data_1YOK
# 
_entry.id   1YOK 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1YOK         
RCSB  RCSB031753   
WWPDB D_1000031753 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1YMT 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1YOK 
_pdbx_database_status.recvd_initial_deposition_date   2005-01-27 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Krylova, I.N.'    1  
'Sablin, E.P.'     2  
'Moore, J.'        3  
'Xu, R.X.'         4  
'Waitt, G.M.'      5  
'MacKay, J.A.'     6  
'Juzumiene, D.'    7  
'Bynum, J.M.'      8  
'Madauss, K.'      9  
'Montana, V.'      10 
'Lebedeva, L.'     11 
'Suzawa, M.'       12 
'Williams, J.D.'   13 
'Williams, S.P.'   14 
'Guy, R.K.'        15 
'Thornton, J.W.'   16 
'Fletterick, R.J.' 17 
'Willson, T.M.'    18 
'Ingraham, H.A.'   19 
# 
_citation.id                        primary 
_citation.title                     
'Structural analyses reveal phosphatidyl inositols as ligands for the NR5 orphan receptors SF-1 and LRH-1.' 
_citation.journal_abbrev            'Cell(Cambridge,Mass.)' 
_citation.journal_volume            120 
_citation.page_first                343 
_citation.page_last                 355 
_citation.year                      2005 
_citation.journal_id_ASTM           CELLB5 
_citation.country                   US 
_citation.journal_id_ISSN           0092-8674 
_citation.journal_id_CSD            0998 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15707893 
_citation.pdbx_database_id_DOI      10.1016/j.cell.2005.01.024 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Krylova, I.N.'    1  
primary 'Sablin, E.P.'     2  
primary 'Moore, J.'        3  
primary 'Xu, R.X.'         4  
primary 'Waitt, G.M.'      5  
primary 'MacKay, J.A.'     6  
primary 'Juzumiene, D.'    7  
primary 'Bynum, J.M.'      8  
primary 'Madauss, K.'      9  
primary 'Montana, V.'      10 
primary 'Lebedeva, L.'     11 
primary 'Suzawa, M.'       12 
primary 'Williams, J.D.'   13 
primary 'Williams, S.P.'   14 
primary 'Guy, R.K.'        15 
primary 'Thornton, J.W.'   16 
primary 'Fletterick, R.J.' 17 
primary 'Willson, T.M.'    18 
primary 'Ingraham, H.A.'   19 
# 
_cell.entry_id           1YOK 
_cell.length_a           59.938 
_cell.length_b           67.199 
_cell.length_c           79.569 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1YOK 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Orphan nuclear receptor NR5A2' 29800.523 1  ? ? 
'sequence database residues 300-541: contains ligand binding domain (residues 346-388)' ? 
2 polymer     syn 'Nuclear receptor coactivator 2' 1708.931  2  ? ? 'sequence database residues 740-753' ? 
3 non-polymer syn 
'(2S)-3-{[{[(2S)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-2-[(6E)-HEXADEC-6-ENOYLOXY]PROPYL (8E)-OCTADEC-8-ENOATE' 746.991 
1  ? ? ?                                                                                       ? 
4 water       nat water 18.015    86 ? ? ?                                                                                       ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 
'Alpha-1-fetoprotein transcription factor, Hepatocytic transcription factor, B1-binding factor, hB1F, CYP7A promoter binding factor' 
2 'NCoA-2, Transcriptional intermediary factor 2' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MKKHHHHHHLVPRGSIPHLILELLKCEPDEPQVQAKIMAYLQQEQANRSKHEKLSTFGLMCKMADQTLFSIVEWARSSIF
FRELKVDDQMKLLQNCWSELLILDHIYRQVVHGKEGSIFLVTGQQVDYSIIASQAGATLNNLMSHAQELVAKLRSLQFDQ
REFVCLKFLVLFSLDVKNLENFQLVEGVQEQVNAALLDYTMCNYPQQTEKFGQLLLRLPEIRAISMQAEEYLYYKHLNGD
VPYNNLLIEMLHAKRA
;
;MKKHHHHHHLVPRGSIPHLILELLKCEPDEPQVQAKIMAYLQQEQANRSKHEKLSTFGLMCKMADQTLFSIVEWARSSIF
FRELKVDDQMKLLQNCWSELLILDHIYRQVVHGKEGSIFLVTGQQVDYSIIASQAGATLNNLMSHAQELVAKLRSLQFDQ
REFVCLKFLVLFSLDVKNLENFQLVEGVQEQVNAALLDYTMCNYPQQTEKFGQLLLRLPEIRAISMQAEEYLYYKHLNGD
VPYNNLLIEMLHAKRA
;
A   ? 
2 'polypeptide(L)' no no KENALLRYLLDKDD KENALLRYLLDKDD B,C ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   LYS n 
1 3   LYS n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  LEU n 
1 11  VAL n 
1 12  PRO n 
1 13  ARG n 
1 14  GLY n 
1 15  SER n 
1 16  ILE n 
1 17  PRO n 
1 18  HIS n 
1 19  LEU n 
1 20  ILE n 
1 21  LEU n 
1 22  GLU n 
1 23  LEU n 
1 24  LEU n 
1 25  LYS n 
1 26  CYS n 
1 27  GLU n 
1 28  PRO n 
1 29  ASP n 
1 30  GLU n 
1 31  PRO n 
1 32  GLN n 
1 33  VAL n 
1 34  GLN n 
1 35  ALA n 
1 36  LYS n 
1 37  ILE n 
1 38  MET n 
1 39  ALA n 
1 40  TYR n 
1 41  LEU n 
1 42  GLN n 
1 43  GLN n 
1 44  GLU n 
1 45  GLN n 
1 46  ALA n 
1 47  ASN n 
1 48  ARG n 
1 49  SER n 
1 50  LYS n 
1 51  HIS n 
1 52  GLU n 
1 53  LYS n 
1 54  LEU n 
1 55  SER n 
1 56  THR n 
1 57  PHE n 
1 58  GLY n 
1 59  LEU n 
1 60  MET n 
1 61  CYS n 
1 62  LYS n 
1 63  MET n 
1 64  ALA n 
1 65  ASP n 
1 66  GLN n 
1 67  THR n 
1 68  LEU n 
1 69  PHE n 
1 70  SER n 
1 71  ILE n 
1 72  VAL n 
1 73  GLU n 
1 74  TRP n 
1 75  ALA n 
1 76  ARG n 
1 77  SER n 
1 78  SER n 
1 79  ILE n 
1 80  PHE n 
1 81  PHE n 
1 82  ARG n 
1 83  GLU n 
1 84  LEU n 
1 85  LYS n 
1 86  VAL n 
1 87  ASP n 
1 88  ASP n 
1 89  GLN n 
1 90  MET n 
1 91  LYS n 
1 92  LEU n 
1 93  LEU n 
1 94  GLN n 
1 95  ASN n 
1 96  CYS n 
1 97  TRP n 
1 98  SER n 
1 99  GLU n 
1 100 LEU n 
1 101 LEU n 
1 102 ILE n 
1 103 LEU n 
1 104 ASP n 
1 105 HIS n 
1 106 ILE n 
1 107 TYR n 
1 108 ARG n 
1 109 GLN n 
1 110 VAL n 
1 111 VAL n 
1 112 HIS n 
1 113 GLY n 
1 114 LYS n 
1 115 GLU n 
1 116 GLY n 
1 117 SER n 
1 118 ILE n 
1 119 PHE n 
1 120 LEU n 
1 121 VAL n 
1 122 THR n 
1 123 GLY n 
1 124 GLN n 
1 125 GLN n 
1 126 VAL n 
1 127 ASP n 
1 128 TYR n 
1 129 SER n 
1 130 ILE n 
1 131 ILE n 
1 132 ALA n 
1 133 SER n 
1 134 GLN n 
1 135 ALA n 
1 136 GLY n 
1 137 ALA n 
1 138 THR n 
1 139 LEU n 
1 140 ASN n 
1 141 ASN n 
1 142 LEU n 
1 143 MET n 
1 144 SER n 
1 145 HIS n 
1 146 ALA n 
1 147 GLN n 
1 148 GLU n 
1 149 LEU n 
1 150 VAL n 
1 151 ALA n 
1 152 LYS n 
1 153 LEU n 
1 154 ARG n 
1 155 SER n 
1 156 LEU n 
1 157 GLN n 
1 158 PHE n 
1 159 ASP n 
1 160 GLN n 
1 161 ARG n 
1 162 GLU n 
1 163 PHE n 
1 164 VAL n 
1 165 CYS n 
1 166 LEU n 
1 167 LYS n 
1 168 PHE n 
1 169 LEU n 
1 170 VAL n 
1 171 LEU n 
1 172 PHE n 
1 173 SER n 
1 174 LEU n 
1 175 ASP n 
1 176 VAL n 
1 177 LYS n 
1 178 ASN n 
1 179 LEU n 
1 180 GLU n 
1 181 ASN n 
1 182 PHE n 
1 183 GLN n 
1 184 LEU n 
1 185 VAL n 
1 186 GLU n 
1 187 GLY n 
1 188 VAL n 
1 189 GLN n 
1 190 GLU n 
1 191 GLN n 
1 192 VAL n 
1 193 ASN n 
1 194 ALA n 
1 195 ALA n 
1 196 LEU n 
1 197 LEU n 
1 198 ASP n 
1 199 TYR n 
1 200 THR n 
1 201 MET n 
1 202 CYS n 
1 203 ASN n 
1 204 TYR n 
1 205 PRO n 
1 206 GLN n 
1 207 GLN n 
1 208 THR n 
1 209 GLU n 
1 210 LYS n 
1 211 PHE n 
1 212 GLY n 
1 213 GLN n 
1 214 LEU n 
1 215 LEU n 
1 216 LEU n 
1 217 ARG n 
1 218 LEU n 
1 219 PRO n 
1 220 GLU n 
1 221 ILE n 
1 222 ARG n 
1 223 ALA n 
1 224 ILE n 
1 225 SER n 
1 226 MET n 
1 227 GLN n 
1 228 ALA n 
1 229 GLU n 
1 230 GLU n 
1 231 TYR n 
1 232 LEU n 
1 233 TYR n 
1 234 TYR n 
1 235 LYS n 
1 236 HIS n 
1 237 LEU n 
1 238 ASN n 
1 239 GLY n 
1 240 ASP n 
1 241 VAL n 
1 242 PRO n 
1 243 TYR n 
1 244 ASN n 
1 245 ASN n 
1 246 LEU n 
1 247 LEU n 
1 248 ILE n 
1 249 GLU n 
1 250 MET n 
1 251 LEU n 
1 252 HIS n 
1 253 ALA n 
1 254 LYS n 
1 255 ARG n 
1 256 ALA n 
2 1   LYS n 
2 2   GLU n 
2 3   ASN n 
2 4   ALA n 
2 5   LEU n 
2 6   LEU n 
2 7   ARG n 
2 8   TYR n 
2 9   LEU n 
2 10  LEU n 
2 11  ASP n 
2 12  LYS n 
2 13  ASP n 
2 14  ASP n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'NR5A2, B1F, CPF, FTF' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                
'The peptide was chemically synthesized. The sequence of the peptide is naturally found in Homo sapiens (human).' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
_struct_ref.pdbx_seq_one_letter_code 
1 UNP NR5A2_HUMAN O00482 1 300 ? ? 
2 UNP NCOA2_HUMAN Q15596 2 740 ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1YOK A 15 ? 256 ? O00482 300 ? 541 ? 300 541 
2 2 1YOK B 1  ? 14  ? Q15596 740 ? 753 ? 740 753 
3 2 1YOK C 1  ? 14  ? Q15596 740 ? 753 ? 740 753 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1YOK MET A 1  ? UNP O00482 ? ? 'CLONING ARTIFACT' 286 1  
1 1YOK LYS A 2  ? UNP O00482 ? ? 'CLONING ARTIFACT' 287 2  
1 1YOK LYS A 3  ? UNP O00482 ? ? 'CLONING ARTIFACT' 288 3  
1 1YOK HIS A 4  ? UNP O00482 ? ? 'CLONING ARTIFACT' 289 4  
1 1YOK HIS A 5  ? UNP O00482 ? ? 'CLONING ARTIFACT' 290 5  
1 1YOK HIS A 6  ? UNP O00482 ? ? 'CLONING ARTIFACT' 291 6  
1 1YOK HIS A 7  ? UNP O00482 ? ? 'CLONING ARTIFACT' 292 7  
1 1YOK HIS A 8  ? UNP O00482 ? ? 'CLONING ARTIFACT' 293 8  
1 1YOK HIS A 9  ? UNP O00482 ? ? 'CLONING ARTIFACT' 294 9  
1 1YOK LEU A 10 ? UNP O00482 ? ? 'CLONING ARTIFACT' 295 10 
1 1YOK VAL A 11 ? UNP O00482 ? ? 'CLONING ARTIFACT' 296 11 
1 1YOK PRO A 12 ? UNP O00482 ? ? 'CLONING ARTIFACT' 297 12 
1 1YOK ARG A 13 ? UNP O00482 ? ? 'CLONING ARTIFACT' 298 13 
1 1YOK GLY A 14 ? UNP O00482 ? ? 'CLONING ARTIFACT' 299 14 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S'  149.211 
P6L non-polymer         . 
'(2S)-3-{[{[(2S)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-2-[(6E)-HEXADEC-6-ENOYLOXY]PROPYL (8E)-OCTADEC-8-ENOATE' ? 
'C40 H75 O10 P'  746.991 
PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1YOK 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      10 
_exptl_crystal.density_percent_sol   48 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              4.9 
_exptl_crystal_grow.pdbx_details    
'Sodium potassium phosphate, glycerol, ethylene glycol, pH 4.9, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2003-04-15 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SAGITALLY FOCUSED Si(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 17-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   17-ID 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.000 
# 
_reflns.entry_id                     1YOK 
_reflns.observed_criterion_sigma_F   2.5 
_reflns.observed_criterion_sigma_I   2.5 
_reflns.d_resolution_high            2.5 
_reflns.d_resolution_low             50 
_reflns.number_all                   11732 
_reflns.number_obs                   11298 
_reflns.percent_possible_obs         95.6 
_reflns.pdbx_Rmerge_I_obs            0.037 
_reflns.pdbx_Rsym_value              0.037 
_reflns.pdbx_netI_over_sigmaI        44 
_reflns.B_iso_Wilson_estimate        56 
_reflns.pdbx_redundancy              6.7 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.50 
_reflns_shell.d_res_low              2.58 
_reflns_shell.percent_possible_all   72.5 
_reflns_shell.Rmerge_I_obs           0.42 
_reflns_shell.pdbx_Rsym_value        0.42 
_reflns_shell.meanI_over_sigI_obs    2.5 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      829 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1YOK 
_refine.ls_d_res_high                            2.5 
_refine.ls_d_res_low                             40 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_ls_sigma_I                          0 
_refine.ls_number_reflns_all                     11732 
_refine.ls_number_reflns_obs                     10787 
_refine.ls_number_reflns_R_free                  652 
_refine.ls_percent_reflns_obs                    91.9 
_refine.ls_R_factor_all                          0.23 
_refine.ls_R_factor_obs                          0.23 
_refine.ls_R_factor_R_work                       0.23 
_refine.ls_R_factor_R_free                       0.29 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'Human SF-1' 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_R_Free_selection_details            Random 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.details                                  ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2116 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         51 
_refine_hist.number_atoms_solvent             86 
_refine_hist.number_atoms_total               2253 
_refine_hist.d_res_high                       2.5 
_refine_hist.d_res_low                        40 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d    0.008 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg 1.329 ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1YOK 
_struct.title                     'crystal structure of human LRH-1 bound with TIF-2 peptide and phosphatidylglycerol' 
_struct.pdbx_descriptor           'Orphan nuclear receptor NR5A2, Nuclear receptor coactivator 2' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1YOK 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
_struct_keywords.text            'LRH-1, TIF-1, phosphatidylglycerol, TRANSCRIPTION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 4 ? 
G N N 4 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PRO A 17  ? LYS A 25  ? PRO A 302 LYS A 310 1 ? 9  
HELX_P HELX_P2  2  ASP A 29  ? GLN A 45  ? ASP A 314 GLN A 330 1 ? 17 
HELX_P HELX_P3  3  SER A 55  ? SER A 77  ? SER A 340 SER A 362 1 ? 23 
HELX_P HELX_P4  4  PHE A 80  ? LEU A 84  ? PHE A 365 LEU A 369 5 ? 5  
HELX_P HELX_P5  5  LYS A 85  ? HIS A 112 ? LYS A 370 HIS A 397 1 ? 28 
HELX_P HELX_P6  6  TYR A 128 ? SER A 133 ? TYR A 413 SER A 418 1 ? 6  
HELX_P HELX_P7  7  GLY A 136 ? GLN A 157 ? GLY A 421 GLN A 442 1 ? 22 
HELX_P HELX_P8  8  ASP A 159 ? PHE A 172 ? ASP A 444 PHE A 457 1 ? 14 
HELX_P HELX_P9  9  ASN A 181 ? TYR A 204 ? ASN A 466 TYR A 489 1 ? 24 
HELX_P HELX_P10 10 GLU A 209 ? LEU A 216 ? GLU A 494 LEU A 501 1 ? 8  
HELX_P HELX_P11 11 LEU A 216 ? ASN A 238 ? LEU A 501 ASN A 523 1 ? 23 
HELX_P HELX_P12 12 ASN A 245 ? HIS A 252 ? ASN A 530 HIS A 537 1 ? 8  
HELX_P HELX_P13 13 ASN B 3   ? LYS B 12  ? ASN B 742 LYS B 751 1 ? 10 
HELX_P HELX_P14 14 ASN C 3   ? LYS C 12  ? ASN C 742 LYS C 751 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   2 
_struct_sheet.details          ? 
# 
_struct_sheet_order.sheet_id     A 
_struct_sheet_order.range_id_1   1 
_struct_sheet_order.range_id_2   2 
_struct_sheet_order.offset       ? 
_struct_sheet_order.sense        anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 SER A 117 ? PHE A 119 ? SER A 402 PHE A 404 
A 2 GLN A 125 ? ASP A 127 ? GLN A 410 ASP A 412 
# 
_pdbx_struct_sheet_hbond.sheet_id                A 
_pdbx_struct_sheet_hbond.range_id_1              1 
_pdbx_struct_sheet_hbond.range_id_2              2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id   N 
_pdbx_struct_sheet_hbond.range_1_label_comp_id   ILE 
_pdbx_struct_sheet_hbond.range_1_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_1_label_seq_id    118 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id    N 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id    ILE 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id     403 
_pdbx_struct_sheet_hbond.range_2_label_atom_id   O 
_pdbx_struct_sheet_hbond.range_2_label_comp_id   VAL 
_pdbx_struct_sheet_hbond.range_2_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_2_label_seq_id    126 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id    O 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id    VAL 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id     411 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    15 
_struct_site.details              'BINDING SITE FOR RESIDUE P6L A 100' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 15 HOH E .   ? HOH A 79  . ? 1_555 ? 
2  AC1 15 THR A 56  ? THR A 341 . ? 1_555 ? 
3  AC1 15 PHE A 57  ? PHE A 342 . ? 1_555 ? 
4  AC1 15 MET A 60  ? MET A 345 . ? 1_555 ? 
5  AC1 15 HIS A 105 ? HIS A 390 . ? 1_555 ? 
6  AC1 15 ILE A 131 ? ILE A 416 . ? 1_555 ? 
7  AC1 15 GLN A 134 ? GLN A 419 . ? 1_555 ? 
8  AC1 15 GLY A 136 ? GLY A 421 . ? 1_555 ? 
9  AC1 15 THR A 138 ? THR A 423 . ? 1_555 ? 
10 AC1 15 LEU A 139 ? LEU A 424 . ? 1_555 ? 
11 AC1 15 LEU A 142 ? LEU A 427 . ? 1_555 ? 
12 AC1 15 ALA A 228 ? ALA A 513 . ? 1_555 ? 
13 AC1 15 TYR A 231 ? TYR A 516 . ? 1_555 ? 
14 AC1 15 TYR A 234 ? TYR A 519 . ? 1_555 ? 
15 AC1 15 LYS A 235 ? LYS A 520 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1YOK 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1YOK 
_atom_sites.fract_transf_matrix[1][1]   0.016684 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014881 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012568 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 15  ? 28.985 54.267 34.372 1.00 88.63  ? 300 SER A N   1 
ATOM   2    C CA  . SER A 1 15  ? 27.739 54.655 33.649 1.00 88.62  ? 300 SER A CA  1 
ATOM   3    C C   . SER A 1 15  ? 27.105 53.481 32.897 1.00 89.53  ? 300 SER A C   1 
ATOM   4    O O   . SER A 1 15  ? 27.492 53.158 31.774 1.00 90.12  ? 300 SER A O   1 
ATOM   5    C CB  . SER A 1 15  ? 28.029 55.799 32.671 1.00 87.83  ? 300 SER A CB  1 
ATOM   6    O OG  . SER A 1 15  ? 26.852 56.199 31.985 1.00 84.70  ? 300 SER A OG  1 
ATOM   7    N N   . ILE A 1 16  ? 26.118 52.858 33.535 1.00 89.80  ? 301 ILE A N   1 
ATOM   8    C CA  . ILE A 1 16  ? 25.391 51.724 32.971 1.00 89.13  ? 301 ILE A CA  1 
ATOM   9    C C   . ILE A 1 16  ? 24.173 52.213 32.191 1.00 88.98  ? 301 ILE A C   1 
ATOM   10   O O   . ILE A 1 16  ? 23.289 52.827 32.759 1.00 89.21  ? 301 ILE A O   1 
ATOM   11   C CB  . ILE A 1 16  ? 24.873 50.801 34.088 1.00 88.43  ? 301 ILE A CB  1 
ATOM   12   C CG1 . ILE A 1 16  ? 26.020 50.397 35.013 1.00 87.76  ? 301 ILE A CG1 1 
ATOM   13   C CG2 . ILE A 1 16  ? 24.207 49.587 33.483 1.00 89.31  ? 301 ILE A CG2 1 
ATOM   14   C CD1 . ILE A 1 16  ? 25.576 49.560 36.193 1.00 88.25  ? 301 ILE A CD1 1 
ATOM   15   N N   . PRO A 1 17  ? 24.116 51.936 30.879 1.00 88.88  ? 302 PRO A N   1 
ATOM   16   C CA  . PRO A 1 17  ? 22.995 52.351 30.025 1.00 89.52  ? 302 PRO A CA  1 
ATOM   17   C C   . PRO A 1 17  ? 21.620 52.107 30.654 1.00 89.68  ? 302 PRO A C   1 
ATOM   18   O O   . PRO A 1 17  ? 21.517 51.527 31.728 1.00 90.79  ? 302 PRO A O   1 
ATOM   19   C CB  . PRO A 1 17  ? 23.218 51.533 28.760 1.00 88.53  ? 302 PRO A CB  1 
ATOM   20   C CG  . PRO A 1 17  ? 24.711 51.553 28.652 1.00 88.89  ? 302 PRO A CG  1 
ATOM   21   C CD  . PRO A 1 17  ? 25.151 51.258 30.081 1.00 89.48  ? 302 PRO A CD  1 
ATOM   22   N N   . HIS A 1 18  ? 20.565 52.550 29.978 1.00 89.32  ? 303 HIS A N   1 
ATOM   23   C CA  . HIS A 1 18  ? 19.211 52.383 30.504 1.00 89.12  ? 303 HIS A CA  1 
ATOM   24   C C   . HIS A 1 18  ? 18.710 50.935 30.478 1.00 86.61  ? 303 HIS A C   1 
ATOM   25   O O   . HIS A 1 18  ? 18.209 50.413 31.481 1.00 85.45  ? 303 HIS A O   1 
ATOM   26   C CB  . HIS A 1 18  ? 18.217 53.297 29.745 1.00 92.51  ? 303 HIS A CB  1 
ATOM   27   C CG  . HIS A 1 18  ? 17.984 52.909 28.309 1.00 95.75  ? 303 HIS A CG  1 
ATOM   28   N ND1 . HIS A 1 18  ? 16.719 52.775 27.773 1.00 96.44  ? 303 HIS A ND1 1 
ATOM   29   C CD2 . HIS A 1 18  ? 18.849 52.630 27.304 1.00 96.02  ? 303 HIS A CD2 1 
ATOM   30   C CE1 . HIS A 1 18  ? 16.816 52.429 26.501 1.00 96.48  ? 303 HIS A CE1 1 
ATOM   31   N NE2 . HIS A 1 18  ? 18.096 52.333 26.191 1.00 96.68  ? 303 HIS A NE2 1 
ATOM   32   N N   . LEU A 1 19  ? 18.869 50.294 29.326 1.00 83.65  ? 304 LEU A N   1 
ATOM   33   C CA  . LEU A 1 19  ? 18.423 48.929 29.102 1.00 80.76  ? 304 LEU A CA  1 
ATOM   34   C C   . LEU A 1 19  ? 19.087 47.930 30.041 1.00 79.16  ? 304 LEU A C   1 
ATOM   35   O O   . LEU A 1 19  ? 18.423 47.158 30.696 1.00 77.40  ? 304 LEU A O   1 
ATOM   36   C CB  . LEU A 1 19  ? 18.707 48.560 27.647 1.00 79.28  ? 304 LEU A CB  1 
ATOM   37   C CG  . LEU A 1 19  ? 17.883 47.440 27.025 1.00 77.68  ? 304 LEU A CG  1 
ATOM   38   C CD1 . LEU A 1 19  ? 16.415 47.689 27.308 1.00 76.80  ? 304 LEU A CD1 1 
ATOM   39   C CD2 . LEU A 1 19  ? 18.154 47.383 25.518 1.00 76.58  ? 304 LEU A CD2 1 
ATOM   40   N N   . ILE A 1 20  ? 20.412 47.966 30.097 1.00 78.81  ? 305 ILE A N   1 
ATOM   41   C CA  . ILE A 1 20  ? 21.168 47.055 30.945 1.00 78.95  ? 305 ILE A CA  1 
ATOM   42   C C   . ILE A 1 20  ? 20.678 47.040 32.397 1.00 79.81  ? 305 ILE A C   1 
ATOM   43   O O   . ILE A 1 20  ? 20.659 45.999 33.039 1.00 78.41  ? 305 ILE A O   1 
ATOM   44   C CB  . ILE A 1 20  ? 22.674 47.398 30.887 1.00 77.12  ? 305 ILE A CB  1 
ATOM   45   C CG1 . ILE A 1 20  ? 23.143 47.322 29.434 1.00 76.27  ? 305 ILE A CG1 1 
ATOM   46   C CG2 . ILE A 1 20  ? 23.477 46.446 31.762 1.00 75.19  ? 305 ILE A CG2 1 
ATOM   47   C CD1 . ILE A 1 20  ? 24.605 47.613 29.242 1.00 78.04  ? 305 ILE A CD1 1 
ATOM   48   N N   . LEU A 1 21  ? 20.277 48.196 32.912 1.00 80.79  ? 306 LEU A N   1 
ATOM   49   C CA  . LEU A 1 21  ? 19.785 48.265 34.280 1.00 81.54  ? 306 LEU A CA  1 
ATOM   50   C C   . LEU A 1 21  ? 18.479 47.488 34.405 1.00 82.23  ? 306 LEU A C   1 
ATOM   51   O O   . LEU A 1 21  ? 18.260 46.796 35.395 1.00 82.71  ? 306 LEU A O   1 
ATOM   52   C CB  . LEU A 1 21  ? 19.601 49.723 34.691 1.00 80.52  ? 306 LEU A CB  1 
ATOM   53   C CG  . LEU A 1 21  ? 20.968 50.403 34.774 1.00 80.38  ? 306 LEU A CG  1 
ATOM   54   C CD1 . LEU A 1 21  ? 20.823 51.900 34.927 1.00 79.94  ? 306 LEU A CD1 1 
ATOM   55   C CD2 . LEU A 1 21  ? 21.738 49.800 35.935 1.00 80.29  ? 306 LEU A CD2 1 
ATOM   56   N N   . GLU A 1 22  ? 17.624 47.600 33.391 1.00 82.34  ? 307 GLU A N   1 
ATOM   57   C CA  . GLU A 1 22  ? 16.348 46.889 33.368 1.00 82.66  ? 307 GLU A CA  1 
ATOM   58   C C   . GLU A 1 22  ? 16.564 45.379 33.395 1.00 81.95  ? 307 GLU A C   1 
ATOM   59   O O   . GLU A 1 22  ? 16.070 44.687 34.280 1.00 82.23  ? 307 GLU A O   1 
ATOM   60   C CB  . GLU A 1 22  ? 15.551 47.264 32.114 1.00 85.15  ? 307 GLU A CB  1 
ATOM   61   C CG  . GLU A 1 22  ? 14.491 48.327 32.345 1.00 87.92  ? 307 GLU A CG  1 
ATOM   62   C CD  . GLU A 1 22  ? 13.410 47.859 33.307 1.00 89.93  ? 307 GLU A CD  1 
ATOM   63   O OE1 . GLU A 1 22  ? 12.711 46.872 32.980 1.00 90.79  ? 307 GLU A OE1 1 
ATOM   64   O OE2 . GLU A 1 22  ? 13.266 48.474 34.390 1.00 89.51  ? 307 GLU A OE2 1 
ATOM   65   N N   . LEU A 1 23  ? 17.301 44.880 32.405 1.00 81.26  ? 308 LEU A N   1 
ATOM   66   C CA  . LEU A 1 23  ? 17.608 43.456 32.299 1.00 79.49  ? 308 LEU A CA  1 
ATOM   67   C C   . LEU A 1 23  ? 18.295 42.995 33.577 1.00 79.72  ? 308 LEU A C   1 
ATOM   68   O O   . LEU A 1 23  ? 18.019 41.927 34.089 1.00 80.63  ? 308 LEU A O   1 
ATOM   69   C CB  . LEU A 1 23  ? 18.562 43.203 31.135 1.00 77.15  ? 308 LEU A CB  1 
ATOM   70   C CG  . LEU A 1 23  ? 18.396 43.974 29.831 1.00 74.48  ? 308 LEU A CG  1 
ATOM   71   C CD1 . LEU A 1 23  ? 19.634 43.762 28.980 1.00 74.32  ? 308 LEU A CD1 1 
ATOM   72   C CD2 . LEU A 1 23  ? 17.158 43.521 29.103 1.00 73.83  ? 308 LEU A CD2 1 
ATOM   73   N N   . LEU A 1 24  ? 19.205 43.827 34.071 1.00 80.23  ? 309 LEU A N   1 
ATOM   74   C CA  . LEU A 1 24  ? 19.978 43.548 35.275 1.00 81.03  ? 309 LEU A CA  1 
ATOM   75   C C   . LEU A 1 24  ? 19.110 43.248 36.505 1.00 82.28  ? 309 LEU A C   1 
ATOM   76   O O   . LEU A 1 24  ? 19.580 42.629 37.470 1.00 82.42  ? 309 LEU A O   1 
ATOM   77   C CB  . LEU A 1 24  ? 20.899 44.736 35.558 1.00 80.52  ? 309 LEU A CB  1 
ATOM   78   C CG  . LEU A 1 24  ? 22.219 44.463 36.269 1.00 81.49  ? 309 LEU A CG  1 
ATOM   79   C CD1 . LEU A 1 24  ? 23.037 43.466 35.464 1.00 81.88  ? 309 LEU A CD1 1 
ATOM   80   C CD2 . LEU A 1 24  ? 22.985 45.767 36.433 1.00 81.31  ? 309 LEU A CD2 1 
ATOM   81   N N   . LYS A 1 25  ? 17.851 43.691 36.470 1.00 82.69  ? 310 LYS A N   1 
ATOM   82   C CA  . LYS A 1 25  ? 16.917 43.464 37.570 1.00 82.23  ? 310 LYS A CA  1 
ATOM   83   C C   . LYS A 1 25  ? 16.155 42.146 37.439 1.00 82.54  ? 310 LYS A C   1 
ATOM   84   O O   . LYS A 1 25  ? 15.524 41.698 38.396 1.00 83.08  ? 310 LYS A O   1 
ATOM   85   C CB  . LYS A 1 25  ? 15.907 44.607 37.665 1.00 81.92  ? 310 LYS A CB  1 
ATOM   86   C CG  . LYS A 1 25  ? 16.504 45.970 37.989 1.00 81.23  ? 310 LYS A CG  1 
ATOM   87   C CD  . LYS A 1 25  ? 15.430 46.990 38.402 1.00 79.82  ? 310 LYS A CD  1 
ATOM   88   C CE  . LYS A 1 25  ? 14.492 47.379 37.255 1.00 78.33  ? 310 LYS A CE  1 
ATOM   89   N NZ  . LYS A 1 25  ? 13.549 46.300 36.846 1.00 77.27  ? 310 LYS A NZ  1 
ATOM   90   N N   . CYS A 1 26  ? 16.207 41.535 36.256 1.00 82.17  ? 311 CYS A N   1 
ATOM   91   C CA  . CYS A 1 26  ? 15.529 40.259 36.007 1.00 81.54  ? 311 CYS A CA  1 
ATOM   92   C C   . CYS A 1 26  ? 16.363 39.072 36.490 1.00 81.27  ? 311 CYS A C   1 
ATOM   93   O O   . CYS A 1 26  ? 15.901 37.928 36.460 1.00 81.26  ? 311 CYS A O   1 
ATOM   94   C CB  . CYS A 1 26  ? 15.230 40.089 34.514 1.00 81.23  ? 311 CYS A CB  1 
ATOM   95   S SG  . CYS A 1 26  ? 14.131 41.344 33.806 1.00 83.13  ? 311 CYS A SG  1 
ATOM   96   N N   . GLU A 1 27  ? 17.590 39.351 36.929 1.00 80.30  ? 312 GLU A N   1 
ATOM   97   C CA  . GLU A 1 27  ? 18.491 38.318 37.422 1.00 79.58  ? 312 GLU A CA  1 
ATOM   98   C C   . GLU A 1 27  ? 17.925 37.706 38.688 1.00 80.41  ? 312 GLU A C   1 
ATOM   99   O O   . GLU A 1 27  ? 17.643 38.395 39.641 1.00 80.83  ? 312 GLU A O   1 
ATOM   100  C CB  . GLU A 1 27  ? 19.874 38.906 37.710 1.00 77.89  ? 312 GLU A CB  1 
ATOM   101  C CG  . GLU A 1 27  ? 20.626 39.390 36.471 1.00 76.15  ? 312 GLU A CG  1 
ATOM   102  C CD  . GLU A 1 27  ? 20.893 38.279 35.470 1.00 74.75  ? 312 GLU A CD  1 
ATOM   103  O OE1 . GLU A 1 27  ? 19.966 37.861 34.741 1.00 73.24  ? 312 GLU A OE1 1 
ATOM   104  O OE2 . GLU A 1 27  ? 22.043 37.818 35.416 1.00 74.89  ? 312 GLU A OE2 1 
ATOM   105  N N   . PRO A 1 28  ? 17.754 36.381 38.699 1.00 81.83  ? 313 PRO A N   1 
ATOM   106  C CA  . PRO A 1 28  ? 17.210 35.723 39.886 1.00 82.46  ? 313 PRO A CA  1 
ATOM   107  C C   . PRO A 1 28  ? 18.081 35.937 41.112 1.00 82.48  ? 313 PRO A C   1 
ATOM   108  O O   . PRO A 1 28  ? 19.147 36.523 41.031 1.00 81.71  ? 313 PRO A O   1 
ATOM   109  C CB  . PRO A 1 28  ? 17.137 34.254 39.463 1.00 83.23  ? 313 PRO A CB  1 
ATOM   110  C CG  . PRO A 1 28  ? 18.295 34.126 38.506 1.00 82.64  ? 313 PRO A CG  1 
ATOM   111  C CD  . PRO A 1 28  ? 18.173 35.393 37.687 1.00 82.58  ? 313 PRO A CD  1 
ATOM   112  N N   . ASP A 1 29  ? 17.599 35.465 42.253 1.00 83.31  ? 314 ASP A N   1 
ATOM   113  C CA  . ASP A 1 29  ? 18.338 35.586 43.495 1.00 84.06  ? 314 ASP A CA  1 
ATOM   114  C C   . ASP A 1 29  ? 19.331 34.446 43.461 1.00 83.91  ? 314 ASP A C   1 
ATOM   115  O O   . ASP A 1 29  ? 18.982 33.312 43.746 1.00 85.11  ? 314 ASP A O   1 
ATOM   116  C CB  . ASP A 1 29  ? 17.399 35.416 44.693 1.00 85.26  ? 314 ASP A CB  1 
ATOM   117  C CG  . ASP A 1 29  ? 18.090 35.674 46.021 1.00 85.74  ? 314 ASP A CG  1 
ATOM   118  O OD1 . ASP A 1 29  ? 19.169 35.093 46.261 1.00 86.48  ? 314 ASP A OD1 1 
ATOM   119  O OD2 . ASP A 1 29  ? 17.549 36.457 46.830 1.00 86.02  ? 314 ASP A OD2 1 
ATOM   120  N N   . GLU A 1 30  ? 20.569 34.743 43.101 1.00 83.55  ? 315 GLU A N   1 
ATOM   121  C CA  . GLU A 1 30  ? 21.573 33.693 43.033 1.00 84.46  ? 315 GLU A CA  1 
ATOM   122  C C   . GLU A 1 30  ? 21.635 32.843 44.303 1.00 83.15  ? 315 GLU A C   1 
ATOM   123  O O   . GLU A 1 30  ? 21.524 31.622 44.234 1.00 82.63  ? 315 GLU A O   1 
ATOM   124  C CB  . GLU A 1 30  ? 22.949 34.288 42.723 1.00 86.99  ? 315 GLU A CB  1 
ATOM   125  C CG  . GLU A 1 30  ? 23.994 33.250 42.345 1.00 89.76  ? 315 GLU A CG  1 
ATOM   126  C CD  . GLU A 1 30  ? 25.195 33.870 41.661 1.00 92.16  ? 315 GLU A CD  1 
ATOM   127  O OE1 . GLU A 1 30  ? 25.863 34.722 42.289 1.00 93.35  ? 315 GLU A OE1 1 
ATOM   128  O OE2 . GLU A 1 30  ? 25.466 33.509 40.495 1.00 92.28  ? 315 GLU A OE2 1 
ATOM   129  N N   . PRO A 1 31  ? 21.808 33.476 45.482 1.00 82.14  ? 316 PRO A N   1 
ATOM   130  C CA  . PRO A 1 31  ? 21.873 32.698 46.726 1.00 80.10  ? 316 PRO A CA  1 
ATOM   131  C C   . PRO A 1 31  ? 20.651 31.807 46.952 1.00 78.00  ? 316 PRO A C   1 
ATOM   132  O O   . PRO A 1 31  ? 20.765 30.677 47.393 1.00 76.67  ? 316 PRO A O   1 
ATOM   133  C CB  . PRO A 1 31  ? 22.001 33.780 47.799 1.00 81.42  ? 316 PRO A CB  1 
ATOM   134  C CG  . PRO A 1 31  ? 22.756 34.867 47.092 1.00 81.05  ? 316 PRO A CG  1 
ATOM   135  C CD  . PRO A 1 31  ? 22.055 34.907 45.752 1.00 81.72  ? 316 PRO A CD  1 
ATOM   136  N N   . GLN A 1 32  ? 19.478 32.338 46.638 1.00 76.54  ? 317 GLN A N   1 
ATOM   137  C CA  . GLN A 1 32  ? 18.236 31.610 46.819 1.00 75.52  ? 317 GLN A CA  1 
ATOM   138  C C   . GLN A 1 32  ? 18.112 30.369 45.941 1.00 73.52  ? 317 GLN A C   1 
ATOM   139  O O   . GLN A 1 32  ? 17.619 29.340 46.379 1.00 73.30  ? 317 GLN A O   1 
ATOM   140  C CB  . GLN A 1 32  ? 17.060 32.545 46.561 1.00 76.62  ? 317 GLN A CB  1 
ATOM   141  C CG  . GLN A 1 32  ? 15.720 31.853 46.561 1.00 78.98  ? 317 GLN A CG  1 
ATOM   142  C CD  . GLN A 1 32  ? 14.593 32.809 46.266 1.00 80.24  ? 317 GLN A CD  1 
ATOM   143  O OE1 . GLN A 1 32  ? 14.214 33.628 47.108 1.00 79.24  ? 317 GLN A OE1 1 
ATOM   144  N NE2 . GLN A 1 32  ? 14.056 32.725 45.051 1.00 80.83  ? 317 GLN A NE2 1 
ATOM   145  N N   . VAL A 1 33  ? 18.557 30.471 44.697 1.00 71.45  ? 318 VAL A N   1 
ATOM   146  C CA  . VAL A 1 33  ? 18.477 29.344 43.780 1.00 70.06  ? 318 VAL A CA  1 
ATOM   147  C C   . VAL A 1 33  ? 19.320 28.152 44.216 1.00 70.22  ? 318 VAL A C   1 
ATOM   148  O O   . VAL A 1 33  ? 18.919 27.020 44.030 1.00 71.44  ? 318 VAL A O   1 
ATOM   149  C CB  . VAL A 1 33  ? 18.913 29.744 42.378 1.00 69.67  ? 318 VAL A CB  1 
ATOM   150  C CG1 . VAL A 1 33  ? 18.847 28.541 41.466 1.00 69.81  ? 318 VAL A CG1 1 
ATOM   151  C CG2 . VAL A 1 33  ? 18.030 30.861 41.860 1.00 69.31  ? 318 VAL A CG2 1 
ATOM   152  N N   . GLN A 1 34  ? 20.495 28.418 44.782 1.00 69.71  ? 319 GLN A N   1 
ATOM   153  C CA  . GLN A 1 34  ? 21.387 27.357 45.251 1.00 70.04  ? 319 GLN A CA  1 
ATOM   154  C C   . GLN A 1 34  ? 20.726 26.549 46.354 1.00 69.54  ? 319 GLN A C   1 
ATOM   155  O O   . GLN A 1 34  ? 20.720 25.324 46.322 1.00 68.90  ? 319 GLN A O   1 
ATOM   156  C CB  . GLN A 1 34  ? 22.685 27.954 45.792 1.00 71.44  ? 319 GLN A CB  1 
ATOM   157  C CG  . GLN A 1 34  ? 23.469 28.751 44.771 1.00 73.93  ? 319 GLN A CG  1 
ATOM   158  C CD  . GLN A 1 34  ? 24.570 29.581 45.400 1.00 74.64  ? 319 GLN A CD  1 
ATOM   159  O OE1 . GLN A 1 34  ? 25.306 30.282 44.704 1.00 75.31  ? 319 GLN A OE1 1 
ATOM   160  N NE2 . GLN A 1 34  ? 24.686 29.508 46.725 1.00 73.81  ? 319 GLN A NE2 1 
ATOM   161  N N   . ALA A 1 35  ? 20.178 27.257 47.338 1.00 69.24  ? 320 ALA A N   1 
ATOM   162  C CA  . ALA A 1 35  ? 19.502 26.628 48.467 1.00 68.04  ? 320 ALA A CA  1 
ATOM   163  C C   . ALA A 1 35  ? 18.334 25.761 48.008 1.00 65.74  ? 320 ALA A C   1 
ATOM   164  O O   . ALA A 1 35  ? 18.113 24.680 48.545 1.00 66.98  ? 320 ALA A O   1 
ATOM   165  C CB  . ALA A 1 35  ? 19.012 27.693 49.430 1.00 69.55  ? 320 ALA A CB  1 
ATOM   166  N N   . LYS A 1 36  ? 17.595 26.246 47.014 1.00 63.12  ? 321 LYS A N   1 
ATOM   167  C CA  . LYS A 1 36  ? 16.449 25.525 46.469 1.00 60.34  ? 321 LYS A CA  1 
ATOM   168  C C   . LYS A 1 36  ? 16.809 24.283 45.659 1.00 56.96  ? 321 LYS A C   1 
ATOM   169  O O   . LYS A 1 36  ? 16.196 23.242 45.820 1.00 55.38  ? 321 LYS A O   1 
ATOM   170  C CB  . LYS A 1 36  ? 15.614 26.442 45.582 1.00 64.49  ? 321 LYS A CB  1 
ATOM   171  C CG  . LYS A 1 36  ? 14.522 25.689 44.831 1.00 67.75  ? 321 LYS A CG  1 
ATOM   172  C CD  . LYS A 1 36  ? 13.663 24.900 45.812 1.00 70.36  ? 321 LYS A CD  1 
ATOM   173  C CE  . LYS A 1 36  ? 12.497 24.227 45.131 1.00 71.13  ? 321 LYS A CE  1 
ATOM   174  N NZ  . LYS A 1 36  ? 11.482 23.833 46.150 1.00 74.75  ? 321 LYS A NZ  1 
ATOM   175  N N   . ILE A 1 37  ? 17.784 24.403 44.762 1.00 53.47  ? 322 ILE A N   1 
ATOM   176  C CA  . ILE A 1 37  ? 18.182 23.258 43.957 1.00 50.53  ? 322 ILE A CA  1 
ATOM   177  C C   . ILE A 1 37  ? 18.849 22.222 44.836 1.00 50.62  ? 322 ILE A C   1 
ATOM   178  O O   . ILE A 1 37  ? 18.682 21.021 44.635 1.00 49.93  ? 322 ILE A O   1 
ATOM   179  C CB  . ILE A 1 37  ? 19.130 23.666 42.838 1.00 48.24  ? 322 ILE A CB  1 
ATOM   180  C CG1 . ILE A 1 37  ? 18.323 24.337 41.725 1.00 45.23  ? 322 ILE A CG1 1 
ATOM   181  C CG2 . ILE A 1 37  ? 19.886 22.444 42.338 1.00 46.17  ? 322 ILE A CG2 1 
ATOM   182  C CD1 . ILE A 1 37  ? 19.151 24.972 40.647 1.00 46.35  ? 322 ILE A CD1 1 
ATOM   183  N N   . MET A 1 38  ? 19.611 22.704 45.811 1.00 51.04  ? 323 MET A N   1 
ATOM   184  C CA  . MET A 1 38  ? 20.281 21.833 46.757 1.00 53.19  ? 323 MET A CA  1 
ATOM   185  C C   . MET A 1 38  ? 19.158 21.131 47.512 1.00 54.04  ? 323 MET A C   1 
ATOM   186  O O   . MET A 1 38  ? 19.130 19.904 47.623 1.00 53.97  ? 323 MET A O   1 
ATOM   187  C CB  . MET A 1 38  ? 21.128 22.666 47.721 1.00 54.48  ? 323 MET A CB  1 
ATOM   188  C CG  . MET A 1 38  ? 21.994 21.858 48.677 1.00 54.44  ? 323 MET A CG  1 
ATOM   189  S SD  . MET A 1 38  ? 23.181 20.812 47.845 1.00 56.84  ? 323 MET A SD  1 
ATOM   190  C CE  . MET A 1 38  ? 22.576 19.181 48.253 1.00 54.94  ? 323 MET A CE  1 
ATOM   191  N N   . ALA A 1 39  ? 18.220 21.924 48.016 1.00 53.15  ? 324 ALA A N   1 
ATOM   192  C CA  . ALA A 1 39  ? 17.090 21.382 48.745 1.00 54.74  ? 324 ALA A CA  1 
ATOM   193  C C   . ALA A 1 39  ? 16.342 20.291 47.961 1.00 54.19  ? 324 ALA A C   1 
ATOM   194  O O   . ALA A 1 39  ? 16.017 19.269 48.520 1.00 54.84  ? 324 ALA A O   1 
ATOM   195  C CB  . ALA A 1 39  ? 16.142 22.510 49.137 1.00 55.35  ? 324 ALA A CB  1 
ATOM   196  N N   . TYR A 1 40  ? 16.078 20.505 46.674 1.00 54.25  ? 325 TYR A N   1 
ATOM   197  C CA  . TYR A 1 40  ? 15.374 19.493 45.873 1.00 57.58  ? 325 TYR A CA  1 
ATOM   198  C C   . TYR A 1 40  ? 16.142 18.182 45.758 1.00 59.52  ? 325 TYR A C   1 
ATOM   199  O O   . TYR A 1 40  ? 15.571 17.114 45.885 1.00 58.40  ? 325 TYR A O   1 
ATOM   200  C CB  . TYR A 1 40  ? 15.093 19.995 44.455 1.00 57.52  ? 325 TYR A CB  1 
ATOM   201  C CG  . TYR A 1 40  ? 14.807 18.875 43.455 1.00 59.65  ? 325 TYR A CG  1 
ATOM   202  C CD1 . TYR A 1 40  ? 13.589 18.205 43.447 1.00 61.41  ? 325 TYR A CD1 1 
ATOM   203  C CD2 . TYR A 1 40  ? 15.760 18.496 42.512 1.00 61.09  ? 325 TYR A CD2 1 
ATOM   204  C CE1 . TYR A 1 40  ? 13.327 17.197 42.527 1.00 61.24  ? 325 TYR A CE1 1 
ATOM   205  C CE2 . TYR A 1 40  ? 15.508 17.490 41.591 1.00 61.20  ? 325 TYR A CE2 1 
ATOM   206  C CZ  . TYR A 1 40  ? 14.289 16.846 41.601 1.00 62.83  ? 325 TYR A CZ  1 
ATOM   207  O OH  . TYR A 1 40  ? 14.027 15.859 40.671 1.00 64.11  ? 325 TYR A OH  1 
ATOM   208  N N   . LEU A 1 41  ? 17.440 18.283 45.489 1.00 62.34  ? 326 LEU A N   1 
ATOM   209  C CA  . LEU A 1 41  ? 18.296 17.110 45.352 1.00 65.38  ? 326 LEU A CA  1 
ATOM   210  C C   . LEU A 1 41  ? 18.224 16.228 46.588 1.00 67.00  ? 326 LEU A C   1 
ATOM   211  O O   . LEU A 1 41  ? 18.255 15.012 46.486 1.00 66.03  ? 326 LEU A O   1 
ATOM   212  C CB  . LEU A 1 41  ? 19.734 17.558 45.098 1.00 64.86  ? 326 LEU A CB  1 
ATOM   213  C CG  . LEU A 1 41  ? 19.838 18.389 43.818 1.00 63.68  ? 326 LEU A CG  1 
ATOM   214  C CD1 . LEU A 1 41  ? 21.136 19.177 43.778 1.00 62.35  ? 326 LEU A CD1 1 
ATOM   215  C CD2 . LEU A 1 41  ? 19.717 17.452 42.634 1.00 63.83  ? 326 LEU A CD2 1 
ATOM   216  N N   . GLN A 1 42  ? 18.133 16.858 47.755 1.00 71.31  ? 327 GLN A N   1 
ATOM   217  C CA  . GLN A 1 42  ? 18.023 16.131 49.016 1.00 77.53  ? 327 GLN A CA  1 
ATOM   218  C C   . GLN A 1 42  ? 16.619 15.555 49.175 1.00 81.02  ? 327 GLN A C   1 
ATOM   219  O O   . GLN A 1 42  ? 16.453 14.366 49.402 1.00 81.48  ? 327 GLN A O   1 
ATOM   220  C CB  . GLN A 1 42  ? 18.321 17.059 50.186 1.00 78.16  ? 327 GLN A CB  1 
ATOM   221  C CG  . GLN A 1 42  ? 19.782 17.424 50.315 1.00 79.95  ? 327 GLN A CG  1 
ATOM   222  C CD  . GLN A 1 42  ? 20.040 18.378 51.455 1.00 80.05  ? 327 GLN A CD  1 
ATOM   223  O OE1 . GLN A 1 42  ? 21.176 18.650 51.790 1.00 82.12  ? 327 GLN A OE1 1 
ATOM   224  N NE2 . GLN A 1 42  ? 18.973 18.895 52.054 1.00 79.78  ? 327 GLN A NE2 1 
ATOM   225  N N   . GLN A 1 43  ? 15.613 16.417 49.062 1.00 84.75  ? 328 GLN A N   1 
ATOM   226  C CA  . GLN A 1 43  ? 14.226 15.990 49.172 1.00 89.41  ? 328 GLN A CA  1 
ATOM   227  C C   . GLN A 1 43  ? 13.967 14.806 48.243 1.00 92.10  ? 328 GLN A C   1 
ATOM   228  O O   . GLN A 1 43  ? 13.284 13.863 48.607 1.00 93.30  ? 328 GLN A O   1 
ATOM   229  C CB  . GLN A 1 43  ? 13.292 17.144 48.813 1.00 89.94  ? 328 GLN A CB  1 
ATOM   230  C CG  . GLN A 1 43  ? 11.825 16.761 48.771 1.00 92.73  ? 328 GLN A CG  1 
ATOM   231  C CD  . GLN A 1 43  ? 11.327 16.196 50.090 1.00 94.23  ? 328 GLN A CD  1 
ATOM   232  O OE1 . GLN A 1 43  ? 11.379 16.854 51.127 1.00 95.31  ? 328 GLN A OE1 1 
ATOM   233  N NE2 . GLN A 1 43  ? 10.835 14.962 50.052 1.00 94.54  ? 328 GLN A NE2 1 
ATOM   234  N N   . GLU A 1 44  ? 14.520 14.871 47.037 1.00 95.15  ? 329 GLU A N   1 
ATOM   235  C CA  . GLU A 1 44  ? 14.361 13.803 46.064 1.00 98.61  ? 329 GLU A CA  1 
ATOM   236  C C   . GLU A 1 44  ? 14.916 12.523 46.680 1.00 101.71 ? 329 GLU A C   1 
ATOM   237  O O   . GLU A 1 44  ? 14.257 11.493 46.671 1.00 101.97 ? 329 GLU A O   1 
ATOM   238  C CB  . GLU A 1 44  ? 15.110 14.157 44.777 1.00 97.79  ? 329 GLU A CB  1 
ATOM   239  C CG  . GLU A 1 44  ? 14.656 13.381 43.555 1.00 97.83  ? 329 GLU A CG  1 
ATOM   240  C CD  . GLU A 1 44  ? 15.323 12.029 43.424 1.00 98.04  ? 329 GLU A CD  1 
ATOM   241  O OE1 . GLU A 1 44  ? 15.412 11.291 44.427 1.00 99.10  ? 329 GLU A OE1 1 
ATOM   242  O OE2 . GLU A 1 44  ? 15.752 11.695 42.305 1.00 97.66  ? 329 GLU A OE2 1 
ATOM   243  N N   . GLN A 1 45  ? 16.134 12.607 47.211 1.00 106.26 ? 330 GLN A N   1 
ATOM   244  C CA  . GLN A 1 45  ? 16.793 11.474 47.868 1.00 110.47 ? 330 GLN A CA  1 
ATOM   245  C C   . GLN A 1 45  ? 15.911 10.953 49.003 1.00 113.12 ? 330 GLN A C   1 
ATOM   246  O O   . GLN A 1 45  ? 15.923 11.504 50.096 1.00 113.45 ? 330 GLN A O   1 
ATOM   247  C CB  . GLN A 1 45  ? 18.146 11.909 48.453 1.00 110.46 ? 330 GLN A CB  1 
ATOM   248  C CG  . GLN A 1 45  ? 19.335 11.781 47.511 1.00 112.03 ? 330 GLN A CG  1 
ATOM   249  C CD  . GLN A 1 45  ? 19.778 10.339 47.316 1.00 112.35 ? 330 GLN A CD  1 
ATOM   250  O OE1 . GLN A 1 45  ? 20.178 9.666  48.262 1.00 112.20 ? 330 GLN A OE1 1 
ATOM   251  N NE2 . GLN A 1 45  ? 19.706 9.861  46.078 1.00 111.84 ? 330 GLN A NE2 1 
ATOM   252  N N   . ALA A 1 46  ? 15.155 9.891  48.740 1.00 116.00 ? 331 ALA A N   1 
ATOM   253  C CA  . ALA A 1 46  ? 14.275 9.320  49.753 1.00 118.93 ? 331 ALA A CA  1 
ATOM   254  C C   . ALA A 1 46  ? 13.425 8.193  49.183 1.00 121.19 ? 331 ALA A C   1 
ATOM   255  O O   . ALA A 1 46  ? 12.208 8.209  49.320 1.00 121.23 ? 331 ALA A O   1 
ATOM   256  C CB  . ALA A 1 46  ? 13.370 10.408 50.331 1.00 118.67 ? 331 ALA A CB  1 
ATOM   257  N N   . ASN A 1 47  ? 14.066 7.211  48.554 1.00 123.99 ? 332 ASN A N   1 
ATOM   258  C CA  . ASN A 1 47  ? 13.322 6.100  47.967 1.00 126.97 ? 332 ASN A CA  1 
ATOM   259  C C   . ASN A 1 47  ? 14.176 4.986  47.355 1.00 128.72 ? 332 ASN A C   1 
ATOM   260  O O   . ASN A 1 47  ? 13.738 4.313  46.426 1.00 129.42 ? 332 ASN A O   1 
ATOM   261  C CB  . ASN A 1 47  ? 12.350 6.637  46.902 1.00 127.09 ? 332 ASN A CB  1 
ATOM   262  C CG  . ASN A 1 47  ? 13.045 7.467  45.824 1.00 127.07 ? 332 ASN A CG  1 
ATOM   263  O OD1 . ASN A 1 47  ? 13.613 8.523  46.096 1.00 127.02 ? 332 ASN A OD1 1 
ATOM   264  N ND2 . ASN A 1 47  ? 12.994 6.983  44.586 1.00 127.07 ? 332 ASN A ND2 1 
ATOM   265  N N   . ARG A 1 48  ? 15.378 4.773  47.881 1.00 130.49 ? 333 ARG A N   1 
ATOM   266  C CA  . ARG A 1 48  ? 16.255 3.740  47.332 1.00 132.18 ? 333 ARG A CA  1 
ATOM   267  C C   . ARG A 1 48  ? 17.196 3.135  48.374 1.00 132.83 ? 333 ARG A C   1 
ATOM   268  O O   . ARG A 1 48  ? 18.186 3.747  48.755 1.00 133.10 ? 333 ARG A O   1 
ATOM   269  C CB  . ARG A 1 48  ? 17.077 4.329  46.179 1.00 133.21 ? 333 ARG A CB  1 
ATOM   270  C CG  . ARG A 1 48  ? 16.241 4.848  45.013 1.00 134.41 ? 333 ARG A CG  1 
ATOM   271  C CD  . ARG A 1 48  ? 16.958 5.943  44.231 1.00 135.31 ? 333 ARG A CD  1 
ATOM   272  N NE  . ARG A 1 48  ? 16.145 6.429  43.118 1.00 136.58 ? 333 ARG A NE  1 
ATOM   273  C CZ  . ARG A 1 48  ? 16.452 7.479  42.362 1.00 136.80 ? 333 ARG A CZ  1 
ATOM   274  N NH1 . ARG A 1 48  ? 15.650 7.843  41.369 1.00 136.79 ? 333 ARG A NH1 1 
ATOM   275  N NH2 . ARG A 1 48  ? 17.557 8.171  42.603 1.00 136.60 ? 333 ARG A NH2 1 
ATOM   276  N N   . SER A 1 49  ? 16.881 1.923  48.821 1.00 133.42 ? 334 SER A N   1 
ATOM   277  C CA  . SER A 1 49  ? 17.700 1.231  49.812 1.00 133.71 ? 334 SER A CA  1 
ATOM   278  C C   . SER A 1 49  ? 18.893 0.559  49.134 1.00 133.72 ? 334 SER A C   1 
ATOM   279  O O   . SER A 1 49  ? 19.394 1.036  48.116 1.00 133.24 ? 334 SER A O   1 
ATOM   280  C CB  . SER A 1 49  ? 16.860 0.181  50.552 1.00 134.19 ? 334 SER A CB  1 
ATOM   281  O OG  . SER A 1 49  ? 17.621 -0.492 51.539 1.00 134.77 ? 334 SER A OG  1 
ATOM   282  N N   . LYS A 1 53  ? 21.221 2.748  43.491 1.00 95.96  ? 338 LYS A N   1 
ATOM   283  C CA  . LYS A 1 53  ? 20.879 4.165  43.447 1.00 95.69  ? 338 LYS A CA  1 
ATOM   284  C C   . LYS A 1 53  ? 21.687 4.896  42.369 1.00 95.69  ? 338 LYS A C   1 
ATOM   285  O O   . LYS A 1 53  ? 22.630 4.337  41.811 1.00 95.70  ? 338 LYS A O   1 
ATOM   286  C CB  . LYS A 1 53  ? 21.127 4.806  44.814 1.00 96.79  ? 338 LYS A CB  1 
ATOM   287  C CG  . LYS A 1 53  ? 20.371 4.151  45.962 1.00 96.98  ? 338 LYS A CG  1 
ATOM   288  C CD  . LYS A 1 53  ? 20.486 4.969  47.246 1.00 97.24  ? 338 LYS A CD  1 
ATOM   289  C CE  . LYS A 1 53  ? 21.926 5.095  47.710 1.00 96.51  ? 338 LYS A CE  1 
ATOM   290  N NZ  . LYS A 1 53  ? 22.023 5.911  48.943 1.00 94.00  ? 338 LYS A NZ  1 
ATOM   291  N N   . LEU A 1 54  ? 21.321 6.150  42.098 1.00 93.98  ? 339 LEU A N   1 
ATOM   292  C CA  . LEU A 1 54  ? 21.976 6.962  41.064 1.00 91.93  ? 339 LEU A CA  1 
ATOM   293  C C   . LEU A 1 54  ? 23.465 7.229  41.265 1.00 89.32  ? 339 LEU A C   1 
ATOM   294  O O   . LEU A 1 54  ? 23.953 7.284  42.390 1.00 88.95  ? 339 LEU A O   1 
ATOM   295  C CB  . LEU A 1 54  ? 21.248 8.306  40.887 1.00 92.31  ? 339 LEU A CB  1 
ATOM   296  C CG  . LEU A 1 54  ? 21.507 9.452  41.866 1.00 91.45  ? 339 LEU A CG  1 
ATOM   297  C CD1 . LEU A 1 54  ? 20.811 10.701 41.358 1.00 90.69  ? 339 LEU A CD1 1 
ATOM   298  C CD2 . LEU A 1 54  ? 21.014 9.087  43.252 1.00 91.80  ? 339 LEU A CD2 1 
ATOM   299  N N   . SER A 1 55  ? 24.170 7.406  40.148 1.00 85.99  ? 340 SER A N   1 
ATOM   300  C CA  . SER A 1 55  ? 25.606 7.661  40.161 1.00 83.69  ? 340 SER A CA  1 
ATOM   301  C C   . SER A 1 55  ? 25.899 9.152  40.166 1.00 81.51  ? 340 SER A C   1 
ATOM   302  O O   . SER A 1 55  ? 24.989 9.964  40.247 1.00 81.94  ? 340 SER A O   1 
ATOM   303  C CB  . SER A 1 55  ? 26.261 7.034  38.934 1.00 83.64  ? 340 SER A CB  1 
ATOM   304  O OG  . SER A 1 55  ? 25.815 7.671  37.753 1.00 83.15  ? 340 SER A OG  1 
ATOM   305  N N   . THR A 1 56  ? 27.180 9.502  40.081 1.00 78.22  ? 341 THR A N   1 
ATOM   306  C CA  . THR A 1 56  ? 27.580 10.904 40.063 1.00 75.76  ? 341 THR A CA  1 
ATOM   307  C C   . THR A 1 56  ? 26.909 11.585 38.878 1.00 73.96  ? 341 THR A C   1 
ATOM   308  O O   . THR A 1 56  ? 26.258 12.618 39.024 1.00 74.15  ? 341 THR A O   1 
ATOM   309  C CB  . THR A 1 56  ? 29.119 11.057 39.927 1.00 76.25  ? 341 THR A CB  1 
ATOM   310  O OG1 . THR A 1 56  ? 29.750 10.657 41.152 1.00 77.34  ? 341 THR A OG1 1 
ATOM   311  C CG2 . THR A 1 56  ? 29.497 12.503 39.601 1.00 73.61  ? 341 THR A CG2 1 
ATOM   312  N N   . PHE A 1 57  ? 27.071 10.980 37.706 1.00 70.69  ? 342 PHE A N   1 
ATOM   313  C CA  . PHE A 1 57  ? 26.493 11.499 36.482 1.00 67.01  ? 342 PHE A CA  1 
ATOM   314  C C   . PHE A 1 57  ? 24.987 11.712 36.642 1.00 66.04  ? 342 PHE A C   1 
ATOM   315  O O   . PHE A 1 57  ? 24.469 12.799 36.372 1.00 64.97  ? 342 PHE A O   1 
ATOM   316  C CB  . PHE A 1 57  ? 26.756 10.530 35.326 1.00 64.89  ? 342 PHE A CB  1 
ATOM   317  C CG  . PHE A 1 57  ? 26.275 11.041 34.007 1.00 61.72  ? 342 PHE A CG  1 
ATOM   318  C CD1 . PHE A 1 57  ? 26.937 12.075 33.374 1.00 60.42  ? 342 PHE A CD1 1 
ATOM   319  C CD2 . PHE A 1 57  ? 25.116 10.551 33.444 1.00 60.10  ? 342 PHE A CD2 1 
ATOM   320  C CE1 . PHE A 1 57  ? 26.447 12.615 32.212 1.00 60.21  ? 342 PHE A CE1 1 
ATOM   321  C CE2 . PHE A 1 57  ? 24.619 11.091 32.276 1.00 59.14  ? 342 PHE A CE2 1 
ATOM   322  C CZ  . PHE A 1 57  ? 25.283 12.121 31.663 1.00 59.12  ? 342 PHE A CZ  1 
ATOM   323  N N   . GLY A 1 58  ? 24.295 10.662 37.075 1.00 64.28  ? 343 GLY A N   1 
ATOM   324  C CA  . GLY A 1 58  ? 22.858 10.735 37.279 1.00 62.97  ? 343 GLY A CA  1 
ATOM   325  C C   . GLY A 1 58  ? 22.447 11.903 38.155 1.00 62.46  ? 343 GLY A C   1 
ATOM   326  O O   . GLY A 1 58  ? 21.368 12.468 37.960 1.00 63.48  ? 343 GLY A O   1 
ATOM   327  N N   . LEU A 1 59  ? 23.296 12.256 39.123 1.00 60.86  ? 344 LEU A N   1 
ATOM   328  C CA  . LEU A 1 59  ? 23.028 13.374 40.029 1.00 59.41  ? 344 LEU A CA  1 
ATOM   329  C C   . LEU A 1 59  ? 23.230 14.708 39.324 1.00 58.17  ? 344 LEU A C   1 
ATOM   330  O O   . LEU A 1 59  ? 22.461 15.634 39.521 1.00 56.21  ? 344 LEU A O   1 
ATOM   331  C CB  . LEU A 1 59  ? 23.952 13.338 41.248 1.00 58.27  ? 344 LEU A CB  1 
ATOM   332  C CG  . LEU A 1 59  ? 23.663 14.495 42.211 1.00 58.56  ? 344 LEU A CG  1 
ATOM   333  C CD1 . LEU A 1 59  ? 22.525 14.103 43.162 1.00 58.56  ? 344 LEU A CD1 1 
ATOM   334  C CD2 . LEU A 1 59  ? 24.908 14.849 42.988 1.00 57.55  ? 344 LEU A CD2 1 
ATOM   335  N N   . MET A 1 60  ? 24.296 14.798 38.529 1.00 57.40  ? 345 MET A N   1 
ATOM   336  C CA  . MET A 1 60  ? 24.591 16.015 37.791 1.00 56.36  ? 345 MET A CA  1 
ATOM   337  C C   . MET A 1 60  ? 23.442 16.311 36.836 1.00 55.55  ? 345 MET A C   1 
ATOM   338  O O   . MET A 1 60  ? 23.074 17.439 36.652 1.00 54.63  ? 345 MET A O   1 
ATOM   339  C CB  . MET A 1 60  ? 25.896 15.870 37.012 1.00 56.26  ? 345 MET A CB  1 
ATOM   340  C CG  . MET A 1 60  ? 27.130 15.745 37.882 1.00 58.87  ? 345 MET A CG  1 
ATOM   341  S SD  . MET A 1 60  ? 27.222 17.024 39.137 1.00 62.25  ? 345 MET A SD  1 
ATOM   342  C CE  . MET A 1 60  ? 27.571 18.445 38.179 1.00 62.84  ? 345 MET A CE  1 
ATOM   343  N N   . CYS A 1 61  ? 22.890 15.267 36.229 1.00 54.89  ? 346 CYS A N   1 
ATOM   344  C CA  . CYS A 1 61  ? 21.773 15.437 35.328 1.00 54.90  ? 346 CYS A CA  1 
ATOM   345  C C   . CYS A 1 61  ? 20.677 16.124 36.102 1.00 55.21  ? 346 CYS A C   1 
ATOM   346  O O   . CYS A 1 61  ? 20.179 17.152 35.674 1.00 57.74  ? 346 CYS A O   1 
ATOM   347  C CB  . CYS A 1 61  ? 21.275 14.086 34.820 1.00 55.47  ? 346 CYS A CB  1 
ATOM   348  S SG  . CYS A 1 61  ? 22.291 13.395 33.507 1.00 58.25  ? 346 CYS A SG  1 
ATOM   349  N N   . LYS A 1 62  ? 20.320 15.547 37.249 1.00 53.30  ? 347 LYS A N   1 
ATOM   350  C CA  . LYS A 1 62  ? 19.277 16.084 38.121 1.00 52.37  ? 347 LYS A CA  1 
ATOM   351  C C   . LYS A 1 62  ? 19.476 17.549 38.465 1.00 50.38  ? 347 LYS A C   1 
ATOM   352  O O   . LYS A 1 62  ? 18.546 18.309 38.511 1.00 50.15  ? 347 LYS A O   1 
ATOM   353  C CB  . LYS A 1 62  ? 19.212 15.276 39.414 1.00 54.10  ? 347 LYS A CB  1 
ATOM   354  C CG  . LYS A 1 62  ? 18.818 13.838 39.186 1.00 57.63  ? 347 LYS A CG  1 
ATOM   355  C CD  . LYS A 1 62  ? 18.270 13.209 40.437 1.00 59.87  ? 347 LYS A CD  1 
ATOM   356  C CE  . LYS A 1 62  ? 17.575 11.894 40.113 1.00 65.04  ? 347 LYS A CE  1 
ATOM   357  N NZ  . LYS A 1 62  ? 16.365 12.044 39.237 1.00 64.10  ? 347 LYS A NZ  1 
ATOM   358  N N   . MET A 1 63  ? 20.722 17.913 38.713 1.00 49.33  ? 348 MET A N   1 
ATOM   359  C CA  . MET A 1 63  ? 21.098 19.268 39.057 1.00 49.43  ? 348 MET A CA  1 
ATOM   360  C C   . MET A 1 63  ? 20.969 20.176 37.830 1.00 50.58  ? 348 MET A C   1 
ATOM   361  O O   . MET A 1 63  ? 20.587 21.342 37.937 1.00 51.50  ? 348 MET A O   1 
ATOM   362  C CB  . MET A 1 63  ? 22.538 19.248 39.555 1.00 47.38  ? 348 MET A CB  1 
ATOM   363  C CG  . MET A 1 63  ? 23.037 20.532 40.142 1.00 47.80  ? 348 MET A CG  1 
ATOM   364  S SD  . MET A 1 63  ? 24.760 20.308 40.618 1.00 51.80  ? 348 MET A SD  1 
ATOM   365  C CE  . MET A 1 63  ? 24.613 19.027 41.878 1.00 48.99  ? 348 MET A CE  1 
ATOM   366  N N   . ALA A 1 64  ? 21.292 19.629 36.665 1.00 49.97  ? 349 ALA A N   1 
ATOM   367  C CA  . ALA A 1 64  ? 21.209 20.374 35.427 1.00 49.97  ? 349 ALA A CA  1 
ATOM   368  C C   . ALA A 1 64  ? 19.769 20.690 35.039 1.00 51.07  ? 349 ALA A C   1 
ATOM   369  O O   . ALA A 1 64  ? 19.465 21.830 34.719 1.00 50.96  ? 349 ALA A O   1 
ATOM   370  C CB  . ALA A 1 64  ? 21.887 19.614 34.308 1.00 49.46  ? 349 ALA A CB  1 
ATOM   371  N N   . ASP A 1 65  ? 18.861 19.718 35.074 1.00 51.11  ? 350 ASP A N   1 
ATOM   372  C CA  . ASP A 1 65  ? 17.523 20.092 34.657 1.00 52.92  ? 350 ASP A CA  1 
ATOM   373  C C   . ASP A 1 65  ? 16.776 20.942 35.663 1.00 51.45  ? 350 ASP A C   1 
ATOM   374  O O   . ASP A 1 65  ? 15.754 21.480 35.346 1.00 51.64  ? 350 ASP A O   1 
ATOM   375  C CB  . ASP A 1 65  ? 16.687 18.887 34.171 1.00 55.20  ? 350 ASP A CB  1 
ATOM   376  C CG  . ASP A 1 65  ? 16.155 18.046 35.275 1.00 57.68  ? 350 ASP A CG  1 
ATOM   377  O OD1 . ASP A 1 65  ? 16.035 18.551 36.405 1.00 63.04  ? 350 ASP A OD1 1 
ATOM   378  O OD2 . ASP A 1 65  ? 15.827 16.874 34.996 1.00 57.38  ? 350 ASP A OD2 1 
ATOM   379  N N   . GLN A 1 66  ? 17.312 21.066 36.875 1.00 51.06  ? 351 GLN A N   1 
ATOM   380  C CA  . GLN A 1 66  ? 16.711 21.948 37.880 1.00 48.32  ? 351 GLN A CA  1 
ATOM   381  C C   . GLN A 1 66  ? 17.171 23.349 37.494 1.00 47.05  ? 351 GLN A C   1 
ATOM   382  O O   . GLN A 1 66  ? 16.485 24.321 37.733 1.00 45.19  ? 351 GLN A O   1 
ATOM   383  C CB  . GLN A 1 66  ? 17.216 21.638 39.290 1.00 47.94  ? 351 GLN A CB  1 
ATOM   384  C CG  . GLN A 1 66  ? 16.524 20.473 39.944 1.00 48.62  ? 351 GLN A CG  1 
ATOM   385  C CD  . GLN A 1 66  ? 15.030 20.674 40.034 1.00 50.23  ? 351 GLN A CD  1 
ATOM   386  O OE1 . GLN A 1 66  ? 14.545 21.577 40.719 1.00 46.57  ? 351 GLN A OE1 1 
ATOM   387  N NE2 . GLN A 1 66  ? 14.284 19.827 39.328 1.00 51.48  ? 351 GLN A NE2 1 
ATOM   388  N N   . THR A 1 67  ? 18.361 23.420 36.901 1.00 45.97  ? 352 THR A N   1 
ATOM   389  C CA  . THR A 1 67  ? 18.912 24.677 36.447 1.00 48.25  ? 352 THR A CA  1 
ATOM   390  C C   . THR A 1 67  ? 18.071 25.134 35.277 1.00 49.36  ? 352 THR A C   1 
ATOM   391  O O   . THR A 1 67  ? 17.993 26.312 34.988 1.00 48.87  ? 352 THR A O   1 
ATOM   392  C CB  . THR A 1 67  ? 20.356 24.527 35.937 1.00 49.00  ? 352 THR A CB  1 
ATOM   393  O OG1 . THR A 1 67  ? 21.194 24.054 36.992 1.00 49.85  ? 352 THR A OG1 1 
ATOM   394  C CG2 . THR A 1 67  ? 20.891 25.875 35.445 1.00 50.84  ? 352 THR A CG2 1 
ATOM   395  N N   . LEU A 1 68  ? 17.450 24.175 34.602 1.00 51.57  ? 353 LEU A N   1 
ATOM   396  C CA  . LEU A 1 68  ? 16.628 24.475 33.449 1.00 54.05  ? 353 LEU A CA  1 
ATOM   397  C C   . LEU A 1 68  ? 15.307 25.076 33.888 1.00 54.01  ? 353 LEU A C   1 
ATOM   398  O O   . LEU A 1 68  ? 14.870 26.060 33.326 1.00 55.08  ? 353 LEU A O   1 
ATOM   399  C CB  . LEU A 1 68  ? 16.405 23.212 32.623 1.00 58.44  ? 353 LEU A CB  1 
ATOM   400  C CG  . LEU A 1 68  ? 16.296 23.486 31.122 1.00 60.39  ? 353 LEU A CG  1 
ATOM   401  C CD1 . LEU A 1 68  ? 16.436 22.194 30.349 1.00 63.40  ? 353 LEU A CD1 1 
ATOM   402  C CD2 . LEU A 1 68  ? 14.978 24.158 30.825 1.00 61.62  ? 353 LEU A CD2 1 
ATOM   403  N N   . PHE A 1 69  ? 14.673 24.474 34.889 1.00 53.19  ? 354 PHE A N   1 
ATOM   404  C CA  . PHE A 1 69  ? 13.427 25.012 35.420 1.00 52.69  ? 354 PHE A CA  1 
ATOM   405  C C   . PHE A 1 69  ? 13.694 26.474 35.819 1.00 52.40  ? 354 PHE A C   1 
ATOM   406  O O   . PHE A 1 69  ? 12.917 27.379 35.527 1.00 52.20  ? 354 PHE A O   1 
ATOM   407  C CB  . PHE A 1 69  ? 13.003 24.241 36.673 1.00 54.18  ? 354 PHE A CB  1 
ATOM   408  C CG  . PHE A 1 69  ? 12.324 22.925 36.402 1.00 54.93  ? 354 PHE A CG  1 
ATOM   409  C CD1 . PHE A 1 69  ? 12.961 21.920 35.698 1.00 55.83  ? 354 PHE A CD1 1 
ATOM   410  C CD2 . PHE A 1 69  ? 11.062 22.674 36.916 1.00 53.61  ? 354 PHE A CD2 1 
ATOM   411  C CE1 . PHE A 1 69  ? 12.351 20.677 35.520 1.00 57.96  ? 354 PHE A CE1 1 
ATOM   412  C CE2 . PHE A 1 69  ? 10.452 21.445 36.742 1.00 54.26  ? 354 PHE A CE2 1 
ATOM   413  C CZ  . PHE A 1 69  ? 11.093 20.444 36.047 1.00 54.52  ? 354 PHE A CZ  1 
ATOM   414  N N   . SER A 1 70  ? 14.809 26.679 36.509 1.00 51.63  ? 355 SER A N   1 
ATOM   415  C CA  . SER A 1 70  ? 15.212 27.992 36.965 1.00 50.54  ? 355 SER A CA  1 
ATOM   416  C C   . SER A 1 70  ? 15.349 28.997 35.821 1.00 52.38  ? 355 SER A C   1 
ATOM   417  O O   . SER A 1 70  ? 14.920 30.156 35.938 1.00 54.51  ? 355 SER A O   1 
ATOM   418  C CB  . SER A 1 70  ? 16.531 27.870 37.718 1.00 49.63  ? 355 SER A CB  1 
ATOM   419  O OG  . SER A 1 70  ? 17.212 29.108 37.761 1.00 53.34  ? 355 SER A OG  1 
ATOM   420  N N   . ILE A 1 71  ? 15.942 28.563 34.715 1.00 50.39  ? 356 ILE A N   1 
ATOM   421  C CA  . ILE A 1 71  ? 16.144 29.443 33.575 1.00 48.98  ? 356 ILE A CA  1 
ATOM   422  C C   . ILE A 1 71  ? 14.853 29.851 32.878 1.00 49.32  ? 356 ILE A C   1 
ATOM   423  O O   . ILE A 1 71  ? 14.686 31.023 32.518 1.00 48.55  ? 356 ILE A O   1 
ATOM   424  C CB  . ILE A 1 71  ? 17.143 28.808 32.573 1.00 46.13  ? 356 ILE A CB  1 
ATOM   425  C CG1 . ILE A 1 71  ? 18.555 29.207 32.989 1.00 43.93  ? 356 ILE A CG1 1 
ATOM   426  C CG2 . ILE A 1 71  ? 16.857 29.253 31.157 1.00 43.87  ? 356 ILE A CG2 1 
ATOM   427  C CD1 . ILE A 1 71  ? 19.655 28.536 32.225 1.00 46.04  ? 356 ILE A CD1 1 
ATOM   428  N N   . VAL A 1 72  ? 13.947 28.889 32.706 1.00 49.50  ? 357 VAL A N   1 
ATOM   429  C CA  . VAL A 1 72  ? 12.651 29.125 32.072 1.00 49.62  ? 357 VAL A CA  1 
ATOM   430  C C   . VAL A 1 72  ? 11.847 30.155 32.859 1.00 51.83  ? 357 VAL A C   1 
ATOM   431  O O   . VAL A 1 72  ? 11.152 30.967 32.286 1.00 51.73  ? 357 VAL A O   1 
ATOM   432  C CB  . VAL A 1 72  ? 11.829 27.831 31.974 1.00 47.72  ? 357 VAL A CB  1 
ATOM   433  C CG1 . VAL A 1 72  ? 10.418 28.146 31.532 1.00 48.21  ? 357 VAL A CG1 1 
ATOM   434  C CG2 . VAL A 1 72  ? 12.473 26.876 30.992 1.00 44.08  ? 357 VAL A CG2 1 
ATOM   435  N N   . GLU A 1 73  ? 11.949 30.116 34.181 1.00 54.68  ? 358 GLU A N   1 
ATOM   436  C CA  . GLU A 1 73  ? 11.229 31.086 34.994 1.00 58.99  ? 358 GLU A CA  1 
ATOM   437  C C   . GLU A 1 73  ? 11.856 32.451 34.814 1.00 58.53  ? 358 GLU A C   1 
ATOM   438  O O   . GLU A 1 73  ? 11.177 33.453 34.833 1.00 59.77  ? 358 GLU A O   1 
ATOM   439  C CB  . GLU A 1 73  ? 11.247 30.687 36.472 1.00 61.30  ? 358 GLU A CB  1 
ATOM   440  C CG  . GLU A 1 73  ? 10.265 29.579 36.782 1.00 67.72  ? 358 GLU A CG  1 
ATOM   441  C CD  . GLU A 1 73  ? 8.893  29.860 36.174 1.00 72.41  ? 358 GLU A CD  1 
ATOM   442  O OE1 . GLU A 1 73  ? 8.320  30.940 36.479 1.00 73.14  ? 358 GLU A OE1 1 
ATOM   443  O OE2 . GLU A 1 73  ? 8.396  29.009 35.390 1.00 72.96  ? 358 GLU A OE2 1 
ATOM   444  N N   . TRP A 1 74  ? 13.170 32.466 34.635 1.00 58.05  ? 359 TRP A N   1 
ATOM   445  C CA  . TRP A 1 74  ? 13.890 33.708 34.436 1.00 57.25  ? 359 TRP A CA  1 
ATOM   446  C C   . TRP A 1 74  ? 13.455 34.380 33.133 1.00 58.64  ? 359 TRP A C   1 
ATOM   447  O O   . TRP A 1 74  ? 13.303 35.582 33.075 1.00 60.30  ? 359 TRP A O   1 
ATOM   448  C CB  . TRP A 1 74  ? 15.390 33.444 34.391 1.00 53.57  ? 359 TRP A CB  1 
ATOM   449  C CG  . TRP A 1 74  ? 16.132 34.573 33.784 1.00 50.40  ? 359 TRP A CG  1 
ATOM   450  C CD1 . TRP A 1 74  ? 16.496 35.730 34.394 1.00 49.02  ? 359 TRP A CD1 1 
ATOM   451  C CD2 . TRP A 1 74  ? 16.523 34.699 32.411 1.00 47.54  ? 359 TRP A CD2 1 
ATOM   452  N NE1 . TRP A 1 74  ? 17.088 36.575 33.489 1.00 50.71  ? 359 TRP A NE1 1 
ATOM   453  C CE2 . TRP A 1 74  ? 17.115 35.963 32.262 1.00 48.46  ? 359 TRP A CE2 1 
ATOM   454  C CE3 . TRP A 1 74  ? 16.424 33.866 31.293 1.00 46.89  ? 359 TRP A CE3 1 
ATOM   455  C CZ2 . TRP A 1 74  ? 17.606 36.419 31.040 1.00 47.03  ? 359 TRP A CZ2 1 
ATOM   456  C CZ3 . TRP A 1 74  ? 16.911 34.319 30.079 1.00 45.98  ? 359 TRP A CZ3 1 
ATOM   457  C CH2 . TRP A 1 74  ? 17.494 35.580 29.963 1.00 46.21  ? 359 TRP A CH2 1 
ATOM   458  N N   . ALA A 1 75  ? 13.265 33.589 32.085 1.00 59.75  ? 360 ALA A N   1 
ATOM   459  C CA  . ALA A 1 75  ? 12.857 34.129 30.797 1.00 61.00  ? 360 ALA A CA  1 
ATOM   460  C C   . ALA A 1 75  ? 11.381 34.524 30.799 1.00 63.65  ? 360 ALA A C   1 
ATOM   461  O O   . ALA A 1 75  ? 11.014 35.569 30.274 1.00 63.25  ? 360 ALA A O   1 
ATOM   462  C CB  . ALA A 1 75  ? 13.116 33.110 29.713 1.00 59.80  ? 360 ALA A CB  1 
ATOM   463  N N   . ARG A 1 76  ? 10.553 33.674 31.406 1.00 65.31  ? 361 ARG A N   1 
ATOM   464  C CA  . ARG A 1 76  ? 9.111  33.873 31.494 1.00 66.37  ? 361 ARG A CA  1 
ATOM   465  C C   . ARG A 1 76  ? 8.666  35.171 32.163 1.00 66.52  ? 361 ARG A C   1 
ATOM   466  O O   . ARG A 1 76  ? 7.662  35.757 31.786 1.00 66.48  ? 361 ARG A O   1 
ATOM   467  C CB  . ARG A 1 76  ? 8.472  32.694 32.222 1.00 67.49  ? 361 ARG A CB  1 
ATOM   468  C CG  . ARG A 1 76  ? 7.064  32.986 32.663 1.00 70.76  ? 361 ARG A CG  1 
ATOM   469  C CD  . ARG A 1 76  ? 6.876  32.661 34.124 1.00 74.16  ? 361 ARG A CD  1 
ATOM   470  N NE  . ARG A 1 76  ? 6.277  31.348 34.294 1.00 76.65  ? 361 ARG A NE  1 
ATOM   471  C CZ  . ARG A 1 76  ? 5.014  31.067 33.996 1.00 78.62  ? 361 ARG A CZ  1 
ATOM   472  N NH1 . ARG A 1 76  ? 4.210  32.009 33.517 1.00 78.74  ? 361 ARG A NH1 1 
ATOM   473  N NH2 . ARG A 1 76  ? 4.557  29.838 34.175 1.00 79.93  ? 361 ARG A NH2 1 
ATOM   474  N N   . SER A 1 77  ? 9.401  35.611 33.171 1.00 67.10  ? 362 SER A N   1 
ATOM   475  C CA  . SER A 1 77  ? 9.048  36.847 33.848 1.00 68.63  ? 362 SER A CA  1 
ATOM   476  C C   . SER A 1 77  ? 10.199 37.822 33.659 1.00 68.84  ? 362 SER A C   1 
ATOM   477  O O   . SER A 1 77  ? 10.706 38.389 34.605 1.00 69.46  ? 362 SER A O   1 
ATOM   478  C CB  . SER A 1 77  ? 8.811  36.588 35.338 1.00 70.08  ? 362 SER A CB  1 
ATOM   479  O OG  . SER A 1 77  ? 9.979  36.094 35.962 1.00 71.30  ? 362 SER A OG  1 
ATOM   480  N N   . SER A 1 78  ? 10.602 37.998 32.407 1.00 68.80  ? 363 SER A N   1 
ATOM   481  C CA  . SER A 1 78  ? 11.698 38.882 32.074 1.00 68.02  ? 363 SER A CA  1 
ATOM   482  C C   . SER A 1 78  ? 11.248 39.948 31.087 1.00 67.34  ? 363 SER A C   1 
ATOM   483  O O   . SER A 1 78  ? 10.443 39.694 30.196 1.00 63.82  ? 363 SER A O   1 
ATOM   484  C CB  . SER A 1 78  ? 12.848 38.074 31.475 1.00 68.64  ? 363 SER A CB  1 
ATOM   485  O OG  . SER A 1 78  ? 13.975 38.891 31.240 1.00 71.06  ? 363 SER A OG  1 
ATOM   486  N N   . ILE A 1 79  ? 11.789 41.146 31.269 1.00 68.08  ? 364 ILE A N   1 
ATOM   487  C CA  . ILE A 1 79  ? 11.453 42.268 30.413 1.00 69.42  ? 364 ILE A CA  1 
ATOM   488  C C   . ILE A 1 79  ? 11.521 41.811 28.964 1.00 69.10  ? 364 ILE A C   1 
ATOM   489  O O   . ILE A 1 79  ? 12.475 41.176 28.561 1.00 70.09  ? 364 ILE A O   1 
ATOM   490  C CB  . ILE A 1 79  ? 12.410 43.466 30.675 1.00 70.75  ? 364 ILE A CB  1 
ATOM   491  C CG1 . ILE A 1 79  ? 12.066 44.642 29.742 1.00 71.29  ? 364 ILE A CG1 1 
ATOM   492  C CG2 . ILE A 1 79  ? 13.851 43.010 30.514 1.00 70.81  ? 364 ILE A CG2 1 
ATOM   493  C CD1 . ILE A 1 79  ? 12.740 45.974 30.116 1.00 69.79  ? 364 ILE A CD1 1 
ATOM   494  N N   . PHE A 1 80  ? 10.465 42.106 28.210 1.00 68.27  ? 365 PHE A N   1 
ATOM   495  C CA  . PHE A 1 80  ? 10.384 41.758 26.797 1.00 66.49  ? 365 PHE A CA  1 
ATOM   496  C C   . PHE A 1 80  ? 9.896  40.343 26.500 1.00 64.91  ? 365 PHE A C   1 
ATOM   497  O O   . PHE A 1 80  ? 8.951  40.164 25.748 1.00 63.51  ? 365 PHE A O   1 
ATOM   498  C CB  . PHE A 1 80  ? 11.745 41.983 26.110 1.00 69.34  ? 365 PHE A CB  1 
ATOM   499  C CG  . PHE A 1 80  ? 12.286 43.381 26.256 1.00 71.89  ? 365 PHE A CG  1 
ATOM   500  C CD1 . PHE A 1 80  ? 13.657 43.607 26.313 1.00 72.27  ? 365 PHE A CD1 1 
ATOM   501  C CD2 . PHE A 1 80  ? 11.428 44.468 26.365 1.00 72.44  ? 365 PHE A CD2 1 
ATOM   502  C CE1 . PHE A 1 80  ? 14.156 44.903 26.480 1.00 73.65  ? 365 PHE A CE1 1 
ATOM   503  C CE2 . PHE A 1 80  ? 11.923 45.753 26.531 1.00 72.60  ? 365 PHE A CE2 1 
ATOM   504  C CZ  . PHE A 1 80  ? 13.284 45.968 26.592 1.00 72.33  ? 365 PHE A CZ  1 
ATOM   505  N N   . PHE A 1 81  ? 10.547 39.335 27.072 1.00 63.46  ? 366 PHE A N   1 
ATOM   506  C CA  . PHE A 1 81  ? 10.129 37.966 26.803 1.00 61.70  ? 366 PHE A CA  1 
ATOM   507  C C   . PHE A 1 81  ? 8.681  37.772 27.208 1.00 62.35  ? 366 PHE A C   1 
ATOM   508  O O   . PHE A 1 81  ? 7.924  37.134 26.499 1.00 60.73  ? 366 PHE A O   1 
ATOM   509  C CB  . PHE A 1 81  ? 10.980 36.949 27.563 1.00 59.33  ? 366 PHE A CB  1 
ATOM   510  C CG  . PHE A 1 81  ? 10.881 35.565 27.002 1.00 56.24  ? 366 PHE A CG  1 
ATOM   511  C CD1 . PHE A 1 81  ? 11.406 35.288 25.748 1.00 53.23  ? 366 PHE A CD1 1 
ATOM   512  C CD2 . PHE A 1 81  ? 10.252 34.546 27.703 1.00 54.87  ? 366 PHE A CD2 1 
ATOM   513  C CE1 . PHE A 1 81  ? 11.301 34.028 25.196 1.00 52.27  ? 366 PHE A CE1 1 
ATOM   514  C CE2 . PHE A 1 81  ? 10.145 33.274 27.145 1.00 54.77  ? 366 PHE A CE2 1 
ATOM   515  C CZ  . PHE A 1 81  ? 10.677 33.023 25.892 1.00 52.51  ? 366 PHE A CZ  1 
ATOM   516  N N   . ARG A 1 82  ? 8.329  38.332 28.366 1.00 63.15  ? 367 ARG A N   1 
ATOM   517  C CA  . ARG A 1 82  ? 6.980  38.253 28.931 1.00 65.69  ? 367 ARG A CA  1 
ATOM   518  C C   . ARG A 1 82  ? 5.866  38.596 27.931 1.00 67.12  ? 367 ARG A C   1 
ATOM   519  O O   . ARG A 1 82  ? 4.740  38.154 28.078 1.00 67.48  ? 367 ARG A O   1 
ATOM   520  C CB  . ARG A 1 82  ? 6.867  39.199 30.127 1.00 65.00  ? 367 ARG A CB  1 
ATOM   521  C CG  . ARG A 1 82  ? 7.152  40.644 29.739 1.00 67.02  ? 367 ARG A CG  1 
ATOM   522  C CD  . ARG A 1 82  ? 6.994  41.633 30.879 1.00 67.80  ? 367 ARG A CD  1 
ATOM   523  N NE  . ARG A 1 82  ? 7.938  41.409 31.962 1.00 69.51  ? 367 ARG A NE  1 
ATOM   524  C CZ  . ARG A 1 82  ? 8.525  42.393 32.635 1.00 71.66  ? 367 ARG A CZ  1 
ATOM   525  N NH1 . ARG A 1 82  ? 8.254  43.654 32.320 1.00 72.20  ? 367 ARG A NH1 1 
ATOM   526  N NH2 . ARG A 1 82  ? 9.384  42.125 33.613 1.00 71.61  ? 367 ARG A NH2 1 
ATOM   527  N N   . GLU A 1 83  ? 6.197  39.382 26.910 1.00 69.28  ? 368 GLU A N   1 
ATOM   528  C CA  . GLU A 1 83  ? 5.235  39.815 25.899 1.00 69.52  ? 368 GLU A CA  1 
ATOM   529  C C   . GLU A 1 83  ? 5.120  38.967 24.639 1.00 68.20  ? 368 GLU A C   1 
ATOM   530  O O   . GLU A 1 83  ? 4.485  39.376 23.677 1.00 69.38  ? 368 GLU A O   1 
ATOM   531  C CB  . GLU A 1 83  ? 5.547  41.259 25.502 1.00 70.60  ? 368 GLU A CB  1 
ATOM   532  C CG  . GLU A 1 83  ? 5.405  42.249 26.646 1.00 74.82  ? 368 GLU A CG  1 
ATOM   533  C CD  . GLU A 1 83  ? 6.575  43.207 26.732 1.00 77.12  ? 368 GLU A CD  1 
ATOM   534  O OE1 . GLU A 1 83  ? 6.916  43.814 25.690 1.00 78.81  ? 368 GLU A OE1 1 
ATOM   535  O OE2 . GLU A 1 83  ? 7.145  43.357 27.839 1.00 77.68  ? 368 GLU A OE2 1 
ATOM   536  N N   . LEU A 1 84  ? 5.727  37.793 24.628 1.00 67.19  ? 369 LEU A N   1 
ATOM   537  C CA  . LEU A 1 84  ? 5.633  36.944 23.448 1.00 66.39  ? 369 LEU A CA  1 
ATOM   538  C C   . LEU A 1 84  ? 4.557  35.885 23.626 1.00 66.25  ? 369 LEU A C   1 
ATOM   539  O O   . LEU A 1 84  ? 4.313  35.429 24.732 1.00 65.77  ? 369 LEU A O   1 
ATOM   540  C CB  . LEU A 1 84  ? 6.980  36.271 23.175 1.00 64.12  ? 369 LEU A CB  1 
ATOM   541  C CG  . LEU A 1 84  ? 8.026  37.072 22.400 1.00 61.63  ? 369 LEU A CG  1 
ATOM   542  C CD1 . LEU A 1 84  ? 9.418  36.615 22.776 1.00 59.01  ? 369 LEU A CD1 1 
ATOM   543  C CD2 . LEU A 1 84  ? 7.778  36.903 20.916 1.00 60.73  ? 369 LEU A CD2 1 
ATOM   544  N N   . LYS A 1 85  ? 3.900  35.512 22.532 1.00 67.56  ? 370 LYS A N   1 
ATOM   545  C CA  . LYS A 1 85  ? 2.889  34.471 22.602 1.00 68.88  ? 370 LYS A CA  1 
ATOM   546  C C   . LYS A 1 85  ? 3.681  33.251 23.039 1.00 69.06  ? 370 LYS A C   1 
ATOM   547  O O   . LYS A 1 85  ? 4.850  33.125 22.695 1.00 69.25  ? 370 LYS A O   1 
ATOM   548  C CB  . LYS A 1 85  ? 2.270  34.200 21.226 1.00 71.85  ? 370 LYS A CB  1 
ATOM   549  C CG  . LYS A 1 85  ? 1.491  35.364 20.625 1.00 75.51  ? 370 LYS A CG  1 
ATOM   550  C CD  . LYS A 1 85  ? 0.703  34.942 19.380 1.00 76.23  ? 370 LYS A CD  1 
ATOM   551  C CE  . LYS A 1 85  ? -0.421 33.971 19.728 1.00 78.20  ? 370 LYS A CE  1 
ATOM   552  N NZ  . LYS A 1 85  ? -1.313 33.659 18.569 1.00 79.17  ? 370 LYS A NZ  1 
ATOM   553  N N   . VAL A 1 86  ? 3.051  32.356 23.792 1.00 68.64  ? 371 VAL A N   1 
ATOM   554  C CA  . VAL A 1 86  ? 3.736  31.154 24.258 1.00 66.65  ? 371 VAL A CA  1 
ATOM   555  C C   . VAL A 1 86  ? 4.392  30.373 23.121 1.00 65.56  ? 371 VAL A C   1 
ATOM   556  O O   . VAL A 1 86  ? 5.392  29.713 23.322 1.00 66.41  ? 371 VAL A O   1 
ATOM   557  C CB  . VAL A 1 86  ? 2.772  30.231 25.040 1.00 65.47  ? 371 VAL A CB  1 
ATOM   558  C CG1 . VAL A 1 86  ? 3.454  28.913 25.379 1.00 64.59  ? 371 VAL A CG1 1 
ATOM   559  C CG2 . VAL A 1 86  ? 2.342  30.923 26.316 1.00 64.12  ? 371 VAL A CG2 1 
ATOM   560  N N   . ASP A 1 87  ? 3.829  30.459 21.925 1.00 64.09  ? 372 ASP A N   1 
ATOM   561  C CA  . ASP A 1 87  ? 4.401  29.760 20.789 1.00 64.58  ? 372 ASP A CA  1 
ATOM   562  C C   . ASP A 1 87  ? 5.752  30.361 20.423 1.00 63.20  ? 372 ASP A C   1 
ATOM   563  O O   . ASP A 1 87  ? 6.677  29.648 20.060 1.00 64.10  ? 372 ASP A O   1 
ATOM   564  C CB  . ASP A 1 87  ? 3.454  29.842 19.606 1.00 66.70  ? 372 ASP A CB  1 
ATOM   565  C CG  . ASP A 1 87  ? 2.070  29.389 19.962 1.00 68.75  ? 372 ASP A CG  1 
ATOM   566  O OD1 . ASP A 1 87  ? 1.910  28.186 20.281 1.00 68.20  ? 372 ASP A OD1 1 
ATOM   567  O OD2 . ASP A 1 87  ? 1.153  30.245 19.938 1.00 70.18  ? 372 ASP A OD2 1 
ATOM   568  N N   . ASP A 1 88  ? 5.862  31.680 20.497 1.00 60.03  ? 373 ASP A N   1 
ATOM   569  C CA  . ASP A 1 88  ? 7.140  32.305 20.199 1.00 58.01  ? 373 ASP A CA  1 
ATOM   570  C C   . ASP A 1 88  ? 8.105  31.952 21.335 1.00 55.92  ? 373 ASP A C   1 
ATOM   571  O O   . ASP A 1 88  ? 9.217  31.518 21.088 1.00 55.33  ? 373 ASP A O   1 
ATOM   572  C CB  . ASP A 1 88  ? 7.000  33.831 20.072 1.00 55.83  ? 373 ASP A CB  1 
ATOM   573  C CG  . ASP A 1 88  ? 6.272  34.253 18.802 1.00 54.87  ? 373 ASP A CG  1 
ATOM   574  O OD1 . ASP A 1 88  ? 6.251  33.479 17.818 1.00 52.14  ? 373 ASP A OD1 1 
ATOM   575  O OD2 . ASP A 1 88  ? 5.732  35.378 18.788 1.00 56.28  ? 373 ASP A OD2 1 
ATOM   576  N N   . GLN A 1 89  ? 7.650  32.131 22.576 1.00 54.12  ? 374 GLN A N   1 
ATOM   577  C CA  . GLN A 1 89  ? 8.446  31.827 23.759 1.00 51.92  ? 374 GLN A CA  1 
ATOM   578  C C   . GLN A 1 89  ? 9.067  30.441 23.665 1.00 50.93  ? 374 GLN A C   1 
ATOM   579  O O   . GLN A 1 89  ? 10.221 30.264 23.991 1.00 49.82  ? 374 GLN A O   1 
ATOM   580  C CB  . GLN A 1 89  ? 7.590  31.916 25.021 1.00 51.02  ? 374 GLN A CB  1 
ATOM   581  C CG  . GLN A 1 89  ? 6.972  33.289 25.257 1.00 53.28  ? 374 GLN A CG  1 
ATOM   582  C CD  . GLN A 1 89  ? 6.451  33.463 26.678 1.00 52.95  ? 374 GLN A CD  1 
ATOM   583  O OE1 . GLN A 1 89  ? 5.947  32.526 27.292 1.00 54.20  ? 374 GLN A OE1 1 
ATOM   584  N NE2 . GLN A 1 89  ? 6.565  34.679 27.201 1.00 53.00  ? 374 GLN A NE2 1 
ATOM   585  N N   . MET A 1 90  ? 8.288  29.469 23.206 1.00 49.37  ? 375 MET A N   1 
ATOM   586  C CA  . MET A 1 90  ? 8.782  28.111 23.063 1.00 50.20  ? 375 MET A CA  1 
ATOM   587  C C   . MET A 1 90  ? 9.832  27.997 21.977 1.00 51.48  ? 375 MET A C   1 
ATOM   588  O O   . MET A 1 90  ? 10.852 27.373 22.172 1.00 53.70  ? 375 MET A O   1 
ATOM   589  C CB  . MET A 1 90  ? 7.631  27.155 22.769 1.00 48.94  ? 375 MET A CB  1 
ATOM   590  C CG  . MET A 1 90  ? 6.910  26.679 24.023 1.00 48.60  ? 375 MET A CG  1 
ATOM   591  S SD  . MET A 1 90  ? 5.364  25.835 23.695 1.00 51.65  ? 375 MET A SD  1 
ATOM   592  C CE  . MET A 1 90  ? 5.908  24.358 22.793 1.00 45.91  ? 375 MET A CE  1 
ATOM   593  N N   . LYS A 1 91  ? 9.580  28.611 20.829 1.00 52.69  ? 376 LYS A N   1 
ATOM   594  C CA  . LYS A 1 91  ? 10.538 28.560 19.729 1.00 52.09  ? 376 LYS A CA  1 
ATOM   595  C C   . LYS A 1 91  ? 11.911 29.153 20.114 1.00 50.03  ? 376 LYS A C   1 
ATOM   596  O O   . LYS A 1 91  ? 12.949 28.593 19.767 1.00 47.43  ? 376 LYS A O   1 
ATOM   597  C CB  . LYS A 1 91  ? 9.956  29.264 18.493 1.00 52.38  ? 376 LYS A CB  1 
ATOM   598  C CG  . LYS A 1 91  ? 8.725  28.551 17.915 1.00 52.79  ? 376 LYS A CG  1 
ATOM   599  C CD  . LYS A 1 91  ? 8.409  29.004 16.490 1.00 53.44  ? 376 LYS A CD  1 
ATOM   600  C CE  . LYS A 1 91  ? 7.164  28.312 15.935 1.00 53.49  ? 376 LYS A CE  1 
ATOM   601  N NZ  . LYS A 1 91  ? 5.908  28.713 16.652 1.00 55.51  ? 376 LYS A NZ  1 
ATOM   602  N N   . LEU A 1 92  ? 11.914 30.276 20.831 1.00 47.57  ? 377 LEU A N   1 
ATOM   603  C CA  . LEU A 1 92  ? 13.160 30.890 21.259 1.00 45.31  ? 377 LEU A CA  1 
ATOM   604  C C   . LEU A 1 92  ? 13.918 30.017 22.279 1.00 46.41  ? 377 LEU A C   1 
ATOM   605  O O   . LEU A 1 92  ? 15.115 29.801 22.140 1.00 45.85  ? 377 LEU A O   1 
ATOM   606  C CB  . LEU A 1 92  ? 12.893 32.249 21.891 1.00 44.53  ? 377 LEU A CB  1 
ATOM   607  C CG  . LEU A 1 92  ? 12.384 33.369 21.002 1.00 45.75  ? 377 LEU A CG  1 
ATOM   608  C CD1 . LEU A 1 92  ? 12.619 34.685 21.721 1.00 45.31  ? 377 LEU A CD1 1 
ATOM   609  C CD2 . LEU A 1 92  ? 13.110 33.367 19.683 1.00 48.29  ? 377 LEU A CD2 1 
ATOM   610  N N   . LEU A 1 93  ? 13.215 29.530 23.309 1.00 45.75  ? 378 LEU A N   1 
ATOM   611  C CA  . LEU A 1 93  ? 13.840 28.706 24.341 1.00 43.05  ? 378 LEU A CA  1 
ATOM   612  C C   . LEU A 1 93  ? 14.264 27.345 23.822 1.00 45.64  ? 378 LEU A C   1 
ATOM   613  O O   . LEU A 1 93  ? 15.290 26.831 24.216 1.00 44.68  ? 378 LEU A O   1 
ATOM   614  C CB  . LEU A 1 93  ? 12.921 28.545 25.549 1.00 39.08  ? 378 LEU A CB  1 
ATOM   615  C CG  . LEU A 1 93  ? 12.795 29.812 26.405 1.00 38.56  ? 378 LEU A CG  1 
ATOM   616  C CD1 . LEU A 1 93  ? 11.692 29.637 27.437 1.00 35.44  ? 378 LEU A CD1 1 
ATOM   617  C CD2 . LEU A 1 93  ? 14.125 30.123 27.081 1.00 35.26  ? 378 LEU A CD2 1 
ATOM   618  N N   . GLN A 1 94  ? 13.484 26.763 22.921 1.00 47.08  ? 379 GLN A N   1 
ATOM   619  C CA  . GLN A 1 94  ? 13.865 25.470 22.364 1.00 48.15  ? 379 GLN A CA  1 
ATOM   620  C C   . GLN A 1 94  ? 15.160 25.638 21.551 1.00 48.00  ? 379 GLN A C   1 
ATOM   621  O O   . GLN A 1 94  ? 15.908 24.668 21.331 1.00 47.89  ? 379 GLN A O   1 
ATOM   622  C CB  . GLN A 1 94  ? 12.745 24.936 21.465 1.00 49.34  ? 379 GLN A CB  1 
ATOM   623  C CG  . GLN A 1 94  ? 12.412 23.467 21.698 1.00 57.09  ? 379 GLN A CG  1 
ATOM   624  C CD  . GLN A 1 94  ? 10.925 23.156 21.489 1.00 63.26  ? 379 GLN A CD  1 
ATOM   625  O OE1 . GLN A 1 94  ? 10.481 22.031 21.707 1.00 66.98  ? 379 GLN A OE1 1 
ATOM   626  N NE2 . GLN A 1 94  ? 10.152 24.161 21.062 1.00 65.70  ? 379 GLN A NE2 1 
ATOM   627  N N   . ASN A 1 95  ? 15.433 26.874 21.121 1.00 45.05  ? 380 ASN A N   1 
ATOM   628  C CA  . ASN A 1 95  ? 16.610 27.166 20.316 1.00 42.63  ? 380 ASN A CA  1 
ATOM   629  C C   . ASN A 1 95  ? 17.880 27.521 21.093 1.00 41.08  ? 380 ASN A C   1 
ATOM   630  O O   . ASN A 1 95  ? 18.989 27.306 20.598 1.00 39.43  ? 380 ASN A O   1 
ATOM   631  C CB  . ASN A 1 95  ? 16.265 28.288 19.334 1.00 44.11  ? 380 ASN A CB  1 
ATOM   632  C CG  . ASN A 1 95  ? 17.481 28.827 18.600 1.00 46.75  ? 380 ASN A CG  1 
ATOM   633  O OD1 . ASN A 1 95  ? 18.012 29.907 18.929 1.00 45.51  ? 380 ASN A OD1 1 
ATOM   634  N ND2 . ASN A 1 95  ? 17.938 28.080 17.600 1.00 45.01  ? 380 ASN A ND2 1 
ATOM   635  N N   . CYS A 1 96  ? 17.724 28.052 22.305 1.00 38.60  ? 381 CYS A N   1 
ATOM   636  C CA  . CYS A 1 96  ? 18.875 28.455 23.102 1.00 36.90  ? 381 CYS A CA  1 
ATOM   637  C C   . CYS A 1 96  ? 18.982 27.864 24.517 1.00 37.21  ? 381 CYS A C   1 
ATOM   638  O O   . CYS A 1 96  ? 19.821 28.309 25.296 1.00 36.62  ? 381 CYS A O   1 
ATOM   639  C CB  . CYS A 1 96  ? 18.883 29.977 23.220 1.00 35.25  ? 381 CYS A CB  1 
ATOM   640  S SG  . CYS A 1 96  ? 17.540 30.656 24.233 1.00 34.01  ? 381 CYS A SG  1 
ATOM   641  N N   . TRP A 1 97  ? 18.154 26.876 24.852 1.00 35.89  ? 382 TRP A N   1 
ATOM   642  C CA  . TRP A 1 97  ? 18.174 26.316 26.206 1.00 36.08  ? 382 TRP A CA  1 
ATOM   643  C C   . TRP A 1 97  ? 19.560 25.824 26.597 1.00 35.30  ? 382 TRP A C   1 
ATOM   644  O O   . TRP A 1 97  ? 20.107 26.246 27.590 1.00 34.33  ? 382 TRP A O   1 
ATOM   645  C CB  . TRP A 1 97  ? 17.119 25.192 26.372 1.00 36.86  ? 382 TRP A CB  1 
ATOM   646  C CG  . TRP A 1 97  ? 17.407 23.931 25.611 1.00 41.45  ? 382 TRP A CG  1 
ATOM   647  C CD1 . TRP A 1 97  ? 17.175 23.700 24.288 1.00 42.41  ? 382 TRP A CD1 1 
ATOM   648  C CD2 . TRP A 1 97  ? 18.105 22.780 26.097 1.00 45.26  ? 382 TRP A CD2 1 
ATOM   649  N NE1 . TRP A 1 97  ? 17.693 22.489 23.913 1.00 44.65  ? 382 TRP A NE1 1 
ATOM   650  C CE2 . TRP A 1 97  ? 18.278 21.898 25.011 1.00 47.22  ? 382 TRP A CE2 1 
ATOM   651  C CE3 . TRP A 1 97  ? 18.622 22.411 27.348 1.00 45.92  ? 382 TRP A CE3 1 
ATOM   652  C CZ2 . TRP A 1 97  ? 18.932 20.671 25.128 1.00 48.25  ? 382 TRP A CZ2 1 
ATOM   653  C CZ3 . TRP A 1 97  ? 19.272 21.198 27.468 1.00 48.01  ? 382 TRP A CZ3 1 
ATOM   654  C CH2 . TRP A 1 97  ? 19.426 20.341 26.362 1.00 49.16  ? 382 TRP A CH2 1 
ATOM   655  N N   . SER A 1 98  ? 20.144 24.960 25.782 1.00 36.35  ? 383 SER A N   1 
ATOM   656  C CA  . SER A 1 98  ? 21.448 24.442 26.094 1.00 36.23  ? 383 SER A CA  1 
ATOM   657  C C   . SER A 1 98  ? 22.471 25.561 26.120 1.00 37.84  ? 383 SER A C   1 
ATOM   658  O O   . SER A 1 98  ? 23.388 25.501 26.929 1.00 40.39  ? 383 SER A O   1 
ATOM   659  C CB  . SER A 1 98  ? 21.866 23.366 25.098 1.00 36.10  ? 383 SER A CB  1 
ATOM   660  O OG  . SER A 1 98  ? 22.397 23.938 23.927 1.00 39.46  ? 383 SER A OG  1 
ATOM   661  N N   . GLU A 1 99  ? 22.345 26.586 25.266 1.00 36.88  ? 384 GLU A N   1 
ATOM   662  C CA  . GLU A 1 99  ? 23.347 27.640 25.342 1.00 37.31  ? 384 GLU A CA  1 
ATOM   663  C C   . GLU A 1 99  ? 23.133 28.554 26.546 1.00 36.33  ? 384 GLU A C   1 
ATOM   664  O O   . GLU A 1 99  ? 24.069 29.116 27.075 1.00 36.93  ? 384 GLU A O   1 
ATOM   665  C CB  . GLU A 1 99  ? 23.494 28.406 24.014 1.00 40.14  ? 384 GLU A CB  1 
ATOM   666  C CG  . GLU A 1 99  ? 22.319 29.161 23.478 1.00 47.54  ? 384 GLU A CG  1 
ATOM   667  C CD  . GLU A 1 99  ? 22.464 29.437 21.977 1.00 47.83  ? 384 GLU A CD  1 
ATOM   668  O OE1 . GLU A 1 99  ? 23.600 29.628 21.491 1.00 46.37  ? 384 GLU A OE1 1 
ATOM   669  O OE2 . GLU A 1 99  ? 21.430 29.469 21.284 1.00 50.84  ? 384 GLU A OE2 1 
ATOM   670  N N   . LEU A 1 100 ? 21.902 28.664 27.016 1.00 36.73  ? 385 LEU A N   1 
ATOM   671  C CA  . LEU A 1 100 ? 21.662 29.450 28.205 1.00 37.35  ? 385 LEU A CA  1 
ATOM   672  C C   . LEU A 1 100 ? 22.304 28.721 29.406 1.00 38.15  ? 385 LEU A C   1 
ATOM   673  O O   . LEU A 1 100 ? 22.951 29.345 30.253 1.00 39.85  ? 385 LEU A O   1 
ATOM   674  C CB  . LEU A 1 100 ? 20.162 29.630 28.420 1.00 38.34  ? 385 LEU A CB  1 
ATOM   675  C CG  . LEU A 1 100 ? 19.587 30.911 27.811 1.00 38.75  ? 385 LEU A CG  1 
ATOM   676  C CD1 . LEU A 1 100 ? 18.117 31.048 28.205 1.00 35.88  ? 385 LEU A CD1 1 
ATOM   677  C CD2 . LEU A 1 100 ? 20.395 32.109 28.315 1.00 35.92  ? 385 LEU A CD2 1 
ATOM   678  N N   . LEU A 1 101 ? 22.125 27.404 29.480 1.00 37.56  ? 386 LEU A N   1 
ATOM   679  C CA  . LEU A 1 101 ? 22.723 26.621 30.555 1.00 39.65  ? 386 LEU A CA  1 
ATOM   680  C C   . LEU A 1 101 ? 24.256 26.731 30.538 1.00 39.11  ? 386 LEU A C   1 
ATOM   681  O O   . LEU A 1 101 ? 24.875 26.865 31.579 1.00 39.25  ? 386 LEU A O   1 
ATOM   682  C CB  . LEU A 1 101 ? 22.320 25.151 30.439 1.00 40.76  ? 386 LEU A CB  1 
ATOM   683  C CG  . LEU A 1 101 ? 20.821 24.884 30.531 1.00 44.00  ? 386 LEU A CG  1 
ATOM   684  C CD1 . LEU A 1 101 ? 20.557 23.385 30.605 1.00 44.70  ? 386 LEU A CD1 1 
ATOM   685  C CD2 . LEU A 1 101 ? 20.275 25.577 31.765 1.00 44.83  ? 386 LEU A CD2 1 
ATOM   686  N N   . ILE A 1 102 ? 24.858 26.669 29.352 1.00 37.65  ? 387 ILE A N   1 
ATOM   687  C CA  . ILE A 1 102 ? 26.310 26.779 29.228 1.00 38.11  ? 387 ILE A CA  1 
ATOM   688  C C   . ILE A 1 102 ? 26.807 28.155 29.661 1.00 38.05  ? 387 ILE A C   1 
ATOM   689  O O   . ILE A 1 102 ? 27.787 28.261 30.378 1.00 38.92  ? 387 ILE A O   1 
ATOM   690  C CB  . ILE A 1 102 ? 26.791 26.567 27.772 1.00 38.45  ? 387 ILE A CB  1 
ATOM   691  C CG1 . ILE A 1 102 ? 26.710 25.088 27.382 1.00 37.48  ? 387 ILE A CG1 1 
ATOM   692  C CG2 . ILE A 1 102 ? 28.184 27.150 27.601 1.00 34.26  ? 387 ILE A CG2 1 
ATOM   693  C CD1 . ILE A 1 102 ? 27.491 24.189 28.264 1.00 40.63  ? 387 ILE A CD1 1 
ATOM   694  N N   . LEU A 1 103 ? 26.127 29.204 29.206 1.00 37.79  ? 388 LEU A N   1 
ATOM   695  C CA  . LEU A 1 103 ? 26.513 30.576 29.539 1.00 38.03  ? 388 LEU A CA  1 
ATOM   696  C C   . LEU A 1 103 ? 26.393 30.766 31.035 1.00 38.42  ? 388 LEU A C   1 
ATOM   697  O O   . LEU A 1 103 ? 27.218 31.408 31.677 1.00 36.56  ? 388 LEU A O   1 
ATOM   698  C CB  . LEU A 1 103 ? 25.611 31.574 28.812 1.00 35.70  ? 388 LEU A CB  1 
ATOM   699  C CG  . LEU A 1 103 ? 25.939 33.045 29.047 1.00 33.19  ? 388 LEU A CG  1 
ATOM   700  C CD1 . LEU A 1 103 ? 27.417 33.305 28.824 1.00 31.38  ? 388 LEU A CD1 1 
ATOM   701  C CD2 . LEU A 1 103 ? 25.097 33.874 28.105 1.00 33.32  ? 388 LEU A CD2 1 
ATOM   702  N N   . ASP A 1 104 ? 25.342 30.186 31.578 1.00 38.72  ? 389 ASP A N   1 
ATOM   703  C CA  . ASP A 1 104 ? 25.096 30.244 32.995 1.00 42.52  ? 389 ASP A CA  1 
ATOM   704  C C   . ASP A 1 104 ? 26.258 29.612 33.774 1.00 41.99  ? 389 ASP A C   1 
ATOM   705  O O   . ASP A 1 104 ? 26.803 30.211 34.672 1.00 42.35  ? 389 ASP A O   1 
ATOM   706  C CB  . ASP A 1 104 ? 23.801 29.504 33.269 1.00 47.94  ? 389 ASP A CB  1 
ATOM   707  C CG  . ASP A 1 104 ? 23.054 30.068 34.431 1.00 51.98  ? 389 ASP A CG  1 
ATOM   708  O OD1 . ASP A 1 104 ? 23.448 29.723 35.571 1.00 52.87  ? 389 ASP A OD1 1 
ATOM   709  O OD2 . ASP A 1 104 ? 22.092 30.852 34.186 1.00 51.86  ? 389 ASP A OD2 1 
ATOM   710  N N   . HIS A 1 105 ? 26.627 28.392 33.404 1.00 41.64  ? 390 HIS A N   1 
ATOM   711  C CA  . HIS A 1 105 ? 27.709 27.687 34.063 1.00 41.87  ? 390 HIS A CA  1 
ATOM   712  C C   . HIS A 1 105 ? 29.014 28.434 33.909 1.00 41.79  ? 390 HIS A C   1 
ATOM   713  O O   . HIS A 1 105 ? 29.801 28.483 34.835 1.00 42.09  ? 390 HIS A O   1 
ATOM   714  C CB  . HIS A 1 105 ? 27.868 26.278 33.476 1.00 42.78  ? 390 HIS A CB  1 
ATOM   715  C CG  . HIS A 1 105 ? 29.164 25.604 33.838 1.00 43.21  ? 390 HIS A CG  1 
ATOM   716  N ND1 . HIS A 1 105 ? 29.386 25.013 35.065 1.00 42.50  ? 390 HIS A ND1 1 
ATOM   717  C CD2 . HIS A 1 105 ? 30.307 25.435 33.128 1.00 42.58  ? 390 HIS A CD2 1 
ATOM   718  C CE1 . HIS A 1 105 ? 30.606 24.507 35.095 1.00 40.11  ? 390 HIS A CE1 1 
ATOM   719  N NE2 . HIS A 1 105 ? 31.186 24.750 33.935 1.00 41.73  ? 390 HIS A NE2 1 
ATOM   720  N N   . ILE A 1 106 ? 29.235 29.007 32.729 1.00 41.85  ? 391 ILE A N   1 
ATOM   721  C CA  . ILE A 1 106 ? 30.472 29.732 32.434 1.00 42.32  ? 391 ILE A CA  1 
ATOM   722  C C   . ILE A 1 106 ? 30.609 30.979 33.284 1.00 43.05  ? 391 ILE A C   1 
ATOM   723  O O   . ILE A 1 106 ? 31.658 31.246 33.815 1.00 42.17  ? 391 ILE A O   1 
ATOM   724  C CB  . ILE A 1 106 ? 30.544 30.183 30.957 1.00 42.69  ? 391 ILE A CB  1 
ATOM   725  C CG1 . ILE A 1 106 ? 30.417 28.993 30.007 1.00 44.93  ? 391 ILE A CG1 1 
ATOM   726  C CG2 . ILE A 1 106 ? 31.835 30.886 30.713 1.00 43.96  ? 391 ILE A CG2 1 
ATOM   727  C CD1 . ILE A 1 106 ? 31.544 27.999 30.096 1.00 47.75  ? 391 ILE A CD1 1 
ATOM   728  N N   . TYR A 1 107 ? 29.525 31.743 33.387 1.00 44.98  ? 392 TYR A N   1 
ATOM   729  C CA  . TYR A 1 107 ? 29.527 32.971 34.169 1.00 47.36  ? 392 TYR A CA  1 
ATOM   730  C C   . TYR A 1 107 ? 29.755 32.655 35.628 1.00 48.04  ? 392 TYR A C   1 
ATOM   731  O O   . TYR A 1 107 ? 30.340 33.428 36.336 1.00 51.16  ? 392 TYR A O   1 
ATOM   732  C CB  . TYR A 1 107 ? 28.202 33.727 34.024 1.00 47.97  ? 392 TYR A CB  1 
ATOM   733  C CG  . TYR A 1 107 ? 28.199 35.048 34.768 1.00 48.16  ? 392 TYR A CG  1 
ATOM   734  C CD1 . TYR A 1 107 ? 29.116 36.041 34.453 1.00 48.06  ? 392 TYR A CD1 1 
ATOM   735  C CD2 . TYR A 1 107 ? 27.310 35.286 35.807 1.00 47.85  ? 392 TYR A CD2 1 
ATOM   736  C CE1 . TYR A 1 107 ? 29.152 37.228 35.150 1.00 48.38  ? 392 TYR A CE1 1 
ATOM   737  C CE2 . TYR A 1 107 ? 27.341 36.475 36.514 1.00 46.75  ? 392 TYR A CE2 1 
ATOM   738  C CZ  . TYR A 1 107 ? 28.265 37.439 36.182 1.00 48.33  ? 392 TYR A CZ  1 
ATOM   739  O OH  . TYR A 1 107 ? 28.334 38.608 36.904 1.00 50.42  ? 392 TYR A OH  1 
ATOM   740  N N   . ARG A 1 108 ? 29.272 31.500 36.058 1.00 47.46  ? 393 ARG A N   1 
ATOM   741  C CA  . ARG A 1 108 ? 29.437 31.054 37.430 1.00 48.69  ? 393 ARG A CA  1 
ATOM   742  C C   . ARG A 1 108 ? 30.914 30.756 37.740 1.00 49.05  ? 393 ARG A C   1 
ATOM   743  O O   . ARG A 1 108 ? 31.381 31.048 38.814 1.00 48.93  ? 393 ARG A O   1 
ATOM   744  C CB  . ARG A 1 108 ? 28.570 29.817 37.645 1.00 49.20  ? 393 ARG A CB  1 
ATOM   745  C CG  . ARG A 1 108 ? 28.546 29.262 39.035 1.00 49.01  ? 393 ARG A CG  1 
ATOM   746  C CD  . ARG A 1 108 ? 27.156 28.702 39.334 1.00 51.89  ? 393 ARG A CD  1 
ATOM   747  N NE  . ARG A 1 108 ? 26.625 27.905 38.230 1.00 52.02  ? 393 ARG A NE  1 
ATOM   748  C CZ  . ARG A 1 108 ? 25.426 28.091 37.688 1.00 52.66  ? 393 ARG A CZ  1 
ATOM   749  N NH1 . ARG A 1 108 ? 24.637 29.048 38.155 1.00 53.91  ? 393 ARG A NH1 1 
ATOM   750  N NH2 . ARG A 1 108 ? 25.018 27.327 36.678 1.00 52.54  ? 393 ARG A NH2 1 
ATOM   751  N N   . GLN A 1 109 ? 31.642 30.182 36.786 1.00 49.14  ? 394 GLN A N   1 
ATOM   752  C CA  . GLN A 1 109 ? 33.061 29.885 36.988 1.00 48.85  ? 394 GLN A CA  1 
ATOM   753  C C   . GLN A 1 109 ? 33.866 31.176 37.052 1.00 51.49  ? 394 GLN A C   1 
ATOM   754  O O   . GLN A 1 109 ? 34.815 31.278 37.796 1.00 52.42  ? 394 GLN A O   1 
ATOM   755  C CB  . GLN A 1 109 ? 33.624 29.025 35.848 1.00 46.53  ? 394 GLN A CB  1 
ATOM   756  C CG  . GLN A 1 109 ? 32.878 27.744 35.596 1.00 47.08  ? 394 GLN A CG  1 
ATOM   757  C CD  . GLN A 1 109 ? 32.551 27.012 36.876 1.00 49.57  ? 394 GLN A CD  1 
ATOM   758  O OE1 . GLN A 1 109 ? 33.434 26.601 37.601 1.00 49.66  ? 394 GLN A OE1 1 
ATOM   759  N NE2 . GLN A 1 109 ? 31.261 26.857 37.159 1.00 51.43  ? 394 GLN A NE2 1 
ATOM   760  N N   . VAL A 1 110 ? 33.485 32.163 36.247 1.00 54.03  ? 395 VAL A N   1 
ATOM   761  C CA  . VAL A 1 110 ? 34.202 33.431 36.230 1.00 55.61  ? 395 VAL A CA  1 
ATOM   762  C C   . VAL A 1 110 ? 34.008 34.182 37.549 1.00 58.01  ? 395 VAL A C   1 
ATOM   763  O O   . VAL A 1 110 ? 34.969 34.586 38.208 1.00 57.48  ? 395 VAL A O   1 
ATOM   764  C CB  . VAL A 1 110 ? 33.727 34.314 35.063 1.00 53.73  ? 395 VAL A CB  1 
ATOM   765  C CG1 . VAL A 1 110 ? 34.465 35.636 35.088 1.00 52.48  ? 395 VAL A CG1 1 
ATOM   766  C CG2 . VAL A 1 110 ? 33.974 33.604 33.741 1.00 52.29  ? 395 VAL A CG2 1 
ATOM   767  N N   . VAL A 1 111 ? 32.751 34.354 37.933 1.00 60.04  ? 396 VAL A N   1 
ATOM   768  C CA  . VAL A 1 111 ? 32.424 35.044 39.167 1.00 61.36  ? 396 VAL A CA  1 
ATOM   769  C C   . VAL A 1 111 ? 32.849 34.302 40.439 1.00 63.32  ? 396 VAL A C   1 
ATOM   770  O O   . VAL A 1 111 ? 33.392 34.911 41.336 1.00 63.90  ? 396 VAL A O   1 
ATOM   771  C CB  . VAL A 1 111 ? 30.914 35.349 39.226 1.00 59.08  ? 396 VAL A CB  1 
ATOM   772  C CG1 . VAL A 1 111 ? 30.517 35.806 40.607 1.00 57.86  ? 396 VAL A CG1 1 
ATOM   773  C CG2 . VAL A 1 111 ? 30.588 36.421 38.221 1.00 58.77  ? 396 VAL A CG2 1 
ATOM   774  N N   . HIS A 1 112 ? 32.627 32.990 40.503 1.00 65.41  ? 397 HIS A N   1 
ATOM   775  C CA  . HIS A 1 112 ? 32.977 32.223 41.702 1.00 68.80  ? 397 HIS A CA  1 
ATOM   776  C C   . HIS A 1 112 ? 34.097 31.192 41.559 1.00 70.91  ? 397 HIS A C   1 
ATOM   777  O O   . HIS A 1 112 ? 34.854 30.974 42.492 1.00 70.54  ? 397 HIS A O   1 
ATOM   778  C CB  . HIS A 1 112 ? 31.732 31.515 42.242 1.00 70.69  ? 397 HIS A CB  1 
ATOM   779  C CG  . HIS A 1 112 ? 30.560 32.424 42.438 1.00 72.58  ? 397 HIS A CG  1 
ATOM   780  N ND1 . HIS A 1 112 ? 30.526 33.393 43.419 1.00 74.27  ? 397 HIS A ND1 1 
ATOM   781  C CD2 . HIS A 1 112 ? 29.402 32.543 41.752 1.00 73.59  ? 397 HIS A CD2 1 
ATOM   782  C CE1 . HIS A 1 112 ? 29.397 34.070 43.325 1.00 74.18  ? 397 HIS A CE1 1 
ATOM   783  N NE2 . HIS A 1 112 ? 28.695 33.577 42.322 1.00 74.56  ? 397 HIS A NE2 1 
ATOM   784  N N   . GLY A 1 113 ? 34.178 30.549 40.397 1.00 74.28  ? 398 GLY A N   1 
ATOM   785  C CA  . GLY A 1 113 ? 35.194 29.536 40.159 1.00 77.23  ? 398 GLY A CA  1 
ATOM   786  C C   . GLY A 1 113 ? 36.598 29.958 40.538 1.00 79.72  ? 398 GLY A C   1 
ATOM   787  O O   . GLY A 1 113 ? 36.835 31.106 40.869 1.00 78.98  ? 398 GLY A O   1 
ATOM   788  N N   . LYS A 1 114 ? 37.536 29.019 40.483 1.00 83.35  ? 399 LYS A N   1 
ATOM   789  C CA  . LYS A 1 114 ? 38.923 29.314 40.833 1.00 86.29  ? 399 LYS A CA  1 
ATOM   790  C C   . LYS A 1 114 ? 39.945 28.571 39.963 1.00 87.88  ? 399 LYS A C   1 
ATOM   791  O O   . LYS A 1 114 ? 39.968 28.720 38.738 1.00 87.98  ? 399 LYS A O   1 
ATOM   792  C CB  . LYS A 1 114 ? 39.164 28.993 42.321 1.00 85.26  ? 399 LYS A CB  1 
ATOM   793  N N   . GLU A 1 115 ? 40.794 27.779 40.611 1.00 89.27  ? 400 GLU A N   1 
ATOM   794  C CA  . GLU A 1 115 ? 41.827 27.029 39.909 1.00 90.08  ? 400 GLU A CA  1 
ATOM   795  C C   . GLU A 1 115 ? 41.655 25.554 40.217 1.00 88.41  ? 400 GLU A C   1 
ATOM   796  O O   . GLU A 1 115 ? 41.595 25.161 41.385 1.00 88.37  ? 400 GLU A O   1 
ATOM   797  C CB  . GLU A 1 115 ? 43.223 27.484 40.355 1.00 93.44  ? 400 GLU A CB  1 
ATOM   798  C CG  . GLU A 1 115 ? 43.532 28.960 40.111 1.00 97.01  ? 400 GLU A CG  1 
ATOM   799  C CD  . GLU A 1 115 ? 42.726 29.892 41.008 1.00 99.83  ? 400 GLU A CD  1 
ATOM   800  O OE1 . GLU A 1 115 ? 42.821 29.753 42.250 1.00 100.92 ? 400 GLU A OE1 1 
ATOM   801  O OE2 . GLU A 1 115 ? 41.998 30.759 40.468 1.00 100.45 ? 400 GLU A OE2 1 
ATOM   802  N N   . GLY A 1 116 ? 41.577 24.742 39.167 1.00 86.52  ? 401 GLY A N   1 
ATOM   803  C CA  . GLY A 1 116 ? 41.399 23.313 39.351 1.00 83.05  ? 401 GLY A CA  1 
ATOM   804  C C   . GLY A 1 116 ? 40.237 23.013 40.284 1.00 80.44  ? 401 GLY A C   1 
ATOM   805  O O   . GLY A 1 116 ? 40.358 22.202 41.190 1.00 79.58  ? 401 GLY A O   1 
ATOM   806  N N   . SER A 1 117 ? 39.113 23.690 40.059 1.00 77.72  ? 402 SER A N   1 
ATOM   807  C CA  . SER A 1 117 ? 37.913 23.511 40.872 1.00 73.40  ? 402 SER A CA  1 
ATOM   808  C C   . SER A 1 117 ? 36.697 24.118 40.179 1.00 69.31  ? 402 SER A C   1 
ATOM   809  O O   . SER A 1 117 ? 36.673 25.307 39.851 1.00 71.17  ? 402 SER A O   1 
ATOM   810  C CB  . SER A 1 117 ? 38.093 24.148 42.255 1.00 73.37  ? 402 SER A CB  1 
ATOM   811  O OG  . SER A 1 117 ? 38.324 25.542 42.150 1.00 75.68  ? 402 SER A OG  1 
ATOM   812  N N   . ILE A 1 118 ? 35.694 23.275 39.963 1.00 63.30  ? 403 ILE A N   1 
ATOM   813  C CA  . ILE A 1 118 ? 34.448 23.658 39.319 1.00 55.87  ? 403 ILE A CA  1 
ATOM   814  C C   . ILE A 1 118 ? 33.412 24.067 40.366 1.00 54.49  ? 403 ILE A C   1 
ATOM   815  O O   . ILE A 1 118 ? 33.158 23.344 41.302 1.00 56.24  ? 403 ILE A O   1 
ATOM   816  C CB  . ILE A 1 118 ? 33.900 22.479 38.519 1.00 52.75  ? 403 ILE A CB  1 
ATOM   817  C CG1 . ILE A 1 118 ? 34.983 21.964 37.578 1.00 49.29  ? 403 ILE A CG1 1 
ATOM   818  C CG2 . ILE A 1 118 ? 32.650 22.885 37.767 1.00 50.25  ? 403 ILE A CG2 1 
ATOM   819  C CD1 . ILE A 1 118 ? 34.598 20.698 36.855 1.00 53.03  ? 403 ILE A CD1 1 
ATOM   820  N N   . PHE A 1 119 ? 32.824 25.241 40.197 1.00 53.24  ? 404 PHE A N   1 
ATOM   821  C CA  . PHE A 1 119 ? 31.804 25.740 41.109 1.00 50.95  ? 404 PHE A CA  1 
ATOM   822  C C   . PHE A 1 119 ? 30.433 25.295 40.589 1.00 50.81  ? 404 PHE A C   1 
ATOM   823  O O   . PHE A 1 119 ? 29.984 25.759 39.561 1.00 50.59  ? 404 PHE A O   1 
ATOM   824  C CB  . PHE A 1 119 ? 31.872 27.259 41.144 1.00 52.17  ? 404 PHE A CB  1 
ATOM   825  C CG  . PHE A 1 119 ? 31.040 27.886 42.216 1.00 55.96  ? 404 PHE A CG  1 
ATOM   826  C CD1 . PHE A 1 119 ? 31.601 28.217 43.441 1.00 59.11  ? 404 PHE A CD1 1 
ATOM   827  C CD2 . PHE A 1 119 ? 29.703 28.185 41.993 1.00 57.18  ? 404 PHE A CD2 1 
ATOM   828  C CE1 . PHE A 1 119 ? 30.839 28.843 44.421 1.00 60.06  ? 404 PHE A CE1 1 
ATOM   829  C CE2 . PHE A 1 119 ? 28.938 28.808 42.964 1.00 57.99  ? 404 PHE A CE2 1 
ATOM   830  C CZ  . PHE A 1 119 ? 29.505 29.138 44.177 1.00 59.23  ? 404 PHE A CZ  1 
ATOM   831  N N   . LEU A 1 120 ? 29.776 24.392 41.308 1.00 50.30  ? 405 LEU A N   1 
ATOM   832  C CA  . LEU A 1 120 ? 28.467 23.892 40.906 1.00 48.82  ? 405 LEU A CA  1 
ATOM   833  C C   . LEU A 1 120 ? 27.349 24.915 41.171 1.00 49.23  ? 405 LEU A C   1 
ATOM   834  O O   . LEU A 1 120 ? 27.546 25.856 41.899 1.00 49.53  ? 405 LEU A O   1 
ATOM   835  C CB  . LEU A 1 120 ? 28.166 22.614 41.667 1.00 47.85  ? 405 LEU A CB  1 
ATOM   836  C CG  . LEU A 1 120 ? 29.266 21.569 41.695 1.00 49.01  ? 405 LEU A CG  1 
ATOM   837  C CD1 . LEU A 1 120 ? 28.808 20.420 42.572 1.00 51.09  ? 405 LEU A CD1 1 
ATOM   838  C CD2 . LEU A 1 120 ? 29.558 21.074 40.294 1.00 47.94  ? 405 LEU A CD2 1 
ATOM   839  N N   . VAL A 1 121 ? 26.171 24.707 40.577 1.00 49.28  ? 406 VAL A N   1 
ATOM   840  C CA  . VAL A 1 121 ? 25.034 25.619 40.765 1.00 48.79  ? 406 VAL A CA  1 
ATOM   841  C C   . VAL A 1 121 ? 24.492 25.581 42.207 1.00 50.26  ? 406 VAL A C   1 
ATOM   842  O O   . VAL A 1 121 ? 23.920 26.572 42.702 1.00 49.30  ? 406 VAL A O   1 
ATOM   843  C CB  . VAL A 1 121 ? 23.869 25.293 39.766 1.00 46.86  ? 406 VAL A CB  1 
ATOM   844  C CG1 . VAL A 1 121 ? 23.255 23.949 40.084 1.00 45.73  ? 406 VAL A CG1 1 
ATOM   845  C CG2 . VAL A 1 121 ? 22.815 26.377 39.807 1.00 43.70  ? 406 VAL A CG2 1 
ATOM   846  N N   . THR A 1 122 ? 24.684 24.450 42.885 1.00 50.05  ? 407 THR A N   1 
ATOM   847  C CA  . THR A 1 122 ? 24.220 24.306 44.256 1.00 51.04  ? 407 THR A CA  1 
ATOM   848  C C   . THR A 1 122 ? 25.058 25.096 45.269 1.00 53.42  ? 407 THR A C   1 
ATOM   849  O O   . THR A 1 122 ? 24.713 25.154 46.444 1.00 54.89  ? 407 THR A O   1 
ATOM   850  C CB  . THR A 1 122 ? 24.176 22.835 44.657 1.00 47.90  ? 407 THR A CB  1 
ATOM   851  O OG1 . THR A 1 122 ? 25.393 22.200 44.270 1.00 47.70  ? 407 THR A OG1 1 
ATOM   852  C CG2 . THR A 1 122 ? 23.034 22.140 43.966 1.00 47.25  ? 407 THR A CG2 1 
ATOM   853  N N   . GLY A 1 123 ? 26.150 25.707 44.811 1.00 53.61  ? 408 GLY A N   1 
ATOM   854  C CA  . GLY A 1 123 ? 26.981 26.506 45.695 1.00 53.98  ? 408 GLY A CA  1 
ATOM   855  C C   . GLY A 1 123 ? 28.320 25.957 46.168 1.00 55.57  ? 408 GLY A C   1 
ATOM   856  O O   . GLY A 1 123 ? 29.038 26.660 46.868 1.00 55.36  ? 408 GLY A O   1 
ATOM   857  N N   . GLN A 1 124 ? 28.678 24.732 45.787 1.00 55.84  ? 409 GLN A N   1 
ATOM   858  C CA  . GLN A 1 124 ? 29.942 24.152 46.245 1.00 57.72  ? 409 GLN A CA  1 
ATOM   859  C C   . GLN A 1 124 ? 31.043 24.029 45.205 1.00 58.84  ? 409 GLN A C   1 
ATOM   860  O O   . GLN A 1 124 ? 30.781 23.781 44.027 1.00 60.15  ? 409 GLN A O   1 
ATOM   861  C CB  . GLN A 1 124 ? 29.724 22.754 46.840 1.00 57.69  ? 409 GLN A CB  1 
ATOM   862  C CG  . GLN A 1 124 ? 28.605 22.635 47.855 1.00 57.54  ? 409 GLN A CG  1 
ATOM   863  C CD  . GLN A 1 124 ? 27.272 22.305 47.216 1.00 57.52  ? 409 GLN A CD  1 
ATOM   864  O OE1 . GLN A 1 124 ? 27.162 21.374 46.437 1.00 58.06  ? 409 GLN A OE1 1 
ATOM   865  N NE2 . GLN A 1 124 ? 26.247 23.070 47.561 1.00 58.45  ? 409 GLN A NE2 1 
ATOM   866  N N   . GLN A 1 125 ? 32.280 24.183 45.668 1.00 60.56  ? 410 GLN A N   1 
ATOM   867  C CA  . GLN A 1 125 ? 33.461 24.055 44.823 1.00 62.51  ? 410 GLN A CA  1 
ATOM   868  C C   . GLN A 1 125 ? 33.783 22.574 44.784 1.00 63.29  ? 410 GLN A C   1 
ATOM   869  O O   . GLN A 1 125 ? 33.466 21.850 45.707 1.00 64.58  ? 410 GLN A O   1 
ATOM   870  C CB  . GLN A 1 125 ? 34.648 24.806 45.428 1.00 64.46  ? 410 GLN A CB  1 
ATOM   871  C CG  . GLN A 1 125 ? 34.527 26.318 45.415 1.00 67.70  ? 410 GLN A CG  1 
ATOM   872  C CD  . GLN A 1 125 ? 34.925 26.928 44.089 1.00 70.21  ? 410 GLN A CD  1 
ATOM   873  O OE1 . GLN A 1 125 ? 34.732 28.116 43.863 1.00 71.70  ? 410 GLN A OE1 1 
ATOM   874  N NE2 . GLN A 1 125 ? 35.495 26.114 43.206 1.00 71.69  ? 410 GLN A NE2 1 
ATOM   875  N N   . VAL A 1 126 ? 34.422 22.136 43.712 1.00 63.53  ? 411 VAL A N   1 
ATOM   876  C CA  . VAL A 1 126 ? 34.782 20.733 43.553 1.00 63.82  ? 411 VAL A CA  1 
ATOM   877  C C   . VAL A 1 126 ? 36.064 20.668 42.734 1.00 64.43  ? 411 VAL A C   1 
ATOM   878  O O   . VAL A 1 126 ? 36.040 20.937 41.546 1.00 64.91  ? 411 VAL A O   1 
ATOM   879  C CB  . VAL A 1 126 ? 33.674 19.965 42.793 1.00 63.41  ? 411 VAL A CB  1 
ATOM   880  C CG1 . VAL A 1 126 ? 34.130 18.553 42.482 1.00 62.15  ? 411 VAL A CG1 1 
ATOM   881  C CG2 . VAL A 1 126 ? 32.402 19.952 43.609 1.00 62.23  ? 411 VAL A CG2 1 
ATOM   882  N N   . ASP A 1 127 ? 37.181 20.316 43.365 1.00 64.71  ? 412 ASP A N   1 
ATOM   883  C CA  . ASP A 1 127 ? 38.440 20.235 42.628 1.00 64.06  ? 412 ASP A CA  1 
ATOM   884  C C   . ASP A 1 127 ? 38.208 19.487 41.316 1.00 61.87  ? 412 ASP A C   1 
ATOM   885  O O   . ASP A 1 127 ? 37.481 18.490 41.274 1.00 59.74  ? 412 ASP A O   1 
ATOM   886  C CB  . ASP A 1 127 ? 39.528 19.506 43.445 1.00 66.56  ? 412 ASP A CB  1 
ATOM   887  C CG  . ASP A 1 127 ? 40.936 19.632 42.813 1.00 68.29  ? 412 ASP A CG  1 
ATOM   888  O OD1 . ASP A 1 127 ? 41.532 20.736 42.894 1.00 69.62  ? 412 ASP A OD1 1 
ATOM   889  O OD2 . ASP A 1 127 ? 41.444 18.637 42.233 1.00 64.96  ? 412 ASP A OD2 1 
ATOM   890  N N   . TYR A 1 128 ? 38.829 19.996 40.255 1.00 60.10  ? 413 TYR A N   1 
ATOM   891  C CA  . TYR A 1 128 ? 38.747 19.425 38.917 1.00 60.67  ? 413 TYR A CA  1 
ATOM   892  C C   . TYR A 1 128 ? 39.053 17.921 38.864 1.00 59.22  ? 413 TYR A C   1 
ATOM   893  O O   . TYR A 1 128 ? 38.465 17.215 38.093 1.00 58.14  ? 413 TYR A O   1 
ATOM   894  C CB  . TYR A 1 128 ? 39.711 20.178 37.992 1.00 63.67  ? 413 TYR A CB  1 
ATOM   895  C CG  . TYR A 1 128 ? 39.759 19.647 36.580 1.00 68.47  ? 413 TYR A CG  1 
ATOM   896  C CD1 . TYR A 1 128 ? 38.700 19.853 35.702 1.00 72.14  ? 413 TYR A CD1 1 
ATOM   897  C CD2 . TYR A 1 128 ? 40.840 18.896 36.134 1.00 71.13  ? 413 TYR A CD2 1 
ATOM   898  C CE1 . TYR A 1 128 ? 38.713 19.319 34.414 1.00 74.95  ? 413 TYR A CE1 1 
ATOM   899  C CE2 . TYR A 1 128 ? 40.864 18.352 34.849 1.00 73.80  ? 413 TYR A CE2 1 
ATOM   900  C CZ  . TYR A 1 128 ? 39.796 18.564 33.993 1.00 75.78  ? 413 TYR A CZ  1 
ATOM   901  O OH  . TYR A 1 128 ? 39.791 17.993 32.731 1.00 77.93  ? 413 TYR A OH  1 
ATOM   902  N N   . SER A 1 129 ? 39.989 17.457 39.691 1.00 60.36  ? 414 SER A N   1 
ATOM   903  C CA  . SER A 1 129 ? 40.394 16.045 39.748 1.00 60.79  ? 414 SER A CA  1 
ATOM   904  C C   . SER A 1 129 ? 39.275 15.067 40.103 1.00 61.37  ? 414 SER A C   1 
ATOM   905  O O   . SER A 1 129 ? 39.324 13.907 39.731 1.00 59.22  ? 414 SER A O   1 
ATOM   906  C CB  . SER A 1 129 ? 41.521 15.871 40.760 1.00 61.13  ? 414 SER A CB  1 
ATOM   907  O OG  . SER A 1 129 ? 41.068 16.174 42.068 1.00 60.98  ? 414 SER A OG  1 
ATOM   908  N N   . ILE A 1 130 ? 38.288 15.545 40.853 1.00 64.39  ? 415 ILE A N   1 
ATOM   909  C CA  . ILE A 1 130 ? 37.141 14.734 41.249 1.00 68.24  ? 415 ILE A CA  1 
ATOM   910  C C   . ILE A 1 130 ? 36.275 14.464 40.020 1.00 70.32  ? 415 ILE A C   1 
ATOM   911  O O   . ILE A 1 130 ? 35.561 13.471 39.959 1.00 70.85  ? 415 ILE A O   1 
ATOM   912  C CB  . ILE A 1 130 ? 36.306 15.472 42.305 1.00 70.01  ? 415 ILE A CB  1 
ATOM   913  C CG1 . ILE A 1 130 ? 37.191 15.789 43.517 1.00 71.44  ? 415 ILE A CG1 1 
ATOM   914  C CG2 . ILE A 1 130 ? 35.099 14.632 42.698 1.00 69.45  ? 415 ILE A CG2 1 
ATOM   915  C CD1 . ILE A 1 130 ? 36.699 16.941 44.380 1.00 73.35  ? 415 ILE A CD1 1 
ATOM   916  N N   . ILE A 1 131 ? 36.358 15.373 39.051 1.00 72.64  ? 416 ILE A N   1 
ATOM   917  C CA  . ILE A 1 131 ? 35.635 15.290 37.787 1.00 75.64  ? 416 ILE A CA  1 
ATOM   918  C C   . ILE A 1 131 ? 36.509 14.565 36.760 1.00 78.81  ? 416 ILE A C   1 
ATOM   919  O O   . ILE A 1 131 ? 36.073 13.628 36.100 1.00 79.60  ? 416 ILE A O   1 
ATOM   920  C CB  . ILE A 1 131 ? 35.363 16.679 37.207 1.00 75.93  ? 416 ILE A CB  1 
ATOM   921  C CG1 . ILE A 1 131 ? 34.804 17.617 38.287 1.00 75.96  ? 416 ILE A CG1 1 
ATOM   922  C CG2 . ILE A 1 131 ? 34.481 16.543 35.986 1.00 74.65  ? 416 ILE A CG2 1 
ATOM   923  C CD1 . ILE A 1 131 ? 33.545 17.138 38.986 1.00 76.60  ? 416 ILE A CD1 1 
ATOM   924  N N   . ALA A 1 132 ? 37.745 15.042 36.627 1.00 81.74  ? 417 ALA A N   1 
ATOM   925  C CA  . ALA A 1 132 ? 38.730 14.489 35.704 1.00 84.39  ? 417 ALA A CA  1 
ATOM   926  C C   . ALA A 1 132 ? 38.950 12.995 35.911 1.00 86.38  ? 417 ALA A C   1 
ATOM   927  O O   . ALA A 1 132 ? 38.945 12.230 34.954 1.00 87.60  ? 417 ALA A O   1 
ATOM   928  C CB  . ALA A 1 132 ? 40.056 15.223 35.865 1.00 84.01  ? 417 ALA A CB  1 
ATOM   929  N N   . SER A 1 133 ? 39.155 12.589 37.163 1.00 88.07  ? 418 SER A N   1 
ATOM   930  C CA  . SER A 1 133 ? 39.382 11.183 37.490 1.00 88.95  ? 418 SER A CA  1 
ATOM   931  C C   . SER A 1 133 ? 38.528 10.225 36.648 1.00 89.04  ? 418 SER A C   1 
ATOM   932  O O   . SER A 1 133 ? 39.060 9.361  35.958 1.00 90.05  ? 418 SER A O   1 
ATOM   933  C CB  . SER A 1 133 ? 39.134 10.934 38.990 1.00 90.15  ? 418 SER A CB  1 
ATOM   934  O OG  . SER A 1 133 ? 37.826 11.313 39.395 1.00 91.56  ? 418 SER A OG  1 
ATOM   935  N N   . GLN A 1 134 ? 37.210 10.393 36.687 1.00 88.37  ? 419 GLN A N   1 
ATOM   936  C CA  . GLN A 1 134 ? 36.316 9.520  35.933 1.00 87.26  ? 419 GLN A CA  1 
ATOM   937  C C   . GLN A 1 134 ? 35.626 10.178 34.735 1.00 85.58  ? 419 GLN A C   1 
ATOM   938  O O   . GLN A 1 134 ? 34.407 10.254 34.685 1.00 87.00  ? 419 GLN A O   1 
ATOM   939  C CB  . GLN A 1 134 ? 35.262 8.936  36.879 1.00 89.74  ? 419 GLN A CB  1 
ATOM   940  C CG  . GLN A 1 134 ? 34.628 9.952  37.832 1.00 92.00  ? 419 GLN A CG  1 
ATOM   941  C CD  . GLN A 1 134 ? 33.620 9.308  38.770 1.00 94.10  ? 419 GLN A CD  1 
ATOM   942  O OE1 . GLN A 1 134 ? 33.902 8.286  39.397 1.00 95.34  ? 419 GLN A OE1 1 
ATOM   943  N NE2 . GLN A 1 134 ? 32.439 9.908  38.873 1.00 93.92  ? 419 GLN A NE2 1 
ATOM   944  N N   . ALA A 1 135 ? 36.406 10.636 33.761 1.00 81.93  ? 420 ALA A N   1 
ATOM   945  C CA  . ALA A 1 135 ? 35.830 11.277 32.585 1.00 77.50  ? 420 ALA A CA  1 
ATOM   946  C C   . ALA A 1 135 ? 36.333 10.644 31.292 1.00 75.69  ? 420 ALA A C   1 
ATOM   947  O O   . ALA A 1 135 ? 37.515 10.355 31.152 1.00 75.79  ? 420 ALA A O   1 
ATOM   948  C CB  . ALA A 1 135 ? 36.144 12.762 32.599 1.00 77.38  ? 420 ALA A CB  1 
ATOM   949  N N   . GLY A 1 136 ? 35.417 10.435 30.350 1.00 72.90  ? 421 GLY A N   1 
ATOM   950  C CA  . GLY A 1 136 ? 35.769 9.838  29.077 1.00 69.24  ? 421 GLY A CA  1 
ATOM   951  C C   . GLY A 1 136 ? 36.223 10.846 28.035 1.00 68.19  ? 421 GLY A C   1 
ATOM   952  O O   . GLY A 1 136 ? 36.348 12.033 28.325 1.00 66.70  ? 421 GLY A O   1 
ATOM   953  N N   . ALA A 1 137 ? 36.447 10.359 26.812 1.00 67.12  ? 422 ALA A N   1 
ATOM   954  C CA  . ALA A 1 137 ? 36.918 11.178 25.688 1.00 64.88  ? 422 ALA A CA  1 
ATOM   955  C C   . ALA A 1 137 ? 36.003 12.336 25.292 1.00 63.10  ? 422 ALA A C   1 
ATOM   956  O O   . ALA A 1 137 ? 36.458 13.475 25.171 1.00 62.66  ? 422 ALA A O   1 
ATOM   957  C CB  . ALA A 1 137 ? 37.180 10.288 24.474 1.00 62.65  ? 422 ALA A CB  1 
ATOM   958  N N   . THR A 1 138 ? 34.725 12.039 25.081 1.00 60.18  ? 423 THR A N   1 
ATOM   959  C CA  . THR A 1 138 ? 33.752 13.057 24.699 1.00 57.99  ? 423 THR A CA  1 
ATOM   960  C C   . THR A 1 138 ? 33.654 14.169 25.758 1.00 56.77  ? 423 THR A C   1 
ATOM   961  O O   . THR A 1 138 ? 33.810 15.357 25.458 1.00 55.23  ? 423 THR A O   1 
ATOM   962  C CB  . THR A 1 138 ? 32.358 12.425 24.499 1.00 58.56  ? 423 THR A CB  1 
ATOM   963  O OG1 . THR A 1 138 ? 32.452 11.354 23.550 1.00 59.76  ? 423 THR A OG1 1 
ATOM   964  C CG2 . THR A 1 138 ? 31.358 13.465 24.003 1.00 57.08  ? 423 THR A CG2 1 
ATOM   965  N N   . LEU A 1 139 ? 33.402 13.771 26.998 1.00 54.93  ? 424 LEU A N   1 
ATOM   966  C CA  . LEU A 1 139 ? 33.286 14.718 28.094 1.00 53.82  ? 424 LEU A CA  1 
ATOM   967  C C   . LEU A 1 139 ? 34.562 15.512 28.295 1.00 53.69  ? 424 LEU A C   1 
ATOM   968  O O   . LEU A 1 139 ? 34.510 16.634 28.736 1.00 55.70  ? 424 LEU A O   1 
ATOM   969  C CB  . LEU A 1 139 ? 32.932 13.990 29.396 1.00 53.53  ? 424 LEU A CB  1 
ATOM   970  C CG  . LEU A 1 139 ? 32.839 14.873 30.644 1.00 51.60  ? 424 LEU A CG  1 
ATOM   971  C CD1 . LEU A 1 139 ? 31.840 16.012 30.409 1.00 50.49  ? 424 LEU A CD1 1 
ATOM   972  C CD2 . LEU A 1 139 ? 32.414 14.038 31.817 1.00 48.34  ? 424 LEU A CD2 1 
ATOM   973  N N   . ASN A 1 140 ? 35.707 14.915 27.977 1.00 53.68  ? 425 ASN A N   1 
ATOM   974  C CA  . ASN A 1 140 ? 36.983 15.606 28.137 1.00 52.91  ? 425 ASN A CA  1 
ATOM   975  C C   . ASN A 1 140 ? 37.138 16.770 27.183 1.00 52.23  ? 425 ASN A C   1 
ATOM   976  O O   . ASN A 1 140 ? 37.580 17.830 27.596 1.00 51.34  ? 425 ASN A O   1 
ATOM   977  C CB  . ASN A 1 140 ? 38.157 14.646 27.949 1.00 52.92  ? 425 ASN A CB  1 
ATOM   978  C CG  . ASN A 1 140 ? 38.545 13.961 29.229 1.00 53.76  ? 425 ASN A CG  1 
ATOM   979  O OD1 . ASN A 1 140 ? 38.663 14.602 30.270 1.00 53.80  ? 425 ASN A OD1 1 
ATOM   980  N ND2 . ASN A 1 140 ? 38.763 12.650 29.161 1.00 54.89  ? 425 ASN A ND2 1 
ATOM   981  N N   . ASN A 1 141 ? 36.796 16.556 25.909 1.00 53.09  ? 426 ASN A N   1 
ATOM   982  C CA  . ASN A 1 141 ? 36.882 17.610 24.889 1.00 53.90  ? 426 ASN A CA  1 
ATOM   983  C C   . ASN A 1 141 ? 35.970 18.772 25.290 1.00 52.23  ? 426 ASN A C   1 
ATOM   984  O O   . ASN A 1 141 ? 36.342 19.927 25.211 1.00 51.23  ? 426 ASN A O   1 
ATOM   985  C CB  . ASN A 1 141 ? 36.426 17.089 23.526 1.00 56.03  ? 426 ASN A CB  1 
ATOM   986  C CG  . ASN A 1 141 ? 37.283 15.954 23.016 1.00 61.94  ? 426 ASN A CG  1 
ATOM   987  O OD1 . ASN A 1 141 ? 38.501 16.086 22.916 1.00 64.83  ? 426 ASN A OD1 1 
ATOM   988  N ND2 . ASN A 1 141 ? 36.648 14.828 22.674 1.00 62.62  ? 426 ASN A ND2 1 
ATOM   989  N N   . LEU A 1 142 ? 34.769 18.417 25.727 1.00 50.03  ? 427 LEU A N   1 
ATOM   990  C CA  . LEU A 1 142 ? 33.753 19.361 26.147 1.00 49.06  ? 427 LEU A CA  1 
ATOM   991  C C   . LEU A 1 142 ? 34.206 20.193 27.356 1.00 48.40  ? 427 LEU A C   1 
ATOM   992  O O   . LEU A 1 142 ? 34.128 21.413 27.345 1.00 46.37  ? 427 LEU A O   1 
ATOM   993  C CB  . LEU A 1 142 ? 32.481 18.584 26.474 1.00 47.90  ? 427 LEU A CB  1 
ATOM   994  C CG  . LEU A 1 142 ? 31.246 19.400 26.790 1.00 50.18  ? 427 LEU A CG  1 
ATOM   995  C CD1 . LEU A 1 142 ? 30.694 19.982 25.507 1.00 52.60  ? 427 LEU A CD1 1 
ATOM   996  C CD2 . LEU A 1 142 ? 30.221 18.518 27.450 1.00 52.93  ? 427 LEU A CD2 1 
ATOM   997  N N   . MET A 1 143 ? 34.679 19.526 28.398 1.00 49.15  ? 428 MET A N   1 
ATOM   998  C CA  . MET A 1 143 ? 35.131 20.235 29.586 1.00 53.01  ? 428 MET A CA  1 
ATOM   999  C C   . MET A 1 143 ? 36.330 21.102 29.277 1.00 53.58  ? 428 MET A C   1 
ATOM   1000 O O   . MET A 1 143 ? 36.561 22.107 29.934 1.00 53.82  ? 428 MET A O   1 
ATOM   1001 C CB  . MET A 1 143 ? 35.518 19.263 30.682 1.00 56.67  ? 428 MET A CB  1 
ATOM   1002 C CG  . MET A 1 143 ? 34.418 18.345 31.103 1.00 62.24  ? 428 MET A CG  1 
ATOM   1003 S SD  . MET A 1 143 ? 34.988 17.436 32.517 1.00 72.08  ? 428 MET A SD  1 
ATOM   1004 C CE  . MET A 1 143 ? 36.672 16.877 31.900 1.00 70.49  ? 428 MET A CE  1 
ATOM   1005 N N   . SER A 1 144 ? 37.110 20.692 28.286 1.00 52.72  ? 429 SER A N   1 
ATOM   1006 C CA  . SER A 1 144 ? 38.270 21.466 27.910 1.00 52.92  ? 429 SER A CA  1 
ATOM   1007 C C   . SER A 1 144 ? 37.841 22.711 27.131 1.00 51.87  ? 429 SER A C   1 
ATOM   1008 O O   . SER A 1 144 ? 38.337 23.791 27.384 1.00 50.08  ? 429 SER A O   1 
ATOM   1009 C CB  . SER A 1 144 ? 39.222 20.621 27.068 1.00 52.92  ? 429 SER A CB  1 
ATOM   1010 O OG  . SER A 1 144 ? 40.402 21.353 26.788 1.00 57.18  ? 429 SER A OG  1 
ATOM   1011 N N   . HIS A 1 145 ? 36.908 22.552 26.191 1.00 52.26  ? 430 HIS A N   1 
ATOM   1012 C CA  . HIS A 1 145 ? 36.435 23.689 25.406 1.00 51.72  ? 430 HIS A CA  1 
ATOM   1013 C C   . HIS A 1 145 ? 35.881 24.730 26.371 1.00 51.95  ? 430 HIS A C   1 
ATOM   1014 O O   . HIS A 1 145 ? 36.208 25.891 26.273 1.00 52.62  ? 430 HIS A O   1 
ATOM   1015 C CB  . HIS A 1 145 ? 35.338 23.272 24.422 1.00 53.87  ? 430 HIS A CB  1 
ATOM   1016 C CG  . HIS A 1 145 ? 35.761 22.226 23.439 1.00 56.09  ? 430 HIS A CG  1 
ATOM   1017 N ND1 . HIS A 1 145 ? 37.044 22.149 22.935 1.00 58.59  ? 430 HIS A ND1 1 
ATOM   1018 C CD2 . HIS A 1 145 ? 35.056 21.250 22.822 1.00 56.51  ? 430 HIS A CD2 1 
ATOM   1019 C CE1 . HIS A 1 145 ? 37.107 21.170 22.048 1.00 58.18  ? 430 HIS A CE1 1 
ATOM   1020 N NE2 . HIS A 1 145 ? 35.916 20.609 21.960 1.00 58.62  ? 430 HIS A NE2 1 
ATOM   1021 N N   . ALA A 1 146 ? 35.050 24.289 27.313 1.00 49.71  ? 431 ALA A N   1 
ATOM   1022 C CA  . ALA A 1 146 ? 34.461 25.182 28.301 1.00 49.75  ? 431 ALA A CA  1 
ATOM   1023 C C   . ALA A 1 146 ? 35.532 25.907 29.100 1.00 50.95  ? 431 ALA A C   1 
ATOM   1024 O O   . ALA A 1 146 ? 35.399 27.078 29.414 1.00 51.81  ? 431 ALA A O   1 
ATOM   1025 C CB  . ALA A 1 146 ? 33.564 24.390 29.244 1.00 48.70  ? 431 ALA A CB  1 
ATOM   1026 N N   . GLN A 1 147 ? 36.593 25.188 29.439 1.00 52.28  ? 432 GLN A N   1 
ATOM   1027 C CA  . GLN A 1 147 ? 37.692 25.752 30.202 1.00 54.29  ? 432 GLN A CA  1 
ATOM   1028 C C   . GLN A 1 147 ? 38.300 26.921 29.439 1.00 55.11  ? 432 GLN A C   1 
ATOM   1029 O O   . GLN A 1 147 ? 38.489 28.023 29.984 1.00 55.19  ? 432 GLN A O   1 
ATOM   1030 C CB  . GLN A 1 147 ? 38.745 24.680 30.447 1.00 56.11  ? 432 GLN A CB  1 
ATOM   1031 N N   . GLU A 1 148 ? 38.607 26.668 28.174 1.00 54.43  ? 433 GLU A N   1 
ATOM   1032 C CA  . GLU A 1 148 ? 39.188 27.673 27.299 1.00 56.68  ? 433 GLU A CA  1 
ATOM   1033 C C   . GLU A 1 148 ? 38.329 28.937 27.299 1.00 54.32  ? 433 GLU A C   1 
ATOM   1034 O O   . GLU A 1 148 ? 38.842 30.036 27.408 1.00 55.52  ? 433 GLU A O   1 
ATOM   1035 C CB  . GLU A 1 148 ? 39.288 27.112 25.876 1.00 60.47  ? 433 GLU A CB  1 
ATOM   1036 C CG  . GLU A 1 148 ? 40.179 27.911 24.936 1.00 66.71  ? 433 GLU A CG  1 
ATOM   1037 C CD  . GLU A 1 148 ? 40.095 27.421 23.497 1.00 69.27  ? 433 GLU A CD  1 
ATOM   1038 O OE1 . GLU A 1 148 ? 39.046 27.632 22.850 1.00 70.68  ? 433 GLU A OE1 1 
ATOM   1039 O OE2 . GLU A 1 148 ? 41.075 26.817 23.013 1.00 72.07  ? 433 GLU A OE2 1 
ATOM   1040 N N   . LEU A 1 149 ? 37.015 28.755 27.177 1.00 51.68  ? 434 LEU A N   1 
ATOM   1041 C CA  . LEU A 1 149 ? 36.057 29.859 27.152 1.00 47.77  ? 434 LEU A CA  1 
ATOM   1042 C C   . LEU A 1 149 ? 35.982 30.603 28.475 1.00 46.47  ? 434 LEU A C   1 
ATOM   1043 O O   . LEU A 1 149 ? 35.948 31.816 28.498 1.00 45.57  ? 434 LEU A O   1 
ATOM   1044 C CB  . LEU A 1 149 ? 34.669 29.338 26.788 1.00 44.18  ? 434 LEU A CB  1 
ATOM   1045 C CG  . LEU A 1 149 ? 33.515 30.330 26.906 1.00 43.03  ? 434 LEU A CG  1 
ATOM   1046 C CD1 . LEU A 1 149 ? 33.799 31.563 26.050 1.00 39.93  ? 434 LEU A CD1 1 
ATOM   1047 C CD2 . LEU A 1 149 ? 32.223 29.643 26.494 1.00 40.34  ? 434 LEU A CD2 1 
ATOM   1048 N N   . VAL A 1 150 ? 35.941 29.858 29.574 1.00 46.13  ? 435 VAL A N   1 
ATOM   1049 C CA  . VAL A 1 150 ? 35.882 30.462 30.896 1.00 45.13  ? 435 VAL A CA  1 
ATOM   1050 C C   . VAL A 1 150 ? 37.098 31.340 31.121 1.00 45.68  ? 435 VAL A C   1 
ATOM   1051 O O   . VAL A 1 150 ? 36.992 32.416 31.702 1.00 44.55  ? 435 VAL A O   1 
ATOM   1052 C CB  . VAL A 1 150 ? 35.856 29.397 32.010 1.00 44.42  ? 435 VAL A CB  1 
ATOM   1053 C CG1 . VAL A 1 150 ? 35.970 30.076 33.370 1.00 42.02  ? 435 VAL A CG1 1 
ATOM   1054 C CG2 . VAL A 1 150 ? 34.584 28.589 31.927 1.00 41.29  ? 435 VAL A CG2 1 
ATOM   1055 N N   . ALA A 1 151 ? 38.254 30.866 30.657 1.00 48.06  ? 436 ALA A N   1 
ATOM   1056 C CA  . ALA A 1 151 ? 39.517 31.599 30.804 1.00 49.64  ? 436 ALA A CA  1 
ATOM   1057 C C   . ALA A 1 151 ? 39.552 32.834 29.906 1.00 49.51  ? 436 ALA A C   1 
ATOM   1058 O O   . ALA A 1 151 ? 40.003 33.890 30.311 1.00 50.33  ? 436 ALA A O   1 
ATOM   1059 C CB  . ALA A 1 151 ? 40.686 30.681 30.484 1.00 50.58  ? 436 ALA A CB  1 
ATOM   1060 N N   . LYS A 1 152 ? 39.065 32.693 28.682 1.00 49.37  ? 437 LYS A N   1 
ATOM   1061 C CA  . LYS A 1 152 ? 39.037 33.817 27.765 1.00 51.07  ? 437 LYS A CA  1 
ATOM   1062 C C   . LYS A 1 152 ? 38.224 34.954 28.374 1.00 51.06  ? 437 LYS A C   1 
ATOM   1063 O O   . LYS A 1 152 ? 38.567 36.121 28.200 1.00 51.25  ? 437 LYS A O   1 
ATOM   1064 C CB  . LYS A 1 152 ? 38.433 33.391 26.430 1.00 53.98  ? 437 LYS A CB  1 
ATOM   1065 C CG  . LYS A 1 152 ? 38.892 34.223 25.253 1.00 57.56  ? 437 LYS A CG  1 
ATOM   1066 C CD  . LYS A 1 152 ? 38.567 33.508 23.952 1.00 60.42  ? 437 LYS A CD  1 
ATOM   1067 C CE  . LYS A 1 152 ? 39.336 32.190 23.839 1.00 61.42  ? 437 LYS A CE  1 
ATOM   1068 N NZ  . LYS A 1 152 ? 38.919 31.343 22.669 1.00 63.36  ? 437 LYS A NZ  1 
ATOM   1069 N N   . LEU A 1 153 ? 37.154 34.603 29.091 1.00 49.93  ? 438 LEU A N   1 
ATOM   1070 C CA  . LEU A 1 153 ? 36.295 35.586 29.745 1.00 48.85  ? 438 LEU A CA  1 
ATOM   1071 C C   . LEU A 1 153 ? 36.909 36.190 31.020 1.00 49.87  ? 438 LEU A C   1 
ATOM   1072 O O   . LEU A 1 153 ? 36.658 37.361 31.328 1.00 49.90  ? 438 LEU A O   1 
ATOM   1073 C CB  . LEU A 1 153 ? 34.933 34.971 30.042 1.00 46.16  ? 438 LEU A CB  1 
ATOM   1074 C CG  . LEU A 1 153 ? 34.074 34.706 28.804 1.00 46.76  ? 438 LEU A CG  1 
ATOM   1075 C CD1 . LEU A 1 153 ? 32.864 33.823 29.159 1.00 43.24  ? 438 LEU A CD1 1 
ATOM   1076 C CD2 . LEU A 1 153 ? 33.636 36.038 28.215 1.00 45.77  ? 438 LEU A CD2 1 
ATOM   1077 N N   . ARG A 1 154 ? 37.688 35.410 31.772 1.00 50.39  ? 439 ARG A N   1 
ATOM   1078 C CA  . ARG A 1 154 ? 38.359 35.965 32.955 1.00 52.19  ? 439 ARG A CA  1 
ATOM   1079 C C   . ARG A 1 154 ? 39.300 37.024 32.399 1.00 52.97  ? 439 ARG A C   1 
ATOM   1080 O O   . ARG A 1 154 ? 39.402 38.121 32.927 1.00 52.86  ? 439 ARG A O   1 
ATOM   1081 C CB  . ARG A 1 154 ? 39.217 34.926 33.679 1.00 53.55  ? 439 ARG A CB  1 
ATOM   1082 C CG  . ARG A 1 154 ? 38.474 33.821 34.400 1.00 55.35  ? 439 ARG A CG  1 
ATOM   1083 C CD  . ARG A 1 154 ? 39.468 32.956 35.168 1.00 56.61  ? 439 ARG A CD  1 
ATOM   1084 N NE  . ARG A 1 154 ? 38.896 31.691 35.629 1.00 58.12  ? 439 ARG A NE  1 
ATOM   1085 C CZ  . ARG A 1 154 ? 38.013 31.576 36.614 1.00 59.44  ? 439 ARG A CZ  1 
ATOM   1086 N NH1 . ARG A 1 154 ? 37.587 32.655 37.262 1.00 62.35  ? 439 ARG A NH1 1 
ATOM   1087 N NH2 . ARG A 1 154 ? 37.552 30.379 36.951 1.00 59.66  ? 439 ARG A NH2 1 
ATOM   1088 N N   . SER A 1 155 ? 39.986 36.659 31.319 1.00 53.99  ? 440 SER A N   1 
ATOM   1089 C CA  . SER A 1 155 ? 40.920 37.536 30.627 1.00 57.11  ? 440 SER A CA  1 
ATOM   1090 C C   . SER A 1 155 ? 40.324 38.869 30.150 1.00 59.21  ? 440 SER A C   1 
ATOM   1091 O O   . SER A 1 155 ? 41.043 39.857 30.036 1.00 59.47  ? 440 SER A O   1 
ATOM   1092 C CB  . SER A 1 155 ? 41.509 36.805 29.426 1.00 57.40  ? 440 SER A CB  1 
ATOM   1093 O OG  . SER A 1 155 ? 42.120 37.719 28.530 1.00 60.62  ? 440 SER A OG  1 
ATOM   1094 N N   . LEU A 1 156 ? 39.024 38.886 29.848 1.00 60.76  ? 441 LEU A N   1 
ATOM   1095 C CA  . LEU A 1 156 ? 38.350 40.104 29.387 1.00 61.80  ? 441 LEU A CA  1 
ATOM   1096 C C   . LEU A 1 156 ? 37.697 40.847 30.541 1.00 63.34  ? 441 LEU A C   1 
ATOM   1097 O O   . LEU A 1 156 ? 37.128 41.922 30.340 1.00 63.08  ? 441 LEU A O   1 
ATOM   1098 C CB  . LEU A 1 156 ? 37.241 39.786 28.377 1.00 61.16  ? 441 LEU A CB  1 
ATOM   1099 C CG  . LEU A 1 156 ? 37.532 38.997 27.105 1.00 62.37  ? 441 LEU A CG  1 
ATOM   1100 C CD1 . LEU A 1 156 ? 36.225 38.757 26.378 1.00 61.76  ? 441 LEU A CD1 1 
ATOM   1101 C CD2 . LEU A 1 156 ? 38.525 39.740 26.227 1.00 60.91  ? 441 LEU A CD2 1 
ATOM   1102 N N   . GLN A 1 157 ? 37.764 40.276 31.741 1.00 63.02  ? 442 GLN A N   1 
ATOM   1103 C CA  . GLN A 1 157 ? 37.132 40.894 32.899 1.00 64.15  ? 442 GLN A CA  1 
ATOM   1104 C C   . GLN A 1 157 ? 35.639 40.980 32.599 1.00 62.91  ? 442 GLN A C   1 
ATOM   1105 O O   . GLN A 1 157 ? 35.042 42.040 32.677 1.00 64.66  ? 442 GLN A O   1 
ATOM   1106 C CB  . GLN A 1 157 ? 37.664 42.304 33.119 1.00 66.55  ? 442 GLN A CB  1 
ATOM   1107 C CG  . GLN A 1 157 ? 39.158 42.425 33.116 1.00 69.88  ? 442 GLN A CG  1 
ATOM   1108 C CD  . GLN A 1 157 ? 39.581 43.774 32.593 1.00 73.58  ? 442 GLN A CD  1 
ATOM   1109 O OE1 . GLN A 1 157 ? 39.195 44.826 33.135 1.00 74.29  ? 442 GLN A OE1 1 
ATOM   1110 N NE2 . GLN A 1 157 ? 40.368 43.763 31.520 1.00 75.29  ? 442 GLN A NE2 1 
ATOM   1111 N N   . PHE A 1 158 ? 35.059 39.848 32.226 1.00 60.10  ? 443 PHE A N   1 
ATOM   1112 C CA  . PHE A 1 158 ? 33.643 39.745 31.903 1.00 55.87  ? 443 PHE A CA  1 
ATOM   1113 C C   . PHE A 1 158 ? 32.833 40.078 33.152 1.00 54.91  ? 443 PHE A C   1 
ATOM   1114 O O   . PHE A 1 158 ? 33.004 39.433 34.164 1.00 55.95  ? 443 PHE A O   1 
ATOM   1115 C CB  . PHE A 1 158 ? 33.380 38.306 31.470 1.00 53.37  ? 443 PHE A CB  1 
ATOM   1116 C CG  . PHE A 1 158 ? 32.015 38.060 30.943 1.00 47.13  ? 443 PHE A CG  1 
ATOM   1117 C CD1 . PHE A 1 158 ? 31.476 38.879 29.972 1.00 46.81  ? 443 PHE A CD1 1 
ATOM   1118 C CD2 . PHE A 1 158 ? 31.306 36.952 31.355 1.00 44.43  ? 443 PHE A CD2 1 
ATOM   1119 C CE1 . PHE A 1 158 ? 30.251 38.592 29.420 1.00 45.98  ? 443 PHE A CE1 1 
ATOM   1120 C CE2 . PHE A 1 158 ? 30.085 36.659 30.809 1.00 43.82  ? 443 PHE A CE2 1 
ATOM   1121 C CZ  . PHE A 1 158 ? 29.555 37.475 29.838 1.00 44.30  ? 443 PHE A CZ  1 
ATOM   1122 N N   . ASP A 1 159 ? 31.965 41.085 33.084 1.00 53.75  ? 444 ASP A N   1 
ATOM   1123 C CA  . ASP A 1 159 ? 31.149 41.449 34.243 1.00 53.81  ? 444 ASP A CA  1 
ATOM   1124 C C   . ASP A 1 159 ? 29.669 41.115 34.069 1.00 53.34  ? 444 ASP A C   1 
ATOM   1125 O O   . ASP A 1 159 ? 29.238 40.695 33.011 1.00 52.31  ? 444 ASP A O   1 
ATOM   1126 C CB  . ASP A 1 159 ? 31.307 42.938 34.606 1.00 52.91  ? 444 ASP A CB  1 
ATOM   1127 C CG  . ASP A 1 159 ? 30.843 43.878 33.505 1.00 54.88  ? 444 ASP A CG  1 
ATOM   1128 O OD1 . ASP A 1 159 ? 29.907 43.531 32.754 1.00 54.27  ? 444 ASP A OD1 1 
ATOM   1129 O OD2 . ASP A 1 159 ? 31.407 44.988 33.407 1.00 56.25  ? 444 ASP A OD2 1 
ATOM   1130 N N   . GLN A 1 160 ? 28.898 41.310 35.128 1.00 54.29  ? 445 GLN A N   1 
ATOM   1131 C CA  . GLN A 1 160 ? 27.477 41.005 35.089 1.00 56.60  ? 445 GLN A CA  1 
ATOM   1132 C C   . GLN A 1 160 ? 26.700 41.814 34.053 1.00 57.95  ? 445 GLN A C   1 
ATOM   1133 O O   . GLN A 1 160 ? 25.787 41.281 33.397 1.00 58.15  ? 445 GLN A O   1 
ATOM   1134 C CB  . GLN A 1 160 ? 26.857 41.196 36.475 1.00 55.85  ? 445 GLN A CB  1 
ATOM   1135 C CG  . GLN A 1 160 ? 25.369 40.909 36.524 1.00 58.59  ? 445 GLN A CG  1 
ATOM   1136 C CD  . GLN A 1 160 ? 24.784 41.098 37.911 1.00 60.93  ? 445 GLN A CD  1 
ATOM   1137 O OE1 . GLN A 1 160 ? 25.101 42.065 38.604 1.00 62.59  ? 445 GLN A OE1 1 
ATOM   1138 N NE2 . GLN A 1 160 ? 23.912 40.180 38.318 1.00 59.93  ? 445 GLN A NE2 1 
ATOM   1139 N N   . ARG A 1 161 ? 27.037 43.094 33.906 1.00 57.74  ? 446 ARG A N   1 
ATOM   1140 C CA  . ARG A 1 161 ? 26.351 43.930 32.924 1.00 57.73  ? 446 ARG A CA  1 
ATOM   1141 C C   . ARG A 1 161 ? 26.505 43.282 31.548 1.00 56.74  ? 446 ARG A C   1 
ATOM   1142 O O   . ARG A 1 161 ? 25.518 43.082 30.834 1.00 55.52  ? 446 ARG A O   1 
ATOM   1143 C CB  . ARG A 1 161 ? 26.937 45.348 32.898 1.00 60.17  ? 446 ARG A CB  1 
ATOM   1144 C CG  . ARG A 1 161 ? 26.376 46.302 33.940 1.00 61.25  ? 446 ARG A CG  1 
ATOM   1145 C CD  . ARG A 1 161 ? 26.846 45.954 35.337 1.00 63.33  ? 446 ARG A CD  1 
ATOM   1146 N NE  . ARG A 1 161 ? 28.298 45.986 35.464 1.00 65.91  ? 446 ARG A NE  1 
ATOM   1147 C CZ  . ARG A 1 161 ? 28.955 45.632 36.567 1.00 70.12  ? 446 ARG A CZ  1 
ATOM   1148 N NH1 . ARG A 1 161 ? 28.284 45.223 37.639 1.00 70.68  ? 446 ARG A NH1 1 
ATOM   1149 N NH2 . ARG A 1 161 ? 30.284 45.672 36.599 1.00 71.08  ? 446 ARG A NH2 1 
ATOM   1150 N N   . GLU A 1 162 ? 27.751 42.958 31.189 1.00 54.90  ? 447 GLU A N   1 
ATOM   1151 C CA  . GLU A 1 162 ? 28.063 42.309 29.918 1.00 53.76  ? 447 GLU A CA  1 
ATOM   1152 C C   . GLU A 1 162 ? 27.378 40.943 29.848 1.00 52.89  ? 447 GLU A C   1 
ATOM   1153 O O   . GLU A 1 162 ? 26.916 40.525 28.790 1.00 52.91  ? 447 GLU A O   1 
ATOM   1154 C CB  . GLU A 1 162 ? 29.578 42.135 29.770 1.00 54.67  ? 447 GLU A CB  1 
ATOM   1155 C CG  . GLU A 1 162 ? 30.356 43.454 29.749 1.00 56.00  ? 447 GLU A CG  1 
ATOM   1156 C CD  . GLU A 1 162 ? 31.849 43.272 29.978 1.00 56.44  ? 447 GLU A CD  1 
ATOM   1157 O OE1 . GLU A 1 162 ? 32.241 42.261 30.586 1.00 59.74  ? 447 GLU A OE1 1 
ATOM   1158 O OE2 . GLU A 1 162 ? 32.639 44.145 29.572 1.00 57.71  ? 447 GLU A OE2 1 
ATOM   1159 N N   . PHE A 1 163 ? 27.305 40.264 30.990 1.00 51.28  ? 448 PHE A N   1 
ATOM   1160 C CA  . PHE A 1 163 ? 26.679 38.953 31.078 1.00 50.30  ? 448 PHE A CA  1 
ATOM   1161 C C   . PHE A 1 163 ? 25.204 38.929 30.656 1.00 51.22  ? 448 PHE A C   1 
ATOM   1162 O O   . PHE A 1 163 ? 24.818 38.157 29.747 1.00 50.57  ? 448 PHE A O   1 
ATOM   1163 C CB  . PHE A 1 163 ? 26.818 38.410 32.501 1.00 49.04  ? 448 PHE A CB  1 
ATOM   1164 C CG  . PHE A 1 163 ? 26.028 37.163 32.748 1.00 47.65  ? 448 PHE A CG  1 
ATOM   1165 C CD1 . PHE A 1 163 ? 24.939 37.172 33.609 1.00 46.08  ? 448 PHE A CD1 1 
ATOM   1166 C CD2 . PHE A 1 163 ? 26.362 35.983 32.110 1.00 45.54  ? 448 PHE A CD2 1 
ATOM   1167 C CE1 . PHE A 1 163 ? 24.198 36.025 33.830 1.00 45.75  ? 448 PHE A CE1 1 
ATOM   1168 C CE2 . PHE A 1 163 ? 25.625 34.834 32.327 1.00 47.27  ? 448 PHE A CE2 1 
ATOM   1169 C CZ  . PHE A 1 163 ? 24.539 34.855 33.191 1.00 47.32  ? 448 PHE A CZ  1 
ATOM   1170 N N   . VAL A 1 164 ? 24.374 39.750 31.302 1.00 50.99  ? 449 VAL A N   1 
ATOM   1171 C CA  . VAL A 1 164 ? 22.951 39.795 30.961 1.00 50.88  ? 449 VAL A CA  1 
ATOM   1172 C C   . VAL A 1 164 ? 22.732 40.197 29.496 1.00 50.80  ? 449 VAL A C   1 
ATOM   1173 O O   . VAL A 1 164 ? 21.785 39.724 28.857 1.00 51.80  ? 449 VAL A O   1 
ATOM   1174 C CB  . VAL A 1 164 ? 22.159 40.757 31.890 1.00 52.74  ? 449 VAL A CB  1 
ATOM   1175 C CG1 . VAL A 1 164 ? 21.865 40.076 33.204 1.00 51.66  ? 449 VAL A CG1 1 
ATOM   1176 C CG2 . VAL A 1 164 ? 22.956 42.037 32.139 1.00 52.34  ? 449 VAL A CG2 1 
ATOM   1177 N N   . CYS A 1 165 ? 23.593 41.060 28.957 1.00 48.84  ? 450 CYS A N   1 
ATOM   1178 C CA  . CYS A 1 165 ? 23.475 41.446 27.548 1.00 48.32  ? 450 CYS A CA  1 
ATOM   1179 C C   . CYS A 1 165 ? 23.678 40.214 26.679 1.00 46.26  ? 450 CYS A C   1 
ATOM   1180 O O   . CYS A 1 165 ? 22.910 39.956 25.746 1.00 45.91  ? 450 CYS A O   1 
ATOM   1181 C CB  . CYS A 1 165 ? 24.522 42.492 27.168 1.00 51.34  ? 450 CYS A CB  1 
ATOM   1182 S SG  . CYS A 1 165 ? 24.071 44.168 27.571 1.00 56.73  ? 450 CYS A SG  1 
ATOM   1183 N N   . LEU A 1 166 ? 24.727 39.453 26.979 1.00 43.18  ? 451 LEU A N   1 
ATOM   1184 C CA  . LEU A 1 166 ? 24.977 38.248 26.224 1.00 40.92  ? 451 LEU A CA  1 
ATOM   1185 C C   . LEU A 1 166 ? 23.782 37.294 26.343 1.00 39.28  ? 451 LEU A C   1 
ATOM   1186 O O   . LEU A 1 166 ? 23.397 36.658 25.366 1.00 36.81  ? 451 LEU A O   1 
ATOM   1187 C CB  . LEU A 1 166 ? 26.276 37.575 26.693 1.00 39.72  ? 451 LEU A CB  1 
ATOM   1188 C CG  . LEU A 1 166 ? 27.581 38.280 26.293 1.00 38.06  ? 451 LEU A CG  1 
ATOM   1189 C CD1 . LEU A 1 166 ? 28.691 37.260 26.108 1.00 36.82  ? 451 LEU A CD1 1 
ATOM   1190 C CD2 . LEU A 1 166 ? 27.387 39.020 24.988 1.00 37.58  ? 451 LEU A CD2 1 
ATOM   1191 N N   . LYS A 1 167 ? 23.181 37.202 27.526 1.00 39.31  ? 452 LYS A N   1 
ATOM   1192 C CA  . LYS A 1 167 ? 22.041 36.306 27.676 1.00 41.75  ? 452 LYS A CA  1 
ATOM   1193 C C   . LYS A 1 167 ? 20.898 36.688 26.754 1.00 42.74  ? 452 LYS A C   1 
ATOM   1194 O O   . LYS A 1 167 ? 20.326 35.823 26.072 1.00 40.82  ? 452 LYS A O   1 
ATOM   1195 C CB  . LYS A 1 167 ? 21.554 36.269 29.116 1.00 42.59  ? 452 LYS A CB  1 
ATOM   1196 C CG  . LYS A 1 167 ? 22.547 35.609 30.037 1.00 46.86  ? 452 LYS A CG  1 
ATOM   1197 C CD  . LYS A 1 167 ? 21.845 34.832 31.125 1.00 48.01  ? 452 LYS A CD  1 
ATOM   1198 C CE  . LYS A 1 167 ? 21.040 35.732 32.009 1.00 47.72  ? 452 LYS A CE  1 
ATOM   1199 N NZ  . LYS A 1 167 ? 20.302 34.930 33.016 1.00 53.38  ? 452 LYS A NZ  1 
ATOM   1200 N N   . PHE A 1 168 ? 20.566 37.975 26.707 1.00 41.98  ? 453 PHE A N   1 
ATOM   1201 C CA  . PHE A 1 168 ? 19.480 38.389 25.833 1.00 43.60  ? 453 PHE A CA  1 
ATOM   1202 C C   . PHE A 1 168 ? 19.821 38.235 24.359 1.00 42.25  ? 453 PHE A C   1 
ATOM   1203 O O   . PHE A 1 168 ? 18.972 37.864 23.564 1.00 43.85  ? 453 PHE A O   1 
ATOM   1204 C CB  . PHE A 1 168 ? 19.025 39.811 26.159 1.00 44.45  ? 453 PHE A CB  1 
ATOM   1205 C CG  . PHE A 1 168 ? 18.078 39.872 27.327 1.00 47.01  ? 453 PHE A CG  1 
ATOM   1206 C CD1 . PHE A 1 168 ? 18.549 39.765 28.636 1.00 45.90  ? 453 PHE A CD1 1 
ATOM   1207 C CD2 . PHE A 1 168 ? 16.701 39.977 27.113 1.00 47.47  ? 453 PHE A CD2 1 
ATOM   1208 C CE1 . PHE A 1 168 ? 17.663 39.758 29.712 1.00 47.78  ? 453 PHE A CE1 1 
ATOM   1209 C CE2 . PHE A 1 168 ? 15.805 39.970 28.180 1.00 46.10  ? 453 PHE A CE2 1 
ATOM   1210 C CZ  . PHE A 1 168 ? 16.282 39.862 29.481 1.00 46.51  ? 453 PHE A CZ  1 
ATOM   1211 N N   . LEU A 1 169 ? 21.066 38.503 23.991 1.00 41.63  ? 454 LEU A N   1 
ATOM   1212 C CA  . LEU A 1 169 ? 21.474 38.320 22.602 1.00 41.59  ? 454 LEU A CA  1 
ATOM   1213 C C   . LEU A 1 169 ? 21.362 36.835 22.227 1.00 43.20  ? 454 LEU A C   1 
ATOM   1214 O O   . LEU A 1 169 ? 21.157 36.475 21.036 1.00 44.29  ? 454 LEU A O   1 
ATOM   1215 C CB  . LEU A 1 169 ? 22.910 38.793 22.408 1.00 39.54  ? 454 LEU A CB  1 
ATOM   1216 C CG  . LEU A 1 169 ? 23.115 40.303 22.507 1.00 37.05  ? 454 LEU A CG  1 
ATOM   1217 C CD1 . LEU A 1 169 ? 24.562 40.654 22.189 1.00 32.49  ? 454 LEU A CD1 1 
ATOM   1218 C CD2 . LEU A 1 169 ? 22.182 40.974 21.519 1.00 37.72  ? 454 LEU A CD2 1 
ATOM   1219 N N   . VAL A 1 170 ? 21.493 35.979 23.243 1.00 41.94  ? 455 VAL A N   1 
ATOM   1220 C CA  . VAL A 1 170 ? 21.405 34.545 23.077 1.00 40.26  ? 455 VAL A CA  1 
ATOM   1221 C C   . VAL A 1 170 ? 19.956 34.105 23.005 1.00 41.53  ? 455 VAL A C   1 
ATOM   1222 O O   . VAL A 1 170 ? 19.583 33.295 22.151 1.00 41.18  ? 455 VAL A O   1 
ATOM   1223 C CB  . VAL A 1 170 ? 22.110 33.825 24.248 1.00 40.68  ? 455 VAL A CB  1 
ATOM   1224 C CG1 . VAL A 1 170 ? 21.587 32.391 24.384 1.00 35.98  ? 455 VAL A CG1 1 
ATOM   1225 C CG2 . VAL A 1 170 ? 23.640 33.822 24.010 1.00 36.41  ? 455 VAL A CG2 1 
ATOM   1226 N N   . LEU A 1 171 ? 19.140 34.653 23.901 1.00 41.77  ? 456 LEU A N   1 
ATOM   1227 C CA  . LEU A 1 171 ? 17.728 34.310 23.968 1.00 43.21  ? 456 LEU A CA  1 
ATOM   1228 C C   . LEU A 1 171 ? 16.987 34.764 22.723 1.00 45.01  ? 456 LEU A C   1 
ATOM   1229 O O   . LEU A 1 171 ? 16.357 33.961 22.044 1.00 41.90  ? 456 LEU A O   1 
ATOM   1230 C CB  . LEU A 1 171 ? 17.089 34.946 25.203 1.00 42.06  ? 456 LEU A CB  1 
ATOM   1231 C CG  . LEU A 1 171 ? 15.572 34.759 25.318 1.00 41.71  ? 456 LEU A CG  1 
ATOM   1232 C CD1 . LEU A 1 171 ? 15.200 33.278 25.258 1.00 38.62  ? 456 LEU A CD1 1 
ATOM   1233 C CD2 . LEU A 1 171 ? 15.097 35.388 26.617 1.00 41.19  ? 456 LEU A CD2 1 
ATOM   1234 N N   . PHE A 1 172 ? 17.091 36.062 22.437 1.00 47.31  ? 457 PHE A N   1 
ATOM   1235 C CA  . PHE A 1 172 ? 16.446 36.683 21.285 1.00 50.24  ? 457 PHE A CA  1 
ATOM   1236 C C   . PHE A 1 172 ? 17.276 36.553 20.015 1.00 51.43  ? 457 PHE A C   1 
ATOM   1237 O O   . PHE A 1 172 ? 17.700 37.540 19.430 1.00 52.09  ? 457 PHE A O   1 
ATOM   1238 C CB  . PHE A 1 172 ? 16.158 38.163 21.579 1.00 50.30  ? 457 PHE A CB  1 
ATOM   1239 C CG  . PHE A 1 172 ? 15.180 38.376 22.707 1.00 51.20  ? 457 PHE A CG  1 
ATOM   1240 C CD1 . PHE A 1 172 ? 15.615 38.506 24.017 1.00 52.08  ? 457 PHE A CD1 1 
ATOM   1241 C CD2 . PHE A 1 172 ? 13.817 38.410 22.461 1.00 52.65  ? 457 PHE A CD2 1 
ATOM   1242 C CE1 . PHE A 1 172 ? 14.707 38.668 25.059 1.00 50.07  ? 457 PHE A CE1 1 
ATOM   1243 C CE2 . PHE A 1 172 ? 12.915 38.571 23.498 1.00 51.23  ? 457 PHE A CE2 1 
ATOM   1244 C CZ  . PHE A 1 172 ? 13.368 38.699 24.797 1.00 50.54  ? 457 PHE A CZ  1 
ATOM   1245 N N   . SER A 1 173 ? 17.497 35.312 19.603 1.00 53.82  ? 458 SER A N   1 
ATOM   1246 C CA  . SER A 1 173 ? 18.269 34.999 18.411 1.00 56.99  ? 458 SER A CA  1 
ATOM   1247 C C   . SER A 1 173 ? 17.478 35.354 17.151 1.00 60.69  ? 458 SER A C   1 
ATOM   1248 O O   . SER A 1 173 ? 16.247 35.330 17.156 1.00 62.74  ? 458 SER A O   1 
ATOM   1249 C CB  . SER A 1 173 ? 18.600 33.506 18.411 1.00 54.59  ? 458 SER A CB  1 
ATOM   1250 O OG  . SER A 1 173 ? 19.339 33.131 17.265 1.00 55.68  ? 458 SER A OG  1 
ATOM   1251 N N   . LEU A 1 174 ? 18.177 35.694 16.072 1.00 62.88  ? 459 LEU A N   1 
ATOM   1252 C CA  . LEU A 1 174 ? 17.486 36.019 14.825 1.00 65.26  ? 459 LEU A CA  1 
ATOM   1253 C C   . LEU A 1 174 ? 17.602 34.856 13.847 1.00 66.18  ? 459 LEU A C   1 
ATOM   1254 O O   . LEU A 1 174 ? 17.325 34.997 12.653 1.00 66.62  ? 459 LEU A O   1 
ATOM   1255 C CB  . LEU A 1 174 ? 18.050 37.302 14.198 1.00 65.36  ? 459 LEU A CB  1 
ATOM   1256 C CG  . LEU A 1 174 ? 17.801 38.604 14.972 1.00 66.49  ? 459 LEU A CG  1 
ATOM   1257 C CD1 . LEU A 1 174 ? 18.353 39.777 14.194 1.00 65.60  ? 459 LEU A CD1 1 
ATOM   1258 C CD2 . LEU A 1 174 ? 16.302 38.789 15.204 1.00 67.68  ? 459 LEU A CD2 1 
ATOM   1259 N N   . ASP A 1 175 ? 17.993 33.701 14.374 1.00 66.38  ? 460 ASP A N   1 
ATOM   1260 C CA  . ASP A 1 175 ? 18.149 32.503 13.568 1.00 67.96  ? 460 ASP A CA  1 
ATOM   1261 C C   . ASP A 1 175 ? 16.975 31.546 13.726 1.00 68.57  ? 460 ASP A C   1 
ATOM   1262 O O   . ASP A 1 175 ? 16.955 30.489 13.096 1.00 68.23  ? 460 ASP A O   1 
ATOM   1263 C CB  . ASP A 1 175 ? 19.446 31.791 13.946 1.00 68.86  ? 460 ASP A CB  1 
ATOM   1264 C CG  . ASP A 1 175 ? 20.663 32.669 13.746 1.00 72.01  ? 460 ASP A CG  1 
ATOM   1265 O OD1 . ASP A 1 175 ? 20.874 33.117 12.598 1.00 73.87  ? 460 ASP A OD1 1 
ATOM   1266 O OD2 . ASP A 1 175 ? 21.400 32.920 14.728 1.00 71.71  ? 460 ASP A OD2 1 
ATOM   1267 N N   . VAL A 1 176 ? 16.002 31.915 14.560 1.00 69.73  ? 461 VAL A N   1 
ATOM   1268 C CA  . VAL A 1 176 ? 14.838 31.065 14.786 1.00 71.58  ? 461 VAL A CA  1 
ATOM   1269 C C   . VAL A 1 176 ? 13.690 31.415 13.843 1.00 73.10  ? 461 VAL A C   1 
ATOM   1270 O O   . VAL A 1 176 ? 13.221 32.551 13.792 1.00 73.03  ? 461 VAL A O   1 
ATOM   1271 C CB  . VAL A 1 176 ? 14.352 31.141 16.258 1.00 70.71  ? 461 VAL A CB  1 
ATOM   1272 C CG1 . VAL A 1 176 ? 15.538 31.017 17.192 1.00 69.48  ? 461 VAL A CG1 1 
ATOM   1273 C CG2 . VAL A 1 176 ? 13.600 32.425 16.511 1.00 69.49  ? 461 VAL A CG2 1 
ATOM   1274 N N   . LYS A 1 177 ? 13.251 30.408 13.096 1.00 75.93  ? 462 LYS A N   1 
ATOM   1275 C CA  . LYS A 1 177 ? 12.176 30.545 12.121 1.00 79.03  ? 462 LYS A CA  1 
ATOM   1276 C C   . LYS A 1 177 ? 10.768 30.343 12.707 1.00 80.40  ? 462 LYS A C   1 
ATOM   1277 O O   . LYS A 1 177 ? 10.603 30.032 13.900 1.00 80.55  ? 462 LYS A O   1 
ATOM   1278 C CB  . LYS A 1 177 ? 12.409 29.559 10.963 1.00 79.74  ? 462 LYS A CB  1 
ATOM   1279 C CG  . LYS A 1 177 ? 13.370 30.054 9.870  1.00 81.76  ? 462 LYS A CG  1 
ATOM   1280 C CD  . LYS A 1 177 ? 14.760 30.428 10.400 1.00 82.98  ? 462 LYS A CD  1 
ATOM   1281 C CE  . LYS A 1 177 ? 15.611 31.113 9.325  1.00 83.54  ? 462 LYS A CE  1 
ATOM   1282 N NZ  . LYS A 1 177 ? 16.937 31.600 9.826  1.00 82.58  ? 462 LYS A NZ  1 
ATOM   1283 N N   . ASN A 1 178 ? 9.761  30.538 11.855 1.00 80.54  ? 463 ASN A N   1 
ATOM   1284 C CA  . ASN A 1 178 ? 8.355  30.391 12.224 1.00 79.62  ? 463 ASN A CA  1 
ATOM   1285 C C   . ASN A 1 178 ? 7.987  31.280 13.405 1.00 79.05  ? 463 ASN A C   1 
ATOM   1286 O O   . ASN A 1 178 ? 7.054  30.998 14.147 1.00 78.36  ? 463 ASN A O   1 
ATOM   1287 C CB  . ASN A 1 178 ? 8.052  28.933 12.562 1.00 81.80  ? 463 ASN A CB  1 
ATOM   1288 C CG  . ASN A 1 178 ? 8.953  27.964 11.816 1.00 84.40  ? 463 ASN A CG  1 
ATOM   1289 O OD1 . ASN A 1 178 ? 9.111  28.044 10.598 1.00 85.04  ? 463 ASN A OD1 1 
ATOM   1290 N ND2 . ASN A 1 178 ? 9.552  27.031 12.556 1.00 85.45  ? 463 ASN A ND2 1 
ATOM   1291 N N   . LEU A 1 179 ? 8.732  32.361 13.571 1.00 78.90  ? 464 LEU A N   1 
ATOM   1292 C CA  . LEU A 1 179 ? 8.479  33.279 14.659 1.00 80.20  ? 464 LEU A CA  1 
ATOM   1293 C C   . LEU A 1 179 ? 7.383  34.240 14.225 1.00 81.04  ? 464 LEU A C   1 
ATOM   1294 O O   . LEU A 1 179 ? 7.433  34.815 13.143 1.00 82.98  ? 464 LEU A O   1 
ATOM   1295 C CB  . LEU A 1 179 ? 9.758  34.041 14.995 1.00 80.70  ? 464 LEU A CB  1 
ATOM   1296 C CG  . LEU A 1 179 ? 10.106 34.156 16.481 1.00 81.82  ? 464 LEU A CG  1 
ATOM   1297 C CD1 . LEU A 1 179 ? 10.208 32.768 17.092 1.00 81.72  ? 464 LEU A CD1 1 
ATOM   1298 C CD2 . LEU A 1 179 ? 11.419 34.903 16.640 1.00 81.52  ? 464 LEU A CD2 1 
ATOM   1299 N N   . GLU A 1 180 ? 6.379  34.403 15.071 1.00 80.85  ? 465 GLU A N   1 
ATOM   1300 C CA  . GLU A 1 180 ? 5.278  35.295 14.756 1.00 79.37  ? 465 GLU A CA  1 
ATOM   1301 C C   . GLU A 1 180 ? 5.675  36.755 14.944 1.00 77.93  ? 465 GLU A C   1 
ATOM   1302 O O   . GLU A 1 180 ? 5.794  37.499 13.992 1.00 78.97  ? 465 GLU A O   1 
ATOM   1303 C CB  . GLU A 1 180 ? 4.085  34.966 15.648 1.00 80.91  ? 465 GLU A CB  1 
ATOM   1304 C CG  . GLU A 1 180 ? 2.874  35.855 15.440 1.00 83.41  ? 465 GLU A CG  1 
ATOM   1305 C CD  . GLU A 1 180 ? 1.743  35.488 16.375 1.00 84.50  ? 465 GLU A CD  1 
ATOM   1306 O OE1 . GLU A 1 180 ? 1.405  34.283 16.437 1.00 85.46  ? 465 GLU A OE1 1 
ATOM   1307 O OE2 . GLU A 1 180 ? 1.198  36.396 17.040 1.00 83.39  ? 465 GLU A OE2 1 
ATOM   1308 N N   . ASN A 1 181 ? 5.890  37.148 16.190 1.00 75.81  ? 466 ASN A N   1 
ATOM   1309 C CA  . ASN A 1 181 ? 6.260  38.517 16.505 1.00 74.48  ? 466 ASN A CA  1 
ATOM   1310 C C   . ASN A 1 181 ? 7.738  38.806 16.209 1.00 75.33  ? 466 ASN A C   1 
ATOM   1311 O O   . ASN A 1 181 ? 8.412  39.471 16.986 1.00 74.29  ? 466 ASN A O   1 
ATOM   1312 C CB  . ASN A 1 181 ? 5.966  38.776 17.979 1.00 72.76  ? 466 ASN A CB  1 
ATOM   1313 C CG  . ASN A 1 181 ? 5.945  40.244 18.318 1.00 72.61  ? 466 ASN A CG  1 
ATOM   1314 O OD1 . ASN A 1 181 ? 6.800  40.991 17.894 1.00 74.92  ? 466 ASN A OD1 1 
ATOM   1315 N ND2 . ASN A 1 181 ? 4.957  40.659 19.103 1.00 72.19  ? 466 ASN A ND2 1 
ATOM   1316 N N   . PHE A 1 182 ? 8.239  38.322 15.076 1.00 76.02  ? 467 PHE A N   1 
ATOM   1317 C CA  . PHE A 1 182 ? 9.639  38.531 14.736 1.00 77.14  ? 467 PHE A CA  1 
ATOM   1318 C C   . PHE A 1 182 ? 10.106 39.964 14.966 1.00 77.35  ? 467 PHE A C   1 
ATOM   1319 O O   . PHE A 1 182 ? 11.208 40.192 15.436 1.00 77.61  ? 467 PHE A O   1 
ATOM   1320 C CB  . PHE A 1 182 ? 9.915  38.149 13.284 1.00 78.36  ? 467 PHE A CB  1 
ATOM   1321 C CG  . PHE A 1 182 ? 11.373 37.890 12.999 1.00 80.61  ? 467 PHE A CG  1 
ATOM   1322 C CD1 . PHE A 1 182 ? 11.909 36.622 13.146 1.00 81.68  ? 467 PHE A CD1 1 
ATOM   1323 C CD2 . PHE A 1 182 ? 12.219 38.925 12.634 1.00 81.34  ? 467 PHE A CD2 1 
ATOM   1324 C CE1 . PHE A 1 182 ? 13.259 36.392 12.930 1.00 82.17  ? 467 PHE A CE1 1 
ATOM   1325 C CE2 . PHE A 1 182 ? 13.567 38.700 12.418 1.00 81.08  ? 467 PHE A CE2 1 
ATOM   1326 C CZ  . PHE A 1 182 ? 14.086 37.434 12.568 1.00 81.70  ? 467 PHE A CZ  1 
ATOM   1327 N N   . GLN A 1 183 ? 9.263  40.931 14.636 1.00 78.27  ? 468 GLN A N   1 
ATOM   1328 C CA  . GLN A 1 183 ? 9.625  42.332 14.811 1.00 78.78  ? 468 GLN A CA  1 
ATOM   1329 C C   . GLN A 1 183 ? 10.094 42.712 16.214 1.00 77.33  ? 468 GLN A C   1 
ATOM   1330 O O   . GLN A 1 183 ? 10.861 43.660 16.375 1.00 77.23  ? 468 GLN A O   1 
ATOM   1331 C CB  . GLN A 1 183 ? 8.459  43.231 14.389 1.00 81.36  ? 468 GLN A CB  1 
ATOM   1332 C CG  . GLN A 1 183 ? 8.356  43.414 12.881 1.00 84.11  ? 468 GLN A CG  1 
ATOM   1333 C CD  . GLN A 1 183 ? 7.113  44.171 12.470 1.00 85.58  ? 468 GLN A CD  1 
ATOM   1334 O OE1 . GLN A 1 183 ? 6.767  45.192 13.062 1.00 87.30  ? 468 GLN A OE1 1 
ATOM   1335 N NE2 . GLN A 1 183 ? 6.436  43.676 11.438 1.00 86.57  ? 468 GLN A NE2 1 
ATOM   1336 N N   . LEU A 1 184 ? 9.635  41.987 17.230 1.00 75.36  ? 469 LEU A N   1 
ATOM   1337 C CA  . LEU A 1 184 ? 10.050 42.285 18.596 1.00 73.56  ? 469 LEU A CA  1 
ATOM   1338 C C   . LEU A 1 184 ? 11.431 41.674 18.900 1.00 72.79  ? 469 LEU A C   1 
ATOM   1339 O O   . LEU A 1 184 ? 12.227 42.250 19.648 1.00 70.86  ? 469 LEU A O   1 
ATOM   1340 C CB  . LEU A 1 184 ? 9.005  41.767 19.588 1.00 72.64  ? 469 LEU A CB  1 
ATOM   1341 C CG  . LEU A 1 184 ? 9.289  42.054 21.066 1.00 73.07  ? 469 LEU A CG  1 
ATOM   1342 C CD1 . LEU A 1 184 ? 9.669  43.513 21.235 1.00 73.64  ? 469 LEU A CD1 1 
ATOM   1343 C CD2 . LEU A 1 184 ? 8.072  41.723 21.913 1.00 72.76  ? 469 LEU A CD2 1 
ATOM   1344 N N   . VAL A 1 185 ? 11.705 40.508 18.314 1.00 71.96  ? 470 VAL A N   1 
ATOM   1345 C CA  . VAL A 1 185 ? 12.982 39.822 18.510 1.00 70.36  ? 470 VAL A CA  1 
ATOM   1346 C C   . VAL A 1 185 ? 14.098 40.737 18.040 1.00 69.27  ? 470 VAL A C   1 
ATOM   1347 O O   . VAL A 1 185 ? 15.056 40.988 18.761 1.00 68.50  ? 470 VAL A O   1 
ATOM   1348 C CB  . VAL A 1 185 ? 13.047 38.506 17.702 1.00 69.72  ? 470 VAL A CB  1 
ATOM   1349 C CG1 . VAL A 1 185 ? 14.407 37.870 17.860 1.00 68.68  ? 470 VAL A CG1 1 
ATOM   1350 C CG2 . VAL A 1 185 ? 11.963 37.555 18.169 1.00 67.30  ? 470 VAL A CG2 1 
ATOM   1351 N N   . GLU A 1 186 ? 13.958 41.234 16.817 1.00 68.11  ? 471 GLU A N   1 
ATOM   1352 C CA  . GLU A 1 186 ? 14.947 42.137 16.258 1.00 67.09  ? 471 GLU A CA  1 
ATOM   1353 C C   . GLU A 1 186 ? 15.077 43.395 17.103 1.00 64.79  ? 471 GLU A C   1 
ATOM   1354 O O   . GLU A 1 186 ? 16.165 43.897 17.306 1.00 63.49  ? 471 GLU A O   1 
ATOM   1355 C CB  . GLU A 1 186 ? 14.565 42.532 14.842 1.00 69.50  ? 471 GLU A CB  1 
ATOM   1356 C CG  . GLU A 1 186 ? 14.899 41.501 13.803 1.00 74.96  ? 471 GLU A CG  1 
ATOM   1357 C CD  . GLU A 1 186 ? 15.174 42.143 12.457 1.00 79.08  ? 471 GLU A CD  1 
ATOM   1358 O OE1 . GLU A 1 186 ? 16.188 42.872 12.334 1.00 78.74  ? 471 GLU A OE1 1 
ATOM   1359 O OE2 . GLU A 1 186 ? 14.371 41.927 11.524 1.00 82.21  ? 471 GLU A OE2 1 
ATOM   1360 N N   . GLY A 1 187 ? 13.951 43.904 17.586 1.00 62.12  ? 472 GLY A N   1 
ATOM   1361 C CA  . GLY A 1 187 ? 13.987 45.103 18.401 1.00 60.48  ? 472 GLY A CA  1 
ATOM   1362 C C   . GLY A 1 187 ? 14.986 44.996 19.533 1.00 60.63  ? 472 GLY A C   1 
ATOM   1363 O O   . GLY A 1 187 ? 15.894 45.819 19.653 1.00 59.88  ? 472 GLY A O   1 
ATOM   1364 N N   . VAL A 1 188 ? 14.814 43.972 20.366 1.00 60.88  ? 473 VAL A N   1 
ATOM   1365 C CA  . VAL A 1 188 ? 15.706 43.746 21.498 1.00 58.95  ? 473 VAL A CA  1 
ATOM   1366 C C   . VAL A 1 188 ? 17.101 43.388 21.018 1.00 57.06  ? 473 VAL A C   1 
ATOM   1367 O O   . VAL A 1 188 ? 18.087 43.873 21.555 1.00 55.24  ? 473 VAL A O   1 
ATOM   1368 C CB  . VAL A 1 188 ? 15.195 42.611 22.415 1.00 60.51  ? 473 VAL A CB  1 
ATOM   1369 C CG1 . VAL A 1 188 ? 16.201 42.360 23.536 1.00 58.84  ? 473 VAL A CG1 1 
ATOM   1370 C CG2 . VAL A 1 188 ? 13.831 42.982 22.997 1.00 60.10  ? 473 VAL A CG2 1 
ATOM   1371 N N   . GLN A 1 189 ? 17.183 42.529 20.010 1.00 55.38  ? 474 GLN A N   1 
ATOM   1372 C CA  . GLN A 1 189 ? 18.484 42.151 19.484 1.00 56.18  ? 474 GLN A CA  1 
ATOM   1373 C C   . GLN A 1 189 ? 19.313 43.415 19.198 1.00 56.86  ? 474 GLN A C   1 
ATOM   1374 O O   . GLN A 1 189 ? 20.355 43.629 19.810 1.00 56.34  ? 474 GLN A O   1 
ATOM   1375 C CB  . GLN A 1 189 ? 18.318 41.309 18.216 1.00 56.44  ? 474 GLN A CB  1 
ATOM   1376 C CG  . GLN A 1 189 ? 19.617 41.036 17.486 1.00 58.44  ? 474 GLN A CG  1 
ATOM   1377 C CD  . GLN A 1 189 ? 20.602 40.197 18.296 1.00 61.20  ? 474 GLN A CD  1 
ATOM   1378 O OE1 . GLN A 1 189 ? 21.795 40.229 18.026 1.00 61.07  ? 474 GLN A OE1 1 
ATOM   1379 N NE2 . GLN A 1 189 ? 20.101 39.433 19.278 1.00 61.39  ? 474 GLN A NE2 1 
ATOM   1380 N N   . GLU A 1 190 ? 18.822 44.259 18.291 1.00 57.40  ? 475 GLU A N   1 
ATOM   1381 C CA  . GLU A 1 190 ? 19.495 45.508 17.921 1.00 58.75  ? 475 GLU A CA  1 
ATOM   1382 C C   . GLU A 1 190 ? 19.645 46.464 19.104 1.00 57.50  ? 475 GLU A C   1 
ATOM   1383 O O   . GLU A 1 190 ? 20.629 47.184 19.218 1.00 56.70  ? 475 GLU A O   1 
ATOM   1384 C CB  . GLU A 1 190 ? 18.700 46.215 16.822 1.00 60.93  ? 475 GLU A CB  1 
ATOM   1385 C CG  . GLU A 1 190 ? 18.330 45.317 15.657 1.00 67.90  ? 475 GLU A CG  1 
ATOM   1386 C CD  . GLU A 1 190 ? 17.096 45.809 14.907 1.00 72.02  ? 475 GLU A CD  1 
ATOM   1387 O OE1 . GLU A 1 190 ? 16.619 45.087 13.995 1.00 72.05  ? 475 GLU A OE1 1 
ATOM   1388 O OE2 . GLU A 1 190 ? 16.605 46.916 15.236 1.00 73.99  ? 475 GLU A OE2 1 
ATOM   1389 N N   . GLN A 1 191 ? 18.654 46.452 19.981 1.00 57.02  ? 476 GLN A N   1 
ATOM   1390 C CA  . GLN A 1 191 ? 18.629 47.327 21.139 1.00 57.92  ? 476 GLN A CA  1 
ATOM   1391 C C   . GLN A 1 191 ? 19.645 46.944 22.199 1.00 57.96  ? 476 GLN A C   1 
ATOM   1392 O O   . GLN A 1 191 ? 20.345 47.805 22.727 1.00 58.59  ? 476 GLN A O   1 
ATOM   1393 C CB  . GLN A 1 191 ? 17.221 47.319 21.730 1.00 59.92  ? 476 GLN A CB  1 
ATOM   1394 C CG  . GLN A 1 191 ? 16.832 48.554 22.516 1.00 59.46  ? 476 GLN A CG  1 
ATOM   1395 C CD  . GLN A 1 191 ? 15.343 48.582 22.791 1.00 58.88  ? 476 GLN A CD  1 
ATOM   1396 O OE1 . GLN A 1 191 ? 14.538 48.613 21.871 1.00 56.05  ? 476 GLN A OE1 1 
ATOM   1397 N NE2 . GLN A 1 191 ? 14.973 48.561 24.069 1.00 60.92  ? 476 GLN A NE2 1 
ATOM   1398 N N   . VAL A 1 192 ? 19.710 45.654 22.524 1.00 57.66  ? 477 VAL A N   1 
ATOM   1399 C CA  . VAL A 1 192 ? 20.660 45.164 23.521 1.00 55.98  ? 477 VAL A CA  1 
ATOM   1400 C C   . VAL A 1 192 ? 22.043 45.236 22.902 1.00 56.03  ? 477 VAL A C   1 
ATOM   1401 O O   . VAL A 1 192 ? 23.025 45.546 23.567 1.00 54.15  ? 477 VAL A O   1 
ATOM   1402 C CB  . VAL A 1 192 ? 20.352 43.717 23.932 1.00 55.83  ? 477 VAL A CB  1 
ATOM   1403 C CG1 . VAL A 1 192 ? 21.431 43.198 24.867 1.00 54.10  ? 477 VAL A CG1 1 
ATOM   1404 C CG2 . VAL A 1 192 ? 18.994 43.657 24.606 1.00 54.62  ? 477 VAL A CG2 1 
ATOM   1405 N N   . ASN A 1 193 ? 22.106 44.954 21.607 1.00 56.93  ? 478 ASN A N   1 
ATOM   1406 C CA  . ASN A 1 193 ? 23.364 45.038 20.893 1.00 58.61  ? 478 ASN A CA  1 
ATOM   1407 C C   . ASN A 1 193 ? 23.898 46.442 21.105 1.00 59.02  ? 478 ASN A C   1 
ATOM   1408 O O   . ASN A 1 193 ? 24.981 46.613 21.621 1.00 62.26  ? 478 ASN A O   1 
ATOM   1409 C CB  . ASN A 1 193 ? 23.150 44.789 19.405 1.00 59.16  ? 478 ASN A CB  1 
ATOM   1410 C CG  . ASN A 1 193 ? 24.445 44.802 18.628 1.00 61.71  ? 478 ASN A CG  1 
ATOM   1411 O OD1 . ASN A 1 193 ? 25.125 45.808 18.567 1.00 61.26  ? 478 ASN A OD1 1 
ATOM   1412 N ND2 . ASN A 1 193 ? 24.791 43.662 18.029 1.00 64.95  ? 478 ASN A ND2 1 
ATOM   1413 N N   . ALA A 1 194 ? 23.102 47.440 20.721 1.00 58.62  ? 479 ALA A N   1 
ATOM   1414 C CA  . ALA A 1 194 ? 23.470 48.852 20.857 1.00 56.66  ? 479 ALA A CA  1 
ATOM   1415 C C   . ALA A 1 194 ? 23.769 49.282 22.295 1.00 54.64  ? 479 ALA A C   1 
ATOM   1416 O O   . ALA A 1 194 ? 24.645 50.108 22.528 1.00 54.40  ? 479 ALA A O   1 
ATOM   1417 C CB  . ALA A 1 194 ? 22.370 49.730 20.268 1.00 56.47  ? 479 ALA A CB  1 
ATOM   1418 N N   . ALA A 1 195 ? 23.040 48.739 23.260 1.00 53.56  ? 480 ALA A N   1 
ATOM   1419 C CA  . ALA A 1 195 ? 23.296 49.097 24.650 1.00 54.50  ? 480 ALA A CA  1 
ATOM   1420 C C   . ALA A 1 195 ? 24.713 48.661 24.988 1.00 55.22  ? 480 ALA A C   1 
ATOM   1421 O O   . ALA A 1 195 ? 25.505 49.443 25.490 1.00 55.88  ? 480 ALA A O   1 
ATOM   1422 C CB  . ALA A 1 195 ? 22.296 48.416 25.576 1.00 53.37  ? 480 ALA A CB  1 
ATOM   1423 N N   . LEU A 1 196 ? 25.026 47.403 24.685 1.00 55.19  ? 481 LEU A N   1 
ATOM   1424 C CA  . LEU A 1 196 ? 26.351 46.855 24.950 1.00 54.82  ? 481 LEU A CA  1 
ATOM   1425 C C   . LEU A 1 196 ? 27.439 47.683 24.279 1.00 55.29  ? 481 LEU A C   1 
ATOM   1426 O O   . LEU A 1 196 ? 28.480 47.931 24.868 1.00 55.19  ? 481 LEU A O   1 
ATOM   1427 C CB  . LEU A 1 196 ? 26.430 45.406 24.455 1.00 54.29  ? 481 LEU A CB  1 
ATOM   1428 C CG  . LEU A 1 196 ? 27.722 44.602 24.659 1.00 51.78  ? 481 LEU A CG  1 
ATOM   1429 C CD1 . LEU A 1 196 ? 28.037 44.435 26.140 1.00 50.21  ? 481 LEU A CD1 1 
ATOM   1430 C CD2 . LEU A 1 196 ? 27.544 43.250 24.019 1.00 49.39  ? 481 LEU A CD2 1 
ATOM   1431 N N   . LEU A 1 197 ? 27.188 48.101 23.038 1.00 55.74  ? 482 LEU A N   1 
ATOM   1432 C CA  . LEU A 1 197 ? 28.148 48.907 22.281 1.00 56.45  ? 482 LEU A CA  1 
ATOM   1433 C C   . LEU A 1 197 ? 28.492 50.175 23.052 1.00 58.81  ? 482 LEU A C   1 
ATOM   1434 O O   . LEU A 1 197 ? 29.638 50.559 23.110 1.00 57.80  ? 482 LEU A O   1 
ATOM   1435 C CB  . LEU A 1 197 ? 27.577 49.272 20.903 1.00 54.53  ? 482 LEU A CB  1 
ATOM   1436 C CG  . LEU A 1 197 ? 28.552 49.758 19.822 1.00 51.13  ? 482 LEU A CG  1 
ATOM   1437 C CD1 . LEU A 1 197 ? 29.608 48.703 19.580 1.00 49.40  ? 482 LEU A CD1 1 
ATOM   1438 C CD2 . LEU A 1 197 ? 27.803 50.034 18.538 1.00 49.29  ? 482 LEU A CD2 1 
ATOM   1439 N N   . ASP A 1 198 ? 27.479 50.810 23.644 1.00 62.35  ? 483 ASP A N   1 
ATOM   1440 C CA  . ASP A 1 198 ? 27.684 52.026 24.428 1.00 65.63  ? 483 ASP A CA  1 
ATOM   1441 C C   . ASP A 1 198 ? 28.378 51.703 25.743 1.00 66.27  ? 483 ASP A C   1 
ATOM   1442 O O   . ASP A 1 198 ? 29.379 52.327 26.109 1.00 66.05  ? 483 ASP A O   1 
ATOM   1443 C CB  . ASP A 1 198 ? 26.347 52.716 24.750 1.00 68.95  ? 483 ASP A CB  1 
ATOM   1444 C CG  . ASP A 1 198 ? 25.665 53.293 23.516 1.00 72.70  ? 483 ASP A CG  1 
ATOM   1445 O OD1 . ASP A 1 198 ? 26.378 53.598 22.533 1.00 74.78  ? 483 ASP A OD1 1 
ATOM   1446 O OD2 . ASP A 1 198 ? 24.420 53.457 23.536 1.00 72.28  ? 483 ASP A OD2 1 
ATOM   1447 N N   . TYR A 1 199 ? 27.831 50.726 26.457 1.00 66.26  ? 484 TYR A N   1 
ATOM   1448 C CA  . TYR A 1 199 ? 28.383 50.336 27.740 1.00 65.73  ? 484 TYR A CA  1 
ATOM   1449 C C   . TYR A 1 199 ? 29.885 50.114 27.697 1.00 66.03  ? 484 TYR A C   1 
ATOM   1450 O O   . TYR A 1 199 ? 30.611 50.680 28.503 1.00 66.55  ? 484 TYR A O   1 
ATOM   1451 C CB  . TYR A 1 199 ? 27.692 49.075 28.253 1.00 64.76  ? 484 TYR A CB  1 
ATOM   1452 C CG  . TYR A 1 199 ? 28.280 48.540 29.542 1.00 63.86  ? 484 TYR A CG  1 
ATOM   1453 C CD1 . TYR A 1 199 ? 29.441 47.773 29.542 1.00 63.22  ? 484 TYR A CD1 1 
ATOM   1454 C CD2 . TYR A 1 199 ? 27.677 48.802 30.759 1.00 63.72  ? 484 TYR A CD2 1 
ATOM   1455 C CE1 . TYR A 1 199 ? 29.979 47.283 30.716 1.00 62.48  ? 484 TYR A CE1 1 
ATOM   1456 C CE2 . TYR A 1 199 ? 28.209 48.314 31.942 1.00 63.69  ? 484 TYR A CE2 1 
ATOM   1457 C CZ  . TYR A 1 199 ? 29.357 47.555 31.916 1.00 63.68  ? 484 TYR A CZ  1 
ATOM   1458 O OH  . TYR A 1 199 ? 29.868 47.055 33.095 1.00 63.16  ? 484 TYR A OH  1 
ATOM   1459 N N   . THR A 1 200 ? 30.352 49.308 26.747 1.00 65.91  ? 485 THR A N   1 
ATOM   1460 C CA  . THR A 1 200 ? 31.778 49.007 26.656 1.00 66.23  ? 485 THR A CA  1 
ATOM   1461 C C   . THR A 1 200 ? 32.659 50.200 26.328 1.00 67.07  ? 485 THR A C   1 
ATOM   1462 O O   . THR A 1 200 ? 33.762 50.301 26.832 1.00 66.73  ? 485 THR A O   1 
ATOM   1463 C CB  . THR A 1 200 ? 32.075 47.906 25.618 1.00 64.67  ? 485 THR A CB  1 
ATOM   1464 O OG1 . THR A 1 200 ? 31.969 48.447 24.303 1.00 64.15  ? 485 THR A OG1 1 
ATOM   1465 C CG2 . THR A 1 200 ? 31.100 46.765 25.760 1.00 63.04  ? 485 THR A CG2 1 
ATOM   1466 N N   . MET A 1 201 ? 32.180 51.103 25.479 1.00 69.12  ? 486 MET A N   1 
ATOM   1467 C CA  . MET A 1 201 ? 32.994 52.259 25.126 1.00 70.82  ? 486 MET A CA  1 
ATOM   1468 C C   . MET A 1 201 ? 33.051 53.302 26.237 1.00 70.99  ? 486 MET A C   1 
ATOM   1469 O O   . MET A 1 201 ? 34.014 54.054 26.333 1.00 70.93  ? 486 MET A O   1 
ATOM   1470 C CB  . MET A 1 201 ? 32.492 52.903 23.836 1.00 71.41  ? 486 MET A CB  1 
ATOM   1471 C CG  . MET A 1 201 ? 31.102 53.453 23.908 1.00 72.93  ? 486 MET A CG  1 
ATOM   1472 S SD  . MET A 1 201 ? 30.769 54.414 22.433 1.00 78.88  ? 486 MET A SD  1 
ATOM   1473 C CE  . MET A 1 201 ? 31.078 56.071 23.043 1.00 74.92  ? 486 MET A CE  1 
ATOM   1474 N N   . CYS A 1 202 ? 32.023 53.330 27.081 1.00 71.25  ? 487 CYS A N   1 
ATOM   1475 C CA  . CYS A 1 202 ? 31.972 54.274 28.187 1.00 72.54  ? 487 CYS A CA  1 
ATOM   1476 C C   . CYS A 1 202 ? 32.722 53.771 29.421 1.00 73.57  ? 487 CYS A C   1 
ATOM   1477 O O   . CYS A 1 202 ? 33.451 54.524 30.058 1.00 74.49  ? 487 CYS A O   1 
ATOM   1478 C CB  . CYS A 1 202 ? 30.518 54.586 28.535 1.00 71.75  ? 487 CYS A CB  1 
ATOM   1479 S SG  . CYS A 1 202 ? 29.691 55.579 27.274 1.00 73.93  ? 487 CYS A SG  1 
ATOM   1480 N N   . ASN A 1 203 ? 32.554 52.494 29.746 1.00 74.83  ? 488 ASN A N   1 
ATOM   1481 C CA  . ASN A 1 203 ? 33.227 51.905 30.902 1.00 74.90  ? 488 ASN A CA  1 
ATOM   1482 C C   . ASN A 1 203 ? 34.630 51.366 30.591 1.00 75.80  ? 488 ASN A C   1 
ATOM   1483 O O   . ASN A 1 203 ? 35.406 51.131 31.499 1.00 76.16  ? 488 ASN A O   1 
ATOM   1484 C CB  . ASN A 1 203 ? 32.374 50.780 31.488 1.00 74.03  ? 488 ASN A CB  1 
ATOM   1485 C CG  . ASN A 1 203 ? 31.087 51.282 32.112 1.00 74.06  ? 488 ASN A CG  1 
ATOM   1486 O OD1 . ASN A 1 203 ? 31.053 51.678 33.263 1.00 74.26  ? 488 ASN A OD1 1 
ATOM   1487 N ND2 . ASN A 1 203 ? 30.015 51.267 31.335 1.00 74.88  ? 488 ASN A ND2 1 
ATOM   1488 N N   . TYR A 1 204 ? 34.953 51.160 29.316 1.00 76.41  ? 489 TYR A N   1 
ATOM   1489 C CA  . TYR A 1 204 ? 36.279 50.653 28.955 1.00 77.83  ? 489 TYR A CA  1 
ATOM   1490 C C   . TYR A 1 204 ? 36.856 51.299 27.696 1.00 80.06  ? 489 TYR A C   1 
ATOM   1491 O O   . TYR A 1 204 ? 37.075 50.618 26.697 1.00 81.07  ? 489 TYR A O   1 
ATOM   1492 C CB  . TYR A 1 204 ? 36.246 49.133 28.742 1.00 76.13  ? 489 TYR A CB  1 
ATOM   1493 C CG  . TYR A 1 204 ? 35.684 48.322 29.895 1.00 74.64  ? 489 TYR A CG  1 
ATOM   1494 C CD1 . TYR A 1 204 ? 34.318 48.069 29.996 1.00 73.87  ? 489 TYR A CD1 1 
ATOM   1495 C CD2 . TYR A 1 204 ? 36.521 47.791 30.870 1.00 74.02  ? 489 TYR A CD2 1 
ATOM   1496 C CE1 . TYR A 1 204 ? 33.801 47.303 31.034 1.00 73.39  ? 489 TYR A CE1 1 
ATOM   1497 C CE2 . TYR A 1 204 ? 36.015 47.027 31.912 1.00 73.71  ? 489 TYR A CE2 1 
ATOM   1498 C CZ  . TYR A 1 204 ? 34.655 46.782 31.989 1.00 73.72  ? 489 TYR A CZ  1 
ATOM   1499 O OH  . TYR A 1 204 ? 34.153 46.005 33.014 1.00 71.10  ? 489 TYR A OH  1 
ATOM   1500 N N   . PRO A 1 205 ? 37.123 52.618 27.735 1.00 81.81  ? 490 PRO A N   1 
ATOM   1501 C CA  . PRO A 1 205 ? 37.678 53.386 26.612 1.00 82.14  ? 490 PRO A CA  1 
ATOM   1502 C C   . PRO A 1 205 ? 39.028 52.907 26.060 1.00 82.73  ? 490 PRO A C   1 
ATOM   1503 O O   . PRO A 1 205 ? 39.177 52.728 24.849 1.00 83.07  ? 490 PRO A O   1 
ATOM   1504 C CB  . PRO A 1 205 ? 37.754 54.801 27.178 1.00 81.65  ? 490 PRO A CB  1 
ATOM   1505 C CG  . PRO A 1 205 ? 36.584 54.845 28.096 1.00 81.52  ? 490 PRO A CG  1 
ATOM   1506 C CD  . PRO A 1 205 ? 36.730 53.530 28.824 1.00 82.51  ? 490 PRO A CD  1 
ATOM   1507 N N   . GLN A 1 206 ? 40.012 52.709 26.937 1.00 83.19  ? 491 GLN A N   1 
ATOM   1508 C CA  . GLN A 1 206 ? 41.334 52.247 26.501 1.00 83.67  ? 491 GLN A CA  1 
ATOM   1509 C C   . GLN A 1 206 ? 41.361 50.786 26.030 1.00 82.70  ? 491 GLN A C   1 
ATOM   1510 O O   . GLN A 1 206 ? 42.431 50.226 25.782 1.00 83.73  ? 491 GLN A O   1 
ATOM   1511 C CB  . GLN A 1 206 ? 42.367 52.435 27.619 1.00 85.62  ? 491 GLN A CB  1 
ATOM   1512 C CG  . GLN A 1 206 ? 43.127 53.761 27.570 1.00 88.48  ? 491 GLN A CG  1 
ATOM   1513 C CD  . GLN A 1 206 ? 43.917 53.948 26.274 1.00 90.22  ? 491 GLN A CD  1 
ATOM   1514 O OE1 . GLN A 1 206 ? 44.625 53.047 25.820 1.00 90.68  ? 491 GLN A OE1 1 
ATOM   1515 N NE2 . GLN A 1 206 ? 43.804 55.135 25.681 1.00 90.56  ? 491 GLN A NE2 1 
ATOM   1516 N N   . GLN A 1 207 ? 40.189 50.173 25.915 1.00 79.99  ? 492 GLN A N   1 
ATOM   1517 C CA  . GLN A 1 207 ? 40.081 48.795 25.464 1.00 78.17  ? 492 GLN A CA  1 
ATOM   1518 C C   . GLN A 1 207 ? 38.934 48.760 24.463 1.00 75.44  ? 492 GLN A C   1 
ATOM   1519 O O   . GLN A 1 207 ? 37.861 48.249 24.763 1.00 76.13  ? 492 GLN A O   1 
ATOM   1520 C CB  . GLN A 1 207 ? 39.759 47.878 26.643 1.00 80.16  ? 492 GLN A CB  1 
ATOM   1521 C CG  . GLN A 1 207 ? 40.654 48.069 27.851 1.00 84.02  ? 492 GLN A CG  1 
ATOM   1522 C CD  . GLN A 1 207 ? 40.106 47.376 29.087 1.00 87.63  ? 492 GLN A CD  1 
ATOM   1523 O OE1 . GLN A 1 207 ? 39.918 46.161 29.103 1.00 89.59  ? 492 GLN A OE1 1 
ATOM   1524 N NE2 . GLN A 1 207 ? 39.840 48.156 30.135 1.00 88.79  ? 492 GLN A NE2 1 
ATOM   1525 N N   . THR A 1 208 ? 39.158 49.311 23.274 1.00 71.24  ? 493 THR A N   1 
ATOM   1526 C CA  . THR A 1 208 ? 38.112 49.344 22.258 1.00 67.45  ? 493 THR A CA  1 
ATOM   1527 C C   . THR A 1 208 ? 37.724 47.971 21.688 1.00 65.78  ? 493 THR A C   1 
ATOM   1528 O O   . THR A 1 208 ? 36.712 47.843 21.026 1.00 65.46  ? 493 THR A O   1 
ATOM   1529 C CB  . THR A 1 208 ? 38.497 50.297 21.107 1.00 66.14  ? 493 THR A CB  1 
ATOM   1530 O OG1 . THR A 1 208 ? 39.813 49.986 20.642 1.00 61.95  ? 493 THR A OG1 1 
ATOM   1531 C CG2 . THR A 1 208 ? 38.457 51.745 21.590 1.00 66.10  ? 493 THR A CG2 1 
ATOM   1532 N N   . GLU A 1 209 ? 38.525 46.949 21.972 1.00 63.11  ? 494 GLU A N   1 
ATOM   1533 C CA  . GLU A 1 209 ? 38.252 45.597 21.491 1.00 60.82  ? 494 GLU A CA  1 
ATOM   1534 C C   . GLU A 1 209 ? 37.285 44.817 22.383 1.00 58.14  ? 494 GLU A C   1 
ATOM   1535 O O   . GLU A 1 209 ? 36.840 43.741 22.011 1.00 56.45  ? 494 GLU A O   1 
ATOM   1536 C CB  . GLU A 1 209 ? 39.555 44.791 21.370 1.00 62.79  ? 494 GLU A CB  1 
ATOM   1537 C CG  . GLU A 1 209 ? 40.156 44.299 22.694 1.00 64.98  ? 494 GLU A CG  1 
ATOM   1538 C CD  . GLU A 1 209 ? 40.901 45.380 23.479 1.00 68.09  ? 494 GLU A CD  1 
ATOM   1539 O OE1 . GLU A 1 209 ? 41.434 45.063 24.565 1.00 69.64  ? 494 GLU A OE1 1 
ATOM   1540 O OE2 . GLU A 1 209 ? 40.965 46.541 23.022 1.00 69.03  ? 494 GLU A OE2 1 
ATOM   1541 N N   . LYS A 1 210 ? 36.962 45.368 23.552 1.00 55.92  ? 495 LYS A N   1 
ATOM   1542 C CA  . LYS A 1 210 ? 36.076 44.705 24.504 1.00 53.42  ? 495 LYS A CA  1 
ATOM   1543 C C   . LYS A 1 210 ? 34.786 44.226 23.864 1.00 52.51  ? 495 LYS A C   1 
ATOM   1544 O O   . LYS A 1 210 ? 34.400 43.083 24.009 1.00 54.04  ? 495 LYS A O   1 
ATOM   1545 C CB  . LYS A 1 210 ? 35.740 45.643 25.658 1.00 54.77  ? 495 LYS A CB  1 
ATOM   1546 C CG  . LYS A 1 210 ? 35.314 44.918 26.912 1.00 54.59  ? 495 LYS A CG  1 
ATOM   1547 C CD  . LYS A 1 210 ? 36.452 44.043 27.413 1.00 57.86  ? 495 LYS A CD  1 
ATOM   1548 C CE  . LYS A 1 210 ? 36.759 44.330 28.874 1.00 59.77  ? 495 LYS A CE  1 
ATOM   1549 N NZ  . LYS A 1 210 ? 35.515 44.265 29.712 1.00 60.28  ? 495 LYS A NZ  1 
ATOM   1550 N N   . PHE A 1 211 ? 34.118 45.126 23.159 1.00 50.22  ? 496 PHE A N   1 
ATOM   1551 C CA  . PHE A 1 211 ? 32.873 44.801 22.492 1.00 46.03  ? 496 PHE A CA  1 
ATOM   1552 C C   . PHE A 1 211 ? 33.017 43.575 21.594 1.00 45.21  ? 496 PHE A C   1 
ATOM   1553 O O   . PHE A 1 211 ? 32.313 42.611 21.752 1.00 43.78  ? 496 PHE A O   1 
ATOM   1554 C CB  . PHE A 1 211 ? 32.412 46.006 21.668 1.00 42.66  ? 496 PHE A CB  1 
ATOM   1555 C CG  . PHE A 1 211 ? 31.149 45.770 20.905 1.00 37.05  ? 496 PHE A CG  1 
ATOM   1556 C CD1 . PHE A 1 211 ? 31.183 45.559 19.537 1.00 37.24  ? 496 PHE A CD1 1 
ATOM   1557 C CD2 . PHE A 1 211 ? 29.925 45.761 21.554 1.00 36.11  ? 496 PHE A CD2 1 
ATOM   1558 C CE1 . PHE A 1 211 ? 30.005 45.347 18.818 1.00 37.75  ? 496 PHE A CE1 1 
ATOM   1559 C CE2 . PHE A 1 211 ? 28.749 45.547 20.851 1.00 36.93  ? 496 PHE A CE2 1 
ATOM   1560 C CZ  . PHE A 1 211 ? 28.789 45.343 19.477 1.00 36.57  ? 496 PHE A CZ  1 
ATOM   1561 N N   . GLY A 1 212 ? 33.948 43.641 20.650 1.00 45.82  ? 497 GLY A N   1 
ATOM   1562 C CA  . GLY A 1 212 ? 34.162 42.541 19.726 1.00 46.04  ? 497 GLY A CA  1 
ATOM   1563 C C   . GLY A 1 212 ? 34.409 41.193 20.377 1.00 47.27  ? 497 GLY A C   1 
ATOM   1564 O O   . GLY A 1 212 ? 33.787 40.215 20.019 1.00 46.03  ? 497 GLY A O   1 
ATOM   1565 N N   . GLN A 1 213 ? 35.328 41.143 21.333 1.00 48.22  ? 498 GLN A N   1 
ATOM   1566 C CA  . GLN A 1 213 ? 35.629 39.891 22.012 1.00 49.74  ? 498 GLN A CA  1 
ATOM   1567 C C   . GLN A 1 213 ? 34.404 39.280 22.684 1.00 49.86  ? 498 GLN A C   1 
ATOM   1568 O O   . GLN A 1 213 ? 34.248 38.049 22.693 1.00 52.45  ? 498 GLN A O   1 
ATOM   1569 C CB  . GLN A 1 213 ? 36.768 40.101 23.008 1.00 51.86  ? 498 GLN A CB  1 
ATOM   1570 C CG  . GLN A 1 213 ? 38.075 40.429 22.286 1.00 55.84  ? 498 GLN A CG  1 
ATOM   1571 C CD  . GLN A 1 213 ? 39.160 40.964 23.204 1.00 59.90  ? 498 GLN A CD  1 
ATOM   1572 O OE1 . GLN A 1 213 ? 38.914 41.841 24.039 1.00 60.06  ? 498 GLN A OE1 1 
ATOM   1573 N NE2 . GLN A 1 213 ? 40.380 40.451 23.038 1.00 60.46  ? 498 GLN A NE2 1 
ATOM   1574 N N   . LEU A 1 214 ? 33.525 40.117 23.232 1.00 47.11  ? 499 LEU A N   1 
ATOM   1575 C CA  . LEU A 1 214 ? 32.312 39.609 23.856 1.00 43.78  ? 499 LEU A CA  1 
ATOM   1576 C C   . LEU A 1 214 ? 31.414 38.965 22.795 1.00 42.84  ? 499 LEU A C   1 
ATOM   1577 O O   . LEU A 1 214 ? 30.974 37.822 22.951 1.00 39.18  ? 499 LEU A O   1 
ATOM   1578 C CB  . LEU A 1 214 ? 31.559 40.733 24.546 1.00 43.90  ? 499 LEU A CB  1 
ATOM   1579 C CG  . LEU A 1 214 ? 32.248 41.314 25.776 1.00 46.84  ? 499 LEU A CG  1 
ATOM   1580 C CD1 . LEU A 1 214 ? 31.351 42.385 26.363 1.00 46.84  ? 499 LEU A CD1 1 
ATOM   1581 C CD2 . LEU A 1 214 ? 32.524 40.213 26.807 1.00 46.48  ? 499 LEU A CD2 1 
ATOM   1582 N N   . LEU A 1 215 ? 31.161 39.690 21.707 1.00 40.19  ? 500 LEU A N   1 
ATOM   1583 C CA  . LEU A 1 215 ? 30.315 39.159 20.654 1.00 40.77  ? 500 LEU A CA  1 
ATOM   1584 C C   . LEU A 1 215 ? 30.852 37.861 20.056 1.00 41.55  ? 500 LEU A C   1 
ATOM   1585 O O   . LEU A 1 215 ? 30.078 37.018 19.646 1.00 41.39  ? 500 LEU A O   1 
ATOM   1586 C CB  . LEU A 1 215 ? 30.117 40.180 19.529 1.00 39.01  ? 500 LEU A CB  1 
ATOM   1587 C CG  . LEU A 1 215 ? 29.278 41.438 19.766 1.00 40.74  ? 500 LEU A CG  1 
ATOM   1588 C CD1 . LEU A 1 215 ? 29.103 42.154 18.451 1.00 42.20  ? 500 LEU A CD1 1 
ATOM   1589 C CD2 . LEU A 1 215 ? 27.928 41.090 20.319 1.00 39.83  ? 500 LEU A CD2 1 
ATOM   1590 N N   . LEU A 1 216 ? 32.177 37.712 20.001 1.00 41.24  ? 501 LEU A N   1 
ATOM   1591 C CA  . LEU A 1 216 ? 32.778 36.517 19.426 1.00 42.35  ? 501 LEU A CA  1 
ATOM   1592 C C   . LEU A 1 216 ? 32.726 35.253 20.299 1.00 41.98  ? 501 LEU A C   1 
ATOM   1593 O O   . LEU A 1 216 ? 33.079 34.161 19.847 1.00 41.70  ? 501 LEU A O   1 
ATOM   1594 C CB  . LEU A 1 216 ? 34.212 36.815 18.989 1.00 43.71  ? 501 LEU A CB  1 
ATOM   1595 C CG  . LEU A 1 216 ? 34.191 37.586 17.668 1.00 46.44  ? 501 LEU A CG  1 
ATOM   1596 C CD1 . LEU A 1 216 ? 35.600 38.000 17.267 1.00 48.59  ? 501 LEU A CD1 1 
ATOM   1597 C CD2 . LEU A 1 216 ? 33.556 36.724 16.592 1.00 45.57  ? 501 LEU A CD2 1 
ATOM   1598 N N   . ARG A 1 217 ? 32.277 35.409 21.539 1.00 39.00  ? 502 ARG A N   1 
ATOM   1599 C CA  . ARG A 1 217 ? 32.136 34.294 22.453 1.00 37.17  ? 502 ARG A CA  1 
ATOM   1600 C C   . ARG A 1 217 ? 30.819 33.605 22.134 1.00 38.16  ? 502 ARG A C   1 
ATOM   1601 O O   . ARG A 1 217 ? 30.658 32.419 22.390 1.00 40.79  ? 502 ARG A O   1 
ATOM   1602 C CB  . ARG A 1 217 ? 32.113 34.787 23.897 1.00 35.79  ? 502 ARG A CB  1 
ATOM   1603 C CG  . ARG A 1 217 ? 33.324 35.613 24.291 1.00 36.93  ? 502 ARG A CG  1 
ATOM   1604 C CD  . ARG A 1 217 ? 34.567 34.760 24.458 1.00 38.28  ? 502 ARG A CD  1 
ATOM   1605 N NE  . ARG A 1 217 ? 35.188 34.332 23.204 1.00 41.32  ? 502 ARG A NE  1 
ATOM   1606 C CZ  . ARG A 1 217 ? 36.075 35.045 22.517 1.00 42.42  ? 502 ARG A CZ  1 
ATOM   1607 N NH1 . ARG A 1 217 ? 36.450 36.239 22.952 1.00 44.62  ? 502 ARG A NH1 1 
ATOM   1608 N NH2 . ARG A 1 217 ? 36.618 34.550 21.414 1.00 42.03  ? 502 ARG A NH2 1 
ATOM   1609 N N   . LEU A 1 218 ? 29.876 34.347 21.561 1.00 37.46  ? 503 LEU A N   1 
ATOM   1610 C CA  . LEU A 1 218 ? 28.581 33.766 21.229 1.00 39.07  ? 503 LEU A CA  1 
ATOM   1611 C C   . LEU A 1 218 ? 28.705 32.535 20.341 1.00 39.48  ? 503 LEU A C   1 
ATOM   1612 O O   . LEU A 1 218 ? 28.108 31.517 20.613 1.00 37.29  ? 503 LEU A O   1 
ATOM   1613 C CB  . LEU A 1 218 ? 27.674 34.814 20.595 1.00 37.30  ? 503 LEU A CB  1 
ATOM   1614 C CG  . LEU A 1 218 ? 27.236 35.810 21.672 1.00 38.88  ? 503 LEU A CG  1 
ATOM   1615 C CD1 . LEU A 1 218 ? 26.506 37.014 21.073 1.00 35.77  ? 503 LEU A CD1 1 
ATOM   1616 C CD2 . LEU A 1 218 ? 26.373 35.059 22.671 1.00 36.13  ? 503 LEU A CD2 1 
ATOM   1617 N N   . PRO A 1 219 ? 29.478 32.629 19.254 1.00 40.52  ? 504 PRO A N   1 
ATOM   1618 C CA  . PRO A 1 219 ? 29.622 31.449 18.393 1.00 40.03  ? 504 PRO A CA  1 
ATOM   1619 C C   . PRO A 1 219 ? 30.220 30.269 19.189 1.00 41.77  ? 504 PRO A C   1 
ATOM   1620 O O   . PRO A 1 219 ? 29.815 29.098 19.011 1.00 42.01  ? 504 PRO A O   1 
ATOM   1621 C CB  . PRO A 1 219 ? 30.544 31.949 17.301 1.00 38.10  ? 504 PRO A CB  1 
ATOM   1622 C CG  . PRO A 1 219 ? 30.098 33.398 17.166 1.00 39.94  ? 504 PRO A CG  1 
ATOM   1623 C CD  . PRO A 1 219 ? 30.015 33.834 18.600 1.00 39.09  ? 504 PRO A CD  1 
ATOM   1624 N N   . GLU A 1 220 ? 31.175 30.570 20.067 1.00 39.59  ? 505 GLU A N   1 
ATOM   1625 C CA  . GLU A 1 220 ? 31.777 29.541 20.892 1.00 39.76  ? 505 GLU A CA  1 
ATOM   1626 C C   . GLU A 1 220 ? 30.740 28.909 21.830 1.00 41.24  ? 505 GLU A C   1 
ATOM   1627 O O   . GLU A 1 220 ? 30.680 27.701 21.962 1.00 42.60  ? 505 GLU A O   1 
ATOM   1628 C CB  . GLU A 1 220 ? 32.933 30.135 21.690 1.00 40.24  ? 505 GLU A CB  1 
ATOM   1629 C CG  . GLU A 1 220 ? 34.185 30.284 20.859 1.00 40.64  ? 505 GLU A CG  1 
ATOM   1630 C CD  . GLU A 1 220 ? 35.148 31.293 21.420 1.00 41.79  ? 505 GLU A CD  1 
ATOM   1631 O OE1 . GLU A 1 220 ? 35.050 31.595 22.628 1.00 40.56  ? 505 GLU A OE1 1 
ATOM   1632 O OE2 . GLU A 1 220 ? 36.010 31.776 20.647 1.00 43.90  ? 505 GLU A OE2 1 
ATOM   1633 N N   . ILE A 1 221 ? 29.925 29.732 22.483 1.00 39.69  ? 506 ILE A N   1 
ATOM   1634 C CA  . ILE A 1 221 ? 28.897 29.214 23.373 1.00 38.41  ? 506 ILE A CA  1 
ATOM   1635 C C   . ILE A 1 221 ? 27.904 28.351 22.583 1.00 38.78  ? 506 ILE A C   1 
ATOM   1636 O O   . ILE A 1 221 ? 27.374 27.375 23.088 1.00 39.91  ? 506 ILE A O   1 
ATOM   1637 C CB  . ILE A 1 221 ? 28.173 30.374 24.077 1.00 37.83  ? 506 ILE A CB  1 
ATOM   1638 C CG1 . ILE A 1 221 ? 29.136 31.029 25.071 1.00 39.12  ? 506 ILE A CG1 1 
ATOM   1639 C CG2 . ILE A 1 221 ? 26.928 29.893 24.747 1.00 31.42  ? 506 ILE A CG2 1 
ATOM   1640 C CD1 . ILE A 1 221 ? 28.650 32.368 25.627 1.00 42.83  ? 506 ILE A CD1 1 
ATOM   1641 N N   . ARG A 1 222 ? 27.671 28.711 21.329 1.00 39.73  ? 507 ARG A N   1 
ATOM   1642 C CA  . ARG A 1 222 ? 26.762 27.952 20.482 1.00 41.30  ? 507 ARG A CA  1 
ATOM   1643 C C   . ARG A 1 222 ? 27.360 26.561 20.208 1.00 41.87  ? 507 ARG A C   1 
ATOM   1644 O O   . ARG A 1 222 ? 26.671 25.558 20.322 1.00 42.98  ? 507 ARG A O   1 
ATOM   1645 C CB  . ARG A 1 222 ? 26.504 28.708 19.163 1.00 41.42  ? 507 ARG A CB  1 
ATOM   1646 C CG  . ARG A 1 222 ? 25.759 27.889 18.110 1.00 44.29  ? 507 ARG A CG  1 
ATOM   1647 C CD  . ARG A 1 222 ? 24.521 27.235 18.705 1.00 44.79  ? 507 ARG A CD  1 
ATOM   1648 N NE  . ARG A 1 222 ? 23.308 27.894 18.249 1.00 46.61  ? 507 ARG A NE  1 
ATOM   1649 C CZ  . ARG A 1 222 ? 22.095 27.697 18.761 1.00 48.86  ? 507 ARG A CZ  1 
ATOM   1650 N NH1 . ARG A 1 222 ? 21.903 26.859 19.770 1.00 49.38  ? 507 ARG A NH1 1 
ATOM   1651 N NH2 . ARG A 1 222 ? 21.057 28.326 18.237 1.00 51.13  ? 507 ARG A NH2 1 
ATOM   1652 N N   . ALA A 1 223 ? 28.645 26.522 19.866 1.00 39.71  ? 508 ALA A N   1 
ATOM   1653 C CA  . ALA A 1 223 ? 29.358 25.281 19.581 1.00 39.60  ? 508 ALA A CA  1 
ATOM   1654 C C   . ALA A 1 223 ? 29.440 24.330 20.789 1.00 39.58  ? 508 ALA A C   1 
ATOM   1655 O O   . ALA A 1 223 ? 29.076 23.164 20.709 1.00 39.63  ? 508 ALA A O   1 
ATOM   1656 C CB  . ALA A 1 223 ? 30.763 25.613 19.091 1.00 38.53  ? 508 ALA A CB  1 
ATOM   1657 N N   . ILE A 1 224 ? 29.942 24.831 21.904 1.00 39.23  ? 509 ILE A N   1 
ATOM   1658 C CA  . ILE A 1 224 ? 30.048 24.026 23.105 1.00 38.96  ? 509 ILE A CA  1 
ATOM   1659 C C   . ILE A 1 224 ? 28.691 23.439 23.453 1.00 40.74  ? 509 ILE A C   1 
ATOM   1660 O O   . ILE A 1 224 ? 28.597 22.287 23.822 1.00 40.97  ? 509 ILE A O   1 
ATOM   1661 C CB  . ILE A 1 224 ? 30.546 24.860 24.299 1.00 38.90  ? 509 ILE A CB  1 
ATOM   1662 C CG1 . ILE A 1 224 ? 31.993 25.299 24.062 1.00 40.97  ? 509 ILE A CG1 1 
ATOM   1663 C CG2 . ILE A 1 224 ? 30.430 24.059 25.581 1.00 38.25  ? 509 ILE A CG2 1 
ATOM   1664 C CD1 . ILE A 1 224 ? 32.643 25.991 25.258 1.00 40.88  ? 509 ILE A CD1 1 
ATOM   1665 N N   . SER A 1 225 ? 27.635 24.240 23.326 1.00 42.48  ? 510 SER A N   1 
ATOM   1666 C CA  . SER A 1 225 ? 26.295 23.761 23.634 1.00 44.92  ? 510 SER A CA  1 
ATOM   1667 C C   . SER A 1 225 ? 25.814 22.680 22.655 1.00 44.50  ? 510 SER A C   1 
ATOM   1668 O O   . SER A 1 225 ? 25.070 21.798 23.037 1.00 42.85  ? 510 SER A O   1 
ATOM   1669 C CB  . SER A 1 225 ? 25.308 24.933 23.676 1.00 45.37  ? 510 SER A CB  1 
ATOM   1670 O OG  . SER A 1 225 ? 25.298 25.634 22.447 1.00 52.62  ? 510 SER A OG  1 
ATOM   1671 N N   . MET A 1 226 ? 26.237 22.756 21.396 1.00 46.61  ? 511 MET A N   1 
ATOM   1672 C CA  . MET A 1 226 ? 25.863 21.735 20.409 1.00 49.45  ? 511 MET A CA  1 
ATOM   1673 C C   . MET A 1 226 ? 26.496 20.423 20.862 1.00 48.10  ? 511 MET A C   1 
ATOM   1674 O O   . MET A 1 226 ? 25.854 19.390 20.900 1.00 47.92  ? 511 MET A O   1 
ATOM   1675 C CB  . MET A 1 226 ? 26.425 22.069 19.027 1.00 52.68  ? 511 MET A CB  1 
ATOM   1676 C CG  . MET A 1 226 ? 25.885 23.324 18.407 1.00 59.48  ? 511 MET A CG  1 
ATOM   1677 S SD  . MET A 1 226 ? 24.201 23.094 17.932 1.00 69.63  ? 511 MET A SD  1 
ATOM   1678 C CE  . MET A 1 226 ? 24.440 22.419 16.216 1.00 66.35  ? 511 MET A CE  1 
ATOM   1679 N N   . GLN A 1 227 ? 27.783 20.500 21.184 1.00 45.95  ? 512 GLN A N   1 
ATOM   1680 C CA  . GLN A 1 227 ? 28.543 19.357 21.636 1.00 45.40  ? 512 GLN A CA  1 
ATOM   1681 C C   . GLN A 1 227 ? 27.923 18.781 22.901 1.00 45.22  ? 512 GLN A C   1 
ATOM   1682 O O   . GLN A 1 227 ? 27.695 17.574 22.986 1.00 45.22  ? 512 GLN A O   1 
ATOM   1683 C CB  . GLN A 1 227 ? 29.991 19.759 21.901 1.00 45.04  ? 512 GLN A CB  1 
ATOM   1684 C CG  . GLN A 1 227 ? 30.705 20.335 20.687 1.00 48.60  ? 512 GLN A CG  1 
ATOM   1685 C CD  . GLN A 1 227 ? 32.102 20.832 21.026 1.00 52.47  ? 512 GLN A CD  1 
ATOM   1686 O OE1 . GLN A 1 227 ? 32.370 21.244 22.148 1.00 52.97  ? 512 GLN A OE1 1 
ATOM   1687 N NE2 . GLN A 1 227 ? 32.994 20.810 20.044 1.00 55.93  ? 512 GLN A NE2 1 
ATOM   1688 N N   . ALA A 1 228 ? 27.644 19.640 23.877 1.00 42.42  ? 513 ALA A N   1 
ATOM   1689 C CA  . ALA A 1 228 ? 27.051 19.181 25.128 1.00 42.43  ? 513 ALA A CA  1 
ATOM   1690 C C   . ALA A 1 228 ? 25.754 18.407 24.907 1.00 41.40  ? 513 ALA A C   1 
ATOM   1691 O O   . ALA A 1 228 ? 25.482 17.492 25.623 1.00 40.27  ? 513 ALA A O   1 
ATOM   1692 C CB  . ALA A 1 228 ? 26.807 20.355 26.076 1.00 40.13  ? 513 ALA A CB  1 
ATOM   1693 N N   . GLU A 1 229 ? 24.966 18.788 23.903 1.00 42.59  ? 514 GLU A N   1 
ATOM   1694 C CA  . GLU A 1 229 ? 23.714 18.091 23.620 1.00 43.43  ? 514 GLU A CA  1 
ATOM   1695 C C   . GLU A 1 229 ? 23.977 16.732 22.988 1.00 44.70  ? 514 GLU A C   1 
ATOM   1696 O O   . GLU A 1 229 ? 23.293 15.761 23.274 1.00 45.88  ? 514 GLU A O   1 
ATOM   1697 C CB  . GLU A 1 229 ? 22.846 18.885 22.659 1.00 43.13  ? 514 GLU A CB  1 
ATOM   1698 C CG  . GLU A 1 229 ? 22.408 20.211 23.162 1.00 47.00  ? 514 GLU A CG  1 
ATOM   1699 C CD  . GLU A 1 229 ? 21.484 20.898 22.189 1.00 48.25  ? 514 GLU A CD  1 
ATOM   1700 O OE1 . GLU A 1 229 ? 21.142 22.067 22.428 1.00 52.95  ? 514 GLU A OE1 1 
ATOM   1701 O OE2 . GLU A 1 229 ? 21.094 20.271 21.186 1.00 51.08  ? 514 GLU A OE2 1 
ATOM   1702 N N   . GLU A 1 230 ? 24.954 16.676 22.094 1.00 43.69  ? 515 GLU A N   1 
ATOM   1703 C CA  . GLU A 1 230 ? 25.270 15.421 21.449 1.00 42.43  ? 515 GLU A CA  1 
ATOM   1704 C C   . GLU A 1 230 ? 25.817 14.437 22.461 1.00 41.70  ? 515 GLU A C   1 
ATOM   1705 O O   . GLU A 1 230 ? 25.495 13.270 22.421 1.00 40.43  ? 515 GLU A O   1 
ATOM   1706 C CB  . GLU A 1 230 ? 26.283 15.654 20.362 1.00 44.21  ? 515 GLU A CB  1 
ATOM   1707 C CG  . GLU A 1 230 ? 25.777 16.589 19.320 1.00 49.38  ? 515 GLU A CG  1 
ATOM   1708 C CD  . GLU A 1 230 ? 26.633 16.537 18.103 1.00 50.51  ? 515 GLU A CD  1 
ATOM   1709 O OE1 . GLU A 1 230 ? 27.872 16.618 18.270 1.00 51.95  ? 515 GLU A OE1 1 
ATOM   1710 O OE2 . GLU A 1 230 ? 26.070 16.409 16.999 1.00 51.13  ? 515 GLU A OE2 1 
ATOM   1711 N N   . TYR A 1 231 ? 26.656 14.941 23.361 1.00 40.19  ? 516 TYR A N   1 
ATOM   1712 C CA  . TYR A 1 231 ? 27.254 14.138 24.405 1.00 38.72  ? 516 TYR A CA  1 
ATOM   1713 C C   . TYR A 1 231 ? 26.186 13.654 25.355 1.00 39.42  ? 516 TYR A C   1 
ATOM   1714 O O   . TYR A 1 231 ? 26.258 12.559 25.838 1.00 39.26  ? 516 TYR A O   1 
ATOM   1715 C CB  . TYR A 1 231 ? 28.268 14.953 25.188 1.00 38.14  ? 516 TYR A CB  1 
ATOM   1716 C CG  . TYR A 1 231 ? 28.535 14.403 26.563 1.00 38.80  ? 516 TYR A CG  1 
ATOM   1717 C CD1 . TYR A 1 231 ? 29.485 13.408 26.775 1.00 39.29  ? 516 TYR A CD1 1 
ATOM   1718 C CD2 . TYR A 1 231 ? 27.829 14.880 27.659 1.00 40.51  ? 516 TYR A CD2 1 
ATOM   1719 C CE1 . TYR A 1 231 ? 29.725 12.909 28.048 1.00 41.06  ? 516 TYR A CE1 1 
ATOM   1720 C CE2 . TYR A 1 231 ? 28.057 14.391 28.926 1.00 41.93  ? 516 TYR A CE2 1 
ATOM   1721 C CZ  . TYR A 1 231 ? 29.002 13.408 29.117 1.00 42.64  ? 516 TYR A CZ  1 
ATOM   1722 O OH  . TYR A 1 231 ? 29.204 12.939 30.390 1.00 43.23  ? 516 TYR A OH  1 
ATOM   1723 N N   . LEU A 1 232 ? 25.200 14.498 25.627 1.00 41.59  ? 517 LEU A N   1 
ATOM   1724 C CA  . LEU A 1 232 ? 24.125 14.118 26.530 1.00 44.43  ? 517 LEU A CA  1 
ATOM   1725 C C   . LEU A 1 232 ? 23.163 13.138 25.856 1.00 46.28  ? 517 LEU A C   1 
ATOM   1726 O O   . LEU A 1 232 ? 22.563 12.308 26.519 1.00 46.94  ? 517 LEU A O   1 
ATOM   1727 C CB  . LEU A 1 232 ? 23.343 15.342 27.001 1.00 45.20  ? 517 LEU A CB  1 
ATOM   1728 C CG  . LEU A 1 232 ? 22.295 14.934 28.033 1.00 45.94  ? 517 LEU A CG  1 
ATOM   1729 C CD1 . LEU A 1 232 ? 22.992 14.678 29.365 1.00 47.28  ? 517 LEU A CD1 1 
ATOM   1730 C CD2 . LEU A 1 232 ? 21.237 16.015 28.163 1.00 48.93  ? 517 LEU A CD2 1 
ATOM   1731 N N   . TYR A 1 233 ? 23.013 13.239 24.538 1.00 46.86  ? 518 TYR A N   1 
ATOM   1732 C CA  . TYR A 1 233 ? 22.134 12.314 23.844 1.00 48.86  ? 518 TYR A CA  1 
ATOM   1733 C C   . TYR A 1 233 ? 22.783 10.932 23.904 1.00 48.07  ? 518 TYR A C   1 
ATOM   1734 O O   . TYR A 1 233 ? 22.121 9.925  24.113 1.00 47.78  ? 518 TYR A O   1 
ATOM   1735 C CB  . TYR A 1 233 ? 21.922 12.727 22.385 1.00 50.50  ? 518 TYR A CB  1 
ATOM   1736 C CG  . TYR A 1 233 ? 20.543 12.365 21.906 1.00 52.62  ? 518 TYR A CG  1 
ATOM   1737 C CD1 . TYR A 1 233 ? 20.006 11.115 22.179 1.00 55.32  ? 518 TYR A CD1 1 
ATOM   1738 C CD2 . TYR A 1 233 ? 19.751 13.285 21.240 1.00 55.49  ? 518 TYR A CD2 1 
ATOM   1739 C CE1 . TYR A 1 233 ? 18.713 10.790 21.810 1.00 56.25  ? 518 TYR A CE1 1 
ATOM   1740 C CE2 . TYR A 1 233 ? 18.449 12.968 20.863 1.00 58.23  ? 518 TYR A CE2 1 
ATOM   1741 C CZ  . TYR A 1 233 ? 17.940 11.717 21.154 1.00 57.71  ? 518 TYR A CZ  1 
ATOM   1742 O OH  . TYR A 1 233 ? 16.656 11.394 20.792 1.00 60.37  ? 518 TYR A OH  1 
ATOM   1743 N N   . TYR A 1 234 ? 24.096 10.908 23.714 1.00 47.70  ? 519 TYR A N   1 
ATOM   1744 C CA  . TYR A 1 234 ? 24.866 9.679  23.770 1.00 47.40  ? 519 TYR A CA  1 
ATOM   1745 C C   . TYR A 1 234 ? 24.684 9.006  25.134 1.00 48.46  ? 519 TYR A C   1 
ATOM   1746 O O   . TYR A 1 234 ? 24.388 7.820  25.204 1.00 50.39  ? 519 TYR A O   1 
ATOM   1747 C CB  . TYR A 1 234 ? 26.336 9.991  23.517 1.00 43.77  ? 519 TYR A CB  1 
ATOM   1748 C CG  . TYR A 1 234 ? 27.274 8.941  24.026 1.00 46.26  ? 519 TYR A CG  1 
ATOM   1749 C CD1 . TYR A 1 234 ? 27.241 7.644  23.530 1.00 48.53  ? 519 TYR A CD1 1 
ATOM   1750 C CD2 . TYR A 1 234 ? 28.205 9.246  25.000 1.00 44.90  ? 519 TYR A CD2 1 
ATOM   1751 C CE1 . TYR A 1 234 ? 28.117 6.688  23.993 1.00 48.38  ? 519 TYR A CE1 1 
ATOM   1752 C CE2 . TYR A 1 234 ? 29.066 8.315  25.464 1.00 46.10  ? 519 TYR A CE2 1 
ATOM   1753 C CZ  . TYR A 1 234 ? 29.031 7.037  24.964 1.00 48.16  ? 519 TYR A CZ  1 
ATOM   1754 O OH  . TYR A 1 234 ? 29.941 6.124  25.434 1.00 48.83  ? 519 TYR A OH  1 
ATOM   1755 N N   . LYS A 1 235 ? 24.849 9.771  26.211 1.00 47.35  ? 520 LYS A N   1 
ATOM   1756 C CA  . LYS A 1 235 ? 24.696 9.246  27.557 1.00 45.68  ? 520 LYS A CA  1 
ATOM   1757 C C   . LYS A 1 235 ? 23.287 8.689  27.764 1.00 46.88  ? 520 LYS A C   1 
ATOM   1758 O O   . LYS A 1 235 ? 23.096 7.699  28.473 1.00 45.97  ? 520 LYS A O   1 
ATOM   1759 C CB  . LYS A 1 235 ? 24.975 10.340 28.571 1.00 46.24  ? 520 LYS A CB  1 
ATOM   1760 C CG  . LYS A 1 235 ? 26.376 10.859 28.513 1.00 48.00  ? 520 LYS A CG  1 
ATOM   1761 C CD  . LYS A 1 235 ? 27.366 9.750  28.799 1.00 50.48  ? 520 LYS A CD  1 
ATOM   1762 C CE  . LYS A 1 235 ? 27.286 9.309  30.251 1.00 49.36  ? 520 LYS A CE  1 
ATOM   1763 N NZ  . LYS A 1 235 ? 28.356 8.332  30.583 1.00 52.99  ? 520 LYS A NZ  1 
ATOM   1764 N N   . HIS A 1 236 ? 22.302 9.330  27.146 1.00 45.74  ? 521 HIS A N   1 
ATOM   1765 C CA  . HIS A 1 236 ? 20.926 8.879  27.247 1.00 45.77  ? 521 HIS A CA  1 
ATOM   1766 C C   . HIS A 1 236 ? 20.657 7.598  26.438 1.00 45.76  ? 521 HIS A C   1 
ATOM   1767 O O   . HIS A 1 236 ? 19.835 6.765  26.807 1.00 45.45  ? 521 HIS A O   1 
ATOM   1768 C CB  . HIS A 1 236 ? 19.991 9.980  26.784 1.00 45.68  ? 521 HIS A CB  1 
ATOM   1769 C CG  . HIS A 1 236 ? 18.594 9.506  26.547 1.00 48.75  ? 521 HIS A CG  1 
ATOM   1770 N ND1 . HIS A 1 236 ? 18.124 9.179  25.294 1.00 51.42  ? 521 HIS A ND1 1 
ATOM   1771 C CD2 . HIS A 1 236 ? 17.578 9.274  27.407 1.00 48.25  ? 521 HIS A CD2 1 
ATOM   1772 C CE1 . HIS A 1 236 ? 16.872 8.767  25.392 1.00 52.40  ? 521 HIS A CE1 1 
ATOM   1773 N NE2 . HIS A 1 236 ? 16.517 8.814  26.662 1.00 52.32  ? 521 HIS A NE2 1 
ATOM   1774 N N   . LEU A 1 237 ? 21.339 7.456  25.314 1.00 46.79  ? 522 LEU A N   1 
ATOM   1775 C CA  . LEU A 1 237 ? 21.175 6.271  24.493 1.00 46.82  ? 522 LEU A CA  1 
ATOM   1776 C C   . LEU A 1 237 ? 21.904 5.110  25.173 1.00 48.22  ? 522 LEU A C   1 
ATOM   1777 O O   . LEU A 1 237 ? 21.512 3.965  25.045 1.00 48.29  ? 522 LEU A O   1 
ATOM   1778 C CB  . LEU A 1 237 ? 21.755 6.517  23.103 1.00 45.81  ? 522 LEU A CB  1 
ATOM   1779 C CG  . LEU A 1 237 ? 21.001 7.476  22.187 1.00 44.38  ? 522 LEU A CG  1 
ATOM   1780 C CD1 . LEU A 1 237 ? 21.889 7.874  21.025 1.00 45.37  ? 522 LEU A CD1 1 
ATOM   1781 C CD2 . LEU A 1 237 ? 19.746 6.819  21.695 1.00 42.99  ? 522 LEU A CD2 1 
ATOM   1782 N N   . ASN A 1 238 ? 22.968 5.433  25.901 1.00 49.89  ? 523 ASN A N   1 
ATOM   1783 C CA  . ASN A 1 238 ? 23.764 4.446  26.618 1.00 50.71  ? 523 ASN A CA  1 
ATOM   1784 C C   . ASN A 1 238 ? 23.118 4.123  27.973 1.00 52.79  ? 523 ASN A C   1 
ATOM   1785 O O   . ASN A 1 238 ? 23.764 3.563  28.846 1.00 53.30  ? 523 ASN A O   1 
ATOM   1786 C CB  . ASN A 1 238 ? 25.177 4.997  26.826 1.00 50.41  ? 523 ASN A CB  1 
ATOM   1787 C CG  . ASN A 1 238 ? 26.170 3.932  27.233 1.00 52.11  ? 523 ASN A CG  1 
ATOM   1788 O OD1 . ASN A 1 238 ? 26.281 2.899  26.590 1.00 56.28  ? 523 ASN A OD1 1 
ATOM   1789 N ND2 . ASN A 1 238 ? 26.913 4.191  28.300 1.00 51.03  ? 523 ASN A ND2 1 
ATOM   1790 N N   . GLY A 1 239 ? 21.843 4.493  28.132 1.00 54.43  ? 524 GLY A N   1 
ATOM   1791 C CA  . GLY A 1 239 ? 21.106 4.256  29.365 1.00 54.83  ? 524 GLY A CA  1 
ATOM   1792 C C   . GLY A 1 239 ? 21.701 4.869  30.627 1.00 57.21  ? 524 GLY A C   1 
ATOM   1793 O O   . GLY A 1 239 ? 21.457 4.382  31.722 1.00 59.03  ? 524 GLY A O   1 
ATOM   1794 N N   . ASP A 1 240 ? 22.468 5.944  30.489 1.00 57.51  ? 525 ASP A N   1 
ATOM   1795 C CA  . ASP A 1 240 ? 23.110 6.573  31.641 1.00 57.11  ? 525 ASP A CA  1 
ATOM   1796 C C   . ASP A 1 240 ? 22.288 7.679  32.294 1.00 57.24  ? 525 ASP A C   1 
ATOM   1797 O O   . ASP A 1 240 ? 22.596 8.108  33.393 1.00 55.84  ? 525 ASP A O   1 
ATOM   1798 C CB  . ASP A 1 240 ? 24.460 7.166  31.232 1.00 57.70  ? 525 ASP A CB  1 
ATOM   1799 C CG  . ASP A 1 240 ? 25.511 6.113  30.928 1.00 59.25  ? 525 ASP A CG  1 
ATOM   1800 O OD1 . ASP A 1 240 ? 25.703 5.206  31.765 1.00 62.20  ? 525 ASP A OD1 1 
ATOM   1801 O OD2 . ASP A 1 240 ? 26.164 6.207  29.862 1.00 58.46  ? 525 ASP A OD2 1 
ATOM   1802 N N   . VAL A 1 241 ? 21.241 8.129  31.611 1.00 58.67  ? 526 VAL A N   1 
ATOM   1803 C CA  . VAL A 1 241 ? 20.418 9.221  32.103 1.00 59.94  ? 526 VAL A CA  1 
ATOM   1804 C C   . VAL A 1 241 ? 19.128 8.809  32.783 1.00 64.59  ? 526 VAL A C   1 
ATOM   1805 O O   . VAL A 1 241 ? 18.411 7.961  32.294 1.00 66.86  ? 526 VAL A O   1 
ATOM   1806 C CB  . VAL A 1 241 ? 20.077 10.164 30.956 1.00 57.17  ? 526 VAL A CB  1 
ATOM   1807 C CG1 . VAL A 1 241 ? 19.150 11.253 31.436 1.00 54.62  ? 526 VAL A CG1 1 
ATOM   1808 C CG2 . VAL A 1 241 ? 21.356 10.743 30.380 1.00 56.42  ? 526 VAL A CG2 1 
ATOM   1809 N N   . PRO A 1 242 ? 18.821 9.430  33.934 1.00 68.69  ? 527 PRO A N   1 
ATOM   1810 C CA  . PRO A 1 242 ? 17.618 9.170  34.732 1.00 70.98  ? 527 PRO A CA  1 
ATOM   1811 C C   . PRO A 1 242 ? 16.294 9.299  33.971 1.00 73.01  ? 527 PRO A C   1 
ATOM   1812 O O   . PRO A 1 242 ? 16.097 10.206 33.155 1.00 72.95  ? 527 PRO A O   1 
ATOM   1813 C CB  . PRO A 1 242 ? 17.739 10.183 35.865 1.00 71.91  ? 527 PRO A CB  1 
ATOM   1814 C CG  . PRO A 1 242 ? 19.232 10.249 36.075 1.00 71.84  ? 527 PRO A CG  1 
ATOM   1815 C CD  . PRO A 1 242 ? 19.736 10.339 34.651 1.00 69.88  ? 527 PRO A CD  1 
ATOM   1816 N N   . TYR A 1 243 ? 15.391 8.375  34.269 1.00 76.41  ? 528 TYR A N   1 
ATOM   1817 C CA  . TYR A 1 243 ? 14.069 8.301  33.660 1.00 79.06  ? 528 TYR A CA  1 
ATOM   1818 C C   . TYR A 1 243 ? 13.416 9.668  33.430 1.00 79.03  ? 528 TYR A C   1 
ATOM   1819 O O   . TYR A 1 243 ? 13.125 10.402 34.369 1.00 79.08  ? 528 TYR A O   1 
ATOM   1820 C CB  . TYR A 1 243 ? 13.172 7.407  34.535 1.00 83.25  ? 528 TYR A CB  1 
ATOM   1821 C CG  . TYR A 1 243 ? 11.862 6.979  33.903 1.00 87.73  ? 528 TYR A CG  1 
ATOM   1822 C CD1 . TYR A 1 243 ? 11.837 6.365  32.654 1.00 89.74  ? 528 TYR A CD1 1 
ATOM   1823 C CD2 . TYR A 1 243 ? 10.648 7.184  34.559 1.00 89.54  ? 528 TYR A CD2 1 
ATOM   1824 C CE1 . TYR A 1 243 ? 10.638 5.967  32.071 1.00 90.79  ? 528 TYR A CE1 1 
ATOM   1825 C CE2 . TYR A 1 243 ? 9.441  6.788  33.983 1.00 90.89  ? 528 TYR A CE2 1 
ATOM   1826 C CZ  . TYR A 1 243 ? 9.445  6.182  32.738 1.00 91.16  ? 528 TYR A CZ  1 
ATOM   1827 O OH  . TYR A 1 243 ? 8.259  5.798  32.151 1.00 91.68  ? 528 TYR A OH  1 
ATOM   1828 N N   . ASN A 1 244 ? 13.219 9.987  32.154 1.00 79.24  ? 529 ASN A N   1 
ATOM   1829 C CA  . ASN A 1 244 ? 12.588 11.221 31.673 1.00 78.94  ? 529 ASN A CA  1 
ATOM   1830 C C   . ASN A 1 244 ? 12.841 12.589 32.323 1.00 77.34  ? 529 ASN A C   1 
ATOM   1831 O O   . ASN A 1 244 ? 11.878 13.270 32.693 1.00 78.33  ? 529 ASN A O   1 
ATOM   1832 C CB  . ASN A 1 244 ? 11.063 11.021 31.584 1.00 81.39  ? 529 ASN A CB  1 
ATOM   1833 C CG  . ASN A 1 244 ? 10.412 10.737 32.941 1.00 82.46  ? 529 ASN A CG  1 
ATOM   1834 O OD1 . ASN A 1 244 ? 10.799 11.289 33.972 1.00 83.17  ? 529 ASN A OD1 1 
ATOM   1835 N ND2 . ASN A 1 244 ? 9.392  9.880  32.931 1.00 82.42  ? 529 ASN A ND2 1 
ATOM   1836 N N   . ASN A 1 245 ? 14.091 13.030 32.452 1.00 74.20  ? 530 ASN A N   1 
ATOM   1837 C CA  . ASN A 1 245 ? 14.290 14.354 33.042 1.00 71.17  ? 530 ASN A CA  1 
ATOM   1838 C C   . ASN A 1 245 ? 13.976 15.406 31.978 1.00 67.21  ? 530 ASN A C   1 
ATOM   1839 O O   . ASN A 1 245 ? 13.811 15.064 30.823 1.00 67.62  ? 530 ASN A O   1 
ATOM   1840 C CB  . ASN A 1 245 ? 15.715 14.531 33.609 1.00 72.85  ? 530 ASN A CB  1 
ATOM   1841 C CG  . ASN A 1 245 ? 16.799 14.487 32.552 1.00 72.81  ? 530 ASN A CG  1 
ATOM   1842 O OD1 . ASN A 1 245 ? 16.627 14.935 31.439 1.00 73.80  ? 530 ASN A OD1 1 
ATOM   1843 N ND2 . ASN A 1 245 ? 17.953 13.958 32.933 1.00 72.93  ? 530 ASN A ND2 1 
ATOM   1844 N N   . LEU A 1 246 ? 13.870 16.675 32.370 1.00 63.38  ? 531 LEU A N   1 
ATOM   1845 C CA  . LEU A 1 246 ? 13.546 17.743 31.415 1.00 57.92  ? 531 LEU A CA  1 
ATOM   1846 C C   . LEU A 1 246 ? 14.504 17.851 30.246 1.00 55.22  ? 531 LEU A C   1 
ATOM   1847 O O   . LEU A 1 246 ? 14.066 17.974 29.128 1.00 55.25  ? 531 LEU A O   1 
ATOM   1848 C CB  . LEU A 1 246 ? 13.473 19.123 32.102 1.00 57.64  ? 531 LEU A CB  1 
ATOM   1849 C CG  . LEU A 1 246 ? 13.401 20.334 31.138 1.00 56.05  ? 531 LEU A CG  1 
ATOM   1850 C CD1 . LEU A 1 246 ? 12.139 20.255 30.308 1.00 56.41  ? 531 LEU A CD1 1 
ATOM   1851 C CD2 . LEU A 1 246 ? 13.430 21.649 31.890 1.00 51.40  ? 531 LEU A CD2 1 
ATOM   1852 N N   . LEU A 1 247 ? 15.809 17.819 30.514 1.00 52.39  ? 532 LEU A N   1 
ATOM   1853 C CA  . LEU A 1 247 ? 16.796 17.937 29.449 1.00 50.36  ? 532 LEU A CA  1 
ATOM   1854 C C   . LEU A 1 247 ? 16.543 16.991 28.296 1.00 50.18  ? 532 LEU A C   1 
ATOM   1855 O O   . LEU A 1 247 ? 16.568 17.406 27.158 1.00 49.18  ? 532 LEU A O   1 
ATOM   1856 C CB  . LEU A 1 247 ? 18.213 17.726 29.977 1.00 51.46  ? 532 LEU A CB  1 
ATOM   1857 C CG  . LEU A 1 247 ? 18.942 19.024 30.335 1.00 52.97  ? 532 LEU A CG  1 
ATOM   1858 C CD1 . LEU A 1 247 ? 18.506 19.511 31.681 1.00 52.82  ? 532 LEU A CD1 1 
ATOM   1859 C CD2 . LEU A 1 247 ? 20.421 18.792 30.350 1.00 52.89  ? 532 LEU A CD2 1 
ATOM   1860 N N   . ILE A 1 248 ? 16.302 15.719 28.599 1.00 50.58  ? 533 ILE A N   1 
ATOM   1861 C CA  . ILE A 1 248 ? 16.033 14.732 27.562 1.00 51.89  ? 533 ILE A CA  1 
ATOM   1862 C C   . ILE A 1 248 ? 14.741 15.071 26.828 1.00 56.01  ? 533 ILE A C   1 
ATOM   1863 O O   . ILE A 1 248 ? 14.632 14.835 25.620 1.00 55.13  ? 533 ILE A O   1 
ATOM   1864 C CB  . ILE A 1 248 ? 15.919 13.304 28.142 1.00 50.55  ? 533 ILE A CB  1 
ATOM   1865 C CG1 . ILE A 1 248 ? 17.243 12.890 28.781 1.00 49.28  ? 533 ILE A CG1 1 
ATOM   1866 C CG2 . ILE A 1 248 ? 15.592 12.320 27.030 1.00 49.58  ? 533 ILE A CG2 1 
ATOM   1867 C CD1 . ILE A 1 248 ? 18.413 12.909 27.821 1.00 48.66  ? 533 ILE A CD1 1 
ATOM   1868 N N   . GLU A 1 249 ? 13.760 15.616 27.558 1.00 59.20  ? 534 GLU A N   1 
ATOM   1869 C CA  . GLU A 1 249 ? 12.484 16.013 26.959 1.00 61.83  ? 534 GLU A CA  1 
ATOM   1870 C C   . GLU A 1 249 ? 12.658 17.238 26.073 1.00 61.73  ? 534 GLU A C   1 
ATOM   1871 O O   . GLU A 1 249 ? 11.825 17.499 25.225 1.00 63.18  ? 534 GLU A O   1 
ATOM   1872 C CB  . GLU A 1 249 ? 11.419 16.282 28.034 1.00 64.86  ? 534 GLU A CB  1 
ATOM   1873 C CG  . GLU A 1 249 ? 10.763 15.009 28.562 1.00 67.95  ? 534 GLU A CG  1 
ATOM   1874 C CD  . GLU A 1 249 ? 9.773  15.263 29.689 1.00 71.83  ? 534 GLU A CD  1 
ATOM   1875 O OE1 . GLU A 1 249 ? 8.744  15.948 29.448 1.00 69.37  ? 534 GLU A OE1 1 
ATOM   1876 O OE2 . GLU A 1 249 ? 10.034 14.763 30.816 1.00 71.67  ? 534 GLU A OE2 1 
ATOM   1877 N N   . MET A 1 250 ? 13.741 17.985 26.287 1.00 61.61  ? 535 MET A N   1 
ATOM   1878 C CA  . MET A 1 250 ? 14.043 19.150 25.462 1.00 62.54  ? 535 MET A CA  1 
ATOM   1879 C C   . MET A 1 250 ? 14.746 18.645 24.205 1.00 63.66  ? 535 MET A C   1 
ATOM   1880 O O   . MET A 1 250 ? 14.373 19.023 23.093 1.00 65.73  ? 535 MET A O   1 
ATOM   1881 C CB  . MET A 1 250 ? 14.948 20.138 26.201 1.00 61.83  ? 535 MET A CB  1 
ATOM   1882 C CG  . MET A 1 250 ? 14.273 20.892 27.352 1.00 61.71  ? 535 MET A CG  1 
ATOM   1883 S SD  . MET A 1 250 ? 12.923 22.011 26.851 1.00 59.71  ? 535 MET A SD  1 
ATOM   1884 C CE  . MET A 1 250 ? 13.815 23.195 25.885 1.00 56.04  ? 535 MET A CE  1 
ATOM   1885 N N   . LEU A 1 251 ? 15.756 17.790 24.386 1.00 63.70  ? 536 LEU A N   1 
ATOM   1886 C CA  . LEU A 1 251 ? 16.486 17.192 23.264 1.00 64.67  ? 536 LEU A CA  1 
ATOM   1887 C C   . LEU A 1 251 ? 15.503 16.543 22.281 1.00 67.13  ? 536 LEU A C   1 
ATOM   1888 O O   . LEU A 1 251 ? 15.771 16.476 21.091 1.00 68.51  ? 536 LEU A O   1 
ATOM   1889 C CB  . LEU A 1 251 ? 17.472 16.131 23.755 1.00 62.36  ? 536 LEU A CB  1 
ATOM   1890 C CG  . LEU A 1 251 ? 18.746 16.599 24.443 1.00 62.62  ? 536 LEU A CG  1 
ATOM   1891 C CD1 . LEU A 1 251 ? 19.488 15.415 25.023 1.00 62.61  ? 536 LEU A CD1 1 
ATOM   1892 C CD2 . LEU A 1 251 ? 19.611 17.328 23.442 1.00 63.26  ? 536 LEU A CD2 1 
ATOM   1893 N N   . HIS A 1 252 ? 14.381 16.037 22.790 1.00 69.31  ? 537 HIS A N   1 
ATOM   1894 C CA  . HIS A 1 252 ? 13.362 15.448 21.932 1.00 71.70  ? 537 HIS A CA  1 
ATOM   1895 C C   . HIS A 1 252 ? 12.633 16.621 21.258 1.00 74.10  ? 537 HIS A C   1 
ATOM   1896 O O   . HIS A 1 252 ? 11.704 17.205 21.834 1.00 73.50  ? 537 HIS A O   1 
ATOM   1897 C CB  . HIS A 1 252 ? 12.355 14.631 22.750 1.00 70.82  ? 537 HIS A CB  1 
ATOM   1898 C CG  . HIS A 1 252 ? 12.891 13.329 23.266 1.00 70.66  ? 537 HIS A CG  1 
ATOM   1899 N ND1 . HIS A 1 252 ? 13.851 12.601 22.601 1.00 70.39  ? 537 HIS A ND1 1 
ATOM   1900 C CD2 . HIS A 1 252 ? 12.528 12.583 24.340 1.00 70.73  ? 537 HIS A CD2 1 
ATOM   1901 C CE1 . HIS A 1 252 ? 14.056 11.458 23.238 1.00 71.11  ? 537 HIS A CE1 1 
ATOM   1902 N NE2 . HIS A 1 252 ? 13.265 11.423 24.294 1.00 69.94  ? 537 HIS A NE2 1 
ATOM   1903 N N   . ALA A 1 253 ? 13.075 16.968 20.050 1.00 76.34  ? 538 ALA A N   1 
ATOM   1904 C CA  . ALA A 1 253 ? 12.497 18.067 19.269 1.00 78.09  ? 538 ALA A CA  1 
ATOM   1905 C C   . ALA A 1 253 ? 13.371 18.365 18.045 1.00 78.72  ? 538 ALA A C   1 
ATOM   1906 O O   . ALA A 1 253 ? 14.105 19.375 18.090 1.00 78.33  ? 538 ALA A O   1 
ATOM   1907 C CB  . ALA A 1 253 ? 12.363 19.324 20.134 1.00 78.62  ? 538 ALA A CB  1 
ATOM   1908 N N   . ASN B 2 3   ? 6.435  19.549 22.285 1.00 63.20  ? 742 ASN B N   1 
ATOM   1909 C CA  . ASN B 2 3   ? 7.144  19.741 23.584 1.00 61.86  ? 742 ASN B CA  1 
ATOM   1910 C C   . ASN B 2 3   ? 6.155  20.146 24.670 1.00 58.76  ? 742 ASN B C   1 
ATOM   1911 O O   . ASN B 2 3   ? 6.000  21.320 24.952 1.00 58.08  ? 742 ASN B O   1 
ATOM   1912 C CB  . ASN B 2 3   ? 8.211  20.833 23.454 1.00 64.28  ? 742 ASN B CB  1 
ATOM   1913 C CG  . ASN B 2 3   ? 9.183  20.841 24.627 1.00 67.34  ? 742 ASN B CG  1 
ATOM   1914 O OD1 . ASN B 2 3   ? 8.784  20.718 25.785 1.00 71.00  ? 742 ASN B OD1 1 
ATOM   1915 N ND2 . ASN B 2 3   ? 10.466 20.989 24.329 1.00 66.74  ? 742 ASN B ND2 1 
ATOM   1916 N N   . ALA B 2 4   ? 5.506  19.163 25.285 1.00 56.04  ? 743 ALA B N   1 
ATOM   1917 C CA  . ALA B 2 4   ? 4.517  19.430 26.327 1.00 51.96  ? 743 ALA B CA  1 
ATOM   1918 C C   . ALA B 2 4   ? 5.075  20.070 27.588 1.00 49.49  ? 743 ALA B C   1 
ATOM   1919 O O   . ALA B 2 4   ? 4.519  21.045 28.081 1.00 48.92  ? 743 ALA B O   1 
ATOM   1920 C CB  . ALA B 2 4   ? 3.784  18.149 26.689 1.00 51.52  ? 743 ALA B CB  1 
ATOM   1921 N N   . LEU B 2 5   ? 6.170  19.514 28.106 1.00 49.83  ? 744 LEU B N   1 
ATOM   1922 C CA  . LEU B 2 5   ? 6.799  20.007 29.336 1.00 46.65  ? 744 LEU B CA  1 
ATOM   1923 C C   . LEU B 2 5   ? 7.180  21.469 29.295 1.00 45.20  ? 744 LEU B C   1 
ATOM   1924 O O   . LEU B 2 5   ? 6.885  22.212 30.222 1.00 41.74  ? 744 LEU B O   1 
ATOM   1925 C CB  . LEU B 2 5   ? 8.032  19.170 29.678 1.00 46.06  ? 744 LEU B CB  1 
ATOM   1926 C CG  . LEU B 2 5   ? 8.954  19.588 30.837 1.00 45.85  ? 744 LEU B CG  1 
ATOM   1927 C CD1 . LEU B 2 5   ? 8.215  20.088 32.076 1.00 40.25  ? 744 LEU B CD1 1 
ATOM   1928 C CD2 . LEU B 2 5   ? 9.768  18.363 31.186 1.00 48.96  ? 744 LEU B CD2 1 
ATOM   1929 N N   . LEU B 2 6   ? 7.857  21.872 28.226 1.00 44.70  ? 745 LEU B N   1 
ATOM   1930 C CA  . LEU B 2 6   ? 8.256  23.260 28.087 1.00 44.16  ? 745 LEU B CA  1 
ATOM   1931 C C   . LEU B 2 6   ? 7.004  24.151 28.067 1.00 46.08  ? 745 LEU B C   1 
ATOM   1932 O O   . LEU B 2 6   ? 6.965  25.197 28.735 1.00 45.83  ? 745 LEU B O   1 
ATOM   1933 C CB  . LEU B 2 6   ? 9.088  23.439 26.819 1.00 40.79  ? 745 LEU B CB  1 
ATOM   1934 C CG  . LEU B 2 6   ? 9.527  24.869 26.523 1.00 40.38  ? 745 LEU B CG  1 
ATOM   1935 C CD1 . LEU B 2 6   ? 10.264 25.443 27.712 1.00 36.90  ? 745 LEU B CD1 1 
ATOM   1936 C CD2 . LEU B 2 6   ? 10.398 24.876 25.273 1.00 42.60  ? 745 LEU B CD2 1 
ATOM   1937 N N   . ARG B 2 7   ? 5.977  23.749 27.315 1.00 48.56  ? 746 ARG B N   1 
ATOM   1938 C CA  . ARG B 2 7   ? 4.734  24.528 27.278 1.00 49.89  ? 746 ARG B CA  1 
ATOM   1939 C C   . ARG B 2 7   ? 4.194  24.644 28.700 1.00 50.67  ? 746 ARG B C   1 
ATOM   1940 O O   . ARG B 2 7   ? 3.799  25.726 29.132 1.00 50.99  ? 746 ARG B O   1 
ATOM   1941 C CB  . ARG B 2 7   ? 3.672  23.860 26.395 1.00 50.10  ? 746 ARG B CB  1 
ATOM   1942 C CG  . ARG B 2 7   ? 2.323  24.604 26.391 1.00 50.69  ? 746 ARG B CG  1 
ATOM   1943 C CD  . ARG B 2 7   ? 1.294  23.959 25.442 1.00 53.04  ? 746 ARG B CD  1 
ATOM   1944 N NE  . ARG B 2 7   ? 1.740  23.945 24.041 1.00 56.62  ? 746 ARG B NE  1 
ATOM   1945 C CZ  . ARG B 2 7   ? 1.803  25.017 23.244 1.00 57.31  ? 746 ARG B CZ  1 
ATOM   1946 N NH1 . ARG B 2 7   ? 1.443  26.221 23.684 1.00 56.36  ? 746 ARG B NH1 1 
ATOM   1947 N NH2 . ARG B 2 7   ? 2.252  24.889 22.001 1.00 56.38  ? 746 ARG B NH2 1 
ATOM   1948 N N   . TYR B 2 8   ? 4.179  23.522 29.422 1.00 50.14  ? 747 TYR B N   1 
ATOM   1949 C CA  . TYR B 2 8   ? 3.699  23.515 30.792 1.00 51.64  ? 747 TYR B CA  1 
ATOM   1950 C C   . TYR B 2 8   ? 4.423  24.560 31.661 1.00 52.54  ? 747 TYR B C   1 
ATOM   1951 O O   . TYR B 2 8   ? 3.791  25.344 32.347 1.00 52.88  ? 747 TYR B O   1 
ATOM   1952 C CB  . TYR B 2 8   ? 3.868  22.125 31.426 1.00 52.26  ? 747 TYR B CB  1 
ATOM   1953 C CG  . TYR B 2 8   ? 3.484  22.138 32.889 1.00 55.68  ? 747 TYR B CG  1 
ATOM   1954 C CD1 . TYR B 2 8   ? 2.151  22.191 33.276 1.00 56.21  ? 747 TYR B CD1 1 
ATOM   1955 C CD2 . TYR B 2 8   ? 4.448  22.278 33.878 1.00 56.62  ? 747 TYR B CD2 1 
ATOM   1956 C CE1 . TYR B 2 8   ? 1.793  22.405 34.594 1.00 57.68  ? 747 TYR B CE1 1 
ATOM   1957 C CE2 . TYR B 2 8   ? 4.093  22.494 35.208 1.00 57.63  ? 747 TYR B CE2 1 
ATOM   1958 C CZ  . TYR B 2 8   ? 2.766  22.565 35.555 1.00 58.06  ? 747 TYR B CZ  1 
ATOM   1959 O OH  . TYR B 2 8   ? 2.406  22.864 36.853 1.00 60.08  ? 747 TYR B OH  1 
ATOM   1960 N N   . LEU B 2 9   ? 5.753  24.568 31.618 1.00 52.77  ? 748 LEU B N   1 
ATOM   1961 C CA  . LEU B 2 9   ? 6.546  25.489 32.430 1.00 53.10  ? 748 LEU B CA  1 
ATOM   1962 C C   . LEU B 2 9   ? 6.290  26.959 32.182 1.00 54.74  ? 748 LEU B C   1 
ATOM   1963 O O   . LEU B 2 9   ? 6.483  27.775 33.072 1.00 56.40  ? 748 LEU B O   1 
ATOM   1964 C CB  . LEU B 2 9   ? 8.040  25.222 32.237 1.00 52.34  ? 748 LEU B CB  1 
ATOM   1965 C CG  . LEU B 2 9   ? 8.543  23.832 32.603 1.00 50.49  ? 748 LEU B CG  1 
ATOM   1966 C CD1 . LEU B 2 9   ? 10.051 23.796 32.455 1.00 50.05  ? 748 LEU B CD1 1 
ATOM   1967 C CD2 . LEU B 2 9   ? 8.133  23.497 34.017 1.00 50.00  ? 748 LEU B CD2 1 
ATOM   1968 N N   . LEU B 2 10  ? 5.893  27.297 30.963 1.00 55.55  ? 749 LEU B N   1 
ATOM   1969 C CA  . LEU B 2 10  ? 5.623  28.682 30.607 1.00 56.86  ? 749 LEU B CA  1 
ATOM   1970 C C   . LEU B 2 10  ? 4.173  29.069 30.898 1.00 59.57  ? 749 LEU B C   1 
ATOM   1971 O O   . LEU B 2 10  ? 3.887  30.228 31.200 1.00 59.42  ? 749 LEU B O   1 
ATOM   1972 C CB  . LEU B 2 10  ? 5.946  28.911 29.125 1.00 54.70  ? 749 LEU B CB  1 
ATOM   1973 C CG  . LEU B 2 10  ? 7.426  28.947 28.728 1.00 51.08  ? 749 LEU B CG  1 
ATOM   1974 C CD1 . LEU B 2 10  ? 7.552  28.793 27.241 1.00 46.65  ? 749 LEU B CD1 1 
ATOM   1975 C CD2 . LEU B 2 10  ? 8.063  30.245 29.203 1.00 50.05  ? 749 LEU B CD2 1 
ATOM   1976 N N   . ASP B 2 11  ? 3.267  28.097 30.800 1.00 61.87  ? 750 ASP B N   1 
ATOM   1977 C CA  . ASP B 2 11  ? 1.853  28.331 31.068 1.00 65.19  ? 750 ASP B CA  1 
ATOM   1978 C C   . ASP B 2 11  ? 1.500  28.095 32.529 1.00 67.32  ? 750 ASP B C   1 
ATOM   1979 O O   . ASP B 2 11  ? 0.606  28.715 33.046 1.00 67.42  ? 750 ASP B O   1 
ATOM   1980 C CB  . ASP B 2 11  ? 0.965  27.428 30.198 1.00 66.94  ? 750 ASP B CB  1 
ATOM   1981 C CG  . ASP B 2 11  ? 0.842  27.926 28.766 1.00 67.53  ? 750 ASP B CG  1 
ATOM   1982 O OD1 . ASP B 2 11  ? 0.952  29.151 28.556 1.00 69.32  ? 750 ASP B OD1 1 
ATOM   1983 O OD2 . ASP B 2 11  ? 0.616  27.101 27.856 1.00 66.99  ? 750 ASP B OD2 1 
ATOM   1984 N N   . LYS B 2 12  ? 2.220  27.196 33.190 1.00 70.89  ? 751 LYS B N   1 
ATOM   1985 C CA  . LYS B 2 12  ? 1.950  26.879 34.588 1.00 74.22  ? 751 LYS B CA  1 
ATOM   1986 C C   . LYS B 2 12  ? 1.728  28.145 35.405 1.00 76.60  ? 751 LYS B C   1 
ATOM   1987 O O   . LYS B 2 12  ? 1.951  29.245 34.926 1.00 74.70  ? 751 LYS B O   1 
ATOM   1988 C CB  . LYS B 2 12  ? 3.108  26.082 35.208 1.00 74.30  ? 751 LYS B CB  1 
ATOM   1989 C CG  . LYS B 2 12  ? 4.183  26.958 35.845 1.00 74.64  ? 751 LYS B CG  1 
ATOM   1990 C CD  . LYS B 2 12  ? 5.184  26.162 36.673 1.00 75.04  ? 751 LYS B CD  1 
ATOM   1991 C CE  . LYS B 2 12  ? 6.105  27.110 37.439 1.00 76.44  ? 751 LYS B CE  1 
ATOM   1992 N NZ  . LYS B 2 12  ? 7.061  26.401 38.329 1.00 77.85  ? 751 LYS B NZ  1 
ATOM   1993 N N   . ASP B 2 13  ? 1.280  27.953 36.644 1.00 80.98  ? 752 ASP B N   1 
ATOM   1994 C CA  . ASP B 2 13  ? 1.018  29.028 37.600 1.00 84.46  ? 752 ASP B CA  1 
ATOM   1995 C C   . ASP B 2 13  ? 1.104  30.453 37.042 1.00 86.06  ? 752 ASP B C   1 
ATOM   1996 O O   . ASP B 2 13  ? 0.036  31.090 36.890 1.00 86.62  ? 752 ASP B O   1 
ATOM   1997 C CB  . ASP B 2 13  ? 1.973  28.880 38.788 1.00 85.33  ? 752 ASP B CB  1 
ATOM   1998 C CG  . ASP B 2 13  ? 1.937  30.072 39.712 1.00 87.69  ? 752 ASP B CG  1 
ATOM   1999 O OD1 . ASP B 2 13  ? 2.530  31.116 39.364 1.00 89.13  ? 752 ASP B OD1 1 
ATOM   2000 O OD2 . ASP B 2 13  ? 1.304  29.971 40.783 1.00 89.72  ? 752 ASP B OD2 1 
ATOM   2001 N N   . LYS C 2 1   ? -3.229 26.580 28.327 1.00 94.46  ? 740 LYS C N   1 
ATOM   2002 C CA  . LYS C 2 1   ? -4.520 26.579 27.576 1.00 94.00  ? 740 LYS C CA  1 
ATOM   2003 C C   . LYS C 2 1   ? -5.375 25.371 27.969 1.00 93.36  ? 740 LYS C C   1 
ATOM   2004 O O   . LYS C 2 1   ? -5.264 24.307 27.346 1.00 93.50  ? 740 LYS C O   1 
ATOM   2005 C CB  . LYS C 2 1   ? -4.242 26.563 26.072 1.00 94.48  ? 740 LYS C CB  1 
ATOM   2006 N N   . GLU C 2 2   ? -6.225 25.559 28.987 1.00 91.07  ? 741 GLU C N   1 
ATOM   2007 C CA  . GLU C 2 2   ? -7.111 24.520 29.529 1.00 88.08  ? 741 GLU C CA  1 
ATOM   2008 C C   . GLU C 2 2   ? -6.469 23.940 30.796 1.00 84.72  ? 741 GLU C C   1 
ATOM   2009 O O   . GLU C 2 2   ? -6.511 22.740 31.041 1.00 86.18  ? 741 GLU C O   1 
ATOM   2010 C CB  . GLU C 2 2   ? -7.342 23.421 28.472 1.00 90.63  ? 741 GLU C CB  1 
ATOM   2011 C CG  . GLU C 2 2   ? -7.791 22.045 28.985 1.00 93.57  ? 741 GLU C CG  1 
ATOM   2012 C CD  . GLU C 2 2   ? -6.798 20.942 28.621 1.00 94.46  ? 741 GLU C CD  1 
ATOM   2013 O OE1 . GLU C 2 2   ? -5.597 21.105 28.919 1.00 95.01  ? 741 GLU C OE1 1 
ATOM   2014 O OE2 . GLU C 2 2   ? -7.212 19.914 28.040 1.00 95.22  ? 741 GLU C OE2 1 
ATOM   2015 N N   . ASN C 2 3   ? -5.897 24.815 31.615 1.00 79.15  ? 742 ASN C N   1 
ATOM   2016 C CA  . ASN C 2 3   ? -5.205 24.385 32.823 1.00 74.07  ? 742 ASN C CA  1 
ATOM   2017 C C   . ASN C 2 3   ? -3.932 23.664 32.373 1.00 70.69  ? 742 ASN C C   1 
ATOM   2018 O O   . ASN C 2 3   ? -3.983 22.594 31.772 1.00 68.53  ? 742 ASN C O   1 
ATOM   2019 C CB  . ASN C 2 3   ? -6.067 23.440 33.661 1.00 73.27  ? 742 ASN C CB  1 
ATOM   2020 C CG  . ASN C 2 3   ? -5.374 23.012 34.943 1.00 73.17  ? 742 ASN C CG  1 
ATOM   2021 O OD1 . ASN C 2 3   ? -5.128 23.823 35.829 1.00 74.13  ? 742 ASN C OD1 1 
ATOM   2022 N ND2 . ASN C 2 3   ? -5.042 21.731 35.037 1.00 71.24  ? 742 ASN C ND2 1 
ATOM   2023 N N   . ALA C 2 4   ? -2.794 24.276 32.671 1.00 67.85  ? 743 ALA C N   1 
ATOM   2024 C CA  . ALA C 2 4   ? -1.488 23.756 32.290 1.00 65.20  ? 743 ALA C CA  1 
ATOM   2025 C C   . ALA C 2 4   ? -1.267 22.261 32.490 1.00 64.31  ? 743 ALA C C   1 
ATOM   2026 O O   . ALA C 2 4   ? -0.991 21.531 31.527 1.00 63.62  ? 743 ALA C O   1 
ATOM   2027 C CB  . ALA C 2 4   ? -0.412 24.532 33.019 1.00 65.62  ? 743 ALA C CB  1 
ATOM   2028 N N   . LEU C 2 5   ? -1.378 21.806 33.736 1.00 62.79  ? 744 LEU C N   1 
ATOM   2029 C CA  . LEU C 2 5   ? -1.159 20.399 34.058 1.00 61.82  ? 744 LEU C CA  1 
ATOM   2030 C C   . LEU C 2 5   ? -2.014 19.464 33.236 1.00 60.26  ? 744 LEU C C   1 
ATOM   2031 O O   . LEU C 2 5   ? -1.528 18.490 32.687 1.00 60.82  ? 744 LEU C O   1 
ATOM   2032 C CB  . LEU C 2 5   ? -1.419 20.135 35.544 1.00 63.08  ? 744 LEU C CB  1 
ATOM   2033 C CG  . LEU C 2 5   ? -1.115 18.705 36.004 1.00 63.01  ? 744 LEU C CG  1 
ATOM   2034 C CD1 . LEU C 2 5   ? 0.260  18.287 35.485 1.00 63.43  ? 744 LEU C CD1 1 
ATOM   2035 C CD2 . LEU C 2 5   ? -1.177 18.624 37.522 1.00 62.52  ? 744 LEU C CD2 1 
ATOM   2036 N N   . LEU C 2 6   ? -3.301 19.767 33.161 1.00 59.51  ? 745 LEU C N   1 
ATOM   2037 C CA  . LEU C 2 6   ? -4.225 18.938 32.410 1.00 59.03  ? 745 LEU C CA  1 
ATOM   2038 C C   . LEU C 2 6   ? -3.714 18.751 30.985 1.00 59.02  ? 745 LEU C C   1 
ATOM   2039 O O   . LEU C 2 6   ? -3.608 17.631 30.505 1.00 58.71  ? 745 LEU C O   1 
ATOM   2040 C CB  . LEU C 2 6   ? -5.609 19.584 32.414 1.00 58.54  ? 745 LEU C CB  1 
ATOM   2041 C CG  . LEU C 2 6   ? -6.751 18.662 32.006 1.00 58.82  ? 745 LEU C CG  1 
ATOM   2042 C CD1 . LEU C 2 6   ? -6.527 17.292 32.623 1.00 56.97  ? 745 LEU C CD1 1 
ATOM   2043 C CD2 . LEU C 2 6   ? -8.090 19.274 32.439 1.00 57.56  ? 745 LEU C CD2 1 
ATOM   2044 N N   . ARG C 2 7   ? -3.383 19.859 30.324 1.00 59.76  ? 746 ARG C N   1 
ATOM   2045 C CA  . ARG C 2 7   ? -2.876 19.810 28.959 1.00 59.86  ? 746 ARG C CA  1 
ATOM   2046 C C   . ARG C 2 7   ? -1.562 19.035 28.883 1.00 59.27  ? 746 ARG C C   1 
ATOM   2047 O O   . ARG C 2 7   ? -1.347 18.230 27.954 1.00 56.22  ? 746 ARG C O   1 
ATOM   2048 C CB  . ARG C 2 7   ? -2.659 21.220 28.409 1.00 62.90  ? 746 ARG C CB  1 
ATOM   2049 C CG  . ARG C 2 7   ? -2.229 21.198 26.953 1.00 67.23  ? 746 ARG C CG  1 
ATOM   2050 C CD  . ARG C 2 7   ? -2.239 22.570 26.305 1.00 71.08  ? 746 ARG C CD  1 
ATOM   2051 N NE  . ARG C 2 7   ? -1.950 22.459 24.877 1.00 74.95  ? 746 ARG C NE  1 
ATOM   2052 C CZ  . ARG C 2 7   ? -1.873 23.487 24.037 1.00 77.54  ? 746 ARG C CZ  1 
ATOM   2053 N NH1 . ARG C 2 7   ? -2.063 24.731 24.467 1.00 79.08  ? 746 ARG C NH1 1 
ATOM   2054 N NH2 . ARG C 2 7   ? -1.596 23.269 22.757 1.00 80.42  ? 746 ARG C NH2 1 
ATOM   2055 N N   . TYR C 2 8   ? -0.679 19.282 29.851 1.00 57.27  ? 747 TYR C N   1 
ATOM   2056 C CA  . TYR C 2 8   ? 0.595  18.588 29.887 1.00 55.83  ? 747 TYR C CA  1 
ATOM   2057 C C   . TYR C 2 8   ? 0.364  17.091 29.960 1.00 55.88  ? 747 TYR C C   1 
ATOM   2058 O O   . TYR C 2 8   ? 1.110  16.336 29.389 1.00 53.16  ? 747 TYR C O   1 
ATOM   2059 C CB  . TYR C 2 8   ? 1.418  19.020 31.094 1.00 57.05  ? 747 TYR C CB  1 
ATOM   2060 C CG  . TYR C 2 8   ? 2.682  18.204 31.252 1.00 58.50  ? 747 TYR C CG  1 
ATOM   2061 C CD1 . TYR C 2 8   ? 3.736  18.354 30.360 1.00 58.67  ? 747 TYR C CD1 1 
ATOM   2062 C CD2 . TYR C 2 8   ? 2.816  17.271 32.281 1.00 57.16  ? 747 TYR C CD2 1 
ATOM   2063 C CE1 . TYR C 2 8   ? 4.886  17.611 30.483 1.00 59.05  ? 747 TYR C CE1 1 
ATOM   2064 C CE2 . TYR C 2 8   ? 3.966  16.517 32.412 1.00 57.81  ? 747 TYR C CE2 1 
ATOM   2065 C CZ  . TYR C 2 8   ? 5.002  16.693 31.508 1.00 59.97  ? 747 TYR C CZ  1 
ATOM   2066 O OH  . TYR C 2 8   ? 6.171  15.967 31.615 1.00 60.56  ? 747 TYR C OH  1 
ATOM   2067 N N   . LEU C 2 9   ? -0.681 16.680 30.681 1.00 56.50  ? 748 LEU C N   1 
ATOM   2068 C CA  . LEU C 2 9   ? -1.011 15.265 30.832 1.00 59.37  ? 748 LEU C CA  1 
ATOM   2069 C C   . LEU C 2 9   ? -1.606 14.665 29.554 1.00 61.76  ? 748 LEU C C   1 
ATOM   2070 O O   . LEU C 2 9   ? -1.278 13.542 29.180 1.00 60.90  ? 748 LEU C O   1 
ATOM   2071 C CB  . LEU C 2 9   ? -1.970 15.074 32.013 1.00 58.71  ? 748 LEU C CB  1 
ATOM   2072 C CG  . LEU C 2 9   ? -1.387 15.361 33.403 1.00 56.82  ? 748 LEU C CG  1 
ATOM   2073 C CD1 . LEU C 2 9   ? -2.495 15.341 34.441 1.00 53.24  ? 748 LEU C CD1 1 
ATOM   2074 C CD2 . LEU C 2 9   ? -0.306 14.340 33.730 1.00 53.67  ? 748 LEU C CD2 1 
ATOM   2075 N N   . LEU C 2 10  ? -2.486 15.409 28.889 1.00 65.01  ? 749 LEU C N   1 
ATOM   2076 C CA  . LEU C 2 10  ? -3.071 14.936 27.634 1.00 68.78  ? 749 LEU C CA  1 
ATOM   2077 C C   . LEU C 2 10  ? -1.973 14.816 26.579 1.00 70.56  ? 749 LEU C C   1 
ATOM   2078 O O   . LEU C 2 10  ? -1.830 13.795 25.939 1.00 69.95  ? 749 LEU C O   1 
ATOM   2079 C CB  . LEU C 2 10  ? -4.133 15.918 27.114 1.00 69.67  ? 749 LEU C CB  1 
ATOM   2080 C CG  . LEU C 2 10  ? -5.587 15.818 27.577 1.00 70.34  ? 749 LEU C CG  1 
ATOM   2081 C CD1 . LEU C 2 10  ? -6.062 14.395 27.344 1.00 70.48  ? 749 LEU C CD1 1 
ATOM   2082 C CD2 . LEU C 2 10  ? -5.723 16.198 29.037 1.00 70.58  ? 749 LEU C CD2 1 
ATOM   2083 N N   . ASP C 2 11  ? -1.193 15.884 26.437 1.00 73.61  ? 750 ASP C N   1 
ATOM   2084 C CA  . ASP C 2 11  ? -0.123 15.971 25.452 1.00 77.27  ? 750 ASP C CA  1 
ATOM   2085 C C   . ASP C 2 11  ? 1.149  15.162 25.700 1.00 80.05  ? 750 ASP C C   1 
ATOM   2086 O O   . ASP C 2 11  ? 1.614  14.457 24.813 1.00 81.12  ? 750 ASP C O   1 
ATOM   2087 C CB  . ASP C 2 11  ? 0.259  17.443 25.241 1.00 76.37  ? 750 ASP C CB  1 
ATOM   2088 C CG  . ASP C 2 11  ? -0.859 18.258 24.594 1.00 77.75  ? 750 ASP C CG  1 
ATOM   2089 O OD1 . ASP C 2 11  ? -1.992 17.740 24.462 1.00 77.03  ? 750 ASP C OD1 1 
ATOM   2090 O OD2 . ASP C 2 11  ? -0.605 19.425 24.220 1.00 78.27  ? 750 ASP C OD2 1 
ATOM   2091 N N   . LYS C 2 12  ? 1.716  15.259 26.896 1.00 83.86  ? 751 LYS C N   1 
ATOM   2092 C CA  . LYS C 2 12  ? 2.962  14.557 27.183 1.00 88.16  ? 751 LYS C CA  1 
ATOM   2093 C C   . LYS C 2 12  ? 3.025  13.143 26.637 1.00 92.21  ? 751 LYS C C   1 
ATOM   2094 O O   . LYS C 2 12  ? 2.026  12.444 26.564 1.00 92.36  ? 751 LYS C O   1 
ATOM   2095 C CB  . LYS C 2 12  ? 3.250  14.526 28.687 1.00 86.35  ? 751 LYS C CB  1 
ATOM   2096 C CG  . LYS C 2 12  ? 2.426  13.534 29.476 1.00 85.11  ? 751 LYS C CG  1 
ATOM   2097 C CD  . LYS C 2 12  ? 3.101  13.264 30.807 1.00 84.75  ? 751 LYS C CD  1 
ATOM   2098 C CE  . LYS C 2 12  ? 4.521  12.756 30.583 1.00 83.95  ? 751 LYS C CE  1 
ATOM   2099 N NZ  . LYS C 2 12  ? 5.285  12.546 31.837 1.00 81.86  ? 751 LYS C NZ  1 
ATOM   2100 N N   . ASP C 2 13  ? 4.227  12.745 26.239 1.00 97.74  ? 752 ASP C N   1 
ATOM   2101 C CA  . ASP C 2 13  ? 4.479  11.411 25.711 1.00 104.14 ? 752 ASP C CA  1 
ATOM   2102 C C   . ASP C 2 13  ? 4.862  10.498 26.882 1.00 107.13 ? 752 ASP C C   1 
ATOM   2103 O O   . ASP C 2 13  ? 5.752  10.832 27.668 1.00 107.71 ? 752 ASP C O   1 
ATOM   2104 C CB  . ASP C 2 13  ? 5.607  11.460 24.668 1.00 106.46 ? 752 ASP C CB  1 
ATOM   2105 C CG  . ASP C 2 13  ? 6.882  12.128 25.195 1.00 109.20 ? 752 ASP C CG  1 
ATOM   2106 O OD1 . ASP C 2 13  ? 6.819  13.303 25.629 1.00 110.17 ? 752 ASP C OD1 1 
ATOM   2107 O OD2 . ASP C 2 13  ? 7.953  11.478 25.165 1.00 109.84 ? 752 ASP C OD2 1 
ATOM   2108 N N   . ASP C 2 14  ? 4.177  9.359  26.992 1.00 109.99 ? 753 ASP C N   1 
ATOM   2109 C CA  . ASP C 2 14  ? 4.400  8.388  28.069 1.00 112.51 ? 753 ASP C CA  1 
ATOM   2110 C C   . ASP C 2 14  ? 3.569  8.754  29.302 1.00 113.41 ? 753 ASP C C   1 
ATOM   2111 O O   . ASP C 2 14  ? 2.683  7.955  29.674 1.00 113.89 ? 753 ASP C O   1 
ATOM   2112 C CB  . ASP C 2 14  ? 5.887  8.314  28.457 1.00 113.97 ? 753 ASP C CB  1 
ATOM   2113 C CG  . ASP C 2 14  ? 6.738  7.607  27.411 1.00 115.55 ? 753 ASP C CG  1 
ATOM   2114 O OD1 . ASP C 2 14  ? 6.511  6.399  27.178 1.00 116.21 ? 753 ASP C OD1 1 
ATOM   2115 O OD2 . ASP C 2 14  ? 7.634  8.255  26.823 1.00 116.15 ? 753 ASP C OD2 1 
ATOM   2116 O OXT . ASP C 2 14  ? 3.805  9.838  29.880 1.00 114.11 ? 753 ASP C OXT 1 
HETATM 2117 C C1  . P6L D 3 .   ? 32.011 9.378  28.785 1.00 77.22  ? 100 P6L A C1  1 
HETATM 2118 C C2  . P6L D 3 .   ? 32.820 9.562  27.501 1.00 72.76  ? 100 P6L A C2  1 
HETATM 2119 O O3  . P6L D 3 .   ? 32.683 10.905 27.151 1.00 71.38  ? 100 P6L A O3  1 
HETATM 2120 O O4  . P6L D 3 .   ? 29.712 12.181 35.014 1.00 95.61  ? 100 P6L A O4  1 
HETATM 2121 C C5  . P6L D 3 .   ? 31.020 11.894 34.554 1.00 93.24  ? 100 P6L A C5  1 
HETATM 2122 C C6  . P6L D 3 .   ? 31.695 11.209 35.737 1.00 95.49  ? 100 P6L A C6  1 
HETATM 2123 C C7  . P6L D 3 .   ? 30.925 11.117 33.240 1.00 89.70  ? 100 P6L A C7  1 
HETATM 2124 O O8  . P6L D 3 .   ? 31.526 12.109 36.835 1.00 99.05  ? 100 P6L A O8  1 
HETATM 2125 O O9  . P6L D 3 .   ? 32.117 10.844 32.450 1.00 84.33  ? 100 P6L A O9  1 
HETATM 2126 O O10 . P6L D 3 .   ? 30.229 10.511 30.886 1.00 82.84  ? 100 P6L A O10 1 
HETATM 2127 P P11 . P6L D 3 .   ? 31.618 10.069 31.193 1.00 83.59  ? 100 P6L A P11 1 
HETATM 2128 O O12 . P6L D 3 .   ? 32.475 10.256 29.900 1.00 81.39  ? 100 P6L A O12 1 
HETATM 2129 O O13 . P6L D 3 .   ? 31.561 8.600  31.510 1.00 86.02  ? 100 P6L A O13 1 
HETATM 2130 C C14 . P6L D 3 .   ? 29.261 13.475 35.064 1.00 96.31  ? 100 P6L A C14 1 
HETATM 2131 O O15 . P6L D 3 .   ? 28.240 13.709 35.702 1.00 98.06  ? 100 P6L A O15 1 
HETATM 2132 C C16 . P6L D 3 .   ? 32.296 13.239 36.879 1.00 100.91 ? 100 P6L A C16 1 
HETATM 2133 O O17 . P6L D 3 .   ? 33.054 13.495 35.944 1.00 101.71 ? 100 P6L A O17 1 
HETATM 2134 C C18 . P6L D 3 .   ? 30.023 14.595 34.369 1.00 95.71  ? 100 P6L A C18 1 
HETATM 2135 C C19 . P6L D 3 .   ? 29.193 15.865 34.202 1.00 94.65  ? 100 P6L A C19 1 
HETATM 2136 C C20 . P6L D 3 .   ? 27.888 15.556 33.496 1.00 94.56  ? 100 P6L A C20 1 
HETATM 2137 C C21 . P6L D 3 .   ? 27.021 16.782 33.321 1.00 93.50  ? 100 P6L A C21 1 
HETATM 2138 C C22 . P6L D 3 .   ? 25.656 16.368 32.804 1.00 93.72  ? 100 P6L A C22 1 
HETATM 2139 C C23 . P6L D 3 .   ? 24.823 17.560 32.369 1.00 94.09  ? 100 P6L A C23 1 
HETATM 2140 C C24 . P6L D 3 .   ? 25.513 18.321 31.256 1.00 94.26  ? 100 P6L A C24 1 
HETATM 2141 C C25 . P6L D 3 .   ? 26.131 17.362 30.257 1.00 94.43  ? 100 P6L A C25 1 
HETATM 2142 C C26 . P6L D 3 .   ? 26.748 18.081 29.064 1.00 94.65  ? 100 P6L A C26 1 
HETATM 2143 C C27 . P6L D 3 .   ? 32.189 14.173 38.082 1.00 101.77 ? 100 P6L A C27 1 
HETATM 2144 C C28 . P6L D 3 .   ? 31.076 15.228 37.962 1.00 101.70 ? 100 P6L A C28 1 
HETATM 2145 C C29 . P6L D 3 .   ? 31.305 16.220 36.813 1.00 101.36 ? 100 P6L A C29 1 
HETATM 2146 C C30 . P6L D 3 .   ? 30.689 17.588 37.130 1.00 100.94 ? 100 P6L A C30 1 
HETATM 2147 C C31 . P6L D 3 .   ? 30.561 18.502 35.899 1.00 98.66  ? 100 P6L A C31 1 
HETATM 2148 C C32 . P6L D 3 .   ? 30.197 19.923 36.326 1.00 95.61  ? 100 P6L A C32 1 
HETATM 2149 C C33 . P6L D 3 .   ? 29.534 20.722 35.217 1.00 93.64  ? 100 P6L A C33 1 
HETATM 2150 C C34 . P6L D 3 .   ? 28.212 20.094 34.818 1.00 92.92  ? 100 P6L A C34 1 
HETATM 2151 C C35 . P6L D 3 .   ? 27.170 21.140 34.432 1.00 91.98  ? 100 P6L A C35 1 
HETATM 2152 C C36 . P6L D 3 .   ? 27.636 22.022 33.280 1.00 90.52  ? 100 P6L A C36 1 
HETATM 2153 C C37 . P6L D 3 .   ? 27.716 19.191 29.468 1.00 94.52  ? 100 P6L A C37 1 
HETATM 2154 C C38 . P6L D 3 .   ? 26.598 23.093 32.962 1.00 88.96  ? 100 P6L A C38 1 
HETATM 2155 C C39 . P6L D 3 .   ? 25.367 22.512 32.288 1.00 86.42  ? 100 P6L A C39 1 
HETATM 2156 C C40 . P6L D 3 .   ? 25.630 22.238 30.818 1.00 85.02  ? 100 P6L A C40 1 
HETATM 2157 C C41 . P6L D 3 .   ? 24.420 21.623 30.139 1.00 83.66  ? 100 P6L A C41 1 
HETATM 2158 C C42 . P6L D 3 .   ? 24.641 21.527 28.640 1.00 83.29  ? 100 P6L A C42 1 
HETATM 2159 C C43 . P6L D 3 .   ? 23.552 20.716 27.963 1.00 82.39  ? 100 P6L A C43 1 
HETATM 2160 C C44 . P6L D 3 .   ? 23.641 19.276 28.412 1.00 83.24  ? 100 P6L A C44 1 
HETATM 2161 C C45 . P6L D 3 .   ? 28.785 18.722 30.444 1.00 93.18  ? 100 P6L A C45 1 
HETATM 2162 C C46 . P6L D 3 .   ? 29.951 19.704 30.473 1.00 91.66  ? 100 P6L A C46 1 
HETATM 2163 C C47 . P6L D 3 .   ? 29.490 21.137 30.652 1.00 89.29  ? 100 P6L A C47 1 
HETATM 2164 C C48 . P6L D 3 .   ? 30.661 22.086 30.540 1.00 88.08  ? 100 P6L A C48 1 
HETATM 2165 C C49 . P6L D 3 .   ? 31.732 21.641 31.510 1.00 87.70  ? 100 P6L A C49 1 
HETATM 2166 C C50 . P6L D 3 .   ? 32.423 8.688  26.313 1.00 70.10  ? 100 P6L A C50 1 
HETATM 2167 O O51 . P6L D 3 .   ? 33.264 9.005  25.216 1.00 65.19  ? 100 P6L A O51 1 
HETATM 2168 O O   . HOH E 4 .   ? 24.243 12.378 20.370 1.00 35.95  ? 1   HOH A O   1 
HETATM 2169 O O   . HOH E 4 .   ? 21.226 31.830 20.199 1.00 33.09  ? 2   HOH A O   1 
HETATM 2170 O O   . HOH E 4 .   ? 24.250 26.098 34.101 1.00 39.91  ? 3   HOH A O   1 
HETATM 2171 O O   . HOH E 4 .   ? 28.498 36.976 17.446 1.00 40.30  ? 4   HOH A O   1 
HETATM 2172 O O   . HOH E 4 .   ? 16.943 31.630 20.970 1.00 42.38  ? 5   HOH A O   1 
HETATM 2173 O O   . HOH E 4 .   ? 26.197 23.169 38.132 1.00 43.88  ? 6   HOH A O   1 
HETATM 2174 O O   . HOH E 4 .   ? 25.862 32.086 17.585 1.00 42.84  ? 7   HOH A O   1 
HETATM 2175 O O   . HOH E 4 .   ? 15.662 8.697  21.479 1.00 46.16  ? 8   HOH A O   1 
HETATM 2176 O O   . HOH E 4 .   ? 23.146 37.560 37.522 1.00 43.70  ? 9   HOH A O   1 
HETATM 2177 O O   . HOH E 4 .   ? 19.247 41.123 40.454 1.00 47.32  ? 10  HOH A O   1 
HETATM 2178 O O   . HOH E 4 .   ? 30.154 3.744  24.633 1.00 47.39  ? 11  HOH A O   1 
HETATM 2179 O O   . HOH E 4 .   ? 42.575 39.191 21.480 1.00 46.41  ? 12  HOH A O   1 
HETATM 2180 O O   . HOH E 4 .   ? 13.103 27.242 17.592 1.00 47.90  ? 14  HOH A O   1 
HETATM 2181 O O   . HOH E 4 .   ? 39.548 26.481 36.803 1.00 48.30  ? 15  HOH A O   1 
HETATM 2182 O O   . HOH E 4 .   ? 23.901 7.165  35.981 1.00 46.08  ? 16  HOH A O   1 
HETATM 2183 O O   . HOH E 4 .   ? 34.231 32.170 45.306 1.00 47.71  ? 17  HOH A O   1 
HETATM 2184 O O   . HOH E 4 .   ? 19.073 33.084 34.799 1.00 48.65  ? 19  HOH A O   1 
HETATM 2185 O O   . HOH E 4 .   ? 20.567 25.700 22.809 1.00 46.22  ? 21  HOH A O   1 
HETATM 2186 O O   . HOH E 4 .   ? 13.587 10.021 29.263 1.00 49.95  ? 22  HOH A O   1 
HETATM 2187 O O   . HOH E 4 .   ? 29.129 28.341 16.618 1.00 51.39  ? 23  HOH A O   1 
HETATM 2188 O O   . HOH E 4 .   ? 14.142 7.663  22.772 1.00 53.02  ? 24  HOH A O   1 
HETATM 2189 O O   . HOH E 4 .   ? 16.302 6.819  23.264 1.00 54.52  ? 28  HOH A O   1 
HETATM 2190 O O   . HOH E 4 .   ? 14.281 11.786 37.085 1.00 56.59  ? 30  HOH A O   1 
HETATM 2191 O O   . HOH E 4 .   ? 40.776 36.463 24.310 1.00 56.33  ? 31  HOH A O   1 
HETATM 2192 O O   . HOH E 4 .   ? 10.123 47.211 21.683 1.00 54.18  ? 32  HOH A O   1 
HETATM 2193 O O   . HOH E 4 .   ? 27.723 25.386 15.965 1.00 56.03  ? 33  HOH A O   1 
HETATM 2194 O O   . HOH E 4 .   ? 1.007  38.746 18.179 1.00 55.50  ? 34  HOH A O   1 
HETATM 2195 O O   . HOH E 4 .   ? 11.677 8.886  53.008 1.00 54.48  ? 35  HOH A O   1 
HETATM 2196 O O   . HOH E 4 .   ? 26.211 33.572 38.081 1.00 54.09  ? 36  HOH A O   1 
HETATM 2197 O O   . HOH E 4 .   ? 41.247 30.768 25.110 1.00 56.49  ? 37  HOH A O   1 
HETATM 2198 O O   . HOH E 4 .   ? 17.353 4.742  25.689 1.00 58.33  ? 40  HOH A O   1 
HETATM 2199 O O   . HOH E 4 .   ? 4.581  37.198 20.442 1.00 57.20  ? 41  HOH A O   1 
HETATM 2200 O O   . HOH E 4 .   ? 22.737 24.163 20.505 1.00 59.26  ? 42  HOH A O   1 
HETATM 2201 O O   . HOH E 4 .   ? 24.181 23.439 36.002 1.00 57.63  ? 43  HOH A O   1 
HETATM 2202 O O   . HOH E 4 .   ? 41.701 42.060 28.467 1.00 56.59  ? 44  HOH A O   1 
HETATM 2203 O O   . HOH E 4 .   ? 26.425 31.720 46.245 1.00 59.28  ? 45  HOH A O   1 
HETATM 2204 O O   . HOH E 4 .   ? 24.336 35.685 38.585 1.00 59.00  ? 46  HOH A O   1 
HETATM 2205 O O   . HOH E 4 .   ? 19.485 24.002 20.679 1.00 57.09  ? 47  HOH A O   1 
HETATM 2206 O O   . HOH E 4 .   ? 26.856 29.995 15.590 1.00 61.60  ? 48  HOH A O   1 
HETATM 2207 O O   . HOH E 4 .   ? 37.871 37.388 20.590 1.00 61.05  ? 49  HOH A O   1 
HETATM 2208 O O   . HOH E 4 .   ? 40.383 38.427 20.903 1.00 62.19  ? 50  HOH A O   1 
HETATM 2209 O O   . HOH E 4 .   ? 35.850 38.442 37.035 1.00 62.12  ? 51  HOH A O   1 
HETATM 2210 O O   . HOH E 4 .   ? 24.260 25.800 49.070 1.00 61.15  ? 52  HOH A O   1 
HETATM 2211 O O   . HOH E 4 .   ? 20.998 31.116 17.153 1.00 65.07  ? 53  HOH A O   1 
HETATM 2212 O O   . HOH E 4 .   ? 17.003 9.293  30.365 1.00 62.43  ? 54  HOH A O   1 
HETATM 2213 O O   . HOH E 4 .   ? 5.036  33.898 29.901 1.00 62.97  ? 55  HOH A O   1 
HETATM 2214 O O   . HOH E 4 .   ? 25.550 30.663 41.022 1.00 63.28  ? 56  HOH A O   1 
HETATM 2215 O O   . HOH E 4 .   ? 11.975 43.620 35.251 1.00 63.82  ? 57  HOH A O   1 
HETATM 2216 O O   . HOH E 4 .   ? 36.219 27.279 37.482 1.00 62.76  ? 58  HOH A O   1 
HETATM 2217 O O   . HOH E 4 .   ? 23.687 33.400 36.858 1.00 63.93  ? 60  HOH A O   1 
HETATM 2218 O O   . HOH E 4 .   ? 45.484 49.275 27.009 1.00 65.44  ? 61  HOH A O   1 
HETATM 2219 O O   . HOH E 4 .   ? 41.700 42.480 25.927 1.00 66.63  ? 62  HOH A O   1 
HETATM 2220 O O   . HOH E 4 .   ? 30.328 53.899 31.071 1.00 65.60  ? 63  HOH A O   1 
HETATM 2221 O O   . HOH E 4 .   ? 19.842 50.545 24.182 1.00 65.60  ? 64  HOH A O   1 
HETATM 2222 O O   . HOH E 4 .   ? 21.664 34.148 35.601 1.00 65.44  ? 65  HOH A O   1 
HETATM 2223 O O   . HOH E 4 .   ? 13.539 13.021 39.731 1.00 68.18  ? 66  HOH A O   1 
HETATM 2224 O O   . HOH E 4 .   ? 27.980 24.904 37.607 1.00 67.61  ? 67  HOH A O   1 
HETATM 2225 O O   . HOH E 4 .   ? 11.784 17.811 34.205 1.00 66.27  ? 68  HOH A O   1 
HETATM 2226 O O   . HOH E 4 .   ? 24.808 52.019 20.343 1.00 67.82  ? 69  HOH A O   1 
HETATM 2227 O O   . HOH E 4 .   ? 7.771  45.067 17.224 1.00 64.05  ? 71  HOH A O   1 
HETATM 2228 O O   . HOH E 4 .   ? 39.269 51.831 30.102 1.00 68.73  ? 72  HOH A O   1 
HETATM 2229 O O   . HOH E 4 .   ? 22.300 27.563 51.294 1.00 69.64  ? 73  HOH A O   1 
HETATM 2230 O O   . HOH E 4 .   ? 21.222 30.148 37.704 1.00 65.98  ? 77  HOH A O   1 
HETATM 2231 O O   . HOH E 4 .   ? 43.854 56.860 22.740 1.00 74.90  ? 78  HOH A O   1 
HETATM 2232 O O   . HOH E 4 .   ? 34.712 7.248  24.429 1.00 77.88  ? 79  HOH A O   1 
HETATM 2233 O O   . HOH E 4 .   ? 28.361 4.319  31.266 1.00 82.41  ? 80  HOH A O   1 
HETATM 2234 O O   . HOH E 4 .   ? 15.207 33.625 42.473 1.00 80.24  ? 81  HOH A O   1 
HETATM 2235 O O   . HOH E 4 .   ? 28.908 7.774  34.157 1.00 79.06  ? 82  HOH A O   1 
HETATM 2236 O O   . HOH E 4 .   ? 5.529  36.904 31.625 1.00 86.14  ? 84  HOH A O   1 
HETATM 2237 O O   . HOH E 4 .   ? 30.369 6.303  28.952 1.00 81.44  ? 85  HOH A O   1 
HETATM 2238 O O   . HOH F 4 .   ? 1.477  21.449 28.348 1.00 48.31  ? 13  HOH B O   1 
HETATM 2239 O O   . HOH F 4 .   ? 4.035  19.873 21.125 1.00 49.06  ? 20  HOH B O   1 
HETATM 2240 O O   . HOH F 4 .   ? -0.618 27.071 39.632 1.00 54.03  ? 25  HOH B O   1 
HETATM 2241 O O   . HOH F 4 .   ? -0.957 28.074 25.132 1.00 52.84  ? 29  HOH B O   1 
HETATM 2242 O O   . HOH F 4 .   ? 2.851  21.683 22.667 1.00 55.68  ? 38  HOH B O   1 
HETATM 2243 O O   . HOH F 4 .   ? 1.148  25.521 38.352 1.00 65.38  ? 59  HOH B O   1 
HETATM 2244 O O   . HOH F 4 .   ? 1.751  21.106 24.974 1.00 85.05  ? 83  HOH B O   1 
HETATM 2245 O O   . HOH F 4 .   ? 8.592  17.967 26.756 1.00 91.18  ? 86  HOH B O   1 
HETATM 2246 O O   . HOH G 4 .   ? 1.815  11.123 22.543 1.00 50.57  ? 18  HOH C O   1 
HETATM 2247 O O   . HOH G 4 .   ? -4.860 19.715 25.512 1.00 53.97  ? 26  HOH C O   1 
HETATM 2248 O O   . HOH G 4 .   ? 2.141  9.150  24.755 1.00 53.86  ? 27  HOH C O   1 
HETATM 2249 O O   . HOH G 4 .   ? -0.081 12.095 24.182 1.00 56.98  ? 39  HOH C O   1 
HETATM 2250 O O   . HOH G 4 .   ? 7.546  11.020 31.126 1.00 72.49  ? 70  HOH C O   1 
HETATM 2251 O O   . HOH G 4 .   ? -1.398 11.481 26.462 1.00 75.45  ? 74  HOH C O   1 
HETATM 2252 O O   . HOH G 4 .   ? 6.707  16.101 26.196 1.00 73.28  ? 75  HOH C O   1 
HETATM 2253 O O   . HOH G 4 .   ? 0.498  11.317 28.324 1.00 72.12  ? 76  HOH C O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   286 ?   ?   ?   A . n 
A 1 2   LYS 2   287 ?   ?   ?   A . n 
A 1 3   LYS 3   288 ?   ?   ?   A . n 
A 1 4   HIS 4   289 ?   ?   ?   A . n 
A 1 5   HIS 5   290 ?   ?   ?   A . n 
A 1 6   HIS 6   291 ?   ?   ?   A . n 
A 1 7   HIS 7   292 ?   ?   ?   A . n 
A 1 8   HIS 8   293 ?   ?   ?   A . n 
A 1 9   HIS 9   294 ?   ?   ?   A . n 
A 1 10  LEU 10  295 ?   ?   ?   A . n 
A 1 11  VAL 11  296 ?   ?   ?   A . n 
A 1 12  PRO 12  297 ?   ?   ?   A . n 
A 1 13  ARG 13  298 ?   ?   ?   A . n 
A 1 14  GLY 14  299 ?   ?   ?   A . n 
A 1 15  SER 15  300 300 SER SER A . n 
A 1 16  ILE 16  301 301 ILE ILE A . n 
A 1 17  PRO 17  302 302 PRO PRO A . n 
A 1 18  HIS 18  303 303 HIS HIS A . n 
A 1 19  LEU 19  304 304 LEU LEU A . n 
A 1 20  ILE 20  305 305 ILE ILE A . n 
A 1 21  LEU 21  306 306 LEU LEU A . n 
A 1 22  GLU 22  307 307 GLU GLU A . n 
A 1 23  LEU 23  308 308 LEU LEU A . n 
A 1 24  LEU 24  309 309 LEU LEU A . n 
A 1 25  LYS 25  310 310 LYS LYS A . n 
A 1 26  CYS 26  311 311 CYS CYS A . n 
A 1 27  GLU 27  312 312 GLU GLU A . n 
A 1 28  PRO 28  313 313 PRO PRO A . n 
A 1 29  ASP 29  314 314 ASP ASP A . n 
A 1 30  GLU 30  315 315 GLU GLU A . n 
A 1 31  PRO 31  316 316 PRO PRO A . n 
A 1 32  GLN 32  317 317 GLN GLN A . n 
A 1 33  VAL 33  318 318 VAL VAL A . n 
A 1 34  GLN 34  319 319 GLN GLN A . n 
A 1 35  ALA 35  320 320 ALA ALA A . n 
A 1 36  LYS 36  321 321 LYS LYS A . n 
A 1 37  ILE 37  322 322 ILE ILE A . n 
A 1 38  MET 38  323 323 MET MET A . n 
A 1 39  ALA 39  324 324 ALA ALA A . n 
A 1 40  TYR 40  325 325 TYR TYR A . n 
A 1 41  LEU 41  326 326 LEU LEU A . n 
A 1 42  GLN 42  327 327 GLN GLN A . n 
A 1 43  GLN 43  328 328 GLN GLN A . n 
A 1 44  GLU 44  329 329 GLU GLU A . n 
A 1 45  GLN 45  330 330 GLN GLN A . n 
A 1 46  ALA 46  331 331 ALA ALA A . n 
A 1 47  ASN 47  332 332 ASN ASN A . n 
A 1 48  ARG 48  333 333 ARG ARG A . n 
A 1 49  SER 49  334 334 SER SER A . n 
A 1 50  LYS 50  335 ?   ?   ?   A . n 
A 1 51  HIS 51  336 ?   ?   ?   A . n 
A 1 52  GLU 52  337 ?   ?   ?   A . n 
A 1 53  LYS 53  338 338 LYS LYS A . n 
A 1 54  LEU 54  339 339 LEU LEU A . n 
A 1 55  SER 55  340 340 SER SER A . n 
A 1 56  THR 56  341 341 THR THR A . n 
A 1 57  PHE 57  342 342 PHE PHE A . n 
A 1 58  GLY 58  343 343 GLY GLY A . n 
A 1 59  LEU 59  344 344 LEU LEU A . n 
A 1 60  MET 60  345 345 MET MET A . n 
A 1 61  CYS 61  346 346 CYS CYS A . n 
A 1 62  LYS 62  347 347 LYS LYS A . n 
A 1 63  MET 63  348 348 MET MET A . n 
A 1 64  ALA 64  349 349 ALA ALA A . n 
A 1 65  ASP 65  350 350 ASP ASP A . n 
A 1 66  GLN 66  351 351 GLN GLN A . n 
A 1 67  THR 67  352 352 THR THR A . n 
A 1 68  LEU 68  353 353 LEU LEU A . n 
A 1 69  PHE 69  354 354 PHE PHE A . n 
A 1 70  SER 70  355 355 SER SER A . n 
A 1 71  ILE 71  356 356 ILE ILE A . n 
A 1 72  VAL 72  357 357 VAL VAL A . n 
A 1 73  GLU 73  358 358 GLU GLU A . n 
A 1 74  TRP 74  359 359 TRP TRP A . n 
A 1 75  ALA 75  360 360 ALA ALA A . n 
A 1 76  ARG 76  361 361 ARG ARG A . n 
A 1 77  SER 77  362 362 SER SER A . n 
A 1 78  SER 78  363 363 SER SER A . n 
A 1 79  ILE 79  364 364 ILE ILE A . n 
A 1 80  PHE 80  365 365 PHE PHE A . n 
A 1 81  PHE 81  366 366 PHE PHE A . n 
A 1 82  ARG 82  367 367 ARG ARG A . n 
A 1 83  GLU 83  368 368 GLU GLU A . n 
A 1 84  LEU 84  369 369 LEU LEU A . n 
A 1 85  LYS 85  370 370 LYS LYS A . n 
A 1 86  VAL 86  371 371 VAL VAL A . n 
A 1 87  ASP 87  372 372 ASP ASP A . n 
A 1 88  ASP 88  373 373 ASP ASP A . n 
A 1 89  GLN 89  374 374 GLN GLN A . n 
A 1 90  MET 90  375 375 MET MET A . n 
A 1 91  LYS 91  376 376 LYS LYS A . n 
A 1 92  LEU 92  377 377 LEU LEU A . n 
A 1 93  LEU 93  378 378 LEU LEU A . n 
A 1 94  GLN 94  379 379 GLN GLN A . n 
A 1 95  ASN 95  380 380 ASN ASN A . n 
A 1 96  CYS 96  381 381 CYS CYS A . n 
A 1 97  TRP 97  382 382 TRP TRP A . n 
A 1 98  SER 98  383 383 SER SER A . n 
A 1 99  GLU 99  384 384 GLU GLU A . n 
A 1 100 LEU 100 385 385 LEU LEU A . n 
A 1 101 LEU 101 386 386 LEU LEU A . n 
A 1 102 ILE 102 387 387 ILE ILE A . n 
A 1 103 LEU 103 388 388 LEU LEU A . n 
A 1 104 ASP 104 389 389 ASP ASP A . n 
A 1 105 HIS 105 390 390 HIS HIS A . n 
A 1 106 ILE 106 391 391 ILE ILE A . n 
A 1 107 TYR 107 392 392 TYR TYR A . n 
A 1 108 ARG 108 393 393 ARG ARG A . n 
A 1 109 GLN 109 394 394 GLN GLN A . n 
A 1 110 VAL 110 395 395 VAL VAL A . n 
A 1 111 VAL 111 396 396 VAL VAL A . n 
A 1 112 HIS 112 397 397 HIS HIS A . n 
A 1 113 GLY 113 398 398 GLY GLY A . n 
A 1 114 LYS 114 399 399 LYS ALA A . n 
A 1 115 GLU 115 400 400 GLU GLU A . n 
A 1 116 GLY 116 401 401 GLY GLY A . n 
A 1 117 SER 117 402 402 SER SER A . n 
A 1 118 ILE 118 403 403 ILE ILE A . n 
A 1 119 PHE 119 404 404 PHE PHE A . n 
A 1 120 LEU 120 405 405 LEU LEU A . n 
A 1 121 VAL 121 406 406 VAL VAL A . n 
A 1 122 THR 122 407 407 THR THR A . n 
A 1 123 GLY 123 408 408 GLY GLY A . n 
A 1 124 GLN 124 409 409 GLN GLN A . n 
A 1 125 GLN 125 410 410 GLN GLN A . n 
A 1 126 VAL 126 411 411 VAL VAL A . n 
A 1 127 ASP 127 412 412 ASP ASP A . n 
A 1 128 TYR 128 413 413 TYR TYR A . n 
A 1 129 SER 129 414 414 SER SER A . n 
A 1 130 ILE 130 415 415 ILE ILE A . n 
A 1 131 ILE 131 416 416 ILE ILE A . n 
A 1 132 ALA 132 417 417 ALA ALA A . n 
A 1 133 SER 133 418 418 SER SER A . n 
A 1 134 GLN 134 419 419 GLN GLN A . n 
A 1 135 ALA 135 420 420 ALA ALA A . n 
A 1 136 GLY 136 421 421 GLY GLY A . n 
A 1 137 ALA 137 422 422 ALA ALA A . n 
A 1 138 THR 138 423 423 THR THR A . n 
A 1 139 LEU 139 424 424 LEU LEU A . n 
A 1 140 ASN 140 425 425 ASN ASN A . n 
A 1 141 ASN 141 426 426 ASN ASN A . n 
A 1 142 LEU 142 427 427 LEU LEU A . n 
A 1 143 MET 143 428 428 MET MET A . n 
A 1 144 SER 144 429 429 SER SER A . n 
A 1 145 HIS 145 430 430 HIS HIS A . n 
A 1 146 ALA 146 431 431 ALA ALA A . n 
A 1 147 GLN 147 432 432 GLN ALA A . n 
A 1 148 GLU 148 433 433 GLU GLU A . n 
A 1 149 LEU 149 434 434 LEU LEU A . n 
A 1 150 VAL 150 435 435 VAL VAL A . n 
A 1 151 ALA 151 436 436 ALA ALA A . n 
A 1 152 LYS 152 437 437 LYS LYS A . n 
A 1 153 LEU 153 438 438 LEU LEU A . n 
A 1 154 ARG 154 439 439 ARG ARG A . n 
A 1 155 SER 155 440 440 SER SER A . n 
A 1 156 LEU 156 441 441 LEU LEU A . n 
A 1 157 GLN 157 442 442 GLN GLN A . n 
A 1 158 PHE 158 443 443 PHE PHE A . n 
A 1 159 ASP 159 444 444 ASP ASP A . n 
A 1 160 GLN 160 445 445 GLN GLN A . n 
A 1 161 ARG 161 446 446 ARG ARG A . n 
A 1 162 GLU 162 447 447 GLU GLU A . n 
A 1 163 PHE 163 448 448 PHE PHE A . n 
A 1 164 VAL 164 449 449 VAL VAL A . n 
A 1 165 CYS 165 450 450 CYS CYS A . n 
A 1 166 LEU 166 451 451 LEU LEU A . n 
A 1 167 LYS 167 452 452 LYS LYS A . n 
A 1 168 PHE 168 453 453 PHE PHE A . n 
A 1 169 LEU 169 454 454 LEU LEU A . n 
A 1 170 VAL 170 455 455 VAL VAL A . n 
A 1 171 LEU 171 456 456 LEU LEU A . n 
A 1 172 PHE 172 457 457 PHE PHE A . n 
A 1 173 SER 173 458 458 SER SER A . n 
A 1 174 LEU 174 459 459 LEU LEU A . n 
A 1 175 ASP 175 460 460 ASP ASP A . n 
A 1 176 VAL 176 461 461 VAL VAL A . n 
A 1 177 LYS 177 462 462 LYS LYS A . n 
A 1 178 ASN 178 463 463 ASN ASN A . n 
A 1 179 LEU 179 464 464 LEU LEU A . n 
A 1 180 GLU 180 465 465 GLU GLU A . n 
A 1 181 ASN 181 466 466 ASN ASN A . n 
A 1 182 PHE 182 467 467 PHE PHE A . n 
A 1 183 GLN 183 468 468 GLN GLN A . n 
A 1 184 LEU 184 469 469 LEU LEU A . n 
A 1 185 VAL 185 470 470 VAL VAL A . n 
A 1 186 GLU 186 471 471 GLU GLU A . n 
A 1 187 GLY 187 472 472 GLY GLY A . n 
A 1 188 VAL 188 473 473 VAL VAL A . n 
A 1 189 GLN 189 474 474 GLN GLN A . n 
A 1 190 GLU 190 475 475 GLU GLU A . n 
A 1 191 GLN 191 476 476 GLN GLN A . n 
A 1 192 VAL 192 477 477 VAL VAL A . n 
A 1 193 ASN 193 478 478 ASN ASN A . n 
A 1 194 ALA 194 479 479 ALA ALA A . n 
A 1 195 ALA 195 480 480 ALA ALA A . n 
A 1 196 LEU 196 481 481 LEU LEU A . n 
A 1 197 LEU 197 482 482 LEU LEU A . n 
A 1 198 ASP 198 483 483 ASP ASP A . n 
A 1 199 TYR 199 484 484 TYR TYR A . n 
A 1 200 THR 200 485 485 THR THR A . n 
A 1 201 MET 201 486 486 MET MET A . n 
A 1 202 CYS 202 487 487 CYS CYS A . n 
A 1 203 ASN 203 488 488 ASN ASN A . n 
A 1 204 TYR 204 489 489 TYR TYR A . n 
A 1 205 PRO 205 490 490 PRO PRO A . n 
A 1 206 GLN 206 491 491 GLN GLN A . n 
A 1 207 GLN 207 492 492 GLN GLN A . n 
A 1 208 THR 208 493 493 THR THR A . n 
A 1 209 GLU 209 494 494 GLU GLU A . n 
A 1 210 LYS 210 495 495 LYS LYS A . n 
A 1 211 PHE 211 496 496 PHE PHE A . n 
A 1 212 GLY 212 497 497 GLY GLY A . n 
A 1 213 GLN 213 498 498 GLN GLN A . n 
A 1 214 LEU 214 499 499 LEU LEU A . n 
A 1 215 LEU 215 500 500 LEU LEU A . n 
A 1 216 LEU 216 501 501 LEU LEU A . n 
A 1 217 ARG 217 502 502 ARG ARG A . n 
A 1 218 LEU 218 503 503 LEU LEU A . n 
A 1 219 PRO 219 504 504 PRO PRO A . n 
A 1 220 GLU 220 505 505 GLU GLU A . n 
A 1 221 ILE 221 506 506 ILE ILE A . n 
A 1 222 ARG 222 507 507 ARG ARG A . n 
A 1 223 ALA 223 508 508 ALA ALA A . n 
A 1 224 ILE 224 509 509 ILE ILE A . n 
A 1 225 SER 225 510 510 SER SER A . n 
A 1 226 MET 226 511 511 MET MET A . n 
A 1 227 GLN 227 512 512 GLN GLN A . n 
A 1 228 ALA 228 513 513 ALA ALA A . n 
A 1 229 GLU 229 514 514 GLU GLU A . n 
A 1 230 GLU 230 515 515 GLU GLU A . n 
A 1 231 TYR 231 516 516 TYR TYR A . n 
A 1 232 LEU 232 517 517 LEU LEU A . n 
A 1 233 TYR 233 518 518 TYR TYR A . n 
A 1 234 TYR 234 519 519 TYR TYR A . n 
A 1 235 LYS 235 520 520 LYS LYS A . n 
A 1 236 HIS 236 521 521 HIS HIS A . n 
A 1 237 LEU 237 522 522 LEU LEU A . n 
A 1 238 ASN 238 523 523 ASN ASN A . n 
A 1 239 GLY 239 524 524 GLY GLY A . n 
A 1 240 ASP 240 525 525 ASP ASP A . n 
A 1 241 VAL 241 526 526 VAL VAL A . n 
A 1 242 PRO 242 527 527 PRO PRO A . n 
A 1 243 TYR 243 528 528 TYR TYR A . n 
A 1 244 ASN 244 529 529 ASN ASN A . n 
A 1 245 ASN 245 530 530 ASN ASN A . n 
A 1 246 LEU 246 531 531 LEU LEU A . n 
A 1 247 LEU 247 532 532 LEU LEU A . n 
A 1 248 ILE 248 533 533 ILE ILE A . n 
A 1 249 GLU 249 534 534 GLU GLU A . n 
A 1 250 MET 250 535 535 MET MET A . n 
A 1 251 LEU 251 536 536 LEU LEU A . n 
A 1 252 HIS 252 537 537 HIS HIS A . n 
A 1 253 ALA 253 538 538 ALA ALA A . n 
A 1 254 LYS 254 539 ?   ?   ?   A . n 
A 1 255 ARG 255 540 ?   ?   ?   A . n 
A 1 256 ALA 256 541 ?   ?   ?   A . n 
B 2 1   LYS 1   740 ?   ?   ?   B . n 
B 2 2   GLU 2   741 ?   ?   ?   B . n 
B 2 3   ASN 3   742 742 ASN ASN B . n 
B 2 4   ALA 4   743 743 ALA ALA B . n 
B 2 5   LEU 5   744 744 LEU LEU B . n 
B 2 6   LEU 6   745 745 LEU LEU B . n 
B 2 7   ARG 7   746 746 ARG ARG B . n 
B 2 8   TYR 8   747 747 TYR TYR B . n 
B 2 9   LEU 9   748 748 LEU LEU B . n 
B 2 10  LEU 10  749 749 LEU LEU B . n 
B 2 11  ASP 11  750 750 ASP ASP B . n 
B 2 12  LYS 12  751 751 LYS LYS B . n 
B 2 13  ASP 13  752 752 ASP ASP B . n 
B 2 14  ASP 14  753 ?   ?   ?   B . n 
C 2 1   LYS 1   740 740 LYS ALA C . n 
C 2 2   GLU 2   741 741 GLU GLU C . n 
C 2 3   ASN 3   742 742 ASN ASN C . n 
C 2 4   ALA 4   743 743 ALA ALA C . n 
C 2 5   LEU 5   744 744 LEU LEU C . n 
C 2 6   LEU 6   745 745 LEU LEU C . n 
C 2 7   ARG 7   746 746 ARG ARG C . n 
C 2 8   TYR 8   747 747 TYR TYR C . n 
C 2 9   LEU 9   748 748 LEU LEU C . n 
C 2 10  LEU 10  749 749 LEU LEU C . n 
C 2 11  ASP 11  750 750 ASP ASP C . n 
C 2 12  LYS 12  751 751 LYS LYS C . n 
C 2 13  ASP 13  752 752 ASP ASP C . n 
C 2 14  ASP 14  753 753 ASP ASP C . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2005-07-19 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000  'data collection' . ? 1 
SCALEPACK 'data scaling'    . ? 2 
AMoRE     phasing           . ? 3 
CNS       refinement        . ? 4 
HKL-2000  'data reduction'  . ? 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PRO A 302 ? ? -44.58  175.16  
2  1 GLN A 330 ? ? -56.64  98.25   
3  1 ALA A 331 ? ? 175.00  53.18   
4  1 ASN A 332 ? ? -175.99 29.46   
5  1 SER A 362 ? ? -117.99 51.75   
6  1 PHE A 365 ? ? 84.51   -54.84  
7  1 LYS A 399 ? ? -143.39 -121.29 
8  1 GLN A 419 ? ? -109.55 61.83   
9  1 ASN A 466 ? ? -77.58  42.44   
10 1 TYR A 528 ? ? -38.79  115.18  
11 1 ASN A 529 ? ? 39.40   54.91   
12 1 LYS B 751 ? ? -44.83  170.41  
13 1 GLU C 741 ? ? 99.47   41.31   
14 1 ASN C 742 ? ? 69.59   112.66  
# 
_pdbx_validate_planes.id              1 
_pdbx_validate_planes.PDB_model_num   1 
_pdbx_validate_planes.auth_comp_id    TYR 
_pdbx_validate_planes.auth_asym_id    B 
_pdbx_validate_planes.auth_seq_id     747 
_pdbx_validate_planes.PDB_ins_code    ? 
_pdbx_validate_planes.label_alt_id    ? 
_pdbx_validate_planes.rmsd            0.072 
_pdbx_validate_planes.type            'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 399 ? CG  ? A LYS 114 CG  
2  1 Y 1 A LYS 399 ? CD  ? A LYS 114 CD  
3  1 Y 1 A LYS 399 ? CE  ? A LYS 114 CE  
4  1 Y 1 A LYS 399 ? NZ  ? A LYS 114 NZ  
5  1 Y 1 A GLN 432 ? CG  ? A GLN 147 CG  
6  1 Y 1 A GLN 432 ? CD  ? A GLN 147 CD  
7  1 Y 1 A GLN 432 ? OE1 ? A GLN 147 OE1 
8  1 Y 1 A GLN 432 ? NE2 ? A GLN 147 NE2 
9  1 Y 1 C LYS 740 ? CG  ? C LYS 1   CG  
10 1 Y 1 C LYS 740 ? CD  ? C LYS 1   CD  
11 1 Y 1 C LYS 740 ? CE  ? C LYS 1   CE  
12 1 Y 1 C LYS 740 ? NZ  ? C LYS 1   NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 286 ? A MET 1   
2  1 Y 1 A LYS 287 ? A LYS 2   
3  1 Y 1 A LYS 288 ? A LYS 3   
4  1 Y 1 A HIS 289 ? A HIS 4   
5  1 Y 1 A HIS 290 ? A HIS 5   
6  1 Y 1 A HIS 291 ? A HIS 6   
7  1 Y 1 A HIS 292 ? A HIS 7   
8  1 Y 1 A HIS 293 ? A HIS 8   
9  1 Y 1 A HIS 294 ? A HIS 9   
10 1 Y 1 A LEU 295 ? A LEU 10  
11 1 Y 1 A VAL 296 ? A VAL 11  
12 1 Y 1 A PRO 297 ? A PRO 12  
13 1 Y 1 A ARG 298 ? A ARG 13  
14 1 Y 1 A GLY 299 ? A GLY 14  
15 1 Y 1 A LYS 335 ? A LYS 50  
16 1 Y 1 A HIS 336 ? A HIS 51  
17 1 Y 1 A GLU 337 ? A GLU 52  
18 1 Y 1 A LYS 539 ? A LYS 254 
19 1 Y 1 A ARG 540 ? A ARG 255 
20 1 Y 1 A ALA 541 ? A ALA 256 
21 1 Y 1 B LYS 740 ? B LYS 1   
22 1 Y 1 B GLU 741 ? B GLU 2   
23 1 Y 1 B ASP 753 ? B ASP 14  
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 '(2S)-3-{[{[(2S)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-2-[(6E)-HEXADEC-6-ENOYLOXY]PROPYL (8E)-OCTADEC-8-ENOATE' P6L 
4 water                                                                                                                      HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 3 P6L 1  100 1  P6L PGL A . 
E 4 HOH 1  1   1  HOH HOH A . 
E 4 HOH 2  2   2  HOH HOH A . 
E 4 HOH 3  3   3  HOH HOH A . 
E 4 HOH 4  4   4  HOH HOH A . 
E 4 HOH 5  5   5  HOH HOH A . 
E 4 HOH 6  6   6  HOH HOH A . 
E 4 HOH 7  7   7  HOH HOH A . 
E 4 HOH 8  8   8  HOH HOH A . 
E 4 HOH 9  9   9  HOH HOH A . 
E 4 HOH 10 10  10 HOH HOH A . 
E 4 HOH 11 11  11 HOH HOH A . 
E 4 HOH 12 12  12 HOH HOH A . 
E 4 HOH 13 14  14 HOH HOH A . 
E 4 HOH 14 15  15 HOH HOH A . 
E 4 HOH 15 16  16 HOH HOH A . 
E 4 HOH 16 17  17 HOH HOH A . 
E 4 HOH 17 19  19 HOH HOH A . 
E 4 HOH 18 21  21 HOH HOH A . 
E 4 HOH 19 22  22 HOH HOH A . 
E 4 HOH 20 23  23 HOH HOH A . 
E 4 HOH 21 24  24 HOH HOH A . 
E 4 HOH 22 28  28 HOH HOH A . 
E 4 HOH 23 30  30 HOH HOH A . 
E 4 HOH 24 31  31 HOH HOH A . 
E 4 HOH 25 32  32 HOH HOH A . 
E 4 HOH 26 33  33 HOH HOH A . 
E 4 HOH 27 34  34 HOH HOH A . 
E 4 HOH 28 35  35 HOH HOH A . 
E 4 HOH 29 36  36 HOH HOH A . 
E 4 HOH 30 37  37 HOH HOH A . 
E 4 HOH 31 40  40 HOH HOH A . 
E 4 HOH 32 41  41 HOH HOH A . 
E 4 HOH 33 42  42 HOH HOH A . 
E 4 HOH 34 43  43 HOH HOH A . 
E 4 HOH 35 44  44 HOH HOH A . 
E 4 HOH 36 45  45 HOH HOH A . 
E 4 HOH 37 46  46 HOH HOH A . 
E 4 HOH 38 47  47 HOH HOH A . 
E 4 HOH 39 48  48 HOH HOH A . 
E 4 HOH 40 49  49 HOH HOH A . 
E 4 HOH 41 50  50 HOH HOH A . 
E 4 HOH 42 51  51 HOH HOH A . 
E 4 HOH 43 52  52 HOH HOH A . 
E 4 HOH 44 53  53 HOH HOH A . 
E 4 HOH 45 54  54 HOH HOH A . 
E 4 HOH 46 55  55 HOH HOH A . 
E 4 HOH 47 56  56 HOH HOH A . 
E 4 HOH 48 57  57 HOH HOH A . 
E 4 HOH 49 58  58 HOH HOH A . 
E 4 HOH 50 60  60 HOH HOH A . 
E 4 HOH 51 61  61 HOH HOH A . 
E 4 HOH 52 62  62 HOH HOH A . 
E 4 HOH 53 63  63 HOH HOH A . 
E 4 HOH 54 64  64 HOH HOH A . 
E 4 HOH 55 65  65 HOH HOH A . 
E 4 HOH 56 66  66 HOH HOH A . 
E 4 HOH 57 67  67 HOH HOH A . 
E 4 HOH 58 68  68 HOH HOH A . 
E 4 HOH 59 69  69 HOH HOH A . 
E 4 HOH 60 71  71 HOH HOH A . 
E 4 HOH 61 72  72 HOH HOH A . 
E 4 HOH 62 73  73 HOH HOH A . 
E 4 HOH 63 77  77 HOH HOH A . 
E 4 HOH 64 78  78 HOH HOH A . 
E 4 HOH 65 79  79 HOH HOH A . 
E 4 HOH 66 80  80 HOH HOH A . 
E 4 HOH 67 81  81 HOH HOH A . 
E 4 HOH 68 82  82 HOH HOH A . 
E 4 HOH 69 84  84 HOH HOH A . 
E 4 HOH 70 85  85 HOH HOH A . 
F 4 HOH 1  13  13 HOH HOH B . 
F 4 HOH 2  20  20 HOH HOH B . 
F 4 HOH 3  25  25 HOH HOH B . 
F 4 HOH 4  29  29 HOH HOH B . 
F 4 HOH 5  38  38 HOH HOH B . 
F 4 HOH 6  59  59 HOH HOH B . 
F 4 HOH 7  83  83 HOH HOH B . 
F 4 HOH 8  86  86 HOH HOH B . 
G 4 HOH 1  18  18 HOH HOH C . 
G 4 HOH 2  26  26 HOH HOH C . 
G 4 HOH 3  27  27 HOH HOH C . 
G 4 HOH 4  39  39 HOH HOH C . 
G 4 HOH 5  70  70 HOH HOH C . 
G 4 HOH 6  74  74 HOH HOH C . 
G 4 HOH 7  75  75 HOH HOH C . 
G 4 HOH 8  76  76 HOH HOH C . 
#