  1  
ATOM   122    H  HG2  . GLU A 1 9   ? 20.495  7.749   -8.006  1.00 0.00 ? 9   GLU A HG2  1  
ATOM   123    H  HG3  . GLU A 1 9   ? 19.279  8.953   -7.574  1.00 0.00 ? 9   GLU A HG3  1  
ATOM   124    N  N    . LYS A 1 10  ? 19.859  10.696  -4.503  1.00 0.00 ? 10  LYS A N    1  
ATOM   125    C  CA   . LYS A 1 10  ? 18.647  11.310  -3.888  1.00 0.00 ? 10  LYS A CA   1  
ATOM   126    C  C    . LYS A 1 10  ? 17.506  11.372  -4.911  1.00 0.00 ? 10  LYS A C    1  
ATOM   127    O  O    . LYS A 1 10  ? 17.705  11.692  -6.066  1.00 0.00 ? 10  LYS A O    1  
ATOM   128    C  CB   . LYS A 1 10  ? 18.999  12.725  -3.418  1.00 0.00 ? 10  LYS A CB   1  
ATOM   129    C  CG   . LYS A 1 10  ? 17.723  13.517  -3.115  1.00 0.00 ? 10  LYS A CG   1  
ATOM   130    C  CD   . LYS A 1 10  ? 17.415  14.456  -4.285  1.00 0.00 ? 10  LYS A CD   1  
ATOM   131    C  CE   . LYS A 1 10  ? 16.107  15.199  -4.010  1.00 0.00 ? 10  LYS A CE   1  
ATOM   132    N  NZ   . LYS A 1 10  ? 16.396  16.449  -3.253  1.00 0.00 ? 10  LYS A NZ   1  
ATOM   133    H  H    . LYS A 1 10  ? 20.700  11.199  -4.525  1.00 0.00 ? 10  LYS A H    1  
ATOM   134    H  HA   . LYS A 1 10  ? 18.338  10.722  -3.041  1.00 0.00 ? 10  LYS A HA   1  
ATOM   135    H  HB2  . LYS A 1 10  ? 19.604  12.665  -2.526  1.00 0.00 ? 10  LYS A HB2  1  
ATOM   136    H  HB3  . LYS A 1 10  ? 19.555  13.229  -4.192  1.00 0.00 ? 10  LYS A HB3  1  
ATOM   137    H  HG2  . LYS A 1 10  ? 16.897  12.837  -2.966  1.00 0.00 ? 10  LYS A HG2  1  
ATOM   138    H  HG3  . LYS A 1 10  ? 17.870  14.102  -2.221  1.00 0.00 ? 10  LYS A HG3  1  
ATOM   139    H  HD2  . LYS A 1 10  ? 18.218  15.169  -4.395  1.00 0.00 ? 10  LYS A HD2  1  
ATOM   140    H  HD3  . LYS A 1 10  ? 17.315  13.882  -5.193  1.00 0.00 ? 10  LYS A HD3  1  
ATOM   141    H  HE2  . LYS A 1 10  ? 15.631  15.448  -4.947  1.00 0.00 ? 10  LYS A HE2  1  
ATOM   142    H  HE3  . LYS A 1 10  ? 15.451  14.568  -3.430  1.00 0.00 ? 10  LYS A HE3  1  
ATOM   143    H  HZ1  . LYS A 1 10  ? 15.564  17.068  -3.274  1.00 0.00 ? 10  LYS A HZ1  1  
ATOM   144    H  HZ2  . LYS A 1 10  ? 17.206  16.938  -3.687  1.00 0.00 ? 10  LYS A HZ2  1  
ATOM   145    H  HZ3  . LYS A 1 10  ? 16.624  16.212  -2.266  1.00 0.00 ? 10  LYS A HZ3  1  
ATOM   146    N  N    . LEU A 1 11  ? 16.307  11.071  -4.479  1.00 0.00 ? 11  LEU A N    1  
ATOM   147    C  CA   . LEU A 1 11  ? 15.135  11.114  -5.402  1.00 0.00 ? 11  LEU A CA   1  
ATOM   148    C  C    . LEU A 1 11  ? 14.073  12.051  -4.816  1.00 0.00 ? 11  LEU A C    1  
ATOM   149    O  O    . LEU A 1 11  ? 14.093  12.361  -3.641  1.00 0.00 ? 11  LEU A O    1  
ATOM   150    C  CB   . LEU A 1 11  ? 14.545  9.706   -5.540  1.00 0.00 ? 11  LEU A CB   1  
ATOM   151    C  CG   . LEU A 1 11  ? 15.506  8.814   -6.331  1.00 0.00 ? 11  LEU A CG   1  
ATOM   152    C  CD1  . LEU A 1 11  ? 16.033  7.702   -5.421  1.00 0.00 ? 11  LEU A CD1  1  
ATOM   153    C  CD2  . LEU A 1 11  ? 14.764  8.191   -7.516  1.00 0.00 ? 11  LEU A CD2  1  
ATOM   154    H  H    . LEU A 1 11  ? 16.180  10.820  -3.540  1.00 0.00 ? 11  LEU A H    1  
ATOM   155    H  HA   . LEU A 1 11  ? 15.444  11.477  -6.370  1.00 0.00 ? 11  LEU A HA   1  
ATOM   156    H  HB2  . LEU A 1 11  ? 14.388  9.285   -4.558  1.00 0.00 ? 11  LEU A HB2  1  
ATOM   157    H  HB3  . LEU A 1 11  ? 13.602  9.764   -6.060  1.00 0.00 ? 11  LEU A HB3  1  
ATOM   158    H  HG   . LEU A 1 11  ? 16.336  9.405   -6.692  1.00 0.00 ? 11  LEU A HG   1  
ATOM   159    H  HD11 . LEU A 1 11  ? 15.212  7.073   -5.111  1.00 0.00 ? 11  LEU A HD11 1  
ATOM   160    H  HD12 . LEU A 1 11  ? 16.501  8.138   -4.552  1.00 0.00 ? 11  LEU A HD12 1  
ATOM   161    H  HD13 . LEU A 1 11  ? 16.757  7.108   -5.961  1.00 0.00 ? 11  LEU A HD13 1  
ATOM   162    H  HD21 . LEU A 1 11  ? 14.326  8.973   -8.118  1.00 0.00 ? 11  LEU A HD21 1  
ATOM   163    H  HD22 . LEU A 1 11  ? 13.984  7.539   -7.149  1.00 0.00 ? 11  LEU A HD22 1  
ATOM   164    H  HD23 . LEU A 1 11  ? 15.458  7.621   -8.115  1.00 0.00 ? 11  LEU A HD23 1  
ATOM   165    N  N    . SER A 1 12  ? 13.145  12.507  -5.617  1.00 0.00 ? 12  SER A N    1  
ATOM   166    C  CA   . SER A 1 12  ? 12.094  13.423  -5.079  1.00 0.00 ? 12  SER A CA   1  
ATOM   167    C  C    . SER A 1 12  ? 10.852  13.396  -5.977  1.00 0.00 ? 12  SER A C    1  
ATOM   168    O  O    . SER A 1 12  ? 10.936  13.179  -7.170  1.00 0.00 ? 12  SER A O    1  
ATOM   169    C  CB   . SER A 1 12  ? 12.643  14.848  -5.015  1.00 0.00 ? 12  SER A CB   1  
ATOM   170    O  OG   . SER A 1 12  ? 13.529  15.062  -6.106  1.00 0.00 ? 12  SER A OG   1  
ATOM   171    H  H    . SER A 1 12  ? 13.138  12.249  -6.562  1.00 0.00 ? 12  SER A H    1  
ATOM   172    H  HA   . SER A 1 12  ? 11.823  13.101  -4.087  1.00 0.00 ? 12  SER A HA   1  
ATOM   173    H  HB2  . SER A 1 12  ? 11.829  15.552  -5.076  1.00 0.00 ? 12  SER A HB2  1  
ATOM   174    H  HB3  . SER A 1 12  ? 13.167  14.989  -4.079  1.00 0.00 ? 12  SER A HB3  1  
ATOM   175    H  HG   . SER A 1 12  ? 13.006  15.337  -6.863  1.00 0.00 ? 12  SER A HG   1  
ATOM   176    N  N    . PHE A 1 13  ? 9.696   13.615  -5.403  1.00 0.00 ? 13  PHE A N    1  
ATOM   177    C  CA   . PHE A 1 13  ? 8.437   13.604  -6.212  1.00 0.00 ? 13  PHE A CA   1  
ATOM   178    C  C    . PHE A 1 13  ? 7.536   14.759  -5.788  1.00 0.00 ? 13  PHE A C    1  
ATOM   179    O  O    . PHE A 1 13  ? 7.677   15.300  -4.711  1.00 0.00 ? 13  PHE A O    1  
ATOM   180    C  CB   . PHE A 1 13  ? 7.693   12.295  -5.971  1.00 0.00 ? 13  PHE A CB   1  
ATOM   181    C  CG   . PHE A 1 13  ? 8.409   11.188  -6.683  1.00 0.00 ? 13  PHE A CG   1  
ATOM   182    C  CD1  . PHE A 1 13  ? 8.121   10.926  -8.023  1.00 0.00 ? 13  PHE A CD1  1  
ATOM   183    C  CD2  . PHE A 1 13  ? 9.365   10.429  -6.006  1.00 0.00 ? 13  PHE A CD2  1  
ATOM   184    C  CE1  . PHE A 1 13  ? 8.788   9.901   -8.693  1.00 0.00 ? 13  PHE A CE1  1  
ATOM   185    C  CE2  . PHE A 1 13  ? 10.038  9.398   -6.673  1.00 0.00 ? 13  PHE A CE2  1  
ATOM   186    C  CZ   . PHE A 1 13  ? 9.749   9.133   -8.019  1.00 0.00 ? 13  PHE A CZ   1  
ATOM   187    H  H    . PHE A 1 13  ? 9.660   13.784  -4.437  1.00 0.00 ? 13  PHE A H    1  
ATOM   188    H  HA   . PHE A 1 13  ? 8.678   13.696  -7.260  1.00 0.00 ? 13  PHE A HA   1  
ATOM   189    H  HB2  . PHE A 1 13  ? 7.662   12.085  -4.912  1.00 0.00 ? 13  PHE A HB2  1  
ATOM   190    H  HB3  . PHE A 1 13  ? 6.686   12.377  -6.353  1.00 0.00 ? 13  PHE A HB3  1  
ATOM   191    H  HD1  . PHE A 1 13  ? 7.380   11.518  -8.540  1.00 0.00 ? 13  PHE A HD1  1  
ATOM   192    H  HD2  . PHE A 1 13  ? 9.582   10.640  -4.967  1.00 0.00 ? 13  PHE A HD2  1  
ATOM   193    H  HE1  . PHE A 1 13  ? 8.562   9.703   -9.728  1.00 0.00 ? 13  PHE A HE1  1  
ATOM   194    H  HE2  . PHE A 1 13  ? 10.777  8.809   -6.152  1.00 0.00 ? 13  PHE A HE2  1  
ATOM   195    H  HZ   . PHE A 1 13  ? 10.266  8.339   -8.537  1.00 0.00 ? 13  PHE A HZ   1  
ATOM   196    N  N    . GLU A 1 14  ? 6.601   15.141  -6.618  1.00 0.00 ? 14  GLU A N    1  
ATOM   197    C  CA   . GLU A 1 14  ? 5.692   16.261  -6.240  1.00 0.00 ? 14  GLU A CA   1  
ATOM   198    C  C    . GLU A 1 14  ? 4.304   16.023  -6.847  1.00 0.00 ? 14  GLU A C    1  
ATOM   199    O  O    . GLU A 1 14  ? 4.176   15.601  -7.979  1.00 0.00 ? 14  GLU A O    1  
ATOM   200    C  CB   . GLU A 1 14  ? 6.263   17.583  -6.760  1.00 0.00 ? 14  GLU A CB   1  
ATOM   201    C  CG   . GLU A 1 14  ? 6.796   17.389  -8.181  1.00 0.00 ? 14  GLU A CG   1  
ATOM   202    C  CD   . GLU A 1 14  ? 6.712   18.714  -8.941  1.00 0.00 ? 14  GLU A CD   1  
ATOM   203    O  OE1  . GLU A 1 14  ? 5.681   19.361  -8.851  1.00 0.00 ? 14  GLU A OE1  1  
ATOM   204    O  OE2  . GLU A 1 14  ? 7.679   19.060  -9.599  1.00 0.00 ? 14  GLU A OE2  1  
ATOM   205    H  H    . GLU A 1 14  ? 6.481   14.704  -7.491  1.00 0.00 ? 14  GLU A H    1  
ATOM   206    H  HA   . GLU A 1 14  ? 5.607   16.304  -5.170  1.00 0.00 ? 14  GLU A HA   1  
ATOM   207    H  HB2  . GLU A 1 14  ? 5.486   18.333  -6.766  1.00 0.00 ? 14  GLU A HB2  1  
ATOM   208    H  HB3  . GLU A 1 14  ? 7.068   17.903  -6.117  1.00 0.00 ? 14  GLU A HB3  1  
ATOM   209    H  HG2  . GLU A 1 14  ? 7.825   17.061  -8.138  1.00 0.00 ? 14  GLU A HG2  1  
ATOM   210    H  HG3  . GLU A 1 14  ? 6.202   16.645  -8.691  1.00 0.00 ? 14  GLU A HG3  1  
ATOM   211    N  N    . GLY A 1 15  ? 3.261   16.293  -6.102  1.00 0.00 ? 15  GLY A N    1  
ATOM   212    C  CA   . GLY A 1 15  ? 1.883   16.081  -6.644  1.00 0.00 ? 15  GLY A CA   1  
ATOM   213    C  C    . GLY A 1 15  ? 0.842   16.278  -5.534  1.00 0.00 ? 15  GLY A C    1  
ATOM   214    O  O    . GLY A 1 15  ? 1.150   16.201  -4.361  1.00 0.00 ? 15  GLY A O    1  
ATOM   215    H  H    . GLY A 1 15  ? 3.384   16.637  -5.191  1.00 0.00 ? 15  GLY A H    1  
ATOM   216    H  HA2  . GLY A 1 15  ? 1.698   16.789  -7.440  1.00 0.00 ? 15  GLY A HA2  1  
ATOM   217    H  HA3  . GLY A 1 15  ? 1.802   15.077  -7.031  1.00 0.00 ? 15  GLY A HA3  1  
ATOM   218    N  N    . VAL A 1 16  ? -0.385  16.554  -5.898  1.00 0.00 ? 16  VAL A N    1  
ATOM   219    C  CA   . VAL A 1 16  ? -1.449  16.779  -4.874  1.00 0.00 ? 16  VAL A CA   1  
ATOM   220    C  C    . VAL A 1 16  ? -1.796  15.478  -4.146  1.00 0.00 ? 16  VAL A C    1  
ATOM   221    O  O    . VAL A 1 16  ? -1.515  14.391  -4.609  1.00 0.00 ? 16  VAL A O    1  
ATOM   222    C  CB   . VAL A 1 16  ? -2.703  17.319  -5.566  1.00 0.00 ? 16  VAL A CB   1  
ATOM   223    C  CG1  . VAL A 1 16  ? -3.524  16.151  -6.115  1.00 0.00 ? 16  VAL A CG1  1  
ATOM   224    C  CG2  . VAL A 1 16  ? -3.546  18.107  -4.560  1.00 0.00 ? 16  VAL A CG2  1  
ATOM   225    H  H    . VAL A 1 16  ? -0.614  16.639  -6.847  1.00 0.00 ? 16  VAL A H    1  
ATOM   226    H  HA   . VAL A 1 16  ? -1.106  17.500  -4.156  1.00 0.00 ? 16  VAL A HA   1  
ATOM   227    H  HB   . VAL A 1 16  ? -2.411  17.967  -6.381  1.00 0.00 ? 16  VAL A HB   1  
ATOM   228    H  HG11 . VAL A 1 16  ? -2.859  15.384  -6.484  1.00 0.00 ? 16  VAL A HG11 1  
ATOM   229    H  HG12 . VAL A 1 16  ? -4.154  16.501  -6.920  1.00 0.00 ? 16  VAL A HG12 1  
ATOM   230    H  HG13 . VAL A 1 16  ? -4.141  15.744  -5.327  1.00 0.00 ? 16  VAL A HG13 1  
ATOM   231    H  HG21 . VAL A 1 16  ? -3.689  17.515  -3.669  1.00 0.00 ? 16  VAL A HG21 1  
ATOM   232    H  HG22 . VAL A 1 16  ? -4.506  18.337  -4.997  1.00 0.00 ? 16  VAL A HG22 1  
ATOM   233    H  HG23 . VAL A 1 16  ? -3.036  19.024  -4.304  1.00 0.00 ? 16  VAL A HG23 1  
ATOM   234    N  N    . GLY A 1 17  ? -2.419  15.598  -3.001  1.00 0.00 ? 17  GLY A N    1  
ATOM   235    C  CA   . GLY A 1 17  ? -2.810  14.389  -2.213  1.00 0.00 ? 17  GLY A CA   1  
ATOM   236    C  C    . GLY A 1 17  ? -4.263  14.011  -2.529  1.00 0.00 ? 17  GLY A C    1  
ATOM   237    O  O    . GLY A 1 17  ? -5.109  14.863  -2.703  1.00 0.00 ? 17  GLY A O    1  
ATOM   238    H  H    . GLY A 1 17  ? -2.632  16.495  -2.662  1.00 0.00 ? 17  GLY A H    1  
ATOM   239    H  HA2  . GLY A 1 17  ? -2.157  13.566  -2.470  1.00 0.00 ? 17  GLY A HA2  1  
ATOM   240    H  HA3  . GLY A 1 17  ? -2.721  14.606  -1.163  1.00 0.00 ? 17  GLY A HA3  1  
ATOM   241    N  N    . ILE A 1 18  ? -4.551  12.737  -2.641  1.00 0.00 ? 18  ILE A N    1  
ATOM   242    C  CA   . ILE A 1 18  ? -5.939  12.301  -2.989  1.00 0.00 ? 18  ILE A CA   1  
ATOM   243    C  C    . ILE A 1 18  ? -6.983  12.818  -1.991  1.00 0.00 ? 18  ILE A C    1  
ATOM   244    O  O    . ILE A 1 18  ? -7.972  13.399  -2.390  1.00 0.00 ? 18  ILE A O    1  
ATOM   245    C  CB   . ILE A 1 18  ? -6.011  10.771  -3.021  1.00 0.00 ? 18  ILE A CB   1  
ATOM   246    C  CG1  . ILE A 1 18  ? -7.441  10.338  -3.359  1.00 0.00 ? 18  ILE A CG1  1  
ATOM   247    C  CG2  . ILE A 1 18  ? -5.616  10.206  -1.657  1.00 0.00 ? 18  ILE A CG2  1  
ATOM   248    C  CD1  . ILE A 1 18  ? -7.486  8.822   -3.575  1.00 0.00 ? 18  ILE A CD1  1  
ATOM   249    H  H    . ILE A 1 18  ? -3.845  12.065  -2.536  1.00 0.00 ? 18  ILE A H    1  
ATOM   250    H  HA   . ILE A 1 18  ? -6.185  12.676  -3.971  1.00 0.00 ? 18  ILE A HA   1  
ATOM   251    H  HB   . ILE A 1 18  ? -5.339  10.397  -3.775  1.00 0.00 ? 18  ILE A HB   1  
ATOM   252    H  HG12 . ILE A 1 18  ? -8.102  10.605  -2.546  1.00 0.00 ? 18  ILE A HG12 1  
ATOM   253    H  HG13 . ILE A 1 18  ? -7.763  10.835  -4.260  1.00 0.00 ? 18  ILE A HG13 1  
ATOM   254    H  HG21 . ILE A 1 18  ? -5.313  9.175   -1.769  1.00 0.00 ? 18  ILE A HG21 1  
ATOM   255    H  HG22 . ILE A 1 18  ? -6.459  10.263  -0.985  1.00 0.00 ? 18  ILE A HG22 1  
ATOM   256    H  HG23 . ILE A 1 18  ? -4.794  10.780  -1.254  1.00 0.00 ? 18  ILE A HG23 1  
ATOM   257    H  HD11 . ILE A 1 18  ? -7.786  8.337   -2.659  1.00 0.00 ? 18  ILE A HD11 1  
ATOM   258    H  HD12 . ILE A 1 18  ? -6.509  8.467   -3.866  1.00 0.00 ? 18  ILE A HD12 1  
ATOM   259    H  HD13 . ILE A 1 18  ? -8.198  8.593   -4.353  1.00 0.00 ? 18  ILE A HD13 1  
ATOM   260    N  N    . HIS A 1 19  ? -6.819  12.601  -0.710  1.00 0.00 ? 19  HIS A N    1  
ATOM   261    C  CA   . HIS A 1 19  ? -7.861  13.077  0.249   1.00 0.00 ? 19  HIS A CA   1  
ATOM   262    C  C    . HIS A 1 19  ? -7.610  14.526  0.663   1.00 0.00 ? 19  HIS A C    1  
ATOM   263    O  O    . HIS A 1 19  ? -8.535  15.290  0.848   1.00 0.00 ? 19  HIS A O    1  
ATOM   264    C  CB   . HIS A 1 19  ? -7.837  12.198  1.502   1.00 0.00 ? 19  HIS A CB   1  
ATOM   265    C  CG   . HIS A 1 19  ? -7.933  10.749  1.112   1.00 0.00 ? 19  HIS A CG   1  
ATOM   266    N  ND1  . HIS A 1 19  ? -8.694  10.319  0.037   1.00 0.00 ? 19  HIS A ND1  1  
ATOM   267    C  CD2  . HIS A 1 19  ? -7.371  9.617   1.650   1.00 0.00 ? 19  HIS A CD2  1  
ATOM   268    C  CE1  . HIS A 1 19  ? -8.573  8.981   -0.037  1.00 0.00 ? 19  HIS A CE1  1  
ATOM   269    N  NE2  . HIS A 1 19  ? -7.778  8.502   0.923   1.00 0.00 ? 19  HIS A NE2  1  
ATOM   270    H  H    . HIS A 1 19  ? -6.043  12.121  -0.351  1.00 0.00 ? 19  HIS A H    1  
ATOM   271    H  HA   . HIS A 1 19  ? -8.830  13.004  -0.215  1.00 0.00 ? 19  HIS A HA   1  
ATOM   272    H  HB2  . HIS A 1 19  ? -6.915  12.365  2.039   1.00 0.00 ? 19  HIS A HB2  1  
ATOM   273    H  HB3  . HIS A 1 19  ? -8.673  12.456  2.135   1.00 0.00 ? 19  HIS A HB3  1  
ATOM   274    H  HD1  . HIS A 1 19  ? -9.226  10.886  -0.561  1.00 0.00 ? 19  HIS A HD1  1  
ATOM   275    H  HD2  . HIS A 1 19  ? -6.714  9.595   2.507   1.00 0.00 ? 19  HIS A HD2  1  
ATOM   276    H  HE1  . HIS A 1 19  ? -9.061  8.368   -0.780  1.00 0.00 ? 19  HIS A HE1  1  
ATOM   277    N  N    . THR A 1 20  ? -6.374  14.908  0.836   1.00 0.00 ? 20  THR A N    1  
ATOM   278    C  CA   . THR A 1 20  ? -6.084  16.306  1.264   1.00 0.00 ? 20  THR A CA   1  
ATOM   279    C  C    . THR A 1 20  ? -6.282  17.265  0.089   1.00 0.00 ? 20  THR A C    1  
ATOM   280    O  O    . THR A 1 20  ? -6.723  18.384  0.261   1.00 0.00 ? 20  THR A O    1  
ATOM   281    C  CB   . THR A 1 20  ? -4.640  16.399  1.764   1.00 0.00 ? 20  THR A CB   1  
ATOM   282    O  OG1  . THR A 1 20  ? -4.319  15.221  2.490   1.00 0.00 ? 20  THR A OG1  1  
ATOM   283    C  CG2  . THR A 1 20  ? -4.492  17.619  2.675   1.00 0.00 ? 20  THR A CG2  1  
ATOM   284    H  H    . THR A 1 20  ? -5.642  14.272  0.694   1.00 0.00 ? 20  THR A H    1  
ATOM   285    H  HA   . THR A 1 20  ? -6.755  16.579  2.064   1.00 0.00 ? 20  THR A HA   1  
ATOM   286    H  HB   . THR A 1 20  ? -3.972  16.499  0.923   1.00 0.00 ? 20  THR A HB   1  
ATOM   287    H  HG1  . THR A 1 20  ? -5.098  14.957  2.986   1.00 0.00 ? 20  THR A HG1  1  
ATOM   288    H  HG21 . THR A 1 20  ? -5.142  18.409  2.328   1.00 0.00 ? 20  THR A HG21 1  
ATOM   289    H  HG22 . THR A 1 20  ? -3.468  17.960  2.658   1.00 0.00 ? 20  THR A HG22 1  
ATOM   290    H  HG23 . THR A 1 20  ? -4.764  17.348  3.685   1.00 0.00 ? 20  THR A HG23 1  
ATOM   291    N  N    . GLY A 1 21  ? -5.962  16.843  -1.101  1.00 0.00 ? 21  GLY A N    1  
ATOM   292    C  CA   . GLY A 1 21  ? -6.137  17.744  -2.274  1.00 0.00 ? 21  GLY A CA   1  
ATOM   293    C  C    . GLY A 1 21  ? -5.192  18.939  -2.136  1.00 0.00 ? 21  GLY A C    1  
ATOM   294    O  O    . GLY A 1 21  ? -5.440  20.007  -2.659  1.00 0.00 ? 21  GLY A O    1  
ATOM   295    H  H    . GLY A 1 21  ? -5.606  15.938  -1.225  1.00 0.00 ? 21  GLY A H    1  
ATOM   296    H  HA2  . GLY A 1 21  ? -5.902  17.206  -3.180  1.00 0.00 ? 21  GLY A HA2  1  
ATOM   297    H  HA3  . GLY A 1 21  ? -7.159  18.092  -2.312  1.00 0.00 ? 21  GLY A HA3  1  
ATOM   298    N  N    . GLU A 1 22  ? -4.103  18.755  -1.437  1.00 0.00 ? 22  GLU A N    1  
ATOM   299    C  CA   . GLU A 1 22  ? -3.121  19.862  -1.260  1.00 0.00 ? 22  GLU A CA   1  
ATOM   300    C  C    . GLU A 1 22  ? -1.801  19.466  -1.924  1.00 0.00 ? 22  GLU A C    1  
ATOM   301    O  O    . GLU A 1 22  ? -1.486  18.299  -2.045  1.00 0.00 ? 22  GLU A O    1  
ATOM   302    C  CB   . GLU A 1 22  ? -2.892  20.107  0.233   1.00 0.00 ? 22  GLU A CB   1  
ATOM   303    C  CG   . GLU A 1 22  ? -3.598  21.397  0.654   1.00 0.00 ? 22  GLU A CG   1  
ATOM   304    C  CD   . GLU A 1 22  ? -2.781  22.604  0.188   1.00 0.00 ? 22  GLU A CD   1  
ATOM   305    O  OE1  . GLU A 1 22  ? -2.947  23.000  -0.954  1.00 0.00 ? 22  GLU A OE1  1  
ATOM   306    O  OE2  . GLU A 1 22  ? -2.003  23.109  0.980   1.00 0.00 ? 22  GLU A OE2  1  
ATOM   307    H  H    . GLU A 1 22  ? -3.929  17.878  -1.036  1.00 0.00 ? 22  GLU A H    1  
ATOM   308    H  HA   . GLU A 1 22  ? -3.501  20.762  -1.720  1.00 0.00 ? 22  GLU A HA   1  
ATOM   309    H  HB2  . GLU A 1 22  ? -3.288  19.278  0.799   1.00 0.00 ? 22  GLU A HB2  1  
ATOM   310    H  HB3  . GLU A 1 22  ? -1.833  20.201  0.424   1.00 0.00 ? 22  GLU A HB3  1  
ATOM   311    H  HG2  . GLU A 1 22  ? -4.581  21.431  0.206   1.00 0.00 ? 22  GLU A HG2  1  
ATOM   312    H  HG3  . GLU A 1 22  ? -3.691  21.422  1.729   1.00 0.00 ? 22  GLU A HG3  1  
ATOM   313    N  N    . TYR A 1 23  ? -1.030  20.422  -2.363  1.00 0.00 ? 23  TYR A N    1  
ATOM   314    C  CA   . TYR A 1 23  ? 0.263   20.086  -3.026  1.00 0.00 ? 23  TYR A CA   1  
ATOM   315    C  C    . TYR A 1 23  ? 1.264   19.576  -1.989  1.00 0.00 ? 23  TYR A C    1  
ATOM   316    O  O    . TYR A 1 23  ? 1.486   20.197  -0.970  1.00 0.00 ? 23  TYR A O    1  
ATOM   317    C  CB   . TYR A 1 23  ? 0.830   21.334  -3.708  1.00 0.00 ? 23  TYR A CB   1  
ATOM   318    C  CG   . TYR A 1 23  ? 2.336   21.235  -3.758  1.00 0.00 ? 23  TYR A CG   1  
ATOM   319    C  CD1  . TYR A 1 23  ? 2.945   20.051  -4.192  1.00 0.00 ? 23  TYR A CD1  1  
ATOM   320    C  CD2  . TYR A 1 23  ? 3.125   22.324  -3.367  1.00 0.00 ? 23  TYR A CD2  1  
ATOM   321    C  CE1  . TYR A 1 23  ? 4.341   19.956  -4.236  1.00 0.00 ? 23  TYR A CE1  1  
ATOM   322    C  CE2  . TYR A 1 23  ? 4.522   22.229  -3.412  1.00 0.00 ? 23  TYR A CE2  1  
ATOM   323    C  CZ   . TYR A 1 23  ? 5.129   21.045  -3.846  1.00 0.00 ? 23  TYR A CZ   1  
ATOM   324    O  OH   . TYR A 1 23  ? 6.505   20.950  -3.889  1.00 0.00 ? 23  TYR A OH   1  
ATOM   325    H  H    . TYR A 1 23  ? -1.301  21.358  -2.261  1.00 0.00 ? 23  TYR A H    1  
ATOM   326    H  HA   . TYR A 1 23  ? 0.094   19.321  -3.766  1.00 0.00 ? 23  TYR A HA   1  
ATOM   327    H  HB2  . TYR A 1 23  ? 0.441   21.406  -4.713  1.00 0.00 ? 23  TYR A HB2  1  
ATOM   328    H  HB3  . TYR A 1 23  ? 0.547   22.212  -3.148  1.00 0.00 ? 23  TYR A HB3  1  
ATOM   329    H  HD1  . TYR A 1 23  ? 2.337   19.211  -4.493  1.00 0.00 ? 23  TYR A HD1  1  
ATOM   330    H  HD2  . TYR A 1 23  ? 2.656   23.239  -3.033  1.00 0.00 ? 23  TYR A HD2  1  
ATOM   331    H  HE1  . TYR A 1 23  ? 4.809   19.042  -4.571  1.00 0.00 ? 23  TYR A HE1  1  
ATOM   332    H  HE2  . TYR A 1 23  ? 5.130   23.069  -3.112  1.00 0.00 ? 23  TYR A HE2  1  
ATOM   333    H  HH   . TYR A 1 23  ? 6.804   20.595  -3.048  1.00 0.00 ? 23  TYR A HH   1  
ATOM   334    N  N    . SER A 1 24  ? 1.878   18.451  -2.246  1.00 0.00 ? 24  SER A N    1  
ATOM   335    C  CA   . SER A 1 24  ? 2.872   17.905  -1.282  1.00 0.00 ? 24  SER A CA   1  
ATOM   336    C  C    . SER A 1 24  ? 4.099   17.418  -2.056  1.00 0.00 ? 24  SER A C    1  
ATOM   337    O  O    . SER A 1 24  ? 4.019   17.112  -3.228  1.00 0.00 ? 24  SER A O    1  
ATOM   338    C  CB   . SER A 1 24  ? 2.256   16.733  -0.517  1.00 0.00 ? 24  SER A CB   1  
ATOM   339    O  OG   . SER A 1 24  ? 3.289   15.843  -0.115  1.00 0.00 ? 24  SER A OG   1  
ATOM   340    H  H    . SER A 1 24  ? 1.694   17.963  -3.077  1.00 0.00 ? 24  SER A H    1  
ATOM   341    H  HA   . SER A 1 24  ? 3.166   18.678  -0.586  1.00 0.00 ? 24  SER A HA   1  
ATOM   342    H  HB2  . SER A 1 24  ? 1.744   17.100  0.357   1.00 0.00 ? 24  SER A HB2  1  
ATOM   343    H  HB3  . SER A 1 24  ? 1.551   16.218  -1.156  1.00 0.00 ? 24  SER A HB3  1  
ATOM   344    H  HG   . SER A 1 24  ? 2.915   15.217  0.509   1.00 0.00 ? 24  SER A HG   1  
ATOM   345    N  N    . LYS A 1 25  ? 5.234   17.348  -1.415  1.00 0.00 ? 25  LYS A N    1  
ATOM   346    C  CA   . LYS A 1 25  ? 6.461   16.885  -2.124  1.00 0.00 ? 25  LYS A CA   1  
ATOM   347    C  C    . LYS A 1 25  ? 7.208   15.899  -1.234  1.00 0.00 ? 25  LYS A C    1  
ATOM   348    O  O    . LYS A 1 25  ? 7.172   16.009  -0.024  1.00 0.00 ? 25  LYS A O    1  
ATOM   349    C  CB   . LYS A 1 25  ? 7.355   18.092  -2.424  1.00 0.00 ? 25  LYS A CB   1  
ATOM   350    C  CG   . LYS A 1 25  ? 8.789   17.624  -2.685  1.00 0.00 ? 25  LYS A CG   1  
ATOM   351    C  CD   . LYS A 1 25  ? 9.599   18.770  -3.295  1.00 0.00 ? 25  LYS A CD   1  
ATOM   352    C  CE   . LYS A 1 25  ? 10.903  18.221  -3.876  1.00 0.00 ? 25  LYS A CE   1  
ATOM   353    N  NZ   . LYS A 1 25  ? 10.868  18.326  -5.362  1.00 0.00 ? 25  LYS A NZ   1  
ATOM   354    H  H    . LYS A 1 25  ? 5.280   17.605  -0.467  1.00 0.00 ? 25  LYS A H    1  
ATOM   355    H  HA   . LYS A 1 25  ? 6.185   16.401  -3.043  1.00 0.00 ? 25  LYS A HA   1  
ATOM   356    H  HB2  . LYS A 1 25  ? 6.979   18.607  -3.296  1.00 0.00 ? 25  LYS A HB2  1  
ATOM   357    H  HB3  . LYS A 1 25  ? 7.347   18.764  -1.579  1.00 0.00 ? 25  LYS A HB3  1  
ATOM   358    H  HG2  . LYS A 1 25  ? 9.244   17.318  -1.754  1.00 0.00 ? 25  LYS A HG2  1  
ATOM   359    H  HG3  . LYS A 1 25  ? 8.776   16.791  -3.371  1.00 0.00 ? 25  LYS A HG3  1  
ATOM   360    H  HD2  . LYS A 1 25  ? 9.024   19.240  -4.081  1.00 0.00 ? 25  LYS A HD2  1  
ATOM   361    H  HD3  . LYS A 1 25  ? 9.826   19.497  -2.530  1.00 0.00 ? 25  LYS A HD3  1  
ATOM   362    H  HE2  . LYS A 1 25  ? 11.735  18.794  -3.494  1.00 0.00 ? 25  LYS A HE2  1  
ATOM   363    H  HE3  . LYS A 1 25  ? 11.017  17.186  -3.591  1.00 0.00 ? 25  LYS A HE3  1  
ATOM   364    H  HZ1  . LYS A 1 25  ? 9.879   18.358  -5.685  1.00 0.00 ? 25  LYS A HZ1  1  
ATOM   365    H  HZ2  . LYS A 1 25  ? 11.343  17.499  -5.779  1.00 0.00 ? 25  LYS A HZ2  1  
ATOM   366    H  HZ3  . LYS A 1 25  ? 11.355  19.194  -5.661  1.00 0.00 ? 25  LYS A HZ3  1  
ATOM   367    N  N    . LEU A 1 26  ? 7.888   14.934  -1.806  1.00 0.00 ? 26  LEU A N    1  
ATOM   368    C  CA   . LEU A 1 26  ? 8.627   13.957  -0.962  1.00 0.00 ? 26  LEU A CA   1  
ATOM   369    C  C    . LEU A 1 26  ? 10.083  13.910  -1.413  1.00 0.00 ? 26  LEU A C    1  
ATOM   370    O  O    . LEU A 1 26  ? 10.381  13.999  -2.586  1.00 0.00 ? 26  LEU A O    1  
ATOM   371    C  CB   . LEU A 1 26  ? 8.030   12.557  -1.135  1.00 0.00 ? 26  LEU A CB   1  
ATOM   372    C  CG   . LEU A 1 26  ? 6.549   12.641  -1.506  1.00 0.00 ? 26  LEU A CG   1  
ATOM   373    C  CD1  . LEU A 1 26  ? 6.021   11.228  -1.747  1.00 0.00 ? 26  LEU A CD1  1  
ATOM   374    C  CD2  . LEU A 1 26  ? 5.757   13.289  -0.366  1.00 0.00 ? 26  LEU A CD2  1  
ATOM   375    H  H    . LEU A 1 26  ? 7.924   14.838  -2.783  1.00 0.00 ? 26  LEU A H    1  
ATOM   376    H  HA   . LEU A 1 26  ? 8.580   14.249  0.073   1.00 0.00 ? 26  LEU A HA   1  
ATOM   377    H  HB2  . LEU A 1 26  ? 8.564   12.037  -1.917  1.00 0.00 ? 26  LEU A HB2  1  
ATOM   378    H  HB3  . LEU A 1 26  ? 8.134   12.010  -0.209  1.00 0.00 ? 26  LEU A HB3  1  
ATOM   379    H  HG   . LEU A 1 26  ? 6.432   13.224  -2.407  1.00 0.00 ? 26  LEU A HG   1  
ATOM   380    H  HD11 . LEU A 1 26  ? 6.847   10.532  -1.756  1.00 0.00 ? 26  LEU A HD11 1  
ATOM   381    H  HD12 . LEU A 1 26  ? 5.509   11.191  -2.697  1.00 0.00 ? 26  LEU A HD12 1  
ATOM   382    H  HD13 . LEU A 1 26  ? 5.337   10.963  -0.957  1.00 0.00 ? 26  LEU A HD13 1  
ATOM   383    H  HD21 . LEU A 1 26  ? 6.435   13.626  0.398   1.00 0.00 ? 26  LEU A HD21 1  
ATOM   384    H  HD22 . LEU A 1 26  ? 5.074   12.567  0.055   1.00 0.00 ? 26  LEU A HD22 1  
ATOM   385    H  HD23 . LEU A 1 26  ? 5.200   14.131  -0.750  1.00 0.00 ? 26  LEU A HD23 1  
ATOM   386    N  N    . ILE A 1 27  ? 10.987  13.749  -0.491  1.00 0.00 ? 27  ILE A N    1  
ATOM   387    C  CA   . ILE A 1 27  ? 12.427  13.666  -0.854  1.00 0.00 ? 27  ILE A CA   1  
ATOM   388    C  C    . ILE A 1 27  ? 12.987  12.380  -0.249  1.00 0.00 ? 27  ILE A C    1  
ATOM   389    O  O    . ILE A 1 27  ? 12.731  12.075  0.898   1.00 0.00 ? 27  ILE A O    1  
ATOM   390    C  CB   . ILE A 1 27  ? 13.177  14.875  -0.284  1.00 0.00 ? 27  ILE A CB   1  
ATOM   391    C  CG1  . ILE A 1 27  ? 12.443  16.161  -0.674  1.00 0.00 ? 27  ILE A CG1  1  
ATOM   392    C  CG2  . ILE A 1 27  ? 14.599  14.914  -0.848  1.00 0.00 ? 27  ILE A CG2  1  
ATOM   393    C  CD1  . ILE A 1 27  ? 13.131  17.359  -0.017  1.00 0.00 ? 27  ILE A CD1  1  
ATOM   394    H  H    . ILE A 1 27  ? 10.714  13.667  0.446   1.00 0.00 ? 27  ILE A H    1  
ATOM   395    H  HA   . ILE A 1 27  ? 12.533  13.641  -1.930  1.00 0.00 ? 27  ILE A HA   1  
ATOM   396    H  HB   . ILE A 1 27  ? 13.221  14.795  0.792   1.00 0.00 ? 27  ILE A HB   1  
ATOM   397    H  HG12 . ILE A 1 27  ? 12.467  16.276  -1.748  1.00 0.00 ? 27  ILE A HG12 1  
ATOM   398    H  HG13 . ILE A 1 27  ? 11.419  16.108  -0.338  1.00 0.00 ? 27  ILE A HG13 1  
ATOM   399    H  HG21 . ILE A 1 27  ? 14.664  15.682  -1.604  1.00 0.00 ? 27  ILE A HG21 1  
ATOM   400    H  HG22 . ILE A 1 27  ? 14.841  13.956  -1.284  1.00 0.00 ? 27  ILE A HG22 1  
ATOM   401    H  HG23 . ILE A 1 27  ? 15.296  15.134  -0.052  1.00 0.00 ? 27  ILE A HG23 1  
ATOM   402    H  HD11 . ILE A 1 27  ? 12.560  18.254  -0.214  1.00 0.00 ? 27  ILE A HD11 1  
ATOM   403    H  HD12 . ILE A 1 27  ? 14.125  17.469  -0.422  1.00 0.00 ? 27  ILE A HD12 1  
ATOM   404    H  HD13 . ILE A 1 27  ? 13.192  17.199  1.050   1.00 0.00 ? 27  ILE A HD13 1  
ATOM   405    N  N    . ILE A 1 28  ? 13.738  11.616  -0.997  1.00 0.00 ? 28  ILE A N    1  
ATOM   406    C  CA   . ILE A 1 28  ? 14.295  10.348  -0.442  1.00 0.00 ? 28  ILE A CA   1  
ATOM   407    C  C    . ILE A 1 28  ? 15.819  10.425  -0.418  1.00 0.00 ? 28  ILE A C    1  
ATOM   408    O  O    . ILE A 1 28  ? 16.448  10.764  -1.402  1.00 0.00 ? 28  ILE A O    1  
ATOM   409    C  CB   . ILE A 1 28  ? 13.858  9.171   -1.317  1.00 0.00 ? 28  ILE A CB   1  
ATOM   410    C  CG1  . ILE A 1 28  ? 12.364  9.294   -1.629  1.00 0.00 ? 28  ILE A CG1  1  
ATOM   411    C  CG2  . ILE A 1 28  ? 14.113  7.860   -0.570  1.00 0.00 ? 28  ILE A CG2  1  
ATOM   412    C  CD1  . ILE A 1 28  ? 11.874  8.011   -2.307  1.00 0.00 ? 28  ILE A CD1  1  
ATOM   413    H  H    . ILE A 1 28  ? 13.942  11.869  -1.923  1.00 0.00 ? 28  ILE A H    1  
ATOM   414    H  HA   . ILE A 1 28  ? 13.929  10.200  0.562   1.00 0.00 ? 28  ILE A HA   1  
ATOM   415    H  HB   . ILE A 1 28  ? 14.422  9.177   -2.237  1.00 0.00 ? 28  ILE A HB   1  
ATOM   416    H  HG12 . ILE A 1 28  ? 11.816  9.446   -0.709  1.00 0.00 ? 28  ILE A HG12 1  
ATOM   417    H  HG13 . ILE A 1 28  ? 12.201  10.132  -2.289  1.00 0.00 ? 28  ILE A HG13 1  
ATOM   418    H  HG21 . ILE A 1 28  ? 15.120  7.859   -0.180  1.00 0.00 ? 28  ILE A HG21 1  
ATOM   419    H  HG22 . ILE A 1 28  ? 13.988  7.029   -1.248  1.00 0.00 ? 28  ILE A HG22 1  
ATOM   420    H  HG23 . ILE A 1 28  ? 13.412  7.769   0.246   1.00 0.00 ? 28  ILE A HG23 1  
ATOM   421    H  HD11 . ILE A 1 28  ? 11.134  8.259   -3.054  1.00 0.00 ? 28  ILE A HD11 1  
ATOM   422    H  HD12 . ILE A 1 28  ? 11.434  7.359   -1.567  1.00 0.00 ? 28  ILE A HD12 1  
ATOM   423    H  HD13 . ILE A 1 28  ? 12.708  7.512   -2.777  1.00 0.00 ? 28  ILE A HD13 1  
ATOM   424    N  N    . HIS A 1 29  ? 16.415  10.109  0.700   1.00 0.00 ? 29  HIS A N    1  
ATOM   425    C  CA   . HIS A 1 29  ? 17.900  10.156  0.798   1.00 0.00 ? 29  HIS A CA   1  
ATOM   426    C  C    . HIS A 1 29  ? 18.411  8.802   1.297   1.00 0.00 ? 29  HIS A C    1  
ATOM   427    O  O    . HIS A 1 29  ? 17.708  8.083   1.978   1.00 0.00 ? 29  HIS A O    1  
ATOM   428    C  CB   . HIS A 1 29  ? 18.309  11.247  1.791   1.00 0.00 ? 29  HIS A CB   1  
ATOM   429    C  CG   . HIS A 1 29  ? 18.376  12.572  1.087   1.00 0.00 ? 29  HIS A CG   1  
ATOM   430    N  ND1  . HIS A 1 29  ? 19.577  13.140  0.695   1.00 0.00 ? 29  HIS A ND1  1  
ATOM   431    C  CD2  . HIS A 1 29  ? 17.399  13.454  0.698   1.00 0.00 ? 29  HIS A CD2  1  
ATOM   432    C  CE1  . HIS A 1 29  ? 19.295  14.314  0.099   1.00 0.00 ? 29  HIS A CE1  1  
ATOM   433    N  NE2  . HIS A 1 29  ? 17.981  14.554  0.074   1.00 0.00 ? 29  HIS A NE2  1  
ATOM   434    H  H    . HIS A 1 29  ? 15.881  9.838   1.477   1.00 0.00 ? 29  HIS A H    1  
ATOM   435    H  HA   . HIS A 1 29  ? 18.320  10.374  -0.173  1.00 0.00 ? 29  HIS A HA   1  
ATOM   436    H  HB2  . HIS A 1 29  ? 17.580  11.299  2.587   1.00 0.00 ? 29  HIS A HB2  1  
ATOM   437    H  HB3  . HIS A 1 29  ? 19.277  11.012  2.208   1.00 0.00 ? 29  HIS A HB3  1  
ATOM   438    H  HD1  . HIS A 1 29  ? 20.470  12.759  0.828   1.00 0.00 ? 29  HIS A HD1  1  
ATOM   439    H  HD2  . HIS A 1 29  ? 16.339  13.316  0.853   1.00 0.00 ? 29  HIS A HD2  1  
ATOM   440    H  HE1  . HIS A 1 29  ? 20.041  14.979  -0.312  1.00 0.00 ? 29  HIS A HE1  1  
ATOM   441    N  N    . PRO A 1 30  ? 19.629  8.459   0.969   1.00 0.00 ? 30  PRO A N    1  
ATOM   442    C  CA   . PRO A 1 30  ? 20.238  7.170   1.405   1.00 0.00 ? 30  PRO A CA   1  
ATOM   443    C  C    . PRO A 1 30  ? 20.445  7.136   2.922   1.00 0.00 ? 30  PRO A C    1  
ATOM   444    O  O    . PRO A 1 30  ? 20.579  8.165   3.556   1.00 0.00 ? 30  PRO A O    1  
ATOM   445    C  CB   . PRO A 1 30  ? 21.585  7.126   0.679   1.00 0.00 ? 30  PRO A CB   1  
ATOM   446    C  CG   . PRO A 1 30  ? 21.897  8.542   0.321   1.00 0.00 ? 30  PRO A CG   1  
ATOM   447    C  CD   . PRO A 1 30  ? 20.556  9.256   0.152   1.00 0.00 ? 30  PRO A CD   1  
ATOM   448    H  HA   . PRO A 1 30  ? 19.627  6.337   1.088   1.00 0.00 ? 30  PRO A HA   1  
ATOM   449    H  HB2  . PRO A 1 30  ? 22.347  6.726   1.334   1.00 0.00 ? 30  PRO A HB2  1  
ATOM   450    H  HB3  . PRO A 1 30  ? 21.509  6.528   -0.216  1.00 0.00 ? 30  PRO A HB3  1  
ATOM   451    H  HG2  . PRO A 1 30  ? 22.470  9.004   1.113   1.00 0.00 ? 30  PRO A HG2  1  
ATOM   452    H  HG3  . PRO A 1 30  ? 22.446  8.578   -0.606  1.00 0.00 ? 30  PRO A HG3  1  
ATOM   453    H  HD2  . PRO A 1 30  ? 20.620  10.270  0.520   1.00 0.00 ? 30  PRO A HD2  1  
ATOM   454    H  HD3  . PRO A 1 30  ? 20.247  9.244   -0.882  1.00 0.00 ? 30  PRO A HD3  1  
ATOM   455    N  N    . GLU A 1 31  ? 20.471  5.971   3.511   1.00 0.00 ? 31  GLU A N    1  
ATOM   456    C  CA   . GLU A 1 31  ? 20.667  5.888   4.988   1.00 0.00 ? 31  GLU A CA   1  
ATOM   457    C  C    . GLU A 1 31  ? 21.714  4.822   5.315   1.00 0.00 ? 31  GLU A C    1  
ATOM   458    O  O    . GLU A 1 31  ? 22.333  4.253   4.439   1.00 0.00 ? 31  GLU A O    1  
ATOM   459    C  CB   . GLU A 1 31  ? 19.344  5.520   5.660   1.00 0.00 ? 31  GLU A CB   1  
ATOM   460    C  CG   . GLU A 1 31  ? 18.472  6.767   5.793   1.00 0.00 ? 31  GLU A CG   1  
ATOM   461    C  CD   . GLU A 1 31  ? 19.098  7.727   6.807   1.00 0.00 ? 31  GLU A CD   1  
ATOM   462    O  OE1  . GLU A 1 31  ? 19.112  7.392   7.980   1.00 0.00 ? 31  GLU A OE1  1  
ATOM   463    O  OE2  . GLU A 1 31  ? 19.550  8.783   6.393   1.00 0.00 ? 31  GLU A OE2  1  
ATOM   464    H  H    . GLU A 1 31  ? 20.360  5.152   2.982   1.00 0.00 ? 31  GLU A H    1  
ATOM   465    H  HA   . GLU A 1 31  ? 21.004  6.843   5.362   1.00 0.00 ? 31  GLU A HA   1  
ATOM   466    H  HB2  . GLU A 1 31  ? 18.830  4.784   5.059   1.00 0.00 ? 31  GLU A HB2  1  
ATOM   467    H  HB3  . GLU A 1 31  ? 19.539  5.112   6.640   1.00 0.00 ? 31  GLU A HB3  1  
ATOM   468    H  HG2  . GLU A 1 31  ? 18.396  7.256   4.833   1.00 0.00 ? 31  GLU A HG2  1  
ATOM   469    H  HG3  . GLU A 1 31  ? 17.487  6.483   6.131   1.00 0.00 ? 31  GLU A HG3  1  
ATOM   470    N  N    . LYS A 1 32  ? 21.914  4.551   6.576   1.00 0.00 ? 32  LYS A N    1  
ATOM   471    C  CA   . LYS A 1 32  ? 22.918  3.525   6.971   1.00 0.00 ? 32  LYS A CA   1  
ATOM   472    C  C    . LYS A 1 32  ? 22.257  2.146   6.990   1.00 0.00 ? 32  LYS A C    1  
ATOM   473    O  O    . LYS A 1 32  ? 21.077  2.014   7.250   1.00 0.00 ? 32  LYS A O    1  
ATOM   474    C  CB   . LYS A 1 32  ? 23.460  3.852   8.365   1.00 0.00 ? 32  LYS A CB   1  
ATOM   475    C  CG   . LYS A 1 32  ? 24.334  2.699   8.861   1.00 0.00 ? 32  LYS A CG   1  
ATOM   476    C  CD   . LYS A 1 32  ? 25.408  3.241   9.808   1.00 0.00 ? 32  LYS A CD   1  
ATOM   477    C  CE   . LYS A 1 32  ? 24.753  4.114   10.881  1.00 0.00 ? 32  LYS A CE   1  
ATOM   478    N  NZ   . LYS A 1 32  ? 25.613  4.136   12.098  1.00 0.00 ? 32  LYS A NZ   1  
ATOM   479    H  H    . LYS A 1 32  ? 21.401  5.025   7.265   1.00 0.00 ? 32  LYS A H    1  
ATOM   480    H  HA   . LYS A 1 32  ? 23.731  3.524   6.261   1.00 0.00 ? 32  LYS A HA   1  
ATOM   481    H  HB2  . LYS A 1 32  ? 24.049  4.757   8.317   1.00 0.00 ? 32  LYS A HB2  1  
ATOM   482    H  HB3  . LYS A 1 32  ? 22.635  3.996   9.048   1.00 0.00 ? 32  LYS A HB3  1  
ATOM   483    H  HG2  . LYS A 1 32  ? 23.719  1.982   9.386   1.00 0.00 ? 32  LYS A HG2  1  
ATOM   484    H  HG3  . LYS A 1 32  ? 24.809  2.219   8.020   1.00 0.00 ? 32  LYS A HG3  1  
ATOM   485    H  HD2  . LYS A 1 32  ? 25.921  2.415   10.280  1.00 0.00 ? 32  LYS A HD2  1  
ATOM   486    H  HD3  . LYS A 1 32  ? 26.116  3.834   9.249   1.00 0.00 ? 32  LYS A HD3  1  
ATOM   487    H  HE2  . LYS A 1 32  ? 24.637  5.119   10.505  1.00 0.00 ? 32  LYS A HE2  1  
ATOM   488    H  HE3  . LYS A 1 32  ? 23.783  3.709   11.132  1.00 0.00 ? 32  LYS A HE3  1  
ATOM   489    H  HZ1  . LYS A 1 32  ? 25.330  4.927   12.709  1.00 0.00 ? 32  LYS A HZ1  1  
ATOM   490    H  HZ2  . LYS A 1 32  ? 26.608  4.253   11.816  1.00 0.00 ? 32  LYS A HZ2  1  
ATOM   491    H  HZ3  . LYS A 1 32  ? 25.503  3.243   12.618  1.00 0.00 ? 32  LYS A HZ3  1  
ATOM   492    N  N    . GLU A 1 33  ? 23.005  1.118   6.707   1.00 0.00 ? 33  GLU A N    1  
ATOM   493    C  CA   . GLU A 1 33  ? 22.421  -0.251  6.698   1.00 0.00 ? 33  GLU A CA   1  
ATOM   494    C  C    . GLU A 1 33  ? 21.591  -0.477  7.965   1.00 0.00 ? 33  GLU A C    1  
ATOM   495    O  O    . GLU A 1 33  ? 21.859  0.085   9.008   1.00 0.00 ? 33  GLU A O    1  
ATOM   496    C  CB   . GLU A 1 33  ? 23.550  -1.284  6.653   1.00 0.00 ? 33  GLU A CB   1  
ATOM   497    C  CG   . GLU A 1 33  ? 24.045  -1.442  5.216   1.00 0.00 ? 33  GLU A CG   1  
ATOM   498    C  CD   . GLU A 1 33  ? 24.684  -0.132  4.752   1.00 0.00 ? 33  GLU A CD   1  
ATOM   499    O  OE1  . GLU A 1 33  ? 23.954  0.824   4.558   1.00 0.00 ? 33  GLU A OE1  1  
ATOM   500    O  OE2  . GLU A 1 33  ? 25.895  -0.108  4.601   1.00 0.00 ? 33  GLU A OE2  1  
ATOM   501    H  H    . GLU A 1 33  ? 23.952  1.247   6.490   1.00 0.00 ? 33  GLU A H    1  
ATOM   502    H  HA   . GLU A 1 33  ? 21.792  -0.369  5.830   1.00 0.00 ? 33  GLU A HA   1  
ATOM   503    H  HB2  . GLU A 1 33  ? 24.364  -0.953  7.281   1.00 0.00 ? 33  GLU A HB2  1  
ATOM   504    H  HB3  . GLU A 1 33  ? 23.183  -2.234  7.011   1.00 0.00 ? 33  GLU A HB3  1  
ATOM   505    H  HG2  . GLU A 1 33  ? 24.777  -2.234  5.175   1.00 0.00 ? 33  GLU A HG2  1  
ATOM   506    H  HG3  . GLU A 1 33  ? 23.213  -1.684  4.573   1.00 0.00 ? 33  GLU A HG3  1  
ATOM   507    N  N    . GLY A 1 34  ? 20.605  -1.327  7.881   1.00 0.00 ? 34  GLY A N    1  
ATOM   508    C  CA   . GLY A 1 34  ? 19.765  -1.635  9.076   1.00 0.00 ? 34  GLY A CA   1  
ATOM   509    C  C    . GLY A 1 34  ? 19.077  -0.375  9.614   1.00 0.00 ? 34  GLY A C    1  
ATOM   510    O  O    . GLY A 1 34  ? 18.655  -0.342  10.753  1.00 0.00 ? 34  GLY A O    1  
ATOM   511    H  H    . GLY A 1 34  ? 20.432  -1.789  7.034   1.00 0.00 ? 34  GLY A H    1  
ATOM   512    H  HA2  . GLY A 1 34  ? 19.013  -2.360  8.802   1.00 0.00 ? 34  GLY A HA2  1  
ATOM   513    H  HA3  . GLY A 1 34  ? 20.393  -2.051  9.850   1.00 0.00 ? 34  GLY A HA3  1  
ATOM   514    N  N    . THR A 1 35  ? 18.937  0.653   8.823   1.00 0.00 ? 35  THR A N    1  
ATOM   515    C  CA   . THR A 1 35  ? 18.249  1.875   9.337   1.00 0.00 ? 35  THR A CA   1  
ATOM   516    C  C    . THR A 1 35  ? 16.737  1.658   9.265   1.00 0.00 ? 35  THR A C    1  
ATOM   517    O  O    . THR A 1 35  ? 16.008  1.983   10.180  1.00 0.00 ? 35  THR A O    1  
ATOM   518    C  CB   . THR A 1 35  ? 18.635  3.091   8.490   1.00 0.00 ? 35  THR A CB   1  
ATOM   519    O  OG1  . THR A 1 35  ? 19.999  3.414   8.722   1.00 0.00 ? 35  THR A OG1  1  
ATOM   520    C  CG2  . THR A 1 35  ? 17.756  4.283   8.872   1.00 0.00 ? 35  THR A CG2  1  
ATOM   521    H  H    . THR A 1 35  ? 19.259  0.625   7.898   1.00 0.00 ? 35  THR A H    1  
ATOM   522    H  HA   . THR A 1 35  ? 18.538  2.044   10.364  1.00 0.00 ? 35  THR A HA   1  
ATOM   523    H  HB   . THR A 1 35  ? 18.490  2.863   7.447   1.00 0.00 ? 35  THR A HB   1  
ATOM   524    H  HG1  . THR A 1 35  ? 20.485  2.593   8.821   1.00 0.00 ? 35  THR A HG1  1  
ATOM   525    H  HG21 . THR A 1 35  ? 18.318  5.198   8.749   1.00 0.00 ? 35  THR A HG21 1  
ATOM   526    H  HG22 . THR A 1 35  ? 17.445  4.187   9.901   1.00 0.00 ? 35  THR A HG22 1  
ATOM   527    H  HG23 . THR A 1 35  ? 16.884  4.309   8.233   1.00 0.00 ? 35  THR A HG23 1  
ATOM   528    N  N    . GLY A 1 36  ? 16.263  1.100   8.183   1.00 0.00 ? 36  GLY A N    1  
ATOM   529    C  CA   . GLY A 1 36  ? 14.800  0.852   8.050   1.00 0.00 ? 36  GLY A CA   1  
ATOM   530    C  C    . GLY A 1 36  ? 14.150  1.977   7.243   1.00 0.00 ? 36  GLY A C    1  
ATOM   531    O  O    . GLY A 1 36  ? 14.818  2.831   6.691   1.00 0.00 ? 36  GLY A O    1  
ATOM   532    H  H    . GLY A 1 36  ? 16.870  0.841   7.459   1.00 0.00 ? 36  GLY A H    1  
ATOM   533    H  HA2  . GLY A 1 36  ? 14.640  -0.091  7.548   1.00 0.00 ? 36  GLY A HA2  1  
ATOM   534    H  HA3  . GLY A 1 36  ? 14.352  0.814   9.032   1.00 0.00 ? 36  GLY A HA3  1  
ATOM   535    N  N    . ILE A 1 37  ? 12.849  1.982   7.178   1.00 0.00 ? 37  ILE A N    1  
ATOM   536    C  CA   . ILE A 1 37  ? 12.136  3.046   6.421   1.00 0.00 ? 37  ILE A CA   1  
ATOM   537    C  C    . ILE A 1 37  ? 11.635  4.094   7.411   1.00 0.00 ? 37  ILE A C    1  
ATOM   538    O  O    . ILE A 1 37  ? 10.884  3.781   8.313   1.00 0.00 ? 37  ILE A O    1  
ATOM   539    C  CB   . ILE A 1 37  ? 10.937  2.429   5.701   1.00 0.00 ? 37  ILE A CB   1  
ATOM   540    C  CG1  . ILE A 1 37  ? 11.321  1.049   5.161   1.00 0.00 ? 37  ILE A CG1  1  
ATOM   541    C  CG2  . ILE A 1 37  ? 10.490  3.334   4.545   1.00 0.00 ? 37  ILE A CG2  1  
ATOM   542    C  CD1  . ILE A 1 37  ? 12.510  1.176   4.208   1.00 0.00 ? 37  ILE A CD1  1  
ATOM   543    H  H    . ILE A 1 37  ? 12.336  1.285   7.638   1.00 0.00 ? 37  ILE A H    1  
ATOM   544    H  HA   . ILE A 1 37  ? 12.807  3.500   5.707   1.00 0.00 ? 37  ILE A HA   1  
ATOM   545    H  HB   . ILE A 1 37  ? 10.123  2.322   6.402   1.00 0.00 ? 37  ILE A HB   1  
ATOM   546    H  HG12 . ILE A 1 37  ? 11.588  0.403   5.986   1.00 0.00 ? 37  ILE A HG12 1  
ATOM   547    H  HG13 . ILE A 1 37  ? 10.483  0.627   4.632   1.00 0.00 ? 37  ILE A HG13 1  
ATOM   548    H  HG21 . ILE A 1 37  ? 10.996  4.285   4.612   1.00 0.00 ? 37  ILE A HG21 1  
ATOM   549    H  HG22 . ILE A 1 37  ? 9.423   3.491   4.607   1.00 0.00 ? 37  ILE A HG22 1  
ATOM   550    H  HG23 . ILE A 1 37  ? 10.729  2.865   3.603   1.00 0.00 ? 37  ILE A HG23 1  
ATOM   551    H  HD11 . ILE A 1 37  ? 12.711  0.217   3.758   1.00 0.00 ? 37  ILE A HD11 1  
ATOM   552    H  HD12 . ILE A 1 37  ? 13.380  1.506   4.757   1.00 0.00 ? 37  ILE A HD12 1  
ATOM   553    H  HD13 . ILE A 1 37  ? 12.276  1.893   3.438   1.00 0.00 ? 37  ILE A HD13 1  
ATOM   554    N  N    . ARG A 1 38  ? 12.037  5.329   7.264   1.00 0.00 ? 38  ARG A N    1  
ATOM   555    C  CA   . ARG A 1 38  ? 11.556  6.367   8.227   1.00 0.00 ? 38  ARG A CA   1  
ATOM   556    C  C    . ARG A 1 38  ? 11.139  7.638   7.489   1.00 0.00 ? 38  ARG A C    1  
ATOM   557    O  O    . ARG A 1 38  ? 11.719  8.013   6.489   1.00 0.00 ? 38  ARG A O    1  
ATOM   558    C  CB   . ARG A 1 38  ? 12.667  6.701   9.223   1.00 0.00 ? 38  ARG A CB   1  
ATOM   559    C  CG   . ARG A 1 38  ? 13.988  6.886   8.476   1.00 0.00 ? 38  ARG A CG   1  
ATOM   560    C  CD   . ARG A 1 38  ? 15.070  7.342   9.456   1.00 0.00 ? 38  ARG A CD   1  
ATOM   561    N  NE   . ARG A 1 38  ? 15.237  6.318   10.525  1.00 0.00 ? 38  ARG A NE   1  
ATOM   562    C  CZ   . ARG A 1 38  ? 15.848  6.628   11.635  1.00 0.00 ? 38  ARG A CZ   1  
ATOM   563    N  NH1  . ARG A 1 38  ? 16.310  7.837   11.810  1.00 0.00 ? 38  ARG A NH1  1  
ATOM   564    N  NH2  . ARG A 1 38  ? 15.999  5.730   12.569  1.00 0.00 ? 38  ARG A NH2  1  
ATOM   565    H  H    . ARG A 1 38  ? 12.649  5.571   6.530   1.00 0.00 ? 38  ARG A H    1  
ATOM   566    H  HA   . ARG A 1 38  ? 10.704  5.983   8.768   1.00 0.00 ? 38  ARG A HA   1  
ATOM   567    H  HB2  . ARG A 1 38  ? 12.417  7.613   9.745   1.00 0.00 ? 38  ARG A HB2  1  
ATOM   568    H  HB3  . ARG A 1 38  ? 12.765  5.896   9.933   1.00 0.00 ? 38  ARG A HB3  1  
ATOM   569    H  HG2  . ARG A 1 38  ? 14.280  5.950   8.023   1.00 0.00 ? 38  ARG A HG2  1  
ATOM   570    H  HG3  . ARG A 1 38  ? 13.864  7.634   7.709   1.00 0.00 ? 38  ARG A HG3  1  
ATOM   571    H  HD2  . ARG A 1 38  ? 16.005  7.466   8.928   1.00 0.00 ? 38  ARG A HD2  1  
ATOM   572    H  HD3  . ARG A 1 38  ? 14.781  8.283   9.900   1.00 0.00 ? 38  ARG A HD3  1  
ATOM   573    H  HE   . ARG A 1 38  ? 14.888  5.412   10.394  1.00 0.00 ? 38  ARG A HE   1  
ATOM   574    H  HH11 . ARG A 1 38  ? 16.195  8.525   11.095  1.00 0.00 ? 38  ARG A HH11 1  
ATOM   575    H  HH12 . ARG A 1 38  ? 16.779  8.074   12.661  1.00 0.00 ? 38  ARG A HH12 1  
ATOM   576    H  HH21 . ARG A 1 38  ? 15.645  4.805   12.434  1.00 0.00 ? 38  ARG A HH21 1  
ATOM   577    H  HH22 . ARG A 1 38  ? 16.469  5.967   13.418  1.00 0.00 ? 38  ARG A HH22 1  
ATOM   578    N  N    . PHE A 1 39  ? 10.138  8.309   7.993   1.00 0.00 ? 39  PHE A N    1  
ATOM   579    C  CA   . PHE A 1 39  ? 9.669   9.568   7.350   1.00 0.00 ? 39  PHE A CA   1  
ATOM   580    C  C    . PHE A 1 39  ? 10.189  10.759  8.158   1.00 0.00 ? 39  PHE A C    1  
ATOM   581    O  O    . PHE A 1 39  ? 10.376  10.667  9.354   1.00 0.00 ? 39  PHE A O    1  
ATOM   582    C  CB   . PHE A 1 39  ? 8.139   9.601   7.331   1.00 0.00 ? 39  PHE A CB   1  
ATOM   583    C  CG   . PHE A 1 39  ? 7.613   8.499   6.442   1.00 0.00 ? 39  PHE A CG   1  
ATOM   584    C  CD1  . PHE A 1 39  ? 7.681   8.630   5.050   1.00 0.00 ? 39  PHE A CD1  1  
ATOM   585    C  CD2  . PHE A 1 39  ? 7.053   7.347   7.009   1.00 0.00 ? 39  PHE A CD2  1  
ATOM   586    C  CE1  . PHE A 1 39  ? 7.192   7.610   4.225   1.00 0.00 ? 39  PHE A CE1  1  
ATOM   587    C  CE2  . PHE A 1 39  ? 6.562   6.328   6.185   1.00 0.00 ? 39  PHE A CE2  1  
ATOM   588    C  CZ   . PHE A 1 39  ? 6.632   6.459   4.792   1.00 0.00 ? 39  PHE A CZ   1  
ATOM   589    H  H    . PHE A 1 39  ? 9.700   7.983   8.807   1.00 0.00 ? 39  PHE A H    1  
ATOM   590    H  HA   . PHE A 1 39  ? 10.048  9.622   6.340   1.00 0.00 ? 39  PHE A HA   1  
ATOM   591    H  HB2  . PHE A 1 39  ? 7.763   9.464   8.333   1.00 0.00 ? 39  PHE A HB2  1  
ATOM   592    H  HB3  . PHE A 1 39  ? 7.805   10.555  6.951   1.00 0.00 ? 39  PHE A HB3  1  
ATOM   593    H  HD1  . PHE A 1 39  ? 8.111   9.518   4.613   1.00 0.00 ? 39  PHE A HD1  1  
ATOM   594    H  HD2  . PHE A 1 39  ? 7.000   7.246   8.083   1.00 0.00 ? 39  PHE A HD2  1  
ATOM   595    H  HE1  . PHE A 1 39  ? 7.246   7.711   3.151   1.00 0.00 ? 39  PHE A HE1  1  
ATOM   596    H  HE2  . PHE A 1 39  ? 6.129   5.440   6.622   1.00 0.00 ? 39  PHE A HE2  1  
ATOM   597    H  HZ   . PHE A 1 39  ? 6.253   5.672   4.156   1.00 0.00 ? 39  PHE A HZ   1  
ATOM   598    N  N    . PHE A 1 40  ? 10.425  11.873  7.520   1.00 0.00 ? 40  PHE A N    1  
ATOM   599    C  CA   . PHE A 1 40  ? 10.936  13.063  8.264   1.00 0.00 ? 40  PHE A CA   1  
ATOM   600    C  C    . PHE A 1 40  ? 10.123  14.297  7.878   1.00 0.00 ? 40  PHE A C    1  
ATOM   601    O  O    . PHE A 1 40  ? 9.793   14.501  6.726   1.00 0.00 ? 40  PHE A O    1  
ATOM   602    C  CB   . PHE A 1 40  ? 12.409  13.284  7.909   1.00 0.00 ? 40  PHE A CB   1  
ATOM   603    C  CG   . PHE A 1 40  ? 12.848  14.674  8.312   1.00 0.00 ? 40  PHE A CG   1  
ATOM   604    C  CD1  . PHE A 1 40  ? 12.483  15.782  7.536   1.00 0.00 ? 40  PHE A CD1  1  
ATOM   605    C  CD2  . PHE A 1 40  ? 13.632  14.851  9.459   1.00 0.00 ? 40  PHE A CD2  1  
ATOM   606    C  CE1  . PHE A 1 40  ? 12.901  17.066  7.910   1.00 0.00 ? 40  PHE A CE1  1  
ATOM   607    C  CE2  . PHE A 1 40  ? 14.052  16.134  9.829   1.00 0.00 ? 40  PHE A CE2  1  
ATOM   608    C  CZ   . PHE A 1 40  ? 13.686  17.242  9.056   1.00 0.00 ? 40  PHE A CZ   1  
ATOM   609    H  H    . PHE A 1 40  ? 10.272  11.926  6.552   1.00 0.00 ? 40  PHE A H    1  
ATOM   610    H  HA   . PHE A 1 40  ? 10.845  12.890  9.328   1.00 0.00 ? 40  PHE A HA   1  
ATOM   611    H  HB2  . PHE A 1 40  ? 13.010  12.559  8.432   1.00 0.00 ? 40  PHE A HB2  1  
ATOM   612    H  HB3  . PHE A 1 40  ? 12.543  13.159  6.844   1.00 0.00 ? 40  PHE A HB3  1  
ATOM   613    H  HD1  . PHE A 1 40  ? 11.879  15.649  6.652   1.00 0.00 ? 40  PHE A HD1  1  
ATOM   614    H  HD2  . PHE A 1 40  ? 13.913  13.998  10.056  1.00 0.00 ? 40  PHE A HD2  1  
ATOM   615    H  HE1  . PHE A 1 40  ? 12.619  17.921  7.312   1.00 0.00 ? 40  PHE A HE1  1  
ATOM   616    H  HE2  . PHE A 1 40  ? 14.657  16.270  10.713  1.00 0.00 ? 40  PHE A HE2  1  
ATOM   617    H  HZ   . PHE A 1 40  ? 14.011  18.231  9.340   1.00 0.00 ? 40  PHE A HZ   1  
ATOM   618    N  N    . LYS A 1 41  ? 9.794   15.122  8.833   1.00 0.00 ? 41  LYS A N    1  
ATOM   619    C  CA   . LYS A 1 41  ? 8.997   16.343  8.522   1.00 0.00 ? 41  LYS A CA   1  
ATOM   620    C  C    . LYS A 1 41  ? 9.020   17.287  9.728   1.00 0.00 ? 41  LYS A C    1  
ATOM   621    O  O    . LYS A 1 41  ? 8.954   16.864  10.865  1.00 0.00 ? 41  LYS A O    1  
ATOM   622    C  CB   . LYS A 1 41  ? 7.549   15.943  8.214   1.00 0.00 ? 41  LYS A CB   1  
ATOM   623    C  CG   . LYS A 1 41  ? 6.728   17.180  7.823   1.00 0.00 ? 41  LYS A CG   1  
ATOM   624    C  CD   . LYS A 1 41  ? 5.334   17.082  8.445   1.00 0.00 ? 41  LYS A CD   1  
ATOM   625    C  CE   . LYS A 1 41  ? 4.495   18.289  8.018   1.00 0.00 ? 41  LYS A CE   1  
ATOM   626    N  NZ   . LYS A 1 41  ? 5.023   19.521  8.672   1.00 0.00 ? 41  LYS A NZ   1  
ATOM   627    H  H    . LYS A 1 41  ? 10.066  14.940  9.756   1.00 0.00 ? 41  LYS A H    1  
ATOM   628    H  HA   . LYS A 1 41  ? 9.423   16.843  7.665   1.00 0.00 ? 41  LYS A HA   1  
ATOM   629    H  HB2  . LYS A 1 41  ? 7.540   15.235  7.398   1.00 0.00 ? 41  LYS A HB2  1  
ATOM   630    H  HB3  . LYS A 1 41  ? 7.111   15.486  9.089   1.00 0.00 ? 41  LYS A HB3  1  
ATOM   631    H  HG2  . LYS A 1 41  ? 7.219   18.073  8.179   1.00 0.00 ? 41  LYS A HG2  1  
ATOM   632    H  HG3  . LYS A 1 41  ? 6.636   17.227  6.751   1.00 0.00 ? 41  LYS A HG3  1  
ATOM   633    H  HD2  . LYS A 1 41  ? 4.854   16.173  8.110   1.00 0.00 ? 41  LYS A HD2  1  
ATOM   634    H  HD3  . LYS A 1 41  ? 5.419   17.068  9.522   1.00 0.00 ? 41  LYS A HD3  1  
ATOM   635    H  HE2  . LYS A 1 41  ? 4.545   18.401  6.945   1.00 0.00 ? 41  LYS A HE2  1  
ATOM   636    H  HE3  . LYS A 1 41  ? 3.468   18.136  8.316   1.00 0.00 ? 41  LYS A HE3  1  
ATOM   637    H  HZ1  . LYS A 1 41  ? 5.628   20.037  8.001   1.00 0.00 ? 41  LYS A HZ1  1  
ATOM   638    H  HZ2  . LYS A 1 41  ? 5.581   19.256  9.509   1.00 0.00 ? 41  LYS A HZ2  1  
ATOM   639    H  HZ3  . LYS A 1 41  ? 4.231   20.128  8.960   1.00 0.00 ? 41  LYS A HZ3  1  
ATOM   640    N  N    . ASN A 1 42  ? 9.106   18.565  9.479   1.00 0.00 ? 42  ASN A N    1  
ATOM   641    C  CA   . ASN A 1 42  ? 9.122   19.547  10.600  1.00 0.00 ? 42  ASN A CA   1  
ATOM   642    C  C    . ASN A 1 42  ? 10.235  19.192  11.594  1.00 0.00 ? 42  ASN A C    1  
ATOM   643    O  O    . ASN A 1 42  ? 10.141  19.471  12.772  1.00 0.00 ? 42  ASN A O    1  
ATOM   644    C  CB   . ASN A 1 42  ? 7.764   19.521  11.307  1.00 0.00 ? 42  ASN A CB   1  
ATOM   645    C  CG   . ASN A 1 42  ? 6.953   20.750  10.892  1.00 0.00 ? 42  ASN A CG   1  
ATOM   646    O  OD1  . ASN A 1 42  ? 6.637   20.919  9.731   1.00 0.00 ? 42  ASN A OD1  1  
ATOM   647    N  ND2  . ASN A 1 42  ? 6.599   21.621  11.797  1.00 0.00 ? 42  ASN A ND2  1  
ATOM   648    H  H    . ASN A 1 42  ? 9.151   18.878  8.550   1.00 0.00 ? 42  ASN A H    1  
ATOM   649    H  HA   . ASN A 1 42  ? 9.298   20.537  10.205  1.00 0.00 ? 42  ASN A HA   1  
ATOM   650    H  HB2  . ASN A 1 42  ? 7.230   18.625  11.025  1.00 0.00 ? 42  ASN A HB2  1  
ATOM   651    H  HB3  . ASN A 1 42  ? 7.909   19.531  12.376  1.00 0.00 ? 42  ASN A HB3  1  
ATOM   652    H  HD21 . ASN A 1 42  ? 6.853   21.484  12.734  1.00 0.00 ? 42  ASN A HD21 1  
ATOM   653    H  HD22 . ASN A 1 42  ? 6.080   22.410  11.540  1.00 0.00 ? 42  ASN A HD22 1  
ATOM   654    N  N    . GLY A 1 43  ? 11.293  18.589  11.129  1.00 0.00 ? 43  GLY A N    1  
ATOM   655    C  CA   . GLY A 1 43  ? 12.408  18.230  12.050  1.00 0.00 ? 43  GLY A CA   1  
ATOM   656    C  C    . GLY A 1 43  ? 11.974  17.090  12.973  1.00 0.00 ? 43  GLY A C    1  
ATOM   657    O  O    . GLY A 1 43  ? 12.431  16.982  14.094  1.00 0.00 ? 43  GLY A O    1  
ATOM   658    H  H    . GLY A 1 43  ? 11.361  18.375  10.175  1.00 0.00 ? 43  GLY A H    1  
ATOM   659    H  HA2  . GLY A 1 43  ? 13.266  17.918  11.472  1.00 0.00 ? 43  GLY A HA2  1  
ATOM   660    H  HA3  . GLY A 1 43  ? 12.670  19.091  12.647  1.00 0.00 ? 43  GLY A HA3  1  
ATOM   661    N  N    . VAL A 1 44  ? 11.098  16.240  12.511  1.00 0.00 ? 44  VAL A N    1  
ATOM   662    C  CA   . VAL A 1 44  ? 10.637  15.105  13.362  1.00 0.00 ? 44  VAL A CA   1  
ATOM   663    C  C    . VAL A 1 44  ? 10.724  13.801  12.566  1.00 0.00 ? 44  VAL A C    1  
ATOM   664    O  O    . VAL A 1 44  ? 10.167  13.676  11.493  1.00 0.00 ? 44  VAL A O    1  
ATOM   665    C  CB   . VAL A 1 44  ? 9.190   15.348  13.786  1.00 0.00 ? 44  VAL A CB   1  
ATOM   666    C  CG1  . VAL A 1 44  ? 8.689   14.161  14.614  1.00 0.00 ? 44  VAL A CG1  1  
ATOM   667    C  CG2  . VAL A 1 44  ? 9.114   16.623  14.627  1.00 0.00 ? 44  VAL A CG2  1  
ATOM   668    H  H    . VAL A 1 44  ? 10.741  16.346  11.605  1.00 0.00 ? 44  VAL A H    1  
ATOM   669    H  HA   . VAL A 1 44  ? 11.262  15.032  14.239  1.00 0.00 ? 44  VAL A HA   1  
ATOM   670    H  HB   . VAL A 1 44  ? 8.575   15.457  12.905  1.00 0.00 ? 44  VAL A HB   1  
ATOM   671    H  HG11 . VAL A 1 44  ? 9.509   13.486  14.810  1.00 0.00 ? 44  VAL A HG11 1  
ATOM   672    H  HG12 . VAL A 1 44  ? 7.918   13.640  14.068  1.00 0.00 ? 44  VAL A HG12 1  
ATOM   673    H  HG13 . VAL A 1 44  ? 8.287   14.519  15.550  1.00 0.00 ? 44  VAL A HG13 1  
ATOM   674    H  HG21 . VAL A 1 44  ? 8.528   16.435  15.515  1.00 0.00 ? 44  VAL A HG21 1  
ATOM   675    H  HG22 . VAL A 1 44  ? 8.649   17.408  14.050  1.00 0.00 ? 44  VAL A HG22 1  
ATOM   676    H  HG23 . VAL A 1 44  ? 10.110  16.927  14.912  1.00 0.00 ? 44  VAL A HG23 1  
ATOM   677    N  N    . TYR A 1 45  ? 11.412  12.825  13.090  1.00 0.00 ? 45  TYR A N    1  
ATOM   678    C  CA   . TYR A 1 45  ? 11.526  11.524  12.372  1.00 0.00 ? 45  TYR A CA   1  
ATOM   679    C  C    . TYR A 1 45  ? 10.356  10.628  12.778  1.00 0.00 ? 45  TYR A C    1  
ATOM   680    O  O    . TYR A 1 45  ? 9.970   10.583  13.929  1.00 0.00 ? 45  TYR A O    1  
ATOM   681    C  CB   . TYR A 1 45  ? 12.844  10.837  12.741  1.00 0.00 ? 45  TYR A CB   1  
ATOM   682    C  CG   . TYR A 1 45  ? 14.008  11.714  12.340  1.00 0.00 ? 45  TYR A CG   1  
ATOM   683    C  CD1  . TYR A 1 45  ? 14.396  12.782  13.158  1.00 0.00 ? 45  TYR A CD1  1  
ATOM   684    C  CD2  . TYR A 1 45  ? 14.699  11.455  11.150  1.00 0.00 ? 45  TYR A CD2  1  
ATOM   685    C  CE1  . TYR A 1 45  ? 15.476  13.591  12.786  1.00 0.00 ? 45  TYR A CE1  1  
ATOM   686    C  CE2  . TYR A 1 45  ? 15.780  12.265  10.779  1.00 0.00 ? 45  TYR A CE2  1  
ATOM   687    C  CZ   . TYR A 1 45  ? 16.168  13.332  11.596  1.00 0.00 ? 45  TYR A CZ   1  
ATOM   688    O  OH   . TYR A 1 45  ? 17.234  14.129  11.231  1.00 0.00 ? 45  TYR A OH   1  
ATOM   689    H  H    . TYR A 1 45  ? 11.843  12.950  13.960  1.00 0.00 ? 45  TYR A H    1  
ATOM   690    H  HA   . TYR A 1 45  ? 11.495  11.697  11.306  1.00 0.00 ? 45  TYR A HA   1  
ATOM   691    H  HB2  . TYR A 1 45  ? 12.872  10.664  13.805  1.00 0.00 ? 45  TYR A HB2  1  
ATOM   692    H  HB3  . TYR A 1 45  ? 12.913  9.892   12.222  1.00 0.00 ? 45  TYR A HB3  1  
ATOM   693    H  HD1  . TYR A 1 45  ? 13.862  12.982  14.075  1.00 0.00 ? 45  TYR A HD1  1  
ATOM   694    H  HD2  . TYR A 1 45  ? 14.400  10.632  10.519  1.00 0.00 ? 45  TYR A HD2  1  
ATOM   695    H  HE1  . TYR A 1 45  ? 15.777  14.415  13.416  1.00 0.00 ? 45  TYR A HE1  1  
ATOM   696    H  HE2  . TYR A 1 45  ? 16.314  12.066  9.861   1.00 0.00 ? 45  TYR A HE2  1  
ATOM   697    H  HH   . TYR A 1 45  ? 17.854  13.587  10.738  1.00 0.00 ? 45  TYR A HH   1  
ATOM   698    N  N    . ILE A 1 46  ? 9.784   9.921   11.842  1.00 0.00 ? 46  ILE A N    1  
ATOM   699    C  CA   . ILE A 1 46  ? 8.630   9.033   12.178  1.00 0.00 ? 46  ILE A CA   1  
ATOM   700    C  C    . ILE A 1 46  ? 8.813   7.659   11.517  1.00 0.00 ? 46  ILE A C    1  
ATOM   701    O  O    . ILE A 1 46  ? 8.431   7.465   10.380  1.00 0.00 ? 46  ILE A O    1  
ATOM   702    C  CB   . ILE A 1 46  ? 7.342   9.670   11.654  1.00 0.00 ? 46  ILE A CB   1  
ATOM   703    C  CG1  . ILE A 1 46  ? 7.306   11.147  12.053  1.00 0.00 ? 46  ILE A CG1  1  
ATOM   704    C  CG2  . ILE A 1 46  ? 6.134   8.950   12.256  1.00 0.00 ? 46  ILE A CG2  1  
ATOM   705    C  CD1  . ILE A 1 46  ? 6.024   11.790  11.521  1.00 0.00 ? 46  ILE A CD1  1  
ATOM   706    H  H    . ILE A 1 46  ? 10.109  9.979   10.920  1.00 0.00 ? 46  ILE A H    1  
ATOM   707    H  HA   . ILE A 1 46  ? 8.557   8.922   13.248  1.00 0.00 ? 46  ILE A HA   1  
ATOM   708    H  HB   . ILE A 1 46  ? 7.311   9.584   10.576  1.00 0.00 ? 46  ILE A HB   1  
ATOM   709    H  HG12 . ILE A 1 46  ? 7.331   11.229  13.130  1.00 0.00 ? 46  ILE A HG12 1  
ATOM   710    H  HG13 . ILE A 1 46  ? 8.161   11.654  11.632  1.00 0.00 ? 46  ILE A HG13 1  
ATOM   711    H  HG21 . ILE A 1 46  ? 5.352   8.876   11.515  1.00 0.00 ? 46  ILE A HG21 1  
ATOM   712    H  HG22 . ILE A 1 46  ? 5.771   9.507   13.108  1.00 0.00 ? 46  ILE A HG22 1  
ATOM   713    H  HG23 . ILE A 1 46  ? 6.426   7.960   12.571  1.00 0.00 ? 46  ILE A HG23 1  
ATOM   714    H  HD11 . ILE A 1 46  ? 5.783   11.369  10.556  1.00 0.00 ? 46  ILE A HD11 1  
ATOM   715    H  HD12 . ILE A 1 46  ? 6.171   12.855  11.423  1.00 0.00 ? 46  ILE A HD12 1  
ATOM   716    H  HD13 . ILE A 1 46  ? 5.214   11.600  12.210  1.00 0.00 ? 46  ILE A HD13 1  
ATOM   717    N  N    . PRO A 1 47  ? 9.376   6.705   12.222  1.00 0.00 ? 47  PRO A N    1  
ATOM   718    C  CA   . PRO A 1 47  ? 9.584   5.330   11.679  1.00 0.00 ? 47  PRO A CA   1  
ATOM   719    C  C    . PRO A 1 47  ? 8.311   4.772   11.030  1.00 0.00 ? 47  PRO A C    1  
ATOM   720    O  O    . PRO A 1 47  ? 7.213   5.037   11.475  1.00 0.00 ? 47  PRO A O    1  
ATOM   721    C  CB   . PRO A 1 47  ? 9.965   4.506   12.910  1.00 0.00 ? 47  PRO A CB   1  
ATOM   722    C  CG   . PRO A 1 47  ? 10.557  5.483   13.870  1.00 0.00 ? 47  PRO A CG   1  
ATOM   723    C  CD   . PRO A 1 47  ? 9.880   6.827   13.600  1.00 0.00 ? 47  PRO A CD   1  
ATOM   724    H  HA   . PRO A 1 47  ? 10.399  5.325   10.973  1.00 0.00 ? 47  PRO A HA   1  
ATOM   725    H  HB2  . PRO A 1 47  ? 9.087   4.042   13.336  1.00 0.00 ? 47  PRO A HB2  1  
ATOM   726    H  HB3  . PRO A 1 47  ? 10.697  3.757   12.648  1.00 0.00 ? 47  PRO A HB3  1  
ATOM   727    H  HG2  . PRO A 1 47  ? 10.365  5.164   14.885  1.00 0.00 ? 47  PRO A HG2  1  
ATOM   728    H  HG3  . PRO A 1 47  ? 11.619  5.572   13.703  1.00 0.00 ? 47  PRO A HG3  1  
ATOM   729    H  HD2  . PRO A 1 47  ? 9.067   6.982   14.294  1.00 0.00 ? 47  PRO A HD2  1  
ATOM   730    H  HD3  . PRO A 1 47  ? 10.596  7.632   13.666  1.00 0.00 ? 47  PRO A HD3  1  
ATOM   731    N  N    . ALA A 1 48  ? 8.448   4.016   9.972   1.00 0.00 ? 48  ALA A N    1  
ATOM   732    C  CA   . ALA A 1 48  ? 7.243   3.461   9.290   1.00 0.00 ? 48  ALA A CA   1  
ATOM   733    C  C    . ALA A 1 48  ? 6.953   2.040   9.785   1.00 0.00 ? 48  ALA A C    1  
ATOM   734    O  O    . ALA A 1 48  ? 7.351   1.069   9.172   1.00 0.00 ? 48  ALA A O    1  
ATOM   735    C  CB   . ALA A 1 48  ? 7.494   3.426   7.781   1.00 0.00 ? 48  ALA A CB   1  
ATOM   736    H  H    . ALA A 1 48  ? 9.341   3.824   9.617   1.00 0.00 ? 48  ALA A H    1  
ATOM   737    H  HA   . ALA A 1 48  ? 6.392   4.093   9.494   1.00 0.00 ? 48  ALA A HA   1  
ATOM   738    H  HB1  . ALA A 1 48  ? 6.557   3.289   7.263   1.00 0.00 ? 48  ALA A HB1  1  
ATOM   739    H  HB2  . ALA A 1 48  ? 8.158   2.607   7.547   1.00 0.00 ? 48  ALA A HB2  1  
ATOM   740    H  HB3  . ALA A 1 48  ? 7.946   4.355   7.470   1.00 0.00 ? 48  ALA A HB3  1  
ATOM   741    N  N    . ARG A 1 49  ? 6.250   1.906   10.878  1.00 0.00 ? 49  ARG A N    1  
ATOM   742    C  CA   . ARG A 1 49  ? 5.925   0.543   11.398  1.00 0.00 ? 49  ARG A CA   1  
ATOM   743    C  C    . ARG A 1 49  ? 4.456   0.508   11.833  1.00 0.00 ? 49  ARG A C    1  
ATOM   744    O  O    . ARG A 1 49  ? 3.871   1.520   12.160  1.00 0.00 ? 49  ARG A O    1  
ATOM   745    C  CB   . ARG A 1 49  ? 6.809   0.213   12.610  1.00 0.00 ? 49  ARG A CB   1  
ATOM   746    C  CG   . ARG A 1 49  ? 8.292   0.274   12.227  1.00 0.00 ? 49  ARG A CG   1  
ATOM   747    C  CD   . ARG A 1 49  ? 8.700   -1.023  11.522  1.00 0.00 ? 49  ARG A CD   1  
ATOM   748    N  NE   . ARG A 1 49  ? 9.448   -1.897  12.473  1.00 0.00 ? 49  ARG A NE   1  
ATOM   749    C  CZ   . ARG A 1 49  ? 8.821   -2.819  13.158  1.00 0.00 ? 49  ARG A CZ   1  
ATOM   750    N  NH1  . ARG A 1 49  ? 7.530   -2.974  13.033  1.00 0.00 ? 49  ARG A NH1  1  
ATOM   751    N  NH2  . ARG A 1 49  ? 9.489   -3.586  13.976  1.00 0.00 ? 49  ARG A NH2  1  
ATOM   752    H  H    . ARG A 1 49  ? 5.929   2.701   11.354  1.00 0.00 ? 49  ARG A H    1  
ATOM   753    H  HA   . ARG A 1 49  ? 6.084   -0.188  10.616  1.00 0.00 ? 49  ARG A HA   1  
ATOM   754    H  HB2  . ARG A 1 49  ? 6.615   0.927   13.397  1.00 0.00 ? 49  ARG A HB2  1  
ATOM   755    H  HB3  . ARG A 1 49  ? 6.572   -0.779  12.964  1.00 0.00 ? 49  ARG A HB3  1  
ATOM   756    H  HG2  . ARG A 1 49  ? 8.463   1.111   11.570  1.00 0.00 ? 49  ARG A HG2  1  
ATOM   757    H  HG3  . ARG A 1 49  ? 8.886   0.393   13.121  1.00 0.00 ? 49  ARG A HG3  1  
ATOM   758    H  HD2  . ARG A 1 49  ? 7.821   -1.538  11.176  1.00 0.00 ? 49  ARG A HD2  1  
ATOM   759    H  HD3  . ARG A 1 49  ? 9.332   -0.789  10.678  1.00 0.00 ? 49  ARG A HD3  1  
ATOM   760    H  HE   . ARG A 1 49  ? 10.415  -1.783  12.581  1.00 0.00 ? 49  ARG A HE   1  
ATOM   761    H  HH11 . ARG A 1 49  ? 7.012   -2.388  12.414  1.00 0.00 ? 49  ARG A HH11 1  
ATOM   762    H  HH12 . ARG A 1 49  ? 7.060   -3.682  13.560  1.00 0.00 ? 49  ARG A HH12 1  
ATOM   763    H  HH21 . ARG A 1 49  ? 10.477  -3.469  14.080  1.00 0.00 ? 49  ARG A HH21 1  
ATOM   764    H  HH22 . ARG A 1 49  ? 9.013   -4.292  14.499  1.00 0.00 ? 49  ARG A HH22 1  
ATOM   765    N  N    . HIS A 1 50  ? 3.852   -0.648  11.836  1.00 0.00 ? 50  HIS A N    1  
ATOM   766    C  CA   . HIS A 1 50  ? 2.424   -0.742  12.245  1.00 0.00 ? 50  HIS A CA   1  
ATOM   767    C  C    . HIS A 1 50  ? 2.229   -0.031  13.583  1.00 0.00 ? 50  HIS A C    1  
ATOM   768    O  O    . HIS A 1 50  ? 1.350   0.792   13.739  1.00 0.00 ? 50  HIS A O    1  
ATOM   769    C  CB   . HIS A 1 50  ? 2.037   -2.217  12.392  1.00 0.00 ? 50  HIS A CB   1  
ATOM   770    C  CG   . HIS A 1 50  ? 2.951   -2.882  13.385  1.00 0.00 ? 50  HIS A CG   1  
ATOM   771    N  ND1  . HIS A 1 50  ? 2.478   -3.472  14.546  1.00 0.00 ? 50  HIS A ND1  1  
ATOM   772    C  CD2  . HIS A 1 50  ? 4.313   -3.064  13.399  1.00 0.00 ? 50  HIS A CD2  1  
ATOM   773    C  CE1  . HIS A 1 50  ? 3.537   -3.978  15.205  1.00 0.00 ? 50  HIS A CE1  1  
ATOM   774    N  NE2  . HIS A 1 50  ? 4.680   -3.758  14.550  1.00 0.00 ? 50  HIS A NE2  1  
ATOM   775    H  H    . HIS A 1 50  ? 4.333   -1.450  11.563  1.00 0.00 ? 50  HIS A H    1  
ATOM   776    H  HA   . HIS A 1 50  ? 1.801   -0.279  11.494  1.00 0.00 ? 50  HIS A HA   1  
ATOM   777    H  HB2  . HIS A 1 50  ? 1.019   -2.288  12.740  1.00 0.00 ? 50  HIS A HB2  1  
ATOM   778    H  HB3  . HIS A 1 50  ? 2.125   -2.710  11.437  1.00 0.00 ? 50  HIS A HB3  1  
ATOM   779    H  HD1  . HIS A 1 50  ? 1.542   -3.513  14.835  1.00 0.00 ? 50  HIS A HD1  1  
ATOM   780    H  HD2  . HIS A 1 50  ? 4.995   -2.722  12.635  1.00 0.00 ? 50  HIS A HD2  1  
ATOM   781    H  HE1  . HIS A 1 50  ? 3.471   -4.500  16.149  1.00 0.00 ? 50  HIS A HE1  1  
ATOM   782    N  N    . GLU A 1 51  ? 3.047   -0.340  14.549  1.00 0.00 ? 51  GLU A N    1  
ATOM   783    C  CA   . GLU A 1 51  ? 2.913   0.319   15.876  1.00 0.00 ? 51  GLU A CA   1  
ATOM   784    C  C    . GLU A 1 51  ? 2.685   1.819   15.680  1.00 0.00 ? 51  GLU A C    1  
ATOM   785    O  O    . GLU A 1 51  ? 2.013   2.461   16.463  1.00 0.00 ? 51  GLU A O    1  
ATOM   786    C  CB   . GLU A 1 51  ? 4.193   0.098   16.685  1.00 0.00 ? 51  GLU A CB   1  
ATOM   787    C  CG   . GLU A 1 51  ? 4.376   -1.398  16.953  1.00 0.00 ? 51  GLU A CG   1  
ATOM   788    C  CD   . GLU A 1 51  ? 4.733   -1.612  18.426  1.00 0.00 ? 51  GLU A CD   1  
ATOM   789    O  OE1  . GLU A 1 51  ? 3.842   -1.509  19.252  1.00 0.00 ? 51  GLU A OE1  1  
ATOM   790    O  OE2  . GLU A 1 51  ? 5.892   -1.876  18.701  1.00 0.00 ? 51  GLU A OE2  1  
ATOM   791    H  H    . GLU A 1 51  ? 3.751   -1.006  14.400  1.00 0.00 ? 51  GLU A H    1  
ATOM   792    H  HA   . GLU A 1 51  ? 2.074   -0.106  16.407  1.00 0.00 ? 51  GLU A HA   1  
ATOM   793    H  HB2  . GLU A 1 51  ? 5.039   0.470   16.125  1.00 0.00 ? 51  GLU A HB2  1  
ATOM   794    H  HB3  . GLU A 1 51  ? 4.121   0.624   17.624  1.00 0.00 ? 51  GLU A HB3  1  
ATOM   795    H  HG2  . GLU A 1 51  ? 3.459   -1.921  16.725  1.00 0.00 ? 51  GLU A HG2  1  
ATOM   796    H  HG3  . GLU A 1 51  ? 5.173   -1.780  16.334  1.00 0.00 ? 51  GLU A HG3  1  
ATOM   797    N  N    . PHE A 1 52  ? 3.250   2.388   14.650  1.00 0.00 ? 52  PHE A N    1  
ATOM   798    C  CA   . PHE A 1 52  ? 3.073   3.853   14.426  1.00 0.00 ? 52  PHE A CA   1  
ATOM   799    C  C    . PHE A 1 52  ? 1.712   4.132   13.784  1.00 0.00 ? 52  PHE A C    1  
ATOM   800    O  O    . PHE A 1 52  ? 1.386   5.260   13.475  1.00 0.00 ? 52  PHE A O    1  
ATOM   801    C  CB   . PHE A 1 52  ? 4.190   4.375   13.524  1.00 0.00 ? 52  PHE A CB   1  
ATOM   802    C  CG   . PHE A 1 52  ? 5.400   4.680   14.371  1.00 0.00 ? 52  PHE A CG   1  
ATOM   803    C  CD1  . PHE A 1 52  ? 6.141   3.635   14.936  1.00 0.00 ? 52  PHE A CD1  1  
ATOM   804    C  CD2  . PHE A 1 52  ? 5.776   6.008   14.600  1.00 0.00 ? 52  PHE A CD2  1  
ATOM   805    C  CE1  . PHE A 1 52  ? 7.258   3.918   15.730  1.00 0.00 ? 52  PHE A CE1  1  
ATOM   806    C  CE2  . PHE A 1 52  ? 6.894   6.291   15.393  1.00 0.00 ? 52  PHE A CE2  1  
ATOM   807    C  CZ   . PHE A 1 52  ? 7.635   5.247   15.958  1.00 0.00 ? 52  PHE A CZ   1  
ATOM   808    H  H    . PHE A 1 52  ? 3.805   1.856   14.036  1.00 0.00 ? 52  PHE A H    1  
ATOM   809    H  HA   . PHE A 1 52  ? 3.121   4.365   15.377  1.00 0.00 ? 52  PHE A HA   1  
ATOM   810    H  HB2  . PHE A 1 52  ? 4.442   3.628   12.788  1.00 0.00 ? 52  PHE A HB2  1  
ATOM   811    H  HB3  . PHE A 1 52  ? 3.863   5.275   13.027  1.00 0.00 ? 52  PHE A HB3  1  
ATOM   812    H  HD1  . PHE A 1 52  ? 5.850   2.610   14.759  1.00 0.00 ? 52  PHE A HD1  1  
ATOM   813    H  HD2  . PHE A 1 52  ? 5.204   6.813   14.164  1.00 0.00 ? 52  PHE A HD2  1  
ATOM   814    H  HE1  . PHE A 1 52  ? 7.829   3.112   16.166  1.00 0.00 ? 52  PHE A HE1  1  
ATOM   815    H  HE2  . PHE A 1 52  ? 7.187   7.316   15.569  1.00 0.00 ? 52  PHE A HE2  1  
ATOM   816    H  HZ   . PHE A 1 52  ? 8.498   5.466   16.570  1.00 0.00 ? 52  PHE A HZ   1  
ATOM   817    N  N    . VAL A 1 53  ? 0.909   3.124   13.594  1.00 0.00 ? 53  VAL A N    1  
ATOM   818    C  CA   . VAL A 1 53  ? -0.431  3.353   12.987  1.00 0.00 ? 53  VAL A CA   1  
ATOM   819    C  C    . VAL A 1 53  ? -1.249  4.247   13.921  1.00 0.00 ? 53  VAL A C    1  
ATOM   820    O  O    . VAL A 1 53  ? -1.520  3.890   15.050  1.00 0.00 ? 53  VAL A O    1  
ATOM   821    C  CB   . VAL A 1 53  ? -1.141  2.013   12.800  1.00 0.00 ? 53  VAL A CB   1  
ATOM   822    C  CG1  . VAL A 1 53  ? -2.655  2.232   12.782  1.00 0.00 ? 53  VAL A CG1  1  
ATOM   823    C  CG2  . VAL A 1 53  ? -0.703  1.384   11.475  1.00 0.00 ? 53  VAL A CG2  1  
ATOM   824    H  H    . VAL A 1 53  ? 1.181   2.220   13.858  1.00 0.00 ? 53  VAL A H    1  
ATOM   825    H  HA   . VAL A 1 53  ? -0.317  3.841   12.030  1.00 0.00 ? 53  VAL A HA   1  
ATOM   826    H  HB   . VAL A 1 53  ? -0.882  1.353   13.616  1.00 0.00 ? 53  VAL A HB   1  
ATOM   827    H  HG11 . VAL A 1 53  ? -3.015  2.349   13.794  1.00 0.00 ? 53  VAL A HG11 1  
ATOM   828    H  HG12 . VAL A 1 53  ? -3.138  1.381   12.325  1.00 0.00 ? 53  VAL A HG12 1  
ATOM   829    H  HG13 . VAL A 1 53  ? -2.883  3.122   12.215  1.00 0.00 ? 53  VAL A HG13 1  
ATOM   830    H  HG21 . VAL A 1 53  ? -0.769  0.308   11.548  1.00 0.00 ? 53  VAL A HG21 1  
ATOM   831    H  HG22 . VAL A 1 53  ? 0.317   1.669   11.263  1.00 0.00 ? 53  VAL A HG22 1  
ATOM   832    H  HG23 . VAL A 1 53  ? -1.347  1.732   10.681  1.00 0.00 ? 53  VAL A HG23 1  
ATOM   833    N  N    . VAL A 1 54  ? -1.634  5.410   13.464  1.00 0.00 ? 54  VAL A N    1  
ATOM   834    C  CA   . VAL A 1 54  ? -2.423  6.328   14.338  1.00 0.00 ? 54  VAL A CA   1  
ATOM   835    C  C    . VAL A 1 54  ? -3.866  6.406   13.846  1.00 0.00 ? 54  VAL A C    1  
ATOM   836    O  O    . VAL A 1 54  ? -4.782  6.623   14.614  1.00 0.00 ? 54  VAL A O    1  
ATOM   837    C  CB   . VAL A 1 54  ? -1.809  7.726   14.298  1.00 0.00 ? 54  VAL A CB   1  
ATOM   838    C  CG1  . VAL A 1 54  ? -0.422  7.700   14.943  1.00 0.00 ? 54  VAL A CG1  1  
ATOM   839    C  CG2  . VAL A 1 54  ? -1.688  8.184   12.843  1.00 0.00 ? 54  VAL A CG2  1  
ATOM   840    H  H    . VAL A 1 54  ? -1.397  5.683   12.551  1.00 0.00 ? 54  VAL A H    1  
ATOM   841    H  HA   . VAL A 1 54  ? -2.411  5.962   15.354  1.00 0.00 ? 54  VAL A HA   1  
ATOM   842    H  HB   . VAL A 1 54  ? -2.446  8.409   14.836  1.00 0.00 ? 54  VAL A HB   1  
ATOM   843    H  HG11 . VAL A 1 54  ? 0.318   7.445   14.199  1.00 0.00 ? 54  VAL A HG11 1  
ATOM   844    H  HG12 . VAL A 1 54  ? -0.404  6.966   15.735  1.00 0.00 ? 54  VAL A HG12 1  
ATOM   845    H  HG13 . VAL A 1 54  ? -0.197  8.674   15.353  1.00 0.00 ? 54  VAL A HG13 1  
ATOM   846    H  HG21 . VAL A 1 54  ? -1.971  7.375   12.185  1.00 0.00 ? 54  VAL A HG21 1  
ATOM   847    H  HG22 . VAL A 1 54  ? -0.668  8.473   12.642  1.00 0.00 ? 54  VAL A HG22 1  
ATOM   848    H  HG23 . VAL A 1 54  ? -2.340  9.029   12.676  1.00 0.00 ? 54  VAL A HG23 1  
ATOM   849    N  N    . HIS A 1 55  ? -4.081  6.230   12.574  1.00 0.00 ? 55  HIS A N    1  
ATOM   850    C  CA   . HIS A 1 55  ? -5.470  6.294   12.041  1.00 0.00 ? 55  HIS A CA   1  
ATOM   851    C  C    . HIS A 1 55  ? -5.592  5.388   10.818  1.00 0.00 ? 55  HIS A C    1  
ATOM   852    O  O    . HIS A 1 55  ? -4.868  5.529   9.849   1.00 0.00 ? 55  HIS A O    1  
ATOM   853    C  CB   . HIS A 1 55  ? -5.797  7.732   11.639  1.00 0.00 ? 55  HIS A CB   1  
ATOM   854    C  CG   . HIS A 1 55  ? -7.074  7.756   10.845  1.00 0.00 ? 55  HIS A CG   1  
ATOM   855    N  ND1  . HIS A 1 55  ? -7.203  8.495   9.678   1.00 0.00 ? 55  HIS A ND1  1  
ATOM   856    C  CD2  . HIS A 1 55  ? -8.286  7.140   11.035  1.00 0.00 ? 55  HIS A CD2  1  
ATOM   857    C  CE1  . HIS A 1 55  ? -8.453  8.307   9.215   1.00 0.00 ? 55  HIS A CE1  1  
ATOM   858    N  NE2  . HIS A 1 55  ? -9.156  7.490   10.005  1.00 0.00 ? 55  HIS A NE2  1  
ATOM   859    H  H    . HIS A 1 55  ? -3.336  6.051   11.965  1.00 0.00 ? 55  HIS A H    1  
ATOM   860    H  HA   . HIS A 1 55  ? -6.163  5.968   12.803  1.00 0.00 ? 55  HIS A HA   1  
ATOM   861    H  HB2  . HIS A 1 55  ? -5.911  8.337   12.525  1.00 0.00 ? 55  HIS A HB2  1  
ATOM   862    H  HB3  . HIS A 1 55  ? -4.994  8.122   11.036  1.00 0.00 ? 55  HIS A HB3  1  
ATOM   863    H  HD1  . HIS A 1 55  ? -6.511  9.052   9.266   1.00 0.00 ? 55  HIS A HD1  1  
ATOM   864    H  HD2  . HIS A 1 55  ? -8.528  6.485   11.857  1.00 0.00 ? 55  HIS A HD2  1  
ATOM   865    H  HE1  . HIS A 1 55  ? -8.840  8.762   8.316   1.00 0.00 ? 55  HIS A HE1  1  
ATOM   866    N  N    . THR A 1 56  ? -6.507  4.463   10.857  1.00 0.00 ? 56  THR A N    1  
ATOM   867    C  CA   . THR A 1 56  ? -6.699  3.539   9.703   1.00 0.00 ? 56  THR A CA   1  
ATOM   868    C  C    . THR A 1 56  ? -8.052  3.827   9.056   1.00 0.00 ? 56  THR A C    1  
ATOM   869    O  O    . THR A 1 56  ? -9.046  4.011   9.729   1.00 0.00 ? 56  THR A O    1  
ATOM   870    C  CB   . THR A 1 56  ? -6.666  2.089   10.187  1.00 0.00 ? 56  THR A CB   1  
ATOM   871    O  OG1  . THR A 1 56  ? -7.652  1.905   11.195  1.00 0.00 ? 56  THR A OG1  1  
ATOM   872    C  CG2  . THR A 1 56  ? -5.284  1.768   10.756  1.00 0.00 ? 56  THR A CG2  1  
ATOM   873    H  H    . THR A 1 56  ? -7.074  4.377   11.651  1.00 0.00 ? 56  THR A H    1  
ATOM   874    H  HA   . THR A 1 56  ? -5.913  3.696   8.979   1.00 0.00 ? 56  THR A HA   1  
ATOM   875    H  HB   . THR A 1 56  ? -6.871  1.427   9.356   1.00 0.00 ? 56  THR A HB   1  
ATOM   876    H  HG1  . THR A 1 56  ? -7.988  1.009   11.121  1.00 0.00 ? 56  THR A HG1  1  
ATOM   877    H  HG21 . THR A 1 56  ? -5.393  1.250   11.697  1.00 0.00 ? 56  THR A HG21 1  
ATOM   878    H  HG22 . THR A 1 56  ? -4.737  2.686   10.912  1.00 0.00 ? 56  THR A HG22 1  
ATOM   879    H  HG23 . THR A 1 56  ? -4.744  1.141   10.062  1.00 0.00 ? 56  THR A HG23 1  
ATOM   880    N  N    . ASN A 1 57  ? -8.101  3.862   7.757   1.00 0.00 ? 57  ASN A N    1  
ATOM   881    C  CA   . ASN A 1 57  ? -9.383  4.128   7.057   1.00 0.00 ? 57  ASN A CA   1  
ATOM   882    C  C    . ASN A 1 57  ? -9.192  3.778   5.584   1.00 0.00 ? 57  ASN A C    1  
ATOM   883    O  O    . ASN A 1 57  ? -8.342  2.982   5.238   1.00 0.00 ? 57  ASN A O    1  
ATOM   884    C  CB   . ASN A 1 57  ? -9.749  5.608   7.192   1.00 0.00 ? 57  ASN A CB   1  
ATOM   885    C  CG   . ASN A 1 57  ? -11.263 5.777   7.038   1.00 0.00 ? 57  ASN A CG   1  
ATOM   886    O  OD1  . ASN A 1 57  ? -12.023 4.898   7.393   1.00 0.00 ? 57  ASN A OD1  1  
ATOM   887    N  ND2  . ASN A 1 57  ? -11.734 6.877   6.520   1.00 0.00 ? 57  ASN A ND2  1  
ATOM   888    H  H    . ASN A 1 57  ? -7.294  3.699   7.224   1.00 0.00 ? 57  ASN A H    1  
ATOM   889    H  HA   . ASN A 1 57  ? -10.166 3.515   7.480   1.00 0.00 ? 57  ASN A HA   1  
ATOM   890    H  HB2  . ASN A 1 57  ? -9.443  5.966   8.164   1.00 0.00 ? 57  ASN A HB2  1  
ATOM   891    H  HB3  . ASN A 1 57  ? -9.245  6.175   6.424   1.00 0.00 ? 57  ASN A HB3  1  
ATOM   892    H  HD21 . ASN A 1 57  ? -11.120 7.587   6.234   1.00 0.00 ? 57  ASN A HD21 1  
ATOM   893    H  HD22 . ASN A 1 57  ? -12.702 6.996   6.417   1.00 0.00 ? 57  ASN A HD22 1  
ATOM   894    N  N    . HIS A 1 58  ? -9.946  4.374   4.707   1.00 0.00 ? 58  HIS A N    1  
ATOM   895    C  CA   . HIS A 1 58  ? -9.756  4.071   3.264   1.00 0.00 ? 58  HIS A CA   1  
ATOM   896    C  C    . HIS A 1 58  ? -8.269  4.224   2.936   1.00 0.00 ? 58  HIS A C    1  
ATOM   897    O  O    . HIS A 1 58  ? -7.811  3.864   1.869   1.00 0.00 ? 58  HIS A O    1  
ATOM   898    C  CB   . HIS A 1 58  ? -10.572 5.052   2.419   1.00 0.00 ? 58  HIS A CB   1  
ATOM   899    C  CG   . HIS A 1 58  ? -11.895 4.429   2.069   1.00 0.00 ? 58  HIS A CG   1  
ATOM   900    N  ND1  . HIS A 1 58  ? -12.522 4.657   0.854   1.00 0.00 ? 58  HIS A ND1  1  
ATOM   901    C  CD2  . HIS A 1 58  ? -12.722 3.581   2.764   1.00 0.00 ? 58  HIS A CD2  1  
ATOM   902    C  CE1  . HIS A 1 58  ? -13.672 3.960   0.855   1.00 0.00 ? 58  HIS A CE1  1  
ATOM   903    N  NE2  . HIS A 1 58  ? -13.844 3.287   1.995   1.00 0.00 ? 58  HIS A NE2  1  
ATOM   904    H  H    . HIS A 1 58  ? -10.616 5.030   4.993   1.00 0.00 ? 58  HIS A H    1  
ATOM   905    H  HA   . HIS A 1 58  ? -10.073 3.060   3.059   1.00 0.00 ? 58  HIS A HA   1  
ATOM   906    H  HB2  . HIS A 1 58  ? -10.739 5.960   2.979   1.00 0.00 ? 58  HIS A HB2  1  
ATOM   907    H  HB3  . HIS A 1 58  ? -10.033 5.283   1.512   1.00 0.00 ? 58  HIS A HB3  1  
ATOM   908    H  HD1  . HIS A 1 58  ? -12.187 5.223   0.127   1.00 0.00 ? 58  HIS A HD1  1  
ATOM   909    H  HD2  . HIS A 1 58  ? -12.530 3.201   3.756   1.00 0.00 ? 58  HIS A HD2  1  
ATOM   910    H  HE1  . HIS A 1 58  ? -14.372 3.948   0.032   1.00 0.00 ? 58  HIS A HE1  1  
ATOM   911    N  N    . SER A 1 59  ? -7.515  4.763   3.858   1.00 0.00 ? 59  SER A N    1  
ATOM   912    C  CA   . SER A 1 59  ? -6.055  4.958   3.632   1.00 0.00 ? 59  SER A CA   1  
ATOM   913    C  C    . SER A 1 59  ? -5.285  4.574   4.903   1.00 0.00 ? 59  SER A C    1  
ATOM   914    O  O    . SER A 1 59  ? -5.854  4.420   5.966   1.00 0.00 ? 59  SER A O    1  
ATOM   915    C  CB   . SER A 1 59  ? -5.783  6.423   3.294   1.00 0.00 ? 59  SER A CB   1  
ATOM   916    O  OG   . SER A 1 59  ? -5.095  6.498   2.052   1.00 0.00 ? 59  SER A OG   1  
ATOM   917    H  H    . SER A 1 59  ? -7.914  5.046   4.707   1.00 0.00 ? 59  SER A H    1  
ATOM   918    H  HA   . SER A 1 59  ? -5.732  4.332   2.814   1.00 0.00 ? 59  SER A HA   1  
ATOM   919    H  HB2  . SER A 1 59  ? -6.717  6.956   3.213   1.00 0.00 ? 59  SER A HB2  1  
ATOM   920    H  HB3  . SER A 1 59  ? -5.184  6.868   4.078   1.00 0.00 ? 59  SER A HB3  1  
ATOM   921    H  HG   . SER A 1 59  ? -4.171  6.682   2.237   1.00 0.00 ? 59  SER A HG   1  
ATOM   922    N  N    . THR A 1 60  ? -3.992  4.433   4.797   1.00 0.00 ? 60  THR A N    1  
ATOM   923    C  CA   . THR A 1 60  ? -3.172  4.073   5.994   1.00 0.00 ? 60  THR A CA   1  
ATOM   924    C  C    . THR A 1 60  ? -2.410  5.317   6.463   1.00 0.00 ? 60  THR A C    1  
ATOM   925    O  O    . THR A 1 60  ? -1.668  5.910   5.705   1.00 0.00 ? 60  THR A O    1  
ATOM   926    C  CB   . THR A 1 60  ? -2.178  2.971   5.618   1.00 0.00 ? 60  THR A CB   1  
ATOM   927    O  OG1  . THR A 1 60  ? -2.794  2.070   4.708   1.00 0.00 ? 60  THR A OG1  1  
ATOM   928    C  CG2  . THR A 1 60  ? -1.751  2.215   6.877   1.00 0.00 ? 60  THR A CG2  1  
ATOM   929    H  H    . THR A 1 60  ? -3.564  4.583   3.928   1.00 0.00 ? 60  THR A H    1  
ATOM   930    H  HA   . THR A 1 60  ? -3.819  3.725   6.785   1.00 0.00 ? 60  THR A HA   1  
ATOM   931    H  HB   . THR A 1 60  ? -1.308  3.411   5.156   1.00 0.00 ? 60  THR A HB   1  
ATOM   932    H  HG1  . THR A 1 60  ? -3.583  2.493   4.362   1.00 0.00 ? 60  THR A HG1  1  
ATOM   933    H  HG21 . THR A 1 60  ? -1.723  2.896   7.714   1.00 0.00 ? 60  THR A HG21 1  
ATOM   934    H  HG22 . THR A 1 60  ? -0.769  1.789   6.727   1.00 0.00 ? 60  THR A HG22 1  
ATOM   935    H  HG23 . THR A 1 60  ? -2.459  1.425   7.080   1.00 0.00 ? 60  THR A HG23 1  
ATOM   936    N  N    . ASP A 1 61  ? -2.601  5.732   7.694   1.00 0.00 ? 61  ASP A N    1  
ATOM   937    C  CA   . ASP A 1 61  ? -1.896  6.958   8.180   1.00 0.00 ? 61  ASP A CA   1  
ATOM   938    C  C    . ASP A 1 61  ? -1.000  6.651   9.388   1.00 0.00 ? 61  ASP A C    1  
ATOM   939    O  O    . ASP A 1 61  ? -1.356  5.903   10.281  1.00 0.00 ? 61  ASP A O    1  
ATOM   940    C  CB   . ASP A 1 61  ? -2.933  8.008   8.583   1.00 0.00 ? 61  ASP A CB   1  
ATOM   941    C  CG   . ASP A 1 61  ? -4.167  7.879   7.689   1.00 0.00 ? 61  ASP A CG   1  
ATOM   942    O  OD1  . ASP A 1 61  ? -4.015  7.430   6.564   1.00 0.00 ? 61  ASP A OD1  1  
ATOM   943    O  OD2  . ASP A 1 61  ? -5.243  8.231   8.143   1.00 0.00 ? 61  ASP A OD2  1  
ATOM   944    H  H    . ASP A 1 61  ? -3.220  5.252   8.287   1.00 0.00 ? 61  ASP A H    1  
ATOM   945    H  HA   . ASP A 1 61  ? -1.287  7.358   7.386   1.00 0.00 ? 61  ASP A HA   1  
ATOM   946    H  HB2  . ASP A 1 61  ? -3.217  7.854   9.615   1.00 0.00 ? 61  ASP A HB2  1  
ATOM   947    H  HB3  . ASP A 1 61  ? -2.510  8.994   8.469   1.00 0.00 ? 61  ASP A HB3  1  
ATOM   948    N  N    . LEU A 1 62  ? 0.153   7.265   9.421   1.00 0.00 ? 62  LEU A N    1  
ATOM   949    C  CA   . LEU A 1 62  ? 1.096   7.071   10.562  1.00 0.00 ? 62  LEU A CA   1  
ATOM   950    C  C    . LEU A 1 62  ? 1.392   8.446   11.166  1.00 0.00 ? 62  LEU A C    1  
ATOM   951    O  O    . LEU A 1 62  ? 1.281   9.452   10.497  1.00 0.00 ? 62  LEU A O    1  
ATOM   952    C  CB   . LEU A 1 62  ? 2.400   6.446   10.056  1.00 0.00 ? 62  LEU A CB   1  
ATOM   953    C  CG   . LEU A 1 62  ? 2.085   5.258   9.148   1.00 0.00 ? 62  LEU A CG   1  
ATOM   954    C  CD1  . LEU A 1 62  ? 3.386   4.682   8.586   1.00 0.00 ? 62  LEU A CD1  1  
ATOM   955    C  CD2  . LEU A 1 62  ? 1.362   4.179   9.954   1.00 0.00 ? 62  LEU A CD2  1  
ATOM   956    H  H    . LEU A 1 62  ? 0.390   7.880   8.695   1.00 0.00 ? 62  LEU A H    1  
ATOM   957    H  HA   . LEU A 1 62  ? 0.643   6.432   11.306  1.00 0.00 ? 62  LEU A HA   1  
ATOM   958    H  HB2  . LEU A 1 62  ? 2.961   7.185   9.501   1.00 0.00 ? 62  LEU A HB2  1  
ATOM   959    H  HB3  . LEU A 1 62  ? 2.986   6.107   10.898  1.00 0.00 ? 62  LEU A HB3  1  
ATOM   960    H  HG   . LEU A 1 62  ? 1.454   5.584   8.333   1.00 0.00 ? 62  LEU A HG   1  
ATOM   961    H  HD11 . LEU A 1 62  ? 3.735   5.304   7.775   1.00 0.00 ? 62  LEU A HD11 1  
ATOM   962    H  HD12 . LEU A 1 62  ? 3.208   3.681   8.220   1.00 0.00 ? 62  LEU A HD12 1  
ATOM   963    H  HD13 . LEU A 1 62  ? 4.133   4.653   9.365   1.00 0.00 ? 62  LEU A HD13 1  
ATOM   964    H  HD21 . LEU A 1 62  ? 1.667   4.238   10.989  1.00 0.00 ? 62  LEU A HD21 1  
ATOM   965    H  HD22 . LEU A 1 62  ? 1.614   3.205   9.560   1.00 0.00 ? 62  LEU A HD22 1  
ATOM   966    H  HD23 . LEU A 1 62  ? 0.295   4.330   9.883   1.00 0.00 ? 62  LEU A HD23 1  
ATOM   967    N  N    . GLY A 1 63  ? 1.761   8.517   12.417  1.00 0.00 ? 63  GLY A N    1  
ATOM   968    C  CA   . GLY A 1 63  ? 2.042   9.856   13.010  1.00 0.00 ? 63  GLY A CA   1  
ATOM   969    C  C    . GLY A 1 63  ? 2.705   9.712   14.374  1.00 0.00 ? 63  GLY A C    1  
ATOM   970    O  O    . GLY A 1 63  ? 2.374   8.838   15.151  1.00 0.00 ? 63  GLY A O    1  
ATOM   971    H  H    . GLY A 1 63  ? 1.851   7.703   12.961  1.00 0.00 ? 63  GLY A H    1  
ATOM   972    H  HA2  . GLY A 1 63  ? 2.698   10.408  12.351  1.00 0.00 ? 63  GLY A HA2  1  
ATOM   973    H  HA3  . GLY A 1 63  ? 1.118   10.394  13.128  1.00 0.00 ? 63  GLY A HA3  1  
ATOM   974    N  N    . PHE A 1 64  ? 3.645   10.565  14.669  1.00 0.00 ? 64  PHE A N    1  
ATOM   975    C  CA   . PHE A 1 64  ? 4.344   10.486  15.982  1.00 0.00 ? 64  PHE A CA   1  
ATOM   976    C  C    . PHE A 1 64  ? 4.676   11.896  16.486  1.00 0.00 ? 64  PHE A C    1  
ATOM   977    O  O    . PHE A 1 64  ? 4.893   12.808  15.713  1.00 0.00 ? 64  PHE A O    1  
ATOM   978    C  CB   . PHE A 1 64  ? 5.644   9.699   15.812  1.00 0.00 ? 64  PHE A CB   1  
ATOM   979    C  CG   . PHE A 1 64  ? 6.258   9.446   17.166  1.00 0.00 ? 64  PHE A CG   1  
ATOM   980    C  CD1  . PHE A 1 64  ? 5.599   8.628   18.091  1.00 0.00 ? 64  PHE A CD1  1  
ATOM   981    C  CD2  . PHE A 1 64  ? 7.487   10.030  17.497  1.00 0.00 ? 64  PHE A CD2  1  
ATOM   982    C  CE1  . PHE A 1 64  ? 6.168   8.394   19.349  1.00 0.00 ? 64  PHE A CE1  1  
ATOM   983    C  CE2  . PHE A 1 64  ? 8.056   9.794   18.755  1.00 0.00 ? 64  PHE A CE2  1  
ATOM   984    C  CZ   . PHE A 1 64  ? 7.397   8.977   19.681  1.00 0.00 ? 64  PHE A CZ   1  
ATOM   985    H  H    . PHE A 1 64  ? 3.906   11.255  14.027  1.00 0.00 ? 64  PHE A H    1  
ATOM   986    H  HA   . PHE A 1 64  ? 3.710   9.984   16.699  1.00 0.00 ? 64  PHE A HA   1  
ATOM   987    H  HB2  . PHE A 1 64  ? 5.436   8.759   15.326  1.00 0.00 ? 64  PHE A HB2  1  
ATOM   988    H  HB3  . PHE A 1 64  ? 6.332   10.272  15.208  1.00 0.00 ? 64  PHE A HB3  1  
ATOM   989    H  HD1  . PHE A 1 64  ? 4.651   8.179   17.835  1.00 0.00 ? 64  PHE A HD1  1  
ATOM   990    H  HD2  . PHE A 1 64  ? 7.996   10.662  16.782  1.00 0.00 ? 64  PHE A HD2  1  
ATOM   991    H  HE1  . PHE A 1 64  ? 5.658   7.764   20.063  1.00 0.00 ? 64  PHE A HE1  1  
ATOM   992    H  HE2  . PHE A 1 64  ? 9.004   10.245  19.011  1.00 0.00 ? 64  PHE A HE2  1  
ATOM   993    H  HZ   . PHE A 1 64  ? 7.835   8.797   20.650  1.00 0.00 ? 64  PHE A HZ   1  
ATOM   994    N  N    . LYS A 1 65  ? 4.730   12.069  17.780  1.00 0.00 ? 65  LYS A N    1  
ATOM   995    C  CA   . LYS A 1 65  ? 5.066   13.405  18.360  1.00 0.00 ? 65  LYS A CA   1  
ATOM   996    C  C    . LYS A 1 65  ? 4.089   14.475  17.861  1.00 0.00 ? 65  LYS A C    1  
ATOM   997    O  O    . LYS A 1 65  ? 4.423   15.641  17.791  1.00 0.00 ? 65  LYS A O    1  
ATOM   998    C  CB   . LYS A 1 65  ? 6.493   13.791  17.963  1.00 0.00 ? 65  LYS A CB   1  
ATOM   999    C  CG   . LYS A 1 65  ? 7.485   13.143  18.932  1.00 0.00 ? 65  LYS A CG   1  
ATOM   1000   C  CD   . LYS A 1 65  ? 7.873   14.149  20.017  1.00 0.00 ? 65  LYS A CD   1  
ATOM   1001   C  CE   . LYS A 1 65  ? 8.691   15.283  19.395  1.00 0.00 ? 65  LYS A CE   1  
ATOM   1002   N  NZ   . LYS A 1 65  ? 10.002  15.391  20.095  1.00 0.00 ? 65  LYS A NZ   1  
ATOM   1003   H  H    . LYS A 1 65  ? 4.556   11.311  18.376  1.00 0.00 ? 65  LYS A H    1  
ATOM   1004   H  HA   . LYS A 1 65  ? 5.003   13.347  19.436  1.00 0.00 ? 65  LYS A HA   1  
ATOM   1005   H  HB2  . LYS A 1 65  ? 6.694   13.449  16.959  1.00 0.00 ? 65  LYS A HB2  1  
ATOM   1006   H  HB3  . LYS A 1 65  ? 6.599   14.864  18.006  1.00 0.00 ? 65  LYS A HB3  1  
ATOM   1007   H  HG2  . LYS A 1 65  ? 7.027   12.278  19.390  1.00 0.00 ? 65  LYS A HG2  1  
ATOM   1008   H  HG3  . LYS A 1 65  ? 8.369   12.839  18.393  1.00 0.00 ? 65  LYS A HG3  1  
ATOM   1009   H  HD2  . LYS A 1 65  ? 6.979   14.555  20.468  1.00 0.00 ? 65  LYS A HD2  1  
ATOM   1010   H  HD3  . LYS A 1 65  ? 8.465   13.655  20.773  1.00 0.00 ? 65  LYS A HD3  1  
ATOM   1011   H  HE2  . LYS A 1 65  ? 8.859   15.076  18.349  1.00 0.00 ? 65  LYS A HE2  1  
ATOM   1012   H  HE3  . LYS A 1 65  ? 8.152   16.214  19.497  1.00 0.00 ? 65  LYS A HE3  1  
ATOM   1013   H  HZ1  . LYS A 1 65  ? 9.920   16.064  20.885  1.00 0.00 ? 65  LYS A HZ1  1  
ATOM   1014   H  HZ2  . LYS A 1 65  ? 10.725  15.727  19.426  1.00 0.00 ? 65  LYS A HZ2  1  
ATOM   1015   H  HZ3  . LYS A 1 65  ? 10.277  14.459  20.465  1.00 0.00 ? 65  LYS A HZ3  1  
ATOM   1016   N  N    . GLY A 1 66  ? 2.886   14.099  17.530  1.00 0.00 ? 66  GLY A N    1  
ATOM   1017   C  CA   . GLY A 1 66  ? 1.897   15.112  17.059  1.00 0.00 ? 66  GLY A CA   1  
ATOM   1018   C  C    . GLY A 1 66  ? 1.987   15.285  15.541  1.00 0.00 ? 66  GLY A C    1  
ATOM   1019   O  O    . GLY A 1 66  ? 1.271   16.075  14.958  1.00 0.00 ? 66  GLY A O    1  
ATOM   1020   H  H    . GLY A 1 66  ? 2.627   13.156  17.603  1.00 0.00 ? 66  GLY A H    1  
ATOM   1021   H  HA2  . GLY A 1 66  ? 0.900   14.787  17.322  1.00 0.00 ? 66  GLY A HA2  1  
ATOM   1022   H  HA3  . GLY A 1 66  ? 2.101   16.059  17.536  1.00 0.00 ? 66  GLY A HA3  1  
ATOM   1023   N  N    . GLN A 1 67  ? 2.849   14.554  14.890  1.00 0.00 ? 67  GLN A N    1  
ATOM   1024   C  CA   . GLN A 1 67  ? 2.959   14.683  13.409  1.00 0.00 ? 67  GLN A CA   1  
ATOM   1025   C  C    . GLN A 1 67  ? 2.187   13.537  12.760  1.00 0.00 ? 67  GLN A C    1  
ATOM   1026   O  O    . GLN A 1 67  ? 2.157   12.437  13.278  1.00 0.00 ? 67  GLN A O    1  
ATOM   1027   C  CB   . GLN A 1 67  ? 4.430   14.617  12.995  1.00 0.00 ? 67  GLN A CB   1  
ATOM   1028   C  CG   . GLN A 1 67  ? 5.072   15.994  13.180  1.00 0.00 ? 67  GLN A CG   1  
ATOM   1029   C  CD   . GLN A 1 67  ? 4.631   16.922  12.046  1.00 0.00 ? 67  GLN A CD   1  
ATOM   1030   O  OE1  . GLN A 1 67  ? 3.894   16.519  11.167  1.00 0.00 ? 67  GLN A OE1  1  
ATOM   1031   N  NE2  . GLN A 1 67  ? 5.053   18.156  12.029  1.00 0.00 ? 67  GLN A NE2  1  
ATOM   1032   H  H    . GLN A 1 67  ? 3.414   13.911  15.368  1.00 0.00 ? 67  GLN A H    1  
ATOM   1033   H  HA   . GLN A 1 67  ? 2.536   15.627  13.095  1.00 0.00 ? 67  GLN A HA   1  
ATOM   1034   H  HB2  . GLN A 1 67  ? 4.945   13.893  13.611  1.00 0.00 ? 67  GLN A HB2  1  
ATOM   1035   H  HB3  . GLN A 1 67  ? 4.501   14.326  11.958  1.00 0.00 ? 67  GLN A HB3  1  
ATOM   1036   H  HG2  . GLN A 1 67  ? 4.762   16.411  14.128  1.00 0.00 ? 67  GLN A HG2  1  
ATOM   1037   H  HG3  . GLN A 1 67  ? 6.146   15.896  13.165  1.00 0.00 ? 67  GLN A HG3  1  
ATOM   1038   H  HE21 . GLN A 1 67  ? 5.646   18.482  12.737  1.00 0.00 ? 67  GLN A HE21 1  
ATOM   1039   H  HE22 . GLN A 1 67  ? 4.776   18.759  11.307  1.00 0.00 ? 67  GLN A HE22 1  
ATOM   1040   N  N    . ARG A 1 68  ? 1.546   13.777  11.645  1.00 0.00 ? 68  ARG A N    1  
ATOM   1041   C  CA   . ARG A 1 68  ? 0.766   12.684  11.000  1.00 0.00 ? 68  ARG A CA   1  
ATOM   1042   C  C    . ARG A 1 68  ? 0.953   12.690  9.484   1.00 0.00 ? 68  ARG A C    1  
ATOM   1043   O  O    . ARG A 1 68  ? 1.157   13.716  8.865   1.00 0.00 ? 68  ARG A O    1  
ATOM   1044   C  CB   . ARG A 1 68  ? -0.718  12.858  11.328  1.00 0.00 ? 68  ARG A CB   1  
ATOM   1045   C  CG   . ARG A 1 68  ? -1.160  14.278  10.970  1.00 0.00 ? 68  ARG A CG   1  
ATOM   1046   C  CD   . ARG A 1 68  ? -2.688  14.348  10.953  1.00 0.00 ? 68  ARG A CD   1  
ATOM   1047   N  NE   . ARG A 1 68  ? -3.237  13.459  12.017  1.00 0.00 ? 68  ARG A NE   1  
ATOM   1048   C  CZ   . ARG A 1 68  ? -4.428  12.942  11.891  1.00 0.00 ? 68  ARG A CZ   1  
ATOM   1049   N  NH1  . ARG A 1 68  ? -5.150  13.206  10.835  1.00 0.00 ? 68  ARG A NH1  1  
ATOM   1050   N  NH2  . ARG A 1 68  ? -4.901  12.161  12.824  1.00 0.00 ? 68  ARG A NH2  1  
ATOM   1051   H  H    . ARG A 1 68  ? 1.567   14.672  11.245  1.00 0.00 ? 68  ARG A H    1  
ATOM   1052   H  HA   . ARG A 1 68  ? 1.100   11.738  11.382  1.00 0.00 ? 68  ARG A HA   1  
ATOM   1053   H  HB2  . ARG A 1 68  ? -1.298  12.145  10.760  1.00 0.00 ? 68  ARG A HB2  1  
ATOM   1054   H  HB3  . ARG A 1 68  ? -0.876  12.690  12.383  1.00 0.00 ? 68  ARG A HB3  1  
ATOM   1055   H  HG2  . ARG A 1 68  ? -0.776  14.971  11.705  1.00 0.00 ? 68  ARG A HG2  1  
ATOM   1056   H  HG3  . ARG A 1 68  ? -0.779  14.539  9.994   1.00 0.00 ? 68  ARG A HG3  1  
ATOM   1057   H  HD2  . ARG A 1 68  ? -3.005  15.364  11.133  1.00 0.00 ? 68  ARG A HD2  1  
ATOM   1058   H  HD3  . ARG A 1 68  ? -3.053  14.022  9.989   1.00 0.00 ? 68  ARG A HD3  1  
ATOM   1059   H  HE   . ARG A 1 68  ? -2.700  13.262  12.813  1.00 0.00 ? 68  ARG A HE   1  
ATOM   1060   H  HH11 . ARG A 1 68  ? -4.790  13.807  10.121  1.00 0.00 ? 68  ARG A HH11 1  
ATOM   1061   H  HH12 . ARG A 1 68  ? -6.061  12.807  10.740  1.00 0.00 ? 68  ARG A HH12 1  
ATOM   1062   H  HH21 . ARG A 1 68  ? -4.351  11.960  13.635  1.00 0.00 ? 68  ARG A HH21 1  
ATOM   1063   H  HH22 . ARG A 1 68  ? -5.815  11.763  12.729  1.00 0.00 ? 68  ARG A HH22 1  
ATOM   1064   N  N    . ILE A 1 69  ? 0.865   11.531  8.891   1.00 0.00 ? 69  ILE A N    1  
ATOM   1065   C  CA   . ILE A 1 69  ? 1.013   11.410  7.414   1.00 0.00 ? 69  ILE A CA   1  
ATOM   1066   C  C    . ILE A 1 69  ? -0.091  10.483  6.900   1.00 0.00 ? 69  ILE A C    1  
ATOM   1067   O  O    . ILE A 1 69  ? -0.358  9.449   7.477   1.00 0.00 ? 69  ILE A O    1  
ATOM   1068   C  CB   . ILE A 1 69  ? 2.385   10.820  7.083   1.00 0.00 ? 69  ILE A CB   1  
ATOM   1069   C  CG1  . ILE A 1 69  ? 3.476   11.704  7.695   1.00 0.00 ? 69  ILE A CG1  1  
ATOM   1070   C  CG2  . ILE A 1 69  ? 2.565   10.764  5.565   1.00 0.00 ? 69  ILE A CG2  1  
ATOM   1071   C  CD1  . ILE A 1 69  ? 4.842   11.044  7.496   1.00 0.00 ? 69  ILE A CD1  1  
ATOM   1072   H  H    . ILE A 1 69  ? 0.687   10.729  9.427   1.00 0.00 ? 69  ILE A H    1  
ATOM   1073   H  HA   . ILE A 1 69  ? 0.913   12.385  6.958   1.00 0.00 ? 69  ILE A HA   1  
ATOM   1074   H  HB   . ILE A 1 69  ? 2.456   9.823   7.491   1.00 0.00 ? 69  ILE A HB   1  
ATOM   1075   H  HG12 . ILE A 1 69  ? 3.468   12.671  7.212   1.00 0.00 ? 69  ILE A HG12 1  
ATOM   1076   H  HG13 . ILE A 1 69  ? 3.289   11.828  8.750   1.00 0.00 ? 69  ILE A HG13 1  
ATOM   1077   H  HG21 . ILE A 1 69  ? 3.496   10.269  5.331   1.00 0.00 ? 69  ILE A HG21 1  
ATOM   1078   H  HG22 . ILE A 1 69  ? 2.580   11.768  5.166   1.00 0.00 ? 69  ILE A HG22 1  
ATOM   1079   H  HG23 . ILE A 1 69  ? 1.745   10.214  5.126   1.00 0.00 ? 69  ILE A HG23 1  
ATOM   1080   H  HD11 . ILE A 1 69  ? 4.762   9.985   7.686   1.00 0.00 ? 69  ILE A HD11 1  
ATOM   1081   H  HD12 . ILE A 1 69  ? 5.555   11.480  8.180   1.00 0.00 ? 69  ILE A HD12 1  
ATOM   1082   H  HD13 . ILE A 1 69  ? 5.174   11.204  6.482   1.00 0.00 ? 69  ILE A HD13 1  
ATOM   1083   N  N    . LYS A 1 70  ? -0.750  10.856  5.837   1.00 0.00 ? 70  LYS A N    1  
ATOM   1084   C  CA   . LYS A 1 70  ? -1.858  10.001  5.310   1.00 0.00 ? 70  LYS A CA   1  
ATOM   1085   C  C    . LYS A 1 70  ? -1.446  9.307   4.008   1.00 0.00 ? 70  LYS A C    1  
ATOM   1086   O  O    . LYS A 1 70  ? -0.581  9.762   3.286   1.00 0.00 ? 70  LYS A O    1  
ATOM   1087   C  CB   . LYS A 1 70  ? -3.088  10.872  5.047   1.00 0.00 ? 70  LYS A CB   1  
ATOM   1088   C  CG   . LYS A 1 70  ? -3.574  11.482  6.365   1.00 0.00 ? 70  LYS A CG   1  
ATOM   1089   C  CD   . LYS A 1 70  ? -4.518  12.649  6.070   1.00 0.00 ? 70  LYS A CD   1  
ATOM   1090   C  CE   . LYS A 1 70  ? -5.183  13.109  7.369   1.00 0.00 ? 70  LYS A CE   1  
ATOM   1091   N  NZ   . LYS A 1 70  ? -6.374  13.944  7.049   1.00 0.00 ? 70  LYS A NZ   1  
ATOM   1092   H  H    . LYS A 1 70  ? -0.522  11.706  5.405   1.00 0.00 ? 70  LYS A H    1  
ATOM   1093   H  HA   . LYS A 1 70  ? -2.110  9.253   6.045   1.00 0.00 ? 70  LYS A HA   1  
ATOM   1094   H  HB2  . LYS A 1 70  ? -2.830  11.661  4.357   1.00 0.00 ? 70  LYS A HB2  1  
ATOM   1095   H  HB3  . LYS A 1 70  ? -3.874  10.265  4.624   1.00 0.00 ? 70  LYS A HB3  1  
ATOM   1096   H  HG2  . LYS A 1 70  ? -4.097  10.730  6.938   1.00 0.00 ? 70  LYS A HG2  1  
ATOM   1097   H  HG3  . LYS A 1 70  ? -2.727  11.841  6.931   1.00 0.00 ? 70  LYS A HG3  1  
ATOM   1098   H  HD2  . LYS A 1 70  ? -3.958  13.467  5.643   1.00 0.00 ? 70  LYS A HD2  1  
ATOM   1099   H  HD3  . LYS A 1 70  ? -5.279  12.330  5.374   1.00 0.00 ? 70  LYS A HD3  1  
ATOM   1100   H  HE2  . LYS A 1 70  ? -5.491  12.246  7.941   1.00 0.00 ? 70  LYS A HE2  1  
ATOM   1101   H  HE3  . LYS A 1 70  ? -4.479  13.690  7.947   1.00 0.00 ? 70  LYS A HE3  1  
ATOM   1102   H  HZ1  . LYS A 1 70  ? -6.064  14.890  6.750   1.00 0.00 ? 70  LYS A HZ1  1  
ATOM   1103   H  HZ2  . LYS A 1 70  ? -6.976  14.025  7.894   1.00 0.00 ? 70  LYS A HZ2  1  
ATOM   1104   H  HZ3  . LYS A 1 70  ? -6.913  13.500  6.280   1.00 0.00 ? 70  LYS A HZ3  1  
ATOM   1105   N  N    . THR A 1 71  ? -2.089  8.207   3.703   1.00 0.00 ? 71  THR A N    1  
ATOM   1106   C  CA   . THR A 1 71  ? -1.782  7.461   2.448   1.00 0.00 ? 71  THR A CA   1  
ATOM   1107   C  C    . THR A 1 71  ? -0.286  7.159   2.347   1.00 0.00 ? 71  THR A C    1  
ATOM   1108   O  O    . THR A 1 71  ? 0.400   7.690   1.499   1.00 0.00 ? 71  THR A O    1  
ATOM   1109   C  CB   . THR A 1 71  ? -2.205  8.306   1.244   1.00 0.00 ? 71  THR A CB   1  
ATOM   1110   O  OG1  . THR A 1 71  ? -3.535  8.767   1.435   1.00 0.00 ? 71  THR A OG1  1  
ATOM   1111   C  CG2  . THR A 1 71  ? -2.132  7.459   -0.026  1.00 0.00 ? 71  THR A CG2  1  
ATOM   1112   H  H    . THR A 1 71  ? -2.792  7.879   4.303   1.00 0.00 ? 71  THR A H    1  
ATOM   1113   H  HA   . THR A 1 71  ? -2.335  6.534   2.441   1.00 0.00 ? 71  THR A HA   1  
ATOM   1114   H  HB   . THR A 1 71  ? -1.541  9.151   1.148   1.00 0.00 ? 71  THR A HB   1  
ATOM   1115   H  HG1  . THR A 1 71  ? -3.515  9.727   1.458   1.00 0.00 ? 71  THR A HG1  1  
ATOM   1116   H  HG21 . THR A 1 71  ? -1.130  7.072   -0.144  1.00 0.00 ? 71  THR A HG21 1  
ATOM   1117   H  HG22 . THR A 1 71  ? -2.385  8.070   -0.881  1.00 0.00 ? 71  THR A HG22 1  
ATOM   1118   H  HG23 . THR A 1 71  ? -2.830  6.638   0.048   1.00 0.00 ? 71  THR A HG23 1  
ATOM   1119   N  N    . VAL A 1 72  ? 0.226   6.298   3.188   1.00 0.00 ? 72  VAL A N    1  
ATOM   1120   C  CA   . VAL A 1 72  ? 1.676   5.952   3.120   1.00 0.00 ? 72  VAL A CA   1  
ATOM   1121   C  C    . VAL A 1 72  ? 1.821   4.490   2.688   1.00 0.00 ? 72  VAL A C    1  
ATOM   1122   O  O    . VAL A 1 72  ? 2.910   3.995   2.480   1.00 0.00 ? 72  VAL A O    1  
ATOM   1123   C  CB   . VAL A 1 72  ? 2.307   6.142   4.500   1.00 0.00 ? 72  VAL A CB   1  
ATOM   1124   C  CG1  . VAL A 1 72  ? 2.296   7.625   4.869   1.00 0.00 ? 72  VAL A CG1  1  
ATOM   1125   C  CG2  . VAL A 1 72  ? 1.504   5.357   5.538   1.00 0.00 ? 72  VAL A CG2  1  
ATOM   1126   H  H    . VAL A 1 72  ? -0.337  5.860   3.860   1.00 0.00 ? 72  VAL A H    1  
ATOM   1127   H  HA   . VAL A 1 72  ? 2.170   6.589   2.404   1.00 0.00 ? 72  VAL A HA   1  
ATOM   1128   H  HB   . VAL A 1 72  ? 3.326   5.783   4.482   1.00 0.00 ? 72  VAL A HB   1  
ATOM   1129   H  HG11 . VAL A 1 72  ? 1.280   7.942   5.054   1.00 0.00 ? 72  VAL A HG11 1  
ATOM   1130   H  HG12 . VAL A 1 72  ? 2.711   8.202   4.057   1.00 0.00 ? 72  VAL A HG12 1  
ATOM   1131   H  HG13 . VAL A 1 72  ? 2.888   7.779   5.760   1.00 0.00 ? 72  VAL A HG13 1  
ATOM   1132   H  HG21 . VAL A 1 72  ? 0.819   4.690   5.036   1.00 0.00 ? 72  VAL A HG21 1  
ATOM   1133   H  HG22 . VAL A 1 72  ? 0.947   6.045   6.156   1.00 0.00 ? 72  VAL A HG22 1  
ATOM   1134   H  HG23 . VAL A 1 72  ? 2.177   4.782   6.157   1.00 0.00 ? 72  VAL A HG23 1  
ATOM   1135   N  N    . GLU A 1 73  ? 0.726   3.794   2.564   1.00 0.00 ? 73  GLU A N    1  
ATOM   1136   C  CA   . GLU A 1 73  ? 0.784   2.360   2.161   1.00 0.00 ? 73  GLU A CA   1  
ATOM   1137   C  C    . GLU A 1 73  ? 1.247   2.232   0.705   1.00 0.00 ? 73  GLU A C    1  
ATOM   1138   O  O    . GLU A 1 73  ? 1.992   1.335   0.359   1.00 0.00 ? 73  GLU A O    1  
ATOM   1139   C  CB   . GLU A 1 73  ? -0.610  1.749   2.303   1.00 0.00 ? 73  GLU A CB   1  
ATOM   1140   C  CG   . GLU A 1 73  ? -1.659  2.785   1.894   1.00 0.00 ? 73  GLU A CG   1  
ATOM   1141   C  CD   . GLU A 1 73  ? -2.866  2.076   1.277   1.00 0.00 ? 73  GLU A CD   1  
ATOM   1142   O  OE1  . GLU A 1 73  ? -2.657  1.169   0.487   1.00 0.00 ? 73  GLU A OE1  1  
ATOM   1143   O  OE2  . GLU A 1 73  ? -3.979  2.453   1.604   1.00 0.00 ? 73  GLU A OE2  1  
ATOM   1144   H  H    . GLU A 1 73  ? -0.141  4.214   2.745   1.00 0.00 ? 73  GLU A H    1  
ATOM   1145   H  HA   . GLU A 1 73  ? 1.470   1.833   2.806   1.00 0.00 ? 73  GLU A HA   1  
ATOM   1146   H  HB2  . GLU A 1 73  ? -0.690  0.880   1.665   1.00 0.00 ? 73  GLU A HB2  1  
ATOM   1147   H  HB3  . GLU A 1 73  ? -0.774  1.460   3.330   1.00 0.00 ? 73  GLU A HB3  1  
ATOM   1148   H  HG2  . GLU A 1 73  ? -1.973  3.341   2.764   1.00 0.00 ? 73  GLU A HG2  1  
ATOM   1149   H  HG3  . GLU A 1 73  ? -1.232  3.461   1.168   1.00 0.00 ? 73  GLU A HG3  1  
ATOM   1150   N  N    . HIS A 1 74  ? 0.801   3.106   -0.154  1.00 0.00 ? 74  HIS A N    1  
ATOM   1151   C  CA   . HIS A 1 74  ? 1.203   3.020   -1.588  1.00 0.00 ? 74  HIS A CA   1  
ATOM   1152   C  C    . HIS A 1 74  ? 2.732   3.003   -1.712  1.00 0.00 ? 74  HIS A C    1  
ATOM   1153   O  O    . HIS A 1 74  ? 3.311   2.060   -2.220  1.00 0.00 ? 74  HIS A O    1  
ATOM   1154   C  CB   . HIS A 1 74  ? 0.637   4.224   -2.342  1.00 0.00 ? 74  HIS A CB   1  
ATOM   1155   C  CG   . HIS A 1 74  ? -0.823  3.991   -2.634  1.00 0.00 ? 74  HIS A CG   1  
ATOM   1156   N  ND1  . HIS A 1 74  ? -1.497  4.667   -3.641  1.00 0.00 ? 74  HIS A ND1  1  
ATOM   1157   C  CD2  . HIS A 1 74  ? -1.751  3.159   -2.057  1.00 0.00 ? 74  HIS A CD2  1  
ATOM   1158   C  CE1  . HIS A 1 74  ? -2.773  4.234   -3.638  1.00 0.00 ? 74  HIS A CE1  1  
ATOM   1159   N  NE2  . HIS A 1 74  ? -2.981  3.314   -2.691  1.00 0.00 ? 74  HIS A NE2  1  
ATOM   1160   H  H    . HIS A 1 74  ? 0.192   3.816   0.139   1.00 0.00 ? 74  HIS A H    1  
ATOM   1161   H  HA   . HIS A 1 74  ? 0.803   2.113   -2.015  1.00 0.00 ? 74  HIS A HA   1  
ATOM   1162   H  HB2  . HIS A 1 74  ? 0.744   5.111   -1.737  1.00 0.00 ? 74  HIS A HB2  1  
ATOM   1163   H  HB3  . HIS A 1 74  ? 1.172   4.354   -3.269  1.00 0.00 ? 74  HIS A HB3  1  
ATOM   1164   H  HD1  . HIS A 1 74  ? -1.116  5.339   -4.244  1.00 0.00 ? 74  HIS A HD1  1  
ATOM   1165   H  HD2  . HIS A 1 74  ? -1.557  2.487   -1.235  1.00 0.00 ? 74  HIS A HD2  1  
ATOM   1166   H  HE1  . HIS A 1 74  ? -3.536  4.583   -4.320  1.00 0.00 ? 74  HIS A HE1  1  
ATOM   1167   N  N    . ILE A 1 75  ? 3.398   4.033   -1.259  1.00 0.00 ? 75  ILE A N    1  
ATOM   1168   C  CA   . ILE A 1 75  ? 4.885   4.044   -1.369  1.00 0.00 ? 75  ILE A CA   1  
ATOM   1169   C  C    . ILE A 1 75  ? 5.450   2.825   -0.643  1.00 0.00 ? 75  ILE A C    1  
ATOM   1170   O  O    . ILE A 1 75  ? 6.333   2.152   -1.134  1.00 0.00 ? 75  ILE A O    1  
ATOM   1171   C  CB   . ILE A 1 75  ? 5.455   5.330   -0.758  1.00 0.00 ? 75  ILE A CB   1  
ATOM   1172   C  CG1  . ILE A 1 75  ? 6.889   5.531   -1.256  1.00 0.00 ? 75  ILE A CG1  1  
ATOM   1173   C  CG2  . ILE A 1 75  ? 5.465   5.232   0.769   1.00 0.00 ? 75  ILE A CG2  1  
ATOM   1174   C  CD1  . ILE A 1 75  ? 6.875   6.351   -2.547  1.00 0.00 ? 75  ILE A CD1  1  
ATOM   1175   H  H    . ILE A 1 75  ? 2.926   4.789   -0.854  1.00 0.00 ? 75  ILE A H    1  
ATOM   1176   H  HA   . ILE A 1 75  ? 5.163   3.993   -2.413  1.00 0.00 ? 75  ILE A HA   1  
ATOM   1177   H  HB   . ILE A 1 75  ? 4.848   6.172   -1.061  1.00 0.00 ? 75  ILE A HB   1  
ATOM   1178   H  HG12 . ILE A 1 75  ? 7.462   6.053   -0.502  1.00 0.00 ? 75  ILE A HG12 1  
ATOM   1179   H  HG13 . ILE A 1 75  ? 7.340   4.569   -1.448  1.00 0.00 ? 75  ILE A HG13 1  
ATOM   1180   H  HG21 . ILE A 1 75  ? 4.497   4.902   1.115   1.00 0.00 ? 75  ILE A HG21 1  
ATOM   1181   H  HG22 . ILE A 1 75  ? 5.688   6.202   1.190   1.00 0.00 ? 75  ILE A HG22 1  
ATOM   1182   H  HG23 . ILE A 1 75  ? 6.220   4.525   1.080   1.00 0.00 ? 75  ILE A HG23 1  
ATOM   1183   H  HD11 . ILE A 1 75  ? 6.133   5.949   -3.220  1.00 0.00 ? 75  ILE A HD11 1  
ATOM   1184   H  HD12 . ILE A 1 75  ? 7.849   6.302   -3.014  1.00 0.00 ? 75  ILE A HD12 1  
ATOM   1185   H  HD13 . ILE A 1 75  ? 6.637   7.378   -2.318  1.00 0.00 ? 75  ILE A HD13 1  
ATOM   1186   N  N    . LEU A 1 76  ? 4.943   2.528   0.522   1.00 0.00 ? 76  LEU A N    1  
ATOM   1187   C  CA   . LEU A 1 76  ? 5.451   1.345   1.271   1.00 0.00 ? 76  LEU A CA   1  
ATOM   1188   C  C    . LEU A 1 76  ? 5.295   0.090   0.410   1.00 0.00 ? 76  LEU A C    1  
ATOM   1189   O  O    . LEU A 1 76  ? 6.124   -0.798  0.438   1.00 0.00 ? 76  LEU A O    1  
ATOM   1190   C  CB   . LEU A 1 76  ? 4.649   1.184   2.562   1.00 0.00 ? 76  LEU A CB   1  
ATOM   1191   C  CG   . LEU A 1 76  ? 5.036   2.292   3.548   1.00 0.00 ? 76  LEU A CG   1  
ATOM   1192   C  CD1  . LEU A 1 76  ? 4.049   2.306   4.716   1.00 0.00 ? 76  LEU A CD1  1  
ATOM   1193   C  CD2  . LEU A 1 76  ? 6.452   2.047   4.083   1.00 0.00 ? 76  LEU A CD2  1  
ATOM   1194   H  H    . LEU A 1 76  ? 4.229   3.080   0.905   1.00 0.00 ? 76  LEU A H    1  
ATOM   1195   H  HA   . LEU A 1 76  ? 6.494   1.491   1.509   1.00 0.00 ? 76  LEU A HA   1  
ATOM   1196   H  HB2  . LEU A 1 76  ? 3.597   1.256   2.336   1.00 0.00 ? 76  LEU A HB2  1  
ATOM   1197   H  HB3  . LEU A 1 76  ? 4.854   0.221   3.001   1.00 0.00 ? 76  LEU A HB3  1  
ATOM   1198   H  HG   . LEU A 1 76  ? 5.003   3.246   3.042   1.00 0.00 ? 76  LEU A HG   1  
ATOM   1199   H  HD11 . LEU A 1 76  ? 4.581   2.520   5.631   1.00 0.00 ? 76  LEU A HD11 1  
ATOM   1200   H  HD12 . LEU A 1 76  ? 3.572   1.341   4.795   1.00 0.00 ? 76  LEU A HD12 1  
ATOM   1201   H  HD13 . LEU A 1 76  ? 3.301   3.066   4.547   1.00 0.00 ? 76  LEU A HD13 1  
ATOM   1202   H  HD21 . LEU A 1 76  ? 7.171   2.517   3.429   1.00 0.00 ? 76  LEU A HD21 1  
ATOM   1203   H  HD22 . LEU A 1 76  ? 6.647   0.986   4.129   1.00 0.00 ? 76  LEU A HD22 1  
ATOM   1204   H  HD23 . LEU A 1 76  ? 6.539   2.470   5.073   1.00 0.00 ? 76  LEU A HD23 1  
ATOM   1205   N  N    . SER A 1 77  ? 4.243   0.008   -0.361  1.00 0.00 ? 77  SER A N    1  
ATOM   1206   C  CA   . SER A 1 77  ? 4.046   -1.192  -1.224  1.00 0.00 ? 77  SER A CA   1  
ATOM   1207   C  C    . SER A 1 77  ? 5.194   -1.295  -2.227  1.00 0.00 ? 77  SER A C    1  
ATOM   1208   O  O    . SER A 1 77  ? 5.818   -2.328  -2.361  1.00 0.00 ? 77  SER A O    1  
ATOM   1209   C  CB   . SER A 1 77  ? 2.718   -1.073  -1.972  1.00 0.00 ? 77  SER A CB   1  
ATOM   1210   O  OG   . SER A 1 77  ? 2.600   -2.147  -2.895  1.00 0.00 ? 77  SER A OG   1  
ATOM   1211   H  H    . SER A 1 77  ? 3.585   0.733   -0.378  1.00 0.00 ? 77  SER A H    1  
ATOM   1212   H  HA   . SER A 1 77  ? 4.034   -2.079  -0.610  1.00 0.00 ? 77  SER A HA   1  
ATOM   1213   H  HB2  . SER A 1 77  ? 1.901   -1.117  -1.272  1.00 0.00 ? 77  SER A HB2  1  
ATOM   1214   H  HB3  . SER A 1 77  ? 2.686   -0.128  -2.498  1.00 0.00 ? 77  SER A HB3  1  
ATOM   1215   H  HG   . SER A 1 77  ? 1.705   -2.142  -3.243  1.00 0.00 ? 77  SER A HG   1  
ATOM   1216   N  N    . VAL A 1 78  ? 5.493   -0.233  -2.925  1.00 0.00 ? 78  VAL A N    1  
ATOM   1217   C  CA   . VAL A 1 78  ? 6.617   -0.295  -3.902  1.00 0.00 ? 78  VAL A CA   1  
ATOM   1218   C  C    . VAL A 1 78  ? 7.889   -0.696  -3.152  1.00 0.00 ? 78  VAL A C    1  
ATOM   1219   O  O    . VAL A 1 78  ? 8.590   -1.612  -3.534  1.00 0.00 ? 78  VAL A O    1  
ATOM   1220   C  CB   . VAL A 1 78  ? 6.826   1.079   -4.554  1.00 0.00 ? 78  VAL A CB   1  
ATOM   1221   C  CG1  . VAL A 1 78  ? 8.190   1.110   -5.245  1.00 0.00 ? 78  VAL A CG1  1  
ATOM   1222   C  CG2  . VAL A 1 78  ? 5.729   1.351   -5.593  1.00 0.00 ? 78  VAL A CG2  1  
ATOM   1223   H  H    . VAL A 1 78  ? 4.989   0.602   -2.797  1.00 0.00 ? 78  VAL A H    1  
ATOM   1224   H  HA   . VAL A 1 78  ? 6.401   -1.034  -4.659  1.00 0.00 ? 78  VAL A HA   1  
ATOM   1225   H  HB   . VAL A 1 78  ? 6.796   1.844   -3.790  1.00 0.00 ? 78  VAL A HB   1  
ATOM   1226   H  HG11 . VAL A 1 78  ? 8.965   1.232   -4.503  1.00 0.00 ? 78  VAL A HG11 1  
ATOM   1227   H  HG12 . VAL A 1 78  ? 8.222   1.938   -5.938  1.00 0.00 ? 78  VAL A HG12 1  
ATOM   1228   H  HG13 . VAL A 1 78  ? 8.344   0.185   -5.780  1.00 0.00 ? 78  VAL A HG13 1  
ATOM   1229   H  HG21 . VAL A 1 78  ? 6.152   1.896   -6.425  1.00 0.00 ? 78  VAL A HG21 1  
ATOM   1230   H  HG22 . VAL A 1 78  ? 4.945   1.941   -5.142  1.00 0.00 ? 78  VAL A HG22 1  
ATOM   1231   H  HG23 . VAL A 1 78  ? 5.317   0.418   -5.950  1.00 0.00 ? 78  VAL A HG23 1  
ATOM   1232   N  N    . LEU A 1 79  ? 8.188   -0.010  -2.084  1.00 0.00 ? 79  LEU A N    1  
ATOM   1233   C  CA   . LEU A 1 79  ? 9.410   -0.343  -1.300  1.00 0.00 ? 79  LEU A CA   1  
ATOM   1234   C  C    . LEU A 1 79  ? 9.412   -1.839  -0.972  1.00 0.00 ? 79  LEU A C    1  
ATOM   1235   O  O    . LEU A 1 79  ? 10.413  -2.514  -1.103  1.00 0.00 ? 79  LEU A O    1  
ATOM   1236   C  CB   . LEU A 1 79  ? 9.417   0.455   0.005   1.00 0.00 ? 79  LEU A CB   1  
ATOM   1237   C  CG   . LEU A 1 79  ? 9.386   1.955   -0.301  1.00 0.00 ? 79  LEU A CG   1  
ATOM   1238   C  CD1  . LEU A 1 79  ? 9.065   2.728   0.980   1.00 0.00 ? 79  LEU A CD1  1  
ATOM   1239   C  CD2  . LEU A 1 79  ? 10.751  2.407   -0.831  1.00 0.00 ? 79  LEU A CD2  1  
ATOM   1240   H  H    . LEU A 1 79  ? 7.603   0.726   -1.807  1.00 0.00 ? 79  LEU A H    1  
ATOM   1241   H  HA   . LEU A 1 79  ? 10.285  -0.097  -1.877  1.00 0.00 ? 79  LEU A HA   1  
ATOM   1242   H  HB2  . LEU A 1 79  ? 8.548   0.189   0.585   1.00 0.00 ? 79  LEU A HB2  1  
ATOM   1243   H  HB3  . LEU A 1 79  ? 10.309  0.221   0.566   1.00 0.00 ? 79  LEU A HB3  1  
ATOM   1244   H  HG   . LEU A 1 79  ? 8.625   2.155   -1.041  1.00 0.00 ? 79  LEU A HG   1  
ATOM   1245   H  HD11 . LEU A 1 79  ? 9.022   2.044   1.814   1.00 0.00 ? 79  LEU A HD11 1  
ATOM   1246   H  HD12 . LEU A 1 79  ? 8.113   3.225   0.872   1.00 0.00 ? 79  LEU A HD12 1  
ATOM   1247   H  HD13 . LEU A 1 79  ? 9.837   3.461   1.157   1.00 0.00 ? 79  LEU A HD13 1  
ATOM   1248   H  HD21 . LEU A 1 79  ? 10.823  3.483   -0.764  1.00 0.00 ? 79  LEU A HD21 1  
ATOM   1249   H  HD22 . LEU A 1 79  ? 10.854  2.106   -1.863  1.00 0.00 ? 79  LEU A HD22 1  
ATOM   1250   H  HD23 . LEU A 1 79  ? 11.536  1.956   -0.243  1.00 0.00 ? 79  LEU A HD23 1  
ATOM   1251   N  N    . HIS A 1 80  ? 8.295   -2.353  -0.536  1.00 0.00 ? 80  HIS A N    1  
ATOM   1252   C  CA   . HIS A 1 80  ? 8.214   -3.801  -0.184  1.00 0.00 ? 80  HIS A CA   1  
ATOM   1253   C  C    . HIS A 1 80  ? 8.663   -4.662  -1.367  1.00 0.00 ? 80  HIS A C    1  
ATOM   1254   O  O    . HIS A 1 80  ? 9.495   -5.537  -1.230  1.00 0.00 ? 80  HIS A O    1  
ATOM   1255   C  CB   . HIS A 1 80  ? 6.764   -4.143  0.161   1.00 0.00 ? 80  HIS A CB   1  
ATOM   1256   C  CG   . HIS A 1 80  ? 6.700   -5.476  0.860   1.00 0.00 ? 80  HIS A CG   1  
ATOM   1257   N  ND1  . HIS A 1 80  ? 5.537   -5.938  1.454   1.00 0.00 ? 80  HIS A ND1  1  
ATOM   1258   C  CD2  . HIS A 1 80  ? 7.638   -6.460  1.059   1.00 0.00 ? 80  HIS A CD2  1  
ATOM   1259   C  CE1  . HIS A 1 80  ? 5.800   -7.149  1.975   1.00 0.00 ? 80  HIS A CE1  1  
ATOM   1260   N  NE2  . HIS A 1 80  ? 7.065   -7.516  1.763   1.00 0.00 ? 80  HIS A NE2  1  
ATOM   1261   H  H    . HIS A 1 80  ? 7.504   -1.783  -0.431  1.00 0.00 ? 80  HIS A H    1  
ATOM   1262   H  HA   . HIS A 1 80  ? 8.843   -4.002  0.670   1.00 0.00 ? 80  HIS A HA   1  
ATOM   1263   H  HB2  . HIS A 1 80  ? 6.361   -3.379  0.807   1.00 0.00 ? 80  HIS A HB2  1  
ATOM   1264   H  HB3  . HIS A 1 80  ? 6.181   -4.188  -0.746  1.00 0.00 ? 80  HIS A HB3  1  
ATOM   1265   H  HD1  . HIS A 1 80  ? 4.678   -5.467  1.487   1.00 0.00 ? 80  HIS A HD1  1  
ATOM   1266   H  HD2  . HIS A 1 80  ? 8.663   -6.422  0.725   1.00 0.00 ? 80  HIS A HD2  1  
ATOM   1267   H  HE1  . HIS A 1 80  ? 5.073   -7.752  2.497   1.00 0.00 ? 80  HIS A HE1  1  
ATOM   1268   N  N    . LEU A 1 81  ? 8.105   -4.435  -2.524  1.00 0.00 ? 81  LEU A N    1  
ATOM   1269   C  CA   . LEU A 1 81  ? 8.481   -5.253  -3.714  1.00 0.00 ? 81  LEU A CA   1  
ATOM   1270   C  C    . LEU A 1 81  ? 9.959   -5.048  -4.065  1.00 0.00 ? 81  LEU A C    1  
ATOM   1271   O  O    . LEU A 1 81  ? 10.636  -5.965  -4.487  1.00 0.00 ? 81  LEU A O    1  
ATOM   1272   C  CB   . LEU A 1 81  ? 7.618   -4.833  -4.908  1.00 0.00 ? 81  LEU A CB   1  
ATOM   1273   C  CG   . LEU A 1 81  ? 6.143   -4.841  -4.502  1.00 0.00 ? 81  LEU A CG   1  
ATOM   1274   C  CD1  . LEU A 1 81  ? 5.294   -4.273  -5.643  1.00 0.00 ? 81  LEU A CD1  1  
ATOM   1275   C  CD2  . LEU A 1 81  ? 5.696   -6.275  -4.203  1.00 0.00 ? 81  LEU A CD2  1  
ATOM   1276   H  H    . LEU A 1 81  ? 7.425   -3.734  -2.609  1.00 0.00 ? 81  LEU A H    1  
ATOM   1277   H  HA   . LEU A 1 81  ? 8.306   -6.296  -3.500  1.00 0.00 ? 81  LEU A HA   1  
ATOM   1278   H  HB2  . LEU A 1 81  ? 7.900   -3.837  -5.220  1.00 0.00 ? 81  LEU A HB2  1  
ATOM   1279   H  HB3  . LEU A 1 81  ? 7.772   -5.522  -5.724  1.00 0.00 ? 81  LEU A HB3  1  
ATOM   1280   H  HG   . LEU A 1 81  ? 6.010   -4.231  -3.621  1.00 0.00 ? 81  LEU A HG   1  
ATOM   1281   H  HD11 . LEU A 1 81  ? 4.249   -4.335  -5.380  1.00 0.00 ? 81  LEU A HD11 1  
ATOM   1282   H  HD12 . LEU A 1 81  ? 5.473   -4.841  -6.544  1.00 0.00 ? 81  LEU A HD12 1  
ATOM   1283   H  HD13 . LEU A 1 81  ? 5.561   -3.240  -5.810  1.00 0.00 ? 81  LEU A HD13 1  
ATOM   1284   H  HD21 . LEU A 1 81  ? 6.307   -6.969  -4.763  1.00 0.00 ? 81  LEU A HD21 1  
ATOM   1285   H  HD22 . LEU A 1 81  ? 4.661   -6.398  -4.487  1.00 0.00 ? 81  LEU A HD22 1  
ATOM   1286   H  HD23 . LEU A 1 81  ? 5.805   -6.473  -3.147  1.00 0.00 ? 81  LEU A HD23 1  
ATOM   1287   N  N    . LEU A 1 82  ? 10.461  -3.852  -3.920  1.00 0.00 ? 82  LEU A N    1  
ATOM   1288   C  CA   . LEU A 1 82  ? 11.888  -3.596  -4.276  1.00 0.00 ? 82  LEU A CA   1  
ATOM   1289   C  C    . LEU A 1 82  ? 12.824  -4.014  -3.137  1.00 0.00 ? 82  LEU A C    1  
ATOM   1290   O  O    . LEU A 1 82  ? 14.030  -3.998  -3.289  1.00 0.00 ? 82  LEU A O    1  
ATOM   1291   C  CB   . LEU A 1 82  ? 12.081  -2.107  -4.566  1.00 0.00 ? 82  LEU A CB   1  
ATOM   1292   C  CG   . LEU A 1 82  ? 11.672  -1.807  -6.012  1.00 0.00 ? 82  LEU A CG   1  
ATOM   1293   C  CD1  . LEU A 1 82  ? 11.685  -0.295  -6.239  1.00 0.00 ? 82  LEU A CD1  1  
ATOM   1294   C  CD2  . LEU A 1 82  ? 12.654  -2.476  -6.981  1.00 0.00 ? 82  LEU A CD2  1  
ATOM   1295   H  H    . LEU A 1 82  ? 9.896   -3.118  -3.599  1.00 0.00 ? 82  LEU A H    1  
ATOM   1296   H  HA   . LEU A 1 82  ? 12.136  -4.163  -5.161  1.00 0.00 ? 82  LEU A HA   1  
ATOM   1297   H  HB2  . LEU A 1 82  ? 11.468  -1.529  -3.891  1.00 0.00 ? 82  LEU A HB2  1  
ATOM   1298   H  HB3  . LEU A 1 82  ? 13.118  -1.843  -4.425  1.00 0.00 ? 82  LEU A HB3  1  
ATOM   1299   H  HG   . LEU A 1 82  ? 10.675  -2.187  -6.188  1.00 0.00 ? 82  LEU A HG   1  
ATOM   1300   H  HD11 . LEU A 1 82  ? 12.274  -0.067  -7.116  1.00 0.00 ? 82  LEU A HD11 1  
ATOM   1301   H  HD12 . LEU A 1 82  ? 12.117  0.193   -5.379  1.00 0.00 ? 82  LEU A HD12 1  
ATOM   1302   H  HD13 . LEU A 1 82  ? 10.675  0.056   -6.383  1.00 0.00 ? 82  LEU A HD13 1  
ATOM   1303   H  HD21 . LEU A 1 82  ? 12.920  -1.779  -7.761  1.00 0.00 ? 82  LEU A HD21 1  
ATOM   1304   H  HD22 . LEU A 1 82  ? 12.188  -3.347  -7.420  1.00 0.00 ? 82  LEU A HD22 1  
ATOM   1305   H  HD23 . LEU A 1 82  ? 13.543  -2.777  -6.447  1.00 0.00 ? 82  LEU A HD23 1  
ATOM   1306   N  N    . GLU A 1 83  ? 12.302  -4.389  -2.001  1.00 0.00 ? 83  GLU A N    1  
ATOM   1307   C  CA   . GLU A 1 83  ? 13.191  -4.804  -0.877  1.00 0.00 ? 83  GLU A CA   1  
ATOM   1308   C  C    . GLU A 1 83  ? 14.075  -3.635  -0.431  1.00 0.00 ? 83  GLU A C    1  
ATOM   1309   O  O    . GLU A 1 83  ? 15.282  -3.755  -0.354  1.00 0.00 ? 83  GLU A O    1  
ATOM   1310   C  CB   . GLU A 1 83  ? 14.081  -5.965  -1.322  1.00 0.00 ? 83  GLU A CB   1  
ATOM   1311   C  CG   . GLU A 1 83  ? 13.336  -6.819  -2.348  1.00 0.00 ? 83  GLU A CG   1  
ATOM   1312   C  CD   . GLU A 1 83  ? 13.823  -8.266  -2.255  1.00 0.00 ? 83  GLU A CD   1  
ATOM   1313   O  OE1  . GLU A 1 83  ? 13.563  -8.894  -1.242  1.00 0.00 ? 83  GLU A OE1  1  
ATOM   1314   O  OE2  . GLU A 1 83  ? 14.450  -8.720  -3.199  1.00 0.00 ? 83  GLU A OE2  1  
ATOM   1315   H  H    . GLU A 1 83  ? 11.331  -4.405  -1.867  1.00 0.00 ? 83  GLU A H    1  
ATOM   1316   H  HA   . GLU A 1 83  ? 12.582  -5.125  -0.044  1.00 0.00 ? 83  GLU A HA   1  
ATOM   1317   H  HB2  . GLU A 1 83  ? 14.987  -5.577  -1.763  1.00 0.00 ? 83  GLU A HB2  1  
ATOM   1318   H  HB3  . GLU A 1 83  ? 14.331  -6.573  -0.466  1.00 0.00 ? 83  GLU A HB3  1  
ATOM   1319   H  HG2  . GLU A 1 83  ? 12.275  -6.782  -2.145  1.00 0.00 ? 83  GLU A HG2  1  
ATOM   1320   H  HG3  . GLU A 1 83  ? 13.527  -6.442  -3.341  1.00 0.00 ? 83  GLU A HG3  1  
ATOM   1321   N  N    . ILE A 1 84  ? 13.486  -2.516  -0.113  1.00 0.00 ? 84  ILE A N    1  
ATOM   1322   C  CA   . ILE A 1 84  ? 14.296  -1.353  0.356   1.00 0.00 ? 84  ILE A CA   1  
ATOM   1323   C  C    . ILE A 1 84  ? 14.419  -1.445  1.879   1.00 0.00 ? 84  ILE A C    1  
ATOM   1324   O  O    . ILE A 1 84  ? 13.434  -1.592  2.574   1.00 0.00 ? 84  ILE A O    1  
ATOM   1325   C  CB   . ILE A 1 84  ? 13.594  -0.053  -0.037  1.00 0.00 ? 84  ILE A CB   1  
ATOM   1326   C  CG1  . ILE A 1 84  ? 13.134  -0.151  -1.496  1.00 0.00 ? 84  ILE A CG1  1  
ATOM   1327   C  CG2  . ILE A 1 84  ? 14.555  1.128   0.123   1.00 0.00 ? 84  ILE A CG2  1  
ATOM   1328   C  CD1  . ILE A 1 84  ? 14.316  -0.515  -2.398  1.00 0.00 ? 84  ILE A CD1  1  
ATOM   1329   H  H    . ILE A 1 84  ? 12.510  -2.443  -0.164  1.00 0.00 ? 84  ILE A H    1  
ATOM   1330   H  HA   . ILE A 1 84  ? 15.278  -1.391  -0.091  1.00 0.00 ? 84  ILE A HA   1  
ATOM   1331   H  HB   . ILE A 1 84  ? 12.736  0.097   0.601   1.00 0.00 ? 84  ILE A HB   1  
ATOM   1332   H  HG12 . ILE A 1 84  ? 12.376  -0.915  -1.578  1.00 0.00 ? 84  ILE A HG12 1  
ATOM   1333   H  HG13 . ILE A 1 84  ? 12.725  0.797   -1.809  1.00 0.00 ? 84  ILE A HG13 1  
ATOM   1334   H  HG21 . ILE A 1 84  ? 13.991  2.017   0.360   1.00 0.00 ? 84  ILE A HG21 1  
ATOM   1335   H  HG22 . ILE A 1 84  ? 15.099  1.281   -0.797  1.00 0.00 ? 84  ILE A HG22 1  
ATOM   1336   H  HG23 . ILE A 1 84  ? 15.251  0.920   0.922   1.00 0.00 ? 84  ILE A HG23 1  
ATOM   1337   H  HD11 . ILE A 1 84  ? 15.227  -0.112  -1.984  1.00 0.00 ? 84  ILE A HD11 1  
ATOM   1338   H  HD12 . ILE A 1 84  ? 14.156  -0.100  -3.383  1.00 0.00 ? 84  ILE A HD12 1  
ATOM   1339   H  HD13 . ILE A 1 84  ? 14.397  -1.590  -2.470  1.00 0.00 ? 84  ILE A HD13 1  
ATOM   1340   N  N    . THR A 1 85  ? 15.618  -1.408  2.401   1.00 0.00 ? 85  THR A N    1  
ATOM   1341   C  CA   . THR A 1 85  ? 15.788  -1.546  3.882   1.00 0.00 ? 85  THR A CA   1  
ATOM   1342   C  C    . THR A 1 85  ? 16.229  -0.228  4.527   1.00 0.00 ? 85  THR A C    1  
ATOM   1343   O  O    . THR A 1 85  ? 15.981  -0.001  5.695   1.00 0.00 ? 85  THR A O    1  
ATOM   1344   C  CB   . THR A 1 85  ? 16.847  -2.613  4.158   1.00 0.00 ? 85  THR A CB   1  
ATOM   1345   O  OG1  . THR A 1 85  ? 18.063  -2.236  3.529   1.00 0.00 ? 85  THR A OG1  1  
ATOM   1346   C  CG2  . THR A 1 85  ? 16.377  -3.956  3.602   1.00 0.00 ? 85  THR A CG2  1  
ATOM   1347   H  H    . THR A 1 85  ? 16.404  -1.331  1.817   1.00 0.00 ? 85  THR A H    1  
ATOM   1348   H  HA   . THR A 1 85  ? 14.854  -1.861  4.322   1.00 0.00 ? 85  THR A HA   1  
ATOM   1349   H  HB   . THR A 1 85  ? 17.002  -2.702  5.221   1.00 0.00 ? 85  THR A HB   1  
ATOM   1350   H  HG1  . THR A 1 85  ? 18.025  -1.293  3.352   1.00 0.00 ? 85  THR A HG1  1  
ATOM   1351   H  HG21 . THR A 1 85  ? 15.346  -3.876  3.289   1.00 0.00 ? 85  THR A HG21 1  
ATOM   1352   H  HG22 . THR A 1 85  ? 16.463  -4.713  4.367   1.00 0.00 ? 85  THR A HG22 1  
ATOM   1353   H  HG23 . THR A 1 85  ? 16.989  -4.228  2.756   1.00 0.00 ? 85  THR A HG23 1  
ATOM   1354   N  N    . ASN A 1 86  ? 16.897  0.631   3.806   1.00 0.00 ? 86  ASN A N    1  
ATOM   1355   C  CA   . ASN A 1 86  ? 17.361  1.911   4.425   1.00 0.00 ? 86  ASN A CA   1  
ATOM   1356   C  C    . ASN A 1 86  ? 16.998  3.104   3.538   1.00 0.00 ? 86  ASN A C    1  
ATOM   1357   O  O    . ASN A 1 86  ? 17.539  3.270   2.463   1.00 0.00 ? 86  ASN A O    1  
ATOM   1358   C  CB   . ASN A 1 86  ? 18.881  1.851   4.580   1.00 0.00 ? 86  ASN A CB   1  
ATOM   1359   C  CG   . ASN A 1 86  ? 19.293  0.443   5.009   1.00 0.00 ? 86  ASN A CG   1  
ATOM   1360   O  OD1  . ASN A 1 86  ? 19.039  0.036   6.125   1.00 0.00 ? 86  ASN A OD1  1  
ATOM   1361   N  ND2  . ASN A 1 86  ? 19.924  -0.325  4.164   1.00 0.00 ? 86  ASN A ND2  1  
ATOM   1362   H  H    . ASN A 1 86  ? 17.109  0.431   2.873   1.00 0.00 ? 86  ASN A H    1  
ATOM   1363   H  HA   . ASN A 1 86  ? 16.908  2.036   5.396   1.00 0.00 ? 86  ASN A HA   1  
ATOM   1364   H  HB2  . ASN A 1 86  ? 19.348  2.090   3.634   1.00 0.00 ? 86  ASN A HB2  1  
ATOM   1365   H  HB3  . ASN A 1 86  ? 19.199  2.560   5.325   1.00 0.00 ? 86  ASN A HB3  1  
ATOM   1366   H  HD21 . ASN A 1 86  ? 20.128  0.003   3.263   1.00 0.00 ? 86  ASN A HD21 1  
ATOM   1367   H  HD22 . ASN A 1 86  ? 20.192  -1.229  4.429   1.00 0.00 ? 86  ASN A HD22 1  
ATOM   1368   N  N    . VAL A 1 87  ? 16.105  3.953   3.987   1.00 0.00 ? 87  VAL A N    1  
ATOM   1369   C  CA   . VAL A 1 87  ? 15.739  5.140   3.163   1.00 0.00 ? 87  VAL A CA   1  
ATOM   1370   C  C    . VAL A 1 87  ? 15.007  6.168   4.032   1.00 0.00 ? 87  VAL A C    1  
ATOM   1371   O  O    . VAL A 1 87  ? 14.114  5.840   4.795   1.00 0.00 ? 87  VAL A O    1  
ATOM   1372   C  CB   . VAL A 1 87  ? 14.815  4.716   2.011   1.00 0.00 ? 87  VAL A CB   1  
ATOM   1373   C  CG1  . VAL A 1 87  ? 15.629  4.203   0.814   1.00 0.00 ? 87  VAL A CG1  1  
ATOM   1374   C  CG2  . VAL A 1 87  ? 13.882  3.607   2.495   1.00 0.00 ? 87  VAL A CG2  1  
ATOM   1375   H  H    . VAL A 1 87  ? 15.686  3.817   4.867   1.00 0.00 ? 87  VAL A H    1  
ATOM   1376   H  HA   . VAL A 1 87  ? 16.636  5.589   2.766   1.00 0.00 ? 87  VAL A HA   1  
ATOM   1377   H  HB   . VAL A 1 87  ? 14.225  5.566   1.698   1.00 0.00 ? 87  VAL A HB   1  
ATOM   1378   H  HG11 . VAL A 1 87  ? 16.544  4.767   0.719   1.00 0.00 ? 87  VAL A HG11 1  
ATOM   1379   H  HG12 . VAL A 1 87  ? 15.047  4.316   -0.087  1.00 0.00 ? 87  VAL A HG12 1  
ATOM   1380   H  HG13 . VAL A 1 87  ? 15.862  3.159   0.959   1.00 0.00 ? 87  VAL A HG13 1  
ATOM   1381   H  HG21 . VAL A 1 87  ? 14.423  2.672   2.528   1.00 0.00 ? 87  VAL A HG21 1  
ATOM   1382   H  HG22 . VAL A 1 87  ? 13.048  3.515   1.816   1.00 0.00 ? 87  VAL A HG22 1  
ATOM   1383   H  HG23 . VAL A 1 87  ? 13.518  3.847   3.483   1.00 0.00 ? 87  VAL A HG23 1  
ATOM   1384   N  N    . THR A 1 88  ? 15.374  7.416   3.905   1.00 0.00 ? 88  THR A N    1  
ATOM   1385   C  CA   . THR A 1 88  ? 14.700  8.482   4.698   1.00 0.00 ? 88  THR A CA   1  
ATOM   1386   C  C    . THR A 1 88  ? 13.785  9.275   3.769   1.00 0.00 ? 88  THR A C    1  
ATOM   1387   O  O    . THR A 1 88  ? 14.234  10.082  2.978   1.00 0.00 ? 88  THR A O    1  
ATOM   1388   C  CB   . THR A 1 88  ? 15.745  9.422   5.303   1.00 0.00 ? 88  THR A CB   1  
ATOM   1389   O  OG1  . THR A 1 88  ? 16.773  8.656   5.912   1.00 0.00 ? 88  THR A OG1  1  
ATOM   1390   C  CG2  . THR A 1 88  ? 15.081  10.312  6.353   1.00 0.00 ? 88  THR A CG2  1  
ATOM   1391   H  H    . THR A 1 88  ? 16.086  7.654   3.276   1.00 0.00 ? 88  THR A H    1  
ATOM   1392   H  HA   . THR A 1 88  ? 14.114  8.032   5.485   1.00 0.00 ? 88  THR A HA   1  
ATOM   1393   H  HB   . THR A 1 88  ? 16.167  10.041  4.527   1.00 0.00 ? 88  THR A HB   1  
ATOM   1394   H  HG1  . THR A 1 88  ? 17.615  9.062   5.691   1.00 0.00 ? 88  THR A HG1  1  
ATOM   1395   H  HG21 . THR A 1 88  ? 15.731  11.144  6.582   1.00 0.00 ? 88  THR A HG21 1  
ATOM   1396   H  HG22 . THR A 1 88  ? 14.901  9.738   7.250   1.00 0.00 ? 88  THR A HG22 1  
ATOM   1397   H  HG23 . THR A 1 88  ? 14.143  10.684  5.969   1.00 0.00 ? 88  THR A HG23 1  
ATOM   1398   N  N    . ILE A 1 89  ? 12.507  9.042   3.846   1.00 0.00 ? 89  ILE A N    1  
ATOM   1399   C  CA   . ILE A 1 89  ? 11.566  9.773   2.957   1.00 0.00 ? 89  ILE A CA   1  
ATOM   1400   C  C    . ILE A 1 89  ? 11.061  11.036  3.657   1.00 0.00 ? 89  ILE A C    1  
ATOM   1401   O  O    . ILE A 1 89  ? 10.203  10.980  4.515   1.00 0.00 ? 89  ILE A O    1  
ATOM   1402   C  CB   . ILE A 1 89  ? 10.381  8.868   2.627   1.00 0.00 ? 89  ILE A CB   1  
ATOM   1403   C  CG1  . ILE A 1 89  ? 10.885  7.621   1.902   1.00 0.00 ? 89  ILE A CG1  1  
ATOM   1404   C  CG2  . ILE A 1 89  ? 9.398   9.616   1.725   1.00 0.00 ? 89  ILE A CG2  1  
ATOM   1405   C  CD1  . ILE A 1 89  ? 9.761   6.590   1.823   1.00 0.00 ? 89  ILE A CD1  1  
ATOM   1406   H  H    . ILE A 1 89  ? 12.171  8.379   4.485   1.00 0.00 ? 89  ILE A H    1  
ATOM   1407   H  HA   . ILE A 1 89  ? 12.071  10.045  2.043   1.00 0.00 ? 89  ILE A HA   1  
ATOM   1408   H  HB   . ILE A 1 89  ? 9.885   8.578   3.540   1.00 0.00 ? 89  ILE A HB   1  
ATOM   1409   H  HG12 . ILE A 1 89  ? 11.202  7.889   0.904   1.00 0.00 ? 89  ILE A HG12 1  
ATOM   1410   H  HG13 . ILE A 1 89  ? 11.719  7.201   2.444   1.00 0.00 ? 89  ILE A HG13 1  
ATOM   1411   H  HG21 . ILE A 1 89  ? 9.164   9.006   0.865   1.00 0.00 ? 89  ILE A HG21 1  
ATOM   1412   H  HG22 . ILE A 1 89  ? 9.845   10.544  1.396   1.00 0.00 ? 89  ILE A HG22 1  
ATOM   1413   H  HG23 . ILE A 1 89  ? 8.493   9.827   2.275   1.00 0.00 ? 89  ILE A HG23 1  
ATOM   1414   H  HD11 . ILE A 1 89  ? 8.929   7.005   1.274   1.00 0.00 ? 89  ILE A HD11 1  
ATOM   1415   H  HD12 . ILE A 1 89  ? 9.440   6.329   2.821   1.00 0.00 ? 89  ILE A HD12 1  
ATOM   1416   H  HD13 . ILE A 1 89  ? 10.119  5.706   1.318   1.00 0.00 ? 89  ILE A HD13 1  
ATOM   1417   N  N    . GLU A 1 90  ? 11.564  12.181  3.283   1.00 0.00 ? 90  GLU A N    1  
ATOM   1418   C  CA   . GLU A 1 90  ? 11.082  13.438  3.915   1.00 0.00 ? 90  GLU A CA   1  
ATOM   1419   C  C    . GLU A 1 90  ? 9.745   13.795  3.272   1.00 0.00 ? 90  GLU A C    1  
ATOM   1420   O  O    . GLU A 1 90  ? 9.657   13.971  2.074   1.00 0.00 ? 90  GLU A O    1  
ATOM   1421   C  CB   . GLU A 1 90  ? 12.091  14.563  3.668   1.00 0.00 ? 90  GLU A CB   1  
ATOM   1422   C  CG   . GLU A 1 90  ? 13.515  14.016  3.797   1.00 0.00 ? 90  GLU A CG   1  
ATOM   1423   C  CD   . GLU A 1 90  ? 14.422  15.093  4.395   1.00 0.00 ? 90  GLU A CD   1  
ATOM   1424   O  OE1  . GLU A 1 90  ? 14.618  16.104  3.741   1.00 0.00 ? 90  GLU A OE1  1  
ATOM   1425   O  OE2  . GLU A 1 90  ? 14.904  14.890  5.496   1.00 0.00 ? 90  GLU A OE2  1  
ATOM   1426   H  H    . GLU A 1 90  ? 12.241  12.223  2.577   1.00 0.00 ? 90  GLU A H    1  
ATOM   1427   H  HA   . GLU A 1 90  ? 10.950  13.287  4.977   1.00 0.00 ? 90  GLU A HA   1  
ATOM   1428   H  HB2  . GLU A 1 90  ? 11.946  14.963  2.675   1.00 0.00 ? 90  GLU A HB2  1  
ATOM   1429   H  HB3  . GLU A 1 90  ? 11.942  15.346  4.395   1.00 0.00 ? 90  GLU A HB3  1  
ATOM   1430   H  HG2  . GLU A 1 90  ? 13.511  13.149  4.441   1.00 0.00 ? 90  GLU A HG2  1  
ATOM   1431   H  HG3  . GLU A 1 90  ? 13.884  13.738  2.821   1.00 0.00 ? 90  GLU A HG3  1  
ATOM   1432   N  N    . VAL A 1 91  ? 8.699   13.882  4.046   1.00 0.00 ? 91  VAL A N    1  
ATOM   1433   C  CA   . VAL A 1 91  ? 7.368   14.201  3.456   1.00 0.00 ? 91  VAL A CA   1  
ATOM   1434   C  C    . VAL A 1 91  ? 6.981   15.645  3.763   1.00 0.00 ? 91  VAL A C    1  
ATOM   1435   O  O    . VAL A 1 91  ? 6.586   15.968  4.863   1.00 0.00 ? 91  VAL A O    1  
ATOM   1436   C  CB   . VAL A 1 91  ? 6.316   13.261  4.048   1.00 0.00 ? 91  VAL A CB   1  
ATOM   1437   C  CG1  . VAL A 1 91  ? 4.947   13.567  3.437   1.00 0.00 ? 91  VAL A CG1  1  
ATOM   1438   C  CG2  . VAL A 1 91  ? 6.696   11.811  3.738   1.00 0.00 ? 91  VAL A CG2  1  
ATOM   1439   H  H    . VAL A 1 91  ? 8.780   13.724  5.009   1.00 0.00 ? 91  VAL A H    1  
ATOM   1440   H  HA   . VAL A 1 91  ? 7.407   14.062  2.389   1.00 0.00 ? 91  VAL A HA   1  
ATOM   1441   H  HB   . VAL A 1 91  ? 6.271   13.401  5.119   1.00 0.00 ? 91  VAL A HB   1  
ATOM   1442   H  HG11 . VAL A 1 91  ? 4.206   12.911  3.870   1.00 0.00 ? 91  VAL A HG11 1  
ATOM   1443   H  HG12 . VAL A 1 91  ? 4.987   13.411  2.369   1.00 0.00 ? 91  VAL A HG12 1  
ATOM   1444   H  HG13 . VAL A 1 91  ? 4.680   14.594  3.641   1.00 0.00 ? 91  VAL A HG13 1  
ATOM   1445   H  HG21 . VAL A 1 91  ? 6.265   11.159  4.483   1.00 0.00 ? 91  VAL A HG21 1  
ATOM   1446   H  HG22 . VAL A 1 91  ? 7.770   11.710  3.751   1.00 0.00 ? 91  VAL A HG22 1  
ATOM   1447   H  HG23 . VAL A 1 91  ? 6.319   11.541  2.763   1.00 0.00 ? 91  VAL A HG23 1  
ATOM   1448   N  N    . ILE A 1 92  ? 7.053   16.512  2.789   1.00 0.00 ? 92  ILE A N    1  
ATOM   1449   C  CA   . ILE A 1 92  ? 6.653   17.922  3.026   1.00 0.00 ? 92  ILE A CA   1  
ATOM   1450   C  C    . ILE A 1 92  ? 5.153   18.025  2.762   1.00 0.00 ? 92  ILE A C    1  
ATOM   1451   O  O    . ILE A 1 92  ? 4.703   17.911  1.639   1.00 0.00 ? 92  ILE A O    1  
ATOM   1452   C  CB   . ILE A 1 92  ? 7.413   18.842  2.072   1.00 0.00 ? 92  ILE A CB   1  
ATOM   1453   C  CG1  . ILE A 1 92  ? 8.906   18.773  2.393   1.00 0.00 ? 92  ILE A CG1  1  
ATOM   1454   C  CG2  . ILE A 1 92  ? 6.919   20.279  2.245   1.00 0.00 ? 92  ILE A CG2  1  
ATOM   1455   C  CD1  . ILE A 1 92  ? 9.620   17.928  1.336   1.00 0.00 ? 92  ILE A CD1  1  
ATOM   1456   H  H    . ILE A 1 92  ? 7.348   16.230  1.896   1.00 0.00 ? 92  ILE A H    1  
ATOM   1457   H  HA   . ILE A 1 92  ? 6.866   18.196  4.053   1.00 0.00 ? 92  ILE A HA   1  
ATOM   1458   H  HB   . ILE A 1 92  ? 7.245   18.524  1.053   1.00 0.00 ? 92  ILE A HB   1  
ATOM   1459   H  HG12 . ILE A 1 92  ? 9.319   19.771  2.398   1.00 0.00 ? 92  ILE A HG12 1  
ATOM   1460   H  HG13 . ILE A 1 92  ? 9.043   18.321  3.365   1.00 0.00 ? 92  ILE A HG13 1  
ATOM   1461   H  HG21 . ILE A 1 92  ? 7.761   20.955  2.217   1.00 0.00 ? 92  ILE A HG21 1  
ATOM   1462   H  HG22 . ILE A 1 92  ? 6.413   20.374  3.194   1.00 0.00 ? 92  ILE A HG22 1  
ATOM   1463   H  HG23 . ILE A 1 92  ? 6.234   20.523  1.447   1.00 0.00 ? 92  ILE A HG23 1  
ATOM   1464   H  HD11 . ILE A 1 92  ? 9.100   16.990  1.213   1.00 0.00 ? 92  ILE A HD11 1  
ATOM   1465   H  HD12 . ILE A 1 92  ? 10.635  17.739  1.652   1.00 0.00 ? 92  ILE A HD12 1  
ATOM   1466   H  HD13 . ILE A 1 92  ? 9.629   18.461  0.396   1.00 0.00 ? 92  ILE A HD13 1  
ATOM   1467   N  N    . GLY A 1 93  ? 4.374   18.216  3.788   1.00 0.00 ? 93  GLY A N    1  
ATOM   1468   C  CA   . GLY A 1 93  ? 2.898   18.297  3.600   1.00 0.00 ? 93  GLY A CA   1  
ATOM   1469   C  C    . GLY A 1 93  ? 2.219   17.402  4.632   1.00 0.00 ? 93  GLY A C    1  
ATOM   1470   O  O    . GLY A 1 93  ? 2.795   17.065  5.647   1.00 0.00 ? 93  GLY A O    1  
ATOM   1471   H  H    . GLY A 1 93  ? 4.756   18.294  4.687   1.00 0.00 ? 93  GLY A H    1  
ATOM   1472   H  HA2  . GLY A 1 93  ? 2.567   19.317  3.733   1.00 0.00 ? 93  GLY A HA2  1  
ATOM   1473   H  HA3  . GLY A 1 93  ? 2.639   17.957  2.609   1.00 0.00 ? 93  GLY A HA3  1  
ATOM   1474   N  N    . ASN A 1 94  ? 0.997   17.025  4.385   1.00 0.00 ? 94  ASN A N    1  
ATOM   1475   C  CA   . ASN A 1 94  ? 0.270   16.159  5.359   1.00 0.00 ? 94  ASN A CA   1  
ATOM   1476   C  C    . ASN A 1 94  ? -0.024  14.785  4.750   1.00 0.00 ? 94  ASN A C    1  
ATOM   1477   O  O    . ASN A 1 94  ? -0.453  13.881  5.441   1.00 0.00 ? 94  ASN A O    1  
ATOM   1478   C  CB   . ASN A 1 94  ? -1.048  16.831  5.742   1.00 0.00 ? 94  ASN A CB   1  
ATOM   1479   C  CG   . ASN A 1 94  ? -0.867  18.350  5.741   1.00 0.00 ? 94  ASN A CG   1  
ATOM   1480   O  OD1  . ASN A 1 94  ? -0.767  18.961  4.696   1.00 0.00 ? 94  ASN A OD1  1  
ATOM   1481   N  ND2  . ASN A 1 94  ? -0.818  18.989  6.878   1.00 0.00 ? 94  ASN A ND2  1  
ATOM   1482   H  H    . ASN A 1 94  ? 0.552   17.322  3.564   1.00 0.00 ? 94  ASN A H    1  
ATOM   1483   H  HA   . ASN A 1 94  ? 0.869   16.033  6.245   1.00 0.00 ? 94  ASN A HA   1  
ATOM   1484   H  HB2  . ASN A 1 94  ? -1.807  16.556  5.028   1.00 0.00 ? 94  ASN A HB2  1  
ATOM   1485   H  HB3  . ASN A 1 94  ? -1.344  16.506  6.727   1.00 0.00 ? 94  ASN A HB3  1  
ATOM   1486   H  HD21 . ASN A 1 94  ? -0.898  18.497  7.721   1.00 0.00 ? 94  ASN A HD21 1  
ATOM   1487   H  HD22 . ASN A 1 94  ? -0.703  19.962  6.888   1.00 0.00 ? 94  ASN A HD22 1  
ATOM   1488   N  N    . GLU A 1 95  ? 0.185   14.606  3.472   1.00 0.00 ? 95  GLU A N    1  
ATOM   1489   C  CA   . GLU A 1 95  ? -0.114  13.273  2.870   1.00 0.00 ? 95  GLU A CA   1  
ATOM   1490   C  C    . GLU A 1 95  ? 0.775   13.008  1.649   1.00 0.00 ? 95  GLU A C    1  
ATOM   1491   O  O    . GLU A 1 95  ? 1.264   13.914  1.005   1.00 0.00 ? 95  GLU A O    1  
ATOM   1492   C  CB   . GLU A 1 95  ? -1.587  13.224  2.458   1.00 0.00 ? 95  GLU A CB   1  
ATOM   1493   C  CG   . GLU A 1 95  ? -1.821  14.129  1.249   1.00 0.00 ? 95  GLU A CG   1  
ATOM   1494   C  CD   . GLU A 1 95  ? -1.297  15.535  1.549   1.00 0.00 ? 95  GLU A CD   1  
ATOM   1495   O  OE1  . GLU A 1 95  ? -1.968  16.255  2.269   1.00 0.00 ? 95  GLU A OE1  1  
ATOM   1496   O  OE2  . GLU A 1 95  ? -0.233  15.867  1.053   1.00 0.00 ? 95  GLU A OE2  1  
ATOM   1497   H  H    . GLU A 1 95  ? 0.518   15.338  2.915   1.00 0.00 ? 95  GLU A H    1  
ATOM   1498   H  HA   . GLU A 1 95  ? 0.068   12.509  3.609   1.00 0.00 ? 95  GLU A HA   1  
ATOM   1499   H  HB2  . GLU A 1 95  ? -1.855  12.209  2.205   1.00 0.00 ? 95  GLU A HB2  1  
ATOM   1500   H  HB3  . GLU A 1 95  ? -2.200  13.563  3.280   1.00 0.00 ? 95  GLU A HB3  1  
ATOM   1501   H  HG2  . GLU A 1 95  ? -1.307  13.725  0.390   1.00 0.00 ? 95  GLU A HG2  1  
ATOM   1502   H  HG3  . GLU A 1 95  ? -2.880  14.180  1.044   1.00 0.00 ? 95  GLU A HG3  1  
ATOM   1503   N  N    . ILE A 1 96  ? 0.983   11.753  1.340   1.00 0.00 ? 96  ILE A N    1  
ATOM   1504   C  CA   . ILE A 1 96  ? 1.839   11.371  0.176   1.00 0.00 ? 96  ILE A CA   1  
ATOM   1505   C  C    . ILE A 1 96  ? 1.098   11.657  -1.145  1.00 0.00 ? 96  ILE A C    1  
ATOM   1506   O  O    . ILE A 1 96  ? 0.010   11.160  -1.356  1.00 0.00 ? 96  ILE A O    1  
ATOM   1507   C  CB   . ILE A 1 96  ? 2.118   9.865   0.268   1.00 0.00 ? 96  ILE A CB   1  
ATOM   1508   C  CG1  . ILE A 1 96  ? 2.681   9.521   1.652   1.00 0.00 ? 96  ILE A CG1  1  
ATOM   1509   C  CG2  . ILE A 1 96  ? 3.116   9.438   -0.810  1.00 0.00 ? 96  ILE A CG2  1  
ATOM   1510   C  CD1  . ILE A 1 96  ? 3.802   10.495  2.021   1.00 0.00 ? 96  ILE A CD1  1  
ATOM   1511   H  H    . ILE A 1 96  ? 0.577   11.050  1.890   1.00 0.00 ? 96  ILE A H    1  
ATOM   1512   H  HA   . ILE A 1 96  ? 2.767   11.913  0.213   1.00 0.00 ? 96  ILE A HA   1  
ATOM   1513   H  HB   . ILE A 1 96  ? 1.192   9.329   0.118   1.00 0.00 ? 96  ILE A HB   1  
ATOM   1514   H  HG12 . ILE A 1 96  ? 1.892   9.589   2.386   1.00 0.00 ? 96  ILE A HG12 1  
ATOM   1515   H  HG13 . ILE A 1 96  ? 3.072   8.517   1.638   1.00 0.00 ? 96  ILE A HG13 1  
ATOM   1516   H  HG21 . ILE A 1 96  ? 3.249   10.239  -1.518  1.00 0.00 ? 96  ILE A HG21 1  
ATOM   1517   H  HG22 . ILE A 1 96  ? 2.738   8.567   -1.324  1.00 0.00 ? 96  ILE A HG22 1  
ATOM   1518   H  HG23 . ILE A 1 96  ? 4.063   9.201   -0.349  1.00 0.00 ? 96  ILE A HG23 1  
ATOM   1519   H  HD11 . ILE A 1 96  ? 4.396   10.071  2.817   1.00 0.00 ? 96  ILE A HD11 1  
ATOM   1520   H  HD12 . ILE A 1 96  ? 3.375   11.430  2.350   1.00 0.00 ? 96  ILE A HD12 1  
ATOM   1521   H  HD13 . ILE A 1 96  ? 4.429   10.667  1.159   1.00 0.00 ? 96  ILE A HD13 1  
ATOM   1522   N  N    . PRO A 1 97  ? 1.678   12.429  -2.044  1.00 0.00 ? 97  PRO A N    1  
ATOM   1523   C  CA   . PRO A 1 97  ? 1.039   12.734  -3.356  1.00 0.00 ? 97  PRO A CA   1  
ATOM   1524   C  C    . PRO A 1 97  ? 0.463   11.481  -4.024  1.00 0.00 ? 97  PRO A C    1  
ATOM   1525   O  O    . PRO A 1 97  ? 1.085   10.437  -4.064  1.00 0.00 ? 97  PRO A O    1  
ATOM   1526   C  CB   . PRO A 1 97  ? 2.187   13.292  -4.194  1.00 0.00 ? 97  PRO A CB   1  
ATOM   1527   C  CG   . PRO A 1 97  ? 3.128   13.902  -3.212  1.00 0.00 ? 97  PRO A CG   1  
ATOM   1528   C  CD   . PRO A 1 97  ? 2.981   13.111  -1.911  1.00 0.00 ? 97  PRO A CD   1  
ATOM   1529   H  HA   . PRO A 1 97  ? 0.276   13.485  -3.240  1.00 0.00 ? 97  PRO A HA   1  
ATOM   1530   H  HB2  . PRO A 1 97  ? 2.674   12.495  -4.738  1.00 0.00 ? 97  PRO A HB2  1  
ATOM   1531   H  HB3  . PRO A 1 97  ? 1.825   14.044  -4.874  1.00 0.00 ? 97  PRO A HB3  1  
ATOM   1532   H  HG2  . PRO A 1 97  ? 4.143   13.829  -3.581  1.00 0.00 ? 97  PRO A HG2  1  
ATOM   1533   H  HG3  . PRO A 1 97  ? 2.869   14.933  -3.039  1.00 0.00 ? 97  PRO A HG3  1  
ATOM   1534   H  HD2  . PRO A 1 97  ? 3.781   12.395  -1.818  1.00 0.00 ? 97  PRO A HD2  1  
ATOM   1535   H  HD3  . PRO A 1 97  ? 2.967   13.778  -1.065  1.00 0.00 ? 97  PRO A HD3  1  
ATOM   1536   N  N    . ILE A 1 98  ? -0.735  11.579  -4.527  1.00 0.00 ? 98  ILE A N    1  
ATOM   1537   C  CA   . ILE A 1 98  ? -1.384  10.406  -5.175  1.00 0.00 ? 98  ILE A CA   1  
ATOM   1538   C  C    . ILE A 1 98  ? -0.874  10.228  -6.609  1.00 0.00 ? 98  ILE A C    1  
ATOM   1539   O  O    . ILE A 1 98  ? -0.830  9.130   -7.125  1.00 0.00 ? 98  ILE A O    1  
ATOM   1540   C  CB   . ILE A 1 98  ? -2.892  10.641  -5.186  1.00 0.00 ? 98  ILE A CB   1  
ATOM   1541   C  CG1  . ILE A 1 98  ? -3.607  9.403   -5.735  1.00 0.00 ? 98  ILE A CG1  1  
ATOM   1542   C  CG2  . ILE A 1 98  ? -3.219  11.852  -6.064  1.00 0.00 ? 98  ILE A CG2  1  
ATOM   1543   C  CD1  . ILE A 1 98  ? -3.445  8.232   -4.760  1.00 0.00 ? 98  ILE A CD1  1  
ATOM   1544   H  H    . ILE A 1 98  ? -1.217  12.429  -4.459  1.00 0.00 ? 98  ILE A H    1  
ATOM   1545   H  HA   . ILE A 1 98  ? -1.167  9.516   -4.604  1.00 0.00 ? 98  ILE A HA   1  
ATOM   1546   H  HB   . ILE A 1 98  ? -3.220  10.836  -4.178  1.00 0.00 ? 98  ILE A HB   1  
ATOM   1547   H  HG12 . ILE A 1 98  ? -4.656  9.622   -5.862  1.00 0.00 ? 98  ILE A HG12 1  
ATOM   1548   H  HG13 . ILE A 1 98  ? -3.177  9.136   -6.688  1.00 0.00 ? 98  ILE A HG13 1  
ATOM   1549   H  HG21 . ILE A 1 98  ? -4.283  12.036  -6.040  1.00 0.00 ? 98  ILE A HG21 1  
ATOM   1550   H  HG22 . ILE A 1 98  ? -2.910  11.658  -7.080  1.00 0.00 ? 98  ILE A HG22 1  
ATOM   1551   H  HG23 . ILE A 1 98  ? -2.697  12.720  -5.689  1.00 0.00 ? 98  ILE A HG23 1  
ATOM   1552   H  HD11 . ILE A 1 98  ? -2.664  7.574   -5.114  1.00 0.00 ? 98  ILE A HD11 1  
ATOM   1553   H  HD12 . ILE A 1 98  ? -4.375  7.686   -4.697  1.00 0.00 ? 98  ILE A HD12 1  
ATOM   1554   H  HD13 . ILE A 1 98  ? -3.182  8.607   -3.782  1.00 0.00 ? 98  ILE A HD13 1  
ATOM   1555   N  N    . LEU A 1 99  ? -0.494  11.296  -7.257  1.00 0.00 ? 99  LEU A N    1  
ATOM   1556   C  CA   . LEU A 1 99  ? 0.012   11.185  -8.658  1.00 0.00 ? 99  LEU A CA   1  
ATOM   1557   C  C    . LEU A 1 99  ? -1.051  10.529  -9.548  1.00 0.00 ? 99  LEU A C    1  
ATOM   1558   O  O    . LEU A 1 99  ? -2.179  10.978  -9.618  1.00 0.00 ? 99  LEU A O    1  
ATOM   1559   C  CB   . LEU A 1 99  ? 1.291   10.342  -8.683  1.00 0.00 ? 99  LEU A CB   1  
ATOM   1560   C  CG   . LEU A 1 99  ? 2.332   10.961  -7.748  1.00 0.00 ? 99  LEU A CG   1  
ATOM   1561   C  CD1  . LEU A 1 99  ? 3.534   10.023  -7.627  1.00 0.00 ? 99  LEU A CD1  1  
ATOM   1562   C  CD2  . LEU A 1 99  ? 2.793   12.306  -8.316  1.00 0.00 ? 99  LEU A CD2  1  
ATOM   1563   H  H    . LEU A 1 99  ? -0.541  12.173  -6.822  1.00 0.00 ? 99  LEU A H    1  
ATOM   1564   H  HA   . LEU A 1 99  ? 0.229   12.174  -9.036  1.00 0.00 ? 99  LEU A HA   1  
ATOM   1565   H  HB2  . LEU A 1 99  ? 1.069   9.336   -8.359  1.00 0.00 ? 99  LEU A HB2  1  
ATOM   1566   H  HB3  . LEU A 1 99  ? 1.685   10.316  -9.689  1.00 0.00 ? 99  LEU A HB3  1  
ATOM   1567   H  HG   . LEU A 1 99  ? 1.893   11.110  -6.773  1.00 0.00 ? 99  LEU A HG   1  
ATOM   1568   H  HD11 . LEU A 1 99  ? 3.268   9.175   -7.011  1.00 0.00 ? 99  LEU A HD11 1  
ATOM   1569   H  HD12 . LEU A 1 99  ? 4.360   10.552  -7.174  1.00 0.00 ? 99  LEU A HD12 1  
ATOM   1570   H  HD13 . LEU A 1 99  ? 3.822   9.678   -8.609  1.00 0.00 ? 99  LEU A HD13 1  
ATOM   1571   H  HD21 . LEU A 1 99  ? 2.078   13.070  -8.052  1.00 0.00 ? 99  LEU A HD21 1  
ATOM   1572   H  HD22 . LEU A 1 99  ? 2.866   12.239  -9.391  1.00 0.00 ? 99  LEU A HD22 1  
ATOM   1573   H  HD23 . LEU A 1 99  ? 3.758   12.558  -7.903  1.00 0.00 ? 99  LEU A HD23 1  
ATOM   1574   N  N    . ASP A 1 100 ? -0.696  9.480   -10.241 1.00 0.00 ? 100 ASP A N    1  
ATOM   1575   C  CA   . ASP A 1 100 ? -1.679  8.806   -11.139 1.00 0.00 ? 100 ASP A CA   1  
ATOM   1576   C  C    . ASP A 1 100 ? -2.589  7.880   -10.328 1.00 0.00 ? 100 ASP A C    1  
ATOM   1577   O  O    . ASP A 1 100 ? -3.691  7.572   -10.739 1.00 0.00 ? 100 ASP A O    1  
ATOM   1578   C  CB   . ASP A 1 100 ? -0.926  7.984   -12.188 1.00 0.00 ? 100 ASP A CB   1  
ATOM   1579   C  CG   . ASP A 1 100 ? -1.908  7.487   -13.251 1.00 0.00 ? 100 ASP A CG   1  
ATOM   1580   O  OD1  . ASP A 1 100 ? -2.497  8.318   -13.922 1.00 0.00 ? 100 ASP A OD1  1  
ATOM   1581   O  OD2  . ASP A 1 100 ? -2.055  6.282   -13.376 1.00 0.00 ? 100 ASP A OD2  1  
ATOM   1582   H  H    . ASP A 1 100 ? 0.221   9.140   -10.180 1.00 0.00 ? 100 ASP A H    1  
ATOM   1583   H  HA   . ASP A 1 100 ? -2.280  9.553   -11.636 1.00 0.00 ? 100 ASP A HA   1  
ATOM   1584   H  HB2  . ASP A 1 100 ? -0.172  8.601   -12.655 1.00 0.00 ? 100 ASP A HB2  1  
ATOM   1585   H  HB3  . ASP A 1 100 ? -0.455  7.137   -11.713 1.00 0.00 ? 100 ASP A HB3  1  
ATOM   1586   N  N    . GLY A 1 101 ? -2.141  7.429   -9.185  1.00 0.00 ? 101 GLY A N    1  
ATOM   1587   C  CA   . GLY A 1 101 ? -2.988  6.520   -8.355  1.00 0.00 ? 101 GLY A CA   1  
ATOM   1588   C  C    . GLY A 1 101 ? -2.282  5.172   -8.188  1.00 0.00 ? 101 GLY A C    1  
ATOM   1589   O  O    . GLY A 1 101 ? -2.713  4.330   -7.425  1.00 0.00 ? 101 GLY A O    1  
ATOM   1590   H  H    . GLY A 1 101 ? -1.249  7.688   -8.874  1.00 0.00 ? 101 GLY A H    1  
ATOM   1591   H  HA2  . GLY A 1 101 ? -3.151  6.965   -7.382  1.00 0.00 ? 101 GLY A HA2  1  
ATOM   1592   H  HA3  . GLY A 1 101 ? -3.939  6.365   -8.843  1.00 0.00 ? 101 GLY A HA3  1  
ATOM   1593   N  N    . SER A 1 102 ? -1.203  4.961   -8.898  1.00 0.00 ? 102 SER A N    1  
ATOM   1594   C  CA   . SER A 1 102 ? -0.470  3.664   -8.786  1.00 0.00 ? 102 SER A CA   1  
ATOM   1595   C  C    . SER A 1 102 ? 0.935   3.909   -8.227  1.00 0.00 ? 102 SER A C    1  
ATOM   1596   O  O    . SER A 1 102 ? 1.262   4.999   -7.801  1.00 0.00 ? 102 SER A O    1  
ATOM   1597   C  CB   . SER A 1 102 ? -0.358  3.024   -10.171 1.00 0.00 ? 102 SER A CB   1  
ATOM   1598   O  OG   . SER A 1 102 ? 0.790   3.538   -10.834 1.00 0.00 ? 102 SER A OG   1  
ATOM   1599   H  H    . SER A 1 102 ? -0.877  5.655   -9.508  1.00 0.00 ? 102 SER A H    1  
ATOM   1600   H  HA   . SER A 1 102 ? -1.006  2.999   -8.127  1.00 0.00 ? 102 SER A HA   1  
ATOM   1601   H  HB2  . SER A 1 102 ? -0.261  1.957   -10.070 1.00 0.00 ? 102 SER A HB2  1  
ATOM   1602   H  HB3  . SER A 1 102 ? -1.248  3.250   -10.744 1.00 0.00 ? 102 SER A HB3  1  
ATOM   1603   H  HG   . SER A 1 102 ? 0.499   4.209   -11.456 1.00 0.00 ? 102 SER A HG   1  
ATOM   1604   N  N    . GLY A 1 103 ? 1.765   2.901   -8.230  1.00 0.00 ? 103 GLY A N    1  
ATOM   1605   C  CA   . GLY A 1 103 ? 3.152   3.064   -7.705  1.00 0.00 ? 103 GLY A CA   1  
ATOM   1606   C  C    . GLY A 1 103 ? 4.135   3.006   -8.872  1.00 0.00 ? 103 GLY A C    1  
ATOM   1607   O  O    . GLY A 1 103 ? 5.329   3.151   -8.708  1.00 0.00 ? 103 GLY A O    1  
ATOM   1608   H  H    . GLY A 1 103 ? 1.478   2.033   -8.583  1.00 0.00 ? 103 GLY A H    1  
ATOM   1609   H  HA2  . GLY A 1 103 ? 3.242   4.015   -7.198  1.00 0.00 ? 103 GLY A HA2  1  
ATOM   1610   H  HA3  . GLY A 1 103 ? 3.370   2.262   -7.019  1.00 0.00 ? 103 GLY A HA3  1  
ATOM   1611   N  N    . TRP A 1 104 ? 3.629   2.782   -10.048 1.00 0.00 ? 104 TRP A N    1  
ATOM   1612   C  CA   . TRP A 1 104 ? 4.505   2.696   -11.253 1.00 0.00 ? 104 TRP A CA   1  
ATOM   1613   C  C    . TRP A 1 104 ? 5.505   3.859   -11.266 1.00 0.00 ? 104 TRP A C    1  
ATOM   1614   O  O    . TRP A 1 104 ? 6.659   3.684   -11.595 1.00 0.00 ? 104 TRP A O    1  
ATOM   1615   C  CB   . TRP A 1 104 ? 3.629   2.754   -12.508 1.00 0.00 ? 104 TRP A CB   1  
ATOM   1616   C  CG   . TRP A 1 104 ? 4.472   2.631   -13.737 1.00 0.00 ? 104 TRP A CG   1  
ATOM   1617   C  CD1  . TRP A 1 104 ? 4.574   3.575   -14.702 1.00 0.00 ? 104 TRP A CD1  1  
ATOM   1618   C  CD2  . TRP A 1 104 ? 5.322   1.522   -14.158 1.00 0.00 ? 104 TRP A CD2  1  
ATOM   1619   N  NE1  . TRP A 1 104 ? 5.431   3.118   -15.686 1.00 0.00 ? 104 TRP A NE1  1  
ATOM   1620   C  CE2  . TRP A 1 104 ? 5.920   1.860   -15.395 1.00 0.00 ? 104 TRP A CE2  1  
ATOM   1621   C  CE3  . TRP A 1 104 ? 5.632   0.271   -13.593 1.00 0.00 ? 104 TRP A CE3  1  
ATOM   1622   C  CZ2  . TRP A 1 104 ? 6.792   0.988   -16.049 1.00 0.00 ? 104 TRP A CZ2  1  
ATOM   1623   C  CZ3  . TRP A 1 104 ? 6.509   -0.609  -14.248 1.00 0.00 ? 104 TRP A CZ3  1  
ATOM   1624   C  CH2  . TRP A 1 104 ? 7.088   -0.249  -15.473 1.00 0.00 ? 104 TRP A CH2  1  
ATOM   1625   H  H    . TRP A 1 104 ? 2.662   2.660   -10.139 1.00 0.00 ? 104 TRP A H    1  
ATOM   1626   H  HA   . TRP A 1 104 ? 5.045   1.762   -11.235 1.00 0.00 ? 104 TRP A HA   1  
ATOM   1627   H  HB2  . TRP A 1 104 ? 2.918   1.943   -12.483 1.00 0.00 ? 104 TRP A HB2  1  
ATOM   1628   H  HB3  . TRP A 1 104 ? 3.098   3.694   -12.531 1.00 0.00 ? 104 TRP A HB3  1  
ATOM   1629   H  HD1  . TRP A 1 104 ? 4.067   4.528   -14.703 1.00 0.00 ? 104 TRP A HD1  1  
ATOM   1630   H  HE1  . TRP A 1 104 ? 5.677   3.613   -16.495 1.00 0.00 ? 104 TRP A HE1  1  
ATOM   1631   H  HE3  . TRP A 1 104 ? 5.190   -0.017  -12.650 1.00 0.00 ? 104 TRP A HE3  1  
ATOM   1632   H  HZ2  . TRP A 1 104 ? 7.237   1.270   -16.993 1.00 0.00 ? 104 TRP A HZ2  1  
ATOM   1633   H  HZ3  . TRP A 1 104 ? 6.740   -1.566  -13.805 1.00 0.00 ? 104 TRP A HZ3  1  
ATOM   1634   H  HH2  . TRP A 1 104 ? 7.762   -0.930  -15.972 1.00 0.00 ? 104 TRP A HH2  1  
ATOM   1635   N  N    . GLU A 1 105 ? 5.074   5.044   -10.930 1.00 0.00 ? 105 GLU A N    1  
ATOM   1636   C  CA   . GLU A 1 105 ? 6.010   6.208   -10.947 1.00 0.00 ? 105 GLU A CA   1  
ATOM   1637   C  C    . GLU A 1 105 ? 7.158   5.988   -9.956  1.00 0.00 ? 105 GLU A C    1  
ATOM   1638   O  O    . GLU A 1 105 ? 8.316   6.096   -10.305 1.00 0.00 ? 105 GLU A O    1  
ATOM   1639   C  CB   . GLU A 1 105 ? 5.249   7.476   -10.565 1.00 0.00 ? 105 GLU A CB   1  
ATOM   1640   C  CG   . GLU A 1 105 ? 4.479   7.989   -11.781 1.00 0.00 ? 105 GLU A CG   1  
ATOM   1641   C  CD   . GLU A 1 105 ? 5.280   9.102   -12.461 1.00 0.00 ? 105 GLU A CD   1  
ATOM   1642   O  OE1  . GLU A 1 105 ? 6.306   8.793   -13.045 1.00 0.00 ? 105 GLU A OE1  1  
ATOM   1643   O  OE2  . GLU A 1 105 ? 4.855   10.243  -12.385 1.00 0.00 ? 105 GLU A OE2  1  
ATOM   1644   H  H    . GLU A 1 105 ? 4.134   5.173   -10.683 1.00 0.00 ? 105 GLU A H    1  
ATOM   1645   H  HA   . GLU A 1 105 ? 6.415   6.325   -11.943 1.00 0.00 ? 105 GLU A HA   1  
ATOM   1646   H  HB2  . GLU A 1 105 ? 4.557   7.254   -9.764  1.00 0.00 ? 105 GLU A HB2  1  
ATOM   1647   H  HB3  . GLU A 1 105 ? 5.947   8.231   -10.239 1.00 0.00 ? 105 GLU A HB3  1  
ATOM   1648   H  HG2  . GLU A 1 105 ? 4.325   7.178   -12.477 1.00 0.00 ? 105 GLU A HG2  1  
ATOM   1649   H  HG3  . GLU A 1 105 ? 3.526   8.377   -11.464 1.00 0.00 ? 105 GLU A HG3  1  
ATOM   1650   N  N    . PHE A 1 106 ? 6.853   5.677   -8.724  1.00 0.00 ? 106 PHE A N    1  
ATOM   1651   C  CA   . PHE A 1 106 ? 7.940   5.452   -7.724  1.00 0.00 ? 106 PHE A CA   1  
ATOM   1652   C  C    . PHE A 1 106 ? 8.749   4.222   -8.140  1.00 0.00 ? 106 PHE A C    1  
ATOM   1653   O  O    . PHE A 1 106 ? 9.962   4.208   -8.088  1.00 0.00 ? 106 PHE A O    1  
ATOM   1654   C  CB   . PHE A 1 106 ? 7.328   5.201   -6.343  1.00 0.00 ? 106 PHE A CB   1  
ATOM   1655   C  CG   . PHE A 1 106 ? 6.495   6.389   -5.923  1.00 0.00 ? 106 PHE A CG   1  
ATOM   1656   C  CD1  . PHE A 1 106 ? 7.096   7.640   -5.741  1.00 0.00 ? 106 PHE A CD1  1  
ATOM   1657   C  CD2  . PHE A 1 106 ? 5.120   6.234   -5.706  1.00 0.00 ? 106 PHE A CD2  1  
ATOM   1658   C  CE1  . PHE A 1 106 ? 6.321   8.737   -5.341  1.00 0.00 ? 106 PHE A CE1  1  
ATOM   1659   C  CE2  . PHE A 1 106 ? 4.347   7.330   -5.309  1.00 0.00 ? 106 PHE A CE2  1  
ATOM   1660   C  CZ   . PHE A 1 106 ? 4.946   8.582   -5.126  1.00 0.00 ? 106 PHE A CZ   1  
ATOM   1661   H  H    . PHE A 1 106 ? 5.914   5.593   -8.460  1.00 0.00 ? 106 PHE A H    1  
ATOM   1662   H  HA   . PHE A 1 106 ? 8.585   6.317   -7.686  1.00 0.00 ? 106 PHE A HA   1  
ATOM   1663   H  HB2  . PHE A 1 106 ? 6.704   4.321   -6.382  1.00 0.00 ? 106 PHE A HB2  1  
ATOM   1664   H  HB3  . PHE A 1 106 ? 8.119   5.047   -5.624  1.00 0.00 ? 106 PHE A HB3  1  
ATOM   1665   H  HD1  . PHE A 1 106 ? 8.156   7.759   -5.908  1.00 0.00 ? 106 PHE A HD1  1  
ATOM   1666   H  HD2  . PHE A 1 106 ? 4.657   5.269   -5.847  1.00 0.00 ? 106 PHE A HD2  1  
ATOM   1667   H  HE1  . PHE A 1 106 ? 6.784   9.702   -5.201  1.00 0.00 ? 106 PHE A HE1  1  
ATOM   1668   H  HE2  . PHE A 1 106 ? 3.285   7.211   -5.143  1.00 0.00 ? 106 PHE A HE2  1  
ATOM   1669   H  HZ   . PHE A 1 106 ? 4.348   9.427   -4.816  1.00 0.00 ? 106 PHE A HZ   1  
ATOM   1670   N  N    . TYR A 1 107 ? 8.069   3.192   -8.550  1.00 0.00 ? 107 TYR A N    1  
ATOM   1671   C  CA   . TYR A 1 107 ? 8.753   1.940   -8.978  1.00 0.00 ? 107 TYR A CA   1  
ATOM   1672   C  C    . TYR A 1 107 ? 9.616   2.212   -10.216 1.00 0.00 ? 107 TYR A C    1  
ATOM   1673   O  O    . TYR A 1 107 ? 10.679  1.648   -10.382 1.00 0.00 ? 107 TYR A O    1  
ATOM   1674   C  CB   . TYR A 1 107 ? 7.676   0.905   -9.318  1.00 0.00 ? 107 TYR A CB   1  
ATOM   1675   C  CG   . TYR A 1 107 ? 8.309   -0.390  -9.762  1.00 0.00 ? 107 TYR A CG   1  
ATOM   1676   C  CD1  . TYR A 1 107 ? 8.806   -1.289  -8.811  1.00 0.00 ? 107 TYR A CD1  1  
ATOM   1677   C  CD2  . TYR A 1 107 ? 8.383   -0.699  -11.124 1.00 0.00 ? 107 TYR A CD2  1  
ATOM   1678   C  CE1  . TYR A 1 107 ? 9.379   -2.496  -9.224  1.00 0.00 ? 107 TYR A CE1  1  
ATOM   1679   C  CE2  . TYR A 1 107 ? 8.957   -1.906  -11.537 1.00 0.00 ? 107 TYR A CE2  1  
ATOM   1680   C  CZ   . TYR A 1 107 ? 9.455   -2.806  -10.587 1.00 0.00 ? 107 TYR A CZ   1  
ATOM   1681   O  OH   . TYR A 1 107 ? 10.020  -3.997  -10.995 1.00 0.00 ? 107 TYR A OH   1  
ATOM   1682   H  H    . TYR A 1 107 ? 7.092   3.241   -8.577  1.00 0.00 ? 107 TYR A H    1  
ATOM   1683   H  HA   . TYR A 1 107 ? 9.371   1.569   -8.175  1.00 0.00 ? 107 TYR A HA   1  
ATOM   1684   H  HB2  . TYR A 1 107 ? 7.067   0.722   -8.445  1.00 0.00 ? 107 TYR A HB2  1  
ATOM   1685   H  HB3  . TYR A 1 107 ? 7.052   1.287   -10.112 1.00 0.00 ? 107 TYR A HB3  1  
ATOM   1686   H  HD1  . TYR A 1 107 ? 8.749   -1.049  -7.759  1.00 0.00 ? 107 TYR A HD1  1  
ATOM   1687   H  HD2  . TYR A 1 107 ? 7.998   -0.005  -11.857 1.00 0.00 ? 107 TYR A HD2  1  
ATOM   1688   H  HE1  . TYR A 1 107 ? 9.760   -3.190  -8.490  1.00 0.00 ? 107 TYR A HE1  1  
ATOM   1689   H  HE2  . TYR A 1 107 ? 9.014   -2.145  -12.588 1.00 0.00 ? 107 TYR A HE2  1  
ATOM   1690   H  HH   . TYR A 1 107 ? 9.418   -4.414  -11.615 1.00 0.00 ? 107 TYR A HH   1  
ATOM   1691   N  N    . GLU A 1 108 ? 9.148   3.053   -11.094 1.00 0.00 ? 108 GLU A N    1  
ATOM   1692   C  CA   . GLU A 1 108 ? 9.908   3.353   -12.344 1.00 0.00 ? 108 GLU A CA   1  
ATOM   1693   C  C    . GLU A 1 108 ? 11.201  4.129   -12.055 1.00 0.00 ? 108 GLU A C    1  
ATOM   1694   O  O    . GLU A 1 108 ? 12.272  3.750   -12.492 1.00 0.00 ? 108 GLU A O    1  
ATOM   1695   C  CB   . GLU A 1 108 ? 9.026   4.198   -13.263 1.00 0.00 ? 108 GLU A CB   1  
ATOM   1696   C  CG   . GLU A 1 108 ? 8.212   3.284   -14.177 1.00 0.00 ? 108 GLU A CG   1  
ATOM   1697   C  CD   . GLU A 1 108 ? 9.002   2.999   -15.457 1.00 0.00 ? 108 GLU A CD   1  
ATOM   1698   O  OE1  . GLU A 1 108 ? 9.098   3.893   -16.283 1.00 0.00 ? 108 GLU A OE1  1  
ATOM   1699   O  OE2  . GLU A 1 108 ? 9.496   1.891   -15.591 1.00 0.00 ? 108 GLU A OE2  1  
ATOM   1700   H  H    . GLU A 1 108 ? 8.280   3.478   -10.941 1.00 0.00 ? 108 GLU A H    1  
ATOM   1701   H  HA   . GLU A 1 108 ? 10.152  2.428   -12.844 1.00 0.00 ? 108 GLU A HA   1  
ATOM   1702   H  HB2  . GLU A 1 108 ? 8.354   4.795   -12.665 1.00 0.00 ? 108 GLU A HB2  1  
ATOM   1703   H  HB3  . GLU A 1 108 ? 9.642   4.847   -13.864 1.00 0.00 ? 108 GLU A HB3  1  
ATOM   1704   H  HG2  . GLU A 1 108 ? 8.004   2.355   -13.666 1.00 0.00 ? 108 GLU A HG2  1  
ATOM   1705   H  HG3  . GLU A 1 108 ? 7.284   3.771   -14.432 1.00 0.00 ? 108 GLU A HG3  1  
ATOM   1706   N  N    . ALA A 1 109 ? 11.116  5.219   -11.343 1.00 0.00 ? 109 ALA A N    1  
ATOM   1707   C  CA   . ALA A 1 109 ? 12.344  6.020   -11.066 1.00 0.00 ? 109 ALA A CA   1  
ATOM   1708   C  C    . ALA A 1 109 ? 13.239  5.309   -10.052 1.00 0.00 ? 109 ALA A C    1  
ATOM   1709   O  O    . ALA A 1 109 ? 14.426  5.153   -10.263 1.00 0.00 ? 109 ALA A O    1  
ATOM   1710   C  CB   . ALA A 1 109 ? 11.943  7.389   -10.512 1.00 0.00 ? 109 ALA A CB   1  
ATOM   1711   H  H    . ALA A 1 109 ? 10.251  5.520   -10.998 1.00 0.00 ? 109 ALA A H    1  
ATOM   1712   H  HA   . ALA A 1 109 ? 12.892  6.159   -11.987 1.00 0.00 ? 109 ALA A HA   1  
ATOM   1713   H  HB1  . ALA A 1 109 ? 12.503  8.159   -11.020 1.00 0.00 ? 109 ALA A HB1  1  
ATOM   1714   H  HB2  . ALA A 1 109 ? 12.159  7.425   -9.454  1.00 0.00 ? 109 ALA A HB2  1  
ATOM   1715   H  HB3  . ALA A 1 109 ? 10.887  7.547   -10.671 1.00 0.00 ? 109 ALA A HB3  1  
ATOM   1716   N  N    . ILE A 1 110 ? 12.694  4.900   -8.945  1.00 0.00 ? 110 ILE A N    1  
ATOM   1717   C  CA   . ILE A 1 110 ? 13.527  4.228   -7.912  1.00 0.00 ? 110 ILE A CA   1  
ATOM   1718   C  C    . ILE A 1 110 ? 14.180  2.970   -8.481  1.00 0.00 ? 110 ILE A C    1  
ATOM   1719   O  O    . ILE A 1 110 ? 15.343  2.720   -8.251  1.00 0.00 ? 110 ILE A O    1  
ATOM   1720   C  CB   . ILE A 1 110 ? 12.651  3.843   -6.721  1.00 0.00 ? 110 ILE A CB   1  
ATOM   1721   C  CG1  . ILE A 1 110 ? 11.995  5.100   -6.143  1.00 0.00 ? 110 ILE A CG1  1  
ATOM   1722   C  CG2  . ILE A 1 110 ? 13.518  3.182   -5.649  1.00 0.00 ? 110 ILE A CG2  1  
ATOM   1723   C  CD1  . ILE A 1 110 ? 10.922  4.694   -5.131  1.00 0.00 ? 110 ILE A CD1  1  
ATOM   1724   H  H    . ILE A 1 110 ? 11.743  5.050   -8.779  1.00 0.00 ? 110 ILE A H    1  
ATOM   1725   H  HA   . ILE A 1 110 ? 14.296  4.908   -7.580  1.00 0.00 ? 110 ILE A HA   1  
ATOM   1726   H  HB   . ILE A 1 110 ? 11.888  3.151   -7.045  1.00 0.00 ? 110 ILE A HB   1  
ATOM   1727   H  HG12 . ILE A 1 110 ? 12.745  5.703   -5.652  1.00 0.00 ? 110 ILE A HG12 1  
ATOM   1728   H  HG13 . ILE A 1 110 ? 11.539  5.668   -6.940  1.00 0.00 ? 110 ILE A HG13 1  
ATOM   1729   H  HG21 . ILE A 1 110 ? 14.561  3.345   -5.879  1.00 0.00 ? 110 ILE A HG21 1  
ATOM   1730   H  HG22 . ILE A 1 110 ? 13.316  2.122   -5.627  1.00 0.00 ? 110 ILE A HG22 1  
ATOM   1731   H  HG23 . ILE A 1 110 ? 13.290  3.612   -4.685  1.00 0.00 ? 110 ILE A HG23 1  
ATOM   1732   H  HD11 . ILE A 1 110 ? 10.287  3.937   -5.565  1.00 0.00 ? 110 ILE A HD11 1  
ATOM   1733   H  HD12 . ILE A 1 110 ? 10.327  5.556   -4.871  1.00 0.00 ? 110 ILE A HD12 1  
ATOM   1734   H  HD13 . ILE A 1 110 ? 11.395  4.300   -4.243  1.00 0.00 ? 110 ILE A HD13 1  
ATOM   1735   N  N    . ARG A 1 111 ? 13.454  2.182   -9.225  1.00 0.00 ? 111 ARG A N    1  
ATOM   1736   C  CA   . ARG A 1 111 ? 14.052  0.941   -9.798  1.00 0.00 ? 111 ARG A CA   1  
ATOM   1737   C  C    . ARG A 1 111 ? 15.326  1.291   -10.564 1.00 0.00 ? 111 ARG A C    1  
ATOM   1738   O  O    . ARG A 1 111 ? 16.253  0.509   -10.632 1.00 0.00 ? 111 ARG A O    1  
ATOM   1739   C  CB   . ARG A 1 111 ? 13.048  0.278   -10.747 1.00 0.00 ? 111 ARG A CB   1  
ATOM   1740   C  CG   . ARG A 1 111 ? 13.702  -0.916  -11.449 1.00 0.00 ? 111 ARG A CG   1  
ATOM   1741   C  CD   . ARG A 1 111 ? 12.656  -1.637  -12.303 1.00 0.00 ? 111 ARG A CD   1  
ATOM   1742   N  NE   . ARG A 1 111 ? 13.183  -2.964  -12.729 1.00 0.00 ? 111 ARG A NE   1  
ATOM   1743   C  CZ   . ARG A 1 111 ? 12.640  -3.587  -13.741 1.00 0.00 ? 111 ARG A CZ   1  
ATOM   1744   N  NH1  . ARG A 1 111 ? 11.644  -3.042  -14.383 1.00 0.00 ? 111 ARG A NH1  1  
ATOM   1745   N  NH2  . ARG A 1 111 ? 13.095  -4.754  -14.112 1.00 0.00 ? 111 ARG A NH2  1  
ATOM   1746   H  H    . ARG A 1 111 ? 12.520  2.407   -9.420  1.00 0.00 ? 111 ARG A H    1  
ATOM   1747   H  HA   . ARG A 1 111 ? 14.297  0.257   -8.997  1.00 0.00 ? 111 ARG A HA   1  
ATOM   1748   H  HB2  . ARG A 1 111 ? 12.193  -0.064  -10.182 1.00 0.00 ? 111 ARG A HB2  1  
ATOM   1749   H  HB3  . ARG A 1 111 ? 12.725  0.995   -11.487 1.00 0.00 ? 111 ARG A HB3  1  
ATOM   1750   H  HG2  . ARG A 1 111 ? 14.505  -0.567  -12.082 1.00 0.00 ? 111 ARG A HG2  1  
ATOM   1751   H  HG3  . ARG A 1 111 ? 14.095  -1.599  -10.711 1.00 0.00 ? 111 ARG A HG3  1  
ATOM   1752   H  HD2  . ARG A 1 111 ? 11.754  -1.777  -11.724 1.00 0.00 ? 111 ARG A HD2  1  
ATOM   1753   H  HD3  . ARG A 1 111 ? 12.433  -1.042  -13.176 1.00 0.00 ? 111 ARG A HD3  1  
ATOM   1754   H  HE   . ARG A 1 111 ? 13.933  -3.371  -12.248 1.00 0.00 ? 111 ARG A HE   1  
ATOM   1755   H  HH11 . ARG A 1 111 ? 11.296  -2.148  -14.101 1.00 0.00 ? 111 ARG A HH11 1  
ATOM   1756   H  HH12 . ARG A 1 111 ? 11.227  -3.518  -15.158 1.00 0.00 ? 111 ARG A HH12 1  
ATOM   1757   H  HH21 . ARG A 1 111 ? 13.859  -5.173  -13.620 1.00 0.00 ? 111 ARG A HH21 1  
ATOM   1758   H  HH22 . ARG A 1 111 ? 12.680  -5.229  -14.887 1.00 0.00 ? 111 ARG A HH22 1  
ATOM   1759   N  N    . LYS A 1 112 ? 15.383  2.455   -11.146 1.00 0.00 ? 112 LYS A N    1  
ATOM   1760   C  CA   . LYS A 1 112 ? 16.606  2.831   -11.909 1.00 0.00 ? 112 LYS A CA   1  
ATOM   1761   C  C    . LYS A 1 112 ? 17.641  3.459   -10.970 1.00 0.00 ? 112 LYS A C    1  
ATOM   1762   O  O    . LYS A 1 112 ? 18.757  3.732   -11.366 1.00 0.00 ? 112 LYS A O    1  
ATOM   1763   C  CB   . LYS A 1 112 ? 16.236  3.835   -13.003 1.00 0.00 ? 112 LYS A CB   1  
ATOM   1764   C  CG   . LYS A 1 112 ? 17.189  3.672   -14.188 1.00 0.00 ? 112 LYS A CG   1  
ATOM   1765   C  CD   . LYS A 1 112 ? 17.292  4.996   -14.946 1.00 0.00 ? 112 LYS A CD   1  
ATOM   1766   C  CE   . LYS A 1 112 ? 17.573  4.720   -16.424 1.00 0.00 ? 112 LYS A CE   1  
ATOM   1767   N  NZ   . LYS A 1 112 ? 18.633  3.681   -16.542 1.00 0.00 ? 112 LYS A NZ   1  
ATOM   1768   H  H    . LYS A 1 112 ? 14.621  3.077   -11.088 1.00 0.00 ? 112 LYS A H    1  
ATOM   1769   H  HA   . LYS A 1 112 ? 17.027  1.948   -12.366 1.00 0.00 ? 112 LYS A HA   1  
ATOM   1770   H  HB2  . LYS A 1 112 ? 15.222  3.655   -13.328 1.00 0.00 ? 112 LYS A HB2  1  
ATOM   1771   H  HB3  . LYS A 1 112 ? 16.318  4.838   -12.613 1.00 0.00 ? 112 LYS A HB3  1  
ATOM   1772   H  HG2  . LYS A 1 112 ? 18.167  3.387   -13.825 1.00 0.00 ? 112 LYS A HG2  1  
ATOM   1773   H  HG3  . LYS A 1 112 ? 16.813  2.908   -14.851 1.00 0.00 ? 112 LYS A HG3  1  
ATOM   1774   H  HD2  . LYS A 1 112 ? 16.361  5.538   -14.851 1.00 0.00 ? 112 LYS A HD2  1  
ATOM   1775   H  HD3  . LYS A 1 112 ? 18.096  5.586   -14.533 1.00 0.00 ? 112 LYS A HD3  1  
ATOM   1776   H  HE2  . LYS A 1 112 ? 16.670  4.369   -16.902 1.00 0.00 ? 112 LYS A HE2  1  
ATOM   1777   H  HE3  . LYS A 1 112 ? 17.904  5.629   -16.904 1.00 0.00 ? 112 LYS A HE3  1  
ATOM   1778   H  HZ1  . LYS A 1 112 ? 18.925  3.374   -15.593 1.00 0.00 ? 112 LYS A HZ1  1  
ATOM   1779   H  HZ2  . LYS A 1 112 ? 19.453  4.079   -17.046 1.00 0.00 ? 112 LYS A HZ2  1  
ATOM   1780   H  HZ3  . LYS A 1 112 ? 18.264  2.866   -17.071 1.00 0.00 ? 112 LYS A HZ3  1  
ATOM   1781   N  N    . ASN A 1 113 ? 17.275  3.711   -9.739  1.00 0.00 ? 113 ASN A N    1  
ATOM   1782   C  CA   . ASN A 1 113 ? 18.240  4.347   -8.789  1.00 0.00 ? 113 ASN A CA   1  
ATOM   1783   C  C    . ASN A 1 113 ? 18.448  3.482   -7.540  1.00 0.00 ? 113 ASN A C    1  
ATOM   1784   O  O    . ASN A 1 113 ? 18.748  3.990   -6.480  1.00 0.00 ? 113 ASN A O    1  
ATOM   1785   C  CB   . ASN A 1 113 ? 17.698  5.714   -8.371  1.00 0.00 ? 113 ASN A CB   1  
ATOM   1786   C  CG   . ASN A 1 113 ? 17.473  6.574   -9.615  1.00 0.00 ? 113 ASN A CG   1  
ATOM   1787   O  OD1  . ASN A 1 113 ? 16.840  6.142   -10.558 1.00 0.00 ? 113 ASN A OD1  1  
ATOM   1788   N  ND2  . ASN A 1 113 ? 17.968  7.781   -9.662  1.00 0.00 ? 113 ASN A ND2  1  
ATOM   1789   H  H    . ASN A 1 113 ? 16.360  3.501   -9.454  1.00 0.00 ? 113 ASN A H    1  
ATOM   1790   H  HA   . ASN A 1 113 ? 19.188  4.484   -9.283  1.00 0.00 ? 113 ASN A HA   1  
ATOM   1791   H  HB2  . ASN A 1 113 ? 16.763  5.586   -7.845  1.00 0.00 ? 113 ASN A HB2  1  
ATOM   1792   H  HB3  . ASN A 1 113 ? 18.411  6.201   -7.723  1.00 0.00 ? 113 ASN A HB3  1  
ATOM   1793   H  HD21 . ASN A 1 113 ? 18.479  8.130   -8.902  1.00 0.00 ? 113 ASN A HD21 1  
ATOM   1794   H  HD22 . ASN A 1 113 ? 17.828  8.337   -10.455 1.00 0.00 ? 113 ASN A HD22 1  
ATOM   1795   N  N    . ILE A 1 114 ? 18.301  2.188   -7.640  1.00 0.00 ? 114 ILE A N    1  
ATOM   1796   C  CA   . ILE A 1 114 ? 18.511  1.338   -6.430  1.00 0.00 ? 114 ILE A CA   1  
ATOM   1797   C  C    . ILE A 1 114 ? 20.002  1.000   -6.290  1.00 0.00 ? 114 ILE A C    1  
ATOM   1798   O  O    . ILE A 1 114 ? 20.713  0.843   -7.264  1.00 0.00 ? 114 ILE A O    1  
ATOM   1799   C  CB   . ILE A 1 114 ? 17.681  0.046   -6.541  1.00 0.00 ? 114 ILE A CB   1  
ATOM   1800   C  CG1  . ILE A 1 114 ? 16.193  0.406   -6.514  1.00 0.00 ? 114 ILE A CG1  1  
ATOM   1801   C  CG2  . ILE A 1 114 ? 17.989  -0.896  -5.369  1.00 0.00 ? 114 ILE A CG2  1  
ATOM   1802   C  CD1  . ILE A 1 114 ? 15.364  -0.809  -6.090  1.00 0.00 ? 114 ILE A CD1  1  
ATOM   1803   H  H    . ILE A 1 114 ? 18.054  1.784   -8.499  1.00 0.00 ? 114 ILE A H    1  
ATOM   1804   H  HA   . ILE A 1 114 ? 18.198  1.891   -5.556  1.00 0.00 ? 114 ILE A HA   1  
ATOM   1805   H  HB   . ILE A 1 114 ? 17.909  -0.451  -7.474  1.00 0.00 ? 114 ILE A HB   1  
ATOM   1806   H  HG12 . ILE A 1 114 ? 16.027  1.217   -5.821  1.00 0.00 ? 114 ILE A HG12 1  
ATOM   1807   H  HG13 . ILE A 1 114 ? 15.892  0.710   -7.498  1.00 0.00 ? 114 ILE A HG13 1  
ATOM   1808   H  HG21 . ILE A 1 114 ? 19.053  -0.992  -5.235  1.00 0.00 ? 114 ILE A HG21 1  
ATOM   1809   H  HG22 . ILE A 1 114 ? 17.572  -1.872  -5.573  1.00 0.00 ? 114 ILE A HG22 1  
ATOM   1810   H  HG23 . ILE A 1 114 ? 17.546  -0.496  -4.469  1.00 0.00 ? 114 ILE A HG23 1  
ATOM   1811   H  HD11 . ILE A 1 114 ? 15.703  -1.682  -6.626  1.00 0.00 ? 114 ILE A HD11 1  
ATOM   1812   H  HD12 . ILE A 1 114 ? 14.325  -0.631  -6.314  1.00 0.00 ? 114 ILE A HD12 1  
ATOM   1813   H  HD13 . ILE A 1 114 ? 15.479  -0.972  -5.028  1.00 0.00 ? 114 ILE A HD13 1  
ATOM   1814   N  N    . LEU A 1 115 ? 20.471  0.873   -5.073  1.00 0.00 ? 115 LEU A N    1  
ATOM   1815   C  CA   . LEU A 1 115 ? 21.906  0.530   -4.837  1.00 0.00 ? 115 LEU A CA   1  
ATOM   1816   C  C    . LEU A 1 115 ? 21.987  -0.621  -3.830  1.00 0.00 ? 115 LEU A C    1  
ATOM   1817   O  O    . LEU A 1 115 ? 21.106  -0.801  -3.013  1.00 0.00 ? 115 LEU A O    1  
ATOM   1818   C  CB   . LEU A 1 115 ? 22.639  1.749   -4.270  1.00 0.00 ? 115 LEU A CB   1  
ATOM   1819   C  CG   . LEU A 1 115 ? 24.113  1.405   -4.043  1.00 0.00 ? 115 LEU A CG   1  
ATOM   1820   C  CD1  . LEU A 1 115 ? 24.762  1.027   -5.375  1.00 0.00 ? 115 LEU A CD1  1  
ATOM   1821   C  CD2  . LEU A 1 115 ? 24.836  2.620   -3.455  1.00 0.00 ? 115 LEU A CD2  1  
ATOM   1822   H  H    . LEU A 1 115 ? 19.870  0.989   -4.309  1.00 0.00 ? 115 LEU A H    1  
ATOM   1823   H  HA   . LEU A 1 115 ? 22.365  0.230   -5.767  1.00 0.00 ? 115 LEU A HA   1  
ATOM   1824   H  HB2  . LEU A 1 115 ? 22.566  2.566   -4.969  1.00 0.00 ? 115 LEU A HB2  1  
ATOM   1825   H  HB3  . LEU A 1 115 ? 22.190  2.036   -3.332  1.00 0.00 ? 115 LEU A HB3  1  
ATOM   1826   H  HG   . LEU A 1 115 ? 24.188  0.574   -3.357  1.00 0.00 ? 115 LEU A HG   1  
ATOM   1827   H  HD11 . LEU A 1 115 ? 25.804  1.312   -5.362  1.00 0.00 ? 115 LEU A HD11 1  
ATOM   1828   H  HD12 . LEU A 1 115 ? 24.258  1.542   -6.179  1.00 0.00 ? 115 LEU A HD12 1  
ATOM   1829   H  HD13 . LEU A 1 115 ? 24.683  -0.040  -5.524  1.00 0.00 ? 115 LEU A HD13 1  
ATOM   1830   H  HD21 . LEU A 1 115 ? 25.619  2.286   -2.791  1.00 0.00 ? 115 LEU A HD21 1  
ATOM   1831   H  HD22 . LEU A 1 115 ? 24.132  3.226   -2.904  1.00 0.00 ? 115 LEU A HD22 1  
ATOM   1832   H  HD23 . LEU A 1 115 ? 25.267  3.205   -4.254  1.00 0.00 ? 115 LEU A HD23 1  
ATOM   1833   N  N    . ASN A 1 116 ? 23.033  -1.399  -3.874  1.00 0.00 ? 116 ASN A N    1  
ATOM   1834   C  CA   . ASN A 1 116 ? 23.161  -2.527  -2.913  1.00 0.00 ? 116 ASN A CA   1  
ATOM   1835   C  C    . ASN A 1 116 ? 24.127  -2.137  -1.791  1.00 0.00 ? 116 ASN A C    1  
ATOM   1836   O  O    . ASN A 1 116 ? 25.102  -1.447  -2.012  1.00 0.00 ? 116 ASN A O    1  
ATOM   1837   C  CB   . ASN A 1 116 ? 23.698  -3.757  -3.645  1.00 0.00 ? 116 ASN A CB   1  
ATOM   1838   C  CG   . ASN A 1 116 ? 22.827  -4.044  -4.870  1.00 0.00 ? 116 ASN A CG   1  
ATOM   1839   O  OD1  . ASN A 1 116 ? 22.912  -3.353  -5.866  1.00 0.00 ? 116 ASN A OD1  1  
ATOM   1840   N  ND2  . ASN A 1 116 ? 21.989  -5.043  -4.837  1.00 0.00 ? 116 ASN A ND2  1  
ATOM   1841   H  H    . ASN A 1 116 ? 23.736  -1.238  -4.536  1.00 0.00 ? 116 ASN A H    1  
ATOM   1842   H  HA   . ASN A 1 116 ? 22.193  -2.755  -2.492  1.00 0.00 ? 116 ASN A HA   1  
ATOM   1843   H  HB2  . ASN A 1 116 ? 24.716  -3.573  -3.960  1.00 0.00 ? 116 ASN A HB2  1  
ATOM   1844   H  HB3  . ASN A 1 116 ? 23.673  -4.604  -2.983  1.00 0.00 ? 116 ASN A HB3  1  
ATOM   1845   H  HD21 . ASN A 1 116 ? 21.922  -5.600  -4.034  1.00 0.00 ? 116 ASN A HD21 1  
ATOM   1846   H  HD22 . ASN A 1 116 ? 21.425  -5.237  -5.616  1.00 0.00 ? 116 ASN A HD22 1  
ATOM   1847   N  N    . GLN A 1 117 ? 23.861  -2.573  -0.588  1.00 0.00 ? 117 GLN A N    1  
ATOM   1848   C  CA   . GLN A 1 117 ? 24.758  -2.227  0.554   1.00 0.00 ? 117 GLN A CA   1  
ATOM   1849   C  C    . GLN A 1 117 ? 25.544  -3.468  0.984   1.00 0.00 ? 117 GLN A C    1  
ATOM   1850   O  O    . GLN A 1 117 ? 25.591  -4.458  0.282   1.00 0.00 ? 117 GLN A O    1  
ATOM   1851   C  CB   . GLN A 1 117 ? 23.915  -1.722  1.727   1.00 0.00 ? 117 GLN A CB   1  
ATOM   1852   C  CG   . GLN A 1 117 ? 23.821  -0.196  1.670   1.00 0.00 ? 117 GLN A CG   1  
ATOM   1853   C  CD   . GLN A 1 117 ? 22.491  0.262   2.273   1.00 0.00 ? 117 GLN A CD   1  
ATOM   1854   O  OE1  . GLN A 1 117 ? 21.500  -0.436  2.192   1.00 0.00 ? 117 GLN A OE1  1  
ATOM   1855   N  NE2  . GLN A 1 117 ? 22.427  1.418   2.876   1.00 0.00 ? 117 GLN A NE2  1  
ATOM   1856   H  H    . GLN A 1 117 ? 23.067  -3.127  -0.434  1.00 0.00 ? 117 GLN A H    1  
ATOM   1857   H  HA   . GLN A 1 117 ? 25.449  -1.456  0.248   1.00 0.00 ? 117 GLN A HA   1  
ATOM   1858   H  HB2  . GLN A 1 117 ? 22.925  -2.147  1.668   1.00 0.00 ? 117 GLN A HB2  1  
ATOM   1859   H  HB3  . GLN A 1 117 ? 24.378  -2.015  2.655   1.00 0.00 ? 117 GLN A HB3  1  
ATOM   1860   H  HG2  . GLN A 1 117 ? 24.639  0.234   2.230   1.00 0.00 ? 117 GLN A HG2  1  
ATOM   1861   H  HG3  . GLN A 1 117 ? 23.879  0.129   0.643   1.00 0.00 ? 117 GLN A HG3  1  
ATOM   1862   H  HE21 . GLN A 1 117 ? 23.225  1.982   2.941   1.00 0.00 ? 117 GLN A HE21 1  
ATOM   1863   H  HE22 . GLN A 1 117 ? 21.579  1.720   3.266   1.00 0.00 ? 117 GLN A HE22 1  
ATOM   1864   N  N    . ASN A 1 118 ? 26.173  -3.414  2.131   1.00 0.00 ? 118 ASN A N    1  
ATOM   1865   C  CA   . ASN A 1 118 ? 26.971  -4.584  2.606   1.00 0.00 ? 118 ASN A CA   1  
ATOM   1866   C  C    . ASN A 1 118 ? 26.380  -5.148  3.902   1.00 0.00 ? 118 ASN A C    1  
ATOM   1867   O  O    . ASN A 1 118 ? 26.961  -5.032  4.963   1.00 0.00 ? 118 ASN A O    1  
ATOM   1868   C  CB   . ASN A 1 118 ? 28.411  -4.143  2.862   1.00 0.00 ? 118 ASN A CB   1  
ATOM   1869   C  CG   . ASN A 1 118 ? 29.212  -5.317  3.427   1.00 0.00 ? 118 ASN A CG   1  
ATOM   1870   O  OD1  . ASN A 1 118 ? 28.720  -6.426  3.496   1.00 0.00 ? 118 ASN A OD1  1  
ATOM   1871   N  ND2  . ASN A 1 118 ? 30.436  -5.121  3.838   1.00 0.00 ? 118 ASN A ND2  1  
ATOM   1872   H  H    . ASN A 1 118 ? 26.128  -2.597  2.672   1.00 0.00 ? 118 ASN A H    1  
ATOM   1873   H  HA   . ASN A 1 118 ? 26.969  -5.352  1.852   1.00 0.00 ? 118 ASN A HA   1  
ATOM   1874   H  HB2  . ASN A 1 118 ? 28.855  -3.814  1.935   1.00 0.00 ? 118 ASN A HB2  1  
ATOM   1875   H  HB3  . ASN A 1 118 ? 28.414  -3.332  3.571   1.00 0.00 ? 118 ASN A HB3  1  
ATOM   1876   H  HD21 . ASN A 1 118 ? 30.833  -4.227  3.783   1.00 0.00 ? 118 ASN A HD21 1  
ATOM   1877   H  HD22 . ASN A 1 118 ? 30.956  -5.867  4.203   1.00 0.00 ? 118 ASN A HD22 1  
ATOM   1878   N  N    . ARG A 1 119 ? 25.238  -5.773  3.823   1.00 0.00 ? 119 ARG A N    1  
ATOM   1879   C  CA   . ARG A 1 119 ? 24.622  -6.361  5.049   1.00 0.00 ? 119 ARG A CA   1  
ATOM   1880   C  C    . ARG A 1 119 ? 23.460  -7.278  4.651   1.00 0.00 ? 119 ARG A C    1  
ATOM   1881   O  O    . ARG A 1 119 ? 22.778  -7.042  3.675   1.00 0.00 ? 119 ARG A O    1  
ATOM   1882   C  CB   . ARG A 1 119 ? 24.115  -5.245  5.963   1.00 0.00 ? 119 ARG A CB   1  
ATOM   1883   C  CG   . ARG A 1 119 ? 23.814  -5.824  7.346   1.00 0.00 ? 119 ARG A CG   1  
ATOM   1884   C  CD   . ARG A 1 119 ? 23.535  -4.689  8.332   1.00 0.00 ? 119 ARG A CD   1  
ATOM   1885   N  NE   . ARG A 1 119 ? 23.452  -5.246  9.713   1.00 0.00 ? 119 ARG A NE   1  
ATOM   1886   C  CZ   . ARG A 1 119 ? 23.405  -4.442  10.740  1.00 0.00 ? 119 ARG A CZ   1  
ATOM   1887   N  NH1  . ARG A 1 119 ? 23.425  -3.150  10.558  1.00 0.00 ? 119 ARG A NH1  1  
ATOM   1888   N  NH2  . ARG A 1 119 ? 23.338  -4.932  11.950  1.00 0.00 ? 119 ARG A NH2  1  
ATOM   1889   H  H    . ARG A 1 119 ? 24.791  -5.865  2.957   1.00 0.00 ? 119 ARG A H    1  
ATOM   1890   H  HA   . ARG A 1 119 ? 25.367  -6.942  5.575   1.00 0.00 ? 119 ARG A HA   1  
ATOM   1891   H  HB2  . ARG A 1 119 ? 24.873  -4.480  6.049   1.00 0.00 ? 119 ARG A HB2  1  
ATOM   1892   H  HB3  . ARG A 1 119 ? 23.217  -4.817  5.548   1.00 0.00 ? 119 ARG A HB3  1  
ATOM   1893   H  HG2  . ARG A 1 119 ? 22.951  -6.470  7.285   1.00 0.00 ? 119 ARG A HG2  1  
ATOM   1894   H  HG3  . ARG A 1 119 ? 24.664  -6.395  7.689   1.00 0.00 ? 119 ARG A HG3  1  
ATOM   1895   H  HD2  . ARG A 1 119 ? 24.335  -3.964  8.282   1.00 0.00 ? 119 ARG A HD2  1  
ATOM   1896   H  HD3  . ARG A 1 119 ? 22.600  -4.214  8.078   1.00 0.00 ? 119 ARG A HD3  1  
ATOM   1897   H  HE   . ARG A 1 119 ? 23.436  -6.216  9.849   1.00 0.00 ? 119 ARG A HE   1  
ATOM   1898   H  HH11 . ARG A 1 119 ? 23.477  -2.776  9.632   1.00 0.00 ? 119 ARG A HH11 1  
ATOM   1899   H  HH12 . ARG A 1 119 ? 23.389  -2.533  11.345  1.00 0.00 ? 119 ARG A HH12 1  
ATOM   1900   H  HH21 . ARG A 1 119 ? 23.323  -5.922  12.089  1.00 0.00 ? 119 ARG A HH21 1  
ATOM   1901   H  HH22 . ARG A 1 119 ? 23.300  -4.316  12.737  1.00 0.00 ? 119 ARG A HH22 1  
ATOM   1902   N  N    . GLU A 1 120 ? 23.237  -8.328  5.397   1.00 0.00 ? 120 GLU A N    1  
ATOM   1903   C  CA   . GLU A 1 120 ? 22.128  -9.270  5.058   1.00 0.00 ? 120 GLU A CA   1  
ATOM   1904   C  C    . GLU A 1 120 ? 20.817  -8.788  5.684   1.00 0.00 ? 120 GLU A C    1  
ATOM   1905   O  O    . GLU A 1 120 ? 20.773  -8.389  6.831   1.00 0.00 ? 120 GLU A O    1  
ATOM   1906   C  CB   . GLU A 1 120 ? 22.465  -10.664 5.593   1.00 0.00 ? 120 GLU A CB   1  
ATOM   1907   C  CG   . GLU A 1 120 ? 21.274  -11.599 5.379   1.00 0.00 ? 120 GLU A CG   1  
ATOM   1908   C  CD   . GLU A 1 120 ? 21.762  -12.922 4.786   1.00 0.00 ? 120 GLU A CD   1  
ATOM   1909   O  OE1  . GLU A 1 120 ? 22.665  -13.507 5.360   1.00 0.00 ? 120 GLU A OE1  1  
ATOM   1910   O  OE2  . GLU A 1 120 ? 21.226  -13.326 3.767   1.00 0.00 ? 120 GLU A OE2  1  
ATOM   1911   H  H    . GLU A 1 120 ? 23.805  -8.502  6.176   1.00 0.00 ? 120 GLU A H    1  
ATOM   1912   H  HA   . GLU A 1 120 ? 22.015  -9.318  3.986   1.00 0.00 ? 120 GLU A HA   1  
ATOM   1913   H  HB2  . GLU A 1 120 ? 23.324  -11.050 5.065   1.00 0.00 ? 120 GLU A HB2  1  
ATOM   1914   H  HB3  . GLU A 1 120 ? 22.687  -10.601 6.648   1.00 0.00 ? 120 GLU A HB3  1  
ATOM   1915   H  HG2  . GLU A 1 120 ? 20.789  -11.786 6.327   1.00 0.00 ? 120 GLU A HG2  1  
ATOM   1916   H  HG3  . GLU A 1 120 ? 20.572  -11.139 4.701   1.00 0.00 ? 120 GLU A HG3  1  
ATOM   1917   N  N    . ILE A 1 121 ? 19.750  -8.814  4.931   1.00 0.00 ? 121 ILE A N    1  
ATOM   1918   C  CA   . ILE A 1 121 ? 18.436  -8.349  5.465   1.00 0.00 ? 121 ILE A CA   1  
ATOM   1919   C  C    . ILE A 1 121 ? 17.770  -9.456  6.286   1.00 0.00 ? 121 ILE A C    1  
ATOM   1920   O  O    . ILE A 1 121 ? 17.937  -10.630 6.019   1.00 0.00 ? 121 ILE A O    1  
ATOM   1921   C  CB   . ILE A 1 121 ? 17.523  -7.987  4.291   1.00 0.00 ? 121 ILE A CB   1  
ATOM   1922   C  CG1  . ILE A 1 121 ? 18.232  -6.980  3.389   1.00 0.00 ? 121 ILE A CG1  1  
ATOM   1923   C  CG2  . ILE A 1 121 ? 16.223  -7.371  4.813   1.00 0.00 ? 121 ILE A CG2  1  
ATOM   1924   C  CD1  . ILE A 1 121 ? 17.450  -6.824  2.083   1.00 0.00 ? 121 ILE A CD1  1  
ATOM   1925   H  H    . ILE A 1 121 ? 19.812  -9.128  4.005   1.00 0.00 ? 121 ILE A H    1  
ATOM   1926   H  HA   . ILE A 1 121 ? 18.584  -7.478  6.085   1.00 0.00 ? 121 ILE A HA   1  
ATOM   1927   H  HB   . ILE A 1 121 ? 17.295  -8.879  3.726   1.00 0.00 ? 121 ILE A HB   1  
ATOM   1928   H  HG12 . ILE A 1 121 ? 18.289  -6.028  3.894   1.00 0.00 ? 121 ILE A HG12 1  
ATOM   1929   H  HG13 . ILE A 1 121 ? 19.228  -7.333  3.168   1.00 0.00 ? 121 ILE A HG13 1  
ATOM   1930   H  HG21 . ILE A 1 121 ? 16.450  -6.655  5.590   1.00 0.00 ? 121 ILE A HG21 1  
ATOM   1931   H  HG22 . ILE A 1 121 ? 15.592  -8.150  5.215   1.00 0.00 ? 121 ILE A HG22 1  
ATOM   1932   H  HG23 . ILE A 1 121 ? 15.710  -6.874  4.003   1.00 0.00 ? 121 ILE A HG23 1  
ATOM   1933   H  HD11 . ILE A 1 121 ? 16.402  -6.695  2.306   1.00 0.00 ? 121 ILE A HD11 1  
ATOM   1934   H  HD12 . ILE A 1 121 ? 17.584  -7.706  1.477   1.00 0.00 ? 121 ILE A HD12 1  
ATOM   1935   H  HD13 . ILE A 1 121 ? 17.813  -5.961  1.547   1.00 0.00 ? 121 ILE A HD13 1  
ATOM   1936   N  N    . ASP A 1 122 ? 16.996  -9.085  7.271   1.00 0.00 ? 122 ASP A N    1  
ATOM   1937   C  CA   . ASP A 1 122 ? 16.293  -10.104 8.101   1.00 0.00 ? 122 ASP A CA   1  
ATOM   1938   C  C    . ASP A 1 122 ? 14.867  -10.256 7.569   1.00 0.00 ? 122 ASP A C    1  
ATOM   1939   O  O    . ASP A 1 122 ? 14.004  -9.443  7.835   1.00 0.00 ? 122 ASP A O    1  
ATOM   1940   C  CB   . ASP A 1 122 ? 16.253  -9.643  9.559   1.00 0.00 ? 122 ASP A CB   1  
ATOM   1941   C  CG   . ASP A 1 122 ? 15.911  -10.830 10.461  1.00 0.00 ? 122 ASP A CG   1  
ATOM   1942   O  OD1  . ASP A 1 122 ? 16.761  -11.690 10.622  1.00 0.00 ? 122 ASP A OD1  1  
ATOM   1943   O  OD2  . ASP A 1 122 ? 14.805  -10.859 10.975  1.00 0.00 ? 122 ASP A OD2  1  
ATOM   1944   H  H    . ASP A 1 122 ? 16.866  -8.131  7.456   1.00 0.00 ? 122 ASP A H    1  
ATOM   1945   H  HA   . ASP A 1 122 ? 16.810  -11.048 8.033   1.00 0.00 ? 122 ASP A HA   1  
ATOM   1946   H  HB2  . ASP A 1 122 ? 17.218  -9.245  9.837   1.00 0.00 ? 122 ASP A HB2  1  
ATOM   1947   H  HB3  . ASP A 1 122 ? 15.501  -8.878  9.674   1.00 0.00 ? 122 ASP A HB3  1  
ATOM   1948   N  N    . TYR A 1 123 ? 14.620  -11.277 6.797   1.00 0.00 ? 123 TYR A N    1  
ATOM   1949   C  CA   . TYR A 1 123 ? 13.260  -11.468 6.221   1.00 0.00 ? 123 TYR A CA   1  
ATOM   1950   C  C    . TYR A 1 123 ? 12.270  -11.899 7.302   1.00 0.00 ? 123 TYR A C    1  
ATOM   1951   O  O    . TYR A 1 123 ? 12.605  -12.614 8.225   1.00 0.00 ? 123 TYR A O    1  
ATOM   1952   C  CB   . TYR A 1 123 ? 13.320  -12.548 5.140   1.00 0.00 ? 123 TYR A CB   1  
ATOM   1953   C  CG   . TYR A 1 123 ? 14.377  -12.189 4.124   1.00 0.00 ? 123 TYR A CG   1  
ATOM   1954   C  CD1  . TYR A 1 123 ? 14.276  -10.994 3.404   1.00 0.00 ? 123 TYR A CD1  1  
ATOM   1955   C  CD2  . TYR A 1 123 ? 15.459  -13.049 3.905   1.00 0.00 ? 123 TYR A CD2  1  
ATOM   1956   C  CE1  . TYR A 1 123 ? 15.256  -10.658 2.463   1.00 0.00 ? 123 TYR A CE1  1  
ATOM   1957   C  CE2  . TYR A 1 123 ? 16.440  -12.714 2.964   1.00 0.00 ? 123 TYR A CE2  1  
ATOM   1958   C  CZ   . TYR A 1 123 ? 16.339  -11.518 2.243   1.00 0.00 ? 123 TYR A CZ   1  
ATOM   1959   O  OH   . TYR A 1 123 ? 17.305  -11.187 1.316   1.00 0.00 ? 123 TYR A OH   1  
ATOM   1960   H  H    . TYR A 1 123 ? 15.336  -11.909 6.579   1.00 0.00 ? 123 TYR A H    1  
ATOM   1961   H  HA   . TYR A 1 123 ? 12.926  -10.541 5.780   1.00 0.00 ? 123 TYR A HA   1  
ATOM   1962   H  HB2  . TYR A 1 123 ? 13.565  -13.498 5.593   1.00 0.00 ? 123 TYR A HB2  1  
ATOM   1963   H  HB3  . TYR A 1 123 ? 12.360  -12.620 4.649   1.00 0.00 ? 123 TYR A HB3  1  
ATOM   1964   H  HD1  . TYR A 1 123 ? 13.441  -10.332 3.574   1.00 0.00 ? 123 TYR A HD1  1  
ATOM   1965   H  HD2  . TYR A 1 123 ? 15.536  -13.971 4.461   1.00 0.00 ? 123 TYR A HD2  1  
ATOM   1966   H  HE1  . TYR A 1 123 ? 15.178  -9.735  1.907   1.00 0.00 ? 123 TYR A HE1  1  
ATOM   1967   H  HE2  . TYR A 1 123 ? 17.275  -13.378 2.794   1.00 0.00 ? 123 TYR A HE2  1  
ATOM   1968   H  HH   . TYR A 1 123 ? 16.915  -11.257 0.442   1.00 0.00 ? 123 TYR A HH   1  
ATOM   1969   N  N    . PHE A 1 124 ? 11.037  -11.486 7.168   1.00 0.00 ? 124 PHE A N    1  
ATOM   1970   C  CA   . PHE A 1 124 ? 9.994   -11.884 8.156   1.00 0.00 ? 124 PHE A CA   1  
ATOM   1971   C  C    . PHE A 1 124 ? 9.247   -13.088 7.581   1.00 0.00 ? 124 PHE A C    1  
ATOM   1972   O  O    . PHE A 1 124 ? 8.697   -13.025 6.499   1.00 0.00 ? 124 PHE A O    1  
ATOM   1973   C  CB   . PHE A 1 124 ? 9.024   -10.719 8.374   1.00 0.00 ? 124 PHE A CB   1  
ATOM   1974   C  CG   . PHE A 1 124 ? 8.096   -11.014 9.533   1.00 0.00 ? 124 PHE A CG   1  
ATOM   1975   C  CD1  . PHE A 1 124 ? 7.072   -11.960 9.392   1.00 0.00 ? 124 PHE A CD1  1  
ATOM   1976   C  CD2  . PHE A 1 124 ? 8.254   -10.332 10.746  1.00 0.00 ? 124 PHE A CD2  1  
ATOM   1977   C  CE1  . PHE A 1 124 ? 6.209   -12.223 10.464  1.00 0.00 ? 124 PHE A CE1  1  
ATOM   1978   C  CE2  . PHE A 1 124 ? 7.390   -10.594 11.818  1.00 0.00 ? 124 PHE A CE2  1  
ATOM   1979   C  CZ   . PHE A 1 124 ? 6.369   -11.540 11.676  1.00 0.00 ? 124 PHE A CZ   1  
ATOM   1980   H  H    . PHE A 1 124 ? 10.788  -10.931 6.400   1.00 0.00 ? 124 PHE A H    1  
ATOM   1981   H  HA   . PHE A 1 124 ? 10.461  -12.157 9.092   1.00 0.00 ? 124 PHE A HA   1  
ATOM   1982   H  HB2  . PHE A 1 124 ? 9.584   -9.821  8.588   1.00 0.00 ? 124 PHE A HB2  1  
ATOM   1983   H  HB3  . PHE A 1 124 ? 8.440   -10.569 7.481   1.00 0.00 ? 124 PHE A HB3  1  
ATOM   1984   H  HD1  . PHE A 1 124 ? 6.946   -12.486 8.458   1.00 0.00 ? 124 PHE A HD1  1  
ATOM   1985   H  HD2  . PHE A 1 124 ? 9.044   -9.603  10.857  1.00 0.00 ? 124 PHE A HD2  1  
ATOM   1986   H  HE1  . PHE A 1 124 ? 5.421   -12.953 10.355  1.00 0.00 ? 124 PHE A HE1  1  
ATOM   1987   H  HE2  . PHE A 1 124 ? 7.509   -10.067 12.754  1.00 0.00 ? 124 PHE A HE2  1  
ATOM   1988   H  HZ   . PHE A 1 124 ? 5.701   -11.741 12.502  1.00 0.00 ? 124 PHE A HZ   1  
ATOM   1989   N  N    . VAL A 1 125 ? 9.240   -14.187 8.284   1.00 0.00 ? 125 VAL A N    1  
ATOM   1990   C  CA   . VAL A 1 125 ? 8.550   -15.403 7.769   1.00 0.00 ? 125 VAL A CA   1  
ATOM   1991   C  C    . VAL A 1 125 ? 7.452   -15.839 8.736   1.00 0.00 ? 125 VAL A C    1  
ATOM   1992   O  O    . VAL A 1 125 ? 7.649   -15.898 9.934   1.00 0.00 ? 125 VAL A O    1  
ATOM   1993   C  CB   . VAL A 1 125 ? 9.568   -16.536 7.620   1.00 0.00 ? 125 VAL A CB   1  
ATOM   1994   C  CG1  . VAL A 1 125 ? 8.986   -17.637 6.733   1.00 0.00 ? 125 VAL A CG1  1  
ATOM   1995   C  CG2  . VAL A 1 125 ? 10.848  -15.991 6.981   1.00 0.00 ? 125 VAL A CG2  1  
ATOM   1996   H  H    . VAL A 1 125 ? 9.699   -14.213 9.145   1.00 0.00 ? 125 VAL A H    1  
ATOM   1997   H  HA   . VAL A 1 125 ? 8.112   -15.192 6.806   1.00 0.00 ? 125 VAL A HA   1  
ATOM   1998   H  HB   . VAL A 1 125 ? 9.796   -16.943 8.595   1.00 0.00 ? 125 VAL A HB   1  
ATOM   1999   H  HG11 . VAL A 1 125 ? 9.134   -18.597 7.204   1.00 0.00 ? 125 VAL A HG11 1  
ATOM   2000   H  HG12 . VAL A 1 125 ? 9.484   -17.626 5.774   1.00 0.00 ? 125 VAL A HG12 1  
ATOM   2001   H  HG13 . VAL A 1 125 ? 7.929   -17.464 6.590   1.00 0.00 ? 125 VAL A HG13 1  
ATOM   2002   H  HG21 . VAL A 1 125 ? 11.567  -16.790 6.880   1.00 0.00 ? 125 VAL A HG21 1  
ATOM   2003   H  HG22 . VAL A 1 125 ? 11.259  -15.213 7.608   1.00 0.00 ? 125 VAL A HG22 1  
ATOM   2004   H  HG23 . VAL A 1 125 ? 10.618  -15.585 6.007   1.00 0.00 ? 125 VAL A HG23 1  
ATOM   2005   N  N    . VAL A 1 126 ? 6.302   -16.166 8.219   1.00 0.00 ? 126 VAL A N    1  
ATOM   2006   C  CA   . VAL A 1 126 ? 5.191   -16.624 9.093   1.00 0.00 ? 126 VAL A CA   1  
ATOM   2007   C  C    . VAL A 1 126 ? 5.435   -18.084 9.465   1.00 0.00 ? 126 VAL A C    1  
ATOM   2008   O  O    . VAL A 1 126 ? 5.761   -18.897 8.624   1.00 0.00 ? 126 VAL A O    1  
ATOM   2009   C  CB   . VAL A 1 126 ? 3.866   -16.496 8.341   1.00 0.00 ? 126 VAL A CB   1  
ATOM   2010   C  CG1  . VAL A 1 126 ? 2.732   -17.058 9.198   1.00 0.00 ? 126 VAL A CG1  1  
ATOM   2011   C  CG2  . VAL A 1 126 ? 3.594   -15.020 8.039   1.00 0.00 ? 126 VAL A CG2  1  
ATOM   2012   H  H    . VAL A 1 126 ? 6.177   -16.127 7.248   1.00 0.00 ? 126 VAL A H    1  
ATOM   2013   H  HA   . VAL A 1 126 ? 5.159   -16.025 9.990   1.00 0.00 ? 126 VAL A HA   1  
ATOM   2014   H  HB   . VAL A 1 126 ? 3.925   -17.047 7.414   1.00 0.00 ? 126 VAL A HB   1  
ATOM   2015   H  HG11 . VAL A 1 126 ? 2.880   -18.119 9.339   1.00 0.00 ? 126 VAL A HG11 1  
ATOM   2016   H  HG12 . VAL A 1 126 ? 1.787   -16.888 8.704   1.00 0.00 ? 126 VAL A HG12 1  
ATOM   2017   H  HG13 . VAL A 1 126 ? 2.729   -16.564 10.159  1.00 0.00 ? 126 VAL A HG13 1  
ATOM   2018   H  HG21 . VAL A 1 126 ? 2.550   -14.889 7.796   1.00 0.00 ? 126 VAL A HG21 1  
ATOM   2019   H  HG22 . VAL A 1 126 ? 4.199   -14.707 7.202   1.00 0.00 ? 126 VAL A HG22 1  
ATOM   2020   H  HG23 . VAL A 1 126 ? 3.840   -14.424 8.906   1.00 0.00 ? 126 VAL A HG23 1  
ATOM   2021   N  N    . GLU A 1 127 ? 5.291   -18.421 10.718  1.00 0.00 ? 127 GLU A N    1  
ATOM   2022   C  CA   . GLU A 1 127 ? 5.523   -19.830 11.145  1.00 0.00 ? 127 GLU A CA   1  
ATOM   2023   C  C    . GLU A 1 127 ? 4.203   -20.440 11.611  1.00 0.00 ? 127 GLU A C    1  
ATOM   2024   O  O    . GLU A 1 127 ? 4.100   -21.632 11.821  1.00 0.00 ? 127 GLU A O    1  
ATOM   2025   C  CB   . GLU A 1 127 ? 6.531   -19.856 12.295  1.00 0.00 ? 127 GLU A CB   1  
ATOM   2026   C  CG   . GLU A 1 127 ? 7.950   -19.763 11.730  1.00 0.00 ? 127 GLU A CG   1  
ATOM   2027   C  CD   . GLU A 1 127 ? 8.475   -21.168 11.424  1.00 0.00 ? 127 GLU A CD   1  
ATOM   2028   O  OE1  . GLU A 1 127 ? 8.025   -21.747 10.448  1.00 0.00 ? 127 GLU A OE1  1  
ATOM   2029   O  OE2  . GLU A 1 127 ? 9.317   -21.641 12.170  1.00 0.00 ? 127 GLU A OE2  1  
ATOM   2030   H  H    . GLU A 1 127 ? 5.033   -17.745 11.379  1.00 0.00 ? 127 GLU A H    1  
ATOM   2031   H  HA   . GLU A 1 127 ? 5.908   -20.404 10.315  1.00 0.00 ? 127 GLU A HA   1  
ATOM   2032   H  HB2  . GLU A 1 127 ? 6.349   -19.019 12.953  1.00 0.00 ? 127 GLU A HB2  1  
ATOM   2033   H  HB3  . GLU A 1 127 ? 6.426   -20.778 12.847  1.00 0.00 ? 127 GLU A HB3  1  
ATOM   2034   H  HG2  . GLU A 1 127 ? 7.938   -19.178 10.822  1.00 0.00 ? 127 GLU A HG2  1  
ATOM   2035   H  HG3  . GLU A 1 127 ? 8.596   -19.290 12.454  1.00 0.00 ? 127 GLU A HG3  1  
ATOM   2036   N  N    . GLU A 1 128 ? 3.189   -19.635 11.773  1.00 0.00 ? 128 GLU A N    1  
ATOM   2037   C  CA   . GLU A 1 128 ? 1.880   -20.182 12.224  1.00 0.00 ? 128 GLU A CA   1  
ATOM   2038   C  C    . GLU A 1 128 ? 0.742   -19.435 11.512  1.00 0.00 ? 128 GLU A C    1  
ATOM   2039   O  O    . GLU A 1 128 ? 0.832   -18.247 11.279  1.00 0.00 ? 128 GLU A O    1  
ATOM   2040   C  CB   . GLU A 1 128 ? 1.746   -20.003 13.738  1.00 0.00 ? 128 GLU A CB   1  
ATOM   2041   C  CG   . GLU A 1 128 ? 2.076   -18.558 14.114  1.00 0.00 ? 128 GLU A CG   1  
ATOM   2042   C  CD   . GLU A 1 128 ? 1.829   -18.351 15.610  1.00 0.00 ? 128 GLU A CD   1  
ATOM   2043   O  OE1  . GLU A 1 128 ? 1.647   -19.339 16.303  1.00 0.00 ? 128 GLU A OE1  1  
ATOM   2044   O  OE2  . GLU A 1 128 ? 1.825   -17.208 16.037  1.00 0.00 ? 128 GLU A OE2  1  
ATOM   2045   H  H    . GLU A 1 128 ? 3.291   -18.674 11.595  1.00 0.00 ? 128 GLU A H    1  
ATOM   2046   H  HA   . GLU A 1 128 ? 1.841   -21.230 11.981  1.00 0.00 ? 128 GLU A HA   1  
ATOM   2047   H  HB2  . GLU A 1 128 ? 0.735   -20.232 14.039  1.00 0.00 ? 128 GLU A HB2  1  
ATOM   2048   H  HB3  . GLU A 1 128 ? 2.431   -20.669 14.240  1.00 0.00 ? 128 GLU A HB3  1  
ATOM   2049   H  HG2  . GLU A 1 128 ? 3.114   -18.355 13.888  1.00 0.00 ? 128 GLU A HG2  1  
ATOM   2050   H  HG3  . GLU A 1 128 ? 1.447   -17.886 13.551  1.00 0.00 ? 128 GLU A HG3  1  
ATOM   2051   N  N    . PRO A 1 129 ? -0.324  -20.121 11.165  1.00 0.00 ? 129 PRO A N    1  
ATOM   2052   C  CA   . PRO A 1 129 ? -1.483  -19.496 10.466  1.00 0.00 ? 129 PRO A CA   1  
ATOM   2053   C  C    . PRO A 1 129 ? -2.330  -18.609 11.386  1.00 0.00 ? 129 PRO A C    1  
ATOM   2054   O  O    . PRO A 1 129 ? -2.142  -18.570 12.585  1.00 0.00 ? 129 PRO A O    1  
ATOM   2055   C  CB   . PRO A 1 129 ? -2.305  -20.687 9.978   1.00 0.00 ? 129 PRO A CB   1  
ATOM   2056   C  CG   . PRO A 1 129 ? -1.975  -21.802 10.910  1.00 0.00 ? 129 PRO A CG   1  
ATOM   2057   C  CD   . PRO A 1 129 ? -0.544  -21.562 11.391  1.00 0.00 ? 129 PRO A CD   1  
ATOM   2058   H  HA   . PRO A 1 129 ? -1.141  -18.928 9.618   1.00 0.00 ? 129 PRO A HA   1  
ATOM   2059   H  HB2  . PRO A 1 129 ? -3.362  -20.455 10.025  1.00 0.00 ? 129 PRO A HB2  1  
ATOM   2060   H  HB3  . PRO A 1 129 ? -2.023  -20.951 8.972   1.00 0.00 ? 129 PRO A HB3  1  
ATOM   2061   H  HG2  . PRO A 1 129 ? -2.658  -21.797 11.748  1.00 0.00 ? 129 PRO A HG2  1  
ATOM   2062   H  HG3  . PRO A 1 129 ? -2.029  -22.746 10.392  1.00 0.00 ? 129 PRO A HG3  1  
ATOM   2063   H  HD2  . PRO A 1 129 ? -0.452  -21.803 12.442  1.00 0.00 ? 129 PRO A HD2  1  
ATOM   2064   H  HD3  . PRO A 1 129 ? 0.151   -22.142 10.804  1.00 0.00 ? 129 PRO A HD3  1  
ATOM   2065   N  N    . ILE A 1 130 ? -3.262  -17.900 10.816  1.00 0.00 ? 130 ILE A N    1  
ATOM   2066   C  CA   . ILE A 1 130 ? -4.131  -17.009 11.632  1.00 0.00 ? 130 ILE A CA   1  
ATOM   2067   C  C    . ILE A 1 130 ? -5.344  -16.574 10.806  1.00 0.00 ? 130 ILE A C    1  
ATOM   2068   O  O    . ILE A 1 130 ? -5.245  -16.342 9.618   1.00 0.00 ? 130 ILE A O    1  
ATOM   2069   C  CB   . ILE A 1 130 ? -3.313  -15.790 12.065  1.00 0.00 ? 130 ILE A CB   1  
ATOM   2070   C  CG1  . ILE A 1 130 ? -4.237  -14.623 12.405  1.00 0.00 ? 130 ILE A CG1  1  
ATOM   2071   C  CG2  . ILE A 1 130 ? -2.382  -15.376 10.931  1.00 0.00 ? 130 ILE A CG2  1  
ATOM   2072   C  CD1  . ILE A 1 130 ? -3.413  -13.520 13.061  1.00 0.00 ? 130 ILE A CD1  1  
ATOM   2073   H  H    . ILE A 1 130 ? -3.376  -17.965 9.845   1.00 0.00 ? 130 ILE A H    1  
ATOM   2074   H  HA   . ILE A 1 130 ? -4.468  -17.543 12.509  1.00 0.00 ? 130 ILE A HA   1  
ATOM   2075   H  HB   . ILE A 1 130 ? -2.724  -16.048 12.934  1.00 0.00 ? 130 ILE A HB   1  
ATOM   2076   H  HG12 . ILE A 1 130 ? -4.693  -14.243 11.501  1.00 0.00 ? 130 ILE A HG12 1  
ATOM   2077   H  HG13 . ILE A 1 130 ? -5.005  -14.952 13.089  1.00 0.00 ? 130 ILE A HG13 1  
ATOM   2078   H  HG21 . ILE A 1 130 ? -2.961  -15.225 10.033  1.00 0.00 ? 130 ILE A HG21 1  
ATOM   2079   H  HG22 . ILE A 1 130 ? -1.650  -16.152 10.766  1.00 0.00 ? 130 ILE A HG22 1  
ATOM   2080   H  HG23 . ILE A 1 130 ? -1.879  -14.457 11.195  1.00 0.00 ? 130 ILE A HG23 1  
ATOM   2081   H  HD11 . ILE A 1 130 ? -3.732  -12.559 12.686  1.00 0.00 ? 130 ILE A HD11 1  
ATOM   2082   H  HD12 . ILE A 1 130 ? -2.367  -13.669 12.828  1.00 0.00 ? 130 ILE A HD12 1  
ATOM   2083   H  HD13 . ILE A 1 130 ? -3.553  -13.557 14.129  1.00 0.00 ? 130 ILE A HD13 1  
ATOM   2084   N  N    . ILE A 1 131 ? -6.487  -16.466 11.430  1.00 0.00 ? 131 ILE A N    1  
ATOM   2085   C  CA   . ILE A 1 131 ? -7.716  -16.049 10.689  1.00 0.00 ? 131 ILE A CA   1  
ATOM   2086   C  C    . ILE A 1 131 ? -8.383  -14.872 11.409  1.00 0.00 ? 131 ILE A C    1  
ATOM   2087   O  O    . ILE A 1 131 ? -8.680  -14.939 12.585  1.00 0.00 ? 131 ILE A O    1  
ATOM   2088   C  CB   . ILE A 1 131 ? -8.695  -17.223 10.626  1.00 0.00 ? 131 ILE A CB   1  
ATOM   2089   C  CG1  . ILE A 1 131 ? -8.075  -18.364 9.817   1.00 0.00 ? 131 ILE A CG1  1  
ATOM   2090   C  CG2  . ILE A 1 131 ? -9.993  -16.772 9.953   1.00 0.00 ? 131 ILE A CG2  1  
ATOM   2091   C  CD1  . ILE A 1 131 ? -7.364  -19.335 10.763  1.00 0.00 ? 131 ILE A CD1  1  
ATOM   2092   H  H    . ILE A 1 131 ? -6.539  -16.661 12.388  1.00 0.00 ? 131 ILE A H    1  
ATOM   2093   H  HA   . ILE A 1 131 ? -7.447  -15.751 9.686   1.00 0.00 ? 131 ILE A HA   1  
ATOM   2094   H  HB   . ILE A 1 131 ? -8.911  -17.565 11.628  1.00 0.00 ? 131 ILE A HB   1  
ATOM   2095   H  HG12 . ILE A 1 131 ? -8.852  -18.890 9.280   1.00 0.00 ? 131 ILE A HG12 1  
ATOM   2096   H  HG13 . ILE A 1 131 ? -7.362  -17.962 9.116   1.00 0.00 ? 131 ILE A HG13 1  
ATOM   2097   H  HG21 . ILE A 1 131 ? -10.771 -16.679 10.695  1.00 0.00 ? 131 ILE A HG21 1  
ATOM   2098   H  HG22 . ILE A 1 131 ? -10.287 -17.501 9.211   1.00 0.00 ? 131 ILE A HG22 1  
ATOM   2099   H  HG23 . ILE A 1 131 ? -9.837  -15.817 9.474   1.00 0.00 ? 131 ILE A HG23 1  
ATOM   2100   H  HD11 . ILE A 1 131 ? -8.067  -19.709 11.491  1.00 0.00 ? 131 ILE A HD11 1  
ATOM   2101   H  HD12 . ILE A 1 131 ? -6.561  -18.820 11.270  1.00 0.00 ? 131 ILE A HD12 1  
ATOM   2102   H  HD13 . ILE A 1 131 ? -6.961  -20.160 10.194  1.00 0.00 ? 131 ILE A HD13 1  
ATOM   2103   N  N    . VAL A 1 132 ? -8.619  -13.796 10.704  1.00 0.00 ? 132 VAL A N    1  
ATOM   2104   C  CA   . VAL A 1 132 ? -9.265  -12.608 11.331  1.00 0.00 ? 132 VAL A CA   1  
ATOM   2105   C  C    . VAL A 1 132 ? -10.554 -12.272 10.574  1.00 0.00 ? 132 VAL A C    1  
ATOM   2106   O  O    . VAL A 1 132 ? -10.535 -11.994 9.390   1.00 0.00 ? 132 VAL A O    1  
ATOM   2107   C  CB   . VAL A 1 132 ? -8.310  -11.417 11.264  1.00 0.00 ? 132 VAL A CB   1  
ATOM   2108   C  CG1  . VAL A 1 132 ? -7.080  -11.696 12.129  1.00 0.00 ? 132 VAL A CG1  1  
ATOM   2109   C  CG2  . VAL A 1 132 ? -7.872  -11.198 9.816   1.00 0.00 ? 132 VAL A CG2  1  
ATOM   2110   H  H    . VAL A 1 132 ? -8.366  -13.772 9.761   1.00 0.00 ? 132 VAL A H    1  
ATOM   2111   H  HA   . VAL A 1 132 ? -9.501  -12.825 12.362  1.00 0.00 ? 132 VAL A HA   1  
ATOM   2112   H  HB   . VAL A 1 132 ? -8.812  -10.534 11.627  1.00 0.00 ? 132 VAL A HB   1  
ATOM   2113   H  HG11 . VAL A 1 132 ? -7.150  -11.131 13.047  1.00 0.00 ? 132 VAL A HG11 1  
ATOM   2114   H  HG12 . VAL A 1 132 ? -6.189  -11.405 11.594  1.00 0.00 ? 132 VAL A HG12 1  
ATOM   2115   H  HG13 . VAL A 1 132 ? -7.033  -12.751 12.359  1.00 0.00 ? 132 VAL A HG13 1  
ATOM   2116   H  HG21 . VAL A 1 132 ? -8.207  -12.029 9.212   1.00 0.00 ? 132 VAL A HG21 1  
ATOM   2117   H  HG22 . VAL A 1 132 ? -6.795  -11.132 9.771   1.00 0.00 ? 132 VAL A HG22 1  
ATOM   2118   H  HG23 . VAL A 1 132 ? -8.306  -10.282 9.442   1.00 0.00 ? 132 VAL A HG23 1  
ATOM   2119   N  N    . GLU A 1 133 ? -11.671 -12.299 11.251  1.00 0.00 ? 133 GLU A N    1  
ATOM   2120   C  CA   . GLU A 1 133 ? -12.969 -11.984 10.583  1.00 0.00 ? 133 GLU A CA   1  
ATOM   2121   C  C    . GLU A 1 133 ? -13.566 -10.713 11.191  1.00 0.00 ? 133 GLU A C    1  
ATOM   2122   O  O    . GLU A 1 133 ? -13.553 -10.526 12.392  1.00 0.00 ? 133 GLU A O    1  
ATOM   2123   C  CB   . GLU A 1 133 ? -13.941 -13.148 10.789  1.00 0.00 ? 133 GLU A CB   1  
ATOM   2124   C  CG   . GLU A 1 133 ? -15.252 -12.855 10.058  1.00 0.00 ? 133 GLU A CG   1  
ATOM   2125   C  CD   . GLU A 1 133 ? -16.090 -14.133 9.982   1.00 0.00 ? 133 GLU A CD   1  
ATOM   2126   O  OE1  . GLU A 1 133 ? -16.388 -14.684 11.029  1.00 0.00 ? 133 GLU A OE1  1  
ATOM   2127   O  OE2  . GLU A 1 133 ? -16.419 -14.537 8.880   1.00 0.00 ? 133 GLU A OE2  1  
ATOM   2128   H  H    . GLU A 1 133 ? -11.654 -12.530 12.202  1.00 0.00 ? 133 GLU A H    1  
ATOM   2129   H  HA   . GLU A 1 133 ? -12.807 -11.835 9.531   1.00 0.00 ? 133 GLU A HA   1  
ATOM   2130   H  HB2  . GLU A 1 133 ? -13.503 -14.056 10.397  1.00 0.00 ? 133 GLU A HB2  1  
ATOM   2131   H  HB3  . GLU A 1 133 ? -14.138 -13.270 11.844  1.00 0.00 ? 133 GLU A HB3  1  
ATOM   2132   H  HG2  . GLU A 1 133 ? -15.800 -12.094 10.594  1.00 0.00 ? 133 GLU A HG2  1  
ATOM   2133   H  HG3  . GLU A 1 133 ? -15.038 -12.508 9.058   1.00 0.00 ? 133 GLU A HG3  1  
ATOM   2134   N  N    . ASP A 1 134 ? -14.094 -9.835  10.376  1.00 0.00 ? 134 ASP A N    1  
ATOM   2135   C  CA   . ASP A 1 134 ? -14.687 -8.583  10.934  1.00 0.00 ? 134 ASP A CA   1  
ATOM   2136   C  C    . ASP A 1 134 ? -15.375 -7.766  9.831   1.00 0.00 ? 134 ASP A C    1  
ATOM   2137   O  O    . ASP A 1 134 ? -14.956 -7.756  8.691   1.00 0.00 ? 134 ASP A O    1  
ATOM   2138   C  CB   . ASP A 1 134 ? -13.579 -7.738  11.567  1.00 0.00 ? 134 ASP A CB   1  
ATOM   2139   C  CG   . ASP A 1 134 ? -14.164 -6.888  12.696  1.00 0.00 ? 134 ASP A CG   1  
ATOM   2140   O  OD1  . ASP A 1 134 ? -15.072 -6.119  12.424  1.00 0.00 ? 134 ASP A OD1  1  
ATOM   2141   O  OD2  . ASP A 1 134 ? -13.696 -7.020  13.815  1.00 0.00 ? 134 ASP A OD2  1  
ATOM   2142   H  H    . ASP A 1 134 ? -14.097 -9.999  9.408   1.00 0.00 ? 134 ASP A H    1  
ATOM   2143   H  HA   . ASP A 1 134 ? -15.412 -8.840  11.692  1.00 0.00 ? 134 ASP A HA   1  
ATOM   2144   H  HB2  . ASP A 1 134 ? -12.813 -8.388  11.963  1.00 0.00 ? 134 ASP A HB2  1  
ATOM   2145   H  HB3  . ASP A 1 134 ? -13.149 -7.090  10.817  1.00 0.00 ? 134 ASP A HB3  1  
ATOM   2146   N  N    . GLU A 1 135 ? -16.422 -7.064  10.183  1.00 0.00 ? 135 GLU A N    1  
ATOM   2147   C  CA   . GLU A 1 135 ? -17.150 -6.215  9.192   1.00 0.00 ? 135 GLU A CA   1  
ATOM   2148   C  C    . GLU A 1 135 ? -17.627 -7.051  8.000   1.00 0.00 ? 135 GLU A C    1  
ATOM   2149   O  O    . GLU A 1 135 ? -17.820 -6.538  6.916   1.00 0.00 ? 135 GLU A O    1  
ATOM   2150   C  CB   . GLU A 1 135 ? -16.223 -5.105  8.692   1.00 0.00 ? 135 GLU A CB   1  
ATOM   2151   C  CG   . GLU A 1 135 ? -16.311 -3.899  9.630   1.00 0.00 ? 135 GLU A CG   1  
ATOM   2152   C  CD   . GLU A 1 135 ? -15.479 -2.748  9.063   1.00 0.00 ? 135 GLU A CD   1  
ATOM   2153   O  OE1  . GLU A 1 135 ? -14.265 -2.829  9.139   1.00 0.00 ? 135 GLU A OE1  1  
ATOM   2154   O  OE2  . GLU A 1 135 ? -16.071 -1.806  8.562   1.00 0.00 ? 135 GLU A OE2  1  
ATOM   2155   H  H    . GLU A 1 135 ? -16.724 -7.083  11.115  1.00 0.00 ? 135 GLU A H    1  
ATOM   2156   H  HA   . GLU A 1 135 ? -18.007 -5.769  9.672   1.00 0.00 ? 135 GLU A HA   1  
ATOM   2157   H  HB2  . GLU A 1 135 ? -15.205 -5.470  8.669   1.00 0.00 ? 135 GLU A HB2  1  
ATOM   2158   H  HB3  . GLU A 1 135 ? -16.521 -4.807  7.697   1.00 0.00 ? 135 GLU A HB3  1  
ATOM   2159   H  HG2  . GLU A 1 135 ? -17.342 -3.589  9.721   1.00 0.00 ? 135 GLU A HG2  1  
ATOM   2160   H  HG3  . GLU A 1 135 ? -15.930 -4.171  10.603  1.00 0.00 ? 135 GLU A HG3  1  
ATOM   2161   N  N    . GLY A 1 136 ? -17.814 -8.327  8.180   1.00 0.00 ? 136 GLY A N    1  
ATOM   2162   C  CA   . GLY A 1 136 ? -18.271 -9.170  7.039   1.00 0.00 ? 136 GLY A CA   1  
ATOM   2163   C  C    . GLY A 1 136 ? -17.088 -9.427  6.110   1.00 0.00 ? 136 GLY A C    1  
ATOM   2164   O  O    . GLY A 1 136 ? -17.233 -9.940  5.018   1.00 0.00 ? 136 GLY A O    1  
ATOM   2165   H  H    . GLY A 1 136 ? -17.643 -8.731  9.055   1.00 0.00 ? 136 GLY A H    1  
ATOM   2166   H  HA2  . GLY A 1 136 ? -18.651 -10.111 7.415   1.00 0.00 ? 136 GLY A HA2  1  
ATOM   2167   H  HA3  . GLY A 1 136 ? -19.049 -8.654  6.496   1.00 0.00 ? 136 GLY A HA3  1  
ATOM   2168   N  N    . ARG A 1 137 ? -15.915 -9.080  6.552   1.00 0.00 ? 137 ARG A N    1  
ATOM   2169   C  CA   . ARG A 1 137 ? -14.694 -9.300  5.732   1.00 0.00 ? 137 ARG A CA   1  
ATOM   2170   C  C    . ARG A 1 137 ? -13.892 -10.416 6.390   1.00 0.00 ? 137 ARG A C    1  
ATOM   2171   O  O    . ARG A 1 137 ? -14.188 -10.808 7.502   1.00 0.00 ? 137 ARG A O    1  
ATOM   2172   C  CB   . ARG A 1 137 ? -13.870 -8.013  5.721   1.00 0.00 ? 137 ARG A CB   1  
ATOM   2173   C  CG   . ARG A 1 137 ? -14.722 -6.867  5.173   1.00 0.00 ? 137 ARG A CG   1  
ATOM   2174   C  CD   . ARG A 1 137 ? -13.882 -5.591  5.105   1.00 0.00 ? 137 ARG A CD   1  
ATOM   2175   N  NE   . ARG A 1 137 ? -14.626 -4.546  4.345   1.00 0.00 ? 137 ARG A NE   1  
ATOM   2176   C  CZ   . ARG A 1 137 ? -14.379 -3.283  4.560   1.00 0.00 ? 137 ARG A CZ   1  
ATOM   2177   N  NH1  . ARG A 1 137 ? -13.476 -2.933  5.435   1.00 0.00 ? 137 ARG A NH1  1  
ATOM   2178   N  NH2  . ARG A 1 137 ? -15.037 -2.369  3.900   1.00 0.00 ? 137 ARG A NH2  1  
ATOM   2179   H  H    . ARG A 1 137 ? -15.831 -8.681  7.443   1.00 0.00 ? 137 ARG A H    1  
ATOM   2180   H  HA   . ARG A 1 137 ? -14.966 -9.579  4.725   1.00 0.00 ? 137 ARG A HA   1  
ATOM   2181   H  HB2  . ARG A 1 137 ? -13.564 -7.780  6.730   1.00 0.00 ? 137 ARG A HB2  1  
ATOM   2182   H  HB3  . ARG A 1 137 ? -12.998 -8.147  5.103   1.00 0.00 ? 137 ARG A HB3  1  
ATOM   2183   H  HG2  . ARG A 1 137 ? -15.077 -7.121  4.184   1.00 0.00 ? 137 ARG A HG2  1  
ATOM   2184   H  HG3  . ARG A 1 137 ? -15.566 -6.703  5.825   1.00 0.00 ? 137 ARG A HG3  1  
ATOM   2185   H  HD2  . ARG A 1 137 ? -13.685 -5.236  6.105   1.00 0.00 ? 137 ARG A HD2  1  
ATOM   2186   H  HD3  . ARG A 1 137 ? -12.946 -5.799  4.606   1.00 0.00 ? 137 ARG A HD3  1  
ATOM   2187   H  HE   . ARG A 1 137 ? -15.304 -4.809  3.688   1.00 0.00 ? 137 ARG A HE   1  
ATOM   2188   H  HH11 . ARG A 1 137 ? -12.974 -3.634  5.942   1.00 0.00 ? 137 ARG A HH11 1  
ATOM   2189   H  HH12 . ARG A 1 137 ? -13.285 -1.966  5.597   1.00 0.00 ? 137 ARG A HH12 1  
ATOM   2190   H  HH21 . ARG A 1 137 ? -15.731 -2.636  3.232   1.00 0.00 ? 137 ARG A HH21 1  
ATOM   2191   H  HH22 . ARG A 1 137 ? -14.846 -1.401  4.063   1.00 0.00 ? 137 ARG A HH22 1  
ATOM   2192   N  N    . LEU A 1 138 ? -12.876 -10.941 5.757   1.00 0.00 ? 138 LEU A N    1  
ATOM   2193   C  CA   . LEU A 1 138 ? -12.099 -12.019 6.426   1.00 0.00 ? 138 LEU A CA   1  
ATOM   2194   C  C    . LEU A 1 138 ? -10.718 -12.118 5.776   1.00 0.00 ? 138 LEU A C    1  
ATOM   2195   O  O    . LEU A 1 138 ? -10.548 -11.802 4.616   1.00 0.00 ? 138 LEU A O    1  
ATOM   2196   C  CB   . LEU A 1 138 ? -12.847 -13.352 6.289   1.00 0.00 ? 138 LEU A CB   1  
ATOM   2197   C  CG   . LEU A 1 138 ? -12.233 -14.400 7.233   1.00 0.00 ? 138 LEU A CG   1  
ATOM   2198   C  CD1  . LEU A 1 138 ? -13.256 -15.506 7.494   1.00 0.00 ? 138 LEU A CD1  1  
ATOM   2199   C  CD2  . LEU A 1 138 ? -10.972 -15.019 6.612   1.00 0.00 ? 138 LEU A CD2  1  
ATOM   2200   H  H    . LEU A 1 138 ? -12.589 -10.644 4.864   1.00 0.00 ? 138 LEU A H    1  
ATOM   2201   H  HA   . LEU A 1 138 ? -11.984 -11.775 7.468   1.00 0.00 ? 138 LEU A HA   1  
ATOM   2202   H  HB2  . LEU A 1 138 ? -13.884 -13.202 6.552   1.00 0.00 ? 138 LEU A HB2  1  
ATOM   2203   H  HB3  . LEU A 1 138 ? -12.786 -13.699 5.270   1.00 0.00 ? 138 LEU A HB3  1  
ATOM   2204   H  HG   . LEU A 1 138 ? -11.979 -13.929 8.172   1.00 0.00 ? 138 LEU A HG   1  
ATOM   2205   H  HD11 . LEU A 1 138 ? -12.740 -16.430 7.713   1.00 0.00 ? 138 LEU A HD11 1  
ATOM   2206   H  HD12 . LEU A 1 138 ? -13.875 -15.639 6.619   1.00 0.00 ? 138 LEU A HD12 1  
ATOM   2207   H  HD13 . LEU A 1 138 ? -13.876 -15.233 8.335   1.00 0.00 ? 138 LEU A HD13 1  
ATOM   2208   H  HD21 . LEU A 1 138 ? -10.822 -14.638 5.614   1.00 0.00 ? 138 LEU A HD21 1  
ATOM   2209   H  HD22 . LEU A 1 138 ? -11.083 -16.092 6.571   1.00 0.00 ? 138 LEU A HD22 1  
ATOM   2210   H  HD23 . LEU A 1 138 ? -10.115 -14.772 7.223   1.00 0.00 ? 138 LEU A HD23 1  
ATOM   2211   N  N    . ILE A 1 139 ? -9.731  -12.563 6.506   1.00 0.00 ? 139 ILE A N    1  
ATOM   2212   C  CA   . ILE A 1 139 ? -8.365  -12.692 5.920   1.00 0.00 ? 139 ILE A CA   1  
ATOM   2213   C  C    . ILE A 1 139 ? -7.657  -13.866 6.601   1.00 0.00 ? 139 ILE A C    1  
ATOM   2214   O  O    . ILE A 1 139 ? -7.783  -14.064 7.793   1.00 0.00 ? 139 ILE A O    1  
ATOM   2215   C  CB   . ILE A 1 139 ? -7.569  -11.402 6.157   1.00 0.00 ? 139 ILE A CB   1  
ATOM   2216   C  CG1  . ILE A 1 139 ? -8.292  -10.224 5.494   1.00 0.00 ? 139 ILE A CG1  1  
ATOM   2217   C  CG2  . ILE A 1 139 ? -6.166  -11.543 5.557   1.00 0.00 ? 139 ILE A CG2  1  
ATOM   2218   C  CD1  . ILE A 1 139 ? -7.448  -8.955  5.632   1.00 0.00 ? 139 ILE A CD1  1  
ATOM   2219   H  H    . ILE A 1 139 ? -9.879  -12.830 7.440   1.00 0.00 ? 139 ILE A H    1  
ATOM   2220   H  HA   . ILE A 1 139 ? -8.444  -12.883 4.860   1.00 0.00 ? 139 ILE A HA   1  
ATOM   2221   H  HB   . ILE A 1 139 ? -7.486  -11.221 7.218   1.00 0.00 ? 139 ILE A HB   1  
ATOM   2222   H  HG12 . ILE A 1 139 ? -8.449  -10.442 4.448   1.00 0.00 ? 139 ILE A HG12 1  
ATOM   2223   H  HG13 . ILE A 1 139 ? -9.245  -10.070 5.975   1.00 0.00 ? 139 ILE A HG13 1  
ATOM   2224   H  HG21 . ILE A 1 139 ? -6.059  -10.867 4.725   1.00 0.00 ? 139 ILE A HG21 1  
ATOM   2225   H  HG22 . ILE A 1 139 ? -6.016  -12.555 5.216   1.00 0.00 ? 139 ILE A HG22 1  
ATOM   2226   H  HG23 . ILE A 1 139 ? -5.428  -11.305 6.310   1.00 0.00 ? 139 ILE A HG23 1  
ATOM   2227   H  HD11 . ILE A 1 139 ? -8.079  -8.087  5.509   1.00 0.00 ? 139 ILE A HD11 1  
ATOM   2228   H  HD12 . ILE A 1 139 ? -6.679  -8.951  4.873   1.00 0.00 ? 139 ILE A HD12 1  
ATOM   2229   H  HD13 . ILE A 1 139 ? -6.988  -8.932  6.609   1.00 0.00 ? 139 ILE A HD13 1  
ATOM   2230   N  N    . LYS A 1 140 ? -6.923  -14.654 5.857   1.00 0.00 ? 140 LYS A N    1  
ATOM   2231   C  CA   . LYS A 1 140 ? -6.224  -15.818 6.474   1.00 0.00 ? 140 LYS A CA   1  
ATOM   2232   C  C    . LYS A 1 140 ? -4.742  -15.797 6.104   1.00 0.00 ? 140 LYS A C    1  
ATOM   2233   O  O    . LYS A 1 140 ? -4.373  -15.464 4.995   1.00 0.00 ? 140 LYS A O    1  
ATOM   2234   C  CB   . LYS A 1 140 ? -6.849  -17.113 5.955   1.00 0.00 ? 140 LYS A CB   1  
ATOM   2235   C  CG   . LYS A 1 140 ? -6.049  -18.307 6.480   1.00 0.00 ? 140 LYS A CG   1  
ATOM   2236   C  CD   . LYS A 1 140 ? -6.911  -19.569 6.421   1.00 0.00 ? 140 LYS A CD   1  
ATOM   2237   C  CE   . LYS A 1 140 ? -6.174  -20.718 7.110   1.00 0.00 ? 140 LYS A CE   1  
ATOM   2238   N  NZ   . LYS A 1 140 ? -5.070  -21.198 6.230   1.00 0.00 ? 140 LYS A NZ   1  
ATOM   2239   H  H    . LYS A 1 140 ? -6.837  -14.487 4.893   1.00 0.00 ? 140 LYS A H    1  
ATOM   2240   H  HA   . LYS A 1 140 ? -6.325  -15.777 7.547   1.00 0.00 ? 140 LYS A HA   1  
ATOM   2241   H  HB2  . LYS A 1 140 ? -7.871  -17.180 6.296   1.00 0.00 ? 140 LYS A HB2  1  
ATOM   2242   H  HB3  . LYS A 1 140 ? -6.829  -17.115 4.876   1.00 0.00 ? 140 LYS A HB3  1  
ATOM   2243   H  HG2  . LYS A 1 140 ? -5.168  -18.444 5.871   1.00 0.00 ? 140 LYS A HG2  1  
ATOM   2244   H  HG3  . LYS A 1 140 ? -5.755  -18.121 7.502   1.00 0.00 ? 140 LYS A HG3  1  
ATOM   2245   H  HD2  . LYS A 1 140 ? -7.849  -19.388 6.924   1.00 0.00 ? 140 LYS A HD2  1  
ATOM   2246   H  HD3  . LYS A 1 140 ? -7.098  -19.830 5.390   1.00 0.00 ? 140 LYS A HD3  1  
ATOM   2247   H  HE2  . LYS A 1 140 ? -5.762  -20.372 8.046   1.00 0.00 ? 140 LYS A HE2  1  
ATOM   2248   H  HE3  . LYS A 1 140 ? -6.863  -21.528 7.297   1.00 0.00 ? 140 LYS A HE3  1  
ATOM   2249   H  HZ1  . LYS A 1 140 ? -5.132  -20.724 5.307   1.00 0.00 ? 140 LYS A HZ1  1  
ATOM   2250   H  HZ2  . LYS A 1 140 ? -5.153  -22.227 6.101   1.00 0.00 ? 140 LYS A HZ2  1  
ATOM   2251   H  HZ3  . LYS A 1 140 ? -4.155  -20.976 6.670   1.00 0.00 ? 140 LYS A HZ3  1  
ATOM   2252   N  N    . ALA A 1 141 ? -3.894  -16.175 7.022   1.00 0.00 ? 141 ALA A N    1  
ATOM   2253   C  CA   . ALA A 1 141 ? -2.434  -16.207 6.731   1.00 0.00 ? 141 ALA A CA   1  
ATOM   2254   C  C    . ALA A 1 141 ? -1.932  -17.633 6.942   1.00 0.00 ? 141 ALA A C    1  
ATOM   2255   O  O    . ALA A 1 141 ? -2.402  -18.343 7.810   1.00 0.00 ? 141 ALA A O    1  
ATOM   2256   C  CB   . ALA A 1 141 ? -1.691  -15.262 7.674   1.00 0.00 ? 141 ALA A CB   1  
ATOM   2257   H  H    . ALA A 1 141 ? -4.218  -16.459 7.904   1.00 0.00 ? 141 ALA A H    1  
ATOM   2258   H  HA   . ALA A 1 141 ? -2.258  -15.909 5.710   1.00 0.00 ? 141 ALA A HA   1  
ATOM   2259   H  HB1  . ALA A 1 141 ? -2.352  -14.464 7.978   1.00 0.00 ? 141 ALA A HB1  1  
ATOM   2260   H  HB2  . ALA A 1 141 ? -0.834  -14.846 7.165   1.00 0.00 ? 141 ALA A HB2  1  
ATOM   2261   H  HB3  . ALA A 1 141 ? -1.360  -15.808 8.542   1.00 0.00 ? 141 ALA A HB3  1  
ATOM   2262   N  N    . GLU A 1 142 ? -0.991  -18.064 6.152   1.00 0.00 ? 142 GLU A N    1  
ATOM   2263   C  CA   . GLU A 1 142 ? -0.468  -19.451 6.300   1.00 0.00 ? 142 GLU A CA   1  
ATOM   2264   C  C    . GLU A 1 142 ? 1.043   -19.437 6.027   1.00 0.00 ? 142 GLU A C    1  
ATOM   2265   O  O    . GLU A 1 142 ? 1.490   -18.767 5.119   1.00 0.00 ? 142 GLU A O    1  
ATOM   2266   C  CB   . GLU A 1 142 ? -1.168  -20.350 5.273   1.00 0.00 ? 142 GLU A CB   1  
ATOM   2267   C  CG   . GLU A 1 142 ? -1.172  -21.806 5.745   1.00 0.00 ? 142 GLU A CG   1  
ATOM   2268   C  CD   . GLU A 1 142 ? -2.145  -22.617 4.885   1.00 0.00 ? 142 GLU A CD   1  
ATOM   2269   O  OE1  . GLU A 1 142 ? -2.022  -22.559 3.672   1.00 0.00 ? 142 GLU A OE1  1  
ATOM   2270   O  OE2  . GLU A 1 142 ? -2.995  -23.280 5.454   1.00 0.00 ? 142 GLU A OE2  1  
ATOM   2271   H  H    . GLU A 1 142 ? -0.632  -17.477 5.453   1.00 0.00 ? 142 GLU A H    1  
ATOM   2272   H  HA   . GLU A 1 142 ? -0.669  -19.803 7.300   1.00 0.00 ? 142 GLU A HA   1  
ATOM   2273   H  HB2  . GLU A 1 142 ? -2.187  -20.015 5.142   1.00 0.00 ? 142 GLU A HB2  1  
ATOM   2274   H  HB3  . GLU A 1 142 ? -0.648  -20.283 4.328   1.00 0.00 ? 142 GLU A HB3  1  
ATOM   2275   H  HG2  . GLU A 1 142 ? -0.179  -22.220 5.646   1.00 0.00 ? 142 GLU A HG2  1  
ATOM   2276   H  HG3  . GLU A 1 142 ? -1.485  -21.854 6.776   1.00 0.00 ? 142 GLU A HG3  1  
ATOM   2277   N  N    . PRO A 1 143 ? 1.836   -20.156 6.789   1.00 0.00 ? 143 PRO A N    1  
ATOM   2278   C  CA   . PRO A 1 143 ? 3.309   -20.181 6.571   1.00 0.00 ? 143 PRO A CA   1  
ATOM   2279   C  C    . PRO A 1 143 ? 3.665   -20.635 5.151   1.00 0.00 ? 143 PRO A C    1  
ATOM   2280   O  O    . PRO A 1 143 ? 2.975   -21.439 4.557   1.00 0.00 ? 143 PRO A O    1  
ATOM   2281   C  CB   . PRO A 1 143 ? 3.841   -21.175 7.615   1.00 0.00 ? 143 PRO A CB   1  
ATOM   2282   C  CG   . PRO A 1 143 ? 2.651   -21.918 8.129   1.00 0.00 ? 143 PRO A CG   1  
ATOM   2283   C  CD   . PRO A 1 143 ? 1.440   -21.013 7.922   1.00 0.00 ? 143 PRO A CD   1  
ATOM   2284   H  HA   . PRO A 1 143 ? 3.727   -19.206 6.762   1.00 0.00 ? 143 PRO A HA   1  
ATOM   2285   H  HB2  . PRO A 1 143 ? 4.540   -21.859 7.156   1.00 0.00 ? 143 PRO A HB2  1  
ATOM   2286   H  HB3  . PRO A 1 143 ? 4.317   -20.646 8.424   1.00 0.00 ? 143 PRO A HB3  1  
ATOM   2287   H  HG2  . PRO A 1 143 ? 2.527   -22.840 7.577   1.00 0.00 ? 143 PRO A HG2  1  
ATOM   2288   H  HG3  . PRO A 1 143 ? 2.771   -22.127 9.179   1.00 0.00 ? 143 PRO A HG3  1  
ATOM   2289   H  HD2  . PRO A 1 143 ? 0.575   -21.608 7.678   1.00 0.00 ? 143 PRO A HD2  1  
ATOM   2290   H  HD3  . PRO A 1 143 ? 1.258   -20.413 8.800   1.00 0.00 ? 143 PRO A HD3  1  
ATOM   2291   N  N    . SER A 1 144 ? 4.742   -20.135 4.608   1.00 0.00 ? 144 SER A N    1  
ATOM   2292   C  CA   . SER A 1 144 ? 5.144   -20.549 3.232   1.00 0.00 ? 144 SER A CA   1  
ATOM   2293   C  C    . SER A 1 144 ? 6.573   -20.083 2.959   1.00 0.00 ? 144 SER A C    1  
ATOM   2294   O  O    . SER A 1 144 ? 7.057   -19.146 3.562   1.00 0.00 ? 144 SER A O    1  
ATOM   2295   C  CB   . SER A 1 144 ? 4.203   -19.926 2.203   1.00 0.00 ? 144 SER A CB   1  
ATOM   2296   O  OG   . SER A 1 144 ? 4.108   -20.785 1.075   1.00 0.00 ? 144 SER A OG   1  
ATOM   2297   H  H    . SER A 1 144 ? 5.297   -19.501 5.111   1.00 0.00 ? 144 SER A H    1  
ATOM   2298   H  HA   . SER A 1 144 ? 5.098   -21.627 3.155   1.00 0.00 ? 144 SER A HA   1  
ATOM   2299   H  HB2  . SER A 1 144 ? 3.225   -19.799 2.634   1.00 0.00 ? 144 SER A HB2  1  
ATOM   2300   H  HB3  . SER A 1 144 ? 4.590   -18.961 1.899   1.00 0.00 ? 144 SER A HB3  1  
ATOM   2301   H  HG   . SER A 1 144 ? 4.443   -20.310 0.311   1.00 0.00 ? 144 SER A HG   1  
ATOM   2302   N  N    . ASP A 1 145 ? 7.254   -20.733 2.056   1.00 0.00 ? 145 ASP A N    1  
ATOM   2303   C  CA   . ASP A 1 145 ? 8.654   -20.331 1.746   1.00 0.00 ? 145 ASP A CA   1  
ATOM   2304   C  C    . ASP A 1 145 ? 8.655   -19.237 0.675   1.00 0.00 ? 145 ASP A C    1  
ATOM   2305   O  O    . ASP A 1 145 ? 9.695   -18.759 0.269   1.00 0.00 ? 145 ASP A O    1  
ATOM   2306   C  CB   . ASP A 1 145 ? 9.426   -21.547 1.231   1.00 0.00 ? 145 ASP A CB   1  
ATOM   2307   C  CG   . ASP A 1 145 ? 8.911   -21.926 -0.159  1.00 0.00 ? 145 ASP A CG   1  
ATOM   2308   O  OD1  . ASP A 1 145 ? 7.859   -22.539 -0.231  1.00 0.00 ? 145 ASP A OD1  1  
ATOM   2309   O  OD2  . ASP A 1 145 ? 9.576   -21.594 -1.126  1.00 0.00 ? 145 ASP A OD2  1  
ATOM   2310   H  H    . ASP A 1 145 ? 6.846   -21.488 1.583   1.00 0.00 ? 145 ASP A H    1  
ATOM   2311   H  HA   . ASP A 1 145 ? 9.127   -19.958 2.642   1.00 0.00 ? 145 ASP A HA   1  
ATOM   2312   H  HB2  . ASP A 1 145 ? 10.479  -21.306 1.173   1.00 0.00 ? 145 ASP A HB2  1  
ATOM   2313   H  HB3  . ASP A 1 145 ? 9.283   -22.377 1.905   1.00 0.00 ? 145 ASP A HB3  1  
ATOM   2314   N  N    . THR A 1 146 ? 7.500   -18.835 0.214   1.00 0.00 ? 146 THR A N    1  
ATOM   2315   C  CA   . THR A 1 146 ? 7.450   -17.771 -0.830  1.00 0.00 ? 146 THR A CA   1  
ATOM   2316   C  C    . THR A 1 146 ? 6.349   -16.768 -0.486  1.00 0.00 ? 146 THR A C    1  
ATOM   2317   O  O    . THR A 1 146 ? 5.361   -17.103 0.135   1.00 0.00 ? 146 THR A O    1  
ATOM   2318   C  CB   . THR A 1 146 ? 7.161   -18.405 -2.192  1.00 0.00 ? 146 THR A CB   1  
ATOM   2319   O  OG1  . THR A 1 146 ? 5.774   -18.699 -2.292  1.00 0.00 ? 146 THR A OG1  1  
ATOM   2320   C  CG2  . THR A 1 146 ? 7.971   -19.693 -2.338  1.00 0.00 ? 146 THR A CG2  1  
ATOM   2321   H  H    . THR A 1 146 ? 6.669   -19.230 0.555   1.00 0.00 ? 146 THR A H    1  
ATOM   2322   H  HA   . THR A 1 146 ? 8.400   -17.259 -0.867  1.00 0.00 ? 146 THR A HA   1  
ATOM   2323   H  HB   . THR A 1 146 ? 7.441   -17.718 -2.976  1.00 0.00 ? 146 THR A HB   1  
ATOM   2324   H  HG1  . THR A 1 146 ? 5.678   -19.494 -2.822  1.00 0.00 ? 146 THR A HG1  1  
ATOM   2325   H  HG21 . THR A 1 146 ? 7.988   -19.993 -3.375  1.00 0.00 ? 146 THR A HG21 1  
ATOM   2326   H  HG22 . THR A 1 146 ? 7.517   -20.474 -1.745  1.00 0.00 ? 146 THR A HG22 1  
ATOM   2327   H  HG23 . THR A 1 146 ? 8.982   -19.524 -1.995  1.00 0.00 ? 146 THR A HG23 1  
ATOM   2328   N  N    . LEU A 1 147 ? 6.514   -15.535 -0.882  1.00 0.00 ? 147 LEU A N    1  
ATOM   2329   C  CA   . LEU A 1 147 ? 5.480   -14.510 -0.573  1.00 0.00 ? 147 LEU A CA   1  
ATOM   2330   C  C    . LEU A 1 147 ? 4.342   -14.603 -1.593  1.00 0.00 ? 147 LEU A C    1  
ATOM   2331   O  O    . LEU A 1 147 ? 4.531   -14.385 -2.772  1.00 0.00 ? 147 LEU A O    1  
ATOM   2332   C  CB   . LEU A 1 147 ? 6.109   -13.116 -0.634  1.00 0.00 ? 147 LEU A CB   1  
ATOM   2333   C  CG   . LEU A 1 147 ? 5.019   -12.052 -0.475  1.00 0.00 ? 147 LEU A CG   1  
ATOM   2334   C  CD1  . LEU A 1 147 ? 4.200   -12.342 0.784   1.00 0.00 ? 147 LEU A CD1  1  
ATOM   2335   C  CD2  . LEU A 1 147 ? 5.671   -10.671 -0.352  1.00 0.00 ? 147 LEU A CD2  1  
ATOM   2336   H  H    . LEU A 1 147 ? 7.320   -15.283 -1.378  1.00 0.00 ? 147 LEU A H    1  
ATOM   2337   H  HA   . LEU A 1 147 ? 5.089   -14.685 0.418   1.00 0.00 ? 147 LEU A HA   1  
ATOM   2338   H  HB2  . LEU A 1 147 ? 6.832   -13.012 0.162   1.00 0.00 ? 147 LEU A HB2  1  
ATOM   2339   H  HB3  . LEU A 1 147 ? 6.601   -12.984 -1.585  1.00 0.00 ? 147 LEU A HB3  1  
ATOM   2340   H  HG   . LEU A 1 147 ? 4.371   -12.070 -1.338  1.00 0.00 ? 147 LEU A HG   1  
ATOM   2341   H  HD11 . LEU A 1 147 ? 4.852   -12.714 1.560   1.00 0.00 ? 147 LEU A HD11 1  
ATOM   2342   H  HD12 . LEU A 1 147 ? 3.449   -13.084 0.561   1.00 0.00 ? 147 LEU A HD12 1  
ATOM   2343   H  HD13 . LEU A 1 147 ? 3.721   -11.434 1.121   1.00 0.00 ? 147 LEU A HD13 1  
ATOM   2344   H  HD21 . LEU A 1 147 ? 6.103   -10.391 -1.302  1.00 0.00 ? 147 LEU A HD21 1  
ATOM   2345   H  HD22 . LEU A 1 147 ? 6.446   -10.704 0.400   1.00 0.00 ? 147 LEU A HD22 1  
ATOM   2346   H  HD23 . LEU A 1 147 ? 4.923   -9.946  -0.068  1.00 0.00 ? 147 LEU A HD23 1  
ATOM   2347   N  N    . GLU A 1 148 ? 3.163   -14.922 -1.141  1.00 0.00 ? 148 GLU A N    1  
ATOM   2348   C  CA   . GLU A 1 148 ? 2.003   -15.026 -2.070  1.00 0.00 ? 148 GLU A CA   1  
ATOM   2349   C  C    . GLU A 1 148 ? 0.779   -14.399 -1.401  1.00 0.00 ? 148 GLU A C    1  
ATOM   2350   O  O    . GLU A 1 148 ? 0.514   -14.634 -0.238  1.00 0.00 ? 148 GLU A O    1  
ATOM   2351   C  CB   . GLU A 1 148 ? 1.726   -16.501 -2.376  1.00 0.00 ? 148 GLU A CB   1  
ATOM   2352   C  CG   . GLU A 1 148 ? 0.416   -16.628 -3.155  1.00 0.00 ? 148 GLU A CG   1  
ATOM   2353   C  CD   . GLU A 1 148 ? 0.386   -17.971 -3.888  1.00 0.00 ? 148 GLU A CD   1  
ATOM   2354   O  OE1  . GLU A 1 148 ? 0.881   -18.028 -5.001  1.00 0.00 ? 148 GLU A OE1  1  
ATOM   2355   O  OE2  . GLU A 1 148 ? -0.130  -18.921 -3.322  1.00 0.00 ? 148 GLU A OE2  1  
ATOM   2356   H  H    . GLU A 1 148 ? 3.037   -15.089 -0.183  1.00 0.00 ? 148 GLU A H    1  
ATOM   2357   H  HA   . GLU A 1 148 ? 2.224   -14.500 -2.987  1.00 0.00 ? 148 GLU A HA   1  
ATOM   2358   H  HB2  . GLU A 1 148 ? 2.536   -16.904 -2.964  1.00 0.00 ? 148 GLU A HB2  1  
ATOM   2359   H  HB3  . GLU A 1 148 ? 1.645   -17.050 -1.451  1.00 0.00 ? 148 GLU A HB3  1  
ATOM   2360   H  HG2  . GLU A 1 148 ? -0.418  -16.572 -2.470  1.00 0.00 ? 148 GLU A HG2  1  
ATOM   2361   H  HG3  . GLU A 1 148 ? 0.344   -15.827 -3.875  1.00 0.00 ? 148 GLU A HG3  1  
ATOM   2362   N  N    . VAL A 1 149 ? 0.037   -13.598 -2.115  1.00 0.00 ? 149 VAL A N    1  
ATOM   2363   C  CA   . VAL A 1 149 ? -1.164  -12.951 -1.505  1.00 0.00 ? 149 VAL A CA   1  
ATOM   2364   C  C    . VAL A 1 149 ? -2.348  -13.061 -2.468  1.00 0.00 ? 149 VAL A C    1  
ATOM   2365   O  O    . VAL A 1 149 ? -2.270  -12.643 -3.607  1.00 0.00 ? 149 VAL A O    1  
ATOM   2366   C  CB   . VAL A 1 149 ? -0.863  -11.474 -1.247  1.00 0.00 ? 149 VAL A CB   1  
ATOM   2367   C  CG1  . VAL A 1 149 ? -2.162  -10.741 -0.909  1.00 0.00 ? 149 VAL A CG1  1  
ATOM   2368   C  CG2  . VAL A 1 149 ? 0.113   -11.349 -0.075  1.00 0.00 ? 149 VAL A CG2  1  
ATOM   2369   H  H    . VAL A 1 149 ? 0.266   -13.411 -3.051  1.00 0.00 ? 149 VAL A H    1  
ATOM   2370   H  HA   . VAL A 1 149 ? -1.406  -13.438 -0.570  1.00 0.00 ? 149 VAL A HA   1  
ATOM   2371   H  HB   . VAL A 1 149 ? -0.424  -11.037 -2.131  1.00 0.00 ? 149 VAL A HB   1  
ATOM   2372   H  HG11 . VAL A 1 149 ? -2.674  -10.476 -1.823  1.00 0.00 ? 149 VAL A HG11 1  
ATOM   2373   H  HG12 . VAL A 1 149 ? -1.934  -9.845  -0.352  1.00 0.00 ? 149 VAL A HG12 1  
ATOM   2374   H  HG13 . VAL A 1 149 ? -2.794  -11.383 -0.314  1.00 0.00 ? 149 VAL A HG13 1  
ATOM   2375   H  HG21 . VAL A 1 149 ? -0.441  -11.240 0.846   1.00 0.00 ? 149 VAL A HG21 1  
ATOM   2376   H  HG22 . VAL A 1 149 ? 0.740   -10.482 -0.221  1.00 0.00 ? 149 VAL A HG22 1  
ATOM   2377   H  HG23 . VAL A 1 149 ? 0.729   -12.234 -0.022  1.00 0.00 ? 149 VAL A HG23 1  
ATOM   2378   N  N    . THR A 1 150 ? -3.446  -13.617 -2.023  1.00 0.00 ? 150 THR A N    1  
ATOM   2379   C  CA   . THR A 1 150 ? -4.635  -13.749 -2.914  1.00 0.00 ? 150 THR A CA   1  
ATOM   2380   C  C    . THR A 1 150 ? -5.756  -12.843 -2.409  1.00 0.00 ? 150 THR A C    1  
ATOM   2381   O  O    . THR A 1 150 ? -6.006  -12.757 -1.223  1.00 0.00 ? 150 THR A O    1  
ATOM   2382   C  CB   . THR A 1 150 ? -5.110  -15.203 -2.922  1.00 0.00 ? 150 THR A CB   1  
ATOM   2383   O  OG1  . THR A 1 150 ? -4.107  -16.023 -3.505  1.00 0.00 ? 150 THR A OG1  1  
ATOM   2384   C  CG2  . THR A 1 150 ? -6.400  -15.317 -3.735  1.00 0.00 ? 150 THR A CG2  1  
ATOM   2385   H  H    . THR A 1 150 ? -3.488  -13.946 -1.100  1.00 0.00 ? 150 THR A H    1  
ATOM   2386   H  HA   . THR A 1 150 ? -4.368  -13.453 -3.913  1.00 0.00 ? 150 THR A HA   1  
ATOM   2387   H  HB   . THR A 1 150 ? -5.298  -15.527 -1.910  1.00 0.00 ? 150 THR A HB   1  
ATOM   2388   H  HG1  . THR A 1 150 ? -3.254  -15.623 -3.321  1.00 0.00 ? 150 THR A HG1  1  
ATOM   2389   H  HG21 . THR A 1 150 ? -7.235  -14.984 -3.136  1.00 0.00 ? 150 THR A HG21 1  
ATOM   2390   H  HG22 . THR A 1 150 ? -6.554  -16.346 -4.025  1.00 0.00 ? 150 THR A HG22 1  
ATOM   2391   H  HG23 . THR A 1 150 ? -6.325  -14.701 -4.619  1.00 0.00 ? 150 THR A HG23 1  
ATOM   2392   N  N    . TYR A 1 151 ? -6.430  -12.162 -3.301  1.00 0.00 ? 151 TYR A N    1  
ATOM   2393   C  CA   . TYR A 1 151 ? -7.532  -11.254 -2.871  1.00 0.00 ? 151 TYR A CA   1  
ATOM   2394   C  C    . TYR A 1 151 ? -8.818  -11.598 -3.619  1.00 0.00 ? 151 TYR A C    1  
ATOM   2395   O  O    . TYR A 1 151 ? -8.837  -11.689 -4.830  1.00 0.00 ? 151 TYR A O    1  
ATOM   2396   C  CB   . TYR A 1 151 ? -7.156  -9.806  -3.188  1.00 0.00 ? 151 TYR A CB   1  
ATOM   2397   C  CG   . TYR A 1 151 ? -8.378  -8.922  -3.053  1.00 0.00 ? 151 TYR A CG   1  
ATOM   2398   C  CD1  . TYR A 1 151 ? -9.127  -8.931  -1.868  1.00 0.00 ? 151 TYR A CD1  1  
ATOM   2399   C  CD2  . TYR A 1 151 ? -8.765  -8.093  -4.115  1.00 0.00 ? 151 TYR A CD2  1  
ATOM   2400   C  CE1  . TYR A 1 151 ? -10.257 -8.115  -1.747  1.00 0.00 ? 151 TYR A CE1  1  
ATOM   2401   C  CE2  . TYR A 1 151 ? -9.896  -7.276  -3.990  1.00 0.00 ? 151 TYR A CE2  1  
ATOM   2402   C  CZ   . TYR A 1 151 ? -10.641 -7.287  -2.807  1.00 0.00 ? 151 TYR A CZ   1  
ATOM   2403   O  OH   . TYR A 1 151 ? -11.754 -6.481  -2.685  1.00 0.00 ? 151 TYR A OH   1  
ATOM   2404   H  H    . TYR A 1 151 ? -6.208  -12.241 -4.254  1.00 0.00 ? 151 TYR A H    1  
ATOM   2405   H  HA   . TYR A 1 151 ? -7.693  -11.359 -1.810  1.00 0.00 ? 151 TYR A HA   1  
ATOM   2406   H  HB2  . TYR A 1 151 ? -6.392  -9.475  -2.505  1.00 0.00 ? 151 TYR A HB2  1  
ATOM   2407   H  HB3  . TYR A 1 151 ? -6.782  -9.746  -4.199  1.00 0.00 ? 151 TYR A HB3  1  
ATOM   2408   H  HD1  . TYR A 1 151 ? -8.833  -9.566  -1.049  1.00 0.00 ? 151 TYR A HD1  1  
ATOM   2409   H  HD2  . TYR A 1 151 ? -8.193  -8.084  -5.031  1.00 0.00 ? 151 TYR A HD2  1  
ATOM   2410   H  HE1  . TYR A 1 151 ? -10.835 -8.124  -0.835  1.00 0.00 ? 151 TYR A HE1  1  
ATOM   2411   H  HE2  . TYR A 1 151 ? -10.193 -6.636  -4.807  1.00 0.00 ? 151 TYR A HE2  1  
ATOM   2412   H  HH   . TYR A 1 151 ? -11.473 -5.570  -2.787  1.00 0.00 ? 151 TYR A HH   1  
ATOM   2413   N  N    . GLU A 1 152 ? -9.896  -11.765 -2.904  1.00 0.00 ? 152 GLU A N    1  
ATOM   2414   C  CA   . GLU A 1 152 ? -11.192 -12.074 -3.565  1.00 0.00 ? 152 GLU A CA   1  
ATOM   2415   C  C    . GLU A 1 152 ? -12.119 -10.870 -3.390  1.00 0.00 ? 152 GLU A C    1  
ATOM   2416   O  O    . GLU A 1 152 ? -12.657 -10.634 -2.326  1.00 0.00 ? 152 GLU A O    1  
ATOM   2417   C  CB   . GLU A 1 152 ? -11.820 -13.311 -2.921  1.00 0.00 ? 152 GLU A CB   1  
ATOM   2418   C  CG   . GLU A 1 152 ? -13.204 -13.556 -3.527  1.00 0.00 ? 152 GLU A CG   1  
ATOM   2419   C  CD   . GLU A 1 152 ? -13.703 -14.942 -3.112  1.00 0.00 ? 152 GLU A CD   1  
ATOM   2420   O  OE1  . GLU A 1 152 ? -12.935 -15.884 -3.222  1.00 0.00 ? 152 GLU A OE1  1  
ATOM   2421   O  OE2  . GLU A 1 152 ? -14.844 -15.037 -2.691  1.00 0.00 ? 152 GLU A OE2  1  
ATOM   2422   H  H    . GLU A 1 152 ? -9.855  -11.668 -1.930  1.00 0.00 ? 152 GLU A H    1  
ATOM   2423   H  HA   . GLU A 1 152 ? -11.028 -12.255 -4.618  1.00 0.00 ? 152 GLU A HA   1  
ATOM   2424   H  HB2  . GLU A 1 152 ? -11.190 -14.169 -3.103  1.00 0.00 ? 152 GLU A HB2  1  
ATOM   2425   H  HB3  . GLU A 1 152 ? -11.918 -13.153 -1.859  1.00 0.00 ? 152 GLU A HB3  1  
ATOM   2426   H  HG2  . GLU A 1 152 ? -13.892 -12.803 -3.172  1.00 0.00 ? 152 GLU A HG2  1  
ATOM   2427   H  HG3  . GLU A 1 152 ? -13.139 -13.507 -4.604  1.00 0.00 ? 152 GLU A HG3  1  
ATOM   2428   N  N    . GLY A 1 153 ? -12.294 -10.097 -4.423  1.00 0.00 ? 153 GLY A N    1  
ATOM   2429   C  CA   . GLY A 1 153 ? -13.170 -8.897  -4.316  1.00 0.00 ? 153 GLY A CA   1  
ATOM   2430   C  C    . GLY A 1 153 ? -14.550 -9.211  -4.893  1.00 0.00 ? 153 GLY A C    1  
ATOM   2431   O  O    . GLY A 1 153 ? -14.674 -9.883  -5.898  1.00 0.00 ? 153 GLY A O    1  
ATOM   2432   H  H    . GLY A 1 153 ? -11.838 -10.310 -5.265  1.00 0.00 ? 153 GLY A H    1  
ATOM   2433   H  HA2  . GLY A 1 153 ? -13.265 -8.611  -3.273  1.00 0.00 ? 153 GLY A HA2  1  
ATOM   2434   H  HA3  . GLY A 1 153 ? -12.730 -8.082  -4.875  1.00 0.00 ? 153 GLY A HA3  1  
ATOM   2435   N  N    . GLU A 1 154 ? -15.587 -8.723  -4.267  1.00 0.00 ? 154 GLU A N    1  
ATOM   2436   C  CA   . GLU A 1 154 ? -16.964 -8.979  -4.777  1.00 0.00 ? 154 GLU A CA   1  
ATOM   2437   C  C    . GLU A 1 154 ? -17.598 -7.649  -5.182  1.00 0.00 ? 154 GLU A C    1  
ATOM   2438   O  O    . GLU A 1 154 ? -18.046 -6.887  -4.350  1.00 0.00 ? 154 GLU A O    1  
ATOM   2439   C  CB   . GLU A 1 154 ? -17.803 -9.630  -3.676  1.00 0.00 ? 154 GLU A CB   1  
ATOM   2440   C  CG   . GLU A 1 154 ? -19.177 -10.001 -4.236  1.00 0.00 ? 154 GLU A CG   1  
ATOM   2441   C  CD   . GLU A 1 154 ? -20.250 -9.144  -3.564  1.00 0.00 ? 154 GLU A CD   1  
ATOM   2442   O  OE1  . GLU A 1 154 ? -20.226 -7.939  -3.760  1.00 0.00 ? 154 GLU A OE1  1  
ATOM   2443   O  OE2  . GLU A 1 154 ? -21.078 -9.704  -2.866  1.00 0.00 ? 154 GLU A OE2  1  
ATOM   2444   H  H    . GLU A 1 154 ? -15.458 -8.179  -3.462  1.00 0.00 ? 154 GLU A H    1  
ATOM   2445   H  HA   . GLU A 1 154 ? -16.918 -9.635  -5.633  1.00 0.00 ? 154 GLU A HA   1  
ATOM   2446   H  HB2  . GLU A 1 154 ? -17.304 -10.521 -3.322  1.00 0.00 ? 154 GLU A HB2  1  
ATOM   2447   H  HB3  . GLU A 1 154 ? -17.925 -8.935  -2.859  1.00 0.00 ? 154 GLU A HB3  1  
ATOM   2448   H  HG2  . GLU A 1 154 ? -19.190 -9.828  -5.302  1.00 0.00 ? 154 GLU A HG2  1  
ATOM   2449   H  HG3  . GLU A 1 154 ? -19.376 -11.045 -4.038  1.00 0.00 ? 154 GLU A HG3  1  
ATOM   2450   N  N    . PHE A 1 155 ? -17.630 -7.358  -6.453  1.00 0.00 ? 155 PHE A N    1  
ATOM   2451   C  CA   . PHE A 1 155 ? -18.225 -6.070  -6.904  1.00 0.00 ? 155 PHE A CA   1  
ATOM   2452   C  C    . PHE A 1 155 ? -19.642 -6.306  -7.431  1.00 0.00 ? 155 PHE A C    1  
ATOM   2453   O  O    . PHE A 1 155 ? -19.926 -7.308  -8.056  1.00 0.00 ? 155 PHE A O    1  
ATOM   2454   C  CB   . PHE A 1 155 ? -17.358 -5.473  -8.012  1.00 0.00 ? 155 PHE A CB   1  
ATOM   2455   C  CG   . PHE A 1 155 ? -15.919 -5.442  -7.558  1.00 0.00 ? 155 PHE A CG   1  
ATOM   2456   C  CD1  . PHE A 1 155 ? -15.493 -4.453  -6.666  1.00 0.00 ? 155 PHE A CD1  1  
ATOM   2457   C  CD2  . PHE A 1 155 ? -15.014 -6.399  -8.027  1.00 0.00 ? 155 PHE A CD2  1  
ATOM   2458   C  CE1  . PHE A 1 155 ? -14.160 -4.419  -6.241  1.00 0.00 ? 155 PHE A CE1  1  
ATOM   2459   C  CE2  . PHE A 1 155 ? -13.680 -6.368  -7.603  1.00 0.00 ? 155 PHE A CE2  1  
ATOM   2460   C  CZ   . PHE A 1 155 ? -13.252 -5.376  -6.709  1.00 0.00 ? 155 PHE A CZ   1  
ATOM   2461   H  H    . PHE A 1 155 ? -17.256 -7.983  -7.110  1.00 0.00 ? 155 PHE A H    1  
ATOM   2462   H  HA   . PHE A 1 155 ? -18.263 -5.383  -6.073  1.00 0.00 ? 155 PHE A HA   1  
ATOM   2463   H  HB2  . PHE A 1 155 ? -17.443 -6.079  -8.902  1.00 0.00 ? 155 PHE A HB2  1  
ATOM   2464   H  HB3  . PHE A 1 155 ? -17.688 -4.468  -8.224  1.00 0.00 ? 155 PHE A HB3  1  
ATOM   2465   H  HD1  . PHE A 1 155 ? -16.193 -3.714  -6.307  1.00 0.00 ? 155 PHE A HD1  1  
ATOM   2466   H  HD2  . PHE A 1 155 ? -15.342 -7.163  -8.716  1.00 0.00 ? 155 PHE A HD2  1  
ATOM   2467   H  HE1  . PHE A 1 155 ? -13.832 -3.653  -5.554  1.00 0.00 ? 155 PHE A HE1  1  
ATOM   2468   H  HE2  . PHE A 1 155 ? -12.980 -7.106  -7.964  1.00 0.00 ? 155 PHE A HE2  1  
ATOM   2469   H  HZ   . PHE A 1 155 ? -12.224 -5.351  -6.381  1.00 0.00 ? 155 PHE A HZ   1  
ATOM   2470   N  N    . LYS A 1 156 ? -20.534 -5.387  -7.178  1.00 0.00 ? 156 LYS A N    1  
ATOM   2471   C  CA   . LYS A 1 156 ? -21.935 -5.547  -7.655  1.00 0.00 ? 156 LYS A CA   1  
ATOM   2472   C  C    . LYS A 1 156 ? -22.087 -4.889  -9.028  1.00 0.00 ? 156 LYS A C    1  
ATOM   2473   O  O    . LYS A 1 156 ? -23.159 -4.863  -9.600  1.00 0.00 ? 156 LYS A O    1  
ATOM   2474   C  CB   . LYS A 1 156 ? -22.886 -4.873  -6.664  1.00 0.00 ? 156 LYS A CB   1  
ATOM   2475   C  CG   . LYS A 1 156 ? -23.137 -5.806  -5.477  1.00 0.00 ? 156 LYS A CG   1  
ATOM   2476   C  CD   . LYS A 1 156 ? -24.175 -5.176  -4.544  1.00 0.00 ? 156 LYS A CD   1  
ATOM   2477   C  CE   . LYS A 1 156 ? -25.581 -5.536  -5.026  1.00 0.00 ? 156 LYS A CE   1  
ATOM   2478   N  NZ   . LYS A 1 156 ? -26.523 -4.436  -4.675  1.00 0.00 ? 156 LYS A NZ   1  
ATOM   2479   H  H    . LYS A 1 156 ? -20.280 -4.588  -6.669  1.00 0.00 ? 156 LYS A H    1  
ATOM   2480   H  HA   . LYS A 1 156 ? -22.176 -6.597  -7.729  1.00 0.00 ? 156 LYS A HA   1  
ATOM   2481   H  HB2  . LYS A 1 156 ? -22.443 -3.953  -6.312  1.00 0.00 ? 156 LYS A HB2  1  
ATOM   2482   H  HB3  . LYS A 1 156 ? -23.822 -4.657  -7.154  1.00 0.00 ? 156 LYS A HB3  1  
ATOM   2483   H  HG2  . LYS A 1 156 ? -23.505 -6.755  -5.839  1.00 0.00 ? 156 LYS A HG2  1  
ATOM   2484   H  HG3  . LYS A 1 156 ? -22.216 -5.958  -4.937  1.00 0.00 ? 156 LYS A HG3  1  
ATOM   2485   H  HD2  . LYS A 1 156 ? -24.030 -5.552  -3.541  1.00 0.00 ? 156 LYS A HD2  1  
ATOM   2486   H  HD3  . LYS A 1 156 ? -24.058 -4.103  -4.547  1.00 0.00 ? 156 LYS A HD3  1  
ATOM   2487   H  HE2  . LYS A 1 156 ? -25.571 -5.672  -6.098  1.00 0.00 ? 156 LYS A HE2  1  
ATOM   2488   H  HE3  . LYS A 1 156 ? -25.902 -6.451  -4.551  1.00 0.00 ? 156 LYS A HE3  1  
ATOM   2489   H  HZ1  . LYS A 1 156 ? -27.188 -4.768  -3.948  1.00 0.00 ? 156 LYS A HZ1  1  
ATOM   2490   H  HZ2  . LYS A 1 156 ? -27.051 -4.147  -5.524  1.00 0.00 ? 156 LYS A HZ2  1  
ATOM   2491   H  HZ3  . LYS A 1 156 ? -25.987 -3.625  -4.306  1.00 0.00 ? 156 LYS A HZ3  1  
ATOM   2492   N  N    . ASN A 1 157 ? -21.023 -4.353  -9.562  1.00 0.00 ? 157 ASN A N    1  
ATOM   2493   C  CA   . ASN A 1 157 ? -21.112 -3.696  -10.896 1.00 0.00 ? 157 ASN A CA   1  
ATOM   2494   C  C    . ASN A 1 157 ? -20.970 -4.752  -11.996 1.00 0.00 ? 157 ASN A C    1  
ATOM   2495   O  O    . ASN A 1 157 ? -21.060 -5.938  -11.747 1.00 0.00 ? 157 ASN A O    1  
ATOM   2496   C  CB   . ASN A 1 157 ? -19.997 -2.655  -11.030 1.00 0.00 ? 157 ASN A CB   1  
ATOM   2497   C  CG   . ASN A 1 157 ? -18.640 -3.337  -10.852 1.00 0.00 ? 157 ASN A CG   1  
ATOM   2498   O  OD1  . ASN A 1 157 ? -17.613 -2.760  -11.153 1.00 0.00 ? 157 ASN A OD1  1  
ATOM   2499   N  ND2  . ASN A 1 157 ? -18.592 -4.547  -10.373 1.00 0.00 ? 157 ASN A ND2  1  
ATOM   2500   H  H    . ASN A 1 157 ? -20.168 -4.383  -9.085  1.00 0.00 ? 157 ASN A H    1  
ATOM   2501   H  HA   . ASN A 1 157 ? -22.070 -3.208  -10.991 1.00 0.00 ? 157 ASN A HA   1  
ATOM   2502   H  HB2  . ASN A 1 157 ? -20.048 -2.196  -12.006 1.00 0.00 ? 157 ASN A HB2  1  
ATOM   2503   H  HB3  . ASN A 1 157 ? -20.119 -1.899  -10.269 1.00 0.00 ? 157 ASN A HB3  1  
ATOM   2504   H  HD21 . ASN A 1 157 ? -19.419 -5.014  -10.133 1.00 0.00 ? 157 ASN A HD21 1  
ATOM   2505   H  HD22 . ASN A 1 157 ? -17.727 -4.989  -10.247 1.00 0.00 ? 157 ASN A HD22 1  
ATOM   2506   N  N    . PHE A 1 158 ? -20.760 -4.331  -13.215 1.00 0.00 ? 158 PHE A N    1  
ATOM   2507   C  CA   . PHE A 1 158 ? -20.626 -5.310  -14.333 1.00 0.00 ? 158 PHE A CA   1  
ATOM   2508   C  C    . PHE A 1 158 ? -19.406 -6.209  -14.108 1.00 0.00 ? 158 PHE A C    1  
ATOM   2509   O  O    . PHE A 1 158 ? -19.347 -7.317  -14.601 1.00 0.00 ? 158 PHE A O    1  
ATOM   2510   C  CB   . PHE A 1 158 ? -20.465 -4.558  -15.654 1.00 0.00 ? 158 PHE A CB   1  
ATOM   2511   C  CG   . PHE A 1 158 ? -19.142 -3.829  -15.668 1.00 0.00 ? 158 PHE A CG   1  
ATOM   2512   C  CD1  . PHE A 1 158 ? -19.010 -2.598  -15.010 1.00 0.00 ? 158 PHE A CD1  1  
ATOM   2513   C  CD2  . PHE A 1 158 ? -18.046 -4.384  -16.340 1.00 0.00 ? 158 PHE A CD2  1  
ATOM   2514   C  CE1  . PHE A 1 158 ? -17.783 -1.925  -15.025 1.00 0.00 ? 158 PHE A CE1  1  
ATOM   2515   C  CE2  . PHE A 1 158 ? -16.819 -3.709  -16.354 1.00 0.00 ? 158 PHE A CE2  1  
ATOM   2516   C  CZ   . PHE A 1 158 ? -16.688 -2.481  -15.697 1.00 0.00 ? 158 PHE A CZ   1  
ATOM   2517   H  H    . PHE A 1 158 ? -20.699 -3.370  -13.395 1.00 0.00 ? 158 PHE A H    1  
ATOM   2518   H  HA   . PHE A 1 158 ? -21.515 -5.922  -14.378 1.00 0.00 ? 158 PHE A HA   1  
ATOM   2519   H  HB2  . PHE A 1 158 ? -20.496 -5.262  -16.473 1.00 0.00 ? 158 PHE A HB2  1  
ATOM   2520   H  HB3  . PHE A 1 158 ? -21.269 -3.847  -15.763 1.00 0.00 ? 158 PHE A HB3  1  
ATOM   2521   H  HD1  . PHE A 1 158 ? -19.855 -2.169  -14.491 1.00 0.00 ? 158 PHE A HD1  1  
ATOM   2522   H  HD2  . PHE A 1 158 ? -18.147 -5.332  -16.846 1.00 0.00 ? 158 PHE A HD2  1  
ATOM   2523   H  HE1  . PHE A 1 158 ? -17.681 -0.977  -14.518 1.00 0.00 ? 158 PHE A HE1  1  
ATOM   2524   H  HE2  . PHE A 1 158 ? -15.974 -4.138  -16.873 1.00 0.00 ? 158 PHE A HE2  1  
ATOM   2525   H  HZ   . PHE A 1 158 ? -15.740 -1.961  -15.707 1.00 0.00 ? 158 PHE A HZ   1  
ATOM   2526   N  N    . LEU A 1 159 ? -18.431 -5.747  -13.374 1.00 0.00 ? 159 LEU A N    1  
ATOM   2527   C  CA   . LEU A 1 159 ? -17.225 -6.591  -13.134 1.00 0.00 ? 159 LEU A CA   1  
ATOM   2528   C  C    . LEU A 1 159 ? -17.616 -7.809  -12.294 1.00 0.00 ? 159 LEU A C    1  
ATOM   2529   O  O    . LEU A 1 159 ? -16.978 -8.841  -12.342 1.00 0.00 ? 159 LEU A O    1  
ATOM   2530   C  CB   . LEU A 1 159 ? -16.164 -5.776  -12.391 1.00 0.00 ? 159 LEU A CB   1  
ATOM   2531   C  CG   . LEU A 1 159 ? -15.563 -4.723  -13.329 1.00 0.00 ? 159 LEU A CG   1  
ATOM   2532   C  CD1  . LEU A 1 159 ? -14.742 -3.725  -12.512 1.00 0.00 ? 159 LEU A CD1  1  
ATOM   2533   C  CD2  . LEU A 1 159 ? -14.653 -5.396  -14.364 1.00 0.00 ? 159 LEU A CD2  1  
ATOM   2534   H  H    . LEU A 1 159 ? -18.490 -4.851  -12.981 1.00 0.00 ? 159 LEU A H    1  
ATOM   2535   H  HA   . LEU A 1 159 ? -16.827 -6.924  -14.081 1.00 0.00 ? 159 LEU A HA   1  
ATOM   2536   H  HB2  . LEU A 1 159 ? -16.621 -5.283  -11.546 1.00 0.00 ? 159 LEU A HB2  1  
ATOM   2537   H  HB3  . LEU A 1 159 ? -15.383 -6.435  -12.040 1.00 0.00 ? 159 LEU A HB3  1  
ATOM   2538   H  HG   . LEU A 1 159 ? -16.362 -4.200  -13.836 1.00 0.00 ? 159 LEU A HG   1  
ATOM   2539   H  HD11 . LEU A 1 159 ? -13.930 -4.242  -12.023 1.00 0.00 ? 159 LEU A HD11 1  
ATOM   2540   H  HD12 . LEU A 1 159 ? -15.374 -3.261  -11.770 1.00 0.00 ? 159 LEU A HD12 1  
ATOM   2541   H  HD13 . LEU A 1 159 ? -14.341 -2.966  -13.169 1.00 0.00 ? 159 LEU A HD13 1  
ATOM   2542   H  HD21 . LEU A 1 159 ? -14.154 -6.243  -13.917 1.00 0.00 ? 159 LEU A HD21 1  
ATOM   2543   H  HD22 . LEU A 1 159 ? -13.915 -4.686  -14.706 1.00 0.00 ? 159 LEU A HD22 1  
ATOM   2544   H  HD23 . LEU A 1 159 ? -15.245 -5.729  -15.204 1.00 0.00 ? 159 LEU A HD23 1  
ATOM   2545   N  N    . GLY A 1 160 ? -18.666 -7.699  -11.525 1.00 0.00 ? 160 GLY A N    1  
ATOM   2546   C  CA   . GLY A 1 160 ? -19.101 -8.848  -10.687 1.00 0.00 ? 160 GLY A CA   1  
ATOM   2547   C  C    . GLY A 1 160 ? -17.990 -9.215  -9.703  1.00 0.00 ? 160 GLY A C    1  
ATOM   2548   O  O    . GLY A 1 160 ? -17.351 -8.361  -9.122  1.00 0.00 ? 160 GLY A O    1  
ATOM   2549   H  H    . GLY A 1 160 ? -19.169 -6.862  -11.501 1.00 0.00 ? 160 GLY A H    1  
ATOM   2550   H  HA2  . GLY A 1 160 ? -19.993 -8.576  -10.140 1.00 0.00 ? 160 GLY A HA2  1  
ATOM   2551   H  HA3  . GLY A 1 160 ? -19.309 -9.698  -11.321 1.00 0.00 ? 160 GLY A HA3  1  
ATOM   2552   N  N    . ARG A 1 161 ? -17.763 -10.482 -9.512  1.00 0.00 ? 161 ARG A N    1  
ATOM   2553   C  CA   . ARG A 1 161 ? -16.698 -10.916 -8.562  1.00 0.00 ? 161 ARG A CA   1  
ATOM   2554   C  C    . ARG A 1 161 ? -15.387 -11.131 -9.316  1.00 0.00 ? 161 ARG A C    1  
ATOM   2555   O  O    . ARG A 1 161 ? -15.373 -11.574 -10.447 1.00 0.00 ? 161 ARG A O    1  
ATOM   2556   C  CB   . ARG A 1 161 ? -17.116 -12.227 -7.894  1.00 0.00 ? 161 ARG A CB   1  
ATOM   2557   C  CG   . ARG A 1 161 ? -18.610 -12.183 -7.567  1.00 0.00 ? 161 ARG A CG   1  
ATOM   2558   C  CD   . ARG A 1 161 ? -18.976 -13.371 -6.676  1.00 0.00 ? 161 ARG A CD   1  
ATOM   2559   N  NE   . ARG A 1 161 ? -18.216 -14.576 -7.115  1.00 0.00 ? 161 ARG A NE   1  
ATOM   2560   C  CZ   . ARG A 1 161 ? -18.600 -15.763 -6.737  1.00 0.00 ? 161 ARG A CZ   1  
ATOM   2561   N  NH1  . ARG A 1 161 ? -19.647 -15.895 -5.970  1.00 0.00 ? 161 ARG A NH1  1  
ATOM   2562   N  NH2  . ARG A 1 161 ? -17.937 -16.818 -7.125  1.00 0.00 ? 161 ARG A NH2  1  
ATOM   2563   H  H    . ARG A 1 161 ? -18.296 -11.148 -9.991  1.00 0.00 ? 161 ARG A H    1  
ATOM   2564   H  HA   . ARG A 1 161 ? -16.556 -10.158 -7.808  1.00 0.00 ? 161 ARG A HA   1  
ATOM   2565   H  HB2  . ARG A 1 161 ? -16.917 -13.050 -8.565  1.00 0.00 ? 161 ARG A HB2  1  
ATOM   2566   H  HB3  . ARG A 1 161 ? -16.554 -12.362 -6.982  1.00 0.00 ? 161 ARG A HB3  1  
ATOM   2567   H  HG2  . ARG A 1 161 ? -18.838 -11.261 -7.052  1.00 0.00 ? 161 ARG A HG2  1  
ATOM   2568   H  HG3  . ARG A 1 161 ? -19.180 -12.234 -8.483  1.00 0.00 ? 161 ARG A HG3  1  
ATOM   2569   H  HD2  . ARG A 1 161 ? -18.727 -13.143 -5.650  1.00 0.00 ? 161 ARG A HD2  1  
ATOM   2570   H  HD3  . ARG A 1 161 ? -20.035 -13.567 -6.753  1.00 0.00 ? 161 ARG A HD3  1  
ATOM   2571   H  HE   . ARG A 1 161 ? -17.428 -14.476 -7.689  1.00 0.00 ? 161 ARG A HE   1  
ATOM   2572   H  HH11 . ARG A 1 161 ? -20.155 -15.086 -5.673  1.00 0.00 ? 161 ARG A HH11 1  
ATOM   2573   H  HH12 . ARG A 1 161 ? -19.942 -16.805 -5.680  1.00 0.00 ? 161 ARG A HH12 1  
ATOM   2574   H  HH21 . ARG A 1 161 ? -17.134 -16.716 -7.713  1.00 0.00 ? 161 ARG A HH21 1  
ATOM   2575   H  HH22 . ARG A 1 161 ? -18.231 -17.728 -6.834  1.00 0.00 ? 161 ARG A HH22 1  
ATOM   2576   N  N    . GLN A 1 162 ? -14.281 -10.825 -8.694  1.00 0.00 ? 162 GLN A N    1  
ATOM   2577   C  CA   . GLN A 1 162 ? -12.970 -11.017 -9.373  1.00 0.00 ? 162 GLN A CA   1  
ATOM   2578   C  C    . GLN A 1 162 ? -11.896 -11.318 -8.328  1.00 0.00 ? 162 GLN A C    1  
ATOM   2579   O  O    . GLN A 1 162 ? -11.840 -10.701 -7.283  1.00 0.00 ? 162 GLN A O    1  
ATOM   2580   C  CB   . GLN A 1 162 ? -12.598 -9.747  -10.142 1.00 0.00 ? 162 GLN A CB   1  
ATOM   2581   C  CG   . GLN A 1 162 ? -12.859 -9.960  -11.634 1.00 0.00 ? 162 GLN A CG   1  
ATOM   2582   C  CD   . GLN A 1 162 ? -11.708 -10.762 -12.245 1.00 0.00 ? 162 GLN A CD   1  
ATOM   2583   O  OE1  . GLN A 1 162 ? -10.608 -10.758 -11.728 1.00 0.00 ? 162 GLN A OE1  1  
ATOM   2584   N  NE2  . GLN A 1 162 ? -11.915 -11.454 -13.331 1.00 0.00 ? 162 GLN A NE2  1  
ATOM   2585   H  H    . GLN A 1 162 ? -14.315 -10.470 -7.778  1.00 0.00 ? 162 GLN A H    1  
ATOM   2586   H  HA   . GLN A 1 162 ? -13.042 -11.845 -10.062 1.00 0.00 ? 162 GLN A HA   1  
ATOM   2587   H  HB2  . GLN A 1 162 ? -13.197 -8.922  -9.784  1.00 0.00 ? 162 GLN A HB2  1  
ATOM   2588   H  HB3  . GLN A 1 162 ? -11.552 -9.528  -9.989  1.00 0.00 ? 162 GLN A HB3  1  
ATOM   2589   H  HG2  . GLN A 1 162 ? -13.785 -10.503 -11.764 1.00 0.00 ? 162 GLN A HG2  1  
ATOM   2590   H  HG3  . GLN A 1 162 ? -12.929 -9.003  -12.128 1.00 0.00 ? 162 GLN A HG3  1  
ATOM   2591   H  HE21 . GLN A 1 162 ? -12.801 -11.457 -13.749 1.00 0.00 ? 162 GLN A HE21 1  
ATOM   2592   H  HE22 . GLN A 1 162 ? -11.184 -11.970 -13.731 1.00 0.00 ? 162 GLN A HE22 1  
ATOM   2593   N  N    . LYS A 1 163 ? -11.043 -12.267 -8.607  1.00 0.00 ? 163 LYS A N    1  
ATOM   2594   C  CA   . LYS A 1 163 ? -9.967  -12.623 -7.639  1.00 0.00 ? 163 LYS A CA   1  
ATOM   2595   C  C    . LYS A 1 163 ? -8.611  -12.496 -8.331  1.00 0.00 ? 163 LYS A C    1  
ATOM   2596   O  O    . LYS A 1 163 ? -8.487  -12.739 -9.515  1.00 0.00 ? 163 LYS A O    1  
ATOM   2597   C  CB   . LYS A 1 163 ? -10.168 -14.065 -7.171  1.00 0.00 ? 163 LYS A CB   1  
ATOM   2598   C  CG   . LYS A 1 163 ? -11.176 -14.759 -8.090  1.00 0.00 ? 163 LYS A CG   1  
ATOM   2599   C  CD   . LYS A 1 163 ? -11.206 -16.256 -7.782  1.00 0.00 ? 163 LYS A CD   1  
ATOM   2600   C  CE   . LYS A 1 163 ? -12.327 -16.920 -8.586  1.00 0.00 ? 163 LYS A CE   1  
ATOM   2601   N  NZ   . LYS A 1 163 ? -12.098 -16.689 -10.040 1.00 0.00 ? 163 LYS A NZ   1  
ATOM   2602   H  H    . LYS A 1 163 ? -11.111 -12.749 -9.457  1.00 0.00 ? 163 LYS A H    1  
ATOM   2603   H  HA   . LYS A 1 163 ? -10.004 -11.957 -6.790  1.00 0.00 ? 163 LYS A HA   1  
ATOM   2604   H  HB2  . LYS A 1 163 ? -9.225  -14.591 -7.207  1.00 0.00 ? 163 LYS A HB2  1  
ATOM   2605   H  HB3  . LYS A 1 163 ? -10.545 -14.067 -6.160  1.00 0.00 ? 163 LYS A HB3  1  
ATOM   2606   H  HG2  . LYS A 1 163 ? -12.158 -14.337 -7.929  1.00 0.00 ? 163 LYS A HG2  1  
ATOM   2607   H  HG3  . LYS A 1 163 ? -10.885 -14.612 -9.120  1.00 0.00 ? 163 LYS A HG3  1  
ATOM   2608   H  HD2  . LYS A 1 163 ? -10.258 -16.699 -8.051  1.00 0.00 ? 163 LYS A HD2  1  
ATOM   2609   H  HD3  . LYS A 1 163 ? -11.387 -16.404 -6.728  1.00 0.00 ? 163 LYS A HD3  1  
ATOM   2610   H  HE2  . LYS A 1 163 ? -12.334 -17.982 -8.386  1.00 0.00 ? 163 LYS A HE2  1  
ATOM   2611   H  HE3  . LYS A 1 163 ? -13.276 -16.494 -8.298  1.00 0.00 ? 163 LYS A HE3  1  
ATOM   2612   H  HZ1  . LYS A 1 163 ? -11.886 -17.594 -10.506 1.00 0.00 ? 163 LYS A HZ1  1  
ATOM   2613   H  HZ2  . LYS A 1 163 ? -11.296 -16.038 -10.165 1.00 0.00 ? 163 LYS A HZ2  1  
ATOM   2614   H  HZ3  . LYS A 1 163 ? -12.951 -16.274 -10.464 1.00 0.00 ? 163 LYS A HZ3  1  
ATOM   2615   N  N    . PHE A 1 164 ? -7.590  -12.121 -7.608  1.00 0.00 ? 164 PHE A N    1  
ATOM   2616   C  CA   . PHE A 1 164 ? -6.244  -11.988 -8.241  1.00 0.00 ? 164 PHE A CA   1  
ATOM   2617   C  C    . PHE A 1 164 ? -5.187  -12.596 -7.320  1.00 0.00 ? 164 PHE A C    1  
ATOM   2618   O  O    . PHE A 1 164 ? -5.066  -12.224 -6.170  1.00 0.00 ? 164 PHE A O    1  
ATOM   2619   C  CB   . PHE A 1 164 ? -5.928  -10.508 -8.470  1.00 0.00 ? 164 PHE A CB   1  
ATOM   2620   C  CG   . PHE A 1 164 ? -4.669  -10.384 -9.298  1.00 0.00 ? 164 PHE A CG   1  
ATOM   2621   C  CD1  . PHE A 1 164 ? -4.681  -10.744 -10.651 1.00 0.00 ? 164 PHE A CD1  1  
ATOM   2622   C  CD2  . PHE A 1 164 ? -3.490  -9.905  -8.713  1.00 0.00 ? 164 PHE A CD2  1  
ATOM   2623   C  CE1  . PHE A 1 164 ? -3.515  -10.626 -11.418 1.00 0.00 ? 164 PHE A CE1  1  
ATOM   2624   C  CE2  . PHE A 1 164 ? -2.325  -9.786  -9.480  1.00 0.00 ? 164 PHE A CE2  1  
ATOM   2625   C  CZ   . PHE A 1 164 ? -2.337  -10.147 -10.832 1.00 0.00 ? 164 PHE A CZ   1  
ATOM   2626   H  H    . PHE A 1 164 ? -7.706  -11.931 -6.647  1.00 0.00 ? 164 PHE A H    1  
ATOM   2627   H  HA   . PHE A 1 164 ? -6.237  -12.508 -9.186  1.00 0.00 ? 164 PHE A HA   1  
ATOM   2628   H  HB2  . PHE A 1 164 ? -6.750  -10.043 -8.994  1.00 0.00 ? 164 PHE A HB2  1  
ATOM   2629   H  HB3  . PHE A 1 164 ? -5.782  -10.019 -7.519  1.00 0.00 ? 164 PHE A HB3  1  
ATOM   2630   H  HD1  . PHE A 1 164 ? -5.589  -11.115 -11.102 1.00 0.00 ? 164 PHE A HD1  1  
ATOM   2631   H  HD2  . PHE A 1 164 ? -3.480  -9.626  -7.670  1.00 0.00 ? 164 PHE A HD2  1  
ATOM   2632   H  HE1  . PHE A 1 164 ? -3.524  -10.906 -12.460 1.00 0.00 ? 164 PHE A HE1  1  
ATOM   2633   H  HE2  . PHE A 1 164 ? -1.416  -9.416  -9.028  1.00 0.00 ? 164 PHE A HE2  1  
ATOM   2634   H  HZ   . PHE A 1 164 ? -1.437  -10.054 -11.425 1.00 0.00 ? 164 PHE A HZ   1  
ATOM   2635   N  N    . THR A 1 165 ? -4.422  -13.535 -7.811  1.00 0.00 ? 165 THR A N    1  
ATOM   2636   C  CA   . THR A 1 165 ? -3.380  -14.165 -6.957  1.00 0.00 ? 165 THR A CA   1  
ATOM   2637   C  C    . THR A 1 165 ? -2.011  -13.579 -7.298  1.00 0.00 ? 165 THR A C    1  
ATOM   2638   O  O    . THR A 1 165 ? -1.556  -13.651 -8.422  1.00 0.00 ? 165 THR A O    1  
ATOM   2639   C  CB   . THR A 1 165 ? -3.364  -15.676 -7.208  1.00 0.00 ? 165 THR A CB   1  
ATOM   2640   O  OG1  . THR A 1 165 ? -4.497  -16.268 -6.587  1.00 0.00 ? 165 THR A OG1  1  
ATOM   2641   C  CG2  . THR A 1 165 ? -2.086  -16.278 -6.622  1.00 0.00 ? 165 THR A CG2  1  
ATOM   2642   H  H    . THR A 1 165 ? -4.527  -13.837 -8.737  1.00 0.00 ? 165 THR A H    1  
ATOM   2643   H  HA   . THR A 1 165 ? -3.601  -13.978 -5.923  1.00 0.00 ? 165 THR A HA   1  
ATOM   2644   H  HB   . THR A 1 165 ? -3.393  -15.866 -8.269  1.00 0.00 ? 165 THR A HB   1  
ATOM   2645   H  HG1  . THR A 1 165 ? -4.903  -15.610 -6.018  1.00 0.00 ? 165 THR A HG1  1  
ATOM   2646   H  HG21 . THR A 1 165 ? -2.287  -17.281 -6.275  1.00 0.00 ? 165 THR A HG21 1  
ATOM   2647   H  HG22 . THR A 1 165 ? -1.748  -15.673 -5.795  1.00 0.00 ? 165 THR A HG22 1  
ATOM   2648   H  HG23 . THR A 1 165 ? -1.321  -16.308 -7.383  1.00 0.00 ? 165 THR A HG23 1  
ATOM   2649   N  N    . PHE A 1 166 ? -1.344  -13.007 -6.332  1.00 0.00 ? 166 PHE A N    1  
ATOM   2650   C  CA   . PHE A 1 166 ? 0.001   -12.429 -6.600  1.00 0.00 ? 166 PHE A CA   1  
ATOM   2651   C  C    . PHE A 1 166 ? 1.071   -13.415 -6.137  1.00 0.00 ? 166 PHE A C    1  
ATOM   2652   O  O    . PHE A 1 166 ? 0.983   -13.978 -5.066  1.00 0.00 ? 166 PHE A O    1  
ATOM   2653   C  CB   . PHE A 1 166 ? 0.177   -11.120 -5.835  1.00 0.00 ? 166 PHE A CB   1  
ATOM   2654   C  CG   . PHE A 1 166 ? 1.654   -10.853 -5.680  1.00 0.00 ? 166 PHE A CG   1  
ATOM   2655   C  CD1  . PHE A 1 166 ? 2.470   -10.769 -6.815  1.00 0.00 ? 166 PHE A CD1  1  
ATOM   2656   C  CD2  . PHE A 1 166 ? 2.213   -10.706 -4.405  1.00 0.00 ? 166 PHE A CD2  1  
ATOM   2657   C  CE1  . PHE A 1 166 ? 3.842   -10.537 -6.675  1.00 0.00 ? 166 PHE A CE1  1  
ATOM   2658   C  CE2  . PHE A 1 166 ? 3.586   -10.471 -4.266  1.00 0.00 ? 166 PHE A CE2  1  
ATOM   2659   C  CZ   . PHE A 1 166 ? 4.401   -10.387 -5.401  1.00 0.00 ? 166 PHE A CZ   1  
ATOM   2660   H  H    . PHE A 1 166 ? -1.724  -12.970 -5.430  1.00 0.00 ? 166 PHE A H    1  
ATOM   2661   H  HA   . PHE A 1 166 ? 0.112   -12.247 -7.659  1.00 0.00 ? 166 PHE A HA   1  
ATOM   2662   H  HB2  . PHE A 1 166 ? -0.286  -10.312 -6.382  1.00 0.00 ? 166 PHE A HB2  1  
ATOM   2663   H  HB3  . PHE A 1 166 ? -0.278  -11.205 -4.859  1.00 0.00 ? 166 PHE A HB3  1  
ATOM   2664   H  HD1  . PHE A 1 166 ? 2.040   -10.883 -7.799  1.00 0.00 ? 166 PHE A HD1  1  
ATOM   2665   H  HD2  . PHE A 1 166 ? 1.584   -10.770 -3.530  1.00 0.00 ? 166 PHE A HD2  1  
ATOM   2666   H  HE1  . PHE A 1 166 ? 4.471   -10.472 -7.552  1.00 0.00 ? 166 PHE A HE1  1  
ATOM   2667   H  HE2  . PHE A 1 166 ? 4.017   -10.355 -3.282  1.00 0.00 ? 166 PHE A HE2  1  
ATOM   2668   H  HZ   . PHE A 1 166 ? 5.462   -10.210 -5.295  1.00 0.00 ? 166 PHE A HZ   1  
ATOM   2669   N  N    . VAL A 1 167 ? 2.080   -13.623 -6.934  1.00 0.00 ? 167 VAL A N    1  
ATOM   2670   C  CA   . VAL A 1 167 ? 3.155   -14.572 -6.536  1.00 0.00 ? 167 VAL A CA   1  
ATOM   2671   C  C    . VAL A 1 167 ? 4.520   -13.947 -6.824  1.00 0.00 ? 167 VAL A C    1  
ATOM   2672   O  O    . VAL A 1 167 ? 4.665   -13.138 -7.720  1.00 0.00 ? 167 VAL A O    1  
ATOM   2673   C  CB   . VAL A 1 167 ? 3.009   -15.871 -7.329  1.00 0.00 ? 167 VAL A CB   1  
ATOM   2674   C  CG1  . VAL A 1 167 ? 3.649   -17.020 -6.550  1.00 0.00 ? 167 VAL A CG1  1  
ATOM   2675   C  CG2  . VAL A 1 167 ? 1.524   -16.169 -7.545  1.00 0.00 ? 167 VAL A CG2  1  
ATOM   2676   H  H    . VAL A 1 167 ? 2.125   -13.153 -7.795  1.00 0.00 ? 167 VAL A H    1  
ATOM   2677   H  HA   . VAL A 1 167 ? 3.073   -14.785 -5.478  1.00 0.00 ? 167 VAL A HA   1  
ATOM   2678   H  HB   . VAL A 1 167 ? 3.502   -15.766 -8.285  1.00 0.00 ? 167 VAL A HB   1  
ATOM   2679   H  HG11 . VAL A 1 167 ? 2.969   -17.359 -5.783  1.00 0.00 ? 167 VAL A HG11 1  
ATOM   2680   H  HG12 . VAL A 1 167 ? 4.566   -16.678 -6.091  1.00 0.00 ? 167 VAL A HG12 1  
ATOM   2681   H  HG13 . VAL A 1 167 ? 3.867   -17.836 -7.224  1.00 0.00 ? 167 VAL A HG13 1  
ATOM   2682   H  HG21 . VAL A 1 167 ? 1.144   -15.544 -8.341  1.00 0.00 ? 167 VAL A HG21 1  
ATOM   2683   H  HG22 . VAL A 1 167 ? 0.979   -15.963 -6.636  1.00 0.00 ? 167 VAL A HG22 1  
ATOM   2684   H  HG23 . VAL A 1 167 ? 1.400   -17.207 -7.813  1.00 0.00 ? 167 VAL A HG23 1  
ATOM   2685   N  N    . GLU A 1 168 ? 5.519   -14.314 -6.075  1.00 0.00 ? 168 GLU A N    1  
ATOM   2686   C  CA   . GLU A 1 168 ? 6.873   -13.742 -6.308  1.00 0.00 ? 168 GLU A CA   1  
ATOM   2687   C  C    . GLU A 1 168 ? 7.241   -13.899 -7.783  1.00 0.00 ? 168 GLU A C    1  
ATOM   2688   O  O    . GLU A 1 168 ? 7.363   -14.999 -8.285  1.00 0.00 ? 168 GLU A O    1  
ATOM   2689   C  CB   . GLU A 1 168 ? 7.896   -14.485 -5.445  1.00 0.00 ? 168 GLU A CB   1  
ATOM   2690   C  CG   . GLU A 1 168 ? 7.520   -14.346 -3.969  1.00 0.00 ? 168 GLU A CG   1  
ATOM   2691   C  CD   . GLU A 1 168 ? 8.760   -14.567 -3.103  1.00 0.00 ? 168 GLU A CD   1  
ATOM   2692   O  OE1  . GLU A 1 168 ? 9.784   -13.976 -3.405  1.00 0.00 ? 168 GLU A OE1  1  
ATOM   2693   O  OE2  . GLU A 1 168 ? 8.667   -15.324 -2.151  1.00 0.00 ? 168 GLU A OE2  1  
ATOM   2694   H  H    . GLU A 1 168 ? 5.380   -14.969 -5.359  1.00 0.00 ? 168 GLU A H    1  
ATOM   2695   H  HA   . GLU A 1 168 ? 6.871   -12.694 -6.045  1.00 0.00 ? 168 GLU A HA   1  
ATOM   2696   H  HB2  . GLU A 1 168 ? 7.903   -15.530 -5.718  1.00 0.00 ? 168 GLU A HB2  1  
ATOM   2697   H  HB3  . GLU A 1 168 ? 8.876   -14.064 -5.605  1.00 0.00 ? 168 GLU A HB3  1  
ATOM   2698   H  HG2  . GLU A 1 168 ? 7.126   -13.356 -3.789  1.00 0.00 ? 168 GLU A HG2  1  
ATOM   2699   H  HG3  . GLU A 1 168 ? 6.771   -15.082 -3.717  1.00 0.00 ? 168 GLU A HG3  1  
ATOM   2700   N  N    . GLY A 1 169 ? 7.418   -12.808 -8.484  1.00 0.00 ? 169 GLY A N    1  
ATOM   2701   C  CA   . GLY A 1 169 ? 7.778   -12.894 -9.930  1.00 0.00 ? 169 GLY A CA   1  
ATOM   2702   C  C    . GLY A 1 169 ? 6.652   -12.298 -10.779 1.00 0.00 ? 169 GLY A C    1  
ATOM   2703   O  O    . GLY A 1 169 ? 6.673   -12.374 -11.992 1.00 0.00 ? 169 GLY A O    1  
ATOM   2704   H  H    . GLY A 1 169 ? 7.311   -11.930 -8.059  1.00 0.00 ? 169 GLY A H    1  
ATOM   2705   H  HA2  . GLY A 1 169 ? 8.692   -12.341 -10.103 1.00 0.00 ? 169 GLY A HA2  1  
ATOM   2706   H  HA3  . GLY A 1 169 ? 7.925   -13.927 -10.207 1.00 0.00 ? 169 GLY A HA3  1  
ATOM   2707   N  N    . ASN A 1 170 ? 5.674   -11.697 -10.156 1.00 0.00 ? 170 ASN A N    1  
ATOM   2708   C  CA   . ASN A 1 170 ? 4.555   -11.090 -10.923 1.00 0.00 ? 170 ASN A CA   1  
ATOM   2709   C  C    . ASN A 1 170 ? 4.265   -9.702  -10.350 1.00 0.00 ? 170 ASN A C    1  
ATOM   2710   O  O    . ASN A 1 170 ? 3.155   -9.212  -10.396 1.00 0.00 ? 170 ASN A O    1  
ATOM   2711   C  CB   . ASN A 1 170 ? 3.317   -11.970 -10.785 1.00 0.00 ? 170 ASN A CB   1  
ATOM   2712   C  CG   . ASN A 1 170 ? 3.294   -12.998 -11.918 1.00 0.00 ? 170 ASN A CG   1  
ATOM   2713   O  OD1  . ASN A 1 170 ? 3.149   -12.645 -13.071 1.00 0.00 ? 170 ASN A OD1  1  
ATOM   2714   N  ND2  . ASN A 1 170 ? 3.433   -14.264 -11.635 1.00 0.00 ? 170 ASN A ND2  1  
ATOM   2715   H  H    . ASN A 1 170 ? 5.674   -11.637 -9.180  1.00 0.00 ? 170 ASN A H    1  
ATOM   2716   H  HA   . ASN A 1 170 ? 4.828   -11.005 -11.964 1.00 0.00 ? 170 ASN A HA   1  
ATOM   2717   H  HB2  . ASN A 1 170 ? 3.348   -12.483 -9.835  1.00 0.00 ? 170 ASN A HB2  1  
ATOM   2718   H  HB3  . ASN A 1 170 ? 2.434   -11.358 -10.835 1.00 0.00 ? 170 ASN A HB3  1  
ATOM   2719   H  HD21 . ASN A 1 170 ? 3.552   -14.549 -10.705 1.00 0.00 ? 170 ASN A HD21 1  
ATOM   2720   H  HD22 . ASN A 1 170 ? 3.419   -14.931 -12.353 1.00 0.00 ? 170 ASN A HD22 1  
ATOM   2721   N  N    . GLU A 1 171 ? 5.267   -9.079  -9.798  1.00 0.00 ? 171 GLU A N    1  
ATOM   2722   C  CA   . GLU A 1 171 ? 5.087   -7.728  -9.197  1.00 0.00 ? 171 GLU A CA   1  
ATOM   2723   C  C    . GLU A 1 171 ? 4.750   -6.698  -10.279 1.00 0.00 ? 171 GLU A C    1  
ATOM   2724   O  O    . GLU A 1 171 ? 4.060   -5.730  -10.031 1.00 0.00 ? 171 GLU A O    1  
ATOM   2725   C  CB   . GLU A 1 171 ? 6.388   -7.315  -8.506  1.00 0.00 ? 171 GLU A CB   1  
ATOM   2726   C  CG   . GLU A 1 171 ? 6.729   -8.323  -7.406  1.00 0.00 ? 171 GLU A CG   1  
ATOM   2727   C  CD   . GLU A 1 171 ? 7.545   -9.473  -8.000  1.00 0.00 ? 171 GLU A CD   1  
ATOM   2728   O  OE1  . GLU A 1 171 ? 6.964   -10.288 -8.697  1.00 0.00 ? 171 GLU A OE1  1  
ATOM   2729   O  OE2  . GLU A 1 171 ? 8.738   -9.521  -7.746  1.00 0.00 ? 171 GLU A OE2  1  
ATOM   2730   H  H    . GLU A 1 171 ? 6.145   -9.509  -9.770  1.00 0.00 ? 171 GLU A H    1  
ATOM   2731   H  HA   . GLU A 1 171 ? 4.291   -7.761  -8.469  1.00 0.00 ? 171 GLU A HA   1  
ATOM   2732   H  HB2  . GLU A 1 171 ? 7.187   -7.290  -9.233  1.00 0.00 ? 171 GLU A HB2  1  
ATOM   2733   H  HB3  . GLU A 1 171 ? 6.269   -6.335  -8.069  1.00 0.00 ? 171 GLU A HB3  1  
ATOM   2734   H  HG2  . GLU A 1 171 ? 7.307   -7.831  -6.636  1.00 0.00 ? 171 GLU A HG2  1  
ATOM   2735   H  HG3  . GLU A 1 171 ? 5.818   -8.712  -6.981  1.00 0.00 ? 171 GLU A HG3  1  
ATOM   2736   N  N    . GLU A 1 172 ? 5.243   -6.887  -11.471 1.00 0.00 ? 172 GLU A N    1  
ATOM   2737   C  CA   . GLU A 1 172 ? 4.969   -5.905  -12.559 1.00 0.00 ? 172 GLU A CA   1  
ATOM   2738   C  C    . GLU A 1 172 ? 3.465   -5.809  -12.833 1.00 0.00 ? 172 GLU A C    1  
ATOM   2739   O  O    . GLU A 1 172 ? 3.006   -4.893  -13.487 1.00 0.00 ? 172 GLU A O    1  
ATOM   2740   C  CB   . GLU A 1 172 ? 5.687   -6.357  -13.831 1.00 0.00 ? 172 GLU A CB   1  
ATOM   2741   C  CG   . GLU A 1 172 ? 7.200   -6.282  -13.611 1.00 0.00 ? 172 GLU A CG   1  
ATOM   2742   C  CD   . GLU A 1 172 ? 7.741   -4.990  -14.225 1.00 0.00 ? 172 GLU A CD   1  
ATOM   2743   O  OE1  . GLU A 1 172 ? 7.628   -4.837  -15.429 1.00 0.00 ? 172 GLU A OE1  1  
ATOM   2744   O  OE2  . GLU A 1 172 ? 8.261   -4.176  -13.479 1.00 0.00 ? 172 GLU A OE2  1  
ATOM   2745   H  H    . GLU A 1 172 ? 5.807   -7.668  -11.651 1.00 0.00 ? 172 GLU A H    1  
ATOM   2746   H  HA   . GLU A 1 172 ? 5.342   -4.936  -12.269 1.00 0.00 ? 172 GLU A HA   1  
ATOM   2747   H  HB2  . GLU A 1 172 ? 5.405   -7.375  -14.062 1.00 0.00 ? 172 GLU A HB2  1  
ATOM   2748   H  HB3  . GLU A 1 172 ? 5.413   -5.710  -14.650 1.00 0.00 ? 172 GLU A HB3  1  
ATOM   2749   H  HG2  . GLU A 1 172 ? 7.409   -6.294  -12.552 1.00 0.00 ? 172 GLU A HG2  1  
ATOM   2750   H  HG3  . GLU A 1 172 ? 7.675   -7.129  -14.082 1.00 0.00 ? 172 GLU A HG3  1  
ATOM   2751   N  N    . GLU A 1 173 ? 2.694   -6.749  -12.362 1.00 0.00 ? 173 GLU A N    1  
ATOM   2752   C  CA   . GLU A 1 173 ? 1.226   -6.707  -12.625 1.00 0.00 ? 173 GLU A CA   1  
ATOM   2753   C  C    . GLU A 1 173 ? 0.481   -6.039  -11.463 1.00 0.00 ? 173 GLU A C    1  
ATOM   2754   O  O    . GLU A 1 173 ? -0.718  -5.859  -11.526 1.00 0.00 ? 173 GLU A O    1  
ATOM   2755   C  CB   . GLU A 1 173 ? 0.706   -8.136  -12.797 1.00 0.00 ? 173 GLU A CB   1  
ATOM   2756   C  CG   . GLU A 1 173 ? 1.439   -8.810  -13.959 1.00 0.00 ? 173 GLU A CG   1  
ATOM   2757   C  CD   . GLU A 1 173 ? 1.151   -8.051  -15.256 1.00 0.00 ? 173 GLU A CD   1  
ATOM   2758   O  OE1  . GLU A 1 173 ? 0.042   -8.164  -15.751 1.00 0.00 ? 173 GLU A OE1  1  
ATOM   2759   O  OE2  . GLU A 1 173 ? 2.044   -7.370  -15.731 1.00 0.00 ? 173 GLU A OE2  1  
ATOM   2760   H  H    . GLU A 1 173 ? 3.079   -7.493  -11.854 1.00 0.00 ? 173 GLU A H    1  
ATOM   2761   H  HA   . GLU A 1 173 ? 1.042   -6.151  -13.534 1.00 0.00 ? 173 GLU A HA   1  
ATOM   2762   H  HB2  . GLU A 1 173 ? 0.880   -8.693  -11.888 1.00 0.00 ? 173 GLU A HB2  1  
ATOM   2763   H  HB3  . GLU A 1 173 ? -0.353  -8.111  -13.007 1.00 0.00 ? 173 GLU A HB3  1  
ATOM   2764   H  HG2  . GLU A 1 173 ? 2.503   -8.803  -13.765 1.00 0.00 ? 173 GLU A HG2  1  
ATOM   2765   H  HG3  . GLU A 1 173 ? 1.098   -9.828  -14.057 1.00 0.00 ? 173 GLU A HG3  1  
ATOM   2766   N  N    . ILE A 1 174 ? 1.161   -5.684  -10.400 1.00 0.00 ? 174 ILE A N    1  
ATOM   2767   C  CA   . ILE A 1 174 ? 0.450   -5.048  -9.246  1.00 0.00 ? 174 ILE A CA   1  
ATOM   2768   C  C    . ILE A 1 174 ? 1.023   -3.659  -8.938  1.00 0.00 ? 174 ILE A C    1  
ATOM   2769   O  O    . ILE A 1 174 ? 0.737   -3.091  -7.903  1.00 0.00 ? 174 ILE A O    1  
ATOM   2770   C  CB   . ILE A 1 174 ? 0.587   -5.937  -8.009  1.00 0.00 ? 174 ILE A CB   1  
ATOM   2771   C  CG1  . ILE A 1 174 ? 1.992   -6.537  -7.963  1.00 0.00 ? 174 ILE A CG1  1  
ATOM   2772   C  CG2  . ILE A 1 174 ? -0.444  -7.064  -8.073  1.00 0.00 ? 174 ILE A CG2  1  
ATOM   2773   C  CD1  . ILE A 1 174 ? 2.219   -7.193  -6.599  1.00 0.00 ? 174 ILE A CD1  1  
ATOM   2774   H  H    . ILE A 1 174 ? 2.126   -5.845  -10.356 1.00 0.00 ? 174 ILE A H    1  
ATOM   2775   H  HA   . ILE A 1 174 ? -0.597  -4.945  -9.484  1.00 0.00 ? 174 ILE A HA   1  
ATOM   2776   H  HB   . ILE A 1 174 ? 0.417   -5.343  -7.121  1.00 0.00 ? 174 ILE A HB   1  
ATOM   2777   H  HG12 . ILE A 1 174 ? 2.089   -7.279  -8.742  1.00 0.00 ? 174 ILE A HG12 1  
ATOM   2778   H  HG13 . ILE A 1 174 ? 2.724   -5.758  -8.112  1.00 0.00 ? 174 ILE A HG13 1  
ATOM   2779   H  HG21 . ILE A 1 174 ? -0.775  -7.192  -9.093  1.00 0.00 ? 174 ILE A HG21 1  
ATOM   2780   H  HG22 . ILE A 1 174 ? -1.289  -6.815  -7.449  1.00 0.00 ? 174 ILE A HG22 1  
ATOM   2781   H  HG23 . ILE A 1 174 ? 0.004   -7.982  -7.722  1.00 0.00 ? 174 ILE A HG23 1  
ATOM   2782   H  HD11 . ILE A 1 174 ? 1.874   -6.530  -5.819  1.00 0.00 ? 174 ILE A HD11 1  
ATOM   2783   H  HD12 . ILE A 1 174 ? 3.273   -7.388  -6.463  1.00 0.00 ? 174 ILE A HD12 1  
ATOM   2784   H  HD13 . ILE A 1 174 ? 1.671   -8.122  -6.550  1.00 0.00 ? 174 ILE A HD13 1  
ATOM   2785   N  N    . VAL A 1 175 ? 1.810   -3.096  -9.820  1.00 0.00 ? 175 VAL A N    1  
ATOM   2786   C  CA   . VAL A 1 175 ? 2.367   -1.735  -9.549  1.00 0.00 ? 175 VAL A CA   1  
ATOM   2787   C  C    . VAL A 1 175 ? 1.680   -0.709  -10.455 1.00 0.00 ? 175 VAL A C    1  
ATOM   2788   O  O    . VAL A 1 175 ? 1.616   0.462   -10.136 1.00 0.00 ? 175 VAL A O    1  
ATOM   2789   C  CB   . VAL A 1 175 ? 3.878   -1.708  -9.810  1.00 0.00 ? 175 VAL A CB   1  
ATOM   2790   C  CG1  . VAL A 1 175 ? 4.625   -2.223  -8.578  1.00 0.00 ? 175 VAL A CG1  1  
ATOM   2791   C  CG2  . VAL A 1 175 ? 4.214   -2.592  -11.007 1.00 0.00 ? 175 VAL A CG2  1  
ATOM   2792   H  H    . VAL A 1 175 ? 2.024   -3.559  -10.656 1.00 0.00 ? 175 VAL A H    1  
ATOM   2793   H  HA   . VAL A 1 175 ? 2.182   -1.471  -8.517  1.00 0.00 ? 175 VAL A HA   1  
ATOM   2794   H  HB   . VAL A 1 175 ? 4.186   -0.692  -10.014 1.00 0.00 ? 175 VAL A HB   1  
ATOM   2795   H  HG11 . VAL A 1 175 ? 5.672   -2.347  -8.818  1.00 0.00 ? 175 VAL A HG11 1  
ATOM   2796   H  HG12 . VAL A 1 175 ? 4.210   -3.174  -8.276  1.00 0.00 ? 175 VAL A HG12 1  
ATOM   2797   H  HG13 . VAL A 1 175 ? 4.523   -1.513  -7.772  1.00 0.00 ? 175 VAL A HG13 1  
ATOM   2798   H  HG21 . VAL A 1 175 ? 3.355   -2.663  -11.657 1.00 0.00 ? 175 VAL A HG21 1  
ATOM   2799   H  HG22 . VAL A 1 175 ? 4.486   -3.575  -10.659 1.00 0.00 ? 175 VAL A HG22 1  
ATOM   2800   H  HG23 . VAL A 1 175 ? 5.042   -2.161  -11.550 1.00 0.00 ? 175 VAL A HG23 1  
ATOM   2801   N  N    . LEU A 1 176 ? 1.176   -1.127  -11.587 1.00 0.00 ? 176 LEU A N    1  
ATOM   2802   C  CA   . LEU A 1 176 ? 0.512   -0.159  -12.507 1.00 0.00 ? 176 LEU A CA   1  
ATOM   2803   C  C    . LEU A 1 176 ? -0.987  -0.078  -12.210 1.00 0.00 ? 176 LEU A C    1  
ATOM   2804   O  O    . LEU A 1 176 ? -1.715  0.633   -12.873 1.00 0.00 ? 176 LEU A O    1  
ATOM   2805   C  CB   . LEU A 1 176 ? 0.708   -0.623  -13.951 1.00 0.00 ? 176 LEU A CB   1  
ATOM   2806   C  CG   . LEU A 1 176 ? 2.163   -0.402  -14.368 1.00 0.00 ? 176 LEU A CG   1  
ATOM   2807   C  CD1  . LEU A 1 176 ? 2.715   -1.687  -14.987 1.00 0.00 ? 176 LEU A CD1  1  
ATOM   2808   C  CD2  . LEU A 1 176 ? 2.230   0.729   -15.397 1.00 0.00 ? 176 LEU A CD2  1  
ATOM   2809   H  H    . LEU A 1 176 ? 1.242   -2.069  -11.849 1.00 0.00 ? 176 LEU A H    1  
ATOM   2810   H  HA   . LEU A 1 176 ? 0.954   0.815   -12.382 1.00 0.00 ? 176 LEU A HA   1  
ATOM   2811   H  HB2  . LEU A 1 176 ? 0.466   -1.673  -14.027 1.00 0.00 ? 176 LEU A HB2  1  
ATOM   2812   H  HB3  . LEU A 1 176 ? 0.060   -0.056  -14.599 1.00 0.00 ? 176 LEU A HB3  1  
ATOM   2813   H  HG   . LEU A 1 176 ? 2.750   -0.139  -13.500 1.00 0.00 ? 176 LEU A HG   1  
ATOM   2814   H  HD11 . LEU A 1 176 ? 2.122   -1.956  -15.848 1.00 0.00 ? 176 LEU A HD11 1  
ATOM   2815   H  HD12 . LEU A 1 176 ? 2.673   -2.484  -14.259 1.00 0.00 ? 176 LEU A HD12 1  
ATOM   2816   H  HD13 . LEU A 1 176 ? 3.739   -1.530  -15.290 1.00 0.00 ? 176 LEU A HD13 1  
ATOM   2817   H  HD21 . LEU A 1 176 ? 1.610   0.481   -16.245 1.00 0.00 ? 176 LEU A HD21 1  
ATOM   2818   H  HD22 . LEU A 1 176 ? 3.251   0.858   -15.723 1.00 0.00 ? 176 LEU A HD22 1  
ATOM   2819   H  HD23 . LEU A 1 176 ? 1.877   1.645   -14.947 1.00 0.00 ? 176 LEU A HD23 1  
ATOM   2820   N  N    . ALA A 1 177 ? -1.458  -0.788  -11.225 1.00 0.00 ? 177 ALA A N    1  
ATOM   2821   C  CA   . ALA A 1 177 ? -2.912  -0.728  -10.908 1.00 0.00 ? 177 ALA A CA   1  
ATOM   2822   C  C    . ALA A 1 177 ? -3.180  0.505   -10.043 1.00 0.00 ? 177 ALA A C    1  
ATOM   2823   O  O    . ALA A 1 177 ? -2.795  0.563   -8.892  1.00 0.00 ? 177 ALA A O    1  
ATOM   2824   C  CB   . ALA A 1 177 ? -3.323  -1.990  -10.151 1.00 0.00 ? 177 ALA A CB   1  
ATOM   2825   H  H    . ALA A 1 177 ? -0.862  -1.353  -10.693 1.00 0.00 ? 177 ALA A H    1  
ATOM   2826   H  HA   . ALA A 1 177 ? -3.477  -0.657  -11.825 1.00 0.00 ? 177 ALA A HA   1  
ATOM   2827   H  HB1  . ALA A 1 177 ? -4.332  -2.263  -10.426 1.00 0.00 ? 177 ALA A HB1  1  
ATOM   2828   H  HB2  . ALA A 1 177 ? -3.278  -1.802  -9.090  1.00 0.00 ? 177 ALA A HB2  1  
ATOM   2829   H  HB3  . ALA A 1 177 ? -2.652  -2.797  -10.402 1.00 0.00 ? 177 ALA A HB3  1  
ATOM   2830   N  N    . ARG A 1 178 ? -3.831  1.496   -10.590 1.00 0.00 ? 178 ARG A N    1  
ATOM   2831   C  CA   . ARG A 1 178 ? -4.112  2.728   -9.799  1.00 0.00 ? 178 ARG A CA   1  
ATOM   2832   C  C    . ARG A 1 178 ? -5.347  2.515   -8.925  1.00 0.00 ? 178 ARG A C    1  
ATOM   2833   O  O    . ARG A 1 178 ? -6.215  1.726   -9.238  1.00 0.00 ? 178 ARG A O    1  
ATOM   2834   C  CB   . ARG A 1 178 ? -4.359  3.901   -10.752 1.00 0.00 ? 178 ARG A CB   1  
ATOM   2835   C  CG   . ARG A 1 178 ? -4.840  3.371   -12.103 1.00 0.00 ? 178 ARG A CG   1  
ATOM   2836   C  CD   . ARG A 1 178 ? -5.250  4.542   -12.997 1.00 0.00 ? 178 ARG A CD   1  
ATOM   2837   N  NE   . ARG A 1 178 ? -4.510  4.460   -14.288 1.00 0.00 ? 178 ARG A NE   1  
ATOM   2838   C  CZ   . ARG A 1 178 ? -4.616  3.394   -15.033 1.00 0.00 ? 178 ARG A CZ   1  
ATOM   2839   N  NH1  . ARG A 1 178 ? -5.380  2.405   -14.655 1.00 0.00 ? 178 ARG A NH1  1  
ATOM   2840   N  NH2  . ARG A 1 178 ? -3.959  3.315   -16.158 1.00 0.00 ? 178 ARG A NH2  1  
ATOM   2841   H  H    . ARG A 1 178 ? -4.127  1.433   -11.521 1.00 0.00 ? 178 ARG A H    1  
ATOM   2842   H  HA   . ARG A 1 178 ? -3.262  2.952   -9.172  1.00 0.00 ? 178 ARG A HA   1  
ATOM   2843   H  HB2  . ARG A 1 178 ? -5.111  4.553   -10.331 1.00 0.00 ? 178 ARG A HB2  1  
ATOM   2844   H  HB3  . ARG A 1 178 ? -3.440  4.452   -10.890 1.00 0.00 ? 178 ARG A HB3  1  
ATOM   2845   H  HG2  . ARG A 1 178 ? -4.042  2.819   -12.578 1.00 0.00 ? 178 ARG A HG2  1  
ATOM   2846   H  HG3  . ARG A 1 178 ? -5.689  2.721   -11.954 1.00 0.00 ? 178 ARG A HG3  1  
ATOM   2847   H  HD2  . ARG A 1 178 ? -6.312  4.495   -13.188 1.00 0.00 ? 178 ARG A HD2  1  
ATOM   2848   H  HD3  . ARG A 1 178 ? -5.012  5.472   -12.504 1.00 0.00 ? 178 ARG A HD3  1  
ATOM   2849   H  HE   . ARG A 1 178 ? -3.941  5.205   -14.575 1.00 0.00 ? 178 ARG A HE   1  
ATOM   2850   H  HH11 . ARG A 1 178 ? -5.887  2.466   -13.793 1.00 0.00 ? 178 ARG A HH11 1  
ATOM   2851   H  HH12 . ARG A 1 178 ? -5.460  1.587   -15.224 1.00 0.00 ? 178 ARG A HH12 1  
ATOM   2852   H  HH21 . ARG A 1 178 ? -3.374  4.072   -16.448 1.00 0.00 ? 178 ARG A HH21 1  
ATOM   2853   H  HH22 . ARG A 1 178 ? -4.042  2.498   -16.729 1.00 0.00 ? 178 ARG A HH22 1  
ATOM   2854   N  N    . THR A 1 179 ? -5.430  3.220   -7.829  1.00 0.00 ? 179 THR A N    1  
ATOM   2855   C  CA   . THR A 1 179 ? -6.605  3.071   -6.927  1.00 0.00 ? 179 THR A CA   1  
ATOM   2856   C  C    . THR A 1 179 ? -7.893  3.292   -7.730  1.00 0.00 ? 179 THR A C    1  
ATOM   2857   O  O    . THR A 1 179 ? -7.884  3.931   -8.766  1.00 0.00 ? 179 THR A O    1  
ATOM   2858   C  CB   . THR A 1 179 ? -6.498  4.097   -5.794  1.00 0.00 ? 179 THR A CB   1  
ATOM   2859   O  OG1  . THR A 1 179 ? -7.342  3.705   -4.727  1.00 0.00 ? 179 THR A OG1  1  
ATOM   2860   C  CG2  . THR A 1 179 ? -6.917  5.483   -6.288  1.00 0.00 ? 179 THR A CG2  1  
ATOM   2861   H  H    . THR A 1 179 ? -4.717  3.852   -7.600  1.00 0.00 ? 179 THR A H    1  
ATOM   2862   H  HA   . THR A 1 179 ? -6.610  2.074   -6.511  1.00 0.00 ? 179 THR A HA   1  
ATOM   2863   H  HB   . THR A 1 179 ? -5.476  4.140   -5.444  1.00 0.00 ? 179 THR A HB   1  
ATOM   2864   H  HG1  . THR A 1 179 ? -8.225  4.035   -4.911  1.00 0.00 ? 179 THR A HG1  1  
ATOM   2865   H  HG21 . THR A 1 179 ? -6.295  6.233   -5.820  1.00 0.00 ? 179 THR A HG21 1  
ATOM   2866   H  HG22 . THR A 1 179 ? -7.950  5.659   -6.026  1.00 0.00 ? 179 THR A HG22 1  
ATOM   2867   H  HG23 . THR A 1 179 ? -6.800  5.538   -7.360  1.00 0.00 ? 179 THR A HG23 1  
ATOM   2868   N  N    . PHE A 1 180 ? -9.004  2.767   -7.273  1.00 0.00 ? 180 PHE A N    1  
ATOM   2869   C  CA   . PHE A 1 180 ? -10.276 2.952   -8.032  1.00 0.00 ? 180 PHE A CA   1  
ATOM   2870   C  C    . PHE A 1 180 ? -11.434 3.212   -7.064  1.00 0.00 ? 180 PHE A C    1  
ATOM   2871   O  O    . PHE A 1 180 ? -11.299 3.076   -5.865  1.00 0.00 ? 180 PHE A O    1  
ATOM   2872   C  CB   . PHE A 1 180 ? -10.569 1.686   -8.843  1.00 0.00 ? 180 PHE A CB   1  
ATOM   2873   C  CG   . PHE A 1 180 ? -10.909 0.541   -7.910  1.00 0.00 ? 180 PHE A CG   1  
ATOM   2874   C  CD1  . PHE A 1 180 ? -9.887  -0.189  -7.288  1.00 0.00 ? 180 PHE A CD1  1  
ATOM   2875   C  CD2  . PHE A 1 180 ? -12.248 0.204   -7.673  1.00 0.00 ? 180 PHE A CD2  1  
ATOM   2876   C  CE1  . PHE A 1 180 ? -10.204 -1.250  -6.432  1.00 0.00 ? 180 PHE A CE1  1  
ATOM   2877   C  CE2  . PHE A 1 180 ? -12.563 -0.858  -6.816  1.00 0.00 ? 180 PHE A CE2  1  
ATOM   2878   C  CZ   . PHE A 1 180 ? -11.542 -1.584  -6.196  1.00 0.00 ? 180 PHE A CZ   1  
ATOM   2879   H  H    . PHE A 1 180 ? -9.005  2.252   -6.439  1.00 0.00 ? 180 PHE A H    1  
ATOM   2880   H  HA   . PHE A 1 180 ? -10.175 3.791   -8.703  1.00 0.00 ? 180 PHE A HA   1  
ATOM   2881   H  HB2  . PHE A 1 180 ? -11.404 1.870   -9.504  1.00 0.00 ? 180 PHE A HB2  1  
ATOM   2882   H  HB3  . PHE A 1 180 ? -9.700  1.425   -9.429  1.00 0.00 ? 180 PHE A HB3  1  
ATOM   2883   H  HD1  . PHE A 1 180 ? -8.853  0.066   -7.465  1.00 0.00 ? 180 PHE A HD1  1  
ATOM   2884   H  HD2  . PHE A 1 180 ? -13.038 0.764   -8.150  1.00 0.00 ? 180 PHE A HD2  1  
ATOM   2885   H  HE1  . PHE A 1 180 ? -9.415  -1.811  -5.953  1.00 0.00 ? 180 PHE A HE1  1  
ATOM   2886   H  HE2  . PHE A 1 180 ? -13.596 -1.118  -6.633  1.00 0.00 ? 180 PHE A HE2  1  
ATOM   2887   H  HZ   . PHE A 1 180 ? -11.784 -2.403  -5.535  1.00 0.00 ? 180 PHE A HZ   1  
ATOM   2888   N  N    . CYS A 1 181 ? -12.578 3.579   -7.582  1.00 0.00 ? 181 CYS A N    1  
ATOM   2889   C  CA   . CYS A 1 181 ? -13.754 3.841   -6.701  1.00 0.00 ? 181 CYS A CA   1  
ATOM   2890   C  C    . CYS A 1 181 ? -15.040 3.692   -7.511  1.00 0.00 ? 181 CYS A C    1  
ATOM   2891   O  O    . CYS A 1 181 ? -15.033 3.730   -8.726  1.00 0.00 ? 181 CYS A O    1  
ATOM   2892   C  CB   . CYS A 1 181 ? -13.693 5.261   -6.148  1.00 0.00 ? 181 CYS A CB   1  
ATOM   2893   S  SG   . CYS A 1 181 ? -14.597 5.338   -4.583  1.00 0.00 ? 181 CYS A SG   1  
ATOM   2894   H  H    . CYS A 1 181 ? -12.666 3.677   -8.553  1.00 0.00 ? 181 CYS A H    1  
ATOM   2895   H  HA   . CYS A 1 181 ? -13.758 3.134   -5.884  1.00 0.00 ? 181 CYS A HA   1  
ATOM   2896   H  HB2  . CYS A 1 181 ? -12.664 5.547   -5.989  1.00 0.00 ? 181 CYS A HB2  1  
ATOM   2897   H  HB3  . CYS A 1 181 ? -14.152 5.934   -6.855  1.00 0.00 ? 181 CYS A HB3  1  
ATOM   2898   H  HG   . CYS A 1 181 ? -14.598 4.458   -4.197  1.00 0.00 ? 181 CYS A HG   1  
ATOM   2899   N  N    . PHE A 1 182 ? -16.146 3.538   -6.840  1.00 0.00 ? 182 PHE A N    1  
ATOM   2900   C  CA   . PHE A 1 182 ? -17.445 3.402   -7.555  1.00 0.00 ? 182 PHE A CA   1  
ATOM   2901   C  C    . PHE A 1 182 ? -18.234 4.702   -7.419  1.00 0.00 ? 182 PHE A C    1  
ATOM   2902   O  O    . PHE A 1 182 ? -18.179 5.368   -6.406  1.00 0.00 ? 182 PHE A O    1  
ATOM   2903   C  CB   . PHE A 1 182 ? -18.237 2.239   -6.961  1.00 0.00 ? 182 PHE A CB   1  
ATOM   2904   C  CG   . PHE A 1 182 ? -17.501 0.954   -7.247  1.00 0.00 ? 182 PHE A CG   1  
ATOM   2905   C  CD1  . PHE A 1 182 ? -17.352 0.520   -8.569  1.00 0.00 ? 182 PHE A CD1  1  
ATOM   2906   C  CD2  . PHE A 1 182 ? -16.957 0.206   -6.197  1.00 0.00 ? 182 PHE A CD2  1  
ATOM   2907   C  CE1  . PHE A 1 182 ? -16.661 -0.665  -8.843  1.00 0.00 ? 182 PHE A CE1  1  
ATOM   2908   C  CE2  . PHE A 1 182 ? -16.264 -0.980  -6.471  1.00 0.00 ? 182 PHE A CE2  1  
ATOM   2909   C  CZ   . PHE A 1 182 ? -16.117 -1.414  -7.794  1.00 0.00 ? 182 PHE A CZ   1  
ATOM   2910   H  H    . PHE A 1 182 ? -16.122 3.531   -5.863  1.00 0.00 ? 182 PHE A H    1  
ATOM   2911   H  HA   . PHE A 1 182 ? -17.259 3.208   -8.601  1.00 0.00 ? 182 PHE A HA   1  
ATOM   2912   H  HB2  . PHE A 1 182 ? -18.337 2.374   -5.894  1.00 0.00 ? 182 PHE A HB2  1  
ATOM   2913   H  HB3  . PHE A 1 182 ? -19.214 2.202   -7.416  1.00 0.00 ? 182 PHE A HB3  1  
ATOM   2914   H  HD1  . PHE A 1 182 ? -17.772 1.097   -9.378  1.00 0.00 ? 182 PHE A HD1  1  
ATOM   2915   H  HD2  . PHE A 1 182 ? -17.072 0.541   -5.177  1.00 0.00 ? 182 PHE A HD2  1  
ATOM   2916   H  HE1  . PHE A 1 182 ? -16.547 -1.002  -9.863  1.00 0.00 ? 182 PHE A HE1  1  
ATOM   2917   H  HE2  . PHE A 1 182 ? -15.843 -1.557  -5.662  1.00 0.00 ? 182 PHE A HE2  1  
ATOM   2918   H  HZ   . PHE A 1 182 ? -15.582 -2.327  -8.007  1.00 0.00 ? 182 PHE A HZ   1  
ATOM   2919   N  N    . ASP A 1 183 ? -18.964 5.076   -8.431  1.00 0.00 ? 183 ASP A N    1  
ATOM   2920   C  CA   . ASP A 1 183 ? -19.745 6.343   -8.356  1.00 0.00 ? 183 ASP A CA   1  
ATOM   2921   C  C    . ASP A 1 183 ? -20.754 6.291   -7.200  1.00 0.00 ? 183 ASP A C    1  
ATOM   2922   O  O    . ASP A 1 183 ? -21.211 7.313   -6.728  1.00 0.00 ? 183 ASP A O    1  
ATOM   2923   C  CB   . ASP A 1 183 ? -20.497 6.552   -9.671  1.00 0.00 ? 183 ASP A CB   1  
ATOM   2924   C  CG   . ASP A 1 183 ? -21.739 5.660   -9.694  1.00 0.00 ? 183 ASP A CG   1  
ATOM   2925   O  OD1  . ASP A 1 183 ? -22.729 6.039   -9.088  1.00 0.00 ? 183 ASP A OD1  1  
ATOM   2926   O  OD2  . ASP A 1 183 ? -21.681 4.613   -10.316 1.00 0.00 ? 183 ASP A OD2  1  
ATOM   2927   H  H    . ASP A 1 183 ? -18.991 4.527   -9.245  1.00 0.00 ? 183 ASP A H    1  
ATOM   2928   H  HA   . ASP A 1 183 ? -19.066 7.170   -8.198  1.00 0.00 ? 183 ASP A HA   1  
ATOM   2929   H  HB2  . ASP A 1 183 ? -20.795 7.588   -9.754  1.00 0.00 ? 183 ASP A HB2  1  
ATOM   2930   H  HB3  . ASP A 1 183 ? -19.855 6.293   -10.499 1.00 0.00 ? 183 ASP A HB3  1  
ATOM   2931   N  N    . TRP A 1 184 ? -21.123 5.121   -6.750  1.00 0.00 ? 184 TRP A N    1  
ATOM   2932   C  CA   . TRP A 1 184 ? -22.120 5.042   -5.640  1.00 0.00 ? 184 TRP A CA   1  
ATOM   2933   C  C    . TRP A 1 184 ? -21.443 5.253   -4.280  1.00 0.00 ? 184 TRP A C    1  
ATOM   2934   O  O    . TRP A 1 184 ? -22.030 5.808   -3.372  1.00 0.00 ? 184 TRP A O    1  
ATOM   2935   C  CB   . TRP A 1 184 ? -22.823 3.680   -5.660  1.00 0.00 ? 184 TRP A CB   1  
ATOM   2936   C  CG   . TRP A 1 184 ? -21.847 2.580   -5.382  1.00 0.00 ? 184 TRP A CG   1  
ATOM   2937   C  CD1  . TRP A 1 184 ? -21.244 2.350   -4.192  1.00 0.00 ? 184 TRP A CD1  1  
ATOM   2938   C  CD2  . TRP A 1 184 ? -21.366 1.546   -6.289  1.00 0.00 ? 184 TRP A CD2  1  
ATOM   2939   N  NE1  . TRP A 1 184 ? -20.418 1.247   -4.314  1.00 0.00 ? 184 TRP A NE1  1  
ATOM   2940   C  CE2  . TRP A 1 184 ? -20.460 0.716   -5.588  1.00 0.00 ? 184 TRP A CE2  1  
ATOM   2941   C  CE3  . TRP A 1 184 ? -21.624 1.253   -7.640  1.00 0.00 ? 184 TRP A CE3  1  
ATOM   2942   C  CZ2  . TRP A 1 184 ? -19.830 -0.366  -6.205  1.00 0.00 ? 184 TRP A CZ2  1  
ATOM   2943   C  CZ3  . TRP A 1 184 ? -20.994 0.164   -8.265  1.00 0.00 ? 184 TRP A CZ3  1  
ATOM   2944   C  CH2  . TRP A 1 184 ? -20.099 -0.644  -7.549  1.00 0.00 ? 184 TRP A CH2  1  
ATOM   2945   H  H    . TRP A 1 184 ? -20.759 4.302   -7.147  1.00 0.00 ? 184 TRP A H    1  
ATOM   2946   H  HA   . TRP A 1 184 ? -22.858 5.817   -5.782  1.00 0.00 ? 184 TRP A HA   1  
ATOM   2947   H  HB2  . TRP A 1 184 ? -23.597 3.667   -4.908  1.00 0.00 ? 184 TRP A HB2  1  
ATOM   2948   H  HB3  . TRP A 1 184 ? -23.270 3.525   -6.631  1.00 0.00 ? 184 TRP A HB3  1  
ATOM   2949   H  HD1  . TRP A 1 184 ? -21.381 2.932   -3.293  1.00 0.00 ? 184 TRP A HD1  1  
ATOM   2950   H  HE1  . TRP A 1 184 ? -19.865 0.872   -3.597  1.00 0.00 ? 184 TRP A HE1  1  
ATOM   2951   H  HE3  . TRP A 1 184 ? -22.311 1.869   -8.201  1.00 0.00 ? 184 TRP A HE3  1  
ATOM   2952   H  HZ2  . TRP A 1 184 ? -19.143 -0.987  -5.650  1.00 0.00 ? 184 TRP A HZ2  1  
ATOM   2953   H  HZ3  . TRP A 1 184 ? -21.200 -0.052  -9.303  1.00 0.00 ? 184 TRP A HZ3  1  
ATOM   2954   H  HH2  . TRP A 1 184 ? -19.618 -1.480  -8.035  1.00 0.00 ? 184 TRP A HH2  1  
ATOM   2955   N  N    . GLU A 1 185 ? -20.226 4.811   -4.119  1.00 0.00 ? 185 GLU A N    1  
ATOM   2956   C  CA   . GLU A 1 185 ? -19.546 4.990   -2.801  1.00 0.00 ? 185 GLU A CA   1  
ATOM   2957   C  C    . GLU A 1 185 ? -18.813 6.332   -2.766  1.00 0.00 ? 185 GLU A C    1  
ATOM   2958   O  O    . GLU A 1 185 ? -18.416 6.802   -1.718  1.00 0.00 ? 185 GLU A O    1  
ATOM   2959   C  CB   . GLU A 1 185 ? -18.544 3.853   -2.577  1.00 0.00 ? 185 GLU A CB   1  
ATOM   2960   C  CG   . GLU A 1 185 ? -17.325 4.045   -3.484  1.00 0.00 ? 185 GLU A CG   1  
ATOM   2961   C  CD   . GLU A 1 185 ? -16.441 2.797   -3.418  1.00 0.00 ? 185 GLU A CD   1  
ATOM   2962   O  OE1  . GLU A 1 185 ? -16.288 2.261   -2.333  1.00 0.00 ? 185 GLU A OE1  1  
ATOM   2963   O  OE2  . GLU A 1 185 ? -15.934 2.400   -4.453  1.00 0.00 ? 185 GLU A OE2  1  
ATOM   2964   H  H    . GLU A 1 185 ? -19.764 4.358   -4.855  1.00 0.00 ? 185 GLU A H    1  
ATOM   2965   H  HA   . GLU A 1 185 ? -20.287 4.968   -2.015  1.00 0.00 ? 185 GLU A HA   1  
ATOM   2966   H  HB2  . GLU A 1 185 ? -18.227 3.853   -1.545  1.00 0.00 ? 185 GLU A HB2  1  
ATOM   2967   H  HB3  . GLU A 1 185 ? -19.013 2.909   -2.808  1.00 0.00 ? 185 GLU A HB3  1  
ATOM   2968   H  HG2  . GLU A 1 185 ? -17.654 4.202   -4.500  1.00 0.00 ? 185 GLU A HG2  1  
ATOM   2969   H  HG3  . GLU A 1 185 ? -16.759 4.901   -3.151  1.00 0.00 ? 185 GLU A HG3  1  
ATOM   2970   N  N    . ILE A 1 186 ? -18.624 6.950   -3.896  1.00 0.00 ? 186 ILE A N    1  
ATOM   2971   C  CA   . ILE A 1 186 ? -17.911 8.254   -3.923  1.00 0.00 ? 186 ILE A CA   1  
ATOM   2972   C  C    . ILE A 1 186 ? -18.582 9.252   -2.976  1.00 0.00 ? 186 ILE A C    1  
ATOM   2973   O  O    . ILE A 1 186 ? -17.935 9.854   -2.142  1.00 0.00 ? 186 ILE A O    1  
ATOM   2974   C  CB   . ILE A 1 186 ? -17.945 8.798   -5.349  1.00 0.00 ? 186 ILE A CB   1  
ATOM   2975   C  CG1  . ILE A 1 186 ? -16.783 8.206   -6.145  1.00 0.00 ? 186 ILE A CG1  1  
ATOM   2976   C  CG2  . ILE A 1 186 ? -17.826 10.323  -5.320  1.00 0.00 ? 186 ILE A CG2  1  
ATOM   2977   C  CD1  . ILE A 1 186 ? -16.918 8.596   -7.618  1.00 0.00 ? 186 ILE A CD1  1  
ATOM   2978   H  H    . ILE A 1 186 ? -18.947 6.557   -4.732  1.00 0.00 ? 186 ILE A H    1  
ATOM   2979   H  HA   . ILE A 1 186 ? -16.885 8.107   -3.618  1.00 0.00 ? 186 ILE A HA   1  
ATOM   2980   H  HB   . ILE A 1 186 ? -18.879 8.518   -5.812  1.00 0.00 ? 186 ILE A HB   1  
ATOM   2981   H  HG12 . ILE A 1 186 ? -15.856 8.583   -5.754  1.00 0.00 ? 186 ILE A HG12 1  
ATOM   2982   H  HG13 . ILE A 1 186 ? -16.797 7.132   -6.057  1.00 0.00 ? 186 ILE A HG13 1  
ATOM   2983   H  HG21 . ILE A 1 186 ? -18.775 10.753  -5.040  1.00 0.00 ? 186 ILE A HG21 1  
ATOM   2984   H  HG22 . ILE A 1 186 ? -17.543 10.681  -6.298  1.00 0.00 ? 186 ILE A HG22 1  
ATOM   2985   H  HG23 . ILE A 1 186 ? -17.073 10.612  -4.601  1.00 0.00 ? 186 ILE A HG23 1  
ATOM   2986   H  HD11 . ILE A 1 186 ? -16.846 7.712   -8.233  1.00 0.00 ? 186 ILE A HD11 1  
ATOM   2987   H  HD12 . ILE A 1 186 ? -16.127 9.281   -7.881  1.00 0.00 ? 186 ILE A HD12 1  
ATOM   2988   H  HD13 . ILE A 1 186 ? -17.874 9.072   -7.781  1.00 0.00 ? 186 ILE A HD13 1  
ATOM   2989   N  N    . GLU A 1 187 ? -19.867 9.445   -3.096  1.00 0.00 ? 187 GLU A N    1  
ATOM   2990   C  CA   . GLU A 1 187 ? -20.555 10.419  -2.200  1.00 0.00 ? 187 GLU A CA   1  
ATOM   2991   C  C    . GLU A 1 187 ? -20.199 10.115  -0.745  1.00 0.00 ? 187 GLU A C    1  
ATOM   2992   O  O    . GLU A 1 187 ? -19.856 10.999  0.015   1.00 0.00 ? 187 GLU A O    1  
ATOM   2993   C  CB   . GLU A 1 187 ? -22.069 10.304  -2.387  1.00 0.00 ? 187 GLU A CB   1  
ATOM   2994   C  CG   . GLU A 1 187 ? -22.419 10.520  -3.861  1.00 0.00 ? 187 GLU A CG   1  
ATOM   2995   C  CD   . GLU A 1 187 ? -23.713 11.329  -3.966  1.00 0.00 ? 187 GLU A CD   1  
ATOM   2996   O  OE1  . GLU A 1 187 ? -23.636 12.544  -3.891  1.00 0.00 ? 187 GLU A OE1  1  
ATOM   2997   O  OE2  . GLU A 1 187 ? -24.758 10.720  -4.121  1.00 0.00 ? 187 GLU A OE2  1  
ATOM   2998   H  H    . GLU A 1 187 ? -20.380 8.966   -3.780  1.00 0.00 ? 187 GLU A H    1  
ATOM   2999   H  HA   . GLU A 1 187 ? -20.237 11.422  -2.446  1.00 0.00 ? 187 GLU A HA   1  
ATOM   3000   H  HB2  . GLU A 1 187 ? -22.396 9.322   -2.078  1.00 0.00 ? 187 GLU A HB2  1  
ATOM   3001   H  HB3  . GLU A 1 187 ? -22.563 11.054  -1.789  1.00 0.00 ? 187 GLU A HB3  1  
ATOM   3002   H  HG2  . GLU A 1 187 ? -21.617 11.056  -4.347  1.00 0.00 ? 187 GLU A HG2  1  
ATOM   3003   H  HG3  . GLU A 1 187 ? -22.556 9.563   -4.343  1.00 0.00 ? 187 GLU A HG3  1  
ATOM   3004   N  N    . HIS A 1 188 ? -20.273 8.876   -0.348  1.00 0.00 ? 188 HIS A N    1  
ATOM   3005   C  CA   . HIS A 1 188 ? -19.933 8.528   1.059   1.00 0.00 ? 188 HIS A CA   1  
ATOM   3006   C  C    . HIS A 1 188 ? -18.509 8.999   1.364   1.00 0.00 ? 188 HIS A C    1  
ATOM   3007   O  O    . HIS A 1 188 ? -18.272 9.721   2.313   1.00 0.00 ? 188 HIS A O    1  
ATOM   3008   C  CB   . HIS A 1 188 ? -20.026 7.013   1.248   1.00 0.00 ? 188 HIS A CB   1  
ATOM   3009   C  CG   . HIS A 1 188 ? -21.174 6.695   2.165   1.00 0.00 ? 188 HIS A CG   1  
ATOM   3010   N  ND1  . HIS A 1 188 ? -22.483 6.627   1.715   1.00 0.00 ? 188 HIS A ND1  1  
ATOM   3011   C  CD2  . HIS A 1 188 ? -21.226 6.430   3.511   1.00 0.00 ? 188 HIS A CD2  1  
ATOM   3012   C  CE1  . HIS A 1 188 ? -23.261 6.332   2.773   1.00 0.00 ? 188 HIS A CE1  1  
ATOM   3013   N  NE2  . HIS A 1 188 ? -22.544 6.201   3.893   1.00 0.00 ? 188 HIS A NE2  1  
ATOM   3014   H  H    . HIS A 1 188 ? -20.550 8.175   -0.974  1.00 0.00 ? 188 HIS A H    1  
ATOM   3015   H  HA   . HIS A 1 188 ? -20.625 9.018   1.728   1.00 0.00 ? 188 HIS A HA   1  
ATOM   3016   H  HB2  . HIS A 1 188 ? -20.187 6.540   0.290   1.00 0.00 ? 188 HIS A HB2  1  
ATOM   3017   H  HB3  . HIS A 1 188 ? -19.107 6.647   1.682   1.00 0.00 ? 188 HIS A HB3  1  
ATOM   3018   H  HD1  . HIS A 1 188 ? -22.787 6.767   0.794   1.00 0.00 ? 188 HIS A HD1  1  
ATOM   3019   H  HD2  . HIS A 1 188 ? -20.373 6.404   4.173   1.00 0.00 ? 188 HIS A HD2  1  
ATOM   3020   H  HE1  . HIS A 1 188 ? -24.333 6.215   2.724   1.00 0.00 ? 188 HIS A HE1  1  
ATOM   3021   N  N    . ILE A 1 189 ? -17.559 8.604   0.560   1.00 0.00 ? 189 ILE A N    1  
ATOM   3022   C  CA   . ILE A 1 189 ? -16.155 9.035   0.799   1.00 0.00 ? 189 ILE A CA   1  
ATOM   3023   C  C    . ILE A 1 189 ? -16.108 10.564  0.856   1.00 0.00 ? 189 ILE A C    1  
ATOM   3024   O  O    . ILE A 1 189 ? -15.339 11.154  1.593   1.00 0.00 ? 189 ILE A O    1  
ATOM   3025   C  CB   . ILE A 1 189 ? -15.272 8.528   -0.342  1.00 0.00 ? 189 ILE A CB   1  
ATOM   3026   C  CG1  . ILE A 1 189 ? -15.429 7.009   -0.460  1.00 0.00 ? 189 ILE A CG1  1  
ATOM   3027   C  CG2  . ILE A 1 189 ? -13.809 8.866   -0.047  1.00 0.00 ? 189 ILE A CG2  1  
ATOM   3028   C  CD1  . ILE A 1 189 ? -14.741 6.518   -1.732  1.00 0.00 ? 189 ILE A CD1  1  
ATOM   3029   H  H    . ILE A 1 189 ? -17.772 8.029   -0.209  1.00 0.00 ? 189 ILE A H    1  
ATOM   3030   H  HA   . ILE A 1 189 ? -15.807 8.623   1.734   1.00 0.00 ? 189 ILE A HA   1  
ATOM   3031   H  HB   . ILE A 1 189 ? -15.572 8.997   -1.267  1.00 0.00 ? 189 ILE A HB   1  
ATOM   3032   H  HG12 . ILE A 1 189 ? -14.979 6.533   0.400   1.00 0.00 ? 189 ILE A HG12 1  
ATOM   3033   H  HG13 . ILE A 1 189 ? -16.478 6.758   -0.500  1.00 0.00 ? 189 ILE A HG13 1  
ATOM   3034   H  HG21 . ILE A 1 189 ? -13.700 9.111   0.999   1.00 0.00 ? 189 ILE A HG21 1  
ATOM   3035   H  HG22 . ILE A 1 189 ? -13.508 9.710   -0.648  1.00 0.00 ? 189 ILE A HG22 1  
ATOM   3036   H  HG23 . ILE A 1 189 ? -13.188 8.015   -0.284  1.00 0.00 ? 189 ILE A HG23 1  
ATOM   3037   H  HD11 . ILE A 1 189 ? -15.125 7.062   -2.583  1.00 0.00 ? 189 ILE A HD11 1  
ATOM   3038   H  HD12 . ILE A 1 189 ? -14.934 5.464   -1.863  1.00 0.00 ? 189 ILE A HD12 1  
ATOM   3039   H  HD13 . ILE A 1 189 ? -13.679 6.682   -1.651  1.00 0.00 ? 189 ILE A HD13 1  
ATOM   3040   N  N    . LYS A 1 190 ? -16.936 11.207  0.079   1.00 0.00 ? 190 LYS A N    1  
ATOM   3041   C  CA   . LYS A 1 190 ? -16.966 12.695  0.066   1.00 0.00 ? 190 LYS A CA   1  
ATOM   3042   C  C    . LYS A 1 190 ? -17.708 13.206  1.305   1.00 0.00 ? 190 LYS A C    1  
ATOM   3043   O  O    . LYS A 1 190 ? -17.430 14.275  1.810   1.00 0.00 ? 190 LYS A O    1  
ATOM   3044   C  CB   . LYS A 1 190 ? -17.701 13.165  -1.192  1.00 0.00 ? 190 LYS A CB   1  
ATOM   3045   C  CG   . LYS A 1 190 ? -16.704 13.352  -2.339  1.00 0.00 ? 190 LYS A CG   1  
ATOM   3046   C  CD   . LYS A 1 190 ? -16.258 14.815  -2.399  1.00 0.00 ? 190 LYS A CD   1  
ATOM   3047   C  CE   . LYS A 1 190 ? -15.368 15.025  -3.625  1.00 0.00 ? 190 LYS A CE   1  
ATOM   3048   N  NZ   . LYS A 1 190 ? -14.032 14.417  -3.378  1.00 0.00 ? 190 LYS A NZ   1  
ATOM   3049   H  H    . LYS A 1 190 ? -17.546 10.704  -0.503  1.00 0.00 ? 190 LYS A H    1  
ATOM   3050   H  HA   . LYS A 1 190 ? -15.958 13.081  0.064   1.00 0.00 ? 190 LYS A HA   1  
ATOM   3051   H  HB2  . LYS A 1 190 ? -18.433 12.423  -1.472  1.00 0.00 ? 190 LYS A HB2  1  
ATOM   3052   H  HB3  . LYS A 1 190 ? -18.200 14.100  -0.991  1.00 0.00 ? 190 LYS A HB3  1  
ATOM   3053   H  HG2  . LYS A 1 190 ? -15.843 12.718  -2.177  1.00 0.00 ? 190 LYS A HG2  1  
ATOM   3054   H  HG3  . LYS A 1 190 ? -17.176 13.084  -3.272  1.00 0.00 ? 190 LYS A HG3  1  
ATOM   3055   H  HD2  . LYS A 1 190 ? -17.127 15.454  -2.470  1.00 0.00 ? 190 LYS A HD2  1  
ATOM   3056   H  HD3  . LYS A 1 190 ? -15.702 15.059  -1.507  1.00 0.00 ? 190 LYS A HD3  1  
ATOM   3057   H  HE2  . LYS A 1 190 ? -15.824 14.555  -4.485  1.00 0.00 ? 190 LYS A HE2  1  
ATOM   3058   H  HE3  . LYS A 1 190 ? -15.255 16.083  -3.810  1.00 0.00 ? 190 LYS A HE3  1  
ATOM   3059   H  HZ1  . LYS A 1 190 ? -13.305 15.161  -3.386  1.00 0.00 ? 190 LYS A HZ1  1  
ATOM   3060   H  HZ2  . LYS A 1 190 ? -13.824 13.721  -4.123  1.00 0.00 ? 190 LYS A HZ2  1  
ATOM   3061   H  HZ3  . LYS A 1 190 ? -14.031 13.946  -2.451  1.00 0.00 ? 190 LYS A HZ3  1  
ATOM   3062   N  N    . LYS A 1 191 ? -18.653 12.452  1.796   1.00 0.00 ? 191 LYS A N    1  
ATOM   3063   C  CA   . LYS A 1 191 ? -19.418 12.895  2.996   1.00 0.00 ? 191 LYS A CA   1  
ATOM   3064   C  C    . LYS A 1 191 ? -18.528 12.817  4.239   1.00 0.00 ? 191 LYS A C    1  
ATOM   3065   O  O    . LYS A 1 191 ? -18.775 13.473  5.231   1.00 0.00 ? 191 LYS A O    1  
ATOM   3066   C  CB   . LYS A 1 191 ? -20.634 11.986  3.189   1.00 0.00 ? 191 LYS A CB   1  
ATOM   3067   C  CG   . LYS A 1 191 ? -21.648 12.237  2.071   1.00 0.00 ? 191 LYS A CG   1  
ATOM   3068   C  CD   . LYS A 1 191 ? -22.994 12.631  2.684   1.00 0.00 ? 191 LYS A CD   1  
ATOM   3069   C  CE   . LYS A 1 191 ? -24.042 12.756  1.578   1.00 0.00 ? 191 LYS A CE   1  
ATOM   3070   N  NZ   . LYS A 1 191 ? -23.640 13.836  0.633   1.00 0.00 ? 191 LYS A NZ   1  
ATOM   3071   H  H    . LYS A 1 191 ? -18.864 11.594  1.371   1.00 0.00 ? 191 LYS A H    1  
ATOM   3072   H  HA   . LYS A 1 191 ? -19.749 13.913  2.856   1.00 0.00 ? 191 LYS A HA   1  
ATOM   3073   H  HB2  . LYS A 1 191 ? -20.317 10.953  3.162   1.00 0.00 ? 191 LYS A HB2  1  
ATOM   3074   H  HB3  . LYS A 1 191 ? -21.093 12.197  4.143   1.00 0.00 ? 191 LYS A HB3  1  
ATOM   3075   H  HG2  . LYS A 1 191 ? -21.295 13.035  1.433   1.00 0.00 ? 191 LYS A HG2  1  
ATOM   3076   H  HG3  . LYS A 1 191 ? -21.771 11.338  1.487   1.00 0.00 ? 191 LYS A HG3  1  
ATOM   3077   H  HD2  . LYS A 1 191 ? -23.302 11.872  3.389   1.00 0.00 ? 191 LYS A HD2  1  
ATOM   3078   H  HD3  . LYS A 1 191 ? -22.894 13.577  3.192   1.00 0.00 ? 191 LYS A HD3  1  
ATOM   3079   H  HE2  . LYS A 1 191 ? -24.117 11.819  1.044   1.00 0.00 ? 191 LYS A HE2  1  
ATOM   3080   H  HE3  . LYS A 1 191 ? -25.000 12.998  2.015   1.00 0.00 ? 191 LYS A HE3  1  
ATOM   3081   H  HZ1  . LYS A 1 191 ? -23.901 13.564  -0.336  1.00 0.00 ? 191 LYS A HZ1  1  
ATOM   3082   H  HZ2  . LYS A 1 191 ? -22.612 13.979  0.689   1.00 0.00 ? 191 LYS A HZ2  1  
ATOM   3083   H  HZ3  . LYS A 1 191 ? -24.129 14.718  0.886   1.00 0.00 ? 191 LYS A HZ3  1  
ATOM   3084   N  N    . VAL A 1 192 ? -17.499 12.018  4.199   1.00 0.00 ? 192 VAL A N    1  
ATOM   3085   C  CA   . VAL A 1 192 ? -16.606 11.903  5.387   1.00 0.00 ? 192 VAL A CA   1  
ATOM   3086   C  C    . VAL A 1 192 ? -15.458 12.908  5.276   1.00 0.00 ? 192 VAL A C    1  
ATOM   3087   O  O    . VAL A 1 192 ? -14.494 12.843  6.013   1.00 0.00 ? 192 VAL A O    1  
ATOM   3088   C  CB   . VAL A 1 192 ? -16.038 10.486  5.477   1.00 0.00 ? 192 VAL A CB   1  
ATOM   3089   C  CG1  . VAL A 1 192 ? -17.148 9.517   5.887   1.00 0.00 ? 192 VAL A CG1  1  
ATOM   3090   C  CG2  . VAL A 1 192 ? -15.481 10.073  4.116   1.00 0.00 ? 192 VAL A CG2  1  
ATOM   3091   H  H    . VAL A 1 192 ? -17.317 11.494  3.393   1.00 0.00 ? 192 VAL A H    1  
ATOM   3092   H  HA   . VAL A 1 192 ? -17.176 12.114  6.278   1.00 0.00 ? 192 VAL A HA   1  
ATOM   3093   H  HB   . VAL A 1 192 ? -15.249 10.461  6.215   1.00 0.00 ? 192 VAL A HB   1  
ATOM   3094   H  HG11 . VAL A 1 192 ? -17.216 9.484   6.965   1.00 0.00 ? 192 VAL A HG11 1  
ATOM   3095   H  HG12 . VAL A 1 192 ? -16.923 8.530   5.510   1.00 0.00 ? 192 VAL A HG12 1  
ATOM   3096   H  HG13 . VAL A 1 192 ? -18.089 9.853   5.477   1.00 0.00 ? 192 VAL A HG13 1  
ATOM   3097   H  HG21 . VAL A 1 192 ? -16.281 10.055  3.396   1.00 0.00 ? 192 VAL A HG21 1  
ATOM   3098   H  HG22 . VAL A 1 192 ? -15.039 9.091   4.189   1.00 0.00 ? 192 VAL A HG22 1  
ATOM   3099   H  HG23 . VAL A 1 192 ? -14.732 10.785  3.805   1.00 0.00 ? 192 VAL A HG23 1  
ATOM   3100   N  N    . GLY A 1 193 ? -15.556 13.851  4.377   1.00 0.00 ? 193 GLY A N    1  
ATOM   3101   C  CA   . GLY A 1 193 ? -14.476 14.871  4.242   1.00 0.00 ? 193 GLY A CA   1  
ATOM   3102   C  C    . GLY A 1 193 ? -13.203 14.241  3.672   1.00 0.00 ? 193 GLY A C    1  
ATOM   3103   O  O    . GLY A 1 193 ? -12.112 14.711  3.929   1.00 0.00 ? 193 GLY A O    1  
ATOM   3104   H  H    . GLY A 1 193 ? -16.346 13.908  3.798   1.00 0.00 ? 193 GLY A H    1  
ATOM   3105   H  HA2  . GLY A 1 193 ? -14.812 15.657  3.579   1.00 0.00 ? 193 GLY A HA2  1  
ATOM   3106   H  HA3  . GLY A 1 193 ? -14.260 15.290  5.213   1.00 0.00 ? 193 GLY A HA3  1  
ATOM   3107   N  N    . LEU A 1 194 ? -13.321 13.186  2.904   1.00 0.00 ? 194 LEU A N    1  
ATOM   3108   C  CA   . LEU A 1 194 ? -12.100 12.545  2.329   1.00 0.00 ? 194 LEU A CA   1  
ATOM   3109   C  C    . LEU A 1 194 ? -12.194 12.528  0.801   1.00 0.00 ? 194 LEU A C    1  
ATOM   3110   O  O    . LEU A 1 194 ? -13.263 12.613  0.229   1.00 0.00 ? 194 LEU A O    1  
ATOM   3111   C  CB   . LEU A 1 194 ? -11.982 11.108  2.844   1.00 0.00 ? 194 LEU A CB   1  
ATOM   3112   C  CG   . LEU A 1 194 ? -11.875 11.114  4.372   1.00 0.00 ? 194 LEU A CG   1  
ATOM   3113   C  CD1  . LEU A 1 194 ? -11.913 9.675   4.890   1.00 0.00 ? 194 LEU A CD1  1  
ATOM   3114   C  CD2  . LEU A 1 194 ? -10.558 11.771  4.797   1.00 0.00 ? 194 LEU A CD2  1  
ATOM   3115   H  H    . LEU A 1 194 ? -14.209 12.815  2.707   1.00 0.00 ? 194 LEU A H    1  
ATOM   3116   H  HA   . LEU A 1 194 ? -11.224 13.103  2.624   1.00 0.00 ? 194 LEU A HA   1  
ATOM   3117   H  HB2  . LEU A 1 194 ? -12.855 10.549  2.547   1.00 0.00 ? 194 LEU A HB2  1  
ATOM   3118   H  HB3  . LEU A 1 194 ? -11.101 10.646  2.425   1.00 0.00 ? 194 LEU A HB3  1  
ATOM   3119   H  HG   . LEU A 1 194 ? -12.705 11.668  4.786   1.00 0.00 ? 194 LEU A HG   1  
ATOM   3120   H  HD11 . LEU A 1 194 ? -11.960 8.993   4.054   1.00 0.00 ? 194 LEU A HD11 1  
ATOM   3121   H  HD12 . LEU A 1 194 ? -12.784 9.542   5.515   1.00 0.00 ? 194 LEU A HD12 1  
ATOM   3122   H  HD13 . LEU A 1 194 ? -11.022 9.478   5.467   1.00 0.00 ? 194 LEU A HD13 1  
ATOM   3123   H  HD21 . LEU A 1 194 ? -10.732 12.811  5.028   1.00 0.00 ? 194 LEU A HD21 1  
ATOM   3124   H  HD22 . LEU A 1 194 ? -9.840  11.698  3.993   1.00 0.00 ? 194 LEU A HD22 1  
ATOM   3125   H  HD23 . LEU A 1 194 ? -10.170 11.267  5.671   1.00 0.00 ? 194 LEU A HD23 1  
ATOM   3126   N  N    . GLY A 1 195 ? -11.076 12.398  0.138   1.00 0.00 ? 195 GLY A N    1  
ATOM   3127   C  CA   . GLY A 1 195 ? -11.086 12.351  -1.353  1.00 0.00 ? 195 GLY A CA   1  
ATOM   3128   C  C    . GLY A 1 195 ? -11.235 13.760  -1.942  1.00 0.00 ? 195 GLY A C    1  
ATOM   3129   O  O    . GLY A 1 195 ? -11.749 13.925  -3.031  1.00 0.00 ? 195 GLY A O    1  
ATOM   3130   H  H    . GLY A 1 195 ? -10.231 12.312  0.625   1.00 0.00 ? 195 GLY A H    1  
ATOM   3131   H  HA2  . GLY A 1 195 ? -10.161 11.913  -1.702  1.00 0.00 ? 195 GLY A HA2  1  
ATOM   3132   H  HA3  . GLY A 1 195 ? -11.914 11.742  -1.681  1.00 0.00 ? 195 GLY A HA3  1  
ATOM   3133   N  N    . LYS A 1 196 ? -10.788 14.779  -1.253  1.00 0.00 ? 196 LYS A N    1  
ATOM   3134   C  CA   . LYS A 1 196 ? -10.920 16.156  -1.817  1.00 0.00 ? 196 LYS A CA   1  
ATOM   3135   C  C    . LYS A 1 196 ? -9.971  16.301  -3.010  1.00 0.00 ? 196 LYS A C    1  
ATOM   3136   O  O    . LYS A 1 196 ? -10.147 17.153  -3.860  1.00 0.00 ? 196 LYS A O    1  
ATOM   3137   C  CB   . LYS A 1 196 ? -10.565 17.196  -0.752  1.00 0.00 ? 196 LYS A CB   1  
ATOM   3138   C  CG   . LYS A 1 196 ? -11.680 17.258  0.292   1.00 0.00 ? 196 LYS A CG   1  
ATOM   3139   C  CD   . LYS A 1 196 ? -11.069 17.436  1.683   1.00 0.00 ? 196 LYS A CD   1  
ATOM   3140   C  CE   . LYS A 1 196 ? -12.185 17.649  2.707   1.00 0.00 ? 196 LYS A CE   1  
ATOM   3141   N  NZ   . LYS A 1 196 ? -11.663 17.375  4.074   1.00 0.00 ? 196 LYS A NZ   1  
ATOM   3142   H  H    . LYS A 1 196 ? -10.365 14.640  -0.378  1.00 0.00 ? 196 LYS A H    1  
ATOM   3143   H  HA   . LYS A 1 196 ? -11.937 16.312  -2.148  1.00 0.00 ? 196 LYS A HA   1  
ATOM   3144   H  HB2  . LYS A 1 196 ? -9.637  16.923  -0.276  1.00 0.00 ? 196 LYS A HB2  1  
ATOM   3145   H  HB3  . LYS A 1 196 ? -10.458 18.165  -1.217  1.00 0.00 ? 196 LYS A HB3  1  
ATOM   3146   H  HG2  . LYS A 1 196 ? -12.331 18.091  0.074   1.00 0.00 ? 196 LYS A HG2  1  
ATOM   3147   H  HG3  . LYS A 1 196 ? -12.249 16.341  0.267   1.00 0.00 ? 196 LYS A HG3  1  
ATOM   3148   H  HD2  . LYS A 1 196 ? -10.504 16.552  1.943   1.00 0.00 ? 196 LYS A HD2  1  
ATOM   3149   H  HD3  . LYS A 1 196 ? -10.415 18.295  1.682   1.00 0.00 ? 196 LYS A HD3  1  
ATOM   3150   H  HE2  . LYS A 1 196 ? -12.533 18.671  2.652   1.00 0.00 ? 196 LYS A HE2  1  
ATOM   3151   H  HE3  . LYS A 1 196 ? -13.004 16.978  2.493   1.00 0.00 ? 196 LYS A HE3  1  
ATOM   3152   H  HZ1  . LYS A 1 196 ? -10.662 17.101  4.015   1.00 0.00 ? 196 LYS A HZ1  1  
ATOM   3153   H  HZ2  . LYS A 1 196 ? -12.210 16.601  4.505   1.00 0.00 ? 196 LYS A HZ2  1  
ATOM   3154   H  HZ3  . LYS A 1 196 ? -11.752 18.230  4.658   1.00 0.00 ? 196 LYS A HZ3  1  
ATOM   3155   N  N    . GLY A 1 197 ? -8.977  15.462  -3.083  1.00 0.00 ? 197 GLY A N    1  
ATOM   3156   C  CA   . GLY A 1 197 ? -8.019  15.523  -4.221  1.00 0.00 ? 197 GLY A CA   1  
ATOM   3157   C  C    . GLY A 1 197 ? -8.344  14.413  -5.221  1.00 0.00 ? 197 GLY A C    1  
ATOM   3158   O  O    . GLY A 1 197 ? -7.718  14.291  -6.256  1.00 0.00 ? 197 GLY A O    1  
ATOM   3159   H  H    . GLY A 1 197 ? -8.874  14.775  -2.393  1.00 0.00 ? 197 GLY A H    1  
ATOM   3160   H  HA2  . GLY A 1 197 ? -8.098  16.486  -4.709  1.00 0.00 ? 197 GLY A HA2  1  
ATOM   3161   H  HA3  . GLY A 1 197 ? -7.017  15.383  -3.854  1.00 0.00 ? 197 GLY A HA3  1  
ATOM   3162   N  N    . GLY A 1 198 ? -9.309  13.591  -4.913  1.00 0.00 ? 198 GLY A N    1  
ATOM   3163   C  CA   . GLY A 1 198 ? -9.662  12.478  -5.836  1.00 0.00 ? 198 GLY A CA   1  
ATOM   3164   C  C    . GLY A 1 198 ? -10.154 13.035  -7.171  1.00 0.00 ? 198 GLY A C    1  
ATOM   3165   O  O    . GLY A 1 198 ? -11.078 13.820  -7.232  1.00 0.00 ? 198 GLY A O    1  
ATOM   3166   H  H    . GLY A 1 198 ? -9.795  13.701  -4.069  1.00 0.00 ? 198 GLY A H    1  
ATOM   3167   H  HA2  . GLY A 1 198 ? -8.788  11.866  -6.007  1.00 0.00 ? 198 GLY A HA2  1  
ATOM   3168   H  HA3  . GLY A 1 198 ? -10.439 11.875  -5.394  1.00 0.00 ? 198 GLY A HA3  1  
ATOM   3169   N  N    . SER A 1 199 ? -9.534  12.622  -8.239  1.00 0.00 ? 199 SER A N    1  
ATOM   3170   C  CA   . SER A 1 199 ? -9.947  13.110  -9.586  1.00 0.00 ? 199 SER A CA   1  
ATOM   3171   C  C    . SER A 1 199 ? -9.920  11.944  -10.575 1.00 0.00 ? 199 SER A C    1  
ATOM   3172   O  O    . SER A 1 199 ? -9.506  10.850  -10.248 1.00 0.00 ? 199 SER A O    1  
ATOM   3173   C  CB   . SER A 1 199 ? -8.982  14.199  -10.053 1.00 0.00 ? 199 SER A CB   1  
ATOM   3174   O  OG   . SER A 1 199 ? -7.645  13.762  -9.847  1.00 0.00 ? 199 SER A OG   1  
ATOM   3175   H  H    . SER A 1 199 ? -8.794  11.989  -8.147  1.00 0.00 ? 199 SER A H    1  
ATOM   3176   H  HA   . SER A 1 199 ? -10.948 13.514  -9.531  1.00 0.00 ? 199 SER A HA   1  
ATOM   3177   H  HB2  . SER A 1 199 ? -9.133  14.392  -11.102 1.00 0.00 ? 199 SER A HB2  1  
ATOM   3178   H  HB3  . SER A 1 199 ? -9.166  15.107  -9.491  1.00 0.00 ? 199 SER A HB3  1  
ATOM   3179   H  HG   . SER A 1 199 ? -7.225  13.679  -10.707 1.00 0.00 ? 199 SER A HG   1  
ATOM   3180   N  N    . LEU A 1 200 ? -10.360 12.166  -11.782 1.00 0.00 ? 200 LEU A N    1  
ATOM   3181   C  CA   . LEU A 1 200 ? -10.358 11.067  -12.788 1.00 0.00 ? 200 LEU A CA   1  
ATOM   3182   C  C    . LEU A 1 200 ? -8.929  10.833  -13.286 1.00 0.00 ? 200 LEU A C    1  
ATOM   3183   O  O    . LEU A 1 200 ? -8.630  9.820   -13.886 1.00 0.00 ? 200 LEU A O    1  
ATOM   3184   C  CB   . LEU A 1 200 ? -11.251 11.454  -13.969 1.00 0.00 ? 200 LEU A CB   1  
ATOM   3185   C  CG   . LEU A 1 200 ? -12.649 11.817  -13.461 1.00 0.00 ? 200 LEU A CG   1  
ATOM   3186   C  CD1  . LEU A 1 200 ? -13.508 12.299  -14.631 1.00 0.00 ? 200 LEU A CD1  1  
ATOM   3187   C  CD2  . LEU A 1 200 ? -13.298 10.583  -12.832 1.00 0.00 ? 200 LEU A CD2  1  
ATOM   3188   H  H    . LEU A 1 200 ? -10.692 13.056  -12.027 1.00 0.00 ? 200 LEU A H    1  
ATOM   3189   H  HA   . LEU A 1 200 ? -10.733 10.162  -12.333 1.00 0.00 ? 200 LEU A HA   1  
ATOM   3190   H  HB2  . LEU A 1 200 ? -10.822 12.303  -14.480 1.00 0.00 ? 200 LEU A HB2  1  
ATOM   3191   H  HB3  . LEU A 1 200 ? -11.324 10.622  -14.653 1.00 0.00 ? 200 LEU A HB3  1  
ATOM   3192   H  HG   . LEU A 1 200 ? -12.571 12.602  -12.723 1.00 0.00 ? 200 LEU A HG   1  
ATOM   3193   H  HD11 . LEU A 1 200 ? -13.872 11.447  -15.186 1.00 0.00 ? 200 LEU A HD11 1  
ATOM   3194   H  HD12 . LEU A 1 200 ? -12.913 12.925  -15.281 1.00 0.00 ? 200 LEU A HD12 1  
ATOM   3195   H  HD13 . LEU A 1 200 ? -14.345 12.867  -14.253 1.00 0.00 ? 200 LEU A HD13 1  
ATOM   3196   H  HD21 . LEU A 1 200 ? -14.372 10.658  -12.919 1.00 0.00 ? 200 LEU A HD21 1  
ATOM   3197   H  HD22 . LEU A 1 200 ? -13.026 10.525  -11.787 1.00 0.00 ? 200 LEU A HD22 1  
ATOM   3198   H  HD23 . LEU A 1 200 ? -12.957 9.695   -13.342 1.00 0.00 ? 200 LEU A HD23 1  
ATOM   3199   N  N    . LYS A 1 201 ? -8.046  11.763  -13.044 1.00 0.00 ? 201 LYS A N    1  
ATOM   3200   C  CA   . LYS A 1 201 ? -6.641  11.592  -13.506 1.00 0.00 ? 201 LYS A CA   1  
ATOM   3201   C  C    . LYS A 1 201 ? -5.837  10.844  -12.441 1.00 0.00 ? 201 LYS A C    1  
ATOM   3202   O  O    . LYS A 1 201 ? -4.786  10.298  -12.716 1.00 0.00 ? 201 LYS A O    1  
ATOM   3203   C  CB   . LYS A 1 201 ? -6.013  12.966  -13.744 1.00 0.00 ? 201 LYS A CB   1  
ATOM   3204   C  CG   . LYS A 1 201 ? -4.614  12.792  -14.336 1.00 0.00 ? 201 LYS A CG   1  
ATOM   3205   C  CD   . LYS A 1 201 ? -4.056  14.158  -14.741 1.00 0.00 ? 201 LYS A CD   1  
ATOM   3206   C  CE   . LYS A 1 201 ? -2.527  14.109  -14.728 1.00 0.00 ? 201 LYS A CE   1  
ATOM   3207   N  NZ   . LYS A 1 201 ? -2.026  14.606  -13.416 1.00 0.00 ? 201 LYS A NZ   1  
ATOM   3208   H  H    . LYS A 1 201 ? -8.309  12.573  -12.560 1.00 0.00 ? 201 LYS A H    1  
ATOM   3209   H  HA   . LYS A 1 201 ? -6.630  11.028  -14.426 1.00 0.00 ? 201 LYS A HA   1  
ATOM   3210   H  HB2  . LYS A 1 201 ? -6.630  13.528  -14.431 1.00 0.00 ? 201 LYS A HB2  1  
ATOM   3211   H  HB3  . LYS A 1 201 ? -5.942  13.497  -12.807 1.00 0.00 ? 201 LYS A HB3  1  
ATOM   3212   H  HG2  . LYS A 1 201 ? -3.966  12.340  -13.599 1.00 0.00 ? 201 LYS A HG2  1  
ATOM   3213   H  HG3  . LYS A 1 201 ? -4.668  12.155  -15.207 1.00 0.00 ? 201 LYS A HG3  1  
ATOM   3214   H  HD2  . LYS A 1 201 ? -4.401  14.407  -15.734 1.00 0.00 ? 201 LYS A HD2  1  
ATOM   3215   H  HD3  . LYS A 1 201 ? -4.396  14.907  -14.042 1.00 0.00 ? 201 LYS A HD3  1  
ATOM   3216   H  HE2  . LYS A 1 201 ? -2.198  13.091  -14.876 1.00 0.00 ? 201 LYS A HE2  1  
ATOM   3217   H  HE3  . LYS A 1 201 ? -2.141  14.732  -15.521 1.00 0.00 ? 201 LYS A HE3  1  
ATOM   3218   H  HZ1  . LYS A 1 201 ? -2.277  15.609  -13.306 1.00 0.00 ? 201 LYS A HZ1  1  
ATOM   3219   H  HZ2  . LYS A 1 201 ? -0.990  14.502  -13.380 1.00 0.00 ? 201 LYS A HZ2  1  
ATOM   3220   H  HZ3  . LYS A 1 201 ? -2.458  14.057  -12.648 1.00 0.00 ? 201 LYS A HZ3  1  
ATOM   3221   N  N    . ASN A 1 202 ? -6.321  10.816  -11.227 1.00 0.00 ? 202 ASN A N    1  
ATOM   3222   C  CA   . ASN A 1 202 ? -5.586  10.107  -10.141 1.00 0.00 ? 202 ASN A CA   1  
ATOM   3223   C  C    . ASN A 1 202 ? -6.504  9.071   -9.490  1.00 0.00 ? 202 ASN A C    1  
ATOM   3224   O  O    . ASN A 1 202 ? -6.074  8.270   -8.683  1.00 0.00 ? 202 ASN A O    1  
ATOM   3225   C  CB   . ASN A 1 202 ? -5.135  11.118  -9.085  1.00 0.00 ? 202 ASN A CB   1  
ATOM   3226   C  CG   . ASN A 1 202 ? -4.420  12.286  -9.766  1.00 0.00 ? 202 ASN A CG   1  
ATOM   3227   O  OD1  . ASN A 1 202 ? -4.385  12.368  -10.977 1.00 0.00 ? 202 ASN A OD1  1  
ATOM   3228   N  ND2  . ASN A 1 202 ? -3.843  13.200  -9.033  1.00 0.00 ? 202 ASN A ND2  1  
ATOM   3229   H  H    . ASN A 1 202 ? -7.169  11.266  -11.029 1.00 0.00 ? 202 ASN A H    1  
ATOM   3230   H  HA   . ASN A 1 202 ? -4.721  9.609   -10.553 1.00 0.00 ? 202 ASN A HA   1  
ATOM   3231   H  HB2  . ASN A 1 202 ? -5.998  11.486  -8.549  1.00 0.00 ? 202 ASN A HB2  1  
ATOM   3232   H  HB3  . ASN A 1 202 ? -4.460  10.637  -8.394  1.00 0.00 ? 202 ASN A HB3  1  
ATOM   3233   H  HD21 . ASN A 1 202 ? -3.871  13.134  -8.056  1.00 0.00 ? 202 ASN A HD21 1  
ATOM   3234   H  HD22 . ASN A 1 202 ? -3.383  13.952  -9.461  1.00 0.00 ? 202 ASN A HD22 1  
ATOM   3235   N  N    . THR A 1 203 ? -7.766  9.081   -9.830  1.00 0.00 ? 203 THR A N    1  
ATOM   3236   C  CA   . THR A 1 203 ? -8.708  8.098   -9.223  1.00 0.00 ? 203 THR A CA   1  
ATOM   3237   C  C    . THR A 1 203 ? -9.557  7.452   -10.318 1.00 0.00 ? 203 THR A C    1  
ATOM   3238   O  O    . THR A 1 203 ? -10.291 8.118   -11.019 1.00 0.00 ? 203 THR A O    1  
ATOM   3239   C  CB   . THR A 1 203 ? -9.625  8.817   -8.232  1.00 0.00 ? 203 THR A CB   1  
ATOM   3240   O  OG1  . THR A 1 203 ? -8.926  9.906   -7.644  1.00 0.00 ? 203 THR A OG1  1  
ATOM   3241   C  CG2  . THR A 1 203 ? -10.063 7.840   -7.141  1.00 0.00 ? 203 THR A CG2  1  
ATOM   3242   H  H    . THR A 1 203 ? -8.092  9.740   -10.480 1.00 0.00 ? 203 THR A H    1  
ATOM   3243   H  HA   . THR A 1 203 ? -8.149  7.333   -8.705  1.00 0.00 ? 203 THR A HA   1  
ATOM   3244   H  HB   . THR A 1 203 ? -10.496 9.184   -8.751  1.00 0.00 ? 203 THR A HB   1  
ATOM   3245   H  HG1  . THR A 1 203 ? -8.017  9.634   -7.501  1.00 0.00 ? 203 THR A HG1  1  
ATOM   3246   H  HG21 . THR A 1 203 ? -9.378  7.898   -6.309  1.00 0.00 ? 203 THR A HG21 1  
ATOM   3247   H  HG22 . THR A 1 203 ? -10.063 6.835   -7.538  1.00 0.00 ? 203 THR A HG22 1  
ATOM   3248   H  HG23 . THR A 1 203 ? -11.059 8.095   -6.808  1.00 0.00 ? 203 THR A HG23 1  
ATOM   3249   N  N    . LEU A 1 204 ? -9.472  6.157   -10.465 1.00 0.00 ? 204 LEU A N    1  
ATOM   3250   C  CA   . LEU A 1 204 ? -10.288 5.475   -11.508 1.00 0.00 ? 204 LEU A CA   1  
ATOM   3251   C  C    . LEU A 1 204 ? -11.705 5.269   -10.972 1.00 0.00 ? 204 LEU A C    1  
ATOM   3252   O  O    . LEU A 1 204 ? -11.911 4.573   -9.998  1.00 0.00 ? 204 LEU A O    1  
ATOM   3253   C  CB   . LEU A 1 204 ? -9.666  4.118   -11.841 1.00 0.00 ? 204 LEU A CB   1  
ATOM   3254   C  CG   . LEU A 1 204 ? -10.364 3.524   -13.066 1.00 0.00 ? 204 LEU A CG   1  
ATOM   3255   C  CD1  . LEU A 1 204 ? -9.636  3.971   -14.335 1.00 0.00 ? 204 LEU A CD1  1  
ATOM   3256   C  CD2  . LEU A 1 204 ? -10.342 1.997   -12.974 1.00 0.00 ? 204 LEU A CD2  1  
ATOM   3257   H  H    . LEU A 1 204 ? -8.880  5.634   -9.882  1.00 0.00 ? 204 LEU A H    1  
ATOM   3258   H  HA   . LEU A 1 204 ? -10.323 6.086   -12.398 1.00 0.00 ? 204 LEU A HA   1  
ATOM   3259   H  HB2  . LEU A 1 204 ? -8.615  4.245   -12.052 1.00 0.00 ? 204 LEU A HB2  1  
ATOM   3260   H  HB3  . LEU A 1 204 ? -9.788  3.450   -11.002 1.00 0.00 ? 204 LEU A HB3  1  
ATOM   3261   H  HG   . LEU A 1 204 ? -11.387 3.871   -13.098 1.00 0.00 ? 204 LEU A HG   1  
ATOM   3262   H  HD11 . LEU A 1 204 ? -10.211 3.678   -15.201 1.00 0.00 ? 204 LEU A HD11 1  
ATOM   3263   H  HD12 . LEU A 1 204 ? -8.662  3.506   -14.374 1.00 0.00 ? 204 LEU A HD12 1  
ATOM   3264   H  HD13 . LEU A 1 204 ? -9.522  5.045   -14.325 1.00 0.00 ? 204 LEU A HD13 1  
ATOM   3265   H  HD21 . LEU A 1 204 ? -11.127 1.665   -12.310 1.00 0.00 ? 204 LEU A HD21 1  
ATOM   3266   H  HD22 . LEU A 1 204 ? -9.385  1.673   -12.591 1.00 0.00 ? 204 LEU A HD22 1  
ATOM   3267   H  HD23 . LEU A 1 204 ? -10.498 1.574   -13.955 1.00 0.00 ? 204 LEU A HD23 1  
ATOM   3268   N  N    . VAL A 1 205 ? -12.684 5.872   -11.592 1.00 0.00 ? 205 VAL A N    1  
ATOM   3269   C  CA   . VAL A 1 205 ? -14.083 5.712   -11.106 1.00 0.00 ? 205 VAL A CA   1  
ATOM   3270   C  C    . VAL A 1 205 ? -14.845 4.764   -12.032 1.00 0.00 ? 205 VAL A C    1  
ATOM   3271   O  O    . VAL A 1 205 ? -14.860 4.936   -13.235 1.00 0.00 ? 205 VAL A O    1  
ATOM   3272   C  CB   . VAL A 1 205 ? -14.774 7.077   -11.092 1.00 0.00 ? 205 VAL A CB   1  
ATOM   3273   C  CG1  . VAL A 1 205 ? -16.256 6.894   -10.762 1.00 0.00 ? 205 VAL A CG1  1  
ATOM   3274   C  CG2  . VAL A 1 205 ? -14.121 7.967   -10.033 1.00 0.00 ? 205 VAL A CG2  1  
ATOM   3275   H  H    . VAL A 1 205 ? -12.502 6.433   -12.376 1.00 0.00 ? 205 VAL A H    1  
ATOM   3276   H  HA   . VAL A 1 205 ? -14.074 5.306   -10.105 1.00 0.00 ? 205 VAL A HA   1  
ATOM   3277   H  HB   . VAL A 1 205 ? -14.675 7.538   -12.064 1.00 0.00 ? 205 VAL A HB   1  
ATOM   3278   H  HG11 . VAL A 1 205 ? -16.765 6.469   -11.615 1.00 0.00 ? 205 VAL A HG11 1  
ATOM   3279   H  HG12 . VAL A 1 205 ? -16.692 7.852   -10.523 1.00 0.00 ? 205 VAL A HG12 1  
ATOM   3280   H  HG13 . VAL A 1 205 ? -16.357 6.231   -9.915  1.00 0.00 ? 205 VAL A HG13 1  
ATOM   3281   H  HG21 . VAL A 1 205 ? -13.142 7.581   -9.791  1.00 0.00 ? 205 VAL A HG21 1  
ATOM   3282   H  HG22 . VAL A 1 205 ? -14.733 7.975   -9.143  1.00 0.00 ? 205 VAL A HG22 1  
ATOM   3283   H  HG23 . VAL A 1 205 ? -14.028 8.973   -10.415 1.00 0.00 ? 205 VAL A HG23 1  
ATOM   3284   N  N    . LEU A 1 206 ? -15.477 3.763   -11.479 1.00 0.00 ? 206 LEU A N    1  
ATOM   3285   C  CA   . LEU A 1 206 ? -16.237 2.800   -12.323 1.00 0.00 ? 206 LEU A CA   1  
ATOM   3286   C  C    . LEU A 1 206 ? -17.740 3.002   -12.112 1.00 0.00 ? 206 LEU A C    1  
ATOM   3287   O  O    . LEU A 1 206 ? -18.187 3.370   -11.041 1.00 0.00 ? 206 LEU A O    1  
ATOM   3288   C  CB   . LEU A 1 206 ? -15.856 1.370   -11.932 1.00 0.00 ? 206 LEU A CB   1  
ATOM   3289   C  CG   . LEU A 1 206 ? -14.526 0.999   -12.589 1.00 0.00 ? 206 LEU A CG   1  
ATOM   3290   C  CD1  . LEU A 1 206 ? -13.831 -0.086  -11.764 1.00 0.00 ? 206 LEU A CD1  1  
ATOM   3291   C  CD2  . LEU A 1 206 ? -14.787 0.472   -14.003 1.00 0.00 ? 206 LEU A CD2  1  
ATOM   3292   H  H    . LEU A 1 206 ? -15.449 3.646   -10.507 1.00 0.00 ? 206 LEU A H    1  
ATOM   3293   H  HA   . LEU A 1 206 ? -15.996 2.963   -13.363 1.00 0.00 ? 206 LEU A HA   1  
ATOM   3294   H  HB2  . LEU A 1 206 ? -15.759 1.305   -10.858 1.00 0.00 ? 206 LEU A HB2  1  
ATOM   3295   H  HB3  . LEU A 1 206 ? -16.624 0.689   -12.266 1.00 0.00 ? 206 LEU A HB3  1  
ATOM   3296   H  HG   . LEU A 1 206 ? -13.893 1.873   -12.640 1.00 0.00 ? 206 LEU A HG   1  
ATOM   3297   H  HD11 . LEU A 1 206 ? -14.556 -0.823  -11.455 1.00 0.00 ? 206 LEU A HD11 1  
ATOM   3298   H  HD12 . LEU A 1 206 ? -13.379 0.362   -10.890 1.00 0.00 ? 206 LEU A HD12 1  
ATOM   3299   H  HD13 . LEU A 1 206 ? -13.066 -0.559  -12.361 1.00 0.00 ? 206 LEU A HD13 1  
ATOM   3300   H  HD21 . LEU A 1 206 ? -14.844 -0.606  -13.981 1.00 0.00 ? 206 LEU A HD21 1  
ATOM   3301   H  HD22 . LEU A 1 206 ? -13.981 0.776   -14.655 1.00 0.00 ? 206 LEU A HD22 1  
ATOM   3302   H  HD23 . LEU A 1 206 ? -15.719 0.875   -14.370 1.00 0.00 ? 206 LEU A HD23 1  
ATOM   3303   N  N    . GLY A 1 207 ? -18.522 2.758   -13.129 1.00 0.00 ? 207 GLY A N    1  
ATOM   3304   C  CA   . GLY A 1 207 ? -19.997 2.925   -12.999 1.00 0.00 ? 207 GLY A CA   1  
ATOM   3305   C  C    . GLY A 1 207 ? -20.651 1.545   -12.914 1.00 0.00 ? 207 GLY A C    1  
ATOM   3306   O  O    . GLY A 1 207 ? -20.100 0.559   -13.364 1.00 0.00 ? 207 GLY A O    1  
ATOM   3307   H  H    . GLY A 1 207 ? -18.139 2.459   -13.980 1.00 0.00 ? 207 GLY A H    1  
ATOM   3308   H  HA2  . GLY A 1 207 ? -20.218 3.486   -12.103 1.00 0.00 ? 207 GLY A HA2  1  
ATOM   3309   H  HA3  . GLY A 1 207 ? -20.380 3.452   -13.861 1.00 0.00 ? 207 GLY A HA3  1  
ATOM   3310   N  N    . LYS A 1 208 ? -21.817 1.464   -12.336 1.00 0.00 ? 208 LYS A N    1  
ATOM   3311   C  CA   . LYS A 1 208 ? -22.501 0.145   -12.216 1.00 0.00 ? 208 LYS A CA   1  
ATOM   3312   C  C    . LYS A 1 208 ? -22.352 -0.639  -13.523 1.00 0.00 ? 208 LYS A C    1  
ATOM   3313   O  O    . LYS A 1 208 ? -22.266 -1.851  -13.520 1.00 0.00 ? 208 LYS A O    1  
ATOM   3314   C  CB   . LYS A 1 208 ? -23.986 0.365   -11.920 1.00 0.00 ? 208 LYS A CB   1  
ATOM   3315   C  CG   . LYS A 1 208 ? -24.660 -0.984  -11.666 1.00 0.00 ? 208 LYS A CG   1  
ATOM   3316   C  CD   . LYS A 1 208 ? -25.884 -1.122  -12.573 1.00 0.00 ? 208 LYS A CD   1  
ATOM   3317   C  CE   . LYS A 1 208 ? -26.544 -2.483  -12.343 1.00 0.00 ? 208 LYS A CE   1  
ATOM   3318   N  NZ   . LYS A 1 208 ? -25.542 -3.564  -12.554 1.00 0.00 ? 208 LYS A NZ   1  
ATOM   3319   H  H    . LYS A 1 208 ? -22.242 2.270   -11.975 1.00 0.00 ? 208 LYS A H    1  
ATOM   3320   H  HA   . LYS A 1 208 ? -22.053 -0.418  -11.410 1.00 0.00 ? 208 LYS A HA   1  
ATOM   3321   H  HB2  . LYS A 1 208 ? -24.089 0.991   -11.045 1.00 0.00 ? 208 LYS A HB2  1  
ATOM   3322   H  HB3  . LYS A 1 208 ? -24.454 0.845   -12.765 1.00 0.00 ? 208 LYS A HB3  1  
ATOM   3323   H  HG2  . LYS A 1 208 ? -23.962 -1.781  -11.878 1.00 0.00 ? 208 LYS A HG2  1  
ATOM   3324   H  HG3  . LYS A 1 208 ? -24.970 -1.043  -10.633 1.00 0.00 ? 208 LYS A HG3  1  
ATOM   3325   H  HD2  . LYS A 1 208 ? -26.589 -0.335  -12.346 1.00 0.00 ? 208 LYS A HD2  1  
ATOM   3326   H  HD3  . LYS A 1 208 ? -25.577 -1.042  -13.605 1.00 0.00 ? 208 LYS A HD3  1  
ATOM   3327   H  HE2  . LYS A 1 208 ? -26.921 -2.534  -11.331 1.00 0.00 ? 208 LYS A HE2  1  
ATOM   3328   H  HE3  . LYS A 1 208 ? -27.362 -2.608  -13.038 1.00 0.00 ? 208 LYS A HE3  1  
ATOM   3329   H  HZ1  . LYS A 1 208 ? -24.971 -3.682  -11.694 1.00 0.00 ? 208 LYS A HZ1  1  
ATOM   3330   H  HZ2  . LYS A 1 208 ? -24.922 -3.310  -13.352 1.00 0.00 ? 208 LYS A HZ2  1  
ATOM   3331   H  HZ3  . LYS A 1 208 ? -26.032 -4.455  -12.766 1.00 0.00 ? 208 LYS A HZ3  1  
ATOM   3332   N  N    . ASP A 1 209 ? -22.323 0.036   -14.640 1.00 0.00 ? 209 ASP A N    1  
ATOM   3333   C  CA   . ASP A 1 209 ? -22.184 -0.690  -15.933 1.00 0.00 ? 209 ASP A CA   1  
ATOM   3334   C  C    . ASP A 1 209 ? -21.405 0.167   -16.933 1.00 0.00 ? 209 ASP A C    1  
ATOM   3335   O  O    . ASP A 1 209 ? -21.425 -0.083  -18.121 1.00 0.00 ? 209 ASP A O    1  
ATOM   3336   C  CB   . ASP A 1 209 ? -23.572 -0.995  -16.499 1.00 0.00 ? 209 ASP A CB   1  
ATOM   3337   C  CG   . ASP A 1 209 ? -23.441 -1.954  -17.683 1.00 0.00 ? 209 ASP A CG   1  
ATOM   3338   O  OD1  . ASP A 1 209 ? -22.320 -2.300  -18.018 1.00 0.00 ? 209 ASP A OD1  1  
ATOM   3339   O  OD2  . ASP A 1 209 ? -24.463 -2.325  -18.235 1.00 0.00 ? 209 ASP A OD2  1  
ATOM   3340   H  H    . ASP A 1 209 ? -22.395 1.013   -14.627 1.00 0.00 ? 209 ASP A H    1  
ATOM   3341   H  HA   . ASP A 1 209 ? -21.654 -1.614  -15.769 1.00 0.00 ? 209 ASP A HA   1  
ATOM   3342   H  HB2  . ASP A 1 209 ? -24.181 -1.450  -15.731 1.00 0.00 ? 209 ASP A HB2  1  
ATOM   3343   H  HB3  . ASP A 1 209 ? -24.037 -0.077  -16.830 1.00 0.00 ? 209 ASP A HB3  1  
ATOM   3344   N  N    . LYS A 1 210 ? -20.724 1.179   -16.470 1.00 0.00 ? 210 LYS A N    1  
ATOM   3345   C  CA   . LYS A 1 210 ? -19.960 2.040   -17.415 1.00 0.00 ? 210 LYS A CA   1  
ATOM   3346   C  C    . LYS A 1 210 ? -18.660 2.517   -16.765 1.00 0.00 ? 210 LYS A C    1  
ATOM   3347   O  O    . LYS A 1 210 ? -18.559 2.634   -15.560 1.00 0.00 ? 210 LYS A O    1  
ATOM   3348   C  CB   . LYS A 1 210 ? -20.812 3.252   -17.797 1.00 0.00 ? 210 LYS A CB   1  
ATOM   3349   C  CG   . LYS A 1 210 ? -20.954 3.312   -19.319 1.00 0.00 ? 210 LYS A CG   1  
ATOM   3350   C  CD   . LYS A 1 210 ? -21.914 4.442   -19.700 1.00 0.00 ? 210 LYS A CD   1  
ATOM   3351   C  CE   . LYS A 1 210 ? -23.037 3.881   -20.575 1.00 0.00 ? 210 LYS A CE   1  
ATOM   3352   N  NZ   . LYS A 1 210 ? -23.910 2.995   -19.754 1.00 0.00 ? 210 LYS A NZ   1  
ATOM   3353   H  H    . LYS A 1 210 ? -20.722 1.377   -15.510 1.00 0.00 ? 210 LYS A H    1  
ATOM   3354   H  HA   . LYS A 1 210 ? -19.728 1.474   -18.305 1.00 0.00 ? 210 LYS A HA   1  
ATOM   3355   H  HB2  . LYS A 1 210 ? -21.790 3.162   -17.348 1.00 0.00 ? 210 LYS A HB2  1  
ATOM   3356   H  HB3  . LYS A 1 210 ? -20.335 4.154   -17.445 1.00 0.00 ? 210 LYS A HB3  1  
ATOM   3357   H  HG2  . LYS A 1 210 ? -19.986 3.496   -19.763 1.00 0.00 ? 210 LYS A HG2  1  
ATOM   3358   H  HG3  . LYS A 1 210 ? -21.344 2.374   -19.681 1.00 0.00 ? 210 LYS A HG3  1  
ATOM   3359   H  HD2  . LYS A 1 210 ? -22.335 4.873   -18.804 1.00 0.00 ? 210 LYS A HD2  1  
ATOM   3360   H  HD3  . LYS A 1 210 ? -21.378 5.201   -20.250 1.00 0.00 ? 210 LYS A HD3  1  
ATOM   3361   H  HE2  . LYS A 1 210 ? -23.623 4.695   -20.973 1.00 0.00 ? 210 LYS A HE2  1  
ATOM   3362   H  HE3  . LYS A 1 210 ? -22.610 3.313   -21.388 1.00 0.00 ? 210 LYS A HE3  1  
ATOM   3363   H  HZ1  . LYS A 1 210 ? -23.319 2.355   -19.187 1.00 0.00 ? 210 LYS A HZ1  1  
ATOM   3364   H  HZ2  . LYS A 1 210 ? -24.525 2.437   -20.381 1.00 0.00 ? 210 LYS A HZ2  1  
ATOM   3365   H  HZ3  . LYS A 1 210 ? -24.495 3.575   -19.120 1.00 0.00 ? 210 LYS A HZ3  1  
ATOM   3366   N  N    . VAL A 1 211 ? -17.667 2.798   -17.564 1.00 0.00 ? 211 VAL A N    1  
ATOM   3367   C  CA   . VAL A 1 211 ? -16.366 3.274   -17.014 1.00 0.00 ? 211 VAL A CA   1  
ATOM   3368   C  C    . VAL A 1 211 ? -16.256 4.786   -17.223 1.00 0.00 ? 211 VAL A C    1  
ATOM   3369   O  O    . VAL A 1 211 ? -16.449 5.286   -18.313 1.00 0.00 ? 211 VAL A O    1  
ATOM   3370   C  CB   . VAL A 1 211 ? -15.220 2.571   -17.746 1.00 0.00 ? 211 VAL A CB   1  
ATOM   3371   C  CG1  . VAL A 1 211 ? -13.879 3.099   -17.233 1.00 0.00 ? 211 VAL A CG1  1  
ATOM   3372   C  CG2  . VAL A 1 211 ? -15.306 1.065   -17.493 1.00 0.00 ? 211 VAL A CG2  1  
ATOM   3373   H  H    . VAL A 1 211 ? -17.778 2.698   -18.532 1.00 0.00 ? 211 VAL A H    1  
ATOM   3374   H  HA   . VAL A 1 211 ? -16.314 3.050   -15.959 1.00 0.00 ? 211 VAL A HA   1  
ATOM   3375   H  HB   . VAL A 1 211 ? -15.299 2.765   -18.806 1.00 0.00 ? 211 VAL A HB   1  
ATOM   3376   H  HG11 . VAL A 1 211 ? -13.121 2.340   -17.360 1.00 0.00 ? 211 VAL A HG11 1  
ATOM   3377   H  HG12 . VAL A 1 211 ? -13.967 3.349   -16.186 1.00 0.00 ? 211 VAL A HG12 1  
ATOM   3378   H  HG13 . VAL A 1 211 ? -13.601 3.980   -17.792 1.00 0.00 ? 211 VAL A HG13 1  
ATOM   3379   H  HG21 . VAL A 1 211 ? -15.563 0.560   -18.413 1.00 0.00 ? 211 VAL A HG21 1  
ATOM   3380   H  HG22 . VAL A 1 211 ? -16.064 0.867   -16.750 1.00 0.00 ? 211 VAL A HG22 1  
ATOM   3381   H  HG23 . VAL A 1 211 ? -14.351 0.703   -17.139 1.00 0.00 ? 211 VAL A HG23 1  
ATOM   3382   N  N    . TYR A 1 212 ? -15.958 5.519   -16.188 1.00 0.00 ? 212 TYR A N    1  
ATOM   3383   C  CA   . TYR A 1 212 ? -15.849 6.997   -16.331 1.00 0.00 ? 212 TYR A CA   1  
ATOM   3384   C  C    . TYR A 1 212 ? -14.587 7.355   -17.121 1.00 0.00 ? 212 TYR A C    1  
ATOM   3385   O  O    . TYR A 1 212 ? -14.646 8.063   -18.107 1.00 0.00 ? 212 TYR A O    1  
ATOM   3386   C  CB   . TYR A 1 212 ? -15.789 7.635   -14.945 1.00 0.00 ? 212 TYR A CB   1  
ATOM   3387   C  CG   . TYR A 1 212 ? -17.194 7.809   -14.419 1.00 0.00 ? 212 TYR A CG   1  
ATOM   3388   C  CD1  . TYR A 1 212 ? -17.897 6.705   -13.922 1.00 0.00 ? 212 TYR A CD1  1  
ATOM   3389   C  CD2  . TYR A 1 212 ? -17.795 9.074   -14.433 1.00 0.00 ? 212 TYR A CD2  1  
ATOM   3390   C  CE1  . TYR A 1 212 ? -19.201 6.865   -13.439 1.00 0.00 ? 212 TYR A CE1  1  
ATOM   3391   C  CE2  . TYR A 1 212 ? -19.099 9.234   -13.950 1.00 0.00 ? 212 TYR A CE2  1  
ATOM   3392   C  CZ   . TYR A 1 212 ? -19.802 8.130   -13.453 1.00 0.00 ? 212 TYR A CZ   1  
ATOM   3393   O  OH   . TYR A 1 212 ? -21.087 8.288   -12.976 1.00 0.00 ? 212 TYR A OH   1  
ATOM   3394   H  H    . TYR A 1 212 ? -15.813 5.101   -15.314 1.00 0.00 ? 212 TYR A H    1  
ATOM   3395   H  HA   . TYR A 1 212 ? -16.716 7.369   -16.857 1.00 0.00 ? 212 TYR A HA   1  
ATOM   3396   H  HB2  . TYR A 1 212 ? -15.229 6.997   -14.277 1.00 0.00 ? 212 TYR A HB2  1  
ATOM   3397   H  HB3  . TYR A 1 212 ? -15.308 8.597   -15.012 1.00 0.00 ? 212 TYR A HB3  1  
ATOM   3398   H  HD1  . TYR A 1 212 ? -17.433 5.730   -13.911 1.00 0.00 ? 212 TYR A HD1  1  
ATOM   3399   H  HD2  . TYR A 1 212 ? -17.253 9.926   -14.817 1.00 0.00 ? 212 TYR A HD2  1  
ATOM   3400   H  HE1  . TYR A 1 212 ? -19.744 6.013   -13.056 1.00 0.00 ? 212 TYR A HE1  1  
ATOM   3401   H  HE2  . TYR A 1 212 ? -19.563 10.209  -13.960 1.00 0.00 ? 212 TYR A HE2  1  
ATOM   3402   H  HH   . TYR A 1 212 ? -21.604 8.725   -13.656 1.00 0.00 ? 212 TYR A HH   1  
ATOM   3403   N  N    . ASN A 1 213 ? -13.446 6.881   -16.701 1.00 0.00 ? 213 ASN A N    1  
ATOM   3404   C  CA   . ASN A 1 213 ? -12.192 7.212   -17.438 1.00 0.00 ? 213 ASN A CA   1  
ATOM   3405   C  C    . ASN A 1 213 ? -12.314 6.734   -18.895 1.00 0.00 ? 213 ASN A C    1  
ATOM   3406   O  O    . ASN A 1 213 ? -12.740 5.624   -19.147 1.00 0.00 ? 213 ASN A O    1  
ATOM   3407   C  CB   . ASN A 1 213 ? -11.008 6.506   -16.770 1.00 0.00 ? 213 ASN A CB   1  
ATOM   3408   C  CG   . ASN A 1 213 ? -10.475 7.373   -15.627 1.00 0.00 ? 213 ASN A CG   1  
ATOM   3409   O  OD1  . ASN A 1 213 ? -9.456  8.019   -15.765 1.00 0.00 ? 213 ASN A OD1  1  
ATOM   3410   N  ND2  . ASN A 1 213 ? -11.126 7.413   -14.496 1.00 0.00 ? 213 ASN A ND2  1  
ATOM   3411   H  H    . ASN A 1 213 ? -13.408 6.315   -15.901 1.00 0.00 ? 213 ASN A H    1  
ATOM   3412   H  HA   . ASN A 1 213 ? -12.038 8.277   -17.404 1.00 0.00 ? 213 ASN A HA   1  
ATOM   3413   H  HB2  . ASN A 1 213 ? -11.332 5.552   -16.380 1.00 0.00 ? 213 ASN A HB2  1  
ATOM   3414   H  HB3  . ASN A 1 213 ? -10.226 6.351   -17.498 1.00 0.00 ? 213 ASN A HB3  1  
ATOM   3415   H  HD21 . ASN A 1 213 ? -11.949 6.892   -14.385 1.00 0.00 ? 213 ASN A HD21 1  
ATOM   3416   H  HD22 . ASN A 1 213 ? -10.791 7.965   -13.758 1.00 0.00 ? 213 ASN A HD22 1  
ATOM   3417   N  N    . PRO A 1 214 ? -11.950 7.557   -19.855 1.00 0.00 ? 214 PRO A N    1  
ATOM   3418   C  CA   . PRO A 1 214 ? -12.035 7.188   -21.300 1.00 0.00 ? 214 PRO A CA   1  
ATOM   3419   C  C    . PRO A 1 214 ? -10.971 6.166   -21.713 1.00 0.00 ? 214 PRO A C    1  
ATOM   3420   O  O    . PRO A 1 214 ? -10.985 5.657   -22.815 1.00 0.00 ? 214 PRO A O    1  
ATOM   3421   C  CB   . PRO A 1 214 ? -11.807 8.514   -22.028 1.00 0.00 ? 214 PRO A CB   1  
ATOM   3422   C  CG   . PRO A 1 214 ? -11.003 9.344   -21.088 1.00 0.00 ? 214 PRO A CG   1  
ATOM   3423   C  CD   . PRO A 1 214 ? -11.415 8.922   -19.677 1.00 0.00 ? 214 PRO A CD   1  
ATOM   3424   H  HA   . PRO A 1 214 ? -13.019 6.818   -21.531 1.00 0.00 ? 214 PRO A HA   1  
ATOM   3425   H  HB2  . PRO A 1 214 ? -11.260 8.346   -22.946 1.00 0.00 ? 214 PRO A HB2  1  
ATOM   3426   H  HB3  . PRO A 1 214 ? -12.749 8.997   -22.235 1.00 0.00 ? 214 PRO A HB3  1  
ATOM   3427   H  HG2  . PRO A 1 214 ? -9.948  9.160   -21.241 1.00 0.00 ? 214 PRO A HG2  1  
ATOM   3428   H  HG3  . PRO A 1 214 ? -11.224 10.389  -21.233 1.00 0.00 ? 214 PRO A HG3  1  
ATOM   3429   H  HD2  . PRO A 1 214 ? -10.556 8.915   -19.022 1.00 0.00 ? 214 PRO A HD2  1  
ATOM   3430   H  HD3  . PRO A 1 214 ? -12.182 9.576   -19.295 1.00 0.00 ? 214 PRO A HD3  1  
ATOM   3431   N  N    . GLU A 1 215 ? -10.044 5.866   -20.844 1.00 0.00 ? 215 GLU A N    1  
ATOM   3432   C  CA   . GLU A 1 215 ? -8.980  4.886   -21.202 1.00 0.00 ? 215 GLU A CA   1  
ATOM   3433   C  C    . GLU A 1 215 ? -9.434  3.470   -20.844 1.00 0.00 ? 215 GLU A C    1  
ATOM   3434   O  O    . GLU A 1 215 ? -8.787  2.498   -21.178 1.00 0.00 ? 215 GLU A O    1  
ATOM   3435   C  CB   . GLU A 1 215 ? -7.700  5.223   -20.432 1.00 0.00 ? 215 GLU A CB   1  
ATOM   3436   C  CG   . GLU A 1 215 ? -6.490  4.666   -21.183 1.00 0.00 ? 215 GLU A CG   1  
ATOM   3437   C  CD   . GLU A 1 215 ? -5.229  4.883   -20.345 1.00 0.00 ? 215 GLU A CD   1  
ATOM   3438   O  OE1  . GLU A 1 215 ? -5.005  4.103   -19.433 1.00 0.00 ? 215 GLU A OE1  1  
ATOM   3439   O  OE2  . GLU A 1 215 ? -4.508  5.826   -20.628 1.00 0.00 ? 215 GLU A OE2  1  
ATOM   3440   H  H    . GLU A 1 215 ? -10.041 6.287   -19.958 1.00 0.00 ? 215 GLU A H    1  
ATOM   3441   H  HA   . GLU A 1 215 ? -8.785  4.942   -22.263 1.00 0.00 ? 215 GLU A HA   1  
ATOM   3442   H  HB2  . GLU A 1 215 ? -7.607  6.296   -20.344 1.00 0.00 ? 215 GLU A HB2  1  
ATOM   3443   H  HB3  . GLU A 1 215 ? -7.746  4.782   -19.448 1.00 0.00 ? 215 GLU A HB3  1  
ATOM   3444   H  HG2  . GLU A 1 215 ? -6.630  3.610   -21.358 1.00 0.00 ? 215 GLU A HG2  1  
ATOM   3445   H  HG3  . GLU A 1 215 ? -6.385  5.178   -22.127 1.00 0.00 ? 215 GLU A HG3  1  
ATOM   3446   N  N    . GLY A 1 216 ? -10.543 3.342   -20.170 1.00 0.00 ? 216 GLY A N    1  
ATOM   3447   C  CA   . GLY A 1 216 ? -11.034 1.985   -19.799 1.00 0.00 ? 216 GLY A CA   1  
ATOM   3448   C  C    . GLY A 1 216 ? -10.121 1.379   -18.731 1.00 0.00 ? 216 GLY A C    1  
ATOM   3449   O  O    . GLY A 1 216 ? -9.303  2.055   -18.141 1.00 0.00 ? 216 GLY A O    1  
ATOM   3450   H  H    . GLY A 1 216 ? -11.055 4.138   -19.912 1.00 0.00 ? 216 GLY A H    1  
ATOM   3451   H  HA2  . GLY A 1 216 ? -12.040 2.060   -19.411 1.00 0.00 ? 216 GLY A HA2  1  
ATOM   3452   H  HA3  . GLY A 1 216 ? -11.033 1.351   -20.670 1.00 0.00 ? 216 GLY A HA3  1  
ATOM   3453   N  N    . LEU A 1 217 ? -10.265 0.106   -18.477 1.00 0.00 ? 217 LEU A N    1  
ATOM   3454   C  CA   . LEU A 1 217 ? -9.417  -0.556  -17.441 1.00 0.00 ? 217 LEU A CA   1  
ATOM   3455   C  C    . LEU A 1 217 ? -8.064  -0.947  -18.043 1.00 0.00 ? 217 LEU A C    1  
ATOM   3456   O  O    . LEU A 1 217 ? -7.967  -1.309  -19.199 1.00 0.00 ? 217 LEU A O    1  
ATOM   3457   C  CB   . LEU A 1 217 ? -10.126 -1.814  -16.935 1.00 0.00 ? 217 LEU A CB   1  
ATOM   3458   C  CG   . LEU A 1 217 ? -11.546 -1.459  -16.492 1.00 0.00 ? 217 LEU A CG   1  
ATOM   3459   C  CD1  . LEU A 1 217 ? -12.282 -2.733  -16.076 1.00 0.00 ? 217 LEU A CD1  1  
ATOM   3460   C  CD2  . LEU A 1 217 ? -11.486 -0.494  -15.305 1.00 0.00 ? 217 LEU A CD2  1  
ATOM   3461   H  H    . LEU A 1 217 ? -10.938 -0.413  -18.963 1.00 0.00 ? 217 LEU A H    1  
ATOM   3462   H  HA   . LEU A 1 217 ? -9.260  0.123   -16.617 1.00 0.00 ? 217 LEU A HA   1  
ATOM   3463   H  HB2  . LEU A 1 217 ? -10.169 -2.546  -17.729 1.00 0.00 ? 217 LEU A HB2  1  
ATOM   3464   H  HB3  . LEU A 1 217 ? -9.581  -2.223  -16.098 1.00 0.00 ? 217 LEU A HB3  1  
ATOM   3465   H  HG   . LEU A 1 217 ? -12.072 -0.991  -17.312 1.00 0.00 ? 217 LEU A HG   1  
ATOM   3466   H  HD11 . LEU A 1 217 ? -13.303 -2.493  -15.821 1.00 0.00 ? 217 LEU A HD11 1  
ATOM   3467   H  HD12 . LEU A 1 217 ? -11.791 -3.170  -15.219 1.00 0.00 ? 217 LEU A HD12 1  
ATOM   3468   H  HD13 . LEU A 1 217 ? -12.272 -3.437  -16.895 1.00 0.00 ? 217 LEU A HD13 1  
ATOM   3469   H  HD21 . LEU A 1 217 ? -12.268 -0.741  -14.600 1.00 0.00 ? 217 LEU A HD21 1  
ATOM   3470   H  HD22 . LEU A 1 217 ? -11.626 0.518   -15.656 1.00 0.00 ? 217 LEU A HD22 1  
ATOM   3471   H  HD23 . LEU A 1 217 ? -10.525 -0.578  -14.819 1.00 0.00 ? 217 LEU A HD23 1  
ATOM   3472   N  N    . ARG A 1 218 ? -7.019  -0.882  -17.261 1.00 0.00 ? 218 ARG A N    1  
ATOM   3473   C  CA   . ARG A 1 218 ? -5.670  -1.254  -17.778 1.00 0.00 ? 218 ARG A CA   1  
ATOM   3474   C  C    . ARG A 1 218 ? -5.473  -2.766  -17.635 1.00 0.00 ? 218 ARG A C    1  
ATOM   3475   O  O    . ARG A 1 218 ? -4.646  -3.361  -18.296 1.00 0.00 ? 218 ARG A O    1  
ATOM   3476   C  CB   . ARG A 1 218 ? -4.596  -0.518  -16.972 1.00 0.00 ? 218 ARG A CB   1  
ATOM   3477   C  CG   . ARG A 1 218 ? -3.444  -0.118  -17.897 1.00 0.00 ? 218 ARG A CG   1  
ATOM   3478   C  CD   . ARG A 1 218 ? -2.394  0.657   -17.096 1.00 0.00 ? 218 ARG A CD   1  
ATOM   3479   N  NE   . ARG A 1 218 ? -1.029  0.200   -17.485 1.00 0.00 ? 218 ARG A NE   1  
ATOM   3480   C  CZ   . ARG A 1 218 ? -0.410  0.761   -18.490 1.00 0.00 ? 218 ARG A CZ   1  
ATOM   3481   N  NH1  . ARG A 1 218 ? -0.991  1.710   -19.171 1.00 0.00 ? 218 ARG A NH1  1  
ATOM   3482   N  NH2  . ARG A 1 218 ? 0.792   0.370   -18.815 1.00 0.00 ? 218 ARG A NH2  1  
ATOM   3483   H  H    . ARG A 1 218 ? -7.124  -0.588  -16.333 1.00 0.00 ? 218 ARG A H    1  
ATOM   3484   H  HA   . ARG A 1 218 ? -5.594  -0.976  -18.819 1.00 0.00 ? 218 ARG A HA   1  
ATOM   3485   H  HB2  . ARG A 1 218 ? -5.025  0.367   -16.526 1.00 0.00 ? 218 ARG A HB2  1  
ATOM   3486   H  HB3  . ARG A 1 218 ? -4.222  -1.168  -16.195 1.00 0.00 ? 218 ARG A HB3  1  
ATOM   3487   H  HG2  . ARG A 1 218 ? -2.995  -1.006  -18.318 1.00 0.00 ? 218 ARG A HG2  1  
ATOM   3488   H  HG3  . ARG A 1 218 ? -3.821  0.508   -18.692 1.00 0.00 ? 218 ARG A HG3  1  
ATOM   3489   H  HD2  . ARG A 1 218 ? -2.493  1.712   -17.300 1.00 0.00 ? 218 ARG A HD2  1  
ATOM   3490   H  HD3  . ARG A 1 218 ? -2.544  0.481   -16.042 1.00 0.00 ? 218 ARG A HD3  1  
ATOM   3491   H  HE   . ARG A 1 218 ? -0.592  -0.518  -16.982 1.00 0.00 ? 218 ARG A HE   1  
ATOM   3492   H  HH11 . ARG A 1 218 ? -1.912  2.010   -18.927 1.00 0.00 ? 218 ARG A HH11 1  
ATOM   3493   H  HH12 . ARG A 1 218 ? -0.513  2.139   -19.937 1.00 0.00 ? 218 ARG A HH12 1  
ATOM   3494   H  HH21 . ARG A 1 218 ? 1.238   -0.360  -18.296 1.00 0.00 ? 218 ARG A HH21 1  
ATOM   3495   H  HH22 . ARG A 1 218 ? 1.266   0.798   -19.583 1.00 0.00 ? 218 ARG A HH22 1  
ATOM   3496   N  N    . TYR A 1 219 ? -6.237  -3.391  -16.780 1.00 0.00 ? 219 TYR A N    1  
ATOM   3497   C  CA   . TYR A 1 219 ? -6.112  -4.866  -16.594 1.00 0.00 ? 219 TYR A CA   1  
ATOM   3498   C  C    . TYR A 1 219 ? -7.494  -5.446  -16.284 1.00 0.00 ? 219 TYR A C    1  
ATOM   3499   O  O    . TYR A 1 219 ? -8.216  -4.932  -15.453 1.00 0.00 ? 219 TYR A O    1  
ATOM   3500   C  CB   . TYR A 1 219 ? -5.179  -5.174  -15.417 1.00 0.00 ? 219 TYR A CB   1  
ATOM   3501   C  CG   . TYR A 1 219 ? -3.842  -4.497  -15.608 1.00 0.00 ? 219 TYR A CG   1  
ATOM   3502   C  CD1  . TYR A 1 219 ? -2.896  -5.046  -16.482 1.00 0.00 ? 219 TYR A CD1  1  
ATOM   3503   C  CD2  . TYR A 1 219 ? -3.544  -3.326  -14.900 1.00 0.00 ? 219 TYR A CD2  1  
ATOM   3504   C  CE1  . TYR A 1 219 ? -1.652  -4.422  -16.648 1.00 0.00 ? 219 TYR A CE1  1  
ATOM   3505   C  CE2  . TYR A 1 219 ? -2.302  -2.705  -15.065 1.00 0.00 ? 219 TYR A CE2  1  
ATOM   3506   C  CZ   . TYR A 1 219 ? -1.356  -3.252  -15.939 1.00 0.00 ? 219 TYR A CZ   1  
ATOM   3507   O  OH   . TYR A 1 219 ? -0.131  -2.638  -16.101 1.00 0.00 ? 219 TYR A OH   1  
ATOM   3508   H  H    . TYR A 1 219 ? -6.904  -2.890  -16.266 1.00 0.00 ? 219 TYR A H    1  
ATOM   3509   H  HA   . TYR A 1 219 ? -5.722  -5.316  -17.496 1.00 0.00 ? 219 TYR A HA   1  
ATOM   3510   H  HB2  . TYR A 1 219 ? -5.630  -4.820  -14.504 1.00 0.00 ? 219 TYR A HB2  1  
ATOM   3511   H  HB3  . TYR A 1 219 ? -5.032  -6.242  -15.351 1.00 0.00 ? 219 TYR A HB3  1  
ATOM   3512   H  HD1  . TYR A 1 219 ? -3.125  -5.948  -17.029 1.00 0.00 ? 219 TYR A HD1  1  
ATOM   3513   H  HD2  . TYR A 1 219 ? -4.270  -2.903  -14.225 1.00 0.00 ? 219 TYR A HD2  1  
ATOM   3514   H  HE1  . TYR A 1 219 ? -0.921  -4.844  -17.319 1.00 0.00 ? 219 TYR A HE1  1  
ATOM   3515   H  HE2  . TYR A 1 219 ? -2.073  -1.802  -14.516 1.00 0.00 ? 219 TYR A HE2  1  
ATOM   3516   H  HH   . TYR A 1 219 ? -0.014  -2.454  -17.035 1.00 0.00 ? 219 TYR A HH   1  
ATOM   3517   N  N    . GLU A 1 220 ? -7.870  -6.516  -16.932 1.00 0.00 ? 220 GLU A N    1  
ATOM   3518   C  CA   . GLU A 1 220 ? -9.206  -7.114  -16.649 1.00 0.00 ? 220 GLU A CA   1  
ATOM   3519   C  C    . GLU A 1 220 ? -9.397  -7.203  -15.135 1.00 0.00 ? 220 GLU A C    1  
ATOM   3520   O  O    . GLU A 1 220 ? -10.493 -7.379  -14.641 1.00 0.00 ? 220 GLU A O    1  
ATOM   3521   C  CB   . GLU A 1 220 ? -9.282  -8.518  -17.255 1.00 0.00 ? 220 GLU A CB   1  
ATOM   3522   C  CG   . GLU A 1 220 ? -9.067  -8.435  -18.767 1.00 0.00 ? 220 GLU A CG   1  
ATOM   3523   C  CD   . GLU A 1 220 ? -7.577  -8.581  -19.079 1.00 0.00 ? 220 GLU A CD   1  
ATOM   3524   O  OE1  . GLU A 1 220 ? -6.779  -8.305  -18.198 1.00 0.00 ? 220 GLU A OE1  1  
ATOM   3525   O  OE2  . GLU A 1 220 ? -7.259  -8.967  -20.191 1.00 0.00 ? 220 GLU A OE2  1  
ATOM   3526   H  H    . GLU A 1 220 ? -7.276  -6.926  -17.595 1.00 0.00 ? 220 GLU A H    1  
ATOM   3527   H  HA   . GLU A 1 220 ? -9.980  -6.493  -17.076 1.00 0.00 ? 220 GLU A HA   1  
ATOM   3528   H  HB2  . GLU A 1 220 ? -8.516  -9.140  -16.815 1.00 0.00 ? 220 GLU A HB2  1  
ATOM   3529   H  HB3  . GLU A 1 220 ? -10.253 -8.945  -17.054 1.00 0.00 ? 220 GLU A HB3  1  
ATOM   3530   H  HG2  . GLU A 1 220 ? -9.619  -9.227  -19.252 1.00 0.00 ? 220 GLU A HG2  1  
ATOM   3531   H  HG3  . GLU A 1 220 ? -9.416  -7.480  -19.128 1.00 0.00 ? 220 GLU A HG3  1  
ATOM   3532   N  N    . ASN A 1 221 ? -8.327  -7.083  -14.400 1.00 0.00 ? 221 ASN A N    1  
ATOM   3533   C  CA   . ASN A 1 221 ? -8.419  -7.159  -12.915 1.00 0.00 ? 221 ASN A CA   1  
ATOM   3534   C  C    . ASN A 1 221 ? -7.651  -5.983  -12.303 1.00 0.00 ? 221 ASN A C    1  
ATOM   3535   O  O    . ASN A 1 221 ? -7.060  -6.089  -11.249 1.00 0.00 ? 221 ASN A O    1  
ATOM   3536   C  CB   . ASN A 1 221 ? -7.810  -8.483  -12.445 1.00 0.00 ? 221 ASN A CB   1  
ATOM   3537   C  CG   . ASN A 1 221 ? -7.457  -9.341  -13.660 1.00 0.00 ? 221 ASN A CG   1  
ATOM   3538   O  OD1  . ASN A 1 221 ? -6.772  -8.892  -14.558 1.00 0.00 ? 221 ASN A OD1  1  
ATOM   3539   N  ND2  . ASN A 1 221 ? -7.900  -10.567 -13.729 1.00 0.00 ? 221 ASN A ND2  1  
ATOM   3540   H  H    . ASN A 1 221 ? -7.459  -6.945  -14.834 1.00 0.00 ? 221 ASN A H    1  
ATOM   3541   H  HA   . ASN A 1 221 ? -9.453  -7.110  -12.613 1.00 0.00 ? 221 ASN A HA   1  
ATOM   3542   H  HB2  . ASN A 1 221 ? -6.917  -8.288  -11.868 1.00 0.00 ? 221 ASN A HB2  1  
ATOM   3543   H  HB3  . ASN A 1 221 ? -8.526  -9.010  -11.834 1.00 0.00 ? 221 ASN A HB3  1  
ATOM   3544   H  HD21 . ASN A 1 221 ? -8.453  -10.929 -13.005 1.00 0.00 ? 221 ASN A HD21 1  
ATOM   3545   H  HD22 . ASN A 1 221 ? -7.681  -11.126 -14.504 1.00 0.00 ? 221 ASN A HD22 1  
ATOM   3546   N  N    . GLU A 1 222 ? -7.656  -4.861  -12.969 1.00 0.00 ? 222 GLU A N    1  
ATOM   3547   C  CA   . GLU A 1 222 ? -6.927  -3.668  -12.450 1.00 0.00 ? 222 GLU A CA   1  
ATOM   3548   C  C    . GLU A 1 222 ? -7.352  -3.332  -11.008 1.00 0.00 ? 222 GLU A C    1  
ATOM   3549   O  O    . GLU A 1 222 ? -6.520  -3.269  -10.126 1.00 0.00 ? 222 GLU A O    1  
ATOM   3550   C  CB   . GLU A 1 222 ? -7.193  -2.468  -13.363 1.00 0.00 ? 222 GLU A CB   1  
ATOM   3551   C  CG   . GLU A 1 222 ? -7.013  -1.173  -12.571 1.00 0.00 ? 222 GLU A CG   1  
ATOM   3552   C  CD   . GLU A 1 222 ? -6.782  -0.009  -13.536 1.00 0.00 ? 222 GLU A CD   1  
ATOM   3553   O  OE1  . GLU A 1 222 ? -6.170  -0.233  -14.567 1.00 0.00 ? 222 GLU A OE1  1  
ATOM   3554   O  OE2  . GLU A 1 222 ? -7.221  1.087   -13.228 1.00 0.00 ? 222 GLU A OE2  1  
ATOM   3555   H  H    . GLU A 1 222 ? -8.137  -4.806  -13.821 1.00 0.00 ? 222 GLU A H    1  
ATOM   3556   H  HA   . GLU A 1 222 ? -5.869  -3.880  -12.453 1.00 0.00 ? 222 GLU A HA   1  
ATOM   3557   H  HB2  . GLU A 1 222 ? -6.495  -2.485  -14.187 1.00 0.00 ? 222 GLU A HB2  1  
ATOM   3558   H  HB3  . GLU A 1 222 ? -8.197  -2.521  -13.749 1.00 0.00 ? 222 GLU A HB3  1  
ATOM   3559   H  HG2  . GLU A 1 222 ? -7.901  -0.984  -11.983 1.00 0.00 ? 222 GLU A HG2  1  
ATOM   3560   H  HG3  . GLU A 1 222 ? -6.161  -1.268  -11.914 1.00 0.00 ? 222 GLU A HG3  1  
ATOM   3561   N  N    . PRO A 1 223 ? -8.622  -3.097  -10.751 1.00 0.00 ? 223 PRO A N    1  
ATOM   3562   C  CA   . PRO A 1 223 ? -9.098  -2.744  -9.379  1.00 0.00 ? 223 PRO A CA   1  
ATOM   3563   C  C    . PRO A 1 223 ? -8.674  -3.764  -8.316  1.00 0.00 ? 223 PRO A C    1  
ATOM   3564   O  O    . PRO A 1 223 ? -8.312  -3.400  -7.211  1.00 0.00 ? 223 PRO A O    1  
ATOM   3565   C  CB   . PRO A 1 223 ? -10.628 -2.700  -9.497  1.00 0.00 ? 223 PRO A CB   1  
ATOM   3566   C  CG   . PRO A 1 223 ? -10.960 -3.327  -10.812 1.00 0.00 ? 223 PRO A CG   1  
ATOM   3567   C  CD   . PRO A 1 223 ? -9.741  -3.135  -11.707 1.00 0.00 ? 223 PRO A CD   1  
ATOM   3568   H  HA   . PRO A 1 223 ? -8.734  -1.765  -9.106  1.00 0.00 ? 223 PRO A HA   1  
ATOM   3569   H  HB2  . PRO A 1 223 ? -11.079 -3.262  -8.690  1.00 0.00 ? 223 PRO A HB2  1  
ATOM   3570   H  HB3  . PRO A 1 223 ? -10.974 -1.679  -9.479  1.00 0.00 ? 223 PRO A HB3  1  
ATOM   3571   H  HG2  . PRO A 1 223 ? -11.163 -4.381  -10.678 1.00 0.00 ? 223 PRO A HG2  1  
ATOM   3572   H  HG3  . PRO A 1 223 ? -11.814 -2.837  -11.251 1.00 0.00 ? 223 PRO A HG3  1  
ATOM   3573   H  HD2  . PRO A 1 223 ? -9.646  -3.963  -12.389 1.00 0.00 ? 223 PRO A HD2  1  
ATOM   3574   H  HD3  . PRO A 1 223 ? -9.811  -2.200  -12.239 1.00 0.00 ? 223 PRO A HD3  1  
ATOM   3575   N  N    . VAL A 1 224 ? -8.694  -5.034  -8.623  1.00 0.00 ? 224 VAL A N    1  
ATOM   3576   C  CA   . VAL A 1 224 ? -8.273  -6.027  -7.598  1.00 0.00 ? 224 VAL A CA   1  
ATOM   3577   C  C    . VAL A 1 224 ? -6.750  -6.074  -7.556  1.00 0.00 ? 224 VAL A C    1  
ATOM   3578   O  O    . VAL A 1 224 ? -6.155  -6.381  -6.542  1.00 0.00 ? 224 VAL A O    1  
ATOM   3579   C  CB   . VAL A 1 224 ? -8.821  -7.416  -7.935  1.00 0.00 ? 224 VAL A CB   1  
ATOM   3580   C  CG1  . VAL A 1 224 ? -10.323 -7.449  -7.665  1.00 0.00 ? 224 VAL A CG1  1  
ATOM   3581   C  CG2  . VAL A 1 224 ? -8.563  -7.737  -9.407  1.00 0.00 ? 224 VAL A CG2  1  
ATOM   3582   H  H    . VAL A 1 224 ? -8.965  -5.334  -9.517  1.00 0.00 ? 224 VAL A H    1  
ATOM   3583   H  HA   . VAL A 1 224 ? -8.646  -5.717  -6.632  1.00 0.00 ? 224 VAL A HA   1  
ATOM   3584   H  HB   . VAL A 1 224 ? -8.330  -8.153  -7.315  1.00 0.00 ? 224 VAL A HB   1  
ATOM   3585   H  HG11 . VAL A 1 224 ? -10.715 -6.444  -7.693  1.00 0.00 ? 224 VAL A HG11 1  
ATOM   3586   H  HG12 . VAL A 1 224 ? -10.503 -7.880  -6.690  1.00 0.00 ? 224 VAL A HG12 1  
ATOM   3587   H  HG13 . VAL A 1 224 ? -10.812 -8.048  -8.418  1.00 0.00 ? 224 VAL A HG13 1  
ATOM   3588   H  HG21 . VAL A 1 224 ? -9.120  -7.052  -10.030 1.00 0.00 ? 224 VAL A HG21 1  
ATOM   3589   H  HG22 . VAL A 1 224 ? -8.877  -8.748  -9.612  1.00 0.00 ? 224 VAL A HG22 1  
ATOM   3590   H  HG23 . VAL A 1 224 ? -7.508  -7.638  -9.618  1.00 0.00 ? 224 VAL A HG23 1  
ATOM   3591   N  N    . ARG A 1 225 ? -6.111  -5.743  -8.644  1.00 0.00 ? 225 ARG A N    1  
ATOM   3592   C  CA   . ARG A 1 225 ? -4.626  -5.740  -8.649  1.00 0.00 ? 225 ARG A CA   1  
ATOM   3593   C  C    . ARG A 1 225 ? -4.168  -4.661  -7.673  1.00 0.00 ? 225 ARG A C    1  
ATOM   3594   O  O    . ARG A 1 225 ? -3.242  -4.845  -6.909  1.00 0.00 ? 225 ARG A O    1  
ATOM   3595   C  CB   . ARG A 1 225 ? -4.113  -5.426  -10.058 1.00 0.00 ? 225 ARG A CB   1  
ATOM   3596   C  CG   . ARG A 1 225 ? -4.108  -6.707  -10.897 1.00 0.00 ? 225 ARG A CG   1  
ATOM   3597   C  CD   . ARG A 1 225 ? -3.780  -6.373  -12.355 1.00 0.00 ? 225 ARG A CD   1  
ATOM   3598   N  NE   . ARG A 1 225 ? -4.427  -7.373  -13.251 1.00 0.00 ? 225 ARG A NE   1  
ATOM   3599   C  CZ   . ARG A 1 225 ? -3.820  -8.496  -13.526 1.00 0.00 ? 225 ARG A CZ   1  
ATOM   3600   N  NH1  . ARG A 1 225 ? -2.647  -8.749  -13.012 1.00 0.00 ? 225 ARG A NH1  1  
ATOM   3601   N  NH2  . ARG A 1 225 ? -4.387  -9.368  -14.315 1.00 0.00 ? 225 ARG A NH2  1  
ATOM   3602   H  H    . ARG A 1 225 ? -6.609  -5.474  -9.443  1.00 0.00 ? 225 ARG A H    1  
ATOM   3603   H  HA   . ARG A 1 225 ? -4.257  -6.703  -8.329  1.00 0.00 ? 225 ARG A HA   1  
ATOM   3604   H  HB2  . ARG A 1 225 ? -4.758  -4.692  -10.518 1.00 0.00 ? 225 ARG A HB2  1  
ATOM   3605   H  HB3  . ARG A 1 225 ? -3.108  -5.033  -9.997  1.00 0.00 ? 225 ARG A HB3  1  
ATOM   3606   H  HG2  . ARG A 1 225 ? -3.364  -7.387  -10.507 1.00 0.00 ? 225 ARG A HG2  1  
ATOM   3607   H  HG3  . ARG A 1 225 ? -5.080  -7.173  -10.847 1.00 0.00 ? 225 ARG A HG3  1  
ATOM   3608   H  HD2  . ARG A 1 225 ? -4.149  -5.387  -12.593 1.00 0.00 ? 225 ARG A HD2  1  
ATOM   3609   H  HD3  . ARG A 1 225 ? -2.711  -6.401  -12.499 1.00 0.00 ? 225 ARG A HD3  1  
ATOM   3610   H  HE   . ARG A 1 225 ? -5.308  -7.187  -13.637 1.00 0.00 ? 225 ARG A HE   1  
ATOM   3611   H  HH11 . ARG A 1 225 ? -2.212  -8.083  -12.405 1.00 0.00 ? 225 ARG A HH11 1  
ATOM   3612   H  HH12 . ARG A 1 225 ? -2.185  -9.610  -13.222 1.00 0.00 ? 225 ARG A HH12 1  
ATOM   3613   H  HH21 . ARG A 1 225 ? -5.286  -9.177  -14.708 1.00 0.00 ? 225 ARG A HH21 1  
ATOM   3614   H  HH22 . ARG A 1 225 ? -3.920  -10.227 -14.526 1.00 0.00 ? 225 ARG A HH22 1  
ATOM   3615   N  N    . HIS A 1 226 ? -4.833  -3.537  -7.687  1.00 0.00 ? 226 HIS A N    1  
ATOM   3616   C  CA   . HIS A 1 226 ? -4.471  -2.437  -6.755  1.00 0.00 ? 226 HIS A CA   1  
ATOM   3617   C  C    . HIS A 1 226 ? -4.743  -2.890  -5.322  1.00 0.00 ? 226 HIS A C    1  
ATOM   3618   O  O    . HIS A 1 226 ? -3.946  -2.670  -4.430  1.00 0.00 ? 226 HIS A O    1  
ATOM   3619   C  CB   . HIS A 1 226 ? -5.326  -1.208  -7.072  1.00 0.00 ? 226 HIS A CB   1  
ATOM   3620   C  CG   . HIS A 1 226 ? -4.934  -0.080  -6.159  1.00 0.00 ? 226 HIS A CG   1  
ATOM   3621   N  ND1  . HIS A 1 226 ? -4.090  0.939   -6.567  1.00 0.00 ? 226 HIS A ND1  1  
ATOM   3622   C  CD2  . HIS A 1 226 ? -5.258  0.202   -4.854  1.00 0.00 ? 226 HIS A CD2  1  
ATOM   3623   C  CE1  . HIS A 1 226 ? -3.935  1.779   -5.528  1.00 0.00 ? 226 HIS A CE1  1  
ATOM   3624   N  NE2  . HIS A 1 226 ? -4.627  1.378   -4.457  1.00 0.00 ? 226 HIS A NE2  1  
ATOM   3625   H  H    . HIS A 1 226 ? -5.582  -3.418  -8.307  1.00 0.00 ? 226 HIS A H    1  
ATOM   3626   H  HA   . HIS A 1 226 ? -3.426  -2.192  -6.865  1.00 0.00 ? 226 HIS A HA   1  
ATOM   3627   H  HB2  . HIS A 1 226 ? -5.171  -0.915  -8.100  1.00 0.00 ? 226 HIS A HB2  1  
ATOM   3628   H  HB3  . HIS A 1 226 ? -6.367  -1.448  -6.922  1.00 0.00 ? 226 HIS A HB3  1  
ATOM   3629   H  HD1  . HIS A 1 226 ? -3.679  1.032   -7.452  1.00 0.00 ? 226 HIS A HD1  1  
ATOM   3630   H  HD2  . HIS A 1 226 ? -5.906  -0.398  -4.230  1.00 0.00 ? 226 HIS A HD2  1  
ATOM   3631   H  HE1  . HIS A 1 226 ? -3.327  2.671   -5.557  1.00 0.00 ? 226 HIS A HE1  1  
ATOM   3632   N  N    . LYS A 1 227 ? -5.860  -3.527  -5.089  1.00 0.00 ? 227 LYS A N    1  
ATOM   3633   C  CA   . LYS A 1 227 ? -6.166  -3.995  -3.708  1.00 0.00 ? 227 LYS A CA   1  
ATOM   3634   C  C    . LYS A 1 227 ? -5.025  -4.891  -3.222  1.00 0.00 ? 227 LYS A C    1  
ATOM   3635   O  O    . LYS A 1 227 ? -4.506  -4.719  -2.137  1.00 0.00 ? 227 LYS A O    1  
ATOM   3636   C  CB   . LYS A 1 227 ? -7.479  -4.783  -3.710  1.00 0.00 ? 227 LYS A CB   1  
ATOM   3637   C  CG   . LYS A 1 227 ? -8.107  -4.735  -2.315  1.00 0.00 ? 227 LYS A CG   1  
ATOM   3638   C  CD   . LYS A 1 227 ? -8.691  -3.342  -2.056  1.00 0.00 ? 227 LYS A CD   1  
ATOM   3639   C  CE   . LYS A 1 227 ? -8.068  -2.755  -0.790  1.00 0.00 ? 227 LYS A CE   1  
ATOM   3640   N  NZ   . LYS A 1 227 ? -8.744  -1.470  -0.454  1.00 0.00 ? 227 LYS A NZ   1  
ATOM   3641   H  H    . LYS A 1 227 ? -6.493  -3.699  -5.821  1.00 0.00 ? 227 LYS A H    1  
ATOM   3642   H  HA   . LYS A 1 227 ? -6.255  -3.142  -3.050  1.00 0.00 ? 227 LYS A HA   1  
ATOM   3643   H  HB2  . LYS A 1 227 ? -8.158  -4.347  -4.429  1.00 0.00 ? 227 LYS A HB2  1  
ATOM   3644   H  HB3  . LYS A 1 227 ? -7.281  -5.809  -3.979  1.00 0.00 ? 227 LYS A HB3  1  
ATOM   3645   H  HG2  . LYS A 1 227 ? -8.894  -5.473  -2.251  1.00 0.00 ? 227 LYS A HG2  1  
ATOM   3646   H  HG3  . LYS A 1 227 ? -7.353  -4.949  -1.573  1.00 0.00 ? 227 LYS A HG3  1  
ATOM   3647   H  HD2  . LYS A 1 227 ? -8.477  -2.699  -2.895  1.00 0.00 ? 227 LYS A HD2  1  
ATOM   3648   H  HD3  . LYS A 1 227 ? -9.760  -3.419  -1.926  1.00 0.00 ? 227 LYS A HD3  1  
ATOM   3649   H  HE2  . LYS A 1 227 ? -8.190  -3.450  0.028   1.00 0.00 ? 227 LYS A HE2  1  
ATOM   3650   H  HE3  . LYS A 1 227 ? -7.016  -2.575  -0.956  1.00 0.00 ? 227 LYS A HE3  1  
ATOM   3651   H  HZ1  . LYS A 1 227 ? -8.442  -0.733  -1.122  1.00 0.00 ? 227 LYS A HZ1  1  
ATOM   3652   H  HZ2  . LYS A 1 227 ? -8.489  -1.187  0.515   1.00 0.00 ? 227 LYS A HZ2  1  
ATOM   3653   H  HZ3  . LYS A 1 227 ? -9.774  -1.593  -0.521  1.00 0.00 ? 227 LYS A HZ3  1  
ATOM   3654   N  N    . VAL A 1 228 ? -4.616  -5.836  -4.025  1.00 0.00 ? 228 VAL A N    1  
ATOM   3655   C  CA   . VAL A 1 228 ? -3.494  -6.726  -3.613  1.00 0.00 ? 228 VAL A CA   1  
ATOM   3656   C  C    . VAL A 1 228 ? -2.249  -5.866  -3.394  1.00 0.00 ? 228 VAL A C    1  
ATOM   3657   O  O    . VAL A 1 228 ? -1.519  -6.032  -2.437  1.00 0.00 ? 228 VAL A O    1  
ATOM   3658   C  CB   . VAL A 1 228 ? -3.222  -7.754  -4.713  1.00 0.00 ? 228 VAL A CB   1  
ATOM   3659   C  CG1  . VAL A 1 228 ? -2.171  -8.755  -4.232  1.00 0.00 ? 228 VAL A CG1  1  
ATOM   3660   C  CG2  . VAL A 1 228 ? -4.520  -8.495  -5.043  1.00 0.00 ? 228 VAL A CG2  1  
ATOM   3661   H  H    . VAL A 1 228 ? -5.038  -5.950  -4.903  1.00 0.00 ? 228 VAL A H    1  
ATOM   3662   H  HA   . VAL A 1 228 ? -3.751  -7.235  -2.694  1.00 0.00 ? 228 VAL A HA   1  
ATOM   3663   H  HB   . VAL A 1 228 ? -2.859  -7.248  -5.598  1.00 0.00 ? 228 VAL A HB   1  
ATOM   3664   H  HG11 . VAL A 1 228 ? -2.587  -9.752  -4.253  1.00 0.00 ? 228 VAL A HG11 1  
ATOM   3665   H  HG12 . VAL A 1 228 ? -1.876  -8.510  -3.223  1.00 0.00 ? 228 VAL A HG12 1  
ATOM   3666   H  HG13 . VAL A 1 228 ? -1.308  -8.712  -4.880  1.00 0.00 ? 228 VAL A HG13 1  
ATOM   3667   H  HG21 . VAL A 1 228 ? -4.445  -9.519  -4.708  1.00 0.00 ? 228 VAL A HG21 1  
ATOM   3668   H  HG22 . VAL A 1 228 ? -4.684  -8.476  -6.111  1.00 0.00 ? 228 VAL A HG22 1  
ATOM   3669   H  HG23 . VAL A 1 228 ? -5.345  -8.011  -4.543  1.00 0.00 ? 228 VAL A HG23 1  
ATOM   3670   N  N    . PHE A 1 229 ? -2.019  -4.935  -4.278  1.00 0.00 ? 229 PHE A N    1  
ATOM   3671   C  CA   . PHE A 1 229 ? -0.840  -4.035  -4.143  1.00 0.00 ? 229 PHE A CA   1  
ATOM   3672   C  C    . PHE A 1 229 ? -0.931  -3.297  -2.809  1.00 0.00 ? 229 PHE A C    1  
ATOM   3673   O  O    . PHE A 1 229 ? 0.054   -3.095  -2.125  1.00 0.00 ? 229 PHE A O    1  
ATOM   3674   C  CB   . PHE A 1 229 ? -0.873  -3.025  -5.295  1.00 0.00 ? 229 PHE A CB   1  
ATOM   3675   C  CG   . PHE A 1 229 ? 0.285   -2.060  -5.189  1.00 0.00 ? 229 PHE A CG   1  
ATOM   3676   C  CD1  . PHE A 1 229 ? 1.580   -2.478  -5.517  1.00 0.00 ? 229 PHE A CD1  1  
ATOM   3677   C  CD2  . PHE A 1 229 ? 0.057   -0.740  -4.783  1.00 0.00 ? 229 PHE A CD2  1  
ATOM   3678   C  CE1  . PHE A 1 229 ? 2.648   -1.576  -5.438  1.00 0.00 ? 229 PHE A CE1  1  
ATOM   3679   C  CE2  . PHE A 1 229 ? 1.125   0.161   -4.699  1.00 0.00 ? 229 PHE A CE2  1  
ATOM   3680   C  CZ   . PHE A 1 229 ? 2.421   -0.256  -5.028  1.00 0.00 ? 229 PHE A CZ   1  
ATOM   3681   H  H    . PHE A 1 229 ? -2.633  -4.819  -5.031  1.00 0.00 ? 229 PHE A H    1  
ATOM   3682   H  HA   . PHE A 1 229 ? 0.071   -4.611  -4.184  1.00 0.00 ? 229 PHE A HA   1  
ATOM   3683   H  HB2  . PHE A 1 229 ? -0.812  -3.555  -6.232  1.00 0.00 ? 229 PHE A HB2  1  
ATOM   3684   H  HB3  . PHE A 1 229 ? -1.802  -2.475  -5.257  1.00 0.00 ? 229 PHE A HB3  1  
ATOM   3685   H  HD1  . PHE A 1 229 ? 1.756   -3.496  -5.832  1.00 0.00 ? 229 PHE A HD1  1  
ATOM   3686   H  HD2  . PHE A 1 229 ? -0.942  -0.417  -4.529  1.00 0.00 ? 229 PHE A HD2  1  
ATOM   3687   H  HE1  . PHE A 1 229 ? 3.647   -1.899  -5.691  1.00 0.00 ? 229 PHE A HE1  1  
ATOM   3688   H  HE2  . PHE A 1 229 ? 0.951   1.179   -4.384  1.00 0.00 ? 229 PHE A HE2  1  
ATOM   3689   H  HZ   . PHE A 1 229 ? 3.243   0.440   -4.968  1.00 0.00 ? 229 PHE A HZ   1  
ATOM   3690   N  N    . ASP A 1 230 ? -2.114  -2.897  -2.436  1.00 0.00 ? 230 ASP A N    1  
ATOM   3691   C  CA   . ASP A 1 230 ? -2.292  -2.173  -1.152  1.00 0.00 ? 230 ASP A CA   1  
ATOM   3692   C  C    . ASP A 1 230 ? -2.142  -3.150  0.016   1.00 0.00 ? 230 ASP A C    1  
ATOM   3693   O  O    . ASP A 1 230 ? -1.564  -2.827  1.034   1.00 0.00 ? 230 ASP A O    1  
ATOM   3694   C  CB   . ASP A 1 230 ? -3.686  -1.549  -1.125  1.00 0.00 ? 230 ASP A CB   1  
ATOM   3695   C  CG   . ASP A 1 230 ? -3.634  -0.152  -1.745  1.00 0.00 ? 230 ASP A CG   1  
ATOM   3696   O  OD1  . ASP A 1 230 ? -3.013  -0.012  -2.785  1.00 0.00 ? 230 ASP A OD1  1  
ATOM   3697   O  OD2  . ASP A 1 230 ? -4.216  0.752   -1.170  1.00 0.00 ? 230 ASP A OD2  1  
ATOM   3698   H  H    . ASP A 1 230 ? -2.890  -3.075  -3.007  1.00 0.00 ? 230 ASP A H    1  
ATOM   3699   H  HA   . ASP A 1 230 ? -1.548  -1.394  -1.070  1.00 0.00 ? 230 ASP A HA   1  
ATOM   3700   H  HB2  . ASP A 1 230 ? -4.369  -2.169  -1.689  1.00 0.00 ? 230 ASP A HB2  1  
ATOM   3701   H  HB3  . ASP A 1 230 ? -4.027  -1.476  -0.105  1.00 0.00 ? 230 ASP A HB3  1  
ATOM   3702   N  N    . LEU A 1 231 ? -2.659  -4.340  -0.118  1.00 0.00 ? 231 LEU A N    1  
ATOM   3703   C  CA   . LEU A 1 231 ? -2.542  -5.326  0.993   1.00 0.00 ? 231 LEU A CA   1  
ATOM   3704   C  C    . LEU A 1 231 ? -1.065  -5.524  1.337   1.00 0.00 ? 231 LEU A C    1  
ATOM   3705   O  O    . LEU A 1 231 ? -0.696  -5.672  2.488   1.00 0.00 ? 231 LEU A O    1  
ATOM   3706   C  CB   . LEU A 1 231 ? -3.157  -6.660  0.561   1.00 0.00 ? 231 LEU A CB   1  
ATOM   3707   C  CG   . LEU A 1 231 ? -2.935  -7.715  1.649   1.00 0.00 ? 231 LEU A CG   1  
ATOM   3708   C  CD1  . LEU A 1 231 ? -3.397  -7.173  3.003   1.00 0.00 ? 231 LEU A CD1  1  
ATOM   3709   C  CD2  . LEU A 1 231 ? -3.740  -8.972  1.307   1.00 0.00 ? 231 LEU A CD2  1  
ATOM   3710   H  H    . LEU A 1 231 ? -3.121  -4.585  -0.946  1.00 0.00 ? 231 LEU A H    1  
ATOM   3711   H  HA   . LEU A 1 231 ? -3.065  -4.949  1.858   1.00 0.00 ? 231 LEU A HA   1  
ATOM   3712   H  HB2  . LEU A 1 231 ? -4.217  -6.530  0.398   1.00 0.00 ? 231 LEU A HB2  1  
ATOM   3713   H  HB3  . LEU A 1 231 ? -2.691  -6.990  -0.356  1.00 0.00 ? 231 LEU A HB3  1  
ATOM   3714   H  HG   . LEU A 1 231 ? -1.884  -7.963  1.702   1.00 0.00 ? 231 LEU A HG   1  
ATOM   3715   H  HD11 . LEU A 1 231 ? -4.292  -6.583  2.868   1.00 0.00 ? 231 LEU A HD11 1  
ATOM   3716   H  HD12 . LEU A 1 231 ? -2.619  -6.556  3.429   1.00 0.00 ? 231 LEU A HD12 1  
ATOM   3717   H  HD13 . LEU A 1 231 ? -3.607  -7.997  3.669   1.00 0.00 ? 231 LEU A HD13 1  
ATOM   3718   H  HD21 . LEU A 1 231 ? -3.167  -9.849  1.569   1.00 0.00 ? 231 LEU A HD21 1  
ATOM   3719   H  HD22 . LEU A 1 231 ? -3.957  -8.984  0.250   1.00 0.00 ? 231 LEU A HD22 1  
ATOM   3720   H  HD23 . LEU A 1 231 ? -4.665  -8.968  1.864   1.00 0.00 ? 231 LEU A HD23 1  
ATOM   3721   N  N    . ILE A 1 232 ? -0.212  -5.501  0.353   1.00 0.00 ? 232 ILE A N    1  
ATOM   3722   C  CA   . ILE A 1 232 ? 1.238   -5.663  0.636   1.00 0.00 ? 232 ILE A CA   1  
ATOM   3723   C  C    . ILE A 1 232 ? 1.727   -4.394  1.336   1.00 0.00 ? 232 ILE A C    1  
ATOM   3724   O  O    . ILE A 1 232 ? 2.389   -4.443  2.353   1.00 0.00 ? 232 ILE A O    1  
ATOM   3725   C  CB   . ILE A 1 232 ? 1.994   -5.859  -0.680  1.00 0.00 ? 232 ILE A CB   1  
ATOM   3726   C  CG1  . ILE A 1 232 ? 1.505   -7.143  -1.356  1.00 0.00 ? 232 ILE A CG1  1  
ATOM   3727   C  CG2  . ILE A 1 232 ? 3.491   -5.976  -0.397  1.00 0.00 ? 232 ILE A CG2  1  
ATOM   3728   C  CD1  . ILE A 1 232 ? 2.030   -7.194  -2.792  1.00 0.00 ? 232 ILE A CD1  1  
ATOM   3729   H  H    . ILE A 1 232 ? -0.528  -5.355  -0.566  1.00 0.00 ? 232 ILE A H    1  
ATOM   3730   H  HA   . ILE A 1 232 ? 1.392   -6.517  1.278   1.00 0.00 ? 232 ILE A HA   1  
ATOM   3731   H  HB   . ILE A 1 232 ? 1.814   -5.015  -1.329  1.00 0.00 ? 232 ILE A HB   1  
ATOM   3732   H  HG12 . ILE A 1 232 ? 1.870   -8.000  -0.807  1.00 0.00 ? 232 ILE A HG12 1  
ATOM   3733   H  HG13 . ILE A 1 232 ? 0.425   -7.155  -1.368  1.00 0.00 ? 232 ILE A HG13 1  
ATOM   3734   H  HG21 . ILE A 1 232 ? 4.013   -6.211  -1.314  1.00 0.00 ? 232 ILE A HG21 1  
ATOM   3735   H  HG22 . ILE A 1 232 ? 3.660   -6.760  0.324   1.00 0.00 ? 232 ILE A HG22 1  
ATOM   3736   H  HG23 . ILE A 1 232 ? 3.857   -5.038  -0.005  1.00 0.00 ? 232 ILE A HG23 1  
ATOM   3737   H  HD11 . ILE A 1 232 ? 3.084   -7.427  -2.782  1.00 0.00 ? 232 ILE A HD11 1  
ATOM   3738   H  HD12 . ILE A 1 232 ? 1.877   -6.236  -3.266  1.00 0.00 ? 232 ILE A HD12 1  
ATOM   3739   H  HD13 . ILE A 1 232 ? 1.498   -7.957  -3.342  1.00 0.00 ? 232 ILE A HD13 1  
ATOM   3740   N  N    . GLY A 1 233 ? 1.390   -3.259  0.792   1.00 0.00 ? 233 GLY A N    1  
ATOM   3741   C  CA   . GLY A 1 233 ? 1.815   -1.974  1.418   1.00 0.00 ? 233 GLY A CA   1  
ATOM   3742   C  C    . GLY A 1 233 ? 1.471   -1.994  2.909   1.00 0.00 ? 233 GLY A C    1  
ATOM   3743   O  O    . GLY A 1 233 ? 2.174   -1.431  3.724   1.00 0.00 ? 233 GLY A O    1  
ATOM   3744   H  H    . GLY A 1 233 ? 0.857   -3.266  -0.033  1.00 0.00 ? 233 GLY A H    1  
ATOM   3745   H  HA2  . GLY A 1 233 ? 2.882   -1.852  1.298   1.00 0.00 ? 233 GLY A HA2  1  
ATOM   3746   H  HA3  . GLY A 1 233 ? 1.301   -1.151  0.943   1.00 0.00 ? 233 GLY A HA3  1  
ATOM   3747   N  N    . ASP A 1 234 ? 0.394   -2.641  3.278   1.00 0.00 ? 234 ASP A N    1  
ATOM   3748   C  CA   . ASP A 1 234 ? 0.019   -2.690  4.718   1.00 0.00 ? 234 ASP A CA   1  
ATOM   3749   C  C    . ASP A 1 234 ? 0.811   -3.795  5.426   1.00 0.00 ? 234 ASP A C    1  
ATOM   3750   O  O    . ASP A 1 234 ? 1.044   -3.726  6.617   1.00 0.00 ? 234 ASP A O    1  
ATOM   3751   C  CB   . ASP A 1 234 ? -1.482  -2.964  4.863   1.00 0.00 ? 234 ASP A CB   1  
ATOM   3752   C  CG   . ASP A 1 234 ? -2.275  -1.888  4.119   1.00 0.00 ? 234 ASP A CG   1  
ATOM   3753   O  OD1  . ASP A 1 234 ? -1.972  -1.650  2.962   1.00 0.00 ? 234 ASP A OD1  1  
ATOM   3754   O  OD2  . ASP A 1 234 ? -3.172  -1.319  4.719   1.00 0.00 ? 234 ASP A OD2  1  
ATOM   3755   H  H    . ASP A 1 234 ? -0.163  -3.090  2.611   1.00 0.00 ? 234 ASP A H    1  
ATOM   3756   H  HA   . ASP A 1 234 ? 0.253   -1.740  5.177   1.00 0.00 ? 234 ASP A HA   1  
ATOM   3757   H  HB2  . ASP A 1 234 ? -1.718  -3.936  4.455   1.00 0.00 ? 234 ASP A HB2  1  
ATOM   3758   H  HB3  . ASP A 1 234 ? -1.748  -2.941  5.908   1.00 0.00 ? 234 ASP A HB3  1  
ATOM   3759   N  N    . LEU A 1 235 ? 1.229   -4.815  4.720   1.00 0.00 ? 235 LEU A N    1  
ATOM   3760   C  CA   . LEU A 1 235 ? 2.003   -5.907  5.383   1.00 0.00 ? 235 LEU A CA   1  
ATOM   3761   C  C    . LEU A 1 235 ? 3.464   -5.491  5.546   1.00 0.00 ? 235 LEU A C    1  
ATOM   3762   O  O    . LEU A 1 235 ? 4.171   -6.004  6.390   1.00 0.00 ? 235 LEU A O    1  
ATOM   3763   C  CB   . LEU A 1 235 ? 1.934   -7.177  4.530   1.00 0.00 ? 235 LEU A CB   1  
ATOM   3764   C  CG   . LEU A 1 235 ? 0.814   -8.084  5.040   1.00 0.00 ? 235 LEU A CG   1  
ATOM   3765   C  CD1  . LEU A 1 235 ? 0.409   -9.065  3.937   1.00 0.00 ? 235 LEU A CD1  1  
ATOM   3766   C  CD2  . LEU A 1 235 ? 1.313   -8.869  6.257   1.00 0.00 ? 235 LEU A CD2  1  
ATOM   3767   H  H    . LEU A 1 235 ? 1.046   -4.875  3.757   1.00 0.00 ? 235 LEU A H    1  
ATOM   3768   H  HA   . LEU A 1 235 ? 1.584   -6.104  6.353   1.00 0.00 ? 235 LEU A HA   1  
ATOM   3769   H  HB2  . LEU A 1 235 ? 1.739   -6.907  3.502   1.00 0.00 ? 235 LEU A HB2  1  
ATOM   3770   H  HB3  . LEU A 1 235 ? 2.876   -7.701  4.591   1.00 0.00 ? 235 LEU A HB3  1  
ATOM   3771   H  HG   . LEU A 1 235 ? -0.040  -7.483  5.320   1.00 0.00 ? 235 LEU A HG   1  
ATOM   3772   H  HD11 . LEU A 1 235 ? 1.191   -9.114  3.194   1.00 0.00 ? 235 LEU A HD11 1  
ATOM   3773   H  HD12 . LEU A 1 235 ? -0.507  -8.728  3.475   1.00 0.00 ? 235 LEU A HD12 1  
ATOM   3774   H  HD13 . LEU A 1 235 ? 0.257   -10.045 4.365   1.00 0.00 ? 235 LEU A HD13 1  
ATOM   3775   H  HD21 . LEU A 1 235 ? 1.633   -9.853  5.944   1.00 0.00 ? 235 LEU A HD21 1  
ATOM   3776   H  HD22 . LEU A 1 235 ? 0.513   -8.962  6.977   1.00 0.00 ? 235 LEU A HD22 1  
ATOM   3777   H  HD23 . LEU A 1 235 ? 2.143   -8.345  6.706   1.00 0.00 ? 235 LEU A HD23 1  
ATOM   3778   N  N    . TYR A 1 236 ? 3.928   -4.574  4.746   1.00 0.00 ? 236 TYR A N    1  
ATOM   3779   C  CA   . TYR A 1 236 ? 5.347   -4.144  4.868   1.00 0.00 ? 236 TYR A CA   1  
ATOM   3780   C  C    . TYR A 1 236 ? 5.519   -3.324  6.144   1.00 0.00 ? 236 TYR A C    1  
ATOM   3781   O  O    . TYR A 1 236 ? 6.622   -3.010  6.546   1.00 0.00 ? 236 TYR A O    1  
ATOM   3782   C  CB   . TYR A 1 236 ? 5.732   -3.308  3.646   1.00 0.00 ? 236 TYR A CB   1  
ATOM   3783   C  CG   . TYR A 1 236 ? 7.239   -3.271  3.483   1.00 0.00 ? 236 TYR A CG   1  
ATOM   3784   C  CD1  . TYR A 1 236 ? 7.977   -4.462  3.356   1.00 0.00 ? 236 TYR A CD1  1  
ATOM   3785   C  CD2  . TYR A 1 236 ? 7.900   -2.038  3.448   1.00 0.00 ? 236 TYR A CD2  1  
ATOM   3786   C  CE1  . TYR A 1 236 ? 9.367   -4.410  3.198   1.00 0.00 ? 236 TYR A CE1  1  
ATOM   3787   C  CE2  . TYR A 1 236 ? 9.290   -1.990  3.290   1.00 0.00 ? 236 TYR A CE2  1  
ATOM   3788   C  CZ   . TYR A 1 236 ? 10.022  -3.175  3.165   1.00 0.00 ? 236 TYR A CZ   1  
ATOM   3789   O  OH   . TYR A 1 236 ? 11.392  -3.125  3.009   1.00 0.00 ? 236 TYR A OH   1  
ATOM   3790   H  H    . TYR A 1 236 ? 3.347   -4.172  4.068   1.00 0.00 ? 236 TYR A H    1  
ATOM   3791   H  HA   . TYR A 1 236 ? 5.974   -5.017  4.925   1.00 0.00 ? 236 TYR A HA   1  
ATOM   3792   H  HB2  . TYR A 1 236 ? 5.286   -3.742  2.765   1.00 0.00 ? 236 TYR A HB2  1  
ATOM   3793   H  HB3  . TYR A 1 236 ? 5.363   -2.301  3.773   1.00 0.00 ? 236 TYR A HB3  1  
ATOM   3794   H  HD1  . TYR A 1 236 ? 7.480   -5.418  3.378   1.00 0.00 ? 236 TYR A HD1  1  
ATOM   3795   H  HD2  . TYR A 1 236 ? 7.337   -1.122  3.547   1.00 0.00 ? 236 TYR A HD2  1  
ATOM   3796   H  HE1  . TYR A 1 236 ? 9.933   -5.325  3.103   1.00 0.00 ? 236 TYR A HE1  1  
ATOM   3797   H  HE2  . TYR A 1 236 ? 9.796   -1.039  3.262   1.00 0.00 ? 236 TYR A HE2  1  
ATOM   3798   H  HH   . TYR A 1 236 ? 11.793  -3.228  3.874   1.00 0.00 ? 236 TYR A HH   1  
ATOM   3799   N  N    . LEU A 1 237 ? 4.441   -2.990  6.797   1.00 0.00 ? 237 LEU A N    1  
ATOM   3800   C  CA   . LEU A 1 237 ? 4.558   -2.212  8.058   1.00 0.00 ? 237 LEU A CA   1  
ATOM   3801   C  C    . LEU A 1 237 ? 5.532   -2.938  8.980   1.00 0.00 ? 237 LEU A C    1  
ATOM   3802   O  O    . LEU A 1 237 ? 6.199   -2.330  9.790   1.00 0.00 ? 237 LEU A O    1  
ATOM   3803   C  CB   . LEU A 1 237 ? 3.187   -2.101  8.727   1.00 0.00 ? 237 LEU A CB   1  
ATOM   3804   C  CG   . LEU A 1 237 ? 2.319   -1.108  7.950   1.00 0.00 ? 237 LEU A CG   1  
ATOM   3805   C  CD1  . LEU A 1 237 ? 0.886   -1.159  8.480   1.00 0.00 ? 237 LEU A CD1  1  
ATOM   3806   C  CD2  . LEU A 1 237 ? 2.874   0.311   8.119   1.00 0.00 ? 237 LEU A CD2  1  
ATOM   3807   H  H    . LEU A 1 237 ? 3.560   -3.266  6.468   1.00 0.00 ? 237 LEU A H    1  
ATOM   3808   H  HA   . LEU A 1 237 ? 4.940   -1.223  7.846   1.00 0.00 ? 237 LEU A HA   1  
ATOM   3809   H  HB2  . LEU A 1 237 ? 2.710   -3.071  8.731   1.00 0.00 ? 237 LEU A HB2  1  
ATOM   3810   H  HB3  . LEU A 1 237 ? 3.308   -1.756  9.742   1.00 0.00 ? 237 LEU A HB3  1  
ATOM   3811   H  HG   . LEU A 1 237 ? 2.322   -1.374  6.902   1.00 0.00 ? 237 LEU A HG   1  
ATOM   3812   H  HD11 . LEU A 1 237 ? 0.564   -0.163  8.745   1.00 0.00 ? 237 LEU A HD11 1  
ATOM   3813   H  HD12 . LEU A 1 237 ? 0.847   -1.793  9.353   1.00 0.00 ? 237 LEU A HD12 1  
ATOM   3814   H  HD13 . LEU A 1 237 ? 0.233   -1.556  7.716   1.00 0.00 ? 237 LEU A HD13 1  
ATOM   3815   H  HD21 . LEU A 1 237 ? 3.624   0.319   8.897   1.00 0.00 ? 237 LEU A HD21 1  
ATOM   3816   H  HD22 . LEU A 1 237 ? 2.071   0.981   8.388   1.00 0.00 ? 237 LEU A HD22 1  
ATOM   3817   H  HD23 . LEU A 1 237 ? 3.316   0.637   7.189   1.00 0.00 ? 237 LEU A HD23 1  
ATOM   3818   N  N    . LEU A 1 238 ? 5.639   -4.235  8.852   1.00 0.00 ? 238 LEU A N    1  
ATOM   3819   C  CA   . LEU A 1 238 ? 6.597   -4.980  9.716   1.00 0.00 ? 238 LEU A CA   1  
ATOM   3820   C  C    . LEU A 1 238 ? 7.996   -4.396  9.506   1.00 0.00 ? 238 LEU A C    1  
ATOM   3821   O  O    . LEU A 1 238 ? 8.908   -4.641  10.272  1.00 0.00 ? 238 LEU A O    1  
ATOM   3822   C  CB   . LEU A 1 238 ? 6.592   -6.462  9.330   1.00 0.00 ? 238 LEU A CB   1  
ATOM   3823   C  CG   . LEU A 1 238 ? 5.202   -7.048  9.590   1.00 0.00 ? 238 LEU A CG   1  
ATOM   3824   C  CD1  . LEU A 1 238 ? 5.135   -8.483  9.058   1.00 0.00 ? 238 LEU A CD1  1  
ATOM   3825   C  CD2  . LEU A 1 238 ? 4.919   -7.050  11.094  1.00 0.00 ? 238 LEU A CD2  1  
ATOM   3826   H  H    . LEU A 1 238 ? 5.107   -4.721  8.183   1.00 0.00 ? 238 LEU A H    1  
ATOM   3827   H  HA   . LEU A 1 238 ? 6.311   -4.872  10.752  1.00 0.00 ? 238 LEU A HA   1  
ATOM   3828   H  HB2  . LEU A 1 238 ? 6.838   -6.562  8.283   1.00 0.00 ? 238 LEU A HB2  1  
ATOM   3829   H  HB3  . LEU A 1 238 ? 7.321   -6.993  9.924   1.00 0.00 ? 238 LEU A HB3  1  
ATOM   3830   H  HG   . LEU A 1 238 ? 4.461   -6.445  9.083   1.00 0.00 ? 238 LEU A HG   1  
ATOM   3831   H  HD11 . LEU A 1 238 ? 4.702   -8.480  8.068   1.00 0.00 ? 238 LEU A HD11 1  
ATOM   3832   H  HD12 . LEU A 1 238 ? 4.522   -9.083  9.716   1.00 0.00 ? 238 LEU A HD12 1  
ATOM   3833   H  HD13 . LEU A 1 238 ? 6.130   -8.899  9.015   1.00 0.00 ? 238 LEU A HD13 1  
ATOM   3834   H  HD21 . LEU A 1 238 ? 5.841   -7.204  11.635  1.00 0.00 ? 238 LEU A HD21 1  
ATOM   3835   H  HD22 . LEU A 1 238 ? 4.227   -7.843  11.330  1.00 0.00 ? 238 LEU A HD22 1  
ATOM   3836   H  HD23 . LEU A 1 238 ? 4.490   -6.100  11.380  1.00 0.00 ? 238 LEU A HD23 1  
ATOM   3837   N  N    . GLY A 1 239 ? 8.163   -3.612  8.474   1.00 0.00 ? 239 GLY A N    1  
ATOM   3838   C  CA   . GLY A 1 239 ? 9.488   -2.990  8.205   1.00 0.00 ? 239 GLY A CA   1  
ATOM   3839   C  C    . GLY A 1 239 ? 10.430  -4.004  7.554   1.00 0.00 ? 239 GLY A C    1  
ATOM   3840   O  O    . GLY A 1 239 ? 11.626  -3.796  7.493   1.00 0.00 ? 239 GLY A O    1  
ATOM   3841   H  H    . GLY A 1 239 ? 7.412   -3.423  7.879   1.00 0.00 ? 239 GLY A H    1  
ATOM   3842   H  HA2  . GLY A 1 239 ? 9.358   -2.145  7.544   1.00 0.00 ? 239 GLY A HA2  1  
ATOM   3843   H  HA3  . GLY A 1 239 ? 9.915   -2.654  9.135   1.00 0.00 ? 239 GLY A HA3  1  
ATOM   3844   N  N    . SER A 1 240 ? 9.915   -5.099  7.062   1.00 0.00 ? 240 SER A N    1  
ATOM   3845   C  CA   . SER A 1 240 ? 10.809  -6.104  6.420   1.00 0.00 ? 240 SER A CA   1  
ATOM   3846   C  C    . SER A 1 240 ? 9.988   -7.003  5.484   1.00 0.00 ? 240 SER A C    1  
ATOM   3847   O  O    . SER A 1 240 ? 8.853   -7.324  5.777   1.00 0.00 ? 240 SER A O    1  
ATOM   3848   C  CB   . SER A 1 240 ? 11.463  -6.963  7.504   1.00 0.00 ? 240 SER A CB   1  
ATOM   3849   O  OG   . SER A 1 240 ? 10.452  -7.646  8.235   1.00 0.00 ? 240 SER A OG   1  
ATOM   3850   H  H    . SER A 1 240 ? 8.947   -5.258  7.113   1.00 0.00 ? 240 SER A H    1  
ATOM   3851   H  HA   . SER A 1 240 ? 11.573  -5.588  5.864   1.00 0.00 ? 240 SER A HA   1  
ATOM   3852   H  HB2  . SER A 1 240 ? 12.120  -7.686  7.048   1.00 0.00 ? 240 SER A HB2  1  
ATOM   3853   H  HB3  . SER A 1 240 ? 12.035  -6.328  8.169   1.00 0.00 ? 240 SER A HB3  1  
ATOM   3854   H  HG   . SER A 1 240 ? 9.793   -7.957  7.609   1.00 0.00 ? 240 SER A HG   1  
ATOM   3855   N  N    . PRO A 1 241 ? 10.548  -7.423  4.373   1.00 0.00 ? 241 PRO A N    1  
ATOM   3856   C  CA   . PRO A 1 241 ? 9.834   -8.310  3.414   1.00 0.00 ? 241 PRO A CA   1  
ATOM   3857   C  C    . PRO A 1 241 ? 9.075   -9.427  4.135   1.00 0.00 ? 241 PRO A C    1  
ATOM   3858   O  O    . PRO A 1 241 ? 9.620   -10.120 4.972   1.00 0.00 ? 241 PRO A O    1  
ATOM   3859   C  CB   . PRO A 1 241 ? 10.954  -8.891  2.554   1.00 0.00 ? 241 PRO A CB   1  
ATOM   3860   C  CG   . PRO A 1 241 ? 12.042  -7.869  2.581   1.00 0.00 ? 241 PRO A CG   1  
ATOM   3861   C  CD   . PRO A 1 241 ? 11.911  -7.106  3.902   1.00 0.00 ? 241 PRO A CD   1  
ATOM   3862   H  HA   . PRO A 1 241 ? 9.163   -7.735  2.797   1.00 0.00 ? 241 PRO A HA   1  
ATOM   3863   H  HB2  . PRO A 1 241 ? 11.300  -9.825  2.974   1.00 0.00 ? 241 PRO A HB2  1  
ATOM   3864   H  HB3  . PRO A 1 241 ? 10.610  -9.037  1.542   1.00 0.00 ? 241 PRO A HB3  1  
ATOM   3865   H  HG2  . PRO A 1 241 ? 13.007  -8.357  2.526   1.00 0.00 ? 241 PRO A HG2  1  
ATOM   3866   H  HG3  . PRO A 1 241 ? 11.926  -7.186  1.755   1.00 0.00 ? 241 PRO A HG3  1  
ATOM   3867   H  HD2  . PRO A 1 241 ? 12.651  -7.448  4.612   1.00 0.00 ? 241 PRO A HD2  1  
ATOM   3868   H  HD3  . PRO A 1 241 ? 12.010  -6.046  3.728   1.00 0.00 ? 241 PRO A HD3  1  
ATOM   3869   N  N    . VAL A 1 242 ? 7.821   -9.601  3.829   1.00 0.00 ? 242 VAL A N    1  
ATOM   3870   C  CA   . VAL A 1 242 ? 7.032   -10.667 4.513   1.00 0.00 ? 242 VAL A CA   1  
ATOM   3871   C  C    . VAL A 1 242 ? 7.003   -11.934 3.655   1.00 0.00 ? 242 VAL A C    1  
ATOM   3872   O  O    . VAL A 1 242 ? 6.792   -11.880 2.460   1.00 0.00 ? 242 VAL A O    1  
ATOM   3873   C  CB   . VAL A 1 242 ? 5.605   -10.170 4.748   1.00 0.00 ? 242 VAL A CB   1  
ATOM   3874   C  CG1  . VAL A 1 242 ? 4.884   -11.115 5.710   1.00 0.00 ? 242 VAL A CG1  1  
ATOM   3875   C  CG2  . VAL A 1 242 ? 5.654   -8.768  5.359   1.00 0.00 ? 242 VAL A CG2  1  
ATOM   3876   H  H    . VAL A 1 242 ? 7.396   -9.026  3.157   1.00 0.00 ? 242 VAL A H    1  
ATOM   3877   H  HA   . VAL A 1 242 ? 7.489   -10.894 5.462   1.00 0.00 ? 242 VAL A HA   1  
ATOM   3878   H  HB   . VAL A 1 242 ? 5.074   -10.138 3.807   1.00 0.00 ? 242 VAL A HB   1  
ATOM   3879   H  HG11 . VAL A 1 242 ? 5.061   -10.797 6.727   1.00 0.00 ? 242 VAL A HG11 1  
ATOM   3880   H  HG12 . VAL A 1 242 ? 5.257   -12.119 5.576   1.00 0.00 ? 242 VAL A HG12 1  
ATOM   3881   H  HG13 . VAL A 1 242 ? 3.823   -11.094 5.507   1.00 0.00 ? 242 VAL A HG13 1  
ATOM   3882   H  HG21 . VAL A 1 242 ? 4.683   -8.516  5.761   1.00 0.00 ? 242 VAL A HG21 1  
ATOM   3883   H  HG22 . VAL A 1 242 ? 5.924   -8.052  4.597   1.00 0.00 ? 242 VAL A HG22 1  
ATOM   3884   H  HG23 . VAL A 1 242 ? 6.388   -8.746  6.150   1.00 0.00 ? 242 VAL A HG23 1  
ATOM   3885   N  N    . LYS A 1 243 ? 7.213   -13.078 4.263   1.00 0.00 ? 243 LYS A N    1  
ATOM   3886   C  CA   . LYS A 1 243 ? 7.196   -14.355 3.489   1.00 0.00 ? 243 LYS A CA   1  
ATOM   3887   C  C    . LYS A 1 243 ? 6.105   -15.277 4.042   1.00 0.00 ? 243 LYS A C    1  
ATOM   3888   O  O    . LYS A 1 243 ? 6.072   -15.579 5.218   1.00 0.00 ? 243 LYS A O    1  
ATOM   3889   C  CB   . LYS A 1 243 ? 8.557   -15.045 3.612   1.00 0.00 ? 243 LYS A CB   1  
ATOM   3890   C  CG   . LYS A 1 243 ? 9.602   -14.266 2.812   1.00 0.00 ? 243 LYS A CG   1  
ATOM   3891   C  CD   . LYS A 1 243 ? 9.780   -14.911 1.436   1.00 0.00 ? 243 LYS A CD   1  
ATOM   3892   C  CE   . LYS A 1 243 ? 10.465  -13.922 0.490   1.00 0.00 ? 243 LYS A CE   1  
ATOM   3893   N  NZ   . LYS A 1 243 ? 10.535  -14.508 -0.879  1.00 0.00 ? 243 LYS A NZ   1  
ATOM   3894   H  H    . LYS A 1 243 ? 7.381   -13.095 5.231   1.00 0.00 ? 243 LYS A H    1  
ATOM   3895   H  HA   . LYS A 1 243 ? 6.993   -14.145 2.448   1.00 0.00 ? 243 LYS A HA   1  
ATOM   3896   H  HB2  . LYS A 1 243 ? 8.850   -15.079 4.650   1.00 0.00 ? 243 LYS A HB2  1  
ATOM   3897   H  HB3  . LYS A 1 243 ? 8.486   -16.050 3.224   1.00 0.00 ? 243 LYS A HB3  1  
ATOM   3898   H  HG2  . LYS A 1 243 ? 9.275   -13.243 2.691   1.00 0.00 ? 243 LYS A HG2  1  
ATOM   3899   H  HG3  . LYS A 1 243 ? 10.545  -14.283 3.338   1.00 0.00 ? 243 LYS A HG3  1  
ATOM   3900   H  HD2  . LYS A 1 243 ? 10.388  -15.799 1.531   1.00 0.00 ? 243 LYS A HD2  1  
ATOM   3901   H  HD3  . LYS A 1 243 ? 8.813   -15.178 1.035   1.00 0.00 ? 243 LYS A HD3  1  
ATOM   3902   H  HE2  . LYS A 1 243 ? 9.899   -13.002 0.459   1.00 0.00 ? 243 LYS A HE2  1  
ATOM   3903   H  HE3  . LYS A 1 243 ? 11.464  -13.717 0.845   1.00 0.00 ? 243 LYS A HE3  1  
ATOM   3904   H  HZ1  . LYS A 1 243 ? 9.694   -15.093 -1.050  1.00 0.00 ? 243 LYS A HZ1  1  
ATOM   3905   H  HZ2  . LYS A 1 243 ? 11.390  -15.095 -0.960  1.00 0.00 ? 243 LYS A HZ2  1  
ATOM   3906   H  HZ3  . LYS A 1 243 ? 10.572  -13.742 -1.582  1.00 0.00 ? 243 LYS A HZ3  1  
ATOM   3907   N  N    . GLY A 1 244 ? 5.215   -15.728 3.200   1.00 0.00 ? 244 GLY A N    1  
ATOM   3908   C  CA   . GLY A 1 244 ? 4.124   -16.633 3.670   1.00 0.00 ? 244 GLY A CA   1  
ATOM   3909   C  C    . GLY A 1 244 ? 2.961   -16.580 2.674   1.00 0.00 ? 244 GLY A C    1  
ATOM   3910   O  O    . GLY A 1 244 ? 2.950   -15.774 1.764   1.00 0.00 ? 244 GLY A O    1  
ATOM   3911   H  H    . GLY A 1 244 ? 5.262   -15.472 2.255   1.00 0.00 ? 244 GLY A H    1  
ATOM   3912   H  HA2  . GLY A 1 244 ? 4.501   -17.643 3.737   1.00 0.00 ? 244 GLY A HA2  1  
ATOM   3913   H  HA3  . GLY A 1 244 ? 3.780   -16.314 4.641   1.00 0.00 ? 244 GLY A HA3  1  
ATOM   3914   N  N    . LYS A 1 245 ? 1.983   -17.432 2.832   1.00 0.00 ? 245 LYS A N    1  
ATOM   3915   C  CA   . LYS A 1 245 ? 0.826   -17.426 1.884   1.00 0.00 ? 245 LYS A CA   1  
ATOM   3916   C  C    . LYS A 1 245 ? -0.377  -16.740 2.539   1.00 0.00 ? 245 LYS A C    1  
ATOM   3917   O  O    . LYS A 1 245 ? -0.942  -17.239 3.492   1.00 0.00 ? 245 LYS A O    1  
ATOM   3918   C  CB   . LYS A 1 245 ? 0.453   -18.866 1.523   1.00 0.00 ? 245 LYS A CB   1  
ATOM   3919   C  CG   . LYS A 1 245 ? -0.912  -18.879 0.831   1.00 0.00 ? 245 LYS A CG   1  
ATOM   3920   C  CD   . LYS A 1 245 ? -0.951  -20.001 -0.208  1.00 0.00 ? 245 LYS A CD   1  
ATOM   3921   C  CE   . LYS A 1 245 ? -2.381  -20.170 -0.722  1.00 0.00 ? 245 LYS A CE   1  
ATOM   3922   N  NZ   . LYS A 1 245 ? -3.182  -18.964 -0.371  1.00 0.00 ? 245 LYS A NZ   1  
ATOM   3923   H  H    . LYS A 1 245 ? 2.012   -18.078 3.570   1.00 0.00 ? 245 LYS A H    1  
ATOM   3924   H  HA   . LYS A 1 245 ? 1.099   -16.891 0.987   1.00 0.00 ? 245 LYS A HA   1  
ATOM   3925   H  HB2  . LYS A 1 245 ? 1.199   -19.273 0.856   1.00 0.00 ? 245 LYS A HB2  1  
ATOM   3926   H  HB3  . LYS A 1 245 ? 0.406   -19.462 2.420   1.00 0.00 ? 245 LYS A HB3  1  
ATOM   3927   H  HG2  . LYS A 1 245 ? -1.686  -19.042 1.567   1.00 0.00 ? 245 LYS A HG2  1  
ATOM   3928   H  HG3  . LYS A 1 245 ? -1.077  -17.932 0.340   1.00 0.00 ? 245 LYS A HG3  1  
ATOM   3929   H  HD2  . LYS A 1 245 ? -0.298  -19.751 -1.032  1.00 0.00 ? 245 LYS A HD2  1  
ATOM   3930   H  HD3  . LYS A 1 245 ? -0.622  -20.924 0.246   1.00 0.00 ? 245 LYS A HD3  1  
ATOM   3931   H  HE2  . LYS A 1 245 ? -2.366  -20.293 -1.795  1.00 0.00 ? 245 LYS A HE2  1  
ATOM   3932   H  HE3  . LYS A 1 245 ? -2.827  -21.043 -0.267  1.00 0.00 ? 245 LYS A HE3  1  
ATOM   3933   H  HZ1  . LYS A 1 245 ? -3.471  -19.016 0.625   1.00 0.00 ? 245 LYS A HZ1  1  
ATOM   3934   H  HZ2  . LYS A 1 245 ? -4.028  -18.922 -0.977  1.00 0.00 ? 245 LYS A HZ2  1  
ATOM   3935   H  HZ3  . LYS A 1 245 ? -2.606  -18.110 -0.519  1.00 0.00 ? 245 LYS A HZ3  1  
ATOM   3936   N  N    . PHE A 1 246 ? -0.763  -15.592 2.041   1.00 0.00 ? 246 PHE A N    1  
ATOM   3937   C  CA   . PHE A 1 246 ? -1.920  -14.866 2.646   1.00 0.00 ? 246 PHE A CA   1  
ATOM   3938   C  C    . PHE A 1 246 ? -3.113  -14.822 1.688   1.00 0.00 ? 246 PHE A C    1  
ATOM   3939   O  O    . PHE A 1 246 ? -2.966  -14.734 0.486   1.00 0.00 ? 246 PHE A O    1  
ATOM   3940   C  CB   . PHE A 1 246 ? -1.519  -13.431 2.981   1.00 0.00 ? 246 PHE A CB   1  
ATOM   3941   C  CG   . PHE A 1 246 ? -0.163  -13.407 3.641   1.00 0.00 ? 246 PHE A CG   1  
ATOM   3942   C  CD1  . PHE A 1 246 ? 0.997   -13.514 2.863   1.00 0.00 ? 246 PHE A CD1  1  
ATOM   3943   C  CD2  . PHE A 1 246 ? -0.066  -13.268 5.028   1.00 0.00 ? 246 PHE A CD2  1  
ATOM   3944   C  CE1  . PHE A 1 246 ? 2.254   -13.482 3.477   1.00 0.00 ? 246 PHE A CE1  1  
ATOM   3945   C  CE2  . PHE A 1 246 ? 1.191   -13.236 5.643   1.00 0.00 ? 246 PHE A CE2  1  
ATOM   3946   C  CZ   . PHE A 1 246 ? 2.351   -13.343 4.867   1.00 0.00 ? 246 PHE A CZ   1  
ATOM   3947   H  H    . PHE A 1 246 ? -0.273  -15.211 1.283   1.00 0.00 ? 246 PHE A H    1  
ATOM   3948   H  HA   . PHE A 1 246 ? -2.219  -15.366 3.550   1.00 0.00 ? 246 PHE A HA   1  
ATOM   3949   H  HB2  . PHE A 1 246 ? -1.488  -12.852 2.078   1.00 0.00 ? 246 PHE A HB2  1  
ATOM   3950   H  HB3  . PHE A 1 246 ? -2.248  -13.003 3.649   1.00 0.00 ? 246 PHE A HB3  1  
ATOM   3951   H  HD1  . PHE A 1 246 ? 0.921   -13.622 1.791   1.00 0.00 ? 246 PHE A HD1  1  
ATOM   3952   H  HD2  . PHE A 1 246 ? -0.961  -13.184 5.624   1.00 0.00 ? 246 PHE A HD2  1  
ATOM   3953   H  HE1  . PHE A 1 246 ? 3.150   -13.564 2.879   1.00 0.00 ? 246 PHE A HE1  1  
ATOM   3954   H  HE2  . PHE A 1 246 ? 1.265   -13.130 6.714   1.00 0.00 ? 246 PHE A HE2  1  
ATOM   3955   H  HZ   . PHE A 1 246 ? 3.320   -13.317 5.340   1.00 0.00 ? 246 PHE A HZ   1  
ATOM   3956   N  N    . TYR A 1 247 ? -4.298  -14.857 2.236   1.00 0.00 ? 247 TYR A N    1  
ATOM   3957   C  CA   . TYR A 1 247 ? -5.530  -14.790 1.405   1.00 0.00 ? 247 TYR A CA   1  
ATOM   3958   C  C    . TYR A 1 247 ? -6.415  -13.687 1.983   1.00 0.00 ? 247 TYR A C    1  
ATOM   3959   O  O    . TYR A 1 247 ? -6.461  -13.503 3.181   1.00 0.00 ? 247 TYR A O    1  
ATOM   3960   C  CB   . TYR A 1 247 ? -6.264  -16.129 1.476   1.00 0.00 ? 247 TYR A CB   1  
ATOM   3961   C  CG   . TYR A 1 247 ? -7.376  -16.150 0.457   1.00 0.00 ? 247 TYR A CG   1  
ATOM   3962   C  CD1  . TYR A 1 247 ? -8.576  -15.481 0.717   1.00 0.00 ? 247 TYR A CD1  1  
ATOM   3963   C  CD2  . TYR A 1 247 ? -7.204  -16.840 -0.747  1.00 0.00 ? 247 TYR A CD2  1  
ATOM   3964   C  CE1  . TYR A 1 247 ? -9.607  -15.500 -0.231  1.00 0.00 ? 247 TYR A CE1  1  
ATOM   3965   C  CE2  . TYR A 1 247 ? -8.232  -16.861 -1.694  1.00 0.00 ? 247 TYR A CE2  1  
ATOM   3966   C  CZ   . TYR A 1 247 ? -9.435  -16.192 -1.437  1.00 0.00 ? 247 TYR A CZ   1  
ATOM   3967   O  OH   . TYR A 1 247 ? -10.450 -16.214 -2.371  1.00 0.00 ? 247 TYR A OH   1  
ATOM   3968   H  H    . TYR A 1 247 ? -4.376  -14.914 3.213   1.00 0.00 ? 247 TYR A H    1  
ATOM   3969   H  HA   . TYR A 1 247 ? -5.273  -14.562 0.381   1.00 0.00 ? 247 TYR A HA   1  
ATOM   3970   H  HB2  . TYR A 1 247 ? -5.570  -16.930 1.270   1.00 0.00 ? 247 TYR A HB2  1  
ATOM   3971   H  HB3  . TYR A 1 247 ? -6.681  -16.260 2.464   1.00 0.00 ? 247 TYR A HB3  1  
ATOM   3972   H  HD1  . TYR A 1 247 ? -8.707  -14.947 1.649   1.00 0.00 ? 247 TYR A HD1  1  
ATOM   3973   H  HD2  . TYR A 1 247 ? -6.277  -17.357 -0.945  1.00 0.00 ? 247 TYR A HD2  1  
ATOM   3974   H  HE1  . TYR A 1 247 ? -10.534 -14.984 -0.031  1.00 0.00 ? 247 TYR A HE1  1  
ATOM   3975   H  HE2  . TYR A 1 247 ? -8.099  -17.393 -2.623  1.00 0.00 ? 247 TYR A HE2  1  
ATOM   3976   H  HH   . TYR A 1 247 ? -10.297 -16.957 -2.958  1.00 0.00 ? 247 TYR A HH   1  
ATOM   3977   N  N    . SER A 1 248 ? -7.108  -12.933 1.166   1.00 0.00 ? 248 SER A N    1  
ATOM   3978   C  CA   . SER A 1 248 ? -7.958  -11.843 1.724   1.00 0.00 ? 248 SER A CA   1  
ATOM   3979   C  C    . SER A 1 248 ? -9.298  -11.790 0.987   1.00 0.00 ? 248 SER A C    1  
ATOM   3980   O  O    . SER A 1 248 ? -9.349  -11.675 -0.220  1.00 0.00 ? 248 SER A O    1  
ATOM   3981   C  CB   . SER A 1 248 ? -7.240  -10.505 1.543   1.00 0.00 ? 248 SER A CB   1  
ATOM   3982   O  OG   . SER A 1 248 ? -6.919  -9.964  2.817   1.00 0.00 ? 248 SER A OG   1  
ATOM   3983   H  H    . SER A 1 248 ? -7.074  -13.063 0.196   1.00 0.00 ? 248 SER A H    1  
ATOM   3984   H  HA   . SER A 1 248 ? -8.133  -12.017 2.773   1.00 0.00 ? 248 SER A HA   1  
ATOM   3985   H  HB2  . SER A 1 248 ? -6.331  -10.655 0.983   1.00 0.00 ? 248 SER A HB2  1  
ATOM   3986   H  HB3  . SER A 1 248 ? -7.885  -9.822  1.003   1.00 0.00 ? 248 SER A HB3  1  
ATOM   3987   H  HG   . SER A 1 248 ? -7.139  -9.029  2.806   1.00 0.00 ? 248 SER A HG   1  
ATOM   3988   N  N    . PHE A 1 249 ? -10.383 -11.855 1.712   1.00 0.00 ? 249 PHE A N    1  
ATOM   3989   C  CA   . PHE A 1 249 ? -11.724 -11.787 1.066   1.00 0.00 ? 249 PHE A CA   1  
ATOM   3990   C  C    . PHE A 1 249 ? -12.365 -10.449 1.427   1.00 0.00 ? 249 PHE A C    1  
ATOM   3991   O  O    . PHE A 1 249 ? -12.645 -10.184 2.585   1.00 0.00 ? 249 PHE A O    1  
ATOM   3992   C  CB   . PHE A 1 249 ? -12.604 -12.928 1.579   1.00 0.00 ? 249 PHE A CB   1  
ATOM   3993   C  CG   . PHE A 1 249 ? -14.057 -12.546 1.433   1.00 0.00 ? 249 PHE A CG   1  
ATOM   3994   C  CD1  . PHE A 1 249 ? -14.652 -12.527 0.165   1.00 0.00 ? 249 PHE A CD1  1  
ATOM   3995   C  CD2  . PHE A 1 249 ? -14.811 -12.210 2.563   1.00 0.00 ? 249 PHE A CD2  1  
ATOM   3996   C  CE1  . PHE A 1 249 ? -16.000 -12.172 0.028   1.00 0.00 ? 249 PHE A CE1  1  
ATOM   3997   C  CE2  . PHE A 1 249 ? -16.158 -11.853 2.427   1.00 0.00 ? 249 PHE A CE2  1  
ATOM   3998   C  CZ   . PHE A 1 249 ? -16.753 -11.835 1.160   1.00 0.00 ? 249 PHE A CZ   1  
ATOM   3999   H  H    . PHE A 1 249 ? -10.313 -11.933 2.687   1.00 0.00 ? 249 PHE A H    1  
ATOM   4000   H  HA   . PHE A 1 249 ? -11.617 -11.860 -0.005  1.00 0.00 ? 249 PHE A HA   1  
ATOM   4001   H  HB2  . PHE A 1 249 ? -12.405 -13.821 1.005   1.00 0.00 ? 249 PHE A HB2  1  
ATOM   4002   H  HB3  . PHE A 1 249 ? -12.384 -13.112 2.621   1.00 0.00 ? 249 PHE A HB3  1  
ATOM   4003   H  HD1  . PHE A 1 249 ? -14.071 -12.787 -0.708  1.00 0.00 ? 249 PHE A HD1  1  
ATOM   4004   H  HD2  . PHE A 1 249 ? -14.352 -12.224 3.542   1.00 0.00 ? 249 PHE A HD2  1  
ATOM   4005   H  HE1  . PHE A 1 249 ? -16.458 -12.157 -0.949  1.00 0.00 ? 249 PHE A HE1  1  
ATOM   4006   H  HE2  . PHE A 1 249 ? -16.739 -11.594 3.300   1.00 0.00 ? 249 PHE A HE2  1  
ATOM   4007   H  HZ   . PHE A 1 249 ? -17.792 -11.560 1.055   1.00 0.00 ? 249 PHE A HZ   1  
ATOM   4008   N  N    . ARG A 1 250 ? -12.590 -9.596  0.457   1.00 0.00 ? 250 ARG A N    1  
ATOM   4009   C  CA   . ARG A 1 250 ? -13.201 -8.274  0.767   1.00 0.00 ? 250 ARG A CA   1  
ATOM   4010   C  C    . ARG A 1 250 ? -12.516 -7.712  2.010   1.00 0.00 ? 250 ARG A C    1  
ATOM   4011   O  O    . ARG A 1 250 ? -13.155 -7.410  2.993   1.00 0.00 ? 250 ARG A O    1  
ATOM   4012   C  CB   . ARG A 1 250 ? -14.689 -8.450  1.052   1.00 0.00 ? 250 ARG A CB   1  
ATOM   4013   C  CG   . ARG A 1 250 ? -15.429 -8.775  -0.247  1.00 0.00 ? 250 ARG A CG   1  
ATOM   4014   C  CD   . ARG A 1 250 ? -16.933 -8.578  -0.038  1.00 0.00 ? 250 ARG A CD   1  
ATOM   4015   N  NE   . ARG A 1 250 ? -17.676 -9.713  -0.654  1.00 0.00 ? 250 ARG A NE   1  
ATOM   4016   C  CZ   . ARG A 1 250 ? -18.982 -9.707  -0.667  1.00 0.00 ? 250 ARG A CZ   1  
ATOM   4017   N  NH1  . ARG A 1 250 ? -19.634 -8.712  -0.129  1.00 0.00 ? 250 ARG A NH1  1  
ATOM   4018   N  NH2  . ARG A 1 250 ? -19.635 -10.692 -1.216  1.00 0.00 ? 250 ARG A NH2  1  
ATOM   4019   H  H    . ARG A 1 250 ? -12.357 -9.819  -0.468  1.00 0.00 ? 250 ARG A H    1  
ATOM   4020   H  HA   . ARG A 1 250 ? -13.061 -7.604  -0.072  1.00 0.00 ? 250 ARG A HA   1  
ATOM   4021   H  HB2  . ARG A 1 250 ? -14.819 -9.257  1.756   1.00 0.00 ? 250 ARG A HB2  1  
ATOM   4022   H  HB3  . ARG A 1 250 ? -15.084 -7.538  1.472   1.00 0.00 ? 250 ARG A HB3  1  
ATOM   4023   H  HG2  . ARG A 1 250 ? -15.084 -8.118  -1.032  1.00 0.00 ? 250 ARG A HG2  1  
ATOM   4024   H  HG3  . ARG A 1 250 ? -15.238 -9.800  -0.524  1.00 0.00 ? 250 ARG A HG3  1  
ATOM   4025   H  HD2  . ARG A 1 250 ? -17.147 -8.540  1.020   1.00 0.00 ? 250 ARG A HD2  1  
ATOM   4026   H  HD3  . ARG A 1 250 ? -17.242 -7.652  -0.500  1.00 0.00 ? 250 ARG A HD3  1  
ATOM   4027   H  HE   . ARG A 1 250 ? -17.186 -10.462 -1.053  1.00 0.00 ? 250 ARG A HE   1  
ATOM   4028   H  HH11 . ARG A 1 250 ? -19.135 -7.956  0.293   1.00 0.00 ? 250 ARG A HH11 1  
ATOM   4029   H  HH12 . ARG A 1 250 ? -20.634 -8.708  -0.138  1.00 0.00 ? 250 ARG A HH12 1  
ATOM   4030   H  HH21 . ARG A 1 250 ? -19.137 -11.455 -1.628  1.00 0.00 ? 250 ARG A HH21 1  
ATOM   4031   H  HH22 . ARG A 1 250 ? -20.636 -10.686 -1.226  1.00 0.00 ? 250 ARG A HH22 1  
ATOM   4032   N  N    . GLY A 1 251 ? -11.222 -7.585  1.978   1.00 0.00 ? 251 GLY A N    1  
ATOM   4033   C  CA   . GLY A 1 251 ? -10.491 -7.063  3.169   1.00 0.00 ? 251 GLY A CA   1  
ATOM   4034   C  C    . GLY A 1 251 ? -10.329 -5.544  3.078   1.00 0.00 ? 251 GLY A C    1  
ATOM   4035   O  O    . GLY A 1 251 ? -10.382 -4.964  2.012   1.00 0.00 ? 251 GLY A O    1  
ATOM   4036   H  H    . GLY A 1 251 ? -10.733 -7.829  1.169   1.00 0.00 ? 251 GLY A H    1  
ATOM   4037   H  HA2  . GLY A 1 251 ? -11.047 -7.308  4.063   1.00 0.00 ? 251 GLY A HA2  1  
ATOM   4038   H  HA3  . GLY A 1 251 ? -9.514  -7.521  3.217   1.00 0.00 ? 251 GLY A HA3  1  
ATOM   4039   N  N    . GLY A 1 252 ? -10.127 -4.903  4.200   1.00 0.00 ? 252 GLY A N    1  
ATOM   4040   C  CA   . GLY A 1 252 ? -9.954  -3.423  4.209   1.00 0.00 ? 252 GLY A CA   1  
ATOM   4041   C  C    . GLY A 1 252 ? -8.584  -3.074  4.796   1.00 0.00 ? 252 GLY A C    1  
ATOM   4042   O  O    . GLY A 1 252 ? -7.759  -3.937  5.028   1.00 0.00 ? 252 GLY A O    1  
ATOM   4043   H  H    . GLY A 1 252 ? -10.088 -5.400  5.042   1.00 0.00 ? 252 GLY A H    1  
ATOM   4044   H  HA2  . GLY A 1 252 ? -10.021 -3.047  3.198   1.00 0.00 ? 252 GLY A HA2  1  
ATOM   4045   H  HA3  . GLY A 1 252 ? -10.727 -2.974  4.815   1.00 0.00 ? 252 GLY A HA3  1  
ATOM   4046   N  N    . HIS A 1 253 ? -8.331  -1.816  5.036   1.00 0.00 ? 253 HIS A N    1  
ATOM   4047   C  CA   . HIS A 1 253 ? -7.009  -1.418  5.601   1.00 0.00 ? 253 HIS A CA   1  
ATOM   4048   C  C    . HIS A 1 253 ? -6.943  -1.780  7.086   1.00 0.00 ? 253 HIS A C    1  
ATOM   4049   O  O    . HIS A 1 253 ? -6.015  -2.422  7.534   1.00 0.00 ? 253 HIS A O    1  
ATOM   4050   C  CB   . HIS A 1 253 ? -6.814  0.090   5.439   1.00 0.00 ? 253 HIS A CB   1  
ATOM   4051   C  CG   . HIS A 1 253 ? -6.561  0.408   3.989   1.00 0.00 ? 253 HIS A CG   1  
ATOM   4052   N  ND1  . HIS A 1 253 ? -5.406  0.006   3.337   1.00 0.00 ? 253 HIS A ND1  1  
ATOM   4053   C  CD2  . HIS A 1 253 ? -7.304  1.085   3.052   1.00 0.00 ? 253 HIS A CD2  1  
ATOM   4054   C  CE1  . HIS A 1 253 ? -5.485  0.439   2.066   1.00 0.00 ? 253 HIS A CE1  1  
ATOM   4055   N  NE2  . HIS A 1 253 ? -6.622  1.103   1.838   1.00 0.00 ? 253 HIS A NE2  1  
ATOM   4056   H  H    . HIS A 1 253 ? -9.006  -1.133  4.842   1.00 0.00 ? 253 HIS A H    1  
ATOM   4057   H  HA   . HIS A 1 253 ? -6.224  -1.938  5.073   1.00 0.00 ? 253 HIS A HA   1  
ATOM   4058   H  HB2  . HIS A 1 253 ? -7.700  0.609   5.776   1.00 0.00 ? 253 HIS A HB2  1  
ATOM   4059   H  HB3  . HIS A 1 253 ? -5.966  0.409   6.027   1.00 0.00 ? 253 HIS A HB3  1  
ATOM   4060   H  HD1  . HIS A 1 253 ? -4.665  -0.501  3.731   1.00 0.00 ? 253 HIS A HD1  1  
ATOM   4061   H  HD2  . HIS A 1 253 ? -8.269  1.535   3.230   1.00 0.00 ? 253 HIS A HD2  1  
ATOM   4062   H  HE1  . HIS A 1 253 ? -4.722  0.272   1.320   1.00 0.00 ? 253 HIS A HE1  1  
ATOM   4063   N  N    . SER A 1 254 ? -7.912  -1.369  7.857   1.00 0.00 ? 254 SER A N    1  
ATOM   4064   C  CA   . SER A 1 254 ? -7.882  -1.692  9.311   1.00 0.00 ? 254 SER A CA   1  
ATOM   4065   C  C    . SER A 1 254 ? -7.750  -3.206  9.493   1.00 0.00 ? 254 SER A C    1  
ATOM   4066   O  O    . SER A 1 254 ? -6.844  -3.684  10.147  1.00 0.00 ? 254 SER A O    1  
ATOM   4067   C  CB   . SER A 1 254 ? -9.176  -1.210  9.966   1.00 0.00 ? 254 SER A CB   1  
ATOM   4068   O  OG   . SER A 1 254 ? -9.536  0.054   9.423   1.00 0.00 ? 254 SER A OG   1  
ATOM   4069   H  H    . SER A 1 254 ? -8.652  -0.846  7.483   1.00 0.00 ? 254 SER A H    1  
ATOM   4070   H  HA   . SER A 1 254 ? -7.039  -1.199  9.771   1.00 0.00 ? 254 SER A HA   1  
ATOM   4071   H  HB2  . SER A 1 254 ? -9.965  -1.916  9.772   1.00 0.00 ? 254 SER A HB2  1  
ATOM   4072   H  HB3  . SER A 1 254 ? -9.027  -1.124  11.035  1.00 0.00 ? 254 SER A HB3  1  
ATOM   4073   H  HG   . SER A 1 254 ? -8.934  0.712   9.779   1.00 0.00 ? 254 SER A HG   1  
ATOM   4074   N  N    . LEU A 1 255 ? -8.647  -3.963  8.927   1.00 0.00 ? 255 LEU A N    1  
ATOM   4075   C  CA   . LEU A 1 255 ? -8.571  -5.445  9.075   1.00 0.00 ? 255 LEU A CA   1  
ATOM   4076   C  C    . LEU A 1 255 ? -7.190  -5.932  8.632   1.00 0.00 ? 255 LEU A C    1  
ATOM   4077   O  O    . LEU A 1 255 ? -6.583  -6.768  9.272   1.00 0.00 ? 255 LEU A O    1  
ATOM   4078   C  CB   . LEU A 1 255 ? -9.653  -6.100  8.214   1.00 0.00 ? 255 LEU A CB   1  
ATOM   4079   C  CG   . LEU A 1 255 ? -9.590  -7.623  8.369   1.00 0.00 ? 255 LEU A CG   1  
ATOM   4080   C  CD1  . LEU A 1 255 ? -9.757  -8.005  9.841   1.00 0.00 ? 255 LEU A CD1  1  
ATOM   4081   C  CD2  . LEU A 1 255 ? -10.719 -8.257  7.558   1.00 0.00 ? 255 LEU A CD2  1  
ATOM   4082   H  H    . LEU A 1 255 ? -9.379  -3.558  8.415   1.00 0.00 ? 255 LEU A H    1  
ATOM   4083   H  HA   . LEU A 1 255 ? -8.728  -5.706  10.111  1.00 0.00 ? 255 LEU A HA   1  
ATOM   4084   H  HB2  . LEU A 1 255 ? -10.625 -5.747  8.530   1.00 0.00 ? 255 LEU A HB2  1  
ATOM   4085   H  HB3  . LEU A 1 255 ? -9.495  -5.839  7.180   1.00 0.00 ? 255 LEU A HB3  1  
ATOM   4086   H  HG   . LEU A 1 255 ? -8.639  -7.984  8.007   1.00 0.00 ? 255 LEU A HG   1  
ATOM   4087   H  HD11 . LEU A 1 255 ? -8.795  -7.982  10.331  1.00 0.00 ? 255 LEU A HD11 1  
ATOM   4088   H  HD12 . LEU A 1 255 ? -10.173 -9.000  9.910   1.00 0.00 ? 255 LEU A HD12 1  
ATOM   4089   H  HD13 . LEU A 1 255 ? -10.423 -7.303  10.322  1.00 0.00 ? 255 LEU A HD13 1  
ATOM   4090   H  HD21 . LEU A 1 255 ? -10.641 -7.948  6.526   1.00 0.00 ? 255 LEU A HD21 1  
ATOM   4091   H  HD22 . LEU A 1 255 ? -11.669 -7.936  7.958   1.00 0.00 ? 255 LEU A HD22 1  
ATOM   4092   H  HD23 . LEU A 1 255 ? -10.648 -9.333  7.618   1.00 0.00 ? 255 LEU A HD23 1  
ATOM   4093   N  N    . ASN A 1 256 ? -6.679  -5.411  7.548   1.00 0.00 ? 256 ASN A N    1  
ATOM   4094   C  CA   . ASN A 1 256 ? -5.331  -5.845  7.084   1.00 0.00 ? 256 ASN A CA   1  
ATOM   4095   C  C    . ASN A 1 256 ? -4.315  -5.554  8.189   1.00 0.00 ? 256 ASN A C    1  
ATOM   4096   O  O    . ASN A 1 256 ? -3.605  -6.432  8.649   1.00 0.00 ? 256 ASN A O    1  
ATOM   4097   C  CB   . ASN A 1 256 ? -4.952  -5.073  5.819   1.00 0.00 ? 256 ASN A CB   1  
ATOM   4098   C  CG   . ASN A 1 256 ? -5.807  -5.560  4.647   1.00 0.00 ? 256 ASN A CG   1  
ATOM   4099   O  OD1  . ASN A 1 256 ? -6.429  -6.602  4.727   1.00 0.00 ? 256 ASN A OD1  1  
ATOM   4100   N  ND2  . ASN A 1 256 ? -5.867  -4.847  3.556   1.00 0.00 ? 256 ASN A ND2  1  
ATOM   4101   H  H    . ASN A 1 256 ? -7.176  -4.728  7.047   1.00 0.00 ? 256 ASN A H    1  
ATOM   4102   H  HA   . ASN A 1 256 ? -5.345  -6.905  6.874   1.00 0.00 ? 256 ASN A HA   1  
ATOM   4103   H  HB2  . ASN A 1 256 ? -5.123  -4.018  5.976   1.00 0.00 ? 256 ASN A HB2  1  
ATOM   4104   H  HB3  . ASN A 1 256 ? -3.908  -5.239  5.593   1.00 0.00 ? 256 ASN A HB3  1  
ATOM   4105   H  HD21 . ASN A 1 256 ? -5.367  -4.006  3.492   1.00 0.00 ? 256 ASN A HD21 1  
ATOM   4106   H  HD22 . ASN A 1 256 ? -6.411  -5.152  2.800   1.00 0.00 ? 256 ASN A HD22 1  
ATOM   4107   N  N    . VAL A 1 257 ? -4.248  -4.327  8.631   1.00 0.00 ? 257 VAL A N    1  
ATOM   4108   C  CA   . VAL A 1 257 ? -3.293  -3.976  9.717   1.00 0.00 ? 257 VAL A CA   1  
ATOM   4109   C  C    . VAL A 1 257 ? -3.495  -4.935  10.893  1.00 0.00 ? 257 VAL A C    1  
ATOM   4110   O  O    . VAL A 1 257 ? -2.548  -5.364  11.518  1.00 0.00 ? 257 VAL A O    1  
ATOM   4111   C  CB   . VAL A 1 257 ? -3.548  -2.540  10.176  1.00 0.00 ? 257 VAL A CB   1  
ATOM   4112   C  CG1  . VAL A 1 257 ? -2.963  -2.339  11.575  1.00 0.00 ? 257 VAL A CG1  1  
ATOM   4113   C  CG2  . VAL A 1 257 ? -2.878  -1.570  9.200   1.00 0.00 ? 257 VAL A CG2  1  
ATOM   4114   H  H    . VAL A 1 257 ? -4.832  -3.636  8.256   1.00 0.00 ? 257 VAL A H    1  
ATOM   4115   H  HA   . VAL A 1 257 ? -2.281  -4.064  9.350   1.00 0.00 ? 257 VAL A HA   1  
ATOM   4116   H  HB   . VAL A 1 257 ? -4.611  -2.352  10.200  1.00 0.00 ? 257 VAL A HB   1  
ATOM   4117   H  HG11 . VAL A 1 257 ? -2.816  -1.285  11.756  1.00 0.00 ? 257 VAL A HG11 1  
ATOM   4118   H  HG12 . VAL A 1 257 ? -2.014  -2.852  11.645  1.00 0.00 ? 257 VAL A HG12 1  
ATOM   4119   H  HG13 . VAL A 1 257 ? -3.643  -2.740  12.311  1.00 0.00 ? 257 VAL A HG13 1  
ATOM   4120   H  HG21 . VAL A 1 257 ? -3.156  -0.557  9.452   1.00 0.00 ? 257 VAL A HG21 1  
ATOM   4121   H  HG22 . VAL A 1 257 ? -3.200  -1.792  8.194   1.00 0.00 ? 257 VAL A HG22 1  
ATOM   4122   H  HG23 . VAL A 1 257 ? -1.805  -1.676  9.267   1.00 0.00 ? 257 VAL A HG23 1  
ATOM   4123   N  N    . LYS A 1 258 ? -4.721  -5.279  11.199  1.00 0.00 ? 258 LYS A N    1  
ATOM   4124   C  CA   . LYS A 1 258 ? -4.966  -6.216  12.334  1.00 0.00 ? 258 LYS A CA   1  
ATOM   4125   C  C    . LYS A 1 258 ? -4.151  -7.486  12.103  1.00 0.00 ? 258 LYS A C    1  
ATOM   4126   O  O    . LYS A 1 258 ? -3.453  -7.956  12.980  1.00 0.00 ? 258 LYS A O    1  
ATOM   4127   C  CB   . LYS A 1 258 ? -6.456  -6.566  12.391  1.00 0.00 ? 258 LYS A CB   1  
ATOM   4128   C  CG   . LYS A 1 258 ? -6.966  -6.404  13.824  1.00 0.00 ? 258 LYS A CG   1  
ATOM   4129   C  CD   . LYS A 1 258 ? -8.363  -7.019  13.941  1.00 0.00 ? 258 LYS A CD   1  
ATOM   4130   C  CE   . LYS A 1 258 ? -8.848  -6.919  15.388  1.00 0.00 ? 258 LYS A CE   1  
ATOM   4131   N  NZ   . LYS A 1 258 ? -9.745  -8.071  15.694  1.00 0.00 ? 258 LYS A NZ   1  
ATOM   4132   H  H    . LYS A 1 258 ? -5.477  -4.926  10.688  1.00 0.00 ? 258 LYS A H    1  
ATOM   4133   H  HA   . LYS A 1 258 ? -4.665  -5.753  13.262  1.00 0.00 ? 258 LYS A HA   1  
ATOM   4134   H  HB2  . LYS A 1 258 ? -7.006  -5.906  11.736  1.00 0.00 ? 258 LYS A HB2  1  
ATOM   4135   H  HB3  . LYS A 1 258 ? -6.599  -7.589  12.074  1.00 0.00 ? 258 LYS A HB3  1  
ATOM   4136   H  HG2  . LYS A 1 258 ? -6.292  -6.905  14.504  1.00 0.00 ? 258 LYS A HG2  1  
ATOM   4137   H  HG3  . LYS A 1 258 ? -7.014  -5.354  14.073  1.00 0.00 ? 258 LYS A HG3  1  
ATOM   4138   H  HD2  . LYS A 1 258 ? -9.045  -6.486  13.294  1.00 0.00 ? 258 LYS A HD2  1  
ATOM   4139   H  HD3  . LYS A 1 258 ? -8.325  -8.057  13.647  1.00 0.00 ? 258 LYS A HD3  1  
ATOM   4140   H  HE2  . LYS A 1 258 ? -7.999  -6.937  16.055  1.00 0.00 ? 258 LYS A HE2  1  
ATOM   4141   H  HE3  . LYS A 1 258 ? -9.391  -5.995  15.523  1.00 0.00 ? 258 LYS A HE3  1  
ATOM   4142   H  HZ1  . LYS A 1 258 ? -9.179  -8.866  16.049  1.00 0.00 ? 258 LYS A HZ1  1  
ATOM   4143   H  HZ2  . LYS A 1 258 ? -10.245 -8.358  14.828  1.00 0.00 ? 258 LYS A HZ2  1  
ATOM   4144   H  HZ3  . LYS A 1 258 ? -10.437 -7.790  16.417  1.00 0.00 ? 258 LYS A HZ3  1  
ATOM   4145   N  N    . LEU A 1 259 ? -4.214  -8.033  10.922  1.00 0.00 ? 259 LEU A N    1  
ATOM   4146   C  CA   . LEU A 1 259 ? -3.424  -9.257  10.629  1.00 0.00 ? 259 LEU A CA   1  
ATOM   4147   C  C    . LEU A 1 259 ? -1.966  -8.986  11.006  1.00 0.00 ? 259 LEU A C    1  
ATOM   4148   O  O    . LEU A 1 259 ? -1.339  -9.754  11.708  1.00 0.00 ? 259 LEU A O    1  
ATOM   4149   C  CB   . LEU A 1 259 ? -3.524  -9.572  9.130   1.00 0.00 ? 259 LEU A CB   1  
ATOM   4150   C  CG   . LEU A 1 259 ? -2.711  -10.831 8.789   1.00 0.00 ? 259 LEU A CG   1  
ATOM   4151   C  CD1  . LEU A 1 259 ? -3.570  -12.085 8.973   1.00 0.00 ? 259 LEU A CD1  1  
ATOM   4152   C  CD2  . LEU A 1 259 ? -2.249  -10.750 7.333   1.00 0.00 ? 259 LEU A CD2  1  
ATOM   4153   H  H    . LEU A 1 259 ? -4.771  -7.630  10.223  1.00 0.00 ? 259 LEU A H    1  
ATOM   4154   H  HA   . LEU A 1 259 ? -3.804  -10.087 11.206  1.00 0.00 ? 259 LEU A HA   1  
ATOM   4155   H  HB2  . LEU A 1 259 ? -4.560  -9.726  8.865   1.00 0.00 ? 259 LEU A HB2  1  
ATOM   4156   H  HB3  . LEU A 1 259 ? -3.136  -8.735  8.568   1.00 0.00 ? 259 LEU A HB3  1  
ATOM   4157   H  HG   . LEU A 1 259 ? -1.850  -10.896 9.433   1.00 0.00 ? 259 LEU A HG   1  
ATOM   4158   H  HD11 . LEU A 1 259 ? -4.432  -11.853 9.580   1.00 0.00 ? 259 LEU A HD11 1  
ATOM   4159   H  HD12 . LEU A 1 259 ? -2.983  -12.849 9.461   1.00 0.00 ? 259 LEU A HD12 1  
ATOM   4160   H  HD13 . LEU A 1 259 ? -3.894  -12.443 8.005   1.00 0.00 ? 259 LEU A HD13 1  
ATOM   4161   H  HD21 . LEU A 1 259 ? -1.704  -9.831  7.178   1.00 0.00 ? 259 LEU A HD21 1  
ATOM   4162   H  HD22 . LEU A 1 259 ? -3.108  -10.775 6.679   1.00 0.00 ? 259 LEU A HD22 1  
ATOM   4163   H  HD23 . LEU A 1 259 ? -1.606  -11.589 7.115   1.00 0.00 ? 259 LEU A HD23 1  
ATOM   4164   N  N    . VAL A 1 260 ? -1.427  -7.894  10.542  1.00 0.00 ? 260 VAL A N    1  
ATOM   4165   C  CA   . VAL A 1 260 ? -0.011  -7.562  10.867  1.00 0.00 ? 260 VAL A CA   1  
ATOM   4166   C  C    . VAL A 1 260 ? 0.143   -7.404  12.379  1.00 0.00 ? 260 VAL A C    1  
ATOM   4167   O  O    . VAL A 1 260 ? 1.107   -7.852  12.967  1.00 0.00 ? 260 VAL A O    1  
ATOM   4168   C  CB   . VAL A 1 260 ? 0.366   -6.248  10.186  1.00 0.00 ? 260 VAL A CB   1  
ATOM   4169   C  CG1  . VAL A 1 260 ? 1.726   -5.780  10.701  1.00 0.00 ? 260 VAL A CG1  1  
ATOM   4170   C  CG2  . VAL A 1 260 ? 0.442   -6.465  8.678   1.00 0.00 ? 260 VAL A CG2  1  
ATOM   4171   H  H    . VAL A 1 260 ? -1.955  -7.290  9.976   1.00 0.00 ? 260 VAL A H    1  
ATOM   4172   H  HA   . VAL A 1 260 ? 0.637   -8.350  10.516  1.00 0.00 ? 260 VAL A HA   1  
ATOM   4173   H  HB   . VAL A 1 260 ? -0.381  -5.500  10.407  1.00 0.00 ? 260 VAL A HB   1  
ATOM   4174   H  HG11 . VAL A 1 260 ? 1.586   -5.144  11.562  1.00 0.00 ? 260 VAL A HG11 1  
ATOM   4175   H  HG12 . VAL A 1 260 ? 2.236   -5.229  9.924   1.00 0.00 ? 260 VAL A HG12 1  
ATOM   4176   H  HG13 . VAL A 1 260 ? 2.317   -6.638  10.980  1.00 0.00 ? 260 VAL A HG13 1  
ATOM   4177   H  HG21 . VAL A 1 260 ? 1.374   -6.953  8.435   1.00 0.00 ? 260 VAL A HG21 1  
ATOM   4178   H  HG22 . VAL A 1 260 ? 0.390   -5.510  8.176   1.00 0.00 ? 260 VAL A HG22 1  
ATOM   4179   H  HG23 . VAL A 1 260 ? -0.384  -7.086  8.360   1.00 0.00 ? 260 VAL A HG23 1  
ATOM   4180   N  N    . LYS A 1 261 ? -0.792  -6.755  13.009  1.00 0.00 ? 261 LYS A N    1  
ATOM   4181   C  CA   . LYS A 1 261 ? -0.701  -6.549  14.479  1.00 0.00 ? 261 LYS A CA   1  
ATOM   4182   C  C    . LYS A 1 261 ? -0.583  -7.896  15.183  1.00 0.00 ? 261 LYS A C    1  
ATOM   4183   O  O    . LYS A 1 261 ? 0.306   -8.117  15.976  1.00 0.00 ? 261 LYS A O    1  
ATOM   4184   C  CB   . LYS A 1 261 ? -1.974  -5.853  14.956  1.00 0.00 ? 261 LYS A CB   1  
ATOM   4185   C  CG   . LYS A 1 261 ? -1.627  -4.549  15.682  1.00 0.00 ? 261 LYS A CG   1  
ATOM   4186   C  CD   . LYS A 1 261 ? -1.243  -3.479  14.658  1.00 0.00 ? 261 LYS A CD   1  
ATOM   4187   C  CE   . LYS A 1 261 ? -0.799  -2.210  15.389  1.00 0.00 ? 261 LYS A CE   1  
ATOM   4188   N  NZ   . LYS A 1 261 ? -1.512  -1.032  14.818  1.00 0.00 ? 261 LYS A NZ   1  
ATOM   4189   H  H    . LYS A 1 261 ? -1.552  -6.393  12.509  1.00 0.00 ? 261 LYS A H    1  
ATOM   4190   H  HA   . LYS A 1 261 ? 0.159   -5.939  14.709  1.00 0.00 ? 261 LYS A HA   1  
ATOM   4191   H  HB2  . LYS A 1 261 ? -2.591  -5.638  14.102  1.00 0.00 ? 261 LYS A HB2  1  
ATOM   4192   H  HB3  . LYS A 1 261 ? -2.513  -6.504  15.626  1.00 0.00 ? 261 LYS A HB3  1  
ATOM   4193   H  HG2  . LYS A 1 261 ? -2.486  -4.215  16.245  1.00 0.00 ? 261 LYS A HG2  1  
ATOM   4194   H  HG3  . LYS A 1 261 ? -0.799  -4.718  16.355  1.00 0.00 ? 261 LYS A HG3  1  
ATOM   4195   H  HD2  . LYS A 1 261 ? -0.433  -3.843  14.042  1.00 0.00 ? 261 LYS A HD2  1  
ATOM   4196   H  HD3  . LYS A 1 261 ? -2.095  -3.254  14.036  1.00 0.00 ? 261 LYS A HD3  1  
ATOM   4197   H  HE2  . LYS A 1 261 ? -1.035  -2.299  16.440  1.00 0.00 ? 261 LYS A HE2  1  
ATOM   4198   H  HE3  . LYS A 1 261 ? 0.266   -2.079  15.271  1.00 0.00 ? 261 LYS A HE3  1  
ATOM   4199   H  HZ1  . LYS A 1 261 ? -1.014  -0.161  15.089  1.00 0.00 ? 261 LYS A HZ1  1  
ATOM   4200   H  HZ2  . LYS A 1 261 ? -2.486  -1.005  15.186  1.00 0.00 ? 261 LYS A HZ2  1  
ATOM   4201   H  HZ3  . LYS A 1 261 ? -1.534  -1.108  13.783  1.00 0.00 ? 261 LYS A HZ3  1  
ATOM   4202   N  N    . GLU A 1 262 ? -1.472  -8.804  14.903  1.00 0.00 ? 262 GLU A N    1  
ATOM   4203   C  CA   . GLU A 1 262 ? -1.403  -10.135 15.568  1.00 0.00 ? 262 GLU A CA   1  
ATOM   4204   C  C    . GLU A 1 262 ? -0.124  -10.858 15.147  1.00 0.00 ? 262 GLU A C    1  
ATOM   4205   O  O    . GLU A 1 262 ? 0.529   -11.491 15.949  1.00 0.00 ? 262 GLU A O    1  
ATOM   4206   C  CB   . GLU A 1 262 ? -2.616  -10.974 15.162  1.00 0.00 ? 262 GLU A CB   1  
ATOM   4207   C  CG   . GLU A 1 262 ? -3.822  -10.574 16.013  1.00 0.00 ? 262 GLU A CG   1  
ATOM   4208   C  CD   . GLU A 1 262 ? -3.775  -11.325 17.345  1.00 0.00 ? 262 GLU A CD   1  
ATOM   4209   O  OE1  . GLU A 1 262 ? -2.680  -11.615 17.800  1.00 0.00 ? 262 GLU A OE1  1  
ATOM   4210   O  OE2  . GLU A 1 262 ? -4.833  -11.598 17.887  1.00 0.00 ? 262 GLU A OE2  1  
ATOM   4211   H  H    . GLU A 1 262 ? -2.188  -8.620  14.260  1.00 0.00 ? 262 GLU A H    1  
ATOM   4212   H  HA   . GLU A 1 262 ? -1.403  -10.000 16.639  1.00 0.00 ? 262 GLU A HA   1  
ATOM   4213   H  HB2  . GLU A 1 262 ? -2.837  -10.808 14.118  1.00 0.00 ? 262 GLU A HB2  1  
ATOM   4214   H  HB3  . GLU A 1 262 ? -2.396  -12.018 15.322  1.00 0.00 ? 262 GLU A HB3  1  
ATOM   4215   H  HG2  . GLU A 1 262 ? -3.796  -9.510  16.197  1.00 0.00 ? 262 GLU A HG2  1  
ATOM   4216   H  HG3  . GLU A 1 262 ? -4.731  -10.829 15.490  1.00 0.00 ? 262 GLU A HG3  1  
ATOM   4217   N  N    . LEU A 1 263 ? 0.236   -10.774 13.897  1.00 0.00 ? 263 LEU A N    1  
ATOM   4218   C  CA   . LEU A 1 263 ? 1.473   -11.465 13.435  1.00 0.00 ? 263 LEU A CA   1  
ATOM   4219   C  C    . LEU A 1 263 ? 2.683   -10.890 14.174  1.00 0.00 ? 263 LEU A C    1  
ATOM   4220   O  O    . LEU A 1 263 ? 3.542   -11.613 14.638  1.00 0.00 ? 263 LEU A O    1  
ATOM   4221   C  CB   . LEU A 1 263 ? 1.663   -11.237 11.930  1.00 0.00 ? 263 LEU A CB   1  
ATOM   4222   C  CG   . LEU A 1 263 ? 0.735   -12.149 11.119  1.00 0.00 ? 263 LEU A CG   1  
ATOM   4223   C  CD1  . LEU A 1 263 ? 0.934   -11.866 9.628   1.00 0.00 ? 263 LEU A CD1  1  
ATOM   4224   C  CD2  . LEU A 1 263 ? 1.075   -13.616 11.400  1.00 0.00 ? 263 LEU A CD2  1  
ATOM   4225   H  H    . LEU A 1 263 ? -0.307  -10.262 13.264  1.00 0.00 ? 263 LEU A H    1  
ATOM   4226   H  HA   . LEU A 1 263 ? 1.392   -12.520 13.638  1.00 0.00 ? 263 LEU A HA   1  
ATOM   4227   H  HB2  . LEU A 1 263 ? 1.440   -10.206 11.695  1.00 0.00 ? 263 LEU A HB2  1  
ATOM   4228   H  HB3  . LEU A 1 263 ? 2.689   -11.448 11.666  1.00 0.00 ? 263 LEU A HB3  1  
ATOM   4229   H  HG   . LEU A 1 263 ? -0.294  -11.954 11.389  1.00 0.00 ? 263 LEU A HG   1  
ATOM   4230   H  HD11 . LEU A 1 263 ? 0.037   -12.127 9.089   1.00 0.00 ? 263 LEU A HD11 1  
ATOM   4231   H  HD12 . LEU A 1 263 ? 1.761   -12.454 9.258   1.00 0.00 ? 263 LEU A HD12 1  
ATOM   4232   H  HD13 . LEU A 1 263 ? 1.148   -10.817 9.487   1.00 0.00 ? 263 LEU A HD13 1  
ATOM   4233   H  HD21 . LEU A 1 263 ? 1.005   -14.184 10.483  1.00 0.00 ? 263 LEU A HD21 1  
ATOM   4234   H  HD22 . LEU A 1 263 ? 0.378   -14.015 12.122  1.00 0.00 ? 263 LEU A HD22 1  
ATOM   4235   H  HD23 . LEU A 1 263 ? 2.078   -13.686 11.792  1.00 0.00 ? 263 LEU A HD23 1  
ATOM   4236   N  N    . ALA A 1 264 ? 2.767   -9.590  14.265  1.00 0.00 ? 264 ALA A N    1  
ATOM   4237   C  CA   . ALA A 1 264 ? 3.931   -8.959  14.948  1.00 0.00 ? 264 ALA A CA   1  
ATOM   4238   C  C    . ALA A 1 264 ? 3.834   -9.148  16.465  1.00 0.00 ? 264 ALA A C    1  
ATOM   4239   O  O    . ALA A 1 264 ? 4.836   -9.191  17.151  1.00 0.00 ? 264 ALA A O    1  
ATOM   4240   C  CB   . ALA A 1 264 ? 3.958   -7.464  14.623  1.00 0.00 ? 264 ALA A CB   1  
ATOM   4241   H  H    . ALA A 1 264 ? 2.071   -9.028  13.866  1.00 0.00 ? 264 ALA A H    1  
ATOM   4242   H  HA   . ALA A 1 264 ? 4.844   -9.418  14.590  1.00 0.00 ? 264 ALA A HA   1  
ATOM   4243   H  HB1  . ALA A 1 264 ? 3.002   -7.026  14.868  1.00 0.00 ? 264 ALA A HB1  1  
ATOM   4244   H  HB2  . ALA A 1 264 ? 4.159   -7.327  13.571  1.00 0.00 ? 264 ALA A HB2  1  
ATOM   4245   H  HB3  . ALA A 1 264 ? 4.733   -6.983  15.202  1.00 0.00 ? 264 ALA A HB3  1  
ATOM   4246   N  N    . LYS A 1 265 ? 2.649   -9.276  17.005  1.00 0.00 ? 265 LYS A N    1  
ATOM   4247   C  CA   . LYS A 1 265 ? 2.537   -9.477  18.475  1.00 0.00 ? 265 LYS A CA   1  
ATOM   4248   C  C    . LYS A 1 265 ? 2.636   -10.971 18.783  1.00 0.00 ? 265 LYS A C    1  
ATOM   4249   O  O    . LYS A 1 265 ? 3.049   -11.368 19.854  1.00 0.00 ? 265 LYS A O    1  
ATOM   4250   C  CB   . LYS A 1 265 ? 1.194   -8.937  18.979  1.00 0.00 ? 265 LYS A CB   1  
ATOM   4251   C  CG   . LYS A 1 265 ? 1.178   -7.408  18.875  1.00 0.00 ? 265 LYS A CG   1  
ATOM   4252   C  CD   . LYS A 1 265 ? 0.309   -6.831  19.995  1.00 0.00 ? 265 LYS A CD   1  
ATOM   4253   C  CE   . LYS A 1 265 ? -1.086  -7.455  19.934  1.00 0.00 ? 265 LYS A CE   1  
ATOM   4254   N  NZ   . LYS A 1 265 ? -1.133  -8.653  20.818  1.00 0.00 ? 265 LYS A NZ   1  
ATOM   4255   H  H    . LYS A 1 265 ? 1.841   -9.259  16.452  1.00 0.00 ? 265 LYS A H    1  
ATOM   4256   H  HA   . LYS A 1 265 ? 3.344   -8.959  18.971  1.00 0.00 ? 265 LYS A HA   1  
ATOM   4257   H  HB2  . LYS A 1 265 ? 0.396   -9.348  18.378  1.00 0.00 ? 265 LYS A HB2  1  
ATOM   4258   H  HB3  . LYS A 1 265 ? 1.054   -9.227  20.009  1.00 0.00 ? 265 LYS A HB3  1  
ATOM   4259   H  HG2  . LYS A 1 265 ? 2.183   -7.030  18.959  1.00 0.00 ? 265 LYS A HG2  1  
ATOM   4260   H  HG3  . LYS A 1 265 ? 0.767   -7.116  17.925  1.00 0.00 ? 265 LYS A HG3  1  
ATOM   4261   H  HD2  . LYS A 1 265 ? 0.761   -7.051  20.951  1.00 0.00 ? 265 LYS A HD2  1  
ATOM   4262   H  HD3  . LYS A 1 265 ? 0.228   -5.761  19.873  1.00 0.00 ? 265 LYS A HD3  1  
ATOM   4263   H  HE2  . LYS A 1 265 ? -1.817  -6.733  20.266  1.00 0.00 ? 265 LYS A HE2  1  
ATOM   4264   H  HE3  . LYS A 1 265 ? -1.305  -7.748  18.917  1.00 0.00 ? 265 LYS A HE3  1  
ATOM   4265   H  HZ1  . LYS A 1 265 ? -0.945  -9.506  20.256  1.00 0.00 ? 265 LYS A HZ1  1  
ATOM   4266   H  HZ2  . LYS A 1 265 ? -2.075  -8.725  21.254  1.00 0.00 ? 265 LYS A HZ2  1  
ATOM   4267   H  HZ3  . LYS A 1 265 ? -0.411  -8.564  21.562  1.00 0.00 ? 265 LYS A HZ3  1  
ATOM   4268   N  N    . LYS A 1 266 ? 2.267   -11.805 17.850  1.00 0.00 ? 266 LYS A N    1  
ATOM   4269   C  CA   . LYS A 1 266 ? 2.350   -13.270 18.090  1.00 0.00 ? 266 LYS A CA   1  
ATOM   4270   C  C    . LYS A 1 266 ? 3.812   -13.710 18.030  1.00 0.00 ? 266 LYS A C    1  
ATOM   4271   O  O    . LYS A 1 266 ? 4.283   -14.449 18.872  1.00 0.00 ? 266 LYS A O    1  
ATOM   4272   C  CB   . LYS A 1 266 ? 1.551   -14.009 17.013  1.00 0.00 ? 266 LYS A CB   1  
ATOM   4273   C  CG   . LYS A 1 266 ? 0.074   -14.076 17.414  1.00 0.00 ? 266 LYS A CG   1  
ATOM   4274   C  CD   . LYS A 1 266 ? -0.664  -15.044 16.487  1.00 0.00 ? 266 LYS A CD   1  
ATOM   4275   C  CE   . LYS A 1 266 ? -1.170  -16.238 17.297  1.00 0.00 ? 266 LYS A CE   1  
ATOM   4276   N  NZ   . LYS A 1 266 ? -1.792  -17.234 16.380  1.00 0.00 ? 266 LYS A NZ   1  
ATOM   4277   H  H    . LYS A 1 266 ? 1.941   -11.468 16.989  1.00 0.00 ? 266 LYS A H    1  
ATOM   4278   H  HA   . LYS A 1 266 ? 1.946   -13.499 19.064  1.00 0.00 ? 266 LYS A HA   1  
ATOM   4279   H  HB2  . LYS A 1 266 ? 1.647   -13.484 16.073  1.00 0.00 ? 266 LYS A HB2  1  
ATOM   4280   H  HB3  . LYS A 1 266 ? 1.939   -15.008 16.904  1.00 0.00 ? 266 LYS A HB3  1  
ATOM   4281   H  HG2  . LYS A 1 266 ? -0.009  -14.423 18.432  1.00 0.00 ? 266 LYS A HG2  1  
ATOM   4282   H  HG3  . LYS A 1 266 ? -0.367  -13.095 17.330  1.00 0.00 ? 266 LYS A HG3  1  
ATOM   4283   H  HD2  . LYS A 1 266 ? -1.501  -14.537 16.029  1.00 0.00 ? 266 LYS A HD2  1  
ATOM   4284   H  HD3  . LYS A 1 266 ? 0.010   -15.392 15.719  1.00 0.00 ? 266 LYS A HD3  1  
ATOM   4285   H  HE2  . LYS A 1 266 ? -0.343  -16.697 17.819  1.00 0.00 ? 266 LYS A HE2  1  
ATOM   4286   H  HE3  . LYS A 1 266 ? -1.905  -15.901 18.014  1.00 0.00 ? 266 LYS A HE3  1  
ATOM   4287   H  HZ1  . LYS A 1 266 ? -1.125  -17.467 15.617  1.00 0.00 ? 266 LYS A HZ1  1  
ATOM   4288   H  HZ2  . LYS A 1 266 ? -2.660  -16.833 15.972  1.00 0.00 ? 266 LYS A HZ2  1  
ATOM   4289   H  HZ3  . LYS A 1 266 ? -2.024  -18.098 16.911  1.00 0.00 ? 266 LYS A HZ3  1  
ATOM   4290   N  N    . GLN A 1 267 ? 4.534   -13.265 17.040  1.00 0.00 ? 267 GLN A N    1  
ATOM   4291   C  CA   . GLN A 1 267 ? 5.966   -13.659 16.928  1.00 0.00 ? 267 GLN A CA   1  
ATOM   4292   C  C    . GLN A 1 267 ? 6.803   -12.836 17.908  1.00 0.00 ? 267 GLN A C    1  
ATOM   4293   O  O    . GLN A 1 267 ? 8.015   -12.810 17.834  1.00 0.00 ? 267 GLN A O    1  
ATOM   4294   C  CB   . GLN A 1 267 ? 6.455   -13.404 15.502  1.00 0.00 ? 267 GLN A CB   1  
ATOM   4295   C  CG   . GLN A 1 267 ? 6.554   -14.732 14.750  1.00 0.00 ? 267 GLN A CG   1  
ATOM   4296   C  CD   . GLN A 1 267 ? 5.161   -15.353 14.621  1.00 0.00 ? 267 GLN A CD   1  
ATOM   4297   O  OE1  . GLN A 1 267 ? 4.245   -14.722 14.131  1.00 0.00 ? 267 GLN A OE1  1  
ATOM   4298   N  NE2  . GLN A 1 267 ? 4.963   -16.571 15.043  1.00 0.00 ? 267 GLN A NE2  1  
ATOM   4299   H  H    . GLN A 1 267 ? 4.136   -12.671 16.370  1.00 0.00 ? 267 GLN A H    1  
ATOM   4300   H  HA   . GLN A 1 267 ? 6.069   -14.709 17.161  1.00 0.00 ? 267 GLN A HA   1  
ATOM   4301   H  HB2  . GLN A 1 267 ? 5.758   -12.753 14.995  1.00 0.00 ? 267 GLN A HB2  1  
ATOM   4302   H  HB3  . GLN A 1 267 ? 7.428   -12.937 15.533  1.00 0.00 ? 267 GLN A HB3  1  
ATOM   4303   H  HG2  . GLN A 1 267 ? 6.965   -14.559 13.766  1.00 0.00 ? 267 GLN A HG2  1  
ATOM   4304   H  HG3  . GLN A 1 267 ? 7.196   -15.407 15.294  1.00 0.00 ? 267 GLN A HG3  1  
ATOM   4305   H  HE21 . GLN A 1 267 ? 5.701   -17.079 15.439  1.00 0.00 ? 267 GLN A HE21 1  
ATOM   4306   H  HE22 . GLN A 1 267 ? 4.074   -16.978 14.965  1.00 0.00 ? 267 GLN A HE22 1  
ATOM   4307   N  N    . LYS A 1 268 ? 6.167   -12.159 18.824  1.00 0.00 ? 268 LYS A N    1  
ATOM   4308   C  CA   . LYS A 1 268 ? 6.928   -11.335 19.804  1.00 0.00 ? 268 LYS A CA   1  
ATOM   4309   C  C    . LYS A 1 268 ? 7.866   -12.234 20.611  1.00 0.00 ? 268 LYS A C    1  
ATOM   4310   O  O    . LYS A 1 268 ? 8.943   -11.831 21.001  1.00 0.00 ? 268 LYS A O    1  
ATOM   4311   C  CB   . LYS A 1 268 ? 5.949   -10.638 20.751  1.00 0.00 ? 268 LYS A CB   1  
ATOM   4312   C  CG   . LYS A 1 268 ? 6.691   -9.572  21.560  1.00 0.00 ? 268 LYS A CG   1  
ATOM   4313   C  CD   . LYS A 1 268 ? 6.280   -9.672  23.030  1.00 0.00 ? 268 LYS A CD   1  
ATOM   4314   C  CE   . LYS A 1 268 ? 7.019   -8.605  23.841  1.00 0.00 ? 268 LYS A CE   1  
ATOM   4315   N  NZ   . LYS A 1 268 ? 6.155   -8.151  24.966  1.00 0.00 ? 268 LYS A NZ   1  
ATOM   4316   H  H    . LYS A 1 268 ? 5.188   -12.191 18.864  1.00 0.00 ? 268 LYS A H    1  
ATOM   4317   H  HA   . LYS A 1 268 ? 7.507   -10.593 19.276  1.00 0.00 ? 268 LYS A HA   1  
ATOM   4318   H  HB2  . LYS A 1 268 ? 5.162   -10.172 20.176  1.00 0.00 ? 268 LYS A HB2  1  
ATOM   4319   H  HB3  . LYS A 1 268 ? 5.521   -11.365 21.425  1.00 0.00 ? 268 LYS A HB3  1  
ATOM   4320   H  HG2  . LYS A 1 268 ? 7.756   -9.729  21.470  1.00 0.00 ? 268 LYS A HG2  1  
ATOM   4321   H  HG3  . LYS A 1 268 ? 6.437   -8.593  21.183  1.00 0.00 ? 268 LYS A HG3  1  
ATOM   4322   H  HD2  . LYS A 1 268 ? 5.215   -9.516  23.116  1.00 0.00 ? 268 LYS A HD2  1  
ATOM   4323   H  HD3  . LYS A 1 268 ? 6.534   -10.649 23.410  1.00 0.00 ? 268 LYS A HD3  1  
ATOM   4324   H  HE2  . LYS A 1 268 ? 7.935   -9.022  24.235  1.00 0.00 ? 268 LYS A HE2  1  
ATOM   4325   H  HE3  . LYS A 1 268 ? 7.252   -7.766  23.203  1.00 0.00 ? 268 LYS A HE3  1  
ATOM   4326   H  HZ1  . LYS A 1 268 ? 6.635   -8.336  25.869  1.00 0.00 ? 268 LYS A HZ1  1  
ATOM   4327   H  HZ2  . LYS A 1 268 ? 5.252   -8.666  24.940  1.00 0.00 ? 268 LYS A HZ2  1  
ATOM   4328   H  HZ3  . LYS A 1 268 ? 5.975   -7.130  24.875  1.00 0.00 ? 268 LYS A HZ3  1  
ATOM   4329   N  N    . LEU A 1 269 ? 7.467   -13.451 20.869  1.00 0.00 ? 269 LEU A N    1  
ATOM   4330   C  CA   . LEU A 1 269 ? 8.339   -14.370 21.654  1.00 0.00 ? 269 LEU A CA   1  
ATOM   4331   C  C    . LEU A 1 269 ? 9.637   -14.624 20.885  1.00 0.00 ? 269 LEU A C    1  
ATOM   4332   O  O    . LEU A 1 269 ? 10.677  -14.860 21.468  1.00 0.00 ? 269 LEU A O    1  
ATOM   4333   C  CB   . LEU A 1 269 ? 7.609   -15.696 21.872  1.00 0.00 ? 269 LEU A CB   1  
ATOM   4334   C  CG   . LEU A 1 269 ? 6.221   -15.424 22.453  1.00 0.00 ? 269 LEU A CG   1  
ATOM   4335   C  CD1  . LEU A 1 269 ? 5.436   -16.735 22.536  1.00 0.00 ? 269 LEU A CD1  1  
ATOM   4336   C  CD2  . LEU A 1 269 ? 6.359   -14.823 23.854  1.00 0.00 ? 269 LEU A CD2  1  
ATOM   4337   H  H    . LEU A 1 269 ? 6.594   -13.762 20.550  1.00 0.00 ? 269 LEU A H    1  
ATOM   4338   H  HA   . LEU A 1 269 ? 8.567   -13.922 22.609  1.00 0.00 ? 269 LEU A HA   1  
ATOM   4339   H  HB2  . LEU A 1 269 ? 7.509   -16.207 20.925  1.00 0.00 ? 269 LEU A HB2  1  
ATOM   4340   H  HB3  . LEU A 1 269 ? 8.173   -16.310 22.556  1.00 0.00 ? 269 LEU A HB3  1  
ATOM   4341   H  HG   . LEU A 1 269 ? 5.693   -14.732 21.813  1.00 0.00 ? 269 LEU A HG   1  
ATOM   4342   H  HD11 . LEU A 1 269 ? 5.157   -16.924 23.562  1.00 0.00 ? 269 LEU A HD11 1  
ATOM   4343   H  HD12 . LEU A 1 269 ? 6.051   -17.547 22.176  1.00 0.00 ? 269 LEU A HD12 1  
ATOM   4344   H  HD13 . LEU A 1 269 ? 4.546   -16.661 21.930  1.00 0.00 ? 269 LEU A HD13 1  
ATOM   4345   H  HD21 . LEU A 1 269 ? 5.639   -15.282 24.516  1.00 0.00 ? 269 LEU A HD21 1  
ATOM   4346   H  HD22 . LEU A 1 269 ? 6.177   -13.759 23.808  1.00 0.00 ? 269 LEU A HD22 1  
ATOM   4347   H  HD23 . LEU A 1 269 ? 7.356   -15.001 24.228  1.00 0.00 ? 269 LEU A HD23 1  
ATOM   4348   N  N    . THR A 1 270 ? 9.583   -14.582 19.581  1.00 0.00 ? 270 THR A N    1  
ATOM   4349   C  CA   . THR A 1 270 ? 10.811  -14.824 18.770  1.00 0.00 ? 270 THR A CA   1  
ATOM   4350   C  C    . THR A 1 270 ? 10.954  -13.720 17.722  1.00 0.00 ? 270 THR A C    1  
ATOM   4351   O  O    . THR A 1 270 ? 10.060  -13.476 16.937  1.00 0.00 ? 270 THR A O    1  
ATOM   4352   C  CB   . THR A 1 270 ? 10.698  -16.180 18.071  1.00 0.00 ? 270 THR A CB   1  
ATOM   4353   O  OG1  . THR A 1 270 ? 9.663   -16.940 18.678  1.00 0.00 ? 270 THR A OG1  1  
ATOM   4354   C  CG2  . THR A 1 270 ? 12.025  -16.932 18.192  1.00 0.00 ? 270 THR A CG2  1  
ATOM   4355   H  H    . THR A 1 270 ? 8.733   -14.392 19.133  1.00 0.00 ? 270 THR A H    1  
ATOM   4356   H  HA   . THR A 1 270 ? 11.678  -14.822 19.415  1.00 0.00 ? 270 THR A HA   1  
ATOM   4357   H  HB   . THR A 1 270 ? 10.470  -16.029 17.026  1.00 0.00 ? 270 THR A HB   1  
ATOM   4358   H  HG1  . THR A 1 270 ? 8.821   -16.581 18.388  1.00 0.00 ? 270 THR A HG1  1  
ATOM   4359   H  HG21 . THR A 1 270 ? 11.959  -17.866 17.654  1.00 0.00 ? 270 THR A HG21 1  
ATOM   4360   H  HG22 . THR A 1 270 ? 12.231  -17.131 19.233  1.00 0.00 ? 270 THR A HG22 1  
ATOM   4361   H  HG23 . THR A 1 270 ? 12.819  -16.331 17.775  1.00 0.00 ? 270 THR A HG23 1  
HETATM 4362   ZN ZN   . ZN  B 2 .   ? -5.354  2.566   -2.367  1.00 0.00 ? 319 ZN  A ZN   1  
HETATM 4363   C  C3G  . TUX C 3 .   ? -10.724 3.165   -2.782  1.00 0.00 ? 320 TUX A C3G  1  
HETATM 4364   C  C4G  . TUX C 3 .   ? -11.171 1.833   -3.356  1.00 0.00 ? 320 TUX A C4G  1  
HETATM 4365   C  C5G  . TUX C 3 .   ? -10.963 0.705   -2.352  1.00 0.00 ? 320 TUX A C5G  1  
HETATM 4366   C  C2G  . TUX C 3 .   ? -9.298  3.066   -2.275  1.00 0.00 ? 320 TUX A C2G  1  
HETATM 4367   C  C1G  . TUX C 3 .   ? -9.152  1.905   -1.297  1.00 0.00 ? 320 TUX A C1G  1  
HETATM 4368   O  O5G  . TUX C 3 .   ? -9.597  0.665   -1.888  1.00 0.00 ? 320 TUX A O5G  1  
HETATM 4369   O  O3G  . TUX C 3 .   ? -10.829 4.197   -3.782  1.00 0.00 ? 320 TUX A O3G  1  
HETATM 4370   O  O1A  . TUX C 3 .   ? -12.772 4.912   -2.768  1.00 0.00 ? 320 TUX A O1A  1  
HETATM 4371   C  C1A  . TUX C 3 .   ? -11.801 5.203   -3.439  1.00 0.00 ? 320 TUX A C1A  1  
HETATM 4372   C  C2A  . TUX C 3 .   ? -11.623 6.629   -3.936  1.00 0.00 ? 320 TUX A C2A  1  
HETATM 4373   C  C3A  . TUX C 3 .   ? -10.937 7.464   -2.860  1.00 0.00 ? 320 TUX A C3A  1  
HETATM 4374   C  C4A  . TUX C 3 .   ? -11.671 8.785   -2.650  1.00 0.00 ? 320 TUX A C4A  1  
HETATM 4375   C  C5A  . TUX C 3 .   ? -11.500 9.700   -3.861  1.00 0.00 ? 320 TUX A C5A  1  
HETATM 4376   C  C6A  . TUX C 3 .   ? -12.674 10.674  -3.981  1.00 0.00 ? 320 TUX A C6A  1  
HETATM 4377   C  C7A  . TUX C 3 .   ? -13.528 10.361  -5.208  1.00 0.00 ? 320 TUX A C7A  1  
HETATM 4378   C  C8A  . TUX C 3 .   ? -13.092 11.210  -6.400  1.00 0.00 ? 320 TUX A C8A  1  
HETATM 4379   C  C9A  . TUX C 3 .   ? -14.060 11.024  -7.566  1.00 0.00 ? 320 TUX A C9A  1  
HETATM 4380   C  CAA  . TUX C 3 .   ? -13.739 11.995  -8.701  1.00 0.00 ? 320 TUX A CAA  1  
HETATM 4381   C  CBA  . TUX C 3 .   ? -15.021 12.601  -9.271  1.00 0.00 ? 320 TUX A CBA  1  
HETATM 4382   C  CCA  . TUX C 3 .   ? -16.042 11.508  -9.578  1.00 0.00 ? 320 TUX A CCA  1  
HETATM 4383   C  CDA  . TUX C 3 .   ? -16.779 11.806  -10.882 1.00 0.00 ? 320 TUX A CDA  1  
HETATM 4384   C  CEA  . TUX C 3 .   ? -17.795 10.707  -11.185 1.00 0.00 ? 320 TUX A CEA  1  
HETATM 4385   C  CZH  . TUX C 3 .   ? -8.878  4.381   -1.624  1.00 0.00 ? 320 TUX A CZH  1  
HETATM 4386   C  CYH  . TUX C 3 .   ? -7.363  4.507   -1.662  1.00 0.00 ? 320 TUX A CYH  1  
HETATM 4387   O  OYH  . TUX C 3 .   ? -6.795  4.734   -2.713  1.00 0.00 ? 320 TUX A OYH  1  
HETATM 4388   N  NXH  . TUX C 3 .   ? -6.704  4.367   -0.546  1.00 0.00 ? 320 TUX A NXH  1  
HETATM 4389   O  OXH  . TUX C 3 .   ? -5.273  4.506   -0.534  1.00 0.00 ? 320 TUX A OXH  1  
HETATM 4390   O  O4G  . TUX C 3 .   ? -12.544 1.906   -3.715  1.00 0.00 ? 320 TUX A O4G  1  
HETATM 4391   C  C6G  . TUX C 3 .   ? -11.268 -0.649  -2.960  1.00 0.00 ? 320 TUX A C6G  1  
HETATM 4392   O  O6G  . TUX C 3 .   ? -10.126 -1.187  -3.611  1.00 0.00 ? 320 TUX A O6G  1  
HETATM 4393   H  H3G  . TUX C 3 .   ? -11.380 3.401   -1.938  1.00 0.00 ? 320 TUX A H3G  1  
HETATM 4394   H  H4G  . TUX C 3 .   ? -10.574 1.623   -4.254  1.00 0.00 ? 320 TUX A H4G  1  
HETATM 4395   H  H5G  . TUX C 3 .   ? -11.639 0.879   -1.501  1.00 0.00 ? 320 TUX A H5G  1  
HETATM 4396   H  H2G  . TUX C 3 .   ? -8.606  2.866   -3.087  1.00 0.00 ? 320 TUX A H2G  1  
HETATM 4397   H  H1G1 . TUX C 3 .   ? -9.753  2.109   -0.400  1.00 0.00 ? 320 TUX A H1G1 1  
HETATM 4398   H  H1G2 . TUX C 3 .   ? -8.100  1.792   -1.002  1.00 0.00 ? 320 TUX A H1G2 1  
HETATM 4399   H  H2A2 . TUX C 3 .   ? -11.001 6.634   -4.843  1.00 0.00 ? 320 TUX A H2A2 1  
HETATM 4400   H  H2A3 . TUX C 3 .   ? -12.600 7.067   -4.180  1.00 0.00 ? 320 TUX A H2A3 1  
HETATM 4401   H  H3A3 . TUX C 3 .   ? -10.924 6.902   -1.916  1.00 0.00 ? 320 TUX A H3A3 1  
HETATM 4402   H  H3A2 . TUX C 3 .   ? -9.906  7.666   -3.166  1.00 0.00 ? 320 TUX A H3A2 1  
HETATM 4403   H  H4A2 . TUX C 3 .   ? -11.234 9.279   -1.770  1.00 0.00 ? 320 TUX A H4A2 1  
HETATM 4404   H  H4A3 . TUX C 3 .   ? -12.727 8.569   -2.460  1.00 0.00 ? 320 TUX A H4A3 1  
HETATM 4405   H  H5A3 . TUX C 3 .   ? -11.354 9.101   -4.772  1.00 0.00 ? 320 TUX A H5A3 1  
HETATM 4406   H  H5A2 . TUX C 3 .   ? -10.581 10.284  -3.710  1.00 0.00 ? 320 TUX A H5A2 1  
HETATM 4407   H  H6A2 . TUX C 3 .   ? -13.326 10.647  -3.096  1.00 0.00 ? 320 TUX A H6A2 1  
HETATM 4408   H  H6A3 . TUX C 3 .   ? -12.281 11.696  -4.056  1.00 0.00 ? 320 TUX A H6A3 1  
HETATM 4409   H  H7A3 . TUX C 3 .   ? -14.574 10.603  -4.972  1.00 0.00 ? 320 TUX A H7A3 1  
HETATM 4410   H  H7A2 . TUX C 3 .   ? -13.497 9.294   -5.462  1.00 0.00 ? 320 TUX A H7A2 1  
HETATM 4411   H  H8A2 . TUX C 3 .   ? -13.082 12.271  -6.112  1.00 0.00 ? 320 TUX A H8A2 1  
HETATM 4412   H  H8A3 . TUX C 3 .   ? -12.079 10.913  -6.709  1.00 0.00 ? 320 TUX A H8A3 1  
HETATM 4413   H  H9A3 . TUX C 3 .   ? -15.086 11.197  -7.212  1.00 0.00 ? 320 TUX A H9A3 1  
HETATM 4414   H  H9A2 . TUX C 3 .   ? -13.962 9.996   -7.940  1.00 0.00 ? 320 TUX A H9A2 1  
HETATM 4415   H  HAA2 . TUX C 3 .   ? -13.084 12.798  -8.335  1.00 0.00 ? 320 TUX A HAA2 1  
HETATM 4416   H  HAA3 . TUX C 3 .   ? -13.213 11.450  -9.497  1.00 0.00 ? 320 TUX A HAA3 1  
HETATM 4417   H  HBA3 . TUX C 3 .   ? -14.778 13.152  -10.191 1.00 0.00 ? 320 TUX A HBA3 1  
HETATM 4418   H  HBA2 . TUX C 3 .   ? -15.441 13.305  -8.541  1.00 0.00 ? 320 TUX A HBA2 1  
HETATM 4419   H  HCA2 . TUX C 3 .   ? -15.519 10.548  -9.682  1.00 0.00 ? 320 TUX A HCA2 1  
HETATM 4420   H  HCA3 . TUX C 3 .   ? -16.768 11.444  -8.755  1.00 0.00 ? 320 TUX A HCA3 1  
HETATM 4421   H  HDA3 . TUX C 3 .   ? -17.302 12.768  -10.800 1.00 0.00 ? 320 TUX A HDA3 1  
HETATM 4422   H  HDA2 . TUX C 3 .   ? -16.055 11.870  -11.706 1.00 0.00 ? 320 TUX A HDA2 1  
HETATM 4423   H  HEA1 . TUX C 3 .   ? -17.286 9.806   -11.556 1.00 0.00 ? 320 TUX A HEA1 1  
HETATM 4424   H  HEA2 . TUX C 3 .   ? -18.504 11.051  -11.951 1.00 0.00 ? 320 TUX A HEA2 1  
HETATM 4425   H  HEA3 . TUX C 3 .   ? -18.352 10.450  -10.275 1.00 0.00 ? 320 TUX A HEA3 1  
HETATM 4426   H  HZH2 . TUX C 3 .   ? -9.230  4.433   -0.595  1.00 0.00 ? 320 TUX A HZH2 1  
HETATM 4427   H  HZH3 . TUX C 3 .   ? -9.333  5.209   -2.183  1.00 0.00 ? 320 TUX A HZH3 1  
HETATM 4428   H  HNH1 . TUX C 3 .   ? -7.183  4.143   0.280   1.00 0.00 ? 320 TUX A HNH1 1  
HETATM 4429   H  HOH1 . TUX C 3 .   ? -4.829  4.824   0.255   1.00 0.00 ? 320 TUX A HOH1 1  
HETATM 4430   H  HOG4 . TUX C 3 .   ? -12.810 2.828   -3.749  1.00 0.00 ? 320 TUX A HOG4 1  
HETATM 4431   H  H6G2 . TUX C 3 .   ? -12.079 -0.524  -3.693  1.00 0.00 ? 320 TUX A H6G2 1  
HETATM 4432   H  H6G3 . TUX C 3 .   ? -11.620 -1.340  -2.189  1.00 0.00 ? 320 TUX A H6G3 1  
HETATM 4433   H  HOG6 . TUX C 3 .   ? -9.876  -0.613  -4.339  1.00 0.00 ? 320 TUX A HOG6 1  
ATOM   4434   N  N    . LEU A 1 3   ? 21.328  -8.607  0.063   1.00 0.00 ? 3   LEU A N    2  
ATOM   4435   C  CA   . LEU A 1 3   ? 21.922  -7.750  1.127   1.00 0.00 ? 3   LEU A CA   2  
ATOM   4436   C  C    . LEU A 1 3   ? 21.057  -6.501  1.317   1.00 0.00 ? 3   LEU A C    2  
ATOM   4437   O  O    . LEU A 1 3   ? 20.196  -6.206  0.513   1.00 0.00 ? 3   LEU A O    2  
ATOM   4438   C  CB   . LEU A 1 3   ? 23.336  -7.336  0.715   1.00 0.00 ? 3   LEU A CB   2  
ATOM   4439   C  CG   . LEU A 1 3   ? 24.205  -8.584  0.551   1.00 0.00 ? 3   LEU A CG   2  
ATOM   4440   C  CD1  . LEU A 1 3   ? 25.317  -8.303  -0.463  1.00 0.00 ? 3   LEU A CD1  2  
ATOM   4441   C  CD2  . LEU A 1 3   ? 24.828  -8.949  1.900   1.00 0.00 ? 3   LEU A CD2  2  
ATOM   4442   H  H    . LEU A 1 3   ? 21.841  -9.356  -0.306  1.00 0.00 ? 3   LEU A H    2  
ATOM   4443   H  HA   . LEU A 1 3   ? 21.964  -8.304  2.050   1.00 0.00 ? 3   LEU A HA   2  
ATOM   4444   H  HB2  . LEU A 1 3   ? 23.293  -6.799  -0.223  1.00 0.00 ? 3   LEU A HB2  2  
ATOM   4445   H  HB3  . LEU A 1 3   ? 23.762  -6.700  1.475   1.00 0.00 ? 3   LEU A HB3  2  
ATOM   4446   H  HG   . LEU A 1 3   ? 23.596  -9.403  0.199   1.00 0.00 ? 3   LEU A HG   2  
ATOM   4447   H  HD11 . LEU A 1 3   ? 25.809  -7.376  -0.210  1.00 0.00 ? 3   LEU A HD11 2  
ATOM   4448   H  HD12 . LEU A 1 3   ? 24.889  -8.226  -1.453  1.00 0.00 ? 3   LEU A HD12 2  
ATOM   4449   H  HD13 . LEU A 1 3   ? 26.034  -9.109  -0.443  1.00 0.00 ? 3   LEU A HD13 2  
ATOM   4450   H  HD21 . LEU A 1 3   ? 25.738  -8.387  2.041   1.00 0.00 ? 3   LEU A HD21 2  
ATOM   4451   H  HD22 . LEU A 1 3   ? 25.052  -10.007 1.917   1.00 0.00 ? 3   LEU A HD22 2  
ATOM   4452   H  HD23 . LEU A 1 3   ? 24.132  -8.716  2.692   1.00 0.00 ? 3   LEU A HD23 2  
ATOM   4453   N  N    . GLU A 1 4   ? 21.275  -5.765  2.375   1.00 0.00 ? 4   GLU A N    2  
ATOM   4454   C  CA   . GLU A 1 4   ? 20.458  -4.540  2.602   1.00 0.00 ? 4   GLU A CA   2  
ATOM   4455   C  C    . GLU A 1 4   ? 20.385  -3.730  1.309   1.00 0.00 ? 4   GLU A C    2  
ATOM   4456   O  O    . GLU A 1 4   ? 21.330  -3.667  0.551   1.00 0.00 ? 4   GLU A O    2  
ATOM   4457   C  CB   . GLU A 1 4   ? 21.084  -3.695  3.716   1.00 0.00 ? 4   GLU A CB   2  
ATOM   4458   C  CG   . GLU A 1 4   ? 20.490  -4.103  5.068   1.00 0.00 ? 4   GLU A CG   2  
ATOM   4459   C  CD   . GLU A 1 4   ? 20.945  -3.119  6.144   1.00 0.00 ? 4   GLU A CD   2  
ATOM   4460   O  OE1  . GLU A 1 4   ? 22.131  -3.084  6.426   1.00 0.00 ? 4   GLU A OE1  2  
ATOM   4461   O  OE2  . GLU A 1 4   ? 20.097  -2.416  6.668   1.00 0.00 ? 4   GLU A OE2  2  
ATOM   4462   H  H    . GLU A 1 4   ? 21.974  -6.017  3.014   1.00 0.00 ? 4   GLU A H    2  
ATOM   4463   H  HA   . GLU A 1 4   ? 19.462  -4.827  2.888   1.00 0.00 ? 4   GLU A HA   2  
ATOM   4464   H  HB2  . GLU A 1 4   ? 22.153  -3.856  3.732   1.00 0.00 ? 4   GLU A HB2  2  
ATOM   4465   H  HB3  . GLU A 1 4   ? 20.880  -2.650  3.535   1.00 0.00 ? 4   GLU A HB3  2  
ATOM   4466   H  HG2  . GLU A 1 4   ? 19.411  -4.091  5.008   1.00 0.00 ? 4   GLU A HG2  2  
ATOM   4467   H  HG3  . GLU A 1 4   ? 20.825  -5.095  5.325   1.00 0.00 ? 4   GLU A HG3  2  
ATOM   4468   N  N    . LYS A 1 5   ? 19.253  -3.142  1.039   1.00 0.00 ? 5   LYS A N    2  
ATOM   4469   C  CA   . LYS A 1 5   ? 19.093  -2.363  -0.222  1.00 0.00 ? 5   LYS A CA   2  
ATOM   4470   C  C    . LYS A 1 5   ? 18.712  -0.911  0.099   1.00 0.00 ? 5   LYS A C    2  
ATOM   4471   O  O    . LYS A 1 5   ? 17.848  -0.647  0.911   1.00 0.00 ? 5   LYS A O    2  
ATOM   4472   C  CB   . LYS A 1 5   ? 17.991  -3.025  -1.052  1.00 0.00 ? 5   LYS A CB   2  
ATOM   4473   C  CG   . LYS A 1 5   ? 18.042  -2.528  -2.497  1.00 0.00 ? 5   LYS A CG   2  
ATOM   4474   C  CD   . LYS A 1 5   ? 17.249  -3.488  -3.387  1.00 0.00 ? 5   LYS A CD   2  
ATOM   4475   C  CE   . LYS A 1 5   ? 18.216  -4.318  -4.234  1.00 0.00 ? 5   LYS A CE   2  
ATOM   4476   N  NZ   . LYS A 1 5   ? 19.059  -5.161  -3.339  1.00 0.00 ? 5   LYS A NZ   2  
ATOM   4477   H  H    . LYS A 1 5   ? 18.495  -3.241  1.653   1.00 0.00 ? 5   LYS A H    2  
ATOM   4478   H  HA   . LYS A 1 5   ? 20.018  -2.376  -0.776  1.00 0.00 ? 5   LYS A HA   2  
ATOM   4479   H  HB2  . LYS A 1 5   ? 18.131  -4.096  -1.037  1.00 0.00 ? 5   LYS A HB2  2  
ATOM   4480   H  HB3  . LYS A 1 5   ? 17.030  -2.787  -0.626  1.00 0.00 ? 5   LYS A HB3  2  
ATOM   4481   H  HG2  . LYS A 1 5   ? 17.610  -1.540  -2.554  1.00 0.00 ? 5   LYS A HG2  2  
ATOM   4482   H  HG3  . LYS A 1 5   ? 19.067  -2.494  -2.833  1.00 0.00 ? 5   LYS A HG3  2  
ATOM   4483   H  HD2  . LYS A 1 5   ? 16.656  -4.146  -2.769  1.00 0.00 ? 5   LYS A HD2  2  
ATOM   4484   H  HD3  . LYS A 1 5   ? 16.598  -2.923  -4.036  1.00 0.00 ? 5   LYS A HD3  2  
ATOM   4485   H  HE2  . LYS A 1 5   ? 17.654  -4.953  -4.903  1.00 0.00 ? 5   LYS A HE2  2  
ATOM   4486   H  HE3  . LYS A 1 5   ? 18.849  -3.658  -4.809  1.00 0.00 ? 5   LYS A HE3  2  
ATOM   4487   H  HZ1  . LYS A 1 5   ? 19.965  -5.363  -3.806  1.00 0.00 ? 5   LYS A HZ1  2  
ATOM   4488   H  HZ2  . LYS A 1 5   ? 18.565  -6.054  -3.138  1.00 0.00 ? 5   LYS A HZ2  2  
ATOM   4489   H  HZ3  . LYS A 1 5   ? 19.236  -4.654  -2.449  1.00 0.00 ? 5   LYS A HZ3  2  
ATOM   4490   N  N    . THR A 1 6   ? 19.351  0.031   -0.546  1.00 0.00 ? 6   THR A N    2  
ATOM   4491   C  CA   . THR A 1 6   ? 19.035  1.470   -0.299  1.00 0.00 ? 6   THR A CA   2  
ATOM   4492   C  C    . THR A 1 6   ? 19.037  2.212   -1.639  1.00 0.00 ? 6   THR A C    2  
ATOM   4493   O  O    . THR A 1 6   ? 19.276  1.624   -2.671  1.00 0.00 ? 6   THR A O    2  
ATOM   4494   C  CB   . THR A 1 6   ? 20.098  2.077   0.621   1.00 0.00 ? 6   THR A CB   2  
ATOM   4495   O  OG1  . THR A 1 6   ? 19.717  3.401   0.971   1.00 0.00 ? 6   THR A OG1  2  
ATOM   4496   C  CG2  . THR A 1 6   ? 21.443  2.104   -0.104  1.00 0.00 ? 6   THR A CG2  2  
ATOM   4497   H  H    . THR A 1 6   ? 20.038  -0.213  -1.202  1.00 0.00 ? 6   THR A H    2  
ATOM   4498   H  HA   . THR A 1 6   ? 18.063  1.554   0.163   1.00 0.00 ? 6   THR A HA   2  
ATOM   4499   H  HB   . THR A 1 6   ? 20.186  1.478   1.514   1.00 0.00 ? 6   THR A HB   2  
ATOM   4500   H  HG1  . THR A 1 6   ? 20.460  3.816   1.416   1.00 0.00 ? 6   THR A HG1  2  
ATOM   4501   H  HG21 . THR A 1 6   ? 21.628  1.140   -0.555  1.00 0.00 ? 6   THR A HG21 2  
ATOM   4502   H  HG22 . THR A 1 6   ? 22.228  2.328   0.603   1.00 0.00 ? 6   THR A HG22 2  
ATOM   4503   H  HG23 . THR A 1 6   ? 21.422  2.863   -0.872  1.00 0.00 ? 6   THR A HG23 2  
ATOM   4504   N  N    . VAL A 1 7   ? 18.762  3.491   -1.648  1.00 0.00 ? 7   VAL A N    2  
ATOM   4505   C  CA   . VAL A 1 7   ? 18.743  4.229   -2.946  1.00 0.00 ? 7   VAL A CA   2  
ATOM   4506   C  C    . VAL A 1 7   ? 20.144  4.743   -3.290  1.00 0.00 ? 7   VAL A C    2  
ATOM   4507   O  O    . VAL A 1 7   ? 20.862  5.240   -2.446  1.00 0.00 ? 7   VAL A O    2  
ATOM   4508   C  CB   . VAL A 1 7   ? 17.786  5.417   -2.849  1.00 0.00 ? 7   VAL A CB   2  
ATOM   4509   C  CG1  . VAL A 1 7   ? 16.341  4.914   -2.865  1.00 0.00 ? 7   VAL A CG1  2  
ATOM   4510   C  CG2  . VAL A 1 7   ? 18.046  6.179   -1.548  1.00 0.00 ? 7   VAL A CG2  2  
ATOM   4511   H  H    . VAL A 1 7   ? 18.552  3.967   -0.815  1.00 0.00 ? 7   VAL A H    2  
ATOM   4512   H  HA   . VAL A 1 7   ? 18.407  3.564   -3.728  1.00 0.00 ? 7   VAL A HA   2  
ATOM   4513   H  HB   . VAL A 1 7   ? 17.947  6.076   -3.692  1.00 0.00 ? 7   VAL A HB   2  
ATOM   4514   H  HG11 . VAL A 1 7   ? 16.119  4.427   -1.927  1.00 0.00 ? 7   VAL A HG11 2  
ATOM   4515   H  HG12 . VAL A 1 7   ? 16.213  4.212   -3.675  1.00 0.00 ? 7   VAL A HG12 2  
ATOM   4516   H  HG13 . VAL A 1 7   ? 15.670  5.750   -3.005  1.00 0.00 ? 7   VAL A HG13 2  
ATOM   4517   H  HG21 . VAL A 1 7   ? 17.522  7.122   -1.571  1.00 0.00 ? 7   VAL A HG21 2  
ATOM   4518   H  HG22 . VAL A 1 7   ? 19.106  6.358   -1.441  1.00 0.00 ? 7   VAL A HG22 2  
ATOM   4519   H  HG23 . VAL A 1 7   ? 17.695  5.592   -0.711  1.00 0.00 ? 7   VAL A HG23 2  
ATOM   4520   N  N    . LYS A 1 8   ? 20.530  4.628   -4.533  1.00 0.00 ? 8   LYS A N    2  
ATOM   4521   C  CA   . LYS A 1 8   ? 21.878  5.110   -4.955  1.00 0.00 ? 8   LYS A CA   2  
ATOM   4522   C  C    . LYS A 1 8   ? 21.896  6.638   -5.006  1.00 0.00 ? 8   LYS A C    2  
ATOM   4523   O  O    . LYS A 1 8   ? 22.841  7.268   -4.573  1.00 0.00 ? 8   LYS A O    2  
ATOM   4524   C  CB   . LYS A 1 8   ? 22.201  4.573   -6.352  1.00 0.00 ? 8   LYS A CB   2  
ATOM   4525   C  CG   . LYS A 1 8   ? 23.637  4.954   -6.718  1.00 0.00 ? 8   LYS A CG   2  
ATOM   4526   C  CD   . LYS A 1 8   ? 23.930  4.530   -8.157  1.00 0.00 ? 8   LYS A CD   2  
ATOM   4527   C  CE   . LYS A 1 8   ? 23.932  5.763   -9.061  1.00 0.00 ? 8   LYS A CE   2  
ATOM   4528   N  NZ   . LYS A 1 8   ? 25.015  6.692   -8.632  1.00 0.00 ? 8   LYS A NZ   2  
ATOM   4529   H  H    . LYS A 1 8   ? 19.928  4.223   -5.192  1.00 0.00 ? 8   LYS A H    2  
ATOM   4530   H  HA   . LYS A 1 8   ? 22.622  4.767   -4.254  1.00 0.00 ? 8   LYS A HA   2  
ATOM   4531   H  HB2  . LYS A 1 8   ? 22.098  3.499   -6.364  1.00 0.00 ? 8   LYS A HB2  2  
ATOM   4532   H  HB3  . LYS A 1 8   ? 21.523  5.008   -7.071  1.00 0.00 ? 8   LYS A HB3  2  
ATOM   4533   H  HG2  . LYS A 1 8   ? 23.758  6.024   -6.627  1.00 0.00 ? 8   LYS A HG2  2  
ATOM   4534   H  HG3  . LYS A 1 8   ? 24.321  4.456   -6.050  1.00 0.00 ? 8   LYS A HG3  2  
ATOM   4535   H  HD2  . LYS A 1 8   ? 24.897  4.049   -8.200  1.00 0.00 ? 8   LYS A HD2  2  
ATOM   4536   H  HD3  . LYS A 1 8   ? 23.171  3.840   -8.492  1.00 0.00 ? 8   LYS A HD3  2  
ATOM   4537   H  HE2  . LYS A 1 8   ? 24.101  5.459   -10.084 1.00 0.00 ? 8   LYS A HE2  2  
ATOM   4538   H  HE3  . LYS A 1 8   ? 22.977  6.264   -8.988  1.00 0.00 ? 8   LYS A HE3  2  
ATOM   4539   H  HZ1  . LYS A 1 8   ? 24.770  7.663   -8.913  1.00 0.00 ? 8   LYS A HZ1  2  
ATOM   4540   H  HZ2  . LYS A 1 8   ? 25.909  6.414   -9.087  1.00 0.00 ? 8   LYS A HZ2  2  
ATOM   4541   H  HZ3  . LYS A 1 8   ? 25.122  6.649   -7.600  1.00 0.00 ? 8   LYS A HZ3  2  
ATOM   4542   N  N    . GLU A 1 9   ? 20.871  7.237   -5.551  1.00 0.00 ? 9   GLU A N    2  
ATOM   4543   C  CA   . GLU A 1 9   ? 20.840  8.726   -5.653  1.00 0.00 ? 9   GLU A CA   2  
ATOM   4544   C  C    . GLU A 1 9   ? 19.568  9.273   -5.003  1.00 0.00 ? 9   GLU A C    2  
ATOM   4545   O  O    . GLU A 1 9   ? 18.539  8.628   -4.981  1.00 0.00 ? 9   GLU A O    2  
ATOM   4546   C  CB   . GLU A 1 9   ? 20.866  9.131   -7.128  1.00 0.00 ? 9   GLU A CB   2  
ATOM   4547   C  CG   . GLU A 1 9   ? 22.009  10.117  -7.365  1.00 0.00 ? 9   GLU A CG   2  
ATOM   4548   C  CD   . GLU A 1 9   ? 21.959  10.619  -8.809  1.00 0.00 ? 9   GLU A CD   2  
ATOM   4549   O  OE1  . GLU A 1 9   ? 21.165  10.093  -9.571  1.00 0.00 ? 9   GLU A OE1  2  
ATOM   4550   O  OE2  . GLU A 1 9   ? 22.716  11.521  -9.130  1.00 0.00 ? 9   GLU A OE2  2  
ATOM   4551   H  H    . GLU A 1 9   ? 20.128  6.705   -5.906  1.00 0.00 ? 9   GLU A H    2  
ATOM   4552   H  HA   . GLU A 1 9   ? 21.701  9.141   -5.155  1.00 0.00 ? 9   GLU A HA   2  
ATOM   4553   H  HB2  . GLU A 1 9   ? 21.014  8.252   -7.740  1.00 0.00 ? 9   GLU A HB2  2  
ATOM   4554   H  HB3  . GLU A 1 9   ? 19.929  9.599   -7.391  1.00 0.00 ? 9   GLU A HB3  2  
ATOM   4555   H  HG2  . GLU A 1 9   ? 21.909  10.953  -6.689  1.00 0.00 ? 9   GLU A HG2  2  
ATOM   4556   H  HG3  . GLU A 1 9   ? 22.953  9.624   -7.191  1.00 0.00 ? 9   GLU A HG3  2  
ATOM   4557   N  N    . LYS A 1 10  ? 19.638  10.464  -4.473  1.00 0.00 ? 10  LYS A N    2  
ATOM   4558   C  CA   . LYS A 1 10  ? 18.442  11.067  -3.820  1.00 0.00 ? 10  LYS A CA   2  
ATOM   4559   C  C    . LYS A 1 10  ? 17.323  11.242  -4.848  1.00 0.00 ? 10  LYS A C    2  
ATOM   4560   O  O    . LYS A 1 10  ? 17.558  11.621  -5.979  1.00 0.00 ? 10  LYS A O    2  
ATOM   4561   C  CB   . LYS A 1 10  ? 18.814  12.431  -3.237  1.00 0.00 ? 10  LYS A CB   2  
ATOM   4562   C  CG   . LYS A 1 10  ? 17.550  13.152  -2.761  1.00 0.00 ? 10  LYS A CG   2  
ATOM   4563   C  CD   . LYS A 1 10  ? 17.193  14.268  -3.745  1.00 0.00 ? 10  LYS A CD   2  
ATOM   4564   C  CE   . LYS A 1 10  ? 18.274  15.352  -3.712  1.00 0.00 ? 10  LYS A CE   2  
ATOM   4565   N  NZ   . LYS A 1 10  ? 17.629  16.695  -3.676  1.00 0.00 ? 10  LYS A NZ   2  
ATOM   4566   H  H    . LYS A 1 10  ? 20.482  10.962  -4.502  1.00 0.00 ? 10  LYS A H    2  
ATOM   4567   H  HA   . LYS A 1 10  ? 18.105  10.419  -3.028  1.00 0.00 ? 10  LYS A HA   2  
ATOM   4568   H  HB2  . LYS A 1 10  ? 19.487  12.294  -2.403  1.00 0.00 ? 10  LYS A HB2  2  
ATOM   4569   H  HB3  . LYS A 1 10  ? 19.298  13.023  -3.996  1.00 0.00 ? 10  LYS A HB3  2  
ATOM   4570   H  HG2  . LYS A 1 10  ? 16.732  12.447  -2.703  1.00 0.00 ? 10  LYS A HG2  2  
ATOM   4571   H  HG3  . LYS A 1 10  ? 17.724  13.576  -1.786  1.00 0.00 ? 10  LYS A HG3  2  
ATOM   4572   H  HD2  . LYS A 1 10  ? 17.123  13.859  -4.742  1.00 0.00 ? 10  LYS A HD2  2  
ATOM   4573   H  HD3  . LYS A 1 10  ? 16.244  14.702  -3.468  1.00 0.00 ? 10  LYS A HD3  2  
ATOM   4574   H  HE2  . LYS A 1 10  ? 18.887  15.225  -2.833  1.00 0.00 ? 10  LYS A HE2  2  
ATOM   4575   H  HE3  . LYS A 1 10  ? 18.891  15.272  -4.594  1.00 0.00 ? 10  LYS A HE3  2  
ATOM   4576   H  HZ1  . LYS A 1 10  ? 17.550  17.017  -2.691  1.00 0.00 ? 10  LYS A HZ1  2  
ATOM   4577   H  HZ2  . LYS A 1 10  ? 16.679  16.635  -4.098  1.00 0.00 ? 10  LYS A HZ2  2  
ATOM   4578   H  HZ3  . LYS A 1 10  ? 18.205  17.371  -4.214  1.00 0.00 ? 10  LYS A HZ3  2  
ATOM   4579   N  N    . LEU A 1 11  ? 16.106  10.974  -4.455  1.00 0.00 ? 11  LEU A N    2  
ATOM   4580   C  CA   . LEU A 1 11  ? 14.958  11.128  -5.397  1.00 0.00 ? 11  LEU A CA   2  
ATOM   4581   C  C    . LEU A 1 11  ? 13.946  12.110  -4.801  1.00 0.00 ? 11  LEU A C    2  
ATOM   4582   O  O    . LEU A 1 11  ? 14.028  12.468  -3.643  1.00 0.00 ? 11  LEU A O    2  
ATOM   4583   C  CB   . LEU A 1 11  ? 14.288  9.769   -5.615  1.00 0.00 ? 11  LEU A CB   2  
ATOM   4584   C  CG   . LEU A 1 11  ? 14.945  9.060   -6.802  1.00 0.00 ? 11  LEU A CG   2  
ATOM   4585   C  CD1  . LEU A 1 11  ? 14.413  7.629   -6.901  1.00 0.00 ? 11  LEU A CD1  2  
ATOM   4586   C  CD2  . LEU A 1 11  ? 14.621  9.811   -8.098  1.00 0.00 ? 11  LEU A CD2  2  
ATOM   4587   H  H    . LEU A 1 11  ? 15.950  10.672  -3.534  1.00 0.00 ? 11  LEU A H    2  
ATOM   4588   H  HA   . LEU A 1 11  ? 15.313  11.510  -6.343  1.00 0.00 ? 11  LEU A HA   2  
ATOM   4589   H  HB2  . LEU A 1 11  ? 14.404  9.165   -4.726  1.00 0.00 ? 11  LEU A HB2  2  
ATOM   4590   H  HB3  . LEU A 1 11  ? 13.237  9.911   -5.816  1.00 0.00 ? 11  LEU A HB3  2  
ATOM   4591   H  HG   . LEU A 1 11  ? 16.015  9.034   -6.657  1.00 0.00 ? 11  LEU A HG   2  
ATOM   4592   H  HD11 . LEU A 1 11  ? 14.558  7.260   -7.906  1.00 0.00 ? 11  LEU A HD11 2  
ATOM   4593   H  HD12 . LEU A 1 11  ? 13.361  7.620   -6.661  1.00 0.00 ? 11  LEU A HD12 2  
ATOM   4594   H  HD13 . LEU A 1 11  ? 14.948  6.998   -6.206  1.00 0.00 ? 11  LEU A HD13 2  
ATOM   4595   H  HD21 . LEU A 1 11  ? 14.282  9.109   -8.846  1.00 0.00 ? 11  LEU A HD21 2  
ATOM   4596   H  HD22 . LEU A 1 11  ? 15.509  10.313  -8.454  1.00 0.00 ? 11  LEU A HD22 2  
ATOM   4597   H  HD23 . LEU A 1 11  ? 13.847  10.539  -7.912  1.00 0.00 ? 11  LEU A HD23 2  
ATOM   4598   N  N    . SER A 1 12  ? 12.995  12.554  -5.580  1.00 0.00 ? 12  SER A N    2  
ATOM   4599   C  CA   . SER A 1 12  ? 11.993  13.516  -5.040  1.00 0.00 ? 12  SER A CA   2  
ATOM   4600   C  C    . SER A 1 12  ? 10.702  13.446  -5.861  1.00 0.00 ? 12  SER A C    2  
ATOM   4601   O  O    . SER A 1 12  ? 10.720  13.178  -7.045  1.00 0.00 ? 12  SER A O    2  
ATOM   4602   C  CB   . SER A 1 12  ? 12.564  14.934  -5.111  1.00 0.00 ? 12  SER A CB   2  
ATOM   4603   O  OG   . SER A 1 12  ? 13.449  15.027  -6.219  1.00 0.00 ? 12  SER A OG   2  
ATOM   4604   H  H    . SER A 1 12  ? 12.945  12.258  -6.513  1.00 0.00 ? 12  SER A H    2  
ATOM   4605   H  HA   . SER A 1 12  ? 11.777  13.269  -4.012  1.00 0.00 ? 12  SER A HA   2  
ATOM   4606   H  HB2  . SER A 1 12  ? 11.762  15.642  -5.237  1.00 0.00 ? 12  SER A HB2  2  
ATOM   4607   H  HB3  . SER A 1 12  ? 13.093  15.154  -4.194  1.00 0.00 ? 12  SER A HB3  2  
ATOM   4608   H  HG   . SER A 1 12  ? 13.518  15.952  -6.467  1.00 0.00 ? 12  SER A HG   2  
ATOM   4609   N  N    . PHE A 1 13  ? 9.582   13.684  -5.232  1.00 0.00 ? 13  PHE A N    2  
ATOM   4610   C  CA   . PHE A 1 13  ? 8.284   13.632  -5.967  1.00 0.00 ? 13  PHE A CA   2  
ATOM   4611   C  C    . PHE A 1 13  ? 7.428   14.828  -5.576  1.00 0.00 ? 13  PHE A C    2  
ATOM   4612   O  O    . PHE A 1 13  ? 7.615   15.417  -4.530  1.00 0.00 ? 13  PHE A O    2  
ATOM   4613   C  CB   . PHE A 1 13  ? 7.543   12.351  -5.598  1.00 0.00 ? 13  PHE A CB   2  
ATOM   4614   C  CG   . PHE A 1 13  ? 8.201   11.195  -6.290  1.00 0.00 ? 13  PHE A CG   2  
ATOM   4615   C  CD1  . PHE A 1 13  ? 7.823   10.857  -7.589  1.00 0.00 ? 13  PHE A CD1  2  
ATOM   4616   C  CD2  . PHE A 1 13  ? 9.198   10.470  -5.635  1.00 0.00 ? 13  PHE A CD2  2  
ATOM   4617   C  CE1  . PHE A 1 13  ? 8.440   9.789   -8.240  1.00 0.00 ? 13  PHE A CE1  2  
ATOM   4618   C  CE2  . PHE A 1 13  ? 9.821   9.399   -6.284  1.00 0.00 ? 13  PHE A CE2  2  
ATOM   4619   C  CZ   . PHE A 1 13  ? 9.443   9.058   -7.589  1.00 0.00 ? 13  PHE A CZ   2  
ATOM   4620   H  H    . PHE A 1 13  ? 9.596   13.896  -4.274  1.00 0.00 ? 13  PHE A H    2  
ATOM   4621   H  HA   . PHE A 1 13  ? 8.468   13.650  -7.031  1.00 0.00 ? 13  PHE A HA   2  
ATOM   4622   H  HB2  . PHE A 1 13  ? 7.582   12.205  -4.528  1.00 0.00 ? 13  PHE A HB2  2  
ATOM   4623   H  HB3  . PHE A 1 13  ? 6.513   12.423  -5.915  1.00 0.00 ? 13  PHE A HB3  2  
ATOM   4624   H  HD1  . PHE A 1 13  ? 7.050   11.420  -8.090  1.00 0.00 ? 13  PHE A HD1  2  
ATOM   4625   H  HD2  . PHE A 1 13  ? 9.486   10.738  -4.627  1.00 0.00 ? 13  PHE A HD2  2  
ATOM   4626   H  HE1  . PHE A 1 13  ? 8.146   9.532   -9.244  1.00 0.00 ? 13  PHE A HE1  2  
ATOM   4627   H  HE2  . PHE A 1 13  ? 10.592  8.837   -5.781  1.00 0.00 ? 13  PHE A HE2  2  
ATOM   4628   H  HZ   . PHE A 1 13  ? 9.923   8.232   -8.092  1.00 0.00 ? 13  PHE A HZ   2  
ATOM   4629   N  N    . GLU A 1 14  ? 6.485   15.199  -6.397  1.00 0.00 ? 14  GLU A N    2  
ATOM   4630   C  CA   . GLU A 1 14  ? 5.622   16.362  -6.049  1.00 0.00 ? 14  GLU A CA   2  
ATOM   4631   C  C    . GLU A 1 14  ? 4.221   16.140  -6.628  1.00 0.00 ? 14  GLU A C    2  
ATOM   4632   O  O    . GLU A 1 14  ? 4.069   15.695  -7.747  1.00 0.00 ? 14  GLU A O    2  
ATOM   4633   C  CB   . GLU A 1 14  ? 6.224   17.637  -6.645  1.00 0.00 ? 14  GLU A CB   2  
ATOM   4634   C  CG   . GLU A 1 14  ? 6.707   17.357  -8.070  1.00 0.00 ? 14  GLU A CG   2  
ATOM   4635   C  CD   . GLU A 1 14  ? 8.235   17.294  -8.089  1.00 0.00 ? 14  GLU A CD   2  
ATOM   4636   O  OE1  . GLU A 1 14  ? 8.798   16.768  -7.145  1.00 0.00 ? 14  GLU A OE1  2  
ATOM   4637   O  OE2  . GLU A 1 14  ? 8.815   17.774  -9.049  1.00 0.00 ? 14  GLU A OE2  2  
ATOM   4638   H  H    . GLU A 1 14  ? 6.327   14.726  -7.244  1.00 0.00 ? 14  GLU A H    2  
ATOM   4639   H  HA   . GLU A 1 14  ? 5.560   16.458  -4.979  1.00 0.00 ? 14  GLU A HA   2  
ATOM   4640   H  HB2  . GLU A 1 14  ? 5.473   18.413  -6.666  1.00 0.00 ? 14  GLU A HB2  2  
ATOM   4641   H  HB3  . GLU A 1 14  ? 7.058   17.958  -6.040  1.00 0.00 ? 14  GLU A HB3  2  
ATOM   4642   H  HG2  . GLU A 1 14  ? 6.302   16.414  -8.408  1.00 0.00 ? 14  GLU A HG2  2  
ATOM   4643   H  HG3  . GLU A 1 14  ? 6.372   18.148  -8.726  1.00 0.00 ? 14  GLU A HG3  2  
ATOM   4644   N  N    . GLY A 1 15  ? 3.196   16.446  -5.877  1.00 0.00 ? 15  GLY A N    2  
ATOM   4645   C  CA   . GLY A 1 15  ? 1.812   16.248  -6.403  1.00 0.00 ? 15  GLY A CA   2  
ATOM   4646   C  C    . GLY A 1 15  ? 0.789   16.458  -5.284  1.00 0.00 ? 15  GLY A C    2  
ATOM   4647   O  O    . GLY A 1 15  ? 1.113   16.407  -4.113  1.00 0.00 ? 15  GLY A O    2  
ATOM   4648   H  H    . GLY A 1 15  ? 3.336   16.807  -4.975  1.00 0.00 ? 15  GLY A H    2  
ATOM   4649   H  HA2  . GLY A 1 15  ? 1.626   16.958  -7.197  1.00 0.00 ? 15  GLY A HA2  2  
ATOM   4650   H  HA3  . GLY A 1 15  ? 1.715   15.243  -6.789  1.00 0.00 ? 15  GLY A HA3  2  
ATOM   4651   N  N    . VAL A 1 16  ? -0.445  16.716  -5.635  1.00 0.00 ? 16  VAL A N    2  
ATOM   4652   C  CA   . VAL A 1 16  ? -1.493  16.950  -4.600  1.00 0.00 ? 16  VAL A CA   2  
ATOM   4653   C  C    . VAL A 1 16  ? -2.021  15.616  -4.059  1.00 0.00 ? 16  VAL A C    2  
ATOM   4654   O  O    . VAL A 1 16  ? -2.236  14.674  -4.795  1.00 0.00 ? 16  VAL A O    2  
ATOM   4655   C  CB   . VAL A 1 16  ? -2.640  17.737  -5.234  1.00 0.00 ? 16  VAL A CB   2  
ATOM   4656   C  CG1  . VAL A 1 16  ? -3.405  16.836  -6.205  1.00 0.00 ? 16  VAL A CG1  2  
ATOM   4657   C  CG2  . VAL A 1 16  ? -3.592  18.232  -4.144  1.00 0.00 ? 16  VAL A CG2  2  
ATOM   4658   H  H    . VAL A 1 16  ? -0.690  16.781  -6.582  1.00 0.00 ? 16  VAL A H    2  
ATOM   4659   H  HA   . VAL A 1 16  ? -1.073  17.520  -3.791  1.00 0.00 ? 16  VAL A HA   2  
ATOM   4660   H  HB   . VAL A 1 16  ? -2.239  18.584  -5.773  1.00 0.00 ? 16  VAL A HB   2  
ATOM   4661   H  HG11 . VAL A 1 16  ? -4.156  16.279  -5.664  1.00 0.00 ? 16  VAL A HG11 2  
ATOM   4662   H  HG12 . VAL A 1 16  ? -2.717  16.149  -6.675  1.00 0.00 ? 16  VAL A HG12 2  
ATOM   4663   H  HG13 . VAL A 1 16  ? -3.880  17.442  -6.960  1.00 0.00 ? 16  VAL A HG13 2  
ATOM   4664   H  HG21 . VAL A 1 16  ? -4.568  18.403  -4.571  1.00 0.00 ? 16  VAL A HG21 2  
ATOM   4665   H  HG22 . VAL A 1 16  ? -3.214  19.154  -3.728  1.00 0.00 ? 16  VAL A HG22 2  
ATOM   4666   H  HG23 . VAL A 1 16  ? -3.665  17.488  -3.363  1.00 0.00 ? 16  VAL A HG23 2  
ATOM   4667   N  N    . GLY A 1 17  ? -2.227  15.536  -2.770  1.00 0.00 ? 17  GLY A N    2  
ATOM   4668   C  CA   . GLY A 1 17  ? -2.738  14.271  -2.160  1.00 0.00 ? 17  GLY A CA   2  
ATOM   4669   C  C    . GLY A 1 17  ? -4.185  14.022  -2.596  1.00 0.00 ? 17  GLY A C    2  
ATOM   4670   O  O    . GLY A 1 17  ? -4.953  14.942  -2.800  1.00 0.00 ? 17  GLY A O    2  
ATOM   4671   H  H    . GLY A 1 17  ? -2.036  16.312  -2.199  1.00 0.00 ? 17  GLY A H    2  
ATOM   4672   H  HA2  . GLY A 1 17  ? -2.118  13.444  -2.480  1.00 0.00 ? 17  GLY A HA2  2  
ATOM   4673   H  HA3  . GLY A 1 17  ? -2.698  14.352  -1.086  1.00 0.00 ? 17  GLY A HA3  2  
ATOM   4674   N  N    . ILE A 1 18  ? -4.547  12.779  -2.775  1.00 0.00 ? 18  ILE A N    2  
ATOM   4675   C  CA   . ILE A 1 18  ? -5.928  12.448  -3.241  1.00 0.00 ? 18  ILE A CA   2  
ATOM   4676   C  C    . ILE A 1 18  ? -7.009  12.894  -2.250  1.00 0.00 ? 18  ILE A C    2  
ATOM   4677   O  O    . ILE A 1 18  ? -7.999  13.471  -2.648  1.00 0.00 ? 18  ILE A O    2  
ATOM   4678   C  CB   . ILE A 1 18  ? -6.059  10.939  -3.451  1.00 0.00 ? 18  ILE A CB   2  
ATOM   4679   C  CG1  . ILE A 1 18  ? -7.541  10.574  -3.589  1.00 0.00 ? 18  ILE A CG1  2  
ATOM   4680   C  CG2  . ILE A 1 18  ? -5.464  10.191  -2.253  1.00 0.00 ? 18  ILE A CG2  2  
ATOM   4681   C  CD1  . ILE A 1 18  ? -7.684  9.356   -4.503  1.00 0.00 ? 18  ILE A CD1  2  
ATOM   4682   H  H    . ILE A 1 18  ? -3.898  12.056  -2.647  1.00 0.00 ? 18  ILE A H    2  
ATOM   4683   H  HA   . ILE A 1 18  ? -6.101  12.941  -4.185  1.00 0.00 ? 18  ILE A HA   2  
ATOM   4684   H  HB   . ILE A 1 18  ? -5.536  10.654  -4.348  1.00 0.00 ? 18  ILE A HB   2  
ATOM   4685   H  HG12 . ILE A 1 18  ? -7.949  10.345  -2.618  1.00 0.00 ? 18  ILE A HG12 2  
ATOM   4686   H  HG13 . ILE A 1 18  ? -8.078  11.406  -4.013  1.00 0.00 ? 18  ILE A HG13 2  
ATOM   4687   H  HG21 . ILE A 1 18  ? -5.991  10.473  -1.355  1.00 0.00 ? 18  ILE A HG21 2  
ATOM   4688   H  HG22 . ILE A 1 18  ? -4.420  10.445  -2.151  1.00 0.00 ? 18  ILE A HG22 2  
ATOM   4689   H  HG23 . ILE A 1 18  ? -5.561  9.127   -2.409  1.00 0.00 ? 18  ILE A HG23 2  
ATOM   4690   H  HD11 . ILE A 1 18  ? -7.252  9.578   -5.468  1.00 0.00 ? 18  ILE A HD11 2  
ATOM   4691   H  HD12 . ILE A 1 18  ? -8.730  9.116   -4.623  1.00 0.00 ? 18  ILE A HD12 2  
ATOM   4692   H  HD13 . ILE A 1 18  ? -7.170  8.514   -4.063  1.00 0.00 ? 18  ILE A HD13 2  
ATOM   4693   N  N    . HIS A 1 19  ? -6.882  12.613  -0.979  1.00 0.00 ? 19  HIS A N    2  
ATOM   4694   C  CA   . HIS A 1 19  ? -7.968  13.015  -0.036  1.00 0.00 ? 19  HIS A CA   2  
ATOM   4695   C  C    . HIS A 1 19  ? -7.767  14.443  0.474   1.00 0.00 ? 19  HIS A C    2  
ATOM   4696   O  O    . HIS A 1 19  ? -8.715  15.185  0.642   1.00 0.00 ? 19  HIS A O    2  
ATOM   4697   C  CB   . HIS A 1 19  ? -7.977  12.053  1.156   1.00 0.00 ? 19  HIS A CB   2  
ATOM   4698   C  CG   . HIS A 1 19  ? -7.666  10.658  0.685   1.00 0.00 ? 19  HIS A CG   2  
ATOM   4699   N  ND1  . HIS A 1 19  ? -8.375  10.048  -0.338  1.00 0.00 ? 19  HIS A ND1  2  
ATOM   4700   C  CD2  . HIS A 1 19  ? -6.724  9.740   1.085   1.00 0.00 ? 19  HIS A CD2  2  
ATOM   4701   C  CE1  . HIS A 1 19  ? -7.854  8.820   -0.518  1.00 0.00 ? 19  HIS A CE1  2  
ATOM   4702   N  NE2  . HIS A 1 19  ? -6.846  8.582   0.323   1.00 0.00 ? 19  HIS A NE2  2  
ATOM   4703   H  H    . HIS A 1 19  ? -6.108  12.132  -0.617  1.00 0.00 ? 19  HIS A H    2  
ATOM   4704   H  HA   . HIS A 1 19  ? -8.915  12.952  -0.546  1.00 0.00 ? 19  HIS A HA   2  
ATOM   4705   H  HB2  . HIS A 1 19  ? -7.234  12.363  1.875   1.00 0.00 ? 19  HIS A HB2  2  
ATOM   4706   H  HB3  . HIS A 1 19  ? -8.952  12.066  1.621   1.00 0.00 ? 19  HIS A HB3  2  
ATOM   4707   H  HD1  . HIS A 1 19  ? -9.121  10.440  -0.838  1.00 0.00 ? 19  HIS A HD1  2  
ATOM   4708   H  HD2  . HIS A 1 19  ? -6.001  9.893   1.873   1.00 0.00 ? 19  HIS A HD2  2  
ATOM   4709   H  HE1  . HIS A 1 19  ? -8.208  8.115   -1.255  1.00 0.00 ? 19  HIS A HE1  2  
ATOM   4710   N  N    . THR A 1 20  ? -6.552  14.834  0.739   1.00 0.00 ? 20  THR A N    2  
ATOM   4711   C  CA   . THR A 1 20  ? -6.315  16.214  1.257   1.00 0.00 ? 20  THR A CA   2  
ATOM   4712   C  C    . THR A 1 20  ? -6.470  17.227  0.126   1.00 0.00 ? 20  THR A C    2  
ATOM   4713   O  O    . THR A 1 20  ? -6.949  18.325  0.326   1.00 0.00 ? 20  THR A O    2  
ATOM   4714   C  CB   . THR A 1 20  ? -4.902  16.310  1.834   1.00 0.00 ? 20  THR A CB   2  
ATOM   4715   O  OG1  . THR A 1 20  ? -4.610  15.126  2.563   1.00 0.00 ? 20  THR A OG1  2  
ATOM   4716   C  CG2  . THR A 1 20  ? -4.810  17.521  2.762   1.00 0.00 ? 20  THR A CG2  2  
ATOM   4717   H  H    . THR A 1 20  ? -5.800  14.221  0.601   1.00 0.00 ? 20  THR A H    2  
ATOM   4718   H  HA   . THR A 1 20  ? -7.034  16.432  2.033   1.00 0.00 ? 20  THR A HA   2  
ATOM   4719   H  HB   . THR A 1 20  ? -4.194  16.425  1.029   1.00 0.00 ? 20  THR A HB   2  
ATOM   4720   H  HG1  . THR A 1 20  ? -4.881  14.375  2.029   1.00 0.00 ? 20  THR A HG1  2  
ATOM   4721   H  HG21 . THR A 1 20  ? -5.129  18.406  2.232   1.00 0.00 ? 20  THR A HG21 2  
ATOM   4722   H  HG22 . THR A 1 20  ? -3.788  17.646  3.088   1.00 0.00 ? 20  THR A HG22 2  
ATOM   4723   H  HG23 . THR A 1 20  ? -5.445  17.366  3.621   1.00 0.00 ? 20  THR A HG23 2  
ATOM   4724   N  N    . GLY A 1 21  ? -6.064  16.874  -1.059  1.00 0.00 ? 21  GLY A N    2  
ATOM   4725   C  CA   . GLY A 1 21  ? -6.186  17.827  -2.193  1.00 0.00 ? 21  GLY A CA   2  
ATOM   4726   C  C    . GLY A 1 21  ? -5.225  18.996  -1.972  1.00 0.00 ? 21  GLY A C    2  
ATOM   4727   O  O    . GLY A 1 21  ? -5.401  20.070  -2.512  1.00 0.00 ? 21  GLY A O    2  
ATOM   4728   H  H    . GLY A 1 21  ? -5.675  15.985  -1.202  1.00 0.00 ? 21  GLY A H    2  
ATOM   4729   H  HA2  . GLY A 1 21  ? -5.933  17.324  -3.113  1.00 0.00 ? 21  GLY A HA2  2  
ATOM   4730   H  HA3  . GLY A 1 21  ? -7.200  18.196  -2.247  1.00 0.00 ? 21  GLY A HA3  2  
ATOM   4731   N  N    . GLU A 1 22  ? -4.204  18.789  -1.182  1.00 0.00 ? 22  GLU A N    2  
ATOM   4732   C  CA   . GLU A 1 22  ? -3.218  19.878  -0.922  1.00 0.00 ? 22  GLU A CA   2  
ATOM   4733   C  C    . GLU A 1 22  ? -1.891  19.525  -1.599  1.00 0.00 ? 22  GLU A C    2  
ATOM   4734   O  O    . GLU A 1 22  ? -1.543  18.370  -1.730  1.00 0.00 ? 22  GLU A O    2  
ATOM   4735   C  CB   . GLU A 1 22  ? -3.001  20.023  0.585   1.00 0.00 ? 22  GLU A CB   2  
ATOM   4736   C  CG   . GLU A 1 22  ? -1.741  20.856  0.838   1.00 0.00 ? 22  GLU A CG   2  
ATOM   4737   C  CD   . GLU A 1 22  ? -1.861  21.564  2.189   1.00 0.00 ? 22  GLU A CD   2  
ATOM   4738   O  OE1  . GLU A 1 22  ? -1.889  20.876  3.195   1.00 0.00 ? 22  GLU A OE1  2  
ATOM   4739   O  OE2  . GLU A 1 22  ? -1.922  22.783  2.192   1.00 0.00 ? 22  GLU A OE2  2  
ATOM   4740   H  H    . GLU A 1 22  ? -4.082  17.912  -0.761  1.00 0.00 ? 22  GLU A H    2  
ATOM   4741   H  HA   . GLU A 1 22  ? -3.591  20.809  -1.325  1.00 0.00 ? 22  GLU A HA   2  
ATOM   4742   H  HB2  . GLU A 1 22  ? -3.856  20.516  1.026   1.00 0.00 ? 22  GLU A HB2  2  
ATOM   4743   H  HB3  . GLU A 1 22  ? -2.879  19.046  1.027   1.00 0.00 ? 22  GLU A HB3  2  
ATOM   4744   H  HG2  . GLU A 1 22  ? -0.877  20.208  0.845   1.00 0.00 ? 22  GLU A HG2  2  
ATOM   4745   H  HG3  . GLU A 1 22  ? -1.633  21.592  0.056   1.00 0.00 ? 22  GLU A HG3  2  
ATOM   4746   N  N    . TYR A 1 23  ? -1.152  20.510  -2.031  1.00 0.00 ? 23  TYR A N    2  
ATOM   4747   C  CA   . TYR A 1 23  ? 0.148   20.229  -2.707  1.00 0.00 ? 23  TYR A CA   2  
ATOM   4748   C  C    . TYR A 1 23  ? 1.174   19.735  -1.685  1.00 0.00 ? 23  TYR A C    2  
ATOM   4749   O  O    . TYR A 1 23  ? 1.363   20.333  -0.645  1.00 0.00 ? 23  TYR A O    2  
ATOM   4750   C  CB   . TYR A 1 23  ? 0.664   21.509  -3.366  1.00 0.00 ? 23  TYR A CB   2  
ATOM   4751   C  CG   . TYR A 1 23  ? 2.166   21.431  -3.502  1.00 0.00 ? 23  TYR A CG   2  
ATOM   4752   C  CD1  . TYR A 1 23  ? 2.750   20.362  -4.190  1.00 0.00 ? 23  TYR A CD1  2  
ATOM   4753   C  CD2  . TYR A 1 23  ? 2.974   22.427  -2.940  1.00 0.00 ? 23  TYR A CD2  2  
ATOM   4754   C  CE1  . TYR A 1 23  ? 4.143   20.288  -4.315  1.00 0.00 ? 23  TYR A CE1  2  
ATOM   4755   C  CE2  . TYR A 1 23  ? 4.367   22.353  -3.066  1.00 0.00 ? 23  TYR A CE2  2  
ATOM   4756   C  CZ   . TYR A 1 23  ? 4.950   21.283  -3.754  1.00 0.00 ? 23  TYR A CZ   2  
ATOM   4757   O  OH   . TYR A 1 23  ? 6.323   21.210  -3.879  1.00 0.00 ? 23  TYR A OH   2  
ATOM   4758   H  H    . TYR A 1 23  ? -1.453  21.434  -1.914  1.00 0.00 ? 23  TYR A H    2  
ATOM   4759   H  HA   . TYR A 1 23  ? 0.002   19.472  -3.462  1.00 0.00 ? 23  TYR A HA   2  
ATOM   4760   H  HB2  . TYR A 1 23  ? 0.219   21.616  -4.344  1.00 0.00 ? 23  TYR A HB2  2  
ATOM   4761   H  HB3  . TYR A 1 23  ? 0.402   22.360  -2.755  1.00 0.00 ? 23  TYR A HB3  2  
ATOM   4762   H  HD1  . TYR A 1 23  ? 2.127   19.593  -4.623  1.00 0.00 ? 23  TYR A HD1  2  
ATOM   4763   H  HD2  . TYR A 1 23  ? 2.523   23.253  -2.410  1.00 0.00 ? 23  TYR A HD2  2  
ATOM   4764   H  HE1  . TYR A 1 23  ? 4.593   19.462  -4.846  1.00 0.00 ? 23  TYR A HE1  2  
ATOM   4765   H  HE2  . TYR A 1 23  ? 4.989   23.121  -2.633  1.00 0.00 ? 23  TYR A HE2  2  
ATOM   4766   H  HH   . TYR A 1 23  ? 6.664   22.104  -3.947  1.00 0.00 ? 23  TYR A HH   2  
ATOM   4767   N  N    . SER A 1 24  ? 1.846   18.651  -1.977  1.00 0.00 ? 24  SER A N    2  
ATOM   4768   C  CA   . SER A 1 24  ? 2.866   18.125  -1.026  1.00 0.00 ? 24  SER A CA   2  
ATOM   4769   C  C    . SER A 1 24  ? 4.081   17.627  -1.816  1.00 0.00 ? 24  SER A C    2  
ATOM   4770   O  O    . SER A 1 24  ? 3.979   17.300  -2.982  1.00 0.00 ? 24  SER A O    2  
ATOM   4771   C  CB   . SER A 1 24  ? 2.269   16.968  -0.224  1.00 0.00 ? 24  SER A CB   2  
ATOM   4772   O  OG   . SER A 1 24  ? 3.321   16.183  0.321   1.00 0.00 ? 24  SER A OG   2  
ATOM   4773   H  H    . SER A 1 24  ? 1.688   18.179  -2.823  1.00 0.00 ? 24  SER A H    2  
ATOM   4774   H  HA   . SER A 1 24  ? 3.171   18.912  -0.351  1.00 0.00 ? 24  SER A HA   2  
ATOM   4775   H  HB2  . SER A 1 24  ? 1.663   17.356  0.578   1.00 0.00 ? 24  SER A HB2  2  
ATOM   4776   H  HB3  . SER A 1 24  ? 1.652   16.360  -0.875  1.00 0.00 ? 24  SER A HB3  2  
ATOM   4777   H  HG   . SER A 1 24  ? 2.975   15.709  1.080   1.00 0.00 ? 24  SER A HG   2  
ATOM   4778   N  N    . LYS A 1 25  ? 5.230   17.572  -1.197  1.00 0.00 ? 25  LYS A N    2  
ATOM   4779   C  CA   . LYS A 1 25  ? 6.448   17.101  -1.921  1.00 0.00 ? 25  LYS A CA   2  
ATOM   4780   C  C    . LYS A 1 25  ? 7.215   16.127  -1.028  1.00 0.00 ? 25  LYS A C    2  
ATOM   4781   O  O    . LYS A 1 25  ? 7.216   16.268  0.178   1.00 0.00 ? 25  LYS A O    2  
ATOM   4782   C  CB   . LYS A 1 25  ? 7.337   18.304  -2.243  1.00 0.00 ? 25  LYS A CB   2  
ATOM   4783   C  CG   . LYS A 1 25  ? 8.749   17.825  -2.590  1.00 0.00 ? 25  LYS A CG   2  
ATOM   4784   C  CD   . LYS A 1 25  ? 9.493   18.933  -3.339  1.00 0.00 ? 25  LYS A CD   2  
ATOM   4785   C  CE   . LYS A 1 25  ? 10.966  18.550  -3.487  1.00 0.00 ? 25  LYS A CE   2  
ATOM   4786   N  NZ   . LYS A 1 25  ? 11.734  19.061  -2.316  1.00 0.00 ? 25  LYS A NZ   2  
ATOM   4787   H  H    . LYS A 1 25  ? 5.294   17.845  -0.255  1.00 0.00 ? 25  LYS A H    2  
ATOM   4788   H  HA   . LYS A 1 25  ? 6.158   16.606  -2.833  1.00 0.00 ? 25  LYS A HA   2  
ATOM   4789   H  HB2  . LYS A 1 25  ? 6.923   18.842  -3.083  1.00 0.00 ? 25  LYS A HB2  2  
ATOM   4790   H  HB3  . LYS A 1 25  ? 7.382   18.955  -1.384  1.00 0.00 ? 25  LYS A HB3  2  
ATOM   4791   H  HG2  . LYS A 1 25  ? 9.280   17.585  -1.680  1.00 0.00 ? 25  LYS A HG2  2  
ATOM   4792   H  HG3  . LYS A 1 25  ? 8.689   16.949  -3.215  1.00 0.00 ? 25  LYS A HG3  2  
ATOM   4793   H  HD2  . LYS A 1 25  ? 9.053   19.061  -4.318  1.00 0.00 ? 25  LYS A HD2  2  
ATOM   4794   H  HD3  . LYS A 1 25  ? 9.416   19.857  -2.786  1.00 0.00 ? 25  LYS A HD3  2  
ATOM   4795   H  HE2  . LYS A 1 25  ? 11.055  17.475  -3.534  1.00 0.00 ? 25  LYS A HE2  2  
ATOM   4796   H  HE3  . LYS A 1 25  ? 11.361  18.984  -4.393  1.00 0.00 ? 25  LYS A HE3  2  
ATOM   4797   H  HZ1  . LYS A 1 25  ? 11.704  18.362  -1.547  1.00 0.00 ? 25  LYS A HZ1  2  
ATOM   4798   H  HZ2  . LYS A 1 25  ? 11.313  19.955  -1.989  1.00 0.00 ? 25  LYS A HZ2  2  
ATOM   4799   H  HZ3  . LYS A 1 25  ? 12.723  19.224  -2.593  1.00 0.00 ? 25  LYS A HZ3  2  
ATOM   4800   N  N    . LEU A 1 26  ? 7.872   15.139  -1.594  1.00 0.00 ? 26  LEU A N    2  
ATOM   4801   C  CA   . LEU A 1 26  ? 8.627   14.173  -0.746  1.00 0.00 ? 26  LEU A CA   2  
ATOM   4802   C  C    . LEU A 1 26  ? 10.060  14.057  -1.261  1.00 0.00 ? 26  LEU A C    2  
ATOM   4803   O  O    . LEU A 1 26  ? 10.309  14.090  -2.449  1.00 0.00 ? 26  LEU A O    2  
ATOM   4804   C  CB   . LEU A 1 26  ? 7.985   12.781  -0.828  1.00 0.00 ? 26  LEU A CB   2  
ATOM   4805   C  CG   . LEU A 1 26  ? 6.483   12.884  -1.108  1.00 0.00 ? 26  LEU A CG   2  
ATOM   4806   C  CD1  . LEU A 1 26  ? 5.928   11.484  -1.367  1.00 0.00 ? 26  LEU A CD1  2  
ATOM   4807   C  CD2  . LEU A 1 26  ? 5.767   13.490  0.100   1.00 0.00 ? 26  LEU A CD2  2  
ATOM   4808   H  H    . LEU A 1 26  ? 7.881   15.019  -2.569  1.00 0.00 ? 26  LEU A H    2  
ATOM   4809   H  HA   . LEU A 1 26  ? 8.638   14.510  0.278   1.00 0.00 ? 26  LEU A HA   2  
ATOM   4810   H  HB2  . LEU A 1 26  ? 8.456   12.221  -1.621  1.00 0.00 ? 26  LEU A HB2  2  
ATOM   4811   H  HB3  . LEU A 1 26  ? 8.137   12.265  0.110   1.00 0.00 ? 26  LEU A HB3  2  
ATOM   4812   H  HG   . LEU A 1 26  ? 6.313   13.498  -1.980  1.00 0.00 ? 26  LEU A HG   2  
ATOM   4813   H  HD11 . LEU A 1 26  ? 5.197   11.245  -0.611  1.00 0.00 ? 26  LEU A HD11 2  
ATOM   4814   H  HD12 . LEU A 1 26  ? 6.732   10.764  -1.329  1.00 0.00 ? 26  LEU A HD12 2  
ATOM   4815   H  HD13 . LEU A 1 26  ? 5.464   11.454  -2.340  1.00 0.00 ? 26  LEU A HD13 2  
ATOM   4816   H  HD21 . LEU A 1 26  ? 5.477   12.701  0.778   1.00 0.00 ? 26  LEU A HD21 2  
ATOM   4817   H  HD22 . LEU A 1 26  ? 4.889   14.021  -0.233  1.00 0.00 ? 26  LEU A HD22 2  
ATOM   4818   H  HD23 . LEU A 1 26  ? 6.427   14.172  0.604   1.00 0.00 ? 26  LEU A HD23 2  
ATOM   4819   N  N    . ILE A 1 27  ? 10.998  13.891  -0.371  1.00 0.00 ? 27  ILE A N    2  
ATOM   4820   C  CA   . ILE A 1 27  ? 12.418  13.737  -0.792  1.00 0.00 ? 27  ILE A CA   2  
ATOM   4821   C  C    . ILE A 1 27  ? 12.925  12.400  -0.250  1.00 0.00 ? 27  ILE A C    2  
ATOM   4822   O  O    . ILE A 1 27  ? 12.592  12.010  0.851   1.00 0.00 ? 27  ILE A O    2  
ATOM   4823   C  CB   . ILE A 1 27  ? 13.258  14.881  -0.223  1.00 0.00 ? 27  ILE A CB   2  
ATOM   4824   C  CG1  . ILE A 1 27  ? 12.537  16.211  -0.457  1.00 0.00 ? 27  ILE A CG1  2  
ATOM   4825   C  CG2  . ILE A 1 27  ? 14.617  14.913  -0.923  1.00 0.00 ? 27  ILE A CG2  2  
ATOM   4826   C  CD1  . ILE A 1 27  ? 13.318  17.343  0.214   1.00 0.00 ? 27  ILE A CD1  2  
ATOM   4827   H  H    . ILE A 1 27  ? 10.763  13.849  0.579   1.00 0.00 ? 27  ILE A H    2  
ATOM   4828   H  HA   . ILE A 1 27  ? 12.480  13.738  -1.870  1.00 0.00 ? 27  ILE A HA   2  
ATOM   4829   H  HB   . ILE A 1 27  ? 13.405  14.731  0.837   1.00 0.00 ? 27  ILE A HB   2  
ATOM   4830   H  HG12 . ILE A 1 27  ? 12.468  16.400  -1.519  1.00 0.00 ? 27  ILE A HG12 2  
ATOM   4831   H  HG13 . ILE A 1 27  ? 11.545  16.162  -0.035  1.00 0.00 ? 27  ILE A HG13 2  
ATOM   4832   H  HG21 . ILE A 1 27  ? 14.626  15.707  -1.656  1.00 0.00 ? 27  ILE A HG21 2  
ATOM   4833   H  HG22 . ILE A 1 27  ? 14.790  13.967  -1.415  1.00 0.00 ? 27  ILE A HG22 2  
ATOM   4834   H  HG23 . ILE A 1 27  ? 15.395  15.088  -0.195  1.00 0.00 ? 27  ILE A HG23 2  
ATOM   4835   H  HD11 . ILE A 1 27  ? 13.267  17.228  1.287   1.00 0.00 ? 27  ILE A HD11 2  
ATOM   4836   H  HD12 . ILE A 1 27  ? 12.888  18.292  -0.068  1.00 0.00 ? 27  ILE A HD12 2  
ATOM   4837   H  HD13 . ILE A 1 27  ? 14.349  17.306  -0.104  1.00 0.00 ? 27  ILE A HD13 2  
ATOM   4838   N  N    . ILE A 1 28  ? 13.710  11.685  -1.012  1.00 0.00 ? 28  ILE A N    2  
ATOM   4839   C  CA   . ILE A 1 28  ? 14.213  10.365  -0.530  1.00 0.00 ? 28  ILE A CA   2  
ATOM   4840   C  C    . ILE A 1 28  ? 15.741  10.363  -0.503  1.00 0.00 ? 28  ILE A C    2  
ATOM   4841   O  O    . ILE A 1 28  ? 16.390  10.517  -1.517  1.00 0.00 ? 28  ILE A O    2  
ATOM   4842   C  CB   . ILE A 1 28  ? 13.722  9.264   -1.470  1.00 0.00 ? 28  ILE A CB   2  
ATOM   4843   C  CG1  . ILE A 1 28  ? 12.212  9.405   -1.667  1.00 0.00 ? 28  ILE A CG1  2  
ATOM   4844   C  CG2  . ILE A 1 28  ? 14.032  7.897   -0.858  1.00 0.00 ? 28  ILE A CG2  2  
ATOM   4845   C  CD1  . ILE A 1 28  ? 11.725  8.346   -2.658  1.00 0.00 ? 28  ILE A CD1  2  
ATOM   4846   H  H    . ILE A 1 28  ? 13.962  12.008  -1.903  1.00 0.00 ? 28  ILE A H    2  
ATOM   4847   H  HA   . ILE A 1 28  ? 13.841  10.175  0.463   1.00 0.00 ? 28  ILE A HA   2  
ATOM   4848   H  HB   . ILE A 1 28  ? 14.223  9.354   -2.422  1.00 0.00 ? 28  ILE A HB   2  
ATOM   4849   H  HG12 . ILE A 1 28  ? 11.712  9.268   -0.719  1.00 0.00 ? 28  ILE A HG12 2  
ATOM   4850   H  HG13 . ILE A 1 28  ? 11.988  10.388  -2.054  1.00 0.00 ? 28  ILE A HG13 2  
ATOM   4851   H  HG21 . ILE A 1 28  ? 14.559  8.032   0.075   1.00 0.00 ? 28  ILE A HG21 2  
ATOM   4852   H  HG22 . ILE A 1 28  ? 14.644  7.327   -1.541  1.00 0.00 ? 28  ILE A HG22 2  
ATOM   4853   H  HG23 . ILE A 1 28  ? 13.108  7.368   -0.676  1.00 0.00 ? 28  ILE A HG23 2  
ATOM   4854   H  HD11 . ILE A 1 28  ? 12.333  8.382   -3.550  1.00 0.00 ? 28  ILE A HD11 2  
ATOM   4855   H  HD12 . ILE A 1 28  ? 10.695  8.541   -2.917  1.00 0.00 ? 28  ILE A HD12 2  
ATOM   4856   H  HD13 . ILE A 1 28  ? 11.805  7.368   -2.208  1.00 0.00 ? 28  ILE A HD13 2  
ATOM   4857   N  N    . HIS A 1 29  ? 16.315  10.178  0.655   1.00 0.00 ? 29  HIS A N    2  
ATOM   4858   C  CA   . HIS A 1 29  ? 17.801  10.151  0.768   1.00 0.00 ? 29  HIS A CA   2  
ATOM   4859   C  C    . HIS A 1 29  ? 18.237  8.767   1.264   1.00 0.00 ? 29  HIS A C    2  
ATOM   4860   O  O    . HIS A 1 29  ? 17.490  8.087   1.938   1.00 0.00 ? 29  HIS A O    2  
ATOM   4861   C  CB   . HIS A 1 29  ? 18.251  11.204  1.787   1.00 0.00 ? 29  HIS A CB   2  
ATOM   4862   C  CG   . HIS A 1 29  ? 18.316  12.558  1.136   1.00 0.00 ? 29  HIS A CG   2  
ATOM   4863   N  ND1  . HIS A 1 29  ? 19.497  13.081  0.632   1.00 0.00 ? 29  HIS A ND1  2  
ATOM   4864   C  CD2  . HIS A 1 29  ? 17.358  13.518  0.920   1.00 0.00 ? 29  HIS A CD2  2  
ATOM   4865   C  CE1  . HIS A 1 29  ? 19.222  14.304  0.143   1.00 0.00 ? 29  HIS A CE1  2  
ATOM   4866   N  NE2  . HIS A 1 29  ? 17.932  14.620  0.293   1.00 0.00 ? 29  HIS A NE2  2  
ATOM   4867   H  H    . HIS A 1 29  ? 15.764  10.048  1.455   1.00 0.00 ? 29  HIS A H    2  
ATOM   4868   H  HA   . HIS A 1 29  ? 18.245  10.358  -0.196  1.00 0.00 ? 29  HIS A HA   2  
ATOM   4869   H  HB2  . HIS A 1 29  ? 17.546  11.234  2.604   1.00 0.00 ? 29  HIS A HB2  2  
ATOM   4870   H  HB3  . HIS A 1 29  ? 19.226  10.942  2.167   1.00 0.00 ? 29  HIS A HB3  2  
ATOM   4871   H  HD1  . HIS A 1 29  ? 20.372  12.640  0.632   1.00 0.00 ? 29  HIS A HD1  2  
ATOM   4872   H  HD2  . HIS A 1 29  ? 16.317  13.430  1.194   1.00 0.00 ? 29  HIS A HD2  2  
ATOM   4873   H  HE1  . HIS A 1 29  ? 19.954  14.953  -0.313  1.00 0.00 ? 29  HIS A HE1  2  
ATOM   4874   N  N    . PRO A 1 30  ? 19.439  8.360   0.950   1.00 0.00 ? 30  PRO A N    2  
ATOM   4875   C  CA   . PRO A 1 30  ? 19.975  7.041   1.394   1.00 0.00 ? 30  PRO A CA   2  
ATOM   4876   C  C    . PRO A 1 30  ? 20.220  7.022   2.907   1.00 0.00 ? 30  PRO A C    2  
ATOM   4877   O  O    . PRO A 1 30  ? 20.256  8.056   3.545   1.00 0.00 ? 30  PRO A O    2  
ATOM   4878   C  CB   . PRO A 1 30  ? 21.296  6.898   0.632   1.00 0.00 ? 30  PRO A CB   2  
ATOM   4879   C  CG   . PRO A 1 30  ? 21.702  8.289   0.270   1.00 0.00 ? 30  PRO A CG   2  
ATOM   4880   C  CD   . PRO A 1 30  ? 20.417  9.106   0.141   1.00 0.00 ? 30  PRO A CD   2  
ATOM   4881   H  HA   . PRO A 1 30  ? 19.302  6.245   1.109   1.00 0.00 ? 30  PRO A HA   2  
ATOM   4882   H  HB2  . PRO A 1 30  ? 22.044  6.439   1.265   1.00 0.00 ? 30  PRO A HB2  2  
ATOM   4883   H  HB3  . PRO A 1 30  ? 21.151  6.312   -0.263  1.00 0.00 ? 30  PRO A HB3  2  
ATOM   4884   H  HG2  . PRO A 1 30  ? 22.332  8.702   1.047   1.00 0.00 ? 30  PRO A HG2  2  
ATOM   4885   H  HG3  . PRO A 1 30  ? 22.228  8.288   -0.672  1.00 0.00 ? 30  PRO A HG3  2  
ATOM   4886   H  HD2  . PRO A 1 30  ? 20.562  10.101  0.537   1.00 0.00 ? 30  PRO A HD2  2  
ATOM   4887   H  HD3  . PRO A 1 30  ? 20.095  9.147   -0.887  1.00 0.00 ? 30  PRO A HD3  2  
ATOM   4888   N  N    . GLU A 1 31  ? 20.381  5.864   3.489   1.00 0.00 ? 31  GLU A N    2  
ATOM   4889   C  CA   . GLU A 1 31  ? 20.616  5.800   4.962   1.00 0.00 ? 31  GLU A CA   2  
ATOM   4890   C  C    . GLU A 1 31  ? 21.764  4.836   5.263   1.00 0.00 ? 31  GLU A C    2  
ATOM   4891   O  O    . GLU A 1 31  ? 22.395  4.308   4.368   1.00 0.00 ? 31  GLU A O    2  
ATOM   4892   C  CB   . GLU A 1 31  ? 19.343  5.316   5.658   1.00 0.00 ? 31  GLU A CB   2  
ATOM   4893   C  CG   . GLU A 1 31  ? 18.474  6.521   6.019   1.00 0.00 ? 31  GLU A CG   2  
ATOM   4894   C  CD   . GLU A 1 31  ? 19.072  7.239   7.231   1.00 0.00 ? 31  GLU A CD   2  
ATOM   4895   O  OE1  . GLU A 1 31  ? 20.042  6.737   7.773   1.00 0.00 ? 31  GLU A OE1  2  
ATOM   4896   O  OE2  . GLU A 1 31  ? 18.551  8.280   7.595   1.00 0.00 ? 31  GLU A OE2  2  
ATOM   4897   H  H    . GLU A 1 31  ? 20.343  5.039   2.961   1.00 0.00 ? 31  GLU A H    2  
ATOM   4898   H  HA   . GLU A 1 31  ? 20.871  6.783   5.329   1.00 0.00 ? 31  GLU A HA   2  
ATOM   4899   H  HB2  . GLU A 1 31  ? 18.796  4.663   4.993   1.00 0.00 ? 31  GLU A HB2  2  
ATOM   4900   H  HB3  . GLU A 1 31  ? 19.605  4.779   6.558   1.00 0.00 ? 31  GLU A HB3  2  
ATOM   4901   H  HG2  . GLU A 1 31  ? 18.437  7.199   5.179   1.00 0.00 ? 31  GLU A HG2  2  
ATOM   4902   H  HG3  . GLU A 1 31  ? 17.476  6.187   6.257   1.00 0.00 ? 31  GLU A HG3  2  
ATOM   4903   N  N    . LYS A 1 32  ? 22.043  4.605   6.517   1.00 0.00 ? 32  LYS A N    2  
ATOM   4904   C  CA   . LYS A 1 32  ? 23.153  3.678   6.872   1.00 0.00 ? 32  LYS A CA   2  
ATOM   4905   C  C    . LYS A 1 32  ? 22.605  2.261   7.037   1.00 0.00 ? 32  LYS A C    2  
ATOM   4906   O  O    . LYS A 1 32  ? 21.428  2.060   7.255   1.00 0.00 ? 32  LYS A O    2  
ATOM   4907   C  CB   . LYS A 1 32  ? 23.803  4.132   8.181   1.00 0.00 ? 32  LYS A CB   2  
ATOM   4908   C  CG   . LYS A 1 32  ? 25.303  3.840   8.132   1.00 0.00 ? 32  LYS A CG   2  
ATOM   4909   C  CD   . LYS A 1 32  ? 25.873  3.835   9.552   1.00 0.00 ? 32  LYS A CD   2  
ATOM   4910   C  CE   . LYS A 1 32  ? 27.353  3.449   9.507   1.00 0.00 ? 32  LYS A CE   2  
ATOM   4911   N  NZ   . LYS A 1 32  ? 27.481  2.010   9.140   1.00 0.00 ? 32  LYS A NZ   2  
ATOM   4912   H  H    . LYS A 1 32  ? 21.524  5.042   7.223   1.00 0.00 ? 32  LYS A H    2  
ATOM   4913   H  HA   . LYS A 1 32  ? 23.892  3.687   6.084   1.00 0.00 ? 32  LYS A HA   2  
ATOM   4914   H  HB2  . LYS A 1 32  ? 23.645  5.193   8.312   1.00 0.00 ? 32  LYS A HB2  2  
ATOM   4915   H  HB3  . LYS A 1 32  ? 23.360  3.596   9.008   1.00 0.00 ? 32  LYS A HB3  2  
ATOM   4916   H  HG2  . LYS A 1 32  ? 25.466  2.874   7.676   1.00 0.00 ? 32  LYS A HG2  2  
ATOM   4917   H  HG3  . LYS A 1 32  ? 25.800  4.601   7.551   1.00 0.00 ? 32  LYS A HG3  2  
ATOM   4918   H  HD2  . LYS A 1 32  ? 25.769  4.820   9.984   1.00 0.00 ? 32  LYS A HD2  2  
ATOM   4919   H  HD3  . LYS A 1 32  ? 25.334  3.118   10.154  1.00 0.00 ? 32  LYS A HD3  2  
ATOM   4920   H  HE2  . LYS A 1 32  ? 27.860  4.054   8.770   1.00 0.00 ? 32  LYS A HE2  2  
ATOM   4921   H  HE3  . LYS A 1 32  ? 27.798  3.615   10.476  1.00 0.00 ? 32  LYS A HE3  2  
ATOM   4922   H  HZ1  . LYS A 1 32  ? 28.473  1.795   8.916   1.00 0.00 ? 32  LYS A HZ1  2  
ATOM   4923   H  HZ2  . LYS A 1 32  ? 26.886  1.809   8.310   1.00 0.00 ? 32  LYS A HZ2  2  
ATOM   4924   H  HZ3  . LYS A 1 32  ? 27.174  1.420   9.939   1.00 0.00 ? 32  LYS A HZ3  2  
ATOM   4925   N  N    . GLU A 1 33  ? 23.452  1.278   6.925   1.00 0.00 ? 33  GLU A N    2  
ATOM   4926   C  CA   . GLU A 1 33  ? 22.990  -0.131  7.064   1.00 0.00 ? 33  GLU A CA   2  
ATOM   4927   C  C    . GLU A 1 33  ? 22.188  -0.308  8.359   1.00 0.00 ? 33  GLU A C    2  
ATOM   4928   O  O    . GLU A 1 33  ? 22.482  0.287   9.377   1.00 0.00 ? 33  GLU A O    2  
ATOM   4929   C  CB   . GLU A 1 33  ? 24.208  -1.057  7.095   1.00 0.00 ? 33  GLU A CB   2  
ATOM   4930   C  CG   . GLU A 1 33  ? 24.574  -1.482  5.671   1.00 0.00 ? 33  GLU A CG   2  
ATOM   4931   C  CD   . GLU A 1 33  ? 25.755  -2.453  5.717   1.00 0.00 ? 33  GLU A CD   2  
ATOM   4932   O  OE1  . GLU A 1 33  ? 26.376  -2.550  6.762   1.00 0.00 ? 33  GLU A OE1  2  
ATOM   4933   O  OE2  . GLU A 1 33  ? 26.016  -3.085  4.706   1.00 0.00 ? 33  GLU A OE2  2  
ATOM   4934   H  H    . GLU A 1 33  ? 24.395  1.467   6.739   1.00 0.00 ? 33  GLU A H    2  
ATOM   4935   H  HA   . GLU A 1 33  ? 22.369  -0.389  6.220   1.00 0.00 ? 33  GLU A HA   2  
ATOM   4936   H  HB2  . GLU A 1 33  ? 25.044  -0.536  7.541   1.00 0.00 ? 33  GLU A HB2  2  
ATOM   4937   H  HB3  . GLU A 1 33  ? 23.977  -1.933  7.682   1.00 0.00 ? 33  GLU A HB3  2  
ATOM   4938   H  HG2  . GLU A 1 33  ? 23.725  -1.966  5.212   1.00 0.00 ? 33  GLU A HG2  2  
ATOM   4939   H  HG3  . GLU A 1 33  ? 24.848  -0.614  5.091   1.00 0.00 ? 33  GLU A HG3  2  
ATOM   4940   N  N    . GLY A 1 34  ? 21.192  -1.154  8.324   1.00 0.00 ? 34  GLY A N    2  
ATOM   4941   C  CA   . GLY A 1 34  ? 20.374  -1.424  9.543   1.00 0.00 ? 34  GLY A CA   2  
ATOM   4942   C  C    . GLY A 1 34  ? 19.617  -0.176  10.010  1.00 0.00 ? 34  GLY A C    2  
ATOM   4943   O  O    . GLY A 1 34  ? 19.241  -0.080  11.162  1.00 0.00 ? 34  GLY A O    2  
ATOM   4944   H  H    . GLY A 1 34  ? 21.000  -1.638  7.496   1.00 0.00 ? 34  GLY A H    2  
ATOM   4945   H  HA2  . GLY A 1 34  ? 19.661  -2.205  9.320   1.00 0.00 ? 34  GLY A HA2  2  
ATOM   4946   H  HA3  . GLY A 1 34  ? 21.025  -1.758  10.336  1.00 0.00 ? 34  GLY A HA3  2  
ATOM   4947   N  N    . THR A 1 35  ? 19.362  0.774   9.151   1.00 0.00 ? 35  THR A N    2  
ATOM   4948   C  CA   . THR A 1 35  ? 18.604  1.976   9.604   1.00 0.00 ? 35  THR A CA   2  
ATOM   4949   C  C    . THR A 1 35  ? 17.105  1.660   9.593   1.00 0.00 ? 35  THR A C    2  
ATOM   4950   O  O    . THR A 1 35  ? 16.390  1.951   10.532  1.00 0.00 ? 35  THR A O    2  
ATOM   4951   C  CB   . THR A 1 35  ? 18.887  3.155   8.671   1.00 0.00 ? 35  THR A CB   2  
ATOM   4952   O  OG1  . THR A 1 35  ? 20.279  3.441   8.682   1.00 0.00 ? 35  THR A OG1  2  
ATOM   4953   C  CG2  . THR A 1 35  ? 18.108  4.380   9.149   1.00 0.00 ? 35  THR A CG2  2  
ATOM   4954   H  H    . THR A 1 35  ? 19.641  0.701   8.214   1.00 0.00 ? 35  THR A H    2  
ATOM   4955   H  HA   . THR A 1 35  ? 18.908  2.232   10.608  1.00 0.00 ? 35  THR A HA   2  
ATOM   4956   H  HB   . THR A 1 35  ? 18.577  2.905   7.671   1.00 0.00 ? 35  THR A HB   2  
ATOM   4957   H  HG1  . THR A 1 35  ? 20.385  4.393   8.728   1.00 0.00 ? 35  THR A HG1  2  
ATOM   4958   H  HG21 . THR A 1 35  ? 18.079  4.392   10.228  1.00 0.00 ? 35  THR A HG21 2  
ATOM   4959   H  HG22 . THR A 1 35  ? 17.102  4.340   8.761   1.00 0.00 ? 35  THR A HG22 2  
ATOM   4960   H  HG23 . THR A 1 35  ? 18.594  5.277   8.793   1.00 0.00 ? 35  THR A HG23 2  
ATOM   4961   N  N    . GLY A 1 36  ? 16.625  1.062   8.533   1.00 0.00 ? 36  GLY A N    2  
ATOM   4962   C  CA   . GLY A 1 36  ? 15.174  0.721   8.454   1.00 0.00 ? 36  GLY A CA   2  
ATOM   4963   C  C    . GLY A 1 36  ? 14.440  1.772   7.615   1.00 0.00 ? 36  GLY A C    2  
ATOM   4964   O  O    . GLY A 1 36  ? 15.050  2.623   6.993   1.00 0.00 ? 36  GLY A O    2  
ATOM   4965   H  H    . GLY A 1 36  ? 17.221  0.836   7.789   1.00 0.00 ? 36  GLY A H    2  
ATOM   4966   H  HA2  . GLY A 1 36  ? 15.059  -0.250  7.994   1.00 0.00 ? 36  GLY A HA2  2  
ATOM   4967   H  HA3  . GLY A 1 36  ? 14.753  0.702   9.447   1.00 0.00 ? 36  GLY A HA3  2  
ATOM   4968   N  N    . ILE A 1 37  ? 13.133  1.721   7.592   1.00 0.00 ? 37  ILE A N    2  
ATOM   4969   C  CA   . ILE A 1 37  ? 12.358  2.718   6.801   1.00 0.00 ? 37  ILE A CA   2  
ATOM   4970   C  C    . ILE A 1 37  ? 11.910  3.835   7.741   1.00 0.00 ? 37  ILE A C    2  
ATOM   4971   O  O    . ILE A 1 37  ? 11.260  3.582   8.737   1.00 0.00 ? 37  ILE A O    2  
ATOM   4972   C  CB   . ILE A 1 37  ? 11.113  2.048   6.204   1.00 0.00 ? 37  ILE A CB   2  
ATOM   4973   C  CG1  . ILE A 1 37  ? 11.503  0.761   5.466   1.00 0.00 ? 37  ILE A CG1  2  
ATOM   4974   C  CG2  . ILE A 1 37  ? 10.440  3.009   5.224   1.00 0.00 ? 37  ILE A CG2  2  
ATOM   4975   C  CD1  . ILE A 1 37  ? 11.942  1.100   4.043   1.00 0.00 ? 37  ILE A CD1  2  
ATOM   4976   H  H    . ILE A 1 37  ? 12.653  1.032   8.096   1.00 0.00 ? 37  ILE A H    2  
ATOM   4977   H  HA   . ILE A 1 37  ? 12.973  3.122   6.011   1.00 0.00 ? 37  ILE A HA   2  
ATOM   4978   H  HB   . ILE A 1 37  ? 10.421  1.811   7.001   1.00 0.00 ? 37  ILE A HB   2  
ATOM   4979   H  HG12 . ILE A 1 37  ? 12.312  0.273   5.987   1.00 0.00 ? 37  ILE A HG12 2  
ATOM   4980   H  HG13 . ILE A 1 37  ? 10.650  0.099   5.428   1.00 0.00 ? 37  ILE A HG13 2  
ATOM   4981   H  HG21 . ILE A 1 37  ? 9.906   3.769   5.774   1.00 0.00 ? 37  ILE A HG21 2  
ATOM   4982   H  HG22 . ILE A 1 37  ? 9.747   2.462   4.602   1.00 0.00 ? 37  ILE A HG22 2  
ATOM   4983   H  HG23 . ILE A 1 37  ? 11.191  3.475   4.602   1.00 0.00 ? 37  ILE A HG23 2  
ATOM   4984   H  HD11 . ILE A 1 37  ? 12.486  2.030   4.049   1.00 0.00 ? 37  ILE A HD11 2  
ATOM   4985   H  HD12 . ILE A 1 37  ? 11.073  1.196   3.409   1.00 0.00 ? 37  ILE A HD12 2  
ATOM   4986   H  HD13 . ILE A 1 37  ? 12.577  0.314   3.667   1.00 0.00 ? 37  ILE A HD13 2  
ATOM   4987   N  N    . ARG A 1 38  ? 12.250  5.063   7.456   1.00 0.00 ? 38  ARG A N    2  
ATOM   4988   C  CA   . ARG A 1 38  ? 11.823  6.157   8.376   1.00 0.00 ? 38  ARG A CA   2  
ATOM   4989   C  C    . ARG A 1 38  ? 11.436  7.410   7.595   1.00 0.00 ? 38  ARG A C    2  
ATOM   4990   O  O    . ARG A 1 38  ? 12.076  7.788   6.634   1.00 0.00 ? 38  ARG A O    2  
ATOM   4991   C  CB   . ARG A 1 38  ? 12.962  6.490   9.340   1.00 0.00 ? 38  ARG A CB   2  
ATOM   4992   C  CG   . ARG A 1 38  ? 14.304  6.343   8.622   1.00 0.00 ? 38  ARG A CG   2  
ATOM   4993   C  CD   . ARG A 1 38  ? 15.409  6.981   9.466   1.00 0.00 ? 38  ARG A CD   2  
ATOM   4994   N  NE   . ARG A 1 38  ? 14.974  7.048   10.890  1.00 0.00 ? 38  ARG A NE   2  
ATOM   4995   C  CZ   . ARG A 1 38  ? 15.692  7.701   11.761  1.00 0.00 ? 38  ARG A CZ   2  
ATOM   4996   N  NH1  . ARG A 1 38  ? 16.788  8.304   11.385  1.00 0.00 ? 38  ARG A NH1  2  
ATOM   4997   N  NH2  . ARG A 1 38  ? 15.316  7.753   13.010  1.00 0.00 ? 38  ARG A NH2  2  
ATOM   4998   H  H    . ARG A 1 38  ? 12.782  5.262   6.655   1.00 0.00 ? 38  ARG A H    2  
ATOM   4999   H  HA   . ARG A 1 38  ? 10.969  5.827   8.944   1.00 0.00 ? 38  ARG A HA   2  
ATOM   5000   H  HB2  . ARG A 1 38  ? 12.850  7.505   9.691   1.00 0.00 ? 38  ARG A HB2  2  
ATOM   5001   H  HB3  . ARG A 1 38  ? 12.929  5.814   10.180  1.00 0.00 ? 38  ARG A HB3  2  
ATOM   5002   H  HG2  . ARG A 1 38  ? 14.520  5.295   8.475   1.00 0.00 ? 38  ARG A HG2  2  
ATOM   5003   H  HG3  . ARG A 1 38  ? 14.255  6.839   7.664   1.00 0.00 ? 38  ARG A HG3  2  
ATOM   5004   H  HD2  . ARG A 1 38  ? 16.306  6.385   9.395   1.00 0.00 ? 38  ARG A HD2  2  
ATOM   5005   H  HD3  . ARG A 1 38  ? 15.610  7.978   9.104   1.00 0.00 ? 38  ARG A HD3  2  
ATOM   5006   H  HE   . ARG A 1 38  ? 14.150  6.602   11.172  1.00 0.00 ? 38  ARG A HE   2  
ATOM   5007   H  HH11 . ARG A 1 38  ? 17.075  8.264   10.428  1.00 0.00 ? 38  ARG A HH11 2  
ATOM   5008   H  HH12 . ARG A 1 38  ? 17.338  8.804   12.052  1.00 0.00 ? 38  ARG A HH12 2  
ATOM   5009   H  HH21 . ARG A 1 38  ? 14.476  7.292   13.299  1.00 0.00 ? 38  ARG A HH21 2  
ATOM   5010   H  HH22 . ARG A 1 38  ? 15.866  8.254   13.678  1.00 0.00 ? 38  ARG A HH22 2  
ATOM   5011   N  N    . PHE A 1 39  ? 10.396  8.065   8.030   1.00 0.00 ? 39  PHE A N    2  
ATOM   5012   C  CA   . PHE A 1 39  ? 9.952   9.312   7.354   1.00 0.00 ? 39  PHE A CA   2  
ATOM   5013   C  C    . PHE A 1 39  ? 10.452  10.502  8.169   1.00 0.00 ? 39  PHE A C    2  
ATOM   5014   O  O    . PHE A 1 39  ? 10.647  10.401  9.363   1.00 0.00 ? 39  PHE A O    2  
ATOM   5015   C  CB   . PHE A 1 39  ? 8.423   9.350   7.287   1.00 0.00 ? 39  PHE A CB   2  
ATOM   5016   C  CG   . PHE A 1 39  ? 7.931   8.349   6.270   1.00 0.00 ? 39  PHE A CG   2  
ATOM   5017   C  CD1  . PHE A 1 39  ? 7.851   8.708   4.921   1.00 0.00 ? 39  PHE A CD1  2  
ATOM   5018   C  CD2  . PHE A 1 39  ? 7.552   7.063   6.677   1.00 0.00 ? 39  PHE A CD2  2  
ATOM   5019   C  CE1  . PHE A 1 39  ? 7.394   7.781   3.976   1.00 0.00 ? 39  PHE A CE1  2  
ATOM   5020   C  CE2  . PHE A 1 39  ? 7.094   6.138   5.732   1.00 0.00 ? 39  PHE A CE2  2  
ATOM   5021   C  CZ   . PHE A 1 39  ? 7.015   6.496   4.381   1.00 0.00 ? 39  PHE A CZ   2  
ATOM   5022   H  H    . PHE A 1 39  ? 9.912   7.741   8.819   1.00 0.00 ? 39  PHE A H    2  
ATOM   5023   H  HA   . PHE A 1 39  ? 10.364  9.354   6.356   1.00 0.00 ? 39  PHE A HA   2  
ATOM   5024   H  HB2  . PHE A 1 39  ? 8.016   9.110   8.257   1.00 0.00 ? 39  PHE A HB2  2  
ATOM   5025   H  HB3  . PHE A 1 39  ? 8.102   10.340  6.999   1.00 0.00 ? 39  PHE A HB3  2  
ATOM   5026   H  HD1  . PHE A 1 39  ? 8.144   9.699   4.607   1.00 0.00 ? 39  PHE A HD1  2  
ATOM   5027   H  HD2  . PHE A 1 39  ? 7.612   6.785   7.720   1.00 0.00 ? 39  PHE A HD2  2  
ATOM   5028   H  HE1  . PHE A 1 39  ? 7.332   8.058   2.933   1.00 0.00 ? 39  PHE A HE1  2  
ATOM   5029   H  HE2  . PHE A 1 39  ? 6.802   5.146   6.044   1.00 0.00 ? 39  PHE A HE2  2  
ATOM   5030   H  HZ   . PHE A 1 39  ? 6.662   5.782   3.652   1.00 0.00 ? 39  PHE A HZ   2  
ATOM   5031   N  N    . PHE A 1 40  ? 10.672  11.619  7.541   1.00 0.00 ? 40  PHE A N    2  
ATOM   5032   C  CA   . PHE A 1 40  ? 11.172  12.805  8.291   1.00 0.00 ? 40  PHE A CA   2  
ATOM   5033   C  C    . PHE A 1 40  ? 10.343  14.031  7.920   1.00 0.00 ? 40  PHE A C    2  
ATOM   5034   O  O    . PHE A 1 40  ? 10.020  14.250  6.770   1.00 0.00 ? 40  PHE A O    2  
ATOM   5035   C  CB   . PHE A 1 40  ? 12.636  13.045  7.925   1.00 0.00 ? 40  PHE A CB   2  
ATOM   5036   C  CG   . PHE A 1 40  ? 13.054  14.441  8.319   1.00 0.00 ? 40  PHE A CG   2  
ATOM   5037   C  CD1  . PHE A 1 40  ? 12.671  15.538  7.536   1.00 0.00 ? 40  PHE A CD1  2  
ATOM   5038   C  CD2  . PHE A 1 40  ? 13.838  14.638  9.462   1.00 0.00 ? 40  PHE A CD2  2  
ATOM   5039   C  CE1  . PHE A 1 40  ? 13.068  16.831  7.899   1.00 0.00 ? 40  PHE A CE1  2  
ATOM   5040   C  CE2  . PHE A 1 40  ? 14.236  15.930  9.824   1.00 0.00 ? 40  PHE A CE2  2  
ATOM   5041   C  CZ   . PHE A 1 40  ? 13.852  17.027  9.043   1.00 0.00 ? 40  PHE A CZ   2  
ATOM   5042   H  H    . PHE A 1 40  ? 10.520  11.675  6.575   1.00 0.00 ? 40  PHE A H    2  
ATOM   5043   H  HA   . PHE A 1 40  ? 11.090  12.622  9.353   1.00 0.00 ? 40  PHE A HA   2  
ATOM   5044   H  HB2  . PHE A 1 40  ? 13.251  12.330  8.447   1.00 0.00 ? 40  PHE A HB2  2  
ATOM   5045   H  HB3  . PHE A 1 40  ? 12.763  12.918  6.859   1.00 0.00 ? 40  PHE A HB3  2  
ATOM   5046   H  HD1  . PHE A 1 40  ? 12.068  15.388  6.654   1.00 0.00 ? 40  PHE A HD1  2  
ATOM   5047   H  HD2  . PHE A 1 40  ? 14.133  13.793  10.065  1.00 0.00 ? 40  PHE A HD2  2  
ATOM   5048   H  HE1  . PHE A 1 40  ? 12.771  17.677  7.296   1.00 0.00 ? 40  PHE A HE1  2  
ATOM   5049   H  HE2  . PHE A 1 40  ? 14.841  16.080  10.706  1.00 0.00 ? 40  PHE A HE2  2  
ATOM   5050   H  HZ   . PHE A 1 40  ? 14.160  18.024  9.321   1.00 0.00 ? 40  PHE A HZ   2  
ATOM   5051   N  N    . LYS A 1 41  ? 9.994   14.833  8.884   1.00 0.00 ? 41  LYS A N    2  
ATOM   5052   C  CA   . LYS A 1 41  ? 9.183   16.044  8.582   1.00 0.00 ? 41  LYS A CA   2  
ATOM   5053   C  C    . LYS A 1 41  ? 9.207   16.988  9.787   1.00 0.00 ? 41  LYS A C    2  
ATOM   5054   O  O    . LYS A 1 41  ? 9.137   16.565  10.923  1.00 0.00 ? 41  LYS A O    2  
ATOM   5055   C  CB   . LYS A 1 41  ? 7.741   15.626  8.277   1.00 0.00 ? 41  LYS A CB   2  
ATOM   5056   C  CG   . LYS A 1 41  ? 6.765   16.676  8.817   1.00 0.00 ? 41  LYS A CG   2  
ATOM   5057   C  CD   . LYS A 1 41  ? 5.379   16.442  8.216   1.00 0.00 ? 41  LYS A CD   2  
ATOM   5058   C  CE   . LYS A 1 41  ? 4.342   17.236  9.012   1.00 0.00 ? 41  LYS A CE   2  
ATOM   5059   N  NZ   . LYS A 1 41  ? 3.088   17.353  8.216   1.00 0.00 ? 41  LYS A NZ   2  
ATOM   5060   H  H    . LYS A 1 41  ? 10.260  14.642  9.808   1.00 0.00 ? 41  LYS A H    2  
ATOM   5061   H  HA   . LYS A 1 41  ? 9.600   16.549  7.723   1.00 0.00 ? 41  LYS A HA   2  
ATOM   5062   H  HB2  . LYS A 1 41  ? 7.613   15.535  7.208   1.00 0.00 ? 41  LYS A HB2  2  
ATOM   5063   H  HB3  . LYS A 1 41  ? 7.535   14.675  8.745   1.00 0.00 ? 41  LYS A HB3  2  
ATOM   5064   H  HG2  . LYS A 1 41  ? 6.707   16.595  9.893   1.00 0.00 ? 41  LYS A HG2  2  
ATOM   5065   H  HG3  . LYS A 1 41  ? 7.108   17.663  8.546   1.00 0.00 ? 41  LYS A HG3  2  
ATOM   5066   H  HD2  . LYS A 1 41  ? 5.373   16.770  7.186   1.00 0.00 ? 41  LYS A HD2  2  
ATOM   5067   H  HD3  . LYS A 1 41  ? 5.138   15.391  8.263   1.00 0.00 ? 41  LYS A HD3  2  
ATOM   5068   H  HE2  . LYS A 1 41  ? 4.133   16.725  9.940   1.00 0.00 ? 41  LYS A HE2  2  
ATOM   5069   H  HE3  . LYS A 1 41  ? 4.728   18.222  9.223   1.00 0.00 ? 41  LYS A HE3  2  
ATOM   5070   H  HZ1  . LYS A 1 41  ? 2.400   16.649  8.547   1.00 0.00 ? 41  LYS A HZ1  2  
ATOM   5071   H  HZ2  . LYS A 1 41  ? 3.300   17.187  7.210   1.00 0.00 ? 41  LYS A HZ2  2  
ATOM   5072   H  HZ3  . LYS A 1 41  ? 2.690   18.307  8.333   1.00 0.00 ? 41  LYS A HZ3  2  
ATOM   5073   N  N    . ASN A 1 42  ? 9.299   18.265  9.543   1.00 0.00 ? 42  ASN A N    2  
ATOM   5074   C  CA   . ASN A 1 42  ? 9.321   19.248  10.665  1.00 0.00 ? 42  ASN A CA   2  
ATOM   5075   C  C    . ASN A 1 42  ? 10.451  18.914  11.643  1.00 0.00 ? 42  ASN A C    2  
ATOM   5076   O  O    . ASN A 1 42  ? 10.366  19.202  12.820  1.00 0.00 ? 42  ASN A O    2  
ATOM   5077   C  CB   . ASN A 1 42  ? 7.983   19.204  11.406  1.00 0.00 ? 42  ASN A CB   2  
ATOM   5078   C  CG   . ASN A 1 42  ? 7.405   20.617  11.500  1.00 0.00 ? 42  ASN A CG   2  
ATOM   5079   O  OD1  . ASN A 1 42  ? 7.933   21.458  12.201  1.00 0.00 ? 42  ASN A OD1  2  
ATOM   5080   N  ND2  . ASN A 1 42  ? 6.333   20.915  10.819  1.00 0.00 ? 42  ASN A ND2  2  
ATOM   5081   H  H    . ASN A 1 42  ? 9.348   18.582  8.615   1.00 0.00 ? 42  ASN A H    2  
ATOM   5082   H  HA   . ASN A 1 42  ? 9.474   20.240  10.268  1.00 0.00 ? 42  ASN A HA   2  
ATOM   5083   H  HB2  . ASN A 1 42  ? 7.295   18.568  10.869  1.00 0.00 ? 42  ASN A HB2  2  
ATOM   5084   H  HB3  . ASN A 1 42  ? 8.135   18.814  12.400  1.00 0.00 ? 42  ASN A HB3  2  
ATOM   5085   H  HD21 . ASN A 1 42  ? 5.907   20.236  10.255  1.00 0.00 ? 42  ASN A HD21 2  
ATOM   5086   H  HD22 . ASN A 1 42  ? 5.954   21.817  10.872  1.00 0.00 ? 42  ASN A HD22 2  
ATOM   5087   N  N    . GLY A 1 43  ? 11.514  18.322  11.171  1.00 0.00 ? 43  GLY A N    2  
ATOM   5088   C  CA   . GLY A 1 43  ? 12.647  17.992  12.083  1.00 0.00 ? 43  GLY A CA   2  
ATOM   5089   C  C    . GLY A 1 43  ? 12.289  16.792  12.965  1.00 0.00 ? 43  GLY A C    2  
ATOM   5090   O  O    . GLY A 1 43  ? 12.972  16.502  13.927  1.00 0.00 ? 43  GLY A O    2  
ATOM   5091   H  H    . GLY A 1 43  ? 11.575  18.104  10.219  1.00 0.00 ? 43  GLY A H    2  
ATOM   5092   H  HA2  . GLY A 1 43  ? 13.522  17.757  11.494  1.00 0.00 ? 43  GLY A HA2  2  
ATOM   5093   H  HA3  . GLY A 1 43  ? 12.858  18.844  12.710  1.00 0.00 ? 43  GLY A HA3  2  
ATOM   5094   N  N    . VAL A 1 44  ? 11.230  16.094  12.650  1.00 0.00 ? 44  VAL A N    2  
ATOM   5095   C  CA   . VAL A 1 44  ? 10.838  14.913  13.477  1.00 0.00 ? 44  VAL A CA   2  
ATOM   5096   C  C    . VAL A 1 44  ? 10.910  13.641  12.629  1.00 0.00 ? 44  VAL A C    2  
ATOM   5097   O  O    . VAL A 1 44  ? 10.525  13.627  11.477  1.00 0.00 ? 44  VAL A O    2  
ATOM   5098   C  CB   . VAL A 1 44  ? 9.408   15.100  13.991  1.00 0.00 ? 44  VAL A CB   2  
ATOM   5099   C  CG1  . VAL A 1 44  ? 9.024   13.908  14.872  1.00 0.00 ? 44  VAL A CG1  2  
ATOM   5100   C  CG2  . VAL A 1 44  ? 9.329   16.388  14.816  1.00 0.00 ? 44  VAL A CG2  2  
ATOM   5101   H  H    . VAL A 1 44  ? 10.693  16.344  11.869  1.00 0.00 ? 44  VAL A H    2  
ATOM   5102   H  HA   . VAL A 1 44  ? 11.510  14.820  14.317  1.00 0.00 ? 44  VAL A HA   2  
ATOM   5103   H  HB   . VAL A 1 44  ? 8.730   15.163  13.153  1.00 0.00 ? 44  VAL A HB   2  
ATOM   5104   H  HG11 . VAL A 1 44  ? 9.909   13.341  15.117  1.00 0.00 ? 44  VAL A HG11 2  
ATOM   5105   H  HG12 . VAL A 1 44  ? 8.329   13.276  14.339  1.00 0.00 ? 44  VAL A HG12 2  
ATOM   5106   H  HG13 . VAL A 1 44  ? 8.562   14.265  15.780  1.00 0.00 ? 44  VAL A HG13 2  
ATOM   5107   H  HG21 . VAL A 1 44  ? 8.313   16.754  14.814  1.00 0.00 ? 44  VAL A HG21 2  
ATOM   5108   H  HG22 . VAL A 1 44  ? 9.981   17.132  14.384  1.00 0.00 ? 44  VAL A HG22 2  
ATOM   5109   H  HG23 . VAL A 1 44  ? 9.636   16.184  15.831  1.00 0.00 ? 44  VAL A HG23 2  
ATOM   5110   N  N    . TYR A 1 45  ? 11.399  12.570  13.194  1.00 0.00 ? 45  TYR A N    2  
ATOM   5111   C  CA   . TYR A 1 45  ? 11.490  11.296  12.426  1.00 0.00 ? 45  TYR A CA   2  
ATOM   5112   C  C    . TYR A 1 45  ? 10.300  10.407  12.789  1.00 0.00 ? 45  TYR A C    2  
ATOM   5113   O  O    . TYR A 1 45  ? 9.878   10.355  13.927  1.00 0.00 ? 45  TYR A O    2  
ATOM   5114   C  CB   . TYR A 1 45  ? 12.792  10.575  12.780  1.00 0.00 ? 45  TYR A CB   2  
ATOM   5115   C  CG   . TYR A 1 45  ? 13.968  11.454  12.431  1.00 0.00 ? 45  TYR A CG   2  
ATOM   5116   C  CD1  . TYR A 1 45  ? 14.340  12.495  13.288  1.00 0.00 ? 45  TYR A CD1  2  
ATOM   5117   C  CD2  . TYR A 1 45  ? 14.686  11.228  11.250  1.00 0.00 ? 45  TYR A CD2  2  
ATOM   5118   C  CE1  . TYR A 1 45  ? 15.432  13.311  12.966  1.00 0.00 ? 45  TYR A CE1  2  
ATOM   5119   C  CE2  . TYR A 1 45  ? 15.777  12.044  10.928  1.00 0.00 ? 45  TYR A CE2  2  
ATOM   5120   C  CZ   . TYR A 1 45  ? 16.149  13.086  11.786  1.00 0.00 ? 45  TYR A CZ   2  
ATOM   5121   O  OH   . TYR A 1 45  ? 17.226  13.889  11.469  1.00 0.00 ? 45  TYR A OH   2  
ATOM   5122   H  H    . TYR A 1 45  ? 11.698  12.603  14.127  1.00 0.00 ? 45  TYR A H    2  
ATOM   5123   H  HA   . TYR A 1 45  ? 11.472  11.510  11.369  1.00 0.00 ? 45  TYR A HA   2  
ATOM   5124   H  HB2  . TYR A 1 45  ? 12.806  10.358  13.838  1.00 0.00 ? 45  TYR A HB2  2  
ATOM   5125   H  HB3  . TYR A 1 45  ? 12.855  9.651   12.223  1.00 0.00 ? 45  TYR A HB3  2  
ATOM   5126   H  HD1  . TYR A 1 45  ? 13.786  12.668  14.199  1.00 0.00 ? 45  TYR A HD1  2  
ATOM   5127   H  HD2  . TYR A 1 45  ? 14.398  10.425  10.587  1.00 0.00 ? 45  TYR A HD2  2  
ATOM   5128   H  HE1  . TYR A 1 45  ? 15.719  14.114  13.629  1.00 0.00 ? 45  TYR A HE1  2  
ATOM   5129   H  HE2  . TYR A 1 45  ? 16.331  11.871  10.017  1.00 0.00 ? 45  TYR A HE2  2  
ATOM   5130   H  HH   . TYR A 1 45  ? 16.897  14.645  10.976  1.00 0.00 ? 45  TYR A HH   2  
ATOM   5131   N  N    . ILE A 1 46  ? 9.749   9.714   11.829  1.00 0.00 ? 46  ILE A N    2  
ATOM   5132   C  CA   . ILE A 1 46  ? 8.577   8.835   12.120  1.00 0.00 ? 46  ILE A CA   2  
ATOM   5133   C  C    . ILE A 1 46  ? 8.775   7.455   11.473  1.00 0.00 ? 46  ILE A C    2  
ATOM   5134   O  O    . ILE A 1 46  ? 8.450   7.261   10.318  1.00 0.00 ? 46  ILE A O    2  
ATOM   5135   C  CB   . ILE A 1 46  ? 7.314   9.479   11.541  1.00 0.00 ? 46  ILE A CB   2  
ATOM   5136   C  CG1  . ILE A 1 46  ? 7.314   10.976  11.857  1.00 0.00 ? 46  ILE A CG1  2  
ATOM   5137   C  CG2  . ILE A 1 46  ? 6.078   8.826   12.162  1.00 0.00 ? 46  ILE A CG2  2  
ATOM   5138   C  CD1  . ILE A 1 46  ? 6.070   11.628  11.251  1.00 0.00 ? 46  ILE A CD1  2  
ATOM   5139   H  H    . ILE A 1 46  ? 10.101  9.778   10.916  1.00 0.00 ? 46  ILE A H    2  
ATOM   5140   H  HA   . ILE A 1 46  ? 8.460   8.727   13.186  1.00 0.00 ? 46  ILE A HA   2  
ATOM   5141   H  HB   . ILE A 1 46  ? 7.297   9.335   10.469  1.00 0.00 ? 46  ILE A HB   2  
ATOM   5142   H  HG12 . ILE A 1 46  ? 7.310   11.117  12.928  1.00 0.00 ? 46  ILE A HG12 2  
ATOM   5143   H  HG13 . ILE A 1 46  ? 8.197   11.434  11.437  1.00 0.00 ? 46  ILE A HG13 2  
ATOM   5144   H  HG21 . ILE A 1 46  ? 6.357   7.890   12.621  1.00 0.00 ? 46  ILE A HG21 2  
ATOM   5145   H  HG22 . ILE A 1 46  ? 5.342   8.645   11.392  1.00 0.00 ? 46  ILE A HG22 2  
ATOM   5146   H  HG23 . ILE A 1 46  ? 5.660   9.484   12.910  1.00 0.00 ? 46  ILE A HG23 2  
ATOM   5147   H  HD11 . ILE A 1 46  ? 5.195   11.313  11.799  1.00 0.00 ? 46  ILE A HD11 2  
ATOM   5148   H  HD12 . ILE A 1 46  ? 5.975   11.328  10.217  1.00 0.00 ? 46  ILE A HD12 2  
ATOM   5149   H  HD13 . ILE A 1 46  ? 6.164   12.703  11.307  1.00 0.00 ? 46  ILE A HD13 2  
ATOM   5150   N  N    . PRO A 1 47  ? 9.290   6.495   12.208  1.00 0.00 ? 47  PRO A N    2  
ATOM   5151   C  CA   . PRO A 1 47  ? 9.508   5.116   11.679  1.00 0.00 ? 47  PRO A CA   2  
ATOM   5152   C  C    . PRO A 1 47  ? 8.237   4.559   11.030  1.00 0.00 ? 47  PRO A C    2  
ATOM   5153   O  O    . PRO A 1 47  ? 7.138   4.876   11.438  1.00 0.00 ? 47  PRO A O    2  
ATOM   5154   C  CB   . PRO A 1 47  ? 9.883   4.297   12.914  1.00 0.00 ? 47  PRO A CB   2  
ATOM   5155   C  CG   . PRO A 1 47  ? 10.402  5.282   13.909  1.00 0.00 ? 47  PRO A CG   2  
ATOM   5156   C  CD   . PRO A 1 47  ? 9.719   6.617   13.611  1.00 0.00 ? 47  PRO A CD   2  
ATOM   5157   H  HA   . PRO A 1 47  ? 10.325  5.107   10.979  1.00 0.00 ? 47  PRO A HA   2  
ATOM   5158   H  HB2  . PRO A 1 47  ? 9.011   3.791   13.302  1.00 0.00 ? 47  PRO A HB2  2  
ATOM   5159   H  HB3  . PRO A 1 47  ? 10.652  3.581   12.669  1.00 0.00 ? 47  PRO A HB3  2  
ATOM   5160   H  HG2  . PRO A 1 47  ? 10.159  4.955   14.911  1.00 0.00 ? 47  PRO A HG2  2  
ATOM   5161   H  HG3  . PRO A 1 47  ? 11.470  5.390   13.803  1.00 0.00 ? 47  PRO A HG3  2  
ATOM   5162   H  HD2  . PRO A 1 47  ? 8.866   6.757   14.261  1.00 0.00 ? 47  PRO A HD2  2  
ATOM   5163   H  HD3  . PRO A 1 47  ? 10.417  7.432   13.717  1.00 0.00 ? 47  PRO A HD3  2  
ATOM   5164   N  N    . ALA A 1 48  ? 8.367   3.752   10.012  1.00 0.00 ? 48  ALA A N    2  
ATOM   5165   C  CA   . ALA A 1 48  ? 7.150   3.209   9.341   1.00 0.00 ? 48  ALA A CA   2  
ATOM   5166   C  C    . ALA A 1 48  ? 6.804   1.823   9.892   1.00 0.00 ? 48  ALA A C    2  
ATOM   5167   O  O    . ALA A 1 48  ? 7.177   0.813   9.329   1.00 0.00 ? 48  ALA A O    2  
ATOM   5168   C  CB   . ALA A 1 48  ? 7.410   3.104   7.838   1.00 0.00 ? 48  ALA A CB   2  
ATOM   5169   H  H    . ALA A 1 48  ? 9.260   3.514   9.676   1.00 0.00 ? 48  ALA A H    2  
ATOM   5170   H  HA   . ALA A 1 48  ? 6.320   3.878   9.513   1.00 0.00 ? 48  ALA A HA   2  
ATOM   5171   H  HB1  . ALA A 1 48  ? 7.907   2.171   7.623   1.00 0.00 ? 48  ALA A HB1  2  
ATOM   5172   H  HB2  . ALA A 1 48  ? 8.036   3.926   7.524   1.00 0.00 ? 48  ALA A HB2  2  
ATOM   5173   H  HB3  . ALA A 1 48  ? 6.470   3.143   7.307   1.00 0.00 ? 48  ALA A HB3  2  
ATOM   5174   N  N    . ARG A 1 49  ? 6.086   1.763   10.983  1.00 0.00 ? 49  ARG A N    2  
ATOM   5175   C  CA   . ARG A 1 49  ? 5.713   0.437   11.557  1.00 0.00 ? 49  ARG A CA   2  
ATOM   5176   C  C    . ARG A 1 49  ? 4.249   0.466   12.010  1.00 0.00 ? 49  ARG A C    2  
ATOM   5177   O  O    . ARG A 1 49  ? 3.705   1.505   12.322  1.00 0.00 ? 49  ARG A O    2  
ATOM   5178   C  CB   . ARG A 1 49  ? 6.611   0.122   12.754  1.00 0.00 ? 49  ARG A CB   2  
ATOM   5179   C  CG   . ARG A 1 49  ? 7.156   -1.301  12.623  1.00 0.00 ? 49  ARG A CG   2  
ATOM   5180   C  CD   . ARG A 1 49  ? 8.036   -1.627  13.831  1.00 0.00 ? 49  ARG A CD   2  
ATOM   5181   N  NE   . ARG A 1 49  ? 9.102   -2.583  13.420  1.00 0.00 ? 49  ARG A NE   2  
ATOM   5182   C  CZ   . ARG A 1 49  ? 8.852   -3.863  13.380  1.00 0.00 ? 49  ARG A CZ   2  
ATOM   5183   N  NH1  . ARG A 1 49  ? 7.670   -4.307  13.707  1.00 0.00 ? 49  ARG A NH1  2  
ATOM   5184   N  NH2  . ARG A 1 49  ? 9.784   -4.699  13.012  1.00 0.00 ? 49  ARG A NH2  2  
ATOM   5185   H  H    . ARG A 1 49  ? 5.792   2.586   11.427  1.00 0.00 ? 49  ARG A H    2  
ATOM   5186   H  HA   . ARG A 1 49  ? 5.836   -0.327  10.801  1.00 0.00 ? 49  ARG A HA   2  
ATOM   5187   H  HB2  . ARG A 1 49  ? 7.433   0.823   12.780  1.00 0.00 ? 49  ARG A HB2  2  
ATOM   5188   H  HB3  . ARG A 1 49  ? 6.038   0.203   13.665  1.00 0.00 ? 49  ARG A HB3  2  
ATOM   5189   H  HG2  . ARG A 1 49  ? 6.332   -1.999  12.577  1.00 0.00 ? 49  ARG A HG2  2  
ATOM   5190   H  HG3  . ARG A 1 49  ? 7.744   -1.380  11.720  1.00 0.00 ? 49  ARG A HG3  2  
ATOM   5191   H  HD2  . ARG A 1 49  ? 8.489   -0.719  14.203  1.00 0.00 ? 49  ARG A HD2  2  
ATOM   5192   H  HD3  . ARG A 1 49  ? 7.431   -2.073  14.608  1.00 0.00 ? 49  ARG A HD3  2  
ATOM   5193   H  HE   . ARG A 1 49  ? 9.992   -2.250  13.176  1.00 0.00 ? 49  ARG A HE   2  
ATOM   5194   H  HH11 . ARG A 1 49  ? 6.955   -3.666  13.989  1.00 0.00 ? 49  ARG A HH11 2  
ATOM   5195   H  HH12 . ARG A 1 49  ? 7.477   -5.288  13.675  1.00 0.00 ? 49  ARG A HH12 2  
ATOM   5196   H  HH21 . ARG A 1 49  ? 10.691  -4.358  12.761  1.00 0.00 ? 49  ARG A HH21 2  
ATOM   5197   H  HH22 . ARG A 1 49  ? 9.593   -5.680  12.979  1.00 0.00 ? 49  ARG A HH22 2  
ATOM   5198   N  N    . HIS A 1 50  ? 3.609   -0.670  12.042  1.00 0.00 ? 50  HIS A N    2  
ATOM   5199   C  CA   . HIS A 1 50  ? 2.180   -0.716  12.465  1.00 0.00 ? 50  HIS A CA   2  
ATOM   5200   C  C    . HIS A 1 50  ? 2.015   0.024   13.792  1.00 0.00 ? 50  HIS A C    2  
ATOM   5201   O  O    . HIS A 1 50  ? 1.151   0.866   13.940  1.00 0.00 ? 50  HIS A O    2  
ATOM   5202   C  CB   . HIS A 1 50  ? 1.742   -2.174  12.625  1.00 0.00 ? 50  HIS A CB   2  
ATOM   5203   C  CG   . HIS A 1 50  ? 2.031   -2.647  14.023  1.00 0.00 ? 50  HIS A CG   2  
ATOM   5204   N  ND1  . HIS A 1 50  ? 1.250   -2.273  15.106  1.00 0.00 ? 50  HIS A ND1  2  
ATOM   5205   C  CD2  . HIS A 1 50  ? 3.001   -3.477  14.528  1.00 0.00 ? 50  HIS A CD2  2  
ATOM   5206   C  CE1  . HIS A 1 50  ? 1.758   -2.874  16.197  1.00 0.00 ? 50  HIS A CE1  2  
ATOM   5207   N  NE2  . HIS A 1 50  ? 2.826   -3.620  15.901  1.00 0.00 ? 50  HIS A NE2  2  
ATOM   5208   H  H    . HIS A 1 50  ? 4.064   -1.491  11.779  1.00 0.00 ? 50  HIS A H    2  
ATOM   5209   H  HA   . HIS A 1 50  ? 1.569   -0.239  11.712  1.00 0.00 ? 50  HIS A HA   2  
ATOM   5210   H  HB2  . HIS A 1 50  ? 0.683   -2.257  12.433  1.00 0.00 ? 50  HIS A HB2  2  
ATOM   5211   H  HB3  . HIS A 1 50  ? 2.284   -2.788  11.921  1.00 0.00 ? 50  HIS A HB3  2  
ATOM   5212   H  HD1  . HIS A 1 50  ? 0.473   -1.677  15.082  1.00 0.00 ? 50  HIS A HD1  2  
ATOM   5213   H  HD2  . HIS A 1 50  ? 3.782   -3.945  13.949  1.00 0.00 ? 50  HIS A HD2  2  
ATOM   5214   H  HE1  . HIS A 1 50  ? 1.353   -2.765  17.193  1.00 0.00 ? 50  HIS A HE1  2  
ATOM   5215   N  N    . GLU A 1 51  ? 2.839   -0.275  14.757  1.00 0.00 ? 51  GLU A N    2  
ATOM   5216   C  CA   . GLU A 1 51  ? 2.723   0.422   16.067  1.00 0.00 ? 51  GLU A CA   2  
ATOM   5217   C  C    . GLU A 1 51  ? 2.525   1.918   15.822  1.00 0.00 ? 51  GLU A C    2  
ATOM   5218   O  O    . GLU A 1 51  ? 1.859   2.599   16.578  1.00 0.00 ? 51  GLU A O    2  
ATOM   5219   C  CB   . GLU A 1 51  ? 4.004   0.207   16.881  1.00 0.00 ? 51  GLU A CB   2  
ATOM   5220   C  CG   . GLU A 1 51  ? 4.237   -1.291  17.093  1.00 0.00 ? 51  GLU A CG   2  
ATOM   5221   C  CD   . GLU A 1 51  ? 5.559   -1.508  17.832  1.00 0.00 ? 51  GLU A CD   2  
ATOM   5222   O  OE1  . GLU A 1 51  ? 6.141   -0.528  18.264  1.00 0.00 ? 51  GLU A OE1  2  
ATOM   5223   O  OE2  . GLU A 1 51  ? 5.964   -2.653  17.955  1.00 0.00 ? 51  GLU A OE2  2  
ATOM   5224   H  H    . GLU A 1 51  ? 3.532   -0.954  14.617  1.00 0.00 ? 51  GLU A H    2  
ATOM   5225   H  HA   . GLU A 1 51  ? 1.878   0.029   16.612  1.00 0.00 ? 51  GLU A HA   2  
ATOM   5226   H  HB2  . GLU A 1 51  ? 4.843   0.631   16.350  1.00 0.00 ? 51  GLU A HB2  2  
ATOM   5227   H  HB3  . GLU A 1 51  ? 3.905   0.692   17.841  1.00 0.00 ? 51  GLU A HB3  2  
ATOM   5228   H  HG2  . GLU A 1 51  ? 3.427   -1.699  17.680  1.00 0.00 ? 51  GLU A HG2  2  
ATOM   5229   H  HG3  . GLU A 1 51  ? 4.277   -1.788  16.136  1.00 0.00 ? 51  GLU A HG3  2  
ATOM   5230   N  N    . PHE A 1 52  ? 3.116   2.441   14.781  1.00 0.00 ? 52  PHE A N    2  
ATOM   5231   C  CA   . PHE A 1 52  ? 2.979   3.901   14.499  1.00 0.00 ? 52  PHE A CA   2  
ATOM   5232   C  C    . PHE A 1 52  ? 1.642   4.189   13.816  1.00 0.00 ? 52  PHE A C    2  
ATOM   5233   O  O    . PHE A 1 52  ? 1.331   5.321   13.500  1.00 0.00 ? 52  PHE A O    2  
ATOM   5234   C  CB   . PHE A 1 52  ? 4.133   4.361   13.607  1.00 0.00 ? 52  PHE A CB   2  
ATOM   5235   C  CG   . PHE A 1 52  ? 5.389   4.444   14.437  1.00 0.00 ? 52  PHE A CG   2  
ATOM   5236   C  CD1  . PHE A 1 52  ? 5.655   5.596   15.184  1.00 0.00 ? 52  PHE A CD1  2  
ATOM   5237   C  CD2  . PHE A 1 52  ? 6.282   3.368   14.469  1.00 0.00 ? 52  PHE A CD2  2  
ATOM   5238   C  CE1  . PHE A 1 52  ? 6.816   5.676   15.961  1.00 0.00 ? 52  PHE A CE1  2  
ATOM   5239   C  CE2  . PHE A 1 52  ? 7.443   3.445   15.248  1.00 0.00 ? 52  PHE A CE2  2  
ATOM   5240   C  CZ   . PHE A 1 52  ? 7.711   4.600   15.993  1.00 0.00 ? 52  PHE A CZ   2  
ATOM   5241   H  H    . PHE A 1 52  ? 3.667   1.873   14.195  1.00 0.00 ? 52  PHE A H    2  
ATOM   5242   H  HA   . PHE A 1 52  ? 3.018   4.446   15.432  1.00 0.00 ? 52  PHE A HA   2  
ATOM   5243   H  HB2  . PHE A 1 52  ? 4.275   3.655   12.804  1.00 0.00 ? 52  PHE A HB2  2  
ATOM   5244   H  HB3  . PHE A 1 52  ? 3.908   5.334   13.198  1.00 0.00 ? 52  PHE A HB3  2  
ATOM   5245   H  HD1  . PHE A 1 52  ? 4.964   6.425   15.159  1.00 0.00 ? 52  PHE A HD1  2  
ATOM   5246   H  HD2  . PHE A 1 52  ? 6.077   2.478   13.893  1.00 0.00 ? 52  PHE A HD2  2  
ATOM   5247   H  HE1  . PHE A 1 52  ? 7.023   6.567   16.535  1.00 0.00 ? 52  PHE A HE1  2  
ATOM   5248   H  HE2  . PHE A 1 52  ? 8.134   2.615   15.272  1.00 0.00 ? 52  PHE A HE2  2  
ATOM   5249   H  HZ   . PHE A 1 52  ? 8.607   4.660   16.593  1.00 0.00 ? 52  PHE A HZ   2  
ATOM   5250   N  N    . VAL A 1 53  ? 0.841   3.186   13.592  1.00 0.00 ? 53  VAL A N    2  
ATOM   5251   C  CA   . VAL A 1 53  ? -0.477  3.427   12.942  1.00 0.00 ? 53  VAL A CA   2  
ATOM   5252   C  C    . VAL A 1 53  ? -1.283  4.398   13.809  1.00 0.00 ? 53  VAL A C    2  
ATOM   5253   O  O    . VAL A 1 53  ? -1.462  4.179   14.990  1.00 0.00 ? 53  VAL A O    2  
ATOM   5254   C  CB   . VAL A 1 53  ? -1.230  2.103   12.816  1.00 0.00 ? 53  VAL A CB   2  
ATOM   5255   C  CG1  . VAL A 1 53  ? -2.730  2.380   12.697  1.00 0.00 ? 53  VAL A CG1  2  
ATOM   5256   C  CG2  . VAL A 1 53  ? -0.749  1.359   11.569  1.00 0.00 ? 53  VAL A CG2  2  
ATOM   5257   H  H    . VAL A 1 53  ? 1.100   2.279   13.859  1.00 0.00 ? 53  VAL A H    2  
ATOM   5258   H  HA   . VAL A 1 53  ? -0.327  3.855   11.965  1.00 0.00 ? 53  VAL A HA   2  
ATOM   5259   H  HB   . VAL A 1 53  ? -1.043  1.499   13.694  1.00 0.00 ? 53  VAL A HB   2  
ATOM   5260   H  HG11 . VAL A 1 53  ? -3.146  2.536   13.681  1.00 0.00 ? 53  VAL A HG11 2  
ATOM   5261   H  HG12 . VAL A 1 53  ? -3.216  1.537   12.228  1.00 0.00 ? 53  VAL A HG12 2  
ATOM   5262   H  HG13 . VAL A 1 53  ? -2.884  3.265   12.097  1.00 0.00 ? 53  VAL A HG13 2  
ATOM   5263   H  HG21 . VAL A 1 53  ? -0.649  0.308   11.794  1.00 0.00 ? 53  VAL A HG21 2  
ATOM   5264   H  HG22 . VAL A 1 53  ? 0.208   1.753   11.260  1.00 0.00 ? 53  VAL A HG22 2  
ATOM   5265   H  HG23 . VAL A 1 53  ? -1.467  1.490   10.772  1.00 0.00 ? 53  VAL A HG23 2  
ATOM   5266   N  N    . VAL A 1 54  ? -1.762  5.472   13.236  1.00 0.00 ? 54  VAL A N    2  
ATOM   5267   C  CA   . VAL A 1 54  ? -2.546  6.460   14.036  1.00 0.00 ? 54  VAL A CA   2  
ATOM   5268   C  C    . VAL A 1 54  ? -3.999  6.486   13.563  1.00 0.00 ? 54  VAL A C    2  
ATOM   5269   O  O    . VAL A 1 54  ? -4.907  6.719   14.338  1.00 0.00 ? 54  VAL A O    2  
ATOM   5270   C  CB   . VAL A 1 54  ? -1.943  7.855   13.864  1.00 0.00 ? 54  VAL A CB   2  
ATOM   5271   C  CG1  . VAL A 1 54  ? -0.544  7.889   14.479  1.00 0.00 ? 54  VAL A CG1  2  
ATOM   5272   C  CG2  . VAL A 1 54  ? -1.855  8.198   12.374  1.00 0.00 ? 54  VAL A CG2  2  
ATOM   5273   H  H    . VAL A 1 54  ? -1.602  5.632   12.282  1.00 0.00 ? 54  VAL A H    2  
ATOM   5274   H  HA   . VAL A 1 54  ? -2.515  6.187   15.079  1.00 0.00 ? 54  VAL A HA   2  
ATOM   5275   H  HB   . VAL A 1 54  ? -2.573  8.577   14.362  1.00 0.00 ? 54  VAL A HB   2  
ATOM   5276   H  HG11 . VAL A 1 54  ? 0.104   7.217   13.935  1.00 0.00 ? 54  VAL A HG11 2  
ATOM   5277   H  HG12 . VAL A 1 54  ? -0.597  7.580   15.512  1.00 0.00 ? 54  VAL A HG12 2  
ATOM   5278   H  HG13 . VAL A 1 54  ? -0.150  8.892   14.422  1.00 0.00 ? 54  VAL A HG13 2  
ATOM   5279   H  HG21 . VAL A 1 54  ? -2.831  8.487   12.013  1.00 0.00 ? 54  VAL A HG21 2  
ATOM   5280   H  HG22 . VAL A 1 54  ? -1.510  7.337   11.825  1.00 0.00 ? 54  VAL A HG22 2  
ATOM   5281   H  HG23 . VAL A 1 54  ? -1.163  9.016   12.234  1.00 0.00 ? 54  VAL A HG23 2  
ATOM   5282   N  N    . HIS A 1 55  ? -4.233  6.256   12.303  1.00 0.00 ? 55  HIS A N    2  
ATOM   5283   C  CA   . HIS A 1 55  ? -5.633  6.278   11.795  1.00 0.00 ? 55  HIS A CA   2  
ATOM   5284   C  C    . HIS A 1 55  ? -5.746  5.389   10.556  1.00 0.00 ? 55  HIS A C    2  
ATOM   5285   O  O    . HIS A 1 55  ? -5.037  5.564   9.582   1.00 0.00 ? 55  HIS A O    2  
ATOM   5286   C  CB   . HIS A 1 55  ? -6.015  7.712   11.428  1.00 0.00 ? 55  HIS A CB   2  
ATOM   5287   C  CG   . HIS A 1 55  ? -7.307  7.715   10.657  1.00 0.00 ? 55  HIS A CG   2  
ATOM   5288   N  ND1  . HIS A 1 55  ? -7.566  8.638   9.653   1.00 0.00 ? 55  HIS A ND1  2  
ATOM   5289   C  CD2  . HIS A 1 55  ? -8.423  6.919   10.729  1.00 0.00 ? 55  HIS A CD2  2  
ATOM   5290   C  CE1  . HIS A 1 55  ? -8.793  8.377   9.168   1.00 0.00 ? 55  HIS A CE1  2  
ATOM   5291   N  NE2  . HIS A 1 55  ? -9.360  7.339   9.789   1.00 0.00 ? 55  HIS A NE2  2  
ATOM   5292   H  H    . HIS A 1 55  ? -3.493  6.073   11.688  1.00 0.00 ? 55  HIS A H    2  
ATOM   5293   H  HA   . HIS A 1 55  ? -6.299  5.913   12.561  1.00 0.00 ? 55  HIS A HA   2  
ATOM   5294   H  HB2  . HIS A 1 55  ? -6.132  8.294   12.330  1.00 0.00 ? 55  HIS A HB2  2  
ATOM   5295   H  HB3  . HIS A 1 55  ? -5.237  8.142   10.821  1.00 0.00 ? 55  HIS A HB3  2  
ATOM   5296   H  HD1  . HIS A 1 55  ? -6.965  9.351   9.353   1.00 0.00 ? 55  HIS A HD1  2  
ATOM   5297   H  HD2  . HIS A 1 55  ? -8.554  6.092   11.412  1.00 0.00 ? 55  HIS A HD2  2  
ATOM   5298   H  HE1  . HIS A 1 55  ? -9.264  8.938   8.372   1.00 0.00 ? 55  HIS A HE1  2  
ATOM   5299   N  N    . THR A 1 56  ? -6.641  4.443   10.589  1.00 0.00 ? 56  THR A N    2  
ATOM   5300   C  CA   . THR A 1 56  ? -6.826  3.536   9.422   1.00 0.00 ? 56  THR A CA   2  
ATOM   5301   C  C    . THR A 1 56  ? -8.191  3.806   8.793   1.00 0.00 ? 56  THR A C    2  
ATOM   5302   O  O    . THR A 1 56  ? -9.190  3.910   9.475   1.00 0.00 ? 56  THR A O    2  
ATOM   5303   C  CB   . THR A 1 56  ? -6.759  2.077   9.880   1.00 0.00 ? 56  THR A CB   2  
ATOM   5304   O  OG1  . THR A 1 56  ? -7.830  1.814   10.777  1.00 0.00 ? 56  THR A OG1  2  
ATOM   5305   C  CG2  . THR A 1 56  ? -5.426  1.822   10.585  1.00 0.00 ? 56  THR A CG2  2  
ATOM   5306   H  H    . THR A 1 56  ? -7.198  4.333   11.385  1.00 0.00 ? 56  THR A H    2  
ATOM   5307   H  HA   . THR A 1 56  ? -6.051  3.720   8.692   1.00 0.00 ? 56  THR A HA   2  
ATOM   5308   H  HB   . THR A 1 56  ? -6.839  1.424   9.021   1.00 0.00 ? 56  THR A HB   2  
ATOM   5309   H  HG1  . THR A 1 56  ? -7.702  0.936   11.143  1.00 0.00 ? 56  THR A HG1  2  
ATOM   5310   H  HG21 . THR A 1 56  ? -5.392  2.388   11.505  1.00 0.00 ? 56  THR A HG21 2  
ATOM   5311   H  HG22 . THR A 1 56  ? -4.615  2.132   9.942   1.00 0.00 ? 56  THR A HG22 2  
ATOM   5312   H  HG23 . THR A 1 56  ? -5.330  0.770   10.806  1.00 0.00 ? 56  THR A HG23 2  
ATOM   5313   N  N    . ASN A 1 57  ? -8.242  3.916   7.498   1.00 0.00 ? 57  ASN A N    2  
ATOM   5314   C  CA   . ASN A 1 57  ? -9.535  4.174   6.812   1.00 0.00 ? 57  ASN A CA   2  
ATOM   5315   C  C    . ASN A 1 57  ? -9.335  3.919   5.321   1.00 0.00 ? 57  ASN A C    2  
ATOM   5316   O  O    . ASN A 1 57  ? -8.463  3.170   4.927   1.00 0.00 ? 57  ASN A O    2  
ATOM   5317   C  CB   . ASN A 1 57  ? -9.961  5.627   7.035   1.00 0.00 ? 57  ASN A CB   2  
ATOM   5318   C  CG   . ASN A 1 57  ? -8.978  6.564   6.330   1.00 0.00 ? 57  ASN A CG   2  
ATOM   5319   O  OD1  . ASN A 1 57  ? -9.377  7.544   5.733   1.00 0.00 ? 57  ASN A OD1  2  
ATOM   5320   N  ND2  . ASN A 1 57  ? -7.701  6.303   6.374   1.00 0.00 ? 57  ASN A ND2  2  
ATOM   5321   H  H    . ASN A 1 57  ? -7.429  3.817   6.960   1.00 0.00 ? 57  ASN A H    2  
ATOM   5322   H  HA   . ASN A 1 57  ? -10.292 3.506   7.197   1.00 0.00 ? 57  ASN A HA   2  
ATOM   5323   H  HB2  . ASN A 1 57  ? -10.953 5.776   6.633   1.00 0.00 ? 57  ASN A HB2  2  
ATOM   5324   H  HB3  . ASN A 1 57  ? -9.964  5.841   8.092   1.00 0.00 ? 57  ASN A HB3  2  
ATOM   5325   H  HD21 . ASN A 1 57  ? -7.378  5.512   6.856   1.00 0.00 ? 57  ASN A HD21 2  
ATOM   5326   H  HD22 . ASN A 1 57  ? -7.064  6.897   5.925   1.00 0.00 ? 57  ASN A HD22 2  
ATOM   5327   N  N    . HIS A 1 58  ? -10.110 4.544   4.483   1.00 0.00 ? 58  HIS A N    2  
ATOM   5328   C  CA   . HIS A 1 58  ? -9.919  4.333   3.023   1.00 0.00 ? 58  HIS A CA   2  
ATOM   5329   C  C    . HIS A 1 58  ? -8.431  4.492   2.701   1.00 0.00 ? 58  HIS A C    2  
ATOM   5330   O  O    . HIS A 1 58  ? -7.979  4.171   1.621   1.00 0.00 ? 58  HIS A O    2  
ATOM   5331   C  CB   . HIS A 1 58  ? -10.730 5.369   2.243   1.00 0.00 ? 58  HIS A CB   2  
ATOM   5332   C  CG   . HIS A 1 58  ? -12.120 4.844   2.016   1.00 0.00 ? 58  HIS A CG   2  
ATOM   5333   N  ND1  . HIS A 1 58  ? -13.248 5.530   2.437   1.00 0.00 ? 58  HIS A ND1  2  
ATOM   5334   C  CD2  . HIS A 1 58  ? -12.579 3.699   1.415   1.00 0.00 ? 58  HIS A CD2  2  
ATOM   5335   C  CE1  . HIS A 1 58  ? -14.321 4.797   2.087   1.00 0.00 ? 58  HIS A CE1  2  
ATOM   5336   N  NE2  . HIS A 1 58  ? -13.969 3.670   1.462   1.00 0.00 ? 58  HIS A NE2  2  
ATOM   5337   H  H    . HIS A 1 58  ? -10.800 5.159   4.808   1.00 0.00 ? 58  HIS A H    2  
ATOM   5338   H  HA   . HIS A 1 58  ? -10.245 3.337   2.755   1.00 0.00 ? 58  HIS A HA   2  
ATOM   5339   H  HB2  . HIS A 1 58  ? -10.779 6.288   2.809   1.00 0.00 ? 58  HIS A HB2  2  
ATOM   5340   H  HB3  . HIS A 1 58  ? -10.255 5.556   1.292   1.00 0.00 ? 58  HIS A HB3  2  
ATOM   5341   H  HD1  . HIS A 1 58  ? -13.263 6.392   2.903   1.00 0.00 ? 58  HIS A HD1  2  
ATOM   5342   H  HD2  . HIS A 1 58  ? -11.955 2.936   0.974   1.00 0.00 ? 58  HIS A HD2  2  
ATOM   5343   H  HE1  . HIS A 1 58  ? -15.343 5.084   2.290   1.00 0.00 ? 58  HIS A HE1  2  
ATOM   5344   N  N    . SER A 1 59  ? -7.669  4.989   3.640   1.00 0.00 ? 59  SER A N    2  
ATOM   5345   C  CA   . SER A 1 59  ? -6.210  5.177   3.413   1.00 0.00 ? 59  SER A CA   2  
ATOM   5346   C  C    . SER A 1 59  ? -5.439  4.748   4.667   1.00 0.00 ? 59  SER A C    2  
ATOM   5347   O  O    . SER A 1 59  ? -6.001  4.578   5.730   1.00 0.00 ? 59  SER A O    2  
ATOM   5348   C  CB   . SER A 1 59  ? -5.923  6.650   3.120   1.00 0.00 ? 59  SER A CB   2  
ATOM   5349   O  OG   . SER A 1 59  ? -4.534  6.899   3.289   1.00 0.00 ? 59  SER A OG   2  
ATOM   5350   H  H    . SER A 1 59  ? -8.062  5.240   4.501   1.00 0.00 ? 59  SER A H    2  
ATOM   5351   H  HA   . SER A 1 59  ? -5.895  4.574   2.572   1.00 0.00 ? 59  SER A HA   2  
ATOM   5352   H  HB2  . SER A 1 59  ? -6.204  6.882   2.107   1.00 0.00 ? 59  SER A HB2  2  
ATOM   5353   H  HB3  . SER A 1 59  ? -6.495  7.268   3.800   1.00 0.00 ? 59  SER A HB3  2  
ATOM   5354   H  HG   . SER A 1 59  ? -4.340  6.871   4.229   1.00 0.00 ? 59  SER A HG   2  
ATOM   5355   N  N    . THR A 1 60  ? -4.149  4.586   4.549   1.00 0.00 ? 60  THR A N    2  
ATOM   5356   C  CA   . THR A 1 60  ? -3.330  4.184   5.730   1.00 0.00 ? 60  THR A CA   2  
ATOM   5357   C  C    . THR A 1 60  ? -2.570  5.409   6.240   1.00 0.00 ? 60  THR A C    2  
ATOM   5358   O  O    . THR A 1 60  ? -1.837  6.035   5.501   1.00 0.00 ? 60  THR A O    2  
ATOM   5359   C  CB   . THR A 1 60  ? -2.331  3.100   5.317   1.00 0.00 ? 60  THR A CB   2  
ATOM   5360   O  OG1  . THR A 1 60  ? -3.036  1.977   4.807   1.00 0.00 ? 60  THR A OG1  2  
ATOM   5361   C  CG2  . THR A 1 60  ? -1.501  2.677   6.530   1.00 0.00 ? 60  THR A CG2  2  
ATOM   5362   H  H    . THR A 1 60  ? -3.724  4.750   3.681   1.00 0.00 ? 60  THR A H    2  
ATOM   5363   H  HA   . THR A 1 60  ? -3.975  3.807   6.510   1.00 0.00 ? 60  THR A HA   2  
ATOM   5364   H  HB   . THR A 1 60  ? -1.674  3.489   4.556   1.00 0.00 ? 60  THR A HB   2  
ATOM   5365   H  HG1  . THR A 1 60  ? -2.402  1.271   4.661   1.00 0.00 ? 60  THR A HG1  2  
ATOM   5366   H  HG21 . THR A 1 60  ? -1.265  1.626   6.456   1.00 0.00 ? 60  THR A HG21 2  
ATOM   5367   H  HG22 . THR A 1 60  ? -2.066  2.856   7.433   1.00 0.00 ? 60  THR A HG22 2  
ATOM   5368   H  HG23 . THR A 1 60  ? -0.586  3.251   6.558   1.00 0.00 ? 60  THR A HG23 2  
ATOM   5369   N  N    . ASP A 1 61  ? -2.753  5.774   7.487   1.00 0.00 ? 61  ASP A N    2  
ATOM   5370   C  CA   . ASP A 1 61  ? -2.049  6.982   8.013   1.00 0.00 ? 61  ASP A CA   2  
ATOM   5371   C  C    . ASP A 1 61  ? -1.162  6.635   9.216   1.00 0.00 ? 61  ASP A C    2  
ATOM   5372   O  O    . ASP A 1 61  ? -1.519  5.847   10.070  1.00 0.00 ? 61  ASP A O    2  
ATOM   5373   C  CB   . ASP A 1 61  ? -3.085  8.024   8.440   1.00 0.00 ? 61  ASP A CB   2  
ATOM   5374   C  CG   . ASP A 1 61  ? -4.224  8.065   7.419   1.00 0.00 ? 61  ASP A CG   2  
ATOM   5375   O  OD1  . ASP A 1 61  ? -4.018  7.593   6.312   1.00 0.00 ? 61  ASP A OD1  2  
ATOM   5376   O  OD2  . ASP A 1 61  ? -5.280  8.570   7.759   1.00 0.00 ? 61  ASP A OD2  2  
ATOM   5377   H  H    . ASP A 1 61  ? -3.366  5.270   8.065   1.00 0.00 ? 61  ASP A H    2  
ATOM   5378   H  HA   . ASP A 1 61  ? -1.434  7.400   7.234   1.00 0.00 ? 61  ASP A HA   2  
ATOM   5379   H  HB2  . ASP A 1 61  ? -3.481  7.761   9.411   1.00 0.00 ? 61  ASP A HB2  2  
ATOM   5380   H  HB3  . ASP A 1 61  ? -2.618  8.996   8.494   1.00 0.00 ? 61  ASP A HB3  2  
ATOM   5381   N  N    . LEU A 1 62  ? -0.015  7.260   9.290   1.00 0.00 ? 62  LEU A N    2  
ATOM   5382   C  CA   . LEU A 1 62  ? 0.917   7.030   10.433  1.00 0.00 ? 62  LEU A CA   2  
ATOM   5383   C  C    . LEU A 1 62  ? 1.227   8.392   11.059  1.00 0.00 ? 62  LEU A C    2  
ATOM   5384   O  O    . LEU A 1 62  ? 1.107   9.411   10.408  1.00 0.00 ? 62  LEU A O    2  
ATOM   5385   C  CB   . LEU A 1 62  ? 2.222   6.397   9.933   1.00 0.00 ? 62  LEU A CB   2  
ATOM   5386   C  CG   . LEU A 1 62  ? 1.921   5.294   8.915   1.00 0.00 ? 62  LEU A CG   2  
ATOM   5387   C  CD1  . LEU A 1 62  ? 3.232   4.816   8.286   1.00 0.00 ? 62  LEU A CD1  2  
ATOM   5388   C  CD2  . LEU A 1 62  ? 1.240   4.119   9.621   1.00 0.00 ? 62  LEU A CD2  2  
ATOM   5389   H  H    . LEU A 1 62  ? 0.221   7.907   8.593   1.00 0.00 ? 62  LEU A H    2  
ATOM   5390   H  HA   . LEU A 1 62  ? 0.451   6.386   11.164  1.00 0.00 ? 62  LEU A HA   2  
ATOM   5391   H  HB2  . LEU A 1 62  ? 2.832   7.157   9.466   1.00 0.00 ? 62  LEU A HB2  2  
ATOM   5392   H  HB3  . LEU A 1 62  ? 2.757   5.974   10.770  1.00 0.00 ? 62  LEU A HB3  2  
ATOM   5393   H  HG   . LEU A 1 62  ? 1.272   5.680   8.143   1.00 0.00 ? 62  LEU A HG   2  
ATOM   5394   H  HD11 . LEU A 1 62  ? 3.077   3.857   7.813   1.00 0.00 ? 62  LEU A HD11 2  
ATOM   5395   H  HD12 . LEU A 1 62  ? 3.985   4.718   9.054   1.00 0.00 ? 62  LEU A HD12 2  
ATOM   5396   H  HD13 . LEU A 1 62  ? 3.561   5.533   7.548   1.00 0.00 ? 62  LEU A HD13 2  
ATOM   5397   H  HD21 . LEU A 1 62  ? 1.291   3.242   8.992   1.00 0.00 ? 62  LEU A HD21 2  
ATOM   5398   H  HD22 . LEU A 1 62  ? 0.207   4.366   9.812   1.00 0.00 ? 62  LEU A HD22 2  
ATOM   5399   H  HD23 . LEU A 1 62  ? 1.742   3.921   10.556  1.00 0.00 ? 62  LEU A HD23 2  
ATOM   5400   N  N    . GLY A 1 63  ? 1.617   8.446   12.303  1.00 0.00 ? 63  GLY A N    2  
ATOM   5401   C  CA   . GLY A 1 63  ? 1.911   9.780   12.902  1.00 0.00 ? 63  GLY A CA   2  
ATOM   5402   C  C    . GLY A 1 63  ? 2.573   9.629   14.266  1.00 0.00 ? 63  GLY A C    2  
ATOM   5403   O  O    . GLY A 1 63  ? 2.222   8.773   15.053  1.00 0.00 ? 63  GLY A O    2  
ATOM   5404   H  H    . GLY A 1 63  ? 1.714   7.626   12.835  1.00 0.00 ? 63  GLY A H    2  
ATOM   5405   H  HA2  . GLY A 1 63  ? 2.572   10.325  12.243  1.00 0.00 ? 63  GLY A HA2  2  
ATOM   5406   H  HA3  . GLY A 1 63  ? 0.991   10.327  13.018  1.00 0.00 ? 63  GLY A HA3  2  
ATOM   5407   N  N    . PHE A 1 64  ? 3.536   10.462  14.548  1.00 0.00 ? 64  PHE A N    2  
ATOM   5408   C  CA   . PHE A 1 64  ? 4.240   10.383  15.860  1.00 0.00 ? 64  PHE A CA   2  
ATOM   5409   C  C    . PHE A 1 64  ? 4.612   11.791  16.339  1.00 0.00 ? 64  PHE A C    2  
ATOM   5410   O  O    . PHE A 1 64  ? 4.853   12.685  15.552  1.00 0.00 ? 64  PHE A O    2  
ATOM   5411   C  CB   . PHE A 1 64  ? 5.522   9.565   15.697  1.00 0.00 ? 64  PHE A CB   2  
ATOM   5412   C  CG   . PHE A 1 64  ? 6.070   9.212   17.059  1.00 0.00 ? 64  PHE A CG   2  
ATOM   5413   C  CD1  . PHE A 1 64  ? 5.371   8.327   17.888  1.00 0.00 ? 64  PHE A CD1  2  
ATOM   5414   C  CD2  . PHE A 1 64  ? 7.281   9.767   17.490  1.00 0.00 ? 64  PHE A CD2  2  
ATOM   5415   C  CE1  . PHE A 1 64  ? 5.881   7.999   19.149  1.00 0.00 ? 64  PHE A CE1  2  
ATOM   5416   C  CE2  . PHE A 1 64  ? 7.792   9.438   18.752  1.00 0.00 ? 64  PHE A CE2  2  
ATOM   5417   C  CZ   . PHE A 1 64  ? 7.091   8.553   19.581  1.00 0.00 ? 64  PHE A CZ   2  
ATOM   5418   H  H    . PHE A 1 64  ? 3.809   11.138  13.895  1.00 0.00 ? 64  PHE A H    2  
ATOM   5419   H  HA   . PHE A 1 64  ? 3.599   9.910   16.587  1.00 0.00 ? 64  PHE A HA   2  
ATOM   5420   H  HB2  . PHE A 1 64  ? 5.304   8.661   15.149  1.00 0.00 ? 64  PHE A HB2  2  
ATOM   5421   H  HB3  . PHE A 1 64  ? 6.252   10.147  15.157  1.00 0.00 ? 64  PHE A HB3  2  
ATOM   5422   H  HD1  . PHE A 1 64  ? 4.437   7.900   17.555  1.00 0.00 ? 64  PHE A HD1  2  
ATOM   5423   H  HD2  . PHE A 1 64  ? 7.821   10.451  16.851  1.00 0.00 ? 64  PHE A HD2  2  
ATOM   5424   H  HE1  . PHE A 1 64  ? 5.341   7.316   19.789  1.00 0.00 ? 64  PHE A HE1  2  
ATOM   5425   H  HE2  . PHE A 1 64  ? 8.725   9.865   19.085  1.00 0.00 ? 64  PHE A HE2  2  
ATOM   5426   H  HZ   . PHE A 1 64  ? 7.486   8.298   20.554  1.00 0.00 ? 64  PHE A HZ   2  
ATOM   5427   N  N    . LYS A 1 65  ? 4.676   11.985  17.628  1.00 0.00 ? 65  LYS A N    2  
ATOM   5428   C  CA   . LYS A 1 65  ? 5.050   13.321  18.179  1.00 0.00 ? 65  LYS A CA   2  
ATOM   5429   C  C    . LYS A 1 65  ? 4.123   14.408  17.627  1.00 0.00 ? 65  LYS A C    2  
ATOM   5430   O  O    . LYS A 1 65  ? 4.524   15.541  17.444  1.00 0.00 ? 65  LYS A O    2  
ATOM   5431   C  CB   . LYS A 1 65  ? 6.498   13.643  17.798  1.00 0.00 ? 65  LYS A CB   2  
ATOM   5432   C  CG   . LYS A 1 65  ? 7.451   12.823  18.670  1.00 0.00 ? 65  LYS A CG   2  
ATOM   5433   C  CD   . LYS A 1 65  ? 8.053   13.721  19.753  1.00 0.00 ? 65  LYS A CD   2  
ATOM   5434   C  CE   . LYS A 1 65  ? 9.164   14.580  19.146  1.00 0.00 ? 65  LYS A CE   2  
ATOM   5435   N  NZ   . LYS A 1 65  ? 9.172   15.917  19.802  1.00 0.00 ? 65  LYS A NZ   2  
ATOM   5436   H  H    . LYS A 1 65  ? 4.484   11.243  18.239  1.00 0.00 ? 65  LYS A H    2  
ATOM   5437   H  HA   . LYS A 1 65  ? 4.965   13.296  19.256  1.00 0.00 ? 65  LYS A HA   2  
ATOM   5438   H  HB2  . LYS A 1 65  ? 6.660   13.399  16.759  1.00 0.00 ? 65  LYS A HB2  2  
ATOM   5439   H  HB3  . LYS A 1 65  ? 6.686   14.694  17.955  1.00 0.00 ? 65  LYS A HB3  2  
ATOM   5440   H  HG2  . LYS A 1 65  ? 6.907   12.013  19.135  1.00 0.00 ? 65  LYS A HG2  2  
ATOM   5441   H  HG3  . LYS A 1 65  ? 8.244   12.420  18.057  1.00 0.00 ? 65  LYS A HG3  2  
ATOM   5442   H  HD2  . LYS A 1 65  ? 7.284   14.360  20.159  1.00 0.00 ? 65  LYS A HD2  2  
ATOM   5443   H  HD3  . LYS A 1 65  ? 8.465   13.108  20.541  1.00 0.00 ? 65  LYS A HD3  2  
ATOM   5444   H  HE2  . LYS A 1 65  ? 10.118  14.097  19.301  1.00 0.00 ? 65  LYS A HE2  2  
ATOM   5445   H  HE3  . LYS A 1 65  ? 8.989   14.699  18.086  1.00 0.00 ? 65  LYS A HE3  2  
ATOM   5446   H  HZ1  . LYS A 1 65  ? 9.505   16.634  19.127  1.00 0.00 ? 65  LYS A HZ1  2  
ATOM   5447   H  HZ2  . LYS A 1 65  ? 9.807   15.894  20.626  1.00 0.00 ? 65  LYS A HZ2  2  
ATOM   5448   H  HZ3  . LYS A 1 65  ? 8.209   16.157  20.113  1.00 0.00 ? 65  LYS A HZ3  2  
ATOM   5449   N  N    . GLY A 1 66  ? 2.885   14.085  17.375  1.00 0.00 ? 66  GLY A N    2  
ATOM   5450   C  CA   . GLY A 1 66  ? 1.941   15.114  16.853  1.00 0.00 ? 66  GLY A CA   2  
ATOM   5451   C  C    . GLY A 1 66  ? 2.079   15.241  15.334  1.00 0.00 ? 66  GLY A C    2  
ATOM   5452   O  O    . GLY A 1 66  ? 1.428   16.055  14.711  1.00 0.00 ? 66  GLY A O    2  
ATOM   5453   H  H    . GLY A 1 66  ? 2.574   13.170  17.538  1.00 0.00 ? 66  GLY A H    2  
ATOM   5454   H  HA2  . GLY A 1 66  ? 0.929   14.827  17.098  1.00 0.00 ? 66  GLY A HA2  2  
ATOM   5455   H  HA3  . GLY A 1 66  ? 2.162   16.067  17.310  1.00 0.00 ? 66  GLY A HA3  2  
ATOM   5456   N  N    . GLN A 1 67  ? 2.906   14.436  14.727  1.00 0.00 ? 67  GLN A N    2  
ATOM   5457   C  CA   . GLN A 1 67  ? 3.062   14.511  13.247  1.00 0.00 ? 67  GLN A CA   2  
ATOM   5458   C  C    . GLN A 1 67  ? 2.170   13.444  12.614  1.00 0.00 ? 67  GLN A C    2  
ATOM   5459   O  O    . GLN A 1 67  ? 2.043   12.355  13.137  1.00 0.00 ? 67  GLN A O    2  
ATOM   5460   C  CB   . GLN A 1 67  ? 4.522   14.258  12.870  1.00 0.00 ? 67  GLN A CB   2  
ATOM   5461   C  CG   . GLN A 1 67  ? 5.419   15.259  13.602  1.00 0.00 ? 67  GLN A CG   2  
ATOM   5462   C  CD   . GLN A 1 67  ? 5.045   16.683  13.184  1.00 0.00 ? 67  GLN A CD   2  
ATOM   5463   O  OE1  . GLN A 1 67  ? 5.323   17.096  12.076  1.00 0.00 ? 67  GLN A OE1  2  
ATOM   5464   N  NE2  . GLN A 1 67  ? 4.421   17.456  14.030  1.00 0.00 ? 67  GLN A NE2  2  
ATOM   5465   H  H    . GLN A 1 67  ? 3.415   13.772  15.239  1.00 0.00 ? 67  GLN A H    2  
ATOM   5466   H  HA   . GLN A 1 67  ? 2.759   15.488  12.900  1.00 0.00 ? 67  GLN A HA   2  
ATOM   5467   H  HB2  . GLN A 1 67  ? 4.798   13.253  13.153  1.00 0.00 ? 67  GLN A HB2  2  
ATOM   5468   H  HB3  . GLN A 1 67  ? 4.646   14.380  11.804  1.00 0.00 ? 67  GLN A HB3  2  
ATOM   5469   H  HG2  . GLN A 1 67  ? 5.285   15.150  14.669  1.00 0.00 ? 67  GLN A HG2  2  
ATOM   5470   H  HG3  . GLN A 1 67  ? 6.451   15.072  13.348  1.00 0.00 ? 67  GLN A HG3  2  
ATOM   5471   H  HE21 . GLN A 1 67  ? 4.197   17.124  14.925  1.00 0.00 ? 67  GLN A HE21 2  
ATOM   5472   H  HE22 . GLN A 1 67  ? 4.176   18.370  13.772  1.00 0.00 ? 67  GLN A HE22 2  
ATOM   5473   N  N    . ARG A 1 68  ? 1.534   13.745  11.509  1.00 0.00 ? 68  ARG A N    2  
ATOM   5474   C  CA   . ARG A 1 68  ? 0.635   12.734  10.876  1.00 0.00 ? 68  ARG A CA   2  
ATOM   5475   C  C    . ARG A 1 68  ? 0.851   12.674  9.363   1.00 0.00 ? 68  ARG A C    2  
ATOM   5476   O  O    . ARG A 1 68  ? 1.087   13.670  8.709   1.00 0.00 ? 68  ARG A O    2  
ATOM   5477   C  CB   . ARG A 1 68  ? -0.822  13.105  11.161  1.00 0.00 ? 68  ARG A CB   2  
ATOM   5478   C  CG   . ARG A 1 68  ? -0.957  13.595  12.603  1.00 0.00 ? 68  ARG A CG   2  
ATOM   5479   C  CD   . ARG A 1 68  ? -2.427  13.895  12.902  1.00 0.00 ? 68  ARG A CD   2  
ATOM   5480   N  NE   . ARG A 1 68  ? -2.616  15.367  13.042  1.00 0.00 ? 68  ARG A NE   2  
ATOM   5481   C  CZ   . ARG A 1 68  ? -2.374  15.950  14.184  1.00 0.00 ? 68  ARG A CZ   2  
ATOM   5482   N  NH1  . ARG A 1 68  ? -1.967  15.245  15.204  1.00 0.00 ? 68  ARG A NH1  2  
ATOM   5483   N  NH2  . ARG A 1 68  ? -2.541  17.239  14.306  1.00 0.00 ? 68  ARG A NH2  2  
ATOM   5484   H  H    . ARG A 1 68  ? 1.635   14.634  11.109  1.00 0.00 ? 68  ARG A H    2  
ATOM   5485   H  HA   . ARG A 1 68  ? 0.839   11.765  11.296  1.00 0.00 ? 68  ARG A HA   2  
ATOM   5486   H  HB2  . ARG A 1 68  ? -1.133  13.887  10.483  1.00 0.00 ? 68  ARG A HB2  2  
ATOM   5487   H  HB3  . ARG A 1 68  ? -1.448  12.237  11.018  1.00 0.00 ? 68  ARG A HB3  2  
ATOM   5488   H  HG2  . ARG A 1 68  ? -0.600  12.830  13.277  1.00 0.00 ? 68  ARG A HG2  2  
ATOM   5489   H  HG3  . ARG A 1 68  ? -0.375  14.494  12.735  1.00 0.00 ? 68  ARG A HG3  2  
ATOM   5490   H  HD2  . ARG A 1 68  ? -3.041  13.529  12.093  1.00 0.00 ? 68  ARG A HD2  2  
ATOM   5491   H  HD3  . ARG A 1 68  ? -2.714  13.407  13.822  1.00 0.00 ? 68  ARG A HD3  2  
ATOM   5492   H  HE   . ARG A 1 68  ? -2.922  15.896  12.276  1.00 0.00 ? 68  ARG A HE   2  
ATOM   5493   H  HH11 . ARG A 1 68  ? -1.839  14.257  15.110  1.00 0.00 ? 68  ARG A HH11 2  
ATOM   5494   H  HH12 . ARG A 1 68  ? -1.781  15.692  16.079  1.00 0.00 ? 68  ARG A HH12 2  
ATOM   5495   H  HH21 . ARG A 1 68  ? -2.855  17.778  13.525  1.00 0.00 ? 68  ARG A HH21 2  
ATOM   5496   H  HH22 . ARG A 1 68  ? -2.357  17.687  15.180  1.00 0.00 ? 68  ARG A HH22 2  
ATOM   5497   N  N    . ILE A 1 69  ? 0.744   11.497  8.809   1.00 0.00 ? 69  ILE A N    2  
ATOM   5498   C  CA   . ILE A 1 69  ? 0.910   11.321  7.338   1.00 0.00 ? 69  ILE A CA   2  
ATOM   5499   C  C    . ILE A 1 69  ? -0.233  10.435  6.834   1.00 0.00 ? 69  ILE A C    2  
ATOM   5500   O  O    . ILE A 1 69  ? -0.610  9.486   7.487   1.00 0.00 ? 69  ILE A O    2  
ATOM   5501   C  CB   . ILE A 1 69  ? 2.251   10.645  7.046   1.00 0.00 ? 69  ILE A CB   2  
ATOM   5502   C  CG1  . ILE A 1 69  ? 3.372   11.404  7.762   1.00 0.00 ? 69  ILE A CG1  2  
ATOM   5503   C  CG2  . ILE A 1 69  ? 2.510   10.656  5.539   1.00 0.00 ? 69  ILE A CG2  2  
ATOM   5504   C  CD1  . ILE A 1 69  ? 4.670   10.599  7.679   1.00 0.00 ? 69  ILE A CD1  2  
ATOM   5505   H  H    . ILE A 1 69  ? 0.536   10.718  9.368   1.00 0.00 ? 69  ILE A H    2  
ATOM   5506   H  HA   . ILE A 1 69  ? 0.869   12.284  6.849   1.00 0.00 ? 69  ILE A HA   2  
ATOM   5507   H  HB   . ILE A 1 69  ? 2.223   9.624   7.398   1.00 0.00 ? 69  ILE A HB   2  
ATOM   5508   H  HG12 . ILE A 1 69  ? 3.513   12.366  7.291   1.00 0.00 ? 69  ILE A HG12 2  
ATOM   5509   H  HG13 . ILE A 1 69  ? 3.105   11.547  8.798   1.00 0.00 ? 69  ILE A HG13 2  
ATOM   5510   H  HG21 . ILE A 1 69  ? 1.626   10.318  5.019   1.00 0.00 ? 69  ILE A HG21 2  
ATOM   5511   H  HG22 . ILE A 1 69  ? 3.336   9.998   5.310   1.00 0.00 ? 69  ILE A HG22 2  
ATOM   5512   H  HG23 . ILE A 1 69  ? 2.753   11.660  5.222   1.00 0.00 ? 69  ILE A HG23 2  
ATOM   5513   H  HD11 . ILE A 1 69  ? 5.504   11.272  7.544   1.00 0.00 ? 69  ILE A HD11 2  
ATOM   5514   H  HD12 . ILE A 1 69  ? 4.618   9.918   6.842   1.00 0.00 ? 69  ILE A HD12 2  
ATOM   5515   H  HD13 . ILE A 1 69  ? 4.805   10.037  8.592   1.00 0.00 ? 69  ILE A HD13 2  
ATOM   5516   N  N    . LYS A 1 70  ? -0.798  10.745  5.694   1.00 0.00 ? 70  LYS A N    2  
ATOM   5517   C  CA   . LYS A 1 70  ? -1.934  9.916   5.176   1.00 0.00 ? 70  LYS A CA   2  
ATOM   5518   C  C    . LYS A 1 70  ? -1.551  9.205   3.872   1.00 0.00 ? 70  LYS A C    2  
ATOM   5519   O  O    . LYS A 1 70  ? -0.698  9.652   3.130   1.00 0.00 ? 70  LYS A O    2  
ATOM   5520   C  CB   . LYS A 1 70  ? -3.142  10.820  4.926   1.00 0.00 ? 70  LYS A CB   2  
ATOM   5521   C  CG   . LYS A 1 70  ? -3.392  11.684  6.165   1.00 0.00 ? 70  LYS A CG   2  
ATOM   5522   C  CD   . LYS A 1 70  ? -4.610  12.583  5.931   1.00 0.00 ? 70  LYS A CD   2  
ATOM   5523   C  CE   . LYS A 1 70  ? -5.891  11.741  5.928   1.00 0.00 ? 70  LYS A CE   2  
ATOM   5524   N  NZ   . LYS A 1 70  ? -6.484  11.744  4.562   1.00 0.00 ? 70  LYS A NZ   2  
ATOM   5525   H  H    . LYS A 1 70  ? -0.481  11.528  5.194   1.00 0.00 ? 70  LYS A H    2  
ATOM   5526   H  HA   . LYS A 1 70  ? -2.200  9.175   5.914   1.00 0.00 ? 70  LYS A HA   2  
ATOM   5527   H  HB2  . LYS A 1 70  ? -2.946  11.454  4.075   1.00 0.00 ? 70  LYS A HB2  2  
ATOM   5528   H  HB3  . LYS A 1 70  ? -4.012  10.213  4.730   1.00 0.00 ? 70  LYS A HB3  2  
ATOM   5529   H  HG2  . LYS A 1 70  ? -3.570  11.047  7.019   1.00 0.00 ? 70  LYS A HG2  2  
ATOM   5530   H  HG3  . LYS A 1 70  ? -2.525  12.300  6.352   1.00 0.00 ? 70  LYS A HG3  2  
ATOM   5531   H  HD2  . LYS A 1 70  ? -4.666  13.322  6.717   1.00 0.00 ? 70  LYS A HD2  2  
ATOM   5532   H  HD3  . LYS A 1 70  ? -4.510  13.082  4.978   1.00 0.00 ? 70  LYS A HD3  2  
ATOM   5533   H  HE2  . LYS A 1 70  ? -5.661  10.727  6.219   1.00 0.00 ? 70  LYS A HE2  2  
ATOM   5534   H  HE3  . LYS A 1 70  ? -6.598  12.163  6.627   1.00 0.00 ? 70  LYS A HE3  2  
ATOM   5535   H  HZ1  . LYS A 1 70  ? -6.009  11.029  3.976   1.00 0.00 ? 70  LYS A HZ1  2  
ATOM   5536   H  HZ2  . LYS A 1 70  ? -6.361  12.684  4.132   1.00 0.00 ? 70  LYS A HZ2  2  
ATOM   5537   H  HZ3  . LYS A 1 70  ? -7.497  11.519  4.622   1.00 0.00 ? 70  LYS A HZ3  2  
ATOM   5538   N  N    . THR A 1 71  ? -2.200  8.103   3.587   1.00 0.00 ? 71  THR A N    2  
ATOM   5539   C  CA   . THR A 1 71  ? -1.918  7.346   2.329   1.00 0.00 ? 71  THR A CA   2  
ATOM   5540   C  C    . THR A 1 71  ? -0.420  7.058   2.197   1.00 0.00 ? 71  THR A C    2  
ATOM   5541   O  O    . THR A 1 71  ? 0.246   7.613   1.349   1.00 0.00 ? 71  THR A O    2  
ATOM   5542   C  CB   . THR A 1 71  ? -2.379  8.176   1.129   1.00 0.00 ? 71  THR A CB   2  
ATOM   5543   O  OG1  . THR A 1 71  ? -3.639  8.764   1.420   1.00 0.00 ? 71  THR A OG1  2  
ATOM   5544   C  CG2  . THR A 1 71  ? -2.507  7.275   -0.100  1.00 0.00 ? 71  THR A CG2  2  
ATOM   5545   H  H    . THR A 1 71  ? -2.892  7.778   4.199   1.00 0.00 ? 71  THR A H    2  
ATOM   5546   H  HA   . THR A 1 71  ? -2.460  6.413   2.344   1.00 0.00 ? 71  THR A HA   2  
ATOM   5547   H  HB   . THR A 1 71  ? -1.657  8.952   0.927   1.00 0.00 ? 71  THR A HB   2  
ATOM   5548   H  HG1  . THR A 1 71  ? -4.130  8.153   1.974   1.00 0.00 ? 71  THR A HG1  2  
ATOM   5549   H  HG21 . THR A 1 71  ? -1.971  6.354   0.070   1.00 0.00 ? 71  THR A HG21 2  
ATOM   5550   H  HG22 . THR A 1 71  ? -2.092  7.779   -0.961  1.00 0.00 ? 71  THR A HG22 2  
ATOM   5551   H  HG23 . THR A 1 71  ? -3.550  7.057   -0.280  1.00 0.00 ? 71  THR A HG23 2  
ATOM   5552   N  N    . VAL A 1 72  ? 0.113   6.188   3.014   1.00 0.00 ? 72  VAL A N    2  
ATOM   5553   C  CA   . VAL A 1 72  ? 1.567   5.863   2.916   1.00 0.00 ? 72  VAL A CA   2  
ATOM   5554   C  C    . VAL A 1 72  ? 1.737   4.408   2.465   1.00 0.00 ? 72  VAL A C    2  
ATOM   5555   O  O    . VAL A 1 72  ? 2.830   3.961   2.178   1.00 0.00 ? 72  VAL A O    2  
ATOM   5556   C  CB   . VAL A 1 72  ? 2.217   6.044   4.287   1.00 0.00 ? 72  VAL A CB   2  
ATOM   5557   C  CG1  . VAL A 1 72  ? 2.280   7.533   4.634   1.00 0.00 ? 72  VAL A CG1  2  
ATOM   5558   C  CG2  . VAL A 1 72  ? 1.383   5.312   5.340   1.00 0.00 ? 72  VAL A CG2  2  
ATOM   5559   H  H    . VAL A 1 72  ? -0.435  5.737   3.689   1.00 0.00 ? 72  VAL A H    2  
ATOM   5560   H  HA   . VAL A 1 72  ? 2.043   6.519   2.203   1.00 0.00 ? 72  VAL A HA   2  
ATOM   5561   H  HB   . VAL A 1 72  ? 3.217   5.636   4.269   1.00 0.00 ? 72  VAL A HB   2  
ATOM   5562   H  HG11 . VAL A 1 72  ? 1.337   8.000   4.389   1.00 0.00 ? 72  VAL A HG11 2  
ATOM   5563   H  HG12 . VAL A 1 72  ? 3.071   8.002   4.067   1.00 0.00 ? 72  VAL A HG12 2  
ATOM   5564   H  HG13 . VAL A 1 72  ? 2.477   7.650   5.689   1.00 0.00 ? 72  VAL A HG13 2  
ATOM   5565   H  HG21 . VAL A 1 72  ? 0.725   4.608   4.851   1.00 0.00 ? 72  VAL A HG21 2  
ATOM   5566   H  HG22 . VAL A 1 72  ? 0.795   6.027   5.896   1.00 0.00 ? 72  VAL A HG22 2  
ATOM   5567   H  HG23 . VAL A 1 72  ? 2.039   4.784   6.014   1.00 0.00 ? 72  VAL A HG23 2  
ATOM   5568   N  N    . GLU A 1 73  ? 0.666   3.663   2.416   1.00 0.00 ? 73  GLU A N    2  
ATOM   5569   C  CA   . GLU A 1 73  ? 0.763   2.233   2.002   1.00 0.00 ? 73  GLU A CA   2  
ATOM   5570   C  C    . GLU A 1 73  ? 1.137   2.131   0.518   1.00 0.00 ? 73  GLU A C    2  
ATOM   5571   O  O    . GLU A 1 73  ? 1.623   1.114   0.065   1.00 0.00 ? 73  GLU A O    2  
ATOM   5572   C  CB   . GLU A 1 73  ? -0.582  1.541   2.243   1.00 0.00 ? 73  GLU A CB   2  
ATOM   5573   C  CG   . GLU A 1 73  ? -1.603  2.015   1.208   1.00 0.00 ? 73  GLU A CG   2  
ATOM   5574   C  CD   . GLU A 1 73  ? -1.606  3.545   1.151   1.00 0.00 ? 73  GLU A CD   2  
ATOM   5575   O  OE1  . GLU A 1 73  ? -1.654  4.157   2.206   1.00 0.00 ? 73  GLU A OE1  2  
ATOM   5576   O  OE2  . GLU A 1 73  ? -1.559  4.078   0.055   1.00 0.00 ? 73  GLU A OE2  2  
ATOM   5577   H  H    . GLU A 1 73  ? -0.203  4.042   2.662   1.00 0.00 ? 73  GLU A H    2  
ATOM   5578   H  HA   . GLU A 1 73  ? 1.524   1.744   2.593   1.00 0.00 ? 73  GLU A HA   2  
ATOM   5579   H  HB2  . GLU A 1 73  ? -0.455  0.471   2.160   1.00 0.00 ? 73  GLU A HB2  2  
ATOM   5580   H  HB3  . GLU A 1 73  ? -0.937  1.783   3.234   1.00 0.00 ? 73  GLU A HB3  2  
ATOM   5581   H  HG2  . GLU A 1 73  ? -1.341  1.618   0.240   1.00 0.00 ? 73  GLU A HG2  2  
ATOM   5582   H  HG3  . GLU A 1 73  ? -2.586  1.667   1.487   1.00 0.00 ? 73  GLU A HG3  2  
ATOM   5583   N  N    . HIS A 1 74  ? 0.921   3.170   -0.245  1.00 0.00 ? 74  HIS A N    2  
ATOM   5584   C  CA   . HIS A 1 74  ? 1.275   3.109   -1.695  1.00 0.00 ? 74  HIS A CA   2  
ATOM   5585   C  C    . HIS A 1 74  ? 2.800   3.140   -1.845  1.00 0.00 ? 74  HIS A C    2  
ATOM   5586   O  O    . HIS A 1 74  ? 3.403   2.215   -2.361  1.00 0.00 ? 74  HIS A O    2  
ATOM   5587   C  CB   . HIS A 1 74  ? 0.660   4.308   -2.424  1.00 0.00 ? 74  HIS A CB   2  
ATOM   5588   C  CG   . HIS A 1 74  ? -0.734  3.970   -2.895  1.00 0.00 ? 74  HIS A CG   2  
ATOM   5589   N  ND1  . HIS A 1 74  ? -1.441  4.792   -3.762  1.00 0.00 ? 74  HIS A ND1  2  
ATOM   5590   C  CD2  . HIS A 1 74  ? -1.566  2.907   -2.631  1.00 0.00 ? 74  HIS A CD2  2  
ATOM   5591   C  CE1  . HIS A 1 74  ? -2.637  4.215   -3.986  1.00 0.00 ? 74  HIS A CE1  2  
ATOM   5592   N  NE2  . HIS A 1 74  ? -2.762  3.065   -3.321  1.00 0.00 ? 74  HIS A NE2  2  
ATOM   5593   H  H    . HIS A 1 74  ? 0.530   3.984   0.132   1.00 0.00 ? 74  HIS A H    2  
ATOM   5594   H  HA   . HIS A 1 74  ? 0.897   2.192   -2.121  1.00 0.00 ? 74  HIS A HA   2  
ATOM   5595   H  HB2  . HIS A 1 74  ? 0.616   5.152   -1.752  1.00 0.00 ? 74  HIS A HB2  2  
ATOM   5596   H  HB3  . HIS A 1 74  ? 1.273   4.561   -3.277  1.00 0.00 ? 74  HIS A HB3  2  
ATOM   5597   H  HD1  . HIS A 1 74  ? -1.126  5.639   -4.143  1.00 0.00 ? 74  HIS A HD1  2  
ATOM   5598   H  HD2  . HIS A 1 74  ? -1.333  2.077   -1.984  1.00 0.00 ? 74  HIS A HD2  2  
ATOM   5599   H  HE1  . HIS A 1 74  ? -3.406  4.630   -4.626  1.00 0.00 ? 74  HIS A HE1  2  
ATOM   5600   N  N    . ILE A 1 75  ? 3.432   4.188   -1.390  1.00 0.00 ? 75  ILE A N    2  
ATOM   5601   C  CA   . ILE A 1 75  ? 4.916   4.259   -1.506  1.00 0.00 ? 75  ILE A CA   2  
ATOM   5602   C  C    . ILE A 1 75  ? 5.524   3.065   -0.771  1.00 0.00 ? 75  ILE A C    2  
ATOM   5603   O  O    . ILE A 1 75  ? 6.429   2.419   -1.259  1.00 0.00 ? 75  ILE A O    2  
ATOM   5604   C  CB   . ILE A 1 75  ? 5.427   5.568   -0.889  1.00 0.00 ? 75  ILE A CB   2  
ATOM   5605   C  CG1  . ILE A 1 75  ? 6.865   5.819   -1.347  1.00 0.00 ? 75  ILE A CG1  2  
ATOM   5606   C  CG2  . ILE A 1 75  ? 5.395   5.477   0.640   1.00 0.00 ? 75  ILE A CG2  2  
ATOM   5607   C  CD1  . ILE A 1 75  ? 6.858   6.638   -2.639  1.00 0.00 ? 75  ILE A CD1  2  
ATOM   5608   H  H    . ILE A 1 75  ? 2.935   4.921   -0.971  1.00 0.00 ? 75  ILE A H    2  
ATOM   5609   H  HA   . ILE A 1 75  ? 5.195   4.219   -2.549  1.00 0.00 ? 75  ILE A HA   2  
ATOM   5610   H  HB   . ILE A 1 75  ? 4.798   6.385   -1.212  1.00 0.00 ? 75  ILE A HB   2  
ATOM   5611   H  HG12 . ILE A 1 75  ? 7.397   6.361   -0.579  1.00 0.00 ? 75  ILE A HG12 2  
ATOM   5612   H  HG13 . ILE A 1 75  ? 7.356   4.874   -1.526  1.00 0.00 ? 75  ILE A HG13 2  
ATOM   5613   H  HG21 . ILE A 1 75  ? 6.162   4.794   0.977   1.00 0.00 ? 75  ILE A HG21 2  
ATOM   5614   H  HG22 . ILE A 1 75  ? 4.427   5.122   0.960   1.00 0.00 ? 75  ILE A HG22 2  
ATOM   5615   H  HG23 . ILE A 1 75  ? 5.577   6.456   1.060   1.00 0.00 ? 75  ILE A HG23 2  
ATOM   5616   H  HD11 . ILE A 1 75  ? 6.093   6.260   -3.301  1.00 0.00 ? 75  ILE A HD11 2  
ATOM   5617   H  HD12 . ILE A 1 75  ? 7.821   6.562   -3.120  1.00 0.00 ? 75  ILE A HD12 2  
ATOM   5618   H  HD13 . ILE A 1 75  ? 6.652   7.673   -2.407  1.00 0.00 ? 75  ILE A HD13 2  
ATOM   5619   N  N    . LEU A 1 76  ? 5.032   2.766   0.398   1.00 0.00 ? 76  LEU A N    2  
ATOM   5620   C  CA   . LEU A 1 76  ? 5.578   1.614   1.168   1.00 0.00 ? 76  LEU A CA   2  
ATOM   5621   C  C    . LEU A 1 76  ? 5.431   0.326   0.350   1.00 0.00 ? 76  LEU A C    2  
ATOM   5622   O  O    . LEU A 1 76  ? 6.292   -0.531  0.373   1.00 0.00 ? 76  LEU A O    2  
ATOM   5623   C  CB   . LEU A 1 76  ? 4.804   1.474   2.481   1.00 0.00 ? 76  LEU A CB   2  
ATOM   5624   C  CG   . LEU A 1 76  ? 5.140   2.644   3.410   1.00 0.00 ? 76  LEU A CG   2  
ATOM   5625   C  CD1  . LEU A 1 76  ? 4.216   2.605   4.628   1.00 0.00 ? 76  LEU A CD1  2  
ATOM   5626   C  CD2  . LEU A 1 76  ? 6.597   2.538   3.876   1.00 0.00 ? 76  LEU A CD2  2  
ATOM   5627   H  H    . LEU A 1 76  ? 4.302   3.301   0.774   1.00 0.00 ? 76  LEU A H    2  
ATOM   5628   H  HA   . LEU A 1 76  ? 6.621   1.788   1.381   1.00 0.00 ? 76  LEU A HA   2  
ATOM   5629   H  HB2  . LEU A 1 76  ? 3.746   1.478   2.270   1.00 0.00 ? 76  LEU A HB2  2  
ATOM   5630   H  HB3  . LEU A 1 76  ? 5.067   0.546   2.960   1.00 0.00 ? 76  LEU A HB3  2  
ATOM   5631   H  HG   . LEU A 1 76  ? 4.997   3.575   2.881   1.00 0.00 ? 76  LEU A HG   2  
ATOM   5632   H  HD11 . LEU A 1 76  ? 3.193   2.727   4.307   1.00 0.00 ? 76  LEU A HD11 2  
ATOM   5633   H  HD12 . LEU A 1 76  ? 4.479   3.404   5.306   1.00 0.00 ? 76  LEU A HD12 2  
ATOM   5634   H  HD13 . LEU A 1 76  ? 4.324   1.656   5.132   1.00 0.00 ? 76  LEU A HD13 2  
ATOM   5635   H  HD21 . LEU A 1 76  ? 7.183   3.311   3.403   1.00 0.00 ? 76  LEU A HD21 2  
ATOM   5636   H  HD22 . LEU A 1 76  ? 6.995   1.571   3.609   1.00 0.00 ? 76  LEU A HD22 2  
ATOM   5637   H  HD23 . LEU A 1 76  ? 6.641   2.659   4.948   1.00 0.00 ? 76  LEU A HD23 2  
ATOM   5638   N  N    . SER A 1 77  ? 4.350   0.179   -0.370  1.00 0.00 ? 77  SER A N    2  
ATOM   5639   C  CA   . SER A 1 77  ? 4.159   -1.058  -1.179  1.00 0.00 ? 77  SER A CA   2  
ATOM   5640   C  C    . SER A 1 77  ? 5.279   -1.182  -2.213  1.00 0.00 ? 77  SER A C    2  
ATOM   5641   O  O    . SER A 1 77  ? 5.896   -2.219  -2.346  1.00 0.00 ? 77  SER A O    2  
ATOM   5642   C  CB   . SER A 1 77  ? 2.811   -0.999  -1.898  1.00 0.00 ? 77  SER A CB   2  
ATOM   5643   O  OG   . SER A 1 77  ? 2.769   -2.006  -2.899  1.00 0.00 ? 77  SER A OG   2  
ATOM   5644   H  H    . SER A 1 77  ? 3.662   0.878   -0.377  1.00 0.00 ? 77  SER A H    2  
ATOM   5645   H  HA   . SER A 1 77  ? 4.183   -1.919  -0.529  1.00 0.00 ? 77  SER A HA   2  
ATOM   5646   H  HB2  . SER A 1 77  ? 2.016   -1.169  -1.192  1.00 0.00 ? 77  SER A HB2  2  
ATOM   5647   H  HB3  . SER A 1 77  ? 2.686   -0.023  -2.348  1.00 0.00 ? 77  SER A HB3  2  
ATOM   5648   H  HG   . SER A 1 77  ? 1.880   -2.031  -3.259  1.00 0.00 ? 77  SER A HG   2  
ATOM   5649   N  N    . VAL A 1 78  ? 5.557   -0.137  -2.944  1.00 0.00 ? 78  VAL A N    2  
ATOM   5650   C  CA   . VAL A 1 78  ? 6.650   -0.222  -3.955  1.00 0.00 ? 78  VAL A CA   2  
ATOM   5651   C  C    . VAL A 1 78  ? 7.951   -0.590  -3.238  1.00 0.00 ? 78  VAL A C    2  
ATOM   5652   O  O    . VAL A 1 78  ? 8.619   -1.541  -3.588  1.00 0.00 ? 78  VAL A O    2  
ATOM   5653   C  CB   . VAL A 1 78  ? 6.813   1.127   -4.663  1.00 0.00 ? 78  VAL A CB   2  
ATOM   5654   C  CG1  . VAL A 1 78  ? 8.086   1.107   -5.511  1.00 0.00 ? 78  VAL A CG1  2  
ATOM   5655   C  CG2  . VAL A 1 78  ? 5.606   1.390   -5.571  1.00 0.00 ? 78  VAL A CG2  2  
ATOM   5656   H  H    . VAL A 1 78  ? 5.057   0.700   -2.819  1.00 0.00 ? 78  VAL A H    2  
ATOM   5657   H  HA   . VAL A 1 78  ? 6.413   -0.989  -4.679  1.00 0.00 ? 78  VAL A HA   2  
ATOM   5658   H  HB   . VAL A 1 78  ? 6.887   1.913   -3.924  1.00 0.00 ? 78  VAL A HB   2  
ATOM   5659   H  HG11 . VAL A 1 78  ? 8.950   1.150   -4.865  1.00 0.00 ? 78  VAL A HG11 2  
ATOM   5660   H  HG12 . VAL A 1 78  ? 8.089   1.961   -6.174  1.00 0.00 ? 78  VAL A HG12 2  
ATOM   5661   H  HG13 . VAL A 1 78  ? 8.116   0.200   -6.094  1.00 0.00 ? 78  VAL A HG13 2  
ATOM   5662   H  HG21 . VAL A 1 78  ? 5.097   0.461   -5.781  1.00 0.00 ? 78  VAL A HG21 2  
ATOM   5663   H  HG22 . VAL A 1 78  ? 5.943   1.831   -6.497  1.00 0.00 ? 78  VAL A HG22 2  
ATOM   5664   H  HG23 . VAL A 1 78  ? 4.926   2.069   -5.077  1.00 0.00 ? 78  VAL A HG23 2  
ATOM   5665   N  N    . LEU A 1 79  ? 8.307   0.159   -2.232  1.00 0.00 ? 79  LEU A N    2  
ATOM   5666   C  CA   . LEU A 1 79  ? 9.557   -0.142  -1.482  1.00 0.00 ? 79  LEU A CA   2  
ATOM   5667   C  C    . LEU A 1 79  ? 9.543   -1.609  -1.043  1.00 0.00 ? 79  LEU A C    2  
ATOM   5668   O  O    . LEU A 1 79  ? 10.524  -2.316  -1.162  1.00 0.00 ? 79  LEU A O    2  
ATOM   5669   C  CB   . LEU A 1 79  ? 9.631   0.759   -0.247  1.00 0.00 ? 79  LEU A CB   2  
ATOM   5670   C  CG   . LEU A 1 79  ? 9.605   2.226   -0.680  1.00 0.00 ? 79  LEU A CG   2  
ATOM   5671   C  CD1  . LEU A 1 79  ? 9.598   3.123   0.559   1.00 0.00 ? 79  LEU A CD1  2  
ATOM   5672   C  CD2  . LEU A 1 79  ? 10.843  2.533   -1.524  1.00 0.00 ? 79  LEU A CD2  2  
ATOM   5673   H  H    . LEU A 1 79  ? 7.746   0.918   -1.973  1.00 0.00 ? 79  LEU A H    2  
ATOM   5674   H  HA   . LEU A 1 79  ? 10.412  0.039   -2.113  1.00 0.00 ? 79  LEU A HA   2  
ATOM   5675   H  HB2  . LEU A 1 79  ? 8.786   0.557   0.391   1.00 0.00 ? 79  LEU A HB2  2  
ATOM   5676   H  HB3  . LEU A 1 79  ? 10.543  0.560   0.291   1.00 0.00 ? 79  LEU A HB3  2  
ATOM   5677   H  HG   . LEU A 1 79  ? 8.715   2.412   -1.264  1.00 0.00 ? 79  LEU A HG   2  
ATOM   5678   H  HD11 . LEU A 1 79  ? 10.018  2.586   1.395   1.00 0.00 ? 79  LEU A HD11 2  
ATOM   5679   H  HD12 . LEU A 1 79  ? 8.582   3.409   0.790   1.00 0.00 ? 79  LEU A HD12 2  
ATOM   5680   H  HD13 . LEU A 1 79  ? 10.186  4.008   0.367   1.00 0.00 ? 79  LEU A HD13 2  
ATOM   5681   H  HD21 . LEU A 1 79  ? 11.648  1.872   -1.237  1.00 0.00 ? 79  LEU A HD21 2  
ATOM   5682   H  HD22 . LEU A 1 79  ? 11.145  3.558   -1.361  1.00 0.00 ? 79  LEU A HD22 2  
ATOM   5683   H  HD23 . LEU A 1 79  ? 10.612  2.387   -2.569  1.00 0.00 ? 79  LEU A HD23 2  
ATOM   5684   N  N    . HIS A 1 80  ? 8.434   -2.065  -0.532  1.00 0.00 ? 80  HIS A N    2  
ATOM   5685   C  CA   . HIS A 1 80  ? 8.334   -3.480  -0.073  1.00 0.00 ? 80  HIS A CA   2  
ATOM   5686   C  C    . HIS A 1 80  ? 8.736   -4.434  -1.202  1.00 0.00 ? 80  HIS A C    2  
ATOM   5687   O  O    . HIS A 1 80  ? 9.632   -5.242  -1.059  1.00 0.00 ? 80  HIS A O    2  
ATOM   5688   C  CB   . HIS A 1 80  ? 6.886   -3.756  0.332   1.00 0.00 ? 80  HIS A CB   2  
ATOM   5689   C  CG   . HIS A 1 80  ? 6.786   -5.084  1.035   1.00 0.00 ? 80  HIS A CG   2  
ATOM   5690   N  ND1  . HIS A 1 80  ? 5.580   -5.568  1.516   1.00 0.00 ? 80  HIS A ND1  2  
ATOM   5691   C  CD2  . HIS A 1 80  ? 7.722   -6.040  1.342   1.00 0.00 ? 80  HIS A CD2  2  
ATOM   5692   C  CE1  . HIS A 1 80  ? 5.818   -6.766  2.079   1.00 0.00 ? 80  HIS A CE1  2  
ATOM   5693   N  NE2  . HIS A 1 80  ? 7.107   -7.102  2.000   1.00 0.00 ? 80  HIS A NE2  2  
ATOM   5694   H  H    . HIS A 1 80  ? 7.658   -1.471  -0.439  1.00 0.00 ? 80  HIS A H    2  
ATOM   5695   H  HA   . HIS A 1 80  ? 8.981   -3.633  0.777   1.00 0.00 ? 80  HIS A HA   2  
ATOM   5696   H  HB2  . HIS A 1 80  ? 6.548   -2.974  0.992   1.00 0.00 ? 80  HIS A HB2  2  
ATOM   5697   H  HB3  . HIS A 1 80  ? 6.265   -3.771  -0.551  1.00 0.00 ? 80  HIS A HB3  2  
ATOM   5698   H  HD1  . HIS A 1 80  ? 4.711   -5.120  1.459   1.00 0.00 ? 80  HIS A HD1  2  
ATOM   5699   H  HD2  . HIS A 1 80  ? 8.775   -5.979  1.111   1.00 0.00 ? 80  HIS A HD2  2  
ATOM   5700   H  HE1  . HIS A 1 80  ? 5.059   -7.381  2.538   1.00 0.00 ? 80  HIS A HE1  2  
ATOM   5701   N  N    . LEU A 1 81  ? 8.067   -4.356  -2.318  1.00 0.00 ? 81  LEU A N    2  
ATOM   5702   C  CA   . LEU A 1 81  ? 8.388   -5.265  -3.455  1.00 0.00 ? 81  LEU A CA   2  
ATOM   5703   C  C    . LEU A 1 81  ? 9.857   -5.119  -3.866  1.00 0.00 ? 81  LEU A C    2  
ATOM   5704   O  O    . LEU A 1 81  ? 10.495  -6.074  -4.258  1.00 0.00 ? 81  LEU A O    2  
ATOM   5705   C  CB   . LEU A 1 81  ? 7.497   -4.915  -4.648  1.00 0.00 ? 81  LEU A CB   2  
ATOM   5706   C  CG   . LEU A 1 81  ? 6.027   -4.997  -4.231  1.00 0.00 ? 81  LEU A CG   2  
ATOM   5707   C  CD1  . LEU A 1 81  ? 5.142   -4.505  -5.376  1.00 0.00 ? 81  LEU A CD1  2  
ATOM   5708   C  CD2  . LEU A 1 81  ? 5.668   -6.448  -3.898  1.00 0.00 ? 81  LEU A CD2  2  
ATOM   5709   H  H    . LEU A 1 81  ? 7.339   -3.704  -2.406  1.00 0.00 ? 81  LEU A H    2  
ATOM   5710   H  HA   . LEU A 1 81  ? 8.201   -6.286  -3.160  1.00 0.00 ? 81  LEU A HA   2  
ATOM   5711   H  HB2  . LEU A 1 81  ? 7.721   -3.911  -4.979  1.00 0.00 ? 81  LEU A HB2  2  
ATOM   5712   H  HB3  . LEU A 1 81  ? 7.681   -5.609  -5.453  1.00 0.00 ? 81  LEU A HB3  2  
ATOM   5713   H  HG   . LEU A 1 81  ? 5.865   -4.376  -3.360  1.00 0.00 ? 81  LEU A HG   2  
ATOM   5714   H  HD11 . LEU A 1 81  ? 5.354   -5.080  -6.266  1.00 0.00 ? 81  LEU A HD11 2  
ATOM   5715   H  HD12 . LEU A 1 81  ? 5.346   -3.461  -5.566  1.00 0.00 ? 81  LEU A HD12 2  
ATOM   5716   H  HD13 . LEU A 1 81  ? 4.104   -4.625  -5.108  1.00 0.00 ? 81  LEU A HD13 2  
ATOM   5717   H  HD21 . LEU A 1 81  ? 4.626   -6.621  -4.124  1.00 0.00 ? 81  LEU A HD21 2  
ATOM   5718   H  HD22 . LEU A 1 81  ? 5.843   -6.630  -2.848  1.00 0.00 ? 81  LEU A HD22 2  
ATOM   5719   H  HD23 . LEU A 1 81  ? 6.279   -7.117  -4.486  1.00 0.00 ? 81  LEU A HD23 2  
ATOM   5720   N  N    . LEU A 1 82  ? 10.395  -3.931  -3.804  1.00 0.00 ? 82  LEU A N    2  
ATOM   5721   C  CA   . LEU A 1 82  ? 11.814  -3.740  -4.221  1.00 0.00 ? 82  LEU A CA   2  
ATOM   5722   C  C    . LEU A 1 82  ? 12.770  -4.110  -3.079  1.00 0.00 ? 82  LEU A C    2  
ATOM   5723   O  O    . LEU A 1 82  ? 13.974  -4.022  -3.221  1.00 0.00 ? 82  LEU A O    2  
ATOM   5724   C  CB   . LEU A 1 82  ? 12.031  -2.279  -4.622  1.00 0.00 ? 82  LEU A CB   2  
ATOM   5725   C  CG   . LEU A 1 82  ? 11.747  -2.105  -6.118  1.00 0.00 ? 82  LEU A CG   2  
ATOM   5726   C  CD1  . LEU A 1 82  ? 11.783  -0.617  -6.471  1.00 0.00 ? 82  LEU A CD1  2  
ATOM   5727   C  CD2  . LEU A 1 82  ? 12.805  -2.849  -6.941  1.00 0.00 ? 82  LEU A CD2  2  
ATOM   5728   H  H    . LEU A 1 82  ? 9.863   -3.164  -3.503  1.00 0.00 ? 82  LEU A H    2  
ATOM   5729   H  HA   . LEU A 1 82  ? 12.020  -4.374  -5.070  1.00 0.00 ? 82  LEU A HA   2  
ATOM   5730   H  HB2  . LEU A 1 82  ? 11.363  -1.650  -4.054  1.00 0.00 ? 82  LEU A HB2  2  
ATOM   5731   H  HB3  . LEU A 1 82  ? 13.050  -1.999  -4.417  1.00 0.00 ? 82  LEU A HB3  2  
ATOM   5732   H  HG   . LEU A 1 82  ? 10.768  -2.502  -6.345  1.00 0.00 ? 82  LEU A HG   2  
ATOM   5733   H  HD11 . LEU A 1 82  ? 12.251  -0.487  -7.436  1.00 0.00 ? 82  LEU A HD11 2  
ATOM   5734   H  HD12 . LEU A 1 82  ? 12.349  -0.083  -5.723  1.00 0.00 ? 82  LEU A HD12 2  
ATOM   5735   H  HD13 . LEU A 1 82  ? 10.776  -0.231  -6.506  1.00 0.00 ? 82  LEU A HD13 2  
ATOM   5736   H  HD21 . LEU A 1 82  ? 13.678  -3.031  -6.332  1.00 0.00 ? 82  LEU A HD21 2  
ATOM   5737   H  HD22 . LEU A 1 82  ? 13.083  -2.249  -7.796  1.00 0.00 ? 82  LEU A HD22 2  
ATOM   5738   H  HD23 . LEU A 1 82  ? 12.401  -3.791  -7.280  1.00 0.00 ? 82  LEU A HD23 2  
ATOM   5739   N  N    . GLU A 1 83  ? 12.257  -4.532  -1.954  1.00 0.00 ? 83  GLU A N    2  
ATOM   5740   C  CA   . GLU A 1 83  ? 13.149  -4.916  -0.817  1.00 0.00 ? 83  GLU A CA   2  
ATOM   5741   C  C    . GLU A 1 83  ? 13.969  -3.712  -0.341  1.00 0.00 ? 83  GLU A C    2  
ATOM   5742   O  O    . GLU A 1 83  ? 15.045  -3.867  0.202   1.00 0.00 ? 83  GLU A O    2  
ATOM   5743   C  CB   . GLU A 1 83  ? 14.106  -6.033  -1.249  1.00 0.00 ? 83  GLU A CB   2  
ATOM   5744   C  CG   . GLU A 1 83  ? 13.353  -7.087  -2.066  1.00 0.00 ? 83  GLU A CG   2  
ATOM   5745   C  CD   . GLU A 1 83  ? 13.896  -7.109  -3.495  1.00 0.00 ? 83  GLU A CD   2  
ATOM   5746   O  OE1  . GLU A 1 83  ? 14.913  -7.749  -3.710  1.00 0.00 ? 83  GLU A OE1  2  
ATOM   5747   O  OE2  . GLU A 1 83  ? 13.288  -6.487  -4.350  1.00 0.00 ? 83  GLU A OE2  2  
ATOM   5748   H  H    . GLU A 1 83  ? 11.287  -4.609  -1.843  1.00 0.00 ? 83  GLU A H    2  
ATOM   5749   H  HA   . GLU A 1 83  ? 12.540  -5.273  0.001   1.00 0.00 ? 83  GLU A HA   2  
ATOM   5750   H  HB2  . GLU A 1 83  ? 14.901  -5.614  -1.846  1.00 0.00 ? 83  GLU A HB2  2  
ATOM   5751   H  HB3  . GLU A 1 83  ? 14.528  -6.499  -0.372  1.00 0.00 ? 83  GLU A HB3  2  
ATOM   5752   H  HG2  . GLU A 1 83  ? 13.492  -8.057  -1.613  1.00 0.00 ? 83  GLU A HG2  2  
ATOM   5753   H  HG3  . GLU A 1 83  ? 12.300  -6.849  -2.086  1.00 0.00 ? 83  GLU A HG3  2  
ATOM   5754   N  N    . ILE A 1 84  ? 13.472  -2.518  -0.514  1.00 0.00 ? 84  ILE A N    2  
ATOM   5755   C  CA   . ILE A 1 84  ? 14.238  -1.328  -0.039  1.00 0.00 ? 84  ILE A CA   2  
ATOM   5756   C  C    . ILE A 1 84  ? 14.142  -1.271  1.487   1.00 0.00 ? 84  ILE A C    2  
ATOM   5757   O  O    . ILE A 1 84  ? 13.065  -1.227  2.047   1.00 0.00 ? 84  ILE A O    2  
ATOM   5758   C  CB   . ILE A 1 84  ? 13.648  -0.056  -0.648  1.00 0.00 ? 84  ILE A CB   2  
ATOM   5759   C  CG1  . ILE A 1 84  ? 13.356  -0.292  -2.133  1.00 0.00 ? 84  ILE A CG1  2  
ATOM   5760   C  CG2  . ILE A 1 84  ? 14.644  1.096   -0.499  1.00 0.00 ? 84  ILE A CG2  2  
ATOM   5761   C  CD1  . ILE A 1 84  ? 14.625  -0.779  -2.843  1.00 0.00 ? 84  ILE A CD1  2  
ATOM   5762   H  H    . ILE A 1 84  ? 12.597  -2.403  -0.939  1.00 0.00 ? 84  ILE A H    2  
ATOM   5763   H  HA   . ILE A 1 84  ? 15.271  -1.423  -0.332  1.00 0.00 ? 84  ILE A HA   2  
ATOM   5764   H  HB   . ILE A 1 84  ? 12.733  0.193   -0.135  1.00 0.00 ? 84  ILE A HB   2  
ATOM   5765   H  HG12 . ILE A 1 84  ? 12.581  -1.038  -2.229  1.00 0.00 ? 84  ILE A HG12 2  
ATOM   5766   H  HG13 . ILE A 1 84  ? 13.025  0.631   -2.584  1.00 0.00 ? 84  ILE A HG13 2  
ATOM   5767   H  HG21 . ILE A 1 84  ? 15.134  1.272   -1.446  1.00 0.00 ? 84  ILE A HG21 2  
ATOM   5768   H  HG22 . ILE A 1 84  ? 15.382  0.840   0.246   1.00 0.00 ? 84  ILE A HG22 2  
ATOM   5769   H  HG23 . ILE A 1 84  ? 14.118  1.988   -0.194  1.00 0.00 ? 84  ILE A HG23 2  
ATOM   5770   H  HD11 . ILE A 1 84  ? 14.663  -1.858  -2.814  1.00 0.00 ? 84  ILE A HD11 2  
ATOM   5771   H  HD12 . ILE A 1 84  ? 15.497  -0.377  -2.349  1.00 0.00 ? 84  ILE A HD12 2  
ATOM   5772   H  HD13 . ILE A 1 84  ? 14.611  -0.447  -3.870  1.00 0.00 ? 84  ILE A HD13 2  
ATOM   5773   N  N    . THR A 1 85  ? 15.259  -1.308  2.166   1.00 0.00 ? 85  THR A N    2  
ATOM   5774   C  CA   . THR A 1 85  ? 15.222  -1.293  3.657   1.00 0.00 ? 85  THR A CA   2  
ATOM   5775   C  C    . THR A 1 85  ? 15.613  0.080   4.207   1.00 0.00 ? 85  THR A C    2  
ATOM   5776   O  O    . THR A 1 85  ? 14.788  0.810   4.720   1.00 0.00 ? 85  THR A O    2  
ATOM   5777   C  CB   . THR A 1 85  ? 16.193  -2.345  4.196   1.00 0.00 ? 85  THR A CB   2  
ATOM   5778   O  OG1  . THR A 1 85  ? 17.314  -2.439  3.329   1.00 0.00 ? 85  THR A OG1  2  
ATOM   5779   C  CG2  . THR A 1 85  ? 15.490  -3.701  4.273   1.00 0.00 ? 85  THR A CG2  2  
ATOM   5780   H  H    . THR A 1 85  ? 16.112  -1.373  1.687   1.00 0.00 ? 85  THR A H    2  
ATOM   5781   H  HA   . THR A 1 85  ? 14.224  -1.535  3.990   1.00 0.00 ? 85  THR A HA   2  
ATOM   5782   H  HB   . THR A 1 85  ? 16.523  -2.060  5.183   1.00 0.00 ? 85  THR A HB   2  
ATOM   5783   H  HG1  . THR A 1 85  ? 17.834  -1.638  3.430   1.00 0.00 ? 85  THR A HG1  2  
ATOM   5784   H  HG21 . THR A 1 85  ? 15.228  -4.027  3.277   1.00 0.00 ? 85  THR A HG21 2  
ATOM   5785   H  HG22 . THR A 1 85  ? 14.594  -3.609  4.869   1.00 0.00 ? 85  THR A HG22 2  
ATOM   5786   H  HG23 . THR A 1 85  ? 16.151  -4.424  4.726   1.00 0.00 ? 85  THR A HG23 2  
ATOM   5787   N  N    . ASN A 1 86  ? 16.873  0.409   4.168   1.00 0.00 ? 86  ASN A N    2  
ATOM   5788   C  CA   . ASN A 1 86  ? 17.329  1.701   4.758   1.00 0.00 ? 86  ASN A CA   2  
ATOM   5789   C  C    . ASN A 1 86  ? 17.070  2.877   3.813   1.00 0.00 ? 86  ASN A C    2  
ATOM   5790   O  O    . ASN A 1 86  ? 17.666  2.987   2.762   1.00 0.00 ? 86  ASN A O    2  
ATOM   5791   C  CB   . ASN A 1 86  ? 18.832  1.603   5.022   1.00 0.00 ? 86  ASN A CB   2  
ATOM   5792   C  CG   . ASN A 1 86  ? 19.124  0.370   5.880   1.00 0.00 ? 86  ASN A CG   2  
ATOM   5793   O  OD1  . ASN A 1 86  ? 19.825  0.455   6.867   1.00 0.00 ? 86  ASN A OD1  2  
ATOM   5794   N  ND2  . ASN A 1 86  ? 18.617  -0.785  5.540   1.00 0.00 ? 86  ASN A ND2  2  
ATOM   5795   H  H    . ASN A 1 86  ? 17.537  -0.220  3.815   1.00 0.00 ? 86  ASN A H    2  
ATOM   5796   H  HA   . ASN A 1 86  ? 16.816  1.872   5.692   1.00 0.00 ? 86  ASN A HA   2  
ATOM   5797   H  HB2  . ASN A 1 86  ? 19.355  1.516   4.081   1.00 0.00 ? 86  ASN A HB2  2  
ATOM   5798   H  HB3  . ASN A 1 86  ? 19.168  2.486   5.538   1.00 0.00 ? 86  ASN A HB3  2  
ATOM   5799   H  HD21 . ASN A 1 86  ? 18.054  -0.857  4.742   1.00 0.00 ? 86  ASN A HD21 2  
ATOM   5800   H  HD22 . ASN A 1 86  ? 18.801  -1.579  6.084   1.00 0.00 ? 86  ASN A HD22 2  
ATOM   5801   N  N    . VAL A 1 87  ? 16.196  3.770   4.207   1.00 0.00 ? 87  VAL A N    2  
ATOM   5802   C  CA   . VAL A 1 87  ? 15.898  4.968   3.363   1.00 0.00 ? 87  VAL A CA   2  
ATOM   5803   C  C    . VAL A 1 87  ? 15.175  6.017   4.212   1.00 0.00 ? 87  VAL A C    2  
ATOM   5804   O  O    . VAL A 1 87  ? 14.348  5.696   5.049   1.00 0.00 ? 87  VAL A O    2  
ATOM   5805   C  CB   . VAL A 1 87  ? 14.993  4.579   2.189   1.00 0.00 ? 87  VAL A CB   2  
ATOM   5806   C  CG1  . VAL A 1 87  ? 15.789  3.810   1.131   1.00 0.00 ? 87  VAL A CG1  2  
ATOM   5807   C  CG2  . VAL A 1 87  ? 13.851  3.708   2.708   1.00 0.00 ? 87  VAL A CG2  2  
ATOM   5808   H  H    . VAL A 1 87  ? 15.746  3.662   5.074   1.00 0.00 ? 87  VAL A H    2  
ATOM   5809   H  HA   . VAL A 1 87  ? 16.821  5.384   2.989   1.00 0.00 ? 87  VAL A HA   2  
ATOM   5810   H  HB   . VAL A 1 87  ? 14.585  5.476   1.745   1.00 0.00 ? 87  VAL A HB   2  
ATOM   5811   H  HG11 . VAL A 1 87  ? 16.785  4.217   1.056   1.00 0.00 ? 87  VAL A HG11 2  
ATOM   5812   H  HG12 . VAL A 1 87  ? 15.293  3.902   0.176   1.00 0.00 ? 87  VAL A HG12 2  
ATOM   5813   H  HG13 . VAL A 1 87  ? 15.843  2.767   1.408   1.00 0.00 ? 87  VAL A HG13 2  
ATOM   5814   H  HG21 . VAL A 1 87  ? 12.942  3.951   2.177   1.00 0.00 ? 87  VAL A HG21 2  
ATOM   5815   H  HG22 . VAL A 1 87  ? 13.713  3.896   3.763   1.00 0.00 ? 87  VAL A HG22 2  
ATOM   5816   H  HG23 . VAL A 1 87  ? 14.092  2.668   2.555   1.00 0.00 ? 87  VAL A HG23 2  
ATOM   5817   N  N    . THR A 1 88  ? 15.473  7.271   3.995   1.00 0.00 ? 88  THR A N    2  
ATOM   5818   C  CA   . THR A 1 88  ? 14.802  8.351   4.774   1.00 0.00 ? 88  THR A CA   2  
ATOM   5819   C  C    . THR A 1 88  ? 13.894  9.153   3.838   1.00 0.00 ? 88  THR A C    2  
ATOM   5820   O  O    . THR A 1 88  ? 14.348  9.985   3.078   1.00 0.00 ? 88  THR A O    2  
ATOM   5821   C  CB   . THR A 1 88  ? 15.855  9.277   5.387   1.00 0.00 ? 88  THR A CB   2  
ATOM   5822   O  OG1  . THR A 1 88  ? 16.803  8.501   6.106   1.00 0.00 ? 88  THR A OG1  2  
ATOM   5823   C  CG2  . THR A 1 88  ? 15.178  10.264  6.340   1.00 0.00 ? 88  THR A CG2  2  
ATOM   5824   H  H    . THR A 1 88  ? 16.135  7.504   3.311   1.00 0.00 ? 88  THR A H    2  
ATOM   5825   H  HA   . THR A 1 88  ? 14.206  7.913   5.562   1.00 0.00 ? 88  THR A HA   2  
ATOM   5826   H  HB   . THR A 1 88  ? 16.356  9.824   4.605   1.00 0.00 ? 88  THR A HB   2  
ATOM   5827   H  HG1  . THR A 1 88  ? 17.668  8.906   5.990   1.00 0.00 ? 88  THR A HG1  2  
ATOM   5828   H  HG21 . THR A 1 88  ? 15.205  9.871   7.345   1.00 0.00 ? 88  THR A HG21 2  
ATOM   5829   H  HG22 . THR A 1 88  ? 14.152  10.409  6.038   1.00 0.00 ? 88  THR A HG22 2  
ATOM   5830   H  HG23 . THR A 1 88  ? 15.700  11.209  6.308   1.00 0.00 ? 88  THR A HG23 2  
ATOM   5831   N  N    . ILE A 1 89  ? 12.615  8.902   3.887   1.00 0.00 ? 89  ILE A N    2  
ATOM   5832   C  CA   . ILE A 1 89  ? 11.673  9.639   2.999   1.00 0.00 ? 89  ILE A CA   2  
ATOM   5833   C  C    . ILE A 1 89  ? 11.169  10.894  3.713   1.00 0.00 ? 89  ILE A C    2  
ATOM   5834   O  O    . ILE A 1 89  ? 10.343  10.821  4.600   1.00 0.00 ? 89  ILE A O    2  
ATOM   5835   C  CB   . ILE A 1 89  ? 10.482  8.740   2.662   1.00 0.00 ? 89  ILE A CB   2  
ATOM   5836   C  CG1  . ILE A 1 89  ? 10.976  7.502   1.912   1.00 0.00 ? 89  ILE A CG1  2  
ATOM   5837   C  CG2  . ILE A 1 89  ? 9.491   9.509   1.785   1.00 0.00 ? 89  ILE A CG2  2  
ATOM   5838   C  CD1  . ILE A 1 89  ? 10.644  6.247   2.721   1.00 0.00 ? 89  ILE A CD1  2  
ATOM   5839   H  H    . ILE A 1 89  ? 12.279  8.223   4.509   1.00 0.00 ? 89  ILE A H    2  
ATOM   5840   H  HA   . ILE A 1 89  ? 12.177  9.919   2.087   1.00 0.00 ? 89  ILE A HA   2  
ATOM   5841   H  HB   . ILE A 1 89  ? 9.993   8.438   3.576   1.00 0.00 ? 89  ILE A HB   2  
ATOM   5842   H  HG12 . ILE A 1 89  ? 10.492  7.449   0.947   1.00 0.00 ? 89  ILE A HG12 2  
ATOM   5843   H  HG13 . ILE A 1 89  ? 12.045  7.566   1.775   1.00 0.00 ? 89  ILE A HG13 2  
ATOM   5844   H  HG21 . ILE A 1 89  ? 10.028  10.224  1.178   1.00 0.00 ? 89  ILE A HG21 2  
ATOM   5845   H  HG22 . ILE A 1 89  ? 8.783   10.030  2.412   1.00 0.00 ? 89  ILE A HG22 2  
ATOM   5846   H  HG23 . ILE A 1 89  ? 8.964   8.817   1.145   1.00 0.00 ? 89  ILE A HG23 2  
ATOM   5847   H  HD11 . ILE A 1 89  ? 11.209  6.252   3.641   1.00 0.00 ? 89  ILE A HD11 2  
ATOM   5848   H  HD12 . ILE A 1 89  ? 10.899  5.369   2.146   1.00 0.00 ? 89  ILE A HD12 2  
ATOM   5849   H  HD13 . ILE A 1 89  ? 9.588   6.234   2.948   1.00 0.00 ? 89  ILE A HD13 2  
ATOM   5850   N  N    . GLU A 1 90  ? 11.638  12.051  3.328   1.00 0.00 ? 90  GLU A N    2  
ATOM   5851   C  CA   . GLU A 1 90  ? 11.156  13.295  3.987   1.00 0.00 ? 90  GLU A CA   2  
ATOM   5852   C  C    . GLU A 1 90  ? 9.799   13.662  3.387   1.00 0.00 ? 90  GLU A C    2  
ATOM   5853   O  O    . GLU A 1 90  ? 9.643   13.715  2.184   1.00 0.00 ? 90  GLU A O    2  
ATOM   5854   C  CB   . GLU A 1 90  ? 12.154  14.429  3.741   1.00 0.00 ? 90  GLU A CB   2  
ATOM   5855   C  CG   . GLU A 1 90  ? 13.569  13.937  4.050   1.00 0.00 ? 90  GLU A CG   2  
ATOM   5856   C  CD   . GLU A 1 90  ? 14.220  14.864  5.079   1.00 0.00 ? 90  GLU A CD   2  
ATOM   5857   O  OE1  . GLU A 1 90  ? 14.131  16.068  4.902   1.00 0.00 ? 90  GLU A OE1  2  
ATOM   5858   O  OE2  . GLU A 1 90  ? 14.794  14.354  6.026   1.00 0.00 ? 90  GLU A OE2  2  
ATOM   5859   H  H    . GLU A 1 90  ? 12.290  12.110  2.600   1.00 0.00 ? 90  GLU A H    2  
ATOM   5860   H  HA   . GLU A 1 90  ? 11.050  13.124  5.049   1.00 0.00 ? 90  GLU A HA   2  
ATOM   5861   H  HB2  . GLU A 1 90  ? 12.097  14.740  2.708   1.00 0.00 ? 90  GLU A HB2  2  
ATOM   5862   H  HB3  . GLU A 1 90  ? 11.917  15.264  4.382   1.00 0.00 ? 90  GLU A HB3  2  
ATOM   5863   H  HG2  . GLU A 1 90  ? 13.521  12.933  4.448   1.00 0.00 ? 90  GLU A HG2  2  
ATOM   5864   H  HG3  . GLU A 1 90  ? 14.158  13.938  3.145   1.00 0.00 ? 90  GLU A HG3  2  
ATOM   5865   N  N    . VAL A 1 91  ? 8.813   13.888  4.212   1.00 0.00 ? 91  VAL A N    2  
ATOM   5866   C  CA   . VAL A 1 91  ? 7.459   14.217  3.676   1.00 0.00 ? 91  VAL A CA   2  
ATOM   5867   C  C    . VAL A 1 91  ? 7.080   15.669  3.980   1.00 0.00 ? 91  VAL A C    2  
ATOM   5868   O  O    . VAL A 1 91  ? 6.811   16.025  5.109   1.00 0.00 ? 91  VAL A O    2  
ATOM   5869   C  CB   . VAL A 1 91  ? 6.427   13.292  4.322   1.00 0.00 ? 91  VAL A CB   2  
ATOM   5870   C  CG1  . VAL A 1 91  ? 5.018   13.754  3.941   1.00 0.00 ? 91  VAL A CG1  2  
ATOM   5871   C  CG2  . VAL A 1 91  ? 6.644   11.861  3.825   1.00 0.00 ? 91  VAL A CG2  2  
ATOM   5872   H  H    . VAL A 1 91  ? 8.958   13.817  5.179   1.00 0.00 ? 91  VAL A H    2  
ATOM   5873   H  HA   . VAL A 1 91  ? 7.450   14.064  2.611   1.00 0.00 ? 91  VAL A HA   2  
ATOM   5874   H  HB   . VAL A 1 91  ? 6.538   13.323  5.396   1.00 0.00 ? 91  VAL A HB   2  
ATOM   5875   H  HG11 . VAL A 1 91  ? 4.305   12.987  4.200   1.00 0.00 ? 91  VAL A HG11 2  
ATOM   5876   H  HG12 . VAL A 1 91  ? 4.976   13.941  2.878   1.00 0.00 ? 91  VAL A HG12 2  
ATOM   5877   H  HG13 . VAL A 1 91  ? 4.781   14.661  4.476   1.00 0.00 ? 91  VAL A HG13 2  
ATOM   5878   H  HG21 . VAL A 1 91  ? 6.050   11.693  2.939   1.00 0.00 ? 91  VAL A HG21 2  
ATOM   5879   H  HG22 . VAL A 1 91  ? 6.349   11.164  4.595   1.00 0.00 ? 91  VAL A HG22 2  
ATOM   5880   H  HG23 . VAL A 1 91  ? 7.690   11.717  3.590   1.00 0.00 ? 91  VAL A HG23 2  
ATOM   5881   N  N    . ILE A 1 92  ? 7.018   16.503  2.973   1.00 0.00 ? 92  ILE A N    2  
ATOM   5882   C  CA   . ILE A 1 92  ? 6.611   17.912  3.205   1.00 0.00 ? 92  ILE A CA   2  
ATOM   5883   C  C    . ILE A 1 92  ? 5.106   17.998  2.977   1.00 0.00 ? 92  ILE A C    2  
ATOM   5884   O  O    . ILE A 1 92  ? 4.630   17.858  1.867   1.00 0.00 ? 92  ILE A O    2  
ATOM   5885   C  CB   . ILE A 1 92  ? 7.340   18.829  2.226   1.00 0.00 ? 92  ILE A CB   2  
ATOM   5886   C  CG1  . ILE A 1 92  ? 8.828   18.825  2.564   1.00 0.00 ? 92  ILE A CG1  2  
ATOM   5887   C  CG2  . ILE A 1 92  ? 6.792   20.253  2.348   1.00 0.00 ? 92  ILE A CG2  2  
ATOM   5888   C  CD1  . ILE A 1 92  ? 9.637   18.467  1.316   1.00 0.00 ? 92  ILE A CD1  2  
ATOM   5889   H  H    . ILE A 1 92  ? 7.210   16.196  2.061   1.00 0.00 ? 92  ILE A H    2  
ATOM   5890   H  HA   . ILE A 1 92  ? 6.845   18.196  4.223   1.00 0.00 ? 92  ILE A HA   2  
ATOM   5891   H  HB   . ILE A 1 92  ? 7.196   18.471  1.217   1.00 0.00 ? 92  ILE A HB   2  
ATOM   5892   H  HG12 . ILE A 1 92  ? 9.118   19.802  2.914   1.00 0.00 ? 92  ILE A HG12 2  
ATOM   5893   H  HG13 . ILE A 1 92  ? 9.015   18.095  3.335   1.00 0.00 ? 92  ILE A HG13 2  
ATOM   5894   H  HG21 . ILE A 1 92  ? 7.583   20.961  2.151   1.00 0.00 ? 92  ILE A HG21 2  
ATOM   5895   H  HG22 . ILE A 1 92  ? 6.412   20.407  3.347   1.00 0.00 ? 92  ILE A HG22 2  
ATOM   5896   H  HG23 . ILE A 1 92  ? 5.995   20.394  1.634   1.00 0.00 ? 92  ILE A HG23 2  
ATOM   5897   H  HD11 . ILE A 1 92  ? 9.544   19.258  0.587   1.00 0.00 ? 92  ILE A HD11 2  
ATOM   5898   H  HD12 . ILE A 1 92  ? 9.263   17.545  0.896   1.00 0.00 ? 92  ILE A HD12 2  
ATOM   5899   H  HD13 . ILE A 1 92  ? 10.676  18.345  1.584   1.00 0.00 ? 92  ILE A HD13 2  
ATOM   5900   N  N    . GLY A 1 93  ? 4.353   18.201  4.018   1.00 0.00 ? 93  GLY A N    2  
ATOM   5901   C  CA   . GLY A 1 93  ? 2.871   18.268  3.868   1.00 0.00 ? 93  GLY A CA   2  
ATOM   5902   C  C    . GLY A 1 93  ? 2.229   17.340  4.897   1.00 0.00 ? 93  GLY A C    2  
ATOM   5903   O  O    . GLY A 1 93  ? 2.827   17.009  5.901   1.00 0.00 ? 93  GLY A O    2  
ATOM   5904   H  H    . GLY A 1 93  ? 4.759   18.299  4.904   1.00 0.00 ? 93  GLY A H    2  
ATOM   5905   H  HA2  . GLY A 1 93  ? 2.529   19.279  4.031   1.00 0.00 ? 93  GLY A HA2  2  
ATOM   5906   H  HA3  . GLY A 1 93  ? 2.590   17.945  2.877   1.00 0.00 ? 93  GLY A HA3  2  
ATOM   5907   N  N    . ASN A 1 94  ? 1.017   16.924  4.658   1.00 0.00 ? 94  ASN A N    2  
ATOM   5908   C  CA   . ASN A 1 94  ? 0.329   16.022  5.629   1.00 0.00 ? 94  ASN A CA   2  
ATOM   5909   C  C    . ASN A 1 94  ? -0.049  14.698  4.956   1.00 0.00 ? 94  ASN A C    2  
ATOM   5910   O  O    . ASN A 1 94  ? -0.460  13.759  5.612   1.00 0.00 ? 94  ASN A O    2  
ATOM   5911   C  CB   . ASN A 1 94  ? -0.939  16.707  6.143   1.00 0.00 ? 94  ASN A CB   2  
ATOM   5912   C  CG   . ASN A 1 94  ? -1.036  18.110  5.543   1.00 0.00 ? 94  ASN A CG   2  
ATOM   5913   O  OD1  . ASN A 1 94  ? -0.332  19.011  5.955   1.00 0.00 ? 94  ASN A OD1  2  
ATOM   5914   N  ND2  . ASN A 1 94  ? -1.886  18.336  4.578   1.00 0.00 ? 94  ASN A ND2  2  
ATOM   5915   H  H    . ASN A 1 94  ? 0.557   17.214  3.843   1.00 0.00 ? 94  ASN A H    2  
ATOM   5916   H  HA   . ASN A 1 94  ? 0.985   15.821  6.463   1.00 0.00 ? 94  ASN A HA   2  
ATOM   5917   H  HB2  . ASN A 1 94  ? -1.803  16.129  5.852   1.00 0.00 ? 94  ASN A HB2  2  
ATOM   5918   H  HB3  . ASN A 1 94  ? -0.899  16.781  7.219   1.00 0.00 ? 94  ASN A HB3  2  
ATOM   5919   H  HD21 . ASN A 1 94  ? -2.454  17.609  4.246   1.00 0.00 ? 94  ASN A HD21 2  
ATOM   5920   H  HD22 . ASN A 1 94  ? -1.957  19.231  4.186   1.00 0.00 ? 94  ASN A HD22 2  
ATOM   5921   N  N    . GLU A 1 95  ? 0.071   14.603  3.659   1.00 0.00 ? 95  GLU A N    2  
ATOM   5922   C  CA   . GLU A 1 95  ? -0.304  13.328  2.986   1.00 0.00 ? 95  GLU A CA   2  
ATOM   5923   C  C    . GLU A 1 95  ? 0.607   13.058  1.785   1.00 0.00 ? 95  GLU A C    2  
ATOM   5924   O  O    . GLU A 1 95  ? 1.111   13.963  1.150   1.00 0.00 ? 95  GLU A O    2  
ATOM   5925   C  CB   . GLU A 1 95  ? -1.758  13.409  2.519   1.00 0.00 ? 95  GLU A CB   2  
ATOM   5926   C  CG   . GLU A 1 95  ? -1.930  14.592  1.566   1.00 0.00 ? 95  GLU A CG   2  
ATOM   5927   C  CD   . GLU A 1 95  ? -1.754  15.903  2.334   1.00 0.00 ? 95  GLU A CD   2  
ATOM   5928   O  OE1  . GLU A 1 95  ? -2.090  15.929  3.507   1.00 0.00 ? 95  GLU A OE1  2  
ATOM   5929   O  OE2  . GLU A 1 95  ? -1.286  16.858  1.738   1.00 0.00 ? 95  GLU A OE2  2  
ATOM   5930   H  H    . GLU A 1 95  ? 0.392   15.363  3.133   1.00 0.00 ? 95  GLU A H    2  
ATOM   5931   H  HA   . GLU A 1 95  ? -0.207  12.517  3.691   1.00 0.00 ? 95  GLU A HA   2  
ATOM   5932   H  HB2  . GLU A 1 95  ? -2.026  12.495  2.010   1.00 0.00 ? 95  GLU A HB2  2  
ATOM   5933   H  HB3  . GLU A 1 95  ? -2.402  13.548  3.374   1.00 0.00 ? 95  GLU A HB3  2  
ATOM   5934   H  HG2  . GLU A 1 95  ? -1.193  14.533  0.778   1.00 0.00 ? 95  GLU A HG2  2  
ATOM   5935   H  HG3  . GLU A 1 95  ? -2.917  14.560  1.137   1.00 0.00 ? 95  GLU A HG3  2  
ATOM   5936   N  N    . ILE A 1 96  ? 0.821   11.806  1.481   1.00 0.00 ? 96  ILE A N    2  
ATOM   5937   C  CA   . ILE A 1 96  ? 1.699   11.432  0.333   1.00 0.00 ? 96  ILE A CA   2  
ATOM   5938   C  C    . ILE A 1 96  ? 0.965   11.686  -0.998  1.00 0.00 ? 96  ILE A C    2  
ATOM   5939   O  O    . ILE A 1 96  ? -0.092  11.135  -1.230  1.00 0.00 ? 96  ILE A O    2  
ATOM   5940   C  CB   . ILE A 1 96  ? 2.017   9.939   0.438   1.00 0.00 ? 96  ILE A CB   2  
ATOM   5941   C  CG1  . ILE A 1 96  ? 2.508   9.615   1.852   1.00 0.00 ? 96  ILE A CG1  2  
ATOM   5942   C  CG2  . ILE A 1 96  ? 3.097   9.554   -0.575  1.00 0.00 ? 96  ILE A CG2  2  
ATOM   5943   C  CD1  . ILE A 1 96  ? 3.605   10.602  2.256   1.00 0.00 ? 96  ILE A CD1  2  
ATOM   5944   H  H    . ILE A 1 96  ? 0.407   11.100  2.020   1.00 0.00 ? 96  ILE A H    2  
ATOM   5945   H  HA   . ILE A 1 96  ? 2.613   11.998  0.380   1.00 0.00 ? 96  ILE A HA   2  
ATOM   5946   H  HB   . ILE A 1 96  ? 1.123   9.373   0.231   1.00 0.00 ? 96  ILE A HB   2  
ATOM   5947   H  HG12 . ILE A 1 96  ? 1.682   9.690   2.544   1.00 0.00 ? 96  ILE A HG12 2  
ATOM   5948   H  HG13 . ILE A 1 96  ? 2.905   8.611   1.872   1.00 0.00 ? 96  ILE A HG13 2  
ATOM   5949   H  HG21 . ILE A 1 96  ? 3.223   10.352  -1.290  1.00 0.00 ? 96  ILE A HG21 2  
ATOM   5950   H  HG22 . ILE A 1 96  ? 2.800   8.654   -1.091  1.00 0.00 ? 96  ILE A HG22 2  
ATOM   5951   H  HG23 . ILE A 1 96  ? 4.029   9.381   -0.058  1.00 0.00 ? 96  ILE A HG23 2  
ATOM   5952   H  HD11 . ILE A 1 96  ? 3.155   11.538  2.554   1.00 0.00 ? 96  ILE A HD11 2  
ATOM   5953   H  HD12 . ILE A 1 96  ? 4.265   10.771  1.419   1.00 0.00 ? 96  ILE A HD12 2  
ATOM   5954   H  HD13 . ILE A 1 96  ? 4.168   10.195  3.082   1.00 0.00 ? 96  ILE A HD13 2  
ATOM   5955   N  N    . PRO A 1 97  ? 1.518   12.494  -1.880  1.00 0.00 ? 97  PRO A N    2  
ATOM   5956   C  CA   . PRO A 1 97  ? 0.887   12.776  -3.203  1.00 0.00 ? 97  PRO A CA   2  
ATOM   5957   C  C    . PRO A 1 97  ? 0.393   11.502  -3.896  1.00 0.00 ? 97  PRO A C    2  
ATOM   5958   O  O    . PRO A 1 97  ? 1.100   10.518  -3.992  1.00 0.00 ? 97  PRO A O    2  
ATOM   5959   C  CB   . PRO A 1 97  ? 2.018   13.405  -4.014  1.00 0.00 ? 97  PRO A CB   2  
ATOM   5960   C  CG   . PRO A 1 97  ? 2.923   14.038  -3.011  1.00 0.00 ? 97  PRO A CG   2  
ATOM   5961   C  CD   . PRO A 1 97  ? 2.782   13.236  -1.717  1.00 0.00 ? 97  PRO A CD   2  
ATOM   5962   H  HA   . PRO A 1 97  ? 0.083   13.484  -3.094  1.00 0.00 ? 97  PRO A HA   2  
ATOM   5963   H  HB2  . PRO A 1 97  ? 2.547   12.641  -4.570  1.00 0.00 ? 97  PRO A HB2  2  
ATOM   5964   H  HB3  . PRO A 1 97  ? 1.628   14.153  -4.683  1.00 0.00 ? 97  PRO A HB3  2  
ATOM   5965   H  HG2  . PRO A 1 97  ? 3.945   14.001  -3.364  1.00 0.00 ? 97  PRO A HG2  2  
ATOM   5966   H  HG3  . PRO A 1 97  ? 2.627   15.060  -2.838  1.00 0.00 ? 97  PRO A HG3  2  
ATOM   5967   H  HD2  . PRO A 1 97  ? 3.613   12.557  -1.602  1.00 0.00 ? 97  PRO A HD2  2  
ATOM   5968   H  HD3  . PRO A 1 97  ? 2.713   13.900  -0.870  1.00 0.00 ? 97  PRO A HD3  2  
ATOM   5969   N  N    . ILE A 1 98  ? -0.821  11.517  -4.375  1.00 0.00 ? 98  ILE A N    2  
ATOM   5970   C  CA   . ILE A 1 98  ? -1.377  10.314  -5.058  1.00 0.00 ? 98  ILE A CA   2  
ATOM   5971   C  C    . ILE A 1 98  ? -0.812  10.210  -6.476  1.00 0.00 ? 98  ILE A C    2  
ATOM   5972   O  O    . ILE A 1 98  ? -0.757  9.143   -7.052  1.00 0.00 ? 98  ILE A O    2  
ATOM   5973   C  CB   . ILE A 1 98  ? -2.898  10.439  -5.128  1.00 0.00 ? 98  ILE A CB   2  
ATOM   5974   C  CG1  . ILE A 1 98  ? -3.484  9.197   -5.804  1.00 0.00 ? 98  ILE A CG1  2  
ATOM   5975   C  CG2  . ILE A 1 98  ? -3.267  11.684  -5.939  1.00 0.00 ? 98  ILE A CG2  2  
ATOM   5976   C  CD1  . ILE A 1 98  ? -3.153  7.958   -4.973  1.00 0.00 ? 98  ILE A CD1  2  
ATOM   5977   H  H    . ILE A 1 98  ? -1.371  12.322  -4.276  1.00 0.00 ? 98  ILE A H    2  
ATOM   5978   H  HA   . ILE A 1 98  ? -1.115  9.427   -4.499  1.00 0.00 ? 98  ILE A HA   2  
ATOM   5979   H  HB   . ILE A 1 98  ? -3.293  10.531  -4.128  1.00 0.00 ? 98  ILE A HB   2  
ATOM   5980   H  HG12 . ILE A 1 98  ? -4.556  9.302   -5.884  1.00 0.00 ? 98  ILE A HG12 2  
ATOM   5981   H  HG13 . ILE A 1 98  ? -3.061  9.090   -6.791  1.00 0.00 ? 98  ILE A HG13 2  
ATOM   5982   H  HG21 . ILE A 1 98  ? -3.059  11.506  -6.984  1.00 0.00 ? 98  ILE A HG21 2  
ATOM   5983   H  HG22 . ILE A 1 98  ? -2.682  12.524  -5.594  1.00 0.00 ? 98  ILE A HG22 2  
ATOM   5984   H  HG23 . ILE A 1 98  ? -4.317  11.899  -5.813  1.00 0.00 ? 98  ILE A HG23 2  
ATOM   5985   H  HD11 . ILE A 1 98  ? -3.944  7.230   -5.078  1.00 0.00 ? 98  ILE A HD11 2  
ATOM   5986   H  HD12 . ILE A 1 98  ? -3.057  8.237   -3.933  1.00 0.00 ? 98  ILE A HD12 2  
ATOM   5987   H  HD13 . ILE A 1 98  ? -2.222  7.532   -5.318  1.00 0.00 ? 98  ILE A HD13 2  
ATOM   5988   N  N    . LEU A 1 99  ? -0.403  11.309  -7.044  1.00 0.00 ? 99  LEU A N    2  
ATOM   5989   C  CA   . LEU A 1 99  ? 0.151   11.277  -8.428  1.00 0.00 ? 99  LEU A CA   2  
ATOM   5990   C  C    . LEU A 1 99  ? -0.894  10.701  -9.393  1.00 0.00 ? 99  LEU A C    2  
ATOM   5991   O  O    . LEU A 1 99  ? -1.917  11.305  -9.641  1.00 0.00 ? 99  LEU A O    2  
ATOM   5992   C  CB   . LEU A 1 99  ? 1.421   10.418  -8.461  1.00 0.00 ? 99  LEU A CB   2  
ATOM   5993   C  CG   . LEU A 1 99  ? 2.417   10.932  -7.418  1.00 0.00 ? 99  LEU A CG   2  
ATOM   5994   C  CD1  . LEU A 1 99  ? 3.464   9.851   -7.141  1.00 0.00 ? 99  LEU A CD1  2  
ATOM   5995   C  CD2  . LEU A 1 99  ? 3.114   12.189  -7.947  1.00 0.00 ? 99  LEU A CD2  2  
ATOM   5996   H  H    . LEU A 1 99  ? -0.464  12.160  -6.562  1.00 0.00 ? 99  LEU A H    2  
ATOM   5997   H  HA   . LEU A 1 99  ? 0.395   12.284  -8.735  1.00 0.00 ? 99  LEU A HA   2  
ATOM   5998   H  HB2  . LEU A 1 99  ? 1.169   9.391   -8.242  1.00 0.00 ? 99  LEU A HB2  2  
ATOM   5999   H  HB3  . LEU A 1 99  ? 1.868   10.476  -9.442  1.00 0.00 ? 99  LEU A HB3  2  
ATOM   6000   H  HG   . LEU A 1 99  ? 1.892   11.166  -6.504  1.00 0.00 ? 99  LEU A HG   2  
ATOM   6001   H  HD11 . LEU A 1 99  ? 3.812   9.439   -8.077  1.00 0.00 ? 99  LEU A HD11 2  
ATOM   6002   H  HD12 . LEU A 1 99  ? 3.024   9.067   -6.544  1.00 0.00 ? 99  LEU A HD12 2  
ATOM   6003   H  HD13 . LEU A 1 99  ? 4.298   10.285  -6.608  1.00 0.00 ? 99  LEU A HD13 2  
ATOM   6004   H  HD21 . LEU A 1 99  ? 3.477   12.008  -8.948  1.00 0.00 ? 99  LEU A HD21 2  
ATOM   6005   H  HD22 . LEU A 1 99  ? 3.945   12.437  -7.303  1.00 0.00 ? 99  LEU A HD22 2  
ATOM   6006   H  HD23 . LEU A 1 99  ? 2.413   13.010  -7.962  1.00 0.00 ? 99  LEU A HD23 2  
ATOM   6007   N  N    . ASP A 1 100 ? -0.640  9.548   -9.955  1.00 0.00 ? 100 ASP A N    2  
ATOM   6008   C  CA   . ASP A 1 100 ? -1.617  8.957   -10.916 1.00 0.00 ? 100 ASP A CA   2  
ATOM   6009   C  C    . ASP A 1 100 ? -2.559  7.977   -10.204 1.00 0.00 ? 100 ASP A C    2  
ATOM   6010   O  O    . ASP A 1 100 ? -3.614  7.652   -10.710 1.00 0.00 ? 100 ASP A O    2  
ATOM   6011   C  CB   . ASP A 1 100 ? -0.855  8.216   -12.016 1.00 0.00 ? 100 ASP A CB   2  
ATOM   6012   C  CG   . ASP A 1 100 ? -1.810  7.881   -13.163 1.00 0.00 ? 100 ASP A CG   2  
ATOM   6013   O  OD1  . ASP A 1 100 ? -2.512  6.889   -13.054 1.00 0.00 ? 100 ASP A OD1  2  
ATOM   6014   O  OD2  . ASP A 1 100 ? -1.823  8.622   -14.133 1.00 0.00 ? 100 ASP A OD2  2  
ATOM   6015   H  H    . ASP A 1 100 ? 0.195   9.078   -9.757  1.00 0.00 ? 100 ASP A H    2  
ATOM   6016   H  HA   . ASP A 1 100 ? -2.201  9.749   -11.362 1.00 0.00 ? 100 ASP A HA   2  
ATOM   6017   H  HB2  . ASP A 1 100 ? -0.055  8.844   -12.384 1.00 0.00 ? 100 ASP A HB2  2  
ATOM   6018   H  HB3  . ASP A 1 100 ? -0.442  7.303   -11.616 1.00 0.00 ? 100 ASP A HB3  2  
ATOM   6019   N  N    . GLY A 1 101 ? -2.188  7.495   -9.046  1.00 0.00 ? 101 GLY A N    2  
ATOM   6020   C  CA   . GLY A 1 101 ? -3.070  6.526   -8.323  1.00 0.00 ? 101 GLY A CA   2  
ATOM   6021   C  C    . GLY A 1 101 ? -2.362  5.172   -8.230  1.00 0.00 ? 101 GLY A C    2  
ATOM   6022   O  O    . GLY A 1 101 ? -2.787  4.287   -7.514  1.00 0.00 ? 101 GLY A O    2  
ATOM   6023   H  H    . GLY A 1 101 ? -1.329  7.761   -8.656  1.00 0.00 ? 101 GLY A H    2  
ATOM   6024   H  HA2  . GLY A 1 101 ? -3.280  6.894   -7.327  1.00 0.00 ? 101 GLY A HA2  2  
ATOM   6025   H  HA3  . GLY A 1 101 ? -3.997  6.406   -8.863  1.00 0.00 ? 101 GLY A HA3  2  
ATOM   6026   N  N    . SER A 1 102 ? -1.284  5.005   -8.953  1.00 0.00 ? 102 SER A N    2  
ATOM   6027   C  CA   . SER A 1 102 ? -0.543  3.709   -8.917  1.00 0.00 ? 102 SER A CA   2  
ATOM   6028   C  C    . SER A 1 102 ? 0.843   3.925   -8.303  1.00 0.00 ? 102 SER A C    2  
ATOM   6029   O  O    . SER A 1 102 ? 1.140   4.978   -7.773  1.00 0.00 ? 102 SER A O    2  
ATOM   6030   C  CB   . SER A 1 102 ? -0.388  3.174   -10.340 1.00 0.00 ? 102 SER A CB   2  
ATOM   6031   O  OG   . SER A 1 102 ? -0.311  4.265   -11.248 1.00 0.00 ? 102 SER A OG   2  
ATOM   6032   H  H    . SER A 1 102 ? -0.964  5.734   -9.524  1.00 0.00 ? 102 SER A H    2  
ATOM   6033   H  HA   . SER A 1 102 ? -1.089  2.994   -8.323  1.00 0.00 ? 102 SER A HA   2  
ATOM   6034   H  HB2  . SER A 1 102 ? 0.515   2.590   -10.412 1.00 0.00 ? 102 SER A HB2  2  
ATOM   6035   H  HB3  . SER A 1 102 ? -1.238  2.549   -10.583 1.00 0.00 ? 102 SER A HB3  2  
ATOM   6036   H  HG   . SER A 1 102 ? 0.614   4.406   -11.466 1.00 0.00 ? 102 SER A HG   2  
ATOM   6037   N  N    . GLY A 1 103 ? 1.692   2.933   -8.374  1.00 0.00 ? 103 GLY A N    2  
ATOM   6038   C  CA   . GLY A 1 103 ? 3.062   3.070   -7.801  1.00 0.00 ? 103 GLY A CA   2  
ATOM   6039   C  C    . GLY A 1 103 ? 4.083   3.005   -8.936  1.00 0.00 ? 103 GLY A C    2  
ATOM   6040   O  O    . GLY A 1 103 ? 5.271   3.162   -8.736  1.00 0.00 ? 103 GLY A O    2  
ATOM   6041   H  H    . GLY A 1 103 ? 1.428   2.095   -8.811  1.00 0.00 ? 103 GLY A H    2  
ATOM   6042   H  HA2  . GLY A 1 103 ? 3.151   4.015   -7.283  1.00 0.00 ? 103 GLY A HA2  2  
ATOM   6043   H  HA3  . GLY A 1 103 ? 3.245   2.258   -7.115  1.00 0.00 ? 103 GLY A HA3  2  
ATOM   6044   N  N    . TRP A 1 104 ? 3.615   2.767   -10.126 1.00 0.00 ? 104 TRP A N    2  
ATOM   6045   C  CA   . TRP A 1 104 ? 4.532   2.678   -11.300 1.00 0.00 ? 104 TRP A CA   2  
ATOM   6046   C  C    . TRP A 1 104 ? 5.520   3.849   -11.287 1.00 0.00 ? 104 TRP A C    2  
ATOM   6047   O  O    . TRP A 1 104 ? 6.684   3.689   -11.591 1.00 0.00 ? 104 TRP A O    2  
ATOM   6048   C  CB   . TRP A 1 104 ? 3.702   2.724   -12.584 1.00 0.00 ? 104 TRP A CB   2  
ATOM   6049   C  CG   . TRP A 1 104 ? 4.584   2.495   -13.771 1.00 0.00 ? 104 TRP A CG   2  
ATOM   6050   C  CD1  . TRP A 1 104 ? 4.805   3.393   -14.758 1.00 0.00 ? 104 TRP A CD1  2  
ATOM   6051   C  CD2  . TRP A 1 104 ? 5.358   1.309   -14.116 1.00 0.00 ? 104 TRP A CD2  2  
ATOM   6052   N  NE1  . TRP A 1 104 ? 5.664   2.836   -15.687 1.00 0.00 ? 104 TRP A NE1  2  
ATOM   6053   C  CE2  . TRP A 1 104 ? 6.035   1.553   -15.335 1.00 0.00 ? 104 TRP A CE2  2  
ATOM   6054   C  CE3  . TRP A 1 104 ? 5.537   0.059   -13.497 1.00 0.00 ? 104 TRP A CE3  2  
ATOM   6055   C  CZ2  . TRP A 1 104 ? 6.860   0.591   -15.917 1.00 0.00 ? 104 TRP A CZ2  2  
ATOM   6056   C  CZ3  . TRP A 1 104 ? 6.368   -0.911  -14.081 1.00 0.00 ? 104 TRP A CZ3  2  
ATOM   6057   C  CH2  . TRP A 1 104 ? 7.028   -0.645  -15.289 1.00 0.00 ? 104 TRP A CH2  2  
ATOM   6058   H  H    . TRP A 1 104 ? 2.652   2.639   -10.248 1.00 0.00 ? 104 TRP A H    2  
ATOM   6059   H  HA   . TRP A 1 104 ? 5.078   1.747   -11.259 1.00 0.00 ? 104 TRP A HA   2  
ATOM   6060   H  HB2  . TRP A 1 104 ? 2.946   1.957   -12.549 1.00 0.00 ? 104 TRP A HB2  2  
ATOM   6061   H  HB3  . TRP A 1 104 ? 3.227   3.689   -12.671 1.00 0.00 ? 104 TRP A HB3  2  
ATOM   6062   H  HD1  . TRP A 1 104 ? 4.379   4.385   -14.813 1.00 0.00 ? 104 TRP A HD1  2  
ATOM   6063   H  HE1  . TRP A 1 104 ? 5.985   3.280   -16.498 1.00 0.00 ? 104 TRP A HE1  2  
ATOM   6064   H  HE3  . TRP A 1 104 ? 5.033   -0.155  -12.566 1.00 0.00 ? 104 TRP A HE3  2  
ATOM   6065   H  HZ2  . TRP A 1 104 ? 7.366   0.801   -16.848 1.00 0.00 ? 104 TRP A HZ2  2  
ATOM   6066   H  HZ3  . TRP A 1 104 ? 6.498   -1.868  -13.597 1.00 0.00 ? 104 TRP A HZ3  2  
ATOM   6067   H  HH2  . TRP A 1 104 ? 7.665   -1.396  -15.732 1.00 0.00 ? 104 TRP A HH2  2  
ATOM   6068   N  N    . GLU A 1 105 ? 5.067   5.028   -10.955 1.00 0.00 ? 105 GLU A N    2  
ATOM   6069   C  CA   . GLU A 1 105 ? 5.989   6.201   -10.943 1.00 0.00 ? 105 GLU A CA   2  
ATOM   6070   C  C    . GLU A 1 105 ? 7.114   5.979   -9.926  1.00 0.00 ? 105 GLU A C    2  
ATOM   6071   O  O    . GLU A 1 105 ? 8.279   6.101   -10.244 1.00 0.00 ? 105 GLU A O    2  
ATOM   6072   C  CB   . GLU A 1 105 ? 5.206   7.458   -10.571 1.00 0.00 ? 105 GLU A CB   2  
ATOM   6073   C  CG   . GLU A 1 105 ? 4.591   8.058   -11.835 1.00 0.00 ? 105 GLU A CG   2  
ATOM   6074   C  CD   . GLU A 1 105 ? 5.656   8.847   -12.599 1.00 0.00 ? 105 GLU A CD   2  
ATOM   6075   O  OE1  . GLU A 1 105 ? 6.825   8.553   -12.418 1.00 0.00 ? 105 GLU A OE1  2  
ATOM   6076   O  OE2  . GLU A 1 105 ? 5.282   9.733   -13.351 1.00 0.00 ? 105 GLU A OE2  2  
ATOM   6077   H  H    . GLU A 1 105 ? 4.122   5.143   -10.725 1.00 0.00 ? 105 GLU A H    2  
ATOM   6078   H  HA   . GLU A 1 105 ? 6.416   6.329   -11.927 1.00 0.00 ? 105 GLU A HA   2  
ATOM   6079   H  HB2  . GLU A 1 105 ? 4.421   7.202   -9.873  1.00 0.00 ? 105 GLU A HB2  2  
ATOM   6080   H  HB3  . GLU A 1 105 ? 5.871   8.179   -10.119 1.00 0.00 ? 105 GLU A HB3  2  
ATOM   6081   H  HG2  . GLU A 1 105 ? 4.212   7.263   -12.462 1.00 0.00 ? 105 GLU A HG2  2  
ATOM   6082   H  HG3  . GLU A 1 105 ? 3.783   8.716   -11.564 1.00 0.00 ? 105 GLU A HG3  2  
ATOM   6083   N  N    . PHE A 1 106 ? 6.778   5.647   -8.709  1.00 0.00 ? 106 PHE A N    2  
ATOM   6084   C  CA   . PHE A 1 106 ? 7.838   5.414   -7.684  1.00 0.00 ? 106 PHE A CA   2  
ATOM   6085   C  C    . PHE A 1 106 ? 8.687   4.215   -8.111  1.00 0.00 ? 106 PHE A C    2  
ATOM   6086   O  O    . PHE A 1 106 ? 9.900   4.232   -8.033  1.00 0.00 ? 106 PHE A O    2  
ATOM   6087   C  CB   . PHE A 1 106 ? 7.188   5.105   -6.331  1.00 0.00 ? 106 PHE A CB   2  
ATOM   6088   C  CG   . PHE A 1 106 ? 6.442   6.317   -5.826  1.00 0.00 ? 106 PHE A CG   2  
ATOM   6089   C  CD1  . PHE A 1 106 ? 7.138   7.493   -5.524  1.00 0.00 ? 106 PHE A CD1  2  
ATOM   6090   C  CD2  . PHE A 1 106 ? 5.054   6.259   -5.649  1.00 0.00 ? 106 PHE A CD2  2  
ATOM   6091   C  CE1  . PHE A 1 106 ? 6.446   8.612   -5.045  1.00 0.00 ? 106 PHE A CE1  2  
ATOM   6092   C  CE2  . PHE A 1 106 ? 4.363   7.380   -5.173  1.00 0.00 ? 106 PHE A CE2  2  
ATOM   6093   C  CZ   . PHE A 1 106 ? 5.059   8.555   -4.870  1.00 0.00 ? 106 PHE A CZ   2  
ATOM   6094   H  H    . PHE A 1 106 ? 5.832   5.549   -8.468  1.00 0.00 ? 106 PHE A H    2  
ATOM   6095   H  HA   . PHE A 1 106 ? 8.460   6.294   -7.597  1.00 0.00 ? 106 PHE A HA   2  
ATOM   6096   H  HB2  . PHE A 1 106 ? 6.498   4.283   -6.447  1.00 0.00 ? 106 PHE A HB2  2  
ATOM   6097   H  HB3  . PHE A 1 106 ? 7.954   4.833   -5.620  1.00 0.00 ? 106 PHE A HB3  2  
ATOM   6098   H  HD1  . PHE A 1 106 ? 8.208   7.537   -5.659  1.00 0.00 ? 106 PHE A HD1  2  
ATOM   6099   H  HD2  . PHE A 1 106 ? 4.518   5.353   -5.882  1.00 0.00 ? 106 PHE A HD2  2  
ATOM   6100   H  HE1  . PHE A 1 106 ? 6.983   9.518   -4.811  1.00 0.00 ? 106 PHE A HE1  2  
ATOM   6101   H  HE2  . PHE A 1 106 ? 3.292   7.336   -5.037  1.00 0.00 ? 106 PHE A HE2  2  
ATOM   6102   H  HZ   . PHE A 1 106 ? 4.524   9.418   -4.500  1.00 0.00 ? 106 PHE A HZ   2  
ATOM   6103   N  N    . TYR A 1 107 ? 8.045   3.174   -8.559  1.00 0.00 ? 107 TYR A N    2  
ATOM   6104   C  CA   . TYR A 1 107 ? 8.775   1.950   -9.000  1.00 0.00 ? 107 TYR A CA   2  
ATOM   6105   C  C    . TYR A 1 107 ? 9.666   2.281   -10.200 1.00 0.00 ? 107 TYR A C    2  
ATOM   6106   O  O    . TYR A 1 107 ? 10.757  1.764   -10.342 1.00 0.00 ? 107 TYR A O    2  
ATOM   6107   C  CB   . TYR A 1 107 ? 7.736   0.898   -9.404  1.00 0.00 ? 107 TYR A CB   2  
ATOM   6108   C  CG   . TYR A 1 107 ? 8.407   -0.297  -10.040 1.00 0.00 ? 107 TYR A CG   2  
ATOM   6109   C  CD1  . TYR A 1 107 ? 8.864   -0.229  -11.363 1.00 0.00 ? 107 TYR A CD1  2  
ATOM   6110   C  CD2  . TYR A 1 107 ? 8.555   -1.481  -9.309  1.00 0.00 ? 107 TYR A CD2  2  
ATOM   6111   C  CE1  . TYR A 1 107 ? 9.472   -1.346  -11.950 1.00 0.00 ? 107 TYR A CE1  2  
ATOM   6112   C  CE2  . TYR A 1 107 ? 9.163   -2.596  -9.897  1.00 0.00 ? 107 TYR A CE2  2  
ATOM   6113   C  CZ   . TYR A 1 107 ? 9.622   -2.529  -11.217 1.00 0.00 ? 107 TYR A CZ   2  
ATOM   6114   O  OH   . TYR A 1 107 ? 10.221  -3.629  -11.796 1.00 0.00 ? 107 TYR A OH   2  
ATOM   6115   H  H    . TYR A 1 107 ? 7.067   3.195   -8.608  1.00 0.00 ? 107 TYR A H    2  
ATOM   6116   H  HA   . TYR A 1 107 ? 9.377   1.572   -8.188  1.00 0.00 ? 107 TYR A HA   2  
ATOM   6117   H  HB2  . TYR A 1 107 ? 7.195   0.578   -8.528  1.00 0.00 ? 107 TYR A HB2  2  
ATOM   6118   H  HB3  . TYR A 1 107 ? 7.044   1.335   -10.109 1.00 0.00 ? 107 TYR A HB3  2  
ATOM   6119   H  HD1  . TYR A 1 107 ? 8.749   0.682   -11.930 1.00 0.00 ? 107 TYR A HD1  2  
ATOM   6120   H  HD2  . TYR A 1 107 ? 8.202   -1.534  -8.289  1.00 0.00 ? 107 TYR A HD2  2  
ATOM   6121   H  HE1  . TYR A 1 107 ? 9.825   -1.295  -12.970 1.00 0.00 ? 107 TYR A HE1  2  
ATOM   6122   H  HE2  . TYR A 1 107 ? 9.275   -3.509  -9.333  1.00 0.00 ? 107 TYR A HE2  2  
ATOM   6123   H  HH   . TYR A 1 107 ? 10.271  -3.476  -12.743 1.00 0.00 ? 107 TYR A HH   2  
ATOM   6124   N  N    . GLU A 1 108 ? 9.192   3.120   -11.073 1.00 0.00 ? 108 GLU A N    2  
ATOM   6125   C  CA   . GLU A 1 108 ? 9.978   3.480   -12.288 1.00 0.00 ? 108 GLU A CA   2  
ATOM   6126   C  C    . GLU A 1 108 ? 11.215  4.313   -11.930 1.00 0.00 ? 108 GLU A C    2  
ATOM   6127   O  O    . GLU A 1 108 ? 12.313  4.026   -12.367 1.00 0.00 ? 108 GLU A O    2  
ATOM   6128   C  CB   . GLU A 1 108 ? 9.088   4.294   -13.228 1.00 0.00 ? 108 GLU A CB   2  
ATOM   6129   C  CG   . GLU A 1 108 ? 8.361   3.352   -14.188 1.00 0.00 ? 108 GLU A CG   2  
ATOM   6130   C  CD   . GLU A 1 108 ? 9.231   3.110   -15.422 1.00 0.00 ? 108 GLU A CD   2  
ATOM   6131   O  OE1  . GLU A 1 108 ? 9.258   3.973   -16.284 1.00 0.00 ? 108 GLU A OE1  2  
ATOM   6132   O  OE2  . GLU A 1 108 ? 9.857   2.064   -15.485 1.00 0.00 ? 108 GLU A OE2  2  
ATOM   6133   H  H    . GLU A 1 108 ? 8.303   3.506   -10.938 1.00 0.00 ? 108 GLU A H    2  
ATOM   6134   H  HA   . GLU A 1 108 ? 10.290  2.578   -12.791 1.00 0.00 ? 108 GLU A HA   2  
ATOM   6135   H  HB2  . GLU A 1 108 ? 8.363   4.846   -12.648 1.00 0.00 ? 108 GLU A HB2  2  
ATOM   6136   H  HB3  . GLU A 1 108 ? 9.694   4.983   -13.794 1.00 0.00 ? 108 GLU A HB3  2  
ATOM   6137   H  HG2  . GLU A 1 108 ? 8.165   2.412   -13.693 1.00 0.00 ? 108 GLU A HG2  2  
ATOM   6138   H  HG3  . GLU A 1 108 ? 7.427   3.800   -14.492 1.00 0.00 ? 108 GLU A HG3  2  
ATOM   6139   N  N    . ALA A 1 109 ? 11.053  5.351   -11.157 1.00 0.00 ? 109 ALA A N    2  
ATOM   6140   C  CA   . ALA A 1 109 ? 12.227  6.202   -10.808 1.00 0.00 ? 109 ALA A CA   2  
ATOM   6141   C  C    . ALA A 1 109 ? 13.104  5.509   -9.765  1.00 0.00 ? 109 ALA A C    2  
ATOM   6142   O  O    . ALA A 1 109 ? 14.302  5.392   -9.932  1.00 0.00 ? 109 ALA A O    2  
ATOM   6143   C  CB   . ALA A 1 109 ? 11.735  7.537   -10.248 1.00 0.00 ? 109 ALA A CB   2  
ATOM   6144   H  H    . ALA A 1 109 ? 10.165  5.580   -10.813 1.00 0.00 ? 109 ALA A H    2  
ATOM   6145   H  HA   . ALA A 1 109 ? 12.810  6.384   -11.699 1.00 0.00 ? 109 ALA A HA   2  
ATOM   6146   H  HB1  . ALA A 1 109 ? 12.149  8.347   -10.832 1.00 0.00 ? 109 ALA A HB1  2  
ATOM   6147   H  HB2  . ALA A 1 109 ? 12.052  7.635   -9.221  1.00 0.00 ? 109 ALA A HB2  2  
ATOM   6148   H  HB3  . ALA A 1 109 ? 10.657  7.572   -10.298 1.00 0.00 ? 109 ALA A HB3  2  
ATOM   6149   N  N    . ILE A 1 110 ? 12.532  5.067   -8.682  1.00 0.00 ? 110 ILE A N    2  
ATOM   6150   C  CA   . ILE A 1 110 ? 13.349  4.406   -7.629  1.00 0.00 ? 110 ILE A CA   2  
ATOM   6151   C  C    . ILE A 1 110 ? 14.098  3.212   -8.214  1.00 0.00 ? 110 ILE A C    2  
ATOM   6152   O  O    . ILE A 1 110 ? 15.263  3.012   -7.939  1.00 0.00 ? 110 ILE A O    2  
ATOM   6153   C  CB   . ILE A 1 110 ? 12.436  3.921   -6.501  1.00 0.00 ? 110 ILE A CB   2  
ATOM   6154   C  CG1  . ILE A 1 110 ? 11.747  5.121   -5.849  1.00 0.00 ? 110 ILE A CG1  2  
ATOM   6155   C  CG2  . ILE A 1 110 ? 13.271  3.183   -5.453  1.00 0.00 ? 110 ILE A CG2  2  
ATOM   6156   C  CD1  . ILE A 1 110 ? 10.659  4.629   -4.892  1.00 0.00 ? 110 ILE A CD1  2  
ATOM   6157   H  H    . ILE A 1 110 ? 11.571  5.180   -8.544  1.00 0.00 ? 110 ILE A H    2  
ATOM   6158   H  HA   . ILE A 1 110 ? 14.061  5.114   -7.233  1.00 0.00 ? 110 ILE A HA   2  
ATOM   6159   H  HB   . ILE A 1 110 ? 11.692  3.251   -6.905  1.00 0.00 ? 110 ILE A HB   2  
ATOM   6160   H  HG12 . ILE A 1 110 ? 12.475  5.700   -5.299  1.00 0.00 ? 110 ILE A HG12 2  
ATOM   6161   H  HG13 . ILE A 1 110 ? 11.299  5.740   -6.613  1.00 0.00 ? 110 ILE A HG13 2  
ATOM   6162   H  HG21 . ILE A 1 110 ? 14.185  3.729   -5.271  1.00 0.00 ? 110 ILE A HG21 2  
ATOM   6163   H  HG22 . ILE A 1 110 ? 13.510  2.194   -5.816  1.00 0.00 ? 110 ILE A HG22 2  
ATOM   6164   H  HG23 . ILE A 1 110 ? 12.708  3.105   -4.535  1.00 0.00 ? 110 ILE A HG23 2  
ATOM   6165   H  HD11 . ILE A 1 110 ? 11.113  4.289   -3.973  1.00 0.00 ? 110 ILE A HD11 2  
ATOM   6166   H  HD12 . ILE A 1 110 ? 10.119  3.813   -5.351  1.00 0.00 ? 110 ILE A HD12 2  
ATOM   6167   H  HD13 . ILE A 1 110 ? 9.974   5.437   -4.678  1.00 0.00 ? 110 ILE A HD13 2  
ATOM   6168   N  N    . ARG A 1 111 ? 13.449  2.417   -9.020  1.00 0.00 ? 111 ARG A N    2  
ATOM   6169   C  CA   . ARG A 1 111 ? 14.139  1.237   -9.611  1.00 0.00 ? 111 ARG A CA   2  
ATOM   6170   C  C    . ARG A 1 111 ? 15.397  1.698   -10.345 1.00 0.00 ? 111 ARG A C    2  
ATOM   6171   O  O    . ARG A 1 111 ? 16.379  0.985   -10.416 1.00 0.00 ? 111 ARG A O    2  
ATOM   6172   C  CB   . ARG A 1 111 ? 13.197  0.531   -10.591 1.00 0.00 ? 111 ARG A CB   2  
ATOM   6173   C  CG   . ARG A 1 111 ? 13.944  -0.611  -11.285 1.00 0.00 ? 111 ARG A CG   2  
ATOM   6174   C  CD   . ARG A 1 111 ? 12.936  -1.611  -11.855 1.00 0.00 ? 111 ARG A CD   2  
ATOM   6175   N  NE   . ARG A 1 111 ? 13.568  -2.371  -12.971 1.00 0.00 ? 111 ARG A NE   2  
ATOM   6176   C  CZ   . ARG A 1 111 ? 14.329  -3.400  -12.712 1.00 0.00 ? 111 ARG A CZ   2  
ATOM   6177   N  NH1  . ARG A 1 111 ? 14.534  -3.767  -11.476 1.00 0.00 ? 111 ARG A NH1  2  
ATOM   6178   N  NH2  . ARG A 1 111 ? 14.884  -4.065  -13.689 1.00 0.00 ? 111 ARG A NH2  2  
ATOM   6179   H  H    . ARG A 1 111 ? 12.511  2.599   -9.243  1.00 0.00 ? 111 ARG A H    2  
ATOM   6180   H  HA   . ARG A 1 111 ? 14.417  0.554   -8.822  1.00 0.00 ? 111 ARG A HA   2  
ATOM   6181   H  HB2  . ARG A 1 111 ? 12.351  0.132   -10.050 1.00 0.00 ? 111 ARG A HB2  2  
ATOM   6182   H  HB3  . ARG A 1 111 ? 12.854  1.236   -11.332 1.00 0.00 ? 111 ARG A HB3  2  
ATOM   6183   H  HG2  . ARG A 1 111 ? 14.547  -0.210  -12.087 1.00 0.00 ? 111 ARG A HG2  2  
ATOM   6184   H  HG3  . ARG A 1 111 ? 14.580  -1.111  -10.571 1.00 0.00 ? 111 ARG A HG3  2  
ATOM   6185   H  HD2  . ARG A 1 111 ? 12.631  -2.298  -11.078 1.00 0.00 ? 111 ARG A HD2  2  
ATOM   6186   H  HD3  . ARG A 1 111 ? 12.070  -1.080  -12.225 1.00 0.00 ? 111 ARG A HD3  2  
ATOM   6187   H  HE   . ARG A 1 111 ? 13.413  -2.098  -13.898 1.00 0.00 ? 111 ARG A HE   2  
ATOM   6188   H  HH11 . ARG A 1 111 ? 14.106  -3.260  -10.727 1.00 0.00 ? 111 ARG A HH11 2  
ATOM   6189   H  HH12 . ARG A 1 111 ? 15.118  -4.554  -11.278 1.00 0.00 ? 111 ARG A HH12 2  
ATOM   6190   H  HH21 . ARG A 1 111 ? 14.727  -3.786  -14.636 1.00 0.00 ? 111 ARG A HH21 2  
ATOM   6191   H  HH22 . ARG A 1 111 ? 15.467  -4.852  -13.490 1.00 0.00 ? 111 ARG A HH22 2  
ATOM   6192   N  N    . LYS A 1 112 ? 15.382  2.881   -10.893 1.00 0.00 ? 112 LYS A N    2  
ATOM   6193   C  CA   . LYS A 1 112 ? 16.590  3.370   -11.619 1.00 0.00 ? 112 LYS A CA   2  
ATOM   6194   C  C    . LYS A 1 112 ? 17.601  3.931   -10.614 1.00 0.00 ? 112 LYS A C    2  
ATOM   6195   O  O    . LYS A 1 112 ? 18.696  4.315   -10.974 1.00 0.00 ? 112 LYS A O    2  
ATOM   6196   C  CB   . LYS A 1 112 ? 16.185  4.467   -12.606 1.00 0.00 ? 112 LYS A CB   2  
ATOM   6197   C  CG   . LYS A 1 112 ? 17.255  4.603   -13.692 1.00 0.00 ? 112 LYS A CG   2  
ATOM   6198   C  CD   . LYS A 1 112 ? 16.879  5.746   -14.640 1.00 0.00 ? 112 LYS A CD   2  
ATOM   6199   C  CE   . LYS A 1 112 ? 17.830  5.750   -15.839 1.00 0.00 ? 112 LYS A CE   2  
ATOM   6200   N  NZ   . LYS A 1 112 ? 17.692  4.469   -16.589 1.00 0.00 ? 112 LYS A NZ   2  
ATOM   6201   H  H    . LYS A 1 112 ? 14.579  3.446   -10.828 1.00 0.00 ? 112 LYS A H    2  
ATOM   6202   H  HA   . LYS A 1 112 ? 17.041  2.549   -12.157 1.00 0.00 ? 112 LYS A HA   2  
ATOM   6203   H  HB2  . LYS A 1 112 ? 15.239  4.209   -13.061 1.00 0.00 ? 112 LYS A HB2  2  
ATOM   6204   H  HB3  . LYS A 1 112 ? 16.086  5.405   -12.081 1.00 0.00 ? 112 LYS A HB3  2  
ATOM   6205   H  HG2  . LYS A 1 112 ? 18.210  4.814   -13.233 1.00 0.00 ? 112 LYS A HG2  2  
ATOM   6206   H  HG3  . LYS A 1 112 ? 17.320  3.682   -14.252 1.00 0.00 ? 112 LYS A HG3  2  
ATOM   6207   H  HD2  . LYS A 1 112 ? 15.865  5.608   -14.984 1.00 0.00 ? 112 LYS A HD2  2  
ATOM   6208   H  HD3  . LYS A 1 112 ? 16.959  6.687   -14.117 1.00 0.00 ? 112 LYS A HD3  2  
ATOM   6209   H  HE2  . LYS A 1 112 ? 17.584  6.576   -16.490 1.00 0.00 ? 112 LYS A HE2  2  
ATOM   6210   H  HE3  . LYS A 1 112 ? 18.848  5.856   -15.492 1.00 0.00 ? 112 LYS A HE3  2  
ATOM   6211   H  HZ1  . LYS A 1 112 ? 18.488  3.843   -16.355 1.00 0.00 ? 112 LYS A HZ1  2  
ATOM   6212   H  HZ2  . LYS A 1 112 ? 17.693  4.664   -17.611 1.00 0.00 ? 112 LYS A HZ2  2  
ATOM   6213   H  HZ3  . LYS A 1 112 ? 16.800  4.006   -16.324 1.00 0.00 ? 112 LYS A HZ3  2  
ATOM   6214   N  N    . ASN A 1 113 ? 17.233  3.998   -9.361  1.00 0.00 ? 113 ASN A N    2  
ATOM   6215   C  CA   . ASN A 1 113 ? 18.166  4.554   -8.336  1.00 0.00 ? 113 ASN A CA   2  
ATOM   6216   C  C    . ASN A 1 113 ? 18.340  3.576   -7.167  1.00 0.00 ? 113 ASN A C    2  
ATOM   6217   O  O    . ASN A 1 113 ? 18.469  3.984   -6.031  1.00 0.00 ? 113 ASN A O    2  
ATOM   6218   C  CB   . ASN A 1 113 ? 17.602  5.875   -7.808  1.00 0.00 ? 113 ASN A CB   2  
ATOM   6219   C  CG   . ASN A 1 113 ? 17.617  6.918   -8.928  1.00 0.00 ? 113 ASN A CG   2  
ATOM   6220   O  OD1  . ASN A 1 113 ? 16.835  6.843   -9.854  1.00 0.00 ? 113 ASN A OD1  2  
ATOM   6221   N  ND2  . ASN A 1 113 ? 18.480  7.894   -8.880  1.00 0.00 ? 113 ASN A ND2  2  
ATOM   6222   H  H    . ASN A 1 113 ? 16.336  3.697   -9.106  1.00 0.00 ? 113 ASN A H    2  
ATOM   6223   H  HA   . ASN A 1 113 ? 19.129  4.737   -8.788  1.00 0.00 ? 113 ASN A HA   2  
ATOM   6224   H  HB2  . ASN A 1 113 ? 16.588  5.723   -7.469  1.00 0.00 ? 113 ASN A HB2  2  
ATOM   6225   H  HB3  . ASN A 1 113 ? 18.209  6.224   -6.987  1.00 0.00 ? 113 ASN A HB3  2  
ATOM   6226   H  HD21 . ASN A 1 113 ? 19.111  7.954   -8.133  1.00 0.00 ? 113 ASN A HD21 2  
ATOM   6227   H  HD22 . ASN A 1 113 ? 18.500  8.567   -9.593  1.00 0.00 ? 113 ASN A HD22 2  
ATOM   6228   N  N    . ILE A 1 114 ? 18.337  2.296   -7.421  1.00 0.00 ? 114 ILE A N    2  
ATOM   6229   C  CA   . ILE A 1 114 ? 18.502  1.327   -6.297  1.00 0.00 ? 114 ILE A CA   2  
ATOM   6230   C  C    . ILE A 1 114 ? 19.986  1.005   -6.077  1.00 0.00 ? 114 ILE A C    2  
ATOM   6231   O  O    . ILE A 1 114 ? 20.769  0.939   -7.004  1.00 0.00 ? 114 ILE A O    2  
ATOM   6232   C  CB   . ILE A 1 114 ? 17.728  0.039   -6.610  1.00 0.00 ? 114 ILE A CB   2  
ATOM   6233   C  CG1  . ILE A 1 114 ? 16.231  0.313   -6.409  1.00 0.00 ? 114 ILE A CG1  2  
ATOM   6234   C  CG2  . ILE A 1 114 ? 18.191  -1.093  -5.679  1.00 0.00 ? 114 ILE A CG2  2  
ATOM   6235   C  CD1  . ILE A 1 114 ? 15.425  -0.982  -6.516  1.00 0.00 ? 114 ILE A CD1  2  
ATOM   6236   H  H    . ILE A 1 114 ? 18.213  1.978   -8.342  1.00 0.00 ? 114 ILE A H    2  
ATOM   6237   H  HA   . ILE A 1 114 ? 18.106  1.770   -5.395  1.00 0.00 ? 114 ILE A HA   2  
ATOM   6238   H  HB   . ILE A 1 114 ? 17.907  -0.247  -7.637  1.00 0.00 ? 114 ILE A HB   2  
ATOM   6239   H  HG12 . ILE A 1 114 ? 16.073  0.752   -5.437  1.00 0.00 ? 114 ILE A HG12 2  
ATOM   6240   H  HG13 . ILE A 1 114 ? 15.899  1.001   -7.167  1.00 0.00 ? 114 ILE A HG13 2  
ATOM   6241   H  HG21 . ILE A 1 114 ? 19.219  -1.344  -5.893  1.00 0.00 ? 114 ILE A HG21 2  
ATOM   6242   H  HG22 . ILE A 1 114 ? 17.583  -1.968  -5.835  1.00 0.00 ? 114 ILE A HG22 2  
ATOM   6243   H  HG23 . ILE A 1 114 ? 18.106  -0.772  -4.651  1.00 0.00 ? 114 ILE A HG23 2  
ATOM   6244   H  HD11 . ILE A 1 114 ? 14.378  -0.746  -6.627  1.00 0.00 ? 114 ILE A HD11 2  
ATOM   6245   H  HD12 . ILE A 1 114 ? 15.568  -1.568  -5.619  1.00 0.00 ? 114 ILE A HD12 2  
ATOM   6246   H  HD13 . ILE A 1 114 ? 15.761  -1.547  -7.372  1.00 0.00 ? 114 ILE A HD13 2  
ATOM   6247   N  N    . LEU A 1 115 ? 20.363  0.795   -4.840  1.00 0.00 ? 115 LEU A N    2  
ATOM   6248   C  CA   . LEU A 1 115 ? 21.780  0.460   -4.513  1.00 0.00 ? 115 LEU A CA   2  
ATOM   6249   C  C    . LEU A 1 115 ? 21.805  -0.762  -3.593  1.00 0.00 ? 115 LEU A C    2  
ATOM   6250   O  O    . LEU A 1 115 ? 20.843  -1.047  -2.908  1.00 0.00 ? 115 LEU A O    2  
ATOM   6251   C  CB   . LEU A 1 115 ? 22.433  1.640   -3.790  1.00 0.00 ? 115 LEU A CB   2  
ATOM   6252   C  CG   . LEU A 1 115 ? 23.946  1.418   -3.695  1.00 0.00 ? 115 LEU A CG   2  
ATOM   6253   C  CD1  . LEU A 1 115 ? 24.554  1.403   -5.099  1.00 0.00 ? 115 LEU A CD1  2  
ATOM   6254   C  CD2  . LEU A 1 115 ? 24.575  2.553   -2.882  1.00 0.00 ? 115 LEU A CD2  2  
ATOM   6255   H  H    . LEU A 1 115 ? 19.702  0.845   -4.123  1.00 0.00 ? 115 LEU A H    2  
ATOM   6256   H  HA   . LEU A 1 115 ? 22.321  0.242   -5.422  1.00 0.00 ? 115 LEU A HA   2  
ATOM   6257   H  HB2  . LEU A 1 115 ? 22.236  2.546   -4.336  1.00 0.00 ? 115 LEU A HB2  2  
ATOM   6258   H  HB3  . LEU A 1 115 ? 22.022  1.724   -2.796  1.00 0.00 ? 115 LEU A HB3  2  
ATOM   6259   H  HG   . LEU A 1 115 ? 24.141  0.473   -3.208  1.00 0.00 ? 115 LEU A HG   2  
ATOM   6260   H  HD11 . LEU A 1 115 ? 25.549  1.820   -5.064  1.00 0.00 ? 115 LEU A HD11 2  
ATOM   6261   H  HD12 . LEU A 1 115 ? 23.939  1.992   -5.763  1.00 0.00 ? 115 LEU A HD12 2  
ATOM   6262   H  HD13 . LEU A 1 115 ? 24.602  0.386   -5.459  1.00 0.00 ? 115 LEU A HD13 2  
ATOM   6263   H  HD21 . LEU A 1 115 ? 25.584  2.282   -2.607  1.00 0.00 ? 115 LEU A HD21 2  
ATOM   6264   H  HD22 . LEU A 1 115 ? 23.992  2.723   -1.989  1.00 0.00 ? 115 LEU A HD22 2  
ATOM   6265   H  HD23 . LEU A 1 115 ? 24.594  3.454   -3.478  1.00 0.00 ? 115 LEU A HD23 2  
ATOM   6266   N  N    . ASN A 1 116 ? 22.893  -1.485  -3.566  1.00 0.00 ? 116 ASN A N    2  
ATOM   6267   C  CA   . ASN A 1 116 ? 22.975  -2.683  -2.687  1.00 0.00 ? 116 ASN A CA   2  
ATOM   6268   C  C    . ASN A 1 116 ? 23.979  -2.432  -1.557  1.00 0.00 ? 116 ASN A C    2  
ATOM   6269   O  O    . ASN A 1 116 ? 25.014  -1.827  -1.755  1.00 0.00 ? 116 ASN A O    2  
ATOM   6270   C  CB   . ASN A 1 116 ? 23.437  -3.881  -3.515  1.00 0.00 ? 116 ASN A CB   2  
ATOM   6271   C  CG   . ASN A 1 116 ? 22.506  -4.064  -4.715  1.00 0.00 ? 116 ASN A CG   2  
ATOM   6272   O  OD1  . ASN A 1 116 ? 22.024  -5.151  -4.964  1.00 0.00 ? 116 ASN A OD1  2  
ATOM   6273   N  ND2  . ASN A 1 116 ? 22.231  -3.040  -5.474  1.00 0.00 ? 116 ASN A ND2  2  
ATOM   6274   H  H    . ASN A 1 116 ? 23.658  -1.241  -4.127  1.00 0.00 ? 116 ASN A H    2  
ATOM   6275   H  HA   . ASN A 1 116 ? 22.003  -2.893  -2.266  1.00 0.00 ? 116 ASN A HA   2  
ATOM   6276   H  HB2  . ASN A 1 116 ? 24.446  -3.711  -3.862  1.00 0.00 ? 116 ASN A HB2  2  
ATOM   6277   H  HB3  . ASN A 1 116 ? 23.412  -4.767  -2.905  1.00 0.00 ? 116 ASN A HB3  2  
ATOM   6278   H  HD21 . ASN A 1 116 ? 22.620  -2.162  -5.272  1.00 0.00 ? 116 ASN A HD21 2  
ATOM   6279   H  HD22 . ASN A 1 116 ? 21.637  -3.147  -6.246  1.00 0.00 ? 116 ASN A HD22 2  
ATOM   6280   N  N    . GLN A 1 117 ? 23.685  -2.906  -0.376  1.00 0.00 ? 117 GLN A N    2  
ATOM   6281   C  CA   . GLN A 1 117 ? 24.623  -2.711  0.768   1.00 0.00 ? 117 GLN A CA   2  
ATOM   6282   C  C    . GLN A 1 117 ? 25.386  -4.017  1.015   1.00 0.00 ? 117 GLN A C    2  
ATOM   6283   O  O    . GLN A 1 117 ? 25.465  -4.863  0.148   1.00 0.00 ? 117 GLN A O    2  
ATOM   6284   C  CB   . GLN A 1 117 ? 23.835  -2.311  2.023   1.00 0.00 ? 117 GLN A CB   2  
ATOM   6285   C  CG   . GLN A 1 117 ? 23.843  -0.787  2.170   1.00 0.00 ? 117 GLN A CG   2  
ATOM   6286   C  CD   . GLN A 1 117 ? 22.566  -0.332  2.879   1.00 0.00 ? 117 GLN A CD   2  
ATOM   6287   O  OE1  . GLN A 1 117 ? 22.612  0.129   4.001   1.00 0.00 ? 117 GLN A OE1  2  
ATOM   6288   N  NE2  . GLN A 1 117 ? 21.419  -0.436  2.265   1.00 0.00 ? 117 GLN A NE2  2  
ATOM   6289   H  H    . GLN A 1 117 ? 22.851  -3.399  -0.243  1.00 0.00 ? 117 GLN A H    2  
ATOM   6290   H  HA   . GLN A 1 117 ? 25.330  -1.932  0.522   1.00 0.00 ? 117 GLN A HA   2  
ATOM   6291   H  HB2  . GLN A 1 117 ? 22.817  -2.654  1.929   1.00 0.00 ? 117 GLN A HB2  2  
ATOM   6292   H  HB3  . GLN A 1 117 ? 24.285  -2.755  2.895   1.00 0.00 ? 117 GLN A HB3  2  
ATOM   6293   H  HG2  . GLN A 1 117 ? 24.704  -0.489  2.750   1.00 0.00 ? 117 GLN A HG2  2  
ATOM   6294   H  HG3  . GLN A 1 117 ? 23.891  -0.331  1.194   1.00 0.00 ? 117 GLN A HG3  2  
ATOM   6295   H  HE21 . GLN A 1 117 ? 21.381  -0.804  1.358   1.00 0.00 ? 117 GLN A HE21 2  
ATOM   6296   H  HE22 . GLN A 1 117 ? 20.596  -0.148  2.712   1.00 0.00 ? 117 GLN A HE22 2  
ATOM   6297   N  N    . ASN A 1 118 ? 25.966  -4.180  2.176   1.00 0.00 ? 118 ASN A N    2  
ATOM   6298   C  CA   . ASN A 1 118 ? 26.742  -5.429  2.453   1.00 0.00 ? 118 ASN A CA   2  
ATOM   6299   C  C    . ASN A 1 118 ? 26.134  -6.208  3.627   1.00 0.00 ? 118 ASN A C    2  
ATOM   6300   O  O    . ASN A 1 118 ? 26.657  -7.228  4.031   1.00 0.00 ? 118 ASN A O    2  
ATOM   6301   C  CB   . ASN A 1 118 ? 28.184  -5.053  2.796   1.00 0.00 ? 118 ASN A CB   2  
ATOM   6302   C  CG   . ASN A 1 118 ? 29.144  -6.028  2.112   1.00 0.00 ? 118 ASN A CG   2  
ATOM   6303   O  OD1  . ASN A 1 118 ? 28.921  -7.222  2.118   1.00 0.00 ? 118 ASN A OD1  2  
ATOM   6304   N  ND2  . ASN A 1 118 ? 30.210  -5.566  1.518   1.00 0.00 ? 118 ASN A ND2  2  
ATOM   6305   H  H    . ASN A 1 118 ? 25.905  -3.476  2.860   1.00 0.00 ? 118 ASN A H    2  
ATOM   6306   H  HA   . ASN A 1 118 ? 26.743  -6.055  1.575   1.00 0.00 ? 118 ASN A HA   2  
ATOM   6307   H  HB2  . ASN A 1 118 ? 28.384  -4.048  2.454   1.00 0.00 ? 118 ASN A HB2  2  
ATOM   6308   H  HB3  . ASN A 1 118 ? 28.322  -5.105  3.865   1.00 0.00 ? 118 ASN A HB3  2  
ATOM   6309   H  HD21 . ASN A 1 118 ? 30.390  -4.603  1.513   1.00 0.00 ? 118 ASN A HD21 2  
ATOM   6310   H  HD22 . ASN A 1 118 ? 30.831  -6.183  1.076   1.00 0.00 ? 118 ASN A HD22 2  
ATOM   6311   N  N    . ARG A 1 119 ? 25.048  -5.747  4.186   1.00 0.00 ? 119 ARG A N    2  
ATOM   6312   C  CA   . ARG A 1 119 ? 24.441  -6.483  5.338   1.00 0.00 ? 119 ARG A CA   2  
ATOM   6313   C  C    . ARG A 1 119 ? 23.256  -7.327  4.859   1.00 0.00 ? 119 ARG A C    2  
ATOM   6314   O  O    . ARG A 1 119 ? 22.650  -7.048  3.844   1.00 0.00 ? 119 ARG A O    2  
ATOM   6315   C  CB   . ARG A 1 119 ? 23.960  -5.478  6.385   1.00 0.00 ? 119 ARG A CB   2  
ATOM   6316   C  CG   . ARG A 1 119 ? 24.057  -6.104  7.777   1.00 0.00 ? 119 ARG A CG   2  
ATOM   6317   C  CD   . ARG A 1 119 ? 23.676  -5.064  8.833   1.00 0.00 ? 119 ARG A CD   2  
ATOM   6318   N  NE   . ARG A 1 119 ? 22.212  -5.141  9.097   1.00 0.00 ? 119 ARG A NE   2  
ATOM   6319   C  CZ   . ARG A 1 119 ? 21.709  -6.195  9.681   1.00 0.00 ? 119 ARG A CZ   2  
ATOM   6320   N  NH1  . ARG A 1 119 ? 22.490  -7.179  10.034  1.00 0.00 ? 119 ARG A NH1  2  
ATOM   6321   N  NH2  . ARG A 1 119 ? 20.426  -6.264  9.911   1.00 0.00 ? 119 ARG A NH2  2  
ATOM   6322   H  H    . ARG A 1 119 ? 24.638  -4.918  3.860   1.00 0.00 ? 119 ARG A H    2  
ATOM   6323   H  HA   . ARG A 1 119 ? 25.184  -7.129  5.781   1.00 0.00 ? 119 ARG A HA   2  
ATOM   6324   H  HB2  . ARG A 1 119 ? 24.576  -4.594  6.345   1.00 0.00 ? 119 ARG A HB2  2  
ATOM   6325   H  HB3  . ARG A 1 119 ? 22.934  -5.214  6.184   1.00 0.00 ? 119 ARG A HB3  2  
ATOM   6326   H  HG2  . ARG A 1 119 ? 23.383  -6.947  7.841   1.00 0.00 ? 119 ARG A HG2  2  
ATOM   6327   H  HG3  . ARG A 1 119 ? 25.068  -6.437  7.953   1.00 0.00 ? 119 ARG A HG3  2  
ATOM   6328   H  HD2  . ARG A 1 119 ? 24.217  -5.263  9.745   1.00 0.00 ? 119 ARG A HD2  2  
ATOM   6329   H  HD3  . ARG A 1 119 ? 23.925  -4.078  8.473   1.00 0.00 ? 119 ARG A HD3  2  
ATOM   6330   H  HE   . ARG A 1 119 ? 21.626  -4.401  8.833   1.00 0.00 ? 119 ARG A HE   2  
ATOM   6331   H  HH11 . ARG A 1 119 ? 23.472  -7.125  9.858   1.00 0.00 ? 119 ARG A HH11 2  
ATOM   6332   H  HH12 . ARG A 1 119 ? 22.106  -7.987  10.480  1.00 0.00 ? 119 ARG A HH12 2  
ATOM   6333   H  HH21 . ARG A 1 119 ? 19.828  -5.509  9.642   1.00 0.00 ? 119 ARG A HH21 2  
ATOM   6334   H  HH22 . ARG A 1 119 ? 20.041  -7.071  10.358  1.00 0.00 ? 119 ARG A HH22 2  
ATOM   6335   N  N    . GLU A 1 120 ? 22.924  -8.365  5.585   1.00 0.00 ? 120 GLU A N    2  
ATOM   6336   C  CA   . GLU A 1 120 ? 21.782  -9.235  5.176   1.00 0.00 ? 120 GLU A CA   2  
ATOM   6337   C  C    . GLU A 1 120 ? 20.481  -8.702  5.779   1.00 0.00 ? 120 GLU A C    2  
ATOM   6338   O  O    . GLU A 1 120 ? 20.429  -8.306  6.926   1.00 0.00 ? 120 GLU A O    2  
ATOM   6339   C  CB   . GLU A 1 120 ? 22.028  -10.662 5.667   1.00 0.00 ? 120 GLU A CB   2  
ATOM   6340   C  CG   . GLU A 1 120 ? 21.096  -11.633 4.938   1.00 0.00 ? 120 GLU A CG   2  
ATOM   6341   C  CD   . GLU A 1 120 ? 19.675  -11.486 5.480   1.00 0.00 ? 120 GLU A CD   2  
ATOM   6342   O  OE1  . GLU A 1 120 ? 19.538  -11.245 6.668   1.00 0.00 ? 120 GLU A OE1  2  
ATOM   6343   O  OE2  . GLU A 1 120 ? 18.748  -11.618 4.698   1.00 0.00 ? 120 GLU A OE2  2  
ATOM   6344   H  H    . GLU A 1 120 ? 23.429  -8.573  6.400   1.00 0.00 ? 120 GLU A H    2  
ATOM   6345   H  HA   . GLU A 1 120 ? 21.703  -9.236  4.101   1.00 0.00 ? 120 GLU A HA   2  
ATOM   6346   H  HB2  . GLU A 1 120 ? 23.050  -10.930 5.466   1.00 0.00 ? 120 GLU A HB2  2  
ATOM   6347   H  HB3  . GLU A 1 120 ? 21.843  -10.715 6.729   1.00 0.00 ? 120 GLU A HB3  2  
ATOM   6348   H  HG2  . GLU A 1 120 ? 21.104  -11.418 3.880   1.00 0.00 ? 120 GLU A HG2  2  
ATOM   6349   H  HG3  . GLU A 1 120 ? 21.436  -12.645 5.100   1.00 0.00 ? 120 GLU A HG3  2  
ATOM   6350   N  N    . ILE A 1 121 ? 19.436  -8.675  5.001   1.00 0.00 ? 121 ILE A N    2  
ATOM   6351   C  CA   . ILE A 1 121 ? 18.128  -8.150  5.501   1.00 0.00 ? 121 ILE A CA   2  
ATOM   6352   C  C    . ILE A 1 121 ? 17.442  -9.178  6.403   1.00 0.00 ? 121 ILE A C    2  
ATOM   6353   O  O    . ILE A 1 121 ? 17.478  -10.366 6.151   1.00 0.00 ? 121 ILE A O    2  
ATOM   6354   C  CB   . ILE A 1 121 ? 17.220  -7.860  4.306   1.00 0.00 ? 121 ILE A CB   2  
ATOM   6355   C  CG1  . ILE A 1 121 ? 17.895  -6.842  3.391   1.00 0.00 ? 121 ILE A CG1  2  
ATOM   6356   C  CG2  . ILE A 1 121 ? 15.886  -7.293  4.793   1.00 0.00 ? 121 ILE A CG2  2  
ATOM   6357   C  CD1  . ILE A 1 121 ? 17.435  -7.065  1.949   1.00 0.00 ? 121 ILE A CD1  2  
ATOM   6358   H  H    . ILE A 1 121 ? 19.508  -8.982  4.073   1.00 0.00 ? 121 ILE A H    2  
ATOM   6359   H  HA   . ILE A 1 121 ? 18.293  -7.238  6.054   1.00 0.00 ? 121 ILE A HA   2  
ATOM   6360   H  HB   . ILE A 1 121 ? 17.043  -8.775  3.758   1.00 0.00 ? 121 ILE A HB   2  
ATOM   6361   H  HG12 . ILE A 1 121 ? 17.623  -5.845  3.707   1.00 0.00 ? 121 ILE A HG12 2  
ATOM   6362   H  HG13 . ILE A 1 121 ? 18.966  -6.961  3.449   1.00 0.00 ? 121 ILE A HG13 2  
ATOM   6363   H  HG21 . ILE A 1 121 ? 16.028  -6.805  5.746   1.00 0.00 ? 121 ILE A HG21 2  
ATOM   6364   H  HG22 . ILE A 1 121 ? 15.172  -8.096  4.903   1.00 0.00 ? 121 ILE A HG22 2  
ATOM   6365   H  HG23 . ILE A 1 121 ? 15.515  -6.577  4.073   1.00 0.00 ? 121 ILE A HG23 2  
ATOM   6366   H  HD11 . ILE A 1 121 ? 18.035  -7.840  1.495   1.00 0.00 ? 121 ILE A HD11 2  
ATOM   6367   H  HD12 . ILE A 1 121 ? 17.549  -6.148  1.389   1.00 0.00 ? 121 ILE A HD12 2  
ATOM   6368   H  HD13 . ILE A 1 121 ? 16.397  -7.364  1.945   1.00 0.00 ? 121 ILE A HD13 2  
ATOM   6369   N  N    . ASP A 1 122 ? 16.791  -8.724  7.439   1.00 0.00 ? 122 ASP A N    2  
ATOM   6370   C  CA   . ASP A 1 122 ? 16.076  -9.670  8.341   1.00 0.00 ? 122 ASP A CA   2  
ATOM   6371   C  C    . ASP A 1 122 ? 14.688  -9.937  7.757   1.00 0.00 ? 122 ASP A C    2  
ATOM   6372   O  O    . ASP A 1 122 ? 13.732  -9.253  8.062   1.00 0.00 ? 122 ASP A O    2  
ATOM   6373   C  CB   . ASP A 1 122 ? 15.942  -9.054  9.734   1.00 0.00 ? 122 ASP A CB   2  
ATOM   6374   C  CG   . ASP A 1 122 ? 15.509  -10.132 10.729  1.00 0.00 ? 122 ASP A CG   2  
ATOM   6375   O  OD1  . ASP A 1 122 ? 14.323  -10.412 10.790  1.00 0.00 ? 122 ASP A OD1  2  
ATOM   6376   O  OD2  . ASP A 1 122 ? 16.371  -10.661 11.411  1.00 0.00 ? 122 ASP A OD2  2  
ATOM   6377   H  H    . ASP A 1 122 ? 16.756  -7.760  7.612   1.00 0.00 ? 122 ASP A H    2  
ATOM   6378   H  HA   . ASP A 1 122 ? 16.626  -10.596 8.405   1.00 0.00 ? 122 ASP A HA   2  
ATOM   6379   H  HB2  . ASP A 1 122 ? 16.893  -8.641  10.039  1.00 0.00 ? 122 ASP A HB2  2  
ATOM   6380   H  HB3  . ASP A 1 122 ? 15.200  -8.271  9.710   1.00 0.00 ? 122 ASP A HB3  2  
ATOM   6381   N  N    . TYR A 1 123 ? 14.579  -10.913 6.902   1.00 0.00 ? 123 TYR A N    2  
ATOM   6382   C  CA   . TYR A 1 123 ? 13.264  -11.217 6.273   1.00 0.00 ? 123 TYR A CA   2  
ATOM   6383   C  C    . TYR A 1 123 ? 12.248  -11.650 7.330   1.00 0.00 ? 123 TYR A C    2  
ATOM   6384   O  O    . TYR A 1 123 ? 12.576  -12.324 8.287   1.00 0.00 ? 123 TYR A O    2  
ATOM   6385   C  CB   . TYR A 1 123 ? 13.437  -12.347 5.255   1.00 0.00 ? 123 TYR A CB   2  
ATOM   6386   C  CG   . TYR A 1 123 ? 14.498  -11.966 4.253   1.00 0.00 ? 123 TYR A CG   2  
ATOM   6387   C  CD1  . TYR A 1 123 ? 14.322  -10.836 3.449   1.00 0.00 ? 123 TYR A CD1  2  
ATOM   6388   C  CD2  . TYR A 1 123 ? 15.655  -12.742 4.128   1.00 0.00 ? 123 TYR A CD2  2  
ATOM   6389   C  CE1  . TYR A 1 123 ? 15.303  -10.480 2.516   1.00 0.00 ? 123 TYR A CE1  2  
ATOM   6390   C  CE2  . TYR A 1 123 ? 16.638  -12.388 3.196   1.00 0.00 ? 123 TYR A CE2  2  
ATOM   6391   C  CZ   . TYR A 1 123 ? 16.462  -11.256 2.390   1.00 0.00 ? 123 TYR A CZ   2  
ATOM   6392   O  OH   . TYR A 1 123 ? 17.430  -10.905 1.470   1.00 0.00 ? 123 TYR A OH   2  
ATOM   6393   H  H    . TYR A 1 123 ? 15.369  -11.441 6.662   1.00 0.00 ? 123 TYR A H    2  
ATOM   6394   H  HA   . TYR A 1 123 ? 12.898  -10.336 5.767   1.00 0.00 ? 123 TYR A HA   2  
ATOM   6395   H  HB2  . TYR A 1 123 ? 13.735  -13.250 5.768   1.00 0.00 ? 123 TYR A HB2  2  
ATOM   6396   H  HB3  . TYR A 1 123 ? 12.503  -12.516 4.741   1.00 0.00 ? 123 TYR A HB3  2  
ATOM   6397   H  HD1  . TYR A 1 123 ? 13.428  -10.240 3.548   1.00 0.00 ? 123 TYR A HD1  2  
ATOM   6398   H  HD2  . TYR A 1 123 ? 15.791  -13.615 4.750   1.00 0.00 ? 123 TYR A HD2  2  
ATOM   6399   H  HE1  . TYR A 1 123 ? 15.167  -9.607  1.895   1.00 0.00 ? 123 TYR A HE1  2  
ATOM   6400   H  HE2  . TYR A 1 123 ? 17.532  -12.986 3.099   1.00 0.00 ? 123 TYR A HE2  2  
ATOM   6401   H  HH   . TYR A 1 123 ? 17.047  -10.981 0.594   1.00 0.00 ? 123 TYR A HH   2  
ATOM   6402   N  N    . PHE A 1 124 ? 11.008  -11.287 7.142   1.00 0.00 ? 124 PHE A N    2  
ATOM   6403   C  CA   . PHE A 1 124 ? 9.945   -11.691 8.105   1.00 0.00 ? 124 PHE A CA   2  
ATOM   6404   C  C    . PHE A 1 124 ? 9.177   -12.857 7.480   1.00 0.00 ? 124 PHE A C    2  
ATOM   6405   O  O    . PHE A 1 124 ? 8.696   -12.763 6.369   1.00 0.00 ? 124 PHE A O    2  
ATOM   6406   C  CB   . PHE A 1 124 ? 9.000   -10.508 8.346   1.00 0.00 ? 124 PHE A CB   2  
ATOM   6407   C  CG   . PHE A 1 124 ? 8.126   -10.771 9.555   1.00 0.00 ? 124 PHE A CG   2  
ATOM   6408   C  CD1  . PHE A 1 124 ? 7.116   -11.740 9.496   1.00 0.00 ? 124 PHE A CD1  2  
ATOM   6409   C  CD2  . PHE A 1 124 ? 8.319   -10.034 10.731  1.00 0.00 ? 124 PHE A CD2  2  
ATOM   6410   C  CE1  . PHE A 1 124 ? 6.302   -11.973 10.612  1.00 0.00 ? 124 PHE A CE1  2  
ATOM   6411   C  CE2  . PHE A 1 124 ? 7.503   -10.266 11.846  1.00 0.00 ? 124 PHE A CE2  2  
ATOM   6412   C  CZ   . PHE A 1 124 ? 6.497   -11.236 11.786  1.00 0.00 ? 124 PHE A CZ   2  
ATOM   6413   H  H    . PHE A 1 124 ? 10.767  -10.762 6.349   1.00 0.00 ? 124 PHE A H    2  
ATOM   6414   H  HA   . PHE A 1 124 ? 10.393  -12.004 9.037   1.00 0.00 ? 124 PHE A HA   2  
ATOM   6415   H  HB2  . PHE A 1 124 ? 9.582   -9.615  8.515   1.00 0.00 ? 124 PHE A HB2  2  
ATOM   6416   H  HB3  . PHE A 1 124 ? 8.375   -10.367 7.479   1.00 0.00 ? 124 PHE A HB3  2  
ATOM   6417   H  HD1  . PHE A 1 124 ? 6.963   -12.309 8.590   1.00 0.00 ? 124 PHE A HD1  2  
ATOM   6418   H  HD2  . PHE A 1 124 ? 9.098   -9.287  10.778  1.00 0.00 ? 124 PHE A HD2  2  
ATOM   6419   H  HE1  . PHE A 1 124 ? 5.526   -12.721 10.567  1.00 0.00 ? 124 PHE A HE1  2  
ATOM   6420   H  HE2  . PHE A 1 124 ? 7.649   -9.697  12.754  1.00 0.00 ? 124 PHE A HE2  2  
ATOM   6421   H  HZ   . PHE A 1 124 ? 5.867   -11.413 12.647  1.00 0.00 ? 124 PHE A HZ   2  
ATOM   6422   N  N    . VAL A 1 125 ? 9.075   -13.961 8.169   1.00 0.00 ? 125 VAL A N    2  
ATOM   6423   C  CA   . VAL A 1 125 ? 8.359   -15.135 7.593   1.00 0.00 ? 125 VAL A CA   2  
ATOM   6424   C  C    . VAL A 1 125 ? 7.336   -15.674 8.589   1.00 0.00 ? 125 VAL A C    2  
ATOM   6425   O  O    . VAL A 1 125 ? 7.556   -15.686 9.784   1.00 0.00 ? 125 VAL A O    2  
ATOM   6426   C  CB   . VAL A 1 125 ? 9.373   -16.234 7.269   1.00 0.00 ? 125 VAL A CB   2  
ATOM   6427   C  CG1  . VAL A 1 125 ? 8.672   -17.377 6.534   1.00 0.00 ? 125 VAL A CG1  2  
ATOM   6428   C  CG2  . VAL A 1 125 ? 10.478  -15.658 6.381   1.00 0.00 ? 125 VAL A CG2  2  
ATOM   6429   H  H    . VAL A 1 125 ? 9.482   -14.022 9.056   1.00 0.00 ? 125 VAL A H    2  
ATOM   6430   H  HA   . VAL A 1 125 ? 7.852   -14.841 6.687   1.00 0.00 ? 125 VAL A HA   2  
ATOM   6431   H  HB   . VAL A 1 125 ? 9.803   -16.607 8.187   1.00 0.00 ? 125 VAL A HB   2  
ATOM   6432   H  HG11 . VAL A 1 125 ? 8.084   -16.976 5.722   1.00 0.00 ? 125 VAL A HG11 2  
ATOM   6433   H  HG12 . VAL A 1 125 ? 8.027   -17.904 7.221   1.00 0.00 ? 125 VAL A HG12 2  
ATOM   6434   H  HG13 . VAL A 1 125 ? 9.413   -18.058 6.140   1.00 0.00 ? 125 VAL A HG13 2  
ATOM   6435   H  HG21 . VAL A 1 125 ? 10.799  -16.410 5.674   1.00 0.00 ? 125 VAL A HG21 2  
ATOM   6436   H  HG22 . VAL A 1 125 ? 11.315  -15.360 6.995   1.00 0.00 ? 125 VAL A HG22 2  
ATOM   6437   H  HG23 . VAL A 1 125 ? 10.100  -14.799 5.846   1.00 0.00 ? 125 VAL A HG23 2  
ATOM   6438   N  N    . VAL A 1 126 ? 6.219   -16.131 8.095   1.00 0.00 ? 126 VAL A N    2  
ATOM   6439   C  CA   . VAL A 1 126 ? 5.172   -16.688 8.991   1.00 0.00 ? 126 VAL A CA   2  
ATOM   6440   C  C    . VAL A 1 126 ? 5.527   -18.135 9.325   1.00 0.00 ? 126 VAL A C    2  
ATOM   6441   O  O    . VAL A 1 126 ? 5.910   -18.900 8.464   1.00 0.00 ? 126 VAL A O    2  
ATOM   6442   C  CB   . VAL A 1 126 ? 3.825   -16.642 8.270   1.00 0.00 ? 126 VAL A CB   2  
ATOM   6443   C  CG1  . VAL A 1 126 ? 2.733   -17.201 9.185   1.00 0.00 ? 126 VAL A CG1  2  
ATOM   6444   C  CG2  . VAL A 1 126 ? 3.497   -15.193 7.904   1.00 0.00 ? 126 VAL A CG2  2  
ATOM   6445   H  H    . VAL A 1 126 ? 6.074   -16.115 7.126   1.00 0.00 ? 126 VAL A H    2  
ATOM   6446   H  HA   . VAL A 1 126 ? 5.118   -16.110 9.900   1.00 0.00 ? 126 VAL A HA   2  
ATOM   6447   H  HB   . VAL A 1 126 ? 3.882   -17.236 7.369   1.00 0.00 ? 126 VAL A HB   2  
ATOM   6448   H  HG11 . VAL A 1 126 ? 2.588   -18.250 8.974   1.00 0.00 ? 126 VAL A HG11 2  
ATOM   6449   H  HG12 . VAL A 1 126 ? 1.810   -16.667 9.010   1.00 0.00 ? 126 VAL A HG12 2  
ATOM   6450   H  HG13 . VAL A 1 126 ? 3.029   -17.078 10.216  1.00 0.00 ? 126 VAL A HG13 2  
ATOM   6451   H  HG21 . VAL A 1 126 ? 2.462   -15.123 7.605   1.00 0.00 ? 126 VAL A HG21 2  
ATOM   6452   H  HG22 . VAL A 1 126 ? 4.130   -14.879 7.088   1.00 0.00 ? 126 VAL A HG22 2  
ATOM   6453   H  HG23 . VAL A 1 126 ? 3.670   -14.557 8.760   1.00 0.00 ? 126 VAL A HG23 2  
ATOM   6454   N  N    . GLU A 1 127 ? 5.411   -18.512 10.569  1.00 0.00 ? 127 GLU A N    2  
ATOM   6455   C  CA   . GLU A 1 127 ? 5.745   -19.911 10.963  1.00 0.00 ? 127 GLU A CA   2  
ATOM   6456   C  C    . GLU A 1 127 ? 4.477   -20.613 11.443  1.00 0.00 ? 127 GLU A C    2  
ATOM   6457   O  O    . GLU A 1 127 ? 4.439   -21.819 11.591  1.00 0.00 ? 127 GLU A O    2  
ATOM   6458   C  CB   . GLU A 1 127 ? 6.776   -19.893 12.092  1.00 0.00 ? 127 GLU A CB   2  
ATOM   6459   C  CG   . GLU A 1 127 ? 8.129   -19.440 11.540  1.00 0.00 ? 127 GLU A CG   2  
ATOM   6460   C  CD   . GLU A 1 127 ? 8.697   -20.527 10.625  1.00 0.00 ? 127 GLU A CD   2  
ATOM   6461   O  OE1  . GLU A 1 127 ? 9.257   -21.478 11.144  1.00 0.00 ? 127 GLU A OE1  2  
ATOM   6462   O  OE2  . GLU A 1 127 ? 8.562   -20.390 9.420   1.00 0.00 ? 127 GLU A OE2  2  
ATOM   6463   H  H    . GLU A 1 127 ? 5.105   -17.873 11.246  1.00 0.00 ? 127 GLU A H    2  
ATOM   6464   H  HA   . GLU A 1 127 ? 6.149   -20.443 10.113  1.00 0.00 ? 127 GLU A HA   2  
ATOM   6465   H  HB2  . GLU A 1 127 ? 6.454   -19.207 12.863  1.00 0.00 ? 127 GLU A HB2  2  
ATOM   6466   H  HB3  . GLU A 1 127 ? 6.872   -20.883 12.509  1.00 0.00 ? 127 GLU A HB3  2  
ATOM   6467   H  HG2  . GLU A 1 127 ? 8.001   -18.526 10.978  1.00 0.00 ? 127 GLU A HG2  2  
ATOM   6468   H  HG3  . GLU A 1 127 ? 8.813   -19.269 12.358  1.00 0.00 ? 127 GLU A HG3  2  
ATOM   6469   N  N    . GLU A 1 128 ? 3.433   -19.868 11.678  1.00 0.00 ? 128 GLU A N    2  
ATOM   6470   C  CA   . GLU A 1 128 ? 2.163   -20.496 12.138  1.00 0.00 ? 128 GLU A CA   2  
ATOM   6471   C  C    . GLU A 1 128 ? 0.984   -19.791 11.457  1.00 0.00 ? 128 GLU A C    2  
ATOM   6472   O  O    . GLU A 1 128 ? 1.012   -18.592 11.259  1.00 0.00 ? 128 GLU A O    2  
ATOM   6473   C  CB   . GLU A 1 128 ? 2.038   -20.357 13.658  1.00 0.00 ? 128 GLU A CB   2  
ATOM   6474   C  CG   . GLU A 1 128 ? 2.542   -18.979 14.089  1.00 0.00 ? 128 GLU A CG   2  
ATOM   6475   C  CD   . GLU A 1 128 ? 1.843   -18.563 15.386  1.00 0.00 ? 128 GLU A CD   2  
ATOM   6476   O  OE1  . GLU A 1 128 ? 0.629   -18.663 15.438  1.00 0.00 ? 128 GLU A OE1  2  
ATOM   6477   O  OE2  . GLU A 1 128 ? 2.534   -18.152 16.302  1.00 0.00 ? 128 GLU A OE2  2  
ATOM   6478   H  H    . GLU A 1 128 ? 3.481   -18.896 11.543  1.00 0.00 ? 128 GLU A H    2  
ATOM   6479   H  HA   . GLU A 1 128 ? 2.174   -21.540 11.870  1.00 0.00 ? 128 GLU A HA   2  
ATOM   6480   H  HB2  . GLU A 1 128 ? 1.003   -20.469 13.945  1.00 0.00 ? 128 GLU A HB2  2  
ATOM   6481   H  HB3  . GLU A 1 128 ? 2.631   -21.121 14.139  1.00 0.00 ? 128 GLU A HB3  2  
ATOM   6482   H  HG2  . GLU A 1 128 ? 3.610   -19.021 14.252  1.00 0.00 ? 128 GLU A HG2  2  
ATOM   6483   H  HG3  . GLU A 1 128 ? 2.324   -18.257 13.318  1.00 0.00 ? 128 GLU A HG3  2  
ATOM   6484   N  N    . PRO A 1 129 ? -0.043  -20.520 11.090  1.00 0.00 ? 129 PRO A N    2  
ATOM   6485   C  CA   . PRO A 1 129 ? -1.227  -19.926 10.412  1.00 0.00 ? 129 PRO A CA   2  
ATOM   6486   C  C    . PRO A 1 129 ? -2.027  -18.980 11.316  1.00 0.00 ? 129 PRO A C    2  
ATOM   6487   O  O    . PRO A 1 129 ? -1.938  -19.028 12.527  1.00 0.00 ? 129 PRO A O    2  
ATOM   6488   C  CB   . PRO A 1 129 ? -2.084  -21.125 10.000  1.00 0.00 ? 129 PRO A CB   2  
ATOM   6489   C  CG   . PRO A 1 129 ? -1.616  -22.277 10.826  1.00 0.00 ? 129 PRO A CG   2  
ATOM   6490   C  CD   . PRO A 1 129 ? -0.187  -21.973 11.275  1.00 0.00 ? 129 PRO A CD   2  
ATOM   6491   H  HA   . PRO A 1 129 ? -0.909  -19.402 9.530   1.00 0.00 ? 129 PRO A HA   2  
ATOM   6492   H  HB2  . PRO A 1 129 ? -3.127  -20.921 10.201  1.00 0.00 ? 129 PRO A HB2  2  
ATOM   6493   H  HB3  . PRO A 1 129 ? -1.942  -21.341 8.954   1.00 0.00 ? 129 PRO A HB3  2  
ATOM   6494   H  HG2  . PRO A 1 129 ? -2.259  -22.399 11.685  1.00 0.00 ? 129 PRO A HG2  2  
ATOM   6495   H  HG3  . PRO A 1 129 ? -1.621  -23.176 10.229  1.00 0.00 ? 129 PRO A HG3  2  
ATOM   6496   H  HD2  . PRO A 1 129 ? -0.054  -22.239 12.315  1.00 0.00 ? 129 PRO A HD2  2  
ATOM   6497   H  HD3  . PRO A 1 129 ? 0.521   -22.498 10.654  1.00 0.00 ? 129 PRO A HD3  2  
ATOM   6498   N  N    . ILE A 1 130 ? -2.801  -18.118 10.718  1.00 0.00 ? 130 ILE A N    2  
ATOM   6499   C  CA   . ILE A 1 130 ? -3.611  -17.152 11.508  1.00 0.00 ? 130 ILE A CA   2  
ATOM   6500   C  C    . ILE A 1 130 ? -4.822  -16.715 10.680  1.00 0.00 ? 130 ILE A C    2  
ATOM   6501   O  O    . ILE A 1 130 ? -4.718  -16.471 9.495   1.00 0.00 ? 130 ILE A O    2  
ATOM   6502   C  CB   . ILE A 1 130 ? -2.744  -15.938 11.852  1.00 0.00 ? 130 ILE A CB   2  
ATOM   6503   C  CG1  . ILE A 1 130 ? -3.628  -14.739 12.201  1.00 0.00 ? 130 ILE A CG1  2  
ATOM   6504   C  CG2  . ILE A 1 130 ? -1.867  -15.586 10.652  1.00 0.00 ? 130 ILE A CG2  2  
ATOM   6505   C  CD1  . ILE A 1 130 ? -2.755  -13.627 12.780  1.00 0.00 ? 130 ILE A CD1  2  
ATOM   6506   H  H    . ILE A 1 130 ? -2.835  -18.111 9.741   1.00 0.00 ? 130 ILE A H    2  
ATOM   6507   H  HA   . ILE A 1 130 ? -3.948  -17.624 12.418  1.00 0.00 ? 130 ILE A HA   2  
ATOM   6508   H  HB   . ILE A 1 130 ? -2.112  -16.179 12.696  1.00 0.00 ? 130 ILE A HB   2  
ATOM   6509   H  HG12 . ILE A 1 130 ? -4.122  -14.380 11.309  1.00 0.00 ? 130 ILE A HG12 2  
ATOM   6510   H  HG13 . ILE A 1 130 ? -4.365  -15.034 12.932  1.00 0.00 ? 130 ILE A HG13 2  
ATOM   6511   H  HG21 . ILE A 1 130 ? -2.282  -16.036 9.764   1.00 0.00 ? 130 ILE A HG21 2  
ATOM   6512   H  HG22 . ILE A 1 130 ? -0.868  -15.962 10.813  1.00 0.00 ? 130 ILE A HG22 2  
ATOM   6513   H  HG23 . ILE A 1 130 ? -1.835  -14.514 10.531  1.00 0.00 ? 130 ILE A HG23 2  
ATOM   6514   H  HD11 . ILE A 1 130 ? -3.346  -12.731 12.899  1.00 0.00 ? 130 ILE A HD11 2  
ATOM   6515   H  HD12 . ILE A 1 130 ? -1.932  -13.430 12.108  1.00 0.00 ? 130 ILE A HD12 2  
ATOM   6516   H  HD13 . ILE A 1 130 ? -2.369  -13.935 13.740  1.00 0.00 ? 130 ILE A HD13 2  
ATOM   6517   N  N    . ILE A 1 131 ? -5.968  -16.621 11.297  1.00 0.00 ? 131 ILE A N    2  
ATOM   6518   C  CA   . ILE A 1 131 ? -7.192  -16.207 10.550  1.00 0.00 ? 131 ILE A CA   2  
ATOM   6519   C  C    . ILE A 1 131 ? -7.869  -15.039 11.272  1.00 0.00 ? 131 ILE A C    2  
ATOM   6520   O  O    . ILE A 1 131 ? -8.177  -15.116 12.445  1.00 0.00 ? 131 ILE A O    2  
ATOM   6521   C  CB   . ILE A 1 131 ? -8.162  -17.386 10.468  1.00 0.00 ? 131 ILE A CB   2  
ATOM   6522   C  CG1  . ILE A 1 131 ? -7.423  -18.613 9.928   1.00 0.00 ? 131 ILE A CG1  2  
ATOM   6523   C  CG2  . ILE A 1 131 ? -9.317  -17.035 9.529   1.00 0.00 ? 131 ILE A CG2  2  
ATOM   6524   C  CD1  . ILE A 1 131 ? -8.317  -19.848 10.055  1.00 0.00 ? 131 ILE A CD1  2  
ATOM   6525   H  H    . ILE A 1 131 ? -6.026  -16.829 12.252  1.00 0.00 ? 131 ILE A H    2  
ATOM   6526   H  HA   . ILE A 1 131 ? -6.919  -15.898 9.552   1.00 0.00 ? 131 ILE A HA   2  
ATOM   6527   H  HB   . ILE A 1 131 ? -8.550  -17.602 11.454  1.00 0.00 ? 131 ILE A HB   2  
ATOM   6528   H  HG12 . ILE A 1 131 ? -7.174  -18.453 8.889   1.00 0.00 ? 131 ILE A HG12 2  
ATOM   6529   H  HG13 . ILE A 1 131 ? -6.518  -18.767 10.496  1.00 0.00 ? 131 ILE A HG13 2  
ATOM   6530   H  HG21 . ILE A 1 131 ? -9.261  -17.649 8.643   1.00 0.00 ? 131 ILE A HG21 2  
ATOM   6531   H  HG22 . ILE A 1 131 ? -9.251  -15.993 9.250   1.00 0.00 ? 131 ILE A HG22 2  
ATOM   6532   H  HG23 . ILE A 1 131 ? -10.257 -17.213 10.032  1.00 0.00 ? 131 ILE A HG23 2  
ATOM   6533   H  HD11 . ILE A 1 131 ? -7.831  -20.693 9.591   1.00 0.00 ? 131 ILE A HD11 2  
ATOM   6534   H  HD12 . ILE A 1 131 ? -9.261  -19.661 9.564   1.00 0.00 ? 131 ILE A HD12 2  
ATOM   6535   H  HD13 . ILE A 1 131 ? -8.490  -20.061 11.099  1.00 0.00 ? 131 ILE A HD13 2  
ATOM   6536   N  N    . VAL A 1 132 ? -8.102  -13.960 10.573  1.00 0.00 ? 132 VAL A N    2  
ATOM   6537   C  CA   . VAL A 1 132 ? -8.760  -12.778 11.202  1.00 0.00 ? 132 VAL A CA   2  
ATOM   6538   C  C    . VAL A 1 132 ? -10.076 -12.486 10.477  1.00 0.00 ? 132 VAL A C    2  
ATOM   6539   O  O    . VAL A 1 132 ? -10.086 -12.107 9.321   1.00 0.00 ? 132 VAL A O    2  
ATOM   6540   C  CB   . VAL A 1 132 ? -7.834  -11.564 11.097  1.00 0.00 ? 132 VAL A CB   2  
ATOM   6541   C  CG1  . VAL A 1 132 ? -6.746  -11.654 12.167  1.00 0.00 ? 132 VAL A CG1  2  
ATOM   6542   C  CG2  . VAL A 1 132 ? -7.184  -11.541 9.713   1.00 0.00 ? 132 VAL A CG2  2  
ATOM   6543   H  H    . VAL A 1 132 ? -7.842  -13.930 9.630   1.00 0.00 ? 132 VAL A H    2  
ATOM   6544   H  HA   . VAL A 1 132 ? -8.963  -12.987 12.242  1.00 0.00 ? 132 VAL A HA   2  
ATOM   6545   H  HB   . VAL A 1 132 ? -8.408  -10.659 11.242  1.00 0.00 ? 132 VAL A HB   2  
ATOM   6546   H  HG11 . VAL A 1 132 ? -5.843  -11.184 11.804  1.00 0.00 ? 132 VAL A HG11 2  
ATOM   6547   H  HG12 . VAL A 1 132 ? -6.547  -12.691 12.391  1.00 0.00 ? 132 VAL A HG12 2  
ATOM   6548   H  HG13 . VAL A 1 132 ? -7.079  -11.149 13.062  1.00 0.00 ? 132 VAL A HG13 2  
ATOM   6549   H  HG21 . VAL A 1 132 ? -7.204  -10.535 9.322   1.00 0.00 ? 132 VAL A HG21 2  
ATOM   6550   H  HG22 . VAL A 1 132 ? -7.727  -12.197 9.051   1.00 0.00 ? 132 VAL A HG22 2  
ATOM   6551   H  HG23 . VAL A 1 132 ? -6.160  -11.876 9.791   1.00 0.00 ? 132 VAL A HG23 2  
ATOM   6552   N  N    . GLU A 1 133 ? -11.184 -12.666 11.146  1.00 0.00 ? 133 GLU A N    2  
ATOM   6553   C  CA   . GLU A 1 133 ? -12.507 -12.405 10.502  1.00 0.00 ? 133 GLU A CA   2  
ATOM   6554   C  C    . GLU A 1 133 ? -13.223 -11.270 11.236  1.00 0.00 ? 133 GLU A C    2  
ATOM   6555   O  O    . GLU A 1 133 ? -13.396 -11.308 12.438  1.00 0.00 ? 133 GLU A O    2  
ATOM   6556   C  CB   . GLU A 1 133 ? -13.362 -13.672 10.572  1.00 0.00 ? 133 GLU A CB   2  
ATOM   6557   C  CG   . GLU A 1 133 ? -14.603 -13.502 9.693   1.00 0.00 ? 133 GLU A CG   2  
ATOM   6558   C  CD   . GLU A 1 133 ? -15.600 -12.574 10.389  1.00 0.00 ? 133 GLU A CD   2  
ATOM   6559   O  OE1  . GLU A 1 133 ? -15.840 -12.771 11.570  1.00 0.00 ? 133 GLU A OE1  2  
ATOM   6560   O  OE2  . GLU A 1 133 ? -16.108 -11.682 9.731   1.00 0.00 ? 133 GLU A OE2  2  
ATOM   6561   H  H    . GLU A 1 133 ? -11.148 -12.976 12.075  1.00 0.00 ? 133 GLU A H    2  
ATOM   6562   H  HA   . GLU A 1 133 ? -12.361 -12.127 9.473   1.00 0.00 ? 133 GLU A HA   2  
ATOM   6563   H  HB2  . GLU A 1 133 ? -12.786 -14.516 10.222  1.00 0.00 ? 133 GLU A HB2  2  
ATOM   6564   H  HB3  . GLU A 1 133 ? -13.668 -13.844 11.593  1.00 0.00 ? 133 GLU A HB3  2  
ATOM   6565   H  HG2  . GLU A 1 133 ? -14.314 -13.075 8.744   1.00 0.00 ? 133 GLU A HG2  2  
ATOM   6566   H  HG3  . GLU A 1 133 ? -15.064 -14.464 9.531   1.00 0.00 ? 133 GLU A HG3  2  
ATOM   6567   N  N    . ASP A 1 134 ? -13.647 -10.260 10.522  1.00 0.00 ? 134 ASP A N    2  
ATOM   6568   C  CA   . ASP A 1 134 ? -14.355 -9.128  11.192  1.00 0.00 ? 134 ASP A CA   2  
ATOM   6569   C  C    . ASP A 1 134 ? -14.894 -8.144  10.148  1.00 0.00 ? 134 ASP A C    2  
ATOM   6570   O  O    . ASP A 1 134 ? -14.383 -8.040  9.051   1.00 0.00 ? 134 ASP A O    2  
ATOM   6571   C  CB   . ASP A 1 134 ? -13.381 -8.395  12.120  1.00 0.00 ? 134 ASP A CB   2  
ATOM   6572   C  CG   . ASP A 1 134 ? -14.134 -7.321  12.908  1.00 0.00 ? 134 ASP A CG   2  
ATOM   6573   O  OD1  . ASP A 1 134 ? -15.250 -7.593  13.320  1.00 0.00 ? 134 ASP A OD1  2  
ATOM   6574   O  OD2  . ASP A 1 134 ? -13.582 -6.249  13.087  1.00 0.00 ? 134 ASP A OD2  2  
ATOM   6575   H  H    . ASP A 1 134 ? -13.502 -10.247 9.551   1.00 0.00 ? 134 ASP A H    2  
ATOM   6576   H  HA   . ASP A 1 134 ? -15.177 -9.516  11.774  1.00 0.00 ? 134 ASP A HA   2  
ATOM   6577   H  HB2  . ASP A 1 134 ? -12.937 -9.101  12.807  1.00 0.00 ? 134 ASP A HB2  2  
ATOM   6578   H  HB3  . ASP A 1 134 ? -12.605 -7.928  11.533  1.00 0.00 ? 134 ASP A HB3  2  
ATOM   6579   N  N    . GLU A 1 135 ? -15.921 -7.412  10.498  1.00 0.00 ? 135 GLU A N    2  
ATOM   6580   C  CA   . GLU A 1 135 ? -16.508 -6.411  9.554   1.00 0.00 ? 135 GLU A CA   2  
ATOM   6581   C  C    . GLU A 1 135 ? -16.992 -7.094  8.272   1.00 0.00 ? 135 GLU A C    2  
ATOM   6582   O  O    . GLU A 1 135 ? -17.154 -6.460  7.248   1.00 0.00 ? 135 GLU A O    2  
ATOM   6583   C  CB   . GLU A 1 135 ? -15.453 -5.361  9.203   1.00 0.00 ? 135 GLU A CB   2  
ATOM   6584   C  CG   . GLU A 1 135 ? -14.851 -4.793  10.490  1.00 0.00 ? 135 GLU A CG   2  
ATOM   6585   C  CD   . GLU A 1 135 ? -15.170 -3.301  10.590  1.00 0.00 ? 135 GLU A CD   2  
ATOM   6586   O  OE1  . GLU A 1 135 ? -14.384 -2.512  10.090  1.00 0.00 ? 135 GLU A OE1  2  
ATOM   6587   O  OE2  . GLU A 1 135 ? -16.194 -2.972  11.165  1.00 0.00 ? 135 GLU A OE2  2  
ATOM   6588   H  H    . GLU A 1 135 ? -16.304 -7.513  11.394  1.00 0.00 ? 135 GLU A H    2  
ATOM   6589   H  HA   . GLU A 1 135 ? -17.345 -5.927  10.031  1.00 0.00 ? 135 GLU A HA   2  
ATOM   6590   H  HB2  . GLU A 1 135 ? -14.674 -5.815  8.609   1.00 0.00 ? 135 GLU A HB2  2  
ATOM   6591   H  HB3  . GLU A 1 135 ? -15.913 -4.561  8.642   1.00 0.00 ? 135 GLU A HB3  2  
ATOM   6592   H  HG2  . GLU A 1 135 ? -15.271 -5.310  11.341  1.00 0.00 ? 135 GLU A HG2  2  
ATOM   6593   H  HG3  . GLU A 1 135 ? -13.780 -4.931  10.478  1.00 0.00 ? 135 GLU A HG3  2  
ATOM   6594   N  N    . GLY A 1 136 ? -17.225 -8.373  8.311   1.00 0.00 ? 136 GLY A N    2  
ATOM   6595   C  CA   . GLY A 1 136 ? -17.698 -9.075  7.085   1.00 0.00 ? 136 GLY A CA   2  
ATOM   6596   C  C    . GLY A 1 136 ? -16.507 -9.338  6.162   1.00 0.00 ? 136 GLY A C    2  
ATOM   6597   O  O    . GLY A 1 136 ? -16.649 -9.870  5.080   1.00 0.00 ? 136 GLY A O    2  
ATOM   6598   H  H    . GLY A 1 136 ? -17.084 -8.872  9.142   1.00 0.00 ? 136 GLY A H    2  
ATOM   6599   H  HA2  . GLY A 1 136 ? -18.156 -10.016 7.361   1.00 0.00 ? 136 GLY A HA2  2  
ATOM   6600   H  HA3  . GLY A 1 136 ? -18.418 -8.459  6.570   1.00 0.00 ? 136 GLY A HA3  2  
ATOM   6601   N  N    . ARG A 1 137 ? -15.330 -8.986  6.597   1.00 0.00 ? 137 ARG A N    2  
ATOM   6602   C  CA   . ARG A 1 137 ? -14.119 -9.230  5.768   1.00 0.00 ? 137 ARG A CA   2  
ATOM   6603   C  C    . ARG A 1 137 ? -13.376 -10.415 6.374   1.00 0.00 ? 137 ARG A C    2  
ATOM   6604   O  O    . ARG A 1 137 ? -13.722 -10.874 7.445   1.00 0.00 ? 137 ARG A O    2  
ATOM   6605   C  CB   . ARG A 1 137 ? -13.220 -7.994  5.801   1.00 0.00 ? 137 ARG A CB   2  
ATOM   6606   C  CG   . ARG A 1 137 ? -14.033 -6.754  5.422   1.00 0.00 ? 137 ARG A CG   2  
ATOM   6607   C  CD   . ARG A 1 137 ? -13.094 -5.553  5.286   1.00 0.00 ? 137 ARG A CD   2  
ATOM   6608   N  NE   . ARG A 1 137 ? -13.241 -4.957  3.927   1.00 0.00 ? 137 ARG A NE   2  
ATOM   6609   C  CZ   . ARG A 1 137 ? -14.339 -4.330  3.606   1.00 0.00 ? 137 ARG A CZ   2  
ATOM   6610   N  NH1  . ARG A 1 137 ? -15.312 -4.233  4.471   1.00 0.00 ? 137 ARG A NH1  2  
ATOM   6611   N  NH2  . ARG A 1 137 ? -14.467 -3.802  2.420   1.00 0.00 ? 137 ARG A NH2  2  
ATOM   6612   H  H    . ARG A 1 137 ? -15.238 -8.578  7.483   1.00 0.00 ? 137 ARG A H    2  
ATOM   6613   H  HA   . ARG A 1 137 ? -14.406 -9.453  4.751   1.00 0.00 ? 137 ARG A HA   2  
ATOM   6614   H  HB2  . ARG A 1 137 ? -12.818 -7.871  6.797   1.00 0.00 ? 137 ARG A HB2  2  
ATOM   6615   H  HB3  . ARG A 1 137 ? -12.412 -8.121  5.101   1.00 0.00 ? 137 ARG A HB3  2  
ATOM   6616   H  HG2  . ARG A 1 137 ? -14.538 -6.928  4.483   1.00 0.00 ? 137 ARG A HG2  2  
ATOM   6617   H  HG3  . ARG A 1 137 ? -14.762 -6.552  6.192   1.00 0.00 ? 137 ARG A HG3  2  
ATOM   6618   H  HD2  . ARG A 1 137 ? -13.346 -4.812  6.031   1.00 0.00 ? 137 ARG A HD2  2  
ATOM   6619   H  HD3  . ARG A 1 137 ? -12.074 -5.875  5.428   1.00 0.00 ? 137 ARG A HD3  2  
ATOM   6620   H  HE   . ARG A 1 137 ? -12.511 -5.033  3.277   1.00 0.00 ? 137 ARG A HE   2  
ATOM   6621   H  HH11 . ARG A 1 137 ? -15.215 -4.639  5.380   1.00 0.00 ? 137 ARG A HH11 2  
ATOM   6622   H  HH12 . ARG A 1 137 ? -16.153 -3.752  4.226   1.00 0.00 ? 137 ARG A HH12 2  
ATOM   6623   H  HH21 . ARG A 1 137 ? -13.721 -3.877  1.757   1.00 0.00 ? 137 ARG A HH21 2  
ATOM   6624   H  HH22 . ARG A 1 137 ? -15.308 -3.321  2.174   1.00 0.00 ? 137 ARG A HH22 2  
ATOM   6625   N  N    . LEU A 1 138 ? -12.353 -10.921 5.739   1.00 0.00 ? 138 LEU A N    2  
ATOM   6626   C  CA   . LEU A 1 138 ? -11.622 -12.067 6.348   1.00 0.00 ? 138 LEU A CA   2  
ATOM   6627   C  C    . LEU A 1 138 ? -10.229 -12.159 5.722   1.00 0.00 ? 138 LEU A C    2  
ATOM   6628   O  O    . LEU A 1 138 ? -10.034 -11.801 4.578   1.00 0.00 ? 138 LEU A O    2  
ATOM   6629   C  CB   . LEU A 1 138 ? -12.403 -13.361 6.098   1.00 0.00 ? 138 LEU A CB   2  
ATOM   6630   C  CG   . LEU A 1 138 ? -11.829 -14.501 6.954   1.00 0.00 ? 138 LEU A CG   2  
ATOM   6631   C  CD1  . LEU A 1 138 ? -12.906 -15.569 7.156   1.00 0.00 ? 138 LEU A CD1  2  
ATOM   6632   C  CD2  . LEU A 1 138 ? -10.614 -15.143 6.267   1.00 0.00 ? 138 LEU A CD2  2  
ATOM   6633   H  H    . LEU A 1 138 ? -12.033 -10.560 4.881   1.00 0.00 ? 138 LEU A H    2  
ATOM   6634   H  HA   . LEU A 1 138 ? -11.525 -11.901 7.407   1.00 0.00 ? 138 LEU A HA   2  
ATOM   6635   H  HB2  . LEU A 1 138 ? -13.439 -13.201 6.368   1.00 0.00 ? 138 LEU A HB2  2  
ATOM   6636   H  HB3  . LEU A 1 138 ? -12.347 -13.624 5.054   1.00 0.00 ? 138 LEU A HB3  2  
ATOM   6637   H  HG   . LEU A 1 138 ? -11.534 -14.111 7.918   1.00 0.00 ? 138 LEU A HG   2  
ATOM   6638   H  HD11 . LEU A 1 138 ? -13.437 -15.377 8.077   1.00 0.00 ? 138 LEU A HD11 2  
ATOM   6639   H  HD12 . LEU A 1 138 ? -12.441 -16.544 7.206   1.00 0.00 ? 138 LEU A HD12 2  
ATOM   6640   H  HD13 . LEU A 1 138 ? -13.599 -15.542 6.328   1.00 0.00 ? 138 LEU A HD13 2  
ATOM   6641   H  HD21 . LEU A 1 138 ? -10.821 -16.185 6.076   1.00 0.00 ? 138 LEU A HD21 2  
ATOM   6642   H  HD22 . LEU A 1 138 ? -9.753  -15.062 6.913   1.00 0.00 ? 138 LEU A HD22 2  
ATOM   6643   H  HD23 . LEU A 1 138 ? -10.407 -14.643 5.334   1.00 0.00 ? 138 LEU A HD23 2  
ATOM   6644   N  N    . ILE A 1 139 ? -9.260  -12.646 6.451   1.00 0.00 ? 139 ILE A N    2  
ATOM   6645   C  CA   . ILE A 1 139 ? -7.888  -12.769 5.881   1.00 0.00 ? 139 ILE A CA   2  
ATOM   6646   C  C    . ILE A 1 139 ? -7.197  -13.982 6.501   1.00 0.00 ? 139 ILE A C    2  
ATOM   6647   O  O    . ILE A 1 139 ? -7.213  -14.167 7.702   1.00 0.00 ? 139 ILE A O    2  
ATOM   6648   C  CB   . ILE A 1 139 ? -7.079  -11.505 6.184   1.00 0.00 ? 139 ILE A CB   2  
ATOM   6649   C  CG1  . ILE A 1 139 ? -7.256  -10.499 5.042   1.00 0.00 ? 139 ILE A CG1  2  
ATOM   6650   C  CG2  . ILE A 1 139 ? -5.598  -11.868 6.319   1.00 0.00 ? 139 ILE A CG2  2  
ATOM   6651   C  CD1  . ILE A 1 139 ? -6.582  -9.173  5.408   1.00 0.00 ? 139 ILE A CD1  2  
ATOM   6652   H  H    . ILE A 1 139 ? -9.425  -12.948 7.369   1.00 0.00 ? 139 ILE A H    2  
ATOM   6653   H  HA   . ILE A 1 139 ? -7.955  -12.907 4.816   1.00 0.00 ? 139 ILE A HA   2  
ATOM   6654   H  HB   . ILE A 1 139 ? -7.428  -11.068 7.107   1.00 0.00 ? 139 ILE A HB   2  
ATOM   6655   H  HG12 . ILE A 1 139 ? -6.805  -10.895 4.144   1.00 0.00 ? 139 ILE A HG12 2  
ATOM   6656   H  HG13 . ILE A 1 139 ? -8.308  -10.329 4.871   1.00 0.00 ? 139 ILE A HG13 2  
ATOM   6657   H  HG21 . ILE A 1 139 ? -5.426  -12.331 7.280   1.00 0.00 ? 139 ILE A HG21 2  
ATOM   6658   H  HG22 . ILE A 1 139 ? -4.998  -10.974 6.240   1.00 0.00 ? 139 ILE A HG22 2  
ATOM   6659   H  HG23 . ILE A 1 139 ? -5.324  -12.555 5.533   1.00 0.00 ? 139 ILE A HG23 2  
ATOM   6660   H  HD11 . ILE A 1 139 ? -6.549  -9.069  6.482   1.00 0.00 ? 139 ILE A HD11 2  
ATOM   6661   H  HD12 . ILE A 1 139 ? -7.147  -8.355  4.985   1.00 0.00 ? 139 ILE A HD12 2  
ATOM   6662   H  HD13 . ILE A 1 139 ? -5.578  -9.160  5.014   1.00 0.00 ? 139 ILE A HD13 2  
ATOM   6663   N  N    . LYS A 1 140 ? -6.599  -14.816 5.690   1.00 0.00 ? 140 LYS A N    2  
ATOM   6664   C  CA   . LYS A 1 140 ? -5.916  -16.025 6.232   1.00 0.00 ? 140 LYS A CA   2  
ATOM   6665   C  C    . LYS A 1 140 ? -4.434  -15.993 5.865   1.00 0.00 ? 140 LYS A C    2  
ATOM   6666   O  O    . LYS A 1 140 ? -4.067  -15.652 4.758   1.00 0.00 ? 140 LYS A O    2  
ATOM   6667   C  CB   . LYS A 1 140 ? -6.558  -17.278 5.629   1.00 0.00 ? 140 LYS A CB   2  
ATOM   6668   C  CG   . LYS A 1 140 ? -5.779  -18.520 6.067   1.00 0.00 ? 140 LYS A CG   2  
ATOM   6669   C  CD   . LYS A 1 140 ? -6.508  -19.775 5.586   1.00 0.00 ? 140 LYS A CD   2  
ATOM   6670   C  CE   . LYS A 1 140 ? -7.431  -20.287 6.693   1.00 0.00 ? 140 LYS A CE   2  
ATOM   6671   N  NZ   . LYS A 1 140 ? -8.272  -21.397 6.162   1.00 0.00 ? 140 LYS A NZ   2  
ATOM   6672   H  H    . LYS A 1 140 ? -6.605  -14.649 4.723   1.00 0.00 ? 140 LYS A H    2  
ATOM   6673   H  HA   . LYS A 1 140 ? -6.019  -16.053 7.306   1.00 0.00 ? 140 LYS A HA   2  
ATOM   6674   H  HB2  . LYS A 1 140 ? -7.581  -17.356 5.967   1.00 0.00 ? 140 LYS A HB2  2  
ATOM   6675   H  HB3  . LYS A 1 140 ? -6.539  -17.206 4.551   1.00 0.00 ? 140 LYS A HB3  2  
ATOM   6676   H  HG2  . LYS A 1 140 ? -4.787  -18.494 5.638   1.00 0.00 ? 140 LYS A HG2  2  
ATOM   6677   H  HG3  . LYS A 1 140 ? -5.705  -18.539 7.144   1.00 0.00 ? 140 LYS A HG3  2  
ATOM   6678   H  HD2  . LYS A 1 140 ? -7.094  -19.537 4.710   1.00 0.00 ? 140 LYS A HD2  2  
ATOM   6679   H  HD3  . LYS A 1 140 ? -5.786  -20.540 5.340   1.00 0.00 ? 140 LYS A HD3  2  
ATOM   6680   H  HE2  . LYS A 1 140 ? -6.837  -20.650 7.519   1.00 0.00 ? 140 LYS A HE2  2  
ATOM   6681   H  HE3  . LYS A 1 140 ? -8.068  -19.485 7.032   1.00 0.00 ? 140 LYS A HE3  2  
ATOM   6682   H  HZ1  . LYS A 1 140 ? -8.311  -22.168 6.859   1.00 0.00 ? 140 LYS A HZ1  2  
ATOM   6683   H  HZ2  . LYS A 1 140 ? -7.859  -21.750 5.274   1.00 0.00 ? 140 LYS A HZ2  2  
ATOM   6684   H  HZ3  . LYS A 1 140 ? -9.234  -21.047 5.981   1.00 0.00 ? 140 LYS A HZ3  2  
ATOM   6685   N  N    . ALA A 1 141 ? -3.584  -16.367 6.781   1.00 0.00 ? 141 ALA A N    2  
ATOM   6686   C  CA   . ALA A 1 141 ? -2.124  -16.389 6.491   1.00 0.00 ? 141 ALA A CA   2  
ATOM   6687   C  C    . ALA A 1 141 ? -1.598  -17.790 6.796   1.00 0.00 ? 141 ALA A C    2  
ATOM   6688   O  O    . ALA A 1 141 ? -1.926  -18.375 7.805   1.00 0.00 ? 141 ALA A O    2  
ATOM   6689   C  CB   . ALA A 1 141 ? -1.404  -15.360 7.366   1.00 0.00 ? 141 ALA A CB   2  
ATOM   6690   H  H    . ALA A 1 141 ? -3.904  -16.657 7.662   1.00 0.00 ? 141 ALA A H    2  
ATOM   6691   H  HA   . ALA A 1 141 ? -1.956  -16.159 5.453   1.00 0.00 ? 141 ALA A HA   2  
ATOM   6692   H  HB1  . ALA A 1 141 ? -0.798  -14.719 6.741   1.00 0.00 ? 141 ALA A HB1  2  
ATOM   6693   H  HB2  . ALA A 1 141 ? -0.770  -15.870 8.076   1.00 0.00 ? 141 ALA A HB2  2  
ATOM   6694   H  HB3  . ALA A 1 141 ? -2.131  -14.761 7.894   1.00 0.00 ? 141 ALA A HB3  2  
ATOM   6695   N  N    . GLU A 1 142 ? -0.798  -18.338 5.925   1.00 0.00 ? 142 GLU A N    2  
ATOM   6696   C  CA   . GLU A 1 142 ? -0.258  -19.710 6.157   1.00 0.00 ? 142 GLU A CA   2  
ATOM   6697   C  C    . GLU A 1 142 ? 1.248   -19.689 5.869   1.00 0.00 ? 142 GLU A C    2  
ATOM   6698   O  O    . GLU A 1 142 ? 1.675   -19.082 4.906   1.00 0.00 ? 142 GLU A O    2  
ATOM   6699   C  CB   . GLU A 1 142 ? -0.951  -20.681 5.192   1.00 0.00 ? 142 GLU A CB   2  
ATOM   6700   C  CG   . GLU A 1 142 ? -0.729  -22.125 5.644   1.00 0.00 ? 142 GLU A CG   2  
ATOM   6701   C  CD   . GLU A 1 142 ? -1.483  -23.074 4.710   1.00 0.00 ? 142 GLU A CD   2  
ATOM   6702   O  OE1  . GLU A 1 142 ? -2.671  -22.866 4.519   1.00 0.00 ? 142 GLU A OE1  2  
ATOM   6703   O  OE2  . GLU A 1 142 ? -0.861  -23.992 4.201   1.00 0.00 ? 142 GLU A OE2  2  
ATOM   6704   H  H    . GLU A 1 142 ? -0.556  -17.850 5.111   1.00 0.00 ? 142 GLU A H    2  
ATOM   6705   H  HA   . GLU A 1 142 ? -0.447  -20.005 7.179   1.00 0.00 ? 142 GLU A HA   2  
ATOM   6706   H  HB2  . GLU A 1 142 ? -2.011  -20.472 5.172   1.00 0.00 ? 142 GLU A HB2  2  
ATOM   6707   H  HB3  . GLU A 1 142 ? -0.543  -20.552 4.202   1.00 0.00 ? 142 GLU A HB3  2  
ATOM   6708   H  HG2  . GLU A 1 142 ? 0.326   -22.354 5.610   1.00 0.00 ? 142 GLU A HG2  2  
ATOM   6709   H  HG3  . GLU A 1 142 ? -1.096  -22.250 6.650   1.00 0.00 ? 142 GLU A HG3  2  
ATOM   6710   N  N    . PRO A 1 143 ? 2.067   -20.327 6.677   1.00 0.00 ? 143 PRO A N    2  
ATOM   6711   C  CA   . PRO A 1 143 ? 3.537   -20.329 6.444   1.00 0.00 ? 143 PRO A CA   2  
ATOM   6712   C  C    . PRO A 1 143 ? 3.891   -20.770 5.019   1.00 0.00 ? 143 PRO A C    2  
ATOM   6713   O  O    . PRO A 1 143 ? 3.219   -21.591 4.426   1.00 0.00 ? 143 PRO A O    2  
ATOM   6714   C  CB   . PRO A 1 143 ? 4.101   -21.313 7.481   1.00 0.00 ? 143 PRO A CB   2  
ATOM   6715   C  CG   . PRO A 1 143 ? 2.925   -22.002 8.098   1.00 0.00 ? 143 PRO A CG   2  
ATOM   6716   C  CD   . PRO A 1 143 ? 1.710   -21.105 7.877   1.00 0.00 ? 143 PRO A CD   2  
ATOM   6717   H  HA   . PRO A 1 143 ? 3.938   -19.349 6.629   1.00 0.00 ? 143 PRO A HA   2  
ATOM   6718   H  HB2  . PRO A 1 143 ? 4.745   -22.034 7.001   1.00 0.00 ? 143 PRO A HB2  2  
ATOM   6719   H  HB3  . PRO A 1 143 ? 4.647   -20.778 8.241   1.00 0.00 ? 143 PRO A HB3  2  
ATOM   6720   H  HG2  . PRO A 1 143 ? 2.772   -22.961 7.624   1.00 0.00 ? 143 PRO A HG2  2  
ATOM   6721   H  HG3  . PRO A 1 143 ? 3.089   -22.134 9.156   1.00 0.00 ? 143 PRO A HG3  2  
ATOM   6722   H  HD2  . PRO A 1 143 ? 0.835   -21.711 7.707   1.00 0.00 ? 143 PRO A HD2  2  
ATOM   6723   H  HD3  . PRO A 1 143 ? 1.563   -20.449 8.722   1.00 0.00 ? 143 PRO A HD3  2  
ATOM   6724   N  N    . SER A 1 144 ? 4.951   -20.238 4.474   1.00 0.00 ? 144 SER A N    2  
ATOM   6725   C  CA   . SER A 1 144 ? 5.364   -20.634 3.095   1.00 0.00 ? 144 SER A CA   2  
ATOM   6726   C  C    . SER A 1 144 ? 6.767   -20.097 2.812   1.00 0.00 ? 144 SER A C    2  
ATOM   6727   O  O    . SER A 1 144 ? 7.222   -19.162 3.438   1.00 0.00 ? 144 SER A O    2  
ATOM   6728   C  CB   . SER A 1 144 ? 4.388   -20.061 2.067   1.00 0.00 ? 144 SER A CB   2  
ATOM   6729   O  OG   . SER A 1 144 ? 4.329   -20.933 0.944   1.00 0.00 ? 144 SER A OG   2  
ATOM   6730   H  H    . SER A 1 144 ? 5.492   -19.593 4.982   1.00 0.00 ? 144 SER A H    2  
ATOM   6731   H  HA   . SER A 1 144 ? 5.372   -21.712 3.020   1.00 0.00 ? 144 SER A HA   2  
ATOM   6732   H  HB2  . SER A 1 144 ? 3.409   -19.978 2.502   1.00 0.00 ? 144 SER A HB2  2  
ATOM   6733   H  HB3  . SER A 1 144 ? 4.728   -19.083 1.754   1.00 0.00 ? 144 SER A HB3  2  
ATOM   6734   H  HG   . SER A 1 144 ? 3.738   -21.657 1.161   1.00 0.00 ? 144 SER A HG   2  
ATOM   6735   N  N    . ASP A 1 145 ? 7.457   -20.684 1.873   1.00 0.00 ? 145 ASP A N    2  
ATOM   6736   C  CA   . ASP A 1 145 ? 8.832   -20.211 1.552   1.00 0.00 ? 145 ASP A CA   2  
ATOM   6737   C  C    . ASP A 1 145 ? 8.776   -19.191 0.413   1.00 0.00 ? 145 ASP A C    2  
ATOM   6738   O  O    . ASP A 1 145 ? 9.793   -18.702 -0.039  1.00 0.00 ? 145 ASP A O    2  
ATOM   6739   C  CB   . ASP A 1 145 ? 9.691   -21.403 1.127   1.00 0.00 ? 145 ASP A CB   2  
ATOM   6740   C  CG   . ASP A 1 145 ? 10.333  -22.036 2.362   1.00 0.00 ? 145 ASP A CG   2  
ATOM   6741   O  OD1  . ASP A 1 145 ? 11.402  -21.592 2.743   1.00 0.00 ? 145 ASP A OD1  2  
ATOM   6742   O  OD2  . ASP A 1 145 ? 9.743   -22.955 2.906   1.00 0.00 ? 145 ASP A OD2  2  
ATOM   6743   H  H    . ASP A 1 145 ? 7.072   -21.439 1.381   1.00 0.00 ? 145 ASP A H    2  
ATOM   6744   H  HA   . ASP A 1 145 ? 9.266   -19.749 2.427   1.00 0.00 ? 145 ASP A HA   2  
ATOM   6745   H  HB2  . ASP A 1 145 ? 9.070   -22.133 0.628   1.00 0.00 ? 145 ASP A HB2  2  
ATOM   6746   H  HB3  . ASP A 1 145 ? 10.465  -21.067 0.452   1.00 0.00 ? 145 ASP A HB3  2  
ATOM   6747   N  N    . THR A 1 146 ? 7.600   -18.863 -0.058  1.00 0.00 ? 146 THR A N    2  
ATOM   6748   C  CA   . THR A 1 146 ? 7.491   -17.873 -1.171  1.00 0.00 ? 146 THR A CA   2  
ATOM   6749   C  C    . THR A 1 146 ? 6.431   -16.825 -0.825  1.00 0.00 ? 146 THR A C    2  
ATOM   6750   O  O    . THR A 1 146 ? 5.384   -17.138 -0.293  1.00 0.00 ? 146 THR A O    2  
ATOM   6751   C  CB   . THR A 1 146 ? 7.093   -18.592 -2.462  1.00 0.00 ? 146 THR A CB   2  
ATOM   6752   O  OG1  . THR A 1 146 ? 5.763   -19.075 -2.344  1.00 0.00 ? 146 THR A OG1  2  
ATOM   6753   C  CG2  . THR A 1 146 ? 8.044   -19.765 -2.708  1.00 0.00 ? 146 THR A CG2  2  
ATOM   6754   H  H    . THR A 1 146 ? 6.788   -19.269 0.319   1.00 0.00 ? 146 THR A H    2  
ATOM   6755   H  HA   . THR A 1 146 ? 8.443   -17.383 -1.312  1.00 0.00 ? 146 THR A HA   2  
ATOM   6756   H  HB   . THR A 1 146 ? 7.157   -17.904 -3.291  1.00 0.00 ? 146 THR A HB   2  
ATOM   6757   H  HG1  . THR A 1 146 ? 5.214   -18.355 -2.022  1.00 0.00 ? 146 THR A HG1  2  
ATOM   6758   H  HG21 . THR A 1 146 ? 8.976   -19.588 -2.192  1.00 0.00 ? 146 THR A HG21 2  
ATOM   6759   H  HG22 . THR A 1 146 ? 8.231   -19.861 -3.767  1.00 0.00 ? 146 THR A HG22 2  
ATOM   6760   H  HG23 . THR A 1 146 ? 7.594   -20.676 -2.339  1.00 0.00 ? 146 THR A HG23 2  
ATOM   6761   N  N    . LEU A 1 147 ? 6.697   -15.581 -1.122  1.00 0.00 ? 147 LEU A N    2  
ATOM   6762   C  CA   . LEU A 1 147 ? 5.707   -14.512 -0.810  1.00 0.00 ? 147 LEU A CA   2  
ATOM   6763   C  C    . LEU A 1 147 ? 4.535   -14.591 -1.792  1.00 0.00 ? 147 LEU A C    2  
ATOM   6764   O  O    . LEU A 1 147 ? 4.691   -14.397 -2.981  1.00 0.00 ? 147 LEU A O    2  
ATOM   6765   C  CB   . LEU A 1 147 ? 6.381   -13.141 -0.929  1.00 0.00 ? 147 LEU A CB   2  
ATOM   6766   C  CG   . LEU A 1 147 ? 5.321   -12.039 -0.850  1.00 0.00 ? 147 LEU A CG   2  
ATOM   6767   C  CD1  . LEU A 1 147 ? 4.441   -12.262 0.382   1.00 0.00 ? 147 LEU A CD1  2  
ATOM   6768   C  CD2  . LEU A 1 147 ? 6.010   -10.677 -0.742  1.00 0.00 ? 147 LEU A CD2  2  
ATOM   6769   H  H    . LEU A 1 147 ? 7.549   -15.353 -1.549  1.00 0.00 ? 147 LEU A H    2  
ATOM   6770   H  HA   . LEU A 1 147 ? 5.341   -14.645 0.197   1.00 0.00 ? 147 LEU A HA   2  
ATOM   6771   H  HB2  . LEU A 1 147 ? 7.089   -13.019 -0.123  1.00 0.00 ? 147 LEU A HB2  2  
ATOM   6772   H  HB3  . LEU A 1 147 ? 6.896   -13.075 -1.874  1.00 0.00 ? 147 LEU A HB3  2  
ATOM   6773   H  HG   . LEU A 1 147 ? 4.708   -12.064 -1.739  1.00 0.00 ? 147 LEU A HG   2  
ATOM   6774   H  HD11 . LEU A 1 147 ? 3.687   -13.003 0.156   1.00 0.00 ? 147 LEU A HD11 2  
ATOM   6775   H  HD12 . LEU A 1 147 ? 3.961   -11.333 0.655   1.00 0.00 ? 147 LEU A HD12 2  
ATOM   6776   H  HD13 . LEU A 1 147 ? 5.051   -12.608 1.203   1.00 0.00 ? 147 LEU A HD13 2  
ATOM   6777   H  HD21 . LEU A 1 147 ? 6.920   -10.686 -1.322  1.00 0.00 ? 147 LEU A HD21 2  
ATOM   6778   H  HD22 . LEU A 1 147 ? 6.242   -10.473 0.293   1.00 0.00 ? 147 LEU A HD22 2  
ATOM   6779   H  HD23 . LEU A 1 147 ? 5.350   -9.910  -1.120  1.00 0.00 ? 147 LEU A HD23 2  
ATOM   6780   N  N    . GLU A 1 148 ? 3.360   -14.862 -1.299  1.00 0.00 ? 148 GLU A N    2  
ATOM   6781   C  CA   . GLU A 1 148 ? 2.171   -14.945 -2.193  1.00 0.00 ? 148 GLU A CA   2  
ATOM   6782   C  C    . GLU A 1 148 ? 0.996   -14.245 -1.513  1.00 0.00 ? 148 GLU A C    2  
ATOM   6783   O  O    . GLU A 1 148 ? 0.775   -14.399 -0.329  1.00 0.00 ? 148 GLU A O    2  
ATOM   6784   C  CB   . GLU A 1 148 ? 1.819   -16.412 -2.443  1.00 0.00 ? 148 GLU A CB   2  
ATOM   6785   C  CG   . GLU A 1 148 ? 0.412   -16.507 -3.034  1.00 0.00 ? 148 GLU A CG   2  
ATOM   6786   C  CD   . GLU A 1 148 ? 0.196   -17.905 -3.616  1.00 0.00 ? 148 GLU A CD   2  
ATOM   6787   O  OE1  . GLU A 1 148 ? 0.406   -18.865 -2.892  1.00 0.00 ? 148 GLU A OE1  2  
ATOM   6788   O  OE2  . GLU A 1 148 ? -0.174  -17.992 -4.775  1.00 0.00 ? 148 GLU A OE2  2  
ATOM   6789   H  H    . GLU A 1 148 ? 3.256   -15.006 -0.335  1.00 0.00 ? 148 GLU A H    2  
ATOM   6790   H  HA   . GLU A 1 148 ? 2.390   -14.458 -3.133  1.00 0.00 ? 148 GLU A HA   2  
ATOM   6791   H  HB2  . GLU A 1 148 ? 2.530   -16.841 -3.132  1.00 0.00 ? 148 GLU A HB2  2  
ATOM   6792   H  HB3  . GLU A 1 148 ? 1.852   -16.951 -1.509  1.00 0.00 ? 148 GLU A HB3  2  
ATOM   6793   H  HG2  . GLU A 1 148 ? -0.317  -16.323 -2.259  1.00 0.00 ? 148 GLU A HG2  2  
ATOM   6794   H  HG3  . GLU A 1 148 ? 0.299   -15.773 -3.817  1.00 0.00 ? 148 GLU A HG3  2  
ATOM   6795   N  N    . VAL A 1 149 ? 0.242   -13.469 -2.242  1.00 0.00 ? 149 VAL A N    2  
ATOM   6796   C  CA   . VAL A 1 149 ? -0.910  -12.758 -1.617  1.00 0.00 ? 149 VAL A CA   2  
ATOM   6797   C  C    . VAL A 1 149 ? -2.100  -12.775 -2.578  1.00 0.00 ? 149 VAL A C    2  
ATOM   6798   O  O    . VAL A 1 149 ? -1.998  -12.333 -3.706  1.00 0.00 ? 149 VAL A O    2  
ATOM   6799   C  CB   . VAL A 1 149 ? -0.508  -11.309 -1.335  1.00 0.00 ? 149 VAL A CB   2  
ATOM   6800   C  CG1  . VAL A 1 149 ? -1.732  -10.516 -0.876  1.00 0.00 ? 149 VAL A CG1  2  
ATOM   6801   C  CG2  . VAL A 1 149 ? 0.563   -11.279 -0.240  1.00 0.00 ? 149 VAL A CG2  2  
ATOM   6802   H  H    . VAL A 1 149 ? 0.428   -13.342 -3.198  1.00 0.00 ? 149 VAL A H    2  
ATOM   6803   H  HA   . VAL A 1 149 ? -1.182  -13.246 -0.692  1.00 0.00 ? 149 VAL A HA   2  
ATOM   6804   H  HB   . VAL A 1 149 ? -0.113  -10.865 -2.237  1.00 0.00 ? 149 VAL A HB   2  
ATOM   6805   H  HG11 . VAL A 1 149 ? -1.412  -9.589  -0.424  1.00 0.00 ? 149 VAL A HG11 2  
ATOM   6806   H  HG12 . VAL A 1 149 ? -2.286  -11.097 -0.153  1.00 0.00 ? 149 VAL A HG12 2  
ATOM   6807   H  HG13 . VAL A 1 149 ? -2.362  -10.304 -1.727  1.00 0.00 ? 149 VAL A HG13 2  
ATOM   6808   H  HG21 . VAL A 1 149 ? 0.344   -12.035 0.499   1.00 0.00 ? 149 VAL A HG21 2  
ATOM   6809   H  HG22 . VAL A 1 149 ? 0.571   -10.307 0.229   1.00 0.00 ? 149 VAL A HG22 2  
ATOM   6810   H  HG23 . VAL A 1 149 ? 1.530   -11.475 -0.679  1.00 0.00 ? 149 VAL A HG23 2  
ATOM   6811   N  N    . THR A 1 150 ? -3.227  -13.283 -2.146  1.00 0.00 ? 150 THR A N    2  
ATOM   6812   C  CA   . THR A 1 150 ? -4.417  -13.327 -3.044  1.00 0.00 ? 150 THR A CA   2  
ATOM   6813   C  C    . THR A 1 150 ? -5.531  -12.443 -2.488  1.00 0.00 ? 150 THR A C    2  
ATOM   6814   O  O    . THR A 1 150 ? -5.716  -12.333 -1.292  1.00 0.00 ? 150 THR A O    2  
ATOM   6815   C  CB   . THR A 1 150 ? -4.922  -14.768 -3.156  1.00 0.00 ? 150 THR A CB   2  
ATOM   6816   O  OG1  . THR A 1 150 ? -4.031  -15.518 -3.969  1.00 0.00 ? 150 THR A OG1  2  
ATOM   6817   C  CG2  . THR A 1 150 ? -6.316  -14.773 -3.783  1.00 0.00 ? 150 THR A CG2  2  
ATOM   6818   H  H    . THR A 1 150 ? -3.288  -13.638 -1.233  1.00 0.00 ? 150 THR A H    2  
ATOM   6819   H  HA   . THR A 1 150 ? -4.143  -12.970 -4.021  1.00 0.00 ? 150 THR A HA   2  
ATOM   6820   H  HB   . THR A 1 150 ? -4.972  -15.209 -2.172  1.00 0.00 ? 150 THR A HB   2  
ATOM   6821   H  HG1  . THR A 1 150 ? -3.630  -16.197 -3.423  1.00 0.00 ? 150 THR A HG1  2  
ATOM   6822   H  HG21 . THR A 1 150 ? -6.373  -14.004 -4.539  1.00 0.00 ? 150 THR A HG21 2  
ATOM   6823   H  HG22 . THR A 1 150 ? -7.055  -14.581 -3.019  1.00 0.00 ? 150 THR A HG22 2  
ATOM   6824   H  HG23 . THR A 1 150 ? -6.505  -15.736 -4.233  1.00 0.00 ? 150 THR A HG23 2  
ATOM   6825   N  N    . TYR A 1 151 ? -6.281  -11.815 -3.357  1.00 0.00 ? 151 TYR A N    2  
ATOM   6826   C  CA   . TYR A 1 151 ? -7.392  -10.938 -2.893  1.00 0.00 ? 151 TYR A CA   2  
ATOM   6827   C  C    . TYR A 1 151 ? -8.671  -11.284 -3.649  1.00 0.00 ? 151 TYR A C    2  
ATOM   6828   O  O    . TYR A 1 151 ? -8.683  -11.357 -4.863  1.00 0.00 ? 151 TYR A O    2  
ATOM   6829   C  CB   . TYR A 1 151 ? -7.055  -9.473  -3.168  1.00 0.00 ? 151 TYR A CB   2  
ATOM   6830   C  CG   . TYR A 1 151 ? -8.215  -8.616  -2.716  1.00 0.00 ? 151 TYR A CG   2  
ATOM   6831   C  CD1  . TYR A 1 151 ? -8.270  -8.153  -1.396  1.00 0.00 ? 151 TYR A CD1  2  
ATOM   6832   C  CD2  . TYR A 1 151 ? -9.245  -8.300  -3.613  1.00 0.00 ? 151 TYR A CD2  2  
ATOM   6833   C  CE1  . TYR A 1 151 ? -9.354  -7.375  -0.972  1.00 0.00 ? 151 TYR A CE1  2  
ATOM   6834   C  CE2  . TYR A 1 151 ? -10.327 -7.520  -3.188  1.00 0.00 ? 151 TYR A CE2  2  
ATOM   6835   C  CZ   . TYR A 1 151 ? -10.383 -7.059  -1.868  1.00 0.00 ? 151 TYR A CZ   2  
ATOM   6836   O  OH   . TYR A 1 151 ? -11.451 -6.292  -1.449  1.00 0.00 ? 151 TYR A OH   2  
ATOM   6837   H  H    . TYR A 1 151 ? -6.110  -11.927 -4.317  1.00 0.00 ? 151 TYR A H    2  
ATOM   6838   H  HA   . TYR A 1 151 ? -7.549  -11.079 -1.835  1.00 0.00 ? 151 TYR A HA   2  
ATOM   6839   H  HB2  . TYR A 1 151 ? -6.163  -9.198  -2.629  1.00 0.00 ? 151 TYR A HB2  2  
ATOM   6840   H  HB3  . TYR A 1 151 ? -6.897  -9.334  -4.226  1.00 0.00 ? 151 TYR A HB3  2  
ATOM   6841   H  HD1  . TYR A 1 151 ? -7.477  -8.394  -0.706  1.00 0.00 ? 151 TYR A HD1  2  
ATOM   6842   H  HD2  . TYR A 1 151 ? -9.200  -8.652  -4.633  1.00 0.00 ? 151 TYR A HD2  2  
ATOM   6843   H  HE1  . TYR A 1 151 ? -9.397  -7.017  0.046   1.00 0.00 ? 151 TYR A HE1  2  
ATOM   6844   H  HE2  . TYR A 1 151 ? -11.121 -7.277  -3.878  1.00 0.00 ? 151 TYR A HE2  2  
ATOM   6845   H  HH   . TYR A 1 151 ? -12.214 -6.529  -1.984  1.00 0.00 ? 151 TYR A HH   2  
ATOM   6846   N  N    . GLU A 1 152 ? -9.752  -11.470 -2.944  1.00 0.00 ? 152 GLU A N    2  
ATOM   6847   C  CA   . GLU A 1 152 ? -11.040 -11.779 -3.620  1.00 0.00 ? 152 GLU A CA   2  
ATOM   6848   C  C    . GLU A 1 152 ? -12.000 -10.611 -3.387  1.00 0.00 ? 152 GLU A C    2  
ATOM   6849   O  O    . GLU A 1 152 ? -12.036 -10.026 -2.323  1.00 0.00 ? 152 GLU A O    2  
ATOM   6850   C  CB   . GLU A 1 152 ? -11.639 -13.067 -3.047  1.00 0.00 ? 152 GLU A CB   2  
ATOM   6851   C  CG   . GLU A 1 152 ? -12.820 -13.513 -3.912  1.00 0.00 ? 152 GLU A CG   2  
ATOM   6852   C  CD   . GLU A 1 152 ? -12.560 -14.923 -4.446  1.00 0.00 ? 152 GLU A CD   2  
ATOM   6853   O  OE1  . GLU A 1 152 ? -11.445 -15.178 -4.872  1.00 0.00 ? 152 GLU A OE1  2  
ATOM   6854   O  OE2  . GLU A 1 152 ? -13.480 -15.724 -4.420  1.00 0.00 ? 152 GLU A OE2  2  
ATOM   6855   H  H    . GLU A 1 152 ? -9.720  -11.385 -1.968  1.00 0.00 ? 152 GLU A H    2  
ATOM   6856   H  HA   . GLU A 1 152 ? -10.870 -11.900 -4.681  1.00 0.00 ? 152 GLU A HA   2  
ATOM   6857   H  HB2  . GLU A 1 152 ? -10.884 -13.841 -3.037  1.00 0.00 ? 152 GLU A HB2  2  
ATOM   6858   H  HB3  . GLU A 1 152 ? -11.981 -12.888 -2.042  1.00 0.00 ? 152 GLU A HB3  2  
ATOM   6859   H  HG2  . GLU A 1 152 ? -13.721 -13.514 -3.317  1.00 0.00 ? 152 GLU A HG2  2  
ATOM   6860   H  HG3  . GLU A 1 152 ? -12.938 -12.833 -4.742  1.00 0.00 ? 152 GLU A HG3  2  
ATOM   6861   N  N    . GLY A 1 153 ? -12.764 -10.262 -4.381  1.00 0.00 ? 153 GLY A N    2  
ATOM   6862   C  CA   . GLY A 1 153 ? -13.712 -9.121  -4.226  1.00 0.00 ? 153 GLY A CA   2  
ATOM   6863   C  C    . GLY A 1 153 ? -15.069 -9.482  -4.829  1.00 0.00 ? 153 GLY A C    2  
ATOM   6864   O  O    . GLY A 1 153 ? -15.150 -10.162 -5.833  1.00 0.00 ? 153 GLY A O    2  
ATOM   6865   H  H    . GLY A 1 153 ? -12.698 -10.755 -5.225  1.00 0.00 ? 153 GLY A H    2  
ATOM   6866   H  HA2  . GLY A 1 153 ? -13.831 -8.890  -3.171  1.00 0.00 ? 153 GLY A HA2  2  
ATOM   6867   H  HA3  . GLY A 1 153 ? -13.316 -8.257  -4.740  1.00 0.00 ? 153 GLY A HA3  2  
ATOM   6868   N  N    . GLU A 1 154 ? -16.133 -9.019  -4.229  1.00 0.00 ? 154 GLU A N    2  
ATOM   6869   C  CA   . GLU A 1 154 ? -17.490 -9.318  -4.768  1.00 0.00 ? 154 GLU A CA   2  
ATOM   6870   C  C    . GLU A 1 154 ? -18.213 -8.001  -5.053  1.00 0.00 ? 154 GLU A C    2  
ATOM   6871   O  O    . GLU A 1 154 ? -18.969 -7.508  -4.241  1.00 0.00 ? 154 GLU A O    2  
ATOM   6872   C  CB   . GLU A 1 154 ? -18.284 -10.128 -3.740  1.00 0.00 ? 154 GLU A CB   2  
ATOM   6873   C  CG   . GLU A 1 154 ? -17.982 -9.610  -2.332  1.00 0.00 ? 154 GLU A CG   2  
ATOM   6874   C  CD   . GLU A 1 154 ? -19.200 -9.833  -1.432  1.00 0.00 ? 154 GLU A CD   2  
ATOM   6875   O  OE1  . GLU A 1 154 ? -20.221 -9.214  -1.685  1.00 0.00 ? 154 GLU A OE1  2  
ATOM   6876   O  OE2  . GLU A 1 154 ? -19.089 -10.617 -0.504  1.00 0.00 ? 154 GLU A OE2  2  
ATOM   6877   H  H    . GLU A 1 154 ? -16.039 -8.465  -3.426  1.00 0.00 ? 154 GLU A H    2  
ATOM   6878   H  HA   . GLU A 1 154 ? -17.399 -9.885  -5.682  1.00 0.00 ? 154 GLU A HA   2  
ATOM   6879   H  HB2  . GLU A 1 154 ? -19.341 -10.027 -3.943  1.00 0.00 ? 154 GLU A HB2  2  
ATOM   6880   H  HB3  . GLU A 1 154 ? -18.003 -11.169 -3.807  1.00 0.00 ? 154 GLU A HB3  2  
ATOM   6881   H  HG2  . GLU A 1 154 ? -17.133 -10.141 -1.928  1.00 0.00 ? 154 GLU A HG2  2  
ATOM   6882   H  HG3  . GLU A 1 154 ? -17.759 -8.555  -2.377  1.00 0.00 ? 154 GLU A HG3  2  
ATOM   6883   N  N    . PHE A 1 155 ? -17.982 -7.426  -6.202  1.00 0.00 ? 155 PHE A N    2  
ATOM   6884   C  CA   . PHE A 1 155 ? -18.649 -6.137  -6.540  1.00 0.00 ? 155 PHE A CA   2  
ATOM   6885   C  C    . PHE A 1 155 ? -20.012 -6.412  -7.172  1.00 0.00 ? 155 PHE A C    2  
ATOM   6886   O  O    . PHE A 1 155 ? -20.213 -7.409  -7.837  1.00 0.00 ? 155 PHE A O    2  
ATOM   6887   C  CB   . PHE A 1 155 ? -17.782 -5.355  -7.524  1.00 0.00 ? 155 PHE A CB   2  
ATOM   6888   C  CG   . PHE A 1 155 ? -16.342 -5.393  -7.071  1.00 0.00 ? 155 PHE A CG   2  
ATOM   6889   C  CD1  . PHE A 1 155 ? -15.505 -6.437  -7.486  1.00 0.00 ? 155 PHE A CD1  2  
ATOM   6890   C  CD2  . PHE A 1 155 ? -15.843 -4.385  -6.237  1.00 0.00 ? 155 PHE A CD2  2  
ATOM   6891   C  CE1  . PHE A 1 155 ? -14.169 -6.471  -7.067  1.00 0.00 ? 155 PHE A CE1  2  
ATOM   6892   C  CE2  . PHE A 1 155 ? -14.506 -4.419  -5.819  1.00 0.00 ? 155 PHE A CE2  2  
ATOM   6893   C  CZ   . PHE A 1 155 ? -13.670 -5.463  -6.233  1.00 0.00 ? 155 PHE A CZ   2  
ATOM   6894   H  H    . PHE A 1 155 ? -17.366 -7.840  -6.842  1.00 0.00 ? 155 PHE A H    2  
ATOM   6895   H  HA   . PHE A 1 155 ? -18.782 -5.556  -5.639  1.00 0.00 ? 155 PHE A HA   2  
ATOM   6896   H  HB2  . PHE A 1 155 ? -17.863 -5.797  -8.507  1.00 0.00 ? 155 PHE A HB2  2  
ATOM   6897   H  HB3  . PHE A 1 155 ? -18.119 -4.330  -7.562  1.00 0.00 ? 155 PHE A HB3  2  
ATOM   6898   H  HD1  . PHE A 1 155 ? -15.890 -7.214  -8.128  1.00 0.00 ? 155 PHE A HD1  2  
ATOM   6899   H  HD2  . PHE A 1 155 ? -16.488 -3.580  -5.917  1.00 0.00 ? 155 PHE A HD2  2  
ATOM   6900   H  HE1  . PHE A 1 155 ? -13.525 -7.277  -7.386  1.00 0.00 ? 155 PHE A HE1  2  
ATOM   6901   H  HE2  . PHE A 1 155 ? -14.121 -3.641  -5.177  1.00 0.00 ? 155 PHE A HE2  2  
ATOM   6902   H  HZ   . PHE A 1 155 ? -12.639 -5.490  -5.911  1.00 0.00 ? 155 PHE A HZ   2  
ATOM   6903   N  N    . LYS A 1 156 ? -20.956 -5.534  -6.965  1.00 0.00 ? 156 LYS A N    2  
ATOM   6904   C  CA   . LYS A 1 156 ? -22.310 -5.742  -7.546  1.00 0.00 ? 156 LYS A CA   2  
ATOM   6905   C  C    . LYS A 1 156 ? -22.414 -5.035  -8.901  1.00 0.00 ? 156 LYS A C    2  
ATOM   6906   O  O    . LYS A 1 156 ? -23.402 -5.164  -9.598  1.00 0.00 ? 156 LYS A O    2  
ATOM   6907   C  CB   . LYS A 1 156 ? -23.367 -5.174  -6.597  1.00 0.00 ? 156 LYS A CB   2  
ATOM   6908   C  CG   . LYS A 1 156 ? -23.519 -6.100  -5.388  1.00 0.00 ? 156 LYS A CG   2  
ATOM   6909   C  CD   . LYS A 1 156 ? -24.656 -5.599  -4.495  1.00 0.00 ? 156 LYS A CD   2  
ATOM   6910   C  CE   . LYS A 1 156 ? -25.424 -6.794  -3.929  1.00 0.00 ? 156 LYS A CE   2  
ATOM   6911   N  NZ   . LYS A 1 156 ? -24.460 -7.872  -3.564  1.00 0.00 ? 156 LYS A NZ   2  
ATOM   6912   H  H    . LYS A 1 156 ? -20.773 -4.738  -6.422  1.00 0.00 ? 156 LYS A H    2  
ATOM   6913   H  HA   . LYS A 1 156 ? -22.483 -6.800  -7.681  1.00 0.00 ? 156 LYS A HA   2  
ATOM   6914   H  HB2  . LYS A 1 156 ? -23.061 -4.192  -6.264  1.00 0.00 ? 156 LYS A HB2  2  
ATOM   6915   H  HB3  . LYS A 1 156 ? -24.312 -5.102  -7.113  1.00 0.00 ? 156 LYS A HB3  2  
ATOM   6916   H  HG2  . LYS A 1 156 ? -23.741 -7.101  -5.728  1.00 0.00 ? 156 LYS A HG2  2  
ATOM   6917   H  HG3  . LYS A 1 156 ? -22.598 -6.108  -4.823  1.00 0.00 ? 156 LYS A HG3  2  
ATOM   6918   H  HD2  . LYS A 1 156 ? -24.246 -5.015  -3.683  1.00 0.00 ? 156 LYS A HD2  2  
ATOM   6919   H  HD3  . LYS A 1 156 ? -25.328 -4.985  -5.076  1.00 0.00 ? 156 LYS A HD3  2  
ATOM   6920   H  HE2  . LYS A 1 156 ? -25.972 -6.489  -3.051  1.00 0.00 ? 156 LYS A HE2  2  
ATOM   6921   H  HE3  . LYS A 1 156 ? -26.113 -7.165  -4.673  1.00 0.00 ? 156 LYS A HE3  2  
ATOM   6922   H  HZ1  . LYS A 1 156 ? -24.157 -8.372  -4.424  1.00 0.00 ? 156 LYS A HZ1  2  
ATOM   6923   H  HZ2  . LYS A 1 156 ? -24.921 -8.543  -2.916  1.00 0.00 ? 156 LYS A HZ2  2  
ATOM   6924   H  HZ3  . LYS A 1 156 ? -23.631 -7.452  -3.099  1.00 0.00 ? 156 LYS A HZ3  2  
ATOM   6925   N  N    . ASN A 1 157 ? -21.412 -4.289  -9.288  1.00 0.00 ? 157 ASN A N    2  
ATOM   6926   C  CA   . ASN A 1 157 ? -21.487 -3.590  -10.604 1.00 0.00 ? 157 ASN A CA   2  
ATOM   6927   C  C    . ASN A 1 157 ? -21.382 -4.623  -11.728 1.00 0.00 ? 157 ASN A C    2  
ATOM   6928   O  O    . ASN A 1 157 ? -21.479 -5.813  -11.496 1.00 0.00 ? 157 ASN A O    2  
ATOM   6929   C  CB   . ASN A 1 157 ? -20.346 -2.577  -10.733 1.00 0.00 ? 157 ASN A CB   2  
ATOM   6930   C  CG   . ASN A 1 157 ? -19.010 -3.314  -10.818 1.00 0.00 ? 157 ASN A CG   2  
ATOM   6931   O  OD1  . ASN A 1 157 ? -18.596 -3.724  -11.884 1.00 0.00 ? 157 ASN A OD1  2  
ATOM   6932   N  ND2  . ASN A 1 157 ? -18.311 -3.498  -9.733  1.00 0.00 ? 157 ASN A ND2  2  
ATOM   6933   H  H    . ASN A 1 157 ? -20.617 -4.192  -8.720  1.00 0.00 ? 157 ASN A H    2  
ATOM   6934   H  HA   . ASN A 1 157 ? -22.432 -3.073  -10.677 1.00 0.00 ? 157 ASN A HA   2  
ATOM   6935   H  HB2  . ASN A 1 157 ? -20.489 -1.990  -11.628 1.00 0.00 ? 157 ASN A HB2  2  
ATOM   6936   H  HB3  . ASN A 1 157 ? -20.344 -1.924  -9.874  1.00 0.00 ? 157 ASN A HB3  2  
ATOM   6937   H  HD21 . ASN A 1 157 ? -18.644 -3.165  -8.873  1.00 0.00 ? 157 ASN A HD21 2  
ATOM   6938   H  HD22 . ASN A 1 157 ? -17.453 -3.970  -9.776  1.00 0.00 ? 157 ASN A HD22 2  
ATOM   6939   N  N    . PHE A 1 158 ? -21.188 -4.187  -12.942 1.00 0.00 ? 158 PHE A N    2  
ATOM   6940   C  CA   . PHE A 1 158 ? -21.081 -5.157  -14.070 1.00 0.00 ? 158 PHE A CA   2  
ATOM   6941   C  C    . PHE A 1 158 ? -19.952 -6.151  -13.786 1.00 0.00 ? 158 PHE A C    2  
ATOM   6942   O  O    . PHE A 1 158 ? -19.917 -7.235  -14.334 1.00 0.00 ? 158 PHE A O    2  
ATOM   6943   C  CB   . PHE A 1 158 ? -20.788 -4.404  -15.369 1.00 0.00 ? 158 PHE A CB   2  
ATOM   6944   C  CG   . PHE A 1 158 ? -19.394 -3.823  -15.319 1.00 0.00 ? 158 PHE A CG   2  
ATOM   6945   C  CD1  . PHE A 1 158 ? -18.295 -4.603  -15.700 1.00 0.00 ? 158 PHE A CD1  2  
ATOM   6946   C  CD2  . PHE A 1 158 ? -19.202 -2.503  -14.894 1.00 0.00 ? 158 PHE A CD2  2  
ATOM   6947   C  CE1  . PHE A 1 158 ? -17.004 -4.062  -15.657 1.00 0.00 ? 158 PHE A CE1  2  
ATOM   6948   C  CE2  . PHE A 1 158 ? -17.911 -1.962  -14.850 1.00 0.00 ? 158 PHE A CE2  2  
ATOM   6949   C  CZ   . PHE A 1 158 ? -16.812 -2.742  -15.232 1.00 0.00 ? 158 PHE A CZ   2  
ATOM   6950   H  H    . PHE A 1 158 ? -21.114 -3.224  -13.112 1.00 0.00 ? 158 PHE A H    2  
ATOM   6951   H  HA   . PHE A 1 158 ? -22.013 -5.694  -14.169 1.00 0.00 ? 158 PHE A HA   2  
ATOM   6952   H  HB2  . PHE A 1 158 ? -20.864 -5.083  -16.204 1.00 0.00 ? 158 PHE A HB2  2  
ATOM   6953   H  HB3  . PHE A 1 158 ? -21.504 -3.606  -15.490 1.00 0.00 ? 158 PHE A HB3  2  
ATOM   6954   H  HD1  . PHE A 1 158 ? -18.444 -5.621  -16.027 1.00 0.00 ? 158 PHE A HD1  2  
ATOM   6955   H  HD2  . PHE A 1 158 ? -20.049 -1.902  -14.600 1.00 0.00 ? 158 PHE A HD2  2  
ATOM   6956   H  HE1  . PHE A 1 158 ? -16.157 -4.663  -15.950 1.00 0.00 ? 158 PHE A HE1  2  
ATOM   6957   H  HE2  . PHE A 1 158 ? -17.762 -0.944  -14.522 1.00 0.00 ? 158 PHE A HE2  2  
ATOM   6958   H  HZ   . PHE A 1 158 ? -15.817 -2.324  -15.198 1.00 0.00 ? 158 PHE A HZ   2  
ATOM   6959   N  N    . LEU A 1 159 ? -19.029 -5.794  -12.936 1.00 0.00 ? 159 LEU A N    2  
ATOM   6960   C  CA   . LEU A 1 159 ? -17.907 -6.726  -12.623 1.00 0.00 ? 159 LEU A CA   2  
ATOM   6961   C  C    . LEU A 1 159 ? -18.465 -8.005  -11.998 1.00 0.00 ? 159 LEU A C    2  
ATOM   6962   O  O    . LEU A 1 159 ? -18.247 -9.094  -12.489 1.00 0.00 ? 159 LEU A O    2  
ATOM   6963   C  CB   . LEU A 1 159 ? -16.946 -6.062  -11.632 1.00 0.00 ? 159 LEU A CB   2  
ATOM   6964   C  CG   . LEU A 1 159 ? -15.990 -5.137  -12.385 1.00 0.00 ? 159 LEU A CG   2  
ATOM   6965   C  CD1  . LEU A 1 159 ? -15.564 -3.988  -11.469 1.00 0.00 ? 159 LEU A CD1  2  
ATOM   6966   C  CD2  . LEU A 1 159 ? -14.753 -5.928  -12.819 1.00 0.00 ? 159 LEU A CD2  2  
ATOM   6967   H  H    . LEU A 1 159 ? -19.073 -4.916  -12.504 1.00 0.00 ? 159 LEU A H    2  
ATOM   6968   H  HA   . LEU A 1 159 ? -17.377 -6.969  -13.531 1.00 0.00 ? 159 LEU A HA   2  
ATOM   6969   H  HB2  . LEU A 1 159 ? -17.510 -5.491  -10.911 1.00 0.00 ? 159 LEU A HB2  2  
ATOM   6970   H  HB3  . LEU A 1 159 ? -16.377 -6.824  -11.121 1.00 0.00 ? 159 LEU A HB3  2  
ATOM   6971   H  HG   . LEU A 1 159 ? -16.488 -4.737  -13.256 1.00 0.00 ? 159 LEU A HG   2  
ATOM   6972   H  HD11 . LEU A 1 159 ? -15.515 -4.341  -10.449 1.00 0.00 ? 159 LEU A HD11 2  
ATOM   6973   H  HD12 . LEU A 1 159 ? -16.285 -3.187  -11.538 1.00 0.00 ? 159 LEU A HD12 2  
ATOM   6974   H  HD13 . LEU A 1 159 ? -14.593 -3.627  -11.772 1.00 0.00 ? 159 LEU A HD13 2  
ATOM   6975   H  HD21 . LEU A 1 159 ? -14.219 -5.375  -13.576 1.00 0.00 ? 159 LEU A HD21 2  
ATOM   6976   H  HD22 . LEU A 1 159 ? -15.060 -6.883  -13.221 1.00 0.00 ? 159 LEU A HD22 2  
ATOM   6977   H  HD23 . LEU A 1 159 ? -14.109 -6.088  -11.967 1.00 0.00 ? 159 LEU A HD23 2  
ATOM   6978   N  N    . GLY A 1 160 ? -19.180 -7.882  -10.912 1.00 0.00 ? 160 GLY A N    2  
ATOM   6979   C  CA   . GLY A 1 160 ? -19.745 -9.091  -10.249 1.00 0.00 ? 160 GLY A CA   2  
ATOM   6980   C  C    . GLY A 1 160 ? -18.731 -9.627  -9.238  1.00 0.00 ? 160 GLY A C    2  
ATOM   6981   O  O    . GLY A 1 160 ? -18.617 -9.125  -8.136  1.00 0.00 ? 160 GLY A O    2  
ATOM   6982   H  H    . GLY A 1 160 ? -19.339 -6.994  -10.529 1.00 0.00 ? 160 GLY A H    2  
ATOM   6983   H  HA2  . GLY A 1 160 ? -20.663 -8.827  -9.741  1.00 0.00 ? 160 GLY A HA2  2  
ATOM   6984   H  HA3  . GLY A 1 160 ? -19.946 -9.850  -10.991 1.00 0.00 ? 160 GLY A HA3  2  
ATOM   6985   N  N    . ARG A 1 161 ? -17.988 -10.637 -9.604  1.00 0.00 ? 161 ARG A N    2  
ATOM   6986   C  CA   . ARG A 1 161 ? -16.974 -11.203 -8.668  1.00 0.00 ? 161 ARG A CA   2  
ATOM   6987   C  C    . ARG A 1 161 ? -15.611 -11.221 -9.360  1.00 0.00 ? 161 ARG A C    2  
ATOM   6988   O  O    . ARG A 1 161 ? -15.497 -11.579 -10.515 1.00 0.00 ? 161 ARG A O    2  
ATOM   6989   C  CB   . ARG A 1 161 ? -17.367 -12.631 -8.285  1.00 0.00 ? 161 ARG A CB   2  
ATOM   6990   C  CG   . ARG A 1 161 ? -18.771 -12.632 -7.680  1.00 0.00 ? 161 ARG A CG   2  
ATOM   6991   C  CD   . ARG A 1 161 ? -19.738 -13.331 -8.638  1.00 0.00 ? 161 ARG A CD   2  
ATOM   6992   N  NE   . ARG A 1 161 ? -21.113 -13.302 -8.062  1.00 0.00 ? 161 ARG A NE   2  
ATOM   6993   C  CZ   . ARG A 1 161 ? -22.058 -14.030 -8.593  1.00 0.00 ? 161 ARG A CZ   2  
ATOM   6994   N  NH1  . ARG A 1 161 ? -21.800 -14.785 -9.624  1.00 0.00 ? 161 ARG A NH1  2  
ATOM   6995   N  NH2  . ARG A 1 161 ? -23.263 -14.002 -8.088  1.00 0.00 ? 161 ARG A NH2  2  
ATOM   6996   H  H    . ARG A 1 161 ? -18.092 -11.024 -10.499 1.00 0.00 ? 161 ARG A H    2  
ATOM   6997   H  HA   . ARG A 1 161 ? -16.915 -10.593 -7.780  1.00 0.00 ? 161 ARG A HA   2  
ATOM   6998   H  HB2  . ARG A 1 161 ? -17.353 -13.257 -9.167  1.00 0.00 ? 161 ARG A HB2  2  
ATOM   6999   H  HB3  . ARG A 1 161 ? -16.665 -13.015 -7.560  1.00 0.00 ? 161 ARG A HB3  2  
ATOM   7000   H  HG2  . ARG A 1 161 ? -18.756 -13.158 -6.737  1.00 0.00 ? 161 ARG A HG2  2  
ATOM   7001   H  HG3  . ARG A 1 161 ? -19.096 -11.614 -7.522  1.00 0.00 ? 161 ARG A HG3  2  
ATOM   7002   H  HD2  . ARG A 1 161 ? -19.735 -12.820 -9.590  1.00 0.00 ? 161 ARG A HD2  2  
ATOM   7003   H  HD3  . ARG A 1 161 ? -19.429 -14.356 -8.779  1.00 0.00 ? 161 ARG A HD3  2  
ATOM   7004   H  HE   . ARG A 1 161 ? -21.307 -12.737 -7.286  1.00 0.00 ? 161 ARG A HE   2  
ATOM   7005   H  HH11 . ARG A 1 161 ? -20.877 -14.807 -10.010 1.00 0.00 ? 161 ARG A HH11 2  
ATOM   7006   H  HH12 . ARG A 1 161 ? -22.524 -15.344 -10.029 1.00 0.00 ? 161 ARG A HH12 2  
ATOM   7007   H  HH21 . ARG A 1 161 ? -23.461 -13.424 -7.297  1.00 0.00 ? 161 ARG A HH21 2  
ATOM   7008   H  HH22 . ARG A 1 161 ? -23.988 -14.558 -8.494  1.00 0.00 ? 161 ARG A HH22 2  
ATOM   7009   N  N    . GLN A 1 162 ? -14.579 -10.835 -8.665  1.00 0.00 ? 162 GLN A N    2  
ATOM   7010   C  CA   . GLN A 1 162 ? -13.228 -10.829 -9.290  1.00 0.00 ? 162 GLN A CA   2  
ATOM   7011   C  C    . GLN A 1 162 ? -12.173 -11.186 -8.242  1.00 0.00 ? 162 GLN A C    2  
ATOM   7012   O  O    . GLN A 1 162 ? -12.398 -11.066 -7.054  1.00 0.00 ? 162 GLN A O    2  
ATOM   7013   C  CB   . GLN A 1 162 ? -12.937 -9.436  -9.853  1.00 0.00 ? 162 GLN A CB   2  
ATOM   7014   C  CG   . GLN A 1 162 ? -12.482 -9.556  -11.310 1.00 0.00 ? 162 GLN A CG   2  
ATOM   7015   C  CD   . GLN A 1 162 ? -13.662 -9.993  -12.180 1.00 0.00 ? 162 GLN A CD   2  
ATOM   7016   O  OE1  . GLN A 1 162 ? -13.490 -10.731 -13.130 1.00 0.00 ? 162 GLN A OE1  2  
ATOM   7017   N  NE2  . GLN A 1 162 ? -14.862 -9.568  -11.895 1.00 0.00 ? 162 GLN A NE2  2  
ATOM   7018   H  H    . GLN A 1 162 ? -14.694 -10.547 -7.734  1.00 0.00 ? 162 GLN A H    2  
ATOM   7019   H  HA   . GLN A 1 162 ? -13.199 -11.553 -10.091 1.00 0.00 ? 162 GLN A HA   2  
ATOM   7020   H  HB2  . GLN A 1 162 ? -13.832 -8.834  -9.803  1.00 0.00 ? 162 GLN A HB2  2  
ATOM   7021   H  HB3  . GLN A 1 162 ? -12.156 -8.969  -9.272  1.00 0.00 ? 162 GLN A HB3  2  
ATOM   7022   H  HG2  . GLN A 1 162 ? -12.117 -8.598  -11.651 1.00 0.00 ? 162 GLN A HG2  2  
ATOM   7023   H  HG3  . GLN A 1 162 ? -11.693 -10.289 -11.380 1.00 0.00 ? 162 GLN A HG3  2  
ATOM   7024   H  HE21 . GLN A 1 162 ? -15.002 -8.972  -11.129 1.00 0.00 ? 162 GLN A HE21 2  
ATOM   7025   H  HE22 . GLN A 1 162 ? -15.623 -9.842  -12.448 1.00 0.00 ? 162 GLN A HE22 2  
ATOM   7026   N  N    . LYS A 1 163 ? -11.022 -11.625 -8.673  1.00 0.00 ? 163 LYS A N    2  
ATOM   7027   C  CA   . LYS A 1 163 ? -9.950  -11.990 -7.704  1.00 0.00 ? 163 LYS A CA   2  
ATOM   7028   C  C    . LYS A 1 163 ? -8.599  -11.990 -8.423  1.00 0.00 ? 163 LYS A C    2  
ATOM   7029   O  O    . LYS A 1 163 ? -8.517  -12.249 -9.606  1.00 0.00 ? 163 LYS A O    2  
ATOM   7030   C  CB   . LYS A 1 163 ? -10.224 -13.381 -7.135  1.00 0.00 ? 163 LYS A CB   2  
ATOM   7031   C  CG   . LYS A 1 163 ? -9.945  -14.425 -8.213  1.00 0.00 ? 163 LYS A CG   2  
ATOM   7032   C  CD   . LYS A 1 163 ? -10.760 -15.689 -7.929  1.00 0.00 ? 163 LYS A CD   2  
ATOM   7033   C  CE   . LYS A 1 163 ? -10.323 -16.802 -8.885  1.00 0.00 ? 163 LYS A CE   2  
ATOM   7034   N  NZ   . LYS A 1 163 ? -8.852  -17.011 -8.766  1.00 0.00 ? 163 LYS A NZ   2  
ATOM   7035   H  H    . LYS A 1 163 ? -10.862 -11.714 -9.635  1.00 0.00 ? 163 LYS A H    2  
ATOM   7036   H  HA   . LYS A 1 163 ? -9.931  -11.270 -6.902  1.00 0.00 ? 163 LYS A HA   2  
ATOM   7037   H  HB2  . LYS A 1 163 ? -9.580  -13.557 -6.285  1.00 0.00 ? 163 LYS A HB2  2  
ATOM   7038   H  HB3  . LYS A 1 163 ? -11.257 -13.450 -6.828  1.00 0.00 ? 163 LYS A HB3  2  
ATOM   7039   H  HG2  . LYS A 1 163 ? -10.222 -14.022 -9.174  1.00 0.00 ? 163 LYS A HG2  2  
ATOM   7040   H  HG3  . LYS A 1 163 ? -8.893  -14.668 -8.214  1.00 0.00 ? 163 LYS A HG3  2  
ATOM   7041   H  HD2  . LYS A 1 163 ? -10.593 -16.003 -6.910  1.00 0.00 ? 163 LYS A HD2  2  
ATOM   7042   H  HD3  . LYS A 1 163 ? -11.809 -15.482 -8.077  1.00 0.00 ? 163 LYS A HD3  2  
ATOM   7043   H  HE2  . LYS A 1 163 ? -10.838 -17.717 -8.629  1.00 0.00 ? 163 LYS A HE2  2  
ATOM   7044   H  HE3  . LYS A 1 163 ? -10.566 -16.523 -9.900  1.00 0.00 ? 163 LYS A HE3  2  
ATOM   7045   H  HZ1  . LYS A 1 163 ? -8.355  -16.138 -9.031  1.00 0.00 ? 163 LYS A HZ1  2  
ATOM   7046   H  HZ2  . LYS A 1 163 ? -8.559  -17.783 -9.400  1.00 0.00 ? 163 LYS A HZ2  2  
ATOM   7047   H  HZ3  . LYS A 1 163 ? -8.615  -17.259 -7.785  1.00 0.00 ? 163 LYS A HZ3  2  
ATOM   7048   N  N    . PHE A 1 164 ? -7.539  -11.699 -7.719  1.00 0.00 ? 164 PHE A N    2  
ATOM   7049   C  CA   . PHE A 1 164 ? -6.197  -11.686 -8.371  1.00 0.00 ? 164 PHE A CA   2  
ATOM   7050   C  C    . PHE A 1 164 ? -5.173  -12.338 -7.442  1.00 0.00 ? 164 PHE A C    2  
ATOM   7051   O  O    . PHE A 1 164 ? -5.053  -11.973 -6.287  1.00 0.00 ? 164 PHE A O    2  
ATOM   7052   C  CB   . PHE A 1 164 ? -5.784  -10.238 -8.652  1.00 0.00 ? 164 PHE A CB   2  
ATOM   7053   C  CG   . PHE A 1 164 ? -4.440  -10.219 -9.339  1.00 0.00 ? 164 PHE A CG   2  
ATOM   7054   C  CD1  . PHE A 1 164 ? -4.360  -10.399 -10.725 1.00 0.00 ? 164 PHE A CD1  2  
ATOM   7055   C  CD2  . PHE A 1 164 ? -3.274  -10.019 -8.591  1.00 0.00 ? 164 PHE A CD2  2  
ATOM   7056   C  CE1  . PHE A 1 164 ? -3.114  -10.379 -11.364 1.00 0.00 ? 164 PHE A CE1  2  
ATOM   7057   C  CE2  . PHE A 1 164 ? -2.027  -9.999  -9.229  1.00 0.00 ? 164 PHE A CE2  2  
ATOM   7058   C  CZ   . PHE A 1 164 ? -1.947  -10.179 -10.614 1.00 0.00 ? 164 PHE A CZ   2  
ATOM   7059   H  H    . PHE A 1 164 ? -7.625  -11.491 -6.761  1.00 0.00 ? 164 PHE A H    2  
ATOM   7060   H  HA   . PHE A 1 164 ? -6.241  -12.235 -9.300  1.00 0.00 ? 164 PHE A HA   2  
ATOM   7061   H  HB2  . PHE A 1 164 ? -6.521  -9.773  -9.291  1.00 0.00 ? 164 PHE A HB2  2  
ATOM   7062   H  HB3  . PHE A 1 164 ? -5.720  -9.695  -7.722  1.00 0.00 ? 164 PHE A HB3  2  
ATOM   7063   H  HD1  . PHE A 1 164 ? -5.260  -10.554 -11.302 1.00 0.00 ? 164 PHE A HD1  2  
ATOM   7064   H  HD2  . PHE A 1 164 ? -3.335  -9.881  -7.522  1.00 0.00 ? 164 PHE A HD2  2  
ATOM   7065   H  HE1  . PHE A 1 164 ? -3.053  -10.518 -12.433 1.00 0.00 ? 164 PHE A HE1  2  
ATOM   7066   H  HE2  . PHE A 1 164 ? -1.127  -9.845  -8.652  1.00 0.00 ? 164 PHE A HE2  2  
ATOM   7067   H  HZ   . PHE A 1 164 ? -0.985  -10.164 -11.107 1.00 0.00 ? 164 PHE A HZ   2  
ATOM   7068   N  N    . THR A 1 165 ? -4.436  -13.302 -7.926  1.00 0.00 ? 165 THR A N    2  
ATOM   7069   C  CA   . THR A 1 165 ? -3.426  -13.973 -7.065  1.00 0.00 ? 165 THR A CA   2  
ATOM   7070   C  C    . THR A 1 165 ? -2.034  -13.441 -7.402  1.00 0.00 ? 165 THR A C    2  
ATOM   7071   O  O    . THR A 1 165 ? -1.593  -13.504 -8.532  1.00 0.00 ? 165 THR A O    2  
ATOM   7072   C  CB   . THR A 1 165 ? -3.467  -15.482 -7.319  1.00 0.00 ? 165 THR A CB   2  
ATOM   7073   O  OG1  . THR A 1 165 ? -4.801  -15.948 -7.175  1.00 0.00 ? 165 THR A OG1  2  
ATOM   7074   C  CG2  . THR A 1 165 ? -2.561  -16.198 -6.316  1.00 0.00 ? 165 THR A CG2  2  
ATOM   7075   H  H    . THR A 1 165 ? -4.538  -13.597 -8.854  1.00 0.00 ? 165 THR A H    2  
ATOM   7076   H  HA   . THR A 1 165 ? -3.647  -13.778 -6.031  1.00 0.00 ? 165 THR A HA   2  
ATOM   7077   H  HB   . THR A 1 165 ? -3.120  -15.688 -8.321  1.00 0.00 ? 165 THR A HB   2  
ATOM   7078   H  HG1  . THR A 1 165 ? -4.832  -16.525 -6.408  1.00 0.00 ? 165 THR A HG1  2  
ATOM   7079   H  HG21 . THR A 1 165 ? -3.153  -16.874 -5.716  1.00 0.00 ? 165 THR A HG21 2  
ATOM   7080   H  HG22 . THR A 1 165 ? -2.087  -15.470 -5.675  1.00 0.00 ? 165 THR A HG22 2  
ATOM   7081   H  HG23 . THR A 1 165 ? -1.805  -16.757 -6.848  1.00 0.00 ? 165 THR A HG23 2  
ATOM   7082   N  N    . PHE A 1 166 ? -1.332  -12.920 -6.432  1.00 0.00 ? 166 PHE A N    2  
ATOM   7083   C  CA   . PHE A 1 166 ? 0.034   -12.394 -6.710  1.00 0.00 ? 166 PHE A CA   2  
ATOM   7084   C  C    . PHE A 1 166 ? 1.075   -13.431 -6.294  1.00 0.00 ? 166 PHE A C    2  
ATOM   7085   O  O    . PHE A 1 166 ? 0.986   -14.025 -5.237  1.00 0.00 ? 166 PHE A O    2  
ATOM   7086   C  CB   . PHE A 1 166 ? 0.278   -11.110 -5.917  1.00 0.00 ? 166 PHE A CB   2  
ATOM   7087   C  CG   . PHE A 1 166 ? 1.769   -10.888 -5.803  1.00 0.00 ? 166 PHE A CG   2  
ATOM   7088   C  CD1  . PHE A 1 166 ? 2.571   -10.925 -6.951  1.00 0.00 ? 166 PHE A CD1  2  
ATOM   7089   C  CD2  . PHE A 1 166 ? 2.352   -10.655 -4.551  1.00 0.00 ? 166 PHE A CD2  2  
ATOM   7090   C  CE1  . PHE A 1 166 ? 3.953   -10.730 -6.848  1.00 0.00 ? 166 PHE A CE1  2  
ATOM   7091   C  CE2  . PHE A 1 166 ? 3.735   -10.458 -4.449  1.00 0.00 ? 166 PHE A CE2  2  
ATOM   7092   C  CZ   . PHE A 1 166 ? 4.536   -10.496 -5.598  1.00 0.00 ? 166 PHE A CZ   2  
ATOM   7093   H  H    . PHE A 1 166 ? -1.700  -12.882 -5.525  1.00 0.00 ? 166 PHE A H    2  
ATOM   7094   H  HA   . PHE A 1 166 ? 0.130   -12.188 -7.765  1.00 0.00 ? 166 PHE A HA   2  
ATOM   7095   H  HB2  . PHE A 1 166 ? -0.176  -10.274 -6.429  1.00 0.00 ? 166 PHE A HB2  2  
ATOM   7096   H  HB3  . PHE A 1 166 ? -0.148  -11.207 -4.930  1.00 0.00 ? 166 PHE A HB3  2  
ATOM   7097   H  HD1  . PHE A 1 166 ? 2.125   -11.104 -7.916  1.00 0.00 ? 166 PHE A HD1  2  
ATOM   7098   H  HD2  . PHE A 1 166 ? 1.735   -10.627 -3.665  1.00 0.00 ? 166 PHE A HD2  2  
ATOM   7099   H  HE1  . PHE A 1 166 ? 4.570   -10.758 -7.733  1.00 0.00 ? 166 PHE A HE1  2  
ATOM   7100   H  HE2  . PHE A 1 166 ? 4.184   -10.277 -3.483  1.00 0.00 ? 166 PHE A HE2  2  
ATOM   7101   H  HZ   . PHE A 1 166 ? 5.603   -10.347 -5.518  1.00 0.00 ? 166 PHE A HZ   2  
ATOM   7102   N  N    . VAL A 1 167 ? 2.065   -13.645 -7.115  1.00 0.00 ? 167 VAL A N    2  
ATOM   7103   C  CA   . VAL A 1 167 ? 3.120   -14.637 -6.769  1.00 0.00 ? 167 VAL A CA   2  
ATOM   7104   C  C    . VAL A 1 167 ? 4.496   -14.024 -7.029  1.00 0.00 ? 167 VAL A C    2  
ATOM   7105   O  O    . VAL A 1 167 ? 4.648   -13.138 -7.845  1.00 0.00 ? 167 VAL A O    2  
ATOM   7106   C  CB   . VAL A 1 167 ? 2.953   -15.889 -7.633  1.00 0.00 ? 167 VAL A CB   2  
ATOM   7107   C  CG1  . VAL A 1 167 ? 3.639   -17.075 -6.953  1.00 0.00 ? 167 VAL A CG1  2  
ATOM   7108   C  CG2  . VAL A 1 167 ? 1.463   -16.195 -7.806  1.00 0.00 ? 167 VAL A CG2  2  
ATOM   7109   H  H    . VAL A 1 167 ? 2.113   -13.148 -7.959  1.00 0.00 ? 167 VAL A H    2  
ATOM   7110   H  HA   . VAL A 1 167 ? 3.034   -14.905 -5.724  1.00 0.00 ? 167 VAL A HA   2  
ATOM   7111   H  HB   . VAL A 1 167 ? 3.403   -15.720 -8.600  1.00 0.00 ? 167 VAL A HB   2  
ATOM   7112   H  HG11 . VAL A 1 167 ? 2.972   -17.508 -6.223  1.00 0.00 ? 167 VAL A HG11 2  
ATOM   7113   H  HG12 . VAL A 1 167 ? 4.539   -16.736 -6.461  1.00 0.00 ? 167 VAL A HG12 2  
ATOM   7114   H  HG13 . VAL A 1 167 ? 3.892   -17.818 -7.695  1.00 0.00 ? 167 VAL A HG13 2  
ATOM   7115   H  HG21 . VAL A 1 167 ? 1.346   -17.092 -8.395  1.00 0.00 ? 167 VAL A HG21 2  
ATOM   7116   H  HG22 . VAL A 1 167 ? 0.982   -15.369 -8.308  1.00 0.00 ? 167 VAL A HG22 2  
ATOM   7117   H  HG23 . VAL A 1 167 ? 1.010   -16.339 -6.835  1.00 0.00 ? 167 VAL A HG23 2  
ATOM   7118   N  N    . GLU A 1 168 ? 5.503   -14.489 -6.342  1.00 0.00 ? 168 GLU A N    2  
ATOM   7119   C  CA   . GLU A 1 168 ? 6.869   -13.932 -6.549  1.00 0.00 ? 168 GLU A CA   2  
ATOM   7120   C  C    . GLU A 1 168 ? 7.270   -14.084 -8.018  1.00 0.00 ? 168 GLU A C    2  
ATOM   7121   O  O    . GLU A 1 168 ? 7.368   -15.181 -8.532  1.00 0.00 ? 168 GLU A O    2  
ATOM   7122   C  CB   . GLU A 1 168 ? 7.867   -14.694 -5.674  1.00 0.00 ? 168 GLU A CB   2  
ATOM   7123   C  CG   . GLU A 1 168 ? 7.597   -14.384 -4.202  1.00 0.00 ? 168 GLU A CG   2  
ATOM   7124   C  CD   . GLU A 1 168 ? 8.810   -14.791 -3.363  1.00 0.00 ? 168 GLU A CD   2  
ATOM   7125   O  OE1  . GLU A 1 168 ? 9.685   -15.449 -3.901  1.00 0.00 ? 168 GLU A OE1  2  
ATOM   7126   O  OE2  . GLU A 1 168 ? 8.843   -14.437 -2.195  1.00 0.00 ? 168 GLU A OE2  2  
ATOM   7127   H  H    . GLU A 1 168 ? 5.359   -15.204 -5.687  1.00 0.00 ? 168 GLU A H    2  
ATOM   7128   H  HA   . GLU A 1 168 ? 6.878   -12.887 -6.279  1.00 0.00 ? 168 GLU A HA   2  
ATOM   7129   H  HB2  . GLU A 1 168 ? 7.758   -15.756 -5.845  1.00 0.00 ? 168 GLU A HB2  2  
ATOM   7130   H  HB3  . GLU A 1 168 ? 8.872   -14.392 -5.925  1.00 0.00 ? 168 GLU A HB3  2  
ATOM   7131   H  HG2  . GLU A 1 168 ? 7.415   -13.326 -4.085  1.00 0.00 ? 168 GLU A HG2  2  
ATOM   7132   H  HG3  . GLU A 1 168 ? 6.732   -14.939 -3.870  1.00 0.00 ? 168 GLU A HG3  2  
ATOM   7133   N  N    . GLY A 1 169 ? 7.510   -12.992 -8.695  1.00 0.00 ? 169 GLY A N    2  
ATOM   7134   C  CA   . GLY A 1 169 ? 7.914   -13.070 -10.131 1.00 0.00 ? 169 GLY A CA   2  
ATOM   7135   C  C    . GLY A 1 169 ? 6.844   -12.421 -11.012 1.00 0.00 ? 169 GLY A C    2  
ATOM   7136   O  O    . GLY A 1 169 ? 6.962   -12.388 -12.221 1.00 0.00 ? 169 GLY A O    2  
ATOM   7137   H  H    . GLY A 1 169 ? 7.429   -12.117 -8.260  1.00 0.00 ? 169 GLY A H    2  
ATOM   7138   H  HA2  . GLY A 1 169 ? 8.853   -12.551 -10.266 1.00 0.00 ? 169 GLY A HA2  2  
ATOM   7139   H  HA3  . GLY A 1 169 ? 8.031   -14.105 -10.419 1.00 0.00 ? 169 GLY A HA3  2  
ATOM   7140   N  N    . ASN A 1 170 ? 5.804   -11.898 -10.420 1.00 0.00 ? 170 ASN A N    2  
ATOM   7141   C  CA   . ASN A 1 170 ? 4.734   -11.247 -11.221 1.00 0.00 ? 170 ASN A CA   2  
ATOM   7142   C  C    . ASN A 1 170 ? 4.376   -9.906  -10.573 1.00 0.00 ? 170 ASN A C    2  
ATOM   7143   O  O    . ASN A 1 170 ? 3.248   -9.457  -10.622 1.00 0.00 ? 170 ASN A O    2  
ATOM   7144   C  CB   . ASN A 1 170 ? 3.504   -12.153 -11.238 1.00 0.00 ? 170 ASN A CB   2  
ATOM   7145   C  CG   . ASN A 1 170 ? 3.579   -13.100 -12.437 1.00 0.00 ? 170 ASN A CG   2  
ATOM   7146   O  OD1  . ASN A 1 170 ? 2.945   -12.871 -13.448 1.00 0.00 ? 170 ASN A OD1  2  
ATOM   7147   N  ND2  . ASN A 1 170 ? 4.334   -14.162 -12.369 1.00 0.00 ? 170 ASN A ND2  2  
ATOM   7148   H  H    . ASN A 1 170 ? 5.722   -11.927 -9.446  1.00 0.00 ? 170 ASN A H    2  
ATOM   7149   H  HA   . ASN A 1 170 ? 5.078   -11.083 -12.230 1.00 0.00 ? 170 ASN A HA   2  
ATOM   7150   H  HB2  . ASN A 1 170 ? 3.476   -12.731 -10.326 1.00 0.00 ? 170 ASN A HB2  2  
ATOM   7151   H  HB3  . ASN A 1 170 ? 2.615   -11.552 -11.309 1.00 0.00 ? 170 ASN A HB3  2  
ATOM   7152   H  HD21 . ASN A 1 170 ? 4.847   -14.347 -11.554 1.00 0.00 ? 170 ASN A HD21 2  
ATOM   7153   H  HD22 . ASN A 1 170 ? 4.389   -14.775 -13.131 1.00 0.00 ? 170 ASN A HD22 2  
ATOM   7154   N  N    . GLU A 1 171 ? 5.334   -9.274  -9.952  1.00 0.00 ? 171 GLU A N    2  
ATOM   7155   C  CA   . GLU A 1 171 ? 5.069   -7.971  -9.278  1.00 0.00 ? 171 GLU A CA   2  
ATOM   7156   C  C    . GLU A 1 171 ? 4.682   -6.898  -10.304 1.00 0.00 ? 171 GLU A C    2  
ATOM   7157   O  O    . GLU A 1 171 ? 3.903   -6.010  -10.021 1.00 0.00 ? 171 GLU A O    2  
ATOM   7158   C  CB   . GLU A 1 171 ? 6.331   -7.517  -8.542  1.00 0.00 ? 171 GLU A CB   2  
ATOM   7159   C  CG   . GLU A 1 171 ? 6.708   -8.553  -7.482  1.00 0.00 ? 171 GLU A CG   2  
ATOM   7160   C  CD   . GLU A 1 171 ? 8.187   -8.398  -7.123  1.00 0.00 ? 171 GLU A CD   2  
ATOM   7161   O  OE1  . GLU A 1 171 ? 9.009   -8.520  -8.016  1.00 0.00 ? 171 GLU A OE1  2  
ATOM   7162   O  OE2  . GLU A 1 171 ? 8.473   -8.158  -5.961  1.00 0.00 ? 171 GLU A OE2  2  
ATOM   7163   H  H    . GLU A 1 171 ? 6.232   -9.665  -9.918  1.00 0.00 ? 171 GLU A H    2  
ATOM   7164   H  HA   . GLU A 1 171 ? 4.268   -8.093  -8.567  1.00 0.00 ? 171 GLU A HA   2  
ATOM   7165   H  HB2  . GLU A 1 171 ? 7.141   -7.414  -9.249  1.00 0.00 ? 171 GLU A HB2  2  
ATOM   7166   H  HB3  . GLU A 1 171 ? 6.147   -6.567  -8.063  1.00 0.00 ? 171 GLU A HB3  2  
ATOM   7167   H  HG2  . GLU A 1 171 ? 6.104   -8.400  -6.600  1.00 0.00 ? 171 GLU A HG2  2  
ATOM   7168   H  HG3  . GLU A 1 171 ? 6.536   -9.546  -7.871  1.00 0.00 ? 171 GLU A HG3  2  
ATOM   7169   N  N    . GLU A 1 172 ? 5.233   -6.958  -11.485 1.00 0.00 ? 172 GLU A N    2  
ATOM   7170   C  CA   . GLU A 1 172 ? 4.916   -5.926  -12.519 1.00 0.00 ? 172 GLU A CA   2  
ATOM   7171   C  C    . GLU A 1 172 ? 3.410   -5.886  -12.810 1.00 0.00 ? 172 GLU A C    2  
ATOM   7172   O  O    . GLU A 1 172 ? 2.921   -4.964  -13.432 1.00 0.00 ? 172 GLU A O    2  
ATOM   7173   C  CB   . GLU A 1 172 ? 5.665   -6.261  -13.811 1.00 0.00 ? 172 GLU A CB   2  
ATOM   7174   C  CG   . GLU A 1 172 ? 7.166   -6.331  -13.528 1.00 0.00 ? 172 GLU A CG   2  
ATOM   7175   C  CD   . GLU A 1 172 ? 7.733   -7.638  -14.086 1.00 0.00 ? 172 GLU A CD   2  
ATOM   7176   O  OE1  . GLU A 1 172 ? 7.426   -8.680  -13.530 1.00 0.00 ? 172 GLU A OE1  2  
ATOM   7177   O  OE2  . GLU A 1 172 ? 8.463   -7.575  -15.062 1.00 0.00 ? 172 GLU A OE2  2  
ATOM   7178   H  H    . GLU A 1 172 ? 5.869   -7.674  -11.693 1.00 0.00 ? 172 GLU A H    2  
ATOM   7179   H  HA   . GLU A 1 172 ? 5.236   -4.959  -12.167 1.00 0.00 ? 172 GLU A HA   2  
ATOM   7180   H  HB2  . GLU A 1 172 ? 5.323   -7.215  -14.188 1.00 0.00 ? 172 GLU A HB2  2  
ATOM   7181   H  HB3  . GLU A 1 172 ? 5.474   -5.494  -14.546 1.00 0.00 ? 172 GLU A HB3  2  
ATOM   7182   H  HG2  . GLU A 1 172 ? 7.660   -5.494  -13.998 1.00 0.00 ? 172 GLU A HG2  2  
ATOM   7183   H  HG3  . GLU A 1 172 ? 7.333   -6.297  -12.462 1.00 0.00 ? 172 GLU A HG3  2  
ATOM   7184   N  N    . GLU A 1 173 ? 2.676   -6.877  -12.392 1.00 0.00 ? 173 GLU A N    2  
ATOM   7185   C  CA   . GLU A 1 173 ? 1.211   -6.886  -12.680 1.00 0.00 ? 173 GLU A CA   2  
ATOM   7186   C  C    . GLU A 1 173 ? 0.425   -6.190  -11.561 1.00 0.00 ? 173 GLU A C    2  
ATOM   7187   O  O    . GLU A 1 173 ? -0.779  -6.049  -11.651 1.00 0.00 ? 173 GLU A O    2  
ATOM   7188   C  CB   . GLU A 1 173 ? 0.732   -8.335  -12.807 1.00 0.00 ? 173 GLU A CB   2  
ATOM   7189   C  CG   . GLU A 1 173 ? 1.450   -9.011  -13.977 1.00 0.00 ? 173 GLU A CG   2  
ATOM   7190   C  CD   . GLU A 1 173 ? 0.626   -10.207 -14.460 1.00 0.00 ? 173 GLU A CD   2  
ATOM   7191   O  OE1  . GLU A 1 173 ? 0.359   -11.082 -13.652 1.00 0.00 ? 173 GLU A OE1  2  
ATOM   7192   O  OE2  . GLU A 1 173 ? 0.276   -10.228 -15.628 1.00 0.00 ? 173 GLU A OE2  2  
ATOM   7193   H  H    . GLU A 1 173 ? 3.084   -7.626  -11.910 1.00 0.00 ? 173 GLU A H    2  
ATOM   7194   H  HA   . GLU A 1 173 ? 1.029   -6.372  -13.614 1.00 0.00 ? 173 GLU A HA   2  
ATOM   7195   H  HB2  . GLU A 1 173 ? 0.952   -8.867  -11.893 1.00 0.00 ? 173 GLU A HB2  2  
ATOM   7196   H  HB3  . GLU A 1 173 ? -0.333  -8.348  -12.984 1.00 0.00 ? 173 GLU A HB3  2  
ATOM   7197   H  HG2  . GLU A 1 173 ? 1.566   -8.304  -14.786 1.00 0.00 ? 173 GLU A HG2  2  
ATOM   7198   H  HG3  . GLU A 1 173 ? 2.422   -9.353  -13.655 1.00 0.00 ? 173 GLU A HG3  2  
ATOM   7199   N  N    . ILE A 1 174 ? 1.078   -5.767  -10.506 1.00 0.00 ? 174 ILE A N    2  
ATOM   7200   C  CA   . ILE A 1 174 ? 0.333   -5.100  -9.391  1.00 0.00 ? 174 ILE A CA   2  
ATOM   7201   C  C    . ILE A 1 174 ? 0.861   -3.682  -9.145  1.00 0.00 ? 174 ILE A C    2  
ATOM   7202   O  O    . ILE A 1 174 ? 0.268   -2.920  -8.406  1.00 0.00 ? 174 ILE A O    2  
ATOM   7203   C  CB   . ILE A 1 174 ? 0.494   -5.921  -8.109  1.00 0.00 ? 174 ILE A CB   2  
ATOM   7204   C  CG1  . ILE A 1 174 ? 1.982   -6.160  -7.847  1.00 0.00 ? 174 ILE A CG1  2  
ATOM   7205   C  CG2  . ILE A 1 174 ? -0.215  -7.267  -8.269  1.00 0.00 ? 174 ILE A CG2  2  
ATOM   7206   C  CD1  . ILE A 1 174 ? 2.186   -6.571  -6.388  1.00 0.00 ? 174 ILE A CD1  2  
ATOM   7207   H  H    . ILE A 1 174 ? 2.047   -5.899  -10.441 1.00 0.00 ? 174 ILE A H    2  
ATOM   7208   H  HA   . ILE A 1 174 ? -0.715  -5.045  -9.640  1.00 0.00 ? 174 ILE A HA   2  
ATOM   7209   H  HB   . ILE A 1 174 ? 0.061   -5.383  -7.279  1.00 0.00 ? 174 ILE A HB   2  
ATOM   7210   H  HG12 . ILE A 1 174 ? 2.335   -6.945  -8.497  1.00 0.00 ? 174 ILE A HG12 2  
ATOM   7211   H  HG13 . ILE A 1 174 ? 2.533   -5.253  -8.044  1.00 0.00 ? 174 ILE A HG13 2  
ATOM   7212   H  HG21 . ILE A 1 174 ? -1.143  -7.125  -8.801  1.00 0.00 ? 174 ILE A HG21 2  
ATOM   7213   H  HG22 . ILE A 1 174 ? -0.420  -7.684  -7.294  1.00 0.00 ? 174 ILE A HG22 2  
ATOM   7214   H  HG23 . ILE A 1 174 ? 0.418   -7.944  -8.824  1.00 0.00 ? 174 ILE A HG23 2  
ATOM   7215   H  HD11 . ILE A 1 174 ? 1.419   -7.276  -6.102  1.00 0.00 ? 174 ILE A HD11 2  
ATOM   7216   H  HD12 . ILE A 1 174 ? 2.124   -5.698  -5.755  1.00 0.00 ? 174 ILE A HD12 2  
ATOM   7217   H  HD13 . ILE A 1 174 ? 3.157   -7.030  -6.276  1.00 0.00 ? 174 ILE A HD13 2  
ATOM   7218   N  N    . VAL A 1 175 ? 1.964   -3.309  -9.735  1.00 0.00 ? 175 VAL A N    2  
ATOM   7219   C  CA   . VAL A 1 175 ? 2.486   -1.931  -9.489  1.00 0.00 ? 175 VAL A CA   2  
ATOM   7220   C  C    . VAL A 1 175 ? 1.790   -0.926  -10.412 1.00 0.00 ? 175 VAL A C    2  
ATOM   7221   O  O    . VAL A 1 175 ? 1.637   0.233   -10.070 1.00 0.00 ? 175 VAL A O    2  
ATOM   7222   C  CB   . VAL A 1 175 ? 4.001   -1.877  -9.717  1.00 0.00 ? 175 VAL A CB   2  
ATOM   7223   C  CG1  . VAL A 1 175 ? 4.723   -2.179  -8.403  1.00 0.00 ? 175 VAL A CG1  2  
ATOM   7224   C  CG2  . VAL A 1 175 ? 4.417   -2.910  -10.764 1.00 0.00 ? 175 VAL A CG2  2  
ATOM   7225   H  H    . VAL A 1 175 ? 2.444   -3.925  -10.325 1.00 0.00 ? 175 VAL A H    2  
ATOM   7226   H  HA   . VAL A 1 175 ? 2.276   -1.660  -8.464  1.00 0.00 ? 175 VAL A HA   2  
ATOM   7227   H  HB   . VAL A 1 175 ? 4.276   -0.888  -10.055 1.00 0.00 ? 175 VAL A HB   2  
ATOM   7228   H  HG11 . VAL A 1 175 ? 4.890   -1.259  -7.863  1.00 0.00 ? 175 VAL A HG11 2  
ATOM   7229   H  HG12 . VAL A 1 175 ? 5.671   -2.651  -8.614  1.00 0.00 ? 175 VAL A HG12 2  
ATOM   7230   H  HG13 . VAL A 1 175 ? 4.117   -2.844  -7.804  1.00 0.00 ? 175 VAL A HG13 2  
ATOM   7231   H  HG21 . VAL A 1 175 ? 5.312   -2.572  -11.265 1.00 0.00 ? 175 VAL A HG21 2  
ATOM   7232   H  HG22 . VAL A 1 175 ? 3.624   -3.033  -11.486 1.00 0.00 ? 175 VAL A HG22 2  
ATOM   7233   H  HG23 . VAL A 1 175 ? 4.614   -3.853  -10.277 1.00 0.00 ? 175 VAL A HG23 2  
ATOM   7234   N  N    . LEU A 1 176 ? 1.374   -1.340  -11.582 1.00 0.00 ? 176 LEU A N    2  
ATOM   7235   C  CA   . LEU A 1 176 ? 0.702   -0.384  -12.510 1.00 0.00 ? 176 LEU A CA   2  
ATOM   7236   C  C    . LEU A 1 176 ? -0.793  -0.299  -12.193 1.00 0.00 ? 176 LEU A C    2  
ATOM   7237   O  O    . LEU A 1 176 ? -1.535  0.392   -12.863 1.00 0.00 ? 176 LEU A O    2  
ATOM   7238   C  CB   . LEU A 1 176 ? 0.884   -0.865  -13.951 1.00 0.00 ? 176 LEU A CB   2  
ATOM   7239   C  CG   . LEU A 1 176 ? 2.311   -0.574  -14.417 1.00 0.00 ? 176 LEU A CG   2  
ATOM   7240   C  CD1  . LEU A 1 176 ? 2.916   -1.838  -15.032 1.00 0.00 ? 176 LEU A CD1  2  
ATOM   7241   C  CD2  . LEU A 1 176 ? 2.286   0.539   -15.468 1.00 0.00 ? 176 LEU A CD2  2  
ATOM   7242   H  H    . LEU A 1 176 ? 1.506   -2.268  -11.865 1.00 0.00 ? 176 LEU A H    2  
ATOM   7243   H  HA   . LEU A 1 176 ? 1.146   0.594   -12.402 1.00 0.00 ? 176 LEU A HA   2  
ATOM   7244   H  HB2  . LEU A 1 176 ? 0.700   -1.929  -14.001 1.00 0.00 ? 176 LEU A HB2  2  
ATOM   7245   H  HB3  . LEU A 1 176 ? 0.186   -0.350  -14.592 1.00 0.00 ? 176 LEU A HB3  2  
ATOM   7246   H  HG   . LEU A 1 176 ? 2.911   -0.263  -13.574 1.00 0.00 ? 176 LEU A HG   2  
ATOM   7247   H  HD11 . LEU A 1 176 ? 3.147   -2.544  -14.248 1.00 0.00 ? 176 LEU A HD11 2  
ATOM   7248   H  HD12 . LEU A 1 176 ? 3.820   -1.582  -15.565 1.00 0.00 ? 176 LEU A HD12 2  
ATOM   7249   H  HD13 . LEU A 1 176 ? 2.207   -2.280  -15.717 1.00 0.00 ? 176 LEU A HD13 2  
ATOM   7250   H  HD21 . LEU A 1 176 ? 3.294   0.886   -15.650 1.00 0.00 ? 176 LEU A HD21 2  
ATOM   7251   H  HD22 . LEU A 1 176 ? 1.684   1.361   -15.109 1.00 0.00 ? 176 LEU A HD22 2  
ATOM   7252   H  HD23 . LEU A 1 176 ? 1.865   0.158   -16.386 1.00 0.00 ? 176 LEU A HD23 2  
ATOM   7253   N  N    . ALA A 1 177 ? -1.251  -0.984  -11.181 1.00 0.00 ? 177 ALA A N    2  
ATOM   7254   C  CA   . ALA A 1 177 ? -2.697  -0.920  -10.840 1.00 0.00 ? 177 ALA A CA   2  
ATOM   7255   C  C    . ALA A 1 177 ? -2.947  0.333   -9.998  1.00 0.00 ? 177 ALA A C    2  
ATOM   7256   O  O    . ALA A 1 177 ? -2.247  0.596   -9.040  1.00 0.00 ? 177 ALA A O    2  
ATOM   7257   C  CB   . ALA A 1 177 ? -3.087  -2.171  -10.052 1.00 0.00 ? 177 ALA A CB   2  
ATOM   7258   H  H    . ALA A 1 177 ? -0.647  -1.536  -10.643 1.00 0.00 ? 177 ALA A H    2  
ATOM   7259   H  HA   . ALA A 1 177 ? -3.280  -0.867  -11.748 1.00 0.00 ? 177 ALA A HA   2  
ATOM   7260   H  HB1  . ALA A 1 177 ? -2.789  -3.049  -10.605 1.00 0.00 ? 177 ALA A HB1  2  
ATOM   7261   H  HB2  . ALA A 1 177 ? -4.155  -2.185  -9.905  1.00 0.00 ? 177 ALA A HB2  2  
ATOM   7262   H  HB3  . ALA A 1 177 ? -2.588  -2.162  -9.096  1.00 0.00 ? 177 ALA A HB3  2  
ATOM   7263   N  N    . ARG A 1 178 ? -3.925  1.119   -10.359 1.00 0.00 ? 178 ARG A N    2  
ATOM   7264   C  CA   . ARG A 1 178 ? -4.201  2.368   -9.590  1.00 0.00 ? 178 ARG A CA   2  
ATOM   7265   C  C    . ARG A 1 178 ? -5.446  2.194   -8.715  1.00 0.00 ? 178 ARG A C    2  
ATOM   7266   O  O    . ARG A 1 178 ? -6.313  1.393   -8.997  1.00 0.00 ? 178 ARG A O    2  
ATOM   7267   C  CB   . ARG A 1 178 ? -4.427  3.525   -10.568 1.00 0.00 ? 178 ARG A CB   2  
ATOM   7268   C  CG   . ARG A 1 178 ? -5.424  3.098   -11.647 1.00 0.00 ? 178 ARG A CG   2  
ATOM   7269   C  CD   . ARG A 1 178 ? -5.557  4.211   -12.687 1.00 0.00 ? 178 ARG A CD   2  
ATOM   7270   N  NE   . ARG A 1 178 ? -6.274  5.370   -12.085 1.00 0.00 ? 178 ARG A NE   2  
ATOM   7271   C  CZ   . ARG A 1 178 ? -6.524  6.427   -12.807 1.00 0.00 ? 178 ARG A CZ   2  
ATOM   7272   N  NH1  . ARG A 1 178 ? -6.148  6.467   -14.055 1.00 0.00 ? 178 ARG A NH1  2  
ATOM   7273   N  NH2  . ARG A 1 178 ? -7.150  7.444   -12.280 1.00 0.00 ? 178 ARG A NH2  2  
ATOM   7274   H  H    . ARG A 1 178 ? -4.468  0.897   -11.143 1.00 0.00 ? 178 ARG A H    2  
ATOM   7275   H  HA   . ARG A 1 178 ? -3.354  2.595   -8.962  1.00 0.00 ? 178 ARG A HA   2  
ATOM   7276   H  HB2  . ARG A 1 178 ? -4.818  4.377   -10.031 1.00 0.00 ? 178 ARG A HB2  2  
ATOM   7277   H  HB3  . ARG A 1 178 ? -3.489  3.791   -11.031 1.00 0.00 ? 178 ARG A HB3  2  
ATOM   7278   H  HG2  . ARG A 1 178 ? -5.072  2.198   -12.128 1.00 0.00 ? 178 ARG A HG2  2  
ATOM   7279   H  HG3  . ARG A 1 178 ? -6.387  2.913   -11.197 1.00 0.00 ? 178 ARG A HG3  2  
ATOM   7280   H  HD2  . ARG A 1 178 ? -4.575  4.523   -13.009 1.00 0.00 ? 178 ARG A HD2  2  
ATOM   7281   H  HD3  . ARG A 1 178 ? -6.115  3.846   -13.537 1.00 0.00 ? 178 ARG A HD3  2  
ATOM   7282   H  HE   . ARG A 1 178 ? -6.554  5.338   -11.147 1.00 0.00 ? 178 ARG A HE   2  
ATOM   7283   H  HH11 . ARG A 1 178 ? -5.668  5.687   -14.458 1.00 0.00 ? 178 ARG A HH11 2  
ATOM   7284   H  HH12 . ARG A 1 178 ? -6.339  7.277   -14.610 1.00 0.00 ? 178 ARG A HH12 2  
ATOM   7285   H  HH21 . ARG A 1 178 ? -7.436  7.413   -11.323 1.00 0.00 ? 178 ARG A HH21 2  
ATOM   7286   H  HH22 . ARG A 1 178 ? -7.342  8.254   -12.835 1.00 0.00 ? 178 ARG A HH22 2  
ATOM   7287   N  N    . THR A 1 179 ? -5.534  2.952   -7.654  1.00 0.00 ? 179 THR A N    2  
ATOM   7288   C  CA   . THR A 1 179 ? -6.716  2.852   -6.750  1.00 0.00 ? 179 THR A CA   2  
ATOM   7289   C  C    . THR A 1 179 ? -7.997  3.085   -7.564  1.00 0.00 ? 179 THR A C    2  
ATOM   7290   O  O    . THR A 1 179 ? -7.971  3.693   -8.619  1.00 0.00 ? 179 THR A O    2  
ATOM   7291   C  CB   . THR A 1 179 ? -6.591  3.908   -5.646  1.00 0.00 ? 179 THR A CB   2  
ATOM   7292   O  OG1  . THR A 1 179 ? -7.404  3.536   -4.542  1.00 0.00 ? 179 THR A OG1  2  
ATOM   7293   C  CG2  . THR A 1 179 ? -7.042  5.266   -6.180  1.00 0.00 ? 179 THR A CG2  2  
ATOM   7294   H  H    . THR A 1 179 ? -4.820  3.592   -7.452  1.00 0.00 ? 179 THR A H    2  
ATOM   7295   H  HA   . THR A 1 179 ? -6.747  1.868   -6.307  1.00 0.00 ? 179 THR A HA   2  
ATOM   7296   H  HB   . THR A 1 179 ? -5.558  3.979   -5.326  1.00 0.00 ? 179 THR A HB   2  
ATOM   7297   H  HG1  . THR A 1 179 ? -8.292  3.865   -4.703  1.00 0.00 ? 179 THR A HG1  2  
ATOM   7298   H  HG21 . THR A 1 179 ? -6.838  5.324   -7.239  1.00 0.00 ? 179 THR A HG21 2  
ATOM   7299   H  HG22 . THR A 1 179 ? -6.504  6.052   -5.668  1.00 0.00 ? 179 THR A HG22 2  
ATOM   7300   H  HG23 . THR A 1 179 ? -8.104  5.384   -6.009  1.00 0.00 ? 179 THR A HG23 2  
ATOM   7301   N  N    . PHE A 1 180 ? -9.118  2.597   -7.094  1.00 0.00 ? 180 PHE A N    2  
ATOM   7302   C  CA   . PHE A 1 180 ? -10.386 2.785   -7.861  1.00 0.00 ? 180 PHE A CA   2  
ATOM   7303   C  C    . PHE A 1 180 ? -11.553 3.067   -6.909  1.00 0.00 ? 180 PHE A C    2  
ATOM   7304   O  O    . PHE A 1 180 ? -11.457 2.877   -5.712  1.00 0.00 ? 180 PHE A O    2  
ATOM   7305   C  CB   . PHE A 1 180 ? -10.686 1.510   -8.654  1.00 0.00 ? 180 PHE A CB   2  
ATOM   7306   C  CG   . PHE A 1 180 ? -11.021 0.388   -7.697  1.00 0.00 ? 180 PHE A CG   2  
ATOM   7307   C  CD1  . PHE A 1 180 ? -9.995  -0.376  -7.124  1.00 0.00 ? 180 PHE A CD1  2  
ATOM   7308   C  CD2  . PHE A 1 180 ? -12.357 0.110   -7.383  1.00 0.00 ? 180 PHE A CD2  2  
ATOM   7309   C  CE1  . PHE A 1 180 ? -10.307 -1.413  -6.236  1.00 0.00 ? 180 PHE A CE1  2  
ATOM   7310   C  CE2  . PHE A 1 180 ? -12.668 -0.929  -6.496  1.00 0.00 ? 180 PHE A CE2  2  
ATOM   7311   C  CZ   . PHE A 1 180 ? -11.642 -1.691  -5.924  1.00 0.00 ? 180 PHE A CZ   2  
ATOM   7312   H  H    . PHE A 1 180 ? -9.128  2.103   -6.248  1.00 0.00 ? 180 PHE A H    2  
ATOM   7313   H  HA   . PHE A 1 180 ? -10.271 3.611   -8.544  1.00 0.00 ? 180 PHE A HA   2  
ATOM   7314   H  HB2  . PHE A 1 180 ? -11.524 1.685   -9.312  1.00 0.00 ? 180 PHE A HB2  2  
ATOM   7315   H  HB3  . PHE A 1 180 ? -9.820  1.237   -9.239  1.00 0.00 ? 180 PHE A HB3  2  
ATOM   7316   H  HD1  . PHE A 1 180 ? -8.964  -0.165  -7.365  1.00 0.00 ? 180 PHE A HD1  2  
ATOM   7317   H  HD2  . PHE A 1 180 ? -13.149 0.698   -7.823  1.00 0.00 ? 180 PHE A HD2  2  
ATOM   7318   H  HE1  . PHE A 1 180 ? -9.517  -2.000  -5.793  1.00 0.00 ? 180 PHE A HE1  2  
ATOM   7319   H  HE2  . PHE A 1 180 ? -13.699 -1.144  -6.254  1.00 0.00 ? 180 PHE A HE2  2  
ATOM   7320   H  HZ   . PHE A 1 180 ? -11.882 -2.492  -5.240  1.00 0.00 ? 180 PHE A HZ   2  
ATOM   7321   N  N    . CYS A 1 181 ? -12.662 3.514   -7.443  1.00 0.00 ? 181 CYS A N    2  
ATOM   7322   C  CA   . CYS A 1 181 ? -13.853 3.808   -6.591  1.00 0.00 ? 181 CYS A CA   2  
ATOM   7323   C  C    . CYS A 1 181 ? -15.116 3.746   -7.457  1.00 0.00 ? 181 CYS A C    2  
ATOM   7324   O  O    . CYS A 1 181 ? -15.049 3.822   -8.666  1.00 0.00 ? 181 CYS A O    2  
ATOM   7325   C  CB   . CYS A 1 181 ? -13.726 5.206   -5.990  1.00 0.00 ? 181 CYS A CB   2  
ATOM   7326   S  SG   . CYS A 1 181 ? -14.332 5.187   -4.285  1.00 0.00 ? 181 CYS A SG   2  
ATOM   7327   H  H    . CYS A 1 181 ? -12.714 3.653   -8.411  1.00 0.00 ? 181 CYS A H    2  
ATOM   7328   H  HA   . CYS A 1 181 ? -13.921 3.076   -5.798  1.00 0.00 ? 181 CYS A HA   2  
ATOM   7329   H  HB2  . CYS A 1 181 ? -12.691 5.511   -6.001  1.00 0.00 ? 181 CYS A HB2  2  
ATOM   7330   H  HB3  . CYS A 1 181 ? -14.315 5.900   -6.571  1.00 0.00 ? 181 CYS A HB3  2  
ATOM   7331   H  HG   . CYS A 1 181 ? -14.827 4.375   -4.156  1.00 0.00 ? 181 CYS A HG   2  
ATOM   7332   N  N    . PHE A 1 182 ? -16.266 3.619   -6.849  1.00 0.00 ? 182 PHE A N    2  
ATOM   7333   C  CA   . PHE A 1 182 ? -17.529 3.566   -7.644  1.00 0.00 ? 182 PHE A CA   2  
ATOM   7334   C  C    . PHE A 1 182 ? -18.258 4.903   -7.519  1.00 0.00 ? 182 PHE A C    2  
ATOM   7335   O  O    . PHE A 1 182 ? -18.222 5.546   -6.491  1.00 0.00 ? 182 PHE A O    2  
ATOM   7336   C  CB   . PHE A 1 182 ? -18.414 2.426   -7.141  1.00 0.00 ? 182 PHE A CB   2  
ATOM   7337   C  CG   . PHE A 1 182 ? -17.639 1.134   -7.227  1.00 0.00 ? 182 PHE A CG   2  
ATOM   7338   C  CD1  . PHE A 1 182 ? -17.520 0.471   -8.453  1.00 0.00 ? 182 PHE A CD1  2  
ATOM   7339   C  CD2  . PHE A 1 182 ? -17.030 0.605   -6.082  1.00 0.00 ? 182 PHE A CD2  2  
ATOM   7340   C  CE1  . PHE A 1 182 ? -16.794 -0.722  -8.536  1.00 0.00 ? 182 PHE A CE1  2  
ATOM   7341   C  CE2  . PHE A 1 182 ? -16.303 -0.587  -6.165  1.00 0.00 ? 182 PHE A CE2  2  
ATOM   7342   C  CZ   . PHE A 1 182 ? -16.184 -1.251  -7.393  1.00 0.00 ? 182 PHE A CZ   2  
ATOM   7343   H  H    . PHE A 1 182 ? -16.301 3.575   -5.872  1.00 0.00 ? 182 PHE A H    2  
ATOM   7344   H  HA   . PHE A 1 182 ? -17.286 3.395   -8.684  1.00 0.00 ? 182 PHE A HA   2  
ATOM   7345   H  HB2  . PHE A 1 182 ? -18.701 2.611   -6.121  1.00 0.00 ? 182 PHE A HB2  2  
ATOM   7346   H  HB3  . PHE A 1 182 ? -19.298 2.354   -7.758  1.00 0.00 ? 182 PHE A HB3  2  
ATOM   7347   H  HD1  . PHE A 1 182 ? -17.991 0.880   -9.335  1.00 0.00 ? 182 PHE A HD1  2  
ATOM   7348   H  HD2  . PHE A 1 182 ? -17.123 1.117   -5.135  1.00 0.00 ? 182 PHE A HD2  2  
ATOM   7349   H  HE1  . PHE A 1 182 ? -16.702 -1.235  -9.483  1.00 0.00 ? 182 PHE A HE1  2  
ATOM   7350   H  HE2  . PHE A 1 182 ? -15.834 -0.996  -5.282  1.00 0.00 ? 182 PHE A HE2  2  
ATOM   7351   H  HZ   . PHE A 1 182 ? -15.622 -2.170  -7.459  1.00 0.00 ? 182 PHE A HZ   2  
ATOM   7352   N  N    . ASP A 1 183 ? -18.905 5.335   -8.564  1.00 0.00 ? 183 ASP A N    2  
ATOM   7353   C  CA   . ASP A 1 183 ? -19.615 6.646   -8.515  1.00 0.00 ? 183 ASP A CA   2  
ATOM   7354   C  C    . ASP A 1 183 ? -20.704 6.658   -7.432  1.00 0.00 ? 183 ASP A C    2  
ATOM   7355   O  O    . ASP A 1 183 ? -21.134 7.708   -6.999  1.00 0.00 ? 183 ASP A O    2  
ATOM   7356   C  CB   . ASP A 1 183 ? -20.261 6.913   -9.876  1.00 0.00 ? 183 ASP A CB   2  
ATOM   7357   C  CG   . ASP A 1 183 ? -21.173 5.741   -10.245 1.00 0.00 ? 183 ASP A CG   2  
ATOM   7358   O  OD1  . ASP A 1 183 ? -21.414 4.910   -9.386  1.00 0.00 ? 183 ASP A OD1  2  
ATOM   7359   O  OD2  . ASP A 1 183 ? -21.612 5.695   -11.382 1.00 0.00 ? 183 ASP A OD2  2  
ATOM   7360   H  H    . ASP A 1 183 ? -18.909 4.804   -9.390  1.00 0.00 ? 183 ASP A H    2  
ATOM   7361   H  HA   . ASP A 1 183 ? -18.901 7.429   -8.307  1.00 0.00 ? 183 ASP A HA   2  
ATOM   7362   H  HB2  . ASP A 1 183 ? -20.843 7.822   -9.825  1.00 0.00 ? 183 ASP A HB2  2  
ATOM   7363   H  HB3  . ASP A 1 183 ? -19.492 7.019   -10.625 1.00 0.00 ? 183 ASP A HB3  2  
ATOM   7364   N  N    . TRP A 1 184 ? -21.184 5.519   -7.010  1.00 0.00 ? 184 TRP A N    2  
ATOM   7365   C  CA   . TRP A 1 184 ? -22.273 5.524   -5.985  1.00 0.00 ? 184 TRP A CA   2  
ATOM   7366   C  C    . TRP A 1 184 ? -21.729 5.831   -4.581  1.00 0.00 ? 184 TRP A C    2  
ATOM   7367   O  O    . TRP A 1 184 ? -22.397 6.468   -3.790  1.00 0.00 ? 184 TRP A O    2  
ATOM   7368   C  CB   . TRP A 1 184 ? -23.005 4.177   -5.983  1.00 0.00 ? 184 TRP A CB   2  
ATOM   7369   C  CG   . TRP A 1 184 ? -22.089 3.073   -5.560  1.00 0.00 ? 184 TRP A CG   2  
ATOM   7370   C  CD1  . TRP A 1 184 ? -21.590 2.907   -4.313  1.00 0.00 ? 184 TRP A CD1  2  
ATOM   7371   C  CD2  . TRP A 1 184 ? -21.577 1.967   -6.357  1.00 0.00 ? 184 TRP A CD2  2  
ATOM   7372   N  NE1  . TRP A 1 184 ? -20.797 1.772   -4.298  1.00 0.00 ? 184 TRP A NE1  2  
ATOM   7373   C  CE2  . TRP A 1 184 ? -20.758 1.158   -5.535  1.00 0.00 ? 184 TRP A CE2  2  
ATOM   7374   C  CE3  . TRP A 1 184 ? -21.740 1.594   -7.702  1.00 0.00 ? 184 TRP A CE3  2  
ATOM   7375   C  CZ2  . TRP A 1 184 ? -20.126 0.016   -6.030  1.00 0.00 ? 184 TRP A CZ2  2  
ATOM   7376   C  CZ3  . TRP A 1 184 ? -21.107 0.446   -8.205  1.00 0.00 ? 184 TRP A CZ3  2  
ATOM   7377   C  CH2  . TRP A 1 184 ? -20.301 -0.341  -7.371  1.00 0.00 ? 184 TRP A CH2  2  
ATOM   7378   H  H    . TRP A 1 184 ? -20.859 4.674   -7.385  1.00 0.00 ? 184 TRP A H    2  
ATOM   7379   H  HA   . TRP A 1 184 ? -22.981 6.296   -6.249  1.00 0.00 ? 184 TRP A HA   2  
ATOM   7380   H  HB2  . TRP A 1 184 ? -23.838 4.227   -5.300  1.00 0.00 ? 184 TRP A HB2  2  
ATOM   7381   H  HB3  . TRP A 1 184 ? -23.374 3.972   -6.978  1.00 0.00 ? 184 TRP A HB3  2  
ATOM   7382   H  HD1  . TRP A 1 184 ? -21.778 3.553   -3.469  1.00 0.00 ? 184 TRP A HD1  2  
ATOM   7383   H  HE1  . TRP A 1 184 ? -20.315 1.430   -3.516  1.00 0.00 ? 184 TRP A HE1  2  
ATOM   7384   H  HE3  . TRP A 1 184 ? -22.358 2.194   -8.353  1.00 0.00 ? 184 TRP A HE3  2  
ATOM   7385   H  HZ2  . TRP A 1 184 ? -19.506 -0.587  -5.384  1.00 0.00 ? 184 TRP A HZ2  2  
ATOM   7386   H  HZ3  . TRP A 1 184 ? -21.240 0.170   -9.238  1.00 0.00 ? 184 TRP A HZ3  2  
ATOM   7387   H  HH2  . TRP A 1 184 ? -19.820 -1.225  -7.766  1.00 0.00 ? 184 TRP A HH2  2  
ATOM   7388   N  N    . GLU A 1 185 ? -20.543 5.395   -4.247  1.00 0.00 ? 185 GLU A N    2  
ATOM   7389   C  CA   . GLU A 1 185 ? -20.016 5.690   -2.876  1.00 0.00 ? 185 GLU A CA   2  
ATOM   7390   C  C    . GLU A 1 185 ? -19.107 6.922   -2.911  1.00 0.00 ? 185 GLU A C    2  
ATOM   7391   O  O    . GLU A 1 185 ? -18.698 7.428   -1.884  1.00 0.00 ? 185 GLU A O    2  
ATOM   7392   C  CB   . GLU A 1 185 ? -19.226 4.491   -2.341  1.00 0.00 ? 185 GLU A CB   2  
ATOM   7393   C  CG   . GLU A 1 185 ? -18.132 4.097   -3.333  1.00 0.00 ? 185 GLU A CG   2  
ATOM   7394   C  CD   . GLU A 1 185 ? -16.952 3.489   -2.573  1.00 0.00 ? 185 GLU A CD   2  
ATOM   7395   O  OE1  . GLU A 1 185 ? -17.087 2.368   -2.109  1.00 0.00 ? 185 GLU A OE1  2  
ATOM   7396   O  OE2  . GLU A 1 185 ? -15.936 4.152   -2.466  1.00 0.00 ? 185 GLU A OE2  2  
ATOM   7397   H  H    . GLU A 1 185 ? -20.005 4.878   -4.883  1.00 0.00 ? 185 GLU A H    2  
ATOM   7398   H  HA   . GLU A 1 185 ? -20.846 5.886   -2.215  1.00 0.00 ? 185 GLU A HA   2  
ATOM   7399   H  HB2  . GLU A 1 185 ? -18.773 4.756   -1.396  1.00 0.00 ? 185 GLU A HB2  2  
ATOM   7400   H  HB3  . GLU A 1 185 ? -19.894 3.657   -2.195  1.00 0.00 ? 185 GLU A HB3  2  
ATOM   7401   H  HG2  . GLU A 1 185 ? -18.525 3.372   -4.025  1.00 0.00 ? 185 GLU A HG2  2  
ATOM   7402   H  HG3  . GLU A 1 185 ? -17.798 4.970   -3.873  1.00 0.00 ? 185 GLU A HG3  2  
ATOM   7403   N  N    . ILE A 1 186 ? -18.790 7.416   -4.076  1.00 0.00 ? 186 ILE A N    2  
ATOM   7404   C  CA   . ILE A 1 186 ? -17.915 8.613   -4.159  1.00 0.00 ? 186 ILE A CA   2  
ATOM   7405   C  C    . ILE A 1 186 ? -18.517 9.755   -3.333  1.00 0.00 ? 186 ILE A C    2  
ATOM   7406   O  O    . ILE A 1 186 ? -17.852 10.350  -2.509  1.00 0.00 ? 186 ILE A O    2  
ATOM   7407   C  CB   . ILE A 1 186 ? -17.795 9.035   -5.620  1.00 0.00 ? 186 ILE A CB   2  
ATOM   7408   C  CG1  . ILE A 1 186 ? -16.625 8.286   -6.256  1.00 0.00 ? 186 ILE A CG1  2  
ATOM   7409   C  CG2  . ILE A 1 186 ? -17.551 10.544  -5.703  1.00 0.00 ? 186 ILE A CG2  2  
ATOM   7410   C  CD1  . ILE A 1 186 ? -16.577 8.584   -7.756  1.00 0.00 ? 186 ILE A CD1  2  
ATOM   7411   H  H    . ILE A 1 186 ? -19.127 7.006   -4.898  1.00 0.00 ? 186 ILE A H    2  
ATOM   7412   H  HA   . ILE A 1 186 ? -16.935 8.370   -3.773  1.00 0.00 ? 186 ILE A HA   2  
ATOM   7413   H  HB   . ILE A 1 186 ? -18.706 8.783   -6.142  1.00 0.00 ? 186 ILE A HB   2  
ATOM   7414   H  HG12 . ILE A 1 186 ? -15.707 8.603   -5.793  1.00 0.00 ? 186 ILE A HG12 2  
ATOM   7415   H  HG13 . ILE A 1 186 ? -16.755 7.228   -6.106  1.00 0.00 ? 186 ILE A HG13 2  
ATOM   7416   H  HG21 . ILE A 1 186 ? -16.819 10.831  -4.963  1.00 0.00 ? 186 ILE A HG21 2  
ATOM   7417   H  HG22 . ILE A 1 186 ? -18.476 11.068  -5.516  1.00 0.00 ? 186 ILE A HG22 2  
ATOM   7418   H  HG23 . ILE A 1 186 ? -17.187 10.799  -6.687  1.00 0.00 ? 186 ILE A HG23 2  
ATOM   7419   H  HD11 . ILE A 1 186 ? -16.591 7.656   -8.308  1.00 0.00 ? 186 ILE A HD11 2  
ATOM   7420   H  HD12 . ILE A 1 186 ? -15.672 9.126   -7.987  1.00 0.00 ? 186 ILE A HD12 2  
ATOM   7421   H  HD13 . ILE A 1 186 ? -17.433 9.180   -8.033  1.00 0.00 ? 186 ILE A HD13 2  
ATOM   7422   N  N    . GLU A 1 187 ? -19.768 10.066  -3.542  1.00 0.00 ? 187 GLU A N    2  
ATOM   7423   C  CA   . GLU A 1 187 ? -20.398 11.168  -2.761  1.00 0.00 ? 187 GLU A CA   2  
ATOM   7424   C  C    . GLU A 1 187 ? -20.151 10.934  -1.270  1.00 0.00 ? 187 GLU A C    2  
ATOM   7425   O  O    . GLU A 1 187 ? -19.673 11.802  -0.568  1.00 0.00 ? 187 GLU A O    2  
ATOM   7426   C  CB   . GLU A 1 187 ? -21.903 11.195  -3.035  1.00 0.00 ? 187 GLU A CB   2  
ATOM   7427   C  CG   . GLU A 1 187 ? -22.144 11.357  -4.538  1.00 0.00 ? 187 GLU A CG   2  
ATOM   7428   C  CD   . GLU A 1 187 ? -23.418 12.172  -4.768  1.00 0.00 ? 187 GLU A CD   2  
ATOM   7429   O  OE1  . GLU A 1 187 ? -24.223 12.249  -3.854  1.00 0.00 ? 187 GLU A OE1  2  
ATOM   7430   O  OE2  . GLU A 1 187 ? -23.568 12.706  -5.855  1.00 0.00 ? 187 GLU A OE2  2  
ATOM   7431   H  H    . GLU A 1 187 ? -20.293 9.579   -4.210  1.00 0.00 ? 187 GLU A H    2  
ATOM   7432   H  HA   . GLU A 1 187 ? -19.961 12.114  -3.054  1.00 0.00 ? 187 GLU A HA   2  
ATOM   7433   H  HB2  . GLU A 1 187 ? -22.347 10.270  -2.695  1.00 0.00 ? 187 GLU A HB2  2  
ATOM   7434   H  HB3  . GLU A 1 187 ? -22.351 12.024  -2.509  1.00 0.00 ? 187 GLU A HB3  2  
ATOM   7435   H  HG2  . GLU A 1 187 ? -21.303 11.868  -4.984  1.00 0.00 ? 187 GLU A HG2  2  
ATOM   7436   H  HG3  . GLU A 1 187 ? -22.256 10.383  -4.991  1.00 0.00 ? 187 GLU A HG3  2  
ATOM   7437   N  N    . HIS A 1 188 ? -20.464 9.765   -0.780  1.00 0.00 ? 188 HIS A N    2  
ATOM   7438   C  CA   . HIS A 1 188 ? -20.234 9.485   0.664   1.00 0.00 ? 188 HIS A CA   2  
ATOM   7439   C  C    . HIS A 1 188 ? -18.778 9.809   1.003   1.00 0.00 ? 188 HIS A C    2  
ATOM   7440   O  O    . HIS A 1 188 ? -18.491 10.507  1.956   1.00 0.00 ? 188 HIS A O    2  
ATOM   7441   C  CB   . HIS A 1 188 ? -20.510 8.008   0.955   1.00 0.00 ? 188 HIS A CB   2  
ATOM   7442   C  CG   . HIS A 1 188 ? -21.612 7.896   1.972   1.00 0.00 ? 188 HIS A CG   2  
ATOM   7443   N  ND1  . HIS A 1 188 ? -22.865 8.452   1.769   1.00 0.00 ? 188 HIS A ND1  2  
ATOM   7444   C  CD2  . HIS A 1 188 ? -21.665 7.293   3.203   1.00 0.00 ? 188 HIS A CD2  2  
ATOM   7445   C  CE1  . HIS A 1 188 ? -23.612 8.175   2.853   1.00 0.00 ? 188 HIS A CE1  2  
ATOM   7446   N  NE2  . HIS A 1 188 ? -22.929 7.471   3.758   1.00 0.00 ? 188 HIS A NE2  2  
ATOM   7447   H  H    . HIS A 1 188 ? -20.843 9.073   -1.361  1.00 0.00 ? 188 HIS A H    2  
ATOM   7448   H  HA   . HIS A 1 188 ? -20.889 10.101  1.262   1.00 0.00 ? 188 HIS A HA   2  
ATOM   7449   H  HB2  . HIS A 1 188 ? -20.807 7.512   0.043   1.00 0.00 ? 188 HIS A HB2  2  
ATOM   7450   H  HB3  . HIS A 1 188 ? -19.615 7.544   1.342   1.00 0.00 ? 188 HIS A HB3  2  
ATOM   7451   H  HD1  . HIS A 1 188 ? -23.154 8.957   0.980   1.00 0.00 ? 188 HIS A HD1  2  
ATOM   7452   H  HD2  . HIS A 1 188 ? -20.849 6.762   3.672   1.00 0.00 ? 188 HIS A HD2  2  
ATOM   7453   H  HE1  . HIS A 1 188 ? -24.640 8.485   2.976   1.00 0.00 ? 188 HIS A HE1  2  
ATOM   7454   N  N    . ILE A 1 189 ? -17.857 9.316   0.220   1.00 0.00 ? 189 ILE A N    2  
ATOM   7455   C  CA   . ILE A 1 189 ? -16.421 9.603   0.484   1.00 0.00 ? 189 ILE A CA   2  
ATOM   7456   C  C    . ILE A 1 189 ? -16.210 11.120  0.486   1.00 0.00 ? 189 ILE A C    2  
ATOM   7457   O  O    . ILE A 1 189 ? -15.391 11.649  1.213   1.00 0.00 ? 189 ILE A O    2  
ATOM   7458   C  CB   . ILE A 1 189 ? -15.567 8.967   -0.614  1.00 0.00 ? 189 ILE A CB   2  
ATOM   7459   C  CG1  . ILE A 1 189 ? -15.762 7.450   -0.588  1.00 0.00 ? 189 ILE A CG1  2  
ATOM   7460   C  CG2  . ILE A 1 189 ? -14.093 9.296   -0.372  1.00 0.00 ? 189 ILE A CG2  2  
ATOM   7461   C  CD1  . ILE A 1 189 ? -15.316 6.854   -1.922  1.00 0.00 ? 189 ILE A CD1  2  
ATOM   7462   H  H    . ILE A 1 189 ? -18.113 8.764   -0.549  1.00 0.00 ? 189 ILE A H    2  
ATOM   7463   H  HA   . ILE A 1 189 ? -16.140 9.193   1.442   1.00 0.00 ? 189 ILE A HA   2  
ATOM   7464   H  HB   . ILE A 1 189 ? -15.870 9.356   -1.576  1.00 0.00 ? 189 ILE A HB   2  
ATOM   7465   H  HG12 . ILE A 1 189 ? -15.174 7.025   0.212   1.00 0.00 ? 189 ILE A HG12 2  
ATOM   7466   H  HG13 . ILE A 1 189 ? -16.805 7.224   -0.427  1.00 0.00 ? 189 ILE A HG13 2  
ATOM   7467   H  HG21 . ILE A 1 189 ? -13.476 8.517   -0.794  1.00 0.00 ? 189 ILE A HG21 2  
ATOM   7468   H  HG22 . ILE A 1 189 ? -13.910 9.364   0.690   1.00 0.00 ? 189 ILE A HG22 2  
ATOM   7469   H  HG23 . ILE A 1 189 ? -13.854 10.240  -0.840  1.00 0.00 ? 189 ILE A HG23 2  
ATOM   7470   H  HD11 . ILE A 1 189 ? -16.184 6.608   -2.516  1.00 0.00 ? 189 ILE A HD11 2  
ATOM   7471   H  HD12 . ILE A 1 189 ? -14.739 5.962   -1.740  1.00 0.00 ? 189 ILE A HD12 2  
ATOM   7472   H  HD13 . ILE A 1 189 ? -14.708 7.574   -2.451  1.00 0.00 ? 189 ILE A HD13 2  
ATOM   7473   N  N    . LYS A 1 190 ? -16.947 11.817  -0.332  1.00 0.00 ? 190 LYS A N    2  
ATOM   7474   C  CA   . LYS A 1 190 ? -16.808 13.298  -0.403  1.00 0.00 ? 190 LYS A CA   2  
ATOM   7475   C  C    . LYS A 1 190 ? -17.509 13.949  0.795   1.00 0.00 ? 190 LYS A C    2  
ATOM   7476   O  O    . LYS A 1 190 ? -17.166 15.039  1.206   1.00 0.00 ? 190 LYS A O    2  
ATOM   7477   C  CB   . LYS A 1 190 ? -17.453 13.792  -1.699  1.00 0.00 ? 190 LYS A CB   2  
ATOM   7478   C  CG   . LYS A 1 190 ? -16.408 13.813  -2.815  1.00 0.00 ? 190 LYS A CG   2  
ATOM   7479   C  CD   . LYS A 1 190 ? -17.104 14.028  -4.160  1.00 0.00 ? 190 LYS A CD   2  
ATOM   7480   C  CE   . LYS A 1 190 ? -16.509 15.255  -4.853  1.00 0.00 ? 190 LYS A CE   2  
ATOM   7481   N  NZ   . LYS A 1 190 ? -16.890 16.484  -4.099  1.00 0.00 ? 190 LYS A NZ   2  
ATOM   7482   H  H    . LYS A 1 190 ? -17.596 11.362  -0.909  1.00 0.00 ? 190 LYS A H    2  
ATOM   7483   H  HA   . LYS A 1 190 ? -15.762 13.564  -0.398  1.00 0.00 ? 190 LYS A HA   2  
ATOM   7484   H  HB2  . LYS A 1 190 ? -18.256 13.125  -1.972  1.00 0.00 ? 190 LYS A HB2  2  
ATOM   7485   H  HB3  . LYS A 1 190 ? -17.846 14.785  -1.556  1.00 0.00 ? 190 LYS A HB3  2  
ATOM   7486   H  HG2  . LYS A 1 190 ? -15.707 14.616  -2.638  1.00 0.00 ? 190 LYS A HG2  2  
ATOM   7487   H  HG3  . LYS A 1 190 ? -15.879 12.871  -2.833  1.00 0.00 ? 190 LYS A HG3  2  
ATOM   7488   H  HD2  . LYS A 1 190 ? -16.960 13.157  -4.784  1.00 0.00 ? 190 LYS A HD2  2  
ATOM   7489   H  HD3  . LYS A 1 190 ? -18.160 14.185  -3.999  1.00 0.00 ? 190 LYS A HD3  2  
ATOM   7490   H  HE2  . LYS A 1 190 ? -15.433 15.167  -4.877  1.00 0.00 ? 190 LYS A HE2  2  
ATOM   7491   H  HE3  . LYS A 1 190 ? -16.888 15.319  -5.862  1.00 0.00 ? 190 LYS A HE3  2  
ATOM   7492   H  HZ1  . LYS A 1 190 ? -17.488 17.086  -4.698  1.00 0.00 ? 190 LYS A HZ1  2  
ATOM   7493   H  HZ2  . LYS A 1 190 ? -16.031 17.006  -3.830  1.00 0.00 ? 190 LYS A HZ2  2  
ATOM   7494   H  HZ3  . LYS A 1 190 ? -17.416 16.217  -3.243  1.00 0.00 ? 190 LYS A HZ3  2  
ATOM   7495   N  N    . LYS A 1 191 ? -18.491 13.295  1.352   1.00 0.00 ? 191 LYS A N    2  
ATOM   7496   C  CA   . LYS A 1 191 ? -19.215 13.887  2.515   1.00 0.00 ? 191 LYS A CA   2  
ATOM   7497   C  C    . LYS A 1 191 ? -18.371 13.738  3.785   1.00 0.00 ? 191 LYS A C    2  
ATOM   7498   O  O    . LYS A 1 191 ? -18.439 14.552  4.683   1.00 0.00 ? 191 LYS A O    2  
ATOM   7499   C  CB   . LYS A 1 191 ? -20.553 13.169  2.705   1.00 0.00 ? 191 LYS A CB   2  
ATOM   7500   C  CG   . LYS A 1 191 ? -21.428 13.386  1.467   1.00 0.00 ? 191 LYS A CG   2  
ATOM   7501   C  CD   . LYS A 1 191 ? -22.860 13.722  1.896   1.00 0.00 ? 191 LYS A CD   2  
ATOM   7502   C  CE   . LYS A 1 191 ? -22.952 15.208  2.246   1.00 0.00 ? 191 LYS A CE   2  
ATOM   7503   N  NZ   . LYS A 1 191 ? -22.530 16.020  1.070   1.00 0.00 ? 191 LYS A NZ   2  
ATOM   7504   H  H    . LYS A 1 191 ? -18.759 12.419  1.003   1.00 0.00 ? 191 LYS A H    2  
ATOM   7505   H  HA   . LYS A 1 191 ? -19.396 14.935  2.327   1.00 0.00 ? 191 LYS A HA   2  
ATOM   7506   H  HB2  . LYS A 1 191 ? -20.377 12.112  2.842   1.00 0.00 ? 191 LYS A HB2  2  
ATOM   7507   H  HB3  . LYS A 1 191 ? -21.054 13.567  3.574   1.00 0.00 ? 191 LYS A HB3  2  
ATOM   7508   H  HG2  . LYS A 1 191 ? -21.026 14.201  0.884   1.00 0.00 ? 191 LYS A HG2  2  
ATOM   7509   H  HG3  . LYS A 1 191 ? -21.435 12.487  0.871   1.00 0.00 ? 191 LYS A HG3  2  
ATOM   7510   H  HD2  . LYS A 1 191 ? -23.537 13.502  1.084   1.00 0.00 ? 191 LYS A HD2  2  
ATOM   7511   H  HD3  . LYS A 1 191 ? -23.128 13.133  2.759   1.00 0.00 ? 191 LYS A HD3  2  
ATOM   7512   H  HE2  . LYS A 1 191 ? -23.971 15.454  2.506   1.00 0.00 ? 191 LYS A HE2  2  
ATOM   7513   H  HE3  . LYS A 1 191 ? -22.304 15.422  3.084   1.00 0.00 ? 191 LYS A HE3  2  
ATOM   7514   H  HZ1  . LYS A 1 191 ? -23.335 16.583  0.728   1.00 0.00 ? 191 LYS A HZ1  2  
ATOM   7515   H  HZ2  . LYS A 1 191 ? -22.202 15.387  0.313   1.00 0.00 ? 191 LYS A HZ2  2  
ATOM   7516   H  HZ3  . LYS A 1 191 ? -21.758 16.659  1.348   1.00 0.00 ? 191 LYS A HZ3  2  
ATOM   7517   N  N    . VAL A 1 192 ? -17.577 12.707  3.868   1.00 0.00 ? 192 VAL A N    2  
ATOM   7518   C  CA   . VAL A 1 192 ? -16.735 12.516  5.083   1.00 0.00 ? 192 VAL A CA   2  
ATOM   7519   C  C    . VAL A 1 192 ? -15.515 13.433  4.998   1.00 0.00 ? 192 VAL A C    2  
ATOM   7520   O  O    . VAL A 1 192 ? -14.610 13.354  5.805   1.00 0.00 ? 192 VAL A O    2  
ATOM   7521   C  CB   . VAL A 1 192 ? -16.272 11.062  5.176   1.00 0.00 ? 192 VAL A CB   2  
ATOM   7522   C  CG1  . VAL A 1 192 ? -17.473 10.156  5.455   1.00 0.00 ? 192 VAL A CG1  2  
ATOM   7523   C  CG2  . VAL A 1 192 ? -15.625 10.653  3.856   1.00 0.00 ? 192 VAL A CG2  2  
ATOM   7524   H  H    . VAL A 1 192 ? -17.536 12.064  3.134   1.00 0.00 ? 192 VAL A H    2  
ATOM   7525   H  HA   . VAL A 1 192 ? -17.311 12.767  5.961   1.00 0.00 ? 192 VAL A HA   2  
ATOM   7526   H  HB   . VAL A 1 192 ? -15.554 10.963  5.977   1.00 0.00 ? 192 VAL A HB   2  
ATOM   7527   H  HG11 . VAL A 1 192 ? -17.722 10.201  6.504   1.00 0.00 ? 192 VAL A HG11 2  
ATOM   7528   H  HG12 . VAL A 1 192 ? -17.226 9.140   5.186   1.00 0.00 ? 192 VAL A HG12 2  
ATOM   7529   H  HG13 . VAL A 1 192 ? -18.318 10.488  4.869   1.00 0.00 ? 192 VAL A HG13 2  
ATOM   7530   H  HG21 . VAL A 1 192 ? -16.354 10.724  3.067   1.00 0.00 ? 192 VAL A HG21 2  
ATOM   7531   H  HG22 . VAL A 1 192 ? -15.270 9.635   3.928   1.00 0.00 ? 192 VAL A HG22 2  
ATOM   7532   H  HG23 . VAL A 1 192 ? -14.797 11.311  3.642   1.00 0.00 ? 192 VAL A HG23 2  
ATOM   7533   N  N    . GLY A 1 193 ? -15.491 14.313  4.036   1.00 0.00 ? 193 GLY A N    2  
ATOM   7534   C  CA   . GLY A 1 193 ? -14.338 15.250  3.907   1.00 0.00 ? 193 GLY A CA   2  
ATOM   7535   C  C    . GLY A 1 193 ? -13.120 14.526  3.323   1.00 0.00 ? 193 GLY A C    2  
ATOM   7536   O  O    . GLY A 1 193 ? -11.998 14.954  3.507   1.00 0.00 ? 193 GLY A O    2  
ATOM   7537   H  H    . GLY A 1 193 ? -16.237 14.372  3.402   1.00 0.00 ? 193 GLY A H    2  
ATOM   7538   H  HA2  . GLY A 1 193 ? -14.614 16.068  3.256   1.00 0.00 ? 193 GLY A HA2  2  
ATOM   7539   H  HA3  . GLY A 1 193 ? -14.083 15.639  4.882   1.00 0.00 ? 193 GLY A HA3  2  
ATOM   7540   N  N    . LEU A 1 194 ? -13.326 13.441  2.620   1.00 0.00 ? 194 LEU A N    2  
ATOM   7541   C  CA   . LEU A 1 194 ? -12.166 12.706  2.029   1.00 0.00 ? 194 LEU A CA   2  
ATOM   7542   C  C    . LEU A 1 194 ? -12.291 12.687  0.501   1.00 0.00 ? 194 LEU A C    2  
ATOM   7543   O  O    . LEU A 1 194 ? -13.367 12.823  -0.047  1.00 0.00 ? 194 LEU A O    2  
ATOM   7544   C  CB   . LEU A 1 194 ? -12.146 11.266  2.550   1.00 0.00 ? 194 LEU A CB   2  
ATOM   7545   C  CG   . LEU A 1 194 ? -12.014 11.265  4.076   1.00 0.00 ? 194 LEU A CG   2  
ATOM   7546   C  CD1  . LEU A 1 194 ? -12.258 9.851   4.605   1.00 0.00 ? 194 LEU A CD1  2  
ATOM   7547   C  CD2  . LEU A 1 194 ? -10.606 11.720  4.480   1.00 0.00 ? 194 LEU A CD2  2  
ATOM   7548   H  H    . LEU A 1 194 ? -14.238 13.110  2.481   1.00 0.00 ? 194 LEU A H    2  
ATOM   7549   H  HA   . LEU A 1 194 ? -11.246 13.198  2.304   1.00 0.00 ? 194 LEU A HA   2  
ATOM   7550   H  HB2  . LEU A 1 194 ? -13.063 10.772  2.270   1.00 0.00 ? 194 LEU A HB2  2  
ATOM   7551   H  HB3  . LEU A 1 194 ? -11.309 10.739  2.117   1.00 0.00 ? 194 LEU A HB3  2  
ATOM   7552   H  HG   . LEU A 1 194 ? -12.746 11.937  4.500   1.00 0.00 ? 194 LEU A HG   2  
ATOM   7553   H  HD11 . LEU A 1 194 ? -13.259 9.784   5.006   1.00 0.00 ? 194 LEU A HD11 2  
ATOM   7554   H  HD12 . LEU A 1 194 ? -11.543 9.629   5.384   1.00 0.00 ? 194 LEU A HD12 2  
ATOM   7555   H  HD13 . LEU A 1 194 ? -12.145 9.140   3.800   1.00 0.00 ? 194 LEU A HD13 2  
ATOM   7556   H  HD21 . LEU A 1 194 ? -10.566 12.799  4.489   1.00 0.00 ? 194 LEU A HD21 2  
ATOM   7557   H  HD22 . LEU A 1 194 ? -9.885  11.339  3.774   1.00 0.00 ? 194 LEU A HD22 2  
ATOM   7558   H  HD23 . LEU A 1 194 ? -10.376 11.343  5.467   1.00 0.00 ? 194 LEU A HD23 2  
ATOM   7559   N  N    . GLY A 1 195 ? -11.196 12.502  -0.185  1.00 0.00 ? 195 GLY A N    2  
ATOM   7560   C  CA   . GLY A 1 195 ? -11.238 12.455  -1.676  1.00 0.00 ? 195 GLY A CA   2  
ATOM   7561   C  C    . GLY A 1 195 ? -11.283 13.872  -2.259  1.00 0.00 ? 195 GLY A C    2  
ATOM   7562   O  O    . GLY A 1 195 ? -11.690 14.072  -3.387  1.00 0.00 ? 195 GLY A O    2  
ATOM   7563   H  H    . GLY A 1 195 ? -10.345 12.382  0.284   1.00 0.00 ? 195 GLY A H    2  
ATOM   7564   H  HA2  . GLY A 1 195 ? -10.357 11.946  -2.042  1.00 0.00 ? 195 GLY A HA2  2  
ATOM   7565   H  HA3  . GLY A 1 195 ? -12.120 11.916  -1.991  1.00 0.00 ? 195 GLY A HA3  2  
ATOM   7566   N  N    . LYS A 1 196 ? -10.866 14.860  -1.512  1.00 0.00 ? 196 LYS A N    2  
ATOM   7567   C  CA   . LYS A 1 196 ? -10.895 16.254  -2.047  1.00 0.00 ? 196 LYS A CA   2  
ATOM   7568   C  C    . LYS A 1 196 ? -9.905  16.382  -3.209  1.00 0.00 ? 196 LYS A C    2  
ATOM   7569   O  O    . LYS A 1 196 ? -10.054 17.218  -4.078  1.00 0.00 ? 196 LYS A O    2  
ATOM   7570   C  CB   . LYS A 1 196 ? -10.511 17.233  -0.936  1.00 0.00 ? 196 LYS A CB   2  
ATOM   7571   C  CG   . LYS A 1 196 ? -11.554 17.168  0.181   1.00 0.00 ? 196 LYS A CG   2  
ATOM   7572   C  CD   . LYS A 1 196 ? -10.897 17.518  1.518   1.00 0.00 ? 196 LYS A CD   2  
ATOM   7573   C  CE   . LYS A 1 196 ? -11.981 17.833  2.552   1.00 0.00 ? 196 LYS A CE   2  
ATOM   7574   N  NZ   . LYS A 1 196 ? -11.545 17.347  3.893   1.00 0.00 ? 196 LYS A NZ   2  
ATOM   7575   H  H    . LYS A 1 196 ? -10.535 14.687  -0.605  1.00 0.00 ? 196 LYS A H    2  
ATOM   7576   H  HA   . LYS A 1 196 ? -11.891 16.483  -2.396  1.00 0.00 ? 196 LYS A HA   2  
ATOM   7577   H  HB2  . LYS A 1 196 ? -9.540  16.968  -0.542  1.00 0.00 ? 196 LYS A HB2  2  
ATOM   7578   H  HB3  . LYS A 1 196 ? -10.476 18.235  -1.336  1.00 0.00 ? 196 LYS A HB3  2  
ATOM   7579   H  HG2  . LYS A 1 196 ? -12.347 17.870  -0.027  1.00 0.00 ? 196 LYS A HG2  2  
ATOM   7580   H  HG3  . LYS A 1 196 ? -11.961 16.169  0.233   1.00 0.00 ? 196 LYS A HG3  2  
ATOM   7581   H  HD2  . LYS A 1 196 ? -10.305 16.681  1.858   1.00 0.00 ? 196 LYS A HD2  2  
ATOM   7582   H  HD3  . LYS A 1 196 ? -10.261 18.381  1.391   1.00 0.00 ? 196 LYS A HD3  2  
ATOM   7583   H  HE2  . LYS A 1 196 ? -12.142 18.900  2.591   1.00 0.00 ? 196 LYS A HE2  2  
ATOM   7584   H  HE3  . LYS A 1 196 ? -12.900 17.341  2.272   1.00 0.00 ? 196 LYS A HE3  2  
ATOM   7585   H  HZ1  . LYS A 1 196 ? -10.553 17.041  3.847   1.00 0.00 ? 196 LYS A HZ1  2  
ATOM   7586   H  HZ2  . LYS A 1 196 ? -12.144 16.546  4.182   1.00 0.00 ? 196 LYS A HZ2  2  
ATOM   7587   H  HZ3  . LYS A 1 196 ? -11.637 18.116  4.586   1.00 0.00 ? 196 LYS A HZ3  2  
ATOM   7588   N  N    . GLY A 1 197 ? -8.901  15.551  -3.233  1.00 0.00 ? 197 GLY A N    2  
ATOM   7589   C  CA   . GLY A 1 197 ? -7.901  15.607  -4.337  1.00 0.00 ? 197 GLY A CA   2  
ATOM   7590   C  C    . GLY A 1 197 ? -8.167  14.483  -5.339  1.00 0.00 ? 197 GLY A C    2  
ATOM   7591   O  O    . GLY A 1 197 ? -7.511  14.379  -6.357  1.00 0.00 ? 197 GLY A O    2  
ATOM   7592   H  H    . GLY A 1 197 ? -8.815  14.881  -2.525  1.00 0.00 ? 197 GLY A H    2  
ATOM   7593   H  HA2  . GLY A 1 197 ? -7.971  16.563  -4.840  1.00 0.00 ? 197 GLY A HA2  2  
ATOM   7594   H  HA3  . GLY A 1 197 ? -6.910  15.485  -3.929  1.00 0.00 ? 197 GLY A HA3  2  
ATOM   7595   N  N    . GLY A 1 198 ? -9.106  13.626  -5.052  1.00 0.00 ? 198 GLY A N    2  
ATOM   7596   C  CA   . GLY A 1 198 ? -9.390  12.495  -5.982  1.00 0.00 ? 198 GLY A CA   2  
ATOM   7597   C  C    . GLY A 1 198 ? -9.904  13.017  -7.323  1.00 0.00 ? 198 GLY A C    2  
ATOM   7598   O  O    . GLY A 1 198 ? -10.840 13.788  -7.395  1.00 0.00 ? 198 GLY A O    2  
ATOM   7599   H  H    . GLY A 1 198 ? -9.615  13.714  -4.217  1.00 0.00 ? 198 GLY A H    2  
ATOM   7600   H  HA2  . GLY A 1 198 ? -8.481  11.936  -6.150  1.00 0.00 ? 198 GLY A HA2  2  
ATOM   7601   H  HA3  . GLY A 1 198 ? -10.132 11.848  -5.541  1.00 0.00 ? 198 GLY A HA3  2  
ATOM   7602   N  N    . SER A 1 199 ? -9.290  12.584  -8.390  1.00 0.00 ? 199 SER A N    2  
ATOM   7603   C  CA   . SER A 1 199 ? -9.720  13.025  -9.746  1.00 0.00 ? 199 SER A CA   2  
ATOM   7604   C  C    . SER A 1 199 ? -9.768  11.811  -10.675 1.00 0.00 ? 199 SER A C    2  
ATOM   7605   O  O    . SER A 1 199 ? -9.325  10.734  -10.327 1.00 0.00 ? 199 SER A O    2  
ATOM   7606   C  CB   . SER A 1 199 ? -8.724  14.049  -10.292 1.00 0.00 ? 199 SER A CB   2  
ATOM   7607   O  OG   . SER A 1 199 ? -7.760  13.383  -11.098 1.00 0.00 ? 199 SER A OG   2  
ATOM   7608   H  H    . SER A 1 199 ? -8.542  11.958  -8.292  1.00 0.00 ? 199 SER A H    2  
ATOM   7609   H  HA   . SER A 1 199 ? -10.702 13.472  -9.685  1.00 0.00 ? 199 SER A HA   2  
ATOM   7610   H  HB2  . SER A 1 199 ? -9.245  14.777  -10.892 1.00 0.00 ? 199 SER A HB2  2  
ATOM   7611   H  HB3  . SER A 1 199 ? -8.234  14.548  -9.465  1.00 0.00 ? 199 SER A HB3  2  
ATOM   7612   H  HG   . SER A 1 199 ? -7.476  13.992  -11.784 1.00 0.00 ? 199 SER A HG   2  
ATOM   7613   N  N    . LEU A 1 200 ? -10.306 11.969  -11.853 1.00 0.00 ? 200 LEU A N    2  
ATOM   7614   C  CA   . LEU A 1 200 ? -10.381 10.818  -12.797 1.00 0.00 ? 200 LEU A CA   2  
ATOM   7615   C  C    . LEU A 1 200 ? -8.971  10.419  -13.231 1.00 0.00 ? 200 LEU A C    2  
ATOM   7616   O  O    . LEU A 1 200 ? -8.677  9.256   -13.423 1.00 0.00 ? 200 LEU A O    2  
ATOM   7617   C  CB   . LEU A 1 200 ? -11.199 11.216  -14.028 1.00 0.00 ? 200 LEU A CB   2  
ATOM   7618   C  CG   . LEU A 1 200 ? -12.639 11.522  -13.616 1.00 0.00 ? 200 LEU A CG   2  
ATOM   7619   C  CD1  . LEU A 1 200 ? -13.201 12.630  -14.507 1.00 0.00 ? 200 LEU A CD1  2  
ATOM   7620   C  CD2  . LEU A 1 200 ? -13.492 10.262  -13.775 1.00 0.00 ? 200 LEU A CD2  2  
ATOM   7621   H  H    . LEU A 1 200 ? -10.661 12.844  -12.117 1.00 0.00 ? 200 LEU A H    2  
ATOM   7622   H  HA   . LEU A 1 200 ? -10.852 9.980   -12.304 1.00 0.00 ? 200 LEU A HA   2  
ATOM   7623   H  HB2  . LEU A 1 200 ? -10.760 12.093  -14.481 1.00 0.00 ? 200 LEU A HB2  2  
ATOM   7624   H  HB3  . LEU A 1 200 ? -11.196 10.404  -14.740 1.00 0.00 ? 200 LEU A HB3  2  
ATOM   7625   H  HG   . LEU A 1 200 ? -12.659 11.845  -12.585 1.00 0.00 ? 200 LEU A HG   2  
ATOM   7626   H  HD11 . LEU A 1 200 ? -14.228 12.826  -14.235 1.00 0.00 ? 200 LEU A HD11 2  
ATOM   7627   H  HD12 . LEU A 1 200 ? -13.157 12.319  -15.541 1.00 0.00 ? 200 LEU A HD12 2  
ATOM   7628   H  HD13 . LEU A 1 200 ? -12.617 13.530  -14.377 1.00 0.00 ? 200 LEU A HD13 2  
ATOM   7629   H  HD21 . LEU A 1 200 ? -14.514 10.482  -13.504 1.00 0.00 ? 200 LEU A HD21 2  
ATOM   7630   H  HD22 . LEU A 1 200 ? -13.109 9.483   -13.133 1.00 0.00 ? 200 LEU A HD22 2  
ATOM   7631   H  HD23 . LEU A 1 200 ? -13.456 9.930   -14.803 1.00 0.00 ? 200 LEU A HD23 2  
ATOM   7632   N  N    . LYS A 1 201 ? -8.097  11.372  -13.392 1.00 0.00 ? 201 LYS A N    2  
ATOM   7633   C  CA   . LYS A 1 201 ? -6.711  11.040  -13.818 1.00 0.00 ? 201 LYS A CA   2  
ATOM   7634   C  C    . LYS A 1 201 ? -5.953  10.401  -12.652 1.00 0.00 ? 201 LYS A C    2  
ATOM   7635   O  O    . LYS A 1 201 ? -5.036  9.630   -12.849 1.00 0.00 ? 201 LYS A O    2  
ATOM   7636   C  CB   . LYS A 1 201 ? -5.987  12.317  -14.252 1.00 0.00 ? 201 LYS A CB   2  
ATOM   7637   C  CG   . LYS A 1 201 ? -4.664  11.946  -14.927 1.00 0.00 ? 201 LYS A CG   2  
ATOM   7638   C  CD   . LYS A 1 201 ? -3.716  13.147  -14.905 1.00 0.00 ? 201 LYS A CD   2  
ATOM   7639   C  CE   . LYS A 1 201 ? -4.243  14.232  -15.847 1.00 0.00 ? 201 LYS A CE   2  
ATOM   7640   N  NZ   . LYS A 1 201 ? -3.157  15.213  -16.130 1.00 0.00 ? 201 LYS A NZ   2  
ATOM   7641   H  H    . LYS A 1 201 ? -8.354  12.305  -13.234 1.00 0.00 ? 201 LYS A H    2  
ATOM   7642   H  HA   . LYS A 1 201 ? -6.745  10.348  -14.646 1.00 0.00 ? 201 LYS A HA   2  
ATOM   7643   H  HB2  . LYS A 1 201 ? -6.607  12.865  -14.946 1.00 0.00 ? 201 LYS A HB2  2  
ATOM   7644   H  HB3  . LYS A 1 201 ? -5.788  12.929  -13.385 1.00 0.00 ? 201 LYS A HB3  2  
ATOM   7645   H  HG2  . LYS A 1 201 ? -4.211  11.120  -14.399 1.00 0.00 ? 201 LYS A HG2  2  
ATOM   7646   H  HG3  . LYS A 1 201 ? -4.852  11.658  -15.951 1.00 0.00 ? 201 LYS A HG3  2  
ATOM   7647   H  HD2  . LYS A 1 201 ? -3.653  13.540  -13.900 1.00 0.00 ? 201 LYS A HD2  2  
ATOM   7648   H  HD3  . LYS A 1 201 ? -2.734  12.837  -15.232 1.00 0.00 ? 201 LYS A HD3  2  
ATOM   7649   H  HE2  . LYS A 1 201 ? -4.569  13.779  -16.771 1.00 0.00 ? 201 LYS A HE2  2  
ATOM   7650   H  HE3  . LYS A 1 201 ? -5.074  14.739  -15.381 1.00 0.00 ? 201 LYS A HE3  2  
ATOM   7651   H  HZ1  . LYS A 1 201 ? -2.542  14.841  -16.882 1.00 0.00 ? 201 LYS A HZ1  2  
ATOM   7652   H  HZ2  . LYS A 1 201 ? -2.596  15.367  -15.267 1.00 0.00 ? 201 LYS A HZ2  2  
ATOM   7653   H  HZ3  . LYS A 1 201 ? -3.574  16.112  -16.440 1.00 0.00 ? 201 LYS A HZ3  2  
ATOM   7654   N  N    . ASN A 1 202 ? -6.320  10.723  -11.440 1.00 0.00 ? 202 ASN A N    2  
ATOM   7655   C  CA   . ASN A 1 202 ? -5.610  10.143  -10.264 1.00 0.00 ? 202 ASN A CA   2  
ATOM   7656   C  C    . ASN A 1 202 ? -6.499  9.106   -9.572  1.00 0.00 ? 202 ASN A C    2  
ATOM   7657   O  O    . ASN A 1 202 ? -6.153  8.581   -8.532  1.00 0.00 ? 202 ASN A O    2  
ATOM   7658   C  CB   . ASN A 1 202 ? -5.280  11.262  -9.272  1.00 0.00 ? 202 ASN A CB   2  
ATOM   7659   C  CG   . ASN A 1 202 ? -4.362  12.293  -9.935  1.00 0.00 ? 202 ASN A CG   2  
ATOM   7660   O  OD1  . ASN A 1 202 ? -3.540  12.900  -9.277  1.00 0.00 ? 202 ASN A OD1  2  
ATOM   7661   N  ND2  . ASN A 1 202 ? -4.467  12.523  -11.216 1.00 0.00 ? 202 ASN A ND2  2  
ATOM   7662   H  H    . ASN A 1 202 ? -7.055  11.355  -11.296 1.00 0.00 ? 202 ASN A H    2  
ATOM   7663   H  HA   . ASN A 1 202 ? -4.695  9.671   -10.588 1.00 0.00 ? 202 ASN A HA   2  
ATOM   7664   H  HB2  . ASN A 1 202 ? -6.196  11.744  -8.959  1.00 0.00 ? 202 ASN A HB2  2  
ATOM   7665   H  HB3  . ASN A 1 202 ? -4.784  10.843  -8.411  1.00 0.00 ? 202 ASN A HB3  2  
ATOM   7666   H  HD21 . ASN A 1 202 ? -5.130  12.039  -11.750 1.00 0.00 ? 202 ASN A HD21 2  
ATOM   7667   H  HD22 . ASN A 1 202 ? -3.881  13.181  -11.645 1.00 0.00 ? 202 ASN A HD22 2  
ATOM   7668   N  N    . THR A 1 203 ? -7.640  8.802   -10.130 1.00 0.00 ? 203 THR A N    2  
ATOM   7669   C  CA   . THR A 1 203 ? -8.527  7.796   -9.480  1.00 0.00 ? 203 THR A CA   2  
ATOM   7670   C  C    . THR A 1 203 ? -9.401  7.114   -10.534 1.00 0.00 ? 203 THR A C    2  
ATOM   7671   O  O    . THR A 1 203 ? -10.150 7.755   -11.244 1.00 0.00 ? 203 THR A O    2  
ATOM   7672   C  CB   . THR A 1 203 ? -9.423  8.496   -8.455  1.00 0.00 ? 203 THR A CB   2  
ATOM   7673   O  OG1  . THR A 1 203 ? -8.663  9.467   -7.749  1.00 0.00 ? 203 THR A OG1  2  
ATOM   7674   C  CG2  . THR A 1 203 ? -9.977  7.466   -7.470  1.00 0.00 ? 203 THR A CG2  2  
ATOM   7675   H  H    . THR A 1 203 ? -7.912  9.231   -10.971 1.00 0.00 ? 203 THR A H    2  
ATOM   7676   H  HA   . THR A 1 203 ? -7.923  7.055   -8.980  1.00 0.00 ? 203 THR A HA   2  
ATOM   7677   H  HB   . THR A 1 203 ? -10.244 8.979   -8.963  1.00 0.00 ? 203 THR A HB   2  
ATOM   7678   H  HG1  . THR A 1 203 ? -9.265  9.963   -7.189  1.00 0.00 ? 203 THR A HG1  2  
ATOM   7679   H  HG21 . THR A 1 203 ? -10.216 6.554   -7.998  1.00 0.00 ? 203 THR A HG21 2  
ATOM   7680   H  HG22 . THR A 1 203 ? -10.870 7.856   -7.005  1.00 0.00 ? 203 THR A HG22 2  
ATOM   7681   H  HG23 . THR A 1 203 ? -9.237  7.259   -6.711  1.00 0.00 ? 203 THR A HG23 2  
ATOM   7682   N  N    . LEU A 1 204 ? -9.319  5.814   -10.635 1.00 0.00 ? 204 LEU A N    2  
ATOM   7683   C  CA   . LEU A 1 204 ? -10.154 5.096   -11.636 1.00 0.00 ? 204 LEU A CA   2  
ATOM   7684   C  C    . LEU A 1 204 ? -11.572 4.952   -11.079 1.00 0.00 ? 204 LEU A C    2  
ATOM   7685   O  O    . LEU A 1 204 ? -11.803 4.222   -10.136 1.00 0.00 ? 204 LEU A O    2  
ATOM   7686   C  CB   . LEU A 1 204 ? -9.560  3.709   -11.896 1.00 0.00 ? 204 LEU A CB   2  
ATOM   7687   C  CG   . LEU A 1 204 ? -10.278 3.057   -13.078 1.00 0.00 ? 204 LEU A CG   2  
ATOM   7688   C  CD1  . LEU A 1 204 ? -9.558  3.422   -14.378 1.00 0.00 ? 204 LEU A CD1  2  
ATOM   7689   C  CD2  . LEU A 1 204 ? -10.271 1.537   -12.901 1.00 0.00 ? 204 LEU A CD2  2  
ATOM   7690   H  H    . LEU A 1 204 ? -8.714  5.311   -10.046 1.00 0.00 ? 204 LEU A H    2  
ATOM   7691   H  HA   . LEU A 1 204 ? -10.183 5.658   -12.558 1.00 0.00 ? 204 LEU A HA   2  
ATOM   7692   H  HB2  . LEU A 1 204 ? -8.508  3.807   -12.122 1.00 0.00 ? 204 LEU A HB2  2  
ATOM   7693   H  HB3  . LEU A 1 204 ? -9.685  3.093   -11.018 1.00 0.00 ? 204 LEU A HB3  2  
ATOM   7694   H  HG   . LEU A 1 204 ? -11.298 3.413   -13.120 1.00 0.00 ? 204 LEU A HG   2  
ATOM   7695   H  HD11 . LEU A 1 204 ? -9.346  4.481   -14.386 1.00 0.00 ? 204 LEU A HD11 2  
ATOM   7696   H  HD12 . LEU A 1 204 ? -10.186 3.174   -15.220 1.00 0.00 ? 204 LEU A HD12 2  
ATOM   7697   H  HD13 . LEU A 1 204 ? -8.633  2.869   -14.444 1.00 0.00 ? 204 LEU A HD13 2  
ATOM   7698   H  HD21 . LEU A 1 204 ? -11.097 1.243   -12.272 1.00 0.00 ? 204 LEU A HD21 2  
ATOM   7699   H  HD22 . LEU A 1 204 ? -9.342  1.233   -12.441 1.00 0.00 ? 204 LEU A HD22 2  
ATOM   7700   H  HD23 . LEU A 1 204 ? -10.367 1.062   -13.867 1.00 0.00 ? 204 LEU A HD23 2  
ATOM   7701   N  N    . VAL A 1 205 ? -12.527 5.641   -11.646 1.00 0.00 ? 205 VAL A N    2  
ATOM   7702   C  CA   . VAL A 1 205 ? -13.920 5.538   -11.131 1.00 0.00 ? 205 VAL A CA   2  
ATOM   7703   C  C    . VAL A 1 205 ? -14.728 4.599   -12.027 1.00 0.00 ? 205 VAL A C    2  
ATOM   7704   O  O    . VAL A 1 205 ? -14.758 4.751   -13.232 1.00 0.00 ? 205 VAL A O    2  
ATOM   7705   C  CB   . VAL A 1 205 ? -14.567 6.923   -11.131 1.00 0.00 ? 205 VAL A CB   2  
ATOM   7706   C  CG1  . VAL A 1 205 ? -16.075 6.782   -10.915 1.00 0.00 ? 205 VAL A CG1  2  
ATOM   7707   C  CG2  . VAL A 1 205 ? -13.967 7.764   -10.003 1.00 0.00 ? 205 VAL A CG2  2  
ATOM   7708   H  H    . VAL A 1 205 ? -12.334 6.230   -12.407 1.00 0.00 ? 205 VAL A H    2  
ATOM   7709   H  HA   . VAL A 1 205 ? -13.903 5.149   -10.124 1.00 0.00 ? 205 VAL A HA   2  
ATOM   7710   H  HB   . VAL A 1 205 ? -14.383 7.405   -12.081 1.00 0.00 ? 205 VAL A HB   2  
ATOM   7711   H  HG11 . VAL A 1 205 ? -16.485 7.733   -10.610 1.00 0.00 ? 205 VAL A HG11 2  
ATOM   7712   H  HG12 . VAL A 1 205 ? -16.261 6.047   -10.146 1.00 0.00 ? 205 VAL A HG12 2  
ATOM   7713   H  HG13 . VAL A 1 205 ? -16.542 6.467   -11.836 1.00 0.00 ? 205 VAL A HG13 2  
ATOM   7714   H  HG21 . VAL A 1 205 ? -14.030 7.217   -9.074  1.00 0.00 ? 205 VAL A HG21 2  
ATOM   7715   H  HG22 . VAL A 1 205 ? -14.514 8.690   -9.914  1.00 0.00 ? 205 VAL A HG22 2  
ATOM   7716   H  HG23 . VAL A 1 205 ? -12.932 7.978   -10.225 1.00 0.00 ? 205 VAL A HG23 2  
ATOM   7717   N  N    . LEU A 1 206 ? -15.382 3.629   -11.448 1.00 0.00 ? 206 LEU A N    2  
ATOM   7718   C  CA   . LEU A 1 206 ? -16.186 2.681   -12.266 1.00 0.00 ? 206 LEU A CA   2  
ATOM   7719   C  C    . LEU A 1 206 ? -17.677 2.973   -12.083 1.00 0.00 ? 206 LEU A C    2  
ATOM   7720   O  O    . LEU A 1 206 ? -18.117 3.405   -11.033 1.00 0.00 ? 206 LEU A O    2  
ATOM   7721   C  CB   . LEU A 1 206 ? -15.890 1.246   -11.821 1.00 0.00 ? 206 LEU A CB   2  
ATOM   7722   C  CG   . LEU A 1 206 ? -14.395 0.964   -11.964 1.00 0.00 ? 206 LEU A CG   2  
ATOM   7723   C  CD1  . LEU A 1 206 ? -13.982 -0.116  -10.962 1.00 0.00 ? 206 LEU A CD1  2  
ATOM   7724   C  CD2  . LEU A 1 206 ? -14.099 0.476   -13.384 1.00 0.00 ? 206 LEU A CD2  2  
ATOM   7725   H  H    . LEU A 1 206 ? -15.342 3.524   -10.475 1.00 0.00 ? 206 LEU A H    2  
ATOM   7726   H  HA   . LEU A 1 206 ? -15.925 2.793   -13.307 1.00 0.00 ? 206 LEU A HA   2  
ATOM   7727   H  HB2  . LEU A 1 206 ? -16.184 1.124   -10.788 1.00 0.00 ? 206 LEU A HB2  2  
ATOM   7728   H  HB3  . LEU A 1 206 ? -16.446 0.556   -12.438 1.00 0.00 ? 206 LEU A HB3  2  
ATOM   7729   H  HG   . LEU A 1 206 ? -13.837 1.868   -11.768 1.00 0.00 ? 206 LEU A HG   2  
ATOM   7730   H  HD11 . LEU A 1 206 ? -14.816 -0.781  -10.787 1.00 0.00 ? 206 LEU A HD11 2  
ATOM   7731   H  HD12 . LEU A 1 206 ? -13.691 0.349   -10.031 1.00 0.00 ? 206 LEU A HD12 2  
ATOM   7732   H  HD13 . LEU A 1 206 ? -13.151 -0.679  -11.360 1.00 0.00 ? 206 LEU A HD13 2  
ATOM   7733   H  HD21 . LEU A 1 206 ? -13.034 0.506   -13.561 1.00 0.00 ? 206 LEU A HD21 2  
ATOM   7734   H  HD22 . LEU A 1 206 ? -14.601 1.115   -14.097 1.00 0.00 ? 206 LEU A HD22 2  
ATOM   7735   H  HD23 . LEU A 1 206 ? -14.454 -0.537  -13.498 1.00 0.00 ? 206 LEU A HD23 2  
ATOM   7736   N  N    . GLY A 1 207 ? -18.456 2.734   -13.104 1.00 0.00 ? 207 GLY A N    2  
ATOM   7737   C  CA   . GLY A 1 207 ? -19.920 2.985   -13.006 1.00 0.00 ? 207 GLY A CA   2  
ATOM   7738   C  C    . GLY A 1 207 ? -20.649 1.644   -12.897 1.00 0.00 ? 207 GLY A C    2  
ATOM   7739   O  O    . GLY A 1 207 ? -20.202 0.641   -13.417 1.00 0.00 ? 207 GLY A O    2  
ATOM   7740   H  H    . GLY A 1 207 ? -18.076 2.384   -13.936 1.00 0.00 ? 207 GLY A H    2  
ATOM   7741   H  HA2  . GLY A 1 207 ? -20.126 3.583   -12.130 1.00 0.00 ? 207 GLY A HA2  2  
ATOM   7742   H  HA3  . GLY A 1 207 ? -20.259 3.506   -13.889 1.00 0.00 ? 207 GLY A HA3  2  
ATOM   7743   N  N    . LYS A 1 208 ? -21.761 1.615   -12.219 1.00 0.00 ? 208 LYS A N    2  
ATOM   7744   C  CA   . LYS A 1 208 ? -22.511 0.336   -12.068 1.00 0.00 ? 208 LYS A CA   2  
ATOM   7745   C  C    . LYS A 1 208 ? -22.540 -0.418  -13.401 1.00 0.00 ? 208 LYS A C    2  
ATOM   7746   O  O    . LYS A 1 208 ? -22.639 -1.630  -13.431 1.00 0.00 ? 208 LYS A O    2  
ATOM   7747   C  CB   . LYS A 1 208 ? -23.944 0.636   -11.621 1.00 0.00 ? 208 LYS A CB   2  
ATOM   7748   C  CG   . LYS A 1 208 ? -24.620 -0.660  -11.167 1.00 0.00 ? 208 LYS A CG   2  
ATOM   7749   C  CD   . LYS A 1 208 ? -24.543 -0.772  -9.643  1.00 0.00 ? 208 LYS A CD   2  
ATOM   7750   C  CE   . LYS A 1 208 ? -25.114 -2.121  -9.201  1.00 0.00 ? 208 LYS A CE   2  
ATOM   7751   N  NZ   . LYS A 1 208 ? -25.022 -2.239  -7.718  1.00 0.00 ? 208 LYS A NZ   2  
ATOM   7752   H  H    . LYS A 1 208 ? -22.101 2.435   -11.803 1.00 0.00 ? 208 LYS A H    2  
ATOM   7753   H  HA   . LYS A 1 208 ? -22.026 -0.278  -11.323 1.00 0.00 ? 208 LYS A HA   2  
ATOM   7754   H  HB2  . LYS A 1 208 ? -23.925 1.340   -10.802 1.00 0.00 ? 208 LYS A HB2  2  
ATOM   7755   H  HB3  . LYS A 1 208 ? -24.498 1.058   -12.446 1.00 0.00 ? 208 LYS A HB3  2  
ATOM   7756   H  HG2  . LYS A 1 208 ? -25.654 -0.654  -11.478 1.00 0.00 ? 208 LYS A HG2  2  
ATOM   7757   H  HG3  . LYS A 1 208 ? -24.115 -1.504  -11.613 1.00 0.00 ? 208 LYS A HG3  2  
ATOM   7758   H  HD2  . LYS A 1 208 ? -23.513 -0.695  -9.326  1.00 0.00 ? 208 LYS A HD2  2  
ATOM   7759   H  HD3  . LYS A 1 208 ? -25.119 0.024   -9.193  1.00 0.00 ? 208 LYS A HD3  2  
ATOM   7760   H  HE2  . LYS A 1 208 ? -26.149 -2.192  -9.504  1.00 0.00 ? 208 LYS A HE2  2  
ATOM   7761   H  HE3  . LYS A 1 208 ? -24.549 -2.918  -9.662  1.00 0.00 ? 208 LYS A HE3  2  
ATOM   7762   H  HZ1  . LYS A 1 208 ? -24.076 -1.943  -7.404  1.00 0.00 ? 208 LYS A HZ1  2  
ATOM   7763   H  HZ2  . LYS A 1 208 ? -25.187 -3.228  -7.438  1.00 0.00 ? 208 LYS A HZ2  2  
ATOM   7764   H  HZ3  . LYS A 1 208 ? -25.738 -1.629  -7.276  1.00 0.00 ? 208 LYS A HZ3  2  
ATOM   7765   N  N    . ASP A 1 209 ? -22.460 0.277   -14.505 1.00 0.00 ? 209 ASP A N    2  
ATOM   7766   C  CA   . ASP A 1 209 ? -22.494 -0.427  -15.821 1.00 0.00 ? 209 ASP A CA   2  
ATOM   7767   C  C    . ASP A 1 209 ? -21.688 0.352   -16.859 1.00 0.00 ? 209 ASP A C    2  
ATOM   7768   O  O    . ASP A 1 209 ? -21.736 0.063   -18.039 1.00 0.00 ? 209 ASP A O    2  
ATOM   7769   C  CB   . ASP A 1 209 ? -23.945 -0.545  -16.288 1.00 0.00 ? 209 ASP A CB   2  
ATOM   7770   C  CG   . ASP A 1 209 ? -24.492 0.846   -16.614 1.00 0.00 ? 209 ASP A CG   2  
ATOM   7771   O  OD1  . ASP A 1 209 ? -23.755 1.804   -16.451 1.00 0.00 ? 209 ASP A OD1  2  
ATOM   7772   O  OD2  . ASP A 1 209 ? -25.638 0.928   -17.022 1.00 0.00 ? 209 ASP A OD2  2  
ATOM   7773   H  H    . ASP A 1 209 ? -22.386 1.253   -14.469 1.00 0.00 ? 209 ASP A H    2  
ATOM   7774   H  HA   . ASP A 1 209 ? -22.073 -1.413  -15.709 1.00 0.00 ? 209 ASP A HA   2  
ATOM   7775   H  HB2  . ASP A 1 209 ? -23.990 -1.169  -17.169 1.00 0.00 ? 209 ASP A HB2  2  
ATOM   7776   H  HB3  . ASP A 1 209 ? -24.536 -0.985  -15.502 1.00 0.00 ? 209 ASP A HB3  2  
ATOM   7777   N  N    . LYS A 1 210 ? -20.951 1.336   -16.436 1.00 0.00 ? 210 LYS A N    2  
ATOM   7778   C  CA   . LYS A 1 210 ? -20.145 2.129   -17.409 1.00 0.00 ? 210 LYS A CA   2  
ATOM   7779   C  C    . LYS A 1 210 ? -18.810 2.528   -16.775 1.00 0.00 ? 210 LYS A C    2  
ATOM   7780   O  O    . LYS A 1 210 ? -18.697 2.666   -15.573 1.00 0.00 ? 210 LYS A O    2  
ATOM   7781   C  CB   . LYS A 1 210 ? -20.920 3.389   -17.801 1.00 0.00 ? 210 LYS A CB   2  
ATOM   7782   C  CG   . LYS A 1 210 ? -21.265 4.186   -16.542 1.00 0.00 ? 210 LYS A CG   2  
ATOM   7783   C  CD   . LYS A 1 210 ? -21.999 5.470   -16.932 1.00 0.00 ? 210 LYS A CD   2  
ATOM   7784   C  CE   . LYS A 1 210 ? -22.284 6.295   -15.676 1.00 0.00 ? 210 LYS A CE   2  
ATOM   7785   N  NZ   . LYS A 1 210 ? -23.755 6.363   -15.450 1.00 0.00 ? 210 LYS A NZ   2  
ATOM   7786   H  H    . LYS A 1 210 ? -20.930 1.553   -15.483 1.00 0.00 ? 210 LYS A H    2  
ATOM   7787   H  HA   . LYS A 1 210 ? -19.960 1.533   -18.291 1.00 0.00 ? 210 LYS A HA   2  
ATOM   7788   H  HB2  . LYS A 1 210 ? -20.313 3.995   -18.458 1.00 0.00 ? 210 LYS A HB2  2  
ATOM   7789   H  HB3  . LYS A 1 210 ? -21.831 3.109   -18.308 1.00 0.00 ? 210 LYS A HB3  2  
ATOM   7790   H  HG2  . LYS A 1 210 ? -21.898 3.589   -15.901 1.00 0.00 ? 210 LYS A HG2  2  
ATOM   7791   H  HG3  . LYS A 1 210 ? -20.357 4.439   -16.017 1.00 0.00 ? 210 LYS A HG3  2  
ATOM   7792   H  HD2  . LYS A 1 210 ? -21.385 6.044   -17.610 1.00 0.00 ? 210 LYS A HD2  2  
ATOM   7793   H  HD3  . LYS A 1 210 ? -22.932 5.219   -17.415 1.00 0.00 ? 210 LYS A HD3  2  
ATOM   7794   H  HE2  . LYS A 1 210 ? -21.810 5.828   -14.824 1.00 0.00 ? 210 LYS A HE2  2  
ATOM   7795   H  HE3  . LYS A 1 210 ? -21.892 7.294   -15.804 1.00 0.00 ? 210 LYS A HE3  2  
ATOM   7796   H  HZ1  . LYS A 1 210 ? -24.046 5.591   -14.819 1.00 0.00 ? 210 LYS A HZ1  2  
ATOM   7797   H  HZ2  . LYS A 1 210 ? -24.250 6.273   -16.362 1.00 0.00 ? 210 LYS A HZ2  2  
ATOM   7798   H  HZ3  . LYS A 1 210 ? -23.997 7.275   -15.014 1.00 0.00 ? 210 LYS A HZ3  2  
ATOM   7799   N  N    . VAL A 1 211 ? -17.800 2.724   -17.578 1.00 0.00 ? 211 VAL A N    2  
ATOM   7800   C  CA   . VAL A 1 211 ? -16.472 3.125   -17.030 1.00 0.00 ? 211 VAL A CA   2  
ATOM   7801   C  C    . VAL A 1 211 ? -16.285 4.629   -17.236 1.00 0.00 ? 211 VAL A C    2  
ATOM   7802   O  O    . VAL A 1 211 ? -16.483 5.145   -18.317 1.00 0.00 ? 211 VAL A O    2  
ATOM   7803   C  CB   . VAL A 1 211 ? -15.362 2.364   -17.759 1.00 0.00 ? 211 VAL A CB   2  
ATOM   7804   C  CG1  . VAL A 1 211 ? -13.998 2.889   -17.305 1.00 0.00 ? 211 VAL A CG1  2  
ATOM   7805   C  CG2  . VAL A 1 211 ? -15.468 0.873   -17.429 1.00 0.00 ? 211 VAL A CG2  2  
ATOM   7806   H  H    . VAL A 1 211 ? -17.916 2.615   -18.545 1.00 0.00 ? 211 VAL A H    2  
ATOM   7807   H  HA   . VAL A 1 211 ? -16.434 2.898   -15.974 1.00 0.00 ? 211 VAL A HA   2  
ATOM   7808   H  HB   . VAL A 1 211 ? -15.467 2.509   -18.824 1.00 0.00 ? 211 VAL A HB   2  
ATOM   7809   H  HG11 . VAL A 1 211 ? -14.005 3.037   -16.235 1.00 0.00 ? 211 VAL A HG11 2  
ATOM   7810   H  HG12 . VAL A 1 211 ? -13.792 3.828   -17.797 1.00 0.00 ? 211 VAL A HG12 2  
ATOM   7811   H  HG13 . VAL A 1 211 ? -13.233 2.172   -17.564 1.00 0.00 ? 211 VAL A HG13 2  
ATOM   7812   H  HG21 . VAL A 1 211 ? -15.493 0.741   -16.358 1.00 0.00 ? 211 VAL A HG21 2  
ATOM   7813   H  HG22 . VAL A 1 211 ? -14.613 0.354   -17.836 1.00 0.00 ? 211 VAL A HG22 2  
ATOM   7814   H  HG23 . VAL A 1 211 ? -16.372 0.473   -17.862 1.00 0.00 ? 211 VAL A HG23 2  
ATOM   7815   N  N    . TYR A 1 212 ? -15.923 5.341   -16.204 1.00 0.00 ? 212 TYR A N    2  
ATOM   7816   C  CA   . TYR A 1 212 ? -15.747 6.812   -16.345 1.00 0.00 ? 212 TYR A CA   2  
ATOM   7817   C  C    . TYR A 1 212 ? -14.473 7.126   -17.133 1.00 0.00 ? 212 TYR A C    2  
ATOM   7818   O  O    . TYR A 1 212 ? -14.510 7.836   -18.119 1.00 0.00 ? 212 TYR A O    2  
ATOM   7819   C  CB   . TYR A 1 212 ? -15.662 7.443   -14.955 1.00 0.00 ? 212 TYR A CB   2  
ATOM   7820   C  CG   . TYR A 1 212 ? -17.058 7.721   -14.452 1.00 0.00 ? 212 TYR A CG   2  
ATOM   7821   C  CD1  . TYR A 1 212 ? -17.862 6.666   -14.004 1.00 0.00 ? 212 TYR A CD1  2  
ATOM   7822   C  CD2  . TYR A 1 212 ? -17.550 9.032   -14.437 1.00 0.00 ? 212 TYR A CD2  2  
ATOM   7823   C  CE1  . TYR A 1 212 ? -19.158 6.922   -13.540 1.00 0.00 ? 212 TYR A CE1  2  
ATOM   7824   C  CE2  . TYR A 1 212 ? -18.846 9.287   -13.973 1.00 0.00 ? 212 TYR A CE2  2  
ATOM   7825   C  CZ   . TYR A 1 212 ? -19.650 8.231   -13.525 1.00 0.00 ? 212 TYR A CZ   2  
ATOM   7826   O  OH   . TYR A 1 212 ? -20.928 8.484   -13.068 1.00 0.00 ? 212 TYR A OH   2  
ATOM   7827   H  H    . TYR A 1 212 ? -15.782 4.912   -15.335 1.00 0.00 ? 212 TYR A H    2  
ATOM   7828   H  HA   . TYR A 1 212 ? -16.597 7.222   -16.868 1.00 0.00 ? 212 TYR A HA   2  
ATOM   7829   H  HB2  . TYR A 1 212 ? -15.163 6.764   -14.281 1.00 0.00 ? 212 TYR A HB2  2  
ATOM   7830   H  HB3  . TYR A 1 212 ? -15.109 8.367   -15.011 1.00 0.00 ? 212 TYR A HB3  2  
ATOM   7831   H  HD1  . TYR A 1 212 ? -17.481 5.655   -14.015 1.00 0.00 ? 212 TYR A HD1  2  
ATOM   7832   H  HD2  . TYR A 1 212 ? -16.929 9.845   -14.783 1.00 0.00 ? 212 TYR A HD2  2  
ATOM   7833   H  HE1  . TYR A 1 212 ? -19.778 6.107   -13.196 1.00 0.00 ? 212 TYR A HE1  2  
ATOM   7834   H  HE2  . TYR A 1 212 ? -19.225 10.299  -13.961 1.00 0.00 ? 212 TYR A HE2  2  
ATOM   7835   H  HH   . TYR A 1 212 ? -21.364 7.640   -12.926 1.00 0.00 ? 212 TYR A HH   2  
ATOM   7836   N  N    . ASN A 1 213 ? -13.345 6.617   -16.717 1.00 0.00 ? 213 ASN A N    2  
ATOM   7837   C  CA   . ASN A 1 213 ? -12.087 6.913   -17.462 1.00 0.00 ? 213 ASN A CA   2  
ATOM   7838   C  C    . ASN A 1 213 ? -12.239 6.459   -18.923 1.00 0.00 ? 213 ASN A C    2  
ATOM   7839   O  O    . ASN A 1 213 ? -12.720 5.374   -19.186 1.00 0.00 ? 213 ASN A O    2  
ATOM   7840   C  CB   . ASN A 1 213 ? -10.921 6.161   -16.815 1.00 0.00 ? 213 ASN A CB   2  
ATOM   7841   C  CG   . ASN A 1 213 ? -10.517 6.863   -15.517 1.00 0.00 ? 213 ASN A CG   2  
ATOM   7842   O  OD1  . ASN A 1 213 ? -11.298 6.949   -14.591 1.00 0.00 ? 213 ASN A OD1  2  
ATOM   7843   N  ND2  . ASN A 1 213 ? -9.320  7.372   -15.411 1.00 0.00 ? 213 ASN A ND2  2  
ATOM   7844   H  H    . ASN A 1 213 ? -13.318 6.051   -15.917 1.00 0.00 ? 213 ASN A H    2  
ATOM   7845   H  HA   . ASN A 1 213 ? -11.897 7.973   -17.417 1.00 0.00 ? 213 ASN A HA   2  
ATOM   7846   H  HB2  . ASN A 1 213 ? -11.223 5.146   -16.599 1.00 0.00 ? 213 ASN A HB2  2  
ATOM   7847   H  HB3  . ASN A 1 213 ? -10.081 6.149   -17.492 1.00 0.00 ? 213 ASN A HB3  2  
ATOM   7848   H  HD21 . ASN A 1 213 ? -8.689  7.303   -16.157 1.00 0.00 ? 213 ASN A HD21 2  
ATOM   7849   H  HD22 . ASN A 1 213 ? -9.052  7.824   -14.583 1.00 0.00 ? 213 ASN A HD22 2  
ATOM   7850   N  N    . PRO A 1 214 ? -11.838 7.274   -19.874 1.00 0.00 ? 214 PRO A N    2  
ATOM   7851   C  CA   . PRO A 1 214 ? -11.944 6.925   -21.323 1.00 0.00 ? 214 PRO A CA   2  
ATOM   7852   C  C    . PRO A 1 214 ? -10.939 5.848   -21.747 1.00 0.00 ? 214 PRO A C    2  
ATOM   7853   O  O    . PRO A 1 214 ? -11.047 5.271   -22.811 1.00 0.00 ? 214 PRO A O    2  
ATOM   7854   C  CB   . PRO A 1 214 ? -11.644 8.242   -22.042 1.00 0.00 ? 214 PRO A CB   2  
ATOM   7855   C  CG   . PRO A 1 214 ? -10.817 9.035   -21.086 1.00 0.00 ? 214 PRO A CG   2  
ATOM   7856   C  CD   . PRO A 1 214 ? -11.241 8.608   -19.682 1.00 0.00 ? 214 PRO A CD   2  
ATOM   7857   H  HA   . PRO A 1 214 ? -12.948 6.610   -21.558 1.00 0.00 ? 214 PRO A HA   2  
ATOM   7858   H  HB2  . PRO A 1 214 ? -11.092 8.054   -22.953 1.00 0.00 ? 214 PRO A HB2  2  
ATOM   7859   H  HB3  . PRO A 1 214 ? -12.561 8.768   -22.259 1.00 0.00 ? 214 PRO A HB3  2  
ATOM   7860   H  HG2  . PRO A 1 214 ? -9.768  8.821   -21.242 1.00 0.00 ? 214 PRO A HG2  2  
ATOM   7861   H  HG3  . PRO A 1 214 ? -11.006 10.089  -21.217 1.00 0.00 ? 214 PRO A HG3  2  
ATOM   7862   H  HD2  . PRO A 1 214 ? -10.379 8.550   -19.029 1.00 0.00 ? 214 PRO A HD2  2  
ATOM   7863   H  HD3  . PRO A 1 214 ? -11.974 9.290   -19.283 1.00 0.00 ? 214 PRO A HD3  2  
ATOM   7864   N  N    . GLU A 1 215 ? -9.957  5.577   -20.929 1.00 0.00 ? 215 GLU A N    2  
ATOM   7865   C  CA   . GLU A 1 215 ? -8.945  4.543   -21.298 1.00 0.00 ? 215 GLU A CA   2  
ATOM   7866   C  C    . GLU A 1 215 ? -9.466  3.152   -20.933 1.00 0.00 ? 215 GLU A C    2  
ATOM   7867   O  O    . GLU A 1 215 ? -8.857  2.149   -21.250 1.00 0.00 ? 215 GLU A O    2  
ATOM   7868   C  CB   . GLU A 1 215 ? -7.642  4.813   -20.541 1.00 0.00 ? 215 GLU A CB   2  
ATOM   7869   C  CG   . GLU A 1 215 ? -6.515  3.977   -21.150 1.00 0.00 ? 215 GLU A CG   2  
ATOM   7870   C  CD   . GLU A 1 215 ? -5.173  4.430   -20.570 1.00 0.00 ? 215 GLU A CD   2  
ATOM   7871   O  OE1  . GLU A 1 215 ? -4.883  4.064   -19.442 1.00 0.00 ? 215 GLU A OE1  2  
ATOM   7872   O  OE2  . GLU A 1 215 ? -4.458  5.134   -21.263 1.00 0.00 ? 215 GLU A OE2  2  
ATOM   7873   H  H    . GLU A 1 215 ? -9.879  6.055   -20.077 1.00 0.00 ? 215 GLU A H    2  
ATOM   7874   H  HA   . GLU A 1 215 ? -8.758  4.588   -22.360 1.00 0.00 ? 215 GLU A HA   2  
ATOM   7875   H  HB2  . GLU A 1 215 ? -7.395  5.862   -20.616 1.00 0.00 ? 215 GLU A HB2  2  
ATOM   7876   H  HB3  . GLU A 1 215 ? -7.767  4.545   -19.503 1.00 0.00 ? 215 GLU A HB3  2  
ATOM   7877   H  HG2  . GLU A 1 215 ? -6.674  2.934   -20.919 1.00 0.00 ? 215 GLU A HG2  2  
ATOM   7878   H  HG3  . GLU A 1 215 ? -6.505  4.111   -22.221 1.00 0.00 ? 215 GLU A HG3  2  
ATOM   7879   N  N    . GLY A 1 216 ? -10.587 3.078   -20.270 1.00 0.00 ? 216 GLY A N    2  
ATOM   7880   C  CA   . GLY A 1 216 ? -11.138 1.747   -19.889 1.00 0.00 ? 216 GLY A CA   2  
ATOM   7881   C  C    . GLY A 1 216 ? -10.295 1.142   -18.767 1.00 0.00 ? 216 GLY A C    2  
ATOM   7882   O  O    . GLY A 1 216 ? -9.501  1.815   -18.138 1.00 0.00 ? 216 GLY A O    2  
ATOM   7883   H  H    . GLY A 1 216 ? -11.066 3.896   -20.022 1.00 0.00 ? 216 GLY A H    2  
ATOM   7884   H  HA2  . GLY A 1 216 ? -12.158 1.862   -19.553 1.00 0.00 ? 216 GLY A HA2  2  
ATOM   7885   H  HA3  . GLY A 1 216 ? -11.115 1.091   -20.744 1.00 0.00 ? 216 GLY A HA3  2  
ATOM   7886   N  N    . LEU A 1 217 ? -10.466 -0.124  -18.506 1.00 0.00 ? 217 LEU A N    2  
ATOM   7887   C  CA   . LEU A 1 217 ? -9.681  -0.780  -17.421 1.00 0.00 ? 217 LEU A CA   2  
ATOM   7888   C  C    . LEU A 1 217 ? -8.278  -1.120  -17.932 1.00 0.00 ? 217 LEU A C    2  
ATOM   7889   O  O    . LEU A 1 217 ? -8.082  -1.400  -19.097 1.00 0.00 ? 217 LEU A O    2  
ATOM   7890   C  CB   . LEU A 1 217 ? -10.391 -2.066  -16.992 1.00 0.00 ? 217 LEU A CB   2  
ATOM   7891   C  CG   . LEU A 1 217 ? -11.891 -1.798  -16.850 1.00 0.00 ? 217 LEU A CG   2  
ATOM   7892   C  CD1  . LEU A 1 217 ? -12.587 -3.052  -16.318 1.00 0.00 ? 217 LEU A CD1  2  
ATOM   7893   C  CD2  . LEU A 1 217 ? -12.111 -0.643  -15.872 1.00 0.00 ? 217 LEU A CD2  2  
ATOM   7894   H  H    . LEU A 1 217 ? -11.116 -0.643  -19.024 1.00 0.00 ? 217 LEU A H    2  
ATOM   7895   H  HA   . LEU A 1 217 ? -9.606  -0.111  -16.577 1.00 0.00 ? 217 LEU A HA   2  
ATOM   7896   H  HB2  . LEU A 1 217 ? -10.230 -2.832  -17.737 1.00 0.00 ? 217 LEU A HB2  2  
ATOM   7897   H  HB3  . LEU A 1 217 ? -9.995  -2.397  -16.043 1.00 0.00 ? 217 LEU A HB3  2  
ATOM   7898   H  HG   . LEU A 1 217 ? -12.302 -1.540  -17.814 1.00 0.00 ? 217 LEU A HG   2  
ATOM   7899   H  HD11 . LEU A 1 217 ? -12.042 -3.929  -16.638 1.00 0.00 ? 217 LEU A HD11 2  
ATOM   7900   H  HD12 . LEU A 1 217 ? -13.595 -3.094  -16.704 1.00 0.00 ? 217 LEU A HD12 2  
ATOM   7901   H  HD13 . LEU A 1 217 ? -12.615 -3.019  -15.239 1.00 0.00 ? 217 LEU A HD13 2  
ATOM   7902   H  HD21 . LEU A 1 217 ? -11.904 0.294   -16.371 1.00 0.00 ? 217 LEU A HD21 2  
ATOM   7903   H  HD22 . LEU A 1 217 ? -11.449 -0.753  -15.027 1.00 0.00 ? 217 LEU A HD22 2  
ATOM   7904   H  HD23 . LEU A 1 217 ? -13.135 -0.650  -15.532 1.00 0.00 ? 217 LEU A HD23 2  
ATOM   7905   N  N    . ARG A 1 218 ? -7.301  -1.100  -17.065 1.00 0.00 ? 218 ARG A N    2  
ATOM   7906   C  CA   . ARG A 1 218 ? -5.909  -1.423  -17.496 1.00 0.00 ? 218 ARG A CA   2  
ATOM   7907   C  C    . ARG A 1 218 ? -5.682  -2.935  -17.393 1.00 0.00 ? 218 ARG A C    2  
ATOM   7908   O  O    . ARG A 1 218 ? -4.827  -3.491  -18.052 1.00 0.00 ? 218 ARG A O    2  
ATOM   7909   C  CB   . ARG A 1 218 ? -4.916  -0.689  -16.592 1.00 0.00 ? 218 ARG A CB   2  
ATOM   7910   C  CG   . ARG A 1 218 ? -3.974  0.160   -17.447 1.00 0.00 ? 218 ARG A CG   2  
ATOM   7911   C  CD   . ARG A 1 218 ? -4.770  1.263   -18.145 1.00 0.00 ? 218 ARG A CD   2  
ATOM   7912   N  NE   . ARG A 1 218 ? -4.887  0.946   -19.596 1.00 0.00 ? 218 ARG A NE   2  
ATOM   7913   C  CZ   . ARG A 1 218 ? -3.815  0.888   -20.339 1.00 0.00 ? 218 ARG A CZ   2  
ATOM   7914   N  NH1  . ARG A 1 218 ? -2.642  1.112   -19.810 1.00 0.00 ? 218 ARG A NH1  2  
ATOM   7915   N  NH2  . ARG A 1 218 ? -3.916  0.606   -21.608 1.00 0.00 ? 218 ARG A NH2  2  
ATOM   7916   H  H    . ARG A 1 218 ? -7.482  -0.873  -16.129 1.00 0.00 ? 218 ARG A H    2  
ATOM   7917   H  HA   . ARG A 1 218 ? -5.766  -1.106  -18.518 1.00 0.00 ? 218 ARG A HA   2  
ATOM   7918   H  HB2  . ARG A 1 218 ? -5.455  -0.050  -15.908 1.00 0.00 ? 218 ARG A HB2  2  
ATOM   7919   H  HB3  . ARG A 1 218 ? -4.338  -1.408  -16.033 1.00 0.00 ? 218 ARG A HB3  2  
ATOM   7920   H  HG2  . ARG A 1 218 ? -3.218  0.606   -16.816 1.00 0.00 ? 218 ARG A HG2  2  
ATOM   7921   H  HG3  . ARG A 1 218 ? -3.499  -0.464  -18.189 1.00 0.00 ? 218 ARG A HG3  2  
ATOM   7922   H  HD2  . ARG A 1 218 ? -5.757  1.326   -17.710 1.00 0.00 ? 218 ARG A HD2  2  
ATOM   7923   H  HD3  . ARG A 1 218 ? -4.262  2.208   -18.023 1.00 0.00 ? 218 ARG A HD3  2  
ATOM   7924   H  HE   . ARG A 1 218 ? -5.767  0.779   -19.993 1.00 0.00 ? 218 ARG A HE   2  
ATOM   7925   H  HH11 . ARG A 1 218 ? -2.565  1.325   -18.836 1.00 0.00 ? 218 ARG A HH11 2  
ATOM   7926   H  HH12 . ARG A 1 218 ? -1.821  1.071   -20.380 1.00 0.00 ? 218 ARG A HH12 2  
ATOM   7927   H  HH21 . ARG A 1 218 ? -4.815  0.435   -22.012 1.00 0.00 ? 218 ARG A HH21 2  
ATOM   7928   H  HH22 . ARG A 1 218 ? -3.096  0.560   -22.177 1.00 0.00 ? 218 ARG A HH22 2  
ATOM   7929   N  N    . TYR A 1 219 ? -6.452  -3.602  -16.578 1.00 0.00 ? 219 TYR A N    2  
ATOM   7930   C  CA   . TYR A 1 219 ? -6.302  -5.080  -16.436 1.00 0.00 ? 219 TYR A CA   2  
ATOM   7931   C  C    . TYR A 1 219 ? -7.666  -5.685  -16.106 1.00 0.00 ? 219 TYR A C    2  
ATOM   7932   O  O    . TYR A 1 219 ? -8.379  -5.189  -15.255 1.00 0.00 ? 219 TYR A O    2  
ATOM   7933   C  CB   . TYR A 1 219 ? -5.333  -5.408  -15.296 1.00 0.00 ? 219 TYR A CB   2  
ATOM   7934   C  CG   . TYR A 1 219 ? -4.007  -4.722  -15.516 1.00 0.00 ? 219 TYR A CG   2  
ATOM   7935   C  CD1  . TYR A 1 219 ? -3.070  -5.272  -16.400 1.00 0.00 ? 219 TYR A CD1  2  
ATOM   7936   C  CD2  . TYR A 1 219 ? -3.708  -3.541  -14.827 1.00 0.00 ? 219 TYR A CD2  2  
ATOM   7937   C  CE1  . TYR A 1 219 ? -1.836  -4.642  -16.594 1.00 0.00 ? 219 TYR A CE1  2  
ATOM   7938   C  CE2  . TYR A 1 219 ? -2.475  -2.909  -15.023 1.00 0.00 ? 219 TYR A CE2  2  
ATOM   7939   C  CZ   . TYR A 1 219 ? -1.538  -3.459  -15.906 1.00 0.00 ? 219 TYR A CZ   2  
ATOM   7940   O  OH   . TYR A 1 219 ? -0.322  -2.837  -16.097 1.00 0.00 ? 219 TYR A OH   2  
ATOM   7941   H  H    . TYR A 1 219 ? -7.144  -3.132  -16.066 1.00 0.00 ? 219 TYR A H    2  
ATOM   7942   H  HA   . TYR A 1 219 ? -5.931  -5.499  -17.360 1.00 0.00 ? 219 TYR A HA   2  
ATOM   7943   H  HB2  . TYR A 1 219 ? -5.757  -5.075  -14.362 1.00 0.00 ? 219 TYR A HB2  2  
ATOM   7944   H  HB3  . TYR A 1 219 ? -5.179  -6.476  -15.256 1.00 0.00 ? 219 TYR A HB3  2  
ATOM   7945   H  HD1  . TYR A 1 219 ? -3.301  -6.183  -16.933 1.00 0.00 ? 219 TYR A HD1  2  
ATOM   7946   H  HD2  . TYR A 1 219 ? -4.430  -3.117  -14.146 1.00 0.00 ? 219 TYR A HD2  2  
ATOM   7947   H  HE1  . TYR A 1 219 ? -1.112  -5.068  -17.273 1.00 0.00 ? 219 TYR A HE1  2  
ATOM   7948   H  HE2  . TYR A 1 219 ? -2.245  -1.997  -14.491 1.00 0.00 ? 219 TYR A HE2  2  
ATOM   7949   H  HH   . TYR A 1 219 ? -0.490  -1.923  -16.334 1.00 0.00 ? 219 TYR A HH   2  
ATOM   7950   N  N    . GLU A 1 220 ? -8.040  -6.753  -16.757 1.00 0.00 ? 220 GLU A N    2  
ATOM   7951   C  CA   . GLU A 1 220 ? -9.359  -7.371  -16.450 1.00 0.00 ? 220 GLU A CA   2  
ATOM   7952   C  C    . GLU A 1 220 ? -9.519  -7.451  -14.929 1.00 0.00 ? 220 GLU A C    2  
ATOM   7953   O  O    . GLU A 1 220 ? -10.604 -7.624  -14.412 1.00 0.00 ? 220 GLU A O    2  
ATOM   7954   C  CB   . GLU A 1 220 ? -9.424  -8.778  -17.049 1.00 0.00 ? 220 GLU A CB   2  
ATOM   7955   C  CG   . GLU A 1 220 ? -10.869 -9.104  -17.428 1.00 0.00 ? 220 GLU A CG   2  
ATOM   7956   C  CD   . GLU A 1 220 ? -11.000 -10.601 -17.711 1.00 0.00 ? 220 GLU A CD   2  
ATOM   7957   O  OE1  . GLU A 1 220 ? -10.070 -11.163 -18.267 1.00 0.00 ? 220 GLU A OE1  2  
ATOM   7958   O  OE2  . GLU A 1 220 ? -12.027 -11.162 -17.366 1.00 0.00 ? 220 GLU A OE2  2  
ATOM   7959   H  H    . GLU A 1 220 ? -7.454  -7.149  -17.436 1.00 0.00 ? 220 GLU A H    2  
ATOM   7960   H  HA   . GLU A 1 220 ? -10.149 -6.763  -16.865 1.00 0.00 ? 220 GLU A HA   2  
ATOM   7961   H  HB2  . GLU A 1 220 ? -8.800  -8.823  -17.930 1.00 0.00 ? 220 GLU A HB2  2  
ATOM   7962   H  HB3  . GLU A 1 220 ? -9.074  -9.496  -16.322 1.00 0.00 ? 220 GLU A HB3  2  
ATOM   7963   H  HG2  . GLU A 1 220 ? -11.524 -8.831  -16.613 1.00 0.00 ? 220 GLU A HG2  2  
ATOM   7964   H  HG3  . GLU A 1 220 ? -11.144 -8.548  -18.312 1.00 0.00 ? 220 GLU A HG3  2  
ATOM   7965   N  N    . ASN A 1 221 ? -8.434  -7.315  -14.216 1.00 0.00 ? 221 ASN A N    2  
ATOM   7966   C  CA   . ASN A 1 221 ? -8.491  -7.369  -12.727 1.00 0.00 ? 221 ASN A CA   2  
ATOM   7967   C  C    . ASN A 1 221 ? -7.741  -6.161  -12.158 1.00 0.00 ? 221 ASN A C    2  
ATOM   7968   O  O    . ASN A 1 221 ? -7.083  -6.243  -11.141 1.00 0.00 ? 221 ASN A O    2  
ATOM   7969   C  CB   . ASN A 1 221 ? -7.831  -8.661  -12.243 1.00 0.00 ? 221 ASN A CB   2  
ATOM   7970   C  CG   . ASN A 1 221 ? -7.793  -9.675  -13.389 1.00 0.00 ? 221 ASN A CG   2  
ATOM   7971   O  OD1  . ASN A 1 221 ? -8.809  -9.973  -13.986 1.00 0.00 ? 221 ASN A OD1  2  
ATOM   7972   N  ND2  . ASN A 1 221 ? -6.657  -10.222 -13.724 1.00 0.00 ? 221 ASN A ND2  2  
ATOM   7973   H  H    . ASN A 1 221 ? -7.574  -7.172  -14.665 1.00 0.00 ? 221 ASN A H    2  
ATOM   7974   H  HA   . ASN A 1 221 ? -9.520  -7.343  -12.403 1.00 0.00 ? 221 ASN A HA   2  
ATOM   7975   H  HB2  . ASN A 1 221 ? -6.825  -8.448  -11.916 1.00 0.00 ? 221 ASN A HB2  2  
ATOM   7976   H  HB3  . ASN A 1 221 ? -8.399  -9.071  -11.423 1.00 0.00 ? 221 ASN A HB3  2  
ATOM   7977   H  HD21 . ASN A 1 221 ? -5.838  -9.981  -13.242 1.00 0.00 ? 221 ASN A HD21 2  
ATOM   7978   H  HD22 . ASN A 1 221 ? -6.623  -10.873 -14.455 1.00 0.00 ? 221 ASN A HD22 2  
ATOM   7979   N  N    . GLU A 1 222 ? -7.828  -5.043  -12.825 1.00 0.00 ? 222 GLU A N    2  
ATOM   7980   C  CA   . GLU A 1 222 ? -7.118  -3.818  -12.359 1.00 0.00 ? 222 GLU A CA   2  
ATOM   7981   C  C    . GLU A 1 222 ? -7.522  -3.436  -10.923 1.00 0.00 ? 222 GLU A C    2  
ATOM   7982   O  O    . GLU A 1 222 ? -6.666  -3.196  -10.094 1.00 0.00 ? 222 GLU A O    2  
ATOM   7983   C  CB   . GLU A 1 222 ? -7.428  -2.657  -13.313 1.00 0.00 ? 222 GLU A CB   2  
ATOM   7984   C  CG   . GLU A 1 222 ? -7.469  -1.336  -12.540 1.00 0.00 ? 222 GLU A CG   2  
ATOM   7985   C  CD   . GLU A 1 222 ? -7.449  -0.167  -13.526 1.00 0.00 ? 222 GLU A CD   2  
ATOM   7986   O  OE1  . GLU A 1 222 ? -8.296  -0.143  -14.404 1.00 0.00 ? 222 GLU A OE1  2  
ATOM   7987   O  OE2  . GLU A 1 222 ? -6.587  0.686   -13.386 1.00 0.00 ? 222 GLU A OE2  2  
ATOM   7988   H  H    . GLU A 1 222 ? -8.355  -5.015  -13.651 1.00 0.00 ? 222 GLU A H    2  
ATOM   7989   H  HA   . GLU A 1 222 ? -6.055  -4.005  -12.379 1.00 0.00 ? 222 GLU A HA   2  
ATOM   7990   H  HB2  . GLU A 1 222 ? -6.659  -2.603  -14.070 1.00 0.00 ? 222 GLU A HB2  2  
ATOM   7991   H  HB3  . GLU A 1 222 ? -8.383  -2.825  -13.788 1.00 0.00 ? 222 GLU A HB3  2  
ATOM   7992   H  HG2  . GLU A 1 222 ? -8.372  -1.290  -11.947 1.00 0.00 ? 222 GLU A HG2  2  
ATOM   7993   H  HG3  . GLU A 1 222 ? -6.608  -1.271  -11.892 1.00 0.00 ? 222 GLU A HG3  2  
ATOM   7994   N  N    . PRO A 1 223 ? -8.799  -3.343  -10.617 1.00 0.00 ? 223 PRO A N    2  
ATOM   7995   C  CA   . PRO A 1 223 ? -9.249  -2.943  -9.249  1.00 0.00 ? 223 PRO A CA   2  
ATOM   7996   C  C    . PRO A 1 223 ? -8.887  -3.965  -8.164  1.00 0.00 ? 223 PRO A C    2  
ATOM   7997   O  O    . PRO A 1 223 ? -8.495  -3.599  -7.070  1.00 0.00 ? 223 PRO A O    2  
ATOM   7998   C  CB   . PRO A 1 223 ? -10.768 -2.804  -9.373  1.00 0.00 ? 223 PRO A CB   2  
ATOM   7999   C  CG   . PRO A 1 223 ? -11.155 -3.592  -10.579 1.00 0.00 ? 223 PRO A CG   2  
ATOM   8000   C  CD   . PRO A 1 223 ? -9.943  -3.604  -11.512 1.00 0.00 ? 223 PRO A CD   2  
ATOM   8001   H  HA   . PRO A 1 223 ? -8.825  -1.983  -8.996  1.00 0.00 ? 223 PRO A HA   2  
ATOM   8002   H  HB2  . PRO A 1 223 ? -11.251 -3.204  -8.491  1.00 0.00 ? 223 PRO A HB2  2  
ATOM   8003   H  HB3  . PRO A 1 223 ? -11.038 -1.768  -9.508  1.00 0.00 ? 223 PRO A HB3  2  
ATOM   8004   H  HG2  . PRO A 1 223 ? -11.413 -4.602  -10.291 1.00 0.00 ? 223 PRO A HG2  2  
ATOM   8005   H  HG3  . PRO A 1 223 ? -11.990 -3.123  -11.075 1.00 0.00 ? 223 PRO A HG3  2  
ATOM   8006   H  HD2  . PRO A 1 223 ? -9.857  -4.569  -11.985 1.00 0.00 ? 223 PRO A HD2  2  
ATOM   8007   H  HD3  . PRO A 1 223 ? -10.030 -2.822  -12.249 1.00 0.00 ? 223 PRO A HD3  2  
ATOM   8008   N  N    . VAL A 1 224 ? -8.984  -5.236  -8.442  1.00 0.00 ? 224 VAL A N    2  
ATOM   8009   C  CA   . VAL A 1 224 ? -8.615  -6.236  -7.401  1.00 0.00 ? 224 VAL A CA   2  
ATOM   8010   C  C    . VAL A 1 224 ? -7.094  -6.335  -7.349  1.00 0.00 ? 224 VAL A C    2  
ATOM   8011   O  O    . VAL A 1 224 ? -6.510  -6.645  -6.329  1.00 0.00 ? 224 VAL A O    2  
ATOM   8012   C  CB   . VAL A 1 224 ? -9.217  -7.603  -7.741  1.00 0.00 ? 224 VAL A CB   2  
ATOM   8013   C  CG1  . VAL A 1 224 ? -10.617 -7.706  -7.136  1.00 0.00 ? 224 VAL A CG1  2  
ATOM   8014   C  CG2  . VAL A 1 224 ? -9.311  -7.768  -9.259  1.00 0.00 ? 224 VAL A CG2  2  
ATOM   8015   H  H    . VAL A 1 224 ? -9.264  -5.542  -9.329  1.00 0.00 ? 224 VAL A H    2  
ATOM   8016   H  HA   . VAL A 1 224 ? -8.986  -5.907  -6.439  1.00 0.00 ? 224 VAL A HA   2  
ATOM   8017   H  HB   . VAL A 1 224 ? -8.590  -8.382  -7.331  1.00 0.00 ? 224 VAL A HB   2  
ATOM   8018   H  HG11 . VAL A 1 224 ? -11.011 -8.698  -7.308  1.00 0.00 ? 224 VAL A HG11 2  
ATOM   8019   H  HG12 . VAL A 1 224 ? -11.264 -6.977  -7.599  1.00 0.00 ? 224 VAL A HG12 2  
ATOM   8020   H  HG13 . VAL A 1 224 ? -10.564 -7.520  -6.075  1.00 0.00 ? 224 VAL A HG13 2  
ATOM   8021   H  HG21 . VAL A 1 224 ? -9.550  -8.795  -9.490  1.00 0.00 ? 224 VAL A HG21 2  
ATOM   8022   H  HG22 . VAL A 1 224 ? -8.366  -7.507  -9.711  1.00 0.00 ? 224 VAL A HG22 2  
ATOM   8023   H  HG23 . VAL A 1 224 ? -10.088 -7.124  -9.645  1.00 0.00 ? 224 VAL A HG23 2  
ATOM   8024   N  N    . ARG A 1 225 ? -6.445  -6.042  -8.443  1.00 0.00 ? 225 ARG A N    2  
ATOM   8025   C  CA   . ARG A 1 225 ? -4.961  -6.086  -8.457  1.00 0.00 ? 225 ARG A CA   2  
ATOM   8026   C  C    . ARG A 1 225 ? -4.452  -4.946  -7.583  1.00 0.00 ? 225 ARG A C    2  
ATOM   8027   O  O    . ARG A 1 225 ? -3.556  -5.114  -6.779  1.00 0.00 ? 225 ARG A O    2  
ATOM   8028   C  CB   . ARG A 1 225 ? -4.453  -5.911  -9.890  1.00 0.00 ? 225 ARG A CB   2  
ATOM   8029   C  CG   . ARG A 1 225 ? -4.389  -7.275  -10.579 1.00 0.00 ? 225 ARG A CG   2  
ATOM   8030   C  CD   . ARG A 1 225 ? -4.300  -7.079  -12.092 1.00 0.00 ? 225 ARG A CD   2  
ATOM   8031   N  NE   . ARG A 1 225 ? -3.151  -6.186  -12.409 1.00 0.00 ? 225 ARG A NE   2  
ATOM   8032   C  CZ   . ARG A 1 225 ? -2.585  -6.243  -13.583 1.00 0.00 ? 225 ARG A CZ   2  
ATOM   8033   N  NH1  . ARG A 1 225 ? -3.025  -7.083  -14.480 1.00 0.00 ? 225 ARG A NH1  2  
ATOM   8034   N  NH2  . ARG A 1 225 ? -1.576  -5.462  -13.860 1.00 0.00 ? 225 ARG A NH2  2  
ATOM   8035   H  H    . ARG A 1 225 ? -6.938  -5.770  -9.245  1.00 0.00 ? 225 ARG A H    2  
ATOM   8036   H  HA   . ARG A 1 225 ? -4.621  -7.032  -8.060  1.00 0.00 ? 225 ARG A HA   2  
ATOM   8037   H  HB2  . ARG A 1 225 ? -5.126  -5.264  -10.434 1.00 0.00 ? 225 ARG A HB2  2  
ATOM   8038   H  HB3  . ARG A 1 225 ? -3.467  -5.472  -9.871  1.00 0.00 ? 225 ARG A HB3  2  
ATOM   8039   H  HG2  . ARG A 1 225 ? -3.518  -7.812  -10.231 1.00 0.00 ? 225 ARG A HG2  2  
ATOM   8040   H  HG3  . ARG A 1 225 ? -5.278  -7.840  -10.341 1.00 0.00 ? 225 ARG A HG3  2  
ATOM   8041   H  HD2  . ARG A 1 225 ? -4.157  -8.035  -12.572 1.00 0.00 ? 225 ARG A HD2  2  
ATOM   8042   H  HD3  . ARG A 1 225 ? -5.215  -6.630  -12.451 1.00 0.00 ? 225 ARG A HD3  2  
ATOM   8043   H  HE   . ARG A 1 225 ? -2.821  -5.555  -11.735 1.00 0.00 ? 225 ARG A HE   2  
ATOM   8044   H  HH11 . ARG A 1 225 ? -3.797  -7.683  -14.266 1.00 0.00 ? 225 ARG A HH11 2  
ATOM   8045   H  HH12 . ARG A 1 225 ? -2.592  -7.125  -15.380 1.00 0.00 ? 225 ARG A HH12 2  
ATOM   8046   H  HH21 . ARG A 1 225 ? -1.239  -4.819  -13.172 1.00 0.00 ? 225 ARG A HH21 2  
ATOM   8047   H  HH22 . ARG A 1 225 ? -1.142  -5.506  -14.759 1.00 0.00 ? 225 ARG A HH22 2  
ATOM   8048   N  N    . HIS A 1 226 ? -5.033  -3.785  -7.725  1.00 0.00 ? 226 HIS A N    2  
ATOM   8049   C  CA   . HIS A 1 226 ? -4.607  -2.628  -6.896  1.00 0.00 ? 226 HIS A CA   2  
ATOM   8050   C  C    . HIS A 1 226 ? -4.809  -2.970  -5.423  1.00 0.00 ? 226 HIS A C    2  
ATOM   8051   O  O    . HIS A 1 226 ? -3.961  -2.711  -4.594  1.00 0.00 ? 226 HIS A O    2  
ATOM   8052   C  CB   . HIS A 1 226 ? -5.457  -1.406  -7.251  1.00 0.00 ? 226 HIS A CB   2  
ATOM   8053   C  CG   . HIS A 1 226 ? -5.201  -0.313  -6.252  1.00 0.00 ? 226 HIS A CG   2  
ATOM   8054   N  ND1  . HIS A 1 226 ? -4.413  0.786   -6.551  1.00 0.00 ? 226 HIS A ND1  2  
ATOM   8055   C  CD2  . HIS A 1 226 ? -5.610  -0.139  -4.952  1.00 0.00 ? 226 HIS A CD2  2  
ATOM   8056   C  CE1  . HIS A 1 226 ? -4.372  1.565   -5.456  1.00 0.00 ? 226 HIS A CE1  2  
ATOM   8057   N  NE2  . HIS A 1 226 ? -5.085  1.048   -4.451  1.00 0.00 ? 226 HIS A NE2  2  
ATOM   8058   H  H    . HIS A 1 226 ? -5.759  -3.674  -8.374  1.00 0.00 ? 226 HIS A H    2  
ATOM   8059   H  HA   . HIS A 1 226 ? -3.566  -2.412  -7.077  1.00 0.00 ? 226 HIS A HA   2  
ATOM   8060   H  HB2  . HIS A 1 226 ? -5.203  -1.060  -8.241  1.00 0.00 ? 226 HIS A HB2  2  
ATOM   8061   H  HB3  . HIS A 1 226 ? -6.498  -1.678  -7.228  1.00 0.00 ? 226 HIS A HB3  2  
ATOM   8062   H  HD1  . HIS A 1 226 ? -3.967  0.963   -7.406  1.00 0.00 ? 226 HIS A HD1  2  
ATOM   8063   H  HD2  . HIS A 1 226 ? -6.243  -0.821  -4.403  1.00 0.00 ? 226 HIS A HD2  2  
ATOM   8064   H  HE1  . HIS A 1 226 ? -3.828  2.494   -5.398  1.00 0.00 ? 226 HIS A HE1  2  
ATOM   8065   N  N    . LYS A 1 227 ? -5.926  -3.560  -5.086  1.00 0.00 ? 227 LYS A N    2  
ATOM   8066   C  CA   . LYS A 1 227 ? -6.162  -3.918  -3.661  1.00 0.00 ? 227 LYS A CA   2  
ATOM   8067   C  C    . LYS A 1 227 ? -5.012  -4.803  -3.178  1.00 0.00 ? 227 LYS A C    2  
ATOM   8068   O  O    . LYS A 1 227 ? -4.513  -4.642  -2.082  1.00 0.00 ? 227 LYS A O    2  
ATOM   8069   C  CB   . LYS A 1 227 ? -7.486  -4.670  -3.527  1.00 0.00 ? 227 LYS A CB   2  
ATOM   8070   C  CG   . LYS A 1 227 ? -8.157  -4.280  -2.209  1.00 0.00 ? 227 LYS A CG   2  
ATOM   8071   C  CD   . LYS A 1 227 ? -8.947  -2.984  -2.400  1.00 0.00 ? 227 LYS A CD   2  
ATOM   8072   C  CE   . LYS A 1 227 ? -8.974  -2.204  -1.084  1.00 0.00 ? 227 LYS A CE   2  
ATOM   8073   N  NZ   . LYS A 1 227 ? -7.704  -1.438  -0.937  1.00 0.00 ? 227 LYS A NZ   2  
ATOM   8074   H  H    . LYS A 1 227 ? -6.603  -3.766  -5.769  1.00 0.00 ? 227 LYS A H    2  
ATOM   8075   H  HA   . LYS A 1 227 ? -6.196  -3.016  -3.066  1.00 0.00 ? 227 LYS A HA   2  
ATOM   8076   H  HB2  . LYS A 1 227 ? -8.133  -4.412  -4.354  1.00 0.00 ? 227 LYS A HB2  2  
ATOM   8077   H  HB3  . LYS A 1 227 ? -7.299  -5.733  -3.533  1.00 0.00 ? 227 LYS A HB3  2  
ATOM   8078   H  HG2  . LYS A 1 227 ? -8.826  -5.067  -1.900  1.00 0.00 ? 227 LYS A HG2  2  
ATOM   8079   H  HG3  . LYS A 1 227 ? -7.403  -4.130  -1.451  1.00 0.00 ? 227 LYS A HG3  2  
ATOM   8080   H  HD2  . LYS A 1 227 ? -8.476  -2.385  -3.165  1.00 0.00 ? 227 LYS A HD2  2  
ATOM   8081   H  HD3  . LYS A 1 227 ? -9.958  -3.219  -2.697  1.00 0.00 ? 227 LYS A HD3  2  
ATOM   8082   H  HE2  . LYS A 1 227 ? -9.809  -1.520  -1.088  1.00 0.00 ? 227 LYS A HE2  2  
ATOM   8083   H  HE3  . LYS A 1 227 ? -9.076  -2.893  -0.260  1.00 0.00 ? 227 LYS A HE3  2  
ATOM   8084   H  HZ1  . LYS A 1 227 ? -6.918  -2.098  -0.779  1.00 0.00 ? 227 LYS A HZ1  2  
ATOM   8085   H  HZ2  . LYS A 1 227 ? -7.784  -0.790  -0.126  1.00 0.00 ? 227 LYS A HZ2  2  
ATOM   8086   H  HZ3  . LYS A 1 227 ? -7.527  -0.892  -1.802  1.00 0.00 ? 227 LYS A HZ3  2  
ATOM   8087   N  N    . VAL A 1 228 ? -4.577  -5.726  -3.992  1.00 0.00 ? 228 VAL A N    2  
ATOM   8088   C  CA   . VAL A 1 228 ? -3.446  -6.605  -3.578  1.00 0.00 ? 228 VAL A CA   2  
ATOM   8089   C  C    . VAL A 1 228 ? -2.212  -5.728  -3.359  1.00 0.00 ? 228 VAL A C    2  
ATOM   8090   O  O    . VAL A 1 228 ? -1.519  -5.841  -2.367  1.00 0.00 ? 228 VAL A O    2  
ATOM   8091   C  CB   . VAL A 1 228 ? -3.153  -7.630  -4.677  1.00 0.00 ? 228 VAL A CB   2  
ATOM   8092   C  CG1  . VAL A 1 228 ? -2.119  -8.638  -4.172  1.00 0.00 ? 228 VAL A CG1  2  
ATOM   8093   C  CG2  . VAL A 1 228 ? -4.440  -8.372  -5.049  1.00 0.00 ? 228 VAL A CG2  2  
ATOM   8094   H  H    . VAL A 1 228 ? -4.986  -5.831  -4.878  1.00 0.00 ? 228 VAL A H    2  
ATOM   8095   H  HA   . VAL A 1 228 ? -3.698  -7.114  -2.659  1.00 0.00 ? 228 VAL A HA   2  
ATOM   8096   H  HB   . VAL A 1 228 ? -2.764  -7.123  -5.548  1.00 0.00 ? 228 VAL A HB   2  
ATOM   8097   H  HG11 . VAL A 1 228 ? -1.277  -8.660  -4.847  1.00 0.00 ? 228 VAL A HG11 2  
ATOM   8098   H  HG12 . VAL A 1 228 ? -2.566  -9.620  -4.122  1.00 0.00 ? 228 VAL A HG12 2  
ATOM   8099   H  HG13 . VAL A 1 228 ? -1.783  -8.346  -3.188  1.00 0.00 ? 228 VAL A HG13 2  
ATOM   8100   H  HG21 . VAL A 1 228 ? -5.293  -7.807  -4.711  1.00 0.00 ? 228 VAL A HG21 2  
ATOM   8101   H  HG22 . VAL A 1 228 ? -4.444  -9.345  -4.580  1.00 0.00 ? 228 VAL A HG22 2  
ATOM   8102   H  HG23 . VAL A 1 228 ? -4.489  -8.490  -6.121  1.00 0.00 ? 228 VAL A HG23 2  
ATOM   8103   N  N    . PHE A 1 229 ? -1.950  -4.843  -4.281  1.00 0.00 ? 229 PHE A N    2  
ATOM   8104   C  CA   . PHE A 1 229 ? -0.780  -3.931  -4.147  1.00 0.00 ? 229 PHE A CA   2  
ATOM   8105   C  C    . PHE A 1 229 ? -0.882  -3.191  -2.814  1.00 0.00 ? 229 PHE A C    2  
ATOM   8106   O  O    . PHE A 1 229 ? 0.091   -3.018  -2.103  1.00 0.00 ? 229 PHE A O    2  
ATOM   8107   C  CB   . PHE A 1 229 ? -0.819  -2.928  -5.305  1.00 0.00 ? 229 PHE A CB   2  
ATOM   8108   C  CG   . PHE A 1 229 ? 0.275   -1.898  -5.152  1.00 0.00 ? 229 PHE A CG   2  
ATOM   8109   C  CD1  . PHE A 1 229 ? 1.599   -2.227  -5.463  1.00 0.00 ? 229 PHE A CD1  2  
ATOM   8110   C  CD2  . PHE A 1 229 ? -0.041  -0.606  -4.715  1.00 0.00 ? 229 PHE A CD2  2  
ATOM   8111   C  CE1  . PHE A 1 229 ? 2.607   -1.264  -5.338  1.00 0.00 ? 229 PHE A CE1  2  
ATOM   8112   C  CE2  . PHE A 1 229 ? 0.967   0.356   -4.587  1.00 0.00 ? 229 PHE A CE2  2  
ATOM   8113   C  CZ   . PHE A 1 229 ? 2.291   0.028   -4.898  1.00 0.00 ? 229 PHE A CZ   2  
ATOM   8114   H  H    . PHE A 1 229 ? -2.536  -4.770  -5.063  1.00 0.00 ? 229 PHE A H    2  
ATOM   8115   H  HA   . PHE A 1 229 ? 0.137   -4.500  -4.184  1.00 0.00 ? 229 PHE A HA   2  
ATOM   8116   H  HB2  . PHE A 1 229 ? -0.686  -3.455  -6.236  1.00 0.00 ? 229 PHE A HB2  2  
ATOM   8117   H  HB3  . PHE A 1 229 ? -1.778  -2.431  -5.312  1.00 0.00 ? 229 PHE A HB3  2  
ATOM   8118   H  HD1  . PHE A 1 229 ? 1.843   -3.224  -5.800  1.00 0.00 ? 229 PHE A HD1  2  
ATOM   8119   H  HD2  . PHE A 1 229 ? -1.063  -0.352  -4.475  1.00 0.00 ? 229 PHE A HD2  2  
ATOM   8120   H  HE1  . PHE A 1 229 ? 3.630   -1.517  -5.576  1.00 0.00 ? 229 PHE A HE1  2  
ATOM   8121   H  HE2  . PHE A 1 229 ? 0.723   1.352   -4.247  1.00 0.00 ? 229 PHE A HE2  2  
ATOM   8122   H  HZ   . PHE A 1 229 ? 3.067   0.771   -4.802  1.00 0.00 ? 229 PHE A HZ   2  
ATOM   8123   N  N    . ASP A 1 230 ? -2.062  -2.759  -2.469  1.00 0.00 ? 230 ASP A N    2  
ATOM   8124   C  CA   . ASP A 1 230 ? -2.254  -2.033  -1.186  1.00 0.00 ? 230 ASP A CA   2  
ATOM   8125   C  C    . ASP A 1 230 ? -2.103  -3.008  -0.014  1.00 0.00 ? 230 ASP A C    2  
ATOM   8126   O  O    . ASP A 1 230 ? -1.536  -2.678  1.009   1.00 0.00 ? 230 ASP A O    2  
ATOM   8127   C  CB   . ASP A 1 230 ? -3.658  -1.427  -1.166  1.00 0.00 ? 230 ASP A CB   2  
ATOM   8128   C  CG   . ASP A 1 230 ? -3.642  -0.070  -1.872  1.00 0.00 ? 230 ASP A CG   2  
ATOM   8129   O  OD1  . ASP A 1 230 ? -3.279  -0.035  -3.035  1.00 0.00 ? 230 ASP A OD1  2  
ATOM   8130   O  OD2  . ASP A 1 230 ? -3.996  0.910   -1.238  1.00 0.00 ? 230 ASP A OD2  2  
ATOM   8131   H  H    . ASP A 1 230 ? -2.829  -2.915  -3.057  1.00 0.00 ? 230 ASP A H    2  
ATOM   8132   H  HA   . ASP A 1 230 ? -1.521  -1.246  -1.101  1.00 0.00 ? 230 ASP A HA   2  
ATOM   8133   H  HB2  . ASP A 1 230 ? -4.342  -2.091  -1.674  1.00 0.00 ? 230 ASP A HB2  2  
ATOM   8134   H  HB3  . ASP A 1 230 ? -3.977  -1.296  -0.146  1.00 0.00 ? 230 ASP A HB3  2  
ATOM   8135   N  N    . LEU A 1 231 ? -2.609  -4.205  -0.152  1.00 0.00 ? 231 LEU A N    2  
ATOM   8136   C  CA   . LEU A 1 231 ? -2.494  -5.196  0.958   1.00 0.00 ? 231 LEU A CA   2  
ATOM   8137   C  C    . LEU A 1 231 ? -1.019  -5.395  1.313   1.00 0.00 ? 231 LEU A C    2  
ATOM   8138   O  O    . LEU A 1 231 ? -0.663  -5.566  2.465   1.00 0.00 ? 231 LEU A O    2  
ATOM   8139   C  CB   . LEU A 1 231 ? -3.103  -6.530  0.515   1.00 0.00 ? 231 LEU A CB   2  
ATOM   8140   C  CG   . LEU A 1 231 ? -2.871  -7.590  1.595   1.00 0.00 ? 231 LEU A CG   2  
ATOM   8141   C  CD1  . LEU A 1 231 ? -3.386  -7.077  2.942   1.00 0.00 ? 231 LEU A CD1  2  
ATOM   8142   C  CD2  . LEU A 1 231 ? -3.624  -8.868  1.221   1.00 0.00 ? 231 LEU A CD2  2  
ATOM   8143   H  H    . LEU A 1 231 ? -3.064  -4.451  -0.984  1.00 0.00 ? 231 LEU A H    2  
ATOM   8144   H  HA   . LEU A 1 231 ? -3.025  -4.827  1.823   1.00 0.00 ? 231 LEU A HA   2  
ATOM   8145   H  HB2  . LEU A 1 231 ? -4.164  -6.405  0.354   1.00 0.00 ? 231 LEU A HB2  2  
ATOM   8146   H  HB3  . LEU A 1 231 ? -2.636  -6.850  -0.405  1.00 0.00 ? 231 LEU A HB3  2  
ATOM   8147   H  HG   . LEU A 1 231 ? -1.815  -7.801  1.672   1.00 0.00 ? 231 LEU A HG   2  
ATOM   8148   H  HD11 . LEU A 1 231 ? -4.274  -6.483  2.785   1.00 0.00 ? 231 LEU A HD11 2  
ATOM   8149   H  HD12 . LEU A 1 231 ? -2.625  -6.473  3.412   1.00 0.00 ? 231 LEU A HD12 2  
ATOM   8150   H  HD13 . LEU A 1 231 ? -3.623  -7.917  3.579   1.00 0.00 ? 231 LEU A HD13 2  
ATOM   8151   H  HD21 . LEU A 1 231 ? -4.661  -8.771  1.508   1.00 0.00 ? 231 LEU A HD21 2  
ATOM   8152   H  HD22 . LEU A 1 231 ? -3.185  -9.709  1.737   1.00 0.00 ? 231 LEU A HD22 2  
ATOM   8153   H  HD23 . LEU A 1 231 ? -3.558  -9.025  0.155   1.00 0.00 ? 231 LEU A HD23 2  
ATOM   8154   N  N    . ILE A 1 232 ? -0.154  -5.354  0.339   1.00 0.00 ? 232 ILE A N    2  
ATOM   8155   C  CA   . ILE A 1 232 ? 1.294   -5.520  0.637   1.00 0.00 ? 232 ILE A CA   2  
ATOM   8156   C  C    . ILE A 1 232 ? 1.778   -4.262  1.353   1.00 0.00 ? 232 ILE A C    2  
ATOM   8157   O  O    . ILE A 1 232 ? 2.423   -4.320  2.380   1.00 0.00 ? 232 ILE A O    2  
ATOM   8158   C  CB   . ILE A 1 232 ? 2.062   -5.703  -0.673  1.00 0.00 ? 232 ILE A CB   2  
ATOM   8159   C  CG1  . ILE A 1 232 ? 1.595   -6.991  -1.358  1.00 0.00 ? 232 ILE A CG1  2  
ATOM   8160   C  CG2  . ILE A 1 232 ? 3.560   -5.796  -0.380  1.00 0.00 ? 232 ILE A CG2  2  
ATOM   8161   C  CD1  . ILE A 1 232 ? 2.236   -7.099  -2.744  1.00 0.00 ? 232 ILE A CD1  2  
ATOM   8162   H  H    . ILE A 1 232 ? -0.458  -5.194  -0.579  1.00 0.00 ? 232 ILE A H    2  
ATOM   8163   H  HA   . ILE A 1 232 ? 1.440   -6.382  1.272   1.00 0.00 ? 232 ILE A HA   2  
ATOM   8164   H  HB   . ILE A 1 232 ? 1.873   -4.858  -1.320  1.00 0.00 ? 232 ILE A HB   2  
ATOM   8165   H  HG12 . ILE A 1 232 ? 1.886   -7.842  -0.760  1.00 0.00 ? 232 ILE A HG12 2  
ATOM   8166   H  HG13 . ILE A 1 232 ? 0.520   -6.972  -1.461  1.00 0.00 ? 232 ILE A HG13 2  
ATOM   8167   H  HG21 . ILE A 1 232 ? 3.930   -4.824  -0.088  1.00 0.00 ? 232 ILE A HG21 2  
ATOM   8168   H  HG22 . ILE A 1 232 ? 4.080   -6.128  -1.266  1.00 0.00 ? 232 ILE A HG22 2  
ATOM   8169   H  HG23 . ILE A 1 232 ? 3.726   -6.501  0.420   1.00 0.00 ? 232 ILE A HG23 2  
ATOM   8170   H  HD11 . ILE A 1 232 ? 2.679   -6.151  -3.013  1.00 0.00 ? 232 ILE A HD11 2  
ATOM   8171   H  HD12 . ILE A 1 232 ? 1.480   -7.361  -3.471  1.00 0.00 ? 232 ILE A HD12 2  
ATOM   8172   H  HD13 . ILE A 1 232 ? 3.000   -7.862  -2.729  1.00 0.00 ? 232 ILE A HD13 2  
ATOM   8173   N  N    . GLY A 1 233 ? 1.458   -3.120  0.812   1.00 0.00 ? 233 GLY A N    2  
ATOM   8174   C  CA   . GLY A 1 233 ? 1.882   -1.846  1.455   1.00 0.00 ? 233 GLY A CA   2  
ATOM   8175   C  C    . GLY A 1 233 ? 1.517   -1.889  2.941   1.00 0.00 ? 233 GLY A C    2  
ATOM   8176   O  O    . GLY A 1 233 ? 2.196   -1.317  3.773   1.00 0.00 ? 233 GLY A O    2  
ATOM   8177   H  H    . GLY A 1 233 ? 0.941   -3.118  -0.022  1.00 0.00 ? 233 GLY A H    2  
ATOM   8178   H  HA2  . GLY A 1 233 ? 2.951   -1.727  1.350   1.00 0.00 ? 233 GLY A HA2  2  
ATOM   8179   H  HA3  . GLY A 1 233 ? 1.377   -1.014  0.987   1.00 0.00 ? 233 GLY A HA3  2  
ATOM   8180   N  N    . ASP A 1 234 ? 0.447   -2.560  3.286   1.00 0.00 ? 234 ASP A N    2  
ATOM   8181   C  CA   . ASP A 1 234 ? 0.044   -2.631  4.719   1.00 0.00 ? 234 ASP A CA   2  
ATOM   8182   C  C    . ASP A 1 234 ? 0.830   -3.735  5.438   1.00 0.00 ? 234 ASP A C    2  
ATOM   8183   O  O    . ASP A 1 234 ? 1.068   -3.654  6.627   1.00 0.00 ? 234 ASP A O    2  
ATOM   8184   C  CB   . ASP A 1 234 ? -1.459  -2.914  4.826   1.00 0.00 ? 234 ASP A CB   2  
ATOM   8185   C  CG   . ASP A 1 234 ? -2.228  -2.003  3.863   1.00 0.00 ? 234 ASP A CG   2  
ATOM   8186   O  OD1  . ASP A 1 234 ? -1.603  -1.451  2.974   1.00 0.00 ? 234 ASP A OD1  2  
ATOM   8187   O  OD2  . ASP A 1 234 ? -3.428  -1.874  4.034   1.00 0.00 ? 234 ASP A OD2  2  
ATOM   8188   H  H    . ASP A 1 234 ? -0.090  -3.012  2.604   1.00 0.00 ? 234 ASP A H    2  
ATOM   8189   H  HA   . ASP A 1 234 ? 0.259   -1.684  5.191   1.00 0.00 ? 234 ASP A HA   2  
ATOM   8190   H  HB2  . ASP A 1 234 ? -1.654  -3.948  4.582   1.00 0.00 ? 234 ASP A HB2  2  
ATOM   8191   H  HB3  . ASP A 1 234 ? -1.786  -2.720  5.835   1.00 0.00 ? 234 ASP A HB3  2  
ATOM   8192   N  N    . LEU A 1 235 ? 1.243   -4.765  4.741   1.00 0.00 ? 235 LEU A N    2  
ATOM   8193   C  CA   . LEU A 1 235 ? 2.016   -5.854  5.414   1.00 0.00 ? 235 LEU A CA   2  
ATOM   8194   C  C    . LEU A 1 235 ? 3.472   -5.424  5.587   1.00 0.00 ? 235 LEU A C    2  
ATOM   8195   O  O    . LEU A 1 235 ? 4.181   -5.928  6.434   1.00 0.00 ? 235 LEU A O    2  
ATOM   8196   C  CB   . LEU A 1 235 ? 1.966   -7.124  4.558   1.00 0.00 ? 235 LEU A CB   2  
ATOM   8197   C  CG   . LEU A 1 235 ? 0.847   -8.044  5.052   1.00 0.00 ? 235 LEU A CG   2  
ATOM   8198   C  CD1  . LEU A 1 235 ? 0.537   -9.089  3.977   1.00 0.00 ? 235 LEU A CD1  2  
ATOM   8199   C  CD2  . LEU A 1 235 ? 1.296   -8.755  6.331   1.00 0.00 ? 235 LEU A CD2  2  
ATOM   8200   H  H    . LEU A 1 235 ? 1.058   -4.831  3.779   1.00 0.00 ? 235 LEU A H    2  
ATOM   8201   H  HA   . LEU A 1 235 ? 1.590   -6.055  6.382   1.00 0.00 ? 235 LEU A HA   2  
ATOM   8202   H  HB2  . LEU A 1 235 ? 1.782   -6.855  3.529   1.00 0.00 ? 235 LEU A HB2  2  
ATOM   8203   H  HB3  . LEU A 1 235 ? 2.912   -7.641  4.630   1.00 0.00 ? 235 LEU A HB3  2  
ATOM   8204   H  HG   . LEU A 1 235 ? -0.039  -7.458  5.253   1.00 0.00 ? 235 LEU A HG   2  
ATOM   8205   H  HD11 . LEU A 1 235 ? -0.024  -9.901  4.417   1.00 0.00 ? 235 LEU A HD11 2  
ATOM   8206   H  HD12 . LEU A 1 235 ? 1.461   -9.469  3.566   1.00 0.00 ? 235 LEU A HD12 2  
ATOM   8207   H  HD13 . LEU A 1 235 ? -0.046  -8.633  3.191   1.00 0.00 ? 235 LEU A HD13 2  
ATOM   8208   H  HD21 . LEU A 1 235 ? 2.148   -8.240  6.750   1.00 0.00 ? 235 LEU A HD21 2  
ATOM   8209   H  HD22 . LEU A 1 235 ? 1.569   -9.774  6.100   1.00 0.00 ? 235 LEU A HD22 2  
ATOM   8210   H  HD23 . LEU A 1 235 ? 0.487   -8.753  7.047   1.00 0.00 ? 235 LEU A HD23 2  
ATOM   8211   N  N    . TYR A 1 236 ? 3.925   -4.501  4.790   1.00 0.00 ? 236 TYR A N    2  
ATOM   8212   C  CA   . TYR A 1 236 ? 5.337   -4.045  4.913   1.00 0.00 ? 236 TYR A CA   2  
ATOM   8213   C  C    . TYR A 1 236 ? 5.510   -3.284  6.226   1.00 0.00 ? 236 TYR A C    2  
ATOM   8214   O  O    . TYR A 1 236 ? 6.610   -2.948  6.621   1.00 0.00 ? 236 TYR A O    2  
ATOM   8215   C  CB   . TYR A 1 236 ? 5.670   -3.137  3.728   1.00 0.00 ? 236 TYR A CB   2  
ATOM   8216   C  CG   . TYR A 1 236 ? 7.149   -2.813  3.696   1.00 0.00 ? 236 TYR A CG   2  
ATOM   8217   C  CD1  . TYR A 1 236 ? 8.111   -3.835  3.655   1.00 0.00 ? 236 TYR A CD1  2  
ATOM   8218   C  CD2  . TYR A 1 236 ? 7.558   -1.475  3.696   1.00 0.00 ? 236 TYR A CD2  2  
ATOM   8219   C  CE1  . TYR A 1 236 ? 9.473   -3.512  3.614   1.00 0.00 ? 236 TYR A CE1  2  
ATOM   8220   C  CE2  . TYR A 1 236 ? 8.917   -1.154  3.655   1.00 0.00 ? 236 TYR A CE2  2  
ATOM   8221   C  CZ   . TYR A 1 236 ? 9.876   -2.172  3.615   1.00 0.00 ? 236 TYR A CZ   2  
ATOM   8222   O  OH   . TYR A 1 236 ? 11.218  -1.856  3.576   1.00 0.00 ? 236 TYR A OH   2  
ATOM   8223   H  H    . TYR A 1 236 ? 3.338   -4.105  4.111   1.00 0.00 ? 236 TYR A H    2  
ATOM   8224   H  HA   . TYR A 1 236 ? 5.987   -4.903  4.909   1.00 0.00 ? 236 TYR A HA   2  
ATOM   8225   H  HB2  . TYR A 1 236 ? 5.392   -3.632  2.813   1.00 0.00 ? 236 TYR A HB2  2  
ATOM   8226   H  HB3  . TYR A 1 236 ? 5.108   -2.219  3.817   1.00 0.00 ? 236 TYR A HB3  2  
ATOM   8227   H  HD1  . TYR A 1 236 ? 7.808   -4.870  3.654   1.00 0.00 ? 236 TYR A HD1  2  
ATOM   8228   H  HD2  . TYR A 1 236 ? 6.820   -0.690  3.727   1.00 0.00 ? 236 TYR A HD2  2  
ATOM   8229   H  HE1  . TYR A 1 236 ? 10.214  -4.297  3.583   1.00 0.00 ? 236 TYR A HE1  2  
ATOM   8230   H  HE2  . TYR A 1 236 ? 9.228   -0.120  3.652   1.00 0.00 ? 236 TYR A HE2  2  
ATOM   8231   H  HH   . TYR A 1 236 ? 11.690  -2.498  4.111   1.00 0.00 ? 236 TYR A HH   2  
ATOM   8232   N  N    . LEU A 1 237 ? 4.432   -3.015  6.910   1.00 0.00 ? 237 LEU A N    2  
ATOM   8233   C  CA   . LEU A 1 237 ? 4.536   -2.283  8.201   1.00 0.00 ? 237 LEU A CA   2  
ATOM   8234   C  C    . LEU A 1 237 ? 5.542   -2.997  9.104   1.00 0.00 ? 237 LEU A C    2  
ATOM   8235   O  O    . LEU A 1 237 ? 6.237   -2.375  9.880   1.00 0.00 ? 237 LEU A O    2  
ATOM   8236   C  CB   . LEU A 1 237 ? 3.165   -2.251  8.881   1.00 0.00 ? 237 LEU A CB   2  
ATOM   8237   C  CG   . LEU A 1 237 ? 2.299   -1.169  8.229   1.00 0.00 ? 237 LEU A CG   2  
ATOM   8238   C  CD1  . LEU A 1 237 ? 0.869   -1.270  8.763   1.00 0.00 ? 237 LEU A CD1  2  
ATOM   8239   C  CD2  . LEU A 1 237 ? 2.867   0.215   8.557   1.00 0.00 ? 237 LEU A CD2  2  
ATOM   8240   H  H    . LEU A 1 237 ? 3.557   -3.298  6.575   1.00 0.00 ? 237 LEU A H    2  
ATOM   8241   H  HA   . LEU A 1 237 ? 4.872   -1.272  8.020   1.00 0.00 ? 237 LEU A HA   2  
ATOM   8242   H  HB2  . LEU A 1 237 ? 2.686   -3.213  8.764   1.00 0.00 ? 237 LEU A HB2  2  
ATOM   8243   H  HB3  . LEU A 1 237 ? 3.285   -2.033  9.930   1.00 0.00 ? 237 LEU A HB3  2  
ATOM   8244   H  HG   . LEU A 1 237 ? 2.291   -1.312  7.159   1.00 0.00 ? 237 LEU A HG   2  
ATOM   8245   H  HD11 . LEU A 1 237 ? 0.476   -0.278  8.929   1.00 0.00 ? 237 LEU A HD11 2  
ATOM   8246   H  HD12 . LEU A 1 237 ? 0.869   -1.818  9.694   1.00 0.00 ? 237 LEU A HD12 2  
ATOM   8247   H  HD13 . LEU A 1 237 ? 0.252   -1.786  8.042   1.00 0.00 ? 237 LEU A HD13 2  
ATOM   8248   H  HD21 . LEU A 1 237 ? 3.303   0.644   7.667   1.00 0.00 ? 237 LEU A HD21 2  
ATOM   8249   H  HD22 . LEU A 1 237 ? 3.624   0.126   9.322   1.00 0.00 ? 237 LEU A HD22 2  
ATOM   8250   H  HD23 . LEU A 1 237 ? 2.073   0.855   8.912   1.00 0.00 ? 237 LEU A HD23 2  
ATOM   8251   N  N    . LEU A 1 238 ? 5.639   -4.295  9.008   1.00 0.00 ? 238 LEU A N    2  
ATOM   8252   C  CA   . LEU A 1 238 ? 6.617   -5.023  9.866   1.00 0.00 ? 238 LEU A CA   2  
ATOM   8253   C  C    . LEU A 1 238 ? 7.999   -4.389  9.703   1.00 0.00 ? 238 LEU A C    2  
ATOM   8254   O  O    . LEU A 1 238 ? 8.912   -4.664  10.457  1.00 0.00 ? 238 LEU A O    2  
ATOM   8255   C  CB   . LEU A 1 238 ? 6.681   -6.491  9.443   1.00 0.00 ? 238 LEU A CB   2  
ATOM   8256   C  CG   . LEU A 1 238 ? 5.346   -7.174  9.747   1.00 0.00 ? 238 LEU A CG   2  
ATOM   8257   C  CD1  . LEU A 1 238 ? 5.344   -8.580  9.148   1.00 0.00 ? 238 LEU A CD1  2  
ATOM   8258   C  CD2  . LEU A 1 238 ? 5.146   -7.269  11.264  1.00 0.00 ? 238 LEU A CD2  2  
ATOM   8259   H  H    . LEU A 1 238 ? 5.081   -4.796  8.371   1.00 0.00 ? 238 LEU A H    2  
ATOM   8260   H  HA   . LEU A 1 238 ? 6.309   -4.957  10.899  1.00 0.00 ? 238 LEU A HA   2  
ATOM   8261   H  HB2  . LEU A 1 238 ? 6.881   -6.550  8.381   1.00 0.00 ? 238 LEU A HB2  2  
ATOM   8262   H  HB3  . LEU A 1 238 ? 7.471   -6.989  9.984   1.00 0.00 ? 238 LEU A HB3  2  
ATOM   8263   H  HG   . LEU A 1 238 ? 4.544   -6.597  9.311   1.00 0.00 ? 238 LEU A HG   2  
ATOM   8264   H  HD11 . LEU A 1 238 ? 5.223   -9.307  9.936   1.00 0.00 ? 238 LEU A HD11 2  
ATOM   8265   H  HD12 . LEU A 1 238 ? 6.279   -8.754  8.637   1.00 0.00 ? 238 LEU A HD12 2  
ATOM   8266   H  HD13 . LEU A 1 238 ? 4.528   -8.670  8.445   1.00 0.00 ? 238 LEU A HD13 2  
ATOM   8267   H  HD21 . LEU A 1 238 ? 4.516   -8.118  11.490  1.00 0.00 ? 238 LEU A HD21 2  
ATOM   8268   H  HD22 . LEU A 1 238 ? 4.674   -6.368  11.623  1.00 0.00 ? 238 LEU A HD22 2  
ATOM   8269   H  HD23 . LEU A 1 238 ? 6.102   -7.393  11.749  1.00 0.00 ? 238 LEU A HD23 2  
ATOM   8270   N  N    . GLY A 1 239 ? 8.159   -3.540  8.726   1.00 0.00 ? 239 GLY A N    2  
ATOM   8271   C  CA   . GLY A 1 239 ? 9.477   -2.885  8.513   1.00 0.00 ? 239 GLY A CA   2  
ATOM   8272   C  C    . GLY A 1 239 ? 10.440  -3.867  7.842   1.00 0.00 ? 239 GLY A C    2  
ATOM   8273   O  O    . GLY A 1 239 ? 11.632  -3.639  7.786   1.00 0.00 ? 239 GLY A O    2  
ATOM   8274   H  H    . GLY A 1 239 ? 7.411   -3.331  8.133   1.00 0.00 ? 239 GLY A H    2  
ATOM   8275   H  HA2  . GLY A 1 239 ? 9.349   -2.016  7.881   1.00 0.00 ? 239 GLY A HA2  2  
ATOM   8276   H  HA3  . GLY A 1 239 ? 9.882   -2.583  9.464   1.00 0.00 ? 239 GLY A HA3  2  
ATOM   8277   N  N    . SER A 1 240 ? 9.936   -4.957  7.328   1.00 0.00 ? 240 SER A N    2  
ATOM   8278   C  CA   . SER A 1 240 ? 10.833  -5.941  6.659   1.00 0.00 ? 240 SER A CA   2  
ATOM   8279   C  C    . SER A 1 240 ? 10.009  -6.818  5.707   1.00 0.00 ? 240 SER A C    2  
ATOM   8280   O  O    . SER A 1 240 ? 8.882   -7.160  6.004   1.00 0.00 ? 240 SER A O    2  
ATOM   8281   C  CB   . SER A 1 240 ? 11.495  -6.824  7.716   1.00 0.00 ? 240 SER A CB   2  
ATOM   8282   O  OG   . SER A 1 240 ? 10.489  -7.470  8.483   1.00 0.00 ? 240 SER A OG   2  
ATOM   8283   H  H    . SER A 1 240 ? 8.970   -5.124  7.374   1.00 0.00 ? 240 SER A H    2  
ATOM   8284   H  HA   . SER A 1 240 ? 11.592  -5.407  6.109   1.00 0.00 ? 240 SER A HA   2  
ATOM   8285   H  HB2  . SER A 1 240 ? 12.109  -7.569  7.233   1.00 0.00 ? 240 SER A HB2  2  
ATOM   8286   H  HB3  . SER A 1 240 ? 12.114  -6.210  8.357   1.00 0.00 ? 240 SER A HB3  2  
ATOM   8287   H  HG   . SER A 1 240 ? 10.274  -6.904  9.228   1.00 0.00 ? 240 SER A HG   2  
ATOM   8288   N  N    . PRO A 1 241 ? 10.559  -7.192  4.575   1.00 0.00 ? 241 PRO A N    2  
ATOM   8289   C  CA   . PRO A 1 241 ? 9.845   -8.049  3.592   1.00 0.00 ? 241 PRO A CA   2  
ATOM   8290   C  C    . PRO A 1 241 ? 9.058   -9.174  4.271   1.00 0.00 ? 241 PRO A C    2  
ATOM   8291   O  O    . PRO A 1 241 ? 9.550   -9.836  5.162   1.00 0.00 ? 241 PRO A O    2  
ATOM   8292   C  CB   . PRO A 1 241 ? 10.969  -8.628  2.735   1.00 0.00 ? 241 PRO A CB   2  
ATOM   8293   C  CG   . PRO A 1 241 ? 12.077  -7.626  2.797   1.00 0.00 ? 241 PRO A CG   2  
ATOM   8294   C  CD   . PRO A 1 241 ? 11.912  -6.842  4.104   1.00 0.00 ? 241 PRO A CD   2  
ATOM   8295   H  HA   . PRO A 1 241 ? 9.194   -7.452  2.976   1.00 0.00 ? 241 PRO A HA   2  
ATOM   8296   H  HB2  . PRO A 1 241 ? 11.293  -9.575  3.141   1.00 0.00 ? 241 PRO A HB2  2  
ATOM   8297   H  HB3  . PRO A 1 241 ? 10.639  -8.749  1.716   1.00 0.00 ? 241 PRO A HB3  2  
ATOM   8298   H  HG2  . PRO A 1 241 ? 13.031  -8.132  2.785   1.00 0.00 ? 241 PRO A HG2  2  
ATOM   8299   H  HG3  . PRO A 1 241 ? 12.008  -6.950  1.960   1.00 0.00 ? 241 PRO A HG3  2  
ATOM   8300   H  HD2  . PRO A 1 241 ? 12.658  -7.149  4.824   1.00 0.00 ? 241 PRO A HD2  2  
ATOM   8301   H  HD3  . PRO A 1 241 ? 11.978  -5.783  3.915   1.00 0.00 ? 241 PRO A HD3  2  
ATOM   8302   N  N    . VAL A 1 242 ? 7.840   -9.395  3.858   1.00 0.00 ? 242 VAL A N    2  
ATOM   8303   C  CA   . VAL A 1 242 ? 7.027   -10.478 4.485   1.00 0.00 ? 242 VAL A CA   2  
ATOM   8304   C  C    . VAL A 1 242 ? 7.023   -11.707 3.575   1.00 0.00 ? 242 VAL A C    2  
ATOM   8305   O  O    . VAL A 1 242 ? 6.873   -11.598 2.374   1.00 0.00 ? 242 VAL A O    2  
ATOM   8306   C  CB   . VAL A 1 242 ? 5.592   -9.989  4.685   1.00 0.00 ? 242 VAL A CB   2  
ATOM   8307   C  CG1  . VAL A 1 242 ? 4.638   -11.184 4.640   1.00 0.00 ? 242 VAL A CG1  2  
ATOM   8308   C  CG2  . VAL A 1 242 ? 5.475   -9.297  6.044   1.00 0.00 ? 242 VAL A CG2  2  
ATOM   8309   H  H    . VAL A 1 242 ? 7.460   -8.850  3.137   1.00 0.00 ? 242 VAL A H    2  
ATOM   8310   H  HA   . VAL A 1 242 ? 7.454   -10.742 5.439   1.00 0.00 ? 242 VAL A HA   2  
ATOM   8311   H  HB   . VAL A 1 242 ? 5.335   -9.293  3.899   1.00 0.00 ? 242 VAL A HB   2  
ATOM   8312   H  HG11 . VAL A 1 242 ? 4.483   -11.484 3.615   1.00 0.00 ? 242 VAL A HG11 2  
ATOM   8313   H  HG12 . VAL A 1 242 ? 3.692   -10.907 5.082   1.00 0.00 ? 242 VAL A HG12 2  
ATOM   8314   H  HG13 . VAL A 1 242 ? 5.065   -12.007 5.194   1.00 0.00 ? 242 VAL A HG13 2  
ATOM   8315   H  HG21 . VAL A 1 242 ? 5.652   -10.014 6.832   1.00 0.00 ? 242 VAL A HG21 2  
ATOM   8316   H  HG22 . VAL A 1 242 ? 4.484   -8.882  6.152   1.00 0.00 ? 242 VAL A HG22 2  
ATOM   8317   H  HG23 . VAL A 1 242 ? 6.206   -8.504  6.109   1.00 0.00 ? 242 VAL A HG23 2  
ATOM   8318   N  N    . LYS A 1 243 ? 7.185   -12.877 4.138   1.00 0.00 ? 243 LYS A N    2  
ATOM   8319   C  CA   . LYS A 1 243 ? 7.191   -14.114 3.303   1.00 0.00 ? 243 LYS A CA   2  
ATOM   8320   C  C    . LYS A 1 243 ? 6.183   -15.122 3.862   1.00 0.00 ? 243 LYS A C    2  
ATOM   8321   O  O    . LYS A 1 243 ? 6.156   -15.405 5.043   1.00 0.00 ? 243 LYS A O    2  
ATOM   8322   C  CB   . LYS A 1 243 ? 8.590   -14.733 3.312   1.00 0.00 ? 243 LYS A CB   2  
ATOM   8323   C  CG   . LYS A 1 243 ? 9.044   -14.976 1.870   1.00 0.00 ? 243 LYS A CG   2  
ATOM   8324   C  CD   . LYS A 1 243 ? 10.279  -15.883 1.857   1.00 0.00 ? 243 LYS A CD   2  
ATOM   8325   C  CE   . LYS A 1 243 ? 11.519  -15.077 2.256   1.00 0.00 ? 243 LYS A CE   2  
ATOM   8326   N  NZ   . LYS A 1 243 ? 12.248  -15.796 3.339   1.00 0.00 ? 243 LYS A NZ   2  
ATOM   8327   H  H    . LYS A 1 243 ? 7.306   -12.941 5.112   1.00 0.00 ? 243 LYS A H    2  
ATOM   8328   H  HA   . LYS A 1 243 ? 6.918   -13.865 2.289   1.00 0.00 ? 243 LYS A HA   2  
ATOM   8329   H  HB2  . LYS A 1 243 ? 9.278   -14.057 3.801   1.00 0.00 ? 243 LYS A HB2  2  
ATOM   8330   H  HB3  . LYS A 1 243 ? 8.566   -15.670 3.845   1.00 0.00 ? 243 LYS A HB3  2  
ATOM   8331   H  HG2  . LYS A 1 243 ? 8.245   -15.452 1.319   1.00 0.00 ? 243 LYS A HG2  2  
ATOM   8332   H  HG3  . LYS A 1 243 ? 9.289   -14.033 1.405   1.00 0.00 ? 243 LYS A HG3  2  
ATOM   8333   H  HD2  . LYS A 1 243 ? 10.137  -16.695 2.555   1.00 0.00 ? 243 LYS A HD2  2  
ATOM   8334   H  HD3  . LYS A 1 243 ? 10.418  -16.283 0.864   1.00 0.00 ? 243 LYS A HD3  2  
ATOM   8335   H  HE2  . LYS A 1 243 ? 12.167  -14.967 1.399   1.00 0.00 ? 243 LYS A HE2  2  
ATOM   8336   H  HE3  . LYS A 1 243 ? 11.219  -14.102 2.609   1.00 0.00 ? 243 LYS A HE3  2  
ATOM   8337   H  HZ1  . LYS A 1 243 ? 12.058  -16.815 3.269   1.00 0.00 ? 243 LYS A HZ1  2  
ATOM   8338   H  HZ2  . LYS A 1 243 ? 11.927  -15.444 4.264   1.00 0.00 ? 243 LYS A HZ2  2  
ATOM   8339   H  HZ3  . LYS A 1 243 ? 13.269  -15.629 3.240   1.00 0.00 ? 243 LYS A HZ3  2  
ATOM   8340   N  N    . GLY A 1 244 ? 5.351   -15.662 3.013   1.00 0.00 ? 244 GLY A N    2  
ATOM   8341   C  CA   . GLY A 1 244 ? 4.335   -16.653 3.471   1.00 0.00 ? 244 GLY A CA   2  
ATOM   8342   C  C    . GLY A 1 244 ? 3.154   -16.638 2.495   1.00 0.00 ? 244 GLY A C    2  
ATOM   8343   O  O    . GLY A 1 244 ? 3.167   -15.921 1.512   1.00 0.00 ? 244 GLY A O    2  
ATOM   8344   H  H    . GLY A 1 244 ? 5.394   -15.414 2.066   1.00 0.00 ? 244 GLY A H    2  
ATOM   8345   H  HA2  . GLY A 1 244 ? 4.779   -17.638 3.495   1.00 0.00 ? 244 GLY A HA2  2  
ATOM   8346   H  HA3  . GLY A 1 244 ? 3.989   -16.392 4.460   1.00 0.00 ? 244 GLY A HA3  2  
ATOM   8347   N  N    . LYS A 1 245 ? 2.140   -17.422 2.746   1.00 0.00 ? 245 LYS A N    2  
ATOM   8348   C  CA   . LYS A 1 245 ? 0.966   -17.445 1.818   1.00 0.00 ? 245 LYS A CA   2  
ATOM   8349   C  C    . LYS A 1 245 ? -0.222  -16.730 2.468   1.00 0.00 ? 245 LYS A C    2  
ATOM   8350   O  O    . LYS A 1 245 ? -0.769  -17.190 3.451   1.00 0.00 ? 245 LYS A O    2  
ATOM   8351   C  CB   . LYS A 1 245 ? 0.583   -18.897 1.515   1.00 0.00 ? 245 LYS A CB   2  
ATOM   8352   C  CG   . LYS A 1 245 ? -0.415  -18.934 0.353   1.00 0.00 ? 245 LYS A CG   2  
ATOM   8353   C  CD   . LYS A 1 245 ? -1.700  -19.633 0.804   1.00 0.00 ? 245 LYS A CD   2  
ATOM   8354   C  CE   . LYS A 1 245 ? -2.727  -19.596 -0.331  1.00 0.00 ? 245 LYS A CE   2  
ATOM   8355   N  NZ   . LYS A 1 245 ? -2.588  -20.824 -1.165  1.00 0.00 ? 245 LYS A NZ   2  
ATOM   8356   H  H    . LYS A 1 245 ? 2.153   -17.997 3.542   1.00 0.00 ? 245 LYS A H    2  
ATOM   8357   H  HA   . LYS A 1 245 ? 1.225   -16.944 0.896   1.00 0.00 ? 245 LYS A HA   2  
ATOM   8358   H  HB2  . LYS A 1 245 ? 1.469   -19.453 1.246   1.00 0.00 ? 245 LYS A HB2  2  
ATOM   8359   H  HB3  . LYS A 1 245 ? 0.131   -19.339 2.389   1.00 0.00 ? 245 LYS A HB3  2  
ATOM   8360   H  HG2  . LYS A 1 245 ? -0.644  -17.926 0.042   1.00 0.00 ? 245 LYS A HG2  2  
ATOM   8361   H  HG3  . LYS A 1 245 ? 0.017   -19.478 -0.473  1.00 0.00 ? 245 LYS A HG3  2  
ATOM   8362   H  HD2  . LYS A 1 245 ? -1.481  -20.659 1.060   1.00 0.00 ? 245 LYS A HD2  2  
ATOM   8363   H  HD3  . LYS A 1 245 ? -2.103  -19.124 1.667   1.00 0.00 ? 245 LYS A HD3  2  
ATOM   8364   H  HE2  . LYS A 1 245 ? -3.722  -19.555 0.086   1.00 0.00 ? 245 LYS A HE2  2  
ATOM   8365   H  HE3  . LYS A 1 245 ? -2.556  -18.723 -0.943  1.00 0.00 ? 245 LYS A HE3  2  
ATOM   8366   H  HZ1  . LYS A 1 245 ? -3.357  -20.857 -1.865  1.00 0.00 ? 245 LYS A HZ1  2  
ATOM   8367   H  HZ2  . LYS A 1 245 ? -2.638  -21.665 -0.555  1.00 0.00 ? 245 LYS A HZ2  2  
ATOM   8368   H  HZ3  . LYS A 1 245 ? -1.674  -20.807 -1.659  1.00 0.00 ? 245 LYS A HZ3  2  
ATOM   8369   N  N    . PHE A 1 246 ? -0.618  -15.604 1.929   1.00 0.00 ? 246 PHE A N    2  
ATOM   8370   C  CA   . PHE A 1 246 ? -1.764  -14.856 2.525   1.00 0.00 ? 246 PHE A CA   2  
ATOM   8371   C  C    . PHE A 1 246 ? -2.945  -14.806 1.559   1.00 0.00 ? 246 PHE A C    2  
ATOM   8372   O  O    . PHE A 1 246 ? -2.791  -14.717 0.357   1.00 0.00 ? 246 PHE A O    2  
ATOM   8373   C  CB   . PHE A 1 246 ? -1.352  -13.423 2.860   1.00 0.00 ? 246 PHE A CB   2  
ATOM   8374   C  CG   . PHE A 1 246 ? -0.068  -13.408 3.656   1.00 0.00 ? 246 PHE A CG   2  
ATOM   8375   C  CD1  . PHE A 1 246 ? 1.142   -13.777 3.053   1.00 0.00 ? 246 PHE A CD1  2  
ATOM   8376   C  CD2  . PHE A 1 246 ? -0.086  -13.003 4.996   1.00 0.00 ? 246 PHE A CD2  2  
ATOM   8377   C  CE1  . PHE A 1 246 ? 2.331   -13.745 3.793   1.00 0.00 ? 246 PHE A CE1  2  
ATOM   8378   C  CE2  . PHE A 1 246 ? 1.101   -12.968 5.734   1.00 0.00 ? 246 PHE A CE2  2  
ATOM   8379   C  CZ   . PHE A 1 246 ? 2.309   -13.339 5.134   1.00 0.00 ? 246 PHE A CZ   2  
ATOM   8380   H  H    . PHE A 1 246 ? -0.148  -15.254 1.143   1.00 0.00 ? 246 PHE A H    2  
ATOM   8381   H  HA   . PHE A 1 246 ? -2.078  -15.347 3.424   1.00 0.00 ? 246 PHE A HA   2  
ATOM   8382   H  HB2  . PHE A 1 246 ? -1.213  -12.877 1.949   1.00 0.00 ? 246 PHE A HB2  2  
ATOM   8383   H  HB3  . PHE A 1 246 ? -2.134  -12.956 3.437   1.00 0.00 ? 246 PHE A HB3  2  
ATOM   8384   H  HD1  . PHE A 1 246 ? 1.159   -14.089 2.020   1.00 0.00 ? 246 PHE A HD1  2  
ATOM   8385   H  HD2  . PHE A 1 246 ? -1.019  -12.718 5.460   1.00 0.00 ? 246 PHE A HD2  2  
ATOM   8386   H  HE1  . PHE A 1 246 ? 3.263   -14.032 3.331   1.00 0.00 ? 246 PHE A HE1  2  
ATOM   8387   H  HE2  . PHE A 1 246 ? 1.086   -12.656 6.768   1.00 0.00 ? 246 PHE A HE2  2  
ATOM   8388   H  HZ   . PHE A 1 246 ? 3.225   -13.309 5.704   1.00 0.00 ? 246 PHE A HZ   2  
ATOM   8389   N  N    . TYR A 1 247 ? -4.129  -14.846 2.101   1.00 0.00 ? 247 TYR A N    2  
ATOM   8390   C  CA   . TYR A 1 247 ? -5.358  -14.783 1.271   1.00 0.00 ? 247 TYR A CA   2  
ATOM   8391   C  C    . TYR A 1 247 ? -6.280  -13.730 1.886   1.00 0.00 ? 247 TYR A C    2  
ATOM   8392   O  O    . TYR A 1 247 ? -6.325  -13.580 3.091   1.00 0.00 ? 247 TYR A O    2  
ATOM   8393   C  CB   . TYR A 1 247 ? -6.050  -16.146 1.285   1.00 0.00 ? 247 TYR A CB   2  
ATOM   8394   C  CG   . TYR A 1 247 ? -7.151  -16.158 0.258   1.00 0.00 ? 247 TYR A CG   2  
ATOM   8395   C  CD1  . TYR A 1 247 ? -8.402  -15.614 0.570   1.00 0.00 ? 247 TYR A CD1  2  
ATOM   8396   C  CD2  . TYR A 1 247 ? -6.923  -16.709 -1.006  1.00 0.00 ? 247 TYR A CD2  2  
ATOM   8397   C  CE1  . TYR A 1 247 ? -9.426  -15.622 -0.384  1.00 0.00 ? 247 TYR A CE1  2  
ATOM   8398   C  CE2  . TYR A 1 247 ? -7.945  -16.718 -1.962  1.00 0.00 ? 247 TYR A CE2  2  
ATOM   8399   C  CZ   . TYR A 1 247 ? -9.197  -16.173 -1.650  1.00 0.00 ? 247 TYR A CZ   2  
ATOM   8400   O  OH   . TYR A 1 247 ? -10.206 -16.181 -2.592  1.00 0.00 ? 247 TYR A OH   2  
ATOM   8401   H  H    . TYR A 1 247 ? -4.205  -14.907 3.075   1.00 0.00 ? 247 TYR A H    2  
ATOM   8402   H  HA   . TYR A 1 247 ? -5.107  -14.506 0.258   1.00 0.00 ? 247 TYR A HA   2  
ATOM   8403   H  HB2  . TYR A 1 247 ? -5.328  -16.915 1.053   1.00 0.00 ? 247 TYR A HB2  2  
ATOM   8404   H  HB3  . TYR A 1 247 ? -6.468  -16.329 2.264   1.00 0.00 ? 247 TYR A HB3  2  
ATOM   8405   H  HD1  . TYR A 1 247 ? -8.577  -15.189 1.549   1.00 0.00 ? 247 TYR A HD1  2  
ATOM   8406   H  HD2  . TYR A 1 247 ? -5.957  -17.130 -1.246  1.00 0.00 ? 247 TYR A HD2  2  
ATOM   8407   H  HE1  . TYR A 1 247 ? -10.391 -15.202 -0.145  1.00 0.00 ? 247 TYR A HE1  2  
ATOM   8408   H  HE2  . TYR A 1 247 ? -7.768  -17.143 -2.937  1.00 0.00 ? 247 TYR A HE2  2  
ATOM   8409   H  HH   . TYR A 1 247 ? -10.926 -15.640 -2.260  1.00 0.00 ? 247 TYR A HH   2  
ATOM   8410   N  N    . SER A 1 248 ? -7.003  -12.985 1.092   1.00 0.00 ? 248 SER A N    2  
ATOM   8411   C  CA   . SER A 1 248 ? -7.890  -11.942 1.681   1.00 0.00 ? 248 SER A CA   2  
ATOM   8412   C  C    . SER A 1 248 ? -9.229  -11.895 0.945   1.00 0.00 ? 248 SER A C    2  
ATOM   8413   O  O    . SER A 1 248 ? -9.288  -11.776 -0.262  1.00 0.00 ? 248 SER A O    2  
ATOM   8414   C  CB   . SER A 1 248 ? -7.205  -10.580 1.569   1.00 0.00 ? 248 SER A CB   2  
ATOM   8415   O  OG   . SER A 1 248 ? -7.933  -9.626  2.330   1.00 0.00 ? 248 SER A OG   2  
ATOM   8416   H  H    . SER A 1 248 ? -6.962  -13.092 0.118   1.00 0.00 ? 248 SER A H    2  
ATOM   8417   H  HA   . SER A 1 248 ? -8.065  -12.164 2.716   1.00 0.00 ? 248 SER A HA   2  
ATOM   8418   H  HB2  . SER A 1 248 ? -6.200  -10.648 1.951   1.00 0.00 ? 248 SER A HB2  2  
ATOM   8419   H  HB3  . SER A 1 248 ? -7.174  -10.280 0.529   1.00 0.00 ? 248 SER A HB3  2  
ATOM   8420   H  HG   . SER A 1 248 ? -8.835  -9.609  2.003   1.00 0.00 ? 248 SER A HG   2  
ATOM   8421   N  N    . PHE A 1 249 ? -10.305 -11.964 1.680   1.00 0.00 ? 249 PHE A N    2  
ATOM   8422   C  CA   . PHE A 1 249 ? -11.654 -11.900 1.055   1.00 0.00 ? 249 PHE A CA   2  
ATOM   8423   C  C    . PHE A 1 249 ? -12.278 -10.552 1.417   1.00 0.00 ? 249 PHE A C    2  
ATOM   8424   O  O    . PHE A 1 249 ? -12.494 -10.260 2.582   1.00 0.00 ? 249 PHE A O    2  
ATOM   8425   C  CB   . PHE A 1 249 ? -12.524 -13.036 1.601   1.00 0.00 ? 249 PHE A CB   2  
ATOM   8426   C  CG   . PHE A 1 249 ? -13.798 -13.133 0.798   1.00 0.00 ? 249 PHE A CG   2  
ATOM   8427   C  CD1  . PHE A 1 249 ? -14.923 -12.390 1.177   1.00 0.00 ? 249 PHE A CD1  2  
ATOM   8428   C  CD2  . PHE A 1 249 ? -13.857 -13.970 -0.323  1.00 0.00 ? 249 PHE A CD2  2  
ATOM   8429   C  CE1  . PHE A 1 249 ? -16.106 -12.481 0.433   1.00 0.00 ? 249 PHE A CE1  2  
ATOM   8430   C  CE2  . PHE A 1 249 ? -15.041 -14.062 -1.066  1.00 0.00 ? 249 PHE A CE2  2  
ATOM   8431   C  CZ   . PHE A 1 249 ? -16.165 -13.317 -0.688  1.00 0.00 ? 249 PHE A CZ   2  
ATOM   8432   H  H    . PHE A 1 249 ? -10.226 -12.039 2.653   1.00 0.00 ? 249 PHE A H    2  
ATOM   8433   H  HA   . PHE A 1 249 ? -11.565 -11.985 -0.016  1.00 0.00 ? 249 PHE A HA   2  
ATOM   8434   H  HB2  . PHE A 1 249 ? -11.983 -13.969 1.531   1.00 0.00 ? 249 PHE A HB2  2  
ATOM   8435   H  HB3  . PHE A 1 249 ? -12.766 -12.839 2.634   1.00 0.00 ? 249 PHE A HB3  2  
ATOM   8436   H  HD1  . PHE A 1 249 ? -14.877 -11.745 2.043   1.00 0.00 ? 249 PHE A HD1  2  
ATOM   8437   H  HD2  . PHE A 1 249 ? -12.990 -14.543 -0.615  1.00 0.00 ? 249 PHE A HD2  2  
ATOM   8438   H  HE1  . PHE A 1 249 ? -16.973 -11.908 0.725   1.00 0.00 ? 249 PHE A HE1  2  
ATOM   8439   H  HE2  . PHE A 1 249 ? -15.087 -14.707 -1.930  1.00 0.00 ? 249 PHE A HE2  2  
ATOM   8440   H  HZ   . PHE A 1 249 ? -17.077 -13.388 -1.261  1.00 0.00 ? 249 PHE A HZ   2  
ATOM   8441   N  N    . ARG A 1 250 ? -12.552 -9.717  0.442   1.00 0.00 ? 250 ARG A N    2  
ATOM   8442   C  CA   . ARG A 1 250 ? -13.137 -8.385  0.762   1.00 0.00 ? 250 ARG A CA   2  
ATOM   8443   C  C    . ARG A 1 250 ? -12.357 -7.810  1.942   1.00 0.00 ? 250 ARG A C    2  
ATOM   8444   O  O    . ARG A 1 250 ? -12.909 -7.497  2.976   1.00 0.00 ? 250 ARG A O    2  
ATOM   8445   C  CB   . ARG A 1 250 ? -14.604 -8.547  1.148   1.00 0.00 ? 250 ARG A CB   2  
ATOM   8446   C  CG   . ARG A 1 250 ? -15.473 -8.500  -0.111  1.00 0.00 ? 250 ARG A CG   2  
ATOM   8447   C  CD   . ARG A 1 250 ? -15.647 -7.048  -0.562  1.00 0.00 ? 250 ARG A CD   2  
ATOM   8448   N  NE   . ARG A 1 250 ? -17.025 -6.586  -0.229  1.00 0.00 ? 250 ARG A NE   2  
ATOM   8449   C  CZ   . ARG A 1 250 ? -17.377 -5.352  -0.469  1.00 0.00 ? 250 ARG A CZ   2  
ATOM   8450   N  NH1  . ARG A 1 250 ? -16.524 -4.521  -1.004  1.00 0.00 ? 250 ARG A NH1  2  
ATOM   8451   N  NH2  . ARG A 1 250 ? -18.582 -4.948  -0.177  1.00 0.00 ? 250 ARG A NH2  2  
ATOM   8452   H  H    . ARG A 1 250 ? -12.361 -9.959  -0.489  1.00 0.00 ? 250 ARG A H    2  
ATOM   8453   H  HA   . ARG A 1 250 ? -13.050 -7.733  -0.099  1.00 0.00 ? 250 ARG A HA   2  
ATOM   8454   H  HB2  . ARG A 1 250 ? -14.733 -9.494  1.645   1.00 0.00 ? 250 ARG A HB2  2  
ATOM   8455   H  HB3  . ARG A 1 250 ? -14.892 -7.747  1.813   1.00 0.00 ? 250 ARG A HB3  2  
ATOM   8456   H  HG2  . ARG A 1 250 ? -14.997 -9.068  -0.898  1.00 0.00 ? 250 ARG A HG2  2  
ATOM   8457   H  HG3  . ARG A 1 250 ? -16.442 -8.926  0.104   1.00 0.00 ? 250 ARG A HG3  2  
ATOM   8458   H  HD2  . ARG A 1 250 ? -14.926 -6.424  -0.053  1.00 0.00 ? 250 ARG A HD2  2  
ATOM   8459   H  HD3  . ARG A 1 250 ? -15.491 -6.980  -1.629  1.00 0.00 ? 250 ARG A HD3  2  
ATOM   8460   H  HE   . ARG A 1 250 ? -17.666 -7.209  0.171   1.00 0.00 ? 250 ARG A HE   2  
ATOM   8461   H  HH11 . ARG A 1 250 ? -15.598 -4.829  -1.228  1.00 0.00 ? 250 ARG A HH11 2  
ATOM   8462   H  HH12 . ARG A 1 250 ? -16.794 -3.577  -1.189  1.00 0.00 ? 250 ARG A HH12 2  
ATOM   8463   H  HH21 . ARG A 1 250 ? -19.237 -5.585  0.232   1.00 0.00 ? 250 ARG A HH21 2  
ATOM   8464   H  HH22 . ARG A 1 250 ? -18.852 -4.002  -0.358  1.00 0.00 ? 250 ARG A HH22 2  
ATOM   8465   N  N    . GLY A 1 251 ? -11.070 -7.699  1.793   1.00 0.00 ? 251 GLY A N    2  
ATOM   8466   C  CA   . GLY A 1 251 ? -10.215 -7.178  2.901   1.00 0.00 ? 251 GLY A CA   2  
ATOM   8467   C  C    . GLY A 1 251 ? -10.162 -5.650  2.880   1.00 0.00 ? 251 GLY A C    2  
ATOM   8468   O  O    . GLY A 1 251 ? -10.202 -5.027  1.838   1.00 0.00 ? 251 GLY A O    2  
ATOM   8469   H  H    . GLY A 1 251 ? -10.665 -7.964  0.943   1.00 0.00 ? 251 GLY A H    2  
ATOM   8470   H  HA2  . GLY A 1 251 ? -10.621 -7.507  3.846   1.00 0.00 ? 251 GLY A HA2  2  
ATOM   8471   H  HA3  . GLY A 1 251 ? -9.214  -7.568  2.788   1.00 0.00 ? 251 GLY A HA3  2  
ATOM   8472   N  N    . GLY A 1 252 ? -10.059 -5.047  4.037   1.00 0.00 ? 252 GLY A N    2  
ATOM   8473   C  CA   . GLY A 1 252 ? -9.990  -3.560  4.115   1.00 0.00 ? 252 GLY A CA   2  
ATOM   8474   C  C    . GLY A 1 252 ? -8.626  -3.151  4.680   1.00 0.00 ? 252 GLY A C    2  
ATOM   8475   O  O    . GLY A 1 252 ? -7.805  -3.985  5.008   1.00 0.00 ? 252 GLY A O    2  
ATOM   8476   H  H    . GLY A 1 252 ? -10.025 -5.578  4.860   1.00 0.00 ? 252 GLY A H    2  
ATOM   8477   H  HA2  . GLY A 1 252 ? -10.115 -3.141  3.128   1.00 0.00 ? 252 GLY A HA2  2  
ATOM   8478   H  HA3  . GLY A 1 252 ? -10.769 -3.196  4.767   1.00 0.00 ? 252 GLY A HA3  2  
ATOM   8479   N  N    . HIS A 1 253 ? -8.373  -1.874  4.797   1.00 0.00 ? 253 HIS A N    2  
ATOM   8480   C  CA   . HIS A 1 253 ? -7.059  -1.424  5.340   1.00 0.00 ? 253 HIS A CA   2  
ATOM   8481   C  C    . HIS A 1 253 ? -6.963  -1.785  6.823   1.00 0.00 ? 253 HIS A C    2  
ATOM   8482   O  O    . HIS A 1 253 ? -5.995  -2.371  7.266   1.00 0.00 ? 253 HIS A O    2  
ATOM   8483   C  CB   . HIS A 1 253 ? -6.924  0.091   5.180   1.00 0.00 ? 253 HIS A CB   2  
ATOM   8484   C  CG   . HIS A 1 253 ? -6.615  0.420   3.744   1.00 0.00 ? 253 HIS A CG   2  
ATOM   8485   N  ND1  . HIS A 1 253 ? -5.388  0.127   3.168   1.00 0.00 ? 253 HIS A ND1  2  
ATOM   8486   C  CD2  . HIS A 1 253 ? -7.359  1.016   2.757   1.00 0.00 ? 253 HIS A CD2  2  
ATOM   8487   C  CE1  . HIS A 1 253 ? -5.430  0.545   1.889   1.00 0.00 ? 253 HIS A CE1  2  
ATOM   8488   N  NE2  . HIS A 1 253 ? -6.609  1.095   1.586   1.00 0.00 ? 253 HIS A NE2  2  
ATOM   8489   H  H    . HIS A 1 253 ? -9.046  -1.214  4.528   1.00 0.00 ? 253 HIS A H    2  
ATOM   8490   H  HA   . HIS A 1 253 ? -6.262  -1.914  4.800   1.00 0.00 ? 253 HIS A HA   2  
ATOM   8491   H  HB2  . HIS A 1 253 ? -7.847  0.570   5.473   1.00 0.00 ? 253 HIS A HB2  2  
ATOM   8492   H  HB3  . HIS A 1 253 ? -6.121  0.448   5.809   1.00 0.00 ? 253 HIS A HB3  2  
ATOM   8493   H  HD1  . HIS A 1 253 ? -4.627  -0.304  3.611   1.00 0.00 ? 253 HIS A HD1  2  
ATOM   8494   H  HD2  . HIS A 1 253 ? -8.374  1.369   2.870   1.00 0.00 ? 253 HIS A HD2  2  
ATOM   8495   H  HE1  . HIS A 1 253 ? -4.609  0.448   1.193   1.00 0.00 ? 253 HIS A HE1  2  
ATOM   8496   N  N    . SER A 1 254 ? -7.952  -1.438  7.599   1.00 0.00 ? 254 SER A N    2  
ATOM   8497   C  CA   . SER A 1 254 ? -7.902  -1.763  9.051   1.00 0.00 ? 254 SER A CA   2  
ATOM   8498   C  C    . SER A 1 254 ? -7.686  -3.267  9.227   1.00 0.00 ? 254 SER A C    2  
ATOM   8499   O  O    . SER A 1 254 ? -6.761  -3.696  9.890   1.00 0.00 ? 254 SER A O    2  
ATOM   8500   C  CB   . SER A 1 254 ? -9.220  -1.357  9.710   1.00 0.00 ? 254 SER A CB   2  
ATOM   8501   O  OG   . SER A 1 254 ? -9.379  0.053   9.612   1.00 0.00 ? 254 SER A OG   2  
ATOM   8502   H  H    . SER A 1 254 ? -8.724  -0.962  7.227   1.00 0.00 ? 254 SER A H    2  
ATOM   8503   H  HA   . SER A 1 254 ? -7.087  -1.224  9.513   1.00 0.00 ? 254 SER A HA   2  
ATOM   8504   H  HB2  . SER A 1 254 ? -10.041 -1.841  9.208   1.00 0.00 ? 254 SER A HB2  2  
ATOM   8505   H  HB3  . SER A 1 254 ? -9.209  -1.658  10.750  1.00 0.00 ? 254 SER A HB3  2  
ATOM   8506   H  HG   . SER A 1 254 ? -10.274 0.231   9.314   1.00 0.00 ? 254 SER A HG   2  
ATOM   8507   N  N    . LEU A 1 255 ? -8.531  -4.073  8.645   1.00 0.00 ? 255 LEU A N    2  
ATOM   8508   C  CA   . LEU A 1 255 ? -8.371  -5.547  8.786   1.00 0.00 ? 255 LEU A CA   2  
ATOM   8509   C  C    . LEU A 1 255 ? -6.936  -5.937  8.426   1.00 0.00 ? 255 LEU A C    2  
ATOM   8510   O  O    . LEU A 1 255 ? -6.335  -6.782  9.060   1.00 0.00 ? 255 LEU A O    2  
ATOM   8511   C  CB   . LEU A 1 255 ? -9.348  -6.265  7.852   1.00 0.00 ? 255 LEU A CB   2  
ATOM   8512   C  CG   . LEU A 1 255 ? -9.181  -7.779  8.000   1.00 0.00 ? 255 LEU A CG   2  
ATOM   8513   C  CD1  . LEU A 1 255 ? -9.470  -8.189  9.447   1.00 0.00 ? 255 LEU A CD1  2  
ATOM   8514   C  CD2  . LEU A 1 255 ? -10.157 -8.494  7.065   1.00 0.00 ? 255 LEU A CD2  2  
ATOM   8515   H  H    . LEU A 1 255 ? -9.278  -3.709  8.124   1.00 0.00 ? 255 LEU A H    2  
ATOM   8516   H  HA   . LEU A 1 255 ? -8.573  -5.833  9.809   1.00 0.00 ? 255 LEU A HA   2  
ATOM   8517   H  HB2  . LEU A 1 255 ? -10.361 -5.987  8.110   1.00 0.00 ? 255 LEU A HB2  2  
ATOM   8518   H  HB3  . LEU A 1 255 ? -9.146  -5.981  6.831   1.00 0.00 ? 255 LEU A HB3  2  
ATOM   8519   H  HG   . LEU A 1 255 ? -8.168  -8.055  7.744   1.00 0.00 ? 255 LEU A HG   2  
ATOM   8520   H  HD11 . LEU A 1 255 ? -9.835  -9.206  9.466   1.00 0.00 ? 255 LEU A HD11 2  
ATOM   8521   H  HD12 . LEU A 1 255 ? -10.217 -7.531  9.865   1.00 0.00 ? 255 LEU A HD12 2  
ATOM   8522   H  HD13 . LEU A 1 255 ? -8.563  -8.122  10.029  1.00 0.00 ? 255 LEU A HD13 2  
ATOM   8523   H  HD21 . LEU A 1 255 ? -10.968 -8.916  7.642   1.00 0.00 ? 255 LEU A HD21 2  
ATOM   8524   H  HD22 . LEU A 1 255 ? -9.639  -9.285  6.541   1.00 0.00 ? 255 LEU A HD22 2  
ATOM   8525   H  HD23 . LEU A 1 255 ? -10.551 -7.787  6.351   1.00 0.00 ? 255 LEU A HD23 2  
ATOM   8526   N  N    . ASN A 1 256 ? -6.376  -5.321  7.420   1.00 0.00 ? 256 ASN A N    2  
ATOM   8527   C  CA   . ASN A 1 256 ? -4.977  -5.657  7.035   1.00 0.00 ? 256 ASN A CA   2  
ATOM   8528   C  C    . ASN A 1 256 ? -4.059  -5.376  8.226   1.00 0.00 ? 256 ASN A C    2  
ATOM   8529   O  O    . ASN A 1 256 ? -3.314  -6.230  8.667   1.00 0.00 ? 256 ASN A O    2  
ATOM   8530   C  CB   . ASN A 1 256 ? -4.549  -4.800  5.842   1.00 0.00 ? 256 ASN A CB   2  
ATOM   8531   C  CG   . ASN A 1 256 ? -5.494  -5.053  4.667   1.00 0.00 ? 256 ASN A CG   2  
ATOM   8532   O  OD1  . ASN A 1 256 ? -5.667  -4.203  3.816   1.00 0.00 ? 256 ASN A OD1  2  
ATOM   8533   N  ND2  . ASN A 1 256 ? -6.116  -6.199  4.582   1.00 0.00 ? 256 ASN A ND2  2  
ATOM   8534   H  H    . ASN A 1 256 ? -6.871  -4.634  6.925   1.00 0.00 ? 256 ASN A H    2  
ATOM   8535   H  HA   . ASN A 1 256 ? -4.915  -6.702  6.772   1.00 0.00 ? 256 ASN A HA   2  
ATOM   8536   H  HB2  . ASN A 1 256 ? -4.585  -3.756  6.117   1.00 0.00 ? 256 ASN A HB2  2  
ATOM   8537   H  HB3  . ASN A 1 256 ? -3.542  -5.061  5.555   1.00 0.00 ? 256 ASN A HB3  2  
ATOM   8538   H  HD21 . ASN A 1 256 ? -5.974  -6.884  5.269   1.00 0.00 ? 256 ASN A HD21 2  
ATOM   8539   H  HD22 . ASN A 1 256 ? -6.722  -6.373  3.832   1.00 0.00 ? 256 ASN A HD22 2  
ATOM   8540   N  N    . VAL A 1 257 ? -4.112  -4.185  8.756   1.00 0.00 ? 257 VAL A N    2  
ATOM   8541   C  CA   . VAL A 1 257 ? -3.252  -3.847  9.923   1.00 0.00 ? 257 VAL A CA   2  
ATOM   8542   C  C    . VAL A 1 257 ? -3.398  -4.926  10.999  1.00 0.00 ? 257 VAL A C    2  
ATOM   8543   O  O    . VAL A 1 257 ? -2.429  -5.362  11.579  1.00 0.00 ? 257 VAL A O    2  
ATOM   8544   C  CB   . VAL A 1 257 ? -3.681  -2.496  10.496  1.00 0.00 ? 257 VAL A CB   2  
ATOM   8545   C  CG1  . VAL A 1 257 ? -2.654  -2.031  11.531  1.00 0.00 ? 257 VAL A CG1  2  
ATOM   8546   C  CG2  . VAL A 1 257 ? -3.764  -1.468  9.366   1.00 0.00 ? 257 VAL A CG2  2  
ATOM   8547   H  H    . VAL A 1 257 ? -4.722  -3.511  8.390   1.00 0.00 ? 257 VAL A H    2  
ATOM   8548   H  HA   . VAL A 1 257 ? -2.221  -3.793  9.607   1.00 0.00 ? 257 VAL A HA   2  
ATOM   8549   H  HB   . VAL A 1 257 ? -4.647  -2.595  10.969  1.00 0.00 ? 257 VAL A HB   2  
ATOM   8550   H  HG11 . VAL A 1 257 ? -1.884  -1.456  11.038  1.00 0.00 ? 257 VAL A HG11 2  
ATOM   8551   H  HG12 . VAL A 1 257 ? -2.210  -2.892  12.010  1.00 0.00 ? 257 VAL A HG12 2  
ATOM   8552   H  HG13 . VAL A 1 257 ? -3.142  -1.417  12.273  1.00 0.00 ? 257 VAL A HG13 2  
ATOM   8553   H  HG21 . VAL A 1 257 ? -4.798  -1.320  9.089   1.00 0.00 ? 257 VAL A HG21 2  
ATOM   8554   H  HG22 . VAL A 1 257 ? -3.211  -1.826  8.512   1.00 0.00 ? 257 VAL A HG22 2  
ATOM   8555   H  HG23 . VAL A 1 257 ? -3.344  -0.529  9.700   1.00 0.00 ? 257 VAL A HG23 2  
ATOM   8556   N  N    . LYS A 1 258 ? -4.599  -5.362  11.272  1.00 0.00 ? 258 LYS A N    2  
ATOM   8557   C  CA   . LYS A 1 258 ? -4.783  -6.414  12.314  1.00 0.00 ? 258 LYS A CA   2  
ATOM   8558   C  C    . LYS A 1 258 ? -3.913  -7.618  11.960  1.00 0.00 ? 258 LYS A C    2  
ATOM   8559   O  O    . LYS A 1 258 ? -3.202  -8.149  12.790  1.00 0.00 ? 258 LYS A O    2  
ATOM   8560   C  CB   . LYS A 1 258 ? -6.254  -6.837  12.361  1.00 0.00 ? 258 LYS A CB   2  
ATOM   8561   C  CG   . LYS A 1 258 ? -7.134  -5.601  12.565  1.00 0.00 ? 258 LYS A CG   2  
ATOM   8562   C  CD   . LYS A 1 258 ? -8.457  -6.016  13.212  1.00 0.00 ? 258 LYS A CD   2  
ATOM   8563   C  CE   . LYS A 1 258 ? -9.328  -4.776  13.431  1.00 0.00 ? 258 LYS A CE   2  
ATOM   8564   N  NZ   . LYS A 1 258 ? -9.996  -4.866  14.760  1.00 0.00 ? 258 LYS A NZ   2  
ATOM   8565   H  H    . LYS A 1 258 ? -5.375  -5.000  10.795  1.00 0.00 ? 258 LYS A H    2  
ATOM   8566   H  HA   . LYS A 1 258 ? -4.487  -6.025  13.279  1.00 0.00 ? 258 LYS A HA   2  
ATOM   8567   H  HB2  . LYS A 1 258 ? -6.519  -7.320  11.432  1.00 0.00 ? 258 LYS A HB2  2  
ATOM   8568   H  HB3  . LYS A 1 258 ? -6.406  -7.523  13.182  1.00 0.00 ? 258 LYS A HB3  2  
ATOM   8569   H  HG2  . LYS A 1 258 ? -6.623  -4.897  13.207  1.00 0.00 ? 258 LYS A HG2  2  
ATOM   8570   H  HG3  . LYS A 1 258 ? -7.332  -5.139  11.610  1.00 0.00 ? 258 LYS A HG3  2  
ATOM   8571   H  HD2  . LYS A 1 258 ? -8.973  -6.709  12.564  1.00 0.00 ? 258 LYS A HD2  2  
ATOM   8572   H  HD3  . LYS A 1 258 ? -8.262  -6.488  14.163  1.00 0.00 ? 258 LYS A HD3  2  
ATOM   8573   H  HE2  . LYS A 1 258 ? -8.708  -3.892  13.399  1.00 0.00 ? 258 LYS A HE2  2  
ATOM   8574   H  HE3  . LYS A 1 258 ? -10.076 -4.720  12.655  1.00 0.00 ? 258 LYS A HE3  2  
ATOM   8575   H  HZ1  . LYS A 1 258 ? -10.360 -5.829  14.902  1.00 0.00 ? 258 LYS A HZ1  2  
ATOM   8576   H  HZ2  . LYS A 1 258 ? -10.785 -4.187  14.797  1.00 0.00 ? 258 LYS A HZ2  2  
ATOM   8577   H  HZ3  . LYS A 1 258 ? -9.312  -4.643  15.510  1.00 0.00 ? 258 LYS A HZ3  2  
ATOM   8578   N  N    . LEU A 1 259 ? -3.950  -8.046  10.728  1.00 0.00 ? 259 LEU A N    2  
ATOM   8579   C  CA   . LEU A 1 259 ? -3.110  -9.205  10.319  1.00 0.00 ? 259 LEU A CA   2  
ATOM   8580   C  C    . LEU A 1 259 ? -1.663  -8.927  10.730  1.00 0.00 ? 259 LEU A C    2  
ATOM   8581   O  O    . LEU A 1 259 ? -0.984  -9.777  11.273  1.00 0.00 ? 259 LEU A O    2  
ATOM   8582   C  CB   . LEU A 1 259 ? -3.198  -9.374  8.797   1.00 0.00 ? 259 LEU A CB   2  
ATOM   8583   C  CG   . LEU A 1 259 ? -2.303  -10.531 8.338   1.00 0.00 ? 259 LEU A CG   2  
ATOM   8584   C  CD1  . LEU A 1 259 ? -2.855  -11.857 8.864   1.00 0.00 ? 259 LEU A CD1  2  
ATOM   8585   C  CD2  . LEU A 1 259 ? -2.277  -10.568 6.808   1.00 0.00 ? 259 LEU A CD2  2  
ATOM   8586   H  H    . LEU A 1 259 ? -4.523  -7.598  10.070  1.00 0.00 ? 259 LEU A H    2  
ATOM   8587   H  HA   . LEU A 1 259 ? -3.463  -10.100 10.810  1.00 0.00 ? 259 LEU A HA   2  
ATOM   8588   H  HB2  . LEU A 1 259 ? -4.221  -9.579  8.519   1.00 0.00 ? 259 LEU A HB2  2  
ATOM   8589   H  HB3  . LEU A 1 259 ? -2.875  -8.462  8.318   1.00 0.00 ? 259 LEU A HB3  2  
ATOM   8590   H  HG   . LEU A 1 259 ? -1.300  -10.386 8.710   1.00 0.00 ? 259 LEU A HG   2  
ATOM   8591   H  HD11 . LEU A 1 259 ? -2.855  -12.586 8.067   1.00 0.00 ? 259 LEU A HD11 2  
ATOM   8592   H  HD12 . LEU A 1 259 ? -3.864  -11.712 9.221   1.00 0.00 ? 259 LEU A HD12 2  
ATOM   8593   H  HD13 . LEU A 1 259 ? -2.233  -12.208 9.675   1.00 0.00 ? 259 LEU A HD13 2  
ATOM   8594   H  HD21 . LEU A 1 259 ? -1.259  -10.468 6.463   1.00 0.00 ? 259 LEU A HD21 2  
ATOM   8595   H  HD22 . LEU A 1 259 ? -2.871  -9.755  6.418   1.00 0.00 ? 259 LEU A HD22 2  
ATOM   8596   H  HD23 . LEU A 1 259 ? -2.683  -11.509 6.464   1.00 0.00 ? 259 LEU A HD23 2  
ATOM   8597   N  N    . VAL A 1 260 ? -1.191  -7.737  10.481  1.00 0.00 ? 260 VAL A N    2  
ATOM   8598   C  CA   . VAL A 1 260 ? 0.207   -7.391  10.863  1.00 0.00 ? 260 VAL A CA   2  
ATOM   8599   C  C    . VAL A 1 260 ? 0.309   -7.326  12.385  1.00 0.00 ? 260 VAL A C    2  
ATOM   8600   O  O    . VAL A 1 260 ? 1.110   -7.999  12.999  1.00 0.00 ? 260 VAL A O    2  
ATOM   8601   C  CB   . VAL A 1 260 ? 0.562   -6.020  10.288  1.00 0.00 ? 260 VAL A CB   2  
ATOM   8602   C  CG1  . VAL A 1 260 ? 1.777   -5.460  11.028  1.00 0.00 ? 260 VAL A CG1  2  
ATOM   8603   C  CG2  . VAL A 1 260 ? 0.885   -6.154  8.801   1.00 0.00 ? 260 VAL A CG2  2  
ATOM   8604   H  H    . VAL A 1 260 ? -1.761  -7.066  10.047  1.00 0.00 ? 260 VAL A H    2  
ATOM   8605   H  HA   . VAL A 1 260 ? 0.888   -8.136  10.480  1.00 0.00 ? 260 VAL A HA   2  
ATOM   8606   H  HB   . VAL A 1 260 ? -0.276  -5.348  10.418  1.00 0.00 ? 260 VAL A HB   2  
ATOM   8607   H  HG11 . VAL A 1 260 ? 1.448   -4.908  11.894  1.00 0.00 ? 260 VAL A HG11 2  
ATOM   8608   H  HG12 . VAL A 1 260 ? 2.329   -4.805  10.370  1.00 0.00 ? 260 VAL A HG12 2  
ATOM   8609   H  HG13 . VAL A 1 260 ? 2.413   -6.274  11.340  1.00 0.00 ? 260 VAL A HG13 2  
ATOM   8610   H  HG21 . VAL A 1 260 ? 0.751   -5.198  8.318   1.00 0.00 ? 260 VAL A HG21 2  
ATOM   8611   H  HG22 . VAL A 1 260 ? 0.223   -6.881  8.353   1.00 0.00 ? 260 VAL A HG22 2  
ATOM   8612   H  HG23 . VAL A 1 260 ? 1.908   -6.477  8.682   1.00 0.00 ? 260 VAL A HG23 2  
ATOM   8613   N  N    . LYS A 1 261 ? -0.504  -6.511  12.987  1.00 0.00 ? 261 LYS A N    2  
ATOM   8614   C  CA   . LYS A 1 261 ? -0.487  -6.364  14.466  1.00 0.00 ? 261 LYS A CA   2  
ATOM   8615   C  C    . LYS A 1 261 ? -0.467  -7.735  15.139  1.00 0.00 ? 261 LYS A C    2  
ATOM   8616   O  O    . LYS A 1 261 ? 0.220   -7.948  16.115  1.00 0.00 ? 261 LYS A O    2  
ATOM   8617   C  CB   . LYS A 1 261 ? -1.751  -5.621  14.889  1.00 0.00 ? 261 LYS A CB   2  
ATOM   8618   C  CG   . LYS A 1 261 ? -1.382  -4.219  15.378  1.00 0.00 ? 261 LYS A CG   2  
ATOM   8619   C  CD   . LYS A 1 261 ? -2.657  -3.430  15.681  1.00 0.00 ? 261 LYS A CD   2  
ATOM   8620   C  CE   . LYS A 1 261 ? -2.520  -2.740  17.040  1.00 0.00 ? 261 LYS A CE   2  
ATOM   8621   N  NZ   . LYS A 1 261 ? -2.421  -3.769  18.113  1.00 0.00 ? 261 LYS A NZ   2  
ATOM   8622   H  H    . LYS A 1 261 ? -1.133  -5.982  12.459  1.00 0.00 ? 261 LYS A H    2  
ATOM   8623   H  HA   . LYS A 1 261 ? 0.381   -5.796  14.766  1.00 0.00 ? 261 LYS A HA   2  
ATOM   8624   H  HB2  . LYS A 1 261 ? -2.412  -5.550  14.040  1.00 0.00 ? 261 LYS A HB2  2  
ATOM   8625   H  HB3  . LYS A 1 261 ? -2.244  -6.162  15.680  1.00 0.00 ? 261 LYS A HB3  2  
ATOM   8626   H  HG2  . LYS A 1 261 ? -0.784  -4.297  16.275  1.00 0.00 ? 261 LYS A HG2  2  
ATOM   8627   H  HG3  . LYS A 1 261 ? -0.819  -3.707  14.613  1.00 0.00 ? 261 LYS A HG3  2  
ATOM   8628   H  HD2  . LYS A 1 261 ? -2.813  -2.688  14.912  1.00 0.00 ? 261 LYS A HD2  2  
ATOM   8629   H  HD3  . LYS A 1 261 ? -3.501  -4.105  15.707  1.00 0.00 ? 261 LYS A HD3  2  
ATOM   8630   H  HE2  . LYS A 1 261 ? -1.628  -2.130  17.043  1.00 0.00 ? 261 LYS A HE2  2  
ATOM   8631   H  HE3  . LYS A 1 261 ? -3.383  -2.117  17.216  1.00 0.00 ? 261 LYS A HE3  2  
ATOM   8632   H  HZ1  . LYS A 1 261 ? -2.384  -4.715  17.684  1.00 0.00 ? 261 LYS A HZ1  2  
ATOM   8633   H  HZ2  . LYS A 1 261 ? -3.254  -3.701  18.733  1.00 0.00 ? 261 LYS A HZ2  2  
ATOM   8634   H  HZ3  . LYS A 1 261 ? -1.558  -3.609  18.669  1.00 0.00 ? 261 LYS A HZ3  2  
ATOM   8635   N  N    . GLU A 1 262 ? -1.216  -8.669  14.633  1.00 0.00 ? 262 GLU A N    2  
ATOM   8636   C  CA   . GLU A 1 262 ? -1.240  -10.021 15.259  1.00 0.00 ? 262 GLU A CA   2  
ATOM   8637   C  C    . GLU A 1 262 ? 0.091   -10.738 15.011  1.00 0.00 ? 262 GLU A C    2  
ATOM   8638   O  O    . GLU A 1 262 ? 0.673   -11.313 15.908  1.00 0.00 ? 262 GLU A O    2  
ATOM   8639   C  CB   . GLU A 1 262 ? -2.380  -10.842 14.653  1.00 0.00 ? 262 GLU A CB   2  
ATOM   8640   C  CG   . GLU A 1 262 ? -3.682  -10.534 15.394  1.00 0.00 ? 262 GLU A CG   2  
ATOM   8641   C  CD   . GLU A 1 262 ? -3.795  -11.437 16.625  1.00 0.00 ? 262 GLU A CD   2  
ATOM   8642   O  OE1  . GLU A 1 262 ? -2.762  -11.802 17.162  1.00 0.00 ? 262 GLU A OE1  2  
ATOM   8643   O  OE2  . GLU A 1 262 ? -4.910  -11.745 17.007  1.00 0.00 ? 262 GLU A OE2  2  
ATOM   8644   H  H    . GLU A 1 262 ? -1.766  -8.485  13.841  1.00 0.00 ? 262 GLU A H    2  
ATOM   8645   H  HA   . GLU A 1 262 ? -1.399  -9.921  16.323  1.00 0.00 ? 262 GLU A HA   2  
ATOM   8646   H  HB2  . GLU A 1 262 ? -2.491  -10.589 13.608  1.00 0.00 ? 262 GLU A HB2  2  
ATOM   8647   H  HB3  . GLU A 1 262 ? -2.156  -11.893 14.746  1.00 0.00 ? 262 GLU A HB3  2  
ATOM   8648   H  HG2  . GLU A 1 262 ? -3.683  -9.499  15.704  1.00 0.00 ? 262 GLU A HG2  2  
ATOM   8649   H  HG3  . GLU A 1 262 ? -4.521  -10.715 14.739  1.00 0.00 ? 262 GLU A HG3  2  
ATOM   8650   N  N    . LEU A 1 263 ? 0.572   -10.711 13.802  1.00 0.00 ? 263 LEU A N    2  
ATOM   8651   C  CA   . LEU A 1 263 ? 1.857   -11.398 13.493  1.00 0.00 ? 263 LEU A CA   2  
ATOM   8652   C  C    . LEU A 1 263 ? 3.007   -10.711 14.235  1.00 0.00 ? 263 LEU A C    2  
ATOM   8653   O  O    . LEU A 1 263 ? 3.931   -11.352 14.695  1.00 0.00 ? 263 LEU A O    2  
ATOM   8654   C  CB   . LEU A 1 263 ? 2.118   -11.329 11.987  1.00 0.00 ? 263 LEU A CB   2  
ATOM   8655   C  CG   . LEU A 1 263 ? 1.258   -12.373 11.269  1.00 0.00 ? 263 LEU A CG   2  
ATOM   8656   C  CD1  . LEU A 1 263 ? 1.380   -12.182 9.756   1.00 0.00 ? 263 LEU A CD1  2  
ATOM   8657   C  CD2  . LEU A 1 263 ? 1.736   -13.779 11.645  1.00 0.00 ? 263 LEU A CD2  2  
ATOM   8658   H  H    . LEU A 1 263 ? 0.084   -10.247 13.092  1.00 0.00 ? 263 LEU A H    2  
ATOM   8659   H  HA   . LEU A 1 263 ? 1.794   -12.432 13.801  1.00 0.00 ? 263 LEU A HA   2  
ATOM   8660   H  HB2  . LEU A 1 263 ? 1.862   -10.343 11.624  1.00 0.00 ? 263 LEU A HB2  2  
ATOM   8661   H  HB3  . LEU A 1 263 ? 3.160   -11.525 11.790  1.00 0.00 ? 263 LEU A HB3  2  
ATOM   8662   H  HG   . LEU A 1 263 ? 0.226   -12.251 11.564  1.00 0.00 ? 263 LEU A HG   2  
ATOM   8663   H  HD11 . LEU A 1 263 ? 2.098   -11.403 9.548   1.00 0.00 ? 263 LEU A HD11 2  
ATOM   8664   H  HD12 . LEU A 1 263 ? 0.418   -11.902 9.351   1.00 0.00 ? 263 LEU A HD12 2  
ATOM   8665   H  HD13 . LEU A 1 263 ? 1.707   -13.105 9.302   1.00 0.00 ? 263 LEU A HD13 2  
ATOM   8666   H  HD21 . LEU A 1 263 ? 1.835   -14.376 10.749  1.00 0.00 ? 263 LEU A HD21 2  
ATOM   8667   H  HD22 . LEU A 1 263 ? 1.015   -14.239 12.304  1.00 0.00 ? 263 LEU A HD22 2  
ATOM   8668   H  HD23 . LEU A 1 263 ? 2.691   -13.717 12.143  1.00 0.00 ? 263 LEU A HD23 2  
ATOM   8669   N  N    . ALA A 1 264 ? 2.966   -9.412  14.342  1.00 0.00 ? 264 ALA A N    2  
ATOM   8670   C  CA   . ALA A 1 264 ? 4.064   -8.687  15.038  1.00 0.00 ? 264 ALA A CA   2  
ATOM   8671   C  C    . ALA A 1 264 ? 3.986   -8.931  16.546  1.00 0.00 ? 264 ALA A C    2  
ATOM   8672   O  O    . ALA A 1 264 ? 4.995   -8.980  17.221  1.00 0.00 ? 264 ALA A O    2  
ATOM   8673   C  CB   . ALA A 1 264 ? 3.945   -7.190  14.756  1.00 0.00 ? 264 ALA A CB   2  
ATOM   8674   H  H    . ALA A 1 264 ? 2.220   -8.914  13.953  1.00 0.00 ? 264 ALA A H    2  
ATOM   8675   H  HA   . ALA A 1 264 ? 5.016   -9.047  14.668  1.00 0.00 ? 264 ALA A HA   2  
ATOM   8676   H  HB1  . ALA A 1 264 ? 3.673   -6.673  15.665  1.00 0.00 ? 264 ALA A HB1  2  
ATOM   8677   H  HB2  . ALA A 1 264 ? 3.186   -7.024  14.007  1.00 0.00 ? 264 ALA A HB2  2  
ATOM   8678   H  HB3  . ALA A 1 264 ? 4.893   -6.815  14.399  1.00 0.00 ? 264 ALA A HB3  2  
ATOM   8679   N  N    . LYS A 1 265 ? 2.809   -9.098  17.089  1.00 0.00 ? 265 LYS A N    2  
ATOM   8680   C  CA   . LYS A 1 265 ? 2.712   -9.355  18.552  1.00 0.00 ? 265 LYS A CA   2  
ATOM   8681   C  C    . LYS A 1 265 ? 2.861   -10.855 18.798  1.00 0.00 ? 265 LYS A C    2  
ATOM   8682   O  O    . LYS A 1 265 ? 3.317   -11.281 19.841  1.00 0.00 ? 265 LYS A O    2  
ATOM   8683   C  CB   . LYS A 1 265 ? 1.355   -8.880  19.080  1.00 0.00 ? 265 LYS A CB   2  
ATOM   8684   C  CG   . LYS A 1 265 ? 1.283   -7.352  19.018  1.00 0.00 ? 265 LYS A CG   2  
ATOM   8685   C  CD   . LYS A 1 265 ? 0.402   -6.834  20.157  1.00 0.00 ? 265 LYS A CD   2  
ATOM   8686   C  CE   . LYS A 1 265 ? 0.409   -5.305  20.152  1.00 0.00 ? 265 LYS A CE   2  
ATOM   8687   N  NZ   . LYS A 1 265 ? 0.505   -4.815  18.748  1.00 0.00 ? 265 LYS A NZ   2  
ATOM   8688   H  H    . LYS A 1 265 ? 1.995   -9.076  16.541  1.00 0.00 ? 265 LYS A H    2  
ATOM   8689   H  HA   . LYS A 1 265 ? 3.504   -8.830  19.062  1.00 0.00 ? 265 LYS A HA   2  
ATOM   8690   H  HB2  . LYS A 1 265 ? 0.567   -9.303  18.476  1.00 0.00 ? 265 LYS A HB2  2  
ATOM   8691   H  HB3  . LYS A 1 265 ? 1.236   -9.202  20.104  1.00 0.00 ? 265 LYS A HB3  2  
ATOM   8692   H  HG2  . LYS A 1 265 ? 2.276   -6.940  19.108  1.00 0.00 ? 265 LYS A HG2  2  
ATOM   8693   H  HG3  . LYS A 1 265 ? 0.858   -7.049  18.076  1.00 0.00 ? 265 LYS A HG3  2  
ATOM   8694   H  HD2  . LYS A 1 265 ? -0.609  -7.192  20.021  1.00 0.00 ? 265 LYS A HD2  2  
ATOM   8695   H  HD3  . LYS A 1 265 ? 0.786   -7.191  21.100  1.00 0.00 ? 265 LYS A HD3  2  
ATOM   8696   H  HE2  . LYS A 1 265 ? -0.503  -4.938  20.600  1.00 0.00 ? 265 LYS A HE2  2  
ATOM   8697   H  HE3  . LYS A 1 265 ? 1.257   -4.946  20.717  1.00 0.00 ? 265 LYS A HE3  2  
ATOM   8698   H  HZ1  . LYS A 1 265 ? 0.604   -3.780  18.747  1.00 0.00 ? 265 LYS A HZ1  2  
ATOM   8699   H  HZ2  . LYS A 1 265 ? -0.357  -5.082  18.228  1.00 0.00 ? 265 LYS A HZ2  2  
ATOM   8700   H  HZ3  . LYS A 1 265 ? 1.333   -5.241  18.287  1.00 0.00 ? 265 LYS A HZ3  2  
ATOM   8701   N  N    . LYS A 1 266 ? 2.484   -11.659 17.843  1.00 0.00 ? 266 LYS A N    2  
ATOM   8702   C  CA   . LYS A 1 266 ? 2.608   -13.130 18.016  1.00 0.00 ? 266 LYS A CA   2  
ATOM   8703   C  C    . LYS A 1 266 ? 4.086   -13.524 17.990  1.00 0.00 ? 266 LYS A C    2  
ATOM   8704   O  O    . LYS A 1 266 ? 4.545   -14.304 18.799  1.00 0.00 ? 266 LYS A O    2  
ATOM   8705   C  CB   . LYS A 1 266 ? 1.876   -13.835 16.875  1.00 0.00 ? 266 LYS A CB   2  
ATOM   8706   C  CG   . LYS A 1 266 ? 0.394   -13.981 17.227  1.00 0.00 ? 266 LYS A CG   2  
ATOM   8707   C  CD   . LYS A 1 266 ? -0.311  -14.822 16.160  1.00 0.00 ? 266 LYS A CD   2  
ATOM   8708   C  CE   . LYS A 1 266 ? -1.205  -15.863 16.836  1.00 0.00 ? 266 LYS A CE   2  
ATOM   8709   N  NZ   . LYS A 1 266 ? -1.909  -16.666 15.796  1.00 0.00 ? 266 LYS A NZ   2  
ATOM   8710   H  H    . LYS A 1 266 ? 2.120   -11.295 17.007  1.00 0.00 ? 266 LYS A H    2  
ATOM   8711   H  HA   . LYS A 1 266 ? 2.173   -13.422 18.961  1.00 0.00 ? 266 LYS A HA   2  
ATOM   8712   H  HB2  . LYS A 1 266 ? 1.977   -13.251 15.971  1.00 0.00 ? 266 LYS A HB2  2  
ATOM   8713   H  HB3  . LYS A 1 266 ? 2.308   -14.810 16.722  1.00 0.00 ? 266 LYS A HB3  2  
ATOM   8714   H  HG2  . LYS A 1 266 ? 0.301   -14.464 18.187  1.00 0.00 ? 266 LYS A HG2  2  
ATOM   8715   H  HG3  . LYS A 1 266 ? -0.062  -13.004 17.272  1.00 0.00 ? 266 LYS A HG3  2  
ATOM   8716   H  HD2  . LYS A 1 266 ? -0.915  -14.178 15.537  1.00 0.00 ? 266 LYS A HD2  2  
ATOM   8717   H  HD3  . LYS A 1 266 ? 0.425   -15.324 15.549  1.00 0.00 ? 266 LYS A HD3  2  
ATOM   8718   H  HE2  . LYS A 1 266 ? -0.599  -16.515 17.446  1.00 0.00 ? 266 LYS A HE2  2  
ATOM   8719   H  HE3  . LYS A 1 266 ? -1.932  -15.362 17.458  1.00 0.00 ? 266 LYS A HE3  2  
ATOM   8720   H  HZ1  . LYS A 1 266 ? -2.898  -16.809 16.080  1.00 0.00 ? 266 LYS A HZ1  2  
ATOM   8721   H  HZ2  . LYS A 1 266 ? -1.438  -17.588 15.694  1.00 0.00 ? 266 LYS A HZ2  2  
ATOM   8722   H  HZ3  . LYS A 1 266 ? -1.881  -16.159 14.888  1.00 0.00 ? 266 LYS A HZ3  2  
ATOM   8723   N  N    . GLN A 1 267 ? 4.834   -12.994 17.061  1.00 0.00 ? 267 GLN A N    2  
ATOM   8724   C  CA   . GLN A 1 267 ? 6.281   -13.344 16.980  1.00 0.00 ? 267 GLN A CA   2  
ATOM   8725   C  C    . GLN A 1 267 ? 7.069   -12.540 18.017  1.00 0.00 ? 267 GLN A C    2  
ATOM   8726   O  O    . GLN A 1 267 ? 8.281   -12.475 17.972  1.00 0.00 ? 267 GLN A O    2  
ATOM   8727   C  CB   . GLN A 1 267 ? 6.806   -13.021 15.579  1.00 0.00 ? 267 GLN A CB   2  
ATOM   8728   C  CG   . GLN A 1 267 ? 6.038   -13.845 14.546  1.00 0.00 ? 267 GLN A CG   2  
ATOM   8729   C  CD   . GLN A 1 267 ? 6.463   -15.311 14.643  1.00 0.00 ? 267 GLN A CD   2  
ATOM   8730   O  OE1  . GLN A 1 267 ? 7.585   -15.608 15.005  1.00 0.00 ? 267 GLN A OE1  2  
ATOM   8731   N  NE2  . GLN A 1 267 ? 5.609   -16.247 14.332  1.00 0.00 ? 267 GLN A NE2  2  
ATOM   8732   H  H    . GLN A 1 267 ? 4.443   -12.368 16.413  1.00 0.00 ? 267 GLN A H    2  
ATOM   8733   H  HA   . GLN A 1 267 ? 6.404   -14.399 17.174  1.00 0.00 ? 267 GLN A HA   2  
ATOM   8734   H  HB2  . GLN A 1 267 ? 6.670   -11.968 15.378  1.00 0.00 ? 267 GLN A HB2  2  
ATOM   8735   H  HB3  . GLN A 1 267 ? 7.857   -13.266 15.524  1.00 0.00 ? 267 GLN A HB3  2  
ATOM   8736   H  HG2  . GLN A 1 267 ? 4.978   -13.763 14.736  1.00 0.00 ? 267 GLN A HG2  2  
ATOM   8737   H  HG3  . GLN A 1 267 ? 6.256   -13.474 13.555  1.00 0.00 ? 267 GLN A HG3  2  
ATOM   8738   H  HE21 . GLN A 1 267 ? 4.705   -16.008 14.040  1.00 0.00 ? 267 GLN A HE21 2  
ATOM   8739   H  HE22 . GLN A 1 267 ? 5.872   -17.189 14.391  1.00 0.00 ? 267 GLN A HE22 2  
ATOM   8740   N  N    . LYS A 1 268 ? 6.392   -11.927 18.949  1.00 0.00 ? 268 LYS A N    2  
ATOM   8741   C  CA   . LYS A 1 268 ? 7.103   -11.128 19.986  1.00 0.00 ? 268 LYS A CA   2  
ATOM   8742   C  C    . LYS A 1 268 ? 7.108   -11.896 21.311  1.00 0.00 ? 268 LYS A C    2  
ATOM   8743   O  O    . LYS A 1 268 ? 7.735   -11.492 22.269  1.00 0.00 ? 268 LYS A O    2  
ATOM   8744   C  CB   . LYS A 1 268 ? 6.389   -9.789  20.176  1.00 0.00 ? 268 LYS A CB   2  
ATOM   8745   C  CG   . LYS A 1 268 ? 7.379   -8.750  20.711  1.00 0.00 ? 268 LYS A CG   2  
ATOM   8746   C  CD   . LYS A 1 268 ? 6.708   -7.374  20.752  1.00 0.00 ? 268 LYS A CD   2  
ATOM   8747   C  CE   . LYS A 1 268 ? 5.559   -7.391  21.762  1.00 0.00 ? 268 LYS A CE   2  
ATOM   8748   N  NZ   . LYS A 1 268 ? 5.581   -6.133  22.560  1.00 0.00 ? 268 LYS A NZ   2  
ATOM   8749   H  H    . LYS A 1 268 ? 5.414   -11.991 18.967  1.00 0.00 ? 268 LYS A H    2  
ATOM   8750   H  HA   . LYS A 1 268 ? 8.120   -10.952 19.670  1.00 0.00 ? 268 LYS A HA   2  
ATOM   8751   H  HB2  . LYS A 1 268 ? 5.993   -9.456  19.228  1.00 0.00 ? 268 LYS A HB2  2  
ATOM   8752   H  HB3  . LYS A 1 268 ? 5.580   -9.910  20.881  1.00 0.00 ? 268 LYS A HB3  2  
ATOM   8753   H  HG2  . LYS A 1 268 ? 7.690   -9.029  21.707  1.00 0.00 ? 268 LYS A HG2  2  
ATOM   8754   H  HG3  . LYS A 1 268 ? 8.241   -8.707  20.063  1.00 0.00 ? 268 LYS A HG3  2  
ATOM   8755   H  HD2  . LYS A 1 268 ? 7.434   -6.630  21.045  1.00 0.00 ? 268 LYS A HD2  2  
ATOM   8756   H  HD3  . LYS A 1 268 ? 6.322   -7.132  19.773  1.00 0.00 ? 268 LYS A HD3  2  
ATOM   8757   H  HE2  . LYS A 1 268 ? 4.618   -7.467  21.235  1.00 0.00 ? 268 LYS A HE2  2  
ATOM   8758   H  HE3  . LYS A 1 268 ? 5.670   -8.238  22.423  1.00 0.00 ? 268 LYS A HE3  2  
ATOM   8759   H  HZ1  . LYS A 1 268 ? 4.867   -5.476  22.191  1.00 0.00 ? 268 LYS A HZ1  2  
ATOM   8760   H  HZ2  . LYS A 1 268 ? 6.524   -5.697  22.492  1.00 0.00 ? 268 LYS A HZ2  2  
ATOM   8761   H  HZ3  . LYS A 1 268 ? 5.368   -6.349  23.554  1.00 0.00 ? 268 LYS A HZ3  2  
ATOM   8762   N  N    . LEU A 1 269 ? 6.416   -13.001 21.371  1.00 0.00 ? 269 LEU A N    2  
ATOM   8763   C  CA   . LEU A 1 269 ? 6.386   -13.791 22.635  1.00 0.00 ? 269 LEU A CA   2  
ATOM   8764   C  C    . LEU A 1 269 ? 7.806   -13.920 23.189  1.00 0.00 ? 269 LEU A C    2  
ATOM   8765   O  O    . LEU A 1 269 ? 8.079   -13.559 24.315  1.00 0.00 ? 269 LEU A O    2  
ATOM   8766   C  CB   . LEU A 1 269 ? 5.817   -15.184 22.355  1.00 0.00 ? 269 LEU A CB   2  
ATOM   8767   C  CG   . LEU A 1 269 ? 4.302   -15.090 22.167  1.00 0.00 ? 269 LEU A CG   2  
ATOM   8768   C  CD1  . LEU A 1 269 ? 3.831   -16.210 21.238  1.00 0.00 ? 269 LEU A CD1  2  
ATOM   8769   C  CD2  . LEU A 1 269 ? 3.610   -15.231 23.524  1.00 0.00 ? 269 LEU A CD2  2  
ATOM   8770   H  H    . LEU A 1 269 ? 5.919   -13.312 20.587  1.00 0.00 ? 269 LEU A H    2  
ATOM   8771   H  HA   . LEU A 1 269 ? 5.763   -13.286 23.359  1.00 0.00 ? 269 LEU A HA   2  
ATOM   8772   H  HB2  . LEU A 1 269 ? 6.268   -15.585 21.459  1.00 0.00 ? 269 LEU A HB2  2  
ATOM   8773   H  HB3  . LEU A 1 269 ? 6.033   -15.835 23.189  1.00 0.00 ? 269 LEU A HB3  2  
ATOM   8774   H  HG   . LEU A 1 269 ? 4.053   -14.133 21.731  1.00 0.00 ? 269 LEU A HG   2  
ATOM   8775   H  HD11 . LEU A 1 269 ? 4.035   -17.167 21.696  1.00 0.00 ? 269 LEU A HD11 2  
ATOM   8776   H  HD12 . LEU A 1 269 ? 4.358   -16.143 20.297  1.00 0.00 ? 269 LEU A HD12 2  
ATOM   8777   H  HD13 . LEU A 1 269 ? 2.771   -16.113 21.063  1.00 0.00 ? 269 LEU A HD13 2  
ATOM   8778   H  HD21 . LEU A 1 269 ? 3.864   -16.186 23.961  1.00 0.00 ? 269 LEU A HD21 2  
ATOM   8779   H  HD22 . LEU A 1 269 ? 2.541   -15.170 23.392  1.00 0.00 ? 269 LEU A HD22 2  
ATOM   8780   H  HD23 . LEU A 1 269 ? 3.937   -14.438 24.179  1.00 0.00 ? 269 LEU A HD23 2  
ATOM   8781   N  N    . THR A 1 270 ? 8.713   -14.434 22.403  1.00 0.00 ? 270 THR A N    2  
ATOM   8782   C  CA   . THR A 1 270 ? 10.115  -14.585 22.885  1.00 0.00 ? 270 THR A CA   2  
ATOM   8783   C  C    . THR A 1 270 ? 10.785  -13.212 22.944  1.00 0.00 ? 270 THR A C    2  
ATOM   8784   O  O    . THR A 1 270 ? 10.592  -12.379 22.082  1.00 0.00 ? 270 THR A O    2  
ATOM   8785   C  CB   . THR A 1 270 ? 10.889  -15.490 21.923  1.00 0.00 ? 270 THR A CB   2  
ATOM   8786   O  OG1  . THR A 1 270 ? 12.200  -15.703 22.427  1.00 0.00 ? 270 THR A OG1  2  
ATOM   8787   C  CG2  . THR A 1 270 ? 10.969  -14.826 20.547  1.00 0.00 ? 270 THR A CG2  2  
ATOM   8788   H  H    . THR A 1 270 ? 8.473   -14.720 21.497  1.00 0.00 ? 270 THR A H    2  
ATOM   8789   H  HA   . THR A 1 270 ? 10.112  -15.027 23.871  1.00 0.00 ? 270 THR A HA   2  
ATOM   8790   H  HB   . THR A 1 270 ? 10.381  -16.437 21.832  1.00 0.00 ? 270 THR A HB   2  
ATOM   8791   H  HG1  . THR A 1 270 ? 12.605  -16.405 21.912  1.00 0.00 ? 270 THR A HG1  2  
ATOM   8792   H  HG21 . THR A 1 270 ? 10.748  -15.555 19.782  1.00 0.00 ? 270 THR A HG21 2  
ATOM   8793   H  HG22 . THR A 1 270 ? 11.963  -14.433 20.394  1.00 0.00 ? 270 THR A HG22 2  
ATOM   8794   H  HG23 . THR A 1 270 ? 10.251  -14.019 20.495  1.00 0.00 ? 270 THR A HG23 2  
HETATM 8795   ZN ZN   . ZN  B 2 .   ? -5.088  2.676   -2.534  1.00 0.00 ? 319 ZN  A ZN   2  
HETATM 8796   C  C3G  . TUX C 3 .   ? -11.556 3.281   -2.605  1.00 0.00 ? 320 TUX A C3G  2  
HETATM 8797   C  C4G  . TUX C 3 .   ? -12.641 2.267   -2.934  1.00 0.00 ? 320 TUX A C4G  2  
HETATM 8798   C  C5G  . TUX C 3 .   ? -12.640 1.121   -1.927  1.00 0.00 ? 320 TUX A C5G  2  
HETATM 8799   C  C2G  . TUX C 3 .   ? -10.207 2.593   -2.470  1.00 0.00 ? 320 TUX A C2G  2  
HETATM 8800   C  C1G  . TUX C 3 .   ? -10.296 1.443   -1.466  1.00 0.00 ? 320 TUX A C1G  2  
HETATM 8801   O  O5G  . TUX C 3 .   ? -11.337 0.512   -1.826  1.00 0.00 ? 320 TUX A O5G  2  
HETATM 8802   O  O3G  . TUX C 3 .   ? -11.502 4.308   -3.609  1.00 0.00 ? 320 TUX A O3G  2  
HETATM 8803   O  O1A  . TUX C 3 .   ? -12.586 5.999   -2.488  1.00 0.00 ? 320 TUX A O1A  2  
HETATM 8804   C  C1A  . TUX C 3 .   ? -11.569 5.626   -3.036  1.00 0.00 ? 320 TUX A C1A  2  
HETATM 8805   C  C2A  . TUX C 3 .   ? -10.366 6.552   -3.109  1.00 0.00 ? 320 TUX A C2A  2  
HETATM 8806   C  C3A  . TUX C 3 .   ? -10.801 7.980   -2.796  1.00 0.00 ? 320 TUX A C3A  2  
HETATM 8807   C  C4A  . TUX C 3 .   ? -11.818 8.472   -3.826  1.00 0.00 ? 320 TUX A C4A  2  
HETATM 8808   C  C5A  . TUX C 3 .   ? -11.481 9.880   -4.318  1.00 0.00 ? 320 TUX A C5A  2  
HETATM 8809   C  C6A  . TUX C 3 .   ? -12.728 10.760  -4.376  1.00 0.00 ? 320 TUX A C6A  2  
HETATM 8810   C  C7A  . TUX C 3 .   ? -13.505 10.506  -5.665  1.00 0.00 ? 320 TUX A C7A  2  
HETATM 8811   C  C8A  . TUX C 3 .   ? -12.983 11.395  -6.791  1.00 0.00 ? 320 TUX A C8A  2  
HETATM 8812   C  C9A  . TUX C 3 .   ? -13.871 11.267  -8.026  1.00 0.00 ? 320 TUX A C9A  2  
HETATM 8813   C  CAA  . TUX C 3 .   ? -13.490 12.305  -9.081  1.00 0.00 ? 320 TUX A CAA  2  
HETATM 8814   C  CBA  . TUX C 3 .   ? -14.714 12.707  -9.899  1.00 0.00 ? 320 TUX A CBA  2  
HETATM 8815   C  CCA  . TUX C 3 .   ? -15.324 11.488  -10.585 1.00 0.00 ? 320 TUX A CCA  2  
HETATM 8816   C  CDA  . TUX C 3 .   ? -16.606 11.870  -11.319 1.00 0.00 ? 320 TUX A CDA  2  
HETATM 8817   C  CEA  . TUX C 3 .   ? -17.542 10.668  -11.417 1.00 0.00 ? 320 TUX A CEA  2  
HETATM 8818   C  CZH  . TUX C 3 .   ? -9.153  3.608   -2.034  1.00 0.00 ? 320 TUX A CZH  2  
HETATM 8819   C  CYH  . TUX C 3 .   ? -7.917  2.882   -1.530  1.00 0.00 ? 320 TUX A CYH  2  
HETATM 8820   O  OYH  . TUX C 3 .   ? -7.523  1.883   -2.096  1.00 0.00 ? 320 TUX A OYH  2  
HETATM 8821   N  NXH  . TUX C 3 .   ? -7.298  3.369   -0.489  1.00 0.00 ? 320 TUX A NXH  2  
HETATM 8822   O  OXH  . TUX C 3 .   ? -6.059  2.784   -0.052  1.00 0.00 ? 320 TUX A OXH  2  
HETATM 8823   O  O4G  . TUX C 3 .   ? -13.909 2.904   -2.931  1.00 0.00 ? 320 TUX A O4G  2  
HETATM 8824   C  C6G  . TUX C 3 .   ? -13.618 0.021   -2.295  1.00 0.00 ? 320 TUX A C6G  2  
HETATM 8825   O  O6G  . TUX C 3 .   ? -13.986 -0.741  -1.156  1.00 0.00 ? 320 TUX A O6G  2  
HETATM 8826   H  H3G  . TUX C 3 .   ? -11.755 3.756   -1.635  1.00 0.00 ? 320 TUX A H3G  2  
HETATM 8827   H  H4G  . TUX C 3 .   ? -12.431 1.832   -3.920  1.00 0.00 ? 320 TUX A H4G  2  
HETATM 8828   H  H5G  . TUX C 3 .   ? -12.933 1.512   -0.943  1.00 0.00 ? 320 TUX A H5G  2  
HETATM 8829   H  H2G  . TUX C 3 .   ? -9.874  2.232   -3.460  1.00 0.00 ? 320 TUX A H2G  2  
HETATM 8830   H  H1G1 . TUX C 3 .   ? -10.517 1.884   -0.484  1.00 0.00 ? 320 TUX A H1G1 2  
HETATM 8831   H  H1G2 . TUX C 3 .   ? -9.393  0.830   -1.399  1.00 0.00 ? 320 TUX A H1G2 2  
HETATM 8832   H  H2A2 . TUX C 3 .   ? -9.905  6.502   -4.105  1.00 0.00 ? 320 TUX A H2A2 2  
HETATM 8833   H  H2A3 . TUX C 3 .   ? -9.627  6.270   -2.350  1.00 0.00 ? 320 TUX A H2A3 2  
HETATM 8834   H  H3A3 . TUX C 3 .   ? -9.886  8.580   -2.737  1.00 0.00 ? 320 TUX A H3A3 2  
HETATM 8835   H  H3A2 . TUX C 3 .   ? -11.269 7.999   -1.803  1.00 0.00 ? 320 TUX A H3A2 2  
HETATM 8836   H  H4A2 . TUX C 3 .   ? -12.812 8.439   -3.370  1.00 0.00 ? 320 TUX A H4A2 2  
HETATM 8837   H  H4A3 . TUX C 3 .   ? -11.821 7.786   -4.684  1.00 0.00 ? 320 TUX A H4A3 2  
HETATM 8838   H  H5A3 . TUX C 3 .   ? -10.762 10.406  -3.682  1.00 0.00 ? 320 TUX A H5A3 2  
HETATM 8839   H  H5A2 . TUX C 3 .   ? -11.065 9.787   -5.329  1.00 0.00 ? 320 TUX A H5A2 2  
HETATM 8840   H  H6A2 . TUX C 3 .   ? -13.378 10.619  -3.501  1.00 0.00 ? 320 TUX A H6A2 2  
HETATM 8841   H  H6A3 . TUX C 3 .   ? -12.400 11.807  -4.352  1.00 0.00 ? 320 TUX A H6A3 2  
HETATM 8842   H  H7A3 . TUX C 3 .   ? -14.571 10.718  -5.498  1.00 0.00 ? 320 TUX A H7A3 2  
HETATM 8843   H  H7A2 . TUX C 3 .   ? -13.399 9.452   -5.953  1.00 0.00 ? 320 TUX A H7A2 2  
HETATM 8844   H  H8A2 . TUX C 3 .   ? -11.958 11.081  -7.040  1.00 0.00 ? 320 TUX A H8A2 2  
HETATM 8845   H  H8A3 . TUX C 3 .   ? -12.969 12.443  -6.462  1.00 0.00 ? 320 TUX A H8A3 2  
HETATM 8846   H  H9A3 . TUX C 3 .   ? -13.746 10.264  -8.448  1.00 0.00 ? 320 TUX A H9A3 2  
HETATM 8847   H  H9A2 . TUX C 3 .   ? -14.926 11.404  -7.745  1.00 0.00 ? 320 TUX A H9A2 2  
HETATM 8848   H  HAA2 . TUX C 3 .   ? -12.731 11.878  -9.750  1.00 0.00 ? 320 TUX A HAA2 2  
HETATM 8849   H  HAA3 . TUX C 3 .   ? -13.069 13.204  -8.607  1.00 0.00 ? 320 TUX A HAA3 2  
HETATM 8850   H  HBA3 . TUX C 3 .   ? -14.419 13.441  -10.663 1.00 0.00 ? 320 TUX A HBA3 2  
HETATM 8851   H  HBA2 . TUX C 3 .   ? -15.459 13.165  -9.234  1.00 0.00 ? 320 TUX A HBA2 2  
HETATM 8852   H  HCA2 . TUX C 3 .   ? -14.600 11.078  -11.299 1.00 0.00 ? 320 TUX A HCA2 2  
HETATM 8853   H  HCA3 . TUX C 3 .   ? -15.567 10.721  -9.838  1.00 0.00 ? 320 TUX A HCA3 2  
HETATM 8854   H  HDA3 . TUX C 3 .   ? -17.102 12.679  -10.765 1.00 0.00 ? 320 TUX A HDA3 2  
HETATM 8855   H  HDA2 . TUX C 3 .   ? -16.359 12.229  -12.328 1.00 0.00 ? 320 TUX A HDA2 2  
HETATM 8856   H  HEA1 . TUX C 3 .   ? -17.734 10.262  -10.415 1.00 0.00 ? 320 TUX A HEA1 2  
HETATM 8857   H  HEA2 . TUX C 3 .   ? -18.497 10.971  -11.870 1.00 0.00 ? 320 TUX A HEA2 2  
HETATM 8858   H  HEA3 . TUX C 3 .   ? -17.085 9.884   -12.041 1.00 0.00 ? 320 TUX A HEA3 2  
HETATM 8859   H  HZH2 . TUX C 3 .   ? -8.877  4.202   -2.912  1.00 0.00 ? 320 TUX A HZH2 2  
HETATM 8860   H  HZH3 . TUX C 3 .   ? -9.555  4.269   -1.252  1.00 0.00 ? 320 TUX A HZH3 2  
HETATM 8861   H  HNH1 . TUX C 3 .   ? -7.636  4.178   -0.052  1.00 0.00 ? 320 TUX A HNH1 2  
HETATM 8862   H  HOH1 . TUX C 3 .   ? -5.282  3.337   0.062   1.00 0.00 ? 320 TUX A HOH1 2  
HETATM 8863   H  HOG4 . TUX C 3 .   ? -14.438 2.561   -3.654  1.00 0.00 ? 320 TUX A HOG4 2  
HETATM 8864   H  H6G2 . TUX C 3 .   ? -13.150 -0.629  -3.048  1.00 0.00 ? 320 TUX A H6G2 2  
HETATM 8865   H  H6G3 . TUX C 3 .   ? -14.511 0.474   -2.745  1.00 0.00 ? 320 TUX A H6G3 2  
HETATM 8866   H  HOG6 . TUX C 3 .   ? -13.324 -1.418  -0.996  1.00 0.00 ? 320 TUX A HOG6 2  
ATOM   8867   N  N    . LEU A 1 3   ? 21.842  -8.444  1.083   1.00 0.00 ? 3   LEU A N    3  
ATOM   8868   C  CA   . LEU A 1 3   ? 22.415  -7.397  1.976   1.00 0.00 ? 3   LEU A CA   3  
ATOM   8869   C  C    . LEU A 1 3   ? 21.486  -6.183  2.001   1.00 0.00 ? 3   LEU A C    3  
ATOM   8870   O  O    . LEU A 1 3   ? 20.776  -5.913  1.052   1.00 0.00 ? 3   LEU A O    3  
ATOM   8871   C  CB   . LEU A 1 3   ? 23.790  -6.974  1.452   1.00 0.00 ? 3   LEU A CB   3  
ATOM   8872   C  CG   . LEU A 1 3   ? 24.723  -8.184  1.421   1.00 0.00 ? 3   LEU A CG   3  
ATOM   8873   C  CD1  . LEU A 1 3   ? 25.805  -7.968  0.363   1.00 0.00 ? 3   LEU A CD1  3  
ATOM   8874   C  CD2  . LEU A 1 3   ? 25.379  -8.355  2.793   1.00 0.00 ? 3   LEU A CD2  3  
ATOM   8875   H  H    . LEU A 1 3   ? 22.379  -8.811  0.351   1.00 0.00 ? 3   LEU A H    3  
ATOM   8876   H  HA   . LEU A 1 3   ? 22.516  -7.794  2.976   1.00 0.00 ? 3   LEU A HA   3  
ATOM   8877   H  HB2  . LEU A 1 3   ? 23.685  -6.573  0.454   1.00 0.00 ? 3   LEU A HB2  3  
ATOM   8878   H  HB3  . LEU A 1 3   ? 24.204  -6.217  2.102   1.00 0.00 ? 3   LEU A HB3  3  
ATOM   8879   H  HG   . LEU A 1 3   ? 24.154  -9.071  1.179   1.00 0.00 ? 3   LEU A HG   3  
ATOM   8880   H  HD11 . LEU A 1 3   ? 25.948  -6.908  0.204   1.00 0.00 ? 3   LEU A HD11 3  
ATOM   8881   H  HD12 . LEU A 1 3   ? 25.500  -8.431  -0.564  1.00 0.00 ? 3   LEU A HD12 3  
ATOM   8882   H  HD13 . LEU A 1 3   ? 26.731  -8.409  0.699   1.00 0.00 ? 3   LEU A HD13 3  
ATOM   8883   H  HD21 . LEU A 1 3   ? 25.937  -7.464  3.040   1.00 0.00 ? 3   LEU A HD21 3  
ATOM   8884   H  HD22 . LEU A 1 3   ? 26.047  -9.203  2.768   1.00 0.00 ? 3   LEU A HD22 3  
ATOM   8885   H  HD23 . LEU A 1 3   ? 24.616  -8.520  3.540   1.00 0.00 ? 3   LEU A HD23 3  
ATOM   8886   N  N    . GLU A 1 4   ? 21.490  -5.448  3.079   1.00 0.00 ? 4   GLU A N    3  
ATOM   8887   C  CA   . GLU A 1 4   ? 20.610  -4.247  3.169   1.00 0.00 ? 4   GLU A CA   3  
ATOM   8888   C  C    . GLU A 1 4   ? 20.632  -3.496  1.837   1.00 0.00 ? 4   GLU A C    3  
ATOM   8889   O  O    . GLU A 1 4   ? 21.656  -3.386  1.193   1.00 0.00 ? 4   GLU A O    3  
ATOM   8890   C  CB   . GLU A 1 4   ? 21.118  -3.325  4.280   1.00 0.00 ? 4   GLU A CB   3  
ATOM   8891   C  CG   . GLU A 1 4   ? 20.740  -3.908  5.644   1.00 0.00 ? 4   GLU A CG   3  
ATOM   8892   C  CD   . GLU A 1 4   ? 19.223  -3.847  5.825   1.00 0.00 ? 4   GLU A CD   3  
ATOM   8893   O  OE1  . GLU A 1 4   ? 18.740  -2.819  6.272   1.00 0.00 ? 4   GLU A OE1  3  
ATOM   8894   O  OE2  . GLU A 1 4   ? 18.568  -4.828  5.514   1.00 0.00 ? 4   GLU A OE2  3  
ATOM   8895   H  H    . GLU A 1 4   ? 22.072  -5.686  3.830   1.00 0.00 ? 4   GLU A H    3  
ATOM   8896   H  HA   . GLU A 1 4   ? 19.600  -4.555  3.392   1.00 0.00 ? 4   GLU A HA   3  
ATOM   8897   H  HB2  . GLU A 1 4   ? 22.192  -3.237  4.212   1.00 0.00 ? 4   GLU A HB2  3  
ATOM   8898   H  HB3  . GLU A 1 4   ? 20.669  -2.349  4.172   1.00 0.00 ? 4   GLU A HB3  3  
ATOM   8899   H  HG2  . GLU A 1 4   ? 21.068  -4.935  5.700   1.00 0.00 ? 4   GLU A HG2  3  
ATOM   8900   H  HG3  . GLU A 1 4   ? 21.215  -3.334  6.426   1.00 0.00 ? 4   GLU A HG3  3  
ATOM   8901   N  N    . LYS A 1 5   ? 19.505  -2.988  1.414   1.00 0.00 ? 5   LYS A N    3  
ATOM   8902   C  CA   . LYS A 1 5   ? 19.451  -2.250  0.119   1.00 0.00 ? 5   LYS A CA   3  
ATOM   8903   C  C    . LYS A 1 5   ? 19.101  -0.781  0.380   1.00 0.00 ? 5   LYS A C    3  
ATOM   8904   O  O    . LYS A 1 5   ? 18.218  -0.474  1.155   1.00 0.00 ? 5   LYS A O    3  
ATOM   8905   C  CB   . LYS A 1 5   ? 18.382  -2.880  -0.773  1.00 0.00 ? 5   LYS A CB   3  
ATOM   8906   C  CG   . LYS A 1 5   ? 18.615  -2.457  -2.223  1.00 0.00 ? 5   LYS A CG   3  
ATOM   8907   C  CD   . LYS A 1 5   ? 19.517  -3.481  -2.914  1.00 0.00 ? 5   LYS A CD   3  
ATOM   8908   C  CE   . LYS A 1 5   ? 18.760  -4.799  -3.094  1.00 0.00 ? 5   LYS A CE   3  
ATOM   8909   N  NZ   . LYS A 1 5   ? 19.414  -5.863  -2.280  1.00 0.00 ? 5   LYS A NZ   3  
ATOM   8910   H  H    . LYS A 1 5   ? 18.689  -3.100  1.945   1.00 0.00 ? 5   LYS A H    3  
ATOM   8911   H  HA   . LYS A 1 5   ? 20.410  -2.309  -0.374  1.00 0.00 ? 5   LYS A HA   3  
ATOM   8912   H  HB2  . LYS A 1 5   ? 18.437  -3.957  -0.697  1.00 0.00 ? 5   LYS A HB2  3  
ATOM   8913   H  HB3  . LYS A 1 5   ? 17.406  -2.547  -0.456  1.00 0.00 ? 5   LYS A HB3  3  
ATOM   8914   H  HG2  . LYS A 1 5   ? 17.667  -2.400  -2.740  1.00 0.00 ? 5   LYS A HG2  3  
ATOM   8915   H  HG3  . LYS A 1 5   ? 19.092  -1.490  -2.240  1.00 0.00 ? 5   LYS A HG3  3  
ATOM   8916   H  HD2  . LYS A 1 5   ? 19.815  -3.102  -3.881  1.00 0.00 ? 5   LYS A HD2  3  
ATOM   8917   H  HD3  . LYS A 1 5   ? 20.395  -3.652  -2.309  1.00 0.00 ? 5   LYS A HD3  3  
ATOM   8918   H  HE2  . LYS A 1 5   ? 17.738  -4.676  -2.770  1.00 0.00 ? 5   LYS A HE2  3  
ATOM   8919   H  HE3  . LYS A 1 5   ? 18.776  -5.083  -4.135  1.00 0.00 ? 5   LYS A HE3  3  
ATOM   8920   H  HZ1  . LYS A 1 5   ? 19.233  -6.790  -2.712  1.00 0.00 ? 5   LYS A HZ1  3  
ATOM   8921   H  HZ2  . LYS A 1 5   ? 19.027  -5.847  -1.314  1.00 0.00 ? 5   LYS A HZ2  3  
ATOM   8922   H  HZ3  . LYS A 1 5   ? 20.440  -5.693  -2.246  1.00 0.00 ? 5   LYS A HZ3  3  
ATOM   8923   N  N    . THR A 1 6   ? 19.788  0.126   -0.265  1.00 0.00 ? 6   THR A N    3  
ATOM   8924   C  CA   . THR A 1 6   ? 19.495  1.575   -0.058  1.00 0.00 ? 6   THR A CA   3  
ATOM   8925   C  C    . THR A 1 6   ? 19.454  2.283   -1.415  1.00 0.00 ? 6   THR A C    3  
ATOM   8926   O  O    . THR A 1 6   ? 19.714  1.687   -2.440  1.00 0.00 ? 6   THR A O    3  
ATOM   8927   C  CB   . THR A 1 6   ? 20.590  2.199   0.810   1.00 0.00 ? 6   THR A CB   3  
ATOM   8928   O  OG1  . THR A 1 6   ? 20.206  3.518   1.178   1.00 0.00 ? 6   THR A OG1  3  
ATOM   8929   C  CG2  . THR A 1 6   ? 21.900  2.247   0.023   1.00 0.00 ? 6   THR A CG2  3  
ATOM   8930   H  H    . THR A 1 6   ? 20.494  -0.147  -0.889  1.00 0.00 ? 6   THR A H    3  
ATOM   8931   H  HA   . THR A 1 6   ? 18.539  1.683   0.433   1.00 0.00 ? 6   THR A HA   3  
ATOM   8932   H  HB   . THR A 1 6   ? 20.729  1.604   1.699   1.00 0.00 ? 6   THR A HB   3  
ATOM   8933   H  HG1  . THR A 1 6   ? 20.671  4.132   0.605   1.00 0.00 ? 6   THR A HG1  3  
ATOM   8934   H  HG21 . THR A 1 6   ? 22.098  1.276   -0.409  1.00 0.00 ? 6   THR A HG21 3  
ATOM   8935   H  HG22 . THR A 1 6   ? 22.709  2.516   0.686   1.00 0.00 ? 6   THR A HG22 3  
ATOM   8936   H  HG23 . THR A 1 6   ? 21.821  2.981   -0.765  1.00 0.00 ? 6   THR A HG23 3  
ATOM   8937   N  N    . VAL A 1 7   ? 19.116  3.548   -1.437  1.00 0.00 ? 7   VAL A N    3  
ATOM   8938   C  CA   . VAL A 1 7   ? 19.050  4.275   -2.738  1.00 0.00 ? 7   VAL A CA   3  
ATOM   8939   C  C    . VAL A 1 7   ? 20.432  4.813   -3.115  1.00 0.00 ? 7   VAL A C    3  
ATOM   8940   O  O    . VAL A 1 7   ? 21.139  5.370   -2.299  1.00 0.00 ? 7   VAL A O    3  
ATOM   8941   C  CB   . VAL A 1 7   ? 18.072  5.444   -2.618  1.00 0.00 ? 7   VAL A CB   3  
ATOM   8942   C  CG1  . VAL A 1 7   ? 16.639  4.910   -2.570  1.00 0.00 ? 7   VAL A CG1  3  
ATOM   8943   C  CG2  . VAL A 1 7   ? 18.368  6.226   -1.335  1.00 0.00 ? 7   VAL A CG2  3  
ATOM   8944   H  H    . VAL A 1 7   ? 18.894  4.019   -0.604  1.00 0.00 ? 7   VAL A H    3  
ATOM   8945   H  HA   . VAL A 1 7   ? 18.706  3.600   -3.507  1.00 0.00 ? 7   VAL A HA   3  
ATOM   8946   H  HB   . VAL A 1 7   ? 18.185  6.095   -3.473  1.00 0.00 ? 7   VAL A HB   3  
ATOM   8947   H  HG11 . VAL A 1 7   ? 15.963  5.714   -2.325  1.00 0.00 ? 7   VAL A HG11 3  
ATOM   8948   H  HG12 . VAL A 1 7   ? 16.570  4.138   -1.817  1.00 0.00 ? 7   VAL A HG12 3  
ATOM   8949   H  HG13 . VAL A 1 7   ? 16.377  4.498   -3.533  1.00 0.00 ? 7   VAL A HG13 3  
ATOM   8950   H  HG21 . VAL A 1 7   ? 17.619  5.998   -0.592  1.00 0.00 ? 7   VAL A HG21 3  
ATOM   8951   H  HG22 . VAL A 1 7   ? 18.353  7.285   -1.548  1.00 0.00 ? 7   VAL A HG22 3  
ATOM   8952   H  HG23 . VAL A 1 7   ? 19.343  5.949   -0.961  1.00 0.00 ? 7   VAL A HG23 3  
ATOM   8953   N  N    . LYS A 1 8   ? 20.814  4.653   -4.352  1.00 0.00 ? 8   LYS A N    3  
ATOM   8954   C  CA   . LYS A 1 8   ? 22.145  5.156   -4.800  1.00 0.00 ? 8   LYS A CA   3  
ATOM   8955   C  C    . LYS A 1 8   ? 22.169  6.686   -4.751  1.00 0.00 ? 8   LYS A C    3  
ATOM   8956   O  O    . LYS A 1 8   ? 23.127  7.284   -4.302  1.00 0.00 ? 8   LYS A O    3  
ATOM   8957   C  CB   . LYS A 1 8   ? 22.403  4.699   -6.238  1.00 0.00 ? 8   LYS A CB   3  
ATOM   8958   C  CG   . LYS A 1 8   ? 23.853  5.002   -6.617  1.00 0.00 ? 8   LYS A CG   3  
ATOM   8959   C  CD   . LYS A 1 8   ? 24.150  4.428   -8.003  1.00 0.00 ? 8   LYS A CD   3  
ATOM   8960   C  CE   . LYS A 1 8   ? 24.745  5.523   -8.888  1.00 0.00 ? 8   LYS A CE   3  
ATOM   8961   N  NZ   . LYS A 1 8   ? 25.885  6.168   -8.176  1.00 0.00 ? 8   LYS A NZ   3  
ATOM   8962   H  H    . LYS A 1 8   ? 20.223  4.200   -4.989  1.00 0.00 ? 8   LYS A H    3  
ATOM   8963   H  HA   . LYS A 1 8   ? 22.917  4.766   -4.154  1.00 0.00 ? 8   LYS A HA   3  
ATOM   8964   H  HB2  . LYS A 1 8   ? 22.222  3.637   -6.319  1.00 0.00 ? 8   LYS A HB2  3  
ATOM   8965   H  HB3  . LYS A 1 8   ? 21.742  5.228   -6.907  1.00 0.00 ? 8   LYS A HB3  3  
ATOM   8966   H  HG2  . LYS A 1 8   ? 24.005  6.072   -6.629  1.00 0.00 ? 8   LYS A HG2  3  
ATOM   8967   H  HG3  . LYS A 1 8   ? 24.515  4.553   -5.893  1.00 0.00 ? 8   LYS A HG3  3  
ATOM   8968   H  HD2  . LYS A 1 8   ? 24.855  3.614   -7.911  1.00 0.00 ? 8   LYS A HD2  3  
ATOM   8969   H  HD3  . LYS A 1 8   ? 23.236  4.065   -8.447  1.00 0.00 ? 8   LYS A HD3  3  
ATOM   8970   H  HE2  . LYS A 1 8   ? 25.096  5.088   -9.812  1.00 0.00 ? 8   LYS A HE2  3  
ATOM   8971   H  HE3  . LYS A 1 8   ? 23.989  6.263   -9.102  1.00 0.00 ? 8   LYS A HE3  3  
ATOM   8972   H  HZ1  . LYS A 1 8   ? 26.391  5.457   -7.613  1.00 0.00 ? 8   LYS A HZ1  3  
ATOM   8973   H  HZ2  . LYS A 1 8   ? 25.523  6.916   -7.549  1.00 0.00 ? 8   LYS A HZ2  3  
ATOM   8974   H  HZ3  . LYS A 1 8   ? 26.538  6.584   -8.871  1.00 0.00 ? 8   LYS A HZ3  3  
ATOM   8975   N  N    . GLU A 1 9   ? 21.128  7.322   -5.218  1.00 0.00 ? 9   GLU A N    3  
ATOM   8976   C  CA   . GLU A 1 9   ? 21.097  8.814   -5.208  1.00 0.00 ? 9   GLU A CA   3  
ATOM   8977   C  C    . GLU A 1 9   ? 19.793  9.303   -4.575  1.00 0.00 ? 9   GLU A C    3  
ATOM   8978   O  O    . GLU A 1 9   ? 18.781  8.632   -4.614  1.00 0.00 ? 9   GLU A O    3  
ATOM   8979   C  CB   . GLU A 1 9   ? 21.184  9.331   -6.646  1.00 0.00 ? 9   GLU A CB   3  
ATOM   8980   C  CG   . GLU A 1 9   ? 21.497  10.828  -6.632  1.00 0.00 ? 9   GLU A CG   3  
ATOM   8981   C  CD   . GLU A 1 9   ? 20.572  11.551  -7.612  1.00 0.00 ? 9   GLU A CD   3  
ATOM   8982   O  OE1  . GLU A 1 9   ? 19.478  11.910  -7.208  1.00 0.00 ? 9   GLU A OE1  3  
ATOM   8983   O  OE2  . GLU A 1 9   ? 20.971  11.733  -8.750  1.00 0.00 ? 9   GLU A OE2  3  
ATOM   8984   H  H    . GLU A 1 9   ? 20.371  6.819   -5.583  1.00 0.00 ? 9   GLU A H    3  
ATOM   8985   H  HA   . GLU A 1 9   ? 21.935  9.191   -4.642  1.00 0.00 ? 9   GLU A HA   3  
ATOM   8986   H  HB2  . GLU A 1 9   ? 21.966  8.802   -7.173  1.00 0.00 ? 9   GLU A HB2  3  
ATOM   8987   H  HB3  . GLU A 1 9   ? 20.240  9.167   -7.144  1.00 0.00 ? 9   GLU A HB3  3  
ATOM   8988   H  HG2  . GLU A 1 9   ? 21.344  11.217  -5.637  1.00 0.00 ? 9   GLU A HG2  3  
ATOM   8989   H  HG3  . GLU A 1 9   ? 22.524  10.983  -6.928  1.00 0.00 ? 9   GLU A HG3  3  
ATOM   8990   N  N    . LYS A 1 10  ? 19.810  10.473  -3.992  1.00 0.00 ? 10  LYS A N    3  
ATOM   8991   C  CA   . LYS A 1 10  ? 18.573  11.008  -3.359  1.00 0.00 ? 10  LYS A CA   3  
ATOM   8992   C  C    . LYS A 1 10  ? 17.511  11.236  -4.435  1.00 0.00 ? 10  LYS A C    3  
ATOM   8993   O  O    . LYS A 1 10  ? 17.793  11.759  -5.496  1.00 0.00 ? 10  LYS A O    3  
ATOM   8994   C  CB   . LYS A 1 10  ? 18.891  12.334  -2.662  1.00 0.00 ? 10  LYS A CB   3  
ATOM   8995   C  CG   . LYS A 1 10  ? 17.586  13.009  -2.219  1.00 0.00 ? 10  LYS A CG   3  
ATOM   8996   C  CD   . LYS A 1 10  ? 17.097  13.997  -3.288  1.00 0.00 ? 10  LYS A CD   3  
ATOM   8997   C  CE   . LYS A 1 10  ? 17.489  15.420  -2.887  1.00 0.00 ? 10  LYS A CE   3  
ATOM   8998   N  NZ   . LYS A 1 10  ? 18.975  15.536  -2.850  1.00 0.00 ? 10  LYS A NZ   3  
ATOM   8999   H  H    . LYS A 1 10  ? 20.637  10.997  -3.972  1.00 0.00 ? 10  LYS A H    3  
ATOM   9000   H  HA   . LYS A 1 10  ? 18.205  10.301  -2.633  1.00 0.00 ? 10  LYS A HA   3  
ATOM   9001   H  HB2  . LYS A 1 10  ? 19.507  12.141  -1.796  1.00 0.00 ? 10  LYS A HB2  3  
ATOM   9002   H  HB3  . LYS A 1 10  ? 19.422  12.979  -3.341  1.00 0.00 ? 10  LYS A HB3  3  
ATOM   9003   H  HG2  . LYS A 1 10  ? 16.829  12.255  -2.061  1.00 0.00 ? 10  LYS A HG2  3  
ATOM   9004   H  HG3  . LYS A 1 10  ? 17.757  13.542  -1.295  1.00 0.00 ? 10  LYS A HG3  3  
ATOM   9005   H  HD2  . LYS A 1 10  ? 17.541  13.757  -4.243  1.00 0.00 ? 10  LYS A HD2  3  
ATOM   9006   H  HD3  . LYS A 1 10  ? 16.023  13.934  -3.368  1.00 0.00 ? 10  LYS A HD3  3  
ATOM   9007   H  HE2  . LYS A 1 10  ? 17.091  16.120  -3.606  1.00 0.00 ? 10  LYS A HE2  3  
ATOM   9008   H  HE3  . LYS A 1 10  ? 17.087  15.642  -1.909  1.00 0.00 ? 10  LYS A HE3  3  
ATOM   9009   H  HZ1  . LYS A 1 10  ? 19.251  16.221  -2.119  1.00 0.00 ? 10  LYS A HZ1  3  
ATOM   9010   H  HZ2  . LYS A 1 10  ? 19.320  15.857  -3.777  1.00 0.00 ? 10  LYS A HZ2  3  
ATOM   9011   H  HZ3  . LYS A 1 10  ? 19.389  14.609  -2.628  1.00 0.00 ? 10  LYS A HZ3  3  
ATOM   9012   N  N    . LEU A 1 11  ? 16.294  10.849  -4.168  1.00 0.00 ? 11  LEU A N    3  
ATOM   9013   C  CA   . LEU A 1 11  ? 15.205  11.041  -5.172  1.00 0.00 ? 11  LEU A CA   3  
ATOM   9014   C  C    . LEU A 1 11  ? 14.131  11.955  -4.585  1.00 0.00 ? 11  LEU A C    3  
ATOM   9015   O  O    . LEU A 1 11  ? 14.126  12.239  -3.404  1.00 0.00 ? 11  LEU A O    3  
ATOM   9016   C  CB   . LEU A 1 11  ? 14.583  9.689   -5.514  1.00 0.00 ? 11  LEU A CB   3  
ATOM   9017   C  CG   . LEU A 1 11  ? 15.602  8.835   -6.269  1.00 0.00 ? 11  LEU A CG   3  
ATOM   9018   C  CD1  . LEU A 1 11  ? 15.841  7.532   -5.506  1.00 0.00 ? 11  LEU A CD1  3  
ATOM   9019   C  CD2  . LEU A 1 11  ? 15.063  8.519   -7.666  1.00 0.00 ? 11  LEU A CD2  3  
ATOM   9020   H  H    . LEU A 1 11  ? 16.094  10.430  -3.304  1.00 0.00 ? 11  LEU A H    3  
ATOM   9021   H  HA   . LEU A 1 11  ? 15.609  11.489  -6.068  1.00 0.00 ? 11  LEU A HA   3  
ATOM   9022   H  HB2  . LEU A 1 11  ? 14.294  9.185   -4.602  1.00 0.00 ? 11  LEU A HB2  3  
ATOM   9023   H  HB3  . LEU A 1 11  ? 13.713  9.839   -6.132  1.00 0.00 ? 11  LEU A HB3  3  
ATOM   9024   H  HG   . LEU A 1 11  ? 16.532  9.378   -6.354  1.00 0.00 ? 11  LEU A HG   3  
ATOM   9025   H  HD11 . LEU A 1 11  ? 16.076  7.756   -4.476  1.00 0.00 ? 11  LEU A HD11 3  
ATOM   9026   H  HD12 . LEU A 1 11  ? 16.665  6.997   -5.955  1.00 0.00 ? 11  LEU A HD12 3  
ATOM   9027   H  HD13 . LEU A 1 11  ? 14.951  6.921   -5.547  1.00 0.00 ? 11  LEU A HD13 3  
ATOM   9028   H  HD21 . LEU A 1 11  ? 14.750  9.434   -8.147  1.00 0.00 ? 11  LEU A HD21 3  
ATOM   9029   H  HD22 . LEU A 1 11  ? 14.219  7.850   -7.583  1.00 0.00 ? 11  LEU A HD22 3  
ATOM   9030   H  HD23 . LEU A 1 11  ? 15.837  8.050   -8.254  1.00 0.00 ? 11  LEU A HD23 3  
ATOM   9031   N  N    . SER A 1 12  ? 13.220  12.422  -5.395  1.00 0.00 ? 12  SER A N    3  
ATOM   9032   C  CA   . SER A 1 12  ? 12.157  13.318  -4.864  1.00 0.00 ? 12  SER A CA   3  
ATOM   9033   C  C    . SER A 1 12  ? 10.939  13.302  -5.791  1.00 0.00 ? 12  SER A C    3  
ATOM   9034   O  O    . SER A 1 12  ? 11.055  13.138  -6.989  1.00 0.00 ? 12  SER A O    3  
ATOM   9035   C  CB   . SER A 1 12  ? 12.701  14.742  -4.756  1.00 0.00 ? 12  SER A CB   3  
ATOM   9036   O  OG   . SER A 1 12  ? 13.445  15.049  -5.929  1.00 0.00 ? 12  SER A OG   3  
ATOM   9037   H  H    . SER A 1 12  ? 13.235  12.189  -6.347  1.00 0.00 ? 12  SER A H    3  
ATOM   9038   H  HA   . SER A 1 12  ? 11.862  12.973  -3.887  1.00 0.00 ? 12  SER A HA   3  
ATOM   9039   H  HB2  . SER A 1 12  ? 11.883  15.437  -4.663  1.00 0.00 ? 12  SER A HB2  3  
ATOM   9040   H  HB3  . SER A 1 12  ? 13.337  14.819  -3.884  1.00 0.00 ? 12  SER A HB3  3  
ATOM   9041   H  HG   . SER A 1 12  ? 13.747  14.223  -6.314  1.00 0.00 ? 12  SER A HG   3  
ATOM   9042   N  N    . PHE A 1 13  ? 9.769   13.476  -5.236  1.00 0.00 ? 13  PHE A N    3  
ATOM   9043   C  CA   . PHE A 1 13  ? 8.527   13.476  -6.067  1.00 0.00 ? 13  PHE A CA   3  
ATOM   9044   C  C    . PHE A 1 13  ? 7.696   14.708  -5.730  1.00 0.00 ? 13  PHE A C    3  
ATOM   9045   O  O    . PHE A 1 13  ? 7.843   15.287  -4.674  1.00 0.00 ? 13  PHE A O    3  
ATOM   9046   C  CB   . PHE A 1 13  ? 7.710   12.224  -5.761  1.00 0.00 ? 13  PHE A CB   3  
ATOM   9047   C  CG   . PHE A 1 13  ? 8.364   11.047  -6.426  1.00 0.00 ? 13  PHE A CG   3  
ATOM   9048   C  CD1  . PHE A 1 13  ? 9.359   10.335  -5.753  1.00 0.00 ? 13  PHE A CD1  3  
ATOM   9049   C  CD2  . PHE A 1 13  ? 7.985   10.679  -7.717  1.00 0.00 ? 13  PHE A CD2  3  
ATOM   9050   C  CE1  . PHE A 1 13  ? 9.977   9.246   -6.376  1.00 0.00 ? 13  PHE A CE1  3  
ATOM   9051   C  CE2  . PHE A 1 13  ? 8.601   9.595   -8.342  1.00 0.00 ? 13  PHE A CE2  3  
ATOM   9052   C  CZ   . PHE A 1 13  ? 9.599   8.874   -7.672  1.00 0.00 ? 13  PHE A CZ   3  
ATOM   9053   H  H    . PHE A 1 13  ? 9.709   13.606  -4.264  1.00 0.00 ? 13  PHE A H    3  
ATOM   9054   H  HA   . PHE A 1 13  ? 8.789   13.491  -7.114  1.00 0.00 ? 13  PHE A HA   3  
ATOM   9055   H  HB2  . PHE A 1 13  ? 7.676   12.067  -4.694  1.00 0.00 ? 13  PHE A HB2  3  
ATOM   9056   H  HB3  . PHE A 1 13  ? 6.707   12.342  -6.142  1.00 0.00 ? 13  PHE A HB3  3  
ATOM   9057   H  HD1  . PHE A 1 13  ? 9.647   10.624  -4.754  1.00 0.00 ? 13  PHE A HD1  3  
ATOM   9058   H  HD2  . PHE A 1 13  ? 7.215   11.232  -8.232  1.00 0.00 ? 13  PHE A HD2  3  
ATOM   9059   H  HE1  . PHE A 1 13  ? 10.746  8.693   -5.858  1.00 0.00 ? 13  PHE A HE1  3  
ATOM   9060   H  HE2  . PHE A 1 13  ? 8.306   9.315   -9.340  1.00 0.00 ? 13  PHE A HE2  3  
ATOM   9061   H  HZ   . PHE A 1 13  ? 10.077  8.037   -8.153  1.00 0.00 ? 13  PHE A HZ   3  
ATOM   9062   N  N    . GLU A 1 14  ? 6.817   15.120  -6.607  1.00 0.00 ? 14  GLU A N    3  
ATOM   9063   C  CA   . GLU A 1 14  ? 5.983   16.321  -6.311  1.00 0.00 ? 14  GLU A CA   3  
ATOM   9064   C  C    . GLU A 1 14  ? 4.609   16.155  -6.968  1.00 0.00 ? 14  GLU A C    3  
ATOM   9065   O  O    . GLU A 1 14  ? 4.503   15.748  -8.108  1.00 0.00 ? 14  GLU A O    3  
ATOM   9066   C  CB   . GLU A 1 14  ? 6.670   17.568  -6.874  1.00 0.00 ? 14  GLU A CB   3  
ATOM   9067   C  CG   . GLU A 1 14  ? 7.257   17.253  -8.251  1.00 0.00 ? 14  GLU A CG   3  
ATOM   9068   C  CD   . GLU A 1 14  ? 7.413   18.550  -9.048  1.00 0.00 ? 14  GLU A CD   3  
ATOM   9069   O  OE1  . GLU A 1 14  ? 8.427   19.208  -8.880  1.00 0.00 ? 14  GLU A OE1  3  
ATOM   9070   O  OE2  . GLU A 1 14  ? 6.515   18.865  -9.811  1.00 0.00 ? 14  GLU A OE2  3  
ATOM   9071   H  H    . GLU A 1 14  ? 6.684   14.656  -7.464  1.00 0.00 ? 14  GLU A H    3  
ATOM   9072   H  HA   . GLU A 1 14  ? 5.863   16.428  -5.246  1.00 0.00 ? 14  GLU A HA   3  
ATOM   9073   H  HB2  . GLU A 1 14  ? 5.948   18.366  -6.964  1.00 0.00 ? 14  GLU A HB2  3  
ATOM   9074   H  HB3  . GLU A 1 14  ? 7.463   17.874  -6.209  1.00 0.00 ? 14  GLU A HB3  3  
ATOM   9075   H  HG2  . GLU A 1 14  ? 8.224   16.785  -8.131  1.00 0.00 ? 14  GLU A HG2  3  
ATOM   9076   H  HG3  . GLU A 1 14  ? 6.596   16.585  -8.781  1.00 0.00 ? 14  GLU A HG3  3  
ATOM   9077   N  N    . GLY A 1 15  ? 3.554   16.467  -6.262  1.00 0.00 ? 15  GLY A N    3  
ATOM   9078   C  CA   . GLY A 1 15  ? 2.190   16.324  -6.856  1.00 0.00 ? 15  GLY A CA   3  
ATOM   9079   C  C    . GLY A 1 15  ? 1.126   16.536  -5.775  1.00 0.00 ? 15  GLY A C    3  
ATOM   9080   O  O    . GLY A 1 15  ? 1.401   16.440  -4.594  1.00 0.00 ? 15  GLY A O    3  
ATOM   9081   H  H    . GLY A 1 15  ? 3.656   16.795  -5.343  1.00 0.00 ? 15  GLY A H    3  
ATOM   9082   H  HA2  . GLY A 1 15  ? 2.059   17.060  -7.638  1.00 0.00 ? 15  GLY A HA2  3  
ATOM   9083   H  HA3  . GLY A 1 15  ? 2.081   15.333  -7.274  1.00 0.00 ? 15  GLY A HA3  3  
ATOM   9084   N  N    . VAL A 1 16  ? -0.085  16.843  -6.163  1.00 0.00 ? 16  VAL A N    3  
ATOM   9085   C  CA   . VAL A 1 16  ? -1.159  17.080  -5.157  1.00 0.00 ? 16  VAL A CA   3  
ATOM   9086   C  C    . VAL A 1 16  ? -1.566  15.772  -4.474  1.00 0.00 ? 16  VAL A C    3  
ATOM   9087   O  O    . VAL A 1 16  ? -1.304  14.689  -4.958  1.00 0.00 ? 16  VAL A O    3  
ATOM   9088   C  CB   . VAL A 1 16  ? -2.376  17.686  -5.858  1.00 0.00 ? 16  VAL A CB   3  
ATOM   9089   C  CG1  . VAL A 1 16  ? -2.713  16.859  -7.101  1.00 0.00 ? 16  VAL A CG1  3  
ATOM   9090   C  CG2  . VAL A 1 16  ? -3.574  17.683  -4.906  1.00 0.00 ? 16  VAL A CG2  3  
ATOM   9091   H  H    . VAL A 1 16  ? -0.297  16.948  -7.114  1.00 0.00 ? 16  VAL A H    3  
ATOM   9092   H  HA   . VAL A 1 16  ? -0.803  17.766  -4.413  1.00 0.00 ? 16  VAL A HA   3  
ATOM   9093   H  HB   . VAL A 1 16  ? -2.152  18.700  -6.154  1.00 0.00 ? 16  VAL A HB   3  
ATOM   9094   H  HG11 . VAL A 1 16  ? -2.474  17.427  -7.987  1.00 0.00 ? 16  VAL A HG11 3  
ATOM   9095   H  HG12 . VAL A 1 16  ? -3.766  16.620  -7.100  1.00 0.00 ? 16  VAL A HG12 3  
ATOM   9096   H  HG13 . VAL A 1 16  ? -2.136  15.945  -7.093  1.00 0.00 ? 16  VAL A HG13 3  
ATOM   9097   H  HG21 . VAL A 1 16  ? -3.923  16.670  -4.766  1.00 0.00 ? 16  VAL A HG21 3  
ATOM   9098   H  HG22 . VAL A 1 16  ? -4.370  18.281  -5.326  1.00 0.00 ? 16  VAL A HG22 3  
ATOM   9099   H  HG23 . VAL A 1 16  ? -3.278  18.097  -3.953  1.00 0.00 ? 16  VAL A HG23 3  
ATOM   9100   N  N    . GLY A 1 17  ? -2.214  15.882  -3.344  1.00 0.00 ? 17  GLY A N    3  
ATOM   9101   C  CA   . GLY A 1 17  ? -2.662  14.665  -2.601  1.00 0.00 ? 17  GLY A CA   3  
ATOM   9102   C  C    . GLY A 1 17  ? -4.117  14.348  -2.967  1.00 0.00 ? 17  GLY A C    3  
ATOM   9103   O  O    . GLY A 1 17  ? -4.929  15.236  -3.142  1.00 0.00 ? 17  GLY A O    3  
ATOM   9104   H  H    . GLY A 1 17  ? -2.409  16.775  -2.986  1.00 0.00 ? 17  GLY A H    3  
ATOM   9105   H  HA2  . GLY A 1 17  ? -2.031  13.828  -2.869  1.00 0.00 ? 17  GLY A HA2  3  
ATOM   9106   H  HA3  . GLY A 1 17  ? -2.592  14.847  -1.541  1.00 0.00 ? 17  GLY A HA3  3  
ATOM   9107   N  N    . ILE A 1 18  ? -4.447  13.091  -3.115  1.00 0.00 ? 18  ILE A N    3  
ATOM   9108   C  CA   . ILE A 1 18  ? -5.839  12.717  -3.506  1.00 0.00 ? 18  ILE A CA   3  
ATOM   9109   C  C    . ILE A 1 18  ? -6.884  13.265  -2.527  1.00 0.00 ? 18  ILE A C    3  
ATOM   9110   O  O    . ILE A 1 18  ? -7.846  13.881  -2.940  1.00 0.00 ? 18  ILE A O    3  
ATOM   9111   C  CB   . ILE A 1 18  ? -5.979  11.195  -3.552  1.00 0.00 ? 18  ILE A CB   3  
ATOM   9112   C  CG1  . ILE A 1 18  ? -7.435  10.838  -3.863  1.00 0.00 ? 18  ILE A CG1  3  
ATOM   9113   C  CG2  . ILE A 1 18  ? -5.580  10.600  -2.201  1.00 0.00 ? 18  ILE A CG2  3  
ATOM   9114   C  CD1  . ILE A 1 18  ? -7.533  9.358   -4.238  1.00 0.00 ? 18  ILE A CD1  3  
ATOM   9115   H  H    . ILE A 1 18  ? -3.769  12.391  -3.003  1.00 0.00 ? 18  ILE A H    3  
ATOM   9116   H  HA   . ILE A 1 18  ? -6.045  13.112  -4.488  1.00 0.00 ? 18  ILE A HA   3  
ATOM   9117   H  HB   . ILE A 1 18  ? -5.341  10.795  -4.323  1.00 0.00 ? 18  ILE A HB   3  
ATOM   9118   H  HG12 . ILE A 1 18  ? -8.052  11.035  -2.998  1.00 0.00 ? 18  ILE A HG12 3  
ATOM   9119   H  HG13 . ILE A 1 18  ? -7.779  11.437  -4.689  1.00 0.00 ? 18  ILE A HG13 3  
ATOM   9120   H  HG21 . ILE A 1 18  ? -6.435  10.599  -1.541  1.00 0.00 ? 18  ILE A HG21 3  
ATOM   9121   H  HG22 . ILE A 1 18  ? -4.789  11.194  -1.765  1.00 0.00 ? 18  ILE A HG22 3  
ATOM   9122   H  HG23 . ILE A 1 18  ? -5.233  9.587   -2.341  1.00 0.00 ? 18  ILE A HG23 3  
ATOM   9123   H  HD11 . ILE A 1 18  ? -8.343  8.901   -3.690  1.00 0.00 ? 18  ILE A HD11 3  
ATOM   9124   H  HD12 . ILE A 1 18  ? -6.607  8.861   -3.992  1.00 0.00 ? 18  ILE A HD12 3  
ATOM   9125   H  HD13 . ILE A 1 18  ? -7.720  9.267   -5.298  1.00 0.00 ? 18  ILE A HD13 3  
ATOM   9126   N  N    . HIS A 1 19  ? -6.749  13.033  -1.245  1.00 0.00 ? 19  HIS A N    3  
ATOM   9127   C  CA   . HIS A 1 19  ? -7.789  13.532  -0.299  1.00 0.00 ? 19  HIS A CA   3  
ATOM   9128   C  C    . HIS A 1 19  ? -7.502  14.970  0.129   1.00 0.00 ? 19  HIS A C    3  
ATOM   9129   O  O    . HIS A 1 19  ? -8.406  15.763  0.293   1.00 0.00 ? 19  HIS A O    3  
ATOM   9130   C  CB   . HIS A 1 19  ? -7.813  12.640  0.945   1.00 0.00 ? 19  HIS A CB   3  
ATOM   9131   C  CG   . HIS A 1 19  ? -8.114  11.221  0.547   1.00 0.00 ? 19  HIS A CG   3  
ATOM   9132   N  ND1  . HIS A 1 19  ? -8.622  10.895  -0.700  1.00 0.00 ? 19  HIS A ND1  3  
ATOM   9133   C  CD2  . HIS A 1 19  ? -7.991  10.032  1.224   1.00 0.00 ? 19  HIS A CD2  3  
ATOM   9134   C  CE1  . HIS A 1 19  ? -8.789  9.561   -0.734  1.00 0.00 ? 19  HIS A CE1  3  
ATOM   9135   N  NE2  . HIS A 1 19  ? -8.418  8.986   0.413   1.00 0.00 ? 19  HIS A NE2  3  
ATOM   9136   H  H    . HIS A 1 19  ? -5.995  12.525  -0.880  1.00 0.00 ? 19  HIS A H    3  
ATOM   9137   H  HA   . HIS A 1 19  ? -8.751  13.494  -0.780  1.00 0.00 ? 19  HIS A HA   3  
ATOM   9138   H  HB2  . HIS A 1 19  ? -6.850  12.679  1.433   1.00 0.00 ? 19  HIS A HB2  3  
ATOM   9139   H  HB3  . HIS A 1 19  ? -8.575  12.990  1.624   1.00 0.00 ? 19  HIS A HB3  3  
ATOM   9140   H  HD1  . HIS A 1 19  ? -8.819  11.522  -1.427  1.00 0.00 ? 19  HIS A HD1  3  
ATOM   9141   H  HD2  . HIS A 1 19  ? -7.619  9.925   2.232   1.00 0.00 ? 19  HIS A HD2  3  
ATOM   9142   H  HE1  . HIS A 1 19  ? -9.181  9.020   -1.581  1.00 0.00 ? 19  HIS A HE1  3  
ATOM   9143   N  N    . THR A 1 20  ? -6.260  15.310  0.331   1.00 0.00 ? 20  THR A N    3  
ATOM   9144   C  CA   . THR A 1 20  ? -5.937  16.697  0.768   1.00 0.00 ? 20  THR A CA   3  
ATOM   9145   C  C    . THR A 1 20  ? -6.139  17.664  -0.394  1.00 0.00 ? 20  THR A C    3  
ATOM   9146   O  O    . THR A 1 20  ? -6.546  18.795  -0.209  1.00 0.00 ? 20  THR A O    3  
ATOM   9147   C  CB   . THR A 1 20  ? -4.482  16.764  1.235   1.00 0.00 ? 20  THR A CB   3  
ATOM   9148   O  OG1  . THR A 1 20  ? -3.652  16.104  0.289   1.00 0.00 ? 20  THR A OG1  3  
ATOM   9149   C  CG2  . THR A 1 20  ? -4.351  16.085  2.600   1.00 0.00 ? 20  THR A CG2  3  
ATOM   9150   H  H    . THR A 1 20  ? -5.544  14.653  0.200   1.00 0.00 ? 20  THR A H    3  
ATOM   9151   H  HA   . THR A 1 20  ? -6.587  16.976  1.583   1.00 0.00 ? 20  THR A HA   3  
ATOM   9152   H  HB   . THR A 1 20  ? -4.179  17.796  1.321   1.00 0.00 ? 20  THR A HB   3  
ATOM   9153   H  HG1  . THR A 1 20  ? -4.215  15.748  -0.402  1.00 0.00 ? 20  THR A HG1  3  
ATOM   9154   H  HG21 . THR A 1 20  ? -4.569  15.032  2.501   1.00 0.00 ? 20  THR A HG21 3  
ATOM   9155   H  HG22 . THR A 1 20  ? -5.047  16.534  3.292   1.00 0.00 ? 20  THR A HG22 3  
ATOM   9156   H  HG23 . THR A 1 20  ? -3.344  16.211  2.969   1.00 0.00 ? 20  THR A HG23 3  
ATOM   9157   N  N    . GLY A 1 21  ? -5.852  17.240  -1.591  1.00 0.00 ? 21  GLY A N    3  
ATOM   9158   C  CA   . GLY A 1 21  ? -6.023  18.152  -2.752  1.00 0.00 ? 21  GLY A CA   3  
ATOM   9159   C  C    . GLY A 1 21  ? -5.063  19.332  -2.592  1.00 0.00 ? 21  GLY A C    3  
ATOM   9160   O  O    . GLY A 1 21  ? -5.281  20.404  -3.122  1.00 0.00 ? 21  GLY A O    3  
ATOM   9161   H  H    . GLY A 1 21  ? -5.518  16.328  -1.724  1.00 0.00 ? 21  GLY A H    3  
ATOM   9162   H  HA2  . GLY A 1 21  ? -5.794  17.620  -3.664  1.00 0.00 ? 21  GLY A HA2  3  
ATOM   9163   H  HA3  . GLY A 1 21  ? -7.040  18.511  -2.784  1.00 0.00 ? 21  GLY A HA3  3  
ATOM   9164   N  N    . GLU A 1 22  ? -3.996  19.130  -1.864  1.00 0.00 ? 22  GLU A N    3  
ATOM   9165   C  CA   . GLU A 1 22  ? -3.001  20.221  -1.658  1.00 0.00 ? 22  GLU A CA   3  
ATOM   9166   C  C    . GLU A 1 22  ? -1.661  19.788  -2.256  1.00 0.00 ? 22  GLU A C    3  
ATOM   9167   O  O    . GLU A 1 22  ? -1.385  18.614  -2.386  1.00 0.00 ? 22  GLU A O    3  
ATOM   9168   C  CB   . GLU A 1 22  ? -2.831  20.487  -0.160  1.00 0.00 ? 22  GLU A CB   3  
ATOM   9169   C  CG   . GLU A 1 22  ? -2.699  21.992  0.079   1.00 0.00 ? 22  GLU A CG   3  
ATOM   9170   C  CD   . GLU A 1 22  ? -2.487  22.256  1.570   1.00 0.00 ? 22  GLU A CD   3  
ATOM   9171   O  OE1  . GLU A 1 22  ? -3.207  21.673  2.362   1.00 0.00 ? 22  GLU A OE1  3  
ATOM   9172   O  OE2  . GLU A 1 22  ? -1.606  23.036  1.894   1.00 0.00 ? 22  GLU A OE2  3  
ATOM   9173   H  H    . GLU A 1 22  ? -3.850  18.250  -1.458  1.00 0.00 ? 22  GLU A H    3  
ATOM   9174   H  HA   . GLU A 1 22  ? -3.341  21.120  -2.148  1.00 0.00 ? 22  GLU A HA   3  
ATOM   9175   H  HB2  . GLU A 1 22  ? -3.693  20.110  0.372   1.00 0.00 ? 22  GLU A HB2  3  
ATOM   9176   H  HB3  . GLU A 1 22  ? -1.942  19.987  0.195   1.00 0.00 ? 22  GLU A HB3  3  
ATOM   9177   H  HG2  . GLU A 1 22  ? -1.855  22.372  -0.479  1.00 0.00 ? 22  GLU A HG2  3  
ATOM   9178   H  HG3  . GLU A 1 22  ? -3.599  22.488  -0.248  1.00 0.00 ? 22  GLU A HG3  3  
ATOM   9179   N  N    . TYR A 1 23  ? -0.831  20.723  -2.627  1.00 0.00 ? 23  TYR A N    3  
ATOM   9180   C  CA   . TYR A 1 23  ? 0.483   20.357  -3.228  1.00 0.00 ? 23  TYR A CA   3  
ATOM   9181   C  C    . TYR A 1 23  ? 1.411   19.780  -2.157  1.00 0.00 ? 23  TYR A C    3  
ATOM   9182   O  O    . TYR A 1 23  ? 1.566   20.341  -1.091  1.00 0.00 ? 23  TYR A O    3  
ATOM   9183   C  CB   . TYR A 1 23  ? 1.125   21.602  -3.842  1.00 0.00 ? 23  TYR A CB   3  
ATOM   9184   C  CG   . TYR A 1 23  ? 2.625   21.438  -3.864  1.00 0.00 ? 23  TYR A CG   3  
ATOM   9185   C  CD1  . TYR A 1 23  ? 3.197   20.314  -4.471  1.00 0.00 ? 23  TYR A CD1  3  
ATOM   9186   C  CD2  . TYR A 1 23  ? 3.445   22.410  -3.276  1.00 0.00 ? 23  TYR A CD2  3  
ATOM   9187   C  CE1  . TYR A 1 23  ? 4.589   20.162  -4.491  1.00 0.00 ? 23  TYR A CE1  3  
ATOM   9188   C  CE2  . TYR A 1 23  ? 4.836   22.257  -3.296  1.00 0.00 ? 23  TYR A CE2  3  
ATOM   9189   C  CZ   . TYR A 1 23  ? 5.408   21.133  -3.903  1.00 0.00 ? 23  TYR A CZ   3  
ATOM   9190   O  OH   . TYR A 1 23  ? 6.779   20.982  -3.921  1.00 0.00 ? 23  TYR A OH   3  
ATOM   9191   H  H    . TYR A 1 23  ? -1.075  21.666  -2.517  1.00 0.00 ? 23  TYR A H    3  
ATOM   9192   H  HA   . TYR A 1 23  ? 0.328   19.619  -3.998  1.00 0.00 ? 23  TYR A HA   3  
ATOM   9193   H  HB2  . TYR A 1 23  ? 0.762   21.734  -4.850  1.00 0.00 ? 23  TYR A HB2  3  
ATOM   9194   H  HB3  . TYR A 1 23  ? 0.867   22.468  -3.250  1.00 0.00 ? 23  TYR A HB3  3  
ATOM   9195   H  HD1  . TYR A 1 23  ? 2.565   19.565  -4.925  1.00 0.00 ? 23  TYR A HD1  3  
ATOM   9196   H  HD2  . TYR A 1 23  ? 3.003   23.277  -2.808  1.00 0.00 ? 23  TYR A HD2  3  
ATOM   9197   H  HE1  . TYR A 1 23  ? 5.030   19.295  -4.960  1.00 0.00 ? 23  TYR A HE1  3  
ATOM   9198   H  HE2  . TYR A 1 23  ? 5.468   23.006  -2.844  1.00 0.00 ? 23  TYR A HE2  3  
ATOM   9199   H  HH   . TYR A 1 23  ? 7.083   20.931  -3.013  1.00 0.00 ? 23  TYR A HH   3  
ATOM   9200   N  N    . SER A 1 24  ? 2.040   18.666  -2.436  1.00 0.00 ? 24  SER A N    3  
ATOM   9201   C  CA   . SER A 1 24  ? 2.968   18.060  -1.440  1.00 0.00 ? 24  SER A CA   3  
ATOM   9202   C  C    . SER A 1 24  ? 4.214   17.547  -2.172  1.00 0.00 ? 24  SER A C    3  
ATOM   9203   O  O    . SER A 1 24  ? 4.183   17.301  -3.361  1.00 0.00 ? 24  SER A O    3  
ATOM   9204   C  CB   . SER A 1 24  ? 2.275   16.894  -0.735  1.00 0.00 ? 24  SER A CB   3  
ATOM   9205   O  OG   . SER A 1 24  ? 3.211   16.232  0.105   1.00 0.00 ? 24  SER A OG   3  
ATOM   9206   H  H    . SER A 1 24  ? 1.914   18.226  -3.304  1.00 0.00 ? 24  SER A H    3  
ATOM   9207   H  HA   . SER A 1 24  ? 3.256   18.805  -0.714  1.00 0.00 ? 24  SER A HA   3  
ATOM   9208   H  HB2  . SER A 1 24  ? 1.460   17.267  -0.135  1.00 0.00 ? 24  SER A HB2  3  
ATOM   9209   H  HB3  . SER A 1 24  ? 1.888   16.205  -1.475  1.00 0.00 ? 24  SER A HB3  3  
ATOM   9210   H  HG   . SER A 1 24  ? 2.869   15.356  0.296   1.00 0.00 ? 24  SER A HG   3  
ATOM   9211   N  N    . LYS A 1 25  ? 5.309   17.392  -1.477  1.00 0.00 ? 25  LYS A N    3  
ATOM   9212   C  CA   . LYS A 1 25  ? 6.550   16.903  -2.146  1.00 0.00 ? 25  LYS A CA   3  
ATOM   9213   C  C    . LYS A 1 25  ? 7.234   15.867  -1.257  1.00 0.00 ? 25  LYS A C    3  
ATOM   9214   O  O    . LYS A 1 25  ? 7.096   15.893  -0.050  1.00 0.00 ? 25  LYS A O    3  
ATOM   9215   C  CB   . LYS A 1 25  ? 7.481   18.094  -2.395  1.00 0.00 ? 25  LYS A CB   3  
ATOM   9216   C  CG   . LYS A 1 25  ? 8.718   17.645  -3.175  1.00 0.00 ? 25  LYS A CG   3  
ATOM   9217   C  CD   . LYS A 1 25  ? 9.751   18.774  -3.179  1.00 0.00 ? 25  LYS A CD   3  
ATOM   9218   C  CE   . LYS A 1 25  ? 11.000  18.333  -3.947  1.00 0.00 ? 25  LYS A CE   3  
ATOM   9219   N  NZ   . LYS A 1 25  ? 10.612  17.390  -5.035  1.00 0.00 ? 25  LYS A NZ   3  
ATOM   9220   H  H    . LYS A 1 25  ? 5.315   17.604  -0.518  1.00 0.00 ? 25  LYS A H    3  
ATOM   9221   H  HA   . LYS A 1 25  ? 6.291   16.447  -3.084  1.00 0.00 ? 25  LYS A HA   3  
ATOM   9222   H  HB2  . LYS A 1 25  ? 6.952   18.839  -2.969  1.00 0.00 ? 25  LYS A HB2  3  
ATOM   9223   H  HB3  . LYS A 1 25  ? 7.786   18.515  -1.451  1.00 0.00 ? 25  LYS A HB3  3  
ATOM   9224   H  HG2  . LYS A 1 25  ? 9.142   16.767  -2.712  1.00 0.00 ? 25  LYS A HG2  3  
ATOM   9225   H  HG3  . LYS A 1 25  ? 8.436   17.419  -4.190  1.00 0.00 ? 25  LYS A HG3  3  
ATOM   9226   H  HD2  . LYS A 1 25  ? 9.327   19.648  -3.652  1.00 0.00 ? 25  LYS A HD2  3  
ATOM   9227   H  HD3  . LYS A 1 25  ? 10.024  19.015  -2.163  1.00 0.00 ? 25  LYS A HD3  3  
ATOM   9228   H  HE2  . LYS A 1 25  ? 11.481  19.198  -4.378  1.00 0.00 ? 25  LYS A HE2  3  
ATOM   9229   H  HE3  . LYS A 1 25  ? 11.683  17.841  -3.272  1.00 0.00 ? 25  LYS A HE3  3  
ATOM   9230   H  HZ1  . LYS A 1 25  ? 10.393  16.459  -4.626  1.00 0.00 ? 25  LYS A HZ1  3  
ATOM   9231   H  HZ2  . LYS A 1 25  ? 11.399  17.298  -5.710  1.00 0.00 ? 25  LYS A HZ2  3  
ATOM   9232   H  HZ3  . LYS A 1 25  ? 9.772   17.754  -5.528  1.00 0.00 ? 25  LYS A HZ3  3  
ATOM   9233   N  N    . LEU A 1 26  ? 7.962   14.944  -1.837  1.00 0.00 ? 26  LEU A N    3  
ATOM   9234   C  CA   . LEU A 1 26  ? 8.638   13.903  -1.016  1.00 0.00 ? 26  LEU A CA   3  
ATOM   9235   C  C    . LEU A 1 26  ? 10.123  13.858  -1.362  1.00 0.00 ? 26  LEU A C    3  
ATOM   9236   O  O    . LEU A 1 26  ? 10.524  14.151  -2.470  1.00 0.00 ? 26  LEU A O    3  
ATOM   9237   C  CB   . LEU A 1 26  ? 8.036   12.524  -1.322  1.00 0.00 ? 26  LEU A CB   3  
ATOM   9238   C  CG   . LEU A 1 26  ? 6.567   12.653  -1.745  1.00 0.00 ? 26  LEU A CG   3  
ATOM   9239   C  CD1  . LEU A 1 26  ? 6.049   11.291  -2.213  1.00 0.00 ? 26  LEU A CD1  3  
ATOM   9240   C  CD2  . LEU A 1 26  ? 5.732   13.123  -0.554  1.00 0.00 ? 26  LEU A CD2  3  
ATOM   9241   H  H    . LEU A 1 26  ? 8.067   14.922  -2.814  1.00 0.00 ? 26  LEU A H    3  
ATOM   9242   H  HA   . LEU A 1 26  ? 8.519   14.126  0.031   1.00 0.00 ? 26  LEU A HA   3  
ATOM   9243   H  HB2  . LEU A 1 26  ? 8.598   12.064  -2.122  1.00 0.00 ? 26  LEU A HB2  3  
ATOM   9244   H  HB3  . LEU A 1 26  ? 8.100   11.904  -0.440  1.00 0.00 ? 26  LEU A HB3  3  
ATOM   9245   H  HG   . LEU A 1 26  ? 6.478   13.362  -2.554  1.00 0.00 ? 26  LEU A HG   3  
ATOM   9246   H  HD11 . LEU A 1 26  ? 5.348   10.908  -1.491  1.00 0.00 ? 26  LEU A HD11 3  
ATOM   9247   H  HD12 . LEU A 1 26  ? 6.875   10.603  -2.313  1.00 0.00 ? 26  LEU A HD12 3  
ATOM   9248   H  HD13 . LEU A 1 26  ? 5.557   11.403  -3.168  1.00 0.00 ? 26  LEU A HD13 3  
ATOM   9249   H  HD21 . LEU A 1 26  ? 6.386   13.406  0.252   1.00 0.00 ? 26  LEU A HD21 3  
ATOM   9250   H  HD22 . LEU A 1 26  ? 5.088   12.322  -0.227  1.00 0.00 ? 26  LEU A HD22 3  
ATOM   9251   H  HD23 . LEU A 1 26  ? 5.134   13.972  -0.847  1.00 0.00 ? 26  LEU A HD23 3  
ATOM   9252   N  N    . ILE A 1 27  ? 10.938  13.476  -0.423  1.00 0.00 ? 27  ILE A N    3  
ATOM   9253   C  CA   . ILE A 1 27  ? 12.398  13.386  -0.692  1.00 0.00 ? 27  ILE A CA   3  
ATOM   9254   C  C    . ILE A 1 27  ? 12.933  12.102  -0.055  1.00 0.00 ? 27  ILE A C    3  
ATOM   9255   O  O    . ILE A 1 27  ? 12.721  11.850  1.113   1.00 0.00 ? 27  ILE A O    3  
ATOM   9256   C  CB   . ILE A 1 27  ? 13.111  14.601  -0.095  1.00 0.00 ? 27  ILE A CB   3  
ATOM   9257   C  CG1  . ILE A 1 27  ? 12.271  15.856  -0.342  1.00 0.00 ? 27  ILE A CG1  3  
ATOM   9258   C  CG2  . ILE A 1 27  ? 14.476  14.770  -0.763  1.00 0.00 ? 27  ILE A CG2  3  
ATOM   9259   C  CD1  . ILE A 1 27  ? 13.010  17.077  0.211   1.00 0.00 ? 27  ILE A CD1  3  
ATOM   9260   H  H    . ILE A 1 27  ? 10.579  13.239  0.460   1.00 0.00 ? 27  ILE A H    3  
ATOM   9261   H  HA   . ILE A 1 27  ? 12.562  13.356  -1.760  1.00 0.00 ? 27  ILE A HA   3  
ATOM   9262   H  HB   . ILE A 1 27  ? 13.244  14.456  0.968   1.00 0.00 ? 27  ILE A HB   3  
ATOM   9263   H  HG12 . ILE A 1 27  ? 12.113  15.981  -1.403  1.00 0.00 ? 27  ILE A HG12 3  
ATOM   9264   H  HG13 . ILE A 1 27  ? 11.319  15.758  0.157   1.00 0.00 ? 27  ILE A HG13 3  
ATOM   9265   H  HG21 . ILE A 1 27  ? 15.024  15.556  -0.266  1.00 0.00 ? 27  ILE A HG21 3  
ATOM   9266   H  HG22 . ILE A 1 27  ? 14.338  15.029  -1.803  1.00 0.00 ? 27  ILE A HG22 3  
ATOM   9267   H  HG23 . ILE A 1 27  ? 15.028  13.845  -0.694  1.00 0.00 ? 27  ILE A HG23 3  
ATOM   9268   H  HD11 . ILE A 1 27  ? 13.780  17.377  -0.485  1.00 0.00 ? 27  ILE A HD11 3  
ATOM   9269   H  HD12 . ILE A 1 27  ? 13.461  16.827  1.160   1.00 0.00 ? 27  ILE A HD12 3  
ATOM   9270   H  HD13 . ILE A 1 27  ? 12.311  17.890  0.346   1.00 0.00 ? 27  ILE A HD13 3  
ATOM   9271   N  N    . ILE A 1 28  ? 13.619  11.284  -0.810  1.00 0.00 ? 28  ILE A N    3  
ATOM   9272   C  CA   . ILE A 1 28  ? 14.154  10.013  -0.239  1.00 0.00 ? 28  ILE A CA   3  
ATOM   9273   C  C    . ILE A 1 28  ? 15.680  10.075  -0.180  1.00 0.00 ? 28  ILE A C    3  
ATOM   9274   O  O    . ILE A 1 28  ? 16.344  10.189  -1.191  1.00 0.00 ? 28  ILE A O    3  
ATOM   9275   C  CB   . ILE A 1 28  ? 13.737  8.840   -1.128  1.00 0.00 ? 28  ILE A CB   3  
ATOM   9276   C  CG1  . ILE A 1 28  ? 12.216  8.837   -1.299  1.00 0.00 ? 28  ILE A CG1  3  
ATOM   9277   C  CG2  . ILE A 1 28  ? 14.177  7.527   -0.479  1.00 0.00 ? 28  ILE A CG2  3  
ATOM   9278   C  CD1  . ILE A 1 28  ? 11.844  7.995   -2.521  1.00 0.00 ? 28  ILE A CD1  3  
ATOM   9279   H  H    . ILE A 1 28  ? 13.783  11.497  -1.752  1.00 0.00 ? 28  ILE A H    3  
ATOM   9280   H  HA   . ILE A 1 28  ? 13.760  9.864   0.755   1.00 0.00 ? 28  ILE A HA   3  
ATOM   9281   H  HB   . ILE A 1 28  ? 14.210  8.937   -2.095  1.00 0.00 ? 28  ILE A HB   3  
ATOM   9282   H  HG12 . ILE A 1 28  ? 11.756  8.416   -0.417  1.00 0.00 ? 28  ILE A HG12 3  
ATOM   9283   H  HG13 . ILE A 1 28  ? 11.866  9.848   -1.440  1.00 0.00 ? 28  ILE A HG13 3  
ATOM   9284   H  HG21 . ILE A 1 28  ? 14.016  7.582   0.588   1.00 0.00 ? 28  ILE A HG21 3  
ATOM   9285   H  HG22 . ILE A 1 28  ? 15.226  7.361   -0.676  1.00 0.00 ? 28  ILE A HG22 3  
ATOM   9286   H  HG23 . ILE A 1 28  ? 13.600  6.711   -0.888  1.00 0.00 ? 28  ILE A HG23 3  
ATOM   9287   H  HD11 . ILE A 1 28  ? 12.328  8.399   -3.397  1.00 0.00 ? 28  ILE A HD11 3  
ATOM   9288   H  HD12 . ILE A 1 28  ? 10.773  8.015   -2.661  1.00 0.00 ? 28  ILE A HD12 3  
ATOM   9289   H  HD13 . ILE A 1 28  ? 12.168  6.976   -2.368  1.00 0.00 ? 28  ILE A HD13 3  
ATOM   9290   N  N    . HIS A 1 29  ? 16.239  9.989   0.997   1.00 0.00 ? 29  HIS A N    3  
ATOM   9291   C  CA   . HIS A 1 29  ? 17.723  10.033  1.128   1.00 0.00 ? 29  HIS A CA   3  
ATOM   9292   C  C    . HIS A 1 29  ? 18.209  8.698   1.708   1.00 0.00 ? 29  HIS A C    3  
ATOM   9293   O  O    . HIS A 1 29  ? 17.512  8.066   2.476   1.00 0.00 ? 29  HIS A O    3  
ATOM   9294   C  CB   . HIS A 1 29  ? 18.117  11.166  2.082   1.00 0.00 ? 29  HIS A CB   3  
ATOM   9295   C  CG   . HIS A 1 29  ? 17.242  12.366  1.840   1.00 0.00 ? 29  HIS A CG   3  
ATOM   9296   N  ND1  . HIS A 1 29  ? 17.764  13.606  1.507   1.00 0.00 ? 29  HIS A ND1  3  
ATOM   9297   C  CD2  . HIS A 1 29  ? 15.881  12.534  1.890   1.00 0.00 ? 29  HIS A CD2  3  
ATOM   9298   C  CE1  . HIS A 1 29  ? 16.732  14.458  1.372   1.00 0.00 ? 29  HIS A CE1  3  
ATOM   9299   N  NE2  . HIS A 1 29  ? 15.561  13.855  1.594   1.00 0.00 ? 29  HIS A NE2  3  
ATOM   9300   H  H    . HIS A 1 29  ? 15.681  9.890   1.797   1.00 0.00 ? 29  HIS A H    3  
ATOM   9301   H  HA   . HIS A 1 29  ? 18.167  10.200  0.158   1.00 0.00 ? 29  HIS A HA   3  
ATOM   9302   H  HB2  . HIS A 1 29  ? 17.993  10.834  3.103   1.00 0.00 ? 29  HIS A HB2  3  
ATOM   9303   H  HB3  . HIS A 1 29  ? 19.148  11.436  1.916   1.00 0.00 ? 29  HIS A HB3  3  
ATOM   9304   H  HD1  . HIS A 1 29  ? 18.713  13.823  1.391   1.00 0.00 ? 29  HIS A HD1  3  
ATOM   9305   H  HD2  . HIS A 1 29  ? 15.167  11.758  2.126   1.00 0.00 ? 29  HIS A HD2  3  
ATOM   9306   H  HE1  . HIS A 1 29  ? 16.838  15.502  1.118   1.00 0.00 ? 29  HIS A HE1  3  
ATOM   9307   N  N    . PRO A 1 30  ? 19.398  8.271   1.357   1.00 0.00 ? 30  PRO A N    3  
ATOM   9308   C  CA   . PRO A 1 30  ? 19.968  6.993   1.874   1.00 0.00 ? 30  PRO A CA   3  
ATOM   9309   C  C    . PRO A 1 30  ? 20.110  7.023   3.400   1.00 0.00 ? 30  PRO A C    3  
ATOM   9310   O  O    . PRO A 1 30  ? 20.081  8.075   4.007   1.00 0.00 ? 30  PRO A O    3  
ATOM   9311   C  CB   . PRO A 1 30  ? 21.347  6.890   1.211   1.00 0.00 ? 30  PRO A CB   3  
ATOM   9312   C  CG   . PRO A 1 30  ? 21.659  8.256   0.692   1.00 0.00 ? 30  PRO A CG   3  
ATOM   9313   C  CD   . PRO A 1 30  ? 20.323  8.949   0.440   1.00 0.00 ? 30  PRO A CD   3  
ATOM   9314   H  HA   . PRO A 1 30  ? 19.356  6.158   1.568   1.00 0.00 ? 30  PRO A HA   3  
ATOM   9315   H  HB2  . PRO A 1 30  ? 22.088  6.589   1.941   1.00 0.00 ? 30  PRO A HB2  3  
ATOM   9316   H  HB3  . PRO A 1 30  ? 21.319  6.184   0.396   1.00 0.00 ? 30  PRO A HB3  3  
ATOM   9317   H  HG2  . PRO A 1 30  ? 22.235  8.807   1.424   1.00 0.00 ? 30  PRO A HG2  3  
ATOM   9318   H  HG3  . PRO A 1 30  ? 22.210  8.183   -0.234  1.00 0.00 ? 30  PRO A HG3  3  
ATOM   9319   H  HD2  . PRO A 1 30  ? 20.394  10.002  0.673   1.00 0.00 ? 30  PRO A HD2  3  
ATOM   9320   H  HD3  . PRO A 1 30  ? 20.006  8.805   -0.582  1.00 0.00 ? 30  PRO A HD3  3  
ATOM   9321   N  N    . GLU A 1 31  ? 20.257  5.885   4.024   1.00 0.00 ? 31  GLU A N    3  
ATOM   9322   C  CA   . GLU A 1 31  ? 20.395  5.866   5.510   1.00 0.00 ? 31  GLU A CA   3  
ATOM   9323   C  C    . GLU A 1 31  ? 21.547  4.946   5.913   1.00 0.00 ? 31  GLU A C    3  
ATOM   9324   O  O    . GLU A 1 31  ? 22.233  4.389   5.079   1.00 0.00 ? 31  GLU A O    3  
ATOM   9325   C  CB   . GLU A 1 31  ? 19.097  5.358   6.138   1.00 0.00 ? 31  GLU A CB   3  
ATOM   9326   C  CG   . GLU A 1 31  ? 18.141  6.531   6.357   1.00 0.00 ? 31  GLU A CG   3  
ATOM   9327   C  CD   . GLU A 1 31  ? 18.666  7.421   7.486   1.00 0.00 ? 31  GLU A CD   3  
ATOM   9328   O  OE1  . GLU A 1 31  ? 19.440  8.319   7.196   1.00 0.00 ? 31  GLU A OE1  3  
ATOM   9329   O  OE2  . GLU A 1 31  ? 18.283  7.193   8.621   1.00 0.00 ? 31  GLU A OE2  3  
ATOM   9330   H  H    . GLU A 1 31  ? 20.274  5.046   3.518   1.00 0.00 ? 31  GLU A H    3  
ATOM   9331   H  HA   . GLU A 1 31  ? 20.598  6.864   5.865   1.00 0.00 ? 31  GLU A HA   3  
ATOM   9332   H  HB2  . GLU A 1 31  ? 18.636  4.639   5.478   1.00 0.00 ? 31  GLU A HB2  3  
ATOM   9333   H  HB3  . GLU A 1 31  ? 19.313  4.891   7.086   1.00 0.00 ? 31  GLU A HB3  3  
ATOM   9334   H  HG2  . GLU A 1 31  ? 18.066  7.109   5.447   1.00 0.00 ? 31  GLU A HG2  3  
ATOM   9335   H  HG3  . GLU A 1 31  ? 17.165  6.155   6.624   1.00 0.00 ? 31  GLU A HG3  3  
ATOM   9336   N  N    . LYS A 1 32  ? 21.765  4.782   7.190   1.00 0.00 ? 32  LYS A N    3  
ATOM   9337   C  CA   . LYS A 1 32  ? 22.873  3.901   7.649   1.00 0.00 ? 32  LYS A CA   3  
ATOM   9338   C  C    . LYS A 1 32  ? 22.409  2.444   7.632   1.00 0.00 ? 32  LYS A C    3  
ATOM   9339   O  O    . LYS A 1 32  ? 21.245  2.145   7.814   1.00 0.00 ? 32  LYS A O    3  
ATOM   9340   C  CB   . LYS A 1 32  ? 23.285  4.291   9.070   1.00 0.00 ? 32  LYS A CB   3  
ATOM   9341   C  CG   . LYS A 1 32  ? 24.777  4.013   9.262   1.00 0.00 ? 32  LYS A CG   3  
ATOM   9342   C  CD   . LYS A 1 32  ? 25.137  4.144   10.744  1.00 0.00 ? 32  LYS A CD   3  
ATOM   9343   C  CE   . LYS A 1 32  ? 26.354  5.060   10.898  1.00 0.00 ? 32  LYS A CE   3  
ATOM   9344   N  NZ   . LYS A 1 32  ? 27.392  4.679   9.900   1.00 0.00 ? 32  LYS A NZ   3  
ATOM   9345   H  H    . LYS A 1 32  ? 21.199  5.242   7.846   1.00 0.00 ? 32  LYS A H    3  
ATOM   9346   H  HA   . LYS A 1 32  ? 23.718  4.015   6.986   1.00 0.00 ? 32  LYS A HA   3  
ATOM   9347   H  HB2  . LYS A 1 32  ? 23.090  5.342   9.225   1.00 0.00 ? 32  LYS A HB2  3  
ATOM   9348   H  HB3  . LYS A 1 32  ? 22.717  3.711   9.782   1.00 0.00 ? 32  LYS A HB3  3  
ATOM   9349   H  HG2  . LYS A 1 32  ? 25.003  3.012   8.923   1.00 0.00 ? 32  LYS A HG2  3  
ATOM   9350   H  HG3  . LYS A 1 32  ? 25.353  4.725   8.689   1.00 0.00 ? 32  LYS A HG3  3  
ATOM   9351   H  HD2  . LYS A 1 32  ? 24.300  4.565   11.281  1.00 0.00 ? 32  LYS A HD2  3  
ATOM   9352   H  HD3  . LYS A 1 32  ? 25.369  3.169   11.145  1.00 0.00 ? 32  LYS A HD3  3  
ATOM   9353   H  HE2  . LYS A 1 32  ? 26.057  6.085   10.736  1.00 0.00 ? 32  LYS A HE2  3  
ATOM   9354   H  HE3  . LYS A 1 32  ? 26.758  4.955   11.895  1.00 0.00 ? 32  LYS A HE3  3  
ATOM   9355   H  HZ1  . LYS A 1 32  ? 28.290  5.147   10.137  1.00 0.00 ? 32  LYS A HZ1  3  
ATOM   9356   H  HZ2  . LYS A 1 32  ? 27.085  4.978   8.951   1.00 0.00 ? 32  LYS A HZ2  3  
ATOM   9357   H  HZ3  . LYS A 1 32  ? 27.526  3.649   9.913   1.00 0.00 ? 32  LYS A HZ3  3  
ATOM   9358   N  N    . GLU A 1 33  ? 23.315  1.538   7.405   1.00 0.00 ? 33  GLU A N    3  
ATOM   9359   C  CA   . GLU A 1 33  ? 22.946  0.095   7.362   1.00 0.00 ? 33  GLU A CA   3  
ATOM   9360   C  C    . GLU A 1 33  ? 22.092  -0.274  8.579   1.00 0.00 ? 33  GLU A C    3  
ATOM   9361   O  O    . GLU A 1 33  ? 22.263  0.256   9.660   1.00 0.00 ? 33  GLU A O    3  
ATOM   9362   C  CB   . GLU A 1 33  ? 24.223  -0.747  7.368   1.00 0.00 ? 33  GLU A CB   3  
ATOM   9363   C  CG   . GLU A 1 33  ? 24.954  -0.573  6.039   1.00 0.00 ? 33  GLU A CG   3  
ATOM   9364   C  CD   . GLU A 1 33  ? 25.468  0.863   5.922   1.00 0.00 ? 33  GLU A CD   3  
ATOM   9365   O  OE1  . GLU A 1 33  ? 26.209  1.278   6.797   1.00 0.00 ? 33  GLU A OE1  3  
ATOM   9366   O  OE2  . GLU A 1 33  ? 25.109  1.524   4.961   1.00 0.00 ? 33  GLU A OE2  3  
ATOM   9367   H  H    . GLU A 1 33  ? 24.245  1.807   7.253   1.00 0.00 ? 33  GLU A H    3  
ATOM   9368   H  HA   . GLU A 1 33  ? 22.390  -0.107  6.459   1.00 0.00 ? 33  GLU A HA   3  
ATOM   9369   H  HB2  . GLU A 1 33  ? 24.863  -0.424  8.177   1.00 0.00 ? 33  GLU A HB2  3  
ATOM   9370   H  HB3  . GLU A 1 33  ? 23.968  -1.785  7.503   1.00 0.00 ? 33  GLU A HB3  3  
ATOM   9371   H  HG2  . GLU A 1 33  ? 25.787  -1.262  5.992   1.00 0.00 ? 33  GLU A HG2  3  
ATOM   9372   H  HG3  . GLU A 1 33  ? 24.273  -0.777  5.228   1.00 0.00 ? 33  GLU A HG3  3  
ATOM   9373   N  N    . GLY A 1 34  ? 21.184  -1.198  8.409   1.00 0.00 ? 34  GLY A N    3  
ATOM   9374   C  CA   . GLY A 1 34  ? 20.321  -1.637  9.543   1.00 0.00 ? 34  GLY A CA   3  
ATOM   9375   C  C    . GLY A 1 34  ? 19.499  -0.468  10.095  1.00 0.00 ? 34  GLY A C    3  
ATOM   9376   O  O    . GLY A 1 34  ? 19.084  -0.484  11.236  1.00 0.00 ? 34  GLY A O    3  
ATOM   9377   H  H    . GLY A 1 34  ? 21.079  -1.617  7.529   1.00 0.00 ? 34  GLY A H    3  
ATOM   9378   H  HA2  . GLY A 1 34  ? 19.651  -2.412  9.200   1.00 0.00 ? 34  GLY A HA2  3  
ATOM   9379   H  HA3  . GLY A 1 34  ? 20.944  -2.033  10.331  1.00 0.00 ? 34  GLY A HA3  3  
ATOM   9380   N  N    . THR A 1 35  ? 19.242  0.539   9.306   1.00 0.00 ? 35  THR A N    3  
ATOM   9381   C  CA   . THR A 1 35  ? 18.432  1.682   9.816   1.00 0.00 ? 35  THR A CA   3  
ATOM   9382   C  C    . THR A 1 35  ? 16.944  1.324   9.746   1.00 0.00 ? 35  THR A C    3  
ATOM   9383   O  O    . THR A 1 35  ? 16.201  1.530   10.686  1.00 0.00 ? 35  THR A O    3  
ATOM   9384   C  CB   . THR A 1 35  ? 18.701  2.925   8.966   1.00 0.00 ? 35  THR A CB   3  
ATOM   9385   O  OG1  . THR A 1 35  ? 19.995  3.429   9.265   1.00 0.00 ? 35  THR A OG1  3  
ATOM   9386   C  CG2  . THR A 1 35  ? 17.652  3.992   9.276   1.00 0.00 ? 35  THR A CG2  3  
ATOM   9387   H  H    . THR A 1 35  ? 19.567  0.545   8.381   1.00 0.00 ? 35  THR A H    3  
ATOM   9388   H  HA   . THR A 1 35  ? 18.704  1.883   10.843  1.00 0.00 ? 35  THR A HA   3  
ATOM   9389   H  HB   . THR A 1 35  ? 18.647  2.665   7.922   1.00 0.00 ? 35  THR A HB   3  
ATOM   9390   H  HG1  . THR A 1 35  ? 20.174  4.157   8.667   1.00 0.00 ? 35  THR A HG1  3  
ATOM   9391   H  HG21 . THR A 1 35  ? 17.312  3.877   10.294  1.00 0.00 ? 35  THR A HG21 3  
ATOM   9392   H  HG22 . THR A 1 35  ? 16.815  3.880   8.603   1.00 0.00 ? 35  THR A HG22 3  
ATOM   9393   H  HG23 . THR A 1 35  ? 18.087  4.971   9.151   1.00 0.00 ? 35  THR A HG23 3  
ATOM   9394   N  N    . GLY A 1 36  ? 16.503  0.785   8.639   1.00 0.00 ? 36  GLY A N    3  
ATOM   9395   C  CA   . GLY A 1 36  ? 15.063  0.412   8.507   1.00 0.00 ? 36  GLY A CA   3  
ATOM   9396   C  C    . GLY A 1 36  ? 14.333  1.457   7.660   1.00 0.00 ? 36  GLY A C    3  
ATOM   9397   O  O    . GLY A 1 36  ? 14.946  2.290   7.018   1.00 0.00 ? 36  GLY A O    3  
ATOM   9398   H  H    . GLY A 1 36  ? 17.120  0.626   7.894   1.00 0.00 ? 36  GLY A H    3  
ATOM   9399   H  HA2  . GLY A 1 36  ? 14.986  -0.557  8.033   1.00 0.00 ? 36  GLY A HA2  3  
ATOM   9400   H  HA3  . GLY A 1 36  ? 14.611  0.369   9.487   1.00 0.00 ? 36  GLY A HA3  3  
ATOM   9401   N  N    . ILE A 1 37  ? 13.026  1.427   7.655   1.00 0.00 ? 37  ILE A N    3  
ATOM   9402   C  CA   . ILE A 1 37  ? 12.261  2.423   6.858   1.00 0.00 ? 37  ILE A CA   3  
ATOM   9403   C  C    . ILE A 1 37  ? 11.764  3.503   7.812   1.00 0.00 ? 37  ILE A C    3  
ATOM   9404   O  O    . ILE A 1 37  ? 11.100  3.210   8.787   1.00 0.00 ? 37  ILE A O    3  
ATOM   9405   C  CB   . ILE A 1 37  ? 11.056  1.745   6.192   1.00 0.00 ? 37  ILE A CB   3  
ATOM   9406   C  CG1  . ILE A 1 37  ? 11.500  0.473   5.458   1.00 0.00 ? 37  ILE A CG1  3  
ATOM   9407   C  CG2  . ILE A 1 37  ? 10.418  2.711   5.191   1.00 0.00 ? 37  ILE A CG2  3  
ATOM   9408   C  CD1  . ILE A 1 37  ? 11.987  0.832   4.054   1.00 0.00 ? 37  ILE A CD1  3  
ATOM   9409   H  H    . ILE A 1 37  ? 12.540  0.756   8.180   1.00 0.00 ? 37  ILE A H    3  
ATOM   9410   H  HA   . ILE A 1 37  ? 12.901  2.862   6.106   1.00 0.00 ? 37  ILE A HA   3  
ATOM   9411   H  HB   . ILE A 1 37  ? 10.330  1.488   6.950   1.00 0.00 ? 37  ILE A HB   3  
ATOM   9412   H  HG12 . ILE A 1 37  ? 12.299  -0.005  6.005   1.00 0.00 ? 37  ILE A HG12 3  
ATOM   9413   H  HG13 . ILE A 1 37  ? 10.664  -0.206  5.381   1.00 0.00 ? 37  ILE A HG13 3  
ATOM   9414   H  HG21 . ILE A 1 37  ? 9.786   2.159   4.511   1.00 0.00 ? 37  ILE A HG21 3  
ATOM   9415   H  HG22 . ILE A 1 37  ? 11.192  3.218   4.634   1.00 0.00 ? 37  ILE A HG22 3  
ATOM   9416   H  HG23 . ILE A 1 37  ? 9.823   3.439   5.723   1.00 0.00 ? 37  ILE A HG23 3  
ATOM   9417   H  HD11 . ILE A 1 37  ? 12.514  1.771   4.089   1.00 0.00 ? 37  ILE A HD11 3  
ATOM   9418   H  HD12 . ILE A 1 37  ? 11.140  0.918   3.391   1.00 0.00 ? 37  ILE A HD12 3  
ATOM   9419   H  HD13 . ILE A 1 37  ? 12.650  0.059   3.694   1.00 0.00 ? 37  ILE A HD13 3  
ATOM   9420   N  N    . ARG A 1 38  ? 12.079  4.744   7.563   1.00 0.00 ? 38  ARG A N    3  
ATOM   9421   C  CA   . ARG A 1 38  ? 11.613  5.807   8.495   1.00 0.00 ? 38  ARG A CA   3  
ATOM   9422   C  C    . ARG A 1 38  ? 11.181  7.048   7.722   1.00 0.00 ? 38  ARG A C    3  
ATOM   9423   O  O    . ARG A 1 38  ? 11.790  7.436   6.743   1.00 0.00 ? 38  ARG A O    3  
ATOM   9424   C  CB   . ARG A 1 38  ? 12.745  6.172   9.457   1.00 0.00 ? 38  ARG A CB   3  
ATOM   9425   C  CG   . ARG A 1 38  ? 14.089  6.034   8.740   1.00 0.00 ? 38  ARG A CG   3  
ATOM   9426   C  CD   . ARG A 1 38  ? 15.210  6.507   9.666   1.00 0.00 ? 38  ARG A CD   3  
ATOM   9427   N  NE   . ARG A 1 38  ? 15.046  5.877   11.007  1.00 0.00 ? 38  ARG A NE   3  
ATOM   9428   C  CZ   . ARG A 1 38  ? 15.988  5.994   11.903  1.00 0.00 ? 38  ARG A CZ   3  
ATOM   9429   N  NH1  . ARG A 1 38  ? 17.072  6.664   11.624  1.00 0.00 ? 38  ARG A NH1  3  
ATOM   9430   N  NH2  . ARG A 1 38  ? 15.845  5.442   13.077  1.00 0.00 ? 38  ARG A NH2  3  
ATOM   9431   H  H    . ARG A 1 38  ? 12.626  4.973   6.777   1.00 0.00 ? 38  ARG A H    3  
ATOM   9432   H  HA   . ARG A 1 38  ? 10.774  5.440   9.063   1.00 0.00 ? 38  ARG A HA   3  
ATOM   9433   H  HB2  . ARG A 1 38  ? 12.617  7.191   9.792   1.00 0.00 ? 38  ARG A HB2  3  
ATOM   9434   H  HB3  . ARG A 1 38  ? 12.723  5.508   10.307  1.00 0.00 ? 38  ARG A HB3  3  
ATOM   9435   H  HG2  . ARG A 1 38  ? 14.252  4.999   8.476   1.00 0.00 ? 38  ARG A HG2  3  
ATOM   9436   H  HG3  . ARG A 1 38  ? 14.086  6.638   7.845   1.00 0.00 ? 38  ARG A HG3  3  
ATOM   9437   H  HD2  . ARG A 1 38  ? 16.165  6.224   9.251   1.00 0.00 ? 38  ARG A HD2  3  
ATOM   9438   H  HD3  . ARG A 1 38  ? 15.165  7.581   9.766   1.00 0.00 ? 38  ARG A HD3  3  
ATOM   9439   H  HE   . ARG A 1 38  ? 14.231  5.375   11.218  1.00 0.00 ? 38  ARG A HE   3  
ATOM   9440   H  HH11 . ARG A 1 38  ? 17.180  7.089   10.725  1.00 0.00 ? 38  ARG A HH11 3  
ATOM   9441   H  HH12 . ARG A 1 38  ? 17.795  6.752   12.309  1.00 0.00 ? 38  ARG A HH12 3  
ATOM   9442   H  HH21 . ARG A 1 38  ? 15.014  4.929   13.292  1.00 0.00 ? 38  ARG A HH21 3  
ATOM   9443   H  HH22 . ARG A 1 38  ? 16.567  5.534   13.763  1.00 0.00 ? 38  ARG A HH22 3  
ATOM   9444   N  N    . PHE A 1 39  ? 10.131  7.680   8.170   1.00 0.00 ? 39  PHE A N    3  
ATOM   9445   C  CA   . PHE A 1 39  ? 9.644   8.906   7.489   1.00 0.00 ? 39  PHE A CA   3  
ATOM   9446   C  C    . PHE A 1 39  ? 10.109  10.126  8.283   1.00 0.00 ? 39  PHE A C    3  
ATOM   9447   O  O    . PHE A 1 39  ? 10.314  10.057  9.477   1.00 0.00 ? 39  PHE A O    3  
ATOM   9448   C  CB   . PHE A 1 39  ? 8.114   8.894   7.439   1.00 0.00 ? 39  PHE A CB   3  
ATOM   9449   C  CG   . PHE A 1 39  ? 7.642   7.952   6.355   1.00 0.00 ? 39  PHE A CG   3  
ATOM   9450   C  CD1  . PHE A 1 39  ? 7.572   8.395   5.030   1.00 0.00 ? 39  PHE A CD1  3  
ATOM   9451   C  CD2  . PHE A 1 39  ? 7.274   6.638   6.674   1.00 0.00 ? 39  PHE A CD2  3  
ATOM   9452   C  CE1  . PHE A 1 39  ? 7.134   7.527   4.022   1.00 0.00 ? 39  PHE A CE1  3  
ATOM   9453   C  CE2  . PHE A 1 39  ? 6.836   5.770   5.666   1.00 0.00 ? 39  PHE A CE2  3  
ATOM   9454   C  CZ   . PHE A 1 39  ? 6.767   6.214   4.341   1.00 0.00 ? 39  PHE A CZ   3  
ATOM   9455   H  H    . PHE A 1 39  ? 9.667   7.347   8.966   1.00 0.00 ? 39  PHE A H    3  
ATOM   9456   H  HA   . PHE A 1 39  ? 10.042  8.952   6.487   1.00 0.00 ? 39  PHE A HA   3  
ATOM   9457   H  HB2  . PHE A 1 39  ? 7.727   8.570   8.392   1.00 0.00 ? 39  PHE A HB2  3  
ATOM   9458   H  HB3  . PHE A 1 39  ? 7.755   9.891   7.227   1.00 0.00 ? 39  PHE A HB3  3  
ATOM   9459   H  HD1  . PHE A 1 39  ? 7.857   9.408   4.784   1.00 0.00 ? 39  PHE A HD1  3  
ATOM   9460   H  HD2  . PHE A 1 39  ? 7.324   6.295   7.697   1.00 0.00 ? 39  PHE A HD2  3  
ATOM   9461   H  HE1  . PHE A 1 39  ? 7.081   7.870   3.000   1.00 0.00 ? 39  PHE A HE1  3  
ATOM   9462   H  HE2  . PHE A 1 39  ? 6.552   4.757   5.911   1.00 0.00 ? 39  PHE A HE2  3  
ATOM   9463   H  HZ   . PHE A 1 39  ? 6.430   5.544   3.563   1.00 0.00 ? 39  PHE A HZ   3  
ATOM   9464   N  N    . PHE A 1 40  ? 10.266  11.240  7.631   1.00 0.00 ? 40  PHE A N    3  
ATOM   9465   C  CA   . PHE A 1 40  ? 10.706  12.474  8.342   1.00 0.00 ? 40  PHE A CA   3  
ATOM   9466   C  C    . PHE A 1 40  ? 9.619   13.534  8.155   1.00 0.00 ? 40  PHE A C    3  
ATOM   9467   O  O    . PHE A 1 40  ? 8.862   13.482  7.205   1.00 0.00 ? 40  PHE A O    3  
ATOM   9468   C  CB   . PHE A 1 40  ? 12.034  12.952  7.742   1.00 0.00 ? 40  PHE A CB   3  
ATOM   9469   C  CG   . PHE A 1 40  ? 12.330  14.371  8.166   1.00 0.00 ? 40  PHE A CG   3  
ATOM   9470   C  CD1  . PHE A 1 40  ? 11.649  15.442  7.572   1.00 0.00 ? 40  PHE A CD1  3  
ATOM   9471   C  CD2  . PHE A 1 40  ? 13.300  14.617  9.144   1.00 0.00 ? 40  PHE A CD2  3  
ATOM   9472   C  CE1  . PHE A 1 40  ? 11.938  16.756  7.958   1.00 0.00 ? 40  PHE A CE1  3  
ATOM   9473   C  CE2  . PHE A 1 40  ? 13.591  15.929  9.529   1.00 0.00 ? 40  PHE A CE2  3  
ATOM   9474   C  CZ   . PHE A 1 40  ? 12.909  17.000  8.936   1.00 0.00 ? 40  PHE A CZ   3  
ATOM   9475   H  H    . PHE A 1 40  ? 10.086  11.270  6.669   1.00 0.00 ? 40  PHE A H    3  
ATOM   9476   H  HA   . PHE A 1 40  ? 10.831  12.262  9.396   1.00 0.00 ? 40  PHE A HA   3  
ATOM   9477   H  HB2  . PHE A 1 40  ? 12.829  12.308  8.086   1.00 0.00 ? 40  PHE A HB2  3  
ATOM   9478   H  HB3  . PHE A 1 40  ? 11.980  12.905  6.667   1.00 0.00 ? 40  PHE A HB3  3  
ATOM   9479   H  HD1  . PHE A 1 40  ? 10.900  15.255  6.817   1.00 0.00 ? 40  PHE A HD1  3  
ATOM   9480   H  HD2  . PHE A 1 40  ? 13.824  13.791  9.603   1.00 0.00 ? 40  PHE A HD2  3  
ATOM   9481   H  HE1  . PHE A 1 40  ? 11.413  17.582  7.500   1.00 0.00 ? 40  PHE A HE1  3  
ATOM   9482   H  HE2  . PHE A 1 40  ? 14.342  16.116  10.281  1.00 0.00 ? 40  PHE A HE2  3  
ATOM   9483   H  HZ   . PHE A 1 40  ? 13.135  18.014  9.231   1.00 0.00 ? 40  PHE A HZ   3  
ATOM   9484   N  N    . LYS A 1 41  ? 9.510   14.487  9.043   1.00 0.00 ? 41  LYS A N    3  
ATOM   9485   C  CA   . LYS A 1 41  ? 8.446   15.514  8.877   1.00 0.00 ? 41  LYS A CA   3  
ATOM   9486   C  C    . LYS A 1 41  ? 8.565   16.579  9.969   1.00 0.00 ? 41  LYS A C    3  
ATOM   9487   O  O    . LYS A 1 41  ? 8.587   16.277  11.147  1.00 0.00 ? 41  LYS A O    3  
ATOM   9488   C  CB   . LYS A 1 41  ? 7.076   14.839  8.988   1.00 0.00 ? 41  LYS A CB   3  
ATOM   9489   C  CG   . LYS A 1 41  ? 6.208   15.244  7.798   1.00 0.00 ? 41  LYS A CG   3  
ATOM   9490   C  CD   . LYS A 1 41  ? 5.980   16.758  7.820   1.00 0.00 ? 41  LYS A CD   3  
ATOM   9491   C  CE   . LYS A 1 41  ? 4.610   17.079  7.215   1.00 0.00 ? 41  LYS A CE   3  
ATOM   9492   N  NZ   . LYS A 1 41  ? 4.482   18.552  7.029   1.00 0.00 ? 41  LYS A NZ   3  
ATOM   9493   H  H    . LYS A 1 41  ? 10.114  14.534  9.814   1.00 0.00 ? 41  LYS A H    3  
ATOM   9494   H  HA   . LYS A 1 41  ? 8.538   15.979  7.908   1.00 0.00 ? 41  LYS A HA   3  
ATOM   9495   H  HB2  . LYS A 1 41  ? 7.204   13.766  8.992   1.00 0.00 ? 41  LYS A HB2  3  
ATOM   9496   H  HB3  . LYS A 1 41  ? 6.595   15.148  9.904   1.00 0.00 ? 41  LYS A HB3  3  
ATOM   9497   H  HG2  . LYS A 1 41  ? 6.709   14.967  6.883   1.00 0.00 ? 41  LYS A HG2  3  
ATOM   9498   H  HG3  . LYS A 1 41  ? 5.257   14.737  7.855   1.00 0.00 ? 41  LYS A HG3  3  
ATOM   9499   H  HD2  . LYS A 1 41  ? 6.015   17.112  8.842   1.00 0.00 ? 41  LYS A HD2  3  
ATOM   9500   H  HD3  . LYS A 1 41  ? 6.749   17.248  7.243   1.00 0.00 ? 41  LYS A HD3  3  
ATOM   9501   H  HE2  . LYS A 1 41  ? 4.515   16.584  6.260   1.00 0.00 ? 41  LYS A HE2  3  
ATOM   9502   H  HE3  . LYS A 1 41  ? 3.834   16.731  7.881   1.00 0.00 ? 41  LYS A HE3  3  
ATOM   9503   H  HZ1  . LYS A 1 41  ? 5.426   18.985  7.017   1.00 0.00 ? 41  LYS A HZ1  3  
ATOM   9504   H  HZ2  . LYS A 1 41  ? 3.925   18.953  7.811   1.00 0.00 ? 41  LYS A HZ2  3  
ATOM   9505   H  HZ3  . LYS A 1 41  ? 4.003   18.747  6.127   1.00 0.00 ? 41  LYS A HZ3  3  
ATOM   9506   N  N    . ASN A 1 42  ? 8.629   17.825  9.587   1.00 0.00 ? 42  ASN A N    3  
ATOM   9507   C  CA   . ASN A 1 42  ? 8.731   18.913  10.602  1.00 0.00 ? 42  ASN A CA   3  
ATOM   9508   C  C    . ASN A 1 42  ? 9.867   18.608  11.589  1.00 0.00 ? 42  ASN A C    3  
ATOM   9509   O  O    . ASN A 1 42  ? 9.775   18.891  12.768  1.00 0.00 ? 42  ASN A O    3  
ATOM   9510   C  CB   . ASN A 1 42  ? 7.397   19.021  11.350  1.00 0.00 ? 42  ASN A CB   3  
ATOM   9511   C  CG   . ASN A 1 42  ? 6.603   20.210  10.807  1.00 0.00 ? 42  ASN A CG   3  
ATOM   9512   O  OD1  . ASN A 1 42  ? 6.010   20.956  11.562  1.00 0.00 ? 42  ASN A OD1  3  
ATOM   9513   N  ND2  . ASN A 1 42  ? 6.566   20.422  9.519   1.00 0.00 ? 42  ASN A ND2  3  
ATOM   9514   H  H    . ASN A 1 42  ? 8.602   18.044  8.631   1.00 0.00 ? 42  ASN A H    3  
ATOM   9515   H  HA   . ASN A 1 42  ? 8.934   19.847  10.101  1.00 0.00 ? 42  ASN A HA   3  
ATOM   9516   H  HB2  . ASN A 1 42  ? 6.829   18.113  11.202  1.00 0.00 ? 42  ASN A HB2  3  
ATOM   9517   H  HB3  . ASN A 1 42  ? 7.577   19.163  12.404  1.00 0.00 ? 42  ASN A HB3  3  
ATOM   9518   H  HD21 . ASN A 1 42  ? 7.043   19.822  8.910   1.00 0.00 ? 42  ASN A HD21 3  
ATOM   9519   H  HD22 . ASN A 1 42  ? 6.058   21.182  9.162   1.00 0.00 ? 42  ASN A HD22 3  
ATOM   9520   N  N    . GLY A 1 43  ? 10.945  18.049  11.117  1.00 0.00 ? 43  GLY A N    3  
ATOM   9521   C  CA   . GLY A 1 43  ? 12.086  17.746  12.028  1.00 0.00 ? 43  GLY A CA   3  
ATOM   9522   C  C    . GLY A 1 43  ? 11.720  16.593  12.964  1.00 0.00 ? 43  GLY A C    3  
ATOM   9523   O  O    . GLY A 1 43  ? 12.287  16.448  14.029  1.00 0.00 ? 43  GLY A O    3  
ATOM   9524   H  H    . GLY A 1 43  ? 11.010  17.840  10.162  1.00 0.00 ? 43  GLY A H    3  
ATOM   9525   H  HA2  . GLY A 1 43  ? 12.950  17.474  11.442  1.00 0.00 ? 43  GLY A HA2  3  
ATOM   9526   H  HA3  . GLY A 1 43  ? 12.314  18.623  12.616  1.00 0.00 ? 43  GLY A HA3  3  
ATOM   9527   N  N    . VAL A 1 44  ? 10.779  15.772  12.577  1.00 0.00 ? 44  VAL A N    3  
ATOM   9528   C  CA   . VAL A 1 44  ? 10.379  14.628  13.448  1.00 0.00 ? 44  VAL A CA   3  
ATOM   9529   C  C    . VAL A 1 44  ? 10.462  13.323  12.654  1.00 0.00 ? 44  VAL A C    3  
ATOM   9530   O  O    . VAL A 1 44  ? 9.920   13.205  11.573  1.00 0.00 ? 44  VAL A O    3  
ATOM   9531   C  CB   . VAL A 1 44  ? 8.943   14.837  13.933  1.00 0.00 ? 44  VAL A CB   3  
ATOM   9532   C  CG1  . VAL A 1 44  ? 8.507   13.636  14.775  1.00 0.00 ? 44  VAL A CG1  3  
ATOM   9533   C  CG2  . VAL A 1 44  ? 8.871   16.108  14.783  1.00 0.00 ? 44  VAL A CG2  3  
ATOM   9534   H  H    . VAL A 1 44  ? 10.335  15.909  11.714  1.00 0.00 ? 44  VAL A H    3  
ATOM   9535   H  HA   . VAL A 1 44  ? 11.041  14.572  14.300  1.00 0.00 ? 44  VAL A HA   3  
ATOM   9536   H  HB   . VAL A 1 44  ? 8.289   14.934  13.080  1.00 0.00 ? 44  VAL A HB   3  
ATOM   9537   H  HG11 . VAL A 1 44  ? 8.431   12.761  14.145  1.00 0.00 ? 44  VAL A HG11 3  
ATOM   9538   H  HG12 . VAL A 1 44  ? 7.546   13.841  15.223  1.00 0.00 ? 44  VAL A HG12 3  
ATOM   9539   H  HG13 . VAL A 1 44  ? 9.235   13.457  15.552  1.00 0.00 ? 44  VAL A HG13 3  
ATOM   9540   H  HG21 . VAL A 1 44  ? 8.884   16.974  14.137  1.00 0.00 ? 44  VAL A HG21 3  
ATOM   9541   H  HG22 . VAL A 1 44  ? 9.719   16.144  15.450  1.00 0.00 ? 44  VAL A HG22 3  
ATOM   9542   H  HG23 . VAL A 1 44  ? 7.958   16.103  15.360  1.00 0.00 ? 44  VAL A HG23 3  
ATOM   9543   N  N    . TYR A 1 45  ? 11.134  12.338  13.187  1.00 0.00 ? 45  TYR A N    3  
ATOM   9544   C  CA   . TYR A 1 45  ? 11.250  11.036  12.470  1.00 0.00 ? 45  TYR A CA   3  
ATOM   9545   C  C    . TYR A 1 45  ? 10.080  10.134  12.872  1.00 0.00 ? 45  TYR A C    3  
ATOM   9546   O  O    . TYR A 1 45  ? 9.655   10.124  14.010  1.00 0.00 ? 45  TYR A O    3  
ATOM   9547   C  CB   . TYR A 1 45  ? 12.572  10.358  12.839  1.00 0.00 ? 45  TYR A CB   3  
ATOM   9548   C  CG   . TYR A 1 45  ? 13.708  11.334  12.648  1.00 0.00 ? 45  TYR A CG   3  
ATOM   9549   C  CD1  . TYR A 1 45  ? 14.098  12.166  13.703  1.00 0.00 ? 45  TYR A CD1  3  
ATOM   9550   C  CD2  . TYR A 1 45  ? 14.372  11.408  11.415  1.00 0.00 ? 45  TYR A CD2  3  
ATOM   9551   C  CE1  . TYR A 1 45  ? 15.151  13.072  13.529  1.00 0.00 ? 45  TYR A CE1  3  
ATOM   9552   C  CE2  . TYR A 1 45  ? 15.425  12.314  11.241  1.00 0.00 ? 45  TYR A CE2  3  
ATOM   9553   C  CZ   . TYR A 1 45  ? 15.813  13.146  12.298  1.00 0.00 ? 45  TYR A CZ   3  
ATOM   9554   O  OH   . TYR A 1 45  ? 16.852  14.040  12.127  1.00 0.00 ? 45  TYR A OH   3  
ATOM   9555   H  H    . TYR A 1 45  ? 11.559  12.458  14.063  1.00 0.00 ? 45  TYR A H    3  
ATOM   9556   H  HA   . TYR A 1 45  ? 11.219  11.210  11.404  1.00 0.00 ? 45  TYR A HA   3  
ATOM   9557   H  HB2  . TYR A 1 45  ? 12.538  10.041  13.871  1.00 0.00 ? 45  TYR A HB2  3  
ATOM   9558   H  HB3  . TYR A 1 45  ? 12.725  9.499   12.203  1.00 0.00 ? 45  TYR A HB3  3  
ATOM   9559   H  HD1  . TYR A 1 45  ? 13.588  12.108  14.653  1.00 0.00 ? 45  TYR A HD1  3  
ATOM   9560   H  HD2  . TYR A 1 45  ? 14.071  10.766  10.599  1.00 0.00 ? 45  TYR A HD2  3  
ATOM   9561   H  HE1  . TYR A 1 45  ? 15.452  13.713  14.344  1.00 0.00 ? 45  TYR A HE1  3  
ATOM   9562   H  HE2  . TYR A 1 45  ? 15.937  12.372  10.292  1.00 0.00 ? 45  TYR A HE2  3  
ATOM   9563   H  HH   . TYR A 1 45  ? 17.636  13.666  12.538  1.00 0.00 ? 45  TYR A HH   3  
ATOM   9564   N  N    . ILE A 1 46  ? 9.546   9.387   11.943  1.00 0.00 ? 46  ILE A N    3  
ATOM   9565   C  CA   . ILE A 1 46  ? 8.393   8.498   12.272  1.00 0.00 ? 46  ILE A CA   3  
ATOM   9566   C  C    . ILE A 1 46  ? 8.585   7.116   11.624  1.00 0.00 ? 46  ILE A C    3  
ATOM   9567   O  O    . ILE A 1 46  ? 8.237   6.921   10.477  1.00 0.00 ? 46  ILE A O    3  
ATOM   9568   C  CB   . ILE A 1 46  ? 7.108   9.120   11.721  1.00 0.00 ? 46  ILE A CB   3  
ATOM   9569   C  CG1  . ILE A 1 46  ? 7.027   10.592  12.139  1.00 0.00 ? 46  ILE A CG1  3  
ATOM   9570   C  CG2  . ILE A 1 46  ? 5.899   8.364   12.276  1.00 0.00 ? 46  ILE A CG2  3  
ATOM   9571   C  CD1  . ILE A 1 46  ? 5.858   11.264  11.415  1.00 0.00 ? 46  ILE A CD1  3  
ATOM   9572   H  H    . ILE A 1 46  ? 9.897   9.421   11.028  1.00 0.00 ? 46  ILE A H    3  
ATOM   9573   H  HA   . ILE A 1 46  ? 8.305   8.396   13.342  1.00 0.00 ? 46  ILE A HA   3  
ATOM   9574   H  HB   . ILE A 1 46  ? 7.109   9.050   10.643  1.00 0.00 ? 46  ILE A HB   3  
ATOM   9575   H  HG12 . ILE A 1 46  ? 6.876   10.655  13.206  1.00 0.00 ? 46  ILE A HG12 3  
ATOM   9576   H  HG13 . ILE A 1 46  ? 7.946   11.093  11.873  1.00 0.00 ? 46  ILE A HG13 3  
ATOM   9577   H  HG21 . ILE A 1 46  ? 5.288   8.010   11.458  1.00 0.00 ? 46  ILE A HG21 3  
ATOM   9578   H  HG22 . ILE A 1 46  ? 5.316   9.025   12.900  1.00 0.00 ? 46  ILE A HG22 3  
ATOM   9579   H  HG23 . ILE A 1 46  ? 6.238   7.523   12.862  1.00 0.00 ? 46  ILE A HG23 3  
ATOM   9580   H  HD11 . ILE A 1 46  ? 5.488   12.082  12.015  1.00 0.00 ? 46  ILE A HD11 3  
ATOM   9581   H  HD12 . ILE A 1 46  ? 5.068   10.545  11.260  1.00 0.00 ? 46  ILE A HD12 3  
ATOM   9582   H  HD13 . ILE A 1 46  ? 6.194   11.641  10.461  1.00 0.00 ? 46  ILE A HD13 3  
ATOM   9583   N  N    . PRO A 1 47  ? 9.116   6.156   12.349  1.00 0.00 ? 47  PRO A N    3  
ATOM   9584   C  CA   . PRO A 1 47  ? 9.320   4.779   11.810  1.00 0.00 ? 47  PRO A CA   3  
ATOM   9585   C  C    . PRO A 1 47  ? 8.063   4.262   11.101  1.00 0.00 ? 47  PRO A C    3  
ATOM   9586   O  O    . PRO A 1 47  ? 6.956   4.565   11.497  1.00 0.00 ? 47  PRO A O    3  
ATOM   9587   C  CB   . PRO A 1 47  ? 9.615   3.945   13.056  1.00 0.00 ? 47  PRO A CB   3  
ATOM   9588   C  CG   . PRO A 1 47  ? 10.200  4.903   14.039  1.00 0.00 ? 47  PRO A CG   3  
ATOM   9589   C  CD   . PRO A 1 47  ? 9.580   6.270   13.743  1.00 0.00 ? 47  PRO A CD   3  
ATOM   9590   H  HA   . PRO A 1 47  ? 10.166  4.755   11.146  1.00 0.00 ? 47  PRO A HA   3  
ATOM   9591   H  HB2  . PRO A 1 47  ? 8.702   3.516   13.444  1.00 0.00 ? 47  PRO A HB2  3  
ATOM   9592   H  HB3  . PRO A 1 47  ? 10.329  3.169   12.828  1.00 0.00 ? 47  PRO A HB3  3  
ATOM   9593   H  HG2  . PRO A 1 47  ? 9.958   4.591   15.046  1.00 0.00 ? 47  PRO A HG2  3  
ATOM   9594   H  HG3  . PRO A 1 47  ? 11.270  4.956   13.914  1.00 0.00 ? 47  PRO A HG3  3  
ATOM   9595   H  HD2  . PRO A 1 47  ? 8.750   6.456   14.412  1.00 0.00 ? 47  PRO A HD2  3  
ATOM   9596   H  HD3  . PRO A 1 47  ? 10.321  7.051   13.828  1.00 0.00 ? 47  PRO A HD3  3  
ATOM   9597   N  N    . ALA A 1 48  ? 8.216   3.506   10.045  1.00 0.00 ? 48  ALA A N    3  
ATOM   9598   C  CA   . ALA A 1 48  ? 7.010   3.010   9.318   1.00 0.00 ? 48  ALA A CA   3  
ATOM   9599   C  C    . ALA A 1 48  ? 6.618   1.616   9.811   1.00 0.00 ? 48  ALA A C    3  
ATOM   9600   O  O    . ALA A 1 48  ? 6.994   0.616   9.231   1.00 0.00 ? 48  ALA A O    3  
ATOM   9601   C  CB   . ALA A 1 48  ? 7.312   2.944   7.821   1.00 0.00 ? 48  ALA A CB   3  
ATOM   9602   H  H    . ALA A 1 48  ? 9.114   3.280   9.717   1.00 0.00 ? 48  ALA A H    3  
ATOM   9603   H  HA   . ALA A 1 48  ? 6.189   3.690   9.484   1.00 0.00 ? 48  ALA A HA   3  
ATOM   9604   H  HB1  . ALA A 1 48  ? 7.895   3.806   7.532   1.00 0.00 ? 48  ALA A HB1  3  
ATOM   9605   H  HB2  . ALA A 1 48  ? 6.384   2.934   7.269   1.00 0.00 ? 48  ALA A HB2  3  
ATOM   9606   H  HB3  . ALA A 1 48  ? 7.868   2.043   7.606   1.00 0.00 ? 48  ALA A HB3  3  
ATOM   9607   N  N    . ARG A 1 49  ? 5.857   1.536   10.869  1.00 0.00 ? 49  ARG A N    3  
ATOM   9608   C  CA   . ARG A 1 49  ? 5.435   0.202   11.382  1.00 0.00 ? 49  ARG A CA   3  
ATOM   9609   C  C    . ARG A 1 49  ? 3.955   0.254   11.780  1.00 0.00 ? 49  ARG A C    3  
ATOM   9610   O  O    . ARG A 1 49  ? 3.424   1.296   12.099  1.00 0.00 ? 49  ARG A O    3  
ATOM   9611   C  CB   . ARG A 1 49  ? 6.284   -0.169  12.600  1.00 0.00 ? 49  ARG A CB   3  
ATOM   9612   C  CG   . ARG A 1 49  ? 7.539   0.708   12.634  1.00 0.00 ? 49  ARG A CG   3  
ATOM   9613   C  CD   . ARG A 1 49  ? 8.456   0.244   13.769  1.00 0.00 ? 49  ARG A CD   3  
ATOM   9614   N  NE   . ARG A 1 49  ? 9.801   -0.088  13.220  1.00 0.00 ? 49  ARG A NE   3  
ATOM   9615   C  CZ   . ARG A 1 49  ? 10.846  -0.074  13.999  1.00 0.00 ? 49  ARG A CZ   3  
ATOM   9616   N  NH1  . ARG A 1 49  ? 10.716  0.234   15.261  1.00 0.00 ? 49  ARG A NH1  3  
ATOM   9617   N  NH2  . ARG A 1 49  ? 12.023  -0.369  13.518  1.00 0.00 ? 49  ARG A NH2  3  
ATOM   9618   H  H    . ARG A 1 49  ? 5.559   2.351   11.324  1.00 0.00 ? 49  ARG A H    3  
ATOM   9619   H  HA   . ARG A 1 49  ? 5.570   -0.539  10.607  1.00 0.00 ? 49  ARG A HA   3  
ATOM   9620   H  HB2  . ARG A 1 49  ? 5.709   -0.011  13.501  1.00 0.00 ? 49  ARG A HB2  3  
ATOM   9621   H  HB3  . ARG A 1 49  ? 6.574   -1.206  12.534  1.00 0.00 ? 49  ARG A HB3  3  
ATOM   9622   H  HG2  . ARG A 1 49  ? 8.061   0.626   11.692  1.00 0.00 ? 49  ARG A HG2  3  
ATOM   9623   H  HG3  . ARG A 1 49  ? 7.255   1.736   12.802  1.00 0.00 ? 49  ARG A HG3  3  
ATOM   9624   H  HD2  . ARG A 1 49  ? 8.551   1.033   14.500  1.00 0.00 ? 49  ARG A HD2  3  
ATOM   9625   H  HD3  . ARG A 1 49  ? 8.032   -0.632  14.238  1.00 0.00 ? 49  ARG A HD3  3  
ATOM   9626   H  HE   . ARG A 1 49  ? 9.900   -0.318  12.272  1.00 0.00 ? 49  ARG A HE   3  
ATOM   9627   H  HH11 . ARG A 1 49  ? 9.815   0.461   15.631  1.00 0.00 ? 49  ARG A HH11 3  
ATOM   9628   H  HH12 . ARG A 1 49  ? 11.518  0.243   15.859  1.00 0.00 ? 49  ARG A HH12 3  
ATOM   9629   H  HH21 . ARG A 1 49  ? 12.123  -0.605  12.552  1.00 0.00 ? 49  ARG A HH21 3  
ATOM   9630   H  HH22 . ARG A 1 49  ? 12.826  -0.357  14.115  1.00 0.00 ? 49  ARG A HH22 3  
ATOM   9631   N  N    . HIS A 1 50  ? 3.285   -0.862  11.754  1.00 0.00 ? 50  HIS A N    3  
ATOM   9632   C  CA   . HIS A 1 50  ? 1.842   -0.880  12.119  1.00 0.00 ? 50  HIS A CA   3  
ATOM   9633   C  C    . HIS A 1 50  ? 1.641   -0.174  13.459  1.00 0.00 ? 50  HIS A C    3  
ATOM   9634   O  O    . HIS A 1 50  ? 0.784   0.674   13.600  1.00 0.00 ? 50  HIS A O    3  
ATOM   9635   C  CB   . HIS A 1 50  ? 1.364   -2.328  12.226  1.00 0.00 ? 50  HIS A CB   3  
ATOM   9636   C  CG   . HIS A 1 50  ? 2.165   -3.051  13.275  1.00 0.00 ? 50  HIS A CG   3  
ATOM   9637   N  ND1  . HIS A 1 50  ? 1.631   -3.390  14.508  1.00 0.00 ? 50  HIS A ND1  3  
ATOM   9638   C  CD2  . HIS A 1 50  ? 3.458   -3.510  13.287  1.00 0.00 ? 50  HIS A CD2  3  
ATOM   9639   C  CE1  . HIS A 1 50  ? 2.591   -4.025  15.205  1.00 0.00 ? 50  HIS A CE1  3  
ATOM   9640   N  NE2  . HIS A 1 50  ? 3.725   -4.125  14.507  1.00 0.00 ? 50  HIS A NE2  3  
ATOM   9641   H  H    . HIS A 1 50  ? 3.726   -1.689  11.487  1.00 0.00 ? 50  HIS A H    3  
ATOM   9642   H  HA   . HIS A 1 50  ? 1.273   -0.371  11.355  1.00 0.00 ? 50  HIS A HA   3  
ATOM   9643   H  HB2  . HIS A 1 50  ? 0.321   -2.343  12.501  1.00 0.00 ? 50  HIS A HB2  3  
ATOM   9644   H  HB3  . HIS A 1 50  ? 1.492   -2.821  11.275  1.00 0.00 ? 50  HIS A HB3  3  
ATOM   9645   H  HD1  . HIS A 1 50  ? 0.721   -3.199  14.818  1.00 0.00 ? 50  HIS A HD1  3  
ATOM   9646   H  HD2  . HIS A 1 50  ? 4.162   -3.409  12.474  1.00 0.00 ? 50  HIS A HD2  3  
ATOM   9647   H  HE1  . HIS A 1 50  ? 2.460   -4.405  16.207  1.00 0.00 ? 50  HIS A HE1  3  
ATOM   9648   N  N    . GLU A 1 51  ? 2.424   -0.516  14.442  1.00 0.00 ? 51  GLU A N    3  
ATOM   9649   C  CA   . GLU A 1 51  ? 2.277   0.139   15.769  1.00 0.00 ? 51  GLU A CA   3  
ATOM   9650   C  C    . GLU A 1 51  ? 2.083   1.646   15.573  1.00 0.00 ? 51  GLU A C    3  
ATOM   9651   O  O    . GLU A 1 51  ? 1.398   2.298   16.334  1.00 0.00 ? 51  GLU A O    3  
ATOM   9652   C  CB   . GLU A 1 51  ? 3.536   -0.108  16.605  1.00 0.00 ? 51  GLU A CB   3  
ATOM   9653   C  CG   . GLU A 1 51  ? 3.771   -1.614  16.747  1.00 0.00 ? 51  GLU A CG   3  
ATOM   9654   C  CD   . GLU A 1 51  ? 4.900   -1.865  17.750  1.00 0.00 ? 51  GLU A CD   3  
ATOM   9655   O  OE1  . GLU A 1 51  ? 5.077   -1.040  18.630  1.00 0.00 ? 51  GLU A OE1  3  
ATOM   9656   O  OE2  . GLU A 1 51  ? 5.566   -2.879  17.620  1.00 0.00 ? 51  GLU A OE2  3  
ATOM   9657   H  H    . GLU A 1 51  ? 3.110   -1.202  14.303  1.00 0.00 ? 51  GLU A H    3  
ATOM   9658   H  HA   . GLU A 1 51  ? 1.418   -0.270  16.281  1.00 0.00 ? 51  GLU A HA   3  
ATOM   9659   H  HB2  . GLU A 1 51  ? 4.387   0.345   16.115  1.00 0.00 ? 51  GLU A HB2  3  
ATOM   9660   H  HB3  . GLU A 1 51  ? 3.411   0.328   17.584  1.00 0.00 ? 51  GLU A HB3  3  
ATOM   9661   H  HG2  . GLU A 1 51  ? 2.865   -2.087  17.097  1.00 0.00 ? 51  GLU A HG2  3  
ATOM   9662   H  HG3  . GLU A 1 51  ? 4.046   -2.026  15.788  1.00 0.00 ? 51  GLU A HG3  3  
ATOM   9663   N  N    . PHE A 1 52  ? 2.696   2.206   14.564  1.00 0.00 ? 52  PHE A N    3  
ATOM   9664   C  CA   . PHE A 1 52  ? 2.558   3.676   14.335  1.00 0.00 ? 52  PHE A CA   3  
ATOM   9665   C  C    . PHE A 1 52  ? 1.208   3.987   13.688  1.00 0.00 ? 52  PHE A C    3  
ATOM   9666   O  O    . PHE A 1 52  ? 0.897   5.125   13.398  1.00 0.00 ? 52  PHE A O    3  
ATOM   9667   C  CB   . PHE A 1 52  ? 3.691   4.166   13.432  1.00 0.00 ? 52  PHE A CB   3  
ATOM   9668   C  CG   . PHE A 1 52  ? 4.936   4.346   14.262  1.00 0.00 ? 52  PHE A CG   3  
ATOM   9669   C  CD1  . PHE A 1 52  ? 5.668   3.229   14.679  1.00 0.00 ? 52  PHE A CD1  3  
ATOM   9670   C  CD2  . PHE A 1 52  ? 5.353   5.630   14.620  1.00 0.00 ? 52  PHE A CD2  3  
ATOM   9671   C  CE1  . PHE A 1 52  ? 6.820   3.398   15.455  1.00 0.00 ? 52  PHE A CE1  3  
ATOM   9672   C  CE2  . PHE A 1 52  ? 6.504   5.802   15.397  1.00 0.00 ? 52  PHE A CE2  3  
ATOM   9673   C  CZ   . PHE A 1 52  ? 7.238   4.685   15.814  1.00 0.00 ? 52  PHE A CZ   3  
ATOM   9674   H  H    . PHE A 1 52  ? 3.261   1.660   13.969  1.00 0.00 ? 52  PHE A H    3  
ATOM   9675   H  HA   . PHE A 1 52  ? 2.618   4.188   15.284  1.00 0.00 ? 52  PHE A HA   3  
ATOM   9676   H  HB2  . PHE A 1 52  ? 3.876   3.442   12.654  1.00 0.00 ? 52  PHE A HB2  3  
ATOM   9677   H  HB3  . PHE A 1 52  ? 3.416   5.110   12.988  1.00 0.00 ? 52  PHE A HB3  3  
ATOM   9678   H  HD1  . PHE A 1 52  ? 5.345   2.236   14.402  1.00 0.00 ? 52  PHE A HD1  3  
ATOM   9679   H  HD2  . PHE A 1 52  ? 4.785   6.488   14.297  1.00 0.00 ? 52  PHE A HD2  3  
ATOM   9680   H  HE1  . PHE A 1 52  ? 7.387   2.536   15.778  1.00 0.00 ? 52  PHE A HE1  3  
ATOM   9681   H  HE2  . PHE A 1 52  ? 6.825   6.794   15.673  1.00 0.00 ? 52  PHE A HE2  3  
ATOM   9682   H  HZ   . PHE A 1 52  ? 8.127   4.817   16.414  1.00 0.00 ? 52  PHE A HZ   3  
ATOM   9683   N  N    . VAL A 1 53  ? 0.396   2.991   13.474  1.00 0.00 ? 53  VAL A N    3  
ATOM   9684   C  CA   . VAL A 1 53  ? -0.938  3.242   12.863  1.00 0.00 ? 53  VAL A CA   3  
ATOM   9685   C  C    . VAL A 1 53  ? -1.753  4.130   13.807  1.00 0.00 ? 53  VAL A C    3  
ATOM   9686   O  O    . VAL A 1 53  ? -2.012  3.762   14.936  1.00 0.00 ? 53  VAL A O    3  
ATOM   9687   C  CB   . VAL A 1 53  ? -1.656  1.908   12.664  1.00 0.00 ? 53  VAL A CB   3  
ATOM   9688   C  CG1  . VAL A 1 53  ? -3.164  2.148   12.581  1.00 0.00 ? 53  VAL A CG1  3  
ATOM   9689   C  CG2  . VAL A 1 53  ? -1.173  1.257   11.367  1.00 0.00 ? 53  VAL A CG2  3  
ATOM   9690   H  H    . VAL A 1 53  ? 0.658   2.081   13.726  1.00 0.00 ? 53  VAL A H    3  
ATOM   9691   H  HA   . VAL A 1 53  ? -0.816  3.738   11.910  1.00 0.00 ? 53  VAL A HA   3  
ATOM   9692   H  HB   . VAL A 1 53  ? -1.440  1.257   13.498  1.00 0.00 ? 53  VAL A HB   3  
ATOM   9693   H  HG11 . VAL A 1 53  ? -3.579  2.175   13.578  1.00 0.00 ? 53  VAL A HG11 3  
ATOM   9694   H  HG12 . VAL A 1 53  ? -3.622  1.348   12.020  1.00 0.00 ? 53  VAL A HG12 3  
ATOM   9695   H  HG13 . VAL A 1 53  ? -3.351  3.089   12.087  1.00 0.00 ? 53  VAL A HG13 3  
ATOM   9696   H  HG21 . VAL A 1 53  ? -1.889  1.444   10.580  1.00 0.00 ? 53  VAL A HG21 3  
ATOM   9697   H  HG22 . VAL A 1 53  ? -1.070  0.192   11.516  1.00 0.00 ? 53  VAL A HG22 3  
ATOM   9698   H  HG23 . VAL A 1 53  ? -0.216  1.674   11.089  1.00 0.00 ? 53  VAL A HG23 3  
ATOM   9699   N  N    . VAL A 1 54  ? -2.146  5.299   13.367  1.00 0.00 ? 54  VAL A N    3  
ATOM   9700   C  CA   . VAL A 1 54  ? -2.930  6.205   14.264  1.00 0.00 ? 54  VAL A CA   3  
ATOM   9701   C  C    . VAL A 1 54  ? -4.375  6.325   13.775  1.00 0.00 ? 54  VAL A C    3  
ATOM   9702   O  O    . VAL A 1 54  ? -5.287  6.509   14.557  1.00 0.00 ? 54  VAL A O    3  
ATOM   9703   C  CB   . VAL A 1 54  ? -2.289  7.594   14.278  1.00 0.00 ? 54  VAL A CB   3  
ATOM   9704   C  CG1  . VAL A 1 54  ? -1.078  7.589   15.211  1.00 0.00 ? 54  VAL A CG1  3  
ATOM   9705   C  CG2  . VAL A 1 54  ? -1.842  7.964   12.864  1.00 0.00 ? 54  VAL A CG2  3  
ATOM   9706   H  H    . VAL A 1 54  ? -1.919  5.584   12.454  1.00 0.00 ? 54  VAL A H    3  
ATOM   9707   H  HA   . VAL A 1 54  ? -2.929  5.806   15.267  1.00 0.00 ? 54  VAL A HA   3  
ATOM   9708   H  HB   . VAL A 1 54  ? -3.010  8.318   14.631  1.00 0.00 ? 54  VAL A HB   3  
ATOM   9709   H  HG11 . VAL A 1 54  ? -0.452  6.738   14.986  1.00 0.00 ? 54  VAL A HG11 3  
ATOM   9710   H  HG12 . VAL A 1 54  ? -1.413  7.528   16.236  1.00 0.00 ? 54  VAL A HG12 3  
ATOM   9711   H  HG13 . VAL A 1 54  ? -0.512  8.499   15.071  1.00 0.00 ? 54  VAL A HG13 3  
ATOM   9712   H  HG21 . VAL A 1 54  ? -2.596  7.655   12.155  1.00 0.00 ? 54  VAL A HG21 3  
ATOM   9713   H  HG22 . VAL A 1 54  ? -0.911  7.466   12.640  1.00 0.00 ? 54  VAL A HG22 3  
ATOM   9714   H  HG23 . VAL A 1 54  ? -1.703  9.033   12.799  1.00 0.00 ? 54  VAL A HG23 3  
ATOM   9715   N  N    . HIS A 1 55  ? -4.598  6.227   12.495  1.00 0.00 ? 55  HIS A N    3  
ATOM   9716   C  CA   . HIS A 1 55  ? -5.992  6.344   11.980  1.00 0.00 ? 55  HIS A CA   3  
ATOM   9717   C  C    . HIS A 1 55  ? -6.171  5.428   10.772  1.00 0.00 ? 55  HIS A C    3  
ATOM   9718   O  O    . HIS A 1 55  ? -5.508  5.571   9.761   1.00 0.00 ? 55  HIS A O    3  
ATOM   9719   C  CB   . HIS A 1 55  ? -6.265  7.792   11.576  1.00 0.00 ? 55  HIS A CB   3  
ATOM   9720   C  CG   . HIS A 1 55  ? -7.474  7.868   10.682  1.00 0.00 ? 55  HIS A CG   3  
ATOM   9721   N  ND1  . HIS A 1 55  ? -7.552  8.763   9.624   1.00 0.00 ? 55  HIS A ND1  3  
ATOM   9722   C  CD2  . HIS A 1 55  ? -8.661  7.179   10.676  1.00 0.00 ? 55  HIS A CD2  3  
ATOM   9723   C  CE1  . HIS A 1 55  ? -8.748  8.590   9.032   1.00 0.00 ? 55  HIS A CE1  3  
ATOM   9724   N  NE2  . HIS A 1 55  ? -9.464  7.637   9.634   1.00 0.00 ? 55  HIS A NE2  3  
ATOM   9725   H  H    . HIS A 1 55  ? -3.856  6.078   11.871  1.00 0.00 ? 55  HIS A H    3  
ATOM   9726   H  HA   . HIS A 1 55  ? -6.686  6.052   12.756  1.00 0.00 ? 55  HIS A HA   3  
ATOM   9727   H  HB2  . HIS A 1 55  ? -6.438  8.384   12.462  1.00 0.00 ? 55  HIS A HB2  3  
ATOM   9728   H  HB3  . HIS A 1 55  ? -5.411  8.177   11.052  1.00 0.00 ? 55  HIS A HB3  3  
ATOM   9729   H  HD1  . HIS A 1 55  ? -6.861  9.405   9.357   1.00 0.00 ? 55  HIS A HD1  3  
ATOM   9730   H  HD2  . HIS A 1 55  ? -8.933  6.400   11.374  1.00 0.00 ? 55  HIS A HD2  3  
ATOM   9731   H  HE1  . HIS A 1 55  ? -9.088  9.156   8.172   1.00 0.00 ? 55  HIS A HE1  3  
ATOM   9732   N  N    . THR A 1 56  ? -7.061  4.485   10.879  1.00 0.00 ? 56  THR A N    3  
ATOM   9733   C  CA   . THR A 1 56  ? -7.302  3.540   9.753   1.00 0.00 ? 56  THR A CA   3  
ATOM   9734   C  C    . THR A 1 56  ? -8.695  3.782   9.175   1.00 0.00 ? 56  THR A C    3  
ATOM   9735   O  O    . THR A 1 56  ? -9.672  3.872   9.892   1.00 0.00 ? 56  THR A O    3  
ATOM   9736   C  CB   . THR A 1 56  ? -7.207  2.099   10.259  1.00 0.00 ? 56  THR A CB   3  
ATOM   9737   O  OG1  . THR A 1 56  ? -8.185  1.888   11.269  1.00 0.00 ? 56  THR A OG1  3  
ATOM   9738   C  CG2  . THR A 1 56  ? -5.813  1.848   10.833  1.00 0.00 ? 56  THR A CG2  3  
ATOM   9739   H  H    . THR A 1 56  ? -7.571  4.397   11.708  1.00 0.00 ? 56  THR A H    3  
ATOM   9740   H  HA   . THR A 1 56  ? -6.562  3.699   8.982   1.00 0.00 ? 56  THR A HA   3  
ATOM   9741   H  HB   . THR A 1 56  ? -7.381  1.417   9.439   1.00 0.00 ? 56  THR A HB   3  
ATOM   9742   H  HG1  . THR A 1 56  ? -8.518  2.745   11.541  1.00 0.00 ? 56  THR A HG1  3  
ATOM   9743   H  HG21 . THR A 1 56  ? -5.280  2.785   10.904  1.00 0.00 ? 56  THR A HG21 3  
ATOM   9744   H  HG22 . THR A 1 56  ? -5.271  1.174   10.187  1.00 0.00 ? 56  THR A HG22 3  
ATOM   9745   H  HG23 . THR A 1 56  ? -5.901  1.410   11.817  1.00 0.00 ? 56  THR A HG23 3  
ATOM   9746   N  N    . ASN A 1 57  ? -8.791  3.884   7.882   1.00 0.00 ? 57  ASN A N    3  
ATOM   9747   C  CA   . ASN A 1 57  ? -10.112 4.115   7.238   1.00 0.00 ? 57  ASN A CA   3  
ATOM   9748   C  C    . ASN A 1 57  ? -9.966  3.841   5.742   1.00 0.00 ? 57  ASN A C    3  
ATOM   9749   O  O    . ASN A 1 57  ? -9.097  3.103   5.325   1.00 0.00 ? 57  ASN A O    3  
ATOM   9750   C  CB   . ASN A 1 57  ? -10.546 5.564   7.463   1.00 0.00 ? 57  ASN A CB   3  
ATOM   9751   C  CG   . ASN A 1 57  ? -12.016 5.725   7.073   1.00 0.00 ? 57  ASN A CG   3  
ATOM   9752   O  OD1  . ASN A 1 57  ? -12.400 6.728   6.507   1.00 0.00 ? 57  ASN A OD1  3  
ATOM   9753   N  ND2  . ASN A 1 57  ? -12.861 4.770   7.352   1.00 0.00 ? 57  ASN A ND2  3  
ATOM   9754   H  H    . ASN A 1 57  ? -7.990  3.799   7.323   1.00 0.00 ? 57  ASN A H    3  
ATOM   9755   H  HA   . ASN A 1 57  ? -10.844 3.442   7.660   1.00 0.00 ? 57  ASN A HA   3  
ATOM   9756   H  HB2  . ASN A 1 57  ? -10.420 5.817   8.505   1.00 0.00 ? 57  ASN A HB2  3  
ATOM   9757   H  HB3  . ASN A 1 57  ? -9.940  6.221   6.857   1.00 0.00 ? 57  ASN A HB3  3  
ATOM   9758   H  HD21 . ASN A 1 57  ? -12.551 3.960   7.807   1.00 0.00 ? 57  ASN A HD21 3  
ATOM   9759   H  HD22 . ASN A 1 57  ? -13.804 4.864   7.106   1.00 0.00 ? 57  ASN A HD22 3  
ATOM   9760   N  N    . HIS A 1 58  ? -10.786 4.437   4.923   1.00 0.00 ? 58  HIS A N    3  
ATOM   9761   C  CA   . HIS A 1 58  ? -10.650 4.205   3.460   1.00 0.00 ? 58  HIS A CA   3  
ATOM   9762   C  C    . HIS A 1 58  ? -9.179  4.380   3.080   1.00 0.00 ? 58  HIS A C    3  
ATOM   9763   O  O    . HIS A 1 58  ? -8.756  4.032   1.994   1.00 0.00 ? 58  HIS A O    3  
ATOM   9764   C  CB   . HIS A 1 58  ? -11.503 5.220   2.696   1.00 0.00 ? 58  HIS A CB   3  
ATOM   9765   C  CG   . HIS A 1 58  ? -12.807 4.583   2.304   1.00 0.00 ? 58  HIS A CG   3  
ATOM   9766   N  ND1  . HIS A 1 58  ? -13.083 4.205   1.000   1.00 0.00 ? 58  HIS A ND1  3  
ATOM   9767   C  CD2  . HIS A 1 58  ? -13.920 4.249   3.035   1.00 0.00 ? 58  HIS A CD2  3  
ATOM   9768   C  CE1  . HIS A 1 58  ? -14.318 3.668   0.986   1.00 0.00 ? 58  HIS A CE1  3  
ATOM   9769   N  NE2  . HIS A 1 58  ? -14.872 3.670   2.201   1.00 0.00 ? 58  HIS A NE2  3  
ATOM   9770   H  H    . HIS A 1 58  ? -11.476 5.043   5.265   1.00 0.00 ? 58  HIS A H    3  
ATOM   9771   H  HA   . HIS A 1 58  ? -10.972 3.202   3.220   1.00 0.00 ? 58  HIS A HA   3  
ATOM   9772   H  HB2  . HIS A 1 58  ? -11.695 6.076   3.326   1.00 0.00 ? 58  HIS A HB2  3  
ATOM   9773   H  HB3  . HIS A 1 58  ? -10.977 5.536   1.808   1.00 0.00 ? 58  HIS A HB3  3  
ATOM   9774   H  HD1  . HIS A 1 58  ? -12.489 4.310   0.228   1.00 0.00 ? 58  HIS A HD1  3  
ATOM   9775   H  HD2  . HIS A 1 58  ? -14.039 4.410   4.097   1.00 0.00 ? 58  HIS A HD2  3  
ATOM   9776   H  HE1  . HIS A 1 58  ? -14.800 3.280   0.101   1.00 0.00 ? 58  HIS A HE1  3  
ATOM   9777   N  N    . SER A 1 59  ? -8.395  4.917   3.978   1.00 0.00 ? 59  SER A N    3  
ATOM   9778   C  CA   . SER A 1 59  ? -6.948  5.122   3.696   1.00 0.00 ? 59  SER A CA   3  
ATOM   9779   C  C    . SER A 1 59  ? -6.127  4.707   4.923   1.00 0.00 ? 59  SER A C    3  
ATOM   9780   O  O    . SER A 1 59  ? -6.653  4.536   6.005   1.00 0.00 ? 59  SER A O    3  
ATOM   9781   C  CB   . SER A 1 59  ? -6.692  6.598   3.384   1.00 0.00 ? 59  SER A CB   3  
ATOM   9782   O  OG   . SER A 1 59  ? -5.365  6.751   2.898   1.00 0.00 ? 59  SER A OG   3  
ATOM   9783   H  H    . SER A 1 59  ? -8.764  5.186   4.845   1.00 0.00 ? 59  SER A H    3  
ATOM   9784   H  HA   . SER A 1 59  ? -6.657  4.519   2.849   1.00 0.00 ? 59  SER A HA   3  
ATOM   9785   H  HB2  . SER A 1 59  ? -7.387  6.936   2.632   1.00 0.00 ? 59  SER A HB2  3  
ATOM   9786   H  HB3  . SER A 1 59  ? -6.828  7.184   4.285   1.00 0.00 ? 59  SER A HB3  3  
ATOM   9787   H  HG   . SER A 1 59  ? -5.416  7.057   1.989   1.00 0.00 ? 59  SER A HG   3  
ATOM   9788   N  N    . THR A 1 60  ? -4.840  4.555   4.761   1.00 0.00 ? 60  THR A N    3  
ATOM   9789   C  CA   . THR A 1 60  ? -3.977  4.162   5.915   1.00 0.00 ? 60  THR A CA   3  
ATOM   9790   C  C    . THR A 1 60  ? -3.156  5.374   6.357   1.00 0.00 ? 60  THR A C    3  
ATOM   9791   O  O    . THR A 1 60  ? -2.440  5.961   5.570   1.00 0.00 ? 60  THR A O    3  
ATOM   9792   C  CB   . THR A 1 60  ? -3.034  3.035   5.487   1.00 0.00 ? 60  THR A CB   3  
ATOM   9793   O  OG1  . THR A 1 60  ? -3.790  1.991   4.890   1.00 0.00 ? 60  THR A OG1  3  
ATOM   9794   C  CG2  . THR A 1 60  ? -2.289  2.497   6.709   1.00 0.00 ? 60  THR A CG2  3  
ATOM   9795   H  H    . THR A 1 60  ? -4.445  4.714   3.878   1.00 0.00 ? 60  THR A H    3  
ATOM   9796   H  HA   . THR A 1 60  ? -4.596  3.826   6.734   1.00 0.00 ? 60  THR A HA   3  
ATOM   9797   H  HB   . THR A 1 60  ? -2.320  3.415   4.774   1.00 0.00 ? 60  THR A HB   3  
ATOM   9798   H  HG1  . THR A 1 60  ? -4.156  2.323   4.067   1.00 0.00 ? 60  THR A HG1  3  
ATOM   9799   H  HG21 . THR A 1 60  ? -1.885  3.323   7.276   1.00 0.00 ? 60  THR A HG21 3  
ATOM   9800   H  HG22 . THR A 1 60  ? -1.485  1.853   6.386   1.00 0.00 ? 60  THR A HG22 3  
ATOM   9801   H  HG23 . THR A 1 60  ? -2.973  1.936   7.329   1.00 0.00 ? 60  THR A HG23 3  
ATOM   9802   N  N    . ASP A 1 61  ? -3.267  5.769   7.603   1.00 0.00 ? 61  ASP A N    3  
ATOM   9803   C  CA   . ASP A 1 61  ? -2.502  6.963   8.074   1.00 0.00 ? 61  ASP A CA   3  
ATOM   9804   C  C    . ASP A 1 61  ? -1.585  6.606   9.252   1.00 0.00 ? 61  ASP A C    3  
ATOM   9805   O  O    . ASP A 1 61  ? -1.958  5.899   10.171  1.00 0.00 ? 61  ASP A O    3  
ATOM   9806   C  CB   . ASP A 1 61  ? -3.486  8.048   8.515   1.00 0.00 ? 61  ASP A CB   3  
ATOM   9807   C  CG   . ASP A 1 61  ? -4.752  7.968   7.661   1.00 0.00 ? 61  ASP A CG   3  
ATOM   9808   O  OD1  . ASP A 1 61  ? -4.681  7.405   6.581   1.00 0.00 ? 61  ASP A OD1  3  
ATOM   9809   O  OD2  . ASP A 1 61  ? -5.773  8.470   8.101   1.00 0.00 ? 61  ASP A OD2  3  
ATOM   9810   H  H    . ASP A 1 61  ? -3.865  5.294   8.220   1.00 0.00 ? 61  ASP A H    3  
ATOM   9811   H  HA   . ASP A 1 61  ? -1.900  7.346   7.265   1.00 0.00 ? 61  ASP A HA   3  
ATOM   9812   H  HB2  . ASP A 1 61  ? -3.739  7.900   9.553   1.00 0.00 ? 61  ASP A HB2  3  
ATOM   9813   H  HB3  . ASP A 1 61  ? -3.031  9.019   8.390   1.00 0.00 ? 61  ASP A HB3  3  
ATOM   9814   N  N    . LEU A 1 62  ? -0.394  7.136   9.230   1.00 0.00 ? 62  LEU A N    3  
ATOM   9815   C  CA   . LEU A 1 62  ? 0.573   6.891   10.338  1.00 0.00 ? 62  LEU A CA   3  
ATOM   9816   C  C    . LEU A 1 62  ? 0.876   8.236   10.997  1.00 0.00 ? 62  LEU A C    3  
ATOM   9817   O  O    . LEU A 1 62  ? 0.717   9.271   10.384  1.00 0.00 ? 62  LEU A O    3  
ATOM   9818   C  CB   . LEU A 1 62  ? 1.869   6.297   9.776   1.00 0.00 ? 62  LEU A CB   3  
ATOM   9819   C  CG   . LEU A 1 62  ? 1.554   5.037   8.971   1.00 0.00 ? 62  LEU A CG   3  
ATOM   9820   C  CD1  . LEU A 1 62  ? 2.820   4.561   8.257   1.00 0.00 ? 62  LEU A CD1  3  
ATOM   9821   C  CD2  . LEU A 1 62  ? 1.055   3.934   9.910   1.00 0.00 ? 62  LEU A CD2  3  
ATOM   9822   H  H    . LEU A 1 62  ? -0.150  7.726   8.486   1.00 0.00 ? 62  LEU A H    3  
ATOM   9823   H  HA   . LEU A 1 62  ? 0.140   6.215   11.061  1.00 0.00 ? 62  LEU A HA   3  
ATOM   9824   H  HB2  . LEU A 1 62  ? 2.345   7.024   9.133   1.00 0.00 ? 62  LEU A HB2  3  
ATOM   9825   H  HB3  . LEU A 1 62  ? 2.534   6.049   10.589  1.00 0.00 ? 62  LEU A HB3  3  
ATOM   9826   H  HG   . LEU A 1 62  ? 0.792   5.260   8.238   1.00 0.00 ? 62  LEU A HG   3  
ATOM   9827   H  HD11 . LEU A 1 62  ? 3.155   5.324   7.570   1.00 0.00 ? 62  LEU A HD11 3  
ATOM   9828   H  HD12 . LEU A 1 62  ? 2.607   3.654   7.712   1.00 0.00 ? 62  LEU A HD12 3  
ATOM   9829   H  HD13 . LEU A 1 62  ? 3.596   4.368   8.985   1.00 0.00 ? 62  LEU A HD13 3  
ATOM   9830   H  HD21 . LEU A 1 62  ? -0.006  3.793   9.767   1.00 0.00 ? 62  LEU A HD21 3  
ATOM   9831   H  HD22 . LEU A 1 62  ? 1.244   4.216   10.936  1.00 0.00 ? 62  LEU A HD22 3  
ATOM   9832   H  HD23 . LEU A 1 62  ? 1.572   3.013   9.689   1.00 0.00 ? 62  LEU A HD23 3  
ATOM   9833   N  N    . GLY A 1 63  ? 1.300   8.256   12.231  1.00 0.00 ? 63  GLY A N    3  
ATOM   9834   C  CA   . GLY A 1 63  ? 1.582   9.575   12.860  1.00 0.00 ? 63  GLY A CA   3  
ATOM   9835   C  C    . GLY A 1 63  ? 2.214   9.408   14.239  1.00 0.00 ? 63  GLY A C    3  
ATOM   9836   O  O    . GLY A 1 63  ? 1.870   8.520   14.994  1.00 0.00 ? 63  GLY A O    3  
ATOM   9837   H  H    . GLY A 1 63  ? 1.424   7.422   12.733  1.00 0.00 ? 63  GLY A H    3  
ATOM   9838   H  HA2  . GLY A 1 63  ? 2.254   10.133  12.226  1.00 0.00 ? 63  GLY A HA2  3  
ATOM   9839   H  HA3  . GLY A 1 63  ? 0.656   10.116  12.965  1.00 0.00 ? 63  GLY A HA3  3  
ATOM   9840   N  N    . PHE A 1 64  ? 3.137   10.269  14.568  1.00 0.00 ? 64  PHE A N    3  
ATOM   9841   C  CA   . PHE A 1 64  ? 3.808   10.191  15.895  1.00 0.00 ? 64  PHE A CA   3  
ATOM   9842   C  C    . PHE A 1 64  ? 4.074   11.609  16.409  1.00 0.00 ? 64  PHE A C    3  
ATOM   9843   O  O    . PHE A 1 64  ? 4.299   12.525  15.644  1.00 0.00 ? 64  PHE A O    3  
ATOM   9844   C  CB   . PHE A 1 64  ? 5.145   9.459   15.748  1.00 0.00 ? 64  PHE A CB   3  
ATOM   9845   C  CG   . PHE A 1 64  ? 5.667   9.082   17.115  1.00 0.00 ? 64  PHE A CG   3  
ATOM   9846   C  CD1  . PHE A 1 64  ? 5.058   8.049   17.838  1.00 0.00 ? 64  PHE A CD1  3  
ATOM   9847   C  CD2  . PHE A 1 64  ? 6.763   9.764   17.659  1.00 0.00 ? 64  PHE A CD2  3  
ATOM   9848   C  CE1  . PHE A 1 64  ? 5.542   7.700   19.103  1.00 0.00 ? 64  PHE A CE1  3  
ATOM   9849   C  CE2  . PHE A 1 64  ? 7.248   9.414   18.923  1.00 0.00 ? 64  PHE A CE2  3  
ATOM   9850   C  CZ   . PHE A 1 64  ? 6.638   8.382   19.646  1.00 0.00 ? 64  PHE A CZ   3  
ATOM   9851   H  H    . PHE A 1 64  ? 3.400   10.973  13.940  1.00 0.00 ? 64  PHE A H    3  
ATOM   9852   H  HA   . PHE A 1 64  ? 3.178   9.660   16.592  1.00 0.00 ? 64  PHE A HA   3  
ATOM   9853   H  HB2  . PHE A 1 64  ? 5.010   8.570   15.155  1.00 0.00 ? 64  PHE A HB2  3  
ATOM   9854   H  HB3  . PHE A 1 64  ? 5.858   10.110  15.262  1.00 0.00 ? 64  PHE A HB3  3  
ATOM   9855   H  HD1  . PHE A 1 64  ? 4.213   7.522   17.419  1.00 0.00 ? 64  PHE A HD1  3  
ATOM   9856   H  HD2  . PHE A 1 64  ? 7.234   10.561  17.101  1.00 0.00 ? 64  PHE A HD2  3  
ATOM   9857   H  HE1  . PHE A 1 64  ? 5.072   6.904   19.662  1.00 0.00 ? 64  PHE A HE1  3  
ATOM   9858   H  HE2  . PHE A 1 64  ? 8.092   9.941   19.343  1.00 0.00 ? 64  PHE A HE2  3  
ATOM   9859   H  HZ   . PHE A 1 64  ? 7.012   8.113   20.624  1.00 0.00 ? 64  PHE A HZ   3  
ATOM   9860   N  N    . LYS A 1 65  ? 4.055   11.794  17.701  1.00 0.00 ? 65  LYS A N    3  
ATOM   9861   C  CA   . LYS A 1 65  ? 4.316   13.146  18.277  1.00 0.00 ? 65  LYS A CA   3  
ATOM   9862   C  C    . LYS A 1 65  ? 3.339   14.177  17.698  1.00 0.00 ? 65  LYS A C    3  
ATOM   9863   O  O    . LYS A 1 65  ? 3.704   15.303  17.427  1.00 0.00 ? 65  LYS A O    3  
ATOM   9864   C  CB   . LYS A 1 65  ? 5.751   13.570  17.954  1.00 0.00 ? 65  LYS A CB   3  
ATOM   9865   C  CG   . LYS A 1 65  ? 6.708   12.947  18.971  1.00 0.00 ? 65  LYS A CG   3  
ATOM   9866   C  CD   . LYS A 1 65  ? 7.031   13.969  20.061  1.00 0.00 ? 65  LYS A CD   3  
ATOM   9867   C  CE   . LYS A 1 65  ? 7.713   13.265  21.234  1.00 0.00 ? 65  LYS A CE   3  
ATOM   9868   N  NZ   . LYS A 1 65  ? 8.803   14.130  21.768  1.00 0.00 ? 65  LYS A NZ   3  
ATOM   9869   H  H    . LYS A 1 65  ? 3.870   11.037  18.297  1.00 0.00 ? 65  LYS A H    3  
ATOM   9870   H  HA   . LYS A 1 65  ? 4.192   13.105  19.349  1.00 0.00 ? 65  LYS A HA   3  
ATOM   9871   H  HB2  . LYS A 1 65  ? 6.013   13.235  16.962  1.00 0.00 ? 65  LYS A HB2  3  
ATOM   9872   H  HB3  . LYS A 1 65  ? 5.828   14.646  18.003  1.00 0.00 ? 65  LYS A HB3  3  
ATOM   9873   H  HG2  . LYS A 1 65  ? 6.244   12.079  19.415  1.00 0.00 ? 65  LYS A HG2  3  
ATOM   9874   H  HG3  . LYS A 1 65  ? 7.620   12.653  18.474  1.00 0.00 ? 65  LYS A HG3  3  
ATOM   9875   H  HD2  . LYS A 1 65  ? 7.693   14.725  19.660  1.00 0.00 ? 65  LYS A HD2  3  
ATOM   9876   H  HD3  . LYS A 1 65  ? 6.118   14.434  20.403  1.00 0.00 ? 65  LYS A HD3  3  
ATOM   9877   H  HE2  . LYS A 1 65  ? 6.988   13.077  22.012  1.00 0.00 ? 65  LYS A HE2  3  
ATOM   9878   H  HE3  . LYS A 1 65  ? 8.130   12.327  20.896  1.00 0.00 ? 65  LYS A HE3  3  
ATOM   9879   H  HZ1  . LYS A 1 65  ? 8.723   15.081  21.356  1.00 0.00 ? 65  LYS A HZ1  3  
ATOM   9880   H  HZ2  . LYS A 1 65  ? 9.726   13.718  21.517  1.00 0.00 ? 65  LYS A HZ2  3  
ATOM   9881   H  HZ3  . LYS A 1 65  ? 8.721   14.193  22.802  1.00 0.00 ? 65  LYS A HZ3  3  
ATOM   9882   N  N    . GLY A 1 66  ? 2.099   13.811  17.526  1.00 0.00 ? 66  GLY A N    3  
ATOM   9883   C  CA   . GLY A 1 66  ? 1.100   14.783  16.988  1.00 0.00 ? 66  GLY A CA   3  
ATOM   9884   C  C    . GLY A 1 66  ? 1.296   14.985  15.481  1.00 0.00 ? 66  GLY A C    3  
ATOM   9885   O  O    . GLY A 1 66  ? 0.642   15.807  14.871  1.00 0.00 ? 66  GLY A O    3  
ATOM   9886   H  H    . GLY A 1 66  ? 1.818   12.902  17.765  1.00 0.00 ? 66  GLY A H    3  
ATOM   9887   H  HA2  . GLY A 1 66  ? 0.103   14.406  17.170  1.00 0.00 ? 66  GLY A HA2  3  
ATOM   9888   H  HA3  . GLY A 1 66  ? 1.220   15.730  17.491  1.00 0.00 ? 66  GLY A HA3  3  
ATOM   9889   N  N    . GLN A 1 67  ? 2.178   14.241  14.870  1.00 0.00 ? 67  GLN A N    3  
ATOM   9890   C  CA   . GLN A 1 67  ? 2.392   14.396  13.402  1.00 0.00 ? 67  GLN A CA   3  
ATOM   9891   C  C    . GLN A 1 67  ? 1.674   13.250  12.688  1.00 0.00 ? 67  GLN A C    3  
ATOM   9892   O  O    . GLN A 1 67  ? 1.676   12.135  13.162  1.00 0.00 ? 67  GLN A O    3  
ATOM   9893   C  CB   . GLN A 1 67  ? 3.890   14.337  13.100  1.00 0.00 ? 67  GLN A CB   3  
ATOM   9894   C  CG   . GLN A 1 67  ? 4.602   15.478  13.830  1.00 0.00 ? 67  GLN A CG   3  
ATOM   9895   C  CD   . GLN A 1 67  ? 4.424   16.778  13.046  1.00 0.00 ? 67  GLN A CD   3  
ATOM   9896   O  OE1  . GLN A 1 67  ? 3.906   16.774  11.947  1.00 0.00 ? 67  GLN A OE1  3  
ATOM   9897   N  NE2  . GLN A 1 67  ? 4.836   17.902  13.568  1.00 0.00 ? 67  GLN A NE2  3  
ATOM   9898   H  H    . GLN A 1 67  ? 2.691   13.573  15.371  1.00 0.00 ? 67  GLN A H    3  
ATOM   9899   H  HA   . GLN A 1 67  ? 1.989   15.341  13.071  1.00 0.00 ? 67  GLN A HA   3  
ATOM   9900   H  HB2  . GLN A 1 67  ? 4.287   13.390  13.438  1.00 0.00 ? 67  GLN A HB2  3  
ATOM   9901   H  HB3  . GLN A 1 67  ? 4.049   14.437  12.037  1.00 0.00 ? 67  GLN A HB3  3  
ATOM   9902   H  HG2  . GLN A 1 67  ? 4.178   15.591  14.818  1.00 0.00 ? 67  GLN A HG2  3  
ATOM   9903   H  HG3  . GLN A 1 67  ? 5.653   15.250  13.915  1.00 0.00 ? 67  GLN A HG3  3  
ATOM   9904   H  HE21 . GLN A 1 67  ? 5.254   17.906  14.455  1.00 0.00 ? 67  GLN A HE21 3  
ATOM   9905   H  HE22 . GLN A 1 67  ? 4.728   18.740  13.074  1.00 0.00 ? 67  GLN A HE22 3  
ATOM   9906   N  N    . ARG A 1 68  ? 1.043   13.508  11.568  1.00 0.00 ? 68  ARG A N    3  
ATOM   9907   C  CA   . ARG A 1 68  ? 0.317   12.406  10.869  1.00 0.00 ? 68  ARG A CA   3  
ATOM   9908   C  C    . ARG A 1 68  ? 0.509   12.479  9.353   1.00 0.00 ? 68  ARG A C    3  
ATOM   9909   O  O    . ARG A 1 68  ? 0.700   13.532  8.778   1.00 0.00 ? 68  ARG A O    3  
ATOM   9910   C  CB   . ARG A 1 68  ? -1.180  12.490  11.188  1.00 0.00 ? 68  ARG A CB   3  
ATOM   9911   C  CG   . ARG A 1 68  ? -1.448  13.655  12.145  1.00 0.00 ? 68  ARG A CG   3  
ATOM   9912   C  CD   . ARG A 1 68  ? -1.153  14.979  11.438  1.00 0.00 ? 68  ARG A CD   3  
ATOM   9913   N  NE   . ARG A 1 68  ? -2.376  15.832  11.454  1.00 0.00 ? 68  ARG A NE   3  
ATOM   9914   C  CZ   . ARG A 1 68  ? -2.705  16.479  12.539  1.00 0.00 ? 68  ARG A CZ   3  
ATOM   9915   N  NH1  . ARG A 1 68  ? -1.966  16.379  13.610  1.00 0.00 ? 68  ARG A NH1  3  
ATOM   9916   N  NH2  . ARG A 1 68  ? -3.774  17.226  12.552  1.00 0.00 ? 68  ARG A NH2  3  
ATOM   9917   H  H    . ARG A 1 68  ? 1.035   14.417  11.202  1.00 0.00 ? 68  ARG A H    3  
ATOM   9918   H  HA   . ARG A 1 68  ? 0.694   11.462  11.214  1.00 0.00 ? 68  ARG A HA   3  
ATOM   9919   H  HB2  . ARG A 1 68  ? -1.734  12.643  10.274  1.00 0.00 ? 68  ARG A HB2  3  
ATOM   9920   H  HB3  . ARG A 1 68  ? -1.500  11.569  11.650  1.00 0.00 ? 68  ARG A HB3  3  
ATOM   9921   H  HG2  . ARG A 1 68  ? -2.483  13.635  12.453  1.00 0.00 ? 68  ARG A HG2  3  
ATOM   9922   H  HG3  . ARG A 1 68  ? -0.814  13.563  13.013  1.00 0.00 ? 68  ARG A HG3  3  
ATOM   9923   H  HD2  . ARG A 1 68  ? -0.350  15.490  11.948  1.00 0.00 ? 68  ARG A HD2  3  
ATOM   9924   H  HD3  . ARG A 1 68  ? -0.864  14.784  10.415  1.00 0.00 ? 68  ARG A HD3  3  
ATOM   9925   H  HE   . ARG A 1 68  ? -2.931  15.906  10.651  1.00 0.00 ? 68  ARG A HE   3  
ATOM   9926   H  HH11 . ARG A 1 68  ? -1.148  15.804  13.603  1.00 0.00 ? 68  ARG A HH11 3  
ATOM   9927   H  HH12 . ARG A 1 68  ? -2.218  16.878  14.439  1.00 0.00 ? 68  ARG A HH12 3  
ATOM   9928   H  HH21 . ARG A 1 68  ? -4.341  17.303  11.732  1.00 0.00 ? 68  ARG A HH21 3  
ATOM   9929   H  HH22 . ARG A 1 68  ? -4.028  17.722  13.383  1.00 0.00 ? 68  ARG A HH22 3  
ATOM   9930   N  N    . ILE A 1 69  ? 0.437   11.343  8.710   1.00 0.00 ? 69  ILE A N    3  
ATOM   9931   C  CA   . ILE A 1 69  ? 0.588   11.287  7.226   1.00 0.00 ? 69  ILE A CA   3  
ATOM   9932   C  C    . ILE A 1 69  ? -0.517  10.390  6.659   1.00 0.00 ? 69  ILE A C    3  
ATOM   9933   O  O    . ILE A 1 69  ? -0.920  9.429   7.285   1.00 0.00 ? 69  ILE A O    3  
ATOM   9934   C  CB   . ILE A 1 69  ? 1.952   10.699  6.865   1.00 0.00 ? 69  ILE A CB   3  
ATOM   9935   C  CG1  . ILE A 1 69  ? 3.020   11.280  7.795   1.00 0.00 ? 69  ILE A CG1  3  
ATOM   9936   C  CG2  . ILE A 1 69  ? 2.285   11.054  5.415   1.00 0.00 ? 69  ILE A CG2  3  
ATOM   9937   C  CD1  . ILE A 1 69  ? 4.395   10.738  7.398   1.00 0.00 ? 69  ILE A CD1  3  
ATOM   9938   H  H    . ILE A 1 69  ? 0.267   10.516  9.212   1.00 0.00 ? 69  ILE A H    3  
ATOM   9939   H  HA   . ILE A 1 69  ? 0.497   12.282  6.814   1.00 0.00 ? 69  ILE A HA   3  
ATOM   9940   H  HB   . ILE A 1 69  ? 1.922   9.625   6.975   1.00 0.00 ? 69  ILE A HB   3  
ATOM   9941   H  HG12 . ILE A 1 69  ? 3.020   12.359  7.714   1.00 0.00 ? 69  ILE A HG12 3  
ATOM   9942   H  HG13 . ILE A 1 69  ? 2.804   10.996  8.813   1.00 0.00 ? 69  ILE A HG13 3  
ATOM   9943   H  HG21 . ILE A 1 69  ? 1.511   10.673  4.765   1.00 0.00 ? 69  ILE A HG21 3  
ATOM   9944   H  HG22 . ILE A 1 69  ? 3.233   10.613  5.143   1.00 0.00 ? 69  ILE A HG22 3  
ATOM   9945   H  HG23 . ILE A 1 69  ? 2.344   12.127  5.312   1.00 0.00 ? 69  ILE A HG23 3  
ATOM   9946   H  HD11 . ILE A 1 69  ? 4.271   9.917   6.707   1.00 0.00 ? 69  ILE A HD11 3  
ATOM   9947   H  HD12 . ILE A 1 69  ? 4.914   10.393  8.279   1.00 0.00 ? 69  ILE A HD12 3  
ATOM   9948   H  HD13 . ILE A 1 69  ? 4.968   11.522  6.925   1.00 0.00 ? 69  ILE A HD13 3  
ATOM   9949   N  N    . LYS A 1 70  ? -1.024  10.701  5.493   1.00 0.00 ? 70  LYS A N    3  
ATOM   9950   C  CA   . LYS A 1 70  ? -2.121  9.869   4.911   1.00 0.00 ? 70  LYS A CA   3  
ATOM   9951   C  C    . LYS A 1 70  ? -1.661  9.159   3.631   1.00 0.00 ? 70  LYS A C    3  
ATOM   9952   O  O    . LYS A 1 70  ? -0.833  9.653   2.889   1.00 0.00 ? 70  LYS A O    3  
ATOM   9953   C  CB   . LYS A 1 70  ? -3.310  10.772  4.583   1.00 0.00 ? 70  LYS A CB   3  
ATOM   9954   C  CG   . LYS A 1 70  ? -4.088  11.073  5.864   1.00 0.00 ? 70  LYS A CG   3  
ATOM   9955   C  CD   . LYS A 1 70  ? -5.361  11.848  5.518   1.00 0.00 ? 70  LYS A CD   3  
ATOM   9956   C  CE   . LYS A 1 70  ? -5.344  13.202  6.231   1.00 0.00 ? 70  LYS A CE   3  
ATOM   9957   N  NZ   . LYS A 1 70  ? -4.080  13.921  5.902   1.00 0.00 ? 70  LYS A NZ   3  
ATOM   9958   H  H    . LYS A 1 70  ? -0.694  11.490  5.010   1.00 0.00 ? 70  LYS A H    3  
ATOM   9959   H  HA   . LYS A 1 70  ? -2.431  9.129   5.632   1.00 0.00 ? 70  LYS A HA   3  
ATOM   9960   H  HB2  . LYS A 1 70  ? -2.951  11.697  4.153   1.00 0.00 ? 70  LYS A HB2  3  
ATOM   9961   H  HB3  . LYS A 1 70  ? -3.959  10.274  3.878   1.00 0.00 ? 70  LYS A HB3  3  
ATOM   9962   H  HG2  . LYS A 1 70  ? -4.352  10.146  6.352   1.00 0.00 ? 70  LYS A HG2  3  
ATOM   9963   H  HG3  . LYS A 1 70  ? -3.477  11.668  6.526   1.00 0.00 ? 70  LYS A HG3  3  
ATOM   9964   H  HD2  . LYS A 1 70  ? -5.407  12.004  4.449   1.00 0.00 ? 70  LYS A HD2  3  
ATOM   9965   H  HD3  . LYS A 1 70  ? -6.224  11.285  5.837   1.00 0.00 ? 70  LYS A HD3  3  
ATOM   9966   H  HE2  . LYS A 1 70  ? -6.188  13.791  5.906   1.00 0.00 ? 70  LYS A HE2  3  
ATOM   9967   H  HE3  . LYS A 1 70  ? -5.403  13.047  7.297   1.00 0.00 ? 70  LYS A HE3  3  
ATOM   9968   H  HZ1  . LYS A 1 70  ? -3.430  13.866  6.711   1.00 0.00 ? 70  LYS A HZ1  3  
ATOM   9969   H  HZ2  . LYS A 1 70  ? -4.293  14.917  5.694   1.00 0.00 ? 70  LYS A HZ2  3  
ATOM   9970   H  HZ3  . LYS A 1 70  ? -3.636  13.479  5.072   1.00 0.00 ? 70  LYS A HZ3  3  
ATOM   9971   N  N    . THR A 1 71  ? -2.226  8.009   3.363   1.00 0.00 ? 71  THR A N    3  
ATOM   9972   C  CA   . THR A 1 71  ? -1.875  7.247   2.124   1.00 0.00 ? 71  THR A CA   3  
ATOM   9973   C  C    . THR A 1 71  ? -0.367  6.997   2.041   1.00 0.00 ? 71  THR A C    3  
ATOM   9974   O  O    . THR A 1 71  ? 0.307   7.538   1.186   1.00 0.00 ? 71  THR A O    3  
ATOM   9975   C  CB   . THR A 1 71  ? -2.323  8.052   0.902   1.00 0.00 ? 71  THR A CB   3  
ATOM   9976   O  OG1  . THR A 1 71  ? -3.523  8.746   1.212   1.00 0.00 ? 71  THR A OG1  3  
ATOM   9977   C  CG2  . THR A 1 71  ? -2.567  7.111   -0.278  1.00 0.00 ? 71  THR A CG2  3  
ATOM   9978   H  H    . THR A 1 71  ? -2.905  7.652   3.972   1.00 0.00 ? 71  THR A H    3  
ATOM   9979   H  HA   . THR A 1 71  ? -2.392  6.300   2.132   1.00 0.00 ? 71  THR A HA   3  
ATOM   9980   H  HB   . THR A 1 71  ? -1.556  8.763   0.637   1.00 0.00 ? 71  THR A HB   3  
ATOM   9981   H  HG1  . THR A 1 71  ? -3.323  9.396   1.891   1.00 0.00 ? 71  THR A HG1  3  
ATOM   9982   H  HG21 . THR A 1 71  ? -2.282  7.604   -1.196  1.00 0.00 ? 71  THR A HG21 3  
ATOM   9983   H  HG22 . THR A 1 71  ? -3.616  6.850   -0.322  1.00 0.00 ? 71  THR A HG22 3  
ATOM   9984   H  HG23 . THR A 1 71  ? -1.978  6.215   -0.153  1.00 0.00 ? 71  THR A HG23 3  
ATOM   9985   N  N    . VAL A 1 72  ? 0.168   6.169   2.900   1.00 0.00 ? 72  VAL A N    3  
ATOM   9986   C  CA   . VAL A 1 72  ? 1.629   5.871   2.845   1.00 0.00 ? 72  VAL A CA   3  
ATOM   9987   C  C    . VAL A 1 72  ? 1.831   4.401   2.470   1.00 0.00 ? 72  VAL A C    3  
ATOM   9988   O  O    . VAL A 1 72  ? 2.938   3.947   2.251   1.00 0.00 ? 72  VAL A O    3  
ATOM   9989   C  CB   . VAL A 1 72  ? 2.252   6.139   4.215   1.00 0.00 ? 72  VAL A CB   3  
ATOM   9990   C  CG1  . VAL A 1 72  ? 2.133   7.629   4.544   1.00 0.00 ? 72  VAL A CG1  3  
ATOM   9991   C  CG2  . VAL A 1 72  ? 1.513   5.321   5.275   1.00 0.00 ? 72  VAL A CG2  3  
ATOM   9992   H  H    . VAL A 1 72  ? -0.383  5.719   3.575   1.00 0.00 ? 72  VAL A H    3  
ATOM   9993   H  HA   . VAL A 1 72  ? 2.101   6.495   2.107   1.00 0.00 ? 72  VAL A HA   3  
ATOM   9994   H  HB   . VAL A 1 72  ? 3.295   5.856   4.199   1.00 0.00 ? 72  VAL A HB   3  
ATOM   9995   H  HG11 . VAL A 1 72  ? 2.796   8.192   3.905   1.00 0.00 ? 72  VAL A HG11 3  
ATOM   9996   H  HG12 . VAL A 1 72  ? 2.402   7.792   5.577   1.00 0.00 ? 72  VAL A HG12 3  
ATOM   9997   H  HG13 . VAL A 1 72  ? 1.116   7.953   4.381   1.00 0.00 ? 72  VAL A HG13 3  
ATOM   9998   H  HG21 . VAL A 1 72  ? 1.209   5.969   6.083   1.00 0.00 ? 72  VAL A HG21 3  
ATOM   9999   H  HG22 . VAL A 1 72  ? 2.167   4.551   5.656   1.00 0.00 ? 72  VAL A HG22 3  
ATOM   10000  H  HG23 . VAL A 1 72  ? 0.640   4.864   4.833   1.00 0.00 ? 72  VAL A HG23 3  
ATOM   10001  N  N    . GLU A 1 73  ? 0.768   3.649   2.410   1.00 0.00 ? 73  GLU A N    3  
ATOM   10002  C  CA   . GLU A 1 73  ? 0.886   2.204   2.070   1.00 0.00 ? 73  GLU A CA   3  
ATOM   10003  C  C    . GLU A 1 73  ? 1.312   2.029   0.608   1.00 0.00 ? 73  GLU A C    3  
ATOM   10004  O  O    . GLU A 1 73  ? 2.049   1.124   0.274   1.00 0.00 ? 73  GLU A O    3  
ATOM   10005  C  CB   . GLU A 1 73  ? -0.467  1.524   2.290   1.00 0.00 ? 73  GLU A CB   3  
ATOM   10006  C  CG   . GLU A 1 73  ? -1.575  2.373   1.662   1.00 0.00 ? 73  GLU A CG   3  
ATOM   10007  C  CD   . GLU A 1 73  ? -2.878  1.572   1.634   1.00 0.00 ? 73  GLU A CD   3  
ATOM   10008  O  OE1  . GLU A 1 73  ? -3.246  1.040   2.667   1.00 0.00 ? 73  GLU A OE1  3  
ATOM   10009  O  OE2  . GLU A 1 73  ? -3.485  1.505   0.577   1.00 0.00 ? 73  GLU A OE2  3  
ATOM   10010  H  H    . GLU A 1 73  ? -0.112  4.034   2.601   1.00 0.00 ? 73  GLU A H    3  
ATOM   10011  H  HA   . GLU A 1 73  ? 1.622   1.745   2.712   1.00 0.00 ? 73  GLU A HA   3  
ATOM   10012  H  HB2  . GLU A 1 73  ? -0.457  0.545   1.832   1.00 0.00 ? 73  GLU A HB2  3  
ATOM   10013  H  HB3  . GLU A 1 73  ? -0.650  1.423   3.349   1.00 0.00 ? 73  GLU A HB3  3  
ATOM   10014  H  HG2  . GLU A 1 73  ? -1.717  3.270   2.247   1.00 0.00 ? 73  GLU A HG2  3  
ATOM   10015  H  HG3  . GLU A 1 73  ? -1.298  2.641   0.655   1.00 0.00 ? 73  GLU A HG3  3  
ATOM   10016  N  N    . HIS A 1 74  ? 0.846   2.874   -0.269  1.00 0.00 ? 74  HIS A N    3  
ATOM   10017  C  CA   . HIS A 1 74  ? 1.217   2.737   -1.706  1.00 0.00 ? 74  HIS A CA   3  
ATOM   10018  C  C    . HIS A 1 74  ? 2.740   2.814   -1.867  1.00 0.00 ? 74  HIS A C    3  
ATOM   10019  O  O    . HIS A 1 74  ? 3.372   1.888   -2.351  1.00 0.00 ? 74  HIS A O    3  
ATOM   10020  C  CB   . HIS A 1 74  ? 0.550   3.855   -2.506  1.00 0.00 ? 74  HIS A CB   3  
ATOM   10021  C  CG   . HIS A 1 74  ? -0.891  3.494   -2.752  1.00 0.00 ? 74  HIS A CG   3  
ATOM   10022  N  ND1  . HIS A 1 74  ? -1.703  4.220   -3.611  1.00 0.00 ? 74  HIS A ND1  3  
ATOM   10023  C  CD2  . HIS A 1 74  ? -1.678  2.482   -2.258  1.00 0.00 ? 74  HIS A CD2  3  
ATOM   10024  C  CE1  . HIS A 1 74  ? -2.918  3.639   -3.609  1.00 0.00 ? 74  HIS A CE1  3  
ATOM   10025  N  NE2  . HIS A 1 74  ? -2.957  2.574   -2.800  1.00 0.00 ? 74  HIS A NE2  3  
ATOM   10026  H  H    . HIS A 1 74  ? 0.243   3.593   0.014   1.00 0.00 ? 74  HIS A H    3  
ATOM   10027  H  HA   . HIS A 1 74  ? 0.870   1.782   -2.073  1.00 0.00 ? 74  HIS A HA   3  
ATOM   10028  H  HB2  . HIS A 1 74  ? 0.603   4.778   -1.949  1.00 0.00 ? 74  HIS A HB2  3  
ATOM   10029  H  HB3  . HIS A 1 74  ? 1.057   3.974   -3.450  1.00 0.00 ? 74  HIS A HB3  3  
ATOM   10030  H  HD1  . HIS A 1 74  ? -1.440  5.012   -4.124  1.00 0.00 ? 74  HIS A HD1  3  
ATOM   10031  H  HD2  . HIS A 1 74  ? -1.355  1.731   -1.552  1.00 0.00 ? 74  HIS A HD2  3  
ATOM   10032  H  HE1  . HIS A 1 74  ? -3.761  3.990   -4.191  1.00 0.00 ? 74  HIS A HE1  3  
ATOM   10033  N  N    . ILE A 1 75  ? 3.344   3.901   -1.472  1.00 0.00 ? 75  ILE A N    3  
ATOM   10034  C  CA   . ILE A 1 75  ? 4.823   4.007   -1.616  1.00 0.00 ? 75  ILE A CA   3  
ATOM   10035  C  C    . ILE A 1 75  ? 5.482   2.844   -0.873  1.00 0.00 ? 75  ILE A C    3  
ATOM   10036  O  O    . ILE A 1 75  ? 6.418   2.239   -1.357  1.00 0.00 ? 75  ILE A O    3  
ATOM   10037  C  CB   . ILE A 1 75  ? 5.313   5.344   -1.045  1.00 0.00 ? 75  ILE A CB   3  
ATOM   10038  C  CG1  . ILE A 1 75  ? 6.803   5.518   -1.357  1.00 0.00 ? 75  ILE A CG1  3  
ATOM   10039  C  CG2  . ILE A 1 75  ? 5.108   5.377   0.470   1.00 0.00 ? 75  ILE A CG2  3  
ATOM   10040  C  CD1  . ILE A 1 75  ? 6.966   6.160   -2.736  1.00 0.00 ? 75  ILE A CD1  3  
ATOM   10041  H  H    . ILE A 1 75  ? 2.829   4.640   -1.084  1.00 0.00 ? 75  ILE A H    3  
ATOM   10042  H  HA   . ILE A 1 75  ? 5.081   3.951   -2.664  1.00 0.00 ? 75  ILE A HA   3  
ATOM   10043  H  HB   . ILE A 1 75  ? 4.755   6.152   -1.498  1.00 0.00 ? 75  ILE A HB   3  
ATOM   10044  H  HG12 . ILE A 1 75  ? 7.255   6.153   -0.609  1.00 0.00 ? 75  ILE A HG12 3  
ATOM   10045  H  HG13 . ILE A 1 75  ? 7.289   4.554   -1.352  1.00 0.00 ? 75  ILE A HG13 3  
ATOM   10046  H  HG21 . ILE A 1 75  ? 5.365   6.356   0.846   1.00 0.00 ? 75  ILE A HG21 3  
ATOM   10047  H  HG22 . ILE A 1 75  ? 5.740   4.636   0.936   1.00 0.00 ? 75  ILE A HG22 3  
ATOM   10048  H  HG23 . ILE A 1 75  ? 4.075   5.164   0.697   1.00 0.00 ? 75  ILE A HG23 3  
ATOM   10049  H  HD11 . ILE A 1 75  ? 7.902   5.841   -3.173  1.00 0.00 ? 75  ILE A HD11 3  
ATOM   10050  H  HD12 . ILE A 1 75  ? 6.964   7.235   -2.635  1.00 0.00 ? 75  ILE A HD12 3  
ATOM   10051  H  HD13 . ILE A 1 75  ? 6.150   5.857   -3.374  1.00 0.00 ? 75  ILE A HD13 3  
ATOM   10052  N  N    . LEU A 1 76  ? 5.004   2.521   0.300   1.00 0.00 ? 76  LEU A N    3  
ATOM   10053  C  CA   . LEU A 1 76  ? 5.613   1.395   1.062   1.00 0.00 ? 76  LEU A CA   3  
ATOM   10054  C  C    . LEU A 1 76  ? 5.489   0.102   0.249   1.00 0.00 ? 76  LEU A C    3  
ATOM   10055  O  O    . LEU A 1 76  ? 6.364   -0.740  0.270   1.00 0.00 ? 76  LEU A O    3  
ATOM   10056  C  CB   . LEU A 1 76  ? 4.890   1.227   2.403   1.00 0.00 ? 76  LEU A CB   3  
ATOM   10057  C  CG   . LEU A 1 76  ? 5.525   2.142   3.456   1.00 0.00 ? 76  LEU A CG   3  
ATOM   10058  C  CD1  . LEU A 1 76  ? 4.494   2.466   4.539   1.00 0.00 ? 76  LEU A CD1  3  
ATOM   10059  C  CD2  . LEU A 1 76  ? 6.721   1.435   4.098   1.00 0.00 ? 76  LEU A CD2  3  
ATOM   10060  H  H    . LEU A 1 76  ? 4.250   3.020   0.682   1.00 0.00 ? 76  LEU A H    3  
ATOM   10061  H  HA   . LEU A 1 76  ? 6.656   1.605   1.240   1.00 0.00 ? 76  LEU A HA   3  
ATOM   10062  H  HB2  . LEU A 1 76  ? 3.848   1.489   2.283   1.00 0.00 ? 76  LEU A HB2  3  
ATOM   10063  H  HB3  . LEU A 1 76  ? 4.967   0.201   2.728   1.00 0.00 ? 76  LEU A HB3  3  
ATOM   10064  H  HG   . LEU A 1 76  ? 5.854   3.058   2.986   1.00 0.00 ? 76  LEU A HG   3  
ATOM   10065  H  HD11 . LEU A 1 76  ? 3.853   1.610   4.693   1.00 0.00 ? 76  LEU A HD11 3  
ATOM   10066  H  HD12 . LEU A 1 76  ? 3.899   3.311   4.229   1.00 0.00 ? 76  LEU A HD12 3  
ATOM   10067  H  HD13 . LEU A 1 76  ? 5.004   2.704   5.460   1.00 0.00 ? 76  LEU A HD13 3  
ATOM   10068  H  HD21 . LEU A 1 76  ? 6.374   0.580   4.659   1.00 0.00 ? 76  LEU A HD21 3  
ATOM   10069  H  HD22 . LEU A 1 76  ? 7.227   2.119   4.764   1.00 0.00 ? 76  LEU A HD22 3  
ATOM   10070  H  HD23 . LEU A 1 76  ? 7.405   1.109   3.330   1.00 0.00 ? 76  LEU A HD23 3  
ATOM   10071  N  N    . SER A 1 77  ? 4.408   -0.067  -0.466  1.00 0.00 ? 77  SER A N    3  
ATOM   10072  C  CA   . SER A 1 77  ? 4.237   -1.309  -1.274  1.00 0.00 ? 77  SER A CA   3  
ATOM   10073  C  C    . SER A 1 77  ? 5.365   -1.411  -2.302  1.00 0.00 ? 77  SER A C    3  
ATOM   10074  O  O    . SER A 1 77  ? 5.988   -2.443  -2.447  1.00 0.00 ? 77  SER A O    3  
ATOM   10075  C  CB   . SER A 1 77  ? 2.889   -1.279  -1.997  1.00 0.00 ? 77  SER A CB   3  
ATOM   10076  O  OG   . SER A 1 77  ? 2.872   -2.287  -2.998  1.00 0.00 ? 77  SER A OG   3  
ATOM   10077  H  H    . SER A 1 77  ? 3.710   0.621   -0.471  1.00 0.00 ? 77  SER A H    3  
ATOM   10078  H  HA   . SER A 1 77  ? 4.276   -2.167  -0.621  1.00 0.00 ? 77  SER A HA   3  
ATOM   10079  H  HB2  . SER A 1 77  ? 2.097   -1.467  -1.293  1.00 0.00 ? 77  SER A HB2  3  
ATOM   10080  H  HB3  . SER A 1 77  ? 2.745   -0.307  -2.448  1.00 0.00 ? 77  SER A HB3  3  
ATOM   10081  H  HG   . SER A 1 77  ? 2.427   -3.058  -2.637  1.00 0.00 ? 77  SER A HG   3  
ATOM   10082  N  N    . VAL A 1 78  ? 5.646   -0.351  -3.010  1.00 0.00 ? 78  VAL A N    3  
ATOM   10083  C  CA   . VAL A 1 78  ? 6.751   -0.415  -4.011  1.00 0.00 ? 78  VAL A CA   3  
ATOM   10084  C  C    . VAL A 1 78  ? 8.049   -0.783  -3.286  1.00 0.00 ? 78  VAL A C    3  
ATOM   10085  O  O    . VAL A 1 78  ? 8.747   -1.703  -3.664  1.00 0.00 ? 78  VAL A O    3  
ATOM   10086  C  CB   . VAL A 1 78  ? 6.916   0.946   -4.695  1.00 0.00 ? 78  VAL A CB   3  
ATOM   10087  C  CG1  . VAL A 1 78  ? 8.248   0.980   -5.446  1.00 0.00 ? 78  VAL A CG1  3  
ATOM   10088  C  CG2  . VAL A 1 78  ? 5.766   1.187   -5.685  1.00 0.00 ? 78  VAL A CG2  3  
ATOM   10089  H  H    . VAL A 1 78  ? 5.143   0.483   -2.875  1.00 0.00 ? 78  VAL A H    3  
ATOM   10090  H  HA   . VAL A 1 78  ? 6.529   -1.173  -4.748  1.00 0.00 ? 78  VAL A HA   3  
ATOM   10091  H  HB   . VAL A 1 78  ? 6.911   1.724   -3.944  1.00 0.00 ? 78  VAL A HB   3  
ATOM   10092  H  HG11 . VAL A 1 78  ? 8.219   1.757   -6.196  1.00 0.00 ? 78  VAL A HG11 3  
ATOM   10093  H  HG12 . VAL A 1 78  ? 8.419   0.026   -5.921  1.00 0.00 ? 78  VAL A HG12 3  
ATOM   10094  H  HG13 . VAL A 1 78  ? 9.048   1.185   -4.749  1.00 0.00 ? 78  VAL A HG13 3  
ATOM   10095  H  HG21 . VAL A 1 78  ? 6.163   1.589   -6.605  1.00 0.00 ? 78  VAL A HG21 3  
ATOM   10096  H  HG22 . VAL A 1 78  ? 5.067   1.889   -5.259  1.00 0.00 ? 78  VAL A HG22 3  
ATOM   10097  H  HG23 . VAL A 1 78  ? 5.258   0.255   -5.891  1.00 0.00 ? 78  VAL A HG23 3  
ATOM   10098  N  N    . LEU A 1 79  ? 8.370   -0.068  -2.245  1.00 0.00 ? 79  LEU A N    3  
ATOM   10099  C  CA   . LEU A 1 79  ? 9.617   -0.367  -1.488  1.00 0.00 ? 79  LEU A CA   3  
ATOM   10100  C  C    . LEU A 1 79  ? 9.653   -1.857  -1.134  1.00 0.00 ? 79  LEU A C    3  
ATOM   10101  O  O    . LEU A 1 79  ? 10.665  -2.514  -1.271  1.00 0.00 ? 79  LEU A O    3  
ATOM   10102  C  CB   . LEU A 1 79  ? 9.636   0.462   -0.203  1.00 0.00 ? 79  LEU A CB   3  
ATOM   10103  C  CG   . LEU A 1 79  ? 9.560   1.952   -0.549  1.00 0.00 ? 79  LEU A CG   3  
ATOM   10104  C  CD1  . LEU A 1 79  ? 9.296   2.758   0.725   1.00 0.00 ? 79  LEU A CD1  3  
ATOM   10105  C  CD2  . LEU A 1 79  ? 10.883  2.406   -1.174  1.00 0.00 ? 79  LEU A CD2  3  
ATOM   10106  H  H    . LEU A 1 79  ? 7.788   0.670   -1.970  1.00 0.00 ? 79  LEU A H    3  
ATOM   10107  H  HA   . LEU A 1 79  ? 10.476  -0.119  -2.091  1.00 0.00 ? 79  LEU A HA   3  
ATOM   10108  H  HB2  . LEU A 1 79  ? 8.788   0.191   0.406   1.00 0.00 ? 79  LEU A HB2  3  
ATOM   10109  H  HB3  . LEU A 1 79  ? 10.544  0.264   0.342   1.00 0.00 ? 79  LEU A HB3  3  
ATOM   10110  H  HG   . LEU A 1 79  ? 8.753   2.116   -1.250  1.00 0.00 ? 79  LEU A HG   3  
ATOM   10111  H  HD11 . LEU A 1 79  ? 8.316   3.208   0.669   1.00 0.00 ? 79  LEU A HD11 3  
ATOM   10112  H  HD12 . LEU A 1 79  ? 10.043  3.530   0.822   1.00 0.00 ? 79  LEU A HD12 3  
ATOM   10113  H  HD13 . LEU A 1 79  ? 9.343   2.101   1.581   1.00 0.00 ? 79  LEU A HD13 3  
ATOM   10114  H  HD21 . LEU A 1 79  ? 10.904  2.125   -2.217  1.00 0.00 ? 79  LEU A HD21 3  
ATOM   10115  H  HD22 . LEU A 1 79  ? 11.708  1.938   -0.658  1.00 0.00 ? 79  LEU A HD22 3  
ATOM   10116  H  HD23 . LEU A 1 79  ? 10.969  3.479   -1.090  1.00 0.00 ? 79  LEU A HD23 3  
ATOM   10117  N  N    . HIS A 1 80  ? 8.554   -2.391  -0.681  1.00 0.00 ? 80  HIS A N    3  
ATOM   10118  C  CA   . HIS A 1 80  ? 8.511   -3.837  -0.314  1.00 0.00 ? 80  HIS A CA   3  
ATOM   10119  C  C    . HIS A 1 80  ? 8.938   -4.690  -1.512  1.00 0.00 ? 80  HIS A C    3  
ATOM   10120  O  O    . HIS A 1 80  ? 9.870   -5.466  -1.435  1.00 0.00 ? 80  HIS A O    3  
ATOM   10121  C  CB   . HIS A 1 80  ? 7.079   -4.200  0.078   1.00 0.00 ? 80  HIS A CB   3  
ATOM   10122  C  CG   . HIS A 1 80  ? 7.040   -5.568  0.708   1.00 0.00 ? 80  HIS A CG   3  
ATOM   10123  N  ND1  . HIS A 1 80  ? 5.867   -6.110  1.211   1.00 0.00 ? 80  HIS A ND1  3  
ATOM   10124  C  CD2  . HIS A 1 80  ? 8.010   -6.519  0.916   1.00 0.00 ? 80  HIS A CD2  3  
ATOM   10125  C  CE1  . HIS A 1 80  ? 6.156   -7.334  1.689   1.00 0.00 ? 80  HIS A CE1  3  
ATOM   10126  N  NE2  . HIS A 1 80  ? 7.448   -7.633  1.535   1.00 0.00 ? 80  HIS A NE2  3  
ATOM   10127  H  H    . HIS A 1 80  ? 7.750   -1.840  -0.577  1.00 0.00 ? 80  HIS A H    3  
ATOM   10128  H  HA   . HIS A 1 80  ? 9.172   -4.021  0.519   1.00 0.00 ? 80  HIS A HA   3  
ATOM   10129  H  HB2  . HIS A 1 80  ? 6.708   -3.471  0.780   1.00 0.00 ? 80  HIS A HB2  3  
ATOM   10130  H  HB3  . HIS A 1 80  ? 6.455   -4.196  -0.803  1.00 0.00 ? 80  HIS A HB3  3  
ATOM   10131  H  HD1  . HIS A 1 80  ? 4.988   -5.678  1.219   1.00 0.00 ? 80  HIS A HD1  3  
ATOM   10132  H  HD2  . HIS A 1 80  ? 9.049   -6.418  0.645   1.00 0.00 ? 80  HIS A HD2  3  
ATOM   10133  H  HE1  . HIS A 1 80  ? 5.431   -7.995  2.143   1.00 0.00 ? 80  HIS A HE1  3  
ATOM   10134  N  N    . LEU A 1 81  ? 8.253   -4.560  -2.614  1.00 0.00 ? 81  LEU A N    3  
ATOM   10135  C  CA   . LEU A 1 81  ? 8.601   -5.368  -3.816  1.00 0.00 ? 81  LEU A CA   3  
ATOM   10136  C  C    . LEU A 1 81  ? 10.062  -5.136  -4.212  1.00 0.00 ? 81  LEU A C    3  
ATOM   10137  O  O    . LEU A 1 81  ? 10.748  -6.045  -4.633  1.00 0.00 ? 81  LEU A O    3  
ATOM   10138  C  CB   . LEU A 1 81  ? 7.689   -4.964  -4.978  1.00 0.00 ? 81  LEU A CB   3  
ATOM   10139  C  CG   . LEU A 1 81  ? 6.228   -5.035  -4.531  1.00 0.00 ? 81  LEU A CG   3  
ATOM   10140  C  CD1  . LEU A 1 81  ? 5.318   -4.610  -5.686  1.00 0.00 ? 81  LEU A CD1  3  
ATOM   10141  C  CD2  . LEU A 1 81  ? 5.890   -6.469  -4.117  1.00 0.00 ? 81  LEU A CD2  3  
ATOM   10142  H  H    . LEU A 1 81  ? 7.499   -3.933  -2.649  1.00 0.00 ? 81  LEU A H    3  
ATOM   10143  H  HA   . LEU A 1 81  ? 8.453   -6.415  -3.598  1.00 0.00 ? 81  LEU A HA   3  
ATOM   10144  H  HB2  . LEU A 1 81  ? 7.924   -3.954  -5.283  1.00 0.00 ? 81  LEU A HB2  3  
ATOM   10145  H  HB3  . LEU A 1 81  ? 7.843   -5.635  -5.808  1.00 0.00 ? 81  LEU A HB3  3  
ATOM   10146  H  HG   . LEU A 1 81  ? 6.076   -4.371  -3.693  1.00 0.00 ? 81  LEU A HG   3  
ATOM   10147  H  HD11 . LEU A 1 81  ? 4.874   -5.487  -6.137  1.00 0.00 ? 81  LEU A HD11 3  
ATOM   10148  H  HD12 . LEU A 1 81  ? 5.898   -4.080  -6.426  1.00 0.00 ? 81  LEU A HD12 3  
ATOM   10149  H  HD13 . LEU A 1 81  ? 4.536   -3.965  -5.311  1.00 0.00 ? 81  LEU A HD13 3  
ATOM   10150  H  HD21 . LEU A 1 81  ? 6.086   -6.595  -3.062  1.00 0.00 ? 81  LEU A HD21 3  
ATOM   10151  H  HD22 . LEU A 1 81  ? 6.500   -7.160  -4.681  1.00 0.00 ? 81  LEU A HD22 3  
ATOM   10152  H  HD23 . LEU A 1 81  ? 4.846   -6.665  -4.315  1.00 0.00 ? 81  LEU A HD23 3  
ATOM   10153  N  N    . LEU A 1 82  ? 10.541  -3.927  -4.105  1.00 0.00 ? 82  LEU A N    3  
ATOM   10154  C  CA   . LEU A 1 82  ? 11.952  -3.653  -4.504  1.00 0.00 ? 82  LEU A CA   3  
ATOM   10155  C  C    . LEU A 1 82  ? 12.920  -4.083  -3.398  1.00 0.00 ? 82  LEU A C    3  
ATOM   10156  O  O    . LEU A 1 82  ? 14.122  -3.962  -3.538  1.00 0.00 ? 82  LEU A O    3  
ATOM   10157  C  CB   . LEU A 1 82  ? 12.116  -2.157  -4.784  1.00 0.00 ? 82  LEU A CB   3  
ATOM   10158  C  CG   . LEU A 1 82  ? 11.747  -1.871  -6.244  1.00 0.00 ? 82  LEU A CG   3  
ATOM   10159  C  CD1  . LEU A 1 82  ? 11.707  -0.359  -6.482  1.00 0.00 ? 82  LEU A CD1  3  
ATOM   10160  C  CD2  . LEU A 1 82  ? 12.791  -2.500  -7.173  1.00 0.00 ? 82  LEU A CD2  3  
ATOM   10161  H  H    . LEU A 1 82  ? 9.971   -3.197  -3.782  1.00 0.00 ? 82  LEU A H    3  
ATOM   10162  H  HA   . LEU A 1 82  ? 12.176  -4.207  -5.403  1.00 0.00 ? 82  LEU A HA   3  
ATOM   10163  H  HB2  . LEU A 1 82  ? 11.464  -1.598  -4.129  1.00 0.00 ? 82  LEU A HB2  3  
ATOM   10164  H  HB3  . LEU A 1 82  ? 13.140  -1.867  -4.608  1.00 0.00 ? 82  LEU A HB3  3  
ATOM   10165  H  HG   . LEU A 1 82  ? 10.774  -2.292  -6.457  1.00 0.00 ? 82  LEU A HG   3  
ATOM   10166  H  HD11 . LEU A 1 82  ? 11.366  0.140   -5.588  1.00 0.00 ? 82  LEU A HD11 3  
ATOM   10167  H  HD12 . LEU A 1 82  ? 11.030  -0.142  -7.294  1.00 0.00 ? 82  LEU A HD12 3  
ATOM   10168  H  HD13 . LEU A 1 82  ? 12.696  -0.009  -6.736  1.00 0.00 ? 82  LEU A HD13 3  
ATOM   10169  H  HD21 . LEU A 1 82  ? 12.340  -3.310  -7.726  1.00 0.00 ? 82  LEU A HD21 3  
ATOM   10170  H  HD22 . LEU A 1 82  ? 13.615  -2.880  -6.587  1.00 0.00 ? 82  LEU A HD22 3  
ATOM   10171  H  HD23 . LEU A 1 82  ? 13.154  -1.753  -7.864  1.00 0.00 ? 82  LEU A HD23 3  
ATOM   10172  N  N    . GLU A 1 83  ? 12.422  -4.589  -2.302  1.00 0.00 ? 83  GLU A N    3  
ATOM   10173  C  CA   . GLU A 1 83  ? 13.330  -5.028  -1.202  1.00 0.00 ? 83  GLU A CA   3  
ATOM   10174  C  C    . GLU A 1 83  ? 14.166  -3.845  -0.709  1.00 0.00 ? 83  GLU A C    3  
ATOM   10175  O  O    . GLU A 1 83  ? 15.348  -3.972  -0.455  1.00 0.00 ? 83  GLU A O    3  
ATOM   10176  C  CB   . GLU A 1 83  ? 14.261  -6.134  -1.707  1.00 0.00 ? 83  GLU A CB   3  
ATOM   10177  C  CG   . GLU A 1 83  ? 13.553  -6.948  -2.792  1.00 0.00 ? 83  GLU A CG   3  
ATOM   10178  C  CD   . GLU A 1 83  ? 14.125  -8.366  -2.822  1.00 0.00 ? 83  GLU A CD   3  
ATOM   10179  O  OE1  . GLU A 1 83  ? 13.637  -9.196  -2.071  1.00 0.00 ? 83  GLU A OE1  3  
ATOM   10180  O  OE2  . GLU A 1 83  ? 15.041  -8.598  -3.593  1.00 0.00 ? 83  GLU A OE2  3  
ATOM   10181  H  H    . GLU A 1 83  ? 11.453  -4.687  -2.191  1.00 0.00 ? 83  GLU A H    3  
ATOM   10182  H  HA   . GLU A 1 83  ? 12.738  -5.409  -0.384  1.00 0.00 ? 83  GLU A HA   3  
ATOM   10183  H  HB2  . GLU A 1 83  ? 15.159  -5.692  -2.114  1.00 0.00 ? 83  GLU A HB2  3  
ATOM   10184  H  HB3  . GLU A 1 83  ? 14.522  -6.785  -0.886  1.00 0.00 ? 83  GLU A HB3  3  
ATOM   10185  H  HG2  . GLU A 1 83  ? 12.494  -6.990  -2.577  1.00 0.00 ? 83  GLU A HG2  3  
ATOM   10186  H  HG3  . GLU A 1 83  ? 13.708  -6.479  -3.752  1.00 0.00 ? 83  GLU A HG3  3  
ATOM   10187  N  N    . ILE A 1 84  ? 13.561  -2.700  -0.557  1.00 0.00 ? 84  ILE A N    3  
ATOM   10188  C  CA   . ILE A 1 84  ? 14.321  -1.515  -0.065  1.00 0.00 ? 84  ILE A CA   3  
ATOM   10189  C  C    . ILE A 1 84  ? 14.268  -1.515  1.466   1.00 0.00 ? 84  ILE A C    3  
ATOM   10190  O  O    . ILE A 1 84  ? 13.206  -1.595  2.052   1.00 0.00 ? 84  ILE A O    3  
ATOM   10191  C  CB   . ILE A 1 84  ? 13.683  -0.231  -0.610  1.00 0.00 ? 84  ILE A CB   3  
ATOM   10192  C  CG1  . ILE A 1 84  ? 13.488  -0.341  -2.128  1.00 0.00 ? 84  ILE A CG1  3  
ATOM   10193  C  CG2  . ILE A 1 84  ? 14.587  0.961   -0.308  1.00 0.00 ? 84  ILE A CG2  3  
ATOM   10194  C  CD1  . ILE A 1 84  ? 14.788  0.031   -2.844  1.00 0.00 ? 84  ILE A CD1  3  
ATOM   10195  H  H    . ILE A 1 84  ? 12.606  -2.620  -0.758  1.00 0.00 ? 84  ILE A H    3  
ATOM   10196  H  HA   . ILE A 1 84  ? 15.348  -1.582  -0.394  1.00 0.00 ? 84  ILE A HA   3  
ATOM   10197  H  HB   . ILE A 1 84  ? 12.726  -0.082  -0.134  1.00 0.00 ? 84  ILE A HB   3  
ATOM   10198  H  HG12 . ILE A 1 84  ? 13.210  -1.350  -2.388  1.00 0.00 ? 84  ILE A HG12 3  
ATOM   10199  H  HG13 . ILE A 1 84  ? 12.705  0.337   -2.437  1.00 0.00 ? 84  ILE A HG13 3  
ATOM   10200  H  HG21 . ILE A 1 84  ? 14.346  1.773   -0.978  1.00 0.00 ? 84  ILE A HG21 3  
ATOM   10201  H  HG22 . ILE A 1 84  ? 15.620  0.676   -0.444  1.00 0.00 ? 84  ILE A HG22 3  
ATOM   10202  H  HG23 . ILE A 1 84  ? 14.429  1.277   0.712   1.00 0.00 ? 84  ILE A HG23 3  
ATOM   10203  H  HD11 . ILE A 1 84  ? 14.903  1.105   -2.847  1.00 0.00 ? 84  ILE A HD11 3  
ATOM   10204  H  HD12 . ILE A 1 84  ? 14.752  -0.329  -3.861  1.00 0.00 ? 84  ILE A HD12 3  
ATOM   10205  H  HD13 . ILE A 1 84  ? 15.624  -0.419  -2.332  1.00 0.00 ? 84  ILE A HD13 3  
ATOM   10206  N  N    . THR A 1 85  ? 15.401  -1.463  2.122   1.00 0.00 ? 85  THR A N    3  
ATOM   10207  C  CA   . THR A 1 85  ? 15.391  -1.504  3.615   1.00 0.00 ? 85  THR A CA   3  
ATOM   10208  C  C    . THR A 1 85  ? 15.703  -0.132  4.216   1.00 0.00 ? 85  THR A C    3  
ATOM   10209  O  O    . THR A 1 85  ? 14.832  0.539   4.734   1.00 0.00 ? 85  THR A O    3  
ATOM   10210  C  CB   . THR A 1 85  ? 16.440  -2.509  4.096   1.00 0.00 ? 85  THR A CB   3  
ATOM   10211  O  OG1  . THR A 1 85  ? 17.634  -2.345  3.343   1.00 0.00 ? 85  THR A OG1  3  
ATOM   10212  C  CG2  . THR A 1 85  ? 15.909  -3.931  3.912   1.00 0.00 ? 85  THR A CG2  3  
ATOM   10213  H  H    . THR A 1 85  ? 16.249  -1.429  1.630   1.00 0.00 ? 85  THR A H    3  
ATOM   10214  H  HA   . THR A 1 85  ? 14.419  -1.825  3.956   1.00 0.00 ? 85  THR A HA   3  
ATOM   10215  H  HB   . THR A 1 85  ? 16.648  -2.339  5.142   1.00 0.00 ? 85  THR A HB   3  
ATOM   10216  H  HG1  . THR A 1 85  ? 17.388  -2.221  2.423   1.00 0.00 ? 85  THR A HG1  3  
ATOM   10217  H  HG21 . THR A 1 85  ? 15.333  -4.215  4.780   1.00 0.00 ? 85  THR A HG21 3  
ATOM   10218  H  HG22 . THR A 1 85  ? 16.737  -4.612  3.792   1.00 0.00 ? 85  THR A HG22 3  
ATOM   10219  H  HG23 . THR A 1 85  ? 15.279  -3.968  3.035   1.00 0.00 ? 85  THR A HG23 3  
ATOM   10220  N  N    . ASN A 1 86  ? 16.945  0.264   4.210   1.00 0.00 ? 86  ASN A N    3  
ATOM   10221  C  CA   . ASN A 1 86  ? 17.318  1.563   4.849   1.00 0.00 ? 86  ASN A CA   3  
ATOM   10222  C  C    . ASN A 1 86  ? 17.042  2.750   3.926   1.00 0.00 ? 86  ASN A C    3  
ATOM   10223  O  O    . ASN A 1 86  ? 17.687  2.929   2.912   1.00 0.00 ? 86  ASN A O    3  
ATOM   10224  C  CB   . ASN A 1 86  ? 18.811  1.527   5.179   1.00 0.00 ? 86  ASN A CB   3  
ATOM   10225  C  CG   . ASN A 1 86  ? 19.110  0.300   6.040   1.00 0.00 ? 86  ASN A CG   3  
ATOM   10226  O  OD1  . ASN A 1 86  ? 18.542  0.137   7.101   1.00 0.00 ? 86  ASN A OD1  3  
ATOM   10227  N  ND2  . ASN A 1 86  ? 19.980  -0.578  5.624   1.00 0.00 ? 86  ASN A ND2  3  
ATOM   10228  H  H    . ASN A 1 86  ? 17.645  -0.317  3.847   1.00 0.00 ? 86  ASN A H    3  
ATOM   10229  H  HA   . ASN A 1 86  ? 16.760  1.684   5.764   1.00 0.00 ? 86  ASN A HA   3  
ATOM   10230  H  HB2  . ASN A 1 86  ? 19.379  1.472   4.262   1.00 0.00 ? 86  ASN A HB2  3  
ATOM   10231  H  HB3  . ASN A 1 86  ? 19.084  2.420   5.718   1.00 0.00 ? 86  ASN A HB3  3  
ATOM   10232  H  HD21 . ASN A 1 86  ? 20.435  -0.449  4.766   1.00 0.00 ? 86  ASN A HD21 3  
ATOM   10233  H  HD22 . ASN A 1 86  ? 20.179  -1.368  6.170   1.00 0.00 ? 86  ASN A HD22 3  
ATOM   10234  N  N    . VAL A 1 87  ? 16.101  3.585   4.298   1.00 0.00 ? 87  VAL A N    3  
ATOM   10235  C  CA   . VAL A 1 87  ? 15.786  4.788   3.473   1.00 0.00 ? 87  VAL A CA   3  
ATOM   10236  C  C    . VAL A 1 87  ? 14.959  5.776   4.307   1.00 0.00 ? 87  VAL A C    3  
ATOM   10237  O  O    . VAL A 1 87  ? 14.099  5.388   5.080   1.00 0.00 ? 87  VAL A O    3  
ATOM   10238  C  CB   . VAL A 1 87  ? 14.981  4.385   2.231   1.00 0.00 ? 87  VAL A CB   3  
ATOM   10239  C  CG1  . VAL A 1 87  ? 15.900  3.753   1.179   1.00 0.00 ? 87  VAL A CG1  3  
ATOM   10240  C  CG2  . VAL A 1 87  ? 13.908  3.375   2.636   1.00 0.00 ? 87  VAL A CG2  3  
ATOM   10241  H  H    . VAL A 1 87  ? 15.613  3.425   5.138   1.00 0.00 ? 87  VAL A H    3  
ATOM   10242  H  HA   . VAL A 1 87  ? 16.706  5.266   3.171   1.00 0.00 ? 87  VAL A HA   3  
ATOM   10243  H  HB   . VAL A 1 87  ? 14.508  5.261   1.813   1.00 0.00 ? 87  VAL A HB   3  
ATOM   10244  H  HG11 . VAL A 1 87  ? 15.452  3.863   0.202   1.00 0.00 ? 87  VAL A HG11 3  
ATOM   10245  H  HG12 . VAL A 1 87  ? 16.031  2.706   1.396   1.00 0.00 ? 87  VAL A HG12 3  
ATOM   10246  H  HG13 . VAL A 1 87  ? 16.861  4.245   1.189   1.00 0.00 ? 87  VAL A HG13 3  
ATOM   10247  H  HG21 . VAL A 1 87  ? 14.379  2.465   2.976   1.00 0.00 ? 87  VAL A HG21 3  
ATOM   10248  H  HG22 . VAL A 1 87  ? 13.277  3.160   1.785   1.00 0.00 ? 87  VAL A HG22 3  
ATOM   10249  H  HG23 . VAL A 1 87  ? 13.309  3.792   3.432   1.00 0.00 ? 87  VAL A HG23 3  
ATOM   10250  N  N    . THR A 1 88  ? 15.212  7.050   4.150   1.00 0.00 ? 88  THR A N    3  
ATOM   10251  C  CA   . THR A 1 88  ? 14.444  8.071   4.921   1.00 0.00 ? 88  THR A CA   3  
ATOM   10252  C  C    . THR A 1 88  ? 13.550  8.863   3.965   1.00 0.00 ? 88  THR A C    3  
ATOM   10253  O  O    . THR A 1 88  ? 14.005  9.724   3.238   1.00 0.00 ? 88  THR A O    3  
ATOM   10254  C  CB   . THR A 1 88  ? 15.415  9.029   5.618   1.00 0.00 ? 88  THR A CB   3  
ATOM   10255  O  OG1  . THR A 1 88  ? 16.304  8.285   6.437   1.00 0.00 ? 88  THR A OG1  3  
ATOM   10256  C  CG2  . THR A 1 88  ? 14.628  10.013  6.486   1.00 0.00 ? 88  THR A CG2  3  
ATOM   10257  H  H    . THR A 1 88  ? 15.906  7.336   3.519   1.00 0.00 ? 88  THR A H    3  
ATOM   10258  H  HA   . THR A 1 88  ? 13.831  7.579   5.661   1.00 0.00 ? 88  THR A HA   3  
ATOM   10259  H  HB   . THR A 1 88  ? 15.978  9.578   4.878   1.00 0.00 ? 88  THR A HB   3  
ATOM   10260  H  HG1  . THR A 1 88  ? 15.800  7.590   6.867   1.00 0.00 ? 88  THR A HG1  3  
ATOM   10261  H  HG21 . THR A 1 88  ? 13.912  9.472   7.086   1.00 0.00 ? 88  THR A HG21 3  
ATOM   10262  H  HG22 . THR A 1 88  ? 14.109  10.717  5.852   1.00 0.00 ? 88  THR A HG22 3  
ATOM   10263  H  HG23 . THR A 1 88  ? 15.309  10.546  7.133   1.00 0.00 ? 88  THR A HG23 3  
ATOM   10264  N  N    . ILE A 1 89  ? 12.278  8.579   3.966   1.00 0.00 ? 89  ILE A N    3  
ATOM   10265  C  CA   . ILE A 1 89  ? 11.347  9.315   3.063   1.00 0.00 ? 89  ILE A CA   3  
ATOM   10266  C  C    . ILE A 1 89  ? 10.810  10.548  3.791   1.00 0.00 ? 89  ILE A C    3  
ATOM   10267  O  O    . ILE A 1 89  ? 10.093  10.439  4.765   1.00 0.00 ? 89  ILE A O    3  
ATOM   10268  C  CB   . ILE A 1 89  ? 10.180  8.406   2.676   1.00 0.00 ? 89  ILE A CB   3  
ATOM   10269  C  CG1  . ILE A 1 89  ? 10.721  7.118   2.049   1.00 0.00 ? 89  ILE A CG1  3  
ATOM   10270  C  CG2  . ILE A 1 89  ? 9.281   9.126   1.668   1.00 0.00 ? 89  ILE A CG2  3  
ATOM   10271  C  CD1  . ILE A 1 89  ? 10.682  5.994   3.085   1.00 0.00 ? 89  ILE A CD1  3  
ATOM   10272  H  H    . ILE A 1 89  ? 11.940  7.882   4.567   1.00 0.00 ? 89  ILE A H    3  
ATOM   10273  H  HA   . ILE A 1 89  ? 11.875  9.622   2.173   1.00 0.00 ? 89  ILE A HA   3  
ATOM   10274  H  HB   . ILE A 1 89  ? 9.609   8.162   3.558   1.00 0.00 ? 89  ILE A HB   3  
ATOM   10275  H  HG12 . ILE A 1 89  ? 10.112  6.849   1.199   1.00 0.00 ? 89  ILE A HG12 3  
ATOM   10276  H  HG13 . ILE A 1 89  ? 11.740  7.274   1.727   1.00 0.00 ? 89  ILE A HG13 3  
ATOM   10277  H  HG21 . ILE A 1 89  ? 8.949   8.426   0.916   1.00 0.00 ? 89  ILE A HG21 3  
ATOM   10278  H  HG22 . ILE A 1 89  ? 9.834   9.925   1.197   1.00 0.00 ? 89  ILE A HG22 3  
ATOM   10279  H  HG23 . ILE A 1 89  ? 8.424   9.536   2.180   1.00 0.00 ? 89  ILE A HG23 3  
ATOM   10280  H  HD11 . ILE A 1 89  ? 11.037  6.367   4.034   1.00 0.00 ? 89  ILE A HD11 3  
ATOM   10281  H  HD12 . ILE A 1 89  ? 11.314  5.181   2.759   1.00 0.00 ? 89  ILE A HD12 3  
ATOM   10282  H  HD13 . ILE A 1 89  ? 9.667   5.640   3.194   1.00 0.00 ? 89  ILE A HD13 3  
ATOM   10283  N  N    . GLU A 1 90  ? 11.139  11.723  3.328   1.00 0.00 ? 90  GLU A N    3  
ATOM   10284  C  CA   . GLU A 1 90  ? 10.631  12.951  3.999   1.00 0.00 ? 90  GLU A CA   3  
ATOM   10285  C  C    . GLU A 1 90  ? 9.340   13.387  3.312   1.00 0.00 ? 90  GLU A C    3  
ATOM   10286  O  O    . GLU A 1 90  ? 9.302   13.578  2.113   1.00 0.00 ? 90  GLU A O    3  
ATOM   10287  C  CB   . GLU A 1 90  ? 11.678  14.063  3.897   1.00 0.00 ? 90  GLU A CB   3  
ATOM   10288  C  CG   . GLU A 1 90  ? 13.077  13.458  4.027   1.00 0.00 ? 90  GLU A CG   3  
ATOM   10289  C  CD   . GLU A 1 90  ? 13.970  14.404  4.834   1.00 0.00 ? 90  GLU A CD   3  
ATOM   10290  O  OE1  . GLU A 1 90  ? 13.670  14.623  5.996   1.00 0.00 ? 90  GLU A OE1  3  
ATOM   10291  O  OE2  . GLU A 1 90  ? 14.939  14.891  4.277   1.00 0.00 ? 90  GLU A OE2  3  
ATOM   10292  H  H    . GLU A 1 90  ? 11.707  11.802  2.535   1.00 0.00 ? 90  GLU A H    3  
ATOM   10293  H  HA   . GLU A 1 90  ? 10.428  12.733  5.038   1.00 0.00 ? 90  GLU A HA   3  
ATOM   10294  H  HB2  . GLU A 1 90  ? 11.585  14.557  2.940   1.00 0.00 ? 90  GLU A HB2  3  
ATOM   10295  H  HB3  . GLU A 1 90  ? 11.523  14.779  4.687   1.00 0.00 ? 90  GLU A HB3  3  
ATOM   10296  H  HG2  . GLU A 1 90  ? 13.011  12.505  4.532   1.00 0.00 ? 90  GLU A HG2  3  
ATOM   10297  H  HG3  . GLU A 1 90  ? 13.501  13.318  3.044   1.00 0.00 ? 90  GLU A HG3  3  
ATOM   10298  N  N    . VAL A 1 91  ? 8.276   13.514  4.055   1.00 0.00 ? 91  VAL A N    3  
ATOM   10299  C  CA   . VAL A 1 91  ? 6.981   13.901  3.430   1.00 0.00 ? 91  VAL A CA   3  
ATOM   10300  C  C    . VAL A 1 91  ? 6.633   15.362  3.719   1.00 0.00 ? 91  VAL A C    3  
ATOM   10301  O  O    . VAL A 1 91  ? 6.224   15.710  4.806   1.00 0.00 ? 91  VAL A O    3  
ATOM   10302  C  CB   . VAL A 1 91  ? 5.873   13.009  3.981   1.00 0.00 ? 91  VAL A CB   3  
ATOM   10303  C  CG1  . VAL A 1 91  ? 4.514   13.563  3.553   1.00 0.00 ? 91  VAL A CG1  3  
ATOM   10304  C  CG2  . VAL A 1 91  ? 6.043   11.591  3.436   1.00 0.00 ? 91  VAL A CG2  3  
ATOM   10305  H  H    . VAL A 1 91  ? 8.330   13.328  5.018   1.00 0.00 ? 91  VAL A H    3  
ATOM   10306  H  HA   . VAL A 1 91  ? 7.046   13.760  2.365   1.00 0.00 ? 91  VAL A HA   3  
ATOM   10307  H  HB   . VAL A 1 91  ? 5.932   12.991  5.060   1.00 0.00 ? 91  VAL A HB   3  
ATOM   10308  H  HG11 . VAL A 1 91  ? 4.560   13.873  2.521   1.00 0.00 ? 91  VAL A HG11 3  
ATOM   10309  H  HG12 . VAL A 1 91  ? 4.259   14.410  4.172   1.00 0.00 ? 91  VAL A HG12 3  
ATOM   10310  H  HG13 . VAL A 1 91  ? 3.762   12.797  3.665   1.00 0.00 ? 91  VAL A HG13 3  
ATOM   10311  H  HG21 . VAL A 1 91  ? 7.089   11.321  3.451   1.00 0.00 ? 91  VAL A HG21 3  
ATOM   10312  H  HG22 . VAL A 1 91  ? 5.675   11.548  2.421   1.00 0.00 ? 91  VAL A HG22 3  
ATOM   10313  H  HG23 . VAL A 1 91  ? 5.485   10.900  4.050   1.00 0.00 ? 91  VAL A HG23 3  
ATOM   10314  N  N    . ILE A 1 92  ? 6.749   16.215  2.739   1.00 0.00 ? 92  ILE A N    3  
ATOM   10315  C  CA   . ILE A 1 92  ? 6.379   17.637  2.955   1.00 0.00 ? 92  ILE A CA   3  
ATOM   10316  C  C    . ILE A 1 92  ? 4.894   17.780  2.627   1.00 0.00 ? 92  ILE A C    3  
ATOM   10317  O  O    . ILE A 1 92  ? 4.493   17.712  1.483   1.00 0.00 ? 92  ILE A O    3  
ATOM   10318  C  CB   . ILE A 1 92  ? 7.208   18.533  2.032   1.00 0.00 ? 92  ILE A CB   3  
ATOM   10319  C  CG1  . ILE A 1 92  ? 8.684   18.419  2.416   1.00 0.00 ? 92  ILE A CG1  3  
ATOM   10320  C  CG2  . ILE A 1 92  ? 6.754   19.986  2.182   1.00 0.00 ? 92  ILE A CG2  3  
ATOM   10321  C  CD1  . ILE A 1 92  ? 9.388   17.450  1.464   1.00 0.00 ? 92  ILE A CD1  3  
ATOM   10322  H  H    . ILE A 1 92  ? 7.048   15.914  1.855   1.00 0.00 ? 92  ILE A H    3  
ATOM   10323  H  HA   . ILE A 1 92  ? 6.554   17.908  3.988   1.00 0.00 ? 92  ILE A HA   3  
ATOM   10324  H  HB   . ILE A 1 92  ? 7.074   18.217  1.007   1.00 0.00 ? 92  ILE A HB   3  
ATOM   10325  H  HG12 . ILE A 1 92  ? 9.148   19.391  2.349   1.00 0.00 ? 92  ILE A HG12 3  
ATOM   10326  H  HG13 . ILE A 1 92  ? 8.763   18.050  3.427   1.00 0.00 ? 92  ILE A HG13 3  
ATOM   10327  H  HG21 . ILE A 1 92  ? 6.298   20.318  1.263   1.00 0.00 ? 92  ILE A HG21 3  
ATOM   10328  H  HG22 . ILE A 1 92  ? 7.608   20.609  2.405   1.00 0.00 ? 92  ILE A HG22 3  
ATOM   10329  H  HG23 . ILE A 1 92  ? 6.037   20.058  2.987   1.00 0.00 ? 92  ILE A HG23 3  
ATOM   10330  H  HD11 . ILE A 1 92  ? 10.439  17.406  1.709   1.00 0.00 ? 92  ILE A HD11 3  
ATOM   10331  H  HD12 . ILE A 1 92  ? 9.269   17.793  0.448   1.00 0.00 ? 92  ILE A HD12 3  
ATOM   10332  H  HD13 . ILE A 1 92  ? 8.953   16.466  1.565   1.00 0.00 ? 92  ILE A HD13 3  
ATOM   10333  N  N    . GLY A 1 93  ? 4.072   17.954  3.623   1.00 0.00 ? 93  GLY A N    3  
ATOM   10334  C  CA   . GLY A 1 93  ? 2.608   18.072  3.371   1.00 0.00 ? 93  GLY A CA   3  
ATOM   10335  C  C    . GLY A 1 93  ? 1.862   17.182  4.363   1.00 0.00 ? 93  GLY A C    3  
ATOM   10336  O  O    . GLY A 1 93  ? 2.404   16.775  5.371   1.00 0.00 ? 93  GLY A O    3  
ATOM   10337  H  H    . GLY A 1 93  ? 4.413   17.995  4.541   1.00 0.00 ? 93  GLY A H    3  
ATOM   10338  H  HA2  . GLY A 1 93  ? 2.296   19.098  3.499   1.00 0.00 ? 93  GLY A HA2  3  
ATOM   10339  H  HA3  . GLY A 1 93  ? 2.386   17.748  2.366   1.00 0.00 ? 93  GLY A HA3  3  
ATOM   10340  N  N    . ASN A 1 94  ? 0.622   16.884  4.091   1.00 0.00 ? 94  ASN A N    3  
ATOM   10341  C  CA   . ASN A 1 94  ? -0.163  16.025  5.028   1.00 0.00 ? 94  ASN A CA   3  
ATOM   10342  C  C    . ASN A 1 94  ? -0.418  14.648  4.405   1.00 0.00 ? 94  ASN A C    3  
ATOM   10343  O  O    . ASN A 1 94  ? -0.820  13.723  5.082   1.00 0.00 ? 94  ASN A O    3  
ATOM   10344  C  CB   . ASN A 1 94  ? -1.504  16.698  5.330   1.00 0.00 ? 94  ASN A CB   3  
ATOM   10345  C  CG   . ASN A 1 94  ? -1.621  16.947  6.834   1.00 0.00 ? 94  ASN A CG   3  
ATOM   10346  O  OD1  . ASN A 1 94  ? -1.979  16.060  7.583   1.00 0.00 ? 94  ASN A OD1  3  
ATOM   10347  N  ND2  . ASN A 1 94  ? -1.334  18.127  7.311   1.00 0.00 ? 94  ASN A ND2  3  
ATOM   10348  H  H    . ASN A 1 94  ? 0.205   17.231  3.276   1.00 0.00 ? 94  ASN A H    3  
ATOM   10349  H  HA   . ASN A 1 94  ? 0.387   15.900  5.948   1.00 0.00 ? 94  ASN A HA   3  
ATOM   10350  H  HB2  . ASN A 1 94  ? -1.561  17.639  4.803   1.00 0.00 ? 94  ASN A HB2  3  
ATOM   10351  H  HB3  . ASN A 1 94  ? -2.310  16.055  5.009   1.00 0.00 ? 94  ASN A HB3  3  
ATOM   10352  H  HD21 . ASN A 1 94  ? -1.045  18.842  6.706   1.00 0.00 ? 94  ASN A HD21 3  
ATOM   10353  H  HD22 . ASN A 1 94  ? -1.406  18.297  8.273   1.00 0.00 ? 94  ASN A HD22 3  
ATOM   10354  N  N    . GLU A 1 95  ? -0.195  14.492  3.127   1.00 0.00 ? 95  GLU A N    3  
ATOM   10355  C  CA   . GLU A 1 95  ? -0.443  13.160  2.507   1.00 0.00 ? 95  GLU A CA   3  
ATOM   10356  C  C    . GLU A 1 95  ? 0.490   12.937  1.314   1.00 0.00 ? 95  GLU A C    3  
ATOM   10357  O  O    . GLU A 1 95  ? 0.973   13.865  0.696   1.00 0.00 ? 95  GLU A O    3  
ATOM   10358  C  CB   . GLU A 1 95  ? -1.900  13.075  2.046   1.00 0.00 ? 95  GLU A CB   3  
ATOM   10359  C  CG   . GLU A 1 95  ? -2.047  13.724  0.671   1.00 0.00 ? 95  GLU A CG   3  
ATOM   10360  C  CD   . GLU A 1 95  ? -1.310  15.066  0.657   1.00 0.00 ? 95  GLU A CD   3  
ATOM   10361  O  OE1  . GLU A 1 95  ? -1.508  15.836  1.581   1.00 0.00 ? 95  GLU A OE1  3  
ATOM   10362  O  OE2  . GLU A 1 95  ? -0.562  15.299  -0.278  1.00 0.00 ? 95  GLU A OE2  3  
ATOM   10363  H  H    . GLU A 1 95  ? 0.128   15.240  2.585   1.00 0.00 ? 95  GLU A H    3  
ATOM   10364  H  HA   . GLU A 1 95  ? -0.262  12.393  3.243   1.00 0.00 ? 95  GLU A HA   3  
ATOM   10365  H  HB2  . GLU A 1 95  ? -2.198  12.039  1.989   1.00 0.00 ? 95  GLU A HB2  3  
ATOM   10366  H  HB3  . GLU A 1 95  ? -2.531  13.593  2.754   1.00 0.00 ? 95  GLU A HB3  3  
ATOM   10367  H  HG2  . GLU A 1 95  ? -1.627  13.073  -0.082  1.00 0.00 ? 95  GLU A HG2  3  
ATOM   10368  H  HG3  . GLU A 1 95  ? -3.093  13.888  0.462   1.00 0.00 ? 95  GLU A HG3  3  
ATOM   10369  N  N    . ILE A 1 96  ? 0.746   11.695  0.999   1.00 0.00 ? 96  ILE A N    3  
ATOM   10370  C  CA   . ILE A 1 96  ? 1.648   11.358  -0.142  1.00 0.00 ? 96  ILE A CA   3  
ATOM   10371  C  C    . ILE A 1 96  ? 0.968   11.717  -1.476  1.00 0.00 ? 96  ILE A C    3  
ATOM   10372  O  O    . ILE A 1 96  ? -0.126  11.265  -1.746  1.00 0.00 ? 96  ILE A O    3  
ATOM   10373  C  CB   . ILE A 1 96  ? 1.912   9.846   -0.114  1.00 0.00 ? 96  ILE A CB   3  
ATOM   10374  C  CG1  . ILE A 1 96  ? 2.396   9.425   1.279   1.00 0.00 ? 96  ILE A CG1  3  
ATOM   10375  C  CG2  . ILE A 1 96  ? 2.970   9.470   -1.151  1.00 0.00 ? 96  ILE A CG2  3  
ATOM   10376  C  CD1  . ILE A 1 96  ? 3.468   10.393  1.784   1.00 0.00 ? 96  ILE A CD1  3  
ATOM   10377  H  H    . ILE A 1 96  ? 0.346   10.971  1.525   1.00 0.00 ? 96  ILE A H    3  
ATOM   10378  H  HA   . ILE A 1 96  ? 2.576   11.889  -0.039  1.00 0.00 ? 96  ILE A HA   3  
ATOM   10379  H  HB   . ILE A 1 96  ? 0.994   9.324   -0.343  1.00 0.00 ? 96  ILE A HB   3  
ATOM   10380  H  HG12 . ILE A 1 96  ? 1.562   9.422   1.964   1.00 0.00 ? 96  ILE A HG12 3  
ATOM   10381  H  HG13 . ILE A 1 96  ? 2.816   8.433   1.221   1.00 0.00 ? 96  ILE A HG13 3  
ATOM   10382  H  HG21 . ILE A 1 96  ? 3.032   10.241  -1.901  1.00 0.00 ? 96  ILE A HG21 3  
ATOM   10383  H  HG22 . ILE A 1 96  ? 2.697   8.536   -1.619  1.00 0.00 ? 96  ILE A HG22 3  
ATOM   10384  H  HG23 . ILE A 1 96  ? 3.927   9.359   -0.663  1.00 0.00 ? 96  ILE A HG23 3  
ATOM   10385  H  HD11 . ILE A 1 96  ? 4.160   10.613  0.987   1.00 0.00 ? 96  ILE A HD11 3  
ATOM   10386  H  HD12 . ILE A 1 96  ? 4.000   9.940   2.608   1.00 0.00 ? 96  ILE A HD12 3  
ATOM   10387  H  HD13 . ILE A 1 96  ? 2.999   11.306  2.119   1.00 0.00 ? 96  ILE A HD13 3  
ATOM   10388  N  N    . PRO A 1 97  ? 1.603   12.505  -2.320  1.00 0.00 ? 97  PRO A N    3  
ATOM   10389  C  CA   . PRO A 1 97  ? 1.019   12.878  -3.638  1.00 0.00 ? 97  PRO A CA   3  
ATOM   10390  C  C    . PRO A 1 97  ? 0.443   11.666  -4.374  1.00 0.00 ? 97  PRO A C    3  
ATOM   10391  O  O    . PRO A 1 97  ? 1.051   10.616  -4.436  1.00 0.00 ? 97  PRO A O    3  
ATOM   10392  C  CB   . PRO A 1 97  ? 2.205   13.443  -4.414  1.00 0.00 ? 97  PRO A CB   3  
ATOM   10393  C  CG   . PRO A 1 97  ? 3.140   13.972  -3.382  1.00 0.00 ? 97  PRO A CG   3  
ATOM   10394  C  CD   . PRO A 1 97  ? 2.923   13.136  -2.118  1.00 0.00 ? 97  PRO A CD   3  
ATOM   10395  H  HA   . PRO A 1 97  ? 0.267   13.641  -3.517  1.00 0.00 ? 97  PRO A HA   3  
ATOM   10396  H  HB2  . PRO A 1 97  ? 2.681   12.660  -4.988  1.00 0.00 ? 97  PRO A HB2  3  
ATOM   10397  H  HB3  . PRO A 1 97  ? 1.884   14.239  -5.063  1.00 0.00 ? 97  PRO A HB3  3  
ATOM   10398  H  HG2  . PRO A 1 97  ? 4.162   13.873  -3.724  1.00 0.00 ? 97  PRO A HG2  3  
ATOM   10399  H  HG3  . PRO A 1 97  ? 2.918   15.008  -3.174  1.00 0.00 ? 97  PRO A HG3  3  
ATOM   10400  H  HD2  . PRO A 1 97  ? 3.696   12.390  -2.026  1.00 0.00 ? 97  PRO A HD2  3  
ATOM   10401  H  HD3  . PRO A 1 97  ? 2.901   13.773  -1.247  1.00 0.00 ? 97  PRO A HD3  3  
ATOM   10402  N  N    . ILE A 1 98  ? -0.731  11.805  -4.920  1.00 0.00 ? 98  ILE A N    3  
ATOM   10403  C  CA   . ILE A 1 98  ? -1.363  10.668  -5.644  1.00 0.00 ? 98  ILE A CA   3  
ATOM   10404  C  C    . ILE A 1 98  ? -0.721  10.505  -7.022  1.00 0.00 ? 98  ILE A C    3  
ATOM   10405  O  O    . ILE A 1 98  ? -0.570  9.407   -7.521  1.00 0.00 ? 98  ILE A O    3  
ATOM   10406  C  CB   . ILE A 1 98  ? -2.854  10.960  -5.810  1.00 0.00 ? 98  ILE A CB   3  
ATOM   10407  C  CG1  . ILE A 1 98  ? -3.590  9.684   -6.232  1.00 0.00 ? 98  ILE A CG1  3  
ATOM   10408  C  CG2  . ILE A 1 98  ? -3.049  12.037  -6.880  1.00 0.00 ? 98  ILE A CG2  3  
ATOM   10409  C  CD1  . ILE A 1 98  ? -3.497  8.639   -5.118  1.00 0.00 ? 98  ILE A CD1  3  
ATOM   10410  H  H    . ILE A 1 98  ? -1.202  12.661  -4.846  1.00 0.00 ? 98  ILE A H    3  
ATOM   10411  H  HA   . ILE A 1 98  ? -1.232  9.761   -5.075  1.00 0.00 ? 98  ILE A HA   3  
ATOM   10412  H  HB   . ILE A 1 98  ? -3.249  11.315  -4.871  1.00 0.00 ? 98  ILE A HB   3  
ATOM   10413  H  HG12 . ILE A 1 98  ? -4.628  9.916   -6.422  1.00 0.00 ? 98  ILE A HG12 3  
ATOM   10414  H  HG13 . ILE A 1 98  ? -3.139  9.291   -7.130  1.00 0.00 ? 98  ILE A HG13 3  
ATOM   10415  H  HG21 . ILE A 1 98  ? -2.837  11.621  -7.854  1.00 0.00 ? 98  ILE A HG21 3  
ATOM   10416  H  HG22 . ILE A 1 98  ? -2.378  12.862  -6.687  1.00 0.00 ? 98  ILE A HG22 3  
ATOM   10417  H  HG23 . ILE A 1 98  ? -4.069  12.390  -6.854  1.00 0.00 ? 98  ILE A HG23 3  
ATOM   10418  H  HD11 . ILE A 1 98  ? -3.341  9.134   -4.171  1.00 0.00 ? 98  ILE A HD11 3  
ATOM   10419  H  HD12 . ILE A 1 98  ? -2.669  7.975   -5.317  1.00 0.00 ? 98  ILE A HD12 3  
ATOM   10420  H  HD13 . ILE A 1 98  ? -4.413  8.069   -5.081  1.00 0.00 ? 98  ILE A HD13 3  
ATOM   10421  N  N    . LEU A 1 99  ? -0.351  11.590  -7.642  1.00 0.00 ? 99  LEU A N    3  
ATOM   10422  C  CA   . LEU A 1 99  ? 0.277   11.506  -8.990  1.00 0.00 ? 99  LEU A CA   3  
ATOM   10423  C  C    . LEU A 1 99  ? -0.646  10.736  -9.941  1.00 0.00 ? 99  LEU A C    3  
ATOM   10424  O  O    . LEU A 1 99  ? -1.649  11.249  -10.395 1.00 0.00 ? 99  LEU A O    3  
ATOM   10425  C  CB   . LEU A 1 99  ? 1.629   10.789  -8.887  1.00 0.00 ? 99  LEU A CB   3  
ATOM   10426  C  CG   . LEU A 1 99  ? 2.655   11.722  -8.236  1.00 0.00 ? 99  LEU A CG   3  
ATOM   10427  C  CD1  . LEU A 1 99  ? 3.865   10.909  -7.776  1.00 0.00 ? 99  LEU A CD1  3  
ATOM   10428  C  CD2  . LEU A 1 99  ? 3.112   12.782  -9.243  1.00 0.00 ? 99  LEU A CD2  3  
ATOM   10429  H  H    . LEU A 1 99  ? -0.489  12.463  -7.220  1.00 0.00 ? 99  LEU A H    3  
ATOM   10430  H  HA   . LEU A 1 99  ? 0.430   12.503  -9.374  1.00 0.00 ? 99  LEU A HA   3  
ATOM   10431  H  HB2  . LEU A 1 99  ? 1.519   9.899   -8.285  1.00 0.00 ? 99  LEU A HB2  3  
ATOM   10432  H  HB3  . LEU A 1 99  ? 1.968   10.513  -9.874  1.00 0.00 ? 99  LEU A HB3  3  
ATOM   10433  H  HG   . LEU A 1 99  ? 2.204   12.206  -7.380  1.00 0.00 ? 99  LEU A HG   3  
ATOM   10434  H  HD11 . LEU A 1 99  ? 3.597   10.321  -6.912  1.00 0.00 ? 99  LEU A HD11 3  
ATOM   10435  H  HD12 . LEU A 1 99  ? 4.672   11.581  -7.518  1.00 0.00 ? 99  LEU A HD12 3  
ATOM   10436  H  HD13 . LEU A 1 99  ? 4.184   10.254  -8.573  1.00 0.00 ? 99  LEU A HD13 3  
ATOM   10437  H  HD21 . LEU A 1 99  ? 2.936   13.766  -8.833  1.00 0.00 ? 99  LEU A HD21 3  
ATOM   10438  H  HD22 . LEU A 1 99  ? 2.559   12.673  -10.164 1.00 0.00 ? 99  LEU A HD22 3  
ATOM   10439  H  HD23 . LEU A 1 99  ? 4.166   12.658  -9.439  1.00 0.00 ? 99  LEU A HD23 3  
ATOM   10440  N  N    . ASP A 1 100 ? -0.309  9.516   -10.258 1.00 0.00 ? 100 ASP A N    3  
ATOM   10441  C  CA   . ASP A 1 100 ? -1.159  8.725   -11.191 1.00 0.00 ? 100 ASP A CA   3  
ATOM   10442  C  C    . ASP A 1 100 ? -2.149  7.855   -10.411 1.00 0.00 ? 100 ASP A C    3  
ATOM   10443  O  O    . ASP A 1 100 ? -3.209  7.520   -10.902 1.00 0.00 ? 100 ASP A O    3  
ATOM   10444  C  CB   . ASP A 1 100 ? -0.262  7.828   -12.041 1.00 0.00 ? 100 ASP A CB   3  
ATOM   10445  C  CG   . ASP A 1 100 ? -0.678  6.367   -11.860 1.00 0.00 ? 100 ASP A CG   3  
ATOM   10446  O  OD1  . ASP A 1 100 ? -1.800  6.042   -12.212 1.00 0.00 ? 100 ASP A OD1  3  
ATOM   10447  O  OD2  . ASP A 1 100 ? 0.134   5.597   -11.372 1.00 0.00 ? 100 ASP A OD2  3  
ATOM   10448  H  H    . ASP A 1 100 ? 0.509   9.122   -9.893  1.00 0.00 ? 100 ASP A H    3  
ATOM   10449  H  HA   . ASP A 1 100 ? -1.706  9.397   -11.837 1.00 0.00 ? 100 ASP A HA   3  
ATOM   10450  H  HB2  . ASP A 1 100 ? -0.358  8.106   -13.079 1.00 0.00 ? 100 ASP A HB2  3  
ATOM   10451  H  HB3  . ASP A 1 100 ? 0.764   7.948   -11.731 1.00 0.00 ? 100 ASP A HB3  3  
ATOM   10452  N  N    . GLY A 1 101 ? -1.809  7.472   -9.209  1.00 0.00 ? 101 GLY A N    3  
ATOM   10453  C  CA   . GLY A 1 101 ? -2.726  6.605   -8.412  1.00 0.00 ? 101 GLY A CA   3  
ATOM   10454  C  C    . GLY A 1 101 ? -2.094  5.220   -8.269  1.00 0.00 ? 101 GLY A C    3  
ATOM   10455  O  O    . GLY A 1 101 ? -2.640  4.339   -7.638  1.00 0.00 ? 101 GLY A O    3  
ATOM   10456  H  H    . GLY A 1 101 ? -0.944  7.742   -8.838  1.00 0.00 ? 101 GLY A H    3  
ATOM   10457  H  HA2  . GLY A 1 101 ? -2.882  7.036   -7.431  1.00 0.00 ? 101 GLY A HA2  3  
ATOM   10458  H  HA3  . GLY A 1 101 ? -3.674  6.513   -8.920  1.00 0.00 ? 101 GLY A HA3  3  
ATOM   10459  N  N    . SER A 1 102 ? -0.943  5.027   -8.858  1.00 0.00 ? 102 SER A N    3  
ATOM   10460  C  CA   . SER A 1 102 ? -0.259  3.705   -8.768  1.00 0.00 ? 102 SER A CA   3  
ATOM   10461  C  C    . SER A 1 102 ? 1.146   3.901   -8.198  1.00 0.00 ? 102 SER A C    3  
ATOM   10462  O  O    . SER A 1 102 ? 1.474   4.951   -7.683  1.00 0.00 ? 102 SER A O    3  
ATOM   10463  C  CB   . SER A 1 102 ? -0.159  3.091   -10.165 1.00 0.00 ? 102 SER A CB   3  
ATOM   10464  O  OG   . SER A 1 102 ? 1.053   3.513   -10.776 1.00 0.00 ? 102 SER A OG   3  
ATOM   10465  H  H    . SER A 1 102 ? -0.526  5.757   -9.361  1.00 0.00 ? 102 SER A H    3  
ATOM   10466  H  HA   . SER A 1 102 ? -0.820  3.046   -8.124  1.00 0.00 ? 102 SER A HA   3  
ATOM   10467  H  HB2  . SER A 1 102 ? -0.164  2.017   -10.090 1.00 0.00 ? 102 SER A HB2  3  
ATOM   10468  H  HB3  . SER A 1 102 ? -1.004  3.412   -10.759 1.00 0.00 ? 102 SER A HB3  3  
ATOM   10469  H  HG   . SER A 1 102 ? 1.052   4.472   -10.806 1.00 0.00 ? 102 SER A HG   3  
ATOM   10470  N  N    . GLY A 1 103 ? 1.980   2.900   -8.294  1.00 0.00 ? 103 GLY A N    3  
ATOM   10471  C  CA   . GLY A 1 103 ? 3.370   3.024   -7.769  1.00 0.00 ? 103 GLY A CA   3  
ATOM   10472  C  C    . GLY A 1 103 ? 4.349   2.927   -8.937  1.00 0.00 ? 103 GLY A C    3  
ATOM   10473  O  O    . GLY A 1 103 ? 5.549   2.995   -8.772  1.00 0.00 ? 103 GLY A O    3  
ATOM   10474  H  H    . GLY A 1 103 ? 1.699   2.064   -8.722  1.00 0.00 ? 103 GLY A H    3  
ATOM   10475  H  HA2  . GLY A 1 103 ? 3.490   3.974   -7.268  1.00 0.00 ? 103 GLY A HA2  3  
ATOM   10476  H  HA3  . GLY A 1 103 ? 3.565   2.219   -7.079  1.00 0.00 ? 103 GLY A HA3  3  
ATOM   10477  N  N    . TRP A 1 104 ? 3.830   2.756   -10.116 1.00 0.00 ? 104 TRP A N    3  
ATOM   10478  C  CA   . TRP A 1 104 ? 4.701   2.636   -11.324 1.00 0.00 ? 104 TRP A CA   3  
ATOM   10479  C  C    . TRP A 1 104 ? 5.773   3.732   -11.329 1.00 0.00 ? 104 TRP A C    3  
ATOM   10480  O  O    . TRP A 1 104 ? 6.922   3.479   -11.631 1.00 0.00 ? 104 TRP A O    3  
ATOM   10481  C  CB   . TRP A 1 104 ? 3.835   2.770   -12.579 1.00 0.00 ? 104 TRP A CB   3  
ATOM   10482  C  CG   . TRP A 1 104 ? 4.676   2.555   -13.798 1.00 0.00 ? 104 TRP A CG   3  
ATOM   10483  C  CD1  . TRP A 1 104 ? 4.916   3.486   -14.750 1.00 0.00 ? 104 TRP A CD1  3  
ATOM   10484  C  CD2  . TRP A 1 104 ? 5.387   1.352   -14.213 1.00 0.00 ? 104 TRP A CD2  3  
ATOM   10485  N  NE1  . TRP A 1 104 ? 5.730   2.932   -15.722 1.00 0.00 ? 104 TRP A NE1  3  
ATOM   10486  C  CE2  . TRP A 1 104 ? 6.047   1.619   -15.437 1.00 0.00 ? 104 TRP A CE2  3  
ATOM   10487  C  CE3  . TRP A 1 104 ? 5.523   0.070   -13.652 1.00 0.00 ? 104 TRP A CE3  3  
ATOM   10488  C  CZ2  . TRP A 1 104 ? 6.814   0.648   -16.081 1.00 0.00 ? 104 TRP A CZ2  3  
ATOM   10489  C  CZ3  . TRP A 1 104 ? 6.294   -0.911  -14.298 1.00 0.00 ? 104 TRP A CZ3  3  
ATOM   10490  C  CH2  . TRP A 1 104 ? 6.939   -0.622  -15.509 1.00 0.00 ? 104 TRP A CH2  3  
ATOM   10491  H  H    . TRP A 1 104 ? 2.856   2.695   -10.207 1.00 0.00 ? 104 TRP A H    3  
ATOM   10492  H  HA   . TRP A 1 104 ? 5.179   1.668   -11.324 1.00 0.00 ? 104 TRP A HA   3  
ATOM   10493  H  HB2  . TRP A 1 104 ? 3.047   2.032   -12.553 1.00 0.00 ? 104 TRP A HB2  3  
ATOM   10494  H  HB3  . TRP A 1 104 ? 3.402   3.759   -12.613 1.00 0.00 ? 104 TRP A HB3  3  
ATOM   10495  H  HD1  . TRP A 1 104 ? 4.534   4.496   -14.752 1.00 0.00 ? 104 TRP A HD1  3  
ATOM   10496  H  HE1  . TRP A 1 104 ? 6.052   3.397   -16.523 1.00 0.00 ? 104 TRP A HE1  3  
ATOM   10497  H  HE3  . TRP A 1 104 ? 5.030   -0.163  -12.720 1.00 0.00 ? 104 TRP A HE3  3  
ATOM   10498  H  HZ2  . TRP A 1 104 ? 7.310   0.875   -17.013 1.00 0.00 ? 104 TRP A HZ2  3  
ATOM   10499  H  HZ3  . TRP A 1 104 ? 6.392   -1.892  -13.859 1.00 0.00 ? 104 TRP A HZ3  3  
ATOM   10500  H  HH2  . TRP A 1 104 ? 7.531   -1.380  -16.000 1.00 0.00 ? 104 TRP A HH2  3  
ATOM   10501  N  N    . GLU A 1 105 ? 5.410   4.947   -11.019 1.00 0.00 ? 105 GLU A N    3  
ATOM   10502  C  CA   . GLU A 1 105 ? 6.418   6.050   -11.033 1.00 0.00 ? 105 GLU A CA   3  
ATOM   10503  C  C    . GLU A 1 105 ? 7.504   5.793   -9.983  1.00 0.00 ? 105 GLU A C    3  
ATOM   10504  O  O    . GLU A 1 105 ? 8.681   5.815   -10.285 1.00 0.00 ? 105 GLU A O    3  
ATOM   10505  C  CB   . GLU A 1 105 ? 5.721   7.380   -10.735 1.00 0.00 ? 105 GLU A CB   3  
ATOM   10506  C  CG   . GLU A 1 105 ? 4.882   7.796   -11.946 1.00 0.00 ? 105 GLU A CG   3  
ATOM   10507  C  CD   . GLU A 1 105 ? 4.241   9.159   -11.683 1.00 0.00 ? 105 GLU A CD   3  
ATOM   10508  O  OE1  . GLU A 1 105 ? 4.948   10.049  -11.241 1.00 0.00 ? 105 GLU A OE1  3  
ATOM   10509  O  OE2  . GLU A 1 105 ? 3.053   9.290   -11.930 1.00 0.00 ? 105 GLU A OE2  3  
ATOM   10510  H  H    . GLU A 1 105 ? 4.476   5.139   -10.795 1.00 0.00 ? 105 GLU A H    3  
ATOM   10511  H  HA   . GLU A 1 105 ? 6.877   6.100   -12.012 1.00 0.00 ? 105 GLU A HA   3  
ATOM   10512  H  HB2  . GLU A 1 105 ? 5.080   7.263   -9.874  1.00 0.00 ? 105 GLU A HB2  3  
ATOM   10513  H  HB3  . GLU A 1 105 ? 6.462   8.138   -10.534 1.00 0.00 ? 105 GLU A HB3  3  
ATOM   10514  H  HG2  . GLU A 1 105 ? 5.517   7.858   -12.818 1.00 0.00 ? 105 GLU A HG2  3  
ATOM   10515  H  HG3  . GLU A 1 105 ? 4.108   7.062   -12.115 1.00 0.00 ? 105 GLU A HG3  3  
ATOM   10516  N  N    . PHE A 1 106 ? 7.131   5.543   -8.757  1.00 0.00 ? 106 PHE A N    3  
ATOM   10517  C  CA   . PHE A 1 106 ? 8.164   5.282   -7.712  1.00 0.00 ? 106 PHE A CA   3  
ATOM   10518  C  C    . PHE A 1 106 ? 8.941   4.021   -8.098  1.00 0.00 ? 106 PHE A C    3  
ATOM   10519  O  O    . PHE A 1 106 ? 10.154  3.976   -8.046  1.00 0.00 ? 106 PHE A O    3  
ATOM   10520  C  CB   . PHE A 1 106 ? 7.483   5.063   -6.357  1.00 0.00 ? 106 PHE A CB   3  
ATOM   10521  C  CG   . PHE A 1 106 ? 6.783   6.330   -5.925  1.00 0.00 ? 106 PHE A CG   3  
ATOM   10522  C  CD1  . PHE A 1 106 ? 7.510   7.361   -5.317  1.00 0.00 ? 106 PHE A CD1  3  
ATOM   10523  C  CD2  . PHE A 1 106 ? 5.405   6.472   -6.127  1.00 0.00 ? 106 PHE A CD2  3  
ATOM   10524  C  CE1  . PHE A 1 106 ? 6.859   8.533   -4.912  1.00 0.00 ? 106 PHE A CE1  3  
ATOM   10525  C  CE2  . PHE A 1 106 ? 4.754   7.644   -5.722  1.00 0.00 ? 106 PHE A CE2  3  
ATOM   10526  C  CZ   . PHE A 1 106 ? 5.481   8.674   -5.115  1.00 0.00 ? 106 PHE A CZ   3  
ATOM   10527  H  H    . PHE A 1 106 ? 6.180   5.524   -8.522  1.00 0.00 ? 106 PHE A H    3  
ATOM   10528  H  HA   . PHE A 1 106 ? 8.839   6.125   -7.649  1.00 0.00 ? 106 PHE A HA   3  
ATOM   10529  H  HB2  . PHE A 1 106 ? 6.760   4.265   -6.444  1.00 0.00 ? 106 PHE A HB2  3  
ATOM   10530  H  HB3  . PHE A 1 106 ? 8.227   4.796   -5.622  1.00 0.00 ? 106 PHE A HB3  3  
ATOM   10531  H  HD1  . PHE A 1 106 ? 8.573   7.252   -5.160  1.00 0.00 ? 106 PHE A HD1  3  
ATOM   10532  H  HD2  . PHE A 1 106 ? 4.844   5.678   -6.595  1.00 0.00 ? 106 PHE A HD2  3  
ATOM   10533  H  HE1  . PHE A 1 106 ? 7.419   9.328   -4.443  1.00 0.00 ? 106 PHE A HE1  3  
ATOM   10534  H  HE2  . PHE A 1 106 ? 3.691   7.753   -5.879  1.00 0.00 ? 106 PHE A HE2  3  
ATOM   10535  H  HZ   . PHE A 1 106 ? 4.978   9.579   -4.801  1.00 0.00 ? 106 PHE A HZ   3  
ATOM   10536  N  N    . TYR A 1 107 ? 8.234   3.001   -8.493  1.00 0.00 ? 107 TYR A N    3  
ATOM   10537  C  CA   . TYR A 1 107 ? 8.886   1.723   -8.902  1.00 0.00 ? 107 TYR A CA   3  
ATOM   10538  C  C    . TYR A 1 107 ? 9.831   1.986   -10.077 1.00 0.00 ? 107 TYR A C    3  
ATOM   10539  O  O    . TYR A 1 107 ? 10.911  1.437   -10.158 1.00 0.00 ? 107 TYR A O    3  
ATOM   10540  C  CB   . TYR A 1 107 ? 7.785   0.745   -9.342  1.00 0.00 ? 107 TYR A CB   3  
ATOM   10541  C  CG   . TYR A 1 107 ? 8.354   -0.632  -9.595  1.00 0.00 ? 107 TYR A CG   3  
ATOM   10542  C  CD1  . TYR A 1 107 ? 9.140   -0.878  -10.730 1.00 0.00 ? 107 TYR A CD1  3  
ATOM   10543  C  CD2  . TYR A 1 107 ? 8.080   -1.671  -8.699  1.00 0.00 ? 107 TYR A CD2  3  
ATOM   10544  C  CE1  . TYR A 1 107 ? 9.650   -2.161  -10.963 1.00 0.00 ? 107 TYR A CE1  3  
ATOM   10545  C  CE2  . TYR A 1 107 ? 8.590   -2.953  -8.932  1.00 0.00 ? 107 TYR A CE2  3  
ATOM   10546  C  CZ   . TYR A 1 107 ? 9.375   -3.199  -10.065 1.00 0.00 ? 107 TYR A CZ   3  
ATOM   10547  O  OH   . TYR A 1 107 ? 9.877   -4.463  -10.296 1.00 0.00 ? 107 TYR A OH   3  
ATOM   10548  H  H    . TYR A 1 107 ? 7.260   3.075   -8.528  1.00 0.00 ? 107 TYR A H    3  
ATOM   10549  H  HA   . TYR A 1 107 ? 9.437   1.306   -8.073  1.00 0.00 ? 107 TYR A HA   3  
ATOM   10550  H  HB2  . TYR A 1 107 ? 7.037   0.680   -8.565  1.00 0.00 ? 107 TYR A HB2  3  
ATOM   10551  H  HB3  . TYR A 1 107 ? 7.325   1.113   -10.246 1.00 0.00 ? 107 TYR A HB3  3  
ATOM   10552  H  HD1  . TYR A 1 107 ? 9.352   -0.081  -11.426 1.00 0.00 ? 107 TYR A HD1  3  
ATOM   10553  H  HD2  . TYR A 1 107 ? 7.473   -1.483  -7.825  1.00 0.00 ? 107 TYR A HD2  3  
ATOM   10554  H  HE1  . TYR A 1 107 ? 10.255  -2.350  -11.837 1.00 0.00 ? 107 TYR A HE1  3  
ATOM   10555  H  HE2  . TYR A 1 107 ? 8.374   -3.753  -8.242  1.00 0.00 ? 107 TYR A HE2  3  
ATOM   10556  H  HH   . TYR A 1 107 ? 9.285   -4.911  -10.905 1.00 0.00 ? 107 TYR A HH   3  
ATOM   10557  N  N    . GLU A 1 108 ? 9.414   2.807   -10.999 1.00 0.00 ? 108 GLU A N    3  
ATOM   10558  C  CA   . GLU A 1 108 ? 10.253  3.098   -12.197 1.00 0.00 ? 108 GLU A CA   3  
ATOM   10559  C  C    . GLU A 1 108 ? 11.453  3.984   -11.840 1.00 0.00 ? 108 GLU A C    3  
ATOM   10560  O  O    . GLU A 1 108 ? 12.568  3.736   -12.266 1.00 0.00 ? 108 GLU A O    3  
ATOM   10561  C  CB   . GLU A 1 108 ? 9.388   3.823   -13.230 1.00 0.00 ? 108 GLU A CB   3  
ATOM   10562  C  CG   . GLU A 1 108 ? 8.609   2.798   -14.057 1.00 0.00 ? 108 GLU A CG   3  
ATOM   10563  C  CD   . GLU A 1 108 ? 9.486   2.291   -15.202 1.00 0.00 ? 108 GLU A CD   3  
ATOM   10564  O  OE1  . GLU A 1 108 ? 9.608   3.000   -16.187 1.00 0.00 ? 108 GLU A OE1  3  
ATOM   10565  O  OE2  . GLU A 1 108 ? 10.019  1.201   -15.076 1.00 0.00 ? 108 GLU A OE2  3  
ATOM   10566  H  H    . GLU A 1 108 ? 8.531   3.221   -10.915 1.00 0.00 ? 108 GLU A H    3  
ATOM   10567  H  HA   . GLU A 1 108 ? 10.607  2.171   -12.621 1.00 0.00 ? 108 GLU A HA   3  
ATOM   10568  H  HB2  . GLU A 1 108 ? 8.694   4.474   -12.719 1.00 0.00 ? 108 GLU A HB2  3  
ATOM   10569  H  HB3  . GLU A 1 108 ? 10.016  4.409   -13.881 1.00 0.00 ? 108 GLU A HB3  3  
ATOM   10570  H  HG2  . GLU A 1 108 ? 8.324   1.969   -13.426 1.00 0.00 ? 108 GLU A HG2  3  
ATOM   10571  H  HG3  . GLU A 1 108 ? 7.724   3.264   -14.463 1.00 0.00 ? 108 GLU A HG3  3  
ATOM   10572  N  N    . ALA A 1 109 ? 11.245  5.022   -11.082 1.00 0.00 ? 109 ALA A N    3  
ATOM   10573  C  CA   . ALA A 1 109 ? 12.380  5.925   -10.734 1.00 0.00 ? 109 ALA A CA   3  
ATOM   10574  C  C    . ALA A 1 109 ? 13.293  5.273   -9.693  1.00 0.00 ? 109 ALA A C    3  
ATOM   10575  O  O    . ALA A 1 109 ? 14.499  5.251   -9.843  1.00 0.00 ? 109 ALA A O    3  
ATOM   10576  C  CB   . ALA A 1 109 ? 11.827  7.236   -10.172 1.00 0.00 ? 109 ALA A CB   3  
ATOM   10577  H  H    . ALA A 1 109 ? 10.346  5.217   -10.745 1.00 0.00 ? 109 ALA A H    3  
ATOM   10578  H  HA   . ALA A 1 109 ? 12.951  6.136   -11.625 1.00 0.00 ? 109 ALA A HA   3  
ATOM   10579  H  HB1  . ALA A 1 109 ? 10.747  7.204   -10.177 1.00 0.00 ? 109 ALA A HB1  3  
ATOM   10580  H  HB2  . ALA A 1 109 ? 12.165  8.061   -10.782 1.00 0.00 ? 109 ALA A HB2  3  
ATOM   10581  H  HB3  . ALA A 1 109 ? 12.177  7.371   -9.160  1.00 0.00 ? 109 ALA A HB3  3  
ATOM   10582  N  N    . ILE A 1 110 ? 12.740  4.767   -8.628  1.00 0.00 ? 110 ILE A N    3  
ATOM   10583  C  CA   . ILE A 1 110 ? 13.585  4.149   -7.569  1.00 0.00 ? 110 ILE A CA   3  
ATOM   10584  C  C    . ILE A 1 110 ? 14.330  2.925   -8.104  1.00 0.00 ? 110 ILE A C    3  
ATOM   10585  O  O    . ILE A 1 110 ? 15.493  2.735   -7.818  1.00 0.00 ? 110 ILE A O    3  
ATOM   10586  C  CB   . ILE A 1 110 ? 12.698  3.723   -6.397  1.00 0.00 ? 110 ILE A CB   3  
ATOM   10587  C  CG1  . ILE A 1 110 ? 12.080  4.965   -5.747  1.00 0.00 ? 110 ILE A CG1  3  
ATOM   10588  C  CG2  . ILE A 1 110 ? 13.545  2.972   -5.367  1.00 0.00 ? 110 ILE A CG2  3  
ATOM   10589  C  CD1  . ILE A 1 110 ? 11.098  4.538   -4.653  1.00 0.00 ? 110 ILE A CD1  3  
ATOM   10590  H  H    . ILE A 1 110 ? 11.771  4.808   -8.505  1.00 0.00 ? 110 ILE A H    3  
ATOM   10591  H  HA   . ILE A 1 110 ? 14.303  4.876   -7.221  1.00 0.00 ? 110 ILE A HA   3  
ATOM   10592  H  HB   . ILE A 1 110 ? 11.914  3.074   -6.759  1.00 0.00 ? 110 ILE A HB   3  
ATOM   10593  H  HG12 . ILE A 1 110 ? 12.863  5.571   -5.314  1.00 0.00 ? 110 ILE A HG12 3  
ATOM   10594  H  HG13 . ILE A 1 110 ? 11.554  5.538   -6.496  1.00 0.00 ? 110 ILE A HG13 3  
ATOM   10595  H  HG21 . ILE A 1 110 ? 13.317  3.337   -4.377  1.00 0.00 ? 110 ILE A HG21 3  
ATOM   10596  H  HG22 . ILE A 1 110 ? 14.591  3.132   -5.577  1.00 0.00 ? 110 ILE A HG22 3  
ATOM   10597  H  HG23 . ILE A 1 110 ? 13.324  1.917   -5.421  1.00 0.00 ? 110 ILE A HG23 3  
ATOM   10598  H  HD11 . ILE A 1 110 ? 11.612  4.504   -3.703  1.00 0.00 ? 110 ILE A HD11 3  
ATOM   10599  H  HD12 . ILE A 1 110 ? 10.704  3.560   -4.884  1.00 0.00 ? 110 ILE A HD12 3  
ATOM   10600  H  HD13 . ILE A 1 110 ? 10.287  5.249   -4.599  1.00 0.00 ? 110 ILE A HD13 3  
ATOM   10601  N  N    . ARG A 1 111 ? 13.683  2.089   -8.871  1.00 0.00 ? 111 ARG A N    3  
ATOM   10602  C  CA   . ARG A 1 111 ? 14.384  0.881   -9.394  1.00 0.00 ? 111 ARG A CA   3  
ATOM   10603  C  C    . ARG A 1 111 ? 15.636  1.297   -10.168 1.00 0.00 ? 111 ARG A C    3  
ATOM   10604  O  O    . ARG A 1 111 ? 16.604  0.565   -10.235 1.00 0.00 ? 111 ARG A O    3  
ATOM   10605  C  CB   . ARG A 1 111 ? 13.448  0.097   -10.316 1.00 0.00 ? 111 ARG A CB   3  
ATOM   10606  C  CG   . ARG A 1 111 ? 14.121  -1.214  -10.728 1.00 0.00 ? 111 ARG A CG   3  
ATOM   10607  C  CD   . ARG A 1 111 ? 14.069  -1.361  -12.249 1.00 0.00 ? 111 ARG A CD   3  
ATOM   10608  N  NE   . ARG A 1 111 ? 14.706  -2.650  -12.642 1.00 0.00 ? 111 ARG A NE   3  
ATOM   10609  C  CZ   . ARG A 1 111 ? 15.129  -2.823  -13.864 1.00 0.00 ? 111 ARG A CZ   3  
ATOM   10610  N  NH1  . ARG A 1 111 ? 14.985  -1.870  -14.745 1.00 0.00 ? 111 ARG A NH1  3  
ATOM   10611  N  NH2  . ARG A 1 111 ? 15.693  -3.949  -14.205 1.00 0.00 ? 111 ARG A NH2  3  
ATOM   10612  H  H    . ARG A 1 111 ? 12.744  2.252   -9.102  1.00 0.00 ? 111 ARG A H    3  
ATOM   10613  H  HA   . ARG A 1 111 ? 14.674  0.252   -8.563  1.00 0.00 ? 111 ARG A HA   3  
ATOM   10614  H  HB2  . ARG A 1 111 ? 12.529  -0.121  -9.793  1.00 0.00 ? 111 ARG A HB2  3  
ATOM   10615  H  HB3  . ARG A 1 111 ? 13.234  0.682   -11.197 1.00 0.00 ? 111 ARG A HB3  3  
ATOM   10616  H  HG2  . ARG A 1 111 ? 15.151  -1.209  -10.403 1.00 0.00 ? 111 ARG A HG2  3  
ATOM   10617  H  HG3  . ARG A 1 111 ? 13.603  -2.044  -10.272 1.00 0.00 ? 111 ARG A HG3  3  
ATOM   10618  H  HD2  . ARG A 1 111 ? 13.040  -1.354  -12.577 1.00 0.00 ? 111 ARG A HD2  3  
ATOM   10619  H  HD3  . ARG A 1 111 ? 14.600  -0.542  -12.709 1.00 0.00 ? 111 ARG A HD3  3  
ATOM   10620  H  HE   . ARG A 1 111 ? 14.810  -3.367  -11.982 1.00 0.00 ? 111 ARG A HE   3  
ATOM   10621  H  HH11 . ARG A 1 111 ? 14.549  -1.009  -14.483 1.00 0.00 ? 111 ARG A HH11 3  
ATOM   10622  H  HH12 . ARG A 1 111 ? 15.311  -2.001  -15.681 1.00 0.00 ? 111 ARG A HH12 3  
ATOM   10623  H  HH21 . ARG A 1 111 ? 15.801  -4.679  -13.530 1.00 0.00 ? 111 ARG A HH21 3  
ATOM   10624  H  HH22 . ARG A 1 111 ? 16.017  -4.083  -15.142 1.00 0.00 ? 111 ARG A HH22 3  
ATOM   10625  N  N    . LYS A 1 112 ? 15.633  2.460   -10.756 1.00 0.00 ? 112 LYS A N    3  
ATOM   10626  C  CA   . LYS A 1 112 ? 16.837  2.899   -11.523 1.00 0.00 ? 112 LYS A CA   3  
ATOM   10627  C  C    . LYS A 1 112 ? 17.884  3.484   -10.568 1.00 0.00 ? 112 LYS A C    3  
ATOM   10628  O  O    . LYS A 1 112 ? 19.002  3.755   -10.958 1.00 0.00 ? 112 LYS A O    3  
ATOM   10629  C  CB   . LYS A 1 112 ? 16.432  3.963   -12.546 1.00 0.00 ? 112 LYS A CB   3  
ATOM   10630  C  CG   . LYS A 1 112 ? 17.359  3.886   -13.763 1.00 0.00 ? 112 LYS A CG   3  
ATOM   10631  C  CD   . LYS A 1 112 ? 16.889  4.878   -14.829 1.00 0.00 ? 112 LYS A CD   3  
ATOM   10632  C  CE   . LYS A 1 112 ? 17.949  4.993   -15.927 1.00 0.00 ? 112 LYS A CE   3  
ATOM   10633  N  NZ   . LYS A 1 112 ? 18.803  6.186   -15.668 1.00 0.00 ? 112 LYS A NZ   3  
ATOM   10634  H  H    . LYS A 1 112 ? 14.841  3.045   -10.697 1.00 0.00 ? 112 LYS A H    3  
ATOM   10635  H  HA   . LYS A 1 112 ? 17.261  2.050   -12.039 1.00 0.00 ? 112 LYS A HA   3  
ATOM   10636  H  HB2  . LYS A 1 112 ? 15.411  3.792   -12.858 1.00 0.00 ? 112 LYS A HB2  3  
ATOM   10637  H  HB3  . LYS A 1 112 ? 16.512  4.942   -12.097 1.00 0.00 ? 112 LYS A HB3  3  
ATOM   10638  H  HG2  . LYS A 1 112 ? 18.368  4.132   -13.461 1.00 0.00 ? 112 LYS A HG2  3  
ATOM   10639  H  HG3  . LYS A 1 112 ? 17.338  2.887   -14.169 1.00 0.00 ? 112 LYS A HG3  3  
ATOM   10640  H  HD2  . LYS A 1 112 ? 15.961  4.531   -15.258 1.00 0.00 ? 112 LYS A HD2  3  
ATOM   10641  H  HD3  . LYS A 1 112 ? 16.736  5.847   -14.377 1.00 0.00 ? 112 LYS A HD3  3  
ATOM   10642  H  HE2  . LYS A 1 112 ? 18.563  4.104   -15.930 1.00 0.00 ? 112 LYS A HE2  3  
ATOM   10643  H  HE3  . LYS A 1 112 ? 17.465  5.099   -16.886 1.00 0.00 ? 112 LYS A HE3  3  
ATOM   10644  H  HZ1  . LYS A 1 112 ? 19.536  5.944   -14.972 1.00 0.00 ? 112 LYS A HZ1  3  
ATOM   10645  H  HZ2  . LYS A 1 112 ? 18.215  6.961   -15.299 1.00 0.00 ? 112 LYS A HZ2  3  
ATOM   10646  H  HZ3  . LYS A 1 112 ? 19.257  6.486   -16.554 1.00 0.00 ? 112 LYS A HZ3  3  
ATOM   10647  N  N    . ASN A 1 113 ? 17.521  3.703   -9.330  1.00 0.00 ? 113 ASN A N    3  
ATOM   10648  C  CA   . ASN A 1 113 ? 18.494  4.299   -8.362  1.00 0.00 ? 113 ASN A CA   3  
ATOM   10649  C  C    . ASN A 1 113 ? 18.689  3.397   -7.138  1.00 0.00 ? 113 ASN A C    3  
ATOM   10650  O  O    . ASN A 1 113 ? 18.923  3.876   -6.048  1.00 0.00 ? 113 ASN A O    3  
ATOM   10651  C  CB   . ASN A 1 113 ? 17.971  5.661   -7.909  1.00 0.00 ? 113 ASN A CB   3  
ATOM   10652  C  CG   . ASN A 1 113 ? 18.261  6.701   -8.993  1.00 0.00 ? 113 ASN A CG   3  
ATOM   10653  O  OD1  . ASN A 1 113 ? 18.468  6.357   -10.140 1.00 0.00 ? 113 ASN A OD1  3  
ATOM   10654  N  ND2  . ASN A 1 113 ? 18.287  7.967   -8.677  1.00 0.00 ? 113 ASN A ND2  3  
ATOM   10655  H  H    . ASN A 1 113 ? 16.604  3.497   -9.057  1.00 0.00 ? 113 ASN A H    3  
ATOM   10656  H  HA   . ASN A 1 113 ? 19.445  4.436   -8.851  1.00 0.00 ? 113 ASN A HA   3  
ATOM   10657  H  HB2  . ASN A 1 113 ? 16.905  5.600   -7.743  1.00 0.00 ? 113 ASN A HB2  3  
ATOM   10658  H  HB3  . ASN A 1 113 ? 18.464  5.952   -6.994  1.00 0.00 ? 113 ASN A HB3  3  
ATOM   10659  H  HD21 . ASN A 1 113 ? 18.121  8.244   -7.752  1.00 0.00 ? 113 ASN A HD21 3  
ATOM   10660  H  HD22 . ASN A 1 113 ? 18.470  8.639   -9.366  1.00 0.00 ? 113 ASN A HD22 3  
ATOM   10661  N  N    . ILE A 1 114 ? 18.599  2.103   -7.292  1.00 0.00 ? 114 ILE A N    3  
ATOM   10662  C  CA   . ILE A 1 114 ? 18.796  1.211   -6.107  1.00 0.00 ? 114 ILE A CA   3  
ATOM   10663  C  C    . ILE A 1 114 ? 20.288  0.911   -5.923  1.00 0.00 ? 114 ILE A C    3  
ATOM   10664  O  O    . ILE A 1 114 ? 21.035  0.803   -6.875  1.00 0.00 ? 114 ILE A O    3  
ATOM   10665  C  CB   . ILE A 1 114 ? 18.028  -0.107  -6.291  1.00 0.00 ? 114 ILE A CB   3  
ATOM   10666  C  CG1  . ILE A 1 114 ? 16.524  0.168   -6.127  1.00 0.00 ? 114 ILE A CG1  3  
ATOM   10667  C  CG2  . ILE A 1 114 ? 18.503  -1.120  -5.236  1.00 0.00 ? 114 ILE A CG2  3  
ATOM   10668  C  CD1  . ILE A 1 114 ? 15.734  -1.143  -6.102  1.00 0.00 ? 114 ILE A CD1  3  
ATOM   10669  H  H    . ILE A 1 114 ? 18.401  1.728   -8.177  1.00 0.00 ? 114 ILE A H    3  
ATOM   10670  H  HA   . ILE A 1 114 ? 18.431  1.718   -5.224  1.00 0.00 ? 114 ILE A HA   3  
ATOM   10671  H  HB   . ILE A 1 114 ? 18.220  -0.500  -7.280  1.00 0.00 ? 114 ILE A HB   3  
ATOM   10672  H  HG12 . ILE A 1 114 ? 16.356  0.703   -5.206  1.00 0.00 ? 114 ILE A HG12 3  
ATOM   10673  H  HG13 . ILE A 1 114 ? 16.185  0.769   -6.952  1.00 0.00 ? 114 ILE A HG13 3  
ATOM   10674  H  HG21 . ILE A 1 114 ? 17.870  -1.993  -5.247  1.00 0.00 ? 114 ILE A HG21 3  
ATOM   10675  H  HG22 . ILE A 1 114 ? 18.465  -0.664  -4.259  1.00 0.00 ? 114 ILE A HG22 3  
ATOM   10676  H  HG23 . ILE A 1 114 ? 19.518  -1.419  -5.452  1.00 0.00 ? 114 ILE A HG23 3  
ATOM   10677  H  HD11 . ILE A 1 114 ? 14.677  -0.925  -6.066  1.00 0.00 ? 114 ILE A HD11 3  
ATOM   10678  H  HD12 . ILE A 1 114 ? 16.012  -1.714  -5.228  1.00 0.00 ? 114 ILE A HD12 3  
ATOM   10679  H  HD13 . ILE A 1 114 ? 15.954  -1.715  -6.991  1.00 0.00 ? 114 ILE A HD13 3  
ATOM   10680  N  N    . LEU A 1 115 ? 20.718  0.757   -4.695  1.00 0.00 ? 115 LEU A N    3  
ATOM   10681  C  CA   . LEU A 1 115 ? 22.152  0.441   -4.427  1.00 0.00 ? 115 LEU A CA   3  
ATOM   10682  C  C    . LEU A 1 115 ? 22.227  -0.724  -3.435  1.00 0.00 ? 115 LEU A C    3  
ATOM   10683  O  O    . LEU A 1 115 ? 21.272  -1.022  -2.749  1.00 0.00 ? 115 LEU A O    3  
ATOM   10684  C  CB   . LEU A 1 115 ? 22.846  1.665   -3.825  1.00 0.00 ? 115 LEU A CB   3  
ATOM   10685  C  CG   . LEU A 1 115 ? 24.366  1.511   -3.942  1.00 0.00 ? 115 LEU A CG   3  
ATOM   10686  C  CD1  . LEU A 1 115 ? 24.776  1.514   -5.417  1.00 0.00 ? 115 LEU A CD1  3  
ATOM   10687  C  CD2  . LEU A 1 115 ? 25.057  2.675   -3.225  1.00 0.00 ? 115 LEU A CD2  3  
ATOM   10688  H  H    . LEU A 1 115 ? 20.090  0.827   -3.948  1.00 0.00 ? 115 LEU A H    3  
ATOM   10689  H  HA   . LEU A 1 115 ? 22.638  0.161   -5.349  1.00 0.00 ? 115 LEU A HA   3  
ATOM   10690  H  HB2  . LEU A 1 115 ? 22.531  2.548   -4.354  1.00 0.00 ? 115 LEU A HB2  3  
ATOM   10691  H  HB3  . LEU A 1 115 ? 22.574  1.753   -2.784  1.00 0.00 ? 115 LEU A HB3  3  
ATOM   10692  H  HG   . LEU A 1 115 ? 24.669  0.578   -3.489  1.00 0.00 ? 115 LEU A HG   3  
ATOM   10693  H  HD11 . LEU A 1 115 ? 24.017  2.012   -6.002  1.00 0.00 ? 115 LEU A HD11 3  
ATOM   10694  H  HD12 . LEU A 1 115 ? 24.888  0.497   -5.763  1.00 0.00 ? 115 LEU A HD12 3  
ATOM   10695  H  HD13 . LEU A 1 115 ? 25.716  2.037   -5.527  1.00 0.00 ? 115 LEU A HD13 3  
ATOM   10696  H  HD21 . LEU A 1 115 ? 24.396  3.079   -2.473  1.00 0.00 ? 115 LEU A HD21 3  
ATOM   10697  H  HD22 . LEU A 1 115 ? 25.299  3.445   -3.942  1.00 0.00 ? 115 LEU A HD22 3  
ATOM   10698  H  HD23 . LEU A 1 115 ? 25.964  2.322   -2.757  1.00 0.00 ? 115 LEU A HD23 3  
ATOM   10699  N  N    . ASN A 1 116 ? 23.351  -1.384  -3.354  1.00 0.00 ? 116 ASN A N    3  
ATOM   10700  C  CA   . ASN A 1 116 ? 23.481  -2.526  -2.405  1.00 0.00 ? 116 ASN A CA   3  
ATOM   10701  C  C    . ASN A 1 116 ? 24.408  -2.136  -1.248  1.00 0.00 ? 116 ASN A C    3  
ATOM   10702  O  O    . ASN A 1 116 ? 25.508  -1.664  -1.455  1.00 0.00 ? 116 ASN A O    3  
ATOM   10703  C  CB   . ASN A 1 116 ? 24.069  -3.725  -3.147  1.00 0.00 ? 116 ASN A CB   3  
ATOM   10704  C  CG   . ASN A 1 116 ? 23.166  -4.085  -4.328  1.00 0.00 ? 116 ASN A CG   3  
ATOM   10705  O  OD1  . ASN A 1 116 ? 21.977  -4.274  -4.163  1.00 0.00 ? 116 ASN A OD1  3  
ATOM   10706  N  ND2  . ASN A 1 116 ? 23.683  -4.189  -5.522  1.00 0.00 ? 116 ASN A ND2  3  
ATOM   10707  H  H    . ASN A 1 116 ? 24.112  -1.132  -3.916  1.00 0.00 ? 116 ASN A H    3  
ATOM   10708  H  HA   . ASN A 1 116 ? 22.509  -2.788  -2.014  1.00 0.00 ? 116 ASN A HA   3  
ATOM   10709  H  HB2  . ASN A 1 116 ? 25.057  -3.475  -3.508  1.00 0.00 ? 116 ASN A HB2  3  
ATOM   10710  H  HB3  . ASN A 1 116 ? 24.131  -4.563  -2.476  1.00 0.00 ? 116 ASN A HB3  3  
ATOM   10711  H  HD21 . ASN A 1 116 ? 24.642  -4.036  -5.656  1.00 0.00 ? 116 ASN A HD21 3  
ATOM   10712  H  HD22 . ASN A 1 116 ? 23.112  -4.418  -6.285  1.00 0.00 ? 116 ASN A HD22 3  
ATOM   10713  N  N    . GLN A 1 117 ? 23.973  -2.335  -0.031  1.00 0.00 ? 117 GLN A N    3  
ATOM   10714  C  CA   . GLN A 1 117 ? 24.828  -1.981  1.141   1.00 0.00 ? 117 GLN A CA   3  
ATOM   10715  C  C    . GLN A 1 117 ? 25.576  -3.222  1.638   1.00 0.00 ? 117 GLN A C    3  
ATOM   10716  O  O    . GLN A 1 117 ? 25.641  -4.230  0.963   1.00 0.00 ? 117 GLN A O    3  
ATOM   10717  C  CB   . GLN A 1 117 ? 23.955  -1.421  2.266   1.00 0.00 ? 117 GLN A CB   3  
ATOM   10718  C  CG   . GLN A 1 117 ? 23.987  0.107   2.219   1.00 0.00 ? 117 GLN A CG   3  
ATOM   10719  C  CD   . GLN A 1 117 ? 22.814  0.674   3.022   1.00 0.00 ? 117 GLN A CD   3  
ATOM   10720  O  OE1  . GLN A 1 117 ? 22.597  1.870   3.037   1.00 0.00 ? 117 GLN A OE1  3  
ATOM   10721  N  NE2  . GLN A 1 117 ? 22.047  -0.136  3.699   1.00 0.00 ? 117 GLN A NE2  3  
ATOM   10722  H  H    . GLN A 1 117 ? 23.083  -2.720  0.112   1.00 0.00 ? 117 GLN A H    3  
ATOM   10723  H  HA   . GLN A 1 117 ? 25.546  -1.232  0.842   1.00 0.00 ? 117 GLN A HA   3  
ATOM   10724  H  HB2  . GLN A 1 117 ? 22.940  -1.763  2.138   1.00 0.00 ? 117 GLN A HB2  3  
ATOM   10725  H  HB3  . GLN A 1 117 ? 24.330  -1.760  3.217   1.00 0.00 ? 117 GLN A HB3  3  
ATOM   10726  H  HG2  . GLN A 1 117 ? 24.916  0.458   2.643   1.00 0.00 ? 117 GLN A HG2  3  
ATOM   10727  H  HG3  . GLN A 1 117 ? 23.913  0.434   1.197   1.00 0.00 ? 117 GLN A HG3  3  
ATOM   10728  H  HE21 . GLN A 1 117 ? 22.224  -1.098  3.693   1.00 0.00 ? 117 GLN A HE21 3  
ATOM   10729  H  HE22 . GLN A 1 117 ? 21.293  0.221   4.213   1.00 0.00 ? 117 GLN A HE22 3  
ATOM   10730  N  N    . ASN A 1 118 ? 26.149  -3.147  2.813   1.00 0.00 ? 118 ASN A N    3  
ATOM   10731  C  CA   . ASN A 1 118 ? 26.906  -4.315  3.357   1.00 0.00 ? 118 ASN A CA   3  
ATOM   10732  C  C    . ASN A 1 118 ? 26.362  -4.717  4.732   1.00 0.00 ? 118 ASN A C    3  
ATOM   10733  O  O    . ASN A 1 118 ? 27.025  -4.567  5.739   1.00 0.00 ? 118 ASN A O    3  
ATOM   10734  C  CB   . ASN A 1 118 ? 28.380  -3.941  3.490   1.00 0.00 ? 118 ASN A CB   3  
ATOM   10735  C  CG   . ASN A 1 118 ? 29.178  -5.165  3.946   1.00 0.00 ? 118 ASN A CG   3  
ATOM   10736  O  OD1  . ASN A 1 118 ? 29.598  -5.242  5.084   1.00 0.00 ? 118 ASN A OD1  3  
ATOM   10737  N  ND2  . ASN A 1 118 ? 29.406  -6.131  3.099   1.00 0.00 ? 118 ASN A ND2  3  
ATOM   10738  H  H    . ASN A 1 118 ? 26.085  -2.318  3.334   1.00 0.00 ? 118 ASN A H    3  
ATOM   10739  H  HA   . ASN A 1 118 ? 26.814  -5.148  2.682   1.00 0.00 ? 118 ASN A HA   3  
ATOM   10740  H  HB2  . ASN A 1 118 ? 28.751  -3.603  2.535   1.00 0.00 ? 118 ASN A HB2  3  
ATOM   10741  H  HB3  . ASN A 1 118 ? 28.486  -3.155  4.218   1.00 0.00 ? 118 ASN A HB3  3  
ATOM   10742  H  HD21 . ASN A 1 118 ? 29.069  -6.068  2.182   1.00 0.00 ? 118 ASN A HD21 3  
ATOM   10743  H  HD22 . ASN A 1 118 ? 29.917  -6.918  3.380   1.00 0.00 ? 118 ASN A HD22 3  
ATOM   10744  N  N    . ARG A 1 119 ? 25.171  -5.250  4.782   1.00 0.00 ? 119 ARG A N    3  
ATOM   10745  C  CA   . ARG A 1 119 ? 24.605  -5.683  6.093   1.00 0.00 ? 119 ARG A CA   3  
ATOM   10746  C  C    . ARG A 1 119 ? 23.495  -6.716  5.870   1.00 0.00 ? 119 ARG A C    3  
ATOM   10747  O  O    . ARG A 1 119 ? 22.675  -6.586  4.982   1.00 0.00 ? 119 ARG A O    3  
ATOM   10748  C  CB   . ARG A 1 119 ? 24.034  -4.478  6.843   1.00 0.00 ? 119 ARG A CB   3  
ATOM   10749  C  CG   . ARG A 1 119 ? 23.192  -4.974  8.026   1.00 0.00 ? 119 ARG A CG   3  
ATOM   10750  C  CD   . ARG A 1 119 ? 23.381  -4.049  9.233   1.00 0.00 ? 119 ARG A CD   3  
ATOM   10751  N  NE   . ARG A 1 119 ? 22.742  -4.664  10.431  1.00 0.00 ? 119 ARG A NE   3  
ATOM   10752  C  CZ   . ARG A 1 119 ? 22.965  -4.168  11.617  1.00 0.00 ? 119 ARG A CZ   3  
ATOM   10753  N  NH1  . ARG A 1 119 ? 23.760  -3.142  11.758  1.00 0.00 ? 119 ARG A NH1  3  
ATOM   10754  N  NH2  . ARG A 1 119 ? 22.395  -4.699  12.665  1.00 0.00 ? 119 ARG A NH2  3  
ATOM   10755  H  H    . ARG A 1 119 ? 24.658  -5.377  3.958   1.00 0.00 ? 119 ARG A H    3  
ATOM   10756  H  HA   . ARG A 1 119 ? 25.389  -6.130  6.686   1.00 0.00 ? 119 ARG A HA   3  
ATOM   10757  H  HB2  . ARG A 1 119 ? 24.846  -3.865  7.203   1.00 0.00 ? 119 ARG A HB2  3  
ATOM   10758  H  HB3  . ARG A 1 119 ? 23.412  -3.900  6.176   1.00 0.00 ? 119 ARG A HB3  3  
ATOM   10759  H  HG2  . ARG A 1 119 ? 22.150  -4.987  7.743   1.00 0.00 ? 119 ARG A HG2  3  
ATOM   10760  H  HG3  . ARG A 1 119 ? 23.502  -5.973  8.293   1.00 0.00 ? 119 ARG A HG3  3  
ATOM   10761  H  HD2  . ARG A 1 119 ? 24.434  -3.909  9.422   1.00 0.00 ? 119 ARG A HD2  3  
ATOM   10762  H  HD3  . ARG A 1 119 ? 22.919  -3.095  9.032   1.00 0.00 ? 119 ARG A HD3  3  
ATOM   10763  H  HE   . ARG A 1 119 ? 22.151  -5.439  10.328  1.00 0.00 ? 119 ARG A HE   3  
ATOM   10764  H  HH11 . ARG A 1 119 ? 24.199  -2.738  10.956  1.00 0.00 ? 119 ARG A HH11 3  
ATOM   10765  H  HH12 . ARG A 1 119 ? 23.927  -2.760  12.666  1.00 0.00 ? 119 ARG A HH12 3  
ATOM   10766  H  HH21 . ARG A 1 119 ? 21.789  -5.486  12.559  1.00 0.00 ? 119 ARG A HH21 3  
ATOM   10767  H  HH22 . ARG A 1 119 ? 22.566  -4.318  13.574  1.00 0.00 ? 119 ARG A HH22 3  
ATOM   10768  N  N    . GLU A 1 120 ? 23.475  -7.746  6.673   1.00 0.00 ? 120 GLU A N    3  
ATOM   10769  C  CA   . GLU A 1 120 ? 22.440  -8.812  6.532   1.00 0.00 ? 120 GLU A CA   3  
ATOM   10770  C  C    . GLU A 1 120 ? 21.040  -8.203  6.401   1.00 0.00 ? 120 GLU A C    3  
ATOM   10771  O  O    . GLU A 1 120 ? 20.824  -7.035  6.656   1.00 0.00 ? 120 GLU A O    3  
ATOM   10772  C  CB   . GLU A 1 120 ? 22.483  -9.717  7.765   1.00 0.00 ? 120 GLU A CB   3  
ATOM   10773  C  CG   . GLU A 1 120 ? 21.462  -10.844 7.608   1.00 0.00 ? 120 GLU A CG   3  
ATOM   10774  C  CD   . GLU A 1 120 ? 21.803  -11.977 8.578   1.00 0.00 ? 120 GLU A CD   3  
ATOM   10775  O  OE1  . GLU A 1 120 ? 21.811  -11.724 9.772   1.00 0.00 ? 120 GLU A OE1  3  
ATOM   10776  O  OE2  . GLU A 1 120 ? 22.051  -13.075 8.112   1.00 0.00 ? 120 GLU A OE2  3  
ATOM   10777  H  H    . GLU A 1 120 ? 24.155  -7.838  7.371   1.00 0.00 ? 120 GLU A H    3  
ATOM   10778  H  HA   . GLU A 1 120 ? 22.654  -9.402  5.654   1.00 0.00 ? 120 GLU A HA   3  
ATOM   10779  H  HB2  . GLU A 1 120 ? 23.472  -10.139 7.868   1.00 0.00 ? 120 GLU A HB2  3  
ATOM   10780  H  HB3  . GLU A 1 120 ? 22.244  -9.138  8.646   1.00 0.00 ? 120 GLU A HB3  3  
ATOM   10781  H  HG2  . GLU A 1 120 ? 20.473  -10.467 7.826   1.00 0.00 ? 120 GLU A HG2  3  
ATOM   10782  H  HG3  . GLU A 1 120 ? 21.492  -11.219 6.596   1.00 0.00 ? 120 GLU A HG3  3  
ATOM   10783  N  N    . ILE A 1 121 ? 20.087  -9.013  6.019   1.00 0.00 ? 121 ILE A N    3  
ATOM   10784  C  CA   . ILE A 1 121 ? 18.683  -8.528  5.881   1.00 0.00 ? 121 ILE A CA   3  
ATOM   10785  C  C    . ILE A 1 121 ? 17.769  -9.437  6.709   1.00 0.00 ? 121 ILE A C    3  
ATOM   10786  O  O    . ILE A 1 121 ? 17.712  -10.631 6.498   1.00 0.00 ? 121 ILE A O    3  
ATOM   10787  C  CB   . ILE A 1 121 ? 18.262  -8.576  4.409   1.00 0.00 ? 121 ILE A CB   3  
ATOM   10788  C  CG1  . ILE A 1 121 ? 19.234  -7.735  3.576   1.00 0.00 ? 121 ILE A CG1  3  
ATOM   10789  C  CG2  . ILE A 1 121 ? 16.845  -8.013  4.267   1.00 0.00 ? 121 ILE A CG2  3  
ATOM   10790  C  CD1  . ILE A 1 121 ? 18.738  -7.655  2.130   1.00 0.00 ? 121 ILE A CD1  3  
ATOM   10791  H  H    . ILE A 1 121 ? 20.299  -9.955  5.855   1.00 0.00 ? 121 ILE A H    3  
ATOM   10792  H  HA   . ILE A 1 121 ? 18.613  -7.514  6.246   1.00 0.00 ? 121 ILE A HA   3  
ATOM   10793  H  HB   . ILE A 1 121 ? 18.278  -9.600  4.063   1.00 0.00 ? 121 ILE A HB   3  
ATOM   10794  H  HG12 . ILE A 1 121 ? 19.295  -6.740  3.992   1.00 0.00 ? 121 ILE A HG12 3  
ATOM   10795  H  HG13 . ILE A 1 121 ? 20.212  -8.193  3.593   1.00 0.00 ? 121 ILE A HG13 3  
ATOM   10796  H  HG21 . ILE A 1 121 ? 16.844  -6.969  4.545   1.00 0.00 ? 121 ILE A HG21 3  
ATOM   10797  H  HG22 . ILE A 1 121 ? 16.176  -8.557  4.917   1.00 0.00 ? 121 ILE A HG22 3  
ATOM   10798  H  HG23 . ILE A 1 121 ? 16.514  -8.115  3.245   1.00 0.00 ? 121 ILE A HG23 3  
ATOM   10799  H  HD11 . ILE A 1 121 ? 18.368  -6.660  1.931   1.00 0.00 ? 121 ILE A HD11 3  
ATOM   10800  H  HD12 . ILE A 1 121 ? 17.944  -8.370  1.981   1.00 0.00 ? 121 ILE A HD12 3  
ATOM   10801  H  HD13 . ILE A 1 121 ? 19.553  -7.877  1.457   1.00 0.00 ? 121 ILE A HD13 3  
ATOM   10802  N  N    . ASP A 1 122 ? 17.069  -8.885  7.664   1.00 0.00 ? 122 ASP A N    3  
ATOM   10803  C  CA   . ASP A 1 122 ? 16.181  -9.726  8.518   1.00 0.00 ? 122 ASP A CA   3  
ATOM   10804  C  C    . ASP A 1 122 ? 14.852  -9.998  7.809   1.00 0.00 ? 122 ASP A C    3  
ATOM   10805  O  O    . ASP A 1 122 ? 13.838  -9.406  8.124   1.00 0.00 ? 122 ASP A O    3  
ATOM   10806  C  CB   . ASP A 1 122 ? 15.909  -9.002  9.836   1.00 0.00 ? 122 ASP A CB   3  
ATOM   10807  C  CG   . ASP A 1 122 ? 15.187  -9.947  10.797  1.00 0.00 ? 122 ASP A CG   3  
ATOM   10808  O  OD1  . ASP A 1 122 ? 15.165  -11.136 10.522  1.00 0.00 ? 122 ASP A OD1  3  
ATOM   10809  O  OD2  . ASP A 1 122 ? 14.666  -9.468  11.790  1.00 0.00 ? 122 ASP A OD2  3  
ATOM   10810  H  H    . ASP A 1 122 ? 17.139  -7.921  7.830   1.00 0.00 ? 122 ASP A H    3  
ATOM   10811  H  HA   . ASP A 1 122 ? 16.671  -10.663 8.724   1.00 0.00 ? 122 ASP A HA   3  
ATOM   10812  H  HB2  . ASP A 1 122 ? 16.847  -8.688  10.274  1.00 0.00 ? 122 ASP A HB2  3  
ATOM   10813  H  HB3  . ASP A 1 122 ? 15.291  -8.138  9.651   1.00 0.00 ? 122 ASP A HB3  3  
ATOM   10814  N  N    . TYR A 1 123 ? 14.843  -10.896 6.862   1.00 0.00 ? 123 TYR A N    3  
ATOM   10815  C  CA   . TYR A 1 123 ? 13.576  -11.213 6.143   1.00 0.00 ? 123 TYR A CA   3  
ATOM   10816  C  C    . TYR A 1 123 ? 12.524  -11.688 7.146   1.00 0.00 ? 123 TYR A C    3  
ATOM   10817  O  O    . TYR A 1 123 ? 12.839  -12.320 8.135   1.00 0.00 ? 123 TYR A O    3  
ATOM   10818  C  CB   . TYR A 1 123 ? 13.833  -12.334 5.134   1.00 0.00 ? 123 TYR A CB   3  
ATOM   10819  C  CG   . TYR A 1 123 ? 14.288  -11.749 3.821   1.00 0.00 ? 123 TYR A CG   3  
ATOM   10820  C  CD1  . TYR A 1 123 ? 15.611  -11.313 3.667   1.00 0.00 ? 123 TYR A CD1  3  
ATOM   10821  C  CD2  . TYR A 1 123 ? 13.389  -11.647 2.754   1.00 0.00 ? 123 TYR A CD2  3  
ATOM   10822  C  CE1  . TYR A 1 123 ? 16.031  -10.775 2.445   1.00 0.00 ? 123 TYR A CE1  3  
ATOM   10823  C  CE2  . TYR A 1 123 ? 13.809  -11.108 1.533   1.00 0.00 ? 123 TYR A CE2  3  
ATOM   10824  C  CZ   . TYR A 1 123 ? 15.129  -10.671 1.378   1.00 0.00 ? 123 TYR A CZ   3  
ATOM   10825  O  OH   . TYR A 1 123 ? 15.545  -10.140 0.174   1.00 0.00 ? 123 TYR A OH   3  
ATOM   10826  H  H    . TYR A 1 123 ? 15.667  -11.366 6.620   1.00 0.00 ? 123 TYR A H    3  
ATOM   10827  H  HA   . TYR A 1 123 ? 13.218  -10.335 5.626   1.00 0.00 ? 123 TYR A HA   3  
ATOM   10828  H  HB2  . TYR A 1 123 ? 14.596  -12.993 5.519   1.00 0.00 ? 123 TYR A HB2  3  
ATOM   10829  H  HB3  . TYR A 1 123 ? 12.921  -12.892 4.980   1.00 0.00 ? 123 TYR A HB3  3  
ATOM   10830  H  HD1  . TYR A 1 123 ? 16.305  -11.391 4.490   1.00 0.00 ? 123 TYR A HD1  3  
ATOM   10831  H  HD2  . TYR A 1 123 ? 12.372  -11.986 2.873   1.00 0.00 ? 123 TYR A HD2  3  
ATOM   10832  H  HE1  . TYR A 1 123 ? 17.050  -10.439 2.325   1.00 0.00 ? 123 TYR A HE1  3  
ATOM   10833  H  HE2  . TYR A 1 123 ? 13.114  -11.029 0.709   1.00 0.00 ? 123 TYR A HE2  3  
ATOM   10834  H  HH   . TYR A 1 123 ? 14.809  -9.651  -0.204  1.00 0.00 ? 123 TYR A HH   3  
ATOM   10835  N  N    . PHE A 1 124 ? 11.277  -11.404 6.893   1.00 0.00 ? 124 PHE A N    3  
ATOM   10836  C  CA   . PHE A 1 124 ? 10.198  -11.851 7.820   1.00 0.00 ? 124 PHE A CA   3  
ATOM   10837  C  C    . PHE A 1 124 ? 9.434   -13.002 7.157   1.00 0.00 ? 124 PHE A C    3  
ATOM   10838  O  O    . PHE A 1 124 ? 8.965   -12.883 6.042   1.00 0.00 ? 124 PHE A O    3  
ATOM   10839  C  CB   . PHE A 1 124 ? 9.247   -10.681 8.089   1.00 0.00 ? 124 PHE A CB   3  
ATOM   10840  C  CG   . PHE A 1 124 ? 8.398   -10.966 9.307   1.00 0.00 ? 124 PHE A CG   3  
ATOM   10841  C  CD1  . PHE A 1 124 ? 7.395   -11.944 9.253   1.00 0.00 ? 124 PHE A CD1  3  
ATOM   10842  C  CD2  . PHE A 1 124 ? 8.607   -10.245 10.489  1.00 0.00 ? 124 PHE A CD2  3  
ATOM   10843  C  CE1  . PHE A 1 124 ? 6.603   -12.196 10.380  1.00 0.00 ? 124 PHE A CE1  3  
ATOM   10844  C  CE2  . PHE A 1 124 ? 7.816   -10.500 11.616  1.00 0.00 ? 124 PHE A CE2  3  
ATOM   10845  C  CZ   . PHE A 1 124 ? 6.814   -11.475 11.562  1.00 0.00 ? 124 PHE A CZ   3  
ATOM   10846  H  H    . PHE A 1 124 ? 11.040  -10.903 6.084   1.00 0.00 ? 124 PHE A H    3  
ATOM   10847  H  HA   . PHE A 1 124 ? 10.632  -12.190 8.748   1.00 0.00 ? 124 PHE A HA   3  
ATOM   10848  H  HB2  . PHE A 1 124 ? 9.824   -9.784  8.260   1.00 0.00 ? 124 PHE A HB2  3  
ATOM   10849  H  HB3  . PHE A 1 124 ? 8.606   -10.534 7.235   1.00 0.00 ? 124 PHE A HB3  3  
ATOM   10850  H  HD1  . PHE A 1 124 ? 7.232   -12.501 8.342   1.00 0.00 ? 124 PHE A HD1  3  
ATOM   10851  H  HD2  . PHE A 1 124 ? 9.381   -9.492  10.532  1.00 0.00 ? 124 PHE A HD2  3  
ATOM   10852  H  HE1  . PHE A 1 124 ? 5.829   -12.949 10.338  1.00 0.00 ? 124 PHE A HE1  3  
ATOM   10853  H  HE2  . PHE A 1 124 ? 7.979   -9.943  12.527  1.00 0.00 ? 124 PHE A HE2  3  
ATOM   10854  H  HZ   . PHE A 1 124 ? 6.201   -11.669 12.431  1.00 0.00 ? 124 PHE A HZ   3  
ATOM   10855  N  N    . VAL A 1 125 ? 9.321   -14.119 7.825   1.00 0.00 ? 125 VAL A N    3  
ATOM   10856  C  CA   . VAL A 1 125 ? 8.603   -15.283 7.224   1.00 0.00 ? 125 VAL A CA   3  
ATOM   10857  C  C    . VAL A 1 125 ? 7.580   -15.837 8.217   1.00 0.00 ? 125 VAL A C    3  
ATOM   10858  O  O    . VAL A 1 125 ? 7.799   -15.845 9.412   1.00 0.00 ? 125 VAL A O    3  
ATOM   10859  C  CB   . VAL A 1 125 ? 9.615   -16.379 6.883   1.00 0.00 ? 125 VAL A CB   3  
ATOM   10860  C  CG1  . VAL A 1 125 ? 8.936   -17.468 6.048   1.00 0.00 ? 125 VAL A CG1  3  
ATOM   10861  C  CG2  . VAL A 1 125 ? 10.772  -15.772 6.087   1.00 0.00 ? 125 VAL A CG2  3  
ATOM   10862  H  H    . VAL A 1 125 ? 9.714   -14.196 8.716   1.00 0.00 ? 125 VAL A H    3  
ATOM   10863  H  HA   . VAL A 1 125 ? 8.096   -14.971 6.323   1.00 0.00 ? 125 VAL A HA   3  
ATOM   10864  H  HB   . VAL A 1 125 ? 9.995   -16.813 7.797   1.00 0.00 ? 125 VAL A HB   3  
ATOM   10865  H  HG11 . VAL A 1 125 ? 9.413   -18.417 6.239   1.00 0.00 ? 125 VAL A HG11 3  
ATOM   10866  H  HG12 . VAL A 1 125 ? 9.025   -17.225 5.000   1.00 0.00 ? 125 VAL A HG12 3  
ATOM   10867  H  HG13 . VAL A 1 125 ? 7.891   -17.528 6.316   1.00 0.00 ? 125 VAL A HG13 3  
ATOM   10868  H  HG21 . VAL A 1 125 ? 11.100  -16.474 5.335   1.00 0.00 ? 125 VAL A HG21 3  
ATOM   10869  H  HG22 . VAL A 1 125 ? 11.591  -15.549 6.755   1.00 0.00 ? 125 VAL A HG22 3  
ATOM   10870  H  HG23 . VAL A 1 125 ? 10.441  -14.861 5.609   1.00 0.00 ? 125 VAL A HG23 3  
ATOM   10871  N  N    . VAL A 1 126 ? 6.466   -16.306 7.727   1.00 0.00 ? 126 VAL A N    3  
ATOM   10872  C  CA   . VAL A 1 126 ? 5.429   -16.868 8.635   1.00 0.00 ? 126 VAL A CA   3  
ATOM   10873  C  C    . VAL A 1 126 ? 5.767   -18.325 8.950   1.00 0.00 ? 126 VAL A C    3  
ATOM   10874  O  O    . VAL A 1 126 ? 6.133   -19.088 8.079   1.00 0.00 ? 126 VAL A O    3  
ATOM   10875  C  CB   . VAL A 1 126 ? 4.064   -16.802 7.949   1.00 0.00 ? 126 VAL A CB   3  
ATOM   10876  C  CG1  . VAL A 1 126 ? 3.021   -17.515 8.812   1.00 0.00 ? 126 VAL A CG1  3  
ATOM   10877  C  CG2  . VAL A 1 126 ? 3.660   -15.339 7.760   1.00 0.00 ? 126 VAL A CG2  3  
ATOM   10878  H  H    . VAL A 1 126 ? 6.313   -16.292 6.759   1.00 0.00 ? 126 VAL A H    3  
ATOM   10879  H  HA   . VAL A 1 126 ? 5.400   -16.299 9.552   1.00 0.00 ? 126 VAL A HA   3  
ATOM   10880  H  HB   . VAL A 1 126 ? 4.124   -17.285 6.984   1.00 0.00 ? 126 VAL A HB   3  
ATOM   10881  H  HG11 . VAL A 1 126 ? 2.083   -16.981 8.758   1.00 0.00 ? 126 VAL A HG11 3  
ATOM   10882  H  HG12 . VAL A 1 126 ? 3.361   -17.545 9.836   1.00 0.00 ? 126 VAL A HG12 3  
ATOM   10883  H  HG13 . VAL A 1 126 ? 2.882   -18.523 8.448   1.00 0.00 ? 126 VAL A HG13 3  
ATOM   10884  H  HG21 . VAL A 1 126 ? 3.685   -15.094 6.710   1.00 0.00 ? 126 VAL A HG21 3  
ATOM   10885  H  HG22 . VAL A 1 126 ? 4.348   -14.703 8.297   1.00 0.00 ? 126 VAL A HG22 3  
ATOM   10886  H  HG23 . VAL A 1 126 ? 2.660   -15.190 8.142   1.00 0.00 ? 126 VAL A HG23 3  
ATOM   10887  N  N    . GLU A 1 127 ? 5.641   -18.712 10.189  1.00 0.00 ? 127 GLU A N    3  
ATOM   10888  C  CA   . GLU A 1 127 ? 5.944   -20.118 10.572  1.00 0.00 ? 127 GLU A CA   3  
ATOM   10889  C  C    . GLU A 1 127 ? 4.672   -20.761 11.122  1.00 0.00 ? 127 GLU A C    3  
ATOM   10890  O  O    . GLU A 1 127 ? 4.586   -21.961 11.282  1.00 0.00 ? 127 GLU A O    3  
ATOM   10891  C  CB   . GLU A 1 127 ? 7.035   -20.129 11.645  1.00 0.00 ? 127 GLU A CB   3  
ATOM   10892  C  CG   . GLU A 1 127 ? 8.336   -19.582 11.053  1.00 0.00 ? 127 GLU A CG   3  
ATOM   10893  C  CD   . GLU A 1 127 ? 9.531   -20.262 11.724  1.00 0.00 ? 127 GLU A CD   3  
ATOM   10894  O  OE1  . GLU A 1 127 ? 9.448   -20.526 12.913  1.00 0.00 ? 127 GLU A OE1  3  
ATOM   10895  O  OE2  . GLU A 1 127 ? 10.510  -20.508 11.038  1.00 0.00 ? 127 GLU A OE2  3  
ATOM   10896  H  H    . GLU A 1 127 ? 5.339   -18.077 10.869  1.00 0.00 ? 127 GLU A H    3  
ATOM   10897  H  HA   . GLU A 1 127 ? 6.279   -20.670 9.707   1.00 0.00 ? 127 GLU A HA   3  
ATOM   10898  H  HB2  . GLU A 1 127 ? 6.729   -19.510 12.475  1.00 0.00 ? 127 GLU A HB2  3  
ATOM   10899  H  HB3  . GLU A 1 127 ? 7.193   -21.138 11.986  1.00 0.00 ? 127 GLU A HB3  3  
ATOM   10900  H  HG2  . GLU A 1 127 ? 8.360   -19.780 9.991   1.00 0.00 ? 127 GLU A HG2  3  
ATOM   10901  H  HG3  . GLU A 1 127 ? 8.390   -18.517 11.223  1.00 0.00 ? 127 GLU A HG3  3  
ATOM   10902  N  N    . GLU A 1 128 ? 3.678   -19.963 11.405  1.00 0.00 ? 128 GLU A N    3  
ATOM   10903  C  CA   . GLU A 1 128 ? 2.401   -20.517 11.935  1.00 0.00 ? 128 GLU A CA   3  
ATOM   10904  C  C    . GLU A 1 128 ? 1.228   -19.793 11.262  1.00 0.00 ? 128 GLU A C    3  
ATOM   10905  O  O    . GLU A 1 128 ? 1.310   -18.615 10.977  1.00 0.00 ? 128 GLU A O    3  
ATOM   10906  C  CB   . GLU A 1 128 ? 2.337   -20.302 13.450  1.00 0.00 ? 128 GLU A CB   3  
ATOM   10907  C  CG   . GLU A 1 128 ? 2.588   -18.827 13.771  1.00 0.00 ? 128 GLU A CG   3  
ATOM   10908  C  CD   . GLU A 1 128 ? 2.885   -18.673 15.263  1.00 0.00 ? 128 GLU A CD   3  
ATOM   10909  O  OE1  . GLU A 1 128 ? 3.555   -19.535 15.807  1.00 0.00 ? 128 GLU A OE1  3  
ATOM   10910  O  OE2  . GLU A 1 128 ? 2.439   -17.693 15.838  1.00 0.00 ? 128 GLU A OE2  3  
ATOM   10911  H  H    . GLU A 1 128 ? 3.770   -18.997 11.261  1.00 0.00 ? 128 GLU A H    3  
ATOM   10912  H  HA   . GLU A 1 128 ? 2.360   -21.571 11.717  1.00 0.00 ? 128 GLU A HA   3  
ATOM   10913  H  HB2  . GLU A 1 128 ? 1.361   -20.590 13.812  1.00 0.00 ? 128 GLU A HB2  3  
ATOM   10914  H  HB3  . GLU A 1 128 ? 3.091   -20.906 13.931  1.00 0.00 ? 128 GLU A HB3  3  
ATOM   10915  H  HG2  . GLU A 1 128 ? 3.431   -18.471 13.196  1.00 0.00 ? 128 GLU A HG2  3  
ATOM   10916  H  HG3  . GLU A 1 128 ? 1.711   -18.250 13.520  1.00 0.00 ? 128 GLU A HG3  3  
ATOM   10917  N  N    . PRO A 1 129 ? 0.144   -20.483 10.998  1.00 0.00 ? 129 PRO A N    3  
ATOM   10918  C  CA   . PRO A 1 129 ? -1.043  -19.871 10.337  1.00 0.00 ? 129 PRO A CA   3  
ATOM   10919  C  C    . PRO A 1 129 ? -1.828  -18.930 11.258  1.00 0.00 ? 129 PRO A C    3  
ATOM   10920  O  O    . PRO A 1 129 ? -1.604  -18.871 12.450  1.00 0.00 ? 129 PRO A O    3  
ATOM   10921  C  CB   . PRO A 1 129 ? -1.907  -21.068 9.943   1.00 0.00 ? 129 PRO A CB   3  
ATOM   10922  C  CG   . PRO A 1 129 ? -1.523  -22.164 10.876  1.00 0.00 ? 129 PRO A CG   3  
ATOM   10923  C  CD   . PRO A 1 129 ? -0.074  -21.910 11.294  1.00 0.00 ? 129 PRO A CD   3  
ATOM   10924  H  HA   . PRO A 1 129 ? -0.738  -19.347 9.448   1.00 0.00 ? 129 PRO A HA   3  
ATOM   10925  H  HB2  . PRO A 1 129 ? -2.954  -20.824 10.057  1.00 0.00 ? 129 PRO A HB2  3  
ATOM   10926  H  HB3  . PRO A 1 129 ? -1.699  -21.361 8.926   1.00 0.00 ? 129 PRO A HB3  3  
ATOM   10927  H  HG2  . PRO A 1 129 ? -2.170  -22.153 11.743  1.00 0.00 ? 129 PRO A HG2  3  
ATOM   10928  H  HG3  . PRO A 1 129 ? -1.593  -23.114 10.373  1.00 0.00 ? 129 PRO A HG3  3  
ATOM   10929  H  HD2  . PRO A 1 129 ? 0.055   -22.107 12.351  1.00 0.00 ? 129 PRO A HD2  3  
ATOM   10930  H  HD3  . PRO A 1 129 ? 0.595   -22.519 10.708  1.00 0.00 ? 129 PRO A HD3  3  
ATOM   10931  N  N    . ILE A 1 130 ? -2.742  -18.192 10.694  1.00 0.00 ? 130 ILE A N    3  
ATOM   10932  C  CA   . ILE A 1 130 ? -3.551  -17.243 11.506  1.00 0.00 ? 130 ILE A CA   3  
ATOM   10933  C  C    . ILE A 1 130 ? -4.770  -16.786 10.695  1.00 0.00 ? 130 ILE A C    3  
ATOM   10934  O  O    . ILE A 1 130 ? -4.665  -16.480 9.523   1.00 0.00 ? 130 ILE A O    3  
ATOM   10935  C  CB   . ILE A 1 130 ? -2.677  -16.040 11.862  1.00 0.00 ? 130 ILE A CB   3  
ATOM   10936  C  CG1  . ILE A 1 130 ? -3.465  -15.055 12.727  1.00 0.00 ? 130 ILE A CG1  3  
ATOM   10937  C  CG2  . ILE A 1 130 ? -2.233  -15.345 10.577  1.00 0.00 ? 130 ILE A CG2  3  
ATOM   10938  C  CD1  . ILE A 1 130 ? -2.639  -13.782 12.918  1.00 0.00 ? 130 ILE A CD1  3  
ATOM   10939  H  H    . ILE A 1 130 ? -2.880  -18.274 9.728   1.00 0.00 ? 130 ILE A H    3  
ATOM   10940  H  HA   . ILE A 1 130 ? -3.881  -17.731 12.410  1.00 0.00 ? 130 ILE A HA   3  
ATOM   10941  H  HB   . ILE A 1 130 ? -1.806  -16.380 12.403  1.00 0.00 ? 130 ILE A HB   3  
ATOM   10942  H  HG12 . ILE A 1 130 ? -4.398  -14.810 12.240  1.00 0.00 ? 130 ILE A HG12 3  
ATOM   10943  H  HG13 . ILE A 1 130 ? -3.666  -15.500 13.690  1.00 0.00 ? 130 ILE A HG13 3  
ATOM   10944  H  HG21 . ILE A 1 130 ? -2.777  -14.420 10.459  1.00 0.00 ? 130 ILE A HG21 3  
ATOM   10945  H  HG22 . ILE A 1 130 ? -2.434  -15.991 9.737   1.00 0.00 ? 130 ILE A HG22 3  
ATOM   10946  H  HG23 . ILE A 1 130 ? -1.175  -15.137 10.627  1.00 0.00 ? 130 ILE A HG23 3  
ATOM   10947  H  HD11 . ILE A 1 130 ? -3.113  -13.154 13.655  1.00 0.00 ? 130 ILE A HD11 3  
ATOM   10948  H  HD12 . ILE A 1 130 ? -2.574  -13.252 11.980  1.00 0.00 ? 130 ILE A HD12 3  
ATOM   10949  H  HD13 . ILE A 1 130 ? -1.644  -14.044 13.252  1.00 0.00 ? 130 ILE A HD13 3  
ATOM   10950  N  N    . ILE A 1 131 ? -5.923  -16.734 11.311  1.00 0.00 ? 131 ILE A N    3  
ATOM   10951  C  CA   . ILE A 1 131 ? -7.150  -16.293 10.582  1.00 0.00 ? 131 ILE A CA   3  
ATOM   10952  C  C    . ILE A 1 131 ? -7.796  -15.131 11.343  1.00 0.00 ? 131 ILE A C    3  
ATOM   10953  O  O    . ILE A 1 131 ? -8.095  -15.236 12.516  1.00 0.00 ? 131 ILE A O    3  
ATOM   10954  C  CB   . ILE A 1 131 ? -8.148  -17.449 10.497  1.00 0.00 ? 131 ILE A CB   3  
ATOM   10955  C  CG1  . ILE A 1 131 ? -7.472  -18.673 9.873   1.00 0.00 ? 131 ILE A CG1  3  
ATOM   10956  C  CG2  . ILE A 1 131 ? -9.338  -17.033 9.630   1.00 0.00 ? 131 ILE A CG2  3  
ATOM   10957  C  CD1  . ILE A 1 131 ? -7.737  -19.900 10.747  1.00 0.00 ? 131 ILE A CD1  3  
ATOM   10958  H  H    . ILE A 1 131 ? -5.987  -16.980 12.257  1.00 0.00 ? 131 ILE A H