data_1ZN8
# 
_entry.id   1ZN8 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1ZN8         
RCSB  RCSB032919   
WWPDB D_1000032919 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1ORE 'Structure of human adenine phosphoribosyltransferase' unspecified 
PDB 1ZN7 'Same protein complexed with PRPP, ADE and R5P'        unspecified 
PDB 1ZN9 'Same protein in Apo and AMP Complexed Forms'          unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1ZN8 
_pdbx_database_status.recvd_initial_deposition_date   2005-05-11 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Iulek, J.'        1 
'Silva, M.'        2 
'Tomich, C.H.T.P.' 3 
'Thiemann, O.H.'   4 
# 
_citation.id                        primary 
_citation.title                     
'Structural Complexes of Human Adenine Phosphoribosyltransferase Reveal Novel Features of the APRT Catalytic Mechanism' 
_citation.journal_abbrev            J.Biomol.Struct.Dyn. 
_citation.journal_volume            25 
_citation.page_first                589 
_citation.page_last                 598 
_citation.year                      2008 
_citation.journal_id_ASTM           JBSDD6 
_citation.country                   US 
_citation.journal_id_ISSN           0739-1102 
_citation.journal_id_CSD            0646 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18399692 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Silva, C.H.'    1 
primary 'Silva, M.'      2 
primary 'Iulek, J.'      3 
primary 'Thiemann, O.H.' 4 
# 
_cell.entry_id           1ZN8 
_cell.length_a           47.060 
_cell.length_b           47.470 
_cell.length_c           47.840 
_cell.angle_alpha        75.41 
_cell.angle_beta         68.42 
_cell.angle_gamma        61.49 
_cell.Z_PDB              2 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         1ZN8 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Adenine phosphoribosyltransferase' 19629.727 2   2.4.2.7 ? ? ? 
2 non-polymer syn 'ADENOSINE MONOPHOSPHATE'           347.221   2   ?       ? ? ? 
3 non-polymer syn 'CHLORIDE ION'                      35.453    1   ?       ? ? ? 
4 water       nat water                               18.015    355 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        APRT 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MADSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHLKATHGGRIDYIAGLDSRGFLFGPSLAQELG
LGCVLIRKRGKLPGPTLWASYSLEYGKAELEIQKDALEPGQRVVVVDDLLATGGTMNAACELLGRLQAEVLECVSLVELT
SLKGREKLAPVPFFSLLQYE
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MADSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHLKATHGGRIDYIAGLDSRGFLFGPSLAQELG
LGCVLIRKRGKLPGPTLWASYSLEYGKAELEIQKDALEPGQRVVVVDDLLATGGTMNAACELLGRLQAEVLECVSLVELT
SLKGREKLAPVPFFSLLQYE
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   ASP n 
1 4   SER n 
1 5   GLU n 
1 6   LEU n 
1 7   GLN n 
1 8   LEU n 
1 9   VAL n 
1 10  GLU n 
1 11  GLN n 
1 12  ARG n 
1 13  ILE n 
1 14  ARG n 
1 15  SER n 
1 16  PHE n 
1 17  PRO n 
1 18  ASP n 
1 19  PHE n 
1 20  PRO n 
1 21  THR n 
1 22  PRO n 
1 23  GLY n 
1 24  VAL n 
1 25  VAL n 
1 26  PHE n 
1 27  ARG n 
1 28  ASP n 
1 29  ILE n 
1 30  SER n 
1 31  PRO n 
1 32  VAL n 
1 33  LEU n 
1 34  LYS n 
1 35  ASP n 
1 36  PRO n 
1 37  ALA n 
1 38  SER n 
1 39  PHE n 
1 40  ARG n 
1 41  ALA n 
1 42  ALA n 
1 43  ILE n 
1 44  GLY n 
1 45  LEU n 
1 46  LEU n 
1 47  ALA n 
1 48  ARG n 
1 49  HIS n 
1 50  LEU n 
1 51  LYS n 
1 52  ALA n 
1 53  THR n 
1 54  HIS n 
1 55  GLY n 
1 56  GLY n 
1 57  ARG n 
1 58  ILE n 
1 59  ASP n 
1 60  TYR n 
1 61  ILE n 
1 62  ALA n 
1 63  GLY n 
1 64  LEU n 
1 65  ASP n 
1 66  SER n 
1 67  ARG n 
1 68  GLY n 
1 69  PHE n 
1 70  LEU n 
1 71  PHE n 
1 72  GLY n 
1 73  PRO n 
1 74  SER n 
1 75  LEU n 
1 76  ALA n 
1 77  GLN n 
1 78  GLU n 
1 79  LEU n 
1 80  GLY n 
1 81  LEU n 
1 82  GLY n 
1 83  CYS n 
1 84  VAL n 
1 85  LEU n 
1 86  ILE n 
1 87  ARG n 
1 88  LYS n 
1 89  ARG n 
1 90  GLY n 
1 91  LYS n 
1 92  LEU n 
1 93  PRO n 
1 94  GLY n 
1 95  PRO n 
1 96  THR n 
1 97  LEU n 
1 98  TRP n 
1 99  ALA n 
1 100 SER n 
1 101 TYR n 
1 102 SER n 
1 103 LEU n 
1 104 GLU n 
1 105 TYR n 
1 106 GLY n 
1 107 LYS n 
1 108 ALA n 
1 109 GLU n 
1 110 LEU n 
1 111 GLU n 
1 112 ILE n 
1 113 GLN n 
1 114 LYS n 
1 115 ASP n 
1 116 ALA n 
1 117 LEU n 
1 118 GLU n 
1 119 PRO n 
1 120 GLY n 
1 121 GLN n 
1 122 ARG n 
1 123 VAL n 
1 124 VAL n 
1 125 VAL n 
1 126 VAL n 
1 127 ASP n 
1 128 ASP n 
1 129 LEU n 
1 130 LEU n 
1 131 ALA n 
1 132 THR n 
1 133 GLY n 
1 134 GLY n 
1 135 THR n 
1 136 MET n 
1 137 ASN n 
1 138 ALA n 
1 139 ALA n 
1 140 CYS n 
1 141 GLU n 
1 142 LEU n 
1 143 LEU n 
1 144 GLY n 
1 145 ARG n 
1 146 LEU n 
1 147 GLN n 
1 148 ALA n 
1 149 GLU n 
1 150 VAL n 
1 151 LEU n 
1 152 GLU n 
1 153 CYS n 
1 154 VAL n 
1 155 SER n 
1 156 LEU n 
1 157 VAL n 
1 158 GLU n 
1 159 LEU n 
1 160 THR n 
1 161 SER n 
1 162 LEU n 
1 163 LYS n 
1 164 GLY n 
1 165 ARG n 
1 166 GLU n 
1 167 LYS n 
1 168 LEU n 
1 169 ALA n 
1 170 PRO n 
1 171 VAL n 
1 172 PRO n 
1 173 PHE n 
1 174 PHE n 
1 175 SER n 
1 176 LEU n 
1 177 LEU n 
1 178 GLN n 
1 179 TYR n 
1 180 GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 APRT 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET29a 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    APT_HUMAN 
_struct_ref.pdbx_db_accession          P07741 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1ZN8 A 2 ? 180 ? P07741 1 ? 179 ? 2 180 
2 1 1ZN8 B 2 ? 180 ? P07741 1 ? 179 ? 2 180 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1ZN8 MET A 1 ? UNP P07741 ? ? 'CLONING ARTIFACT' 1 1 
2 1ZN8 MET B 1 ? UNP P07741 ? ? 'CLONING ARTIFACT' 1 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                   ? 'C3 H7 N O2'      89.093  
AMP non-polymer         . 'ADENOSINE MONOPHOSPHATE' ? 'C10 H14 N5 O7 P' 347.221 
ARG 'L-peptide linking' y ARGININE                  ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'           ? 'C4 H7 N O4'      133.103 
CL  non-polymer         . 'CHLORIDE ION'            ? 'Cl -1'           35.453  
CYS 'L-peptide linking' y CYSTEINE                  ? 'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking' y GLUTAMINE                 ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'           ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                   ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                 ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                     ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                   ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                    ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE             ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                   ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                    ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                 ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                  ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                    ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1ZN8 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.17 
_exptl_crystal.density_percent_sol   42.91 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.50 
_exptl_crystal_grow.pdbx_details    
;15.0 % (V/V) glycerol, 25.5 % (w/V) polyethylene glycol 4000, 0.17 mol/L sodium acetate and 0.085 mol/L Tris-HCl pH 8.5 , VAPOR DIFFUSION, HANGING DROP, temperature 291 K, pH 8.50
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_diffrn.id 
_diffrn.ambient_temp 
_diffrn.ambient_temp_details 
_diffrn.crystal_id 
1 ? ? 1 
2 ? ? 1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 1.5418 1.0 
2 1.4538 1.0 
# 
loop_
_diffrn_source.diffrn_id 
_diffrn_source.source 
_diffrn_source.type 
_diffrn_source.pdbx_synchrotron_site 
_diffrn_source.pdbx_synchrotron_beamline 
_diffrn_source.pdbx_wavelength 
_diffrn_source.pdbx_wavelength_list 
1 'ROTATING ANODE' RIGAKU                   ?    ?        ? 1.5418 
2 SYNCHROTRON      'LNLS BEAMLINE D03B-MX1' LNLS D03B-MX1 ? 1.4538 
# 
_reflns.entry_id                     1ZN8 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             44.000 
_reflns.d_resolution_high            1.760 
_reflns.number_obs                   31837 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_refine.entry_id                                 1ZN8 
_refine.ls_number_reflns_obs                     30208 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             44.00 
_refine.ls_d_res_high                            1.76 
_refine.ls_percent_reflns_obs                    95.5 
_refine.ls_R_factor_obs                          0.16 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.157 
_refine.ls_R_factor_R_free                       0.211 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.100 
_refine.ls_number_reflns_R_free                  1629 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.967 
_refine.correlation_coeff_Fo_to_Fc_free          0.939 
_refine.B_iso_mean                               17.51 
_refine.aniso_B[1][1]                            -0.48000 
_refine.aniso_B[2][2]                            -0.37000 
_refine.aniso_B[3][3]                            0.31000 
_refine.aniso_B[1][2]                            0.96000 
_refine.aniso_B[1][3]                            -0.34000 
_refine.aniso_B[2][3]                            -0.24000 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.123 
_refine.pdbx_overall_ESU_R_Free                  0.125 
_refine.overall_SU_ML                            0.088 
_refine.overall_SU_B                             5.533 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2717 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         47 
_refine_hist.number_atoms_solvent             355 
_refine_hist.number_atoms_total               3119 
_refine_hist.d_res_high                       1.76 
_refine_hist.d_res_low                        44.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.020  0.022  ? 2919 'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.007  0.020  ? 2801 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.932  2.025  ? 3966 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            0.962  3.000  ? 6499 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.317  5.000  ? 355  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       30.747 23.252 ? 123  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       15.397 15.000 ? 512  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       22.271 15.000 ? 26   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.133  0.200  ? 459  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.007  0.020  ? 3165 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.001  0.020  ? 584  'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.214  0.200  ? 561  'X-RAY DIFFRACTION' ? 
r_nbd_other                  0.203  0.200  ? 2792 'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.180  0.200  ? 1362 'X-RAY DIFFRACTION' ? 
r_nbtor_other                0.088  0.200  ? 1732 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.230  0.200  ? 282  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.284  0.200  ? 30   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         0.295  0.200  ? 92   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.219  0.200  ? 29   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  1.467  1.500  ? 1930 'X-RAY DIFFRACTION' ? 
r_mcbond_other               0.300  1.500  ? 730  'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.607  2.000  ? 2893 'X-RAY DIFFRACTION' ? 
r_scbond_it                  2.758  3.000  ? 1229 'X-RAY DIFFRACTION' ? 
r_scangle_it                 4.006  4.500  ? 1073 'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.76 
_refine_ls_shell.d_res_low                        1.81 
_refine_ls_shell.number_reflns_R_work             1683 
_refine_ls_shell.R_factor_R_work                  0.22 
_refine_ls_shell.percent_reflns_obs               72.22 
_refine_ls_shell.R_factor_R_free                  0.288 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             93 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1ZN8 
_struct.title                     
'Human Adenine Phosphoribosyltransferase Complexed with AMP, in Space Group P1 at 1.76 A Resolution' 
_struct.pdbx_descriptor           'Adenine phosphoribosyltransferase (E.C.2.4.2.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1ZN8 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'Glycosyltransferase, Purine salvage, TRANSFERASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 2 ? 
F N N 4 ? 
G N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 3   ? GLN A 11  ? ASP A 3   GLN A 11  1 ? 9  
HELX_P HELX_P2  2  ILE A 29  ? ASP A 35  ? ILE A 29  ASP A 35  1 ? 7  
HELX_P HELX_P3  3  ASP A 35  ? GLY A 55  ? ASP A 35  GLY A 55  1 ? 21 
HELX_P HELX_P4  4  ARG A 67  ? GLY A 80  ? ARG A 67  GLY A 80  1 ? 14 
HELX_P HELX_P5  5  GLY A 133 ? LEU A 146 ? GLY A 133 LEU A 146 1 ? 14 
HELX_P HELX_P6  6  LYS A 163 ? ALA A 169 ? LYS A 163 ALA A 169 1 ? 7  
HELX_P HELX_P7  7  ASP B 3   ? GLN B 11  ? ASP B 3   GLN B 11  1 ? 9  
HELX_P HELX_P8  8  ILE B 29  ? ASP B 35  ? ILE B 29  ASP B 35  1 ? 7  
HELX_P HELX_P9  9  ASP B 35  ? GLY B 55  ? ASP B 35  GLY B 55  1 ? 21 
HELX_P HELX_P10 10 SER B 66  ? LEU B 70  ? SER B 66  LEU B 70  5 ? 5  
HELX_P HELX_P11 11 PHE B 71  ? GLY B 80  ? PHE B 71  GLY B 80  1 ? 10 
HELX_P HELX_P12 12 ASP B 115 ? LEU B 117 ? ASP B 115 LEU B 117 5 ? 3  
HELX_P HELX_P13 13 GLY B 133 ? LEU B 146 ? GLY B 133 LEU B 146 1 ? 14 
HELX_P HELX_P14 14 LYS B 163 ? ALA B 169 ? LYS B 163 ALA B 169 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PHE 19  A . ? PHE 19  A PRO 20  A ? PRO 20  A 1 4.42  
2 ASP 65  A . ? ASP 65  A SER 66  A ? SER 66  A 1 4.45  
3 ALA 169 A . ? ALA 169 A PRO 170 A ? PRO 170 A 1 15.49 
4 PHE 19  B . ? PHE 19  B PRO 20  B ? PRO 20  B 1 -0.81 
5 ASP 65  B . ? ASP 65  B SER 66  B ? SER 66  B 1 -4.49 
6 ALA 169 B . ? ALA 169 B PRO 170 B ? PRO 170 B 1 11.40 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 7 ? 
C ? 2 ? 
D ? 7 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? parallel      
B 4 5 ? parallel      
B 5 6 ? parallel      
B 6 7 ? parallel      
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? parallel      
D 4 5 ? parallel      
D 5 6 ? parallel      
D 6 7 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ARG A 14  ? PRO A 17  ? ARG A 14  PRO A 17  
A 2 VAL A 25  ? ASP A 28  ? VAL A 25  ASP A 28  
B 1 THR A 96  ? LEU A 103 ? THR A 96  LEU A 103 
B 2 GLY A 106 ? GLN A 113 ? GLY A 106 GLN A 113 
B 3 GLY A 82  ? LYS A 88  ? GLY A 82  LYS A 88  
B 4 TYR A 60  ? LEU A 64  ? TYR A 60  LEU A 64  
B 5 ARG A 122 ? LEU A 130 ? ARG A 122 LEU A 130 
B 6 GLU A 149 ? LEU A 159 ? GLU A 149 LEU A 159 
B 7 PHE A 173 ? TYR A 179 ? PHE A 173 TYR A 179 
C 1 ARG B 14  ? PRO B 17  ? ARG B 14  PRO B 17  
C 2 VAL B 25  ? ASP B 28  ? VAL B 25  ASP B 28  
D 1 THR B 96  ? LEU B 103 ? THR B 96  LEU B 103 
D 2 GLY B 106 ? GLN B 113 ? GLY B 106 GLN B 113 
D 3 GLY B 82  ? LYS B 88  ? GLY B 82  LYS B 88  
D 4 TYR B 60  ? LEU B 64  ? TYR B 60  LEU B 64  
D 5 ARG B 122 ? LEU B 130 ? ARG B 122 LEU B 130 
D 6 GLU B 149 ? LEU B 159 ? GLU B 149 LEU B 159 
D 7 PHE B 173 ? TYR B 179 ? PHE B 173 TYR B 179 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ARG A 14  ? N ARG A 14  O ASP A 28  ? O ASP A 28  
B 1 2 N ALA A 99  ? N ALA A 99  O LEU A 110 ? O LEU A 110 
B 2 3 O GLU A 111 ? O GLU A 111 N ARG A 87  ? N ARG A 87  
B 3 4 O VAL A 84  ? O VAL A 84  N ILE A 61  ? N ILE A 61  
B 4 5 N ALA A 62  ? N ALA A 62  O VAL A 126 ? O VAL A 126 
B 5 6 N VAL A 125 ? N VAL A 125 O VAL A 154 ? O VAL A 154 
B 6 7 N GLU A 158 ? N GLU A 158 O TYR A 179 ? O TYR A 179 
C 1 2 N ARG B 14  ? N ARG B 14  O ASP B 28  ? O ASP B 28  
D 1 2 N TYR B 101 ? N TYR B 101 O ALA B 108 ? O ALA B 108 
D 2 3 O GLU B 111 ? O GLU B 111 N ARG B 87  ? N ARG B 87  
D 3 4 O VAL B 84  ? O VAL B 84  N ILE B 61  ? N ILE B 61  
D 4 5 N ALA B 62  ? N ALA B 62  O VAL B 124 ? O VAL B 124 
D 5 6 N VAL B 123 ? N VAL B 123 O GLU B 149 ? O GLU B 149 
D 6 7 N GLU B 158 ? N GLU B 158 O TYR B 179 ? O TYR B 179 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE CL B 1030'  
AC2 Software ? ? ? ? 20 'BINDING SITE FOR RESIDUE AMP A 1031' 
AC3 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE AMP B 1032' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 3  TRP B 98  ? TRP B 98   . ? 1_555 ? 
2  AC1 3  ARG B 145 ? ARG B 145  . ? 1_555 ? 
3  AC1 3  HOH G .   ? HOH B 1211 . ? 1_555 ? 
4  AC2 20 VAL A 25  ? VAL A 25   . ? 1_555 ? 
5  AC2 20 PHE A 26  ? PHE A 26   . ? 1_555 ? 
6  AC2 20 ARG A 27  ? ARG A 27   . ? 1_555 ? 
7  AC2 20 ARG A 67  ? ARG A 67   . ? 1_555 ? 
8  AC2 20 ASP A 127 ? ASP A 127  . ? 1_555 ? 
9  AC2 20 ASP A 128 ? ASP A 128  . ? 1_555 ? 
10 AC2 20 LEU A 129 ? LEU A 129  . ? 1_555 ? 
11 AC2 20 ALA A 131 ? ALA A 131  . ? 1_555 ? 
12 AC2 20 THR A 132 ? THR A 132  . ? 1_555 ? 
13 AC2 20 GLY A 133 ? GLY A 133  . ? 1_555 ? 
14 AC2 20 GLY A 134 ? GLY A 134  . ? 1_555 ? 
15 AC2 20 THR A 135 ? THR A 135  . ? 1_555 ? 
16 AC2 20 LEU A 159 ? LEU A 159  . ? 1_555 ? 
17 AC2 20 HOH F .   ? HOH A 1032 . ? 1_555 ? 
18 AC2 20 HOH F .   ? HOH A 1033 . ? 1_555 ? 
19 AC2 20 HOH F .   ? HOH A 1034 . ? 1_555 ? 
20 AC2 20 HOH F .   ? HOH A 1061 . ? 1_555 ? 
21 AC2 20 HOH F .   ? HOH A 1093 . ? 1_555 ? 
22 AC2 20 HOH F .   ? HOH A 1114 . ? 1_555 ? 
23 AC2 20 HOH F .   ? HOH A 1158 . ? 1_555 ? 
24 AC3 17 VAL B 25  ? VAL B 25   . ? 1_555 ? 
25 AC3 17 PHE B 26  ? PHE B 26   . ? 1_555 ? 
26 AC3 17 ARG B 27  ? ARG B 27   . ? 1_555 ? 
27 AC3 17 ARG B 67  ? ARG B 67   . ? 1_555 ? 
28 AC3 17 ASP B 127 ? ASP B 127  . ? 1_555 ? 
29 AC3 17 ASP B 128 ? ASP B 128  . ? 1_555 ? 
30 AC3 17 ALA B 131 ? ALA B 131  . ? 1_555 ? 
31 AC3 17 THR B 132 ? THR B 132  . ? 1_555 ? 
32 AC3 17 GLY B 133 ? GLY B 133  . ? 1_555 ? 
33 AC3 17 GLY B 134 ? GLY B 134  . ? 1_555 ? 
34 AC3 17 THR B 135 ? THR B 135  . ? 1_555 ? 
35 AC3 17 LEU B 159 ? LEU B 159  . ? 1_555 ? 
36 AC3 17 HOH G .   ? HOH B 1033 . ? 1_555 ? 
37 AC3 17 HOH G .   ? HOH B 1034 . ? 1_555 ? 
38 AC3 17 HOH G .   ? HOH B 1068 . ? 1_555 ? 
39 AC3 17 HOH G .   ? HOH B 1084 . ? 1_555 ? 
40 AC3 17 HOH G .   ? HOH B 1127 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1ZN8 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1ZN8 
_atom_sites.fract_transf_matrix[1][1]   0.021249 
_atom_sites.fract_transf_matrix[1][2]   -0.011542 
_atom_sites.fract_transf_matrix[1][3]   -0.007358 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.023973 
_atom_sites.fract_transf_matrix[2][3]   -0.002250 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.022577 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . ASP A 1 3   ? 42.660 -3.238  19.889  1.00 32.04 ? 3    ASP A N     1 
ATOM   2    C  CA    . ASP A 1 3   ? 41.285 -3.783  19.821  1.00 30.90 ? 3    ASP A CA    1 
ATOM   3    C  C     . ASP A 1 3   ? 41.177 -4.716  18.593  1.00 30.22 ? 3    ASP A C     1 
ATOM   4    O  O     . ASP A 1 3   ? 41.240 -4.285  17.447  1.00 30.21 ? 3    ASP A O     1 
ATOM   5    C  CB    . ASP A 1 3   ? 40.271 -2.620  19.777  1.00 30.88 ? 3    ASP A CB    1 
ATOM   6    C  CG    . ASP A 1 3   ? 38.845 -3.074  19.594  1.00 30.66 ? 3    ASP A CG    1 
ATOM   7    O  OD1   . ASP A 1 3   ? 38.627 -4.230  19.235  1.00 36.99 ? 3    ASP A OD1   1 
ATOM   8    O  OD2   . ASP A 1 3   ? 37.923 -2.266  19.814  1.00 26.42 ? 3    ASP A OD2   1 
ATOM   9    N  N     . SER A 1 4   ? 41.001 -5.995  18.843  1.00 29.81 ? 4    SER A N     1 
ATOM   10   C  CA    . SER A 1 4   ? 41.014 -6.982  17.762  1.00 29.66 ? 4    SER A CA    1 
ATOM   11   C  C     . SER A 1 4   ? 39.855 -6.792  16.790  1.00 28.40 ? 4    SER A C     1 
ATOM   12   O  O     . SER A 1 4   ? 40.046 -6.971  15.581  1.00 27.87 ? 4    SER A O     1 
ATOM   13   C  CB    . SER A 1 4   ? 41.014 -8.410  18.332  1.00 30.44 ? 4    SER A CB    1 
ATOM   14   O  OG    . SER A 1 4   ? 39.902 -8.593  19.158  1.00 30.60 ? 4    SER A OG    1 
ATOM   15   N  N     . GLU A 1 5   ? 38.669 -6.444  17.315  1.00 26.06 ? 5    GLU A N     1 
ATOM   16   C  CA    . GLU A 1 5   ? 37.526 -6.035  16.510  1.00 25.47 ? 5    GLU A CA    1 
ATOM   17   C  C     . GLU A 1 5   ? 37.839 -4.831  15.565  1.00 23.66 ? 5    GLU A C     1 
ATOM   18   O  O     . GLU A 1 5   ? 37.579 -4.888  14.372  1.00 22.52 ? 5    GLU A O     1 
ATOM   19   C  CB    A GLU A 1 5   ? 36.251 -5.704  17.383  0.65 25.76 ? 5    GLU A CB    1 
ATOM   20   C  CB    B GLU A 1 5   ? 36.364 -5.719  17.407  0.35 25.22 ? 5    GLU A CB    1 
ATOM   21   C  CG    A GLU A 1 5   ? 35.477 -6.887  18.127  0.65 27.08 ? 5    GLU A CG    1 
ATOM   22   C  CG    B GLU A 1 5   ? 35.094 -5.749  16.688  0.35 24.45 ? 5    GLU A CG    1 
ATOM   23   C  CD    A GLU A 1 5   ? 34.479 -6.434  19.284  0.65 29.03 ? 5    GLU A CD    1 
ATOM   24   C  CD    B GLU A 1 5   ? 33.951 -5.873  17.633  0.35 24.32 ? 5    GLU A CD    1 
ATOM   25   O  OE1   A GLU A 1 5   ? 34.539 -5.269  19.748  0.65 28.09 ? 5    GLU A OE1   1 
ATOM   26   O  OE1   B GLU A 1 5   ? 34.065 -5.302  18.727  0.35 24.28 ? 5    GLU A OE1   1 
ATOM   27   O  OE2   A GLU A 1 5   ? 33.622 -7.254  19.775  0.65 29.61 ? 5    GLU A OE2   1 
ATOM   28   O  OE2   B GLU A 1 5   ? 32.958 -6.544  17.287  0.35 24.15 ? 5    GLU A OE2   1 
ATOM   29   N  N     . LEU A 1 6   ? 38.450 -3.773  16.089  1.00 21.78 ? 6    LEU A N     1 
ATOM   30   C  CA    . LEU A 1 6   ? 38.776 -2.603  15.300  1.00 19.77 ? 6    LEU A CA    1 
ATOM   31   C  C     . LEU A 1 6   ? 39.896 -2.969  14.288  1.00 19.40 ? 6    LEU A C     1 
ATOM   32   O  O     . LEU A 1 6   ? 39.920 -2.496  13.168  1.00 19.19 ? 6    LEU A O     1 
ATOM   33   C  CB    . LEU A 1 6   ? 39.133 -1.420  16.203  1.00 21.15 ? 6    LEU A CB    1 
ATOM   34   C  CG    . LEU A 1 6   ? 39.435 -0.093  15.511  1.00 21.18 ? 6    LEU A CG    1 
ATOM   35   C  CD1   . LEU A 1 6   ? 38.223 0.331   14.669  1.00 21.69 ? 6    LEU A CD1   1 
ATOM   36   C  CD2   . LEU A 1 6   ? 39.875 1.018   16.453  1.00 20.63 ? 6    LEU A CD2   1 
ATOM   37   N  N     . GLN A 1 7   ? 40.823 -3.828  14.694  1.00 17.82 ? 7    GLN A N     1 
ATOM   38   C  CA    . GLN A 1 7   ? 41.848 -4.298  13.798  1.00 19.07 ? 7    GLN A CA    1 
ATOM   39   C  C     . GLN A 1 7   ? 41.252 -5.015  12.583  1.00 18.63 ? 7    GLN A C     1 
ATOM   40   O  O     . GLN A 1 7   ? 41.791 -4.923  11.482  1.00 19.72 ? 7    GLN A O     1 
ATOM   41   C  CB    . GLN A 1 7   ? 42.759 -5.277  14.521  1.00 18.80 ? 7    GLN A CB    1 
ATOM   42   C  CG    . GLN A 1 7   ? 43.990 -5.592  13.724  1.00 23.14 ? 7    GLN A CG    1 
ATOM   43   N  N     . LEU A 1 8   ? 40.167 -5.763  12.780  1.00 19.23 ? 8    LEU A N     1 
ATOM   44   C  CA    . LEU A 1 8   ? 39.480 -6.504  11.693  1.00 19.38 ? 8    LEU A CA    1 
ATOM   45   C  C     . LEU A 1 8   ? 38.986 -5.567  10.557  1.00 18.71 ? 8    LEU A C     1 
ATOM   46   O  O     . LEU A 1 8   ? 38.944 -5.967  9.349   1.00 19.01 ? 8    LEU A O     1 
ATOM   47   C  CB    . LEU A 1 8   ? 38.288 -7.304  12.286  1.00 21.22 ? 8    LEU A CB    1 
ATOM   48   C  CG    . LEU A 1 8   ? 38.205 -8.842  12.456  1.00 25.78 ? 8    LEU A CG    1 
ATOM   49   C  CD1   . LEU A 1 8   ? 39.567 -9.530  12.481  1.00 29.22 ? 8    LEU A CD1   1 
ATOM   50   C  CD2   . LEU A 1 8   ? 37.334 -9.273  13.629  1.00 24.33 ? 8    LEU A CD2   1 
ATOM   51   N  N     . VAL A 1 9   ? 38.629 -4.328  10.959  1.00 16.09 ? 9    VAL A N     1 
ATOM   52   C  CA    . VAL A 1 9   ? 38.172 -3.294  10.021  1.00 14.49 ? 9    VAL A CA    1 
ATOM   53   C  C     . VAL A 1 9   ? 39.367 -2.548  9.436   1.00 15.35 ? 9    VAL A C     1 
ATOM   54   O  O     . VAL A 1 9   ? 39.481 -2.348  8.213   1.00 16.12 ? 9    VAL A O     1 
ATOM   55   C  CB    . VAL A 1 9   ? 37.180 -2.286  10.745  1.00 13.56 ? 9    VAL A CB    1 
ATOM   56   C  CG1   . VAL A 1 9   ? 36.519 -1.374  9.728   1.00 16.11 ? 9    VAL A CG1   1 
ATOM   57   C  CG2   . VAL A 1 9   ? 36.155 -2.985  11.524  1.00 15.86 ? 9    VAL A CG2   1 
ATOM   58   N  N     . GLU A 1 10  ? 40.292 -2.151  10.292  1.00 16.41 ? 10   GLU A N     1 
ATOM   59   C  CA    . GLU A 1 10  ? 41.463 -1.437  9.850   1.00 18.04 ? 10   GLU A CA    1 
ATOM   60   C  C     . GLU A 1 10  ? 42.257 -2.222  8.778   1.00 17.99 ? 10   GLU A C     1 
ATOM   61   O  O     . GLU A 1 10  ? 42.705 -1.623  7.784   1.00 18.36 ? 10   GLU A O     1 
ATOM   62   C  CB    . GLU A 1 10  ? 42.369 -1.092  11.047  1.00 18.55 ? 10   GLU A CB    1 
ATOM   63   C  CG    . GLU A 1 10  ? 43.419 -0.076  10.633  1.00 21.55 ? 10   GLU A CG    1 
ATOM   64   C  CD    . GLU A 1 10  ? 44.468 0.204   11.668  1.00 29.28 ? 10   GLU A CD    1 
ATOM   65   O  OE1   . GLU A 1 10  ? 45.092 1.286   11.554  1.00 35.76 ? 10   GLU A OE1   1 
ATOM   66   O  OE2   . GLU A 1 10  ? 44.690 -0.649  12.581  1.00 36.56 ? 10   GLU A OE2   1 
ATOM   67   N  N     . GLN A 1 11  ? 42.445 -3.536  8.995   1.00 17.97 ? 11   GLN A N     1 
ATOM   68   C  CA    . GLN A 1 11  ? 43.183 -4.435  8.091   1.00 20.21 ? 11   GLN A CA    1 
ATOM   69   C  C     . GLN A 1 11  ? 42.523 -4.544  6.718   1.00 19.80 ? 11   GLN A C     1 
ATOM   70   O  O     . GLN A 1 11  ? 43.171 -4.943  5.770   1.00 20.59 ? 11   GLN A O     1 
ATOM   71   C  CB    . GLN A 1 11  ? 43.227 -5.868  8.641   1.00 20.94 ? 11   GLN A CB    1 
ATOM   72   C  CG    . GLN A 1 11  ? 44.153 -6.152  9.778   1.00 27.45 ? 11   GLN A CG    1 
ATOM   73   C  CD    . GLN A 1 11  ? 43.899 -7.581  10.350  1.00 32.64 ? 11   GLN A CD    1 
ATOM   74   O  OE1   . GLN A 1 11  ? 43.028 -8.339  9.851   1.00 38.28 ? 11   GLN A OE1   1 
ATOM   75   N  NE2   . GLN A 1 11  ? 44.625 -7.926  11.423  1.00 36.14 ? 11   GLN A NE2   1 
ATOM   76   N  N     . ARG A 1 12  ? 41.250 -4.170  6.610   1.00 18.36 ? 12   ARG A N     1 
ATOM   77   C  CA    . ARG A 1 12  ? 40.485 -4.287  5.387   1.00 18.95 ? 12   ARG A CA    1 
ATOM   78   C  C     . ARG A 1 12  ? 40.072 -2.938  4.758   1.00 20.28 ? 12   ARG A C     1 
ATOM   79   O  O     . ARG A 1 12  ? 39.095 -2.860  3.950   1.00 20.31 ? 12   ARG A O     1 
ATOM   80   C  CB    . ARG A 1 12  ? 39.243 -5.090  5.701   1.00 19.53 ? 12   ARG A CB    1 
ATOM   81   C  CG    . ARG A 1 12  ? 39.512 -6.463  6.152   1.00 21.29 ? 12   ARG A CG    1 
ATOM   82   C  CD    . ARG A 1 12  ? 39.806 -7.371  5.031   1.00 25.00 ? 12   ARG A CD    1 
ATOM   83   N  NE    . ARG A 1 12  ? 40.008 -8.723  5.541   1.00 27.58 ? 12   ARG A NE    1 
ATOM   84   C  CZ    . ARG A 1 12  ? 41.190 -9.269  5.854   1.00 32.01 ? 12   ARG A CZ    1 
ATOM   85   N  NH1   . ARG A 1 12  ? 42.358 -8.609  5.724   1.00 33.51 ? 12   ARG A NH1   1 
ATOM   86   N  NH2   . ARG A 1 12  ? 41.206 -10.501 6.333   1.00 34.14 ? 12   ARG A NH2   1 
ATOM   87   N  N     . ILE A 1 13  ? 40.771 -1.867  5.129   1.00 19.52 ? 13   ILE A N     1 
ATOM   88   C  CA    . ILE A 1 13  ? 40.684 -0.646  4.363   1.00 20.80 ? 13   ILE A CA    1 
ATOM   89   C  C     . ILE A 1 13  ? 41.913 -0.613  3.488   1.00 20.56 ? 13   ILE A C     1 
ATOM   90   O  O     . ILE A 1 13  ? 43.035 -0.764  3.968   1.00 21.74 ? 13   ILE A O     1 
ATOM   91   C  CB    . ILE A 1 13  ? 40.638 0.675   5.213   1.00 21.82 ? 13   ILE A CB    1 
ATOM   92   C  CG1   . ILE A 1 13  ? 39.685 0.589   6.429   1.00 25.24 ? 13   ILE A CG1   1 
ATOM   93   C  CG2   . ILE A 1 13  ? 40.284 1.892   4.295   1.00 23.44 ? 13   ILE A CG2   1 
ATOM   94   C  CD1   . ILE A 1 13  ? 38.226 0.637   6.131   1.00 25.20 ? 13   ILE A CD1   1 
ATOM   95   N  N     . ARG A 1 14  ? 41.673 -0.429  2.196   1.00 19.79 ? 14   ARG A N     1 
ATOM   96   C  CA    . ARG A 1 14  ? 42.689 -0.349  1.153   1.00 20.61 ? 14   ARG A CA    1 
ATOM   97   C  C     . ARG A 1 14  ? 42.782 1.052   0.636   1.00 18.33 ? 14   ARG A C     1 
ATOM   98   O  O     . ARG A 1 14  ? 41.778 1.655   0.369   1.00 17.93 ? 14   ARG A O     1 
ATOM   99   C  CB    . ARG A 1 14  ? 42.291 -1.205  -0.025  1.00 21.72 ? 14   ARG A CB    1 
ATOM   100  C  CG    . ARG A 1 14  ? 42.951 -2.515  -0.094  1.00 28.25 ? 14   ARG A CG    1 
ATOM   101  C  CD    . ARG A 1 14  ? 42.823 -3.046  -1.504  1.00 32.56 ? 14   ARG A CD    1 
ATOM   102  N  NE    . ARG A 1 14  ? 41.444 -3.027  -1.968  1.00 34.86 ? 14   ARG A NE    1 
ATOM   103  C  CZ    . ARG A 1 14  ? 40.997 -3.737  -2.999  1.00 36.29 ? 14   ARG A CZ    1 
ATOM   104  N  NH1   . ARG A 1 14  ? 39.701 -3.694  -3.332  1.00 37.44 ? 14   ARG A NH1   1 
ATOM   105  N  NH2   . ARG A 1 14  ? 41.833 -4.515  -3.664  1.00 35.07 ? 14   ARG A NH2   1 
ATOM   106  N  N     . SER A 1 15  ? 43.994 1.556   0.476   1.00 16.94 ? 15   SER A N     1 
ATOM   107  C  CA    . SER A 1 15  ? 44.193 2.913   0.074   1.00 16.44 ? 15   SER A CA    1 
ATOM   108  C  C     . SER A 1 15  ? 44.763 2.965   -1.349  1.00 17.01 ? 15   SER A C     1 
ATOM   109  O  O     . SER A 1 15  ? 45.671 2.222   -1.688  1.00 17.11 ? 15   SER A O     1 
ATOM   110  C  CB    . SER A 1 15  ? 45.161 3.606   1.020   1.00 17.85 ? 15   SER A CB    1 
ATOM   111  O  OG    . SER A 1 15  ? 44.590 3.611   2.313   1.00 20.74 ? 15   SER A OG    1 
ATOM   112  N  N     . PHE A 1 16  ? 44.273 3.915   -2.125  1.00 16.15 ? 16   PHE A N     1 
ATOM   113  C  CA    . PHE A 1 16  ? 44.682 4.085   -3.492  1.00 15.02 ? 16   PHE A CA    1 
ATOM   114  C  C     . PHE A 1 16  ? 45.022 5.549   -3.705  1.00 14.24 ? 16   PHE A C     1 
ATOM   115  O  O     . PHE A 1 16  ? 44.105 6.374   -3.854  1.00 13.25 ? 16   PHE A O     1 
ATOM   116  C  CB    . PHE A 1 16  ? 43.519 3.725   -4.388  1.00 15.97 ? 16   PHE A CB    1 
ATOM   117  C  CG    . PHE A 1 16  ? 43.190 2.257   -4.426  1.00 18.12 ? 16   PHE A CG    1 
ATOM   118  C  CD1   . PHE A 1 16  ? 43.781 1.417   -5.387  1.00 19.20 ? 16   PHE A CD1   1 
ATOM   119  C  CD2   . PHE A 1 16  ? 42.231 1.735   -3.603  1.00 18.19 ? 16   PHE A CD2   1 
ATOM   120  C  CE1   . PHE A 1 16  ? 43.463 0.074   -5.458  1.00 19.60 ? 16   PHE A CE1   1 
ATOM   121  C  CE2   . PHE A 1 16  ? 41.912 0.396   -3.671  1.00 20.55 ? 16   PHE A CE2   1 
ATOM   122  C  CZ    . PHE A 1 16  ? 42.524 -0.435  -4.610  1.00 17.84 ? 16   PHE A CZ    1 
ATOM   123  N  N     . PRO A 1 17  ? 46.317 5.885   -3.723  1.00 14.06 ? 17   PRO A N     1 
ATOM   124  C  CA    . PRO A 1 17  ? 46.716 7.229   -3.993  1.00 13.73 ? 17   PRO A CA    1 
ATOM   125  C  C     . PRO A 1 17  ? 46.250 7.666   -5.370  1.00 15.36 ? 17   PRO A C     1 
ATOM   126  O  O     . PRO A 1 17  ? 46.226 6.845   -6.330  1.00 11.85 ? 17   PRO A O     1 
ATOM   127  C  CB    . PRO A 1 17  ? 48.243 7.142   -3.993  1.00 14.72 ? 17   PRO A CB    1 
ATOM   128  C  CG    . PRO A 1 17  ? 48.547 5.928   -3.163  1.00 15.01 ? 17   PRO A CG    1 
ATOM   129  C  CD    . PRO A 1 17  ? 47.477 5.002   -3.497  1.00 14.53 ? 17   PRO A CD    1 
ATOM   130  N  N     . ASP A 1 18  ? 45.883 8.947   -5.453  1.00 15.37 ? 18   ASP A N     1 
ATOM   131  C  CA    . ASP A 1 18  ? 45.569 9.600   -6.712  1.00 16.73 ? 18   ASP A CA    1 
ATOM   132  C  C     . ASP A 1 18  ? 44.387 9.023   -7.451  1.00 17.84 ? 18   ASP A C     1 
ATOM   133  O  O     . ASP A 1 18  ? 44.347 8.975   -8.700  1.00 19.16 ? 18   ASP A O     1 
ATOM   134  C  CB    . ASP A 1 18  ? 46.819 9.628   -7.569  1.00 17.57 ? 18   ASP A CB    1 
ATOM   135  C  CG    . ASP A 1 18  ? 47.946 10.412  -6.918  1.00 20.25 ? 18   ASP A CG    1 
ATOM   136  O  OD1   . ASP A 1 18  ? 49.089 9.963   -7.000  1.00 21.16 ? 18   ASP A OD1   1 
ATOM   137  O  OD2   . ASP A 1 18  ? 47.668 11.452  -6.272  1.00 23.47 ? 18   ASP A OD2   1 
ATOM   138  N  N     . PHE A 1 19  ? 43.405 8.584   -6.682  1.00 19.21 ? 19   PHE A N     1 
ATOM   139  C  CA    . PHE A 1 19  ? 42.093 8.296   -7.251  1.00 21.42 ? 19   PHE A CA    1 
ATOM   140  C  C     . PHE A 1 19  ? 41.048 9.076   -6.461  1.00 23.53 ? 19   PHE A C     1 
ATOM   141  O  O     . PHE A 1 19  ? 41.072 9.064   -5.246  1.00 20.25 ? 19   PHE A O     1 
ATOM   142  C  CB    . PHE A 1 19  ? 41.815 6.797   -7.230  1.00 22.57 ? 19   PHE A CB    1 
ATOM   143  C  CG    . PHE A 1 19  ? 40.486 6.437   -7.800  1.00 22.99 ? 19   PHE A CG    1 
ATOM   144  C  CD1   . PHE A 1 19  ? 40.344 6.234   -9.164  1.00 25.25 ? 19   PHE A CD1   1 
ATOM   145  C  CD2   . PHE A 1 19  ? 39.375 6.412   -6.996  1.00 22.60 ? 19   PHE A CD2   1 
ATOM   146  C  CE1   . PHE A 1 19  ? 39.089 5.971   -9.710  1.00 26.18 ? 19   PHE A CE1   1 
ATOM   147  C  CE2   . PHE A 1 19  ? 38.120 6.134   -7.509  1.00 26.71 ? 19   PHE A CE2   1 
ATOM   148  C  CZ    . PHE A 1 19  ? 37.967 5.919   -8.866  1.00 26.58 ? 19   PHE A CZ    1 
ATOM   149  N  N     . PRO A 1 20  ? 40.075 9.705   -7.138  1.00 25.87 ? 20   PRO A N     1 
ATOM   150  C  CA    . PRO A 1 20  ? 39.752 9.724   -8.589  1.00 27.30 ? 20   PRO A CA    1 
ATOM   151  C  C     . PRO A 1 20  ? 40.580 10.678  -9.419  1.00 27.67 ? 20   PRO A C     1 
ATOM   152  O  O     . PRO A 1 20  ? 40.584 10.541  -10.655 1.00 29.25 ? 20   PRO A O     1 
ATOM   153  C  CB    . PRO A 1 20  ? 38.249 10.113  -8.614  1.00 28.29 ? 20   PRO A CB    1 
ATOM   154  C  CG    . PRO A 1 20  ? 38.059 10.974  -7.376  1.00 27.60 ? 20   PRO A CG    1 
ATOM   155  C  CD    . PRO A 1 20  ? 39.120 10.510  -6.339  1.00 26.65 ? 20   PRO A CD    1 
ATOM   156  N  N     . THR A 1 21  ? 41.316 11.561  -8.734  1.00 27.05 ? 21   THR A N     1 
ATOM   157  C  CA    . THR A 1 21  ? 41.997 12.748  -9.235  1.00 28.04 ? 21   THR A CA    1 
ATOM   158  C  C     . THR A 1 21  ? 43.319 12.760  -8.490  1.00 26.99 ? 21   THR A C     1 
ATOM   159  O  O     . THR A 1 21  ? 43.370 12.320  -7.346  1.00 26.59 ? 21   THR A O     1 
ATOM   160  C  CB    . THR A 1 21  ? 41.196 14.140  -8.906  1.00 28.13 ? 21   THR A CB    1 
ATOM   161  O  OG1   . THR A 1 21  ? 41.984 15.094  -8.149  1.00 28.25 ? 21   THR A OG1   1 
ATOM   162  C  CG2   . THR A 1 21  ? 40.138 13.868  -8.042  1.00 27.25 ? 21   THR A CG2   1 
ATOM   163  N  N     . PRO A 1 22  ? 44.386 13.276  -9.107  1.00 26.85 ? 22   PRO A N     1 
ATOM   164  C  CA    . PRO A 1 22  ? 45.670 13.328  -8.386  1.00 26.80 ? 22   PRO A CA    1 
ATOM   165  C  C     . PRO A 1 22  ? 45.592 14.122  -7.083  1.00 27.78 ? 22   PRO A C     1 
ATOM   166  O  O     . PRO A 1 22  ? 44.897 15.156  -7.033  1.00 27.90 ? 22   PRO A O     1 
ATOM   167  C  CB    . PRO A 1 22  ? 46.609 14.014  -9.375  1.00 26.82 ? 22   PRO A CB    1 
ATOM   168  C  CG    . PRO A 1 22  ? 45.940 13.870  -10.685 1.00 25.99 ? 22   PRO A CG    1 
ATOM   169  C  CD    . PRO A 1 22  ? 44.494 13.870  -10.457 1.00 26.55 ? 22   PRO A CD    1 
ATOM   170  N  N     . GLY A 1 23  ? 46.314 13.646  -6.065  1.00 27.05 ? 23   GLY A N     1 
ATOM   171  C  CA    . GLY A 1 23  ? 46.174 14.139  -4.690  1.00 27.03 ? 23   GLY A CA    1 
ATOM   172  C  C     . GLY A 1 23  ? 45.210 13.441  -3.716  1.00 26.15 ? 23   GLY A C     1 
ATOM   173  O  O     . GLY A 1 23  ? 45.531 13.323  -2.543  1.00 26.28 ? 23   GLY A O     1 
ATOM   174  N  N     . VAL A 1 24  ? 44.040 13.003  -4.177  1.00 24.54 ? 24   VAL A N     1 
ATOM   175  C  CA    . VAL A 1 24  ? 43.095 12.301  -3.306  1.00 23.53 ? 24   VAL A CA    1 
ATOM   176  C  C     . VAL A 1 24  ? 43.654 10.914  -3.006  1.00 23.20 ? 24   VAL A C     1 
ATOM   177  O  O     . VAL A 1 24  ? 43.995 10.217  -3.949  1.00 24.82 ? 24   VAL A O     1 
ATOM   178  C  CB    . VAL A 1 24  ? 41.720 12.093  -3.985  1.00 24.13 ? 24   VAL A CB    1 
ATOM   179  C  CG1   . VAL A 1 24  ? 40.728 11.397  -3.031  1.00 23.30 ? 24   VAL A CG1   1 
ATOM   180  C  CG2   . VAL A 1 24  ? 41.092 13.387  -4.424  1.00 24.47 ? 24   VAL A CG2   1 
ATOM   181  N  N     . VAL A 1 25  ? 43.750 10.503  -1.735  1.00 21.32 ? 25   VAL A N     1 
ATOM   182  C  CA    . VAL A 1 25  ? 44.041 9.100   -1.373  1.00 19.06 ? 25   VAL A CA    1 
ATOM   183  C  C     . VAL A 1 25  ? 42.707 8.405   -1.057  1.00 17.18 ? 25   VAL A C     1 
ATOM   184  O  O     . VAL A 1 25  ? 42.080 8.667   -0.037  1.00 16.85 ? 25   VAL A O     1 
ATOM   185  C  CB    . VAL A 1 25  ? 45.008 8.960   -0.176  1.00 18.60 ? 25   VAL A CB    1 
ATOM   186  C  CG1   . VAL A 1 25  ? 45.206 7.486   0.207   1.00 19.01 ? 25   VAL A CG1   1 
ATOM   187  C  CG2   . VAL A 1 25  ? 46.370 9.555   -0.481  1.00 20.83 ? 25   VAL A CG2   1 
ATOM   188  N  N     . PHE A 1 26  ? 42.243 7.594   -1.988  1.00 16.33 ? 26   PHE A N     1 
ATOM   189  C  CA    . PHE A 1 26  ? 41.011 6.917   -1.833  1.00 15.13 ? 26   PHE A CA    1 
ATOM   190  C  C     . PHE A 1 26  ? 41.117 5.778   -0.812  1.00 14.62 ? 26   PHE A C     1 
ATOM   191  O  O     . PHE A 1 26  ? 42.040 4.978   -0.858  1.00 13.39 ? 26   PHE A O     1 
ATOM   192  C  CB    . PHE A 1 26  ? 40.587 6.412   -3.206  1.00 15.85 ? 26   PHE A CB    1 
ATOM   193  C  CG    . PHE A 1 26  ? 39.137 5.936   -3.249  1.00 15.28 ? 26   PHE A CG    1 
ATOM   194  C  CD1   . PHE A 1 26  ? 38.127 6.788   -3.619  1.00 17.07 ? 26   PHE A CD1   1 
ATOM   195  C  CD2   . PHE A 1 26  ? 38.827 4.617   -2.961  1.00 16.63 ? 26   PHE A CD2   1 
ATOM   196  C  CE1   . PHE A 1 26  ? 36.788 6.308   -3.681  1.00 21.15 ? 26   PHE A CE1   1 
ATOM   197  C  CE2   . PHE A 1 26  ? 37.484 4.144   -3.013  1.00 15.75 ? 26   PHE A CE2   1 
ATOM   198  C  CZ    . PHE A 1 26  ? 36.510 4.990   -3.361  1.00 17.76 ? 26   PHE A CZ    1 
ATOM   199  N  N     . ARG A 1 27  ? 40.173 5.766   0.140   1.00 14.77 ? 27   ARG A N     1 
ATOM   200  C  CA    . ARG A 1 27  ? 40.032 4.743   1.136   1.00 15.11 ? 27   ARG A CA    1 
ATOM   201  C  C     . ARG A 1 27  ? 38.866 3.878   0.710   1.00 14.51 ? 27   ARG A C     1 
ATOM   202  O  O     . ARG A 1 27  ? 37.705 4.337   0.648   1.00 15.26 ? 27   ARG A O     1 
ATOM   203  C  CB    . ARG A 1 27  ? 39.777 5.347   2.521   1.00 16.20 ? 27   ARG A CB    1 
ATOM   204  C  CG    . ARG A 1 27  ? 40.728 6.478   2.847   1.00 17.13 ? 27   ARG A CG    1 
ATOM   205  C  CD    . ARG A 1 27  ? 42.135 6.007   2.971   1.00 21.24 ? 27   ARG A CD    1 
ATOM   206  N  NE    . ARG A 1 27  ? 42.985 7.156   3.317   1.00 26.39 ? 27   ARG A NE    1 
ATOM   207  C  CZ    . ARG A 1 27  ? 44.237 7.092   3.754   1.00 27.77 ? 27   ARG A CZ    1 
ATOM   208  N  NH1   . ARG A 1 27  ? 44.862 5.938   3.915   1.00 30.97 ? 27   ARG A NH1   1 
ATOM   209  N  NH2   . ARG A 1 27  ? 44.878 8.203   4.044   1.00 29.47 ? 27   ARG A NH2   1 
ATOM   210  N  N     . ASP A 1 28  ? 39.198 2.648   0.338   1.00 15.39 ? 28   ASP A N     1 
ATOM   211  C  CA    . ASP A 1 28  ? 38.208 1.681   -0.195  1.00 16.19 ? 28   ASP A CA    1 
ATOM   212  C  C     . ASP A 1 28  ? 37.795 0.733   0.922   1.00 17.41 ? 28   ASP A C     1 
ATOM   213  O  O     . ASP A 1 28  ? 38.623 -0.055  1.431   1.00 17.35 ? 28   ASP A O     1 
ATOM   214  C  CB    . ASP A 1 28  ? 38.851 0.922   -1.400  1.00 14.99 ? 28   ASP A CB    1 
ATOM   215  C  CG    . ASP A 1 28  ? 37.929 -0.102  -2.044  1.00 15.65 ? 28   ASP A CG    1 
ATOM   216  O  OD1   . ASP A 1 28  ? 36.715 0.004   -1.886  1.00 15.81 ? 28   ASP A OD1   1 
ATOM   217  O  OD2   . ASP A 1 28  ? 38.453 -0.969  -2.743  1.00 20.02 ? 28   ASP A OD2   1 
ATOM   218  N  N     . ILE A 1 29  ? 36.508 0.789   1.275   1.00 17.49 ? 29   ILE A N     1 
ATOM   219  C  CA    . ILE A 1 29  ? 35.901 -0.123  2.223   1.00 18.96 ? 29   ILE A CA    1 
ATOM   220  C  C     . ILE A 1 29  ? 35.473 -1.459  1.606   1.00 17.46 ? 29   ILE A C     1 
ATOM   221  O  O     . ILE A 1 29  ? 34.982 -2.296  2.318   1.00 16.75 ? 29   ILE A O     1 
ATOM   222  C  CB    . ILE A 1 29  ? 34.667 0.513   3.052   1.00 18.41 ? 29   ILE A CB    1 
ATOM   223  C  CG1   . ILE A 1 29  ? 33.523 1.083   2.185   1.00 24.56 ? 29   ILE A CG1   1 
ATOM   224  C  CG2   . ILE A 1 29  ? 35.115 1.581   3.936   1.00 22.24 ? 29   ILE A CG2   1 
ATOM   225  C  CD1   . ILE A 1 29  ? 32.897 0.174   1.258   1.00 24.99 ? 29   ILE A CD1   1 
ATOM   226  N  N     . SER A 1 30  ? 35.618 -1.664  0.296   1.00 17.25 ? 30   SER A N     1 
ATOM   227  C  CA    . SER A 1 30  ? 35.238 -2.941  -0.308  1.00 17.77 ? 30   SER A CA    1 
ATOM   228  C  C     . SER A 1 30  ? 35.719 -4.196  0.410   1.00 16.84 ? 30   SER A C     1 
ATOM   229  O  O     . SER A 1 30  ? 34.977 -5.167  0.512   1.00 16.73 ? 30   SER A O     1 
ATOM   230  C  CB    . SER A 1 30  ? 35.699 -3.001  -1.771  1.00 18.04 ? 30   SER A CB    1 
ATOM   231  O  OG    . SER A 1 30  ? 35.061 -1.940  -2.455  1.00 23.13 ? 30   SER A OG    1 
ATOM   232  N  N     . PRO A 1 31  ? 36.977 -4.235  0.841   1.00 14.80 ? 31   PRO A N     1 
ATOM   233  C  CA    . PRO A 1 31  ? 37.403 -5.471  1.542   1.00 15.15 ? 31   PRO A CA    1 
ATOM   234  C  C     . PRO A 1 31  ? 36.687 -5.732  2.879   1.00 13.73 ? 31   PRO A C     1 
ATOM   235  O  O     . PRO A 1 31  ? 36.587 -6.873  3.321   1.00 13.70 ? 31   PRO A O     1 
ATOM   236  C  CB    . PRO A 1 31  ? 38.912 -5.262  1.725   1.00 15.39 ? 31   PRO A CB    1 
ATOM   237  C  CG    . PRO A 1 31  ? 39.255 -4.177  0.781   1.00 14.87 ? 31   PRO A CG    1 
ATOM   238  C  CD    . PRO A 1 31  ? 38.097 -3.272  0.713   1.00 14.61 ? 31   PRO A CD    1 
ATOM   239  N  N     . VAL A 1 32  ? 36.154 -4.678  3.511   1.00 13.50 ? 32   VAL A N     1 
ATOM   240  C  CA    . VAL A 1 32  ? 35.361 -4.831  4.717   1.00 13.61 ? 32   VAL A CA    1 
ATOM   241  C  C     . VAL A 1 32  ? 34.095 -5.617  4.369   1.00 13.00 ? 32   VAL A C     1 
ATOM   242  O  O     . VAL A 1 32  ? 33.628 -6.427  5.158   1.00 12.55 ? 32   VAL A O     1 
ATOM   243  C  CB    . VAL A 1 32  ? 34.962 -3.453  5.332   1.00 13.76 ? 32   VAL A CB    1 
ATOM   244  C  CG1   . VAL A 1 32  ? 34.012 -3.592  6.485   1.00 16.44 ? 32   VAL A CG1   1 
ATOM   245  C  CG2   . VAL A 1 32  ? 36.232 -2.614  5.769   1.00 14.86 ? 32   VAL A CG2   1 
ATOM   246  N  N     . LEU A 1 33  ? 33.481 -5.274  3.244   1.00 14.22 ? 33   LEU A N     1 
ATOM   247  C  CA    . LEU A 1 33  ? 32.210 -5.912  2.816   1.00 14.57 ? 33   LEU A CA    1 
ATOM   248  C  C     . LEU A 1 33  ? 32.433 -7.363  2.415   1.00 14.28 ? 33   LEU A C     1 
ATOM   249  O  O     . LEU A 1 33  ? 31.578 -8.208  2.592   1.00 13.01 ? 33   LEU A O     1 
ATOM   250  C  CB    . LEU A 1 33  ? 31.569 -5.154  1.632   1.00 14.80 ? 33   LEU A CB    1 
ATOM   251  C  CG    . LEU A 1 33  ? 30.647 -3.934  1.887   1.00 20.13 ? 33   LEU A CG    1 
ATOM   252  C  CD1   . LEU A 1 33  ? 29.363 -4.361  2.426   1.00 23.90 ? 33   LEU A CD1   1 
ATOM   253  C  CD2   . LEU A 1 33  ? 31.203 -2.993  2.843   1.00 21.39 ? 33   LEU A CD2   1 
ATOM   254  N  N     . LYS A 1 34  ? 33.623 -7.630  1.876   1.00 14.18 ? 34   LYS A N     1 
ATOM   255  C  CA    . LYS A 1 34  ? 33.944 -8.931  1.319   1.00 14.90 ? 34   LYS A CA    1 
ATOM   256  C  C     . LYS A 1 34  ? 34.305 -9.922  2.412   1.00 15.16 ? 34   LYS A C     1 
ATOM   257  O  O     . LYS A 1 34  ? 34.176 -11.101 2.217   1.00 15.71 ? 34   LYS A O     1 
ATOM   258  C  CB    . LYS A 1 34  ? 35.128 -8.790  0.327   1.00 14.70 ? 34   LYS A CB    1 
ATOM   259  C  CG    . LYS A 1 34  ? 35.338 -10.017 -0.461  1.00 16.57 ? 34   LYS A CG    1 
ATOM   260  C  CD    . LYS A 1 34  ? 36.342 -9.869  -1.570  1.00 16.44 ? 34   LYS A CD    1 
ATOM   261  C  CE    . LYS A 1 34  ? 36.504 -11.191 -2.275  1.00 16.21 ? 34   LYS A CE    1 
ATOM   262  N  NZ    . LYS A 1 34  ? 37.580 -11.235 -3.305  1.00 17.41 ? 34   LYS A NZ    1 
ATOM   263  N  N     . ASP A 1 35  ? 34.763 -9.442  3.588   1.00 16.08 ? 35   ASP A N     1 
ATOM   264  C  CA    . ASP A 1 35  ? 35.194 -10.319 4.659   1.00 15.14 ? 35   ASP A CA    1 
ATOM   265  C  C     . ASP A 1 35  ? 34.092 -10.249 5.686   1.00 15.29 ? 35   ASP A C     1 
ATOM   266  O  O     . ASP A 1 35  ? 33.919 -9.205  6.372   1.00 13.69 ? 35   ASP A O     1 
ATOM   267  C  CB    . ASP A 1 35  ? 36.486 -9.834  5.278   1.00 14.86 ? 35   ASP A CB    1 
ATOM   268  C  CG    . ASP A 1 35  ? 36.850 -10.566 6.548   1.00 19.36 ? 35   ASP A CG    1 
ATOM   269  O  OD1   . ASP A 1 35  ? 38.019 -10.362 7.014   1.00 28.85 ? 35   ASP A OD1   1 
ATOM   270  O  OD2   . ASP A 1 35  ? 36.042 -11.336 7.093   1.00 26.17 ? 35   ASP A OD2   1 
ATOM   271  N  N     . PRO A 1 36  ? 33.302 -11.324 5.783   1.00 14.81 ? 36   PRO A N     1 
ATOM   272  C  CA    . PRO A 1 36  ? 32.143 -11.206 6.659   1.00 14.53 ? 36   PRO A CA    1 
ATOM   273  C  C     . PRO A 1 36  ? 32.428 -10.909 8.151   1.00 16.26 ? 36   PRO A C     1 
ATOM   274  O  O     . PRO A 1 36  ? 31.592 -10.272 8.809   1.00 15.78 ? 36   PRO A O     1 
ATOM   275  C  CB    . PRO A 1 36  ? 31.414 -12.539 6.437   1.00 13.85 ? 36   PRO A CB    1 
ATOM   276  C  CG    . PRO A 1 36  ? 32.448 -13.445 5.971   1.00 14.32 ? 36   PRO A CG    1 
ATOM   277  C  CD    . PRO A 1 36  ? 33.356 -12.647 5.135   1.00 14.83 ? 36   PRO A CD    1 
ATOM   278  N  N     . ALA A 1 37  ? 33.586 -11.331 8.669   1.00 15.92 ? 37   ALA A N     1 
ATOM   279  C  CA    . ALA A 1 37  ? 33.977 -10.980 10.012  1.00 16.25 ? 37   ALA A CA    1 
ATOM   280  C  C     . ALA A 1 37  ? 34.268 -9.487  10.211  1.00 15.41 ? 37   ALA A C     1 
ATOM   281  O  O     . ALA A 1 37  ? 33.974 -8.926  11.269  1.00 15.05 ? 37   ALA A O     1 
ATOM   282  C  CB    . ALA A 1 37  ? 35.203 -11.796 10.403  1.00 16.73 ? 37   ALA A CB    1 
ATOM   283  N  N     . SER A 1 38  ? 34.899 -8.876  9.206   1.00 15.68 ? 38   SER A N     1 
ATOM   284  C  CA    . SER A 1 38  ? 35.243 -7.448  9.199   1.00 15.38 ? 38   SER A CA    1 
ATOM   285  C  C     . SER A 1 38  ? 33.927 -6.614  9.151   1.00 15.04 ? 38   SER A C     1 
ATOM   286  O  O     . SER A 1 38  ? 33.753 -5.646  9.872   1.00 14.26 ? 38   SER A O     1 
ATOM   287  C  CB    . SER A 1 38  ? 36.126 -7.169  7.997   1.00 15.47 ? 38   SER A CB    1 
ATOM   288  O  OG    . SER A 1 38  ? 36.656 -5.828  7.954   1.00 18.67 ? 38   SER A OG    1 
ATOM   289  N  N     . PHE A 1 39  ? 33.004 -7.005  8.274   1.00 14.13 ? 39   PHE A N     1 
ATOM   290  C  CA    . PHE A 1 39  ? 31.751 -6.276  8.157   1.00 14.12 ? 39   PHE A CA    1 
ATOM   291  C  C     . PHE A 1 39  ? 30.954 -6.318  9.467   1.00 14.57 ? 39   PHE A C     1 
ATOM   292  O  O     . PHE A 1 39  ? 30.390 -5.333  9.958   1.00 16.18 ? 39   PHE A O     1 
ATOM   293  C  CB    . PHE A 1 39  ? 30.890 -6.874  7.067   1.00 14.00 ? 39   PHE A CB    1 
ATOM   294  C  CG    . PHE A 1 39  ? 29.605 -6.088  6.822   1.00 13.43 ? 39   PHE A CG    1 
ATOM   295  C  CD1   . PHE A 1 39  ? 29.611 -4.845  6.134   1.00 17.84 ? 39   PHE A CD1   1 
ATOM   296  C  CD2   . PHE A 1 39  ? 28.401 -6.601  7.232   1.00 17.70 ? 39   PHE A CD2   1 
ATOM   297  C  CE1   . PHE A 1 39  ? 28.376 -4.130  5.932   1.00 14.88 ? 39   PHE A CE1   1 
ATOM   298  C  CE2   . PHE A 1 39  ? 27.229 -5.923  7.031   1.00 13.76 ? 39   PHE A CE2   1 
ATOM   299  C  CZ    . PHE A 1 39  ? 27.186 -4.703  6.425   1.00 15.80 ? 39   PHE A CZ    1 
ATOM   300  N  N     . ARG A 1 40  ? 30.882 -7.508  10.018  1.00 15.33 ? 40   ARG A N     1 
ATOM   301  C  CA    . ARG A 1 40  ? 30.222 -7.719  11.295  1.00 15.88 ? 40   ARG A CA    1 
ATOM   302  C  C     . ARG A 1 40  ? 30.881 -6.909  12.435  1.00 14.96 ? 40   ARG A C     1 
ATOM   303  O  O     . ARG A 1 40  ? 30.182 -6.320  13.267  1.00 14.46 ? 40   ARG A O     1 
ATOM   304  C  CB    . ARG A 1 40  ? 30.163 -9.206  11.582  1.00 17.49 ? 40   ARG A CB    1 
ATOM   305  C  CG    . ARG A 1 40  ? 29.440 -9.566  12.876  1.00 20.64 ? 40   ARG A CG    1 
ATOM   306  C  CD    . ARG A 1 40  ? 29.778 -10.983 13.399  1.00 23.55 ? 40   ARG A CD    1 
ATOM   307  N  N     . ALA A 1 41  ? 32.214 -6.836  12.408  1.00 14.97 ? 41   ALA A N     1 
ATOM   308  C  CA    . ALA A 1 41  ? 32.940 -6.019  13.354  1.00 14.55 ? 41   ALA A CA    1 
ATOM   309  C  C     . ALA A 1 41  ? 32.617 -4.527  13.202  1.00 13.45 ? 41   ALA A C     1 
ATOM   310  O  O     . ALA A 1 41  ? 32.451 -3.861  14.220  1.00 15.89 ? 41   ALA A O     1 
ATOM   311  C  CB    . ALA A 1 41  ? 34.448 -6.285  13.279  1.00 14.86 ? 41   ALA A CB    1 
ATOM   312  N  N     . ALA A 1 42  ? 32.543 -3.990  11.964  1.00 13.48 ? 42   ALA A N     1 
ATOM   313  C  CA    . ALA A 1 42  ? 32.299 -2.565  11.712  1.00 11.71 ? 42   ALA A CA    1 
ATOM   314  C  C     . ALA A 1 42  ? 30.931 -2.198  12.226  1.00 13.42 ? 42   ALA A C     1 
ATOM   315  O  O     . ALA A 1 42  ? 30.765 -1.233  12.962  1.00 13.46 ? 42   ALA A O     1 
ATOM   316  C  CB    . ALA A 1 42  ? 32.430 -2.206  10.204  1.00 11.77 ? 42   ALA A CB    1 
ATOM   317  N  N     . ILE A 1 43  ? 29.937 -3.010  11.901  1.00 13.65 ? 43   ILE A N     1 
ATOM   318  C  CA    . ILE A 1 43  ? 28.577 -2.759  12.353  1.00 14.18 ? 43   ILE A CA    1 
ATOM   319  C  C     . ILE A 1 43  ? 28.443 -2.874  13.885  1.00 14.21 ? 43   ILE A C     1 
ATOM   320  O  O     . ILE A 1 43  ? 27.757 -2.054  14.522  1.00 14.34 ? 43   ILE A O     1 
ATOM   321  C  CB    . ILE A 1 43  ? 27.584 -3.718  11.632  1.00 13.38 ? 43   ILE A CB    1 
ATOM   322  C  CG1   . ILE A 1 43  ? 27.554 -3.519  10.099  1.00 17.16 ? 43   ILE A CG1   1 
ATOM   323  C  CG2   . ILE A 1 43  ? 26.123 -3.618  12.182  1.00 16.62 ? 43   ILE A CG2   1 
ATOM   324  C  CD1   . ILE A 1 43  ? 27.098 -2.193  9.621   1.00 14.21 ? 43   ILE A CD1   1 
ATOM   325  N  N     . GLY A 1 44  ? 29.054 -3.895  14.495  1.00 13.74 ? 44   GLY A N     1 
ATOM   326  C  CA    . GLY A 1 44  ? 29.067 -3.991  15.943  1.00 12.45 ? 44   GLY A CA    1 
ATOM   327  C  C     . GLY A 1 44  ? 29.741 -2.807  16.645  1.00 12.14 ? 44   GLY A C     1 
ATOM   328  O  O     . GLY A 1 44  ? 29.276 -2.378  17.680  1.00 12.45 ? 44   GLY A O     1 
ATOM   329  N  N     . LEU A 1 45  ? 30.832 -2.282  16.112  1.00 11.90 ? 45   LEU A N     1 
ATOM   330  C  CA    . LEU A 1 45  ? 31.544 -1.216  16.788  1.00 13.88 ? 45   LEU A CA    1 
ATOM   331  C  C     . LEU A 1 45  ? 30.664 0.046   16.745  1.00 14.83 ? 45   LEU A C     1 
ATOM   332  O  O     . LEU A 1 45  ? 30.642 0.859   17.692  1.00 15.96 ? 45   LEU A O     1 
ATOM   333  C  CB    . LEU A 1 45  ? 32.911 -1.029  16.121  1.00 14.32 ? 45   LEU A CB    1 
ATOM   334  C  CG    . LEU A 1 45  ? 33.917 -2.156  16.419  1.00 12.74 ? 45   LEU A CG    1 
ATOM   335  C  CD1   . LEU A 1 45  ? 35.093 -2.014  15.367  1.00 13.11 ? 45   LEU A CD1   1 
ATOM   336  C  CD2   . LEU A 1 45  ? 34.403 -2.071  17.816  1.00 17.85 ? 45   LEU A CD2   1 
ATOM   337  N  N     . LEU A 1 46  ? 29.990 0.237   15.603  1.00 14.79 ? 46   LEU A N     1 
ATOM   338  C  CA    . LEU A 1 46  ? 29.163 1.428   15.403  1.00 14.85 ? 46   LEU A CA    1 
ATOM   339  C  C     . LEU A 1 46  ? 27.958 1.350   16.296  1.00 14.69 ? 46   LEU A C     1 
ATOM   340  O  O     . LEU A 1 46  ? 27.611 2.306   16.935  1.00 15.84 ? 46   LEU A O     1 
ATOM   341  C  CB    . LEU A 1 46  ? 28.712 1.539   13.961  1.00 15.26 ? 46   LEU A CB    1 
ATOM   342  C  CG    . LEU A 1 46  ? 29.852 1.969   13.027  1.00 14.76 ? 46   LEU A CG    1 
ATOM   343  C  CD1   . LEU A 1 46  ? 29.306 1.751   11.635  1.00 15.46 ? 46   LEU A CD1   1 
ATOM   344  C  CD2   . LEU A 1 46  ? 30.267 3.410   13.248  1.00 15.61 ? 46   LEU A CD2   1 
ATOM   345  N  N     . ALA A 1 47  ? 27.353 0.174   16.333  1.00 14.92 ? 47   ALA A N     1 
ATOM   346  C  CA    . ALA A 1 47  ? 26.158 -0.071  17.087  1.00 16.15 ? 47   ALA A CA    1 
ATOM   347  C  C     . ALA A 1 47  ? 26.413 0.044   18.611  1.00 15.99 ? 47   ALA A C     1 
ATOM   348  O  O     . ALA A 1 47  ? 25.610 0.650   19.321  1.00 16.22 ? 47   ALA A O     1 
ATOM   349  C  CB    . ALA A 1 47  ? 25.615 -1.403  16.743  1.00 15.96 ? 47   ALA A CB    1 
ATOM   350  N  N     . ARG A 1 48  ? 27.565 -0.471  19.092  1.00 16.68 ? 48   ARG A N     1 
ATOM   351  C  CA    . ARG A 1 48  ? 27.941 -0.340  20.483  1.00 17.13 ? 48   ARG A CA    1 
ATOM   352  C  C     . ARG A 1 48  ? 28.201 1.110   20.868  1.00 16.11 ? 48   ARG A C     1 
ATOM   353  O  O     . ARG A 1 48  ? 27.773 1.588   21.934  1.00 18.08 ? 48   ARG A O     1 
ATOM   354  C  CB    . ARG A 1 48  ? 29.180 -1.177  20.751  1.00 17.87 ? 48   ARG A CB    1 
ATOM   355  C  CG    . ARG A 1 48  ? 29.662 -1.104  22.158  1.00 22.78 ? 48   ARG A CG    1 
ATOM   356  C  CD    . ARG A 1 48  ? 30.931 -1.967  22.371  1.00 22.95 ? 48   ARG A CD    1 
ATOM   357  N  NE    . ARG A 1 48  ? 30.766 -3.416  22.212  1.00 25.28 ? 48   ARG A NE    1 
ATOM   358  C  CZ    . ARG A 1 48  ? 31.442 -4.194  21.365  1.00 24.21 ? 48   ARG A CZ    1 
ATOM   359  N  NH1   . ARG A 1 48  ? 32.320 -3.673  20.512  1.00 23.09 ? 48   ARG A NH1   1 
ATOM   360  N  NH2   . ARG A 1 48  ? 31.201 -5.505  21.350  1.00 21.57 ? 48   ARG A NH2   1 
ATOM   361  N  N     . HIS A 1 49  ? 28.929 1.824   20.021  1.00 15.62 ? 49   HIS A N     1 
ATOM   362  C  CA    . HIS A 1 49  ? 29.097 3.244   20.255  1.00 14.99 ? 49   HIS A CA    1 
ATOM   363  C  C     . HIS A 1 49  ? 27.801 3.992   20.394  1.00 14.85 ? 49   HIS A C     1 
ATOM   364  O  O     . HIS A 1 49  ? 27.626 4.813   21.306  1.00 14.05 ? 49   HIS A O     1 
ATOM   365  C  CB    . HIS A 1 49  ? 29.906 3.913   19.141  1.00 15.09 ? 49   HIS A CB    1 
ATOM   366  C  CG    . HIS A 1 49  ? 29.894 5.410   19.249  1.00 13.95 ? 49   HIS A CG    1 
ATOM   367  N  ND1   . HIS A 1 49  ? 30.595 6.076   20.225  1.00 18.03 ? 49   HIS A ND1   1 
ATOM   368  C  CD2   . HIS A 1 49  ? 29.210 6.353   18.569  1.00 16.48 ? 49   HIS A CD2   1 
ATOM   369  C  CE1   . HIS A 1 49  ? 30.398 7.376   20.091  1.00 19.22 ? 49   HIS A CE1   1 
ATOM   370  N  NE2   . HIS A 1 49  ? 29.561 7.568   19.086  1.00 19.60 ? 49   HIS A NE2   1 
ATOM   371  N  N     . LEU A 1 50  ? 26.878 3.723   19.485  1.00 16.25 ? 50   LEU A N     1 
ATOM   372  C  CA    . LEU A 1 50  ? 25.657 4.469   19.437  1.00 15.94 ? 50   LEU A CA    1 
ATOM   373  C  C     . LEU A 1 50  ? 24.732 4.178   20.605  1.00 17.42 ? 50   LEU A C     1 
ATOM   374  O  O     . LEU A 1 50  ? 24.091 5.085   21.181  1.00 16.58 ? 50   LEU A O     1 
ATOM   375  C  CB    . LEU A 1 50  ? 24.920 4.224   18.130  1.00 15.37 ? 50   LEU A CB    1 
ATOM   376  C  CG    . LEU A 1 50  ? 25.555 4.883   16.896  1.00 14.18 ? 50   LEU A CG    1 
ATOM   377  C  CD1   . LEU A 1 50  ? 24.763 4.410   15.717  1.00 15.10 ? 50   LEU A CD1   1 
ATOM   378  C  CD2   . LEU A 1 50  ? 25.504 6.342   16.978  1.00 12.22 ? 50   LEU A CD2   1 
ATOM   379  N  N     . LYS A 1 51  ? 24.688 2.924   21.015  1.00 16.67 ? 51   LYS A N     1 
ATOM   380  C  CA    . LYS A 1 51  ? 23.963 2.617   22.222  1.00 16.12 ? 51   LYS A CA    1 
ATOM   381  C  C     . LYS A 1 51  ? 24.618 3.173   23.478  1.00 15.49 ? 51   LYS A C     1 
ATOM   382  O  O     . LYS A 1 51  ? 23.917 3.620   24.366  1.00 17.47 ? 51   LYS A O     1 
ATOM   383  C  CB    . LYS A 1 51  ? 23.774 1.139   22.388  1.00 17.62 ? 51   LYS A CB    1 
ATOM   384  C  CG    . LYS A 1 51  ? 22.752 0.597   21.494  1.00 19.62 ? 51   LYS A CG    1 
ATOM   385  C  CD    . LYS A 1 51  ? 22.612 -0.888  21.601  1.00 22.17 ? 51   LYS A CD    1 
ATOM   386  C  CE    . LYS A 1 51  ? 23.786 -1.658  20.971  1.00 24.98 ? 51   LYS A CE    1 
ATOM   387  N  NZ    . LYS A 1 51  ? 23.592 -3.151  21.192  1.00 28.57 ? 51   LYS A NZ    1 
ATOM   388  N  N     . ALA A 1 52  ? 25.949 3.165   23.553  1.00 14.00 ? 52   ALA A N     1 
ATOM   389  C  CA    . ALA A 1 52  ? 26.632 3.711   24.689  1.00 13.97 ? 52   ALA A CA    1 
ATOM   390  C  C     . ALA A 1 52  ? 26.425 5.242   24.804  1.00 14.86 ? 52   ALA A C     1 
ATOM   391  O  O     . ALA A 1 52  ? 26.491 5.831   25.905  1.00 14.87 ? 52   ALA A O     1 
ATOM   392  C  CB    . ALA A 1 52  ? 28.106 3.401   24.593  1.00 13.61 ? 52   ALA A CB    1 
ATOM   393  N  N     . THR A 1 53  ? 26.236 5.889   23.653  1.00 15.67 ? 53   THR A N     1 
ATOM   394  C  CA    . THR A 1 53  ? 26.147 7.329   23.547  1.00 16.94 ? 53   THR A CA    1 
ATOM   395  C  C     . THR A 1 53  ? 24.710 7.922   23.537  1.00 17.12 ? 53   THR A C     1 
ATOM   396  O  O     . THR A 1 53  ? 24.492 9.097   23.958  1.00 19.38 ? 53   THR A O     1 
ATOM   397  C  CB    . THR A 1 53  ? 26.941 7.763   22.301  1.00 16.91 ? 53   THR A CB    1 
ATOM   398  O  OG1   . THR A 1 53  ? 28.315 7.558   22.616  1.00 20.63 ? 53   THR A OG1   1 
ATOM   399  C  CG2   . THR A 1 53  ? 26.785 9.217   22.101  1.00 20.29 ? 53   THR A CG2   1 
ATOM   400  N  N     . HIS A 1 54  ? 23.738 7.112   23.128  1.00 15.71 ? 54   HIS A N     1 
ATOM   401  C  CA    . HIS A 1 54  ? 22.389 7.564   23.020  1.00 15.23 ? 54   HIS A CA    1 
ATOM   402  C  C     . HIS A 1 54  ? 21.355 6.713   23.692  1.00 16.04 ? 54   HIS A C     1 
ATOM   403  O  O     . HIS A 1 54  ? 20.201 7.100   23.642  1.00 14.34 ? 54   HIS A O     1 
ATOM   404  C  CB    . HIS A 1 54  ? 21.980 7.693   21.526  1.00 17.20 ? 54   HIS A CB    1 
ATOM   405  C  CG    . HIS A 1 54  ? 22.801 8.686   20.796  1.00 12.00 ? 54   HIS A CG    1 
ATOM   406  N  ND1   . HIS A 1 54  ? 22.645 10.032  20.982  1.00 15.74 ? 54   HIS A ND1   1 
ATOM   407  C  CD2   . HIS A 1 54  ? 23.845 8.526   19.943  1.00 16.07 ? 54   HIS A CD2   1 
ATOM   408  C  CE1   . HIS A 1 54  ? 23.575 10.666  20.284  1.00 19.80 ? 54   HIS A CE1   1 
ATOM   409  N  NE2   . HIS A 1 54  ? 24.308 9.776   19.638  1.00 19.81 ? 54   HIS A NE2   1 
ATOM   410  N  N     . GLY A 1 55  ? 21.744 5.603   24.320  1.00 15.17 ? 55   GLY A N     1 
ATOM   411  C  CA    . GLY A 1 55  ? 20.749 4.629   24.875  1.00 16.69 ? 55   GLY A CA    1 
ATOM   412  C  C     . GLY A 1 55  ? 19.688 4.281   23.861  1.00 16.58 ? 55   GLY A C     1 
ATOM   413  O  O     . GLY A 1 55  ? 20.004 4.068   22.707  1.00 19.07 ? 55   GLY A O     1 
ATOM   414  N  N     . GLY A 1 56  ? 18.419 4.372   24.232  1.00 17.80 ? 56   GLY A N     1 
ATOM   415  C  CA    . GLY A 1 56  ? 17.345 4.059   23.268  1.00 17.79 ? 56   GLY A CA    1 
ATOM   416  C  C     . GLY A 1 56  ? 16.662 5.226   22.576  1.00 17.44 ? 56   GLY A C     1 
ATOM   417  O  O     . GLY A 1 56  ? 15.521 5.089   22.135  1.00 19.01 ? 56   GLY A O     1 
ATOM   418  N  N     . ARG A 1 57  ? 17.315 6.388   22.521  1.00 17.83 ? 57   ARG A N     1 
ATOM   419  C  CA    . ARG A 1 57  ? 16.709 7.606   21.935  1.00 17.09 ? 57   ARG A CA    1 
ATOM   420  C  C     . ARG A 1 57  ? 16.686 7.581   20.398  1.00 15.64 ? 57   ARG A C     1 
ATOM   421  O  O     . ARG A 1 57  ? 16.012 8.399   19.752  1.00 15.21 ? 57   ARG A O     1 
ATOM   422  C  CB    A ARG A 1 57  ? 17.407 8.853   22.471  0.65 18.48 ? 57   ARG A CB    1 
ATOM   423  C  CB    B ARG A 1 57  ? 17.477 8.845   22.413  0.35 17.28 ? 57   ARG A CB    1 
ATOM   424  C  CG    A ARG A 1 57  ? 17.073 9.104   23.958  0.65 21.41 ? 57   ARG A CG    1 
ATOM   425  C  CG    B ARG A 1 57  ? 17.463 9.066   23.932  0.35 17.01 ? 57   ARG A CG    1 
ATOM   426  C  CD    A ARG A 1 57  ? 16.859 10.575  24.302  0.65 24.73 ? 57   ARG A CD    1 
ATOM   427  C  CD    B ARG A 1 57  ? 16.053 9.381   24.474  0.35 16.64 ? 57   ARG A CD    1 
ATOM   428  N  NE    A ARG A 1 57  ? 17.821 11.384  23.572  0.65 26.46 ? 57   ARG A NE    1 
ATOM   429  N  NE    B ARG A 1 57  ? 16.073 9.778   25.884  0.35 13.56 ? 57   ARG A NE    1 
ATOM   430  C  CZ    A ARG A 1 57  ? 17.548 12.494  22.909  0.65 28.45 ? 57   ARG A CZ    1 
ATOM   431  C  CZ    B ARG A 1 57  ? 15.886 8.966   26.927  0.35 15.25 ? 57   ARG A CZ    1 
ATOM   432  N  NH1   A ARG A 1 57  ? 18.521 13.092  22.266  0.65 29.18 ? 57   ARG A NH1   1 
ATOM   433  N  NH1   B ARG A 1 57  ? 15.933 9.464   28.156  0.35 14.66 ? 57   ARG A NH1   1 
ATOM   434  N  NH2   A ARG A 1 57  ? 16.332 13.033  22.902  0.65 31.01 ? 57   ARG A NH2   1 
ATOM   435  N  NH2   B ARG A 1 57  ? 15.659 7.661   26.765  0.35 14.28 ? 57   ARG A NH2   1 
ATOM   436  N  N     . ILE A 1 58  ? 17.394 6.650   19.770  1.00 15.53 ? 58   ILE A N     1 
ATOM   437  C  CA    . ILE A 1 58  ? 17.474 6.678   18.293  1.00 15.13 ? 58   ILE A CA    1 
ATOM   438  C  C     . ILE A 1 58  ? 16.199 6.085   17.709  1.00 15.63 ? 58   ILE A C     1 
ATOM   439  O  O     . ILE A 1 58  ? 15.817 5.008   18.066  1.00 15.46 ? 58   ILE A O     1 
ATOM   440  C  CB    . ILE A 1 58  ? 18.713 5.933   17.736  1.00 15.96 ? 58   ILE A CB    1 
ATOM   441  C  CG1   . ILE A 1 58  ? 19.972 6.408   18.448  1.00 16.73 ? 58   ILE A CG1   1 
ATOM   442  C  CG2   . ILE A 1 58  ? 18.847 6.241   16.252  1.00 13.51 ? 58   ILE A CG2   1 
ATOM   443  C  CD1   . ILE A 1 58  ? 21.173 5.482   18.282  1.00 19.45 ? 58   ILE A CD1   1 
ATOM   444  N  N     . ASP A 1 59  ? 15.567 6.789   16.775  1.00 17.04 ? 59   ASP A N     1 
ATOM   445  C  CA    . ASP A 1 59  ? 14.324 6.290   16.133  1.00 16.73 ? 59   ASP A CA    1 
ATOM   446  C  C     . ASP A 1 59  ? 14.662 5.591   14.801  1.00 15.45 ? 59   ASP A C     1 
ATOM   447  O  O     . ASP A 1 59  ? 14.091 4.554   14.489  1.00 14.47 ? 59   ASP A O     1 
ATOM   448  C  CB    . ASP A 1 59  ? 13.321 7.415   15.851  1.00 16.75 ? 59   ASP A CB    1 
ATOM   449  C  CG    . ASP A 1 59  ? 12.724 7.988   17.112  1.00 18.44 ? 59   ASP A CG    1 
ATOM   450  O  OD1   . ASP A 1 59  ? 12.425 7.211   18.024  1.00 22.33 ? 59   ASP A OD1   1 
ATOM   451  O  OD2   . ASP A 1 59  ? 12.558 9.206   17.202  1.00 17.75 ? 59   ASP A OD2   1 
ATOM   452  N  N     . TYR A 1 60  ? 15.576 6.183   14.023  1.00 14.56 ? 60   TYR A N     1 
ATOM   453  C  CA    . TYR A 1 60  ? 15.951 5.625   12.725  1.00 13.26 ? 60   TYR A CA    1 
ATOM   454  C  C     . TYR A 1 60  ? 17.386 5.904   12.415  1.00 12.64 ? 60   TYR A C     1 
ATOM   455  O  O     . TYR A 1 60  ? 17.956 6.929   12.857  1.00 14.07 ? 60   TYR A O     1 
ATOM   456  C  CB    . TYR A 1 60  ? 15.162 6.249   11.575  1.00 12.47 ? 60   TYR A CB    1 
ATOM   457  C  CG    . TYR A 1 60  ? 13.683 5.978   11.631  1.00 14.45 ? 60   TYR A CG    1 
ATOM   458  C  CD1   . TYR A 1 60  ? 12.798 6.869   12.221  1.00 16.39 ? 60   TYR A CD1   1 
ATOM   459  C  CD2   . TYR A 1 60  ? 13.174 4.813   11.075  1.00 12.78 ? 60   TYR A CD2   1 
ATOM   460  C  CE1   . TYR A 1 60  ? 11.446 6.570   12.279  1.00 16.00 ? 60   TYR A CE1   1 
ATOM   461  C  CE2   . TYR A 1 60  ? 11.828 4.514   11.163  1.00 17.85 ? 60   TYR A CE2   1 
ATOM   462  C  CZ    . TYR A 1 60  ? 10.987 5.377   11.733  1.00 18.01 ? 60   TYR A CZ    1 
ATOM   463  O  OH    . TYR A 1 60  ? 9.642  4.983   11.720  1.00 19.62 ? 60   TYR A OH    1 
ATOM   464  N  N     . ILE A 1 61  ? 17.938 4.989   11.636  1.00 12.09 ? 61   ILE A N     1 
ATOM   465  C  CA    . ILE A 1 61  ? 19.197 5.244   10.904  1.00 12.28 ? 61   ILE A CA    1 
ATOM   466  C  C     . ILE A 1 61  ? 18.863 5.844   9.529   1.00 13.53 ? 61   ILE A C     1 
ATOM   467  O  O     . ILE A 1 61  ? 17.866 5.486   8.903   1.00 14.52 ? 61   ILE A O     1 
ATOM   468  C  CB    . ILE A 1 61  ? 20.071 3.964   10.772  1.00 12.46 ? 61   ILE A CB    1 
ATOM   469  C  CG1   . ILE A 1 61  ? 20.331 3.393   12.146  1.00 12.95 ? 61   ILE A CG1   1 
ATOM   470  C  CG2   . ILE A 1 61  ? 21.403 4.243   9.920   1.00 13.53 ? 61   ILE A CG2   1 
ATOM   471  C  CD1   . ILE A 1 61  ? 21.152 4.287   13.087  1.00 14.43 ? 61   ILE A CD1   1 
ATOM   472  N  N     . ALA A 1 62  ? 19.661 6.812   9.083   1.00 12.58 ? 62   ALA A N     1 
ATOM   473  C  CA    . ALA A 1 62  ? 19.553 7.291   7.748   1.00 12.40 ? 62   ALA A CA    1 
ATOM   474  C  C     . ALA A 1 62  ? 20.816 6.914   7.013   1.00 13.07 ? 62   ALA A C     1 
ATOM   475  O  O     . ALA A 1 62  ? 21.898 7.328   7.420   1.00 13.99 ? 62   ALA A O     1 
ATOM   476  C  CB    . ALA A 1 62  ? 19.313 8.813   7.722   1.00 14.12 ? 62   ALA A CB    1 
ATOM   477  N  N     . GLY A 1 63  ? 20.678 6.162   5.918   1.00 14.51 ? 63   GLY A N     1 
ATOM   478  C  CA    . GLY A 1 63  ? 21.831 5.764   5.120   1.00 13.37 ? 63   GLY A CA    1 
ATOM   479  C  C     . GLY A 1 63  ? 21.973 6.688   3.942   1.00 14.29 ? 63   GLY A C     1 
ATOM   480  O  O     . GLY A 1 63  ? 20.976 7.047   3.307   1.00 14.46 ? 63   GLY A O     1 
ATOM   481  N  N     . LEU A 1 64  ? 23.213 7.106   3.633   1.00 14.11 ? 64   LEU A N     1 
ATOM   482  C  CA    . LEU A 1 64  ? 23.448 8.002   2.533   1.00 15.85 ? 64   LEU A CA    1 
ATOM   483  C  C     . LEU A 1 64  ? 23.873 7.269   1.288   1.00 16.21 ? 64   LEU A C     1 
ATOM   484  O  O     . LEU A 1 64  ? 24.797 6.452   1.320   1.00 17.66 ? 64   LEU A O     1 
ATOM   485  C  CB    . LEU A 1 64  ? 24.577 8.954   2.842   1.00 16.22 ? 64   LEU A CB    1 
ATOM   486  C  CG    . LEU A 1 64  ? 24.435 9.800   4.093   1.00 18.74 ? 64   LEU A CG    1 
ATOM   487  C  CD1   . LEU A 1 64  ? 25.503 10.920  4.046   1.00 20.96 ? 64   LEU A CD1   1 
ATOM   488  C  CD2   . LEU A 1 64  ? 22.992 10.344  4.213   1.00 20.80 ? 64   LEU A CD2   1 
ATOM   489  N  N     . ASP A 1 65  ? 23.278 7.663   0.175   1.00 16.50 ? 65   ASP A N     1 
ATOM   490  C  CA    . ASP A 1 65  ? 23.543 7.119   -1.158  1.00 17.72 ? 65   ASP A CA    1 
ATOM   491  C  C     . ASP A 1 65  ? 24.937 7.454   -1.604  1.00 19.99 ? 65   ASP A C     1 
ATOM   492  O  O     . ASP A 1 65  ? 25.324 8.638   -1.559  1.00 20.02 ? 65   ASP A O     1 
ATOM   493  C  CB    . ASP A 1 65  ? 22.476 7.783   -2.084  1.00 18.91 ? 65   ASP A CB    1 
ATOM   494  C  CG    . ASP A 1 65  ? 22.352 7.167   -3.450  1.00 21.78 ? 65   ASP A CG    1 
ATOM   495  O  OD1   . ASP A 1 65  ? 21.364 7.522   -4.140  1.00 18.84 ? 65   ASP A OD1   1 
ATOM   496  O  OD2   . ASP A 1 65  ? 23.181 6.327   -3.848  1.00 22.65 ? 65   ASP A OD2   1 
ATOM   497  N  N     . SER A 1 66  ? 25.756 6.459   -2.030  1.00 19.40 ? 66   SER A N     1 
ATOM   498  C  CA    . SER A 1 66  ? 25.377 5.061   -2.187  1.00 20.25 ? 66   SER A CA    1 
ATOM   499  C  C     . SER A 1 66  ? 26.081 4.193   -1.187  1.00 18.66 ? 66   SER A C     1 
ATOM   500  O  O     . SER A 1 66  ? 25.528 3.201   -0.793  1.00 16.98 ? 66   SER A O     1 
ATOM   501  C  CB    . SER A 1 66  ? 25.812 4.578   -3.557  1.00 23.08 ? 66   SER A CB    1 
ATOM   502  O  OG    . SER A 1 66  ? 27.211 4.797   -3.623  1.00 27.30 ? 66   SER A OG    1 
ATOM   503  N  N     . ARG A 1 67  ? 27.306 4.526   -0.792  1.00 15.79 ? 67   ARG A N     1 
ATOM   504  C  CA    . ARG A 1 67  ? 28.061 3.635   0.174   1.00 17.03 ? 67   ARG A CA    1 
ATOM   505  C  C     . ARG A 1 67  ? 27.547 3.583   1.603   1.00 17.53 ? 67   ARG A C     1 
ATOM   506  O  O     . ARG A 1 67  ? 27.767 2.603   2.314   1.00 15.66 ? 67   ARG A O     1 
ATOM   507  C  CB    . ARG A 1 67  ? 29.545 3.923   0.129   1.00 18.58 ? 67   ARG A CB    1 
ATOM   508  C  CG    . ARG A 1 67  ? 30.155 3.425   -1.134  1.00 18.45 ? 67   ARG A CG    1 
ATOM   509  C  CD    . ARG A 1 67  ? 31.611 3.735   -1.204  1.00 26.04 ? 67   ARG A CD    1 
ATOM   510  N  NE    . ARG A 1 67  ? 31.852 4.961   -1.974  1.00 30.49 ? 67   ARG A NE    1 
ATOM   511  C  CZ    . ARG A 1 67  ? 32.803 5.859   -1.725  1.00 31.13 ? 67   ARG A CZ    1 
ATOM   512  N  NH1   . ARG A 1 67  ? 33.591 5.754   -0.667  1.00 34.74 ? 67   ARG A NH1   1 
ATOM   513  N  NH2   . ARG A 1 67  ? 32.927 6.910   -2.506  1.00 29.24 ? 67   ARG A NH2   1 
ATOM   514  N  N     . GLY A 1 68  ? 26.816 4.602   2.028   1.00 16.50 ? 68   GLY A N     1 
ATOM   515  C  CA    . GLY A 1 68  ? 26.119 4.496   3.296   1.00 16.53 ? 68   GLY A CA    1 
ATOM   516  C  C     . GLY A 1 68  ? 25.014 3.468   3.241   1.00 14.25 ? 68   GLY A C     1 
ATOM   517  O  O     . GLY A 1 68  ? 24.660 2.931   4.282   1.00 15.34 ? 68   GLY A O     1 
ATOM   518  N  N     . PHE A 1 69  ? 24.464 3.217   2.038   1.00 14.04 ? 69   PHE A N     1 
ATOM   519  C  CA    . PHE A 1 69  ? 23.493 2.138   1.840   1.00 12.86 ? 69   PHE A CA    1 
ATOM   520  C  C     . PHE A 1 69  ? 24.059 0.758   2.224   1.00 11.86 ? 69   PHE A C     1 
ATOM   521  O  O     . PHE A 1 69  ? 23.326 -0.114  2.610   1.00 11.82 ? 69   PHE A O     1 
ATOM   522  C  CB    . PHE A 1 69  ? 23.037 2.085   0.364   1.00 14.19 ? 69   PHE A CB    1 
ATOM   523  C  CG    . PHE A 1 69  ? 22.117 3.176   -0.038  1.00 14.80 ? 69   PHE A CG    1 
ATOM   524  C  CD1   . PHE A 1 69  ? 21.791 4.247   0.817   1.00 12.45 ? 69   PHE A CD1   1 
ATOM   525  C  CD2   . PHE A 1 69  ? 21.574 3.137   -1.307  1.00 19.84 ? 69   PHE A CD2   1 
ATOM   526  C  CE1   . PHE A 1 69  ? 20.893 5.232   0.419   1.00 11.55 ? 69   PHE A CE1   1 
ATOM   527  C  CE2   . PHE A 1 69  ? 20.686 4.136   -1.720  1.00 18.26 ? 69   PHE A CE2   1 
ATOM   528  C  CZ    . PHE A 1 69  ? 20.355 5.165   -0.865  1.00 12.93 ? 69   PHE A CZ    1 
ATOM   529  N  N     . LEU A 1 70  ? 25.381 0.578   2.106   1.00 13.20 ? 70   LEU A N     1 
ATOM   530  C  CA    . LEU A 1 70  ? 26.009 -0.689  2.440   1.00 13.44 ? 70   LEU A CA    1 
ATOM   531  C  C     . LEU A 1 70  ? 26.025 -0.937  3.954   1.00 13.78 ? 70   LEU A C     1 
ATOM   532  O  O     . LEU A 1 70  ? 26.046 -2.082  4.401   1.00 14.11 ? 70   LEU A O     1 
ATOM   533  C  CB    . LEU A 1 70  ? 27.432 -0.708  1.937   1.00 14.59 ? 70   LEU A CB    1 
ATOM   534  C  CG    . LEU A 1 70  ? 27.594 -0.639  0.441   1.00 14.39 ? 70   LEU A CG    1 
ATOM   535  C  CD1   . LEU A 1 70  ? 29.008 -0.197  0.128   1.00 18.68 ? 70   LEU A CD1   1 
ATOM   536  C  CD2   . LEU A 1 70  ? 27.330 -2.035  -0.108  1.00 15.99 ? 70   LEU A CD2   1 
ATOM   537  N  N     . PHE A 1 71  ? 25.959 0.134   4.731   1.00 14.28 ? 71   PHE A N     1 
ATOM   538  C  CA    . PHE A 1 71  ? 26.008 0.020   6.220   1.00 13.53 ? 71   PHE A CA    1 
ATOM   539  C  C     . PHE A 1 71  ? 24.697 0.314   6.928   1.00 14.43 ? 71   PHE A C     1 
ATOM   540  O  O     . PHE A 1 71  ? 24.406 -0.291  7.950   1.00 16.21 ? 71   PHE A O     1 
ATOM   541  C  CB    . PHE A 1 71  ? 27.133 0.926   6.741   1.00 13.22 ? 71   PHE A CB    1 
ATOM   542  C  CG    . PHE A 1 71  ? 28.452 0.500   6.219   1.00 13.35 ? 71   PHE A CG    1 
ATOM   543  C  CD1   . PHE A 1 71  ? 28.986 1.089   5.061   1.00 13.75 ? 71   PHE A CD1   1 
ATOM   544  C  CD2   . PHE A 1 71  ? 29.090 -0.597  6.755   1.00 16.10 ? 71   PHE A CD2   1 
ATOM   545  C  CE1   . PHE A 1 71  ? 30.213 0.633   4.538   1.00 14.33 ? 71   PHE A CE1   1 
ATOM   546  C  CE2   . PHE A 1 71  ? 30.293 -1.079  6.227   1.00 16.61 ? 71   PHE A CE2   1 
ATOM   547  C  CZ    . PHE A 1 71  ? 30.835 -0.449  5.085   1.00 13.29 ? 71   PHE A CZ    1 
ATOM   548  N  N     . GLY A 1 72  ? 23.929 1.249   6.395   1.00 14.30 ? 72   GLY A N     1 
ATOM   549  C  CA    . GLY A 1 72  ? 22.668 1.680   6.987   1.00 15.25 ? 72   GLY A CA    1 
ATOM   550  C  C     . GLY A 1 72  ? 21.745 0.563   7.417   1.00 14.80 ? 72   GLY A C     1 
ATOM   551  O  O     . GLY A 1 72  ? 21.363 0.453   8.608   1.00 11.62 ? 72   GLY A O     1 
ATOM   552  N  N     . PRO A 1 73  ? 21.265 -0.218  6.449   1.00 14.25 ? 73   PRO A N     1 
ATOM   553  C  CA    . PRO A 1 73  ? 20.361 -1.293  6.816   1.00 14.26 ? 73   PRO A CA    1 
ATOM   554  C  C     . PRO A 1 73  ? 20.897 -2.251  7.892   1.00 13.92 ? 73   PRO A C     1 
ATOM   555  O  O     . PRO A 1 73  ? 20.176 -2.637  8.834   1.00 13.55 ? 73   PRO A O     1 
ATOM   556  C  CB    . PRO A 1 73  ? 20.110 -1.981  5.459   1.00 13.85 ? 73   PRO A CB    1 
ATOM   557  C  CG    . PRO A 1 73  ? 20.274 -0.943  4.490   1.00 13.23 ? 73   PRO A CG    1 
ATOM   558  C  CD    . PRO A 1 73  ? 21.378 -0.089  4.988   1.00 15.76 ? 73   PRO A CD    1 
ATOM   559  N  N     . SER A 1 74  ? 22.175 -2.636  7.799   1.00 13.79 ? 74   SER A N     1 
ATOM   560  C  CA    . SER A 1 74  ? 22.733 -3.569  8.742   1.00 14.80 ? 74   SER A CA    1 
ATOM   561  C  C     . SER A 1 74  ? 22.854 -2.927  10.137  1.00 14.14 ? 74   SER A C     1 
ATOM   562  O  O     . SER A 1 74  ? 22.638 -3.561  11.135  1.00 14.51 ? 74   SER A O     1 
ATOM   563  C  CB    . SER A 1 74  ? 24.114 -4.046  8.237   1.00 16.23 ? 74   SER A CB    1 
ATOM   564  O  OG    . SER A 1 74  ? 23.919 -4.944  7.143   1.00 18.76 ? 74   SER A OG    1 
ATOM   565  N  N     . LEU A 1 75  ? 23.213 -1.658  10.180  1.00 14.39 ? 75   LEU A N     1 
ATOM   566  C  CA    . LEU A 1 75  ? 23.359 -0.953  11.438  1.00 13.96 ? 75   LEU A CA    1 
ATOM   567  C  C     . LEU A 1 75  ? 21.981 -0.809  12.087  1.00 14.02 ? 75   LEU A C     1 
ATOM   568  O  O     . LEU A 1 75  ? 21.787 -1.094  13.266  1.00 13.63 ? 75   LEU A O     1 
ATOM   569  C  CB    . LEU A 1 75  ? 24.018 0.422   11.173  1.00 13.98 ? 75   LEU A CB    1 
ATOM   570  C  CG    . LEU A 1 75  ? 24.215 1.345   12.429  1.00 13.48 ? 75   LEU A CG    1 
ATOM   571  C  CD1   . LEU A 1 75  ? 24.897 0.638   13.645  1.00 14.94 ? 75   LEU A CD1   1 
ATOM   572  C  CD2   . LEU A 1 75  ? 24.978 2.545   12.043  1.00 12.95 ? 75   LEU A CD2   1 
ATOM   573  N  N     . ALA A 1 76  ? 20.993 -0.444  11.295  1.00 13.97 ? 76   ALA A N     1 
ATOM   574  C  CA    . ALA A 1 76  ? 19.630 -0.282  11.760  1.00 13.10 ? 76   ALA A CA    1 
ATOM   575  C  C     . ALA A 1 76  ? 19.086 -1.594  12.310  1.00 13.92 ? 76   ALA A C     1 
ATOM   576  O  O     . ALA A 1 76  ? 18.563 -1.639  13.421  1.00 15.40 ? 76   ALA A O     1 
ATOM   577  C  CB    . ALA A 1 76  ? 18.759 0.228   10.608  1.00 13.50 ? 76   ALA A CB    1 
ATOM   578  N  N     . GLN A 1 77  ? 19.238 -2.681  11.567  1.00 14.70 ? 77   GLN A N     1 
ATOM   579  C  CA    . GLN A 1 77  ? 18.846 -4.007  12.045  1.00 15.77 ? 77   GLN A CA    1 
ATOM   580  C  C     . GLN A 1 77  ? 19.499 -4.380  13.358  1.00 16.13 ? 77   GLN A C     1 
ATOM   581  O  O     . GLN A 1 77  ? 18.838 -4.859  14.224  1.00 17.21 ? 77   GLN A O     1 
ATOM   582  C  CB    . GLN A 1 77  ? 19.119 -5.081  10.992  1.00 16.78 ? 77   GLN A CB    1 
ATOM   583  C  CG    . GLN A 1 77  ? 18.078 -5.067  9.869   1.00 19.80 ? 77   GLN A CG    1 
ATOM   584  C  CD    . GLN A 1 77  ? 16.745 -5.768  10.255  1.00 18.89 ? 77   GLN A CD    1 
ATOM   585  O  OE1   . GLN A 1 77  ? 16.761 -6.911  10.660  1.00 26.34 ? 77   GLN A OE1   1 
ATOM   586  N  NE2   . GLN A 1 77  ? 15.621 -5.077  10.133  1.00 18.48 ? 77   GLN A NE2   1 
ATOM   587  N  N     . GLU A 1 78  ? 20.803 -4.158  13.497  1.00 17.19 ? 78   GLU A N     1 
ATOM   588  C  CA    . GLU A 1 78  ? 21.509 -4.528  14.741  1.00 16.62 ? 78   GLU A CA    1 
ATOM   589  C  C     . GLU A 1 78  ? 20.918 -3.734  15.898  1.00 17.02 ? 78   GLU A C     1 
ATOM   590  O  O     . GLU A 1 78  ? 20.873 -4.222  16.992  1.00 16.40 ? 78   GLU A O     1 
ATOM   591  C  CB    . GLU A 1 78  ? 22.980 -4.186  14.602  1.00 17.06 ? 78   GLU A CB    1 
ATOM   592  C  CG    . GLU A 1 78  ? 23.857 -4.440  15.800  1.00 17.46 ? 78   GLU A CG    1 
ATOM   593  C  CD    . GLU A 1 78  ? 23.892 -5.883  16.325  1.00 24.07 ? 78   GLU A CD    1 
ATOM   594  O  OE1   . GLU A 1 78  ? 23.566 -6.835  15.570  1.00 24.54 ? 78   GLU A OE1   1 
ATOM   595  O  OE2   . GLU A 1 78  ? 24.289 -6.048  17.512  1.00 25.75 ? 78   GLU A OE2   1 
ATOM   596  N  N     . LEU A 1 79  ? 20.498 -2.498  15.635  1.00 15.22 ? 79   LEU A N     1 
ATOM   597  C  CA    . LEU A 1 79  ? 19.887 -1.595  16.643  1.00 14.79 ? 79   LEU A CA    1 
ATOM   598  C  C     . LEU A 1 79  ? 18.388 -1.795  16.838  1.00 16.05 ? 79   LEU A C     1 
ATOM   599  O  O     . LEU A 1 79  ? 17.818 -1.233  17.760  1.00 16.87 ? 79   LEU A O     1 
ATOM   600  C  CB    . LEU A 1 79  ? 20.180 -0.105  16.325  1.00 15.26 ? 79   LEU A CB    1 
ATOM   601  C  CG    . LEU A 1 79  ? 21.652 0.322   16.400  1.00 15.28 ? 79   LEU A CG    1 
ATOM   602  C  CD1   . LEU A 1 79  ? 21.864 1.714   15.847  1.00 13.35 ? 79   LEU A CD1   1 
ATOM   603  C  CD2   . LEU A 1 79  ? 22.091 0.221   17.853  1.00 19.27 ? 79   LEU A CD2   1 
ATOM   604  N  N     . GLY A 1 80  ? 17.755 -2.586  15.975  1.00 15.86 ? 80   GLY A N     1 
ATOM   605  C  CA    . GLY A 1 80  ? 16.338 -2.886  16.063  1.00 16.09 ? 80   GLY A CA    1 
ATOM   606  C  C     . GLY A 1 80  ? 15.508 -1.802  15.368  1.00 15.31 ? 80   GLY A C     1 
ATOM   607  O  O     . GLY A 1 80  ? 14.319 -1.676  15.615  1.00 15.59 ? 80   GLY A O     1 
ATOM   608  N  N     . LEU A 1 81  ? 16.146 -1.003  14.502  1.00 14.96 ? 81   LEU A N     1 
ATOM   609  C  CA    . LEU A 1 81  ? 15.525 0.172   13.931  1.00 13.47 ? 81   LEU A CA    1 
ATOM   610  C  C     . LEU A 1 81  ? 15.310 0.018   12.420  1.00 14.39 ? 81   LEU A C     1 
ATOM   611  O  O     . LEU A 1 81  ? 15.965 -0.823  11.775  1.00 14.37 ? 81   LEU A O     1 
ATOM   612  C  CB    . LEU A 1 81  ? 16.419 1.392   14.229  1.00 14.62 ? 81   LEU A CB    1 
ATOM   613  C  CG    . LEU A 1 81  ? 16.911 1.730   15.638  1.00 14.22 ? 81   LEU A CG    1 
ATOM   614  C  CD1   . LEU A 1 81  ? 17.795 2.985   15.531  1.00 17.20 ? 81   LEU A CD1   1 
ATOM   615  C  CD2   . LEU A 1 81  ? 15.717 1.859   16.525  1.00 18.03 ? 81   LEU A CD2   1 
ATOM   616  N  N     . GLY A 1 82  ? 14.385 0.815   11.867  1.00 14.52 ? 82   GLY A N     1 
ATOM   617  C  CA    . GLY A 1 82  ? 14.314 1.030   10.440  1.00 13.33 ? 82   GLY A CA    1 
ATOM   618  C  C     . GLY A 1 82  ? 15.418 1.935   9.909   1.00 13.23 ? 82   GLY A C     1 
ATOM   619  O  O     . GLY A 1 82  ? 16.076 2.625   10.680  1.00 13.34 ? 82   GLY A O     1 
ATOM   620  N  N     . CYS A 1 83  ? 15.598 1.923   8.596   1.00 12.43 ? 83   CYS A N     1 
ATOM   621  C  CA    . CYS A 1 83  ? 16.543 2.769   7.869   1.00 13.47 ? 83   CYS A CA    1 
ATOM   622  C  C     . CYS A 1 83  ? 15.785 3.610   6.848   1.00 13.76 ? 83   CYS A C     1 
ATOM   623  O  O     . CYS A 1 83  ? 14.928 3.078   6.152   1.00 14.79 ? 83   CYS A O     1 
ATOM   624  C  CB    . CYS A 1 83  ? 17.526 1.865   7.107   1.00 13.18 ? 83   CYS A CB    1 
ATOM   625  S  SG    . CYS A 1 83  ? 18.930 2.753   6.509   1.00 16.28 ? 83   CYS A SG    1 
ATOM   626  N  N     . VAL A 1 84  ? 16.010 4.921   6.875   1.00 13.46 ? 84   VAL A N     1 
ATOM   627  C  CA    . VAL A 1 84  ? 15.514 5.803   5.856   1.00 13.79 ? 84   VAL A CA    1 
ATOM   628  C  C     . VAL A 1 84  ? 16.618 6.120   4.915   1.00 13.45 ? 84   VAL A C     1 
ATOM   629  O  O     . VAL A 1 84  ? 17.798 6.022   5.248   1.00 14.48 ? 84   VAL A O     1 
ATOM   630  C  CB    . VAL A 1 84  ? 14.846 7.050   6.442   1.00 15.13 ? 84   VAL A CB    1 
ATOM   631  C  CG1   . VAL A 1 84  ? 13.745 6.643   7.348   1.00 13.62 ? 84   VAL A CG1   1 
ATOM   632  C  CG2   . VAL A 1 84  ? 15.806 7.953   7.203   1.00 12.92 ? 84   VAL A CG2   1 
ATOM   633  N  N     . LEU A 1 85  ? 16.225 6.523   3.706   1.00 14.81 ? 85   LEU A N     1 
ATOM   634  C  CA    . LEU A 1 85  ? 17.125 6.733   2.628   1.00 15.40 ? 85   LEU A CA    1 
ATOM   635  C  C     . LEU A 1 85  ? 17.237 8.211   2.306   1.00 15.22 ? 85   LEU A C     1 
ATOM   636  O  O     . LEU A 1 85  ? 16.211 8.931   2.202   1.00 14.70 ? 85   LEU A O     1 
ATOM   637  C  CB    . LEU A 1 85  ? 16.601 6.005   1.354   1.00 15.24 ? 85   LEU A CB    1 
ATOM   638  C  CG    . LEU A 1 85  ? 16.344 4.529   1.594   1.00 19.22 ? 85   LEU A CG    1 
ATOM   639  C  CD1   . LEU A 1 85  ? 15.853 3.887   0.268   1.00 17.61 ? 85   LEU A CD1   1 
ATOM   640  C  CD2   . LEU A 1 85  ? 17.600 3.865   2.235   1.00 18.65 ? 85   LEU A CD2   1 
ATOM   641  N  N     . ILE A 1 86  ? 18.478 8.637   2.136   1.00 15.14 ? 86   ILE A N     1 
ATOM   642  C  CA    . ILE A 1 86  ? 18.815 9.908   1.578   1.00 16.41 ? 86   ILE A CA    1 
ATOM   643  C  C     . ILE A 1 86  ? 19.556 9.663   0.266   1.00 15.45 ? 86   ILE A C     1 
ATOM   644  O  O     . ILE A 1 86  ? 20.589 9.041   0.225   1.00 15.99 ? 86   ILE A O     1 
ATOM   645  C  CB    . ILE A 1 86  ? 19.608 10.792  2.583   1.00 17.20 ? 86   ILE A CB    1 
ATOM   646  C  CG1   . ILE A 1 86  ? 18.706 11.081  3.757   1.00 16.65 ? 86   ILE A CG1   1 
ATOM   647  C  CG2   . ILE A 1 86  ? 20.153 12.090  1.889   1.00 18.68 ? 86   ILE A CG2   1 
ATOM   648  C  CD1   . ILE A 1 86  ? 19.325 11.885  4.850   1.00 19.53 ? 86   ILE A CD1   1 
ATOM   649  N  N     . ARG A 1 87  ? 18.938 10.083  -0.821  1.00 16.12 ? 87   ARG A N     1 
ATOM   650  C  CA    . ARG A 1 87  ? 19.403 9.698   -2.122  1.00 17.93 ? 87   ARG A CA    1 
ATOM   651  C  C     . ARG A 1 87  ? 20.000 10.837  -2.906  1.00 19.31 ? 87   ARG A C     1 
ATOM   652  O  O     . ARG A 1 87  ? 19.730 12.011  -2.703  1.00 17.38 ? 87   ARG A O     1 
ATOM   653  C  CB    . ARG A 1 87  ? 18.304 9.047   -2.931  1.00 18.55 ? 87   ARG A CB    1 
ATOM   654  C  CG    . ARG A 1 87  ? 17.729 7.787   -2.285  1.00 20.92 ? 87   ARG A CG    1 
ATOM   655  C  CD    . ARG A 1 87  ? 17.598 6.651   -3.225  1.00 25.11 ? 87   ARG A CD    1 
ATOM   656  N  NE    . ARG A 1 87  ? 18.803 6.464   -4.030  1.00 27.77 ? 87   ARG A NE    1 
ATOM   657  C  CZ    . ARG A 1 87  ? 18.879 5.665   -5.075  1.00 28.79 ? 87   ARG A CZ    1 
ATOM   658  N  NH1   . ARG A 1 87  ? 17.797 5.030   -5.468  1.00 28.54 ? 87   ARG A NH1   1 
ATOM   659  N  NH2   . ARG A 1 87  ? 20.012 5.549   -5.767  1.00 29.85 ? 87   ARG A NH2   1 
ATOM   660  N  N     . LYS A 1 88  ? 20.847 10.479  -3.849  1.00 20.55 ? 88   LYS A N     1 
ATOM   661  C  CA    . LYS A 1 88  ? 21.163 11.438  -4.873  1.00 20.79 ? 88   LYS A CA    1 
ATOM   662  C  C     . LYS A 1 88  ? 19.891 11.858  -5.612  1.00 20.53 ? 88   LYS A C     1 
ATOM   663  O  O     . LYS A 1 88  ? 19.017 11.040  -5.908  1.00 18.52 ? 88   LYS A O     1 
ATOM   664  C  CB    . LYS A 1 88  ? 22.205 10.868  -5.830  1.00 22.77 ? 88   LYS A CB    1 
ATOM   665  C  CG    . LYS A 1 88  ? 23.464 10.427  -5.074  1.00 24.34 ? 88   LYS A CG    1 
ATOM   666  C  CD    . LYS A 1 88  ? 24.576 10.168  -6.026  1.00 28.83 ? 88   LYS A CD    1 
ATOM   667  C  CE    . LYS A 1 88  ? 25.775 9.597   -5.357  1.00 28.22 ? 88   LYS A CE    1 
ATOM   668  N  NZ    . LYS A 1 88  ? 26.325 10.557  -4.333  1.00 30.92 ? 88   LYS A NZ    1 
ATOM   669  N  N     . ARG A 1 89  ? 19.816 13.147  -5.923  1.00 19.32 ? 89   ARG A N     1 
ATOM   670  C  CA    . ARG A 1 89  ? 18.617 13.720  -6.521  1.00 19.61 ? 89   ARG A CA    1 
ATOM   671  C  C     . ARG A 1 89  ? 18.195 13.029  -7.818  1.00 19.69 ? 89   ARG A C     1 
ATOM   672  O  O     . ARG A 1 89  ? 19.043 12.708  -8.632  1.00 18.80 ? 89   ARG A O     1 
ATOM   673  C  CB    . ARG A 1 89  ? 18.814 15.207  -6.800  1.00 19.80 ? 89   ARG A CB    1 
ATOM   674  C  CG    . ARG A 1 89  ? 17.520 15.842  -7.379  1.00 19.44 ? 89   ARG A CG    1 
ATOM   675  C  CD    . ARG A 1 89  ? 17.304 17.278  -7.011  1.00 19.45 ? 89   ARG A CD    1 
ATOM   676  N  NE    . ARG A 1 89  ? 16.150 17.812  -7.718  1.00 19.33 ? 89   ARG A NE    1 
ATOM   677  C  CZ    . ARG A 1 89  ? 16.114 18.961  -8.409  1.00 18.85 ? 89   ARG A CZ    1 
ATOM   678  N  NH1   . ARG A 1 89  ? 15.010 19.345  -9.042  1.00 23.46 ? 89   ARG A NH1   1 
ATOM   679  N  NH2   . ARG A 1 89  ? 17.154 19.753  -8.438  1.00 18.20 ? 89   ARG A NH2   1 
ATOM   680  N  N     . GLY A 1 90  ? 16.872 12.837  -7.957  1.00 20.59 ? 90   GLY A N     1 
ATOM   681  C  CA    . GLY A 1 90  ? 16.190 12.348  -9.197  1.00 20.54 ? 90   GLY A CA    1 
ATOM   682  C  C     . GLY A 1 90  ? 15.851 10.881  -9.184  1.00 20.49 ? 90   GLY A C     1 
ATOM   683  O  O     . GLY A 1 90  ? 15.351 10.358  -10.171 1.00 21.41 ? 90   GLY A O     1 
ATOM   684  N  N     . LYS A 1 91  ? 16.082 10.237  -8.039  1.00 21.61 ? 91   LYS A N     1 
ATOM   685  C  CA    . LYS A 1 91  ? 15.872 8.796   -7.844  1.00 22.58 ? 91   LYS A CA    1 
ATOM   686  C  C     . LYS A 1 91  ? 14.584 8.437   -7.129  1.00 22.40 ? 91   LYS A C     1 
ATOM   687  O  O     . LYS A 1 91  ? 14.023 7.338   -7.374  1.00 22.38 ? 91   LYS A O     1 
ATOM   688  C  CB    . LYS A 1 91  ? 17.015 8.207   -7.017  1.00 24.06 ? 91   LYS A CB    1 
ATOM   689  C  CG    . LYS A 1 91  ? 18.415 8.393   -7.670  1.00 26.45 ? 91   LYS A CG    1 
ATOM   690  C  CD    . LYS A 1 91  ? 18.488 7.629   -8.968  1.00 30.08 ? 91   LYS A CD    1 
ATOM   691  N  N     . LEU A 1 92  ? 14.135 9.320   -6.223  1.00 21.40 ? 92   LEU A N     1 
ATOM   692  C  CA    . LEU A 1 92  ? 12.955 9.054   -5.405  1.00 21.26 ? 92   LEU A CA    1 
ATOM   693  C  C     . LEU A 1 92  ? 11.643 9.537   -6.061  1.00 19.91 ? 92   LEU A C     1 
ATOM   694  O  O     . LEU A 1 92  ? 11.581 10.597  -6.687  1.00 18.88 ? 92   LEU A O     1 
ATOM   695  C  CB    . LEU A 1 92  ? 13.154 9.687   -4.018  1.00 20.93 ? 92   LEU A CB    1 
ATOM   696  C  CG    . LEU A 1 92  ? 14.218 9.029   -3.135  1.00 23.00 ? 92   LEU A CG    1 
ATOM   697  C  CD1   . LEU A 1 92  ? 14.586 9.988   -2.029  1.00 24.88 ? 92   LEU A CD1   1 
ATOM   698  C  CD2   . LEU A 1 92  ? 13.715 7.701   -2.549  1.00 25.91 ? 92   LEU A CD2   1 
ATOM   699  N  N     . PRO A 1 93  ? 10.572 8.710   -5.962  1.00 19.24 ? 93   PRO A N     1 
ATOM   700  C  CA    . PRO A 1 93  ? 9.277  9.134   -6.389  1.00 17.78 ? 93   PRO A CA    1 
ATOM   701  C  C     . PRO A 1 93  ? 8.611  9.962   -5.268  1.00 18.17 ? 93   PRO A C     1 
ATOM   702  O  O     . PRO A 1 93  ? 9.061  9.892   -4.105  1.00 18.32 ? 93   PRO A O     1 
ATOM   703  C  CB    . PRO A 1 93  ? 8.524  7.799   -6.578  1.00 18.07 ? 93   PRO A CB    1 
ATOM   704  C  CG    . PRO A 1 93  ? 9.086  6.895   -5.531  1.00 20.24 ? 93   PRO A CG    1 
ATOM   705  C  CD    . PRO A 1 93  ? 10.583 7.322   -5.437  1.00 19.58 ? 93   PRO A CD    1 
ATOM   706  N  N     . GLY A 1 94  ? 7.487  10.593  -5.605  1.00 17.95 ? 94   GLY A N     1 
ATOM   707  C  CA    . GLY A 1 94  ? 6.622  11.337  -4.628  1.00 17.78 ? 94   GLY A CA    1 
ATOM   708  C  C     . GLY A 1 94  ? 7.271  12.661  -4.269  1.00 17.65 ? 94   GLY A C     1 
ATOM   709  O  O     . GLY A 1 94  ? 8.341  12.953  -4.752  1.00 18.77 ? 94   GLY A O     1 
ATOM   710  N  N     . PRO A 1 95  ? 6.630  13.470  -3.423  1.00 17.47 ? 95   PRO A N     1 
ATOM   711  C  CA    . PRO A 1 95  ? 7.224  14.788  -3.049  1.00 17.00 ? 95   PRO A CA    1 
ATOM   712  C  C     . PRO A 1 95  ? 8.541  14.652  -2.344  1.00 15.92 ? 95   PRO A C     1 
ATOM   713  O  O     . PRO A 1 95  ? 8.688  13.828  -1.419  1.00 15.31 ? 95   PRO A O     1 
ATOM   714  C  CB    . PRO A 1 95  ? 6.203  15.372  -2.072  1.00 17.34 ? 95   PRO A CB    1 
ATOM   715  C  CG    . PRO A 1 95  ? 4.925  14.670  -2.431  1.00 18.35 ? 95   PRO A CG    1 
ATOM   716  C  CD    . PRO A 1 95  ? 5.339  13.265  -2.745  1.00 17.72 ? 95   PRO A CD    1 
ATOM   717  N  N     . THR A 1 96  ? 9.494  15.481  -2.751  1.00 14.78 ? 96   THR A N     1 
ATOM   718  C  CA    . THR A 1 96  ? 10.784 15.490  -2.110  1.00 14.73 ? 96   THR A CA    1 
ATOM   719  C  C     . THR A 1 96  ? 11.243 16.935  -1.811  1.00 15.11 ? 96   THR A C     1 
ATOM   720  O  O     . THR A 1 96  ? 10.668 17.930  -2.272  1.00 13.35 ? 96   THR A O     1 
ATOM   721  C  CB    . THR A 1 96  ? 11.846 14.914  -3.031  1.00 15.01 ? 96   THR A CB    1 
ATOM   722  O  OG1   . THR A 1 96  ? 11.825 15.641  -4.254  1.00 13.66 ? 96   THR A OG1   1 
ATOM   723  C  CG2   . THR A 1 96  ? 11.626 13.405  -3.348  1.00 15.38 ? 96   THR A CG2   1 
ATOM   724  N  N     . LEU A 1 97  ? 12.324 16.989  -1.056  1.00 14.64 ? 97   LEU A N     1 
ATOM   725  C  CA    . LEU A 1 97  ? 13.121 18.170  -0.891  1.00 15.16 ? 97   LEU A CA    1 
ATOM   726  C  C     . LEU A 1 97  ? 14.515 17.768  -1.208  1.00 12.46 ? 97   LEU A C     1 
ATOM   727  O  O     . LEU A 1 97  ? 14.883 16.608  -1.061  1.00 11.74 ? 97   LEU A O     1 
ATOM   728  C  CB    . LEU A 1 97  ? 13.051 18.755  0.509   1.00 16.55 ? 97   LEU A CB    1 
ATOM   729  C  CG    . LEU A 1 97  ? 13.129 17.991  1.796   1.00 20.12 ? 97   LEU A CG    1 
ATOM   730  C  CD1   . LEU A 1 97  ? 13.091 18.989  2.961   1.00 23.30 ? 97   LEU A CD1   1 
ATOM   731  C  CD2   . LEU A 1 97  ? 11.968 17.084  1.973   1.00 25.77 ? 97   LEU A CD2   1 
ATOM   732  N  N     . TRP A 1 98  ? 15.339 18.745  -1.513  1.00 11.88 ? 98   TRP A N     1 
ATOM   733  C  CA    . TRP A 1 98  ? 16.697 18.426  -1.857  1.00 13.25 ? 98   TRP A CA    1 
ATOM   734  C  C     . TRP A 1 98  ? 17.659 19.523  -1.369  1.00 13.09 ? 98   TRP A C     1 
ATOM   735  O  O     . TRP A 1 98  ? 17.235 20.620  -0.990  1.00 13.25 ? 98   TRP A O     1 
ATOM   736  C  CB    . TRP A 1 98  ? 16.797 18.211  -3.393  1.00 13.69 ? 98   TRP A CB    1 
ATOM   737  C  CG    . TRP A 1 98  ? 16.361 19.328  -4.213  1.00 14.25 ? 98   TRP A CG    1 
ATOM   738  C  CD1   . TRP A 1 98  ? 17.085 20.413  -4.567  1.00 11.69 ? 98   TRP A CD1   1 
ATOM   739  C  CD2   . TRP A 1 98  ? 15.059 19.516  -4.816  1.00 17.01 ? 98   TRP A CD2   1 
ATOM   740  N  NE1   . TRP A 1 98  ? 16.329 21.263  -5.295  1.00 15.03 ? 98   TRP A NE1   1 
ATOM   741  C  CE2   . TRP A 1 98  ? 15.093 20.735  -5.490  1.00 15.32 ? 98   TRP A CE2   1 
ATOM   742  C  CE3   . TRP A 1 98  ? 13.888 18.751  -4.852  1.00 18.17 ? 98   TRP A CE3   1 
ATOM   743  C  CZ2   . TRP A 1 98  ? 13.988 21.248  -6.208  1.00 16.81 ? 98   TRP A CZ2   1 
ATOM   744  C  CZ3   . TRP A 1 98  ? 12.794 19.242  -5.573  1.00 15.76 ? 98   TRP A CZ3   1 
ATOM   745  C  CH2   . TRP A 1 98  ? 12.852 20.471  -6.234  1.00 17.53 ? 98   TRP A CH2   1 
ATOM   746  N  N     . ALA A 1 99  ? 18.935 19.189  -1.312  1.00 14.96 ? 99   ALA A N     1 
ATOM   747  C  CA    . ALA A 1 99  ? 19.963 20.073  -0.784  1.00 15.22 ? 99   ALA A CA    1 
ATOM   748  C  C     . ALA A 1 99  ? 21.266 19.937  -1.542  1.00 17.06 ? 99   ALA A C     1 
ATOM   749  O  O     . ALA A 1 99  ? 21.762 18.818  -1.701  1.00 15.67 ? 99   ALA A O     1 
ATOM   750  C  CB    . ALA A 1 99  ? 20.228 19.737  0.707   1.00 14.63 ? 99   ALA A CB    1 
ATOM   751  N  N     . SER A 1 100 ? 21.818 21.093  -1.956  1.00 21.17 ? 100  SER A N     1 
ATOM   752  C  CA    . SER A 1 100 ? 23.045 21.195  -2.780  1.00 22.74 ? 100  SER A CA    1 
ATOM   753  C  C     . SER A 1 100 ? 24.241 21.278  -1.898  1.00 24.05 ? 100  SER A C     1 
ATOM   754  O  O     . SER A 1 100 ? 24.162 21.725  -0.771  1.00 25.90 ? 100  SER A O     1 
ATOM   755  C  CB    A SER A 1 100 ? 23.009 22.455  -3.651  0.65 23.62 ? 100  SER A CB    1 
ATOM   756  C  CB    B SER A 1 100 ? 23.009 22.429  -3.685  0.35 23.00 ? 100  SER A CB    1 
ATOM   757  O  OG    A SER A 1 100 ? 23.989 22.430  -4.674  0.65 25.13 ? 100  SER A OG    1 
ATOM   758  O  OG    B SER A 1 100 ? 22.885 23.626  -2.932  0.35 21.69 ? 100  SER A OG    1 
ATOM   759  N  N     . TYR A 1 101 ? 25.366 20.828  -2.417  1.00 25.05 ? 101  TYR A N     1 
ATOM   760  C  CA    . TYR A 1 101 ? 26.606 20.879  -1.680  1.00 24.88 ? 101  TYR A CA    1 
ATOM   761  C  C     . TYR A 1 101 ? 27.696 20.767  -2.731  1.00 26.06 ? 101  TYR A C     1 
ATOM   762  O  O     . TYR A 1 101 ? 27.468 20.377  -3.890  1.00 24.42 ? 101  TYR A O     1 
ATOM   763  C  CB    . TYR A 1 101 ? 26.712 19.754  -0.609  1.00 25.49 ? 101  TYR A CB    1 
ATOM   764  C  CG    . TYR A 1 101 ? 26.726 18.384  -1.180  1.00 23.03 ? 101  TYR A CG    1 
ATOM   765  C  CD1   . TYR A 1 101 ? 25.549 17.792  -1.621  1.00 24.67 ? 101  TYR A CD1   1 
ATOM   766  C  CD2   . TYR A 1 101 ? 27.922 17.695  -1.356  1.00 24.69 ? 101  TYR A CD2   1 
ATOM   767  C  CE1   . TYR A 1 101 ? 25.543 16.501  -2.199  1.00 23.93 ? 101  TYR A CE1   1 
ATOM   768  C  CE2   . TYR A 1 101 ? 27.936 16.384  -1.935  1.00 22.75 ? 101  TYR A CE2   1 
ATOM   769  C  CZ    . TYR A 1 101 ? 26.723 15.820  -2.347  1.00 25.85 ? 101  TYR A CZ    1 
ATOM   770  O  OH    . TYR A 1 101 ? 26.695 14.593  -2.955  1.00 28.78 ? 101  TYR A OH    1 
ATOM   771  N  N     . SER A 1 102 ? 28.891 21.155  -2.319  1.00 27.16 ? 102  SER A N     1 
ATOM   772  C  CA    . SER A 1 102 ? 30.030 21.146  -3.201  1.00 27.14 ? 102  SER A CA    1 
ATOM   773  C  C     . SER A 1 102 ? 30.599 19.729  -3.153  1.00 28.76 ? 102  SER A C     1 
ATOM   774  O  O     . SER A 1 102 ? 30.908 19.182  -2.062  1.00 28.55 ? 102  SER A O     1 
ATOM   775  C  CB    . SER A 1 102 ? 31.054 22.196  -2.751  1.00 27.59 ? 102  SER A CB    1 
ATOM   776  O  OG    . SER A 1 102 ? 32.310 22.041  -3.403  1.00 28.04 ? 102  SER A OG    1 
ATOM   777  N  N     . LEU A 1 103 ? 30.739 19.129  -4.329  1.00 29.32 ? 103  LEU A N     1 
ATOM   778  C  CA    . LEU A 1 103 ? 31.414 17.853  -4.440  1.00 30.57 ? 103  LEU A CA    1 
ATOM   779  C  C     . LEU A 1 103 ? 32.407 17.938  -5.580  1.00 30.25 ? 103  LEU A C     1 
ATOM   780  O  O     . LEU A 1 103 ? 32.018 18.240  -6.707  1.00 29.80 ? 103  LEU A O     1 
ATOM   781  C  CB    . LEU A 1 103 ? 30.397 16.728  -4.670  1.00 31.59 ? 103  LEU A CB    1 
ATOM   782  C  CG    . LEU A 1 103 ? 30.828 15.292  -4.287  1.00 33.63 ? 103  LEU A CG    1 
ATOM   783  C  CD1   . LEU A 1 103 ? 31.610 14.675  -5.423  1.00 34.65 ? 103  LEU A CD1   1 
ATOM   784  C  CD2   . LEU A 1 103 ? 31.636 15.189  -2.976  1.00 33.62 ? 103  LEU A CD2   1 
ATOM   785  N  N     . GLU A 1 104 ? 33.682 17.685  -5.278  1.00 30.79 ? 104  GLU A N     1 
ATOM   786  C  CA    . GLU A 1 104 ? 34.770 17.891  -6.255  1.00 31.42 ? 104  GLU A CA    1 
ATOM   787  C  C     . GLU A 1 104 ? 34.761 19.354  -6.771  1.00 30.64 ? 104  GLU A C     1 
ATOM   788  O  O     . GLU A 1 104 ? 34.827 20.278  -5.960  1.00 30.22 ? 104  GLU A O     1 
ATOM   789  C  CB    . GLU A 1 104 ? 34.732 16.844  -7.404  1.00 32.17 ? 104  GLU A CB    1 
ATOM   790  C  CG    . GLU A 1 104 ? 35.032 15.400  -6.977  1.00 33.20 ? 104  GLU A CG    1 
ATOM   791  N  N     . TYR A 1 105 ? 34.673 19.565  -8.093  1.00 30.26 ? 105  TYR A N     1 
ATOM   792  C  CA    . TYR A 1 105 ? 34.762 20.913  -8.675  1.00 30.35 ? 105  TYR A CA    1 
ATOM   793  C  C     . TYR A 1 105 ? 33.401 21.557  -8.969  1.00 30.23 ? 105  TYR A C     1 
ATOM   794  O  O     . TYR A 1 105 ? 33.367 22.696  -9.452  1.00 30.11 ? 105  TYR A O     1 
ATOM   795  C  CB    . TYR A 1 105 ? 35.593 20.903  -9.978  1.00 30.81 ? 105  TYR A CB    1 
ATOM   796  C  CG    . TYR A 1 105 ? 37.051 20.529  -9.812  1.00 30.65 ? 105  TYR A CG    1 
ATOM   797  C  CD1   . TYR A 1 105 ? 37.503 19.241  -10.079 1.00 30.84 ? 105  TYR A CD1   1 
ATOM   798  C  CD2   . TYR A 1 105 ? 37.984 21.464  -9.399  1.00 29.48 ? 105  TYR A CD2   1 
ATOM   799  C  CE1   . TYR A 1 105 ? 38.847 18.899  -9.937  1.00 29.87 ? 105  TYR A CE1   1 
ATOM   800  C  CE2   . TYR A 1 105 ? 39.319 21.116  -9.254  1.00 29.47 ? 105  TYR A CE2   1 
ATOM   801  C  CZ    . TYR A 1 105 ? 39.740 19.849  -9.522  1.00 29.59 ? 105  TYR A CZ    1 
ATOM   802  O  OH    . TYR A 1 105 ? 41.064 19.542  -9.373  1.00 32.17 ? 105  TYR A OH    1 
ATOM   803  N  N     . GLY A 1 106 ? 32.295 20.864  -8.656  1.00 29.73 ? 106  GLY A N     1 
ATOM   804  C  CA    . GLY A 1 106 ? 30.952 21.362  -8.931  1.00 29.63 ? 106  GLY A CA    1 
ATOM   805  C  C     . GLY A 1 106 ? 29.939 21.056  -7.834  1.00 29.69 ? 106  GLY A C     1 
ATOM   806  O  O     . GLY A 1 106 ? 30.292 20.975  -6.681  1.00 29.03 ? 106  GLY A O     1 
ATOM   807  N  N     . LYS A 1 107 ? 28.670 20.910  -8.206  1.00 30.27 ? 107  LYS A N     1 
ATOM   808  C  CA    . LYS A 1 107 ? 27.605 20.765  -7.230  1.00 29.92 ? 107  LYS A CA    1 
ATOM   809  C  C     . LYS A 1 107 ? 26.897 19.455  -7.454  1.00 29.01 ? 107  LYS A C     1 
ATOM   810  O  O     . LYS A 1 107 ? 26.691 19.040  -8.585  1.00 29.79 ? 107  LYS A O     1 
ATOM   811  C  CB    . LYS A 1 107 ? 26.602 21.930  -7.326  1.00 31.20 ? 107  LYS A CB    1 
ATOM   812  C  CG    . LYS A 1 107 ? 27.274 23.324  -7.097  1.00 33.53 ? 107  LYS A CG    1 
ATOM   813  C  CD    . LYS A 1 107 ? 26.290 24.510  -7.079  1.00 34.20 ? 107  LYS A CD    1 
ATOM   814  N  N     . ALA A 1 108 ? 26.561 18.788  -6.355  1.00 27.12 ? 108  ALA A N     1 
ATOM   815  C  CA    . ALA A 1 108 ? 25.655 17.657  -6.357  1.00 25.11 ? 108  ALA A CA    1 
ATOM   816  C  C     . ALA A 1 108 ? 24.494 17.955  -5.397  1.00 23.36 ? 108  ALA A C     1 
ATOM   817  O  O     . ALA A 1 108 ? 24.551 18.888  -4.616  1.00 21.94 ? 108  ALA A O     1 
ATOM   818  C  CB    . ALA A 1 108 ? 26.392 16.451  -5.919  1.00 24.67 ? 108  ALA A CB    1 
ATOM   819  N  N     . GLU A 1 109 ? 23.434 17.141  -5.490  1.00 22.46 ? 109  GLU A N     1 
ATOM   820  C  CA    . GLU A 1 109 ? 22.254 17.267  -4.611  1.00 20.86 ? 109  GLU A CA    1 
ATOM   821  C  C     . GLU A 1 109 ? 21.819 15.952  -4.051  1.00 19.07 ? 109  GLU A C     1 
ATOM   822  O  O     . GLU A 1 109 ? 21.929 14.935  -4.737  1.00 18.97 ? 109  GLU A O     1 
ATOM   823  C  CB    A GLU A 1 109 ? 21.097 17.938  -5.366  0.65 21.14 ? 109  GLU A CB    1 
ATOM   824  C  CB    B GLU A 1 109 ? 21.112 17.934  -5.357  0.35 20.94 ? 109  GLU A CB    1 
ATOM   825  C  CG    A GLU A 1 109 ? 21.329 19.448  -5.588  0.65 21.16 ? 109  GLU A CG    1 
ATOM   826  C  CG    B GLU A 1 109 ? 21.456 19.348  -5.778  0.35 20.71 ? 109  GLU A CG    1 
ATOM   827  C  CD    A GLU A 1 109 ? 20.412 20.066  -6.607  0.65 22.04 ? 109  GLU A CD    1 
ATOM   828  C  CD    B GLU A 1 109 ? 20.692 19.760  -6.973  0.35 21.05 ? 109  GLU A CD    1 
ATOM   829  O  OE1   A GLU A 1 109 ? 20.168 21.284  -6.511  0.65 21.98 ? 109  GLU A OE1   1 
ATOM   830  O  OE1   B GLU A 1 109 ? 21.313 19.951  -8.033  0.35 20.73 ? 109  GLU A OE1   1 
ATOM   831  O  OE2   A GLU A 1 109 ? 19.951 19.348  -7.515  0.65 24.59 ? 109  GLU A OE2   1 
ATOM   832  O  OE2   B GLU A 1 109 ? 19.461 19.850  -6.850  0.35 19.40 ? 109  GLU A OE2   1 
ATOM   833  N  N     . LEU A 1 110 ? 21.440 15.965  -2.757  1.00 17.84 ? 110  LEU A N     1 
ATOM   834  C  CA    . LEU A 1 110 ? 20.831 14.847  -2.090  1.00 15.93 ? 110  LEU A CA    1 
ATOM   835  C  C     . LEU A 1 110 ? 19.357 15.165  -1.934  1.00 15.50 ? 110  LEU A C     1 
ATOM   836  O  O     . LEU A 1 110 ? 19.001 16.336  -1.901  1.00 15.01 ? 110  LEU A O     1 
ATOM   837  C  CB    . LEU A 1 110 ? 21.429 14.646  -0.677  1.00 16.60 ? 110  LEU A CB    1 
ATOM   838  C  CG    . LEU A 1 110 ? 22.870 14.130  -0.689  1.00 16.14 ? 110  LEU A CG    1 
ATOM   839  C  CD1   . LEU A 1 110 ? 23.253 13.993  0.759   1.00 17.83 ? 110  LEU A CD1   1 
ATOM   840  C  CD2   . LEU A 1 110 ? 23.091 12.847  -1.498  1.00 19.55 ? 110  LEU A CD2   1 
ATOM   841  N  N     . GLU A 1 111 ? 18.518 14.124  -1.817  1.00 14.54 ? 111  GLU A N     1 
ATOM   842  C  CA    . GLU A 1 111 ? 17.093 14.309  -1.751  1.00 15.18 ? 111  GLU A CA    1 
ATOM   843  C  C     . GLU A 1 111 ? 16.529 13.390  -0.701  1.00 14.46 ? 111  GLU A C     1 
ATOM   844  O  O     . GLU A 1 111 ? 17.094 12.340  -0.410  1.00 14.49 ? 111  GLU A O     1 
ATOM   845  C  CB    . GLU A 1 111 ? 16.513 13.940  -3.141  1.00 15.80 ? 111  GLU A CB    1 
ATOM   846  C  CG    . GLU A 1 111 ? 15.101 14.185  -3.426  1.00 18.27 ? 111  GLU A CG    1 
ATOM   847  C  CD    . GLU A 1 111 ? 14.808 14.088  -4.933  1.00 20.82 ? 111  GLU A CD    1 
ATOM   848  O  OE1   . GLU A 1 111 ? 14.034 14.928  -5.472  1.00 23.43 ? 111  GLU A OE1   1 
ATOM   849  O  OE2   . GLU A 1 111 ? 15.369 13.158  -5.566  1.00 18.21 ? 111  GLU A OE2   1 
ATOM   850  N  N     . ILE A 1 112 ? 15.400 13.781  -0.123  1.00 14.41 ? 112  ILE A N     1 
ATOM   851  C  CA    . ILE A 1 112 ? 14.666 12.929  0.765   1.00 14.26 ? 112  ILE A CA    1 
ATOM   852  C  C     . ILE A 1 112 ? 13.154 13.052  0.475   1.00 13.38 ? 112  ILE A C     1 
ATOM   853  O  O     . ILE A 1 112 ? 12.664 14.072  -0.009  1.00 14.05 ? 112  ILE A O     1 
ATOM   854  C  CB    . ILE A 1 112 ? 15.015 13.232  2.237   1.00 13.75 ? 112  ILE A CB    1 
ATOM   855  C  CG1   . ILE A 1 112 ? 14.541 12.117  3.116   1.00 16.54 ? 112  ILE A CG1   1 
ATOM   856  C  CG2   . ILE A 1 112 ? 14.393 14.549  2.729   1.00 17.00 ? 112  ILE A CG2   1 
ATOM   857  C  CD1   . ILE A 1 112 ? 15.224 12.170  4.477   1.00 20.56 ? 112  ILE A CD1   1 
ATOM   858  N  N     . GLN A 1 113 ? 12.412 11.972  0.686   1.00 13.14 ? 113  GLN A N     1 
ATOM   859  C  CA    . GLN A 1 113 ? 10.951 12.102  0.556   1.00 12.74 ? 113  GLN A CA    1 
ATOM   860  C  C     . GLN A 1 113 ? 10.417 13.012  1.672   1.00 13.89 ? 113  GLN A C     1 
ATOM   861  O  O     . GLN A 1 113 ? 10.861 12.881  2.827   1.00 12.46 ? 113  GLN A O     1 
ATOM   862  C  CB    . GLN A 1 113 ? 10.299 10.733  0.497   1.00 13.17 ? 113  GLN A CB    1 
ATOM   863  C  CG    . GLN A 1 113 ? 10.511 10.044  -0.822  1.00 17.30 ? 113  GLN A CG    1 
ATOM   864  C  CD    . GLN A 1 113 ? 10.065 8.563   -0.854  1.00 20.19 ? 113  GLN A CD    1 
ATOM   865  O  OE1   . GLN A 1 113 ? 10.264 7.805   0.119   1.00 24.52 ? 113  GLN A OE1   1 
ATOM   866  N  NE2   . GLN A 1 113 ? 9.493  8.135   -1.994  1.00 17.57 ? 113  GLN A NE2   1 
ATOM   867  N  N     . LYS A 1 114 ? 9.485  13.925  1.369   1.00 14.71 ? 114  LYS A N     1 
ATOM   868  C  CA    . LYS A 1 114 ? 8.897  14.780  2.396   1.00 14.48 ? 114  LYS A CA    1 
ATOM   869  C  C     . LYS A 1 114 ? 8.292  13.956  3.515   1.00 16.63 ? 114  LYS A C     1 
ATOM   870  O  O     . LYS A 1 114 ? 8.204  14.425  4.628   1.00 18.18 ? 114  LYS A O     1 
ATOM   871  C  CB    . LYS A 1 114 ? 7.840  15.755  1.841   1.00 16.32 ? 114  LYS A CB    1 
ATOM   872  C  CG    . LYS A 1 114 ? 8.381  16.772  0.814   1.00 12.82 ? 114  LYS A CG    1 
ATOM   873  C  CD    . LYS A 1 114 ? 7.354  17.864  0.612   1.00 14.97 ? 114  LYS A CD    1 
ATOM   874  C  CE    . LYS A 1 114 ? 7.605  18.710  -0.601  1.00 13.81 ? 114  LYS A CE    1 
ATOM   875  N  NZ    . LYS A 1 114 ? 6.557  19.797  -0.765  1.00 12.85 ? 114  LYS A NZ    1 
ATOM   876  N  N     . ASP A 1 115 ? 7.837  12.752  3.234   1.00 17.98 ? 115  ASP A N     1 
ATOM   877  C  CA    . ASP A 1 115 ? 7.243  11.955  4.292   1.00 18.60 ? 115  ASP A CA    1 
ATOM   878  C  C     . ASP A 1 115 ? 8.203  10.953  4.950   1.00 19.66 ? 115  ASP A C     1 
ATOM   879  O  O     . ASP A 1 115 ? 7.758  10.107  5.692   1.00 19.16 ? 115  ASP A O     1 
ATOM   880  C  CB    . ASP A 1 115 ? 5.922  11.308  3.833   1.00 18.06 ? 115  ASP A CB    1 
ATOM   881  C  CG    . ASP A 1 115 ? 6.099  10.243  2.724   1.00 22.80 ? 115  ASP A CG    1 
ATOM   882  O  OD1   . ASP A 1 115 ? 5.085  9.612   2.335   1.00 23.81 ? 115  ASP A OD1   1 
ATOM   883  O  OD2   . ASP A 1 115 ? 7.221  10.020  2.260   1.00 18.12 ? 115  ASP A OD2   1 
ATOM   884  N  N     . ALA A 1 116 ? 9.507  11.064  4.700   1.00 18.81 ? 116  ALA A N     1 
ATOM   885  C  CA    . ALA A 1 116 ? 10.446 10.104  5.246   1.00 20.00 ? 116  ALA A CA    1 
ATOM   886  C  C     . ALA A 1 116 ? 10.388 10.017  6.803   1.00 21.33 ? 116  ALA A C     1 
ATOM   887  O  O     . ALA A 1 116 ? 10.591 8.934   7.367   1.00 20.82 ? 116  ALA A O     1 
ATOM   888  C  CB    . ALA A 1 116 ? 11.861 10.412  4.800   1.00 19.06 ? 116  ALA A CB    1 
ATOM   889  N  N     . LEU A 1 117 ? 10.187 11.167  7.475   1.00 20.68 ? 117  LEU A N     1 
ATOM   890  C  CA    . LEU A 1 117 ? 10.084 11.224  8.924   1.00 19.95 ? 117  LEU A CA    1 
ATOM   891  C  C     . LEU A 1 117 ? 9.089  12.275  9.370   1.00 19.53 ? 117  LEU A C     1 
ATOM   892  O  O     . LEU A 1 117 ? 8.733  13.149  8.599   1.00 18.29 ? 117  LEU A O     1 
ATOM   893  C  CB    . LEU A 1 117 ? 11.407 11.615  9.503   1.00 20.61 ? 117  LEU A CB    1 
ATOM   894  C  CG    . LEU A 1 117 ? 12.648 10.757  9.284   1.00 22.81 ? 117  LEU A CG    1 
ATOM   895  C  CD1   . LEU A 1 117 ? 13.842 11.627  9.394   1.00 28.92 ? 117  LEU A CD1   1 
ATOM   896  C  CD2   . LEU A 1 117 ? 12.743 9.646   10.259  1.00 25.93 ? 117  LEU A CD2   1 
ATOM   897  N  N     . GLU A 1 118 ? 8.691  12.186  10.647  1.00 19.01 ? 118  GLU A N     1 
ATOM   898  C  CA    . GLU A 1 118 ? 7.739  13.094  11.287  1.00 19.86 ? 118  GLU A CA    1 
ATOM   899  C  C     . GLU A 1 118 ? 8.506  14.039  12.163  1.00 19.92 ? 118  GLU A C     1 
ATOM   900  O  O     . GLU A 1 118 ? 9.636  13.721  12.589  1.00 18.51 ? 118  GLU A O     1 
ATOM   901  C  CB    A GLU A 1 118 ? 6.753  12.312  12.132  0.65 19.62 ? 118  GLU A CB    1 
ATOM   902  C  CB    B GLU A 1 118 ? 6.719  12.319  12.137  0.35 19.57 ? 118  GLU A CB    1 
ATOM   903  C  CG    A GLU A 1 118 ? 6.032  11.307  11.350  0.65 22.15 ? 118  GLU A CG    1 
ATOM   904  C  CG    B GLU A 1 118 ? 5.491  11.806  11.401  0.35 20.90 ? 118  GLU A CG    1 
ATOM   905  C  CD    A GLU A 1 118 ? 5.018  10.525  12.144  0.65 24.88 ? 118  GLU A CD    1 
ATOM   906  C  CD    B GLU A 1 118 ? 4.897  12.827  10.461  0.35 21.24 ? 118  GLU A CD    1 
ATOM   907  O  OE1   A GLU A 1 118 ? 4.253  9.800   11.492  0.65 26.25 ? 118  GLU A OE1   1 
ATOM   908  O  OE1   B GLU A 1 118 ? 4.315  13.833  10.936  0.35 22.08 ? 118  GLU A OE1   1 
ATOM   909  O  OE2   A GLU A 1 118 ? 4.989  10.601  13.394  0.65 29.80 ? 118  GLU A OE2   1 
ATOM   910  O  OE2   B GLU A 1 118 ? 5.051  12.637  9.236   0.35 23.55 ? 118  GLU A OE2   1 
ATOM   911  N  N     . PRO A 1 119 ? 7.941  15.249  12.385  1.00 19.21 ? 119  PRO A N     1 
ATOM   912  C  CA    . PRO A 1 119 ? 8.615  16.175  13.289  1.00 18.91 ? 119  PRO A CA    1 
ATOM   913  C  C     . PRO A 1 119 ? 9.012  15.550  14.613  1.00 17.76 ? 119  PRO A C     1 
ATOM   914  O  O     . PRO A 1 119 ? 8.222  14.856  15.232  1.00 17.51 ? 119  PRO A O     1 
ATOM   915  C  CB    . PRO A 1 119 ? 7.604  17.299  13.413  1.00 18.84 ? 119  PRO A CB    1 
ATOM   916  C  CG    . PRO A 1 119 ? 7.104  17.389  12.010  1.00 17.23 ? 119  PRO A CG    1 
ATOM   917  C  CD    . PRO A 1 119 ? 6.803  15.914  11.719  1.00 19.23 ? 119  PRO A CD    1 
ATOM   918  N  N     . GLY A 1 120 ? 10.239 15.795  15.021  1.00 17.34 ? 120  GLY A N     1 
ATOM   919  C  CA    . GLY A 1 120 ? 10.664 15.316  16.346  1.00 17.42 ? 120  GLY A CA    1 
ATOM   920  C  C     . GLY A 1 120 ? 11.362 13.964  16.401  1.00 17.02 ? 120  GLY A C     1 
ATOM   921  O  O     . GLY A 1 120 ? 12.025 13.643  17.419  1.00 17.55 ? 120  GLY A O     1 
ATOM   922  N  N     . GLN A 1 121 ? 11.242 13.178  15.336  1.00 16.01 ? 121  GLN A N     1 
ATOM   923  C  CA    . GLN A 1 121 ? 11.918 11.897  15.243  1.00 15.58 ? 121  GLN A CA    1 
ATOM   924  C  C     . GLN A 1 121 ? 13.434 12.070  15.194  1.00 15.67 ? 121  GLN A C     1 
ATOM   925  O  O     . GLN A 1 121 ? 13.921 13.033  14.658  1.00 15.86 ? 121  GLN A O     1 
ATOM   926  C  CB    . GLN A 1 121 ? 11.376 11.085  14.067  1.00 16.01 ? 121  GLN A CB    1 
ATOM   927  C  CG    . GLN A 1 121 ? 9.955  10.610  14.403  1.00 19.34 ? 121  GLN A CG    1 
ATOM   928  C  CD    . GLN A 1 121 ? 9.357  9.654   13.370  1.00 18.91 ? 121  GLN A CD    1 
ATOM   929  O  OE1   . GLN A 1 121 ? 9.468  9.840   12.168  1.00 20.22 ? 121  GLN A OE1   1 
ATOM   930  N  NE2   . GLN A 1 121 ? 8.722  8.619   13.865  1.00 17.91 ? 121  GLN A NE2   1 
ATOM   931  N  N     . ARG A 1 122 ? 14.143 11.131  15.815  1.00 16.21 ? 122  ARG A N     1 
ATOM   932  C  CA    . ARG A 1 122 ? 15.591 11.259  16.136  1.00 16.87 ? 122  ARG A CA    1 
ATOM   933  C  C     . ARG A 1 122 ? 16.391 10.308  15.273  1.00 15.49 ? 122  ARG A C     1 
ATOM   934  O  O     . ARG A 1 122 ? 16.077 9.128   15.210  1.00 15.11 ? 122  ARG A O     1 
ATOM   935  C  CB    . ARG A 1 122 ? 15.758 10.936  17.636  1.00 16.52 ? 122  ARG A CB    1 
ATOM   936  C  CG    . ARG A 1 122 ? 15.282 12.085  18.549  1.00 18.83 ? 122  ARG A CG    1 
ATOM   937  C  CD    . ARG A 1 122 ? 15.135 11.750  20.029  1.00 23.70 ? 122  ARG A CD    1 
ATOM   938  N  NE    . ARG A 1 122 ? 14.392 10.513  20.208  1.00 28.68 ? 122  ARG A NE    1 
ATOM   939  C  CZ    . ARG A 1 122 ? 13.549 10.212  21.194  1.00 31.58 ? 122  ARG A CZ    1 
ATOM   940  N  NH1   . ARG A 1 122 ? 12.974 9.019   21.174  1.00 32.48 ? 122  ARG A NH1   1 
ATOM   941  N  NH2   . ARG A 1 122 ? 13.277 11.054  22.184  1.00 34.07 ? 122  ARG A NH2   1 
ATOM   942  N  N     . VAL A 1 123 ? 17.440 10.802  14.589  1.00 16.17 ? 123  VAL A N     1 
ATOM   943  C  CA    . VAL A 1 123 ? 18.028 10.024  13.512  1.00 14.84 ? 123  VAL A CA    1 
ATOM   944  C  C     . VAL A 1 123 ? 19.515 10.082  13.711  1.00 13.78 ? 123  VAL A C     1 
ATOM   945  O  O     . VAL A 1 123 ? 20.027 11.069  14.255  1.00 12.26 ? 123  VAL A O     1 
ATOM   946  C  CB    . VAL A 1 123 ? 17.652 10.630  12.139  1.00 15.15 ? 123  VAL A CB    1 
ATOM   947  C  CG1   . VAL A 1 123 ? 18.139 9.759   11.013  1.00 16.83 ? 123  VAL A CG1   1 
ATOM   948  C  CG2   . VAL A 1 123 ? 16.151 10.747  12.003  1.00 19.80 ? 123  VAL A CG2   1 
ATOM   949  N  N     . VAL A 1 124 ? 20.185 9.014   13.307  1.00 13.05 ? 124  VAL A N     1 
ATOM   950  C  CA    . VAL A 1 124 ? 21.651 8.960   13.192  1.00 14.13 ? 124  VAL A CA    1 
ATOM   951  C  C     . VAL A 1 124 ? 21.903 8.643   11.730  1.00 14.19 ? 124  VAL A C     1 
ATOM   952  O  O     . VAL A 1 124 ? 21.346 7.712   11.205  1.00 13.13 ? 124  VAL A O     1 
ATOM   953  C  CB    . VAL A 1 124 ? 22.322 7.870   14.072  1.00 13.09 ? 124  VAL A CB    1 
ATOM   954  C  CG1   . VAL A 1 124 ? 23.850 7.758   13.755  1.00 13.30 ? 124  VAL A CG1   1 
ATOM   955  C  CG2   . VAL A 1 124 ? 22.123 8.221   15.563  1.00 14.54 ? 124  VAL A CG2   1 
ATOM   956  N  N     . VAL A 1 125 ? 22.776 9.425   11.130  1.00 13.23 ? 125  VAL A N     1 
ATOM   957  C  CA    . VAL A 1 125 ? 23.105 9.339   9.728   1.00 13.69 ? 125  VAL A CA    1 
ATOM   958  C  C     . VAL A 1 125 ? 24.425 8.528   9.670   1.00 13.94 ? 125  VAL A C     1 
ATOM   959  O  O     . VAL A 1 125 ? 25.368 8.746   10.470  1.00 13.80 ? 125  VAL A O     1 
ATOM   960  C  CB    . VAL A 1 125 ? 23.363 10.715  9.130   1.00 14.09 ? 125  VAL A CB    1 
ATOM   961  C  CG1   . VAL A 1 125 ? 23.695 10.570  7.678   1.00 15.09 ? 125  VAL A CG1   1 
ATOM   962  C  CG2   . VAL A 1 125 ? 22.167 11.690  9.347   1.00 13.06 ? 125  VAL A CG2   1 
ATOM   963  N  N     . VAL A 1 126 ? 24.498 7.616   8.730   1.00 14.30 ? 126  VAL A N     1 
ATOM   964  C  CA    . VAL A 1 126 ? 25.750 6.865   8.455   1.00 13.97 ? 126  VAL A CA    1 
ATOM   965  C  C     . VAL A 1 126 ? 26.180 6.969   6.998   1.00 13.49 ? 126  VAL A C     1 
ATOM   966  O  O     . VAL A 1 126 ? 25.354 7.002   6.059   1.00 14.20 ? 126  VAL A O     1 
ATOM   967  C  CB    . VAL A 1 126 ? 25.632 5.361   8.873   1.00 14.35 ? 126  VAL A CB    1 
ATOM   968  C  CG1   . VAL A 1 126 ? 24.528 4.675   8.144   1.00 17.59 ? 126  VAL A CG1   1 
ATOM   969  C  CG2   . VAL A 1 126 ? 26.966 4.607   8.742   1.00 15.56 ? 126  VAL A CG2   1 
ATOM   970  N  N     . ASP A 1 127 ? 27.491 7.084   6.815   1.00 14.60 ? 127  ASP A N     1 
ATOM   971  C  CA    . ASP A 1 127 ? 28.120 6.947   5.512   1.00 14.23 ? 127  ASP A CA    1 
ATOM   972  C  C     . ASP A 1 127 ? 29.443 6.234   5.729   1.00 13.51 ? 127  ASP A C     1 
ATOM   973  O  O     . ASP A 1 127 ? 29.896 6.059   6.889   1.00 12.37 ? 127  ASP A O     1 
ATOM   974  C  CB    . ASP A 1 127 ? 28.375 8.306   4.928   1.00 15.57 ? 127  ASP A CB    1 
ATOM   975  C  CG    . ASP A 1 127 ? 28.419 8.343   3.386   1.00 18.18 ? 127  ASP A CG    1 
ATOM   976  O  OD1   . ASP A 1 127 ? 28.346 7.287   2.719   1.00 15.23 ? 127  ASP A OD1   1 
ATOM   977  O  OD2   . ASP A 1 127 ? 28.541 9.475   2.865   1.00 16.48 ? 127  ASP A OD2   1 
ATOM   978  N  N     . ASP A 1 128 ? 30.085 5.819   4.640   1.00 13.05 ? 128  ASP A N     1 
ATOM   979  C  CA    . ASP A 1 128 ? 31.317 5.089   4.833   1.00 13.99 ? 128  ASP A CA    1 
ATOM   980  C  C     . ASP A 1 128 ? 32.426 5.943   5.385   1.00 15.33 ? 128  ASP A C     1 
ATOM   981  O  O     . ASP A 1 128 ? 33.234 5.476   6.175   1.00 14.72 ? 128  ASP A O     1 
ATOM   982  C  CB    . ASP A 1 128 ? 31.753 4.289   3.608   1.00 14.27 ? 128  ASP A CB    1 
ATOM   983  C  CG    . ASP A 1 128 ? 32.087 5.142   2.400   1.00 15.72 ? 128  ASP A CG    1 
ATOM   984  O  OD1   . ASP A 1 128 ? 32.850 4.635   1.539   1.00 17.90 ? 128  ASP A OD1   1 
ATOM   985  O  OD2   . ASP A 1 128 ? 31.595 6.295   2.292   1.00 14.56 ? 128  ASP A OD2   1 
ATOM   986  N  N     . LEU A 1 129 ? 32.509 7.180   4.891   1.00 14.82 ? 129  LEU A N     1 
ATOM   987  C  CA    . LEU A 1 129 ? 33.670 8.000   5.133   1.00 15.57 ? 129  LEU A CA    1 
ATOM   988  C  C     . LEU A 1 129 ? 33.233 9.477   5.220   1.00 15.64 ? 129  LEU A C     1 
ATOM   989  O  O     . LEU A 1 129 ? 32.406 9.945   4.380   1.00 14.63 ? 129  LEU A O     1 
ATOM   990  C  CB    . LEU A 1 129 ? 34.632 7.753   3.964   1.00 16.37 ? 129  LEU A CB    1 
ATOM   991  C  CG    . LEU A 1 129 ? 35.824 8.544   3.380   1.00 20.33 ? 129  LEU A CG    1 
ATOM   992  C  CD1   . LEU A 1 129 ? 35.820 10.020  3.528   1.00 18.27 ? 129  LEU A CD1   1 
ATOM   993  C  CD2   . LEU A 1 129 ? 37.094 7.913   3.653   1.00 16.58 ? 129  LEU A CD2   1 
ATOM   994  N  N     . LEU A 1 130 ? 33.831 10.187  6.176   1.00 15.50 ? 130  LEU A N     1 
ATOM   995  C  CA    . LEU A 1 130 ? 33.711 11.661  6.328   1.00 16.00 ? 130  LEU A CA    1 
ATOM   996  C  C     . LEU A 1 130 ? 34.977 12.295  5.821   1.00 15.05 ? 130  LEU A C     1 
ATOM   997  O  O     . LEU A 1 130 ? 36.041 11.973  6.283   1.00 13.85 ? 130  LEU A O     1 
ATOM   998  C  CB    . LEU A 1 130 ? 33.522 12.078  7.791   1.00 17.12 ? 130  LEU A CB    1 
ATOM   999  C  CG    . LEU A 1 130 ? 33.246 13.562  8.024   1.00 17.41 ? 130  LEU A CG    1 
ATOM   1000 C  CD1   . LEU A 1 130 ? 31.834 13.929  7.743   1.00 17.62 ? 130  LEU A CD1   1 
ATOM   1001 C  CD2   . LEU A 1 130 ? 33.593 13.969  9.386   1.00 16.38 ? 130  LEU A CD2   1 
ATOM   1002 N  N     . ALA A 1 131 ? 34.854 13.208  4.873   1.00 15.28 ? 131  ALA A N     1 
ATOM   1003 C  CA    . ALA A 1 131 ? 36.009 13.963  4.369   1.00 13.85 ? 131  ALA A CA    1 
ATOM   1004 C  C     . ALA A 1 131 ? 35.702 15.394  4.702   1.00 14.32 ? 131  ALA A C     1 
ATOM   1005 O  O     . ALA A 1 131 ? 35.781 15.756  5.878   1.00 14.20 ? 131  ALA A O     1 
ATOM   1006 C  CB    . ALA A 1 131 ? 36.177 13.675  2.911   1.00 14.52 ? 131  ALA A CB    1 
ATOM   1007 N  N     . THR A 1 132 ? 35.254 16.211  3.746   1.00 14.71 ? 132  THR A N     1 
ATOM   1008 C  CA    . THR A 1 132 ? 34.920 17.606  4.046   1.00 14.43 ? 132  THR A CA    1 
ATOM   1009 C  C     . THR A 1 132 ? 33.667 17.802  4.899   1.00 15.10 ? 132  THR A C     1 
ATOM   1010 O  O     . THR A 1 132 ? 33.508 18.861  5.529   1.00 15.21 ? 132  THR A O     1 
ATOM   1011 C  CB    . THR A 1 132 ? 34.746 18.526  2.808   1.00 15.77 ? 132  THR A CB    1 
ATOM   1012 O  OG1   . THR A 1 132 ? 33.563 18.205  2.087   1.00 17.06 ? 132  THR A OG1   1 
ATOM   1013 C  CG2   . THR A 1 132 ? 35.941 18.455  1.871   1.00 16.00 ? 132  THR A CG2   1 
ATOM   1014 N  N     . GLY A 1 133 ? 32.814 16.770  4.929   1.00 14.13 ? 133  GLY A N     1 
ATOM   1015 C  CA    . GLY A 1 133 ? 31.496 16.828  5.581   1.00 14.72 ? 133  GLY A CA    1 
ATOM   1016 C  C     . GLY A 1 133 ? 30.379 17.460  4.754   1.00 14.18 ? 133  GLY A C     1 
ATOM   1017 O  O     . GLY A 1 133 ? 29.263 17.608  5.232   1.00 17.18 ? 133  GLY A O     1 
ATOM   1018 N  N     . GLY A 1 134 ? 30.628 17.818  3.500   1.00 15.29 ? 134  GLY A N     1 
ATOM   1019 C  CA    . GLY A 1 134 ? 29.568 18.369  2.664   1.00 13.70 ? 134  GLY A CA    1 
ATOM   1020 C  C     . GLY A 1 134 ? 28.381 17.439  2.493   1.00 14.50 ? 134  GLY A C     1 
ATOM   1021 O  O     . GLY A 1 134 ? 27.248 17.871  2.568   1.00 15.73 ? 134  GLY A O     1 
ATOM   1022 N  N     . THR A 1 135 ? 28.627 16.154  2.279   1.00 14.87 ? 135  THR A N     1 
ATOM   1023 C  CA    . THR A 1 135 ? 27.556 15.172  2.074   1.00 15.34 ? 135  THR A CA    1 
ATOM   1024 C  C     . THR A 1 135 ? 26.743 15.029  3.374   1.00 15.06 ? 135  THR A C     1 
ATOM   1025 O  O     . THR A 1 135 ? 25.513 15.140  3.391   1.00 14.03 ? 135  THR A O     1 
ATOM   1026 C  CB    . THR A 1 135 ? 28.191 13.850  1.603   1.00 16.21 ? 135  THR A CB    1 
ATOM   1027 O  OG1   . THR A 1 135 ? 28.996 14.125  0.453   1.00 17.54 ? 135  THR A OG1   1 
ATOM   1028 C  CG2   . THR A 1 135 ? 27.145 12.858  1.189   1.00 18.39 ? 135  THR A CG2   1 
ATOM   1029 N  N     . MET A 1 136 ? 27.444 14.801  4.482   1.00 14.79 ? 136  MET A N     1 
ATOM   1030 C  CA    . MET A 1 136 ? 26.784 14.665  5.755   1.00 16.05 ? 136  MET A CA    1 
ATOM   1031 C  C     . MET A 1 136 ? 26.062 15.915  6.175   1.00 14.84 ? 136  MET A C     1 
ATOM   1032 O  O     . MET A 1 136 ? 25.043 15.826  6.820   1.00 13.51 ? 136  MET A O     1 
ATOM   1033 C  CB    A MET A 1 136 ? 27.745 14.251  6.877   0.65 17.16 ? 136  MET A CB    1 
ATOM   1034 C  CB    B MET A 1 136 ? 27.787 14.262  6.827   0.35 15.67 ? 136  MET A CB    1 
ATOM   1035 C  CG    A MET A 1 136 ? 27.509 12.855  7.403   0.65 20.90 ? 136  MET A CG    1 
ATOM   1036 C  CG    B MET A 1 136 ? 28.107 12.793  6.796   0.35 14.45 ? 136  MET A CG    1 
ATOM   1037 S  SD    A MET A 1 136 ? 28.998 12.052  8.031   0.65 21.06 ? 136  MET A SD    1 
ATOM   1038 S  SD    B MET A 1 136 ? 26.806 11.876  7.668   0.35 11.42 ? 136  MET A SD    1 
ATOM   1039 C  CE    A MET A 1 136 ? 28.645 10.376  7.654   0.65 21.90 ? 136  MET A CE    1 
ATOM   1040 C  CE    B MET A 1 136 ? 27.742 10.420  7.910   0.35 12.00 ? 136  MET A CE    1 
ATOM   1041 N  N     . ASN A 1 137 ? 26.639 17.060  5.879   1.00 14.46 ? 137  ASN A N     1 
ATOM   1042 C  CA    . ASN A 1 137 ? 26.027 18.323  6.236   1.00 15.07 ? 137  ASN A CA    1 
ATOM   1043 C  C     . ASN A 1 137 ? 24.754 18.531  5.431   1.00 14.31 ? 137  ASN A C     1 
ATOM   1044 O  O     . ASN A 1 137 ? 23.820 19.078  5.938   1.00 14.16 ? 137  ASN A O     1 
ATOM   1045 C  CB    . ASN A 1 137 ? 26.998 19.480  6.010   1.00 15.32 ? 137  ASN A CB    1 
ATOM   1046 C  CG    . ASN A 1 137 ? 26.479 20.763  6.583   1.00 19.19 ? 137  ASN A CG    1 
ATOM   1047 O  OD1   . ASN A 1 137 ? 26.385 20.907  7.796   1.00 24.73 ? 137  ASN A OD1   1 
ATOM   1048 N  ND2   . ASN A 1 137 ? 26.097 21.680  5.724   1.00 24.05 ? 137  ASN A ND2   1 
ATOM   1049 N  N     . ALA A 1 138 ? 24.732 18.118  4.155   1.00 15.19 ? 138  ALA A N     1 
ATOM   1050 C  CA    . ALA A 1 138 ? 23.476 18.224  3.367   1.00 15.04 ? 138  ALA A CA    1 
ATOM   1051 C  C     . ALA A 1 138 ? 22.399 17.312  3.929   1.00 14.03 ? 138  ALA A C     1 
ATOM   1052 O  O     . ALA A 1 138 ? 21.220 17.651  3.946   1.00 14.11 ? 138  ALA A O     1 
ATOM   1053 C  CB    . ALA A 1 138 ? 23.702 17.907  1.920   1.00 15.18 ? 138  ALA A CB    1 
ATOM   1054 N  N     . ALA A 1 139 ? 22.804 16.141  4.382   1.00 15.24 ? 139  ALA A N     1 
ATOM   1055 C  CA    . ALA A 1 139 ? 21.888 15.177  4.946   1.00 14.17 ? 139  ALA A CA    1 
ATOM   1056 C  C     . ALA A 1 139 ? 21.314 15.768  6.207   1.00 14.14 ? 139  ALA A C     1 
ATOM   1057 O  O     . ALA A 1 139 ? 20.120 15.672  6.423   1.00 15.22 ? 139  ALA A O     1 
ATOM   1058 C  CB    . ALA A 1 139 ? 22.605 13.838  5.222   1.00 15.12 ? 139  ALA A CB    1 
ATOM   1059 N  N     . CYS A 1 140 ? 22.141 16.443  7.033   1.00 14.47 ? 140  CYS A N     1 
ATOM   1060 C  CA    . CYS A 1 140 ? 21.616 17.066  8.260   1.00 13.71 ? 140  CYS A CA    1 
ATOM   1061 C  C     . CYS A 1 140 ? 20.607 18.158  7.931   1.00 14.85 ? 140  CYS A C     1 
ATOM   1062 O  O     . CYS A 1 140 ? 19.548 18.266  8.534   1.00 14.82 ? 140  CYS A O     1 
ATOM   1063 C  CB    . CYS A 1 140 ? 22.757 17.600  9.119   1.00 13.70 ? 140  CYS A CB    1 
ATOM   1064 S  SG    . CYS A 1 140 ? 23.821 16.310  9.904   1.00 15.67 ? 140  CYS A SG    1 
ATOM   1065 N  N     . GLU A 1 141 ? 20.916 18.943  6.909   1.00 15.64 ? 141  GLU A N     1 
ATOM   1066 C  CA    . GLU A 1 141 ? 20.045 20.025  6.462   1.00 17.17 ? 141  GLU A CA    1 
ATOM   1067 C  C     . GLU A 1 141 ? 18.668 19.493  6.077   1.00 16.63 ? 141  GLU A C     1 
ATOM   1068 O  O     . GLU A 1 141 ? 17.604 20.045  6.493   1.00 15.53 ? 141  GLU A O     1 
ATOM   1069 C  CB    . GLU A 1 141 ? 20.649 20.717  5.252   1.00 17.29 ? 141  GLU A CB    1 
ATOM   1070 C  CG    . GLU A 1 141 ? 19.700 21.835  4.762   1.00 21.68 ? 141  GLU A CG    1 
ATOM   1071 C  CD    . GLU A 1 141 ? 20.057 22.426  3.446   1.00 26.52 ? 141  GLU A CD    1 
ATOM   1072 O  OE1   . GLU A 1 141 ? 19.086 22.744  2.686   1.00 24.88 ? 141  GLU A OE1   1 
ATOM   1073 O  OE2   . GLU A 1 141 ? 21.306 22.532  3.182   1.00 27.77 ? 141  GLU A OE2   1 
ATOM   1074 N  N     . LEU A 1 142 ? 18.681 18.421  5.283   1.00 15.27 ? 142  LEU A N     1 
ATOM   1075 C  CA    . LEU A 1 142 ? 17.434 17.787  4.873   1.00 14.98 ? 142  LEU A CA    1 
ATOM   1076 C  C     . LEU A 1 142 ? 16.604 17.285  6.020   1.00 16.51 ? 142  LEU A C     1 
ATOM   1077 O  O     . LEU A 1 142 ? 15.409 17.535  6.064   1.00 14.88 ? 142  LEU A O     1 
ATOM   1078 C  CB    . LEU A 1 142 ? 17.664 16.628  3.908   1.00 15.70 ? 142  LEU A CB    1 
ATOM   1079 C  CG    . LEU A 1 142 ? 18.225 16.969  2.522   1.00 16.94 ? 142  LEU A CG    1 
ATOM   1080 C  CD1   . LEU A 1 142 ? 18.641 15.752  1.729   1.00 15.78 ? 142  LEU A CD1   1 
ATOM   1081 C  CD2   . LEU A 1 142 ? 17.181 17.775  1.744   1.00 16.70 ? 142  LEU A CD2   1 
ATOM   1082 N  N     . LEU A 1 143 ? 17.253 16.537  6.919   1.00 15.18 ? 143  LEU A N     1 
ATOM   1083 C  CA    . LEU A 1 143 ? 16.606 16.041  8.085   1.00 14.90 ? 143  LEU A CA    1 
ATOM   1084 C  C     . LEU A 1 143 ? 16.072 17.175  8.962   1.00 14.65 ? 143  LEU A C     1 
ATOM   1085 O  O     . LEU A 1 143 ? 14.948 17.046  9.491   1.00 15.70 ? 143  LEU A O     1 
ATOM   1086 C  CB    . LEU A 1 143 ? 17.551 15.122  8.851   1.00 14.51 ? 143  LEU A CB    1 
ATOM   1087 C  CG    . LEU A 1 143 ? 17.879 13.845  8.102   1.00 13.18 ? 143  LEU A CG    1 
ATOM   1088 C  CD1   . LEU A 1 143 ? 19.151 13.199  8.620   1.00 16.57 ? 143  LEU A CD1   1 
ATOM   1089 C  CD2   . LEU A 1 143 ? 16.725 12.880  8.126   1.00 15.53 ? 143  LEU A CD2   1 
ATOM   1090 N  N     . GLY A 1 144 ? 16.818 18.290  9.074   1.00 14.36 ? 144  GLY A N     1 
ATOM   1091 C  CA    . GLY A 1 144 ? 16.369 19.393  9.926   1.00 15.69 ? 144  GLY A CA    1 
ATOM   1092 C  C     . GLY A 1 144 ? 15.159 20.075  9.264   1.00 16.34 ? 144  GLY A C     1 
ATOM   1093 O  O     . GLY A 1 144 ? 14.250 20.644  9.932   1.00 15.72 ? 144  GLY A O     1 
ATOM   1094 N  N     . ARG A 1 145 ? 15.119 20.008  7.940   1.00 16.71 ? 145  ARG A N     1 
ATOM   1095 C  CA    . ARG A 1 145 ? 13.978 20.566  7.218   1.00 16.61 ? 145  ARG A CA    1 
ATOM   1096 C  C     . ARG A 1 145 ? 12.700 19.753  7.378   1.00 16.36 ? 145  ARG A C     1 
ATOM   1097 O  O     . ARG A 1 145 ? 11.602 20.280  7.177   1.00 16.71 ? 145  ARG A O     1 
ATOM   1098 C  CB    . ARG A 1 145 ? 14.351 20.827  5.761   1.00 17.71 ? 145  ARG A CB    1 
ATOM   1099 C  CG    . ARG A 1 145 ? 15.102 22.100  5.599   1.00 16.49 ? 145  ARG A CG    1 
ATOM   1100 C  CD    . ARG A 1 145 ? 15.855 22.180  4.318   1.00 17.30 ? 145  ARG A CD    1 
ATOM   1101 N  NE    . ARG A 1 145 ? 14.933 22.283  3.237   1.00 18.36 ? 145  ARG A NE    1 
ATOM   1102 C  CZ    . ARG A 1 145 ? 15.208 22.053  1.967   1.00 18.19 ? 145  ARG A CZ    1 
ATOM   1103 N  NH1   . ARG A 1 145 ? 16.407 21.682  1.581   1.00 19.57 ? 145  ARG A NH1   1 
ATOM   1104 N  NH2   . ARG A 1 145 ? 14.238 22.181  1.085   1.00 17.81 ? 145  ARG A NH2   1 
ATOM   1105 N  N     . LEU A 1 146 ? 12.829 18.500  7.807   1.00 16.10 ? 146  LEU A N     1 
ATOM   1106 C  CA    . LEU A 1 146 ? 11.691 17.670  8.185   1.00 16.09 ? 146  LEU A CA    1 
ATOM   1107 C  C     . LEU A 1 146 ? 11.409 17.772  9.691   1.00 15.91 ? 146  LEU A C     1 
ATOM   1108 O  O     . LEU A 1 146 ? 10.518 17.126  10.182  1.00 15.84 ? 146  LEU A O     1 
ATOM   1109 C  CB    . LEU A 1 146 ? 11.976 16.228  7.820   1.00 16.62 ? 146  LEU A CB    1 
ATOM   1110 C  CG    . LEU A 1 146 ? 12.048 15.872  6.332   1.00 17.81 ? 146  LEU A CG    1 
ATOM   1111 C  CD1   . LEU A 1 146 ? 12.201 14.342  6.162   1.00 21.50 ? 146  LEU A CD1   1 
ATOM   1112 C  CD2   . LEU A 1 146 ? 10.874 16.340  5.613   1.00 15.94 ? 146  LEU A CD2   1 
ATOM   1113 N  N     . GLN A 1 147 ? 12.158 18.636  10.373  1.00 17.33 ? 147  GLN A N     1 
ATOM   1114 C  CA    . GLN A 1 147 ? 12.072 18.837  11.839  1.00 17.57 ? 147  GLN A CA    1 
ATOM   1115 C  C     . GLN A 1 147 ? 12.449 17.611  12.628  1.00 17.38 ? 147  GLN A C     1 
ATOM   1116 O  O     . GLN A 1 147 ? 12.046 17.459  13.812  1.00 17.38 ? 147  GLN A O     1 
ATOM   1117 C  CB    . GLN A 1 147 ? 10.690 19.328  12.281  1.00 18.17 ? 147  GLN A CB    1 
ATOM   1118 C  CG    . GLN A 1 147 ? 10.228 20.599  11.577  1.00 20.16 ? 147  GLN A CG    1 
ATOM   1119 C  CD    . GLN A 1 147 ? 8.795  20.913  11.937  1.00 25.27 ? 147  GLN A CD    1 
ATOM   1120 O  OE1   . GLN A 1 147 ? 8.501  21.175  13.102  1.00 30.46 ? 147  GLN A OE1   1 
ATOM   1121 N  NE2   . GLN A 1 147 ? 7.894  20.834  10.967  1.00 29.84 ? 147  GLN A NE2   1 
ATOM   1122 N  N     . ALA A 1 148 ? 13.292 16.780  12.028  1.00 16.61 ? 148  ALA A N     1 
ATOM   1123 C  CA    . ALA A 1 148 ? 13.910 15.662  12.702  1.00 16.42 ? 148  ALA A CA    1 
ATOM   1124 C  C     . ALA A 1 148 ? 15.111 16.181  13.466  1.00 16.31 ? 148  ALA A C     1 
ATOM   1125 O  O     . ALA A 1 148 ? 15.677 17.181  13.087  1.00 16.23 ? 148  ALA A O     1 
ATOM   1126 C  CB    . ALA A 1 148 ? 14.328 14.575  11.725  1.00 16.94 ? 148  ALA A CB    1 
ATOM   1127 N  N     . GLU A 1 149 ? 15.445 15.484  14.549  1.00 15.37 ? 149  GLU A N     1 
ATOM   1128 C  CA    . GLU A 1 149 ? 16.633 15.754  15.371  1.00 16.78 ? 149  GLU A CA    1 
ATOM   1129 C  C     . GLU A 1 149 ? 17.773 14.839  14.955  1.00 15.54 ? 149  GLU A C     1 
ATOM   1130 O  O     . GLU A 1 149 ? 17.670 13.652  15.086  1.00 14.99 ? 149  GLU A O     1 
ATOM   1131 C  CB    . GLU A 1 149 ? 16.335 15.492  16.840  1.00 15.77 ? 149  GLU A CB    1 
ATOM   1132 C  CG    . GLU A 1 149 ? 17.448 15.937  17.769  1.00 20.24 ? 149  GLU A CG    1 
ATOM   1133 C  CD    . GLU A 1 149 ? 17.142 15.770  19.234  1.00 21.45 ? 149  GLU A CD    1 
ATOM   1134 O  OE1   . GLU A 1 149 ? 16.024 15.385  19.598  1.00 22.34 ? 149  GLU A OE1   1 
ATOM   1135 O  OE2   . GLU A 1 149 ? 18.062 16.053  20.038  1.00 24.13 ? 149  GLU A OE2   1 
ATOM   1136 N  N     . VAL A 1 150 ? 18.874 15.390  14.470  1.00 16.56 ? 150  VAL A N     1 
ATOM   1137 C  CA    . VAL A 1 150 ? 20.041 14.563  14.167  1.00 15.52 ? 150  VAL A CA    1 
ATOM   1138 C  C     . VAL A 1 150 ? 20.905 14.426  15.422  1.00 13.87 ? 150  VAL A C     1 
ATOM   1139 O  O     . VAL A 1 150 ? 21.511 15.383  15.880  1.00 14.44 ? 150  VAL A O     1 
ATOM   1140 C  CB    . VAL A 1 150 ? 20.868 15.086  12.989  1.00 15.45 ? 150  VAL A CB    1 
ATOM   1141 C  CG1   . VAL A 1 150 ? 21.971 14.138  12.697  1.00 17.51 ? 150  VAL A CG1   1 
ATOM   1142 C  CG2   . VAL A 1 150 ? 20.004 15.289  11.789  1.00 16.09 ? 150  VAL A CG2   1 
ATOM   1143 N  N     . LEU A 1 151 ? 20.964 13.220  15.971  1.00 13.33 ? 151  LEU A N     1 
ATOM   1144 C  CA    . LEU A 1 151 ? 21.618 12.972  17.244  1.00 12.88 ? 151  LEU A CA    1 
ATOM   1145 C  C     . LEU A 1 151 ? 23.092 12.843  17.046  1.00 12.66 ? 151  LEU A C     1 
ATOM   1146 O  O     . LEU A 1 151 ? 23.886 13.182  17.919  1.00 12.54 ? 151  LEU A O     1 
ATOM   1147 C  CB    . LEU A 1 151 ? 21.050 11.670  17.827  1.00 13.34 ? 151  LEU A CB    1 
ATOM   1148 C  CG    . LEU A 1 151 ? 19.605 11.696  18.297  1.00 15.53 ? 151  LEU A CG    1 
ATOM   1149 C  CD1   . LEU A 1 151 ? 19.232 10.369  18.901  1.00 16.47 ? 151  LEU A CD1   1 
ATOM   1150 C  CD2   . LEU A 1 151 ? 19.388 12.822  19.236  1.00 18.92 ? 151  LEU A CD2   1 
ATOM   1151 N  N     . GLU A 1 152 ? 23.450 12.306  15.892  1.00 12.78 ? 152  GLU A N     1 
ATOM   1152 C  CA    . GLU A 1 152 ? 24.849 12.050  15.539  1.00 12.52 ? 152  GLU A CA    1 
ATOM   1153 C  C     . GLU A 1 152 ? 24.975 11.630  14.087  1.00 12.58 ? 152  GLU A C     1 
ATOM   1154 O  O     . GLU A 1 152 ? 24.060 11.111  13.491  1.00 10.75 ? 152  GLU A O     1 
ATOM   1155 C  CB    . GLU A 1 152 ? 25.413 10.964  16.452  1.00 13.15 ? 152  GLU A CB    1 
ATOM   1156 C  CG    . GLU A 1 152 ? 26.908 10.810  16.460  1.00 14.43 ? 152  GLU A CG    1 
ATOM   1157 C  CD    . GLU A 1 152 ? 27.388 9.853   17.559  1.00 14.61 ? 152  GLU A CD    1 
ATOM   1158 O  OE1   . GLU A 1 152 ? 26.738 9.754   18.607  1.00 23.18 ? 152  GLU A OE1   1 
ATOM   1159 O  OE2   . GLU A 1 152 ? 28.444 9.235   17.382  1.00 22.82 ? 152  GLU A OE2   1 
ATOM   1160 N  N     . CYS A 1 153 ? 26.178 11.806  13.551  1.00 12.89 ? 153  CYS A N     1 
ATOM   1161 C  CA    . CYS A 1 153 ? 26.564 11.237  12.280  1.00 12.35 ? 153  CYS A CA    1 
ATOM   1162 C  C     . CYS A 1 153 ? 27.762 10.312  12.583  1.00 13.73 ? 153  CYS A C     1 
ATOM   1163 O  O     . CYS A 1 153 ? 28.652 10.608  13.424  1.00 12.78 ? 153  CYS A O     1 
ATOM   1164 C  CB    . CYS A 1 153 ? 27.007 12.314  11.314  1.00 13.99 ? 153  CYS A CB    1 
ATOM   1165 S  SG    . CYS A 1 153 ? 25.765 13.502  10.832  1.00 14.58 ? 153  CYS A SG    1 
ATOM   1166 N  N     . VAL A 1 154 ? 27.806 9.199   11.877  1.00 12.91 ? 154  VAL A N     1 
ATOM   1167 C  CA    . VAL A 1 154 ? 28.877 8.223   12.084  1.00 12.92 ? 154  VAL A CA    1 
ATOM   1168 C  C     . VAL A 1 154 ? 29.438 7.742   10.773  1.00 12.65 ? 154  VAL A C     1 
ATOM   1169 O  O     . VAL A 1 154 ? 28.736 7.710   9.756   1.00 13.10 ? 154  VAL A O     1 
ATOM   1170 C  CB    . VAL A 1 154 ? 28.455 7.027   12.950  1.00 12.65 ? 154  VAL A CB    1 
ATOM   1171 C  CG1   . VAL A 1 154 ? 28.045 7.527   14.311  1.00 13.02 ? 154  VAL A CG1   1 
ATOM   1172 C  CG2   . VAL A 1 154 ? 27.344 6.146   12.272  1.00 14.54 ? 154  VAL A CG2   1 
ATOM   1173 N  N     . SER A 1 155 ? 30.723 7.368   10.780  1.00 12.75 ? 155  SER A N     1 
ATOM   1174 C  CA    . SER A 1 155 ? 31.254 6.754   9.615   1.00 13.80 ? 155  SER A CA    1 
ATOM   1175 C  C     . SER A 1 155 ? 32.306 5.662   9.994   1.00 13.94 ? 155  SER A C     1 
ATOM   1176 O  O     . SER A 1 155 ? 32.620 5.481   11.158  1.00 13.94 ? 155  SER A O     1 
ATOM   1177 C  CB    . SER A 1 155 ? 31.866 7.822   8.732   1.00 12.20 ? 155  SER A CB    1 
ATOM   1178 O  OG    . SER A 1 155 ? 33.088 8.322   9.329   1.00 13.19 ? 155  SER A OG    1 
ATOM   1179 N  N     . LEU A 1 156 ? 32.810 4.921   9.008   1.00 13.22 ? 156  LEU A N     1 
ATOM   1180 C  CA    . LEU A 1 156 ? 33.937 4.044   9.267   1.00 12.98 ? 156  LEU A CA    1 
ATOM   1181 C  C     . LEU A 1 156 ? 35.237 4.805   9.318   1.00 14.34 ? 156  LEU A C     1 
ATOM   1182 O  O     . LEU A 1 156 ? 36.117 4.507   10.123  1.00 15.17 ? 156  LEU A O     1 
ATOM   1183 C  CB    . LEU A 1 156 ? 33.992 2.926   8.203   1.00 13.77 ? 156  LEU A CB    1 
ATOM   1184 C  CG    . LEU A 1 156 ? 32.969 1.786   8.370   1.00 13.07 ? 156  LEU A CG    1 
ATOM   1185 C  CD1   . LEU A 1 156 ? 31.611 2.159   7.813   1.00 14.43 ? 156  LEU A CD1   1 
ATOM   1186 C  CD2   . LEU A 1 156 ? 33.451 0.530   7.635   1.00 14.38 ? 156  LEU A CD2   1 
ATOM   1187 N  N     . VAL A 1 157 ? 35.385 5.748   8.399   1.00 14.16 ? 157  VAL A N     1 
ATOM   1188 C  CA    . VAL A 1 157 ? 36.635 6.451   8.172   1.00 13.94 ? 157  VAL A CA    1 
ATOM   1189 C  C     . VAL A 1 157 ? 36.388 7.960   8.211   1.00 13.01 ? 157  VAL A C     1 
ATOM   1190 O  O     . VAL A 1 157 ? 35.380 8.455   7.740   1.00 12.02 ? 157  VAL A O     1 
ATOM   1191 C  CB    . VAL A 1 157 ? 37.249 6.052   6.813   1.00 13.44 ? 157  VAL A CB    1 
ATOM   1192 C  CG1   . VAL A 1 157 ? 38.538 6.826   6.555   1.00 13.45 ? 157  VAL A CG1   1 
ATOM   1193 C  CG2   . VAL A 1 157 ? 37.493 4.526   6.745   1.00 13.84 ? 157  VAL A CG2   1 
ATOM   1194 N  N     . GLU A 1 158 ? 37.338 8.663   8.824   1.00 12.88 ? 158  GLU A N     1 
ATOM   1195 C  CA    . GLU A 1 158 ? 37.325 10.120  8.911   1.00 12.94 ? 158  GLU A CA    1 
ATOM   1196 C  C     . GLU A 1 158 ? 38.707 10.611  8.492   1.00 13.28 ? 158  GLU A C     1 
ATOM   1197 O  O     . GLU A 1 158 ? 39.684 10.126  8.992   1.00 12.41 ? 158  GLU A O     1 
ATOM   1198 C  CB    . GLU A 1 158 ? 37.077 10.557  10.384  1.00 13.93 ? 158  GLU A CB    1 
ATOM   1199 C  CG    . GLU A 1 158 ? 37.153 12.016  10.656  1.00 15.12 ? 158  GLU A CG    1 
ATOM   1200 C  CD    . GLU A 1 158 ? 37.141 12.360  12.115  1.00 17.15 ? 158  GLU A CD    1 
ATOM   1201 O  OE1   . GLU A 1 158 ? 37.150 13.564  12.433  1.00 18.99 ? 158  GLU A OE1   1 
ATOM   1202 O  OE2   . GLU A 1 158 ? 37.142 11.447  12.946  1.00 17.84 ? 158  GLU A OE2   1 
ATOM   1203 N  N     . LEU A 1 159 ? 38.733 11.572  7.577   1.00 13.10 ? 159  LEU A N     1 
ATOM   1204 C  CA    . LEU A 1 159 ? 39.995 12.182  7.137   1.00 13.84 ? 159  LEU A CA    1 
ATOM   1205 C  C     . LEU A 1 159 ? 40.137 13.479  7.905   1.00 13.45 ? 159  LEU A C     1 
ATOM   1206 O  O     . LEU A 1 159 ? 39.467 14.456  7.588   1.00 14.65 ? 159  LEU A O     1 
ATOM   1207 C  CB    . LEU A 1 159 ? 39.921 12.423  5.617   1.00 13.23 ? 159  LEU A CB    1 
ATOM   1208 C  CG    . LEU A 1 159 ? 40.092 11.222  4.656   1.00 17.96 ? 159  LEU A CG    1 
ATOM   1209 C  CD1   . LEU A 1 159 ? 40.177 9.824   5.190   1.00 18.95 ? 159  LEU A CD1   1 
ATOM   1210 C  CD2   . LEU A 1 159 ? 39.321 11.424  3.395   1.00 16.98 ? 159  LEU A CD2   1 
ATOM   1211 N  N     . THR A 1 160 ? 40.999 13.518  8.922   1.00 14.66 ? 160  THR A N     1 
ATOM   1212 C  CA    . THR A 1 160 ? 40.889 14.575  9.916   1.00 14.75 ? 160  THR A CA    1 
ATOM   1213 C  C     . THR A 1 160 ? 41.386 15.921  9.414   1.00 14.79 ? 160  THR A C     1 
ATOM   1214 O  O     . THR A 1 160 ? 40.927 16.956  9.889   1.00 14.26 ? 160  THR A O     1 
ATOM   1215 C  CB    . THR A 1 160 ? 41.600 14.151  11.220  1.00 15.79 ? 160  THR A CB    1 
ATOM   1216 O  OG1   . THR A 1 160 ? 42.942 13.809  10.898  1.00 15.95 ? 160  THR A OG1   1 
ATOM   1217 C  CG2   . THR A 1 160 ? 40.963 12.964  11.786  1.00 18.83 ? 160  THR A CG2   1 
ATOM   1218 N  N     . SER A 1 161 ? 42.290 15.932  8.428   1.00 14.19 ? 161  SER A N     1 
ATOM   1219 C  CA    . SER A 1 161 ? 42.802 17.232  7.962   1.00 14.65 ? 161  SER A CA    1 
ATOM   1220 C  C     . SER A 1 161 ? 41.739 18.020  7.240   1.00 15.68 ? 161  SER A C     1 
ATOM   1221 O  O     . SER A 1 161 ? 41.944 19.182  6.928   1.00 18.04 ? 161  SER A O     1 
ATOM   1222 C  CB    . SER A 1 161 ? 43.997 17.056  7.044   1.00 14.96 ? 161  SER A CB    1 
ATOM   1223 O  OG    . SER A 1 161 ? 43.664 16.343  5.861   1.00 15.50 ? 161  SER A OG    1 
ATOM   1224 N  N     . LEU A 1 162 ? 40.597 17.394  6.963   1.00 16.01 ? 162  LEU A N     1 
ATOM   1225 C  CA    . LEU A 1 162 ? 39.596 18.019  6.164   1.00 16.16 ? 162  LEU A CA    1 
ATOM   1226 C  C     . LEU A 1 162 ? 38.481 18.685  6.977   1.00 16.51 ? 162  LEU A C     1 
ATOM   1227 O  O     . LEU A 1 162 ? 37.601 19.311  6.403   1.00 16.74 ? 162  LEU A O     1 
ATOM   1228 C  CB    . LEU A 1 162 ? 39.059 16.990  5.211   1.00 16.56 ? 162  LEU A CB    1 
ATOM   1229 C  CG    . LEU A 1 162 ? 39.592 16.911  3.790   1.00 17.98 ? 162  LEU A CG    1 
ATOM   1230 C  CD1   . LEU A 1 162 ? 40.960 17.334  3.465   1.00 17.17 ? 162  LEU A CD1   1 
ATOM   1231 C  CD2   . LEU A 1 162 ? 39.230 15.571  3.180   1.00 20.47 ? 162  LEU A CD2   1 
ATOM   1232 N  N     . LYS A 1 163 ? 38.552 18.525  8.299   1.00 16.80 ? 163  LYS A N     1 
ATOM   1233 C  CA    . LYS A 1 163 ? 37.784 19.241  9.309   1.00 18.25 ? 163  LYS A CA    1 
ATOM   1234 C  C     . LYS A 1 163 ? 36.295 19.065  9.125   1.00 18.70 ? 163  LYS A C     1 
ATOM   1235 O  O     . LYS A 1 163 ? 35.489 19.975  9.329   1.00 18.93 ? 163  LYS A O     1 
ATOM   1236 C  CB    A LYS A 1 163 ? 38.176 20.737  9.346   0.65 18.36 ? 163  LYS A CB    1 
ATOM   1237 C  CB    B LYS A 1 163 ? 38.170 20.721  9.332   0.35 18.28 ? 163  LYS A CB    1 
ATOM   1238 C  CG    A LYS A 1 163 ? 39.607 20.988  9.665   0.65 18.70 ? 163  LYS A CG    1 
ATOM   1239 C  CG    B LYS A 1 163 ? 39.600 20.909  9.653   0.35 18.56 ? 163  LYS A CG    1 
ATOM   1240 C  CD    A LYS A 1 163 ? 39.883 22.489  9.947   0.65 19.70 ? 163  LYS A CD    1 
ATOM   1241 C  CD    B LYS A 1 163 ? 39.963 22.370  9.843   0.35 19.44 ? 163  LYS A CD    1 
ATOM   1242 C  CE    A LYS A 1 163 ? 41.361 22.723  10.385  0.65 21.27 ? 163  LYS A CE    1 
ATOM   1243 C  CE    B LYS A 1 163 ? 41.359 22.492  10.458  0.35 20.39 ? 163  LYS A CE    1 
ATOM   1244 N  NZ    A LYS A 1 163 ? 41.752 24.171  10.567  0.65 20.68 ? 163  LYS A NZ    1 
ATOM   1245 N  NZ    B LYS A 1 163 ? 42.207 21.287  10.208  0.35 19.95 ? 163  LYS A NZ    1 
ATOM   1246 N  N     . GLY A 1 164 ? 35.939 17.878  8.675   1.00 18.64 ? 164  GLY A N     1 
ATOM   1247 C  CA    . GLY A 1 164 ? 34.547 17.500  8.534   1.00 18.36 ? 164  GLY A CA    1 
ATOM   1248 C  C     . GLY A 1 164 ? 33.817 17.528  9.856   1.00 18.80 ? 164  GLY A C     1 
ATOM   1249 O  O     . GLY A 1 164 ? 32.669 17.913  9.913   1.00 18.73 ? 164  GLY A O     1 
ATOM   1250 N  N     . ARG A 1 165 ? 34.471 17.045  10.911  1.00 19.90 ? 165  ARG A N     1 
ATOM   1251 C  CA    . ARG A 1 165 ? 33.916 17.126  12.274  1.00 20.52 ? 165  ARG A CA    1 
ATOM   1252 C  C     . ARG A 1 165 ? 33.447 18.578  12.678  1.00 21.38 ? 165  ARG A C     1 
ATOM   1253 O  O     . ARG A 1 165 ? 32.304 18.779  13.133  1.00 20.64 ? 165  ARG A O     1 
ATOM   1254 C  CB    A ARG A 1 165 ? 34.938 16.572  13.276  0.65 20.94 ? 165  ARG A CB    1 
ATOM   1255 C  CB    B ARG A 1 165 ? 34.944 16.588  13.278  0.35 20.48 ? 165  ARG A CB    1 
ATOM   1256 C  CG    A ARG A 1 165 ? 34.707 17.022  14.729  0.65 21.60 ? 165  ARG A CG    1 
ATOM   1257 C  CG    B ARG A 1 165 ? 34.371 16.230  14.641  0.35 19.92 ? 165  ARG A CG    1 
ATOM   1258 C  CD    A ARG A 1 165 ? 35.690 16.364  15.695  0.65 25.30 ? 165  ARG A CD    1 
ATOM   1259 C  CD    B ARG A 1 165 ? 35.454 15.845  15.626  0.35 19.34 ? 165  ARG A CD    1 
ATOM   1260 N  NE    A ARG A 1 165 ? 35.767 14.919  15.490  0.65 26.90 ? 165  ARG A NE    1 
ATOM   1261 N  NE    B ARG A 1 165 ? 34.962 14.890  16.612  0.35 18.05 ? 165  ARG A NE    1 
ATOM   1262 C  CZ    A ARG A 1 165 ? 34.948 14.016  16.033  0.65 29.46 ? 165  ARG A CZ    1 
ATOM   1263 C  CZ    B ARG A 1 165 ? 34.977 13.569  16.462  0.35 18.83 ? 165  ARG A CZ    1 
ATOM   1264 N  NH1   A ARG A 1 165 ? 33.946 14.377  16.829  0.65 27.26 ? 165  ARG A NH1   1 
ATOM   1265 N  NH1   B ARG A 1 165 ? 34.506 12.799  17.424  0.35 17.10 ? 165  ARG A NH1   1 
ATOM   1266 N  NH2   A ARG A 1 165 ? 35.145 12.724  15.761  0.65 31.91 ? 165  ARG A NH2   1 
ATOM   1267 N  NH2   B ARG A 1 165 ? 35.471 13.006  15.354  0.35 19.79 ? 165  ARG A NH2   1 
ATOM   1268 N  N     . GLU A 1 166 ? 34.336 19.571  12.548  1.00 22.65 ? 166  GLU A N     1 
ATOM   1269 C  CA    . GLU A 1 166 ? 33.961 21.003  12.758  1.00 22.98 ? 166  GLU A CA    1 
ATOM   1270 C  C     . GLU A 1 166 ? 32.781 21.506  11.914  1.00 22.39 ? 166  GLU A C     1 
ATOM   1271 O  O     . GLU A 1 166 ? 31.907 22.258  12.388  1.00 21.17 ? 166  GLU A O     1 
ATOM   1272 C  CB    . GLU A 1 166 ? 35.153 21.909  12.485  1.00 24.40 ? 166  GLU A CB    1 
ATOM   1273 C  CG    . GLU A 1 166 ? 36.279 21.769  13.473  1.00 27.68 ? 166  GLU A CG    1 
ATOM   1274 C  CD    . GLU A 1 166 ? 37.564 22.484  13.004  1.00 32.36 ? 166  GLU A CD    1 
ATOM   1275 O  OE1   . GLU A 1 166 ? 37.450 23.661  12.517  1.00 34.83 ? 166  GLU A OE1   1 
ATOM   1276 O  OE2   . GLU A 1 166 ? 38.667 21.864  13.119  1.00 32.90 ? 166  GLU A OE2   1 
ATOM   1277 N  N     . LYS A 1 167 ? 32.771 21.089  10.665  1.00 20.91 ? 167  LYS A N     1 
ATOM   1278 C  CA    . LYS A 1 167 ? 31.717 21.426  9.717   1.00 21.58 ? 167  LYS A CA    1 
ATOM   1279 C  C     . LYS A 1 167 ? 30.351 20.939  10.198  1.00 20.86 ? 167  LYS A C     1 
ATOM   1280 O  O     . LYS A 1 167 ? 29.344 21.643  10.027  1.00 20.78 ? 167  LYS A O     1 
ATOM   1281 C  CB    . LYS A 1 167 ? 32.063 20.825  8.351   1.00 22.23 ? 167  LYS A CB    1 
ATOM   1282 C  CG    . LYS A 1 167 ? 30.968 20.801  7.297   1.00 25.41 ? 167  LYS A CG    1 
ATOM   1283 C  CD    . LYS A 1 167 ? 30.616 22.178  6.785   1.00 30.35 ? 167  LYS A CD    1 
ATOM   1284 C  CE    . LYS A 1 167 ? 31.420 22.535  5.551   1.00 33.71 ? 167  LYS A CE    1 
ATOM   1285 N  NZ    . LYS A 1 167 ? 30.796 23.667  4.857   1.00 36.52 ? 167  LYS A NZ    1 
ATOM   1286 N  N     . LEU A 1 168 ? 30.312 19.759  10.815  1.00 19.73 ? 168  LEU A N     1 
ATOM   1287 C  CA    . LEU A 1 168 ? 29.024 19.224  11.375  1.00 19.34 ? 168  LEU A CA    1 
ATOM   1288 C  C     . LEU A 1 168 ? 28.651 19.762  12.730  1.00 18.90 ? 168  LEU A C     1 
ATOM   1289 O  O     . LEU A 1 168 ? 27.497 19.729  13.078  1.00 18.77 ? 168  LEU A O     1 
ATOM   1290 C  CB    . LEU A 1 168 ? 29.028 17.702  11.511  1.00 18.97 ? 168  LEU A CB    1 
ATOM   1291 C  CG    . LEU A 1 168 ? 29.269 16.958  10.208  1.00 20.26 ? 168  LEU A CG    1 
ATOM   1292 C  CD1   . LEU A 1 168 ? 29.503 15.468  10.444  1.00 20.90 ? 168  LEU A CD1   1 
ATOM   1293 C  CD2   . LEU A 1 168 ? 28.097 17.187  9.299   1.00 19.00 ? 168  LEU A CD2   1 
ATOM   1294 N  N     . ALA A 1 169 ? 29.634 20.221  13.484  1.00 18.25 ? 169  ALA A N     1 
ATOM   1295 C  CA    . ALA A 1 169 ? 29.396 20.782  14.824  1.00 19.70 ? 169  ALA A CA    1 
ATOM   1296 C  C     . ALA A 1 169 ? 28.271 21.805  14.728  1.00 20.02 ? 169  ALA A C     1 
ATOM   1297 O  O     . ALA A 1 169 ? 28.238 22.601  13.793  1.00 20.52 ? 169  ALA A O     1 
ATOM   1298 C  CB    . ALA A 1 169 ? 30.681 21.392  15.421  1.00 20.02 ? 169  ALA A CB    1 
ATOM   1299 N  N     . PRO A 1 170 ? 27.315 21.772  15.666  1.00 20.43 ? 170  PRO A N     1 
ATOM   1300 C  CA    . PRO A 1 170 ? 27.295 21.120  16.942  1.00 19.82 ? 170  PRO A CA    1 
ATOM   1301 C  C     . PRO A 1 170 ? 26.750 19.680  16.894  1.00 19.73 ? 170  PRO A C     1 
ATOM   1302 O  O     . PRO A 1 170 ? 26.745 19.002  17.907  1.00 19.90 ? 170  PRO A O     1 
ATOM   1303 C  CB    . PRO A 1 170 ? 26.341 22.026  17.755  1.00 20.31 ? 170  PRO A CB    1 
ATOM   1304 C  CG    . PRO A 1 170 ? 25.377 22.463  16.814  1.00 20.33 ? 170  PRO A CG    1 
ATOM   1305 C  CD    . PRO A 1 170 ? 26.024 22.432  15.422  1.00 21.29 ? 170  PRO A CD    1 
ATOM   1306 N  N     . VAL A 1 171 ? 26.386 19.172  15.721  1.00 20.09 ? 171  VAL A N     1 
ATOM   1307 C  CA    . VAL A 1 171 ? 26.013 17.749  15.603  1.00 18.28 ? 171  VAL A CA    1 
ATOM   1308 C  C     . VAL A 1 171 ? 27.249 16.862  15.893  1.00 16.79 ? 171  VAL A C     1 
ATOM   1309 O  O     . VAL A 1 171 ? 28.318 17.002  15.277  1.00 15.05 ? 171  VAL A O     1 
ATOM   1310 C  CB    . VAL A 1 171 ? 25.405 17.392  14.201  1.00 19.35 ? 171  VAL A CB    1 
ATOM   1311 C  CG1   . VAL A 1 171 ? 25.024 15.870  14.072  1.00 19.93 ? 171  VAL A CG1   1 
ATOM   1312 C  CG2   . VAL A 1 171 ? 24.184 18.281  13.900  1.00 20.41 ? 171  VAL A CG2   1 
ATOM   1313 N  N     . PRO A 1 172 ? 27.135 15.961  16.857  1.00 15.96 ? 172  PRO A N     1 
ATOM   1314 C  CA    . PRO A 1 172 ? 28.213 15.058  17.181  1.00 15.82 ? 172  PRO A CA    1 
ATOM   1315 C  C     . PRO A 1 172 ? 28.573 14.137  16.026  1.00 14.84 ? 172  PRO A C     1 
ATOM   1316 O  O     . PRO A 1 172 ? 27.720 13.816  15.187  1.00 13.52 ? 172  PRO A O     1 
ATOM   1317 C  CB    . PRO A 1 172 ? 27.611 14.195  18.294  1.00 15.45 ? 172  PRO A CB    1 
ATOM   1318 C  CG    . PRO A 1 172 ? 26.577 15.005  18.853  1.00 17.29 ? 172  PRO A CG    1 
ATOM   1319 C  CD    . PRO A 1 172 ? 25.980 15.727  17.731  1.00 16.04 ? 172  PRO A CD    1 
ATOM   1320 N  N     . PHE A 1 173 ? 29.828 13.689  16.037  1.00 15.22 ? 173  PHE A N     1 
ATOM   1321 C  CA    . PHE A 1 173 ? 30.390 12.853  15.001  1.00 14.34 ? 173  PHE A CA    1 
ATOM   1322 C  C     . PHE A 1 173 ? 31.300 11.795  15.655  1.00 14.60 ? 173  PHE A C     1 
ATOM   1323 O  O     . PHE A 1 173 ? 32.051 12.094  16.585  1.00 15.06 ? 173  PHE A O     1 
ATOM   1324 C  CB    . PHE A 1 173 ? 31.263 13.640  14.006  1.00 14.64 ? 173  PHE A CB    1 
ATOM   1325 C  CG    . PHE A 1 173 ? 31.839 12.743  12.948  1.00 11.69 ? 173  PHE A CG    1 
ATOM   1326 C  CD1   . PHE A 1 173 ? 33.166 12.341  13.018  1.00 13.30 ? 173  PHE A CD1   1 
ATOM   1327 C  CD2   . PHE A 1 173 ? 31.028 12.221  11.950  1.00 10.60 ? 173  PHE A CD2   1 
ATOM   1328 C  CE1   . PHE A 1 173 ? 33.672 11.444  12.106  1.00 16.41 ? 173  PHE A CE1   1 
ATOM   1329 C  CE2   . PHE A 1 173 ? 31.544 11.297  11.047  1.00 15.09 ? 173  PHE A CE2   1 
ATOM   1330 C  CZ    . PHE A 1 173 ? 32.817 10.923  11.123  1.00 12.87 ? 173  PHE A CZ    1 
ATOM   1331 N  N     . PHE A 1 174 ? 31.252 10.589  15.118  1.00 13.71 ? 174  PHE A N     1 
ATOM   1332 C  CA    . PHE A 1 174 ? 32.093 9.518   15.515  1.00 14.16 ? 174  PHE A CA    1 
ATOM   1333 C  C     . PHE A 1 174 ? 32.517 8.664   14.288  1.00 13.97 ? 174  PHE A C     1 
ATOM   1334 O  O     . PHE A 1 174 ? 31.691 8.260   13.466  1.00 15.03 ? 174  PHE A O     1 
ATOM   1335 C  CB    . PHE A 1 174 ? 31.347 8.657   16.528  1.00 14.71 ? 174  PHE A CB    1 
ATOM   1336 C  CG    . PHE A 1 174 ? 32.054 7.369   16.873  1.00 15.34 ? 174  PHE A CG    1 
ATOM   1337 C  CD1   . PHE A 1 174 ? 33.016 7.349   17.864  1.00 17.01 ? 174  PHE A CD1   1 
ATOM   1338 C  CD2   . PHE A 1 174 ? 31.772 6.189   16.182  1.00 16.45 ? 174  PHE A CD2   1 
ATOM   1339 C  CE1   . PHE A 1 174 ? 33.669 6.205   18.179  1.00 16.32 ? 174  PHE A CE1   1 
ATOM   1340 C  CE2   . PHE A 1 174 ? 32.470 5.016   16.478  1.00 17.85 ? 174  PHE A CE2   1 
ATOM   1341 C  CZ    . PHE A 1 174 ? 33.386 5.013   17.482  1.00 16.24 ? 174  PHE A CZ    1 
ATOM   1342 N  N     . SER A 1 175 ? 33.817 8.372   14.222  1.00 13.14 ? 175  SER A N     1 
ATOM   1343 C  CA    . SER A 1 175 ? 34.381 7.515   13.243  1.00 13.14 ? 175  SER A CA    1 
ATOM   1344 C  C     . SER A 1 175 ? 35.176 6.379   13.875  1.00 13.22 ? 175  SER A C     1 
ATOM   1345 O  O     . SER A 1 175 ? 35.846 6.568   14.924  1.00 13.36 ? 175  SER A O     1 
ATOM   1346 C  CB    . SER A 1 175 ? 35.341 8.279   12.312  1.00 12.15 ? 175  SER A CB    1 
ATOM   1347 O  OG    . SER A 1 175 ? 36.457 8.785   13.061  1.00 16.48 ? 175  SER A OG    1 
ATOM   1348 N  N     . LEU A 1 176 ? 35.172 5.211   13.222  1.00 14.00 ? 176  LEU A N     1 
ATOM   1349 C  CA    . LEU A 1 176 ? 35.977 4.066   13.721  1.00 14.45 ? 176  LEU A CA    1 
ATOM   1350 C  C     . LEU A 1 176 ? 37.448 4.295   13.595  1.00 15.42 ? 176  LEU A C     1 
ATOM   1351 O  O     . LEU A 1 176 ? 38.201 3.939   14.499  1.00 15.78 ? 176  LEU A O     1 
ATOM   1352 C  CB    . LEU A 1 176 ? 35.630 2.768   13.014  1.00 15.09 ? 176  LEU A CB    1 
ATOM   1353 C  CG    . LEU A 1 176 ? 34.191 2.306   13.171  1.00 17.00 ? 176  LEU A CG    1 
ATOM   1354 C  CD1   . LEU A 1 176 ? 33.990 1.066   12.332  1.00 18.45 ? 176  LEU A CD1   1 
ATOM   1355 C  CD2   . LEU A 1 176 ? 33.869 1.989   14.611  1.00 18.81 ? 176  LEU A CD2   1 
ATOM   1356 N  N     . LEU A 1 177 ? 37.837 4.856   12.452  1.00 15.63 ? 177  LEU A N     1 
ATOM   1357 C  CA    . LEU A 1 177 ? 39.221 5.021   12.048  1.00 16.63 ? 177  LEU A CA    1 
ATOM   1358 C  C     . LEU A 1 177 ? 39.464 6.400   11.518  1.00 16.69 ? 177  LEU A C     1 
ATOM   1359 O  O     . LEU A 1 177 ? 38.613 6.947   10.844  1.00 16.06 ? 177  LEU A O     1 
ATOM   1360 C  CB    . LEU A 1 177 ? 39.602 4.017   10.960  1.00 16.28 ? 177  LEU A CB    1 
ATOM   1361 C  CG    . LEU A 1 177 ? 39.357 2.562   11.370  1.00 17.36 ? 177  LEU A CG    1 
ATOM   1362 C  CD1   . LEU A 1 177 ? 39.435 1.658   10.185  1.00 18.12 ? 177  LEU A CD1   1 
ATOM   1363 C  CD2   . LEU A 1 177 ? 40.341 2.198   12.447  1.00 15.32 ? 177  LEU A CD2   1 
ATOM   1364 N  N     . GLN A 1 178 ? 40.632 6.938   11.863  1.00 17.30 ? 178  GLN A N     1 
ATOM   1365 C  CA    . GLN A 1 178 ? 41.081 8.245   11.389  1.00 18.38 ? 178  GLN A CA    1 
ATOM   1366 C  C     . GLN A 1 178 ? 42.410 8.163   10.563  1.00 19.93 ? 178  GLN A C     1 
ATOM   1367 O  O     . GLN A 1 178 ? 43.346 7.407   10.898  1.00 19.33 ? 178  GLN A O     1 
ATOM   1368 C  CB    . GLN A 1 178 ? 41.223 9.199   12.596  1.00 18.61 ? 178  GLN A CB    1 
ATOM   1369 C  CG    . GLN A 1 178 ? 39.969 9.349   13.454  1.00 18.23 ? 178  GLN A CG    1 
ATOM   1370 C  CD    . GLN A 1 178 ? 39.762 8.177   14.458  1.00 22.33 ? 178  GLN A CD    1 
ATOM   1371 O  OE1   . GLN A 1 178 ? 40.699 7.760   15.178  1.00 26.62 ? 178  GLN A OE1   1 
ATOM   1372 N  NE2   . GLN A 1 178 ? 38.524 7.664   14.522  1.00 20.26 ? 178  GLN A NE2   1 
ATOM   1373 N  N     . TYR A 1 179 ? 42.458 8.882   9.438   1.00 19.92 ? 179  TYR A N     1 
ATOM   1374 C  CA    . TYR A 1 179 ? 43.688 9.188   8.722   1.00 19.82 ? 179  TYR A CA    1 
ATOM   1375 C  C     . TYR A 1 179 ? 43.780 10.729  8.530   1.00 20.10 ? 179  TYR A C     1 
ATOM   1376 O  O     . TYR A 1 179 ? 42.763 11.412  8.570   1.00 17.89 ? 179  TYR A O     1 
ATOM   1377 C  CB    . TYR A 1 179 ? 43.698 8.497   7.381   1.00 20.70 ? 179  TYR A CB    1 
ATOM   1378 C  CG    . TYR A 1 179 ? 43.316 7.028   7.437   1.00 21.75 ? 179  TYR A CG    1 
ATOM   1379 C  CD1   . TYR A 1 179 ? 44.283 6.047   7.515   1.00 27.36 ? 179  TYR A CD1   1 
ATOM   1380 C  CD2   . TYR A 1 179 ? 41.992 6.631   7.441   1.00 26.34 ? 179  TYR A CD2   1 
ATOM   1381 C  CE1   . TYR A 1 179 ? 43.938 4.688   7.542   1.00 28.35 ? 179  TYR A CE1   1 
ATOM   1382 C  CE2   . TYR A 1 179 ? 41.643 5.297   7.497   1.00 24.76 ? 179  TYR A CE2   1 
ATOM   1383 C  CZ    . TYR A 1 179 ? 42.614 4.320   7.555   1.00 28.74 ? 179  TYR A CZ    1 
ATOM   1384 O  OH    . TYR A 1 179 ? 42.262 2.949   7.603   1.00 29.79 ? 179  TYR A OH    1 
ATOM   1385 N  N     . GLU A 1 180 ? 44.982 11.290  8.372   1.00 22.40 ? 180  GLU A N     1 
ATOM   1386 C  CA    . GLU A 1 180 ? 45.053 12.757  8.031   1.00 22.44 ? 180  GLU A CA    1 
ATOM   1387 C  C     . GLU A 1 180 ? 44.205 13.054  6.792   1.00 23.08 ? 180  GLU A C     1 
ATOM   1388 O  O     . GLU A 1 180 ? 44.263 12.283  5.820   1.00 24.18 ? 180  GLU A O     1 
ATOM   1389 C  CB    A GLU A 1 180 ? 46.492 13.266  7.903   0.33 23.08 ? 180  GLU A CB    1 
ATOM   1390 C  CB    B GLU A 1 180 ? 46.508 13.239  7.885   0.34 23.02 ? 180  GLU A CB    1 
ATOM   1391 C  CB    C GLU A 1 180 ? 46.494 13.212  7.723   0.33 22.74 ? 180  GLU A CB    1 
ATOM   1392 C  CG    A GLU A 1 180 ? 46.891 14.247  9.050   0.33 23.96 ? 180  GLU A CG    1 
ATOM   1393 C  CG    B GLU A 1 180 ? 47.084 13.826  9.213   0.34 23.86 ? 180  GLU A CG    1 
ATOM   1394 C  CG    C GLU A 1 180 ? 47.232 13.986  8.835   0.33 23.10 ? 180  GLU A CG    1 
ATOM   1395 C  CD    A GLU A 1 180 ? 46.799 13.640  10.470  0.33 25.24 ? 180  GLU A CD    1 
ATOM   1396 C  CD    B GLU A 1 180 ? 48.615 13.862  9.269   0.34 24.50 ? 180  GLU A CD    1 
ATOM   1397 C  CD    C GLU A 1 180 ? 46.578 15.305  9.220   0.33 22.19 ? 180  GLU A CD    1 
ATOM   1398 O  OE1   A GLU A 1 180 ? 46.477 12.439  10.614  0.33 28.25 ? 180  GLU A OE1   1 
ATOM   1399 O  OE1   B GLU A 1 180 ? 49.225 14.019  8.185   0.34 24.59 ? 180  GLU A OE1   1 
ATOM   1400 O  OE1   C GLU A 1 180 ? 45.442 15.263  9.727   0.33 23.40 ? 180  GLU A OE1   1 
ATOM   1401 O  OE2   A GLU A 1 180 ? 47.056 14.368  11.450  0.33 23.31 ? 180  GLU A OE2   1 
ATOM   1402 O  OE2   B GLU A 1 180 ? 49.189 13.738  10.395  0.34 20.64 ? 180  GLU A OE2   1 
ATOM   1403 O  OE2   C GLU A 1 180 ? 47.200 16.386  9.048   0.33 19.45 ? 180  GLU A OE2   1 
ATOM   1404 O  OXT   . GLU A 1 180 ? 43.417 14.001  6.731   1.00 23.16 ? 180  GLU A OXT   1 
ATOM   1405 N  N     . ALA B 1 2   ? -1.903 -16.289 2.298   1.00 38.32 ? 2    ALA B N     1 
ATOM   1406 C  CA    . ALA B 1 2   ? -0.506 -16.489 1.791   1.00 38.22 ? 2    ALA B CA    1 
ATOM   1407 C  C     . ALA B 1 2   ? 0.590  -16.104 2.816   1.00 37.11 ? 2    ALA B C     1 
ATOM   1408 O  O     . ALA B 1 2   ? 0.303  -15.484 3.849   1.00 38.13 ? 2    ALA B O     1 
ATOM   1409 C  CB    . ALA B 1 2   ? -0.318 -15.748 0.440   1.00 38.84 ? 2    ALA B CB    1 
ATOM   1410 N  N     . ASP B 1 3   ? 1.831  -16.501 2.526   1.00 35.19 ? 3    ASP B N     1 
ATOM   1411 C  CA    . ASP B 1 3   ? 2.911  -16.473 3.506   1.00 33.59 ? 3    ASP B CA    1 
ATOM   1412 C  C     . ASP B 1 3   ? 2.909  -15.127 4.313   1.00 32.31 ? 3    ASP B C     1 
ATOM   1413 O  O     . ASP B 1 3   ? 2.857  -14.052 3.736   1.00 31.67 ? 3    ASP B O     1 
ATOM   1414 C  CB    . ASP B 1 3   ? 4.236  -16.739 2.752   1.00 34.18 ? 3    ASP B CB    1 
ATOM   1415 C  CG    . ASP B 1 3   ? 5.456  -16.890 3.661   1.00 35.38 ? 3    ASP B CG    1 
ATOM   1416 O  OD1   . ASP B 1 3   ? 5.356  -16.857 4.916   1.00 38.68 ? 3    ASP B OD1   1 
ATOM   1417 O  OD2   . ASP B 1 3   ? 6.529  -17.109 3.080   1.00 33.11 ? 3    ASP B OD2   1 
ATOM   1418 N  N     . SER B 1 4   ? 2.941  -15.217 5.646   1.00 30.18 ? 4    SER B N     1 
ATOM   1419 C  CA    . SER B 1 4   ? 2.894  -14.050 6.499   1.00 28.76 ? 4    SER B CA    1 
ATOM   1420 C  C     . SER B 1 4   ? 4.162  -13.218 6.379   1.00 26.99 ? 4    SER B C     1 
ATOM   1421 O  O     . SER B 1 4   ? 4.126  -11.998 6.513   1.00 24.12 ? 4    SER B O     1 
ATOM   1422 C  CB    . SER B 1 4   ? 2.597  -14.444 7.981   1.00 30.71 ? 4    SER B CB    1 
ATOM   1423 O  OG    . SER B 1 4   ? 3.335  -15.579 8.434   1.00 30.44 ? 4    SER B OG    1 
ATOM   1424 N  N     . GLU B 1 5   ? 5.286  -13.876 6.154   1.00 24.71 ? 5    GLU B N     1 
ATOM   1425 C  CA    . GLU B 1 5   ? 6.551  -13.181 6.052   1.00 24.51 ? 5    GLU B CA    1 
ATOM   1426 C  C     . GLU B 1 5   ? 6.560  -12.436 4.710   1.00 22.85 ? 5    GLU B C     1 
ATOM   1427 O  O     . GLU B 1 5   ? 6.922  -11.288 4.634   1.00 22.71 ? 5    GLU B O     1 
ATOM   1428 C  CB    A GLU B 1 5   ? 7.678  -14.228 6.108   0.65 25.10 ? 5    GLU B CB    1 
ATOM   1429 C  CB    B GLU B 1 5   ? 7.760  -14.117 6.188   0.35 24.69 ? 5    GLU B CB    1 
ATOM   1430 C  CG    A GLU B 1 5   ? 8.895  -13.895 6.931   0.65 26.14 ? 5    GLU B CG    1 
ATOM   1431 C  CG    B GLU B 1 5   ? 8.322  -14.191 7.611   0.35 25.28 ? 5    GLU B CG    1 
ATOM   1432 C  CD    A GLU B 1 5   ? 10.021 -14.920 6.724   0.65 29.18 ? 5    GLU B CD    1 
ATOM   1433 C  CD    B GLU B 1 5   ? 7.407  -14.922 8.563   0.35 26.61 ? 5    GLU B CD    1 
ATOM   1434 O  OE1   A GLU B 1 5   ? 11.226 -14.499 6.700   0.65 28.68 ? 5    GLU B OE1   1 
ATOM   1435 O  OE1   B GLU B 1 5   ? 7.192  -14.431 9.697   0.35 26.65 ? 5    GLU B OE1   1 
ATOM   1436 O  OE2   A GLU B 1 5   ? 9.697  -16.128 6.572   0.65 29.80 ? 5    GLU B OE2   1 
ATOM   1437 O  OE2   B GLU B 1 5   ? 6.900  -15.999 8.180   0.35 26.94 ? 5    GLU B OE2   1 
ATOM   1438 N  N     . LEU B 1 6   ? 6.104  -13.097 3.651   1.00 20.78 ? 6    LEU B N     1 
ATOM   1439 C  CA    . LEU B 1 6   ? 6.035  -12.477 2.340   1.00 20.91 ? 6    LEU B CA    1 
ATOM   1440 C  C     . LEU B 1 6   ? 5.057  -11.289 2.361   1.00 21.45 ? 6    LEU B C     1 
ATOM   1441 O  O     . LEU B 1 6   ? 5.293  -10.262 1.744   1.00 21.62 ? 6    LEU B O     1 
ATOM   1442 C  CB    . LEU B 1 6   ? 5.632  -13.537 1.317   1.00 20.57 ? 6    LEU B CB    1 
ATOM   1443 C  CG    . LEU B 1 6   ? 5.535  -13.085 -0.122  1.00 20.20 ? 6    LEU B CG    1 
ATOM   1444 C  CD1   . LEU B 1 6   ? 6.908  -12.600 -0.634  1.00 20.89 ? 6    LEU B CD1   1 
ATOM   1445 C  CD2   . LEU B 1 6   ? 4.943  -14.227 -0.918  1.00 19.66 ? 6    LEU B CD2   1 
ATOM   1446 N  N     . GLN B 1 7   ? 3.975  -11.439 3.116   1.00 20.93 ? 7    GLN B N     1 
ATOM   1447 C  CA    . GLN B 1 7   ? 3.010  -10.329 3.317   1.00 21.38 ? 7    GLN B CA    1 
ATOM   1448 C  C     . GLN B 1 7   ? 3.589  -9.086  4.004   1.00 20.32 ? 7    GLN B C     1 
ATOM   1449 O  O     . GLN B 1 7   ? 3.238  -7.980  3.636   1.00 22.37 ? 7    GLN B O     1 
ATOM   1450 C  CB    . GLN B 1 7   ? 1.836  -10.811 4.096   1.00 20.60 ? 7    GLN B CB    1 
ATOM   1451 C  CG    . GLN B 1 7   ? 0.695  -11.255 3.198   1.00 23.81 ? 7    GLN B CG    1 
ATOM   1452 N  N     . LEU B 1 8   ? 4.467  -9.278  4.971   1.00 20.74 ? 8    LEU B N     1 
ATOM   1453 C  CA    . LEU B 1 8   ? 5.252  -8.189  5.588   1.00 21.89 ? 8    LEU B CA    1 
ATOM   1454 C  C     . LEU B 1 8   ? 6.051  -7.379  4.566   1.00 21.15 ? 8    LEU B C     1 
ATOM   1455 O  O     . LEU B 1 8   ? 6.317  -6.173  4.787   1.00 20.78 ? 8    LEU B O     1 
ATOM   1456 C  CB    . LEU B 1 8   ? 6.270  -8.724  6.621   1.00 22.14 ? 8    LEU B CB    1 
ATOM   1457 C  CG    . LEU B 1 8   ? 6.042  -8.751  8.149   1.00 26.95 ? 8    LEU B CG    1 
ATOM   1458 C  CD1   . LEU B 1 8   ? 4.609  -8.604  8.502   1.00 28.07 ? 8    LEU B CD1   1 
ATOM   1459 C  CD2   . LEU B 1 8   ? 6.674  -9.979  8.826   1.00 26.52 ? 8    LEU B CD2   1 
ATOM   1460 N  N     . VAL B 1 9   ? 6.492  -8.053  3.490   1.00 19.36 ? 9    VAL B N     1 
ATOM   1461 C  CA    . VAL B 1 9   ? 7.212  -7.379  2.440   1.00 17.93 ? 9    VAL B CA    1 
ATOM   1462 C  C     . VAL B 1 9   ? 6.242  -6.718  1.442   1.00 17.90 ? 9    VAL B C     1 
ATOM   1463 O  O     . VAL B 1 9   ? 6.437  -5.581  1.032   1.00 17.75 ? 9    VAL B O     1 
ATOM   1464 C  CB    . VAL B 1 9   ? 8.194  -8.344  1.704   1.00 18.12 ? 9    VAL B CB    1 
ATOM   1465 C  CG1   . VAL B 1 9   ? 8.928  -7.625  0.654   1.00 17.82 ? 9    VAL B CG1   1 
ATOM   1466 C  CG2   . VAL B 1 9   ? 9.174  -9.010  2.705   1.00 16.93 ? 9    VAL B CG2   1 
ATOM   1467 N  N     . GLU B 1 10  ? 5.196  -7.445  1.052   1.00 18.00 ? 10   GLU B N     1 
ATOM   1468 C  CA    . GLU B 1 10  ? 4.303  -7.002  -0.008  1.00 18.86 ? 10   GLU B CA    1 
ATOM   1469 C  C     . GLU B 1 10  ? 3.590  -5.754  0.448   1.00 18.90 ? 10   GLU B C     1 
ATOM   1470 O  O     . GLU B 1 10  ? 3.343  -4.851  -0.349  1.00 17.55 ? 10   GLU B O     1 
ATOM   1471 C  CB    . GLU B 1 10  ? 3.257  -8.067  -0.340  1.00 18.84 ? 10   GLU B CB    1 
ATOM   1472 C  CG    . GLU B 1 10  ? 2.458  -7.694  -1.592  1.00 23.91 ? 10   GLU B CG    1 
ATOM   1473 C  CD    . GLU B 1 10  ? 1.418  -8.680  -1.942  1.00 31.42 ? 10   GLU B CD    1 
ATOM   1474 O  OE1   . GLU B 1 10  ? 1.036  -9.475  -1.046  1.00 40.57 ? 10   GLU B OE1   1 
ATOM   1475 O  OE2   . GLU B 1 10  ? 0.925  -8.616  -3.103  1.00 38.51 ? 10   GLU B OE2   1 
ATOM   1476 N  N     . GLN B 1 11  ? 3.228  -5.709  1.717   1.00 18.69 ? 11   GLN B N     1 
ATOM   1477 C  CA    . GLN B 1 11  ? 2.503  -4.562  2.252   1.00 20.41 ? 11   GLN B CA    1 
ATOM   1478 C  C     . GLN B 1 11  ? 3.352  -3.311  2.336   1.00 19.31 ? 11   GLN B C     1 
ATOM   1479 O  O     . GLN B 1 11  ? 2.838  -2.263  2.667   1.00 21.47 ? 11   GLN B O     1 
ATOM   1480 C  CB    . GLN B 1 11  ? 2.041  -4.801  3.690   1.00 20.76 ? 11   GLN B CB    1 
ATOM   1481 C  CG    . GLN B 1 11  ? 1.172  -5.950  3.908   1.00 26.06 ? 11   GLN B CG    1 
ATOM   1482 C  CD    . GLN B 1 11  ? 0.899  -6.133  5.427   1.00 31.37 ? 11   GLN B CD    1 
ATOM   1483 O  OE1   . GLN B 1 11  ? 1.770  -5.826  6.280   1.00 36.83 ? 11   GLN B OE1   1 
ATOM   1484 N  NE2   . GLN B 1 11  ? -0.297 -6.599  5.757   1.00 33.71 ? 11   GLN B NE2   1 
ATOM   1485 N  N     . ARG B 1 12  ? 4.646  -3.438  2.121   1.00 19.02 ? 12   ARG B N     1 
ATOM   1486 C  CA    . ARG B 1 12  ? 5.593  -2.341  2.288   1.00 18.81 ? 12   ARG B CA    1 
ATOM   1487 C  C     . ARG B 1 12  ? 6.230  -1.929  0.971   1.00 19.38 ? 12   ARG B C     1 
ATOM   1488 O  O     . ARG B 1 12  ? 7.238  -1.201  0.914   1.00 19.35 ? 12   ARG B O     1 
ATOM   1489 C  CB    . ARG B 1 12  ? 6.643  -2.784  3.267   1.00 18.54 ? 12   ARG B CB    1 
ATOM   1490 C  CG    . ARG B 1 12  ? 6.188  -2.869  4.652   1.00 18.50 ? 12   ARG B CG    1 
ATOM   1491 C  CD    . ARG B 1 12  ? 5.937  -1.509  5.228   1.00 23.74 ? 12   ARG B CD    1 
ATOM   1492 N  NE    . ARG B 1 12  ? 5.430  -1.613  6.587   1.00 26.06 ? 12   ARG B NE    1 
ATOM   1493 C  CZ    . ARG B 1 12  ? 4.159  -1.701  6.920   1.00 35.47 ? 12   ARG B CZ    1 
ATOM   1494 N  NH1   . ARG B 1 12  ? 3.202  -1.712  5.985   1.00 39.09 ? 12   ARG B NH1   1 
ATOM   1495 N  NH2   . ARG B 1 12  ? 3.841  -1.787  8.206   1.00 36.95 ? 12   ARG B NH2   1 
ATOM   1496 N  N     . ILE B 1 13  ? 5.653  -2.412  -0.100  1.00 18.61 ? 13   ILE B N     1 
ATOM   1497 C  CA    . ILE B 1 13  ? 5.938  -1.916  -1.409  1.00 19.50 ? 13   ILE B CA    1 
ATOM   1498 C  C     . ILE B 1 13  ? 4.920  -0.824  -1.782  1.00 18.59 ? 13   ILE B C     1 
ATOM   1499 O  O     . ILE B 1 13  ? 3.704  -1.053  -1.832  1.00 19.76 ? 13   ILE B O     1 
ATOM   1500 C  CB    . ILE B 1 13  ? 5.891  -3.048  -2.454  1.00 19.72 ? 13   ILE B CB    1 
ATOM   1501 C  CG1   . ILE B 1 13  ? 6.772  -4.257  -2.066  1.00 21.72 ? 13   ILE B CG1   1 
ATOM   1502 C  CG2   . ILE B 1 13  ? 6.317  -2.522  -3.839  1.00 19.88 ? 13   ILE B CG2   1 
ATOM   1503 C  CD1   . ILE B 1 13  ? 8.258  -3.959  -2.034  1.00 23.94 ? 13   ILE B CD1   1 
ATOM   1504 N  N     . ARG B 1 14  ? 5.411  0.360   -2.102  1.00 17.48 ? 14   ARG B N     1 
ATOM   1505 C  CA    . ARG B 1 14  ? 4.539  1.483   -2.414  1.00 18.06 ? 14   ARG B CA    1 
ATOM   1506 C  C     . ARG B 1 14  ? 4.667  1.752   -3.911  1.00 17.39 ? 14   ARG B C     1 
ATOM   1507 O  O     . ARG B 1 14  ? 5.786  1.788   -4.448  1.00 17.55 ? 14   ARG B O     1 
ATOM   1508 C  CB    . ARG B 1 14  ? 5.048  2.677   -1.611  1.00 19.28 ? 14   ARG B CB    1 
ATOM   1509 C  CG    . ARG B 1 14  ? 4.163  3.810   -1.568  1.00 24.05 ? 14   ARG B CG    1 
ATOM   1510 C  CD    . ARG B 1 14  ? 4.625  4.820   -0.532  1.00 26.67 ? 14   ARG B CD    1 
ATOM   1511 N  NE    . ARG B 1 14  ? 6.066  5.041   -0.458  1.00 29.75 ? 14   ARG B NE    1 
ATOM   1512 C  CZ    . ARG B 1 14  ? 6.623  5.994   0.289   1.00 34.47 ? 14   ARG B CZ    1 
ATOM   1513 N  NH1   . ARG B 1 14  ? 7.949  6.146   0.328   1.00 37.68 ? 14   ARG B NH1   1 
ATOM   1514 N  NH2   . ARG B 1 14  ? 5.855  6.810   0.998   1.00 34.02 ? 14   ARG B NH2   1 
ATOM   1515 N  N     . SER B 1 15  ? 3.536  1.836   -4.594  1.00 16.55 ? 15   SER B N     1 
ATOM   1516 C  CA    . SER B 1 15  ? 3.521  1.978   -6.045  1.00 16.66 ? 15   SER B CA    1 
ATOM   1517 C  C     . SER B 1 15  ? 3.124  3.376   -6.464  1.00 15.80 ? 15   SER B C     1 
ATOM   1518 O  O     . SER B 1 15  ? 2.037  3.844   -6.126  1.00 18.18 ? 15   SER B O     1 
ATOM   1519 C  CB    . SER B 1 15  ? 2.600  0.925   -6.633  1.00 16.77 ? 15   SER B CB    1 
ATOM   1520 O  OG    . SER B 1 15  ? 3.166  -0.363  -6.328  1.00 19.30 ? 15   SER B OG    1 
ATOM   1521 N  N     . PHE B 1 16  ? 3.981  4.047   -7.217  1.00 14.82 ? 16   PHE B N     1 
ATOM   1522 C  CA    . PHE B 1 16  ? 3.748  5.434   -7.623  1.00 15.49 ? 16   PHE B CA    1 
ATOM   1523 C  C     . PHE B 1 16  ? 3.482  5.469   -9.128  1.00 15.42 ? 16   PHE B C     1 
ATOM   1524 O  O     . PHE B 1 16  ? 4.378  5.219   -9.913  1.00 17.25 ? 16   PHE B O     1 
ATOM   1525 C  CB    . PHE B 1 16  ? 4.987  6.294   -7.325  1.00 15.38 ? 16   PHE B CB    1 
ATOM   1526 C  CG    . PHE B 1 16  ? 5.184  6.623   -5.865  1.00 16.99 ? 16   PHE B CG    1 
ATOM   1527 C  CD1   . PHE B 1 16  ? 4.597  7.754   -5.298  1.00 16.86 ? 16   PHE B CD1   1 
ATOM   1528 C  CD2   . PHE B 1 16  ? 5.937  5.808   -5.063  1.00 15.00 ? 16   PHE B CD2   1 
ATOM   1529 C  CE1   . PHE B 1 16  ? 4.802  8.024   -3.937  1.00 14.86 ? 16   PHE B CE1   1 
ATOM   1530 C  CE2   . PHE B 1 16  ? 6.147  6.095   -3.752  1.00 17.20 ? 16   PHE B CE2   1 
ATOM   1531 C  CZ    . PHE B 1 16  ? 5.547  7.182   -3.190  1.00 14.56 ? 16   PHE B CZ    1 
ATOM   1532 N  N     . PRO B 1 17  ? 2.265  5.777   -9.531  1.00 15.05 ? 17   PRO B N     1 
ATOM   1533 C  CA    . PRO B 1 17  ? 2.057  5.847   -10.972 1.00 15.94 ? 17   PRO B CA    1 
ATOM   1534 C  C     . PRO B 1 17  ? 2.745  7.019   -11.660 1.00 17.00 ? 17   PRO B C     1 
ATOM   1535 O  O     . PRO B 1 17  ? 3.057  8.077   -11.039 1.00 14.66 ? 17   PRO B O     1 
ATOM   1536 C  CB    . PRO B 1 17  ? 0.558  5.962   -11.092 1.00 17.14 ? 17   PRO B CB    1 
ATOM   1537 C  CG    . PRO B 1 17  ? 0.140  6.591   -9.806  1.00 16.05 ? 17   PRO B CG    1 
ATOM   1538 C  CD    . PRO B 1 17  ? 1.048  6.092   -8.761  1.00 14.42 ? 17   PRO B CD    1 
ATOM   1539 N  N     . ASP B 1 18  ? 3.014  6.805   -12.952 1.00 16.70 ? 18   ASP B N     1 
ATOM   1540 C  CA    . ASP B 1 18  ? 3.558  7.830   -13.793 1.00 18.30 ? 18   ASP B CA    1 
ATOM   1541 C  C     . ASP B 1 18  ? 4.868  8.409   -13.283 1.00 18.68 ? 18   ASP B C     1 
ATOM   1542 O  O     . ASP B 1 18  ? 5.105  9.591   -13.444 1.00 19.34 ? 18   ASP B O     1 
ATOM   1543 C  CB    . ASP B 1 18  ? 2.519  8.940   -13.984 1.00 18.20 ? 18   ASP B CB    1 
ATOM   1544 C  CG    . ASP B 1 18  ? 1.145  8.402   -14.434 1.00 20.69 ? 18   ASP B CG    1 
ATOM   1545 O  OD1   . ASP B 1 18  ? 0.109  8.747   -13.807 1.00 20.56 ? 18   ASP B OD1   1 
ATOM   1546 O  OD2   . ASP B 1 18  ? 1.087  7.598   -15.386 1.00 22.02 ? 18   ASP B OD2   1 
ATOM   1547 N  N     . PHE B 1 19  ? 5.703  7.590   -12.659 1.00 19.74 ? 19   PHE B N     1 
ATOM   1548 C  CA    . PHE B 1 19  ? 7.070  8.013   -12.325 1.00 20.53 ? 19   PHE B CA    1 
ATOM   1549 C  C     . PHE B 1 19  ? 8.008  6.962   -12.838 1.00 21.73 ? 19   PHE B C     1 
ATOM   1550 O  O     . PHE B 1 19  ? 7.798  5.792   -12.562 1.00 22.15 ? 19   PHE B O     1 
ATOM   1551 C  CB    . PHE B 1 19  ? 7.270  8.168   -10.816 1.00 22.05 ? 19   PHE B CB    1 
ATOM   1552 C  CG    . PHE B 1 19  ? 8.634  8.633   -10.453 1.00 20.55 ? 19   PHE B CG    1 
ATOM   1553 C  CD1   . PHE B 1 19  ? 8.918  9.988   -10.419 1.00 22.27 ? 19   PHE B CD1   1 
ATOM   1554 C  CD2   . PHE B 1 19  ? 9.622  7.726   -10.107 1.00 19.00 ? 19   PHE B CD2   1 
ATOM   1555 C  CE1   . PHE B 1 19  ? 10.177 10.424  -10.102 1.00 22.35 ? 19   PHE B CE1   1 
ATOM   1556 C  CE2   . PHE B 1 19  ? 10.888 8.160   -9.780  1.00 23.83 ? 19   PHE B CE2   1 
ATOM   1557 C  CZ    . PHE B 1 19  ? 11.160 9.512   -9.754  1.00 23.47 ? 19   PHE B CZ    1 
ATOM   1558 N  N     . PRO B 1 20  ? 9.088  7.366   -13.531 1.00 22.19 ? 20   PRO B N     1 
ATOM   1559 C  CA    . PRO B 1 20  ? 9.466  8.765   -13.873 1.00 23.15 ? 20   PRO B CA    1 
ATOM   1560 C  C     . PRO B 1 20  ? 8.709  9.343   -15.061 1.00 22.69 ? 20   PRO B C     1 
ATOM   1561 O  O     . PRO B 1 20  ? 8.691  10.542  -15.246 1.00 24.84 ? 20   PRO B O     1 
ATOM   1562 C  CB    . PRO B 1 20  ? 10.956 8.655   -14.177 1.00 22.79 ? 20   PRO B CB    1 
ATOM   1563 C  CG    . PRO B 1 20  ? 11.089 7.262   -14.768 1.00 23.72 ? 20   PRO B CG    1 
ATOM   1564 C  CD    . PRO B 1 20  ? 10.118 6.404   -13.967 1.00 22.62 ? 20   PRO B CD    1 
ATOM   1565 N  N     . THR B 1 21  ? 7.996  8.501   -15.793 1.00 22.84 ? 21   THR B N     1 
ATOM   1566 C  CA    . THR B 1 21  ? 7.328  8.900   -16.973 1.00 22.58 ? 21   THR B CA    1 
ATOM   1567 C  C     . THR B 1 21  ? 5.876  8.377   -16.973 1.00 21.31 ? 21   THR B C     1 
ATOM   1568 O  O     . THR B 1 21  ? 5.524  7.443   -16.278 1.00 18.36 ? 21   THR B O     1 
ATOM   1569 C  CB    . THR B 1 21  ? 8.117  8.435   -18.255 1.00 23.06 ? 21   THR B CB    1 
ATOM   1570 O  OG1   . THR B 1 21  ? 8.169  7.000   -18.358 1.00 24.09 ? 21   THR B OG1   1 
ATOM   1571 C  CG2   . THR B 1 21  ? 9.531  8.939   -18.224 1.00 25.72 ? 21   THR B CG2   1 
ATOM   1572 N  N     . PRO B 1 22  ? 5.010  9.009   -17.755 1.00 19.97 ? 22   PRO B N     1 
ATOM   1573 C  CA    . PRO B 1 22  ? 3.614  8.586   -17.703 1.00 20.29 ? 22   PRO B CA    1 
ATOM   1574 C  C     . PRO B 1 22  ? 3.373  7.130   -18.133 1.00 21.29 ? 22   PRO B C     1 
ATOM   1575 O  O     . PRO B 1 22  ? 3.943  6.663   -19.131 1.00 22.08 ? 22   PRO B O     1 
ATOM   1576 C  CB    . PRO B 1 22  ? 2.928  9.557   -18.663 1.00 19.44 ? 22   PRO B CB    1 
ATOM   1577 C  CG    . PRO B 1 22  ? 3.847  10.688  -18.746 1.00 19.88 ? 22   PRO B CG    1 
ATOM   1578 C  CD    . PRO B 1 22  ? 5.199  10.153  -18.648 1.00 20.12 ? 22   PRO B CD    1 
ATOM   1579 N  N     . GLY B 1 23  ? 2.510  6.429   -17.401 1.00 20.52 ? 23   GLY B N     1 
ATOM   1580 C  CA    . GLY B 1 23  ? 2.228  5.049   -17.724 1.00 21.54 ? 23   GLY B CA    1 
ATOM   1581 C  C     . GLY B 1 23  ? 3.128  4.049   -17.000 1.00 21.51 ? 23   GLY B C     1 
ATOM   1582 O  O     . GLY B 1 23  ? 2.736  2.899   -16.873 1.00 23.21 ? 23   GLY B O     1 
ATOM   1583 N  N     . VAL B 1 24  ? 4.306  4.489   -16.534 1.00 21.96 ? 24   VAL B N     1 
ATOM   1584 C  CA    . VAL B 1 24  ? 5.230  3.658   -15.734 1.00 23.22 ? 24   VAL B CA    1 
ATOM   1585 C  C     . VAL B 1 24  ? 4.806  3.700   -14.275 1.00 22.19 ? 24   VAL B C     1 
ATOM   1586 O  O     . VAL B 1 24  ? 4.534  4.791   -13.743 1.00 22.55 ? 24   VAL B O     1 
ATOM   1587 C  CB    . VAL B 1 24  ? 6.677  4.215   -15.797 1.00 22.81 ? 24   VAL B CB    1 
ATOM   1588 C  CG1   . VAL B 1 24  ? 7.631  3.391   -14.987 1.00 25.93 ? 24   VAL B CG1   1 
ATOM   1589 C  CG2   . VAL B 1 24  ? 7.150  4.296   -17.239 1.00 25.66 ? 24   VAL B CG2   1 
ATOM   1590 N  N     . VAL B 1 25  ? 4.802  2.543   -13.608 1.00 21.42 ? 25   VAL B N     1 
ATOM   1591 C  CA    . VAL B 1 25  ? 4.481  2.473   -12.181 1.00 20.30 ? 25   VAL B CA    1 
ATOM   1592 C  C     . VAL B 1 25  ? 5.818  2.211   -11.471 1.00 20.42 ? 25   VAL B C     1 
ATOM   1593 O  O     . VAL B 1 25  ? 6.504  1.197   -11.725 1.00 19.46 ? 25   VAL B O     1 
ATOM   1594 C  CB    . VAL B 1 25  ? 3.416  1.405   -11.882 1.00 20.80 ? 25   VAL B CB    1 
ATOM   1595 C  CG1   . VAL B 1 25  ? 3.138  1.286   -10.403 1.00 20.60 ? 25   VAL B CG1   1 
ATOM   1596 C  CG2   . VAL B 1 25  ? 2.106  1.729   -12.627 1.00 19.48 ? 25   VAL B CG2   1 
ATOM   1597 N  N     . PHE B 1 26  ? 6.206  3.146   -10.614 1.00 18.93 ? 26   PHE B N     1 
ATOM   1598 C  CA    . PHE B 1 26  ? 7.457  3.010   -9.856  1.00 17.99 ? 26   PHE B CA    1 
ATOM   1599 C  C     . PHE B 1 26  ? 7.151  2.170   -8.614  1.00 16.86 ? 26   PHE B C     1 
ATOM   1600 O  O     . PHE B 1 26  ? 6.213  2.474   -7.885  1.00 14.22 ? 26   PHE B O     1 
ATOM   1601 C  CB    . PHE B 1 26  ? 8.053  4.388   -9.495  1.00 17.84 ? 26   PHE B CB    1 
ATOM   1602 C  CG    . PHE B 1 26  ? 9.447  4.317   -8.889  1.00 18.46 ? 26   PHE B CG    1 
ATOM   1603 C  CD1   . PHE B 1 26  ? 10.556 4.463   -9.685  1.00 19.47 ? 26   PHE B CD1   1 
ATOM   1604 C  CD2   . PHE B 1 26  ? 9.637  4.089   -7.547  1.00 15.49 ? 26   PHE B CD2   1 
ATOM   1605 C  CE1   . PHE B 1 26  ? 11.831 4.387   -9.144  1.00 22.77 ? 26   PHE B CE1   1 
ATOM   1606 C  CE2   . PHE B 1 26  ? 10.893 4.016   -7.008  1.00 17.82 ? 26   PHE B CE2   1 
ATOM   1607 C  CZ    . PHE B 1 26  ? 11.979 4.185   -7.791  1.00 20.21 ? 26   PHE B CZ    1 
ATOM   1608 N  N     . ARG B 1 27  ? 7.946  1.116   -8.388  1.00 17.38 ? 27   ARG B N     1 
ATOM   1609 C  CA    . ARG B 1 27  ? 7.840  0.255   -7.199  1.00 17.52 ? 27   ARG B CA    1 
ATOM   1610 C  C     . ARG B 1 27  ? 8.899  0.662   -6.250  1.00 16.66 ? 27   ARG B C     1 
ATOM   1611 O  O     . ARG B 1 27  ? 10.135 0.466   -6.521  1.00 18.90 ? 27   ARG B O     1 
ATOM   1612 C  CB    . ARG B 1 27  ? 7.999  -1.204  -7.546  1.00 18.15 ? 27   ARG B CB    1 
ATOM   1613 C  CG    . ARG B 1 27  ? 7.101  -1.683  -8.693  1.00 19.24 ? 27   ARG B CG    1 
ATOM   1614 C  CD    . ARG B 1 27  ? 5.614  -1.533  -8.448  1.00 19.16 ? 27   ARG B CD    1 
ATOM   1615 N  NE    . ARG B 1 27  ? 4.888  -1.867  -9.668  1.00 18.69 ? 27   ARG B NE    1 
ATOM   1616 C  CZ    . ARG B 1 27  ? 3.580  -2.062  -9.747  1.00 19.18 ? 27   ARG B CZ    1 
ATOM   1617 N  NH1   . ARG B 1 27  ? 2.786  -2.005  -8.678  1.00 21.04 ? 27   ARG B NH1   1 
ATOM   1618 N  NH2   . ARG B 1 27  ? 3.058  -2.318  -10.923 1.00 19.45 ? 27   ARG B NH2   1 
ATOM   1619 N  N     . ASP B 1 28  ? 8.447  1.250   -5.136  1.00 16.93 ? 28   ASP B N     1 
ATOM   1620 C  CA    . ASP B 1 28  ? 9.337  1.823   -4.106  1.00 16.65 ? 28   ASP B CA    1 
ATOM   1621 C  C     . ASP B 1 28  ? 9.447  0.875   -2.897  1.00 17.20 ? 28   ASP B C     1 
ATOM   1622 O  O     . ASP B 1 28  ? 8.437  0.621   -2.169  1.00 15.44 ? 28   ASP B O     1 
ATOM   1623 C  CB    . ASP B 1 28  ? 8.782  3.167   -3.670  1.00 16.50 ? 28   ASP B CB    1 
ATOM   1624 C  CG    . ASP B 1 28  ? 9.627  3.854   -2.588  1.00 18.52 ? 28   ASP B CG    1 
ATOM   1625 O  OD1   . ASP B 1 28  ? 10.830 3.563   -2.516  1.00 15.72 ? 28   ASP B OD1   1 
ATOM   1626 O  OD2   . ASP B 1 28  ? 9.033  4.676   -1.851  1.00 24.80 ? 28   ASP B OD2   1 
ATOM   1627 N  N     . ILE B 1 29  ? 10.654 0.346   -2.731  1.00 17.38 ? 29   ILE B N     1 
ATOM   1628 C  CA    . ILE B 1 29  ? 11.016 -0.567  -1.625  1.00 18.95 ? 29   ILE B CA    1 
ATOM   1629 C  C     . ILE B 1 29  ? 11.331 0.166   -0.313  1.00 16.96 ? 29   ILE B C     1 
ATOM   1630 O  O     . ILE B 1 29  ? 11.533 -0.445  0.703   1.00 16.40 ? 29   ILE B O     1 
ATOM   1631 C  CB    . ILE B 1 29  ? 12.162 -1.617  -2.016  1.00 19.72 ? 29   ILE B CB    1 
ATOM   1632 C  CG1   . ILE B 1 29  ? 13.422 -0.943  -2.592  1.00 24.90 ? 29   ILE B CG1   1 
ATOM   1633 C  CG2   . ILE B 1 29  ? 11.648 -2.562  -3.039  1.00 22.42 ? 29   ILE B CG2   1 
ATOM   1634 C  CD1   . ILE B 1 29  ? 14.276 -0.205  -1.617  1.00 26.77 ? 29   ILE B CD1   1 
ATOM   1635 N  N     . SER B 1 30  ? 11.327 1.499   -0.317  1.00 16.76 ? 30   SER B N     1 
ATOM   1636 C  CA    . SER B 1 30  ? 11.673 2.258   0.891   1.00 17.11 ? 30   SER B CA    1 
ATOM   1637 C  C     . SER B 1 30  ? 10.967 1.871   2.166   1.00 16.04 ? 30   SER B C     1 
ATOM   1638 O  O     . SER B 1 30  ? 11.572 1.790   3.236   1.00 15.15 ? 30   SER B O     1 
ATOM   1639 C  CB    . SER B 1 30  ? 11.424 3.732   0.649   1.00 17.61 ? 30   SER B CB    1 
ATOM   1640 O  OG    . SER B 1 30  ? 12.477 4.155   -0.155  1.00 24.40 ? 30   SER B OG    1 
ATOM   1641 N  N     . PRO B 1 31  ? 9.659  1.639   2.070   1.00 15.13 ? 31   PRO B N     1 
ATOM   1642 C  CA    . PRO B 1 31  ? 9.022  1.289   3.324   1.00 14.51 ? 31   PRO B CA    1 
ATOM   1643 C  C     . PRO B 1 31  ? 9.485  -0.072  3.934   1.00 13.25 ? 31   PRO B C     1 
ATOM   1644 O  O     . PRO B 1 31  ? 9.330  -0.290  5.108   1.00 12.57 ? 31   PRO B O     1 
ATOM   1645 C  CB    . PRO B 1 31  ? 7.531  1.252   2.938   1.00 15.80 ? 31   PRO B CB    1 
ATOM   1646 C  CG    . PRO B 1 31  ? 7.422  2.049   1.690   1.00 14.04 ? 31   PRO B CG    1 
ATOM   1647 C  CD    . PRO B 1 31  ? 8.700  1.814   0.966   1.00 14.97 ? 31   PRO B CD    1 
ATOM   1648 N  N     . VAL B 1 32  ? 9.991  -0.986  3.108   1.00 12.42 ? 32   VAL B N     1 
ATOM   1649 C  CA    . VAL B 1 32  ? 10.551 -2.264  3.567   1.00 13.70 ? 32   VAL B CA    1 
ATOM   1650 C  C     . VAL B 1 32  ? 11.744 -1.964  4.462   1.00 12.17 ? 32   VAL B C     1 
ATOM   1651 O  O     . VAL B 1 32  ? 11.905 -2.559  5.489   1.00 14.26 ? 32   VAL B O     1 
ATOM   1652 C  CB    . VAL B 1 32  ? 11.019 -3.163  2.330   1.00 12.52 ? 32   VAL B CB    1 
ATOM   1653 C  CG1   . VAL B 1 32  ? 11.725 -4.446  2.753   1.00 14.54 ? 32   VAL B CG1   1 
ATOM   1654 C  CG2   . VAL B 1 32  ? 9.894  -3.499  1.410   1.00 13.95 ? 32   VAL B CG2   1 
ATOM   1655 N  N     . LEU B 1 33  ? 12.602 -1.051  4.023   1.00 13.70 ? 33   LEU B N     1 
ATOM   1656 C  CA    . LEU B 1 33  ? 13.786 -0.621  4.795   1.00 14.34 ? 33   LEU B CA    1 
ATOM   1657 C  C     . LEU B 1 33  ? 13.427 0.044   6.120   1.00 14.29 ? 33   LEU B C     1 
ATOM   1658 O  O     . LEU B 1 33  ? 14.100 -0.166  7.113   1.00 13.40 ? 33   LEU B O     1 
ATOM   1659 C  CB    . LEU B 1 33  ? 14.623 0.340   3.978   1.00 15.70 ? 33   LEU B CB    1 
ATOM   1660 C  CG    . LEU B 1 33  ? 15.711 -0.203  3.074   1.00 20.57 ? 33   LEU B CG    1 
ATOM   1661 C  CD1   . LEU B 1 33  ? 16.899 -0.726  3.843   1.00 21.94 ? 33   LEU B CD1   1 
ATOM   1662 C  CD2   . LEU B 1 33  ? 15.205 -1.221  2.090   1.00 22.08 ? 33   LEU B CD2   1 
ATOM   1663 N  N     . LYS B 1 34  ? 12.345 0.832   6.108   1.00 14.13 ? 34   LYS B N     1 
ATOM   1664 C  CA    . LYS B 1 34  ? 11.977 1.675   7.196   1.00 13.71 ? 34   LYS B CA    1 
ATOM   1665 C  C     . LYS B 1 34  ? 11.327 0.879   8.323   1.00 13.67 ? 34   LYS B C     1 
ATOM   1666 O  O     . LYS B 1 34  ? 11.346 1.303   9.504   1.00 12.58 ? 34   LYS B O     1 
ATOM   1667 C  CB    . LYS B 1 34  ? 11.057 2.779   6.692   1.00 14.58 ? 34   LYS B CB    1 
ATOM   1668 C  CG    . LYS B 1 34  ? 10.852 3.863   7.688   1.00 15.28 ? 34   LYS B CG    1 
ATOM   1669 C  CD    . LYS B 1 34  ? 9.897  4.917   7.251   1.00 17.62 ? 34   LYS B CD    1 
ATOM   1670 C  CE    . LYS B 1 34  ? 9.489  5.826   8.385   1.00 18.10 ? 34   LYS B CE    1 
ATOM   1671 N  NZ    . LYS B 1 34  ? 8.820  7.030   7.914   1.00 15.78 ? 34   LYS B NZ    1 
ATOM   1672 N  N     . ASP B 1 35  ? 10.732 -0.255  7.952   1.00 13.41 ? 35   ASP B N     1 
ATOM   1673 C  CA    . ASP B 1 35  ? 10.088 -1.174  8.879   1.00 14.73 ? 35   ASP B CA    1 
ATOM   1674 C  C     . ASP B 1 35  ? 11.002 -2.344  9.195   1.00 15.15 ? 35   ASP B C     1 
ATOM   1675 O  O     . ASP B 1 35  ? 11.150 -3.239  8.365   1.00 14.71 ? 35   ASP B O     1 
ATOM   1676 C  CB    . ASP B 1 35  ? 8.779  -1.691  8.278   1.00 14.95 ? 35   ASP B CB    1 
ATOM   1677 C  CG    . ASP B 1 35  ? 8.086  -2.671  9.165   1.00 17.35 ? 35   ASP B CG    1 
ATOM   1678 O  OD1   . ASP B 1 35  ? 6.912  -2.935  8.890   1.00 21.70 ? 35   ASP B OD1   1 
ATOM   1679 O  OD2   . ASP B 1 35  ? 8.635  -3.072  10.194  1.00 16.78 ? 35   ASP B OD2   1 
ATOM   1680 N  N     . PRO B 1 36  ? 11.602 -2.376  10.422  1.00 13.63 ? 36   PRO B N     1 
ATOM   1681 C  CA    . PRO B 1 36  ? 12.614 -3.367  10.678  1.00 13.94 ? 36   PRO B CA    1 
ATOM   1682 C  C     . PRO B 1 36  ? 12.158 -4.846  10.460  1.00 15.10 ? 36   PRO B C     1 
ATOM   1683 O  O     . PRO B 1 36  ? 12.907 -5.693  9.965   1.00 14.43 ? 36   PRO B O     1 
ATOM   1684 C  CB    . PRO B 1 36  ? 13.058 -3.033  12.109  1.00 14.81 ? 36   PRO B CB    1 
ATOM   1685 C  CG    . PRO B 1 36  ? 11.963 -2.305  12.678  1.00 13.27 ? 36   PRO B CG    1 
ATOM   1686 C  CD    . PRO B 1 36  ? 11.448 -1.484  11.557  1.00 14.71 ? 36   PRO B CD    1 
ATOM   1687 N  N     . ALA B 1 37  ? 10.890 -5.111  10.721  1.00 14.36 ? 37   ALA B N     1 
ATOM   1688 C  CA    . ALA B 1 37  ? 10.353 -6.467  10.576  1.00 14.69 ? 37   ALA B CA    1 
ATOM   1689 C  C     . ALA B 1 37  ? 10.151 -6.841  9.104   1.00 14.17 ? 37   ALA B C     1 
ATOM   1690 O  O     . ALA B 1 37  ? 10.413 -7.981  8.758   1.00 14.79 ? 37   ALA B O     1 
ATOM   1691 C  CB    . ALA B 1 37  ? 9.103  -6.578  11.326  1.00 15.04 ? 37   ALA B CB    1 
ATOM   1692 N  N     . SER B 1 38  ? 9.820  -5.860  8.258   1.00 14.56 ? 38   SER B N     1 
ATOM   1693 C  CA    . SER B 1 38  ? 9.691  -6.030  6.813   1.00 14.26 ? 38   SER B CA    1 
ATOM   1694 C  C     . SER B 1 38  ? 11.045 -6.349  6.186   1.00 14.43 ? 38   SER B C     1 
ATOM   1695 O  O     . SER B 1 38  ? 11.146 -7.295  5.392   1.00 13.72 ? 38   SER B O     1 
ATOM   1696 C  CB    . SER B 1 38  ? 9.156  -4.755  6.143   1.00 14.19 ? 38   SER B CB    1 
ATOM   1697 O  OG    . SER B 1 38  ? 8.714  -5.015  4.818   1.00 16.81 ? 38   SER B OG    1 
ATOM   1698 N  N     . PHE B 1 39  ? 12.054 -5.565  6.553   1.00 13.16 ? 39   PHE B N     1 
ATOM   1699 C  CA    . PHE B 1 39  ? 13.418 -5.790  6.023   1.00 12.63 ? 39   PHE B CA    1 
ATOM   1700 C  C     . PHE B 1 39  ? 13.977 -7.184  6.445   1.00 12.26 ? 39   PHE B C     1 
ATOM   1701 O  O     . PHE B 1 39  ? 14.496 -7.894  5.636   1.00 11.96 ? 39   PHE B O     1 
ATOM   1702 C  CB    . PHE B 1 39  ? 14.356 -4.681  6.481   1.00 14.12 ? 39   PHE B CB    1 
ATOM   1703 C  CG    . PHE B 1 39  ? 15.715 -4.803  5.937   1.00 12.62 ? 39   PHE B CG    1 
ATOM   1704 C  CD1   . PHE B 1 39  ? 15.988 -4.469  4.592   1.00 11.66 ? 39   PHE B CD1   1 
ATOM   1705 C  CD2   . PHE B 1 39  ? 16.739 -5.279  6.728   1.00 17.17 ? 39   PHE B CD2   1 
ATOM   1706 C  CE1   . PHE B 1 39  ? 17.224 -4.605  4.111   1.00 17.02 ? 39   PHE B CE1   1 
ATOM   1707 C  CE2   . PHE B 1 39  ? 17.993 -5.436  6.218   1.00 13.81 ? 39   PHE B CE2   1 
ATOM   1708 C  CZ    . PHE B 1 39  ? 18.233 -5.077  4.915   1.00 16.75 ? 39   PHE B CZ    1 
ATOM   1709 N  N     . ARG B 1 40  ? 13.841 -7.536  7.724   1.00 13.35 ? 40   ARG B N     1 
ATOM   1710 C  CA    . ARG B 1 40  ? 14.257 -8.829  8.266   1.00 14.63 ? 40   ARG B CA    1 
ATOM   1711 C  C     . ARG B 1 40  ? 13.551 -9.974  7.485   1.00 15.04 ? 40   ARG B C     1 
ATOM   1712 O  O     . ARG B 1 40  ? 14.206 -10.924 7.032   1.00 15.29 ? 40   ARG B O     1 
ATOM   1713 C  CB    . ARG B 1 40  ? 13.996 -8.902  9.773   1.00 14.47 ? 40   ARG B CB    1 
ATOM   1714 C  CG    . ARG B 1 40  ? 14.462 -10.185 10.431  1.00 18.55 ? 40   ARG B CG    1 
ATOM   1715 C  CD    . ARG B 1 40  ? 14.506 -10.208 12.012  1.00 21.01 ? 40   ARG B CD    1 
ATOM   1716 N  N     . ALA B 1 41  ? 12.246 -9.794  7.242   1.00 14.28 ? 41   ALA B N     1 
ATOM   1717 C  CA    . ALA B 1 41  ? 11.449 -10.741 6.427   1.00 14.37 ? 41   ALA B CA    1 
ATOM   1718 C  C     . ALA B 1 41  ? 11.964 -10.934 5.009   1.00 13.98 ? 41   ALA B C     1 
ATOM   1719 O  O     . ALA B 1 41  ? 12.170 -12.064 4.588   1.00 15.03 ? 41   ALA B O     1 
ATOM   1720 C  CB    . ALA B 1 41  ? 10.025 -10.326 6.404   1.00 14.28 ? 41   ALA B CB    1 
ATOM   1721 N  N     . ALA B 1 42  ? 12.232 -9.835  4.306   1.00 13.07 ? 42   ALA B N     1 
ATOM   1722 C  CA    . ALA B 1 42  ? 12.817 -9.843  2.949   1.00 14.01 ? 42   ALA B CA    1 
ATOM   1723 C  C     . ALA B 1 42  ? 14.143 -10.581 2.859   1.00 14.22 ? 42   ALA B C     1 
ATOM   1724 O  O     . ALA B 1 42  ? 14.322 -11.426 1.986   1.00 12.70 ? 42   ALA B O     1 
ATOM   1725 C  CB    . ALA B 1 42  ? 12.945 -8.410  2.396   1.00 14.70 ? 42   ALA B CB    1 
ATOM   1726 N  N     . ILE B 1 43  ? 15.079 -10.251 3.771   1.00 14.43 ? 43   ILE B N     1 
ATOM   1727 C  CA    . ILE B 1 43  ? 16.395 -10.888 3.803   1.00 13.77 ? 43   ILE B CA    1 
ATOM   1728 C  C     . ILE B 1 43  ? 16.220 -12.364 4.141   1.00 13.70 ? 43   ILE B C     1 
ATOM   1729 O  O     . ILE B 1 43  ? 16.894 -13.212 3.594   1.00 15.94 ? 43   ILE B O     1 
ATOM   1730 C  CB    . ILE B 1 43  ? 17.333 -10.234 4.846   1.00 13.52 ? 43   ILE B CB    1 
ATOM   1731 C  CG1   . ILE B 1 43  ? 17.517 -8.740  4.522   1.00 14.16 ? 43   ILE B CG1   1 
ATOM   1732 C  CG2   . ILE B 1 43  ? 18.661 -11.005 5.037   1.00 15.21 ? 43   ILE B CG2   1 
ATOM   1733 C  CD1   . ILE B 1 43  ? 18.249 -8.442  3.276   1.00 15.51 ? 43   ILE B CD1   1 
ATOM   1734 N  N     . GLY B 1 44  ? 15.312 -12.667 5.063   1.00 14.57 ? 44   GLY B N     1 
ATOM   1735 C  CA    . GLY B 1 44  ? 15.069 -14.067 5.464   1.00 14.15 ? 44   GLY B CA    1 
ATOM   1736 C  C     . GLY B 1 44  ? 14.544 -14.914 4.308   1.00 13.67 ? 44   GLY B C     1 
ATOM   1737 O  O     . GLY B 1 44  ? 14.989 -16.032 4.084   1.00 14.47 ? 44   GLY B O     1 
ATOM   1738 N  N     . LEU B 1 45  ? 13.550 -14.395 3.597   1.00 12.67 ? 45   LEU B N     1 
ATOM   1739 C  CA    . LEU B 1 45  ? 12.989 -15.107 2.482   1.00 12.48 ? 45   LEU B CA    1 
ATOM   1740 C  C     . LEU B 1 45  ? 14.009 -15.287 1.392   1.00 12.12 ? 45   LEU B C     1 
ATOM   1741 O  O     . LEU B 1 45  ? 14.065 -16.333 0.765   1.00 13.80 ? 45   LEU B O     1 
ATOM   1742 C  CB    . LEU B 1 45  ? 11.792 -14.363 1.927   1.00 12.63 ? 45   LEU B CB    1 
ATOM   1743 C  CG    . LEU B 1 45  ? 10.578 -14.339 2.862   1.00 11.52 ? 45   LEU B CG    1 
ATOM   1744 C  CD1   . LEU B 1 45  ? 9.667  -13.173 2.439   1.00 18.19 ? 45   LEU B CD1   1 
ATOM   1745 C  CD2   . LEU B 1 45  ? 9.894  -15.612 2.858   1.00 15.76 ? 45   LEU B CD2   1 
ATOM   1746 N  N     . LEU B 1 46  ? 14.800 -14.266 1.123   1.00 13.45 ? 46   LEU B N     1 
ATOM   1747 C  CA    . LEU B 1 46  ? 15.852 -14.434 0.081   1.00 12.60 ? 46   LEU B CA    1 
ATOM   1748 C  C     . LEU B 1 46  ? 16.872 -15.481 0.496   1.00 13.53 ? 46   LEU B C     1 
ATOM   1749 O  O     . LEU B 1 46  ? 17.267 -16.355 -0.285  1.00 13.63 ? 46   LEU B O     1 
ATOM   1750 C  CB    . LEU B 1 46  ? 16.580 -13.106 -0.211  1.00 13.64 ? 46   LEU B CB    1 
ATOM   1751 C  CG    . LEU B 1 46  ? 15.677 -12.219 -1.028  1.00 15.21 ? 46   LEU B CG    1 
ATOM   1752 C  CD1   . LEU B 1 46  ? 16.237 -10.769 -0.911  1.00 18.02 ? 46   LEU B CD1   1 
ATOM   1753 C  CD2   . LEU B 1 46  ? 15.552 -12.721 -2.457  1.00 15.72 ? 46   LEU B CD2   1 
ATOM   1754 N  N     . ALA B 1 47  ? 17.295 -15.403 1.748   1.00 14.28 ? 47   ALA B N     1 
ATOM   1755 C  CA    . ALA B 1 47  ? 18.333 -16.297 2.246   1.00 13.51 ? 47   ALA B CA    1 
ATOM   1756 C  C     . ALA B 1 47  ? 17.894 -17.739 2.240   1.00 14.42 ? 47   ALA B C     1 
ATOM   1757 O  O     . ALA B 1 47  ? 18.669 -18.627 1.894   1.00 13.64 ? 47   ALA B O     1 
ATOM   1758 C  CB    . ALA B 1 47  ? 18.771 -15.887 3.637   1.00 14.34 ? 47   ALA B CB    1 
ATOM   1759 N  N     . ARG B 1 48  ? 16.641 -17.970 2.654   1.00 14.79 ? 48   ARG B N     1 
ATOM   1760 C  CA    . ARG B 1 48  ? 16.082 -19.323 2.697   1.00 15.17 ? 48   ARG B CA    1 
ATOM   1761 C  C     . ARG B 1 48  ? 15.973 -19.877 1.258   1.00 14.47 ? 48   ARG B C     1 
ATOM   1762 O  O     . ARG B 1 48  ? 16.342 -21.024 0.987   1.00 15.68 ? 48   ARG B O     1 
ATOM   1763 C  CB    . ARG B 1 48  ? 14.733 -19.308 3.445   1.00 17.40 ? 48   ARG B CB    1 
ATOM   1764 C  CG    . ARG B 1 48  ? 14.348 -20.632 4.085   1.00 22.71 ? 48   ARG B CG    1 
ATOM   1765 C  CD    . ARG B 1 48  ? 12.983 -20.669 4.959   1.00 26.69 ? 48   ARG B CD    1 
ATOM   1766 N  NE    . ARG B 1 48  ? 12.914 -19.625 5.977   1.00 31.65 ? 48   ARG B NE    1 
ATOM   1767 C  CZ    . ARG B 1 48  ? 12.395 -18.419 5.752   1.00 35.93 ? 48   ARG B CZ    1 
ATOM   1768 N  NH1   . ARG B 1 48  ? 11.865 -18.132 4.570   1.00 37.25 ? 48   ARG B NH1   1 
ATOM   1769 N  NH2   . ARG B 1 48  ? 12.392 -17.488 6.702   1.00 40.27 ? 48   ARG B NH2   1 
ATOM   1770 N  N     . HIS B 1 49  ? 15.476 -19.064 0.324   1.00 12.59 ? 49   HIS B N     1 
ATOM   1771 C  CA    . HIS B 1 49  ? 15.447 -19.482 -1.047  1.00 12.27 ? 49   HIS B CA    1 
ATOM   1772 C  C     . HIS B 1 49  ? 16.832 -19.896 -1.520  1.00 12.48 ? 49   HIS B C     1 
ATOM   1773 O  O     . HIS B 1 49  ? 17.002 -20.945 -2.140  1.00 12.47 ? 49   HIS B O     1 
ATOM   1774 C  CB    . HIS B 1 49  ? 14.966 -18.350 -1.960  1.00 13.36 ? 49   HIS B CB    1 
ATOM   1775 C  CG    . HIS B 1 49  ? 15.109 -18.687 -3.398  1.00 12.99 ? 49   HIS B CG    1 
ATOM   1776 N  ND1   . HIS B 1 49  ? 14.356 -19.664 -3.999  1.00 14.05 ? 49   HIS B ND1   1 
ATOM   1777 C  CD2   . HIS B 1 49  ? 15.960 -18.223 -4.346  1.00 14.79 ? 49   HIS B CD2   1 
ATOM   1778 C  CE1   . HIS B 1 49  ? 14.708 -19.759 -5.266  1.00 15.59 ? 49   HIS B CE1   1 
ATOM   1779 N  NE2   . HIS B 1 49  ? 15.692 -18.901 -5.498  1.00 16.68 ? 49   HIS B NE2   1 
ATOM   1780 N  N     . LEU B 1 50  ? 17.813 -19.043 -1.280  1.00 13.31 ? 50   LEU B N     1 
ATOM   1781 C  CA    . LEU B 1 50  ? 19.169 -19.292 -1.821  1.00 12.55 ? 50   LEU B CA    1 
ATOM   1782 C  C     . LEU B 1 50  ? 19.904 -20.516 -1.268  1.00 12.91 ? 50   LEU B C     1 
ATOM   1783 O  O     . LEU B 1 50  ? 20.551 -21.270 -2.013  1.00 13.38 ? 50   LEU B O     1 
ATOM   1784 C  CB    . LEU B 1 50  ? 20.023 -18.023 -1.662  1.00 11.97 ? 50   LEU B CB    1 
ATOM   1785 C  CG    . LEU B 1 50  ? 19.635 -16.860 -2.544  1.00 12.90 ? 50   LEU B CG    1 
ATOM   1786 C  CD1   . LEU B 1 50  ? 20.556 -15.679 -2.184  1.00 15.77 ? 50   LEU B CD1   1 
ATOM   1787 C  CD2   . LEU B 1 50  ? 19.800 -17.298 -3.992  1.00 11.68 ? 50   LEU B CD2   1 
ATOM   1788 N  N     . LYS B 1 51  ? 19.806 -20.732 0.035   1.00 12.49 ? 51   LYS B N     1 
ATOM   1789 C  CA    . LYS B 1 51  ? 20.374 -21.928 0.653   1.00 12.80 ? 51   LYS B CA    1 
ATOM   1790 C  C     . LYS B 1 51  ? 19.646 -23.181 0.200   1.00 11.37 ? 51   LYS B C     1 
ATOM   1791 O  O     . LYS B 1 51  ? 20.271 -24.193 -0.058  1.00 9.98  ? 51   LYS B O     1 
ATOM   1792 C  CB    . LYS B 1 51  ? 20.279 -21.840 2.150   1.00 14.00 ? 51   LYS B CB    1 
ATOM   1793 C  CG    . LYS B 1 51  ? 21.050 -20.721 2.771   1.00 19.43 ? 51   LYS B CG    1 
ATOM   1794 C  CD    . LYS B 1 51  ? 21.126 -20.899 4.311   1.00 21.36 ? 51   LYS B CD    1 
ATOM   1795 C  CE    . LYS B 1 51  ? 20.107 -20.075 5.040   1.00 24.75 ? 51   LYS B CE    1 
ATOM   1796 N  NZ    . LYS B 1 51  ? 20.405 -20.116 6.473   1.00 29.08 ? 51   LYS B NZ    1 
ATOM   1797 N  N     . ALA B 1 52  ? 18.329 -23.096 0.039   1.00 11.22 ? 52   ALA B N     1 
ATOM   1798 C  CA    . ALA B 1 52  ? 17.560 -24.251 -0.419  1.00 11.37 ? 52   ALA B CA    1 
ATOM   1799 C  C     . ALA B 1 52  ? 17.881 -24.644 -1.853  1.00 11.41 ? 52   ALA B C     1 
ATOM   1800 O  O     . ALA B 1 52  ? 17.844 -25.828 -2.221  1.00 12.38 ? 52   ALA B O     1 
ATOM   1801 C  CB    . ALA B 1 52  ? 16.031 -24.029 -0.299  1.00 10.28 ? 52   ALA B CB    1 
ATOM   1802 N  N     . THR B 1 53  ? 18.135 -23.649 -2.666  1.00 13.97 ? 53   THR B N     1 
ATOM   1803 C  CA    . THR B 1 53  ? 18.386 -23.835 -4.093  1.00 14.84 ? 53   THR B CA    1 
ATOM   1804 C  C     . THR B 1 53  ? 19.855 -24.184 -4.420  1.00 13.39 ? 53   THR B C     1 
ATOM   1805 O  O     . THR B 1 53  ? 20.136 -24.954 -5.318  1.00 13.26 ? 53   THR B O     1 
ATOM   1806 C  CB    . THR B 1 53  ? 17.958 -22.560 -4.790  1.00 15.63 ? 53   THR B CB    1 
ATOM   1807 O  OG1   . THR B 1 53  ? 16.583 -22.311 -4.480  1.00 19.22 ? 53   THR B OG1   1 
ATOM   1808 C  CG2   . THR B 1 53  ? 18.138 -22.690 -6.249  1.00 18.75 ? 53   THR B CG2   1 
ATOM   1809 N  N     . HIS B 1 54  ? 20.798 -23.614 -3.668  1.00 13.90 ? 54   HIS B N     1 
ATOM   1810 C  CA    . HIS B 1 54  ? 22.239 -23.761 -3.938  1.00 12.06 ? 54   HIS B CA    1 
ATOM   1811 C  C     . HIS B 1 54  ? 23.100 -24.405 -2.850  1.00 12.73 ? 54   HIS B C     1 
ATOM   1812 O  O     . HIS B 1 54  ? 24.297 -24.686 -3.089  1.00 11.29 ? 54   HIS B O     1 
ATOM   1813 C  CB    . HIS B 1 54  ? 22.820 -22.381 -4.283  1.00 12.18 ? 54   HIS B CB    1 
ATOM   1814 C  CG    . HIS B 1 54  ? 22.132 -21.735 -5.428  1.00 14.13 ? 54   HIS B CG    1 
ATOM   1815 N  ND1   . HIS B 1 54  ? 22.296 -22.167 -6.732  1.00 18.43 ? 54   HIS B ND1   1 
ATOM   1816 C  CD2   . HIS B 1 54  ? 21.286 -20.675 -5.474  1.00 17.91 ? 54   HIS B CD2   1 
ATOM   1817 C  CE1   . HIS B 1 54  ? 21.538 -21.421 -7.524  1.00 18.12 ? 54   HIS B CE1   1 
ATOM   1818 N  NE2   . HIS B 1 54  ? 20.910 -20.516 -6.785  1.00 19.21 ? 54   HIS B NE2   1 
ATOM   1819 N  N     . GLY B 1 55  ? 22.494 -24.674 -1.691  1.00 12.13 ? 55   GLY B N     1 
ATOM   1820 C  CA    . GLY B 1 55  ? 23.180 -25.216 -0.521  1.00 12.41 ? 55   GLY B CA    1 
ATOM   1821 C  C     . GLY B 1 55  ? 24.467 -24.462 -0.228  1.00 12.72 ? 55   GLY B C     1 
ATOM   1822 O  O     . GLY B 1 55  ? 24.425 -23.270 -0.065  1.00 14.48 ? 55   GLY B O     1 
ATOM   1823 N  N     . GLY B 1 56  ? 25.611 -25.158 -0.206  1.00 13.10 ? 56   GLY B N     1 
ATOM   1824 C  CA    . GLY B 1 56  ? 26.909 -24.547 0.036   1.00 13.35 ? 56   GLY B CA    1 
ATOM   1825 C  C     . GLY B 1 56  ? 27.646 -24.028 -1.183  1.00 13.13 ? 56   GLY B C     1 
ATOM   1826 O  O     . GLY B 1 56  ? 28.816 -23.583 -1.062  1.00 12.97 ? 56   GLY B O     1 
ATOM   1827 N  N     . ARG B 1 57  ? 27.006 -24.067 -2.362  1.00 13.60 ? 57   ARG B N     1 
ATOM   1828 C  CA    . ARG B 1 57  ? 27.674 -23.579 -3.627  1.00 13.83 ? 57   ARG B CA    1 
ATOM   1829 C  C     . ARG B 1 57  ? 28.047 -22.084 -3.664  1.00 13.66 ? 57   ARG B C     1 
ATOM   1830 O  O     . ARG B 1 57  ? 28.990 -21.710 -4.361  1.00 13.37 ? 57   ARG B O     1 
ATOM   1831 C  CB    A ARG B 1 57  ? 26.854 -23.955 -4.850  0.65 14.95 ? 57   ARG B CB    1 
ATOM   1832 C  CB    B ARG B 1 57  ? 26.860 -23.945 -4.879  0.35 14.59 ? 57   ARG B CB    1 
ATOM   1833 C  CG    A ARG B 1 57  ? 26.887 -25.407 -5.124  0.65 16.34 ? 57   ARG B CG    1 
ATOM   1834 C  CG    B ARG B 1 57  ? 27.427 -25.087 -5.711  0.35 15.97 ? 57   ARG B CG    1 
ATOM   1835 C  CD    A ARG B 1 57  ? 26.024 -25.836 -6.306  0.65 19.34 ? 57   ARG B CD    1 
ATOM   1836 C  CD    B ARG B 1 57  ? 27.002 -26.440 -5.183  0.35 18.06 ? 57   ARG B CD    1 
ATOM   1837 N  NE    A ARG B 1 57  ? 26.284 -25.127 -7.558  0.65 25.03 ? 57   ARG B NE    1 
ATOM   1838 N  NE    B ARG B 1 57  ? 27.535 -27.531 -5.990  0.35 19.35 ? 57   ARG B NE    1 
ATOM   1839 C  CZ    A ARG B 1 57  ? 27.112 -25.512 -8.539  0.65 27.28 ? 57   ARG B CZ    1 
ATOM   1840 C  CZ    B ARG B 1 57  ? 27.597 -28.812 -5.613  0.35 18.03 ? 57   ARG B CZ    1 
ATOM   1841 N  NH1   A ARG B 1 57  ? 27.209 -24.756 -9.625  0.65 28.38 ? 57   ARG B NH1   1 
ATOM   1842 N  NH1   B ARG B 1 57  ? 28.107 -29.704 -6.440  0.35 18.74 ? 57   ARG B NH1   1 
ATOM   1843 N  NH2   A ARG B 1 57  ? 27.823 -26.636 -8.471  0.65 28.93 ? 57   ARG B NH2   1 
ATOM   1844 N  NH2   B ARG B 1 57  ? 27.159 -29.208 -4.416  0.35 18.06 ? 57   ARG B NH2   1 
ATOM   1845 N  N     . ILE B 1 58  ? 27.286 -21.233 -2.971  1.00 12.44 ? 58   ILE B N     1 
ATOM   1846 C  CA    . ILE B 1 58  ? 27.452 -19.797 -3.023  1.00 13.43 ? 58   ILE B CA    1 
ATOM   1847 C  C     . ILE B 1 58  ? 28.729 -19.370 -2.283  1.00 12.37 ? 58   ILE B C     1 
ATOM   1848 O  O     . ILE B 1 58  ? 28.968 -19.757 -1.117  1.00 12.79 ? 58   ILE B O     1 
ATOM   1849 C  CB    . ILE B 1 58  ? 26.211 -18.999 -2.487  1.00 13.82 ? 58   ILE B CB    1 
ATOM   1850 C  CG1   . ILE B 1 58  ? 24.854 -19.480 -3.035  1.00 15.64 ? 58   ILE B CG1   1 
ATOM   1851 C  CG2   . ILE B 1 58  ? 26.352 -17.582 -2.849  1.00 16.69 ? 58   ILE B CG2   1 
ATOM   1852 C  CD1   . ILE B 1 58  ? 23.678 -18.903 -2.194  1.00 16.16 ? 58   ILE B CD1   1 
ATOM   1853 N  N     . ASP B 1 59  ? 29.595 -18.603 -2.968  1.00 11.10 ? 59   ASP B N     1 
ATOM   1854 C  CA    . ASP B 1 59  ? 30.798 -18.101 -2.355  1.00 11.81 ? 59   ASP B CA    1 
ATOM   1855 C  C     . ASP B 1 59  ? 30.634 -16.626 -1.890  1.00 12.70 ? 59   ASP B C     1 
ATOM   1856 O  O     . ASP B 1 59  ? 31.052 -16.280 -0.758  1.00 12.05 ? 59   ASP B O     1 
ATOM   1857 C  CB    . ASP B 1 59  ? 32.010 -18.205 -3.287  1.00 10.90 ? 59   ASP B CB    1 
ATOM   1858 C  CG    . ASP B 1 59  ? 32.391 -19.658 -3.601  1.00 11.31 ? 59   ASP B CG    1 
ATOM   1859 O  OD1   . ASP B 1 59  ? 32.420 -20.494 -2.666  1.00 15.47 ? 59   ASP B OD1   1 
ATOM   1860 O  OD2   . ASP B 1 59  ? 32.669 -19.943 -4.800  1.00 12.01 ? 59   ASP B OD2   1 
ATOM   1861 N  N     . TYR B 1 60  ? 29.986 -15.812 -2.748  1.00 12.84 ? 60   TYR B N     1 
ATOM   1862 C  CA    . TYR B 1 60  ? 29.716 -14.419 -2.466  1.00 13.33 ? 60   TYR B CA    1 
ATOM   1863 C  C     . TYR B 1 60  ? 28.397 -13.959 -3.011  1.00 13.31 ? 60   TYR B C     1 
ATOM   1864 O  O     . TYR B 1 60  ? 27.911 -14.446 -4.011  1.00 12.81 ? 60   TYR B O     1 
ATOM   1865 C  CB    . TYR B 1 60  ? 30.817 -13.510 -3.068  1.00 12.79 ? 60   TYR B CB    1 
ATOM   1866 C  CG    . TYR B 1 60  ? 32.176 -13.741 -2.466  1.00 13.71 ? 60   TYR B CG    1 
ATOM   1867 C  CD1   . TYR B 1 60  ? 33.097 -14.594 -3.074  1.00 14.84 ? 60   TYR B CD1   1 
ATOM   1868 C  CD2   . TYR B 1 60  ? 32.531 -13.130 -1.301  1.00 15.35 ? 60   TYR B CD2   1 
ATOM   1869 C  CE1   . TYR B 1 60  ? 34.292 -14.809 -2.526  1.00 17.79 ? 60   TYR B CE1   1 
ATOM   1870 C  CE2   . TYR B 1 60  ? 33.763 -13.353 -0.723  1.00 18.88 ? 60   TYR B CE2   1 
ATOM   1871 C  CZ    . TYR B 1 60  ? 34.639 -14.219 -1.334  1.00 16.05 ? 60   TYR B CZ    1 
ATOM   1872 O  OH    . TYR B 1 60  ? 35.878 -14.454 -0.722  1.00 19.91 ? 60   TYR B OH    1 
ATOM   1873 N  N     . ILE B 1 61  ? 27.834 -12.959 -2.324  1.00 13.41 ? 61   ILE B N     1 
ATOM   1874 C  CA    . ILE B 1 61  ? 26.749 -12.162 -2.888  1.00 14.37 ? 61   ILE B CA    1 
ATOM   1875 C  C     . ILE B 1 61  ? 27.385 -10.966 -3.589  1.00 13.29 ? 61   ILE B C     1 
ATOM   1876 O  O     . ILE B 1 61  ? 28.422 -10.443 -3.130  1.00 13.56 ? 61   ILE B O     1 
ATOM   1877 C  CB    . ILE B 1 61  ? 25.794 -11.692 -1.779  1.00 14.85 ? 61   ILE B CB    1 
ATOM   1878 C  CG1   . ILE B 1 61  ? 25.198 -12.899 -1.100  1.00 15.89 ? 61   ILE B CG1   1 
ATOM   1879 C  CG2   . ILE B 1 61  ? 24.721 -10.753 -2.324  1.00 15.40 ? 61   ILE B CG2   1 
ATOM   1880 C  CD1   . ILE B 1 61  ? 24.479 -13.813 -2.035  1.00 16.74 ? 61   ILE B CD1   1 
ATOM   1881 N  N     . ALA B 1 62  ? 26.832 -10.608 -4.736  1.00 13.91 ? 62   ALA B N     1 
ATOM   1882 C  CA    . ALA B 1 62  ? 27.170 -9.426  -5.490  1.00 14.78 ? 62   ALA B CA    1 
ATOM   1883 C  C     . ALA B 1 62  ? 25.994 -8.469  -5.461  1.00 15.89 ? 62   ALA B C     1 
ATOM   1884 O  O     . ALA B 1 62  ? 24.891 -8.821  -5.871  1.00 17.58 ? 62   ALA B O     1 
ATOM   1885 C  CB    . ALA B 1 62  ? 27.528 -9.771  -6.915  1.00 15.02 ? 62   ALA B CB    1 
ATOM   1886 N  N     . GLY B 1 63  ? 26.220 -7.288  -4.911  1.00 15.31 ? 63   GLY B N     1 
ATOM   1887 C  CA    . GLY B 1 63  ? 25.189 -6.263  -4.835  1.00 16.07 ? 63   GLY B CA    1 
ATOM   1888 C  C     . GLY B 1 63  ? 25.339 -5.224  -5.924  1.00 17.25 ? 63   GLY B C     1 
ATOM   1889 O  O     . GLY B 1 63  ? 26.422 -4.740  -6.169  1.00 18.33 ? 63   GLY B O     1 
ATOM   1890 N  N     . LEU B 1 64  ? 24.218 -4.865  -6.536  1.00 18.26 ? 64   LEU B N     1 
ATOM   1891 C  CA    . LEU B 1 64  ? 24.143 -3.841  -7.565  1.00 19.11 ? 64   LEU B CA    1 
ATOM   1892 C  C     . LEU B 1 64  ? 23.886 -2.415  -7.027  1.00 20.62 ? 64   LEU B C     1 
ATOM   1893 O  O     . LEU B 1 64  ? 22.958 -2.116  -6.217  1.00 19.10 ? 64   LEU B O     1 
ATOM   1894 C  CB    . LEU B 1 64  ? 23.061 -4.160  -8.603  1.00 20.76 ? 64   LEU B CB    1 
ATOM   1895 C  CG    . LEU B 1 64  ? 23.204 -5.456  -9.407  1.00 21.43 ? 64   LEU B CG    1 
ATOM   1896 C  CD1   . LEU B 1 64  ? 22.323 -5.424  -10.634 1.00 18.83 ? 64   LEU B CD1   1 
ATOM   1897 C  CD2   . LEU B 1 64  ? 24.648 -5.759  -9.801  1.00 28.31 ? 64   LEU B CD2   1 
ATOM   1898 N  N     . ASP B 1 65  ? 24.718 -1.526  -7.525  1.00 19.12 ? 65   ASP B N     1 
ATOM   1899 C  CA    . ASP B 1 65  ? 24.663 -0.101  -7.202  1.00 20.88 ? 65   ASP B CA    1 
ATOM   1900 C  C     . ASP B 1 65  ? 23.379 0.475   -7.742  1.00 21.61 ? 65   ASP B C     1 
ATOM   1901 O  O     . ASP B 1 65  ? 23.095 0.216   -8.903  1.00 22.78 ? 65   ASP B O     1 
ATOM   1902 C  CB    . ASP B 1 65  ? 25.885 0.525   -7.889  1.00 20.86 ? 65   ASP B CB    1 
ATOM   1903 C  CG    . ASP B 1 65  ? 26.159 2.000   -7.513  1.00 23.45 ? 65   ASP B CG    1 
ATOM   1904 O  OD1   . ASP B 1 65  ? 27.211 2.476   -7.931  1.00 22.17 ? 65   ASP B OD1   1 
ATOM   1905 O  OD2   . ASP B 1 65  ? 25.385 2.659   -6.804  1.00 29.31 ? 65   ASP B OD2   1 
ATOM   1906 N  N     . SER B 1 66  ? 22.580 1.236   -6.966  1.00 21.21 ? 66   SER B N     1 
ATOM   1907 C  CA    . SER B 1 66  ? 22.793 1.500   -5.573  1.00 21.76 ? 66   SER B CA    1 
ATOM   1908 C  C     . SER B 1 66  ? 21.767 0.827   -4.706  1.00 19.83 ? 66   SER B C     1 
ATOM   1909 O  O     . SER B 1 66  ? 22.042 0.561   -3.548  1.00 18.65 ? 66   SER B O     1 
ATOM   1910 C  CB    . SER B 1 66  ? 22.836 3.023   -5.274  1.00 24.32 ? 66   SER B CB    1 
ATOM   1911 O  OG    . SER B 1 66  ? 21.528 3.559   -5.335  1.00 30.89 ? 66   SER B OG    1 
ATOM   1912 N  N     . ARG B 1 67  ? 20.577 0.516   -5.228  1.00 17.45 ? 67   ARG B N     1 
ATOM   1913 C  CA    . ARG B 1 67  ? 19.572 -0.094  -4.358  1.00 17.72 ? 67   ARG B CA    1 
ATOM   1914 C  C     . ARG B 1 67  ? 19.866 -1.571  -3.976  1.00 16.95 ? 67   ARG B C     1 
ATOM   1915 O  O     . ARG B 1 67  ? 19.400 -2.030  -2.955  1.00 16.58 ? 67   ARG B O     1 
ATOM   1916 C  CB    . ARG B 1 67  ? 18.143 0.086   -4.928  1.00 18.74 ? 67   ARG B CB    1 
ATOM   1917 C  CG    . ARG B 1 67  ? 17.564 1.515   -4.809  1.00 21.13 ? 67   ARG B CG    1 
ATOM   1918 C  CD    . ARG B 1 67  ? 16.144 1.624   -5.434  1.00 26.29 ? 67   ARG B CD    1 
ATOM   1919 N  NE    . ARG B 1 67  ? 16.079 2.816   -6.286  1.00 31.82 ? 67   ARG B NE    1 
ATOM   1920 C  CZ    . ARG B 1 67  ? 15.640 2.911   -7.539  1.00 33.31 ? 67   ARG B CZ    1 
ATOM   1921 N  NH1   . ARG B 1 67  ? 15.147 1.880   -8.195  1.00 34.88 ? 67   ARG B NH1   1 
ATOM   1922 N  NH2   . ARG B 1 67  ? 15.705 4.082   -8.131  1.00 36.27 ? 67   ARG B NH2   1 
ATOM   1923 N  N     . GLY B 1 68  ? 20.634 -2.318  -4.776  1.00 15.85 ? 68   GLY B N     1 
ATOM   1924 C  CA    . GLY B 1 68  ? 21.069 -3.638  -4.352  1.00 15.71 ? 68   GLY B CA    1 
ATOM   1925 C  C     . GLY B 1 68  ? 22.065 -3.563  -3.212  1.00 15.10 ? 68   GLY B C     1 
ATOM   1926 O  O     . GLY B 1 68  ? 22.232 -4.513  -2.479  1.00 13.88 ? 68   GLY B O     1 
ATOM   1927 N  N     . PHE B 1 69  ? 22.733 -2.411  -3.055  1.00 14.38 ? 69   PHE B N     1 
ATOM   1928 C  CA    . PHE B 1 69  ? 23.600 -2.217  -1.860  1.00 15.08 ? 69   PHE B CA    1 
ATOM   1929 C  C     . PHE B 1 69  ? 22.831 -2.320  -0.556  1.00 15.57 ? 69   PHE B C     1 
ATOM   1930 O  O     . PHE B 1 69  ? 23.376 -2.582  0.483   1.00 12.23 ? 69   PHE B O     1 
ATOM   1931 C  CB    . PHE B 1 69  ? 24.314 -0.881  -1.884  1.00 15.60 ? 69   PHE B CB    1 
ATOM   1932 C  CG    . PHE B 1 69  ? 25.408 -0.762  -2.881  1.00 15.84 ? 69   PHE B CG    1 
ATOM   1933 C  CD1   . PHE B 1 69  ? 25.715 -1.749  -3.807  1.00 13.91 ? 69   PHE B CD1   1 
ATOM   1934 C  CD2   . PHE B 1 69  ? 26.133 0.430   -2.933  1.00 18.59 ? 69   PHE B CD2   1 
ATOM   1935 C  CE1   . PHE B 1 69  ? 26.773 -1.565  -4.728  1.00 16.29 ? 69   PHE B CE1   1 
ATOM   1936 C  CE2   . PHE B 1 69  ? 27.151 0.605   -3.818  1.00 18.93 ? 69   PHE B CE2   1 
ATOM   1937 C  CZ    . PHE B 1 69  ? 27.458 -0.400  -4.748  1.00 19.05 ? 69   PHE B CZ    1 
ATOM   1938 N  N     . LEU B 1 70  ? 21.546 -2.036  -0.607  1.00 14.36 ? 70   LEU B N     1 
ATOM   1939 C  CA    . LEU B 1 70  ? 20.750 -1.993  0.550   1.00 14.66 ? 70   LEU B CA    1 
ATOM   1940 C  C     . LEU B 1 70  ? 20.453 -3.367  1.045   1.00 15.67 ? 70   LEU B C     1 
ATOM   1941 O  O     . LEU B 1 70  ? 20.136 -3.521  2.214   1.00 15.50 ? 70   LEU B O     1 
ATOM   1942 C  CB    . LEU B 1 70  ? 19.412 -1.335  0.241   1.00 14.56 ? 70   LEU B CB    1 
ATOM   1943 C  CG    . LEU B 1 70  ? 19.427 0.173   0.037   1.00 15.23 ? 70   LEU B CG    1 
ATOM   1944 C  CD1   . LEU B 1 70  ? 18.143 0.676   -0.645  1.00 15.86 ? 70   LEU B CD1   1 
ATOM   1945 C  CD2   . LEU B 1 70  ? 19.676 0.901   1.334   1.00 16.72 ? 70   LEU B CD2   1 
ATOM   1946 N  N     . PHE B 1 71  ? 20.507 -4.360  0.135   1.00 15.31 ? 71   PHE B N     1 
ATOM   1947 C  CA    . PHE B 1 71  ? 20.166 -5.761  0.491   1.00 16.22 ? 71   PHE B CA    1 
ATOM   1948 C  C     . PHE B 1 71  ? 21.368 -6.730  0.482   1.00 15.60 ? 71   PHE B C     1 
ATOM   1949 O  O     . PHE B 1 71  ? 21.433 -7.663  1.227   1.00 15.86 ? 71   PHE B O     1 
ATOM   1950 C  CB    . PHE B 1 71  ? 19.061 -6.283  -0.420  1.00 16.24 ? 71   PHE B CB    1 
ATOM   1951 C  CG    . PHE B 1 71  ? 17.805 -5.462  -0.333  1.00 17.22 ? 71   PHE B CG    1 
ATOM   1952 C  CD1   . PHE B 1 71  ? 17.555 -4.443  -1.236  1.00 17.24 ? 71   PHE B CD1   1 
ATOM   1953 C  CD2   . PHE B 1 71  ? 16.886 -5.693  0.668   1.00 17.76 ? 71   PHE B CD2   1 
ATOM   1954 C  CE1   . PHE B 1 71  ? 16.419 -3.694  -1.167  1.00 17.96 ? 71   PHE B CE1   1 
ATOM   1955 C  CE2   . PHE B 1 71  ? 15.730 -4.897  0.756   1.00 17.70 ? 71   PHE B CE2   1 
ATOM   1956 C  CZ    . PHE B 1 71  ? 15.515 -3.913  -0.165  1.00 18.49 ? 71   PHE B CZ    1 
ATOM   1957 N  N     . GLY B 1 72  ? 22.341 -6.472  -0.337  1.00 16.18 ? 72   GLY B N     1 
ATOM   1958 C  CA    . GLY B 1 72  ? 23.416 -7.435  -0.497  1.00 16.48 ? 72   GLY B CA    1 
ATOM   1959 C  C     . GLY B 1 72  ? 24.162 -7.703  0.794   1.00 16.01 ? 72   GLY B C     1 
ATOM   1960 O  O     . GLY B 1 72  ? 24.418 -8.849  1.098   1.00 13.54 ? 72   GLY B O     1 
ATOM   1961 N  N     . PRO B 1 73  ? 24.647 -6.650  1.486   1.00 16.05 ? 73   PRO B N     1 
ATOM   1962 C  CA    . PRO B 1 73  ? 25.406 -6.963  2.723   1.00 16.37 ? 73   PRO B CA    1 
ATOM   1963 C  C     . PRO B 1 73  ? 24.630 -7.729  3.771   1.00 16.32 ? 73   PRO B C     1 
ATOM   1964 O  O     . PRO B 1 73  ? 25.147 -8.687  4.347   1.00 15.80 ? 73   PRO B O     1 
ATOM   1965 C  CB    . PRO B 1 73  ? 25.878 -5.597  3.206   1.00 17.28 ? 73   PRO B CB    1 
ATOM   1966 C  CG    . PRO B 1 73  ? 25.838 -4.751  2.001   1.00 16.68 ? 73   PRO B CG    1 
ATOM   1967 C  CD    . PRO B 1 73  ? 24.687 -5.206  1.178   1.00 16.49 ? 73   PRO B CD    1 
ATOM   1968 N  N     . SER B 1 74  ? 23.387 -7.342  4.024   1.00 16.03 ? 74   SER B N     1 
ATOM   1969 C  CA    . SER B 1 74  ? 22.540 -8.060  4.937   1.00 15.54 ? 74   SER B CA    1 
ATOM   1970 C  C     . SER B 1 74  ? 22.297 -9.506  4.471   1.00 14.49 ? 74   SER B C     1 
ATOM   1971 O  O     . SER B 1 74  ? 22.330 -10.390 5.286   1.00 14.12 ? 74   SER B O     1 
ATOM   1972 C  CB    . SER B 1 74  ? 21.212 -7.335  5.106   1.00 14.32 ? 74   SER B CB    1 
ATOM   1973 O  OG    . SER B 1 74  ? 21.425 -6.139  5.828   1.00 19.38 ? 74   SER B OG    1 
ATOM   1974 N  N     . LEU B 1 75  ? 22.013 -9.721  3.200   1.00 14.11 ? 75   LEU B N     1 
ATOM   1975 C  CA    . LEU B 1 75  ? 21.806 -11.065 2.678   1.00 14.20 ? 75   LEU B CA    1 
ATOM   1976 C  C     . LEU B 1 75  ? 23.072 -11.921 2.840   1.00 13.68 ? 75   LEU B C     1 
ATOM   1977 O  O     . LEU B 1 75  ? 23.048 -13.069 3.275   1.00 14.62 ? 75   LEU B O     1 
ATOM   1978 C  CB    . LEU B 1 75  ? 21.379 -10.970 1.214   1.00 14.55 ? 75   LEU B CB    1 
ATOM   1979 C  CG    . LEU B 1 75  ? 21.085 -12.275 0.453   1.00 14.34 ? 75   LEU B CG    1 
ATOM   1980 C  CD1   . LEU B 1 75  ? 20.122 -13.189 1.194   1.00 14.97 ? 75   LEU B CD1   1 
ATOM   1981 C  CD2   . LEU B 1 75  ? 20.580 -11.908 -0.942  1.00 14.40 ? 75   LEU B CD2   1 
ATOM   1982 N  N     . ALA B 1 76  ? 24.192 -11.326 2.509   1.00 14.08 ? 76   ALA B N     1 
ATOM   1983 C  CA    . ALA B 1 76  ? 25.460 -11.997 2.617   1.00 13.88 ? 76   ALA B CA    1 
ATOM   1984 C  C     . ALA B 1 76  ? 25.729 -12.371 4.060   1.00 13.90 ? 76   ALA B C     1 
ATOM   1985 O  O     . ALA B 1 76  ? 26.066 -13.522 4.332   1.00 15.07 ? 76   ALA B O     1 
ATOM   1986 C  CB    . ALA B 1 76  ? 26.545 -11.105 2.079   1.00 14.25 ? 76   ALA B CB    1 
ATOM   1987 N  N     . GLN B 1 77  ? 25.540 -11.409 4.979   1.00 15.12 ? 77   GLN B N     1 
ATOM   1988 C  CA    . GLN B 1 77  ? 25.703 -11.675 6.412   1.00 15.02 ? 77   GLN B CA    1 
ATOM   1989 C  C     . GLN B 1 77  ? 24.869 -12.819 6.902   1.00 16.23 ? 77   GLN B C     1 
ATOM   1990 O  O     . GLN B 1 77  ? 25.381 -13.696 7.658   1.00 17.86 ? 77   GLN B O     1 
ATOM   1991 C  CB    . GLN B 1 77  ? 25.467 -10.409 7.237   1.00 15.80 ? 77   GLN B CB    1 
ATOM   1992 C  CG    . GLN B 1 77  ? 26.673 -9.535  7.302   1.00 19.20 ? 77   GLN B CG    1 
ATOM   1993 C  CD    . GLN B 1 77  ? 27.789 -10.018 8.267   1.00 22.56 ? 77   GLN B CD    1 
ATOM   1994 O  OE1   . GLN B 1 77  ? 27.559 -10.208 9.456   1.00 26.12 ? 77   GLN B OE1   1 
ATOM   1995 N  NE2   . GLN B 1 77  ? 28.999 -10.151 7.749   1.00 24.31 ? 77   GLN B NE2   1 
ATOM   1996 N  N     . GLU B 1 78  ? 23.598 -12.851 6.487   1.00 15.82 ? 78   GLU B N     1 
ATOM   1997 C  CA    . GLU B 1 78  ? 22.690 -13.951 6.820   1.00 15.93 ? 78   GLU B CA    1 
ATOM   1998 C  C     . GLU B 1 78  ? 23.156 -15.325 6.357   1.00 17.03 ? 78   GLU B C     1 
ATOM   1999 O  O     . GLU B 1 78  ? 22.962 -16.302 7.081   1.00 16.81 ? 78   GLU B O     1 
ATOM   2000 C  CB    . GLU B 1 78  ? 21.256 -13.643 6.343   1.00 16.26 ? 78   GLU B CB    1 
ATOM   2001 C  CG    . GLU B 1 78  ? 20.205 -14.650 6.636   1.00 18.44 ? 78   GLU B CG    1 
ATOM   2002 C  CD    . GLU B 1 78  ? 19.961 -14.907 8.122   1.00 24.63 ? 78   GLU B CD    1 
ATOM   2003 O  OE1   . GLU B 1 78  ? 20.287 -14.024 8.963   1.00 23.49 ? 78   GLU B OE1   1 
ATOM   2004 O  OE2   . GLU B 1 78  ? 19.377 -15.982 8.423   1.00 27.73 ? 78   GLU B OE2   1 
ATOM   2005 N  N     . LEU B 1 79  ? 23.855 -15.395 5.222   1.00 16.58 ? 79   LEU B N     1 
ATOM   2006 C  CA    . LEU B 1 79  ? 24.423 -16.620 4.656   1.00 16.12 ? 79   LEU B CA    1 
ATOM   2007 C  C     . LEU B 1 79  ? 25.859 -16.938 5.121   1.00 17.27 ? 79   LEU B C     1 
ATOM   2008 O  O     . LEU B 1 79  ? 26.440 -17.971 4.741   1.00 17.30 ? 79   LEU B O     1 
ATOM   2009 C  CB    . LEU B 1 79  ? 24.358 -16.524 3.145   1.00 17.19 ? 79   LEU B CB    1 
ATOM   2010 C  CG    . LEU B 1 79  ? 22.977 -16.384 2.507   1.00 17.04 ? 79   LEU B CG    1 
ATOM   2011 C  CD1   . LEU B 1 79  ? 23.068 -15.909 1.080   1.00 17.86 ? 79   LEU B CD1   1 
ATOM   2012 C  CD2   . LEU B 1 79  ? 22.238 -17.686 2.617   1.00 15.82 ? 79   LEU B CD2   1 
ATOM   2013 N  N     . GLY B 1 80  ? 26.405 -16.069 5.979   1.00 17.78 ? 80   GLY B N     1 
ATOM   2014 C  CA    . GLY B 1 80  ? 27.778 -16.120 6.392   1.00 17.05 ? 80   GLY B CA    1 
ATOM   2015 C  C     . GLY B 1 80  ? 28.834 -15.836 5.341   1.00 16.83 ? 80   GLY B C     1 
ATOM   2016 O  O     . GLY B 1 80  ? 29.950 -16.372 5.432   1.00 17.70 ? 80   GLY B O     1 
ATOM   2017 N  N     . LEU B 1 81  ? 28.486 -15.029 4.337   1.00 15.74 ? 81   LEU B N     1 
ATOM   2018 C  CA    . LEU B 1 81  ? 29.315 -14.788 3.167   1.00 14.33 ? 81   LEU B CA    1 
ATOM   2019 C  C     . LEU B 1 81  ? 29.645 -13.329 3.111   1.00 14.65 ? 81   LEU B C     1 
ATOM   2020 O  O     . LEU B 1 81  ? 29.021 -12.495 3.790   1.00 15.02 ? 81   LEU B O     1 
ATOM   2021 C  CB    . LEU B 1 81  ? 28.550 -15.202 1.910   1.00 14.82 ? 81   LEU B CB    1 
ATOM   2022 C  CG    . LEU B 1 81  ? 27.967 -16.612 1.852   1.00 15.56 ? 81   LEU B CG    1 
ATOM   2023 C  CD1   . LEU B 1 81  ? 27.150 -16.699 0.550   1.00 16.59 ? 81   LEU B CD1   1 
ATOM   2024 C  CD2   . LEU B 1 81  ? 29.079 -17.610 1.921   1.00 16.03 ? 81   LEU B CD2   1 
ATOM   2025 N  N     . GLY B 1 82  ? 30.680 -13.033 2.339   1.00 14.31 ? 82   GLY B N     1 
ATOM   2026 C  CA    . GLY B 1 82  ? 30.988 -11.704 1.998   1.00 14.09 ? 82   GLY B CA    1 
ATOM   2027 C  C     . GLY B 1 82  ? 30.127 -11.207 0.856   1.00 13.40 ? 82   GLY B C     1 
ATOM   2028 O  O     . GLY B 1 82  ? 29.404 -11.957 0.192   1.00 13.52 ? 82   GLY B O     1 
ATOM   2029 N  N     . CYS B 1 83  ? 30.251 -9.912  0.622   1.00 14.39 ? 83   CYS B N     1 
ATOM   2030 C  CA    . CYS B 1 83  ? 29.526 -9.221  -0.438  1.00 14.41 ? 83   CYS B CA    1 
ATOM   2031 C  C     . CYS B 1 83  ? 30.531 -8.449  -1.266  1.00 15.14 ? 83   CYS B C     1 
ATOM   2032 O  O     . CYS B 1 83  ? 31.404 -7.731  -0.719  1.00 15.53 ? 83   CYS B O     1 
ATOM   2033 C  CB    . CYS B 1 83  ? 28.469 -8.263  0.167   1.00 14.40 ? 83   CYS B CB    1 
ATOM   2034 S  SG    . CYS B 1 83  ? 27.392 -7.518  -1.012  1.00 16.69 ? 83   CYS B SG    1 
ATOM   2035 N  N     . VAL B 1 84  ? 30.459 -8.667  -2.581  1.00 14.50 ? 84   VAL B N     1 
ATOM   2036 C  CA    . VAL B 1 84  ? 31.217 -7.912  -3.503  1.00 15.05 ? 84   VAL B CA    1 
ATOM   2037 C  C     . VAL B 1 84  ? 30.287 -6.921  -4.187  1.00 14.92 ? 84   VAL B C     1 
ATOM   2038 O  O     . VAL B 1 84  ? 29.095 -7.056  -4.165  1.00 14.77 ? 84   VAL B O     1 
ATOM   2039 C  CB    . VAL B 1 84  ? 31.991 -8.780  -4.579  1.00 15.66 ? 84   VAL B CB    1 
ATOM   2040 C  CG1   . VAL B 1 84  ? 32.996 -9.621  -3.879  1.00 14.26 ? 84   VAL B CG1   1 
ATOM   2041 C  CG2   . VAL B 1 84  ? 31.043 -9.617  -5.506  1.00 17.17 ? 84   VAL B CG2   1 
ATOM   2042 N  N     . LEU B 1 85  ? 30.899 -5.930  -4.793  1.00 14.03 ? 85   LEU B N     1 
ATOM   2043 C  CA    . LEU B 1 85  ? 30.200 -4.756  -5.288  1.00 15.26 ? 85   LEU B CA    1 
ATOM   2044 C  C     . LEU B 1 85  ? 30.351 -4.612  -6.777  1.00 14.98 ? 85   LEU B C     1 
ATOM   2045 O  O     . LEU B 1 85  ? 31.459 -4.771  -7.295  1.00 13.97 ? 85   LEU B O     1 
ATOM   2046 C  CB    . LEU B 1 85  ? 30.779 -3.499  -4.634  1.00 17.42 ? 85   LEU B CB    1 
ATOM   2047 C  CG    . LEU B 1 85  ? 30.614 -3.499  -3.099  1.00 20.06 ? 85   LEU B CG    1 
ATOM   2048 C  CD1   . LEU B 1 85  ? 31.249 -2.238  -2.615  1.00 23.87 ? 85   LEU B CD1   1 
ATOM   2049 C  CD2   . LEU B 1 85  ? 29.160 -3.626  -2.683  1.00 20.92 ? 85   LEU B CD2   1 
ATOM   2050 N  N     . ILE B 1 86  ? 29.218 -4.323  -7.430  1.00 15.05 ? 86   ILE B N     1 
ATOM   2051 C  CA    . ILE B 1 86  ? 29.149 -3.986  -8.822  1.00 16.01 ? 86   ILE B CA    1 
ATOM   2052 C  C     . ILE B 1 86  ? 28.611 -2.569  -8.864  1.00 16.78 ? 86   ILE B C     1 
ATOM   2053 O  O     . ILE B 1 86  ? 27.464 -2.320  -8.545  1.00 16.70 ? 86   ILE B O     1 
ATOM   2054 C  CB    . ILE B 1 86  ? 28.305 -4.967  -9.685  1.00 16.59 ? 86   ILE B CB    1 
ATOM   2055 C  CG1   . ILE B 1 86  ? 29.029 -6.335  -9.714  1.00 18.48 ? 86   ILE B CG1   1 
ATOM   2056 C  CG2   . ILE B 1 86  ? 28.173 -4.390  -11.160 1.00 17.45 ? 86   ILE B CG2   1 
ATOM   2057 C  CD1   . ILE B 1 86  ? 28.278 -7.433  -10.361 1.00 19.65 ? 86   ILE B CD1   1 
ATOM   2058 N  N     . ARG B 1 87  ? 29.459 -1.672  -9.355  1.00 17.41 ? 87   ARG B N     1 
ATOM   2059 C  CA    . ARG B 1 87  ? 29.182 -0.271  -9.344  1.00 19.79 ? 87   ARG B CA    1 
ATOM   2060 C  C     . ARG B 1 87  ? 28.980 0.357   -10.714 1.00 19.88 ? 87   ARG B C     1 
ATOM   2061 O  O     . ARG B 1 87  ? 29.411 -0.097  -11.741 1.00 20.11 ? 87   ARG B O     1 
ATOM   2062 C  CB    . ARG B 1 87  ? 30.315 0.473   -8.666  1.00 18.96 ? 87   ARG B CB    1 
ATOM   2063 C  CG    . ARG B 1 87  ? 30.484 0.023   -7.170  1.00 23.64 ? 87   ARG B CG    1 
ATOM   2064 C  CD    . ARG B 1 87  ? 30.713 1.183   -6.213  1.00 27.40 ? 87   ARG B CD    1 
ATOM   2065 N  NE    . ARG B 1 87  ? 29.631 2.175   -6.317  1.00 28.12 ? 87   ARG B NE    1 
ATOM   2066 C  CZ    . ARG B 1 87  ? 29.571 3.334   -5.654  1.00 29.29 ? 87   ARG B CZ    1 
ATOM   2067 N  NH1   . ARG B 1 87  ? 30.544 3.682   -4.862  1.00 27.00 ? 87   ARG B NH1   1 
ATOM   2068 N  NH2   . ARG B 1 87  ? 28.555 4.181   -5.851  1.00 30.31 ? 87   ARG B NH2   1 
ATOM   2069 N  N     . LYS B 1 88  ? 28.310 1.461   -10.672 1.00 21.07 ? 88   LYS B N     1 
ATOM   2070 C  CA    . LYS B 1 88  ? 28.325 2.374   -11.780 1.00 21.69 ? 88   LYS B CA    1 
ATOM   2071 C  C     . LYS B 1 88  ? 29.762 2.820   -12.105 1.00 21.83 ? 88   LYS B C     1 
ATOM   2072 O  O     . LYS B 1 88  ? 30.607 3.050   -11.228 1.00 20.65 ? 88   LYS B O     1 
ATOM   2073 C  CB    . LYS B 1 88  ? 27.460 3.561   -11.440 1.00 22.92 ? 88   LYS B CB    1 
ATOM   2074 C  CG    . LYS B 1 88  ? 26.069 3.166   -11.026 1.00 26.11 ? 88   LYS B CG    1 
ATOM   2075 C  CD    . LYS B 1 88  ? 25.234 4.386   -10.648 1.00 25.84 ? 88   LYS B CD    1 
ATOM   2076 C  CE    . LYS B 1 88  ? 23.875 3.926   -10.114 1.00 28.39 ? 88   LYS B CE    1 
ATOM   2077 N  NZ    . LYS B 1 88  ? 23.030 3.311   -11.168 1.00 30.24 ? 88   LYS B NZ    1 
ATOM   2078 N  N     . ARG B 1 89  ? 30.033 2.945   -13.390 1.00 20.70 ? 89   ARG B N     1 
ATOM   2079 C  CA    . ARG B 1 89  ? 31.374 3.137   -13.838 1.00 21.33 ? 89   ARG B CA    1 
ATOM   2080 C  C     . ARG B 1 89  ? 31.949 4.441   -13.273 1.00 21.92 ? 89   ARG B C     1 
ATOM   2081 O  O     . ARG B 1 89  ? 31.235 5.445   -13.145 1.00 23.03 ? 89   ARG B O     1 
ATOM   2082 C  CB    . ARG B 1 89  ? 31.436 3.124   -15.370 1.00 22.15 ? 89   ARG B CB    1 
ATOM   2083 C  CG    . ARG B 1 89  ? 32.877 3.032   -15.881 1.00 21.17 ? 89   ARG B CG    1 
ATOM   2084 C  CD    . ARG B 1 89  ? 32.982 3.290   -17.323 1.00 25.42 ? 89   ARG B CD    1 
ATOM   2085 N  NE    . ARG B 1 89  ? 34.398 3.375   -17.691 1.00 28.71 ? 89   ARG B NE    1 
ATOM   2086 C  CZ    . ARG B 1 89  ? 34.905 3.907   -18.797 1.00 31.60 ? 89   ARG B CZ    1 
ATOM   2087 N  NH1   . ARG B 1 89  ? 36.227 3.885   -18.979 1.00 32.69 ? 89   ARG B NH1   1 
ATOM   2088 N  NH2   . ARG B 1 89  ? 34.125 4.443   -19.726 1.00 34.32 ? 89   ARG B NH2   1 
ATOM   2089 N  N     . GLY B 1 90  ? 33.246 4.418   -12.960 1.00 21.76 ? 90   GLY B N     1 
ATOM   2090 C  CA    . GLY B 1 90  ? 33.937 5.584   -12.455 1.00 21.59 ? 90   GLY B CA    1 
ATOM   2091 C  C     . GLY B 1 90  ? 34.105 5.672   -10.935 1.00 22.33 ? 90   GLY B C     1 
ATOM   2092 O  O     . GLY B 1 90  ? 34.775 6.571   -10.468 1.00 21.60 ? 90   GLY B O     1 
ATOM   2093 N  N     . LYS B 1 91  ? 33.494 4.767   -10.173 1.00 22.05 ? 91   LYS B N     1 
ATOM   2094 C  CA    . LYS B 1 91  ? 33.456 4.915   -8.719  1.00 22.84 ? 91   LYS B CA    1 
ATOM   2095 C  C     . LYS B 1 91  ? 34.450 4.034   -7.957  1.00 24.31 ? 91   LYS B C     1 
ATOM   2096 O  O     . LYS B 1 91  ? 34.649 4.240   -6.750  1.00 24.89 ? 91   LYS B O     1 
ATOM   2097 C  CB    . LYS B 1 91  ? 32.054 4.619   -8.204  1.00 22.80 ? 91   LYS B CB    1 
ATOM   2098 C  CG    . LYS B 1 91  ? 30.949 5.624   -8.649  1.00 22.42 ? 91   LYS B CG    1 
ATOM   2099 N  N     . LEU B 1 92  ? 35.019 3.021   -8.630  1.00 24.31 ? 92   LEU B N     1 
ATOM   2100 C  CA    . LEU B 1 92  ? 35.866 2.031   -7.980  1.00 24.83 ? 92   LEU B CA    1 
ATOM   2101 C  C     . LEU B 1 92  ? 37.276 2.297   -8.439  1.00 24.73 ? 92   LEU B C     1 
ATOM   2102 O  O     . LEU B 1 92  ? 37.512 2.514   -9.647  1.00 24.06 ? 92   LEU B O     1 
ATOM   2103 C  CB    . LEU B 1 92  ? 35.464 0.590   -8.362  1.00 25.65 ? 92   LEU B CB    1 
ATOM   2104 C  CG    . LEU B 1 92  ? 34.238 0.008   -7.700  1.00 29.18 ? 92   LEU B CG    1 
ATOM   2105 C  CD1   . LEU B 1 92  ? 33.809 -1.302  -8.390  1.00 31.92 ? 92   LEU B CD1   1 
ATOM   2106 C  CD2   . LEU B 1 92  ? 34.545 -0.209  -6.187  1.00 31.92 ? 92   LEU B CD2   1 
ATOM   2107 N  N     . PRO B 1 93  ? 38.237 2.249   -7.484  1.00 24.16 ? 93   PRO B N     1 
ATOM   2108 C  CA    . PRO B 1 93  ? 39.655 2.379   -7.819  1.00 23.89 ? 93   PRO B CA    1 
ATOM   2109 C  C     . PRO B 1 93  ? 40.288 1.041   -8.159  1.00 23.32 ? 93   PRO B C     1 
ATOM   2110 O  O     . PRO B 1 93  ? 39.707 -0.030  -7.960  1.00 23.06 ? 93   PRO B O     1 
ATOM   2111 C  CB    . PRO B 1 93  ? 40.259 2.962   -6.532  1.00 23.76 ? 93   PRO B CB    1 
ATOM   2112 C  CG    . PRO B 1 93  ? 39.524 2.256   -5.458  1.00 24.04 ? 93   PRO B CG    1 
ATOM   2113 C  CD    . PRO B 1 93  ? 38.062 2.001   -6.034  1.00 23.94 ? 93   PRO B CD    1 
ATOM   2114 N  N     . GLY B 1 94  ? 41.491 1.111   -8.694  1.00 24.24 ? 94   GLY B N     1 
ATOM   2115 C  CA    . GLY B 1 94  ? 42.255 -0.082  -9.083  1.00 24.79 ? 94   GLY B CA    1 
ATOM   2116 C  C     . GLY B 1 94  ? 41.798 -0.582  -10.444 1.00 24.78 ? 94   GLY B C     1 
ATOM   2117 O  O     . GLY B 1 94  ? 40.979 0.062   -11.086 1.00 24.26 ? 94   GLY B O     1 
ATOM   2118 N  N     . PRO B 1 95  ? 42.359 -1.720  -10.910 1.00 24.37 ? 95   PRO B N     1 
ATOM   2119 C  CA    . PRO B 1 95  ? 41.952 -2.343  -12.175 1.00 23.16 ? 95   PRO B CA    1 
ATOM   2120 C  C     . PRO B 1 95  ? 40.505 -2.760  -12.158 1.00 23.32 ? 95   PRO B C     1 
ATOM   2121 O  O     . PRO B 1 95  ? 40.084 -3.385  -11.175 1.00 22.42 ? 95   PRO B O     1 
ATOM   2122 C  CB    . PRO B 1 95  ? 42.824 -3.605  -12.236 1.00 23.76 ? 95   PRO B CB    1 
ATOM   2123 C  CG    . PRO B 1 95  ? 43.981 -3.281  -11.421 1.00 23.31 ? 95   PRO B CG    1 
ATOM   2124 C  CD    . PRO B 1 95  ? 43.478 -2.452  -10.295 1.00 24.42 ? 95   PRO B CD    1 
ATOM   2125 N  N     . THR B 1 96  ? 39.793 -2.469  -13.263 1.00 21.12 ? 96   THR B N     1 
ATOM   2126 C  CA    . THR B 1 96  ? 38.383 -2.813  -13.402 1.00 21.97 ? 96   THR B CA    1 
ATOM   2127 C  C     . THR B 1 96  ? 38.030 -3.330  -14.787 1.00 21.45 ? 96   THR B C     1 
ATOM   2128 O  O     . THR B 1 96  ? 38.799 -3.198  -15.707 1.00 22.22 ? 96   THR B O     1 
ATOM   2129 C  CB    . THR B 1 96  ? 37.501 -1.591  -13.107 1.00 22.08 ? 96   THR B CB    1 
ATOM   2130 O  OG1   . THR B 1 96  ? 37.776 -0.568  -14.074 1.00 22.12 ? 96   THR B OG1   1 
ATOM   2131 C  CG2   . THR B 1 96  ? 37.775 -1.033  -11.682 1.00 20.80 ? 96   THR B CG2   1 
ATOM   2132 N  N     . LEU B 1 97  ? 36.875 -3.974  -14.871 1.00 20.77 ? 97   LEU B N     1 
ATOM   2133 C  CA    . LEU B 1 97  ? 36.227 -4.343  -16.121 1.00 20.82 ? 97   LEU B CA    1 
ATOM   2134 C  C     . LEU B 1 97  ? 34.940 -3.552  -16.088 1.00 20.20 ? 97   LEU B C     1 
ATOM   2135 O  O     . LEU B 1 97  ? 34.387 -3.372  -15.014 1.00 16.99 ? 97   LEU B O     1 
ATOM   2136 C  CB    . LEU B 1 97  ? 35.893 -5.849  -16.181 1.00 20.96 ? 97   LEU B CB    1 
ATOM   2137 C  CG    . LEU B 1 97  ? 37.065 -6.846  -16.230 1.00 22.33 ? 97   LEU B CG    1 
ATOM   2138 C  CD1   . LEU B 1 97  ? 36.520 -8.298  -16.349 1.00 24.72 ? 97   LEU B CD1   1 
ATOM   2139 C  CD2   . LEU B 1 97  ? 38.033 -6.574  -17.337 1.00 23.59 ? 97   LEU B CD2   1 
ATOM   2140 N  N     . TRP B 1 98  ? 34.511 -3.063  -17.250 1.00 20.22 ? 98   TRP B N     1 
ATOM   2141 C  CA    . TRP B 1 98  ? 33.242 -2.390  -17.403 1.00 21.90 ? 98   TRP B CA    1 
ATOM   2142 C  C     . TRP B 1 98  ? 32.426 -2.899  -18.610 1.00 22.30 ? 98   TRP B C     1 
ATOM   2143 O  O     . TRP B 1 98  ? 32.934 -3.596  -19.505 1.00 22.46 ? 98   TRP B O     1 
ATOM   2144 C  CB    A TRP B 1 98  ? 33.396 -0.863  -17.389 0.65 22.22 ? 98   TRP B CB    1 
ATOM   2145 C  CB    B TRP B 1 98  ? 33.458 -0.859  -17.475 0.35 21.64 ? 98   TRP B CB    1 
ATOM   2146 C  CG    A TRP B 1 98  ? 34.290 -0.300  -18.359 0.65 24.45 ? 98   TRP B CG    1 
ATOM   2147 C  CG    B TRP B 1 98  ? 33.997 -0.294  -18.773 0.35 22.32 ? 98   TRP B CG    1 
ATOM   2148 C  CD1   A TRP B 1 98  ? 33.941 0.317   -19.501 0.65 25.29 ? 98   TRP B CD1   1 
ATOM   2149 C  CD1   B TRP B 1 98  ? 35.310 -0.235  -19.170 0.35 21.87 ? 98   TRP B CD1   1 
ATOM   2150 C  CD2   A TRP B 1 98  ? 35.719 -0.257  -18.290 0.65 26.56 ? 98   TRP B CD2   1 
ATOM   2151 C  CD2   B TRP B 1 98  ? 33.239 0.337   -19.812 0.35 21.97 ? 98   TRP B CD2   1 
ATOM   2152 N  NE1   A TRP B 1 98  ? 35.062 0.755   -20.166 0.65 26.84 ? 98   TRP B NE1   1 
ATOM   2153 N  NE1   B TRP B 1 98  ? 35.407 0.370   -20.394 0.35 23.34 ? 98   TRP B NE1   1 
ATOM   2154 C  CE2   A TRP B 1 98  ? 36.167 0.407   -19.440 0.65 25.55 ? 98   TRP B CE2   1 
ATOM   2155 C  CE2   B TRP B 1 98  ? 34.154 0.742   -20.811 0.35 23.54 ? 98   TRP B CE2   1 
ATOM   2156 C  CE3   A TRP B 1 98  ? 36.663 -0.736  -17.369 0.65 27.99 ? 98   TRP B CE3   1 
ATOM   2157 C  CE3   B TRP B 1 98  ? 31.880 0.603   -19.993 0.35 21.96 ? 98   TRP B CE3   1 
ATOM   2158 C  CZ2   A TRP B 1 98  ? 37.513 0.613   -19.706 0.65 28.40 ? 98   TRP B CZ2   1 
ATOM   2159 C  CZ2   B TRP B 1 98  ? 33.747 1.381   -21.985 0.35 22.98 ? 98   TRP B CZ2   1 
ATOM   2160 C  CZ3   A TRP B 1 98  ? 38.009 -0.528  -17.629 0.65 28.84 ? 98   TRP B CZ3   1 
ATOM   2161 C  CZ3   B TRP B 1 98  ? 31.472 1.245   -21.163 0.35 23.06 ? 98   TRP B CZ3   1 
ATOM   2162 C  CH2   A TRP B 1 98  ? 38.422 0.137   -18.788 0.65 29.15 ? 98   TRP B CH2   1 
ATOM   2163 C  CH2   B TRP B 1 98  ? 32.403 1.626   -22.141 0.35 23.16 ? 98   TRP B CH2   1 
ATOM   2164 N  N     . ALA B 1 99  ? 31.124 -2.670  -18.542 1.00 23.77 ? 99   ALA B N     1 
ATOM   2165 C  CA    . ALA B 1 99  ? 30.199 -3.196  -19.518 1.00 24.39 ? 99   ALA B CA    1 
ATOM   2166 C  C     . ALA B 1 99  ? 29.169 -2.113  -19.688 1.00 26.08 ? 99   ALA B C     1 
ATOM   2167 O  O     . ALA B 1 99  ? 28.587 -1.648  -18.714 1.00 25.22 ? 99   ALA B O     1 
ATOM   2168 C  CB    . ALA B 1 99  ? 29.541 -4.500  -19.043 1.00 25.14 ? 99   ALA B CB    1 
ATOM   2169 N  N     . SER B 1 100 ? 28.967 -1.713  -20.947 1.00 28.46 ? 100  SER B N     1 
ATOM   2170 C  CA    . SER B 1 100 ? 27.924 -0.768  -21.338 1.00 29.91 ? 100  SER B CA    1 
ATOM   2171 C  C     . SER B 1 100 ? 26.590 -1.520  -21.560 1.00 30.46 ? 100  SER B C     1 
ATOM   2172 O  O     . SER B 1 100 ? 26.566 -2.698  -21.907 1.00 32.00 ? 100  SER B O     1 
ATOM   2173 C  CB    . SER B 1 100 ? 28.373 -0.027  -22.621 1.00 30.59 ? 100  SER B CB    1 
ATOM   2174 O  OG    . SER B 1 100 ? 27.629 1.170   -22.852 1.00 34.92 ? 100  SER B OG    1 
ATOM   2175 N  N     . TYR B 1 101 ? 25.468 -0.864  -21.313 1.00 30.16 ? 101  TYR B N     1 
ATOM   2176 C  CA    . TYR B 1 101 ? 24.162 -1.490  -21.534 1.00 29.77 ? 101  TYR B CA    1 
ATOM   2177 C  C     . TYR B 1 101 ? 23.172 -0.368  -21.707 1.00 29.66 ? 101  TYR B C     1 
ATOM   2178 O  O     . TYR B 1 101 ? 23.505 0.778   -21.437 1.00 29.55 ? 101  TYR B O     1 
ATOM   2179 C  CB    . TYR B 1 101 ? 23.734 -2.441  -20.393 1.00 30.00 ? 101  TYR B CB    1 
ATOM   2180 C  CG    . TYR B 1 101 ? 23.488 -1.751  -19.070 1.00 28.04 ? 101  TYR B CG    1 
ATOM   2181 C  CD1   . TYR B 1 101 ? 24.558 -1.334  -18.294 1.00 24.43 ? 101  TYR B CD1   1 
ATOM   2182 C  CD2   . TYR B 1 101 ? 22.196 -1.491  -18.617 1.00 29.09 ? 101  TYR B CD2   1 
ATOM   2183 C  CE1   . TYR B 1 101 ? 24.362 -0.699  -17.112 1.00 26.36 ? 101  TYR B CE1   1 
ATOM   2184 C  CE2   . TYR B 1 101 ? 21.992 -0.829  -17.424 1.00 30.26 ? 101  TYR B CE2   1 
ATOM   2185 C  CZ    . TYR B 1 101 ? 23.089 -0.448  -16.681 1.00 30.86 ? 101  TYR B CZ    1 
ATOM   2186 O  OH    . TYR B 1 101 ? 22.919 0.206   -15.489 1.00 35.99 ? 101  TYR B OH    1 
ATOM   2187 N  N     . SER B 1 102 ? 21.955 -0.716  -22.134 1.00 30.12 ? 102  SER B N     1 
ATOM   2188 C  CA    . SER B 1 102 ? 20.895 0.254   -22.420 1.00 29.89 ? 102  SER B CA    1 
ATOM   2189 C  C     . SER B 1 102 ? 19.962 0.425   -21.204 1.00 29.27 ? 102  SER B C     1 
ATOM   2190 O  O     . SER B 1 102 ? 19.489 -0.553  -20.593 1.00 28.75 ? 102  SER B O     1 
ATOM   2191 C  CB    . SER B 1 102 ? 20.115 -0.136  -23.701 1.00 30.49 ? 102  SER B CB    1 
ATOM   2192 O  OG    . SER B 1 102 ? 18.985 0.692   -23.890 1.00 33.81 ? 102  SER B OG    1 
ATOM   2193 N  N     . LEU B 1 103 ? 19.743 1.682   -20.845 1.00 28.30 ? 103  LEU B N     1 
ATOM   2194 C  CA    . LEU B 1 103 ? 19.005 2.043   -19.639 1.00 29.16 ? 103  LEU B CA    1 
ATOM   2195 C  C     . LEU B 1 103 ? 18.122 3.216   -20.012 1.00 29.27 ? 103  LEU B C     1 
ATOM   2196 O  O     . LEU B 1 103 ? 18.628 4.253   -20.455 1.00 28.82 ? 103  LEU B O     1 
ATOM   2197 C  CB    . LEU B 1 103 ? 19.994 2.388   -18.517 1.00 29.32 ? 103  LEU B CB    1 
ATOM   2198 C  CG    . LEU B 1 103 ? 19.596 2.431   -17.029 1.00 30.90 ? 103  LEU B CG    1 
ATOM   2199 C  CD1   . LEU B 1 103 ? 19.537 3.863   -16.587 1.00 34.02 ? 103  LEU B CD1   1 
ATOM   2200 C  CD2   . LEU B 1 103 ? 18.297 1.712   -16.696 1.00 30.61 ? 103  LEU B CD2   1 
ATOM   2201 N  N     . GLU B 1 104 ? 16.811 3.009   -19.877 1.00 29.87 ? 104  GLU B N     1 
ATOM   2202 C  CA    . GLU B 1 104 ? 15.786 3.926   -20.356 1.00 30.72 ? 104  GLU B CA    1 
ATOM   2203 C  C     . GLU B 1 104 ? 16.138 4.313   -21.774 1.00 29.70 ? 104  GLU B C     1 
ATOM   2204 O  O     . GLU B 1 104 ? 16.155 3.450   -22.610 1.00 29.10 ? 104  GLU B O     1 
ATOM   2205 C  CB    . GLU B 1 104 ? 15.622 5.112   -19.426 1.00 31.96 ? 104  GLU B CB    1 
ATOM   2206 C  CG    . GLU B 1 104 ? 15.219 4.671   -18.040 1.00 35.71 ? 104  GLU B CG    1 
ATOM   2207 C  CD    . GLU B 1 104 ? 15.321 5.787   -17.034 1.00 40.81 ? 104  GLU B CD    1 
ATOM   2208 O  OE1   . GLU B 1 104 ? 16.460 6.241   -16.768 1.00 44.74 ? 104  GLU B OE1   1 
ATOM   2209 O  OE2   . GLU B 1 104 ? 14.267 6.211   -16.511 1.00 45.03 ? 104  GLU B OE2   1 
ATOM   2210 N  N     . TYR B 1 105 ? 16.483 5.572   -22.017 1.00 29.68 ? 105  TYR B N     1 
ATOM   2211 C  CA    . TYR B 1 105 ? 16.661 6.084   -23.393 1.00 29.80 ? 105  TYR B CA    1 
ATOM   2212 C  C     . TYR B 1 105 ? 18.121 6.187   -23.827 1.00 30.53 ? 105  TYR B C     1 
ATOM   2213 O  O     . TYR B 1 105 ? 18.378 6.496   -24.986 1.00 31.37 ? 105  TYR B O     1 
ATOM   2214 C  CB    . TYR B 1 105 ? 15.990 7.441   -23.540 1.00 29.70 ? 105  TYR B CB    1 
ATOM   2215 C  CG    . TYR B 1 105 ? 14.496 7.325   -23.573 1.00 29.40 ? 105  TYR B CG    1 
ATOM   2216 C  CD1   . TYR B 1 105 ? 13.759 7.328   -22.407 1.00 30.31 ? 105  TYR B CD1   1 
ATOM   2217 C  CD2   . TYR B 1 105 ? 13.831 7.144   -24.765 1.00 28.75 ? 105  TYR B CD2   1 
ATOM   2218 C  CE1   . TYR B 1 105 ? 12.398 7.196   -22.421 1.00 30.16 ? 105  TYR B CE1   1 
ATOM   2219 C  CE2   . TYR B 1 105 ? 12.478 7.009   -24.791 1.00 28.65 ? 105  TYR B CE2   1 
ATOM   2220 C  CZ    . TYR B 1 105 ? 11.764 7.043   -23.618 1.00 28.75 ? 105  TYR B CZ    1 
ATOM   2221 O  OH    . TYR B 1 105 ? 10.400 6.934   -23.642 1.00 27.52 ? 105  TYR B OH    1 
ATOM   2222 N  N     . GLY B 1 106 ? 19.055 5.861   -22.926 1.00 30.32 ? 106  GLY B N     1 
ATOM   2223 C  CA    . GLY B 1 106 ? 20.484 6.061   -23.190 1.00 30.53 ? 106  GLY B CA    1 
ATOM   2224 C  C     . GLY B 1 106 ? 21.317 4.859   -22.809 1.00 30.55 ? 106  GLY B C     1 
ATOM   2225 O  O     . GLY B 1 106 ? 20.796 3.753   -22.701 1.00 28.88 ? 106  GLY B O     1 
ATOM   2226 N  N     . LYS B 1 107 ? 22.624 5.069   -22.661 1.00 31.09 ? 107  LYS B N     1 
ATOM   2227 C  CA    . LYS B 1 107 ? 23.539 3.989   -22.288 1.00 31.73 ? 107  LYS B CA    1 
ATOM   2228 C  C     . LYS B 1 107 ? 24.068 4.242   -20.901 1.00 31.79 ? 107  LYS B C     1 
ATOM   2229 O  O     . LYS B 1 107 ? 24.359 5.377   -20.562 1.00 33.21 ? 107  LYS B O     1 
ATOM   2230 C  CB    . LYS B 1 107 ? 24.722 3.927   -23.255 1.00 32.52 ? 107  LYS B CB    1 
ATOM   2231 C  CG    . LYS B 1 107 ? 24.385 3.440   -24.651 1.00 34.14 ? 107  LYS B CG    1 
ATOM   2232 C  CD    . LYS B 1 107 ? 23.709 2.052   -24.586 1.00 37.69 ? 107  LYS B CD    1 
ATOM   2233 C  CE    . LYS B 1 107 ? 23.416 1.430   -25.959 1.00 37.89 ? 107  LYS B CE    1 
ATOM   2234 N  NZ    . LYS B 1 107 ? 23.483 -0.097  -25.864 1.00 36.79 ? 107  LYS B NZ    1 
ATOM   2235 N  N     . ALA B 1 108 ? 24.191 3.185   -20.087 1.00 31.18 ? 108  ALA B N     1 
ATOM   2236 C  CA    . ALA B 1 108 ? 24.971 3.265   -18.836 1.00 28.91 ? 108  ALA B CA    1 
ATOM   2237 C  C     . ALA B 1 108 ? 26.079 2.215   -18.765 1.00 27.49 ? 108  ALA B C     1 
ATOM   2238 O  O     . ALA B 1 108 ? 26.208 1.321   -19.610 1.00 25.83 ? 108  ALA B O     1 
ATOM   2239 C  CB    . ALA B 1 108 ? 24.079 3.176   -17.657 1.00 28.78 ? 108  ALA B CB    1 
ATOM   2240 N  N     . GLU B 1 109 ? 26.930 2.369   -17.774 1.00 25.25 ? 109  GLU B N     1 
ATOM   2241 C  CA    . GLU B 1 109 ? 28.073 1.510   -17.660 1.00 24.57 ? 109  GLU B CA    1 
ATOM   2242 C  C     . GLU B 1 109 ? 28.172 1.046   -16.222 1.00 22.25 ? 109  GLU B C     1 
ATOM   2243 O  O     . GLU B 1 109 ? 28.036 1.846   -15.360 1.00 22.68 ? 109  GLU B O     1 
ATOM   2244 C  CB    A GLU B 1 109 ? 29.334 2.278   -18.014 0.65 24.94 ? 109  GLU B CB    1 
ATOM   2245 C  CB    B GLU B 1 109 ? 29.333 2.286   -18.043 0.35 24.30 ? 109  GLU B CB    1 
ATOM   2246 C  CG    A GLU B 1 109 ? 29.380 2.847   -19.408 0.65 26.21 ? 109  GLU B CG    1 
ATOM   2247 C  CG    B GLU B 1 109 ? 29.326 2.856   -19.471 0.35 23.94 ? 109  GLU B CG    1 
ATOM   2248 C  CD    A GLU B 1 109 ? 30.749 3.387   -19.696 0.65 28.43 ? 109  GLU B CD    1 
ATOM   2249 C  CD    B GLU B 1 109 ? 29.601 4.346   -19.512 0.35 23.00 ? 109  GLU B CD    1 
ATOM   2250 O  OE1   A GLU B 1 109 ? 31.664 2.559   -19.933 0.65 30.80 ? 109  GLU B OE1   1 
ATOM   2251 O  OE1   B GLU B 1 109 ? 30.205 4.874   -18.551 0.35 21.70 ? 109  GLU B OE1   1 
ATOM   2252 O  OE2   A GLU B 1 109 ? 30.921 4.623   -19.650 0.65 28.70 ? 109  GLU B OE2   1 
ATOM   2253 O  OE2   B GLU B 1 109 ? 29.207 4.990   -20.507 0.35 24.36 ? 109  GLU B OE2   1 
ATOM   2254 N  N     . LEU B 1 110 ? 28.370 -0.256  -16.021 1.00 21.44 ? 110  LEU B N     1 
ATOM   2255 C  CA    . LEU B 1 110 ? 28.675 -0.849  -14.717 1.00 19.90 ? 110  LEU B CA    1 
ATOM   2256 C  C     . LEU B 1 110 ? 30.134 -1.288  -14.770 1.00 19.01 ? 110  LEU B C     1 
ATOM   2257 O  O     . LEU B 1 110 ? 30.681 -1.466  -15.840 1.00 20.15 ? 110  LEU B O     1 
ATOM   2258 C  CB    . LEU B 1 110 ? 27.762 -2.061  -14.423 1.00 20.54 ? 110  LEU B CB    1 
ATOM   2259 C  CG    . LEU B 1 110 ? 26.264 -1.811  -14.199 1.00 21.47 ? 110  LEU B CG    1 
ATOM   2260 C  CD1   . LEU B 1 110 ? 25.623 -3.115  -13.841 1.00 22.84 ? 110  LEU B CD1   1 
ATOM   2261 C  CD2   . LEU B 1 110 ? 25.995 -0.823  -13.158 1.00 22.74 ? 110  LEU B CD2   1 
ATOM   2262 N  N     . GLU B 1 111 ? 30.761 -1.465  -13.602 1.00 18.72 ? 111  GLU B N     1 
ATOM   2263 C  CA    . GLU B 1 111 ? 32.106 -1.932  -13.516 1.00 19.16 ? 111  GLU B CA    1 
ATOM   2264 C  C     . GLU B 1 111 ? 32.283 -2.831  -12.289 1.00 17.96 ? 111  GLU B C     1 
ATOM   2265 O  O     . GLU B 1 111 ? 31.473 -2.823  -11.370 1.00 17.32 ? 111  GLU B O     1 
ATOM   2266 C  CB    . GLU B 1 111 ? 33.065 -0.740  -13.441 1.00 19.88 ? 111  GLU B CB    1 
ATOM   2267 C  CG    . GLU B 1 111 ? 33.059 -0.072  -12.086 1.00 21.12 ? 111  GLU B CG    1 
ATOM   2268 C  CD    . GLU B 1 111 ? 33.869 1.229   -11.957 1.00 24.16 ? 111  GLU B CD    1 
ATOM   2269 O  OE1   . GLU B 1 111 ? 34.634 1.666   -12.868 1.00 18.72 ? 111  GLU B OE1   1 
ATOM   2270 O  OE2   . GLU B 1 111 ? 33.694 1.808   -10.869 1.00 22.40 ? 111  GLU B OE2   1 
ATOM   2271 N  N     . ILE B 1 112 ? 33.358 -3.594  -12.281 1.00 17.56 ? 112  ILE B N     1 
ATOM   2272 C  CA    . ILE B 1 112 ? 33.724 -4.371  -11.129 1.00 17.03 ? 112  ILE B CA    1 
ATOM   2273 C  C     . ILE B 1 112 ? 35.228 -4.283  -11.012 1.00 17.29 ? 112  ILE B C     1 
ATOM   2274 O  O     . ILE B 1 112 ? 35.893 -4.194  -12.045 1.00 15.55 ? 112  ILE B O     1 
ATOM   2275 C  CB    . ILE B 1 112 ? 33.264 -5.828  -11.336 1.00 17.33 ? 112  ILE B CB    1 
ATOM   2276 C  CG1   . ILE B 1 112 ? 33.345 -6.609  -10.025 1.00 16.47 ? 112  ILE B CG1   1 
ATOM   2277 C  CG2   . ILE B 1 112 ? 34.079 -6.544  -12.425 1.00 18.43 ? 112  ILE B CG2   1 
ATOM   2278 C  CD1   . ILE B 1 112 ? 32.526 -7.872  -10.077 1.00 17.78 ? 112  ILE B CD1   1 
ATOM   2279 N  N     . GLN B 1 113 ? 35.760 -4.369  -9.780  1.00 17.41 ? 113  GLN B N     1 
ATOM   2280 C  CA    . GLN B 1 113 ? 37.193 -4.523  -9.577  1.00 18.25 ? 113  GLN B CA    1 
ATOM   2281 C  C     . GLN B 1 113 ? 37.643 -5.930  -10.045 1.00 19.05 ? 113  GLN B C     1 
ATOM   2282 O  O     . GLN B 1 113 ? 37.000 -6.920  -9.743  1.00 19.17 ? 113  GLN B O     1 
ATOM   2283 C  CB    . GLN B 1 113 ? 37.593 -4.305  -8.108  1.00 17.95 ? 113  GLN B CB    1 
ATOM   2284 C  CG    . GLN B 1 113 ? 37.588 -2.832  -7.654  1.00 18.36 ? 113  GLN B CG    1 
ATOM   2285 C  CD    . GLN B 1 113 ? 37.690 -2.629  -6.169  1.00 19.53 ? 113  GLN B CD    1 
ATOM   2286 O  OE1   . GLN B 1 113 ? 37.266 -3.468  -5.374  1.00 23.62 ? 113  GLN B OE1   1 
ATOM   2287 N  NE2   . GLN B 1 113 ? 38.336 -1.523  -5.774  1.00 21.96 ? 113  GLN B NE2   1 
ATOM   2288 N  N     . LYS B 1 114 ? 38.758 -5.988  -10.780 1.00 19.41 ? 114  LYS B N     1 
ATOM   2289 C  CA    . LYS B 1 114 ? 39.277 -7.244  -11.295 1.00 21.44 ? 114  LYS B CA    1 
ATOM   2290 C  C     . LYS B 1 114 ? 39.547 -8.269  -10.204 1.00 21.99 ? 114  LYS B C     1 
ATOM   2291 O  O     . LYS B 1 114 ? 39.349 -9.449  -10.431 1.00 24.70 ? 114  LYS B O     1 
ATOM   2292 C  CB    . LYS B 1 114 ? 40.519 -6.982  -12.160 1.00 21.63 ? 114  LYS B CB    1 
ATOM   2293 C  CG    . LYS B 1 114 ? 40.191 -6.653  -13.574 1.00 23.52 ? 114  LYS B CG    1 
ATOM   2294 C  CD    . LYS B 1 114 ? 41.463 -6.455  -14.396 1.00 26.49 ? 114  LYS B CD    1 
ATOM   2295 C  CE    . LYS B 1 114 ? 41.284 -5.441  -15.540 1.00 29.39 ? 114  LYS B CE    1 
ATOM   2296 N  NZ    . LYS B 1 114 ? 42.521 -5.364  -16.405 1.00 33.33 ? 114  LYS B NZ    1 
ATOM   2297 N  N     . ASP B 1 115 ? 39.910 -7.839  -8.992  1.00 21.75 ? 115  ASP B N     1 
ATOM   2298 C  CA    . ASP B 1 115 ? 40.159 -8.787  -7.906  1.00 21.61 ? 115  ASP B CA    1 
ATOM   2299 C  C     . ASP B 1 115 ? 38.953 -9.061  -7.044  1.00 21.22 ? 115  ASP B C     1 
ATOM   2300 O  O     . ASP B 1 115 ? 39.081 -9.645  -5.959  1.00 22.77 ? 115  ASP B O     1 
ATOM   2301 C  CB    . ASP B 1 115 ? 41.359 -8.357  -7.026  1.00 22.23 ? 115  ASP B CB    1 
ATOM   2302 C  CG    . ASP B 1 115 ? 41.163 -6.996  -6.333  1.00 25.62 ? 115  ASP B CG    1 
ATOM   2303 O  OD1   . ASP B 1 115 ? 42.137 -6.535  -5.685  1.00 28.25 ? 115  ASP B OD1   1 
ATOM   2304 O  OD2   . ASP B 1 115 ? 40.068 -6.401  -6.418  1.00 25.24 ? 115  ASP B OD2   1 
ATOM   2305 N  N     . ALA B 1 116 ? 37.772 -8.614  -7.473  1.00 20.46 ? 116  ALA B N     1 
ATOM   2306 C  CA    . ALA B 1 116 ? 36.590 -8.858  -6.665  1.00 19.54 ? 116  ALA B CA    1 
ATOM   2307 C  C     . ALA B 1 116 ? 36.367 -10.376 -6.478  1.00 18.91 ? 116  ALA B C     1 
ATOM   2308 O  O     . ALA B 1 116 ? 36.005 -10.806 -5.404  1.00 19.89 ? 116  ALA B O     1 
ATOM   2309 C  CB    . ALA B 1 116 ? 35.379 -8.209  -7.303  1.00 19.42 ? 116  ALA B CB    1 
ATOM   2310 N  N     . LEU B 1 117 ? 36.594 -11.170 -7.544  1.00 18.62 ? 117  LEU B N     1 
ATOM   2311 C  CA    . LEU B 1 117 ? 36.351 -12.626 -7.554  1.00 18.62 ? 117  LEU B CA    1 
ATOM   2312 C  C     . LEU B 1 117 ? 37.505 -13.305 -8.291  1.00 19.43 ? 117  LEU B C     1 
ATOM   2313 O  O     . LEU B 1 117 ? 38.081 -12.688 -9.162  1.00 18.52 ? 117  LEU B O     1 
ATOM   2314 C  CB    . LEU B 1 117 ? 35.057 -12.929 -8.258  1.00 19.14 ? 117  LEU B CB    1 
ATOM   2315 C  CG    . LEU B 1 117 ? 33.850 -12.390 -7.482  1.00 20.16 ? 117  LEU B CG    1 
ATOM   2316 C  CD1   . LEU B 1 117 ? 32.628 -12.441 -8.361  1.00 20.40 ? 117  LEU B CD1   1 
ATOM   2317 C  CD2   . LEU B 1 117 ? 33.622 -13.139 -6.188  1.00 19.35 ? 117  LEU B CD2   1 
ATOM   2318 N  N     . GLU B 1 118 ? 37.879 -14.517 -7.874  1.00 18.22 ? 118  GLU B N     1 
ATOM   2319 C  CA    . GLU B 1 118 ? 38.825 -15.336 -8.636  1.00 17.93 ? 118  GLU B CA    1 
ATOM   2320 C  C     . GLU B 1 118 ? 38.079 -16.308 -9.529  1.00 16.41 ? 118  GLU B C     1 
ATOM   2321 O  O     . GLU B 1 118 ? 36.928 -16.666 -9.282  1.00 14.21 ? 118  GLU B O     1 
ATOM   2322 C  CB    . GLU B 1 118 ? 39.760 -16.191 -7.729  1.00 17.97 ? 118  GLU B CB    1 
ATOM   2323 C  CG    . GLU B 1 118 ? 40.240 -15.621 -6.455  1.00 23.13 ? 118  GLU B CG    1 
ATOM   2324 C  CD    . GLU B 1 118 ? 41.018 -16.648 -5.648  1.00 22.87 ? 118  GLU B CD    1 
ATOM   2325 O  OE1   . GLU B 1 118 ? 41.201 -16.425 -4.448  1.00 27.88 ? 118  GLU B OE1   1 
ATOM   2326 O  OE2   . GLU B 1 118 ? 41.474 -17.656 -6.263  1.00 29.77 ? 118  GLU B OE2   1 
ATOM   2327 N  N     . PRO B 1 119 ? 38.744 -16.784 -10.589 1.00 15.62 ? 119  PRO B N     1 
ATOM   2328 C  CA    . PRO B 1 119 ? 38.130 -17.801 -11.452 1.00 15.63 ? 119  PRO B CA    1 
ATOM   2329 C  C     . PRO B 1 119 ? 37.646 -18.998 -10.697 1.00 14.94 ? 119  PRO B C     1 
ATOM   2330 O  O     . PRO B 1 119 ? 38.301 -19.465 -9.759  1.00 16.08 ? 119  PRO B O     1 
ATOM   2331 C  CB    . PRO B 1 119 ? 39.261 -18.143 -12.470 1.00 15.13 ? 119  PRO B CB    1 
ATOM   2332 C  CG    . PRO B 1 119 ? 40.125 -16.933 -12.417 1.00 15.90 ? 119  PRO B CG    1 
ATOM   2333 C  CD    . PRO B 1 119 ? 40.111 -16.435 -11.030 1.00 16.00 ? 119  PRO B CD    1 
ATOM   2334 N  N     . GLY B 1 120 ? 36.422 -19.408 -11.007 1.00 15.68 ? 120  GLY B N     1 
ATOM   2335 C  CA    . GLY B 1 120 ? 35.810 -20.542 -10.304 1.00 14.55 ? 120  GLY B CA    1 
ATOM   2336 C  C     . GLY B 1 120 ? 34.863 -20.219 -9.187  1.00 14.82 ? 120  GLY B C     1 
ATOM   2337 O  O     . GLY B 1 120 ? 34.115 -21.112 -8.722  1.00 16.70 ? 120  GLY B O     1 
ATOM   2338 N  N     . GLN B 1 121 ? 34.928 -18.995 -8.703  1.00 14.62 ? 121  GLN B N     1 
ATOM   2339 C  CA    . GLN B 1 121 ? 34.036 -18.537 -7.620  1.00 14.60 ? 121  GLN B CA    1 
ATOM   2340 C  C     . GLN B 1 121 ? 32.609 -18.318 -8.104  1.00 13.34 ? 121  GLN B C     1 
ATOM   2341 O  O     . GLN B 1 121 ? 32.355 -17.998 -9.258  1.00 12.80 ? 121  GLN B O     1 
ATOM   2342 C  CB    . GLN B 1 121 ? 34.616 -17.308 -6.889  1.00 13.34 ? 121  GLN B CB    1 
ATOM   2343 C  CG    . GLN B 1 121 ? 35.823 -17.747 -6.118  1.00 15.46 ? 121  GLN B CG    1 
ATOM   2344 C  CD    . GLN B 1 121 ? 36.432 -16.686 -5.233  1.00 13.05 ? 121  GLN B CD    1 
ATOM   2345 O  OE1   . GLN B 1 121 ? 36.564 -15.535 -5.626  1.00 15.96 ? 121  GLN B OE1   1 
ATOM   2346 N  NE2   . GLN B 1 121 ? 36.856 -17.077 -4.029  1.00 14.51 ? 121  GLN B NE2   1 
ATOM   2347 N  N     . ARG B 1 122 ? 31.674 -18.630 -7.204  1.00 13.39 ? 122  ARG B N     1 
ATOM   2348 C  CA    . ARG B 1 122 ? 30.261 -18.777 -7.506  1.00 13.97 ? 122  ARG B CA    1 
ATOM   2349 C  C     . ARG B 1 122 ? 29.548 -17.686 -6.744  1.00 15.02 ? 122  ARG B C     1 
ATOM   2350 O  O     . ARG B 1 122 ? 29.751 -17.519 -5.533  1.00 14.59 ? 122  ARG B O     1 
ATOM   2351 C  CB    . ARG B 1 122 ? 29.749 -20.147 -7.060  1.00 13.99 ? 122  ARG B CB    1 
ATOM   2352 C  CG    . ARG B 1 122 ? 30.433 -21.256 -7.810  1.00 18.54 ? 122  ARG B CG    1 
ATOM   2353 C  CD    . ARG B 1 122 ? 29.790 -22.598 -7.688  1.00 21.80 ? 122  ARG B CD    1 
ATOM   2354 N  NE    . ARG B 1 122 ? 30.603 -23.522 -8.457  1.00 28.43 ? 122  ARG B NE    1 
ATOM   2355 C  CZ    . ARG B 1 122 ? 31.083 -24.686 -8.039  1.00 33.15 ? 122  ARG B CZ    1 
ATOM   2356 N  NH1   . ARG B 1 122 ? 31.857 -25.382 -8.874  1.00 33.24 ? 122  ARG B NH1   1 
ATOM   2357 N  NH2   . ARG B 1 122 ? 30.787 -25.171 -6.829  1.00 32.35 ? 122  ARG B NH2   1 
ATOM   2358 N  N     . VAL B 1 123 ? 28.730 -16.972 -7.478  1.00 15.32 ? 123  VAL B N     1 
ATOM   2359 C  CA    . VAL B 1 123 ? 28.085 -15.752 -7.025  1.00 15.98 ? 123  VAL B CA    1 
ATOM   2360 C  C     . VAL B 1 123 ? 26.592 -15.760 -7.263  1.00 15.23 ? 123  VAL B C     1 
ATOM   2361 O  O     . VAL B 1 123 ? 26.072 -16.344 -8.234  1.00 13.67 ? 123  VAL B O     1 
ATOM   2362 C  CB    . VAL B 1 123 ? 28.766 -14.512 -7.734  1.00 17.34 ? 123  VAL B CB    1 
ATOM   2363 C  CG1   . VAL B 1 123 ? 28.247 -13.241 -7.255  1.00 21.26 ? 123  VAL B CG1   1 
ATOM   2364 C  CG2   . VAL B 1 123 ? 30.204 -14.501 -7.453  1.00 21.34 ? 123  VAL B CG2   1 
ATOM   2365 N  N     . VAL B 1 124 ? 25.900 -15.052 -6.370  1.00 14.92 ? 124  VAL B N     1 
ATOM   2366 C  CA    . VAL B 1 124 ? 24.454 -14.687 -6.562  1.00 14.25 ? 124  VAL B CA    1 
ATOM   2367 C  C     . VAL B 1 124 ? 24.354 -13.145 -6.540  1.00 13.67 ? 124  VAL B C     1 
ATOM   2368 O  O     . VAL B 1 124 ? 24.919 -12.469 -5.682  1.00 14.16 ? 124  VAL B O     1 
ATOM   2369 C  CB    . VAL B 1 124 ? 23.542 -15.320 -5.516  1.00 14.81 ? 124  VAL B CB    1 
ATOM   2370 C  CG1   . VAL B 1 124 ? 22.116 -14.723 -5.617  1.00 16.69 ? 124  VAL B CG1   1 
ATOM   2371 C  CG2   . VAL B 1 124 ? 23.503 -16.801 -5.693  1.00 13.71 ? 124  VAL B CG2   1 
ATOM   2372 N  N     . VAL B 1 125 ? 23.723 -12.634 -7.575  1.00 14.46 ? 125  VAL B N     1 
ATOM   2373 C  CA    . VAL B 1 125 ? 23.560 -11.223 -7.804  1.00 13.58 ? 125  VAL B CA    1 
ATOM   2374 C  C     . VAL B 1 125 ? 22.208 -10.797 -7.212  1.00 14.26 ? 125  VAL B C     1 
ATOM   2375 O  O     . VAL B 1 125 ? 21.198 -11.491 -7.371  1.00 13.27 ? 125  VAL B O     1 
ATOM   2376 C  CB    . VAL B 1 125 ? 23.663 -10.849 -9.321  1.00 13.12 ? 125  VAL B CB    1 
ATOM   2377 C  CG1   . VAL B 1 125 ? 23.547 -9.342  -9.462  1.00 15.76 ? 125  VAL B CG1   1 
ATOM   2378 C  CG2   . VAL B 1 125 ? 24.981 -11.262 -9.951  1.00 12.92 ? 125  VAL B CG2   1 
ATOM   2379 N  N     . VAL B 1 126 ? 22.241 -9.689  -6.469  1.00 14.65 ? 126  VAL B N     1 
ATOM   2380 C  CA    . VAL B 1 126 ? 21.041 -9.070  -5.866  1.00 14.90 ? 126  VAL B CA    1 
ATOM   2381 C  C     . VAL B 1 126 ? 20.821 -7.617  -6.266  1.00 14.36 ? 126  VAL B C     1 
ATOM   2382 O  O     . VAL B 1 126 ? 21.752 -6.788  -6.284  1.00 14.38 ? 126  VAL B O     1 
ATOM   2383 C  CB    . VAL B 1 126 ? 20.971 -9.246  -4.333  1.00 15.73 ? 126  VAL B CB    1 
ATOM   2384 C  CG1   . VAL B 1 126 ? 22.045 -8.433  -3.622  1.00 14.66 ? 126  VAL B CG1   1 
ATOM   2385 C  CG2   . VAL B 1 126 ? 19.546 -8.917  -3.819  1.00 17.63 ? 126  VAL B CG2   1 
ATOM   2386 N  N     . ASP B 1 127 ? 19.575 -7.340  -6.616  1.00 14.03 ? 127  ASP B N     1 
ATOM   2387 C  CA    . ASP B 1 127 ? 19.099 -5.976  -6.757  1.00 14.71 ? 127  ASP B CA    1 
ATOM   2388 C  C     . ASP B 1 127 ? 17.727 -5.863  -6.164  1.00 14.79 ? 127  ASP B C     1 
ATOM   2389 O  O     . ASP B 1 127 ? 17.076 -6.890  -5.869  1.00 14.03 ? 127  ASP B O     1 
ATOM   2390 C  CB    . ASP B 1 127 ? 19.085 -5.623  -8.250  1.00 15.00 ? 127  ASP B CB    1 
ATOM   2391 C  CG    . ASP B 1 127 ? 19.210 -4.111  -8.529  1.00 17.76 ? 127  ASP B CG    1 
ATOM   2392 O  OD1   . ASP B 1 127 ? 19.317 -3.299  -7.579  1.00 17.50 ? 127  ASP B OD1   1 
ATOM   2393 O  OD2   . ASP B 1 127 ? 19.239 -3.750  -9.717  1.00 16.24 ? 127  ASP B OD2   1 
ATOM   2394 N  N     . ASP B 1 128 ? 17.218 -4.643  -6.037  1.00 14.09 ? 128  ASP B N     1 
ATOM   2395 C  CA    . ASP B 1 128 ? 15.846 -4.489  -5.500  1.00 14.59 ? 128  ASP B CA    1 
ATOM   2396 C  C     . ASP B 1 128 ? 14.802 -4.987  -6.459  1.00 14.46 ? 128  ASP B C     1 
ATOM   2397 O  O     . ASP B 1 128 ? 13.830 -5.633  -6.065  1.00 12.98 ? 128  ASP B O     1 
ATOM   2398 C  CB    . ASP B 1 128 ? 15.538 -3.060  -5.015  1.00 14.25 ? 128  ASP B CB    1 
ATOM   2399 C  CG    . ASP B 1 128 ? 15.405 -2.032  -6.149  1.00 16.31 ? 128  ASP B CG    1 
ATOM   2400 O  OD1   . ASP B 1 128 ? 14.628 -1.042  -5.965  1.00 22.18 ? 128  ASP B OD1   1 
ATOM   2401 O  OD2   . ASP B 1 128 ? 16.076 -2.185  -7.188  1.00 18.53 ? 128  ASP B OD2   1 
ATOM   2402 N  N     . LEU B 1 129 ? 14.988 -4.724  -7.761  1.00 14.22 ? 129  LEU B N     1 
ATOM   2403 C  CA    . LEU B 1 129 ? 13.895 -5.017  -8.686  1.00 14.61 ? 129  LEU B CA    1 
ATOM   2404 C  C     . LEU B 1 129 ? 14.418 -5.360  -10.058 1.00 15.11 ? 129  LEU B C     1 
ATOM   2405 O  O     . LEU B 1 129 ? 15.415 -4.775  -10.494 1.00 14.99 ? 129  LEU B O     1 
ATOM   2406 C  CB    . LEU B 1 129 ? 13.022 -3.776  -8.723  1.00 15.87 ? 129  LEU B CB    1 
ATOM   2407 C  CG    . LEU B 1 129 ? 12.108 -3.173  -9.809  1.00 18.94 ? 129  LEU B CG    1 
ATOM   2408 C  CD1   . LEU B 1 129 ? 12.065 -3.595  -11.234 1.00 19.57 ? 129  LEU B CD1   1 
ATOM   2409 C  CD2   . LEU B 1 129 ? 10.725 -2.982  -9.183  1.00 18.34 ? 129  LEU B CD2   1 
ATOM   2410 N  N     . LEU B 1 130 ? 13.725 -6.271  -10.728 1.00 15.09 ? 130  LEU B N     1 
ATOM   2411 C  CA    . LEU B 1 130 ? 14.031 -6.673  -12.096 1.00 16.59 ? 130  LEU B CA    1 
ATOM   2412 C  C     . LEU B 1 130 ? 12.976 -6.142  -13.007 1.00 15.07 ? 130  LEU B C     1 
ATOM   2413 O  O     . LEU B 1 130 ? 11.798 -6.493  -12.914 1.00 14.94 ? 130  LEU B O     1 
ATOM   2414 C  CB    . LEU B 1 130 ? 14.074 -8.195  -12.290 1.00 17.49 ? 130  LEU B CB    1 
ATOM   2415 C  CG    . LEU B 1 130 ? 14.457 -8.710  -13.699 1.00 17.31 ? 130  LEU B CG    1 
ATOM   2416 C  CD1   . LEU B 1 130 ? 15.922 -8.711  -13.941 1.00 21.16 ? 130  LEU B CD1   1 
ATOM   2417 C  CD2   . LEU B 1 130 ? 13.962 -10.105 -13.880 1.00 17.36 ? 130  LEU B CD2   1 
ATOM   2418 N  N     . ALA B 1 131 ? 13.421 -5.367  -13.972 1.00 16.25 ? 131  ALA B N     1 
ATOM   2419 C  CA    . ALA B 1 131 ? 12.463 -4.788  -14.975 1.00 17.44 ? 131  ALA B CA    1 
ATOM   2420 C  C     . ALA B 1 131 ? 12.833 -5.342  -16.338 1.00 17.85 ? 131  ALA B C     1 
ATOM   2421 O  O     . ALA B 1 131 ? 12.518 -6.531  -16.578 1.00 17.88 ? 131  ALA B O     1 
ATOM   2422 C  CB    . ALA B 1 131 ? 12.409 -3.289  -14.888 1.00 18.15 ? 131  ALA B CB    1 
ATOM   2423 N  N     . THR B 1 132 ? 13.546 -4.614  -17.197 1.00 18.70 ? 132  THR B N     1 
ATOM   2424 C  CA    . THR B 1 132 ? 13.971 -5.210  -18.467 1.00 19.60 ? 132  THR B CA    1 
ATOM   2425 C  C     . THR B 1 132 ? 15.078 -6.266  -18.333 1.00 19.19 ? 132  THR B C     1 
ATOM   2426 O  O     . THR B 1 132 ? 15.293 -7.093  -19.210 1.00 19.74 ? 132  THR B O     1 
ATOM   2427 C  CB    . THR B 1 132 ? 14.456 -4.161  -19.517 1.00 20.03 ? 132  THR B CB    1 
ATOM   2428 O  OG1   . THR B 1 132 ? 15.653 -3.543  -19.068 1.00 23.16 ? 132  THR B OG1   1 
ATOM   2429 C  CG2   . THR B 1 132 ? 13.408 -3.120  -19.771 1.00 21.08 ? 132  THR B CG2   1 
ATOM   2430 N  N     . GLY B 1 133 ? 15.801 -6.211  -17.236 1.00 18.89 ? 133  GLY B N     1 
ATOM   2431 C  CA    . GLY B 1 133 ? 16.881 -7.149  -17.023 1.00 18.36 ? 133  GLY B CA    1 
ATOM   2432 C  C     . GLY B 1 133 ? 18.198 -6.661  -17.588 1.00 18.37 ? 133  GLY B C     1 
ATOM   2433 O  O     . GLY B 1 133 ? 19.218 -7.340  -17.455 1.00 18.05 ? 133  GLY B O     1 
ATOM   2434 N  N     . GLY B 1 134 ? 18.222 -5.458  -18.163 1.00 18.24 ? 134  GLY B N     1 
ATOM   2435 C  CA    . GLY B 1 134 ? 19.514 -4.908  -18.638 1.00 18.65 ? 134  GLY B CA    1 
ATOM   2436 C  C     . GLY B 1 134 ? 20.631 -4.758  -17.622 1.00 18.48 ? 134  GLY B C     1 
ATOM   2437 O  O     . GLY B 1 134 ? 21.801 -5.108  -17.897 1.00 15.99 ? 134  GLY B O     1 
ATOM   2438 N  N     . THR B 1 135 ? 20.300 -4.246  -16.449 1.00 19.10 ? 135  THR B N     1 
ATOM   2439 C  CA    . THR B 1 135 ? 21.263 -4.064  -15.406 1.00 19.36 ? 135  THR B CA    1 
ATOM   2440 C  C     . THR B 1 135 ? 21.802 -5.436  -14.903 1.00 18.47 ? 135  THR B C     1 
ATOM   2441 O  O     . THR B 1 135 ? 23.011 -5.677  -14.887 1.00 17.48 ? 135  THR B O     1 
ATOM   2442 C  CB    . THR B 1 135 ? 20.590 -3.275  -14.249 1.00 20.82 ? 135  THR B CB    1 
ATOM   2443 O  OG1   . THR B 1 135 ? 19.981 -2.098  -14.778 1.00 20.45 ? 135  THR B OG1   1 
ATOM   2444 C  CG2   . THR B 1 135 ? 21.589 -2.882  -13.236 1.00 22.85 ? 135  THR B CG2   1 
ATOM   2445 N  N     . MET B 1 136 ? 20.903 -6.350  -14.560 1.00 16.77 ? 136  MET B N     1 
ATOM   2446 C  CA    . MET B 1 136 ? 21.349 -7.682  -14.134 1.00 17.34 ? 136  MET B CA    1 
ATOM   2447 C  C     . MET B 1 136 ? 22.173 -8.400  -15.224 1.00 16.68 ? 136  MET B C     1 
ATOM   2448 O  O     . MET B 1 136 ? 23.145 -9.097  -14.945 1.00 17.26 ? 136  MET B O     1 
ATOM   2449 C  CB    A MET B 1 136 ? 20.179 -8.521  -13.629 0.65 17.81 ? 136  MET B CB    1 
ATOM   2450 C  CB    B MET B 1 136 ? 20.147 -8.550  -13.769 0.35 16.93 ? 136  MET B CB    1 
ATOM   2451 C  CG    A MET B 1 136 ? 19.671 -8.069  -12.260 0.65 19.32 ? 136  MET B CG    1 
ATOM   2452 C  CG    B MET B 1 136 ? 19.599 -8.312  -12.389 0.35 16.34 ? 136  MET B CG    1 
ATOM   2453 S  SD    A MET B 1 136 ? 18.458 -9.169  -11.544 0.65 22.15 ? 136  MET B SD    1 
ATOM   2454 S  SD    B MET B 1 136 ? 20.667 -9.028  -11.132 0.35 13.05 ? 136  MET B SD    1 
ATOM   2455 C  CE    A MET B 1 136 ? 18.422 -8.573  -9.896  0.65 23.19 ? 136  MET B CE    1 
ATOM   2456 C  CE    B MET B 1 136 ? 19.501 -9.064  -9.806  0.35 12.72 ? 136  MET B CE    1 
ATOM   2457 N  N     . ASN B 1 137 ? 21.762 -8.236  -16.475 1.00 17.07 ? 137  ASN B N     1 
ATOM   2458 C  CA    . ASN B 1 137 ? 22.431 -8.886  -17.551 1.00 17.67 ? 137  ASN B CA    1 
ATOM   2459 C  C     . ASN B 1 137 ? 23.860 -8.372  -17.655 1.00 17.19 ? 137  ASN B C     1 
ATOM   2460 O  O     . ASN B 1 137 ? 24.790 -9.148  -17.837 1.00 17.73 ? 137  ASN B O     1 
ATOM   2461 C  CB    . ASN B 1 137 ? 21.672 -8.634  -18.849 1.00 18.71 ? 137  ASN B CB    1 
ATOM   2462 C  CG    . ASN B 1 137 ? 22.147 -9.476  -19.961 1.00 20.78 ? 137  ASN B CG    1 
ATOM   2463 O  OD1   . ASN B 1 137 ? 22.601 -8.968  -20.997 1.00 27.42 ? 137  ASN B OD1   1 
ATOM   2464 N  ND2   . ASN B 1 137 ? 22.039 -10.771 -19.790 1.00 20.59 ? 137  ASN B ND2   1 
ATOM   2465 N  N     . ALA B 1 138 ? 24.042 -7.065  -17.485 1.00 16.66 ? 138  ALA B N     1 
ATOM   2466 C  CA    . ALA B 1 138 ? 25.353 -6.450  -17.549 1.00 15.96 ? 138  ALA B CA    1 
ATOM   2467 C  C     . ALA B 1 138 ? 26.211 -6.924  -16.390 1.00 16.65 ? 138  ALA B C     1 
ATOM   2468 O  O     . ALA B 1 138 ? 27.403 -7.132  -16.538 1.00 16.61 ? 138  ALA B O     1 
ATOM   2469 C  CB    . ALA B 1 138 ? 25.225 -4.936  -17.509 1.00 16.54 ? 138  ALA B CB    1 
ATOM   2470 N  N     . ALA B 1 139 ? 25.623 -7.030  -15.203 1.00 14.21 ? 139  ALA B N     1 
ATOM   2471 C  CA    . ALA B 1 139 ? 26.328 -7.577  -14.041 1.00 15.05 ? 139  ALA B CA    1 
ATOM   2472 C  C     . ALA B 1 139 ? 26.755 -8.995  -14.348 1.00 14.42 ? 139  ALA B C     1 
ATOM   2473 O  O     . ALA B 1 139 ? 27.890 -9.306  -14.112 1.00 19.04 ? 139  ALA B O     1 
ATOM   2474 C  CB    . ALA B 1 139 ? 25.451 -7.502  -12.772 1.00 14.68 ? 139  ALA B CB    1 
ATOM   2475 N  N     . CYS B 1 140 ? 25.868 -9.852  -14.889 1.00 14.98 ? 140  CYS B N     1 
ATOM   2476 C  CA    . CYS B 1 140 ? 26.221 -11.230 -15.244 1.00 15.93 ? 140  CYS B CA    1 
ATOM   2477 C  C     . CYS B 1 140 ? 27.415 -11.299 -16.220 1.00 17.82 ? 140  CYS B C     1 
ATOM   2478 O  O     . CYS B 1 140 ? 28.296 -12.140 -16.080 1.00 18.02 ? 140  CYS B O     1 
ATOM   2479 C  CB    . CYS B 1 140 ? 25.013 -11.950 -15.841 1.00 17.16 ? 140  CYS B CB    1 
ATOM   2480 S  SG    . CYS B 1 140 ? 23.770 -12.371 -14.603 1.00 18.45 ? 140  CYS B SG    1 
ATOM   2481 N  N     . GLU B 1 141 ? 27.404 -10.423 -17.230 1.00 18.69 ? 141  GLU B N     1 
ATOM   2482 C  CA    . GLU B 1 141 ? 28.484 -10.277 -18.178 1.00 19.73 ? 141  GLU B CA    1 
ATOM   2483 C  C     . GLU B 1 141 ? 29.813 -10.025 -17.519 1.00 19.63 ? 141  GLU B C     1 
ATOM   2484 O  O     . GLU B 1 141 ? 30.847 -10.659 -17.851 1.00 18.71 ? 141  GLU B O     1 
ATOM   2485 C  CB    . GLU B 1 141 ? 28.196 -9.104  -19.139 1.00 20.77 ? 141  GLU B CB    1 
ATOM   2486 C  CG    . GLU B 1 141 ? 29.386 -8.784  -20.040 1.00 23.39 ? 141  GLU B CG    1 
ATOM   2487 C  CD    . GLU B 1 141 ? 29.240 -7.545  -20.924 1.00 29.71 ? 141  GLU B CD    1 
ATOM   2488 O  OE1   . GLU B 1 141 ? 30.323 -6.951  -21.258 1.00 31.26 ? 141  GLU B OE1   1 
ATOM   2489 O  OE2   . GLU B 1 141 ? 28.087 -7.188  -21.326 1.00 28.31 ? 141  GLU B OE2   1 
ATOM   2490 N  N     . LEU B 1 142 ? 29.830 -9.032  -16.636 1.00 19.64 ? 142  LEU B N     1 
ATOM   2491 C  CA    . LEU B 1 142 ? 31.058 -8.713  -15.893 1.00 19.93 ? 142  LEU B CA    1 
ATOM   2492 C  C     . LEU B 1 142 ? 31.558 -9.840  -15.028 1.00 19.96 ? 142  LEU B C     1 
ATOM   2493 O  O     . LEU B 1 142 ? 32.762 -10.099 -14.985 1.00 18.16 ? 142  LEU B O     1 
ATOM   2494 C  CB    . LEU B 1 142 ? 30.866 -7.499  -14.978 1.00 21.05 ? 142  LEU B CB    1 
ATOM   2495 C  CG    . LEU B 1 142 ? 30.725 -6.152  -15.664 1.00 22.62 ? 142  LEU B CG    1 
ATOM   2496 C  CD1   . LEU B 1 142 ? 30.172 -5.125  -14.652 1.00 22.89 ? 142  LEU B CD1   1 
ATOM   2497 C  CD2   . LEU B 1 142 ? 32.025 -5.678  -16.283 1.00 23.34 ? 142  LEU B CD2   1 
ATOM   2498 N  N     . LEU B 1 143 ? 30.646 -10.503 -14.303 1.00 17.88 ? 143  LEU B N     1 
ATOM   2499 C  CA    . LEU B 1 143 ? 31.073 -11.598 -13.466 1.00 18.02 ? 143  LEU B CA    1 
ATOM   2500 C  C     . LEU B 1 143 ? 31.630 -12.727 -14.325 1.00 18.42 ? 143  LEU B C     1 
ATOM   2501 O  O     . LEU B 1 143 ? 32.675 -13.306 -14.004 1.00 19.08 ? 143  LEU B O     1 
ATOM   2502 C  CB    . LEU B 1 143 ? 29.908 -12.044 -12.569 1.00 18.45 ? 143  LEU B CB    1 
ATOM   2503 C  CG    . LEU B 1 143 ? 29.514 -10.899 -11.636 1.00 15.82 ? 143  LEU B CG    1 
ATOM   2504 C  CD1   . LEU B 1 143 ? 28.110 -11.110 -11.103 1.00 14.99 ? 143  LEU B CD1   1 
ATOM   2505 C  CD2   . LEU B 1 143 ? 30.498 -10.825 -10.504 1.00 17.94 ? 143  LEU B CD2   1 
ATOM   2506 N  N     . GLY B 1 144 ? 30.974 -13.007 -15.442 1.00 18.25 ? 144  GLY B N     1 
ATOM   2507 C  CA    . GLY B 1 144 ? 31.405 -14.047 -16.350 1.00 19.22 ? 144  GLY B CA    1 
ATOM   2508 C  C     . GLY B 1 144 ? 32.805 -13.791 -16.846 1.00 20.12 ? 144  GLY B C     1 
ATOM   2509 O  O     . GLY B 1 144 ? 33.560 -14.731 -17.053 1.00 20.99 ? 144  GLY B O     1 
ATOM   2510 N  N     . ARG B 1 145 ? 33.147 -12.517 -17.041 1.00 20.41 ? 145  ARG B N     1 
ATOM   2511 C  CA    . ARG B 1 145 ? 34.464 -12.114 -17.511 1.00 20.38 ? 145  ARG B CA    1 
ATOM   2512 C  C     . ARG B 1 145 ? 35.607 -12.253 -16.493 1.00 20.09 ? 145  ARG B C     1 
ATOM   2513 O  O     . ARG B 1 145 ? 36.787 -12.352 -16.907 1.00 18.97 ? 145  ARG B O     1 
ATOM   2514 C  CB    . ARG B 1 145 ? 34.449 -10.709 -18.113 1.00 20.17 ? 145  ARG B CB    1 
ATOM   2515 C  CG    . ARG B 1 145 ? 33.598 -10.669 -19.395 1.00 21.82 ? 145  ARG B CG    1 
ATOM   2516 C  CD    . ARG B 1 145 ? 33.347 -9.293  -19.852 1.00 22.86 ? 145  ARG B CD    1 
ATOM   2517 N  NE    . ARG B 1 145 ? 34.594 -8.544  -20.008 1.00 25.37 ? 145  ARG B NE    1 
ATOM   2518 C  CZ    . ARG B 1 145 ? 34.676 -7.216  -19.986 1.00 26.05 ? 145  ARG B CZ    1 
ATOM   2519 N  NH1   . ARG B 1 145 ? 33.585 -6.471  -19.830 1.00 28.63 ? 145  ARG B NH1   1 
ATOM   2520 N  NH2   . ARG B 1 145 ? 35.857 -6.644  -20.113 1.00 28.22 ? 145  ARG B NH2   1 
ATOM   2521 N  N     . LEU B 1 146 ? 35.265 -12.335 -15.209 1.00 19.06 ? 146  LEU B N     1 
ATOM   2522 C  CA    . LEU B 1 146 ? 36.228 -12.677 -14.156 1.00 18.00 ? 146  LEU B CA    1 
ATOM   2523 C  C     . LEU B 1 146 ? 36.337 -14.185 -14.000 1.00 18.46 ? 146  LEU B C     1 
ATOM   2524 O  O     . LEU B 1 146 ? 37.041 -14.700 -13.112 1.00 18.07 ? 146  LEU B O     1 
ATOM   2525 C  CB    . LEU B 1 146 ? 35.780 -12.077 -12.819 1.00 17.05 ? 146  LEU B CB    1 
ATOM   2526 C  CG    . LEU B 1 146 ? 35.733 -10.581 -12.657 1.00 17.72 ? 146  LEU B CG    1 
ATOM   2527 C  CD1   . LEU B 1 146 ? 35.418 -10.201 -11.209 1.00 18.33 ? 146  LEU B CD1   1 
ATOM   2528 C  CD2   . LEU B 1 146 ? 36.989 -9.931  -13.166 1.00 17.15 ? 146  LEU B CD2   1 
ATOM   2529 N  N     . GLN B 1 147 ? 35.599 -14.891 -14.852 1.00 18.17 ? 147  GLN B N     1 
ATOM   2530 C  CA    . GLN B 1 147 ? 35.518 -16.344 -14.865 1.00 18.65 ? 147  GLN B CA    1 
ATOM   2531 C  C     . GLN B 1 147 ? 34.830 -16.850 -13.584 1.00 17.63 ? 147  GLN B C     1 
ATOM   2532 O  O     . GLN B 1 147 ? 35.069 -17.955 -13.125 1.00 17.87 ? 147  GLN B O     1 
ATOM   2533 C  CB    . GLN B 1 147 ? 36.912 -16.987 -15.096 1.00 18.23 ? 147  GLN B CB    1 
ATOM   2534 C  CG    . GLN B 1 147 ? 37.625 -16.526 -16.391 1.00 22.83 ? 147  GLN B CG    1 
ATOM   2535 C  CD    . GLN B 1 147 ? 39.051 -17.012 -16.386 1.00 26.22 ? 147  GLN B CD    1 
ATOM   2536 O  OE1   . GLN B 1 147 ? 39.275 -18.217 -16.399 1.00 29.40 ? 147  GLN B OE1   1 
ATOM   2537 N  NE2   . GLN B 1 147 ? 40.021 -16.094 -16.260 1.00 29.93 ? 147  GLN B NE2   1 
ATOM   2538 N  N     . ALA B 1 148 ? 33.941 -16.023 -13.047 1.00 17.46 ? 148  ALA B N     1 
ATOM   2539 C  CA    . ALA B 1 148 ? 33.060 -16.397 -11.950 1.00 17.60 ? 148  ALA B CA    1 
ATOM   2540 C  C     . ALA B 1 148 ? 31.788 -17.047 -12.490 1.00 17.64 ? 148  ALA B C     1 
ATOM   2541 O  O     . ALA B 1 148 ? 31.340 -16.717 -13.561 1.00 18.15 ? 148  ALA B O     1 
ATOM   2542 C  CB    . ALA B 1 148 ? 32.730 -15.157 -11.113 1.00 16.63 ? 148  ALA B CB    1 
ATOM   2543 N  N     . GLU B 1 149 ? 31.158 -17.919 -11.719 1.00 15.92 ? 149  GLU B N     1 
ATOM   2544 C  CA    . GLU B 1 149 ? 29.916 -18.513 -12.124 1.00 17.00 ? 149  GLU B CA    1 
ATOM   2545 C  C     . GLU B 1 149 ? 28.744 -17.833 -11.453 1.00 16.15 ? 149  GLU B C     1 
ATOM   2546 O  O     . GLU B 1 149 ? 28.693 -17.784 -10.202 1.00 15.34 ? 149  GLU B O     1 
ATOM   2547 C  CB    . GLU B 1 149 ? 29.981 -20.007 -11.797 1.00 17.81 ? 149  GLU B CB    1 
ATOM   2548 C  CG    . GLU B 1 149 ? 28.690 -20.793 -12.070 1.00 21.49 ? 149  GLU B CG    1 
ATOM   2549 C  CD    . GLU B 1 149 ? 28.850 -22.285 -11.735 1.00 20.70 ? 149  GLU B CD    1 
ATOM   2550 O  OE1   . GLU B 1 149 ? 29.925 -22.687 -11.223 1.00 23.90 ? 149  GLU B OE1   1 
ATOM   2551 O  OE2   . GLU B 1 149 ? 27.890 -23.014 -11.995 1.00 26.23 ? 149  GLU B OE2   1 
ATOM   2552 N  N     . VAL B 1 150 ? 27.802 -17.315 -12.248 1.00 15.00 ? 150  VAL B N     1 
ATOM   2553 C  CA    . VAL B 1 150 ? 26.596 -16.749 -11.680 1.00 15.49 ? 150  VAL B CA    1 
ATOM   2554 C  C     . VAL B 1 150 ? 25.546 -17.821 -11.514 1.00 15.07 ? 150  VAL B C     1 
ATOM   2555 O  O     . VAL B 1 150 ? 24.934 -18.265 -12.509 1.00 15.27 ? 150  VAL B O     1 
ATOM   2556 C  CB    . VAL B 1 150 ? 26.005 -15.568 -12.515 1.00 14.93 ? 150  VAL B CB    1 
ATOM   2557 C  CG1   . VAL B 1 150 ? 24.784 -15.029 -11.824 1.00 15.27 ? 150  VAL B CG1   1 
ATOM   2558 C  CG2   . VAL B 1 150 ? 27.033 -14.482 -12.688 1.00 17.98 ? 150  VAL B CG2   1 
ATOM   2559 N  N     . LEU B 1 151 ? 25.333 -18.212 -10.266 1.00 13.72 ? 151  LEU B N     1 
ATOM   2560 C  CA    . LEU B 1 151 ? 24.339 -19.212 -9.910  1.00 13.75 ? 151  LEU B CA    1 
ATOM   2561 C  C     . LEU B 1 151 ? 22.890 -18.781 -10.097 1.00 13.93 ? 151  LEU B C     1 
ATOM   2562 O  O     . LEU B 1 151 ? 22.063 -19.612 -10.481 1.00 13.56 ? 151  LEU B O     1 
ATOM   2563 C  CB    . LEU B 1 151 ? 24.542 -19.610 -8.454  1.00 14.13 ? 151  LEU B CB    1 
ATOM   2564 C  CG    . LEU B 1 151 ? 25.887 -20.210 -8.144  1.00 13.57 ? 151  LEU B CG    1 
ATOM   2565 C  CD1   . LEU B 1 151 ? 25.874 -20.550 -6.693  1.00 12.92 ? 151  LEU B CD1   1 
ATOM   2566 C  CD2   . LEU B 1 151 ? 26.202 -21.372 -8.950  1.00 16.56 ? 151  LEU B CD2   1 
ATOM   2567 N  N     . GLU B 1 152 ? 22.578 -17.518 -9.809  1.00 13.95 ? 152  GLU B N     1 
ATOM   2568 C  CA    . GLU B 1 152 ? 21.232 -16.989 -9.881  1.00 14.89 ? 152  GLU B CA    1 
ATOM   2569 C  C     . GLU B 1 152 ? 21.310 -15.475 -9.690  1.00 14.31 ? 152  GLU B C     1 
ATOM   2570 O  O     . GLU B 1 152 ? 22.233 -14.985 -9.046  1.00 13.44 ? 152  GLU B O     1 
ATOM   2571 C  CB    . GLU B 1 152 ? 20.403 -17.571 -8.708  1.00 15.44 ? 152  GLU B CB    1 
ATOM   2572 C  CG    . GLU B 1 152 ? 18.917 -17.245 -8.681  1.00 16.02 ? 152  GLU B CG    1 
ATOM   2573 C  CD    . GLU B 1 152 ? 18.151 -18.062 -7.652  1.00 18.93 ? 152  GLU B CD    1 
ATOM   2574 O  OE1   . GLU B 1 152 ? 18.755 -18.754 -6.824  1.00 17.60 ? 152  GLU B OE1   1 
ATOM   2575 O  OE2   . GLU B 1 152 ? 16.896 -18.080 -7.662  1.00 25.11 ? 152  GLU B OE2   1 
ATOM   2576 N  N     . CYS B 1 153 ? 20.290 -14.766 -10.159 1.00 13.97 ? 153  CYS B N     1 
ATOM   2577 C  CA    . CYS B 1 153 ? 20.060 -13.376 -9.800  1.00 13.19 ? 153  CYS B CA    1 
ATOM   2578 C  C     . CYS B 1 153 ? 18.744 -13.356 -9.062  1.00 14.06 ? 153  CYS B C     1 
ATOM   2579 O  O     . CYS B 1 153 ? 17.833 -14.100 -9.409  1.00 12.91 ? 153  CYS B O     1 
ATOM   2580 C  CB    . CYS B 1 153 ? 19.981 -12.461 -11.037 1.00 14.93 ? 153  CYS B CB    1 
ATOM   2581 S  SG    . CYS B 1 153 ? 21.403 -12.458 -12.047 1.00 16.29 ? 153  CYS B SG    1 
ATOM   2582 N  N     . VAL B 1 154 ? 18.655 -12.526 -8.029  1.00 14.33 ? 154  VAL B N     1 
ATOM   2583 C  CA    . VAL B 1 154 ? 17.446 -12.422 -7.220  1.00 13.25 ? 154  VAL B CA    1 
ATOM   2584 C  C     . VAL B 1 154 ? 17.048 -10.967 -6.985  1.00 13.15 ? 154  VAL B C     1 
ATOM   2585 O  O     . VAL B 1 154 ? 17.879 -10.084 -6.947  1.00 14.32 ? 154  VAL B O     1 
ATOM   2586 C  CB    . VAL B 1 154 ? 17.599 -13.164 -5.841  1.00 13.26 ? 154  VAL B CB    1 
ATOM   2587 C  CG1   . VAL B 1 154 ? 17.850 -14.679 -6.031  1.00 9.74  ? 154  VAL B CG1   1 
ATOM   2588 C  CG2   . VAL B 1 154 ? 18.671 -12.570 -4.974  1.00 14.39 ? 154  VAL B CG2   1 
ATOM   2589 N  N     . SER B 1 155 ? 15.762 -10.722 -6.736  1.00 13.95 ? 155  SER B N     1 
ATOM   2590 C  CA    . SER B 1 155 ? 15.295 -9.378  -6.456  1.00 14.24 ? 155  SER B CA    1 
ATOM   2591 C  C     . SER B 1 155 ? 14.081 -9.484  -5.547  1.00 14.86 ? 155  SER B C     1 
ATOM   2592 O  O     . SER B 1 155 ? 13.510 -10.563 -5.418  1.00 13.73 ? 155  SER B O     1 
ATOM   2593 C  CB    . SER B 1 155 ? 14.908 -8.687  -7.798  1.00 13.26 ? 155  SER B CB    1 
ATOM   2594 O  OG    . SER B 1 155 ? 13.650 -9.229  -8.239  1.00 15.30 ? 155  SER B OG    1 
ATOM   2595 N  N     . LEU B 1 156 ? 13.696 -8.370  -4.917  1.00 15.24 ? 156  LEU B N     1 
ATOM   2596 C  CA    . LEU B 1 156 ? 12.448 -8.331  -4.189  1.00 14.97 ? 156  LEU B CA    1 
ATOM   2597 C  C     . LEU B 1 156 ? 11.267 -8.306  -5.149  1.00 14.78 ? 156  LEU B C     1 
ATOM   2598 O  O     . LEU B 1 156 ? 10.281 -8.931  -4.904  1.00 15.36 ? 156  LEU B O     1 
ATOM   2599 C  CB    . LEU B 1 156 ? 12.399 -7.109  -3.228  1.00 15.32 ? 156  LEU B CB    1 
ATOM   2600 C  CG    . LEU B 1 156 ? 13.289 -7.241  -1.967  1.00 15.80 ? 156  LEU B CG    1 
ATOM   2601 C  CD1   . LEU B 1 156 ? 14.743 -6.879  -2.179  1.00 12.56 ? 156  LEU B CD1   1 
ATOM   2602 C  CD2   . LEU B 1 156 ? 12.698 -6.357  -0.877  1.00 16.10 ? 156  LEU B CD2   1 
ATOM   2603 N  N     . VAL B 1 157 ? 11.384 -7.581  -6.238  1.00 14.14 ? 157  VAL B N     1 
ATOM   2604 C  CA    . VAL B 1 157 ? 10.254 -7.339  -7.158  1.00 13.56 ? 157  VAL B CA    1 
ATOM   2605 C  C     . VAL B 1 157 ? 10.674 -7.658  -8.589  1.00 12.81 ? 157  VAL B C     1 
ATOM   2606 O  O     . VAL B 1 157 ? 11.809 -7.397  -8.998  1.00 13.00 ? 157  VAL B O     1 
ATOM   2607 C  CB    . VAL B 1 157 ? 9.812  -5.849  -7.055  1.00 13.46 ? 157  VAL B CB    1 
ATOM   2608 C  CG1   . VAL B 1 157 ? 8.828  -5.453  -8.139  1.00 14.24 ? 157  VAL B CG1   1 
ATOM   2609 C  CG2   . VAL B 1 157 ? 9.318  -5.531  -5.670  1.00 15.69 ? 157  VAL B CG2   1 
ATOM   2610 N  N     . GLU B 1 158 ? 9.707  -8.176  -9.352  1.00 13.44 ? 158  GLU B N     1 
ATOM   2611 C  CA    . GLU B 1 158 ? 9.913  -8.484  -10.750 1.00 12.97 ? 158  GLU B CA    1 
ATOM   2612 C  C     . GLU B 1 158 ? 8.743  -7.973  -11.540 1.00 12.76 ? 158  GLU B C     1 
ATOM   2613 O  O     . GLU B 1 158 ? 7.618  -8.168  -11.175 1.00 11.26 ? 158  GLU B O     1 
ATOM   2614 C  CB    . GLU B 1 158 ? 10.069 -10.013 -10.921 1.00 13.15 ? 158  GLU B CB    1 
ATOM   2615 C  CG    . GLU B 1 158 ? 9.897  -10.531 -12.344 1.00 14.91 ? 158  GLU B CG    1 
ATOM   2616 C  CD    . GLU B 1 158 ? 9.933  -12.041 -12.467 1.00 17.37 ? 158  GLU B CD    1 
ATOM   2617 O  OE1   . GLU B 1 158 ? 10.063 -12.558 -13.633 1.00 17.30 ? 158  GLU B OE1   1 
ATOM   2618 O  OE2   . GLU B 1 158 ? 9.810  -12.692 -11.415 1.00 18.16 ? 158  GLU B OE2   1 
ATOM   2619 N  N     . LEU B 1 159 ? 9.021  -7.360  -12.679 1.00 13.04 ? 159  LEU B N     1 
ATOM   2620 C  CA    . LEU B 1 159 ? 7.914  -6.833  -13.533 1.00 15.60 ? 159  LEU B CA    1 
ATOM   2621 C  C     . LEU B 1 159 ? 7.771  -7.803  -14.695 1.00 14.99 ? 159  LEU B C     1 
ATOM   2622 O  O     . LEU B 1 159 ? 8.583  -7.819  -15.575 1.00 14.64 ? 159  LEU B O     1 
ATOM   2623 C  CB    . LEU B 1 159 ? 8.284  -5.391  -13.963 1.00 15.57 ? 159  LEU B CB    1 
ATOM   2624 C  CG    . LEU B 1 159 ? 7.988  -4.143  -13.068 1.00 20.76 ? 159  LEU B CG    1 
ATOM   2625 C  CD1   . LEU B 1 159 ? 7.617  -4.378  -11.645 1.00 17.32 ? 159  LEU B CD1   1 
ATOM   2626 C  CD2   . LEU B 1 159 ? 9.058  -3.042  -13.197 1.00 20.19 ? 159  LEU B CD2   1 
ATOM   2627 N  N     . THR B 1 160 ? 6.767  -8.680  -14.640 1.00 15.80 ? 160  THR B N     1 
ATOM   2628 C  CA    . THR B 1 160 ? 6.759  -9.838  -15.513 1.00 16.24 ? 160  THR B CA    1 
ATOM   2629 C  C     . THR B 1 160 ? 6.496  -9.498  -16.964 1.00 16.51 ? 160  THR B C     1 
ATOM   2630 O  O     . THR B 1 160 ? 6.991  -10.177 -17.847 1.00 16.51 ? 160  THR B O     1 
ATOM   2631 C  CB    . THR B 1 160 ? 5.765  -10.882 -15.039 1.00 17.15 ? 160  THR B CB    1 
ATOM   2632 O  OG1   . THR B 1 160 ? 4.490  -10.277 -14.910 1.00 18.04 ? 160  THR B OG1   1 
ATOM   2633 C  CG2   . THR B 1 160 ? 6.166  -11.394 -13.702 1.00 17.78 ? 160  THR B CG2   1 
ATOM   2634 N  N     . SER B 1 161 ? 5.746  -8.437  -17.216 1.00 16.50 ? 161  SER B N     1 
ATOM   2635 C  CA    . SER B 1 161 ? 5.407  -8.128  -18.630 1.00 17.52 ? 161  SER B CA    1 
ATOM   2636 C  C     . SER B 1 161 ? 6.641  -7.679  -19.380 1.00 16.79 ? 161  SER B C     1 
ATOM   2637 O  O     . SER B 1 161 ? 6.625  -7.622  -20.622 1.00 19.54 ? 161  SER B O     1 
ATOM   2638 C  CB    . SER B 1 161 ? 4.308  -7.080  -18.663 1.00 18.65 ? 161  SER B CB    1 
ATOM   2639 O  OG    . SER B 1 161 ? 4.842  -5.811  -18.285 1.00 21.07 ? 161  SER B OG    1 
ATOM   2640 N  N     . LEU B 1 162 ? 7.717  -7.377  -18.642 1.00 16.51 ? 162  LEU B N     1 
ATOM   2641 C  CA    . LEU B 1 162 ? 8.968  -6.899  -19.222 1.00 16.69 ? 162  LEU B CA    1 
ATOM   2642 C  C     . LEU B 1 162 ? 9.908  -8.017  -19.606 1.00 16.62 ? 162  LEU B C     1 
ATOM   2643 O  O     . LEU B 1 162 ? 10.927 -7.767  -20.269 1.00 18.52 ? 162  LEU B O     1 
ATOM   2644 C  CB    . LEU B 1 162 ? 9.678  -5.923  -18.314 1.00 16.67 ? 162  LEU B CB    1 
ATOM   2645 C  CG    . LEU B 1 162 ? 9.382  -4.449  -18.407 1.00 17.85 ? 162  LEU B CG    1 
ATOM   2646 C  CD1   . LEU B 1 162 ? 8.141  -4.101  -19.173 1.00 15.55 ? 162  LEU B CD1   1 
ATOM   2647 C  CD2   . LEU B 1 162 ? 9.563  -3.684  -17.156 1.00 19.10 ? 162  LEU B CD2   1 
ATOM   2648 N  N     . LYS B 1 163 ? 9.568  -9.245  -19.241 1.00 17.49 ? 163  LYS B N     1 
ATOM   2649 C  CA    . LYS B 1 163 ? 10.345 -10.443 -19.616 1.00 18.45 ? 163  LYS B CA    1 
ATOM   2650 C  C     . LYS B 1 163 ? 11.823 -10.315 -19.311 1.00 18.86 ? 163  LYS B C     1 
ATOM   2651 O  O     . LYS B 1 163 ? 12.662 -10.851 -20.013 1.00 19.27 ? 163  LYS B O     1 
ATOM   2652 C  CB    . LYS B 1 163 ? 10.141 -10.778 -21.107 1.00 19.24 ? 163  LYS B CB    1 
ATOM   2653 C  CG    . LYS B 1 163 ? 8.676  -11.048 -21.485 1.00 20.37 ? 163  LYS B CG    1 
ATOM   2654 C  CD    . LYS B 1 163 ? 8.505  -11.314 -23.055 1.00 21.80 ? 163  LYS B CD    1 
ATOM   2655 C  CE    . LYS B 1 163 ? 7.035  -11.695 -23.432 1.00 23.68 ? 163  LYS B CE    1 
ATOM   2656 N  NZ    . LYS B 1 163 ? 6.788  -12.110 -24.914 1.00 26.33 ? 163  LYS B NZ    1 
ATOM   2657 N  N     . GLY B 1 164 ? 12.145 -9.631  -18.239 1.00 19.72 ? 164  GLY B N     1 
ATOM   2658 C  CA    . GLY B 1 164 ? 13.530 -9.614  -17.741 1.00 21.27 ? 164  GLY B CA    1 
ATOM   2659 C  C     . GLY B 1 164 ? 14.121 -10.987 -17.519 1.00 21.67 ? 164  GLY B C     1 
ATOM   2660 O  O     . GLY B 1 164 ? 15.291 -11.174 -17.760 1.00 23.31 ? 164  GLY B O     1 
ATOM   2661 N  N     . ARG B 1 165 ? 13.327 -11.908 -16.985 1.00 22.63 ? 165  ARG B N     1 
ATOM   2662 C  CA    . ARG B 1 165 ? 13.711 -13.309 -16.786 1.00 23.29 ? 165  ARG B CA    1 
ATOM   2663 C  C     . ARG B 1 165 ? 14.355 -13.924 -18.078 1.00 24.44 ? 165  ARG B C     1 
ATOM   2664 O  O     . ARG B 1 165 ? 15.501 -14.427 -18.105 1.00 24.58 ? 165  ARG B O     1 
ATOM   2665 C  CB    A ARG B 1 165 ? 12.478 -14.124 -16.351 0.65 22.89 ? 165  ARG B CB    1 
ATOM   2666 C  CB    B ARG B 1 165 ? 12.472 -14.109 -16.367 0.35 22.90 ? 165  ARG B CB    1 
ATOM   2667 C  CG    A ARG B 1 165 ? 12.703 -15.602 -16.327 0.65 24.42 ? 165  ARG B CG    1 
ATOM   2668 C  CG    B ARG B 1 165 ? 12.759 -15.442 -15.760 0.35 22.93 ? 165  ARG B CG    1 
ATOM   2669 C  CD    A ARG B 1 165 ? 11.521 -16.355 -15.817 0.65 25.90 ? 165  ARG B CD    1 
ATOM   2670 C  CD    B ARG B 1 165 ? 11.508 -16.032 -15.165 0.35 22.21 ? 165  ARG B CD    1 
ATOM   2671 N  NE    A ARG B 1 165 ? 11.397 -16.250 -14.370 0.65 26.52 ? 165  ARG B NE    1 
ATOM   2672 N  NE    B ARG B 1 165 ? 11.152 -15.437 -13.876 0.35 22.21 ? 165  ARG B NE    1 
ATOM   2673 C  CZ    A ARG B 1 165 ? 11.989 -17.043 -13.477 0.65 26.35 ? 165  ARG B CZ    1 
ATOM   2674 C  CZ    B ARG B 1 165 ? 11.258 -16.038 -12.690 0.35 20.61 ? 165  ARG B CZ    1 
ATOM   2675 N  NH1   A ARG B 1 165 ? 12.787 -18.035 -13.854 0.65 27.89 ? 165  ARG B NH1   1 
ATOM   2676 N  NH1   B ARG B 1 165 ? 11.744 -17.271 -12.581 0.35 19.75 ? 165  ARG B NH1   1 
ATOM   2677 N  NH2   A ARG B 1 165 ? 11.768 -16.833 -12.184 0.65 27.19 ? 165  ARG B NH2   1 
ATOM   2678 N  NH2   B ARG B 1 165 ? 10.883 -15.398 -11.605 0.35 19.41 ? 165  ARG B NH2   1 
ATOM   2679 N  N     . GLU B 1 166 ? 13.586 -13.859 -19.166 1.00 25.40 ? 166  GLU B N     1 
ATOM   2680 C  CA    . GLU B 1 166 ? 14.047 -14.360 -20.466 1.00 25.14 ? 166  GLU B CA    1 
ATOM   2681 C  C     . GLU B 1 166 ? 15.351 -13.742 -20.863 1.00 24.03 ? 166  GLU B C     1 
ATOM   2682 O  O     . GLU B 1 166 ? 16.202 -14.403 -21.440 1.00 23.19 ? 166  GLU B O     1 
ATOM   2683 C  CB    A GLU B 1 166 ? 13.042 -14.048 -21.569 0.65 25.29 ? 166  GLU B CB    1 
ATOM   2684 C  CB    B GLU B 1 166 ? 12.965 -14.133 -21.534 0.35 25.34 ? 166  GLU B CB    1 
ATOM   2685 C  CG    A GLU B 1 166 ? 11.833 -14.902 -21.519 0.65 26.75 ? 166  GLU B CG    1 
ATOM   2686 C  CG    B GLU B 1 166 ? 11.883 -15.237 -21.586 0.35 26.92 ? 166  GLU B CG    1 
ATOM   2687 C  CD    A GLU B 1 166 ? 10.728 -14.386 -22.417 0.65 27.16 ? 166  GLU B CD    1 
ATOM   2688 C  CD    B GLU B 1 166 ? 10.857 -15.197 -20.443 0.35 27.92 ? 166  GLU B CD    1 
ATOM   2689 O  OE1   A GLU B 1 166 ? 11.014 -14.124 -23.614 0.65 25.44 ? 166  GLU B OE1   1 
ATOM   2690 O  OE1   B GLU B 1 166 ? 10.443 -14.091 -20.041 0.35 28.68 ? 166  GLU B OE1   1 
ATOM   2691 O  OE2   A GLU B 1 166 ? 9.582  -14.246 -21.915 0.65 27.78 ? 166  GLU B OE2   1 
ATOM   2692 O  OE2   B GLU B 1 166 ? 10.446 -16.278 -19.962 0.35 27.25 ? 166  GLU B OE2   1 
ATOM   2693 N  N     . LYS B 1 167 ? 15.516 -12.460 -20.613 1.00 23.21 ? 167  LYS B N     1 
ATOM   2694 C  CA    . LYS B 1 167 ? 16.778 -11.838 -20.949 1.00 22.31 ? 167  LYS B CA    1 
ATOM   2695 C  C     . LYS B 1 167 ? 17.946 -12.477 -20.190 1.00 22.35 ? 167  LYS B C     1 
ATOM   2696 O  O     . LYS B 1 167 ? 19.027 -12.640 -20.743 1.00 22.25 ? 167  LYS B O     1 
ATOM   2697 C  CB    . LYS B 1 167 ? 16.707 -10.343 -20.679 1.00 23.38 ? 167  LYS B CB    1 
ATOM   2698 C  CG    . LYS B 1 167 ? 18.052 -9.713  -20.530 1.00 26.45 ? 167  LYS B CG    1 
ATOM   2699 C  CD    . LYS B 1 167 ? 18.506 -8.946  -21.672 1.00 28.95 ? 167  LYS B CD    1 
ATOM   2700 C  CE    . LYS B 1 167 ? 18.098 -7.491  -21.465 1.00 31.23 ? 167  LYS B CE    1 
ATOM   2701 N  NZ    . LYS B 1 167 ? 19.125 -6.559  -22.040 1.00 34.58 ? 167  LYS B NZ    1 
ATOM   2702 N  N     . LEU B 1 168 ? 17.739 -12.817 -18.916 1.00 21.25 ? 168  LEU B N     1 
ATOM   2703 C  CA    . LEU B 1 168 ? 18.804 -13.445 -18.123 1.00 20.69 ? 168  LEU B CA    1 
ATOM   2704 C  C     . LEU B 1 168 ? 19.029 -14.903 -18.457 1.00 20.31 ? 168  LEU B C     1 
ATOM   2705 O  O     . LEU B 1 168 ? 20.131 -15.364 -18.283 1.00 18.63 ? 168  LEU B O     1 
ATOM   2706 C  CB    . LEU B 1 168 ? 18.527 -13.323 -16.603 1.00 20.58 ? 168  LEU B CB    1 
ATOM   2707 C  CG    . LEU B 1 168 ? 18.469 -11.890 -16.064 1.00 21.27 ? 168  LEU B CG    1 
ATOM   2708 C  CD1   . LEU B 1 168 ? 18.180 -11.912 -14.603 1.00 22.24 ? 168  LEU B CD1   1 
ATOM   2709 C  CD2   . LEU B 1 168 ? 19.798 -11.155 -16.363 1.00 20.48 ? 168  LEU B CD2   1 
ATOM   2710 N  N     . ALA B 1 169 ? 17.989 -15.640 -18.869 1.00 21.21 ? 169  ALA B N     1 
ATOM   2711 C  CA    . ALA B 1 169 ? 18.194 -17.059 -19.252 1.00 21.66 ? 169  ALA B CA    1 
ATOM   2712 C  C     . ALA B 1 169 ? 19.472 -17.174 -20.085 1.00 22.32 ? 169  ALA B C     1 
ATOM   2713 O  O     . ALA B 1 169 ? 19.721 -16.338 -20.974 1.00 24.62 ? 169  ALA B O     1 
ATOM   2714 C  CB    . ALA B 1 169 ? 17.038 -17.636 -20.000 1.00 22.42 ? 169  ALA B CB    1 
ATOM   2715 N  N     . PRO B 1 170 ? 20.285 -18.202 -19.818 1.00 21.88 ? 170  PRO B N     1 
ATOM   2716 C  CA    . PRO B 1 170 ? 19.993 -19.373 -18.974 1.00 21.31 ? 170  PRO B CA    1 
ATOM   2717 C  C     . PRO B 1 170 ? 20.311 -19.196 -17.478 1.00 20.86 ? 170  PRO B C     1 
ATOM   2718 O  O     . PRO B 1 170 ? 20.215 -20.153 -16.726 1.00 20.31 ? 170  PRO B O     1 
ATOM   2719 C  CB    . PRO B 1 170 ? 20.920 -20.444 -19.561 1.00 21.74 ? 170  PRO B CB    1 
ATOM   2720 C  CG    . PRO B 1 170 ? 22.102 -19.678 -20.004 1.00 23.13 ? 170  PRO B CG    1 
ATOM   2721 C  CD    . PRO B 1 170 ? 21.622 -18.309 -20.433 1.00 22.20 ? 170  PRO B CD    1 
ATOM   2722 N  N     . VAL B 1 171 ? 20.667 -17.977 -17.055 1.00 19.97 ? 171  VAL B N     1 
ATOM   2723 C  CA    . VAL B 1 171 ? 20.963 -17.738 -15.649 1.00 18.37 ? 171  VAL B CA    1 
ATOM   2724 C  C     . VAL B 1 171 ? 19.626 -17.712 -14.948 1.00 16.71 ? 171  VAL B C     1 
ATOM   2725 O  O     . VAL B 1 171 ? 18.714 -17.042 -15.407 1.00 16.75 ? 171  VAL B O     1 
ATOM   2726 C  CB    . VAL B 1 171 ? 21.768 -16.456 -15.418 1.00 18.91 ? 171  VAL B CB    1 
ATOM   2727 C  CG1   . VAL B 1 171 ? 21.867 -16.147 -13.953 1.00 18.15 ? 171  VAL B CG1   1 
ATOM   2728 C  CG2   . VAL B 1 171 ? 23.172 -16.599 -15.954 1.00 20.06 ? 171  VAL B CG2   1 
ATOM   2729 N  N     . PRO B 1 172 ? 19.460 -18.541 -13.900 1.00 15.38 ? 172  PRO B N     1 
ATOM   2730 C  CA    . PRO B 1 172 ? 18.198 -18.589 -13.201 1.00 15.15 ? 172  PRO B CA    1 
ATOM   2731 C  C     . PRO B 1 172 ? 17.910 -17.257 -12.448 1.00 14.44 ? 172  PRO B C     1 
ATOM   2732 O  O     . PRO B 1 172 ? 18.819 -16.497 -12.085 1.00 12.28 ? 172  PRO B O     1 
ATOM   2733 C  CB    . PRO B 1 172 ? 18.410 -19.723 -12.196 1.00 15.25 ? 172  PRO B CB    1 
ATOM   2734 C  CG    . PRO B 1 172 ? 19.502 -20.480 -12.717 1.00 16.73 ? 172  PRO B CG    1 
ATOM   2735 C  CD    . PRO B 1 172 ? 20.401 -19.522 -13.356 1.00 15.51 ? 172  PRO B CD    1 
ATOM   2736 N  N     . PHE B 1 173 ? 16.638 -17.048 -12.163 1.00 14.73 ? 173  PHE B N     1 
ATOM   2737 C  CA    . PHE B 1 173 ? 16.165 -15.827 -11.558 1.00 13.74 ? 173  PHE B CA    1 
ATOM   2738 C  C     . PHE B 1 173 ? 15.036 -16.185 -10.570 1.00 13.80 ? 173  PHE B C     1 
ATOM   2739 O  O     . PHE B 1 173 ? 14.229 -17.096 -10.834 1.00 13.44 ? 173  PHE B O     1 
ATOM   2740 C  CB    . PHE B 1 173 ? 15.676 -14.806 -12.608 1.00 14.57 ? 173  PHE B CB    1 
ATOM   2741 C  CG    . PHE B 1 173 ? 15.093 -13.613 -11.984 1.00 14.29 ? 173  PHE B CG    1 
ATOM   2742 C  CD1   . PHE B 1 173 ? 13.749 -13.531 -11.732 1.00 13.42 ? 173  PHE B CD1   1 
ATOM   2743 C  CD2   . PHE B 1 173 ? 15.911 -12.657 -11.422 1.00 11.27 ? 173  PHE B CD2   1 
ATOM   2744 C  CE1   . PHE B 1 173 ? 13.233 -12.446 -11.023 1.00 14.11 ? 173  PHE B CE1   1 
ATOM   2745 C  CE2   . PHE B 1 173 ? 15.388 -11.574 -10.672 1.00 11.57 ? 173  PHE B CE2   1 
ATOM   2746 C  CZ    . PHE B 1 173 ? 14.066 -11.481 -10.484 1.00 13.02 ? 173  PHE B CZ    1 
ATOM   2747 N  N     . PHE B 1 174 ? 14.966 -15.444 -9.487  1.00 12.32 ? 174  PHE B N     1 
ATOM   2748 C  CA    . PHE B 1 174 ? 13.942 -15.581 -8.481  1.00 12.51 ? 174  PHE B CA    1 
ATOM   2749 C  C     . PHE B 1 174 ? 13.595 -14.198 -7.942  1.00 13.43 ? 174  PHE B C     1 
ATOM   2750 O  O     . PHE B 1 174 ? 14.464 -13.418 -7.649  1.00 15.56 ? 174  PHE B O     1 
ATOM   2751 C  CB    . PHE B 1 174 ? 14.429 -16.497 -7.355  1.00 13.29 ? 174  PHE B CB    1 
ATOM   2752 C  CG    . PHE B 1 174 ? 13.550 -16.489 -6.134  1.00 14.47 ? 174  PHE B CG    1 
ATOM   2753 C  CD1   . PHE B 1 174 ? 12.490 -17.363 -6.026  1.00 16.63 ? 174  PHE B CD1   1 
ATOM   2754 C  CD2   . PHE B 1 174 ? 13.825 -15.627 -5.079  1.00 15.29 ? 174  PHE B CD2   1 
ATOM   2755 C  CE1   . PHE B 1 174 ? 11.679 -17.356 -4.914  1.00 18.54 ? 174  PHE B CE1   1 
ATOM   2756 C  CE2   . PHE B 1 174 ? 13.055 -15.651 -3.956  1.00 17.56 ? 174  PHE B CE2   1 
ATOM   2757 C  CZ    . PHE B 1 174 ? 11.983 -16.513 -3.866  1.00 16.68 ? 174  PHE B CZ    1 
ATOM   2758 N  N     . SER B 1 175 ? 12.296 -13.930 -7.755  1.00 14.65 ? 175  SER B N     1 
ATOM   2759 C  CA    . SER B 1 175 ? 11.821 -12.710 -7.150  1.00 14.01 ? 175  SER B CA    1 
ATOM   2760 C  C     . SER B 1 175 ? 10.839 -13.076 -6.038  1.00 14.87 ? 175  SER B C     1 
ATOM   2761 O  O     . SER B 1 175 ? 10.140 -14.067 -6.143  1.00 14.28 ? 175  SER B O     1 
ATOM   2762 C  CB    . SER B 1 175 ? 11.070 -11.850 -8.179  1.00 14.94 ? 175  SER B CB    1 
ATOM   2763 O  OG    . SER B 1 175 ? 9.987  -12.558 -8.791  1.00 16.29 ? 175  SER B OG    1 
ATOM   2764 N  N     . LEU B 1 176 ? 10.805 -12.281 -4.977  1.00 16.06 ? 176  LEU B N     1 
ATOM   2765 C  CA    . LEU B 1 176 ? 9.796  -12.460 -3.922  1.00 16.08 ? 176  LEU B CA    1 
ATOM   2766 C  C     . LEU B 1 176 ? 8.389  -12.138 -4.386  1.00 16.31 ? 176  LEU B C     1 
ATOM   2767 O  O     . LEU B 1 176 ? 7.425  -12.897 -4.066  1.00 16.52 ? 176  LEU B O     1 
ATOM   2768 C  CB    . LEU B 1 176 ? 10.154 -11.587 -2.729  1.00 16.70 ? 176  LEU B CB    1 
ATOM   2769 C  CG    . LEU B 1 176 ? 11.420 -11.898 -1.944  1.00 17.32 ? 176  LEU B CG    1 
ATOM   2770 C  CD1   . LEU B 1 176 ? 11.552 -10.875 -0.817  1.00 16.60 ? 176  LEU B CD1   1 
ATOM   2771 C  CD2   . LEU B 1 176 ? 11.411 -13.295 -1.352  1.00 17.47 ? 176  LEU B CD2   1 
ATOM   2772 N  N     . LEU B 1 177 ? 8.284  -11.083 -5.195  1.00 15.50 ? 177  LEU B N     1 
ATOM   2773 C  CA    . LEU B 1 177 ? 7.001  -10.519 -5.616  1.00 14.90 ? 177  LEU B CA    1 
ATOM   2774 C  C     . LEU B 1 177 ? 6.982  -10.169 -7.085  1.00 15.23 ? 177  LEU B C     1 
ATOM   2775 O  O     . LEU B 1 177 ? 7.944  -9.722  -7.593  1.00 15.06 ? 177  LEU B O     1 
ATOM   2776 C  CB    . LEU B 1 177 ? 6.677  -9.257  -4.828  1.00 15.84 ? 177  LEU B CB    1 
ATOM   2777 C  CG    . LEU B 1 177 ? 6.616  -9.369  -3.303  1.00 18.35 ? 177  LEU B CG    1 
ATOM   2778 C  CD1   . LEU B 1 177 ? 6.674  -8.012  -2.625  1.00 20.19 ? 177  LEU B CD1   1 
ATOM   2779 C  CD2   . LEU B 1 177 ? 5.408  -10.155 -2.904  1.00 21.11 ? 177  LEU B CD2   1 
ATOM   2780 N  N     . GLN B 1 178 ? 5.830  -10.356 -7.715  1.00 14.94 ? 178  GLN B N     1 
ATOM   2781 C  CA    . GLN B 1 178 ? 5.665  -10.092 -9.162  1.00 16.33 ? 178  GLN B CA    1 
ATOM   2782 C  C     . GLN B 1 178 ? 4.514  -9.140  -9.406  1.00 16.22 ? 178  GLN B C     1 
ATOM   2783 O  O     . GLN B 1 178 ? 3.482  -9.237  -8.762  1.00 17.87 ? 178  GLN B O     1 
ATOM   2784 C  CB    . GLN B 1 178 ? 5.474  -11.398 -9.937  1.00 15.88 ? 178  GLN B CB    1 
ATOM   2785 C  CG    . GLN B 1 178 ? 6.617  -12.414 -9.771  1.00 17.82 ? 178  GLN B CG    1 
ATOM   2786 C  CD    . GLN B 1 178 ? 6.454  -13.254 -8.503  1.00 19.87 ? 178  GLN B CD    1 
ATOM   2787 O  OE1   . GLN B 1 178 ? 5.362  -13.717 -8.190  1.00 20.67 ? 178  GLN B OE1   1 
ATOM   2788 N  NE2   . GLN B 1 178 ? 7.522  -13.411 -7.763  1.00 12.63 ? 178  GLN B NE2   1 
ATOM   2789 N  N     . TYR B 1 179 ? 4.706  -8.175  -10.292 1.00 18.09 ? 179  TYR B N     1 
ATOM   2790 C  CA    . TYR B 1 179 ? 3.635  -7.322  -10.768 1.00 18.29 ? 179  TYR B CA    1 
ATOM   2791 C  C     . TYR B 1 179 ? 3.649  -7.427  -12.286 1.00 18.53 ? 179  TYR B C     1 
ATOM   2792 O  O     . TYR B 1 179 ? 4.687  -7.670  -12.872 1.00 16.31 ? 179  TYR B O     1 
ATOM   2793 C  CB    . TYR B 1 179 ? 3.897  -5.900  -10.331 1.00 18.37 ? 179  TYR B CB    1 
ATOM   2794 C  CG    . TYR B 1 179 ? 3.945  -5.720  -8.847  1.00 19.88 ? 179  TYR B CG    1 
ATOM   2795 C  CD1   . TYR B 1 179 ? 2.808  -5.535  -8.131  1.00 21.54 ? 179  TYR B CD1   1 
ATOM   2796 C  CD2   . TYR B 1 179 ? 5.150  -5.775  -8.151  1.00 23.02 ? 179  TYR B CD2   1 
ATOM   2797 C  CE1   . TYR B 1 179 ? 2.851  -5.390  -6.759  1.00 23.56 ? 179  TYR B CE1   1 
ATOM   2798 C  CE2   . TYR B 1 179 ? 5.197  -5.641  -6.787  1.00 23.59 ? 179  TYR B CE2   1 
ATOM   2799 C  CZ    . TYR B 1 179 ? 4.034  -5.437  -6.101  1.00 24.40 ? 179  TYR B CZ    1 
ATOM   2800 O  OH    . TYR B 1 179 ? 4.051  -5.308  -4.729  1.00 28.52 ? 179  TYR B OH    1 
ATOM   2801 N  N     . GLU B 1 180 ? 2.537  -7.228  -12.959 1.00 21.21 ? 180  GLU B N     1 
ATOM   2802 C  CA    . GLU B 1 180 ? 2.661  -7.133  -14.417 1.00 23.82 ? 180  GLU B CA    1 
ATOM   2803 C  C     . GLU B 1 180 ? 3.732  -6.045  -14.776 1.00 25.88 ? 180  GLU B C     1 
ATOM   2804 O  O     . GLU B 1 180 ? 3.448  -4.879  -14.417 1.00 27.81 ? 180  GLU B O     1 
ATOM   2805 C  CB    A GLU B 1 180 ? 1.341  -6.762  -15.057 0.65 24.67 ? 180  GLU B CB    1 
ATOM   2806 C  CB    B GLU B 1 180 ? 1.318  -6.773  -15.040 0.35 24.25 ? 180  GLU B CB    1 
ATOM   2807 C  CG    A GLU B 1 180 ? 1.208  -7.277  -16.497 0.65 26.46 ? 180  GLU B CG    1 
ATOM   2808 C  CG    B GLU B 1 180 ? 0.427  -7.977  -15.377 0.35 25.18 ? 180  GLU B CG    1 
ATOM   2809 C  CD    A GLU B 1 180 ? 0.272  -8.475  -16.612 0.65 30.89 ? 180  GLU B CD    1 
ATOM   2810 C  CD    B GLU B 1 180 ? -0.408 -8.466  -14.209 0.35 27.65 ? 180  GLU B CD    1 
ATOM   2811 O  OE1   A GLU B 1 180 ? 0.754  -9.636  -16.632 0.65 32.96 ? 180  GLU B OE1   1 
ATOM   2812 O  OE1   B GLU B 1 180 ? 0.184  -8.726  -13.132 0.35 29.34 ? 180  GLU B OE1   1 
ATOM   2813 O  OE2   A GLU B 1 180 ? -0.958 -8.240  -16.682 0.65 31.35 ? 180  GLU B OE2   1 
ATOM   2814 O  OE2   B GLU B 1 180 ? -1.655 -8.614  -14.378 0.35 28.44 ? 180  GLU B OE2   1 
ATOM   2815 O  OXT   . GLU B 1 180 ? 4.848  -6.240  -15.375 1.00 26.79 ? 180  GLU B OXT   1 
HETATM 2816 P  P     . AMP C 2 .   ? 32.573 14.832  1.800   1.00 18.81 ? 1031 AMP A P     1 
HETATM 2817 O  O1P   . AMP C 2 .   ? 31.166 15.245  1.331   1.00 19.05 ? 1031 AMP A O1P   1 
HETATM 2818 O  O2P   . AMP C 2 .   ? 32.620 14.359  3.213   1.00 14.16 ? 1031 AMP A O2P   1 
HETATM 2819 O  O3P   . AMP C 2 .   ? 33.742 15.658  1.345   1.00 19.10 ? 1031 AMP A O3P   1 
HETATM 2820 O  "O5'" . AMP C 2 .   ? 32.785 13.545  0.898   1.00 19.72 ? 1031 AMP A "O5'" 1 
HETATM 2821 C  "C5'" . AMP C 2 .   ? 32.321 12.300  1.410   1.00 26.09 ? 1031 AMP A "C5'" 1 
HETATM 2822 C  "C4'" . AMP C 2 .   ? 31.733 11.496  0.267   1.00 24.70 ? 1031 AMP A "C4'" 1 
HETATM 2823 O  "O4'" . AMP C 2 .   ? 32.706 11.331  -0.767  1.00 25.82 ? 1031 AMP A "O4'" 1 
HETATM 2824 C  "C3'" . AMP C 2 .   ? 31.417 10.196  0.914   1.00 28.12 ? 1031 AMP A "C3'" 1 
HETATM 2825 O  "O3'" . AMP C 2 .   ? 30.206 9.735   0.296   1.00 28.19 ? 1031 AMP A "O3'" 1 
HETATM 2826 C  "C2'" . AMP C 2 .   ? 32.634 9.342   0.646   1.00 26.66 ? 1031 AMP A "C2'" 1 
HETATM 2827 O  "O2'" . AMP C 2 .   ? 32.167 8.020   0.295   1.00 29.77 ? 1031 AMP A "O2'" 1 
HETATM 2828 C  "C1'" . AMP C 2 .   ? 33.308 10.061  -0.551  1.00 23.58 ? 1031 AMP A "C1'" 1 
HETATM 2829 N  N9    . AMP C 2 .   ? 34.741 10.284  -0.321  1.00 19.91 ? 1031 AMP A N9    1 
HETATM 2830 C  C8    . AMP C 2 .   ? 35.341 11.473  -0.163  1.00 20.93 ? 1031 AMP A C8    1 
HETATM 2831 N  N7    . AMP C 2 .   ? 36.683 11.335  -0.008  1.00 17.74 ? 1031 AMP A N7    1 
HETATM 2832 C  C5    . AMP C 2 .   ? 36.942 10.007  -0.094  1.00 17.51 ? 1031 AMP A C5    1 
HETATM 2833 C  C6    . AMP C 2 .   ? 38.143 9.196   -0.023  1.00 17.31 ? 1031 AMP A C6    1 
HETATM 2834 N  N6    . AMP C 2 .   ? 39.330 9.759   0.166   1.00 17.91 ? 1031 AMP A N6    1 
HETATM 2835 N  N1    . AMP C 2 .   ? 37.976 7.872   -0.168  1.00 21.48 ? 1031 AMP A N1    1 
HETATM 2836 C  C2    . AMP C 2 .   ? 36.740 7.282   -0.349  1.00 17.69 ? 1031 AMP A C2    1 
HETATM 2837 N  N3    . AMP C 2 .   ? 35.569 7.955   -0.443  1.00 15.89 ? 1031 AMP A N3    1 
HETATM 2838 C  C4    . AMP C 2 .   ? 35.640 9.314   -0.331  1.00 19.82 ? 1031 AMP A C4    1 
HETATM 2839 CL CL    . CL  D 3 .   ? 37.021 -3.358  -19.952 1.00 52.02 ? 1030 CL  B CL    1 
HETATM 2840 P  P     . AMP E 2 .   ? 16.362 -2.989  -15.820 1.00 23.26 ? 1032 AMP B P     1 
HETATM 2841 O  O1P   . AMP E 2 .   ? 17.897 -2.869  -16.163 1.00 18.61 ? 1032 AMP B O1P   1 
HETATM 2842 O  O2P   . AMP E 2 .   ? 15.970 -4.318  -15.101 1.00 18.15 ? 1032 AMP B O2P   1 
HETATM 2843 O  O3P   . AMP E 2 .   ? 15.478 -2.527  -16.945 1.00 24.21 ? 1032 AMP B O3P   1 
HETATM 2844 O  "O5'" . AMP E 2 .   ? 16.187 -1.763  -14.794 1.00 23.83 ? 1032 AMP B "O5'" 1 
HETATM 2845 C  "C5'" . AMP E 2 .   ? 16.253 -2.084  -13.425 1.00 27.37 ? 1032 AMP B "C5'" 1 
HETATM 2846 C  "C4'" . AMP E 2 .   ? 16.904 -0.935  -12.709 1.00 29.24 ? 1032 AMP B "C4'" 1 
HETATM 2847 O  "O4'" . AMP E 2 .   ? 16.036 0.199   -12.741 1.00 31.51 ? 1032 AMP B "O4'" 1 
HETATM 2848 C  "C3'" . AMP E 2 .   ? 17.038 -1.357  -11.282 1.00 30.59 ? 1032 AMP B "C3'" 1 
HETATM 2849 O  "O3'" . AMP E 2 .   ? 18.103 -0.650  -10.660 1.00 32.16 ? 1032 AMP B "O3'" 1 
HETATM 2850 C  "C2'" . AMP E 2 .   ? 15.693 -0.997  -10.694 1.00 28.92 ? 1032 AMP B "C2'" 1 
HETATM 2851 O  "O2'" . AMP E 2 .   ? 15.840 -0.568  -9.330  1.00 31.50 ? 1032 AMP B "O2'" 1 
HETATM 2852 C  "C1'" . AMP E 2 .   ? 15.228 0.175   -11.569 1.00 28.07 ? 1032 AMP B "C1'" 1 
HETATM 2853 N  N9    . AMP E 2 .   ? 13.825 0.123   -12.019 1.00 26.26 ? 1032 AMP B N9    1 
HETATM 2854 C  C8    . AMP E 2 .   ? 13.424 -0.171  -13.280 1.00 25.04 ? 1032 AMP B C8    1 
HETATM 2855 N  N7    . AMP E 2 .   ? 12.092 -0.087  -13.377 1.00 26.96 ? 1032 AMP B N7    1 
HETATM 2856 C  C5    . AMP E 2 .   ? 11.627 0.276   -12.143 1.00 25.38 ? 1032 AMP B C5    1 
HETATM 2857 C  C6    . AMP E 2 .   ? 10.299 0.531   -11.562 1.00 24.93 ? 1032 AMP B C6    1 
HETATM 2858 N  N6    . AMP E 2 .   ? 9.195  0.427   -12.327 1.00 24.70 ? 1032 AMP B N6    1 
HETATM 2859 N  N1    . AMP E 2 .   ? 10.248 0.859   -10.255 1.00 25.27 ? 1032 AMP B N1    1 
HETATM 2860 C  C2    . AMP E 2 .   ? 11.373 0.997   -9.506  1.00 24.30 ? 1032 AMP B C2    1 
HETATM 2861 N  N3    . AMP E 2 .   ? 12.623 0.798   -9.974  1.00 23.47 ? 1032 AMP B N3    1 
HETATM 2862 C  C4    . AMP E 2 .   ? 12.789 0.429   -11.257 1.00 24.47 ? 1032 AMP B C4    1 
HETATM 2863 O  O     . HOH F 4 .   ? 35.595 15.246  -0.708  1.00 26.22 ? 1032 HOH A O     1 
HETATM 2864 O  O     . HOH F 4 .   ? 29.605 7.569   -1.307  1.00 32.45 ? 1033 HOH A O     1 
HETATM 2865 O  O     . HOH F 4 .   ? 38.185 13.464  -0.305  1.00 32.74 ? 1034 HOH A O     1 
HETATM 2866 O  O     . HOH F 4 .   ? 43.093 12.750  3.133   1.00 29.71 ? 1035 HOH A O     1 
HETATM 2867 O  O     . HOH F 4 .   ? 19.528 23.162  -5.051  1.00 32.47 ? 1036 HOH A O     1 
HETATM 2868 O  O     . HOH F 4 .   ? 42.556 12.413  0.360   1.00 27.46 ? 1037 HOH A O     1 
HETATM 2869 O  O     . HOH F 4 .   ? 44.522 16.376  11.135  1.00 26.19 ? 1038 HOH A O     1 
HETATM 2870 O  O     . HOH F 4 .   ? 5.781  13.376  7.466   1.00 31.25 ? 1039 HOH A O     1 
HETATM 2871 O  O     . HOH F 4 .   ? 16.288 -6.004  13.950  1.00 35.75 ? 1040 HOH A O     1 
HETATM 2872 O  O     . HOH F 4 .   ? 45.022 -0.895  6.399   1.00 48.44 ? 1041 HOH A O     1 
HETATM 2873 O  O     . HOH F 4 .   ? 20.231 19.265  11.534  1.00 35.77 ? 1042 HOH A O     1 
HETATM 2874 O  O     . HOH F 4 .   ? 44.961 1.463   4.031   1.00 43.36 ? 1043 HOH A O     1 
HETATM 2875 O  O     . HOH F 4 .   ? 6.741  7.037   12.009  1.00 50.46 ? 1044 HOH A O     1 
HETATM 2876 O  O     . HOH F 4 .   ? 6.210  9.776   -0.805  1.00 30.06 ? 1045 HOH A O     1 
HETATM 2877 O  O     . HOH F 4 .   ? 38.298 -8.837  2.156   1.00 20.08 ? 1046 HOH A O     1 
HETATM 2878 O  O     . HOH F 4 .   ? 14.483 21.592  -1.891  1.00 17.85 ? 1047 HOH A O     1 
HETATM 2879 O  O     . HOH F 4 .   ? 46.169 10.392  4.819   1.00 29.10 ? 1048 HOH A O     1 
HETATM 2880 O  O     . HOH F 4 .   ? 39.914 -8.482  8.810   1.00 25.30 ? 1049 HOH A O     1 
HETATM 2881 O  O     . HOH F 4 .   ? 35.135 3.494   0.336   1.00 22.06 ? 1050 HOH A O     1 
HETATM 2882 O  O     . HOH F 4 .   ? 44.077 1.249   7.182   1.00 49.43 ? 1051 HOH A O     1 
HETATM 2883 O  O     . HOH F 4 .   ? 46.292 -0.184  0.978   1.00 26.02 ? 1052 HOH A O     1 
HETATM 2884 O  O     . HOH F 4 .   ? 8.247  8.525   10.224  1.00 20.94 ? 1053 HOH A O     1 
HETATM 2885 O  O     . HOH F 4 .   ? 11.728 22.969  2.587   1.00 34.63 ? 1054 HOH A O     1 
HETATM 2886 O  O     . HOH F 4 .   ? 34.761 2.012   -2.185  1.00 20.81 ? 1055 HOH A O     1 
HETATM 2887 O  O     . HOH F 4 .   ? 42.789 9.832   2.408   1.00 23.64 ? 1056 HOH A O     1 
HETATM 2888 O  O     . HOH F 4 .   ? 44.036 -11.287 6.996   1.00 38.10 ? 1057 HOH A O     1 
HETATM 2889 O  O     . HOH F 4 .   ? 12.665 2.328   13.746  1.00 14.19 ? 1058 HOH A O     1 
HETATM 2890 O  O     . HOH F 4 .   ? 6.963  21.317  1.651   1.00 22.16 ? 1059 HOH A O     1 
HETATM 2891 O  O     . HOH F 4 .   ? 45.678 4.508   -7.050  1.00 31.75 ? 1060 HOH A O     1 
HETATM 2892 O  O     . HOH F 4 .   ? 30.233 13.962  4.382   1.00 15.58 ? 1061 HOH A O     1 
HETATM 2893 O  O     . HOH F 4 .   ? 37.012 15.158  8.013   1.00 13.24 ? 1062 HOH A O     1 
HETATM 2894 O  O     . HOH F 4 .   ? 30.060 11.347  4.269   1.00 15.60 ? 1063 HOH A O     1 
HETATM 2895 O  O     . HOH F 4 .   ? 44.467 10.627  -10.662 1.00 22.95 ? 1064 HOH A O     1 
HETATM 2896 O  O     . HOH F 4 .   ? 13.268 6.263   3.249   1.00 18.34 ? 1065 HOH A O     1 
HETATM 2897 O  O     . HOH F 4 .   ? 13.580 9.445   1.314   1.00 17.35 ? 1066 HOH A O     1 
HETATM 2898 O  O     . HOH F 4 .   ? 8.452  16.030  9.066   1.00 19.73 ? 1067 HOH A O     1 
HETATM 2899 O  O     . HOH F 4 .   ? 23.754 -3.056  5.149   1.00 20.74 ? 1068 HOH A O     1 
HETATM 2900 O  O     . HOH F 4 .   ? 36.970 15.676  10.899  1.00 18.89 ? 1069 HOH A O     1 
HETATM 2901 O  O     . HOH F 4 .   ? 39.070 16.976  11.808  1.00 18.02 ? 1070 HOH A O     1 
HETATM 2902 O  O     . HOH F 4 .   ? 16.040 -2.484  9.565   1.00 20.30 ? 1071 HOH A O     1 
HETATM 2903 O  O     . HOH F 4 .   ? 22.801 -6.276  11.061  1.00 21.02 ? 1072 HOH A O     1 
HETATM 2904 O  O     . HOH F 4 .   ? 46.011 17.490  -7.708  1.00 23.96 ? 1073 HOH A O     1 
HETATM 2905 O  O     . HOH F 4 .   ? 23.731 -7.682  8.564   1.00 24.12 ? 1074 HOH A O     1 
HETATM 2906 O  O     . HOH F 4 .   ? 19.122 18.123  14.518  1.00 26.47 ? 1075 HOH A O     1 
HETATM 2907 O  O     . HOH F 4 .   ? 27.033 20.712  2.687   1.00 26.68 ? 1076 HOH A O     1 
HETATM 2908 O  O     . HOH F 4 .   ? 23.296 14.387  20.073  1.00 28.48 ? 1077 HOH A O     1 
HETATM 2909 O  O     . HOH F 4 .   ? 17.822 22.207  8.258   1.00 23.28 ? 1078 HOH A O     1 
HETATM 2910 O  O     . HOH F 4 .   ? 37.028 6.594   17.591  1.00 29.54 ? 1079 HOH A O     1 
HETATM 2911 O  O     . HOH F 4 .   ? 31.017 17.377  15.057  1.00 24.33 ? 1080 HOH A O     1 
HETATM 2912 O  O     . HOH F 4 .   ? 29.033 -7.800  3.639   1.00 20.58 ? 1081 HOH A O     1 
HETATM 2913 O  O     . HOH F 4 .   ? 37.168 3.697   17.037  1.00 21.07 ? 1082 HOH A O     1 
HETATM 2914 O  O     . HOH F 4 .   ? 16.154 11.003  -5.249  1.00 25.06 ? 1083 HOH A O     1 
HETATM 2915 O  O     . HOH F 4 .   ? 37.343 19.266  12.851  1.00 22.04 ? 1084 HOH A O     1 
HETATM 2916 O  O     . HOH F 4 .   ? 42.376 5.258   13.640  1.00 25.81 ? 1085 HOH A O     1 
HETATM 2917 O  O     . HOH F 4 .   ? 35.066 -13.929 2.346   1.00 29.81 ? 1086 HOH A O     1 
HETATM 2918 O  O     . HOH F 4 .   ? 34.931 17.461  -2.318  1.00 26.28 ? 1087 HOH A O     1 
HETATM 2919 O  O     . HOH F 4 .   ? 10.413 10.101  18.443  1.00 27.21 ? 1088 HOH A O     1 
HETATM 2920 O  O     . HOH F 4 .   ? 9.674  17.002  -5.254  1.00 28.42 ? 1089 HOH A O     1 
HETATM 2921 O  O     . HOH F 4 .   ? 33.593 -9.952  13.664  1.00 24.56 ? 1090 HOH A O     1 
HETATM 2922 O  O     . HOH F 4 .   ? 12.531 6.943   0.817   1.00 22.39 ? 1091 HOH A O     1 
HETATM 2923 O  O     . HOH F 4 .   ? 50.829 9.236   -8.760  1.00 23.89 ? 1092 HOH A O     1 
HETATM 2924 O  O     . HOH F 4 .   ? 27.544 9.731   0.077   1.00 29.58 ? 1093 HOH A O     1 
HETATM 2925 O  O     . HOH F 4 .   ? 31.386 14.444  18.616  1.00 30.99 ? 1094 HOH A O     1 
HETATM 2926 O  O     . HOH F 4 .   ? 35.192 20.065  -2.988  1.00 29.06 ? 1095 HOH A O     1 
HETATM 2927 O  O     . HOH F 4 .   ? 6.483  9.994   8.135   1.00 31.31 ? 1096 HOH A O     1 
HETATM 2928 O  O     . HOH F 4 .   ? 47.223 9.375   8.382   1.00 30.93 ? 1097 HOH A O     1 
HETATM 2929 O  O     . HOH F 4 .   ? 13.252 12.241  -7.367  1.00 21.57 ? 1098 HOH A O     1 
HETATM 2930 O  O     . HOH F 4 .   ? 28.681 12.715  -1.828  1.00 36.27 ? 1099 HOH A O     1 
HETATM 2931 O  O     . HOH F 4 .   ? 32.756 0.986   19.464  1.00 29.04 ? 1100 HOH A O     1 
HETATM 2932 O  O     . HOH F 4 .   ? 8.987  7.878   2.664   1.00 34.51 ? 1101 HOH A O     1 
HETATM 2933 O  O     . HOH F 4 .   ? 17.390 3.187   19.941  1.00 32.17 ? 1102 HOH A O     1 
HETATM 2934 O  O     . HOH F 4 .   ? 29.598 21.508  0.742   1.00 29.85 ? 1103 HOH A O     1 
HETATM 2935 O  O     . HOH F 4 .   ? 41.841 -8.810  14.720  1.00 31.26 ? 1104 HOH A O     1 
HETATM 2936 O  O     . HOH F 4 .   ? 33.627 -0.939  20.843  1.00 29.10 ? 1105 HOH A O     1 
HETATM 2937 O  O     . HOH F 4 .   ? 12.158 0.219   15.698  1.00 22.74 ? 1106 HOH A O     1 
HETATM 2938 O  O     . HOH F 4 .   ? 5.933  10.526  -7.959  1.00 25.44 ? 1107 HOH A O     1 
HETATM 2939 O  O     . HOH F 4 .   ? 23.320 22.622  4.433   1.00 37.01 ? 1108 HOH A O     1 
HETATM 2940 O  O     . HOH F 4 .   ? 21.510 14.065  22.042  1.00 32.53 ? 1109 HOH A O     1 
HETATM 2941 O  O     . HOH F 4 .   ? 27.625 7.287   0.302   1.00 40.44 ? 1110 HOH A O     1 
HETATM 2942 O  O     . HOH F 4 .   ? 6.907  12.554  0.177   1.00 24.40 ? 1111 HOH A O     1 
HETATM 2943 O  O     . HOH F 4 .   ? 7.484  17.562  5.080   1.00 31.54 ? 1112 HOH A O     1 
HETATM 2944 O  O     . HOH F 4 .   ? 25.295 18.903  20.428  1.00 39.91 ? 1113 HOH A O     1 
HETATM 2945 O  O     . HOH F 4 .   ? 31.217 17.208  -0.381  1.00 41.69 ? 1114 HOH A O     1 
HETATM 2946 O  O     . HOH F 4 .   ? 22.888 6.463   -6.791  1.00 41.79 ? 1115 HOH A O     1 
HETATM 2947 O  O     . HOH F 4 .   ? 5.488  14.682  15.058  1.00 32.12 ? 1116 HOH A O     1 
HETATM 2948 O  O     . HOH F 4 .   ? 13.826 15.798  -7.761  1.00 26.66 ? 1117 HOH A O     1 
HETATM 2949 O  O     . HOH F 4 .   ? 37.847 0.425   19.530  1.00 28.26 ? 1118 HOH A O     1 
HETATM 2950 O  O     . HOH F 4 .   ? 13.511 3.548   18.877  1.00 36.03 ? 1119 HOH A O     1 
HETATM 2951 O  O     . HOH F 4 .   ? 28.641 6.939   -3.242  1.00 36.88 ? 1120 HOH A O     1 
HETATM 2952 O  O     . HOH F 4 .   ? 24.367 23.809  6.375   1.00 40.76 ? 1121 HOH A O     1 
HETATM 2953 O  O     . HOH F 4 .   ? 35.503 -3.242  20.397  1.00 44.57 ? 1122 HOH A O     1 
HETATM 2954 O  O     . HOH F 4 .   ? 31.903 20.377  1.161   1.00 31.15 ? 1123 HOH A O     1 
HETATM 2955 O  O     . HOH F 4 .   ? 29.828 23.749  11.996  1.00 32.70 ? 1124 HOH A O     1 
HETATM 2956 O  O     . HOH F 4 .   ? 12.798 -4.469  16.133  1.00 42.34 ? 1125 HOH A O     1 
HETATM 2957 O  O     . HOH F 4 .   ? 20.983 -3.165  19.864  1.00 34.20 ? 1126 HOH A O     1 
HETATM 2958 O  O     . HOH F 4 .   ? 25.051 20.844  11.260  1.00 35.05 ? 1127 HOH A O     1 
HETATM 2959 O  O     . HOH F 4 .   ? 9.709  12.720  -7.132  1.00 33.69 ? 1128 HOH A O     1 
HETATM 2960 O  O     . HOH F 4 .   ? 23.543 -9.140  16.857  1.00 49.02 ? 1129 HOH A O     1 
HETATM 2961 O  O     . HOH F 4 .   ? 8.536  8.106   16.578  1.00 31.33 ? 1130 HOH A O     1 
HETATM 2962 O  O     . HOH F 4 .   ? 27.167 -7.043  14.215  1.00 43.30 ? 1131 HOH A O     1 
HETATM 2963 O  O     . HOH F 4 .   ? 13.394 15.429  18.873  1.00 39.97 ? 1132 HOH A O     1 
HETATM 2964 O  O     . HOH F 4 .   ? 42.756 9.075   16.335  1.00 38.65 ? 1133 HOH A O     1 
HETATM 2965 O  O     . HOH F 4 .   ? 19.198 15.253  22.110  1.00 30.92 ? 1134 HOH A O     1 
HETATM 2966 O  O     . HOH F 4 .   ? 8.870  20.063  8.045   1.00 37.02 ? 1135 HOH A O     1 
HETATM 2967 O  O     . HOH F 4 .   ? 42.754 17.790  -9.904  1.00 37.48 ? 1136 HOH A O     1 
HETATM 2968 O  O     . HOH F 4 .   ? 26.501 4.113   28.388  1.00 33.27 ? 1137 HOH A O     1 
HETATM 2969 O  O     . HOH F 4 .   ? 47.951 1.325   -3.366  1.00 28.47 ? 1138 HOH A O     1 
HETATM 2970 O  O     . HOH F 4 .   ? 25.413 -4.273  19.268  1.00 30.85 ? 1139 HOH A O     1 
HETATM 2971 O  O     . HOH F 4 .   ? 39.419 21.945  5.749   1.00 43.64 ? 1140 HOH A O     1 
HETATM 2972 O  O     . HOH F 4 .   ? 27.950 -4.164  19.492  1.00 29.59 ? 1141 HOH A O     1 
HETATM 2973 O  O     . HOH F 4 .   ? 38.330 -9.765  17.015  1.00 46.90 ? 1142 HOH A O     1 
HETATM 2974 O  O     . HOH F 4 .   ? 10.592 15.430  -6.904  1.00 38.13 ? 1143 HOH A O     1 
HETATM 2975 O  O     . HOH F 4 .   ? 37.168 11.064  15.695  1.00 35.87 ? 1144 HOH A O     1 
HETATM 2976 O  O     . HOH F 4 .   ? 44.539 11.793  12.043  1.00 38.72 ? 1145 HOH A O     1 
HETATM 2977 O  O     . HOH F 4 .   ? 47.853 13.587  -1.693  1.00 27.56 ? 1146 HOH A O     1 
HETATM 2978 O  O     . HOH F 4 .   ? 20.586 17.269  19.063  1.00 40.97 ? 1147 HOH A O     1 
HETATM 2979 O  O     . HOH F 4 .   ? 23.297 15.576  -8.089  1.00 31.81 ? 1148 HOH A O     1 
HETATM 2980 O  O     . HOH F 4 .   ? 43.684 6.971   -10.947 1.00 30.82 ? 1149 HOH A O     1 
HETATM 2981 O  O     . HOH F 4 .   ? 14.710 5.341   -5.430  1.00 43.58 ? 1150 HOH A O     1 
HETATM 2982 O  O     . HOH F 4 .   ? 14.682 -7.170  12.930  1.00 39.79 ? 1151 HOH A O     1 
HETATM 2983 O  O     . HOH F 4 .   ? 24.432 11.243  24.033  1.00 43.15 ? 1152 HOH A O     1 
HETATM 2984 O  O     . HOH F 4 .   ? 48.116 10.595  -3.282  1.00 43.08 ? 1153 HOH A O     1 
HETATM 2985 O  O     . HOH F 4 .   ? 35.798 -13.809 7.505   1.00 44.75 ? 1154 HOH A O     1 
HETATM 2986 O  O     . HOH F 4 .   ? 22.479 24.962  -5.456  1.00 42.90 ? 1155 HOH A O     1 
HETATM 2987 O  O     . HOH F 4 .   ? 22.076 23.037  0.238   1.00 41.74 ? 1156 HOH A O     1 
HETATM 2988 O  O     . HOH F 4 .   ? 7.892  10.795  -1.973  1.00 55.05 ? 1157 HOH A O     1 
HETATM 2989 O  O     . HOH F 4 .   ? 30.159 7.497   1.148   1.00 47.35 ? 1158 HOH A O     1 
HETATM 2990 O  O     . HOH F 4 .   ? 39.265 -8.577  -2.981  1.00 41.11 ? 1159 HOH A O     1 
HETATM 2991 O  O     . HOH F 4 .   ? 19.798 23.814  -2.013  1.00 29.48 ? 1160 HOH A O     1 
HETATM 2992 O  O     . HOH F 4 .   ? 9.383  4.912   3.367   1.00 31.09 ? 1161 HOH A O     1 
HETATM 2993 O  O     . HOH F 4 .   ? 45.617 -2.913  4.819   1.00 45.51 ? 1162 HOH A O     1 
HETATM 2994 O  O     . HOH F 4 .   ? 43.992 14.727  1.996   1.00 51.09 ? 1163 HOH A O     1 
HETATM 2995 O  O     . HOH F 4 .   ? 40.818 -11.198 15.529  1.00 54.02 ? 1164 HOH A O     1 
HETATM 2996 O  O     . HOH F 4 .   ? 10.757 6.666   4.453   1.00 27.90 ? 1165 HOH A O     1 
HETATM 2997 O  O     . HOH F 4 .   ? 4.415  14.401  5.705   1.00 46.97 ? 1166 HOH A O     1 
HETATM 2998 O  O     . HOH F 4 .   ? 47.319 -2.820  7.188   1.00 46.91 ? 1167 HOH A O     1 
HETATM 2999 O  O     . HOH F 4 .   ? 38.048 -11.438 2.070   1.00 28.24 ? 1168 HOH A O     1 
HETATM 3000 O  O     . HOH F 4 .   ? 35.756 1.427   18.149  1.00 27.23 ? 1169 HOH A O     1 
HETATM 3001 O  O     . HOH F 4 .   ? 4.995  17.796  3.736   1.00 31.79 ? 1170 HOH A O     1 
HETATM 3002 O  O     . HOH F 4 .   ? 8.677  19.565  3.588   1.00 30.36 ? 1171 HOH A O     1 
HETATM 3003 O  O     . HOH F 4 .   ? 7.521  18.261  7.657   1.00 36.38 ? 1172 HOH A O     1 
HETATM 3004 O  O     . HOH F 4 .   ? 7.295  13.000  -8.625  1.00 33.99 ? 1173 HOH A O     1 
HETATM 3005 O  O     . HOH F 4 .   ? 9.645  5.193   15.928  1.00 45.00 ? 1174 HOH A O     1 
HETATM 3006 O  O     . HOH F 4 .   ? 32.407 -8.628  15.889  1.00 29.79 ? 1175 HOH A O     1 
HETATM 3007 O  O     . HOH F 4 .   ? 4.621  13.854  0.839   1.00 25.24 ? 1176 HOH A O     1 
HETATM 3008 O  O     . HOH F 4 .   ? 9.702  -1.075  14.751  1.00 33.32 ? 1177 HOH A O     1 
HETATM 3009 O  O     . HOH F 4 .   ? 12.347 -6.875  13.483  1.00 40.05 ? 1178 HOH A O     1 
HETATM 3010 O  O     . HOH F 4 .   ? 3.674  9.747   -1.002  1.00 34.89 ? 1179 HOH A O     1 
HETATM 3011 O  O     . HOH F 4 .   ? 34.658 21.300  -1.120  1.00 33.78 ? 1180 HOH A O     1 
HETATM 3012 O  O     . HOH F 4 .   ? 28.824 -6.807  18.589  1.00 35.39 ? 1181 HOH A O     1 
HETATM 3013 O  O     . HOH F 4 .   ? 30.192 15.431  20.663  1.00 38.13 ? 1182 HOH A O     1 
HETATM 3014 O  O     . HOH F 4 .   ? 32.465 18.229  17.078  1.00 37.76 ? 1183 HOH A O     1 
HETATM 3015 O  O     . HOH F 4 .   ? 31.110 25.305  10.564  1.00 47.17 ? 1184 HOH A O     1 
HETATM 3016 O  O     . HOH F 4 .   ? 15.103 5.014   -2.947  1.00 67.61 ? 1185 HOH A O     1 
HETATM 3017 O  O     . HOH F 4 .   ? 11.951 17.137  -8.585  1.00 41.37 ? 1186 HOH A O     1 
HETATM 3018 O  O     . HOH F 4 .   ? 19.013 1.716   20.223  1.00 41.38 ? 1187 HOH A O     1 
HETATM 3019 O  O     . HOH F 4 .   ? 19.869 -3.353  22.609  1.00 43.63 ? 1188 HOH A O     1 
HETATM 3020 O  O     . HOH F 4 .   ? 35.912 -10.287 17.357  1.00 38.00 ? 1189 HOH A O     1 
HETATM 3021 O  O     . HOH F 4 .   ? 15.880 23.744  8.765   1.00 35.40 ? 1190 HOH A O     1 
HETATM 3022 O  O     . HOH F 4 .   ? 20.148 22.304  9.592   1.00 41.96 ? 1191 HOH A O     1 
HETATM 3023 O  O     . HOH F 4 .   ? 39.520 -7.655  -0.751  1.00 37.10 ? 1192 HOH A O     1 
HETATM 3024 O  O     . HOH F 4 .   ? 37.576 -6.117  -2.037  1.00 28.86 ? 1193 HOH A O     1 
HETATM 3025 O  O     . HOH F 4 .   ? 4.317  15.161  3.059   1.00 30.12 ? 1194 HOH A O     1 
HETATM 3026 O  O     . HOH F 4 .   ? 2.456  7.288   0.196   1.00 40.00 ? 1195 HOH A O     1 
HETATM 3027 O  O     . HOH F 4 .   ? 21.705 -5.553  22.679  1.00 32.73 ? 1196 HOH A O     1 
HETATM 3028 O  O     . HOH F 4 .   ? 22.212 21.702  8.892   1.00 41.46 ? 1197 HOH A O     1 
HETATM 3029 O  O     . HOH F 4 .   ? 42.925 -4.667  2.401   1.00 35.33 ? 1198 HOH A O     1 
HETATM 3030 O  O     . HOH F 4 .   ? 1.525  5.304   0.873   1.00 38.96 ? 1199 HOH A O     1 
HETATM 3031 O  O     . HOH F 4 .   ? 11.675 23.531  6.491   1.00 40.69 ? 1200 HOH A O     1 
HETATM 3032 O  O     . HOH F 4 .   ? 14.786 20.442  13.414  1.00 42.07 ? 1201 HOH A O     1 
HETATM 3033 O  O     . HOH F 4 .   ? 14.955 19.258  16.023  1.00 43.70 ? 1202 HOH A O     1 
HETATM 3034 O  O     . HOH F 4 .   ? 45.589 -3.866  11.800  1.00 46.64 ? 1203 HOH A O     1 
HETATM 3035 O  O     . HOH F 4 .   ? 23.413 20.532  -9.154  1.00 46.80 ? 1204 HOH A O     1 
HETATM 3036 O  O     . HOH F 4 .   ? 43.152 -1.587  17.074  1.00 38.96 ? 1205 HOH A O     1 
HETATM 3037 O  O     . HOH F 4 .   ? 9.211  18.843  16.786  1.00 44.20 ? 1206 HOH A O     1 
HETATM 3038 O  O     . HOH G 4 .   ? 14.015 -0.110  -17.391 1.00 35.43 ? 1033 HOH B O     1 
HETATM 3039 O  O     . HOH G 4 .   ? 11.190 0.138   -15.808 1.00 39.29 ? 1034 HOH B O     1 
HETATM 3040 O  O     . HOH G 4 .   ? 18.922 1.490   -8.369  1.00 57.47 ? 1035 HOH B O     1 
HETATM 3041 O  O     . HOH G 4 .   ? 1.576  -3.729  -13.022 1.00 33.16 ? 1036 HOH B O     1 
HETATM 3042 O  O     . HOH G 4 .   ? 40.386 -12.039 -6.068  1.00 29.69 ? 1037 HOH B O     1 
HETATM 3043 O  O     . HOH G 4 .   ? 1.802  -2.520  -1.081  1.00 28.24 ? 1038 HOH B O     1 
HETATM 3044 O  O     . HOH G 4 .   ? 41.194 -12.278 -8.707  1.00 26.65 ? 1039 HOH B O     1 
HETATM 3045 O  O     . HOH G 4 .   ? 33.508 2.636   -4.519  1.00 28.65 ? 1040 HOH B O     1 
HETATM 3046 O  O     . HOH G 4 .   ? 1.157  4.869   -14.498 1.00 33.02 ? 1041 HOH B O     1 
HETATM 3047 O  O     . HOH G 4 .   ? 2.231  -4.656  -3.010  1.00 39.32 ? 1042 HOH B O     1 
HETATM 3048 O  O     . HOH G 4 .   ? 23.010 -19.049 6.913   1.00 42.64 ? 1043 HOH B O     1 
HETATM 3049 O  O     . HOH G 4 .   ? 1.142  -16.762 10.075  1.00 51.20 ? 1044 HOH B O     1 
HETATM 3050 O  O     . HOH G 4 .   ? 7.470  -3.253  12.505  1.00 42.86 ? 1045 HOH B O     1 
HETATM 3051 O  O     . HOH G 4 .   ? 5.245  -5.183  7.183   1.00 29.24 ? 1046 HOH B O     1 
HETATM 3052 O  O     . HOH G 4 .   ? 2.839  -11.375 -12.510 1.00 31.60 ? 1047 HOH B O     1 
HETATM 3053 O  O     . HOH G 4 .   ? 7.267  7.314   5.567   1.00 36.97 ? 1048 HOH B O     1 
HETATM 3054 O  O     . HOH G 4 .   ? 30.784 -16.519 8.599   1.00 40.48 ? 1049 HOH B O     1 
HETATM 3055 O  O     . HOH G 4 .   ? 43.038 3.832   -9.025  1.00 37.07 ? 1050 HOH B O     1 
HETATM 3056 O  O     . HOH G 4 .   ? 0.135  -6.652  -11.257 1.00 36.76 ? 1051 HOH B O     1 
HETATM 3057 O  O     . HOH G 4 .   ? 5.858  -4.869  9.928   1.00 47.60 ? 1052 HOH B O     1 
HETATM 3058 O  O     . HOH G 4 .   ? 12.503 0.721   -5.309  1.00 23.69 ? 1053 HOH B O     1 
HETATM 3059 O  O     . HOH G 4 .   ? 34.039 -4.524  -7.409  1.00 17.45 ? 1054 HOH B O     1 
HETATM 3060 O  O     . HOH G 4 .   ? 16.564 -12.170 8.330   1.00 27.74 ? 1055 HOH B O     1 
HETATM 3061 O  O     . HOH G 4 .   ? 41.471 -4.967  -9.287  1.00 32.10 ? 1056 HOH B O     1 
HETATM 3062 O  O     . HOH G 4 .   ? 37.613 -6.055  -4.487  1.00 48.48 ? 1057 HOH B O     1 
HETATM 3063 O  O     . HOH G 4 .   ? 4.815  -13.446 -4.901  1.00 27.90 ? 1058 HOH B O     1 
HETATM 3064 O  O     . HOH G 4 .   ? 28.411 -20.135 5.236   1.00 40.18 ? 1059 HOH B O     1 
HETATM 3065 O  O     . HOH G 4 .   ? 29.067 -10.094 5.082   1.00 17.64 ? 1060 HOH B O     1 
HETATM 3066 O  O     . HOH G 4 .   ? 10.999 -8.460  -15.828 1.00 13.22 ? 1061 HOH B O     1 
HETATM 3067 O  O     . HOH G 4 .   ? 17.898 -5.286  -11.525 1.00 15.16 ? 1062 HOH B O     1 
HETATM 3068 O  O     . HOH G 4 .   ? 13.421 3.640   3.956   1.00 12.75 ? 1063 HOH B O     1 
HETATM 3069 O  O     . HOH G 4 .   ? 36.627 -19.877 -3.346  1.00 19.95 ? 1064 HOH B O     1 
HETATM 3070 O  O     . HOH G 4 .   ? 5.646  -1.434  -12.443 1.00 20.23 ? 1065 HOH B O     1 
HETATM 3071 O  O     . HOH G 4 .   ? 36.351 3.462   -11.886 1.00 22.13 ? 1066 HOH B O     1 
HETATM 3072 O  O     . HOH G 4 .   ? 22.163 -4.677  3.831   1.00 19.07 ? 1067 HOH B O     1 
HETATM 3073 O  O     . HOH G 4 .   ? 18.141 -5.645  -14.319 1.00 16.86 ? 1068 HOH B O     1 
HETATM 3074 O  O     . HOH G 4 .   ? 33.228 -5.950  -1.381  1.00 13.24 ? 1069 HOH B O     1 
HETATM 3075 O  O     . HOH G 4 .   ? 34.902 -21.098 -1.968  1.00 17.85 ? 1070 HOH B O     1 
HETATM 3076 O  O     . HOH G 4 .   ? 10.620 -11.411 -15.749 1.00 19.07 ? 1071 HOH B O     1 
HETATM 3077 O  O     . HOH G 4 .   ? 7.618  1.353   6.632   1.00 21.71 ? 1072 HOH B O     1 
HETATM 3078 O  O     . HOH G 4 .   ? 27.388 -20.899 0.858   1.00 20.89 ? 1073 HOH B O     1 
HETATM 3079 O  O     . HOH G 4 .   ? 13.235 3.316   -4.076  1.00 20.59 ? 1074 HOH B O     1 
HETATM 3080 O  O     . HOH G 4 .   ? 17.901 5.310   -27.636 1.00 18.99 ? 1075 HOH B O     1 
HETATM 3081 O  O     . HOH G 4 .   ? 33.721 -5.780  -3.994  1.00 16.61 ? 1076 HOH B O     1 
HETATM 3082 O  O     . HOH G 4 .   ? 37.983 -13.809 -4.236  1.00 22.66 ? 1077 HOH B O     1 
HETATM 3083 O  O     . HOH G 4 .   ? 11.681 -17.809 0.256   1.00 22.83 ? 1078 HOH B O     1 
HETATM 3084 O  O     . HOH G 4 .   ? 9.594  1.716   11.415  1.00 30.89 ? 1079 HOH B O     1 
HETATM 3085 O  O     . HOH G 4 .   ? 21.541 -10.041 8.098   1.00 22.74 ? 1080 HOH B O     1 
HETATM 3086 O  O     . HOH G 4 .   ? 35.691 0.709   -14.946 1.00 28.03 ? 1081 HOH B O     1 
HETATM 3087 O  O     . HOH G 4 .   ? 28.283 -17.218 -15.140 1.00 29.85 ? 1082 HOH B O     1 
HETATM 3088 O  O     . HOH G 4 .   ? 32.308 -15.267 1.734   1.00 19.46 ? 1083 HOH B O     1 
HETATM 3089 O  O     . HOH G 4 .   ? 18.057 -1.749  -18.861 1.00 30.40 ? 1084 HOH B O     1 
HETATM 3090 O  O     . HOH G 4 .   ? 4.863  11.324  -15.296 1.00 30.45 ? 1085 HOH B O     1 
HETATM 3091 O  O     . HOH G 4 .   ? 22.891 -22.051 -11.387 1.00 26.13 ? 1086 HOH B O     1 
HETATM 3092 O  O     . HOH G 4 .   ? 3.443  7.080   -21.749 1.00 22.07 ? 1087 HOH B O     1 
HETATM 3093 O  O     . HOH G 4 .   ? 8.590  -12.421 -17.256 1.00 21.14 ? 1088 HOH B O     1 
HETATM 3094 O  O     . HOH G 4 .   ? 12.702 -19.114 8.770   1.00 38.18 ? 1089 HOH B O     1 
HETATM 3095 O  O     . HOH G 4 .   ? 33.598 -22.122 -5.866  1.00 26.10 ? 1090 HOH B O     1 
HETATM 3096 O  O     . HOH G 4 .   ? 16.515 -1.661  7.179   1.00 20.95 ? 1091 HOH B O     1 
HETATM 3097 O  O     . HOH G 4 .   ? 18.585 3.187   -24.142 1.00 24.56 ? 1092 HOH B O     1 
HETATM 3098 O  O     . HOH G 4 .   ? 10.278 -10.191 10.466  1.00 26.17 ? 1093 HOH B O     1 
HETATM 3099 O  O     . HOH G 4 .   ? 30.560 -3.391  -23.251 1.00 29.85 ? 1094 HOH B O     1 
HETATM 3100 O  O     . HOH G 4 .   ? 17.684 -27.748 -0.245  1.00 22.60 ? 1095 HOH B O     1 
HETATM 3101 O  O     . HOH G 4 .   ? 3.592  -11.204 -6.140  1.00 20.99 ? 1096 HOH B O     1 
HETATM 3102 O  O     . HOH G 4 .   ? 33.036 -18.186 0.540   1.00 28.74 ? 1097 HOH B O     1 
HETATM 3103 O  O     . HOH G 4 .   ? 20.946 -6.880  8.483   1.00 25.55 ? 1098 HOH B O     1 
HETATM 3104 O  O     . HOH G 4 .   ? 24.639 -10.268 -22.735 1.00 29.92 ? 1099 HOH B O     1 
HETATM 3105 O  O     . HOH G 4 .   ? 30.570 -12.656 -19.832 1.00 28.37 ? 1100 HOH B O     1 
HETATM 3106 O  O     . HOH G 4 .   ? 16.079 -16.383 -16.029 1.00 26.33 ? 1101 HOH B O     1 
HETATM 3107 O  O     . HOH G 4 .   ? 39.727 -12.100 -10.612 1.00 15.97 ? 1102 HOH B O     1 
HETATM 3108 O  O     . HOH G 4 .   ? 21.534 -21.073 8.635   1.00 39.26 ? 1103 HOH B O     1 
HETATM 3109 O  O     . HOH G 4 .   ? 25.493 2.655   -14.350 1.00 44.75 ? 1104 HOH B O     1 
HETATM 3110 O  O     . HOH G 4 .   ? 0.319  10.543  -11.692 1.00 27.55 ? 1105 HOH B O     1 
HETATM 3111 O  O     . HOH G 4 .   ? 40.821 -18.435 -2.377  1.00 27.39 ? 1106 HOH B O     1 
HETATM 3112 O  O     . HOH G 4 .   ? 41.197 -0.522  -15.178 1.00 31.76 ? 1107 HOH B O     1 
HETATM 3113 O  O     . HOH G 4 .   ? 40.931 -19.283 -9.153  1.00 21.99 ? 1108 HOH B O     1 
HETATM 3114 O  O     . HOH G 4 .   ? 16.973 7.938   -20.171 1.00 42.01 ? 1109 HOH B O     1 
HETATM 3115 O  O     . HOH G 4 .   ? 14.971 -19.367 -12.846 1.00 29.51 ? 1110 HOH B O     1 
HETATM 3116 O  O     . HOH G 4 .   ? 6.986  -17.283 0.584   1.00 27.15 ? 1111 HOH B O     1 
HETATM 3117 O  O     . HOH G 4 .   ? 23.168 0.468   -28.636 1.00 24.87 ? 1112 HOH B O     1 
HETATM 3118 O  O     . HOH G 4 .   ? 25.227 -20.047 3.609   1.00 23.89 ? 1113 HOH B O     1 
HETATM 3119 O  O     . HOH G 4 .   ? 14.971 6.131   -9.567  1.00 43.05 ? 1114 HOH B O     1 
HETATM 3120 O  O     . HOH G 4 .   ? 8.055  -15.391 -3.195  1.00 28.62 ? 1115 HOH B O     1 
HETATM 3121 O  O     . HOH G 4 .   ? 10.967 -19.081 2.429   1.00 30.89 ? 1116 HOH B O     1 
HETATM 3122 O  O     . HOH G 4 .   ? 32.268 -16.976 4.168   1.00 26.57 ? 1117 HOH B O     1 
HETATM 3123 O  O     . HOH G 4 .   ? 15.407 0.233   -19.491 1.00 29.36 ? 1118 HOH B O     1 
HETATM 3124 O  O     . HOH G 4 .   ? 22.290 -5.669  -20.671 1.00 27.56 ? 1119 HOH B O     1 
HETATM 3125 O  O     . HOH G 4 .   ? 10.724 -16.114 -9.023  1.00 27.96 ? 1120 HOH B O     1 
HETATM 3126 O  O     . HOH G 4 .   ? 10.822 6.161   -18.438 1.00 42.59 ? 1121 HOH B O     1 
HETATM 3127 O  O     . HOH G 4 .   ? 8.822  8.552   -22.230 1.00 31.05 ? 1122 HOH B O     1 
HETATM 3128 O  O     . HOH G 4 .   ? 23.141 8.072   -22.353 1.00 31.40 ? 1123 HOH B O     1 
HETATM 3129 O  O     . HOH G 4 .   ? 20.199 -0.584  -7.908  1.00 47.00 ? 1124 HOH B O     1 
HETATM 3130 O  O     . HOH G 4 .   ? -0.290 2.529   -6.350  1.00 40.56 ? 1125 HOH B O     1 
HETATM 3131 O  O     . HOH G 4 .   ? 29.556 -27.752 -6.754  1.00 35.67 ? 1126 HOH B O     1 
HETATM 3132 O  O     . HOH G 4 .   ? 20.737 -1.351  -10.494 1.00 35.62 ? 1127 HOH B O     1 
HETATM 3133 O  O     . HOH G 4 .   ? 39.879 2.540   -11.419 1.00 33.17 ? 1128 HOH B O     1 
HETATM 3134 O  O     . HOH G 4 .   ? 17.340 -3.715  -21.378 1.00 31.41 ? 1129 HOH B O     1 
HETATM 3135 O  O     . HOH G 4 .   ? 22.676 0.349   -11.398 1.00 45.60 ? 1130 HOH B O     1 
HETATM 3136 O  O     . HOH G 4 .   ? 20.524 -22.717 -15.728 1.00 40.95 ? 1131 HOH B O     1 
HETATM 3137 O  O     . HOH G 4 .   ? 27.663 -14.931 -16.662 1.00 35.08 ? 1132 HOH B O     1 
HETATM 3138 O  O     . HOH G 4 .   ? 3.201  -10.872 -17.298 1.00 36.75 ? 1133 HOH B O     1 
HETATM 3139 O  O     . HOH G 4 .   ? 15.085 0.796   -22.048 1.00 40.59 ? 1134 HOH B O     1 
HETATM 3140 O  O     . HOH G 4 .   ? 22.889 -2.811  -24.269 1.00 42.55 ? 1135 HOH B O     1 
HETATM 3141 O  O     . HOH G 4 .   ? 2.191  -1.690  -4.254  1.00 29.11 ? 1136 HOH B O     1 
HETATM 3142 O  O     . HOH G 4 .   ? 41.285 -11.029 -11.772 1.00 31.51 ? 1137 HOH B O     1 
HETATM 3143 O  O     . HOH G 4 .   ? 18.477 -17.864 6.712   1.00 27.91 ? 1138 HOH B O     1 
HETATM 3144 O  O     . HOH G 4 .   ? 32.700 -22.525 -10.716 1.00 29.19 ? 1139 HOH B O     1 
HETATM 3145 O  O     . HOH G 4 .   ? 21.189 -12.547 -21.513 1.00 28.75 ? 1140 HOH B O     1 
HETATM 3146 O  O     . HOH G 4 .   ? 8.679  -14.826 -14.218 1.00 34.56 ? 1141 HOH B O     1 
HETATM 3147 O  O     . HOH G 4 .   ? 34.835 -20.539 -14.098 1.00 42.10 ? 1142 HOH B O     1 
HETATM 3148 O  O     . HOH G 4 .   ? 12.844 7.745   -17.979 1.00 41.87 ? 1143 HOH B O     1 
HETATM 3149 O  O     . HOH G 4 .   ? 18.190 -14.995 -22.463 1.00 27.56 ? 1144 HOH B O     1 
HETATM 3150 O  O     . HOH G 4 .   ? 15.891 -17.430 6.491   1.00 33.65 ? 1145 HOH B O     1 
HETATM 3151 O  O     . HOH G 4 .   ? 33.724 6.676   -5.752  1.00 32.96 ? 1146 HOH B O     1 
HETATM 3152 O  O     . HOH G 4 .   ? 36.964 -16.883 -1.121  1.00 32.57 ? 1147 HOH B O     1 
HETATM 3153 O  O     . HOH G 4 .   ? 4.959  -0.124  -15.357 1.00 39.26 ? 1148 HOH B O     1 
HETATM 3154 O  O     . HOH G 4 .   ? 19.587 -14.653 11.588  1.00 47.76 ? 1149 HOH B O     1 
HETATM 3155 O  O     . HOH G 4 .   ? 20.608 -3.914  -21.888 1.00 34.13 ? 1150 HOH B O     1 
HETATM 3156 O  O     . HOH G 4 .   ? 0.044  -2.659  -8.875  1.00 36.33 ? 1151 HOH B O     1 
HETATM 3157 O  O     . HOH G 4 .   ? 24.976 -11.857 -19.618 1.00 39.16 ? 1152 HOH B O     1 
HETATM 3158 O  O     . HOH G 4 .   ? 10.580 -17.027 9.156   1.00 35.82 ? 1153 HOH B O     1 
HETATM 3159 O  O     . HOH G 4 .   ? 8.853  -14.164 -25.273 1.00 35.82 ? 1154 HOH B O     1 
HETATM 3160 O  O     . HOH G 4 .   ? 9.737  4.022   -12.588 1.00 35.28 ? 1155 HOH B O     1 
HETATM 3161 O  O     . HOH G 4 .   ? 36.600 2.938   -15.921 1.00 33.83 ? 1156 HOH B O     1 
HETATM 3162 O  O     . HOH G 4 .   ? 34.785 -3.459  -4.860  1.00 39.86 ? 1157 HOH B O     1 
HETATM 3163 O  O     . HOH G 4 .   ? 31.124 -23.401 -4.374  1.00 25.39 ? 1158 HOH B O     1 
HETATM 3164 O  O     . HOH G 4 .   ? 22.993 -16.843 10.244  1.00 39.08 ? 1159 HOH B O     1 
HETATM 3165 O  O     . HOH G 4 .   ? 3.296  0.790   1.633   1.00 39.81 ? 1160 HOH B O     1 
HETATM 3166 O  O     . HOH G 4 .   ? 25.694 -21.471 -0.538  1.00 38.22 ? 1161 HOH B O     1 
HETATM 3167 O  O     . HOH G 4 .   ? -1.201 -13.006 3.461   1.00 46.55 ? 1162 HOH B O     1 
HETATM 3168 O  O     . HOH G 4 .   ? 26.152 -22.034 -13.372 1.00 43.21 ? 1163 HOH B O     1 
HETATM 3169 O  O     . HOH G 4 .   ? 32.596 -17.484 -16.779 1.00 44.64 ? 1164 HOH B O     1 
HETATM 3170 O  O     . HOH G 4 .   ? 0.582  1.729   -17.253 1.00 38.88 ? 1165 HOH B O     1 
HETATM 3171 O  O     . HOH G 4 .   ? 9.850  -15.282 -10.776 0.65 29.50 ? 1166 HOH B O     1 
HETATM 3172 O  O     . HOH G 4 .   ? 22.299 -14.649 -19.360 1.00 42.21 ? 1167 HOH B O     1 
HETATM 3173 O  O     . HOH G 4 .   ? 39.097 -13.440 -12.136 1.00 23.36 ? 1168 HOH B O     1 
HETATM 3174 O  O     . HOH G 4 .   ? 29.020 5.737   -14.845 1.00 36.64 ? 1169 HOH B O     1 
HETATM 3175 O  O     . HOH G 4 .   ? 21.722 -11.827 9.281   1.00 33.78 ? 1170 HOH B O     1 
HETATM 3176 O  O     . HOH G 4 .   ? 2.013  10.929  -10.309 1.00 33.66 ? 1171 HOH B O     1 
HETATM 3177 O  O     . HOH G 4 .   ? 36.673 7.966   -12.055 1.00 33.32 ? 1172 HOH B O     1 
HETATM 3178 O  O     . HOH G 4 .   ? 24.041 -20.183 -14.449 1.00 41.40 ? 1173 HOH B O     1 
HETATM 3179 O  O     . HOH G 4 .   ? 36.944 -10.459 -21.372 1.00 45.62 ? 1174 HOH B O     1 
HETATM 3180 O  O     . HOH G 4 .   ? 1.764  -14.322 0.802   1.00 43.09 ? 1175 HOH B O     1 
HETATM 3181 O  O     . HOH G 4 .   ? 35.448 -18.663 -0.231  1.00 36.69 ? 1176 HOH B O     1 
HETATM 3182 O  O     . HOH G 4 .   ? 1.633  -1.643  -15.397 1.00 44.12 ? 1177 HOH B O     1 
HETATM 3183 O  O     . HOH G 4 .   ? 7.313  1.385   9.430   1.00 40.01 ? 1178 HOH B O     1 
HETATM 3184 O  O     . HOH G 4 .   ? 43.457 -6.572  -9.908  1.00 31.19 ? 1179 HOH B O     1 
HETATM 3185 O  O     . HOH G 4 .   ? -2.153 -6.491  -12.803 1.00 31.92 ? 1180 HOH B O     1 
HETATM 3186 O  O     . HOH G 4 .   ? 9.024  -16.511 -0.786  1.00 27.30 ? 1181 HOH B O     1 
HETATM 3187 O  O     . HOH G 4 .   ? 18.733 -9.220  8.500   1.00 38.97 ? 1182 HOH B O     1 
HETATM 3188 O  O     . HOH G 4 .   ? 13.094 1.786   -19.219 1.00 39.81 ? 1183 HOH B O     1 
HETATM 3189 O  O     . HOH G 4 .   ? 2.329  11.989  -15.771 1.00 33.88 ? 1184 HOH B O     1 
HETATM 3190 O  O     . HOH G 4 .   ? 15.496 -1.283  -22.870 1.00 30.58 ? 1185 HOH B O     1 
HETATM 3191 O  O     . HOH G 4 .   ? 19.920 3.883   -8.873  1.00 43.59 ? 1186 HOH B O     1 
HETATM 3192 O  O     . HOH G 4 .   ? 10.089 -14.079 -19.196 0.65 19.65 ? 1187 HOH B O     1 
HETATM 3193 O  O     . HOH G 4 .   ? 25.529 -20.382 8.125   1.00 41.38 ? 1188 HOH B O     1 
HETATM 3194 O  O     . HOH G 4 .   ? 6.717  3.747   5.540   1.00 39.42 ? 1189 HOH B O     1 
HETATM 3195 O  O     . HOH G 4 .   ? 11.138 -12.442 9.507   1.00 34.05 ? 1190 HOH B O     1 
HETATM 3196 O  O     . HOH G 4 .   ? 42.594 -19.868 -11.195 1.00 34.87 ? 1191 HOH B O     1 
HETATM 3197 O  O     . HOH G 4 .   ? 10.647 -9.217  13.088  1.00 38.31 ? 1192 HOH B O     1 
HETATM 3198 O  O     . HOH G 4 .   ? 5.532  -6.910  12.076  1.00 33.57 ? 1193 HOH B O     1 
HETATM 3199 O  O     . HOH G 4 .   ? 23.974 -23.949 -10.489 1.00 26.86 ? 1194 HOH B O     1 
HETATM 3200 O  O     . HOH G 4 .   ? 5.649  -2.795  -15.695 1.00 32.21 ? 1195 HOH B O     1 
HETATM 3201 O  O     . HOH G 4 .   ? 26.778 -11.153 -20.889 1.00 38.59 ? 1196 HOH B O     1 
HETATM 3202 O  O     . HOH G 4 .   ? 41.819 -3.421  -7.409  1.00 45.81 ? 1197 HOH B O     1 
HETATM 3203 O  O     . HOH G 4 .   ? 43.214 -9.224  -10.456 1.00 34.44 ? 1198 HOH B O     1 
HETATM 3204 O  O     . HOH G 4 .   ? 28.750 -21.422 2.690   1.00 34.38 ? 1199 HOH B O     1 
HETATM 3205 O  O     . HOH G 4 .   ? 26.015 -14.877 -18.399 1.00 45.48 ? 1200 HOH B O     1 
HETATM 3206 O  O     . HOH G 4 .   ? 7.600  -14.319 -16.012 1.00 35.24 ? 1201 HOH B O     1 
HETATM 3207 O  O     . HOH G 4 .   ? 4.616  1.356   9.579   1.00 45.47 ? 1202 HOH B O     1 
HETATM 3208 O  O     . HOH G 4 .   ? 6.494  4.185   8.774   1.00 49.00 ? 1203 HOH B O     1 
HETATM 3209 O  O     . HOH G 4 .   ? 24.800 -17.028 -19.586 1.00 36.69 ? 1204 HOH B O     1 
HETATM 3210 O  O     . HOH G 4 .   ? 4.331  4.418   8.130   1.00 46.74 ? 1205 HOH B O     1 
HETATM 3211 O  O     . HOH G 4 .   ? 0.812  -0.322  9.651   1.00 53.27 ? 1206 HOH B O     1 
HETATM 3212 O  O     . HOH G 4 .   ? 23.488 -23.277 3.869   1.00 43.20 ? 1207 HOH B O     1 
HETATM 3213 O  O     . HOH G 4 .   ? 25.173 -18.799 -17.700 1.00 37.67 ? 1208 HOH B O     1 
HETATM 3214 O  O     . HOH G 4 .   ? 16.856 -20.250 -17.080 1.00 42.65 ? 1209 HOH B O     1 
HETATM 3215 O  O     . HOH G 4 .   ? 46.065 0.608   -9.189  1.00 40.02 ? 1210 HOH B O     1 
HETATM 3216 O  O     . HOH G 4 .   ? 35.563 -2.435  -22.134 1.00 44.47 ? 1211 HOH B O     1 
HETATM 3217 O  O     . HOH G 4 .   ? 32.730 1.123   -21.833 0.65 36.83 ? 1212 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   ALA 2   2   ?   ?   ?   A . n 
A 1 3   ASP 3   3   3   ASP ASP A . n 
A 1 4   SER 4   4   4   SER SER A . n 
A 1 5   GLU 5   5   5   GLU GLU A . n 
A 1 6   LEU 6   6   6   LEU LEU A . n 
A 1 7   GLN 7   7   7   GLN GLN A . n 
A 1 8   LEU 8   8   8   LEU LEU A . n 
A 1 9   VAL 9   9   9   VAL VAL A . n 
A 1 10  GLU 10  10  10  GLU GLU A . n 
A 1 11  GLN 11  11  11  GLN GLN A . n 
A 1 12  ARG 12  12  12  ARG ARG A . n 
A 1 13  ILE 13  13  13  ILE ILE A . n 
A 1 14  ARG 14  14  14  ARG ARG A . n 
A 1 15  SER 15  15  15  SER SER A . n 
A 1 16  PHE 16  16  16  PHE PHE A . n 
A 1 17  PRO 17  17  17  PRO PRO A . n 
A 1 18  ASP 18  18  18  ASP ASP A . n 
A 1 19  PHE 19  19  19  PHE PHE A . n 
A 1 20  PRO 20  20  20  PRO PRO A . n 
A 1 21  THR 21  21  21  THR THR A . n 
A 1 22  PRO 22  22  22  PRO PRO A . n 
A 1 23  GLY 23  23  23  GLY GLY A . n 
A 1 24  VAL 24  24  24  VAL VAL A . n 
A 1 25  VAL 25  25  25  VAL VAL A . n 
A 1 26  PHE 26  26  26  PHE PHE A . n 
A 1 27  ARG 27  27  27  ARG ARG A . n 
A 1 28  ASP 28  28  28  ASP ASP A . n 
A 1 29  ILE 29  29  29  ILE ILE A . n 
A 1 30  SER 30  30  30  SER SER A . n 
A 1 31  PRO 31  31  31  PRO PRO A . n 
A 1 32  VAL 32  32  32  VAL VAL A . n 
A 1 33  LEU 33  33  33  LEU LEU A . n 
A 1 34  LYS 34  34  34  LYS LYS A . n 
A 1 35  ASP 35  35  35  ASP ASP A . n 
A 1 36  PRO 36  36  36  PRO PRO A . n 
A 1 37  ALA 37  37  37  ALA ALA A . n 
A 1 38  SER 38  38  38  SER SER A . n 
A 1 39  PHE 39  39  39  PHE PHE A . n 
A 1 40  ARG 40  40  40  ARG ARG A . n 
A 1 41  ALA 41  41  41  ALA ALA A . n 
A 1 42  ALA 42  42  42  ALA ALA A . n 
A 1 43  ILE 43  43  43  ILE ILE A . n 
A 1 44  GLY 44  44  44  GLY GLY A . n 
A 1 45  LEU 45  45  45  LEU LEU A . n 
A 1 46  LEU 46  46  46  LEU LEU A . n 
A 1 47  ALA 47  47  47  ALA ALA A . n 
A 1 48  ARG 48  48  48  ARG ARG A . n 
A 1 49  HIS 49  49  49  HIS HIS A . n 
A 1 50  LEU 50  50  50  LEU LEU A . n 
A 1 51  LYS 51  51  51  LYS LYS A . n 
A 1 52  ALA 52  52  52  ALA ALA A . n 
A 1 53  THR 53  53  53  THR THR A . n 
A 1 54  HIS 54  54  54  HIS HIS A . n 
A 1 55  GLY 55  55  55  GLY GLY A . n 
A 1 56  GLY 56  56  56  GLY GLY A . n 
A 1 57  ARG 57  57  57  ARG ARG A . n 
A 1 58  ILE 58  58  58  ILE ILE A . n 
A 1 59  ASP 59  59  59  ASP ASP A . n 
A 1 60  TYR 60  60  60  TYR TYR A . n 
A 1 61  ILE 61  61  61  ILE ILE A . n 
A 1 62  ALA 62  62  62  ALA ALA A . n 
A 1 63  GLY 63  63  63  GLY GLY A . n 
A 1 64  LEU 64  64  64  LEU LEU A . n 
A 1 65  ASP 65  65  65  ASP ASP A . n 
A 1 66  SER 66  66  66  SER SER A . n 
A 1 67  ARG 67  67  67  ARG ARG A . n 
A 1 68  GLY 68  68  68  GLY GLY A . n 
A 1 69  PHE 69  69  69  PHE PHE A . n 
A 1 70  LEU 70  70  70  LEU LEU A . n 
A 1 71  PHE 71  71  71  PHE PHE A . n 
A 1 72  GLY 72  72  72  GLY GLY A . n 
A 1 73  PRO 73  73  73  PRO PRO A . n 
A 1 74  SER 74  74  74  SER SER A . n 
A 1 75  LEU 75  75  75  LEU LEU A . n 
A 1 76  ALA 76  76  76  ALA ALA A . n 
A 1 77  GLN 77  77  77  GLN GLN A . n 
A 1 78  GLU 78  78  78  GLU GLU A . n 
A 1 79  LEU 79  79  79  LEU LEU A . n 
A 1 80  GLY 80  80  80  GLY GLY A . n 
A 1 81  LEU 81  81  81  LEU LEU A . n 
A 1 82  GLY 82  82  82  GLY GLY A . n 
A 1 83  CYS 83  83  83  CYS CYS A . n 
A 1 84  VAL 84  84  84  VAL VAL A . n 
A 1 85  LEU 85  85  85  LEU LEU A . n 
A 1 86  ILE 86  86  86  ILE ILE A . n 
A 1 87  ARG 87  87  87  ARG ARG A . n 
A 1 88  LYS 88  88  88  LYS LYS A . n 
A 1 89  ARG 89  89  89  ARG ARG A . n 
A 1 90  GLY 90  90  90  GLY GLY A . n 
A 1 91  LYS 91  91  91  LYS LYS A . n 
A 1 92  LEU 92  92  92  LEU LEU A . n 
A 1 93  PRO 93  93  93  PRO PRO A . n 
A 1 94  GLY 94  94  94  GLY GLY A . n 
A 1 95  PRO 95  95  95  PRO PRO A . n 
A 1 96  THR 96  96  96  THR THR A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  TRP 98  98  98  TRP TRP A . n 
A 1 99  ALA 99  99  99  ALA ALA A . n 
A 1 100 SER 100 100 100 SER SER A . n 
A 1 101 TYR 101 101 101 TYR TYR A . n 
A 1 102 SER 102 102 102 SER SER A . n 
A 1 103 LEU 103 103 103 LEU LEU A . n 
A 1 104 GLU 104 104 104 GLU GLU A . n 
A 1 105 TYR 105 105 105 TYR TYR A . n 
A 1 106 GLY 106 106 106 GLY GLY A . n 
A 1 107 LYS 107 107 107 LYS LYS A . n 
A 1 108 ALA 108 108 108 ALA ALA A . n 
A 1 109 GLU 109 109 109 GLU GLU A . n 
A 1 110 LEU 110 110 110 LEU LEU A . n 
A 1 111 GLU 111 111 111 GLU GLU A . n 
A 1 112 ILE 112 112 112 ILE ILE A . n 
A 1 113 GLN 113 113 113 GLN GLN A . n 
A 1 114 LYS 114 114 114 LYS LYS A . n 
A 1 115 ASP 115 115 115 ASP ASP A . n 
A 1 116 ALA 116 116 116 ALA ALA A . n 
A 1 117 LEU 117 117 117 LEU LEU A . n 
A 1 118 GLU 118 118 118 GLU GLU A . n 
A 1 119 PRO 119 119 119 PRO PRO A . n 
A 1 120 GLY 120 120 120 GLY GLY A . n 
A 1 121 GLN 121 121 121 GLN GLN A . n 
A 1 122 ARG 122 122 122 ARG ARG A . n 
A 1 123 VAL 123 123 123 VAL VAL A . n 
A 1 124 VAL 124 124 124 VAL VAL A . n 
A 1 125 VAL 125 125 125 VAL VAL A . n 
A 1 126 VAL 126 126 126 VAL VAL A . n 
A 1 127 ASP 127 127 127 ASP ASP A . n 
A 1 128 ASP 128 128 128 ASP ASP A . n 
A 1 129 LEU 129 129 129 LEU LEU A . n 
A 1 130 LEU 130 130 130 LEU LEU A . n 
A 1 131 ALA 131 131 131 ALA ALA A . n 
A 1 132 THR 132 132 132 THR THR A . n 
A 1 133 GLY 133 133 133 GLY GLY A . n 
A 1 134 GLY 134 134 134 GLY GLY A . n 
A 1 135 THR 135 135 135 THR THR A . n 
A 1 136 MET 136 136 136 MET MET A . n 
A 1 137 ASN 137 137 137 ASN ASN A . n 
A 1 138 ALA 138 138 138 ALA ALA A . n 
A 1 139 ALA 139 139 139 ALA ALA A . n 
A 1 140 CYS 140 140 140 CYS CYS A . n 
A 1 141 GLU 141 141 141 GLU GLU A . n 
A 1 142 LEU 142 142 142 LEU LEU A . n 
A 1 143 LEU 143 143 143 LEU LEU A . n 
A 1 144 GLY 144 144 144 GLY GLY A . n 
A 1 145 ARG 145 145 145 ARG ARG A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 GLN 147 147 147 GLN GLN A . n 
A 1 148 ALA 148 148 148 ALA ALA A . n 
A 1 149 GLU 149 149 149 GLU GLU A . n 
A 1 150 VAL 150 150 150 VAL VAL A . n 
A 1 151 LEU 151 151 151 LEU LEU A . n 
A 1 152 GLU 152 152 152 GLU GLU A . n 
A 1 153 CYS 153 153 153 CYS CYS A . n 
A 1 154 VAL 154 154 154 VAL VAL A . n 
A 1 155 SER 155 155 155 SER SER A . n 
A 1 156 LEU 156 156 156 LEU LEU A . n 
A 1 157 VAL 157 157 157 VAL VAL A . n 
A 1 158 GLU 158 158 158 GLU GLU A . n 
A 1 159 LEU 159 159 159 LEU LEU A . n 
A 1 160 THR 160 160 160 THR THR A . n 
A 1 161 SER 161 161 161 SER SER A . n 
A 1 162 LEU 162 162 162 LEU LEU A . n 
A 1 163 LYS 163 163 163 LYS LYS A . n 
A 1 164 GLY 164 164 164 GLY GLY A . n 
A 1 165 ARG 165 165 165 ARG ARG A . n 
A 1 166 GLU 166 166 166 GLU GLU A . n 
A 1 167 LYS 167 167 167 LYS LYS A . n 
A 1 168 LEU 168 168 168 LEU LEU A . n 
A 1 169 ALA 169 169 169 ALA ALA A . n 
A 1 170 PRO 170 170 170 PRO PRO A . n 
A 1 171 VAL 171 171 171 VAL VAL A . n 
A 1 172 PRO 172 172 172 PRO PRO A . n 
A 1 173 PHE 173 173 173 PHE PHE A . n 
A 1 174 PHE 174 174 174 PHE PHE A . n 
A 1 175 SER 175 175 175 SER SER A . n 
A 1 176 LEU 176 176 176 LEU LEU A . n 
A 1 177 LEU 177 177 177 LEU LEU A . n 
A 1 178 GLN 178 178 178 GLN GLN A . n 
A 1 179 TYR 179 179 179 TYR TYR A . n 
A 1 180 GLU 180 180 180 GLU GLU A . n 
B 1 1   MET 1   1   ?   ?   ?   B . n 
B 1 2   ALA 2   2   2   ALA ALA B . n 
B 1 3   ASP 3   3   3   ASP ASP B . n 
B 1 4   SER 4   4   4   SER SER B . n 
B 1 5   GLU 5   5   5   GLU GLU B . n 
B 1 6   LEU 6   6   6   LEU LEU B . n 
B 1 7   GLN 7   7   7   GLN GLN B . n 
B 1 8   LEU 8   8   8   LEU LEU B . n 
B 1 9   VAL 9   9   9   VAL VAL B . n 
B 1 10  GLU 10  10  10  GLU GLU B . n 
B 1 11  GLN 11  11  11  GLN GLN B . n 
B 1 12  ARG 12  12  12  ARG ARG B . n 
B 1 13  ILE 13  13  13  ILE ILE B . n 
B 1 14  ARG 14  14  14  ARG ARG B . n 
B 1 15  SER 15  15  15  SER SER B . n 
B 1 16  PHE 16  16  16  PHE PHE B . n 
B 1 17  PRO 17  17  17  PRO PRO B . n 
B 1 18  ASP 18  18  18  ASP ASP B . n 
B 1 19  PHE 19  19  19  PHE PHE B . n 
B 1 20  PRO 20  20  20  PRO PRO B . n 
B 1 21  THR 21  21  21  THR THR B . n 
B 1 22  PRO 22  22  22  PRO PRO B . n 
B 1 23  GLY 23  23  23  GLY GLY B . n 
B 1 24  VAL 24  24  24  VAL VAL B . n 
B 1 25  VAL 25  25  25  VAL VAL B . n 
B 1 26  PHE 26  26  26  PHE PHE B . n 
B 1 27  ARG 27  27  27  ARG ARG B . n 
B 1 28  ASP 28  28  28  ASP ASP B . n 
B 1 29  ILE 29  29  29  ILE ILE B . n 
B 1 30  SER 30  30  30  SER SER B . n 
B 1 31  PRO 31  31  31  PRO PRO B . n 
B 1 32  VAL 32  32  32  VAL VAL B . n 
B 1 33  LEU 33  33  33  LEU LEU B . n 
B 1 34  LYS 34  34  34  LYS LYS B . n 
B 1 35  ASP 35  35  35  ASP ASP B . n 
B 1 36  PRO 36  36  36  PRO PRO B . n 
B 1 37  ALA 37  37  37  ALA ALA B . n 
B 1 38  SER 38  38  38  SER SER B . n 
B 1 39  PHE 39  39  39  PHE PHE B . n 
B 1 40  ARG 40  40  40  ARG ARG B . n 
B 1 41  ALA 41  41  41  ALA ALA B . n 
B 1 42  ALA 42  42  42  ALA ALA B . n 
B 1 43  ILE 43  43  43  ILE ILE B . n 
B 1 44  GLY 44  44  44  GLY GLY B . n 
B 1 45  LEU 45  45  45  LEU LEU B . n 
B 1 46  LEU 46  46  46  LEU LEU B . n 
B 1 47  ALA 47  47  47  ALA ALA B . n 
B 1 48  ARG 48  48  48  ARG ARG B . n 
B 1 49  HIS 49  49  49  HIS HIS B . n 
B 1 50  LEU 50  50  50  LEU LEU B . n 
B 1 51  LYS 51  51  51  LYS LYS B . n 
B 1 52  ALA 52  52  52  ALA ALA B . n 
B 1 53  THR 53  53  53  THR THR B . n 
B 1 54  HIS 54  54  54  HIS HIS B . n 
B 1 55  GLY 55  55  55  GLY GLY B . n 
B 1 56  GLY 56  56  56  GLY GLY B . n 
B 1 57  ARG 57  57  57  ARG ARG B . n 
B 1 58  ILE 58  58  58  ILE ILE B . n 
B 1 59  ASP 59  59  59  ASP ASP B . n 
B 1 60  TYR 60  60  60  TYR TYR B . n 
B 1 61  ILE 61  61  61  ILE ILE B . n 
B 1 62  ALA 62  62  62  ALA ALA B . n 
B 1 63  GLY 63  63  63  GLY GLY B . n 
B 1 64  LEU 64  64  64  LEU LEU B . n 
B 1 65  ASP 65  65  65  ASP ASP B . n 
B 1 66  SER 66  66  66  SER SER B . n 
B 1 67  ARG 67  67  67  ARG ARG B . n 
B 1 68  GLY 68  68  68  GLY GLY B . n 
B 1 69  PHE 69  69  69  PHE PHE B . n 
B 1 70  LEU 70  70  70  LEU LEU B . n 
B 1 71  PHE 71  71  71  PHE PHE B . n 
B 1 72  GLY 72  72  72  GLY GLY B . n 
B 1 73  PRO 73  73  73  PRO PRO B . n 
B 1 74  SER 74  74  74  SER SER B . n 
B 1 75  LEU 75  75  75  LEU LEU B . n 
B 1 76  ALA 76  76  76  ALA ALA B . n 
B 1 77  GLN 77  77  77  GLN GLN B . n 
B 1 78  GLU 78  78  78  GLU GLU B . n 
B 1 79  LEU 79  79  79  LEU LEU B . n 
B 1 80  GLY 80  80  80  GLY GLY B . n 
B 1 81  LEU 81  81  81  LEU LEU B . n 
B 1 82  GLY 82  82  82  GLY GLY B . n 
B 1 83  CYS 83  83  83  CYS CYS B . n 
B 1 84  VAL 84  84  84  VAL VAL B . n 
B 1 85  LEU 85  85  85  LEU LEU B . n 
B 1 86  ILE 86  86  86  ILE ILE B . n 
B 1 87  ARG 87  87  87  ARG ARG B . n 
B 1 88  LYS 88  88  88  LYS LYS B . n 
B 1 89  ARG 89  89  89  ARG ARG B . n 
B 1 90  GLY 90  90  90  GLY GLY B . n 
B 1 91  LYS 91  91  91  LYS LYS B . n 
B 1 92  LEU 92  92  92  LEU LEU B . n 
B 1 93  PRO 93  93  93  PRO PRO B . n 
B 1 94  GLY 94  94  94  GLY GLY B . n 
B 1 95  PRO 95  95  95  PRO PRO B . n 
B 1 96  THR 96  96  96  THR THR B . n 
B 1 97  LEU 97  97  97  LEU LEU B . n 
B 1 98  TRP 98  98  98  TRP TRP B . n 
B 1 99  ALA 99  99  99  ALA ALA B . n 
B 1 100 SER 100 100 100 SER SER B . n 
B 1 101 TYR 101 101 101 TYR TYR B . n 
B 1 102 SER 102 102 102 SER SER B . n 
B 1 103 LEU 103 103 103 LEU LEU B . n 
B 1 104 GLU 104 104 104 GLU GLU B . n 
B 1 105 TYR 105 105 105 TYR TYR B . n 
B 1 106 GLY 106 106 106 GLY GLY B . n 
B 1 107 LYS 107 107 107 LYS LYS B . n 
B 1 108 ALA 108 108 108 ALA ALA B . n 
B 1 109 GLU 109 109 109 GLU GLU B . n 
B 1 110 LEU 110 110 110 LEU LEU B . n 
B 1 111 GLU 111 111 111 GLU GLU B . n 
B 1 112 ILE 112 112 112 ILE ILE B . n 
B 1 113 GLN 113 113 113 GLN GLN B . n 
B 1 114 LYS 114 114 114 LYS LYS B . n 
B 1 115 ASP 115 115 115 ASP ASP B . n 
B 1 116 ALA 116 116 116 ALA ALA B . n 
B 1 117 LEU 117 117 117 LEU LEU B . n 
B 1 118 GLU 118 118 118 GLU GLU B . n 
B 1 119 PRO 119 119 119 PRO PRO B . n 
B 1 120 GLY 120 120 120 GLY GLY B . n 
B 1 121 GLN 121 121 121 GLN GLN B . n 
B 1 122 ARG 122 122 122 ARG ARG B . n 
B 1 123 VAL 123 123 123 VAL VAL B . n 
B 1 124 VAL 124 124 124 VAL VAL B . n 
B 1 125 VAL 125 125 125 VAL VAL B . n 
B 1 126 VAL 126 126 126 VAL VAL B . n 
B 1 127 ASP 127 127 127 ASP ASP B . n 
B 1 128 ASP 128 128 128 ASP ASP B . n 
B 1 129 LEU 129 129 129 LEU LEU B . n 
B 1 130 LEU 130 130 130 LEU LEU B . n 
B 1 131 ALA 131 131 131 ALA ALA B . n 
B 1 132 THR 132 132 132 THR THR B . n 
B 1 133 GLY 133 133 133 GLY GLY B . n 
B 1 134 GLY 134 134 134 GLY GLY B . n 
B 1 135 THR 135 135 135 THR THR B . n 
B 1 136 MET 136 136 136 MET MET B . n 
B 1 137 ASN 137 137 137 ASN ASN B . n 
B 1 138 ALA 138 138 138 ALA ALA B . n 
B 1 139 ALA 139 139 139 ALA ALA B . n 
B 1 140 CYS 140 140 140 CYS CYS B . n 
B 1 141 GLU 141 141 141 GLU GLU B . n 
B 1 142 LEU 142 142 142 LEU LEU B . n 
B 1 143 LEU 143 143 143 LEU LEU B . n 
B 1 144 GLY 144 144 144 GLY GLY B . n 
B 1 145 ARG 145 145 145 ARG ARG B . n 
B 1 146 LEU 146 146 146 LEU LEU B . n 
B 1 147 GLN 147 147 147 GLN GLN B . n 
B 1 148 ALA 148 148 148 ALA ALA B . n 
B 1 149 GLU 149 149 149 GLU GLU B . n 
B 1 150 VAL 150 150 150 VAL VAL B . n 
B 1 151 LEU 151 151 151 LEU LEU B . n 
B 1 152 GLU 152 152 152 GLU GLU B . n 
B 1 153 CYS 153 153 153 CYS CYS B . n 
B 1 154 VAL 154 154 154 VAL VAL B . n 
B 1 155 SER 155 155 155 SER SER B . n 
B 1 156 LEU 156 156 156 LEU LEU B . n 
B 1 157 VAL 157 157 157 VAL VAL B . n 
B 1 158 GLU 158 158 158 GLU GLU B . n 
B 1 159 LEU 159 159 159 LEU LEU B . n 
B 1 160 THR 160 160 160 THR THR B . n 
B 1 161 SER 161 161 161 SER SER B . n 
B 1 162 LEU 162 162 162 LEU LEU B . n 
B 1 163 LYS 163 163 163 LYS LYS B . n 
B 1 164 GLY 164 164 164 GLY GLY B . n 
B 1 165 ARG 165 165 165 ARG ARG B . n 
B 1 166 GLU 166 166 166 GLU GLU B . n 
B 1 167 LYS 167 167 167 LYS LYS B . n 
B 1 168 LEU 168 168 168 LEU LEU B . n 
B 1 169 ALA 169 169 169 ALA ALA B . n 
B 1 170 PRO 170 170 170 PRO PRO B . n 
B 1 171 VAL 171 171 171 VAL VAL B . n 
B 1 172 PRO 172 172 172 PRO PRO B . n 
B 1 173 PHE 173 173 173 PHE PHE B . n 
B 1 174 PHE 174 174 174 PHE PHE B . n 
B 1 175 SER 175 175 175 SER SER B . n 
B 1 176 LEU 176 176 176 LEU LEU B . n 
B 1 177 LEU 177 177 177 LEU LEU B . n 
B 1 178 GLN 178 178 178 GLN GLN B . n 
B 1 179 TYR 179 179 179 TYR TYR B . n 
B 1 180 GLU 180 180 180 GLU GLU B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 AMP 1   1031 1031 AMP AMP A . 
D 3 CL  1   1030 1030 CL  CL  B . 
E 2 AMP 1   1032 1032 AMP AMP B . 
F 4 HOH 1   1032 1    HOH HOH A . 
F 4 HOH 2   1033 2    HOH HOH A . 
F 4 HOH 3   1034 3    HOH HOH A . 
F 4 HOH 4   1035 4    HOH HOH A . 
F 4 HOH 5   1036 5    HOH HOH A . 
F 4 HOH 6   1037 6    HOH HOH A . 
F 4 HOH 7   1038 7    HOH HOH A . 
F 4 HOH 8   1039 8    HOH HOH A . 
F 4 HOH 9   1040 9    HOH HOH A . 
F 4 HOH 10  1041 10   HOH HOH A . 
F 4 HOH 11  1042 11   HOH HOH A . 
F 4 HOH 12  1043 12   HOH HOH A . 
F 4 HOH 13  1044 13   HOH HOH A . 
F 4 HOH 14  1045 14   HOH HOH A . 
F 4 HOH 15  1046 15   HOH HOH A . 
F 4 HOH 16  1047 16   HOH HOH A . 
F 4 HOH 17  1048 17   HOH HOH A . 
F 4 HOH 18  1049 18   HOH HOH A . 
F 4 HOH 19  1050 19   HOH HOH A . 
F 4 HOH 20  1051 20   HOH HOH A . 
F 4 HOH 21  1052 21   HOH HOH A . 
F 4 HOH 22  1053 22   HOH HOH A . 
F 4 HOH 23  1054 23   HOH HOH A . 
F 4 HOH 24  1055 24   HOH HOH A . 
F 4 HOH 25  1056 25   HOH HOH A . 
F 4 HOH 26  1057 26   HOH HOH A . 
F 4 HOH 27  1058 27   HOH HOH A . 
F 4 HOH 28  1059 28   HOH HOH A . 
F 4 HOH 29  1060 29   HOH HOH A . 
F 4 HOH 30  1061 30   HOH HOH A . 
F 4 HOH 31  1062 31   HOH HOH A . 
F 4 HOH 32  1063 32   HOH HOH A . 
F 4 HOH 33  1064 33   HOH HOH A . 
F 4 HOH 34  1065 34   HOH HOH A . 
F 4 HOH 35  1066 35   HOH HOH A . 
F 4 HOH 36  1067 36   HOH HOH A . 
F 4 HOH 37  1068 37   HOH HOH A . 
F 4 HOH 38  1069 38   HOH HOH A . 
F 4 HOH 39  1070 39   HOH HOH A . 
F 4 HOH 40  1071 40   HOH HOH A . 
F 4 HOH 41  1072 41   HOH HOH A . 
F 4 HOH 42  1073 42   HOH HOH A . 
F 4 HOH 43  1074 43   HOH HOH A . 
F 4 HOH 44  1075 44   HOH HOH A . 
F 4 HOH 45  1076 45   HOH HOH A . 
F 4 HOH 46  1077 46   HOH HOH A . 
F 4 HOH 47  1078 47   HOH HOH A . 
F 4 HOH 48  1079 48   HOH HOH A . 
F 4 HOH 49  1080 49   HOH HOH A . 
F 4 HOH 50  1081 50   HOH HOH A . 
F 4 HOH 51  1082 51   HOH HOH A . 
F 4 HOH 52  1083 52   HOH HOH A . 
F 4 HOH 53  1084 53   HOH HOH A . 
F 4 HOH 54  1085 54   HOH HOH A . 
F 4 HOH 55  1086 55   HOH HOH A . 
F 4 HOH 56  1087 56   HOH HOH A . 
F 4 HOH 57  1088 57   HOH HOH A . 
F 4 HOH 58  1089 58   HOH HOH A . 
F 4 HOH 59  1090 59   HOH HOH A . 
F 4 HOH 60  1091 60   HOH HOH A . 
F 4 HOH 61  1092 61   HOH HOH A . 
F 4 HOH 62  1093 62   HOH HOH A . 
F 4 HOH 63  1094 63   HOH HOH A . 
F 4 HOH 64  1095 64   HOH HOH A . 
F 4 HOH 65  1096 65   HOH HOH A . 
F 4 HOH 66  1097 66   HOH HOH A . 
F 4 HOH 67  1098 67   HOH HOH A . 
F 4 HOH 68  1099 68   HOH HOH A . 
F 4 HOH 69  1100 69   HOH HOH A . 
F 4 HOH 70  1101 70   HOH HOH A . 
F 4 HOH 71  1102 71   HOH HOH A . 
F 4 HOH 72  1103 72   HOH HOH A . 
F 4 HOH 73  1104 73   HOH HOH A . 
F 4 HOH 74  1105 74   HOH HOH A . 
F 4 HOH 75  1106 75   HOH HOH A . 
F 4 HOH 76  1107 76   HOH HOH A . 
F 4 HOH 77  1108 77   HOH HOH A . 
F 4 HOH 78  1109 78   HOH HOH A . 
F 4 HOH 79  1110 79   HOH HOH A . 
F 4 HOH 80  1111 80   HOH HOH A . 
F 4 HOH 81  1112 81   HOH HOH A . 
F 4 HOH 82  1113 82   HOH HOH A . 
F 4 HOH 83  1114 83   HOH HOH A . 
F 4 HOH 84  1115 84   HOH HOH A . 
F 4 HOH 85  1116 85   HOH HOH A . 
F 4 HOH 86  1117 87   HOH HOH A . 
F 4 HOH 87  1118 88   HOH HOH A . 
F 4 HOH 88  1119 89   HOH HOH A . 
F 4 HOH 89  1120 90   HOH HOH A . 
F 4 HOH 90  1121 91   HOH HOH A . 
F 4 HOH 91  1122 92   HOH HOH A . 
F 4 HOH 92  1123 93   HOH HOH A . 
F 4 HOH 93  1124 94   HOH HOH A . 
F 4 HOH 94  1125 95   HOH HOH A . 
F 4 HOH 95  1126 96   HOH HOH A . 
F 4 HOH 96  1127 97   HOH HOH A . 
F 4 HOH 97  1128 98   HOH HOH A . 
F 4 HOH 98  1129 99   HOH HOH A . 
F 4 HOH 99  1130 100  HOH HOH A . 
F 4 HOH 100 1131 101  HOH HOH A . 
F 4 HOH 101 1132 102  HOH HOH A . 
F 4 HOH 102 1133 103  HOH HOH A . 
F 4 HOH 103 1134 104  HOH HOH A . 
F 4 HOH 104 1135 105  HOH HOH A . 
F 4 HOH 105 1136 106  HOH HOH A . 
F 4 HOH 106 1137 107  HOH HOH A . 
F 4 HOH 107 1138 108  HOH HOH A . 
F 4 HOH 108 1139 109  HOH HOH A . 
F 4 HOH 109 1140 110  HOH HOH A . 
F 4 HOH 110 1141 111  HOH HOH A . 
F 4 HOH 111 1142 112  HOH HOH A . 
F 4 HOH 112 1143 113  HOH HOH A . 
F 4 HOH 113 1144 114  HOH HOH A . 
F 4 HOH 114 1145 115  HOH HOH A . 
F 4 HOH 115 1146 116  HOH HOH A . 
F 4 HOH 116 1147 117  HOH HOH A . 
F 4 HOH 117 1148 118  HOH HOH A . 
F 4 HOH 118 1149 119  HOH HOH A . 
F 4 HOH 119 1150 120  HOH HOH A . 
F 4 HOH 120 1151 121  HOH HOH A . 
F 4 HOH 121 1152 122  HOH HOH A . 
F 4 HOH 122 1153 123  HOH HOH A . 
F 4 HOH 123 1154 125  HOH HOH A . 
F 4 HOH 124 1155 126  HOH HOH A . 
F 4 HOH 125 1156 127  HOH HOH A . 
F 4 HOH 126 1157 128  HOH HOH A . 
F 4 HOH 127 1158 129  HOH HOH A . 
F 4 HOH 128 1159 153  HOH HOH A . 
F 4 HOH 129 1160 274  HOH HOH A . 
F 4 HOH 130 1161 275  HOH HOH A . 
F 4 HOH 131 1162 276  HOH HOH A . 
F 4 HOH 132 1163 277  HOH HOH A . 
F 4 HOH 133 1164 278  HOH HOH A . 
F 4 HOH 134 1165 279  HOH HOH A . 
F 4 HOH 135 1166 280  HOH HOH A . 
F 4 HOH 136 1167 281  HOH HOH A . 
F 4 HOH 137 1168 282  HOH HOH A . 
F 4 HOH 138 1169 283  HOH HOH A . 
F 4 HOH 139 1170 284  HOH HOH A . 
F 4 HOH 140 1171 285  HOH HOH A . 
F 4 HOH 141 1172 286  HOH HOH A . 
F 4 HOH 142 1173 287  HOH HOH A . 
F 4 HOH 143 1174 288  HOH HOH A . 
F 4 HOH 144 1175 289  HOH HOH A . 
F 4 HOH 145 1176 290  HOH HOH A . 
F 4 HOH 146 1177 291  HOH HOH A . 
F 4 HOH 147 1178 292  HOH HOH A . 
F 4 HOH 148 1179 293  HOH HOH A . 
F 4 HOH 149 1180 294  HOH HOH A . 
F 4 HOH 150 1181 295  HOH HOH A . 
F 4 HOH 151 1182 296  HOH HOH A . 
F 4 HOH 152 1183 297  HOH HOH A . 
F 4 HOH 153 1184 298  HOH HOH A . 
F 4 HOH 154 1185 299  HOH HOH A . 
F 4 HOH 155 1186 300  HOH HOH A . 
F 4 HOH 156 1187 301  HOH HOH A . 
F 4 HOH 157 1188 302  HOH HOH A . 
F 4 HOH 158 1189 303  HOH HOH A . 
F 4 HOH 159 1190 304  HOH HOH A . 
F 4 HOH 160 1191 305  HOH HOH A . 
F 4 HOH 161 1192 309  HOH HOH A . 
F 4 HOH 162 1193 312  HOH HOH A . 
F 4 HOH 163 1194 337  HOH HOH A . 
F 4 HOH 164 1195 338  HOH HOH A . 
F 4 HOH 165 1196 339  HOH HOH A . 
F 4 HOH 166 1197 340  HOH HOH A . 
F 4 HOH 167 1198 341  HOH HOH A . 
F 4 HOH 168 1199 342  HOH HOH A . 
F 4 HOH 169 1200 345  HOH HOH A . 
F 4 HOH 170 1201 346  HOH HOH A . 
F 4 HOH 171 1202 349  HOH HOH A . 
F 4 HOH 172 1203 351  HOH HOH A . 
F 4 HOH 173 1204 354  HOH HOH A . 
F 4 HOH 174 1205 355  HOH HOH A . 
F 4 HOH 175 1206 357  HOH HOH A . 
G 4 HOH 1   1033 130  HOH HOH B . 
G 4 HOH 2   1034 131  HOH HOH B . 
G 4 HOH 3   1035 132  HOH HOH B . 
G 4 HOH 4   1036 133  HOH HOH B . 
G 4 HOH 5   1037 134  HOH HOH B . 
G 4 HOH 6   1038 135  HOH HOH B . 
G 4 HOH 7   1039 136  HOH HOH B . 
G 4 HOH 8   1040 137  HOH HOH B . 
G 4 HOH 9   1041 138  HOH HOH B . 
G 4 HOH 10  1042 139  HOH HOH B . 
G 4 HOH 11  1043 140  HOH HOH B . 
G 4 HOH 12  1044 141  HOH HOH B . 
G 4 HOH 13  1045 142  HOH HOH B . 
G 4 HOH 14  1046 143  HOH HOH B . 
G 4 HOH 15  1047 144  HOH HOH B . 
G 4 HOH 16  1048 145  HOH HOH B . 
G 4 HOH 17  1049 146  HOH HOH B . 
G 4 HOH 18  1050 147  HOH HOH B . 
G 4 HOH 19  1051 148  HOH HOH B . 
G 4 HOH 20  1052 149  HOH HOH B . 
G 4 HOH 21  1053 150  HOH HOH B . 
G 4 HOH 22  1054 151  HOH HOH B . 
G 4 HOH 23  1055 152  HOH HOH B . 
G 4 HOH 24  1056 154  HOH HOH B . 
G 4 HOH 25  1057 155  HOH HOH B . 
G 4 HOH 26  1058 156  HOH HOH B . 
G 4 HOH 27  1059 157  HOH HOH B . 
G 4 HOH 28  1060 158  HOH HOH B . 
G 4 HOH 29  1061 159  HOH HOH B . 
G 4 HOH 30  1062 160  HOH HOH B . 
G 4 HOH 31  1063 161  HOH HOH B . 
G 4 HOH 32  1064 162  HOH HOH B . 
G 4 HOH 33  1065 163  HOH HOH B . 
G 4 HOH 34  1066 164  HOH HOH B . 
G 4 HOH 35  1067 165  HOH HOH B . 
G 4 HOH 36  1068 166  HOH HOH B . 
G 4 HOH 37  1069 167  HOH HOH B . 
G 4 HOH 38  1070 168  HOH HOH B . 
G 4 HOH 39  1071 169  HOH HOH B . 
G 4 HOH 40  1072 170  HOH HOH B . 
G 4 HOH 41  1073 171  HOH HOH B . 
G 4 HOH 42  1074 172  HOH HOH B . 
G 4 HOH 43  1075 173  HOH HOH B . 
G 4 HOH 44  1076 174  HOH HOH B . 
G 4 HOH 45  1077 175  HOH HOH B . 
G 4 HOH 46  1078 176  HOH HOH B . 
G 4 HOH 47  1079 177  HOH HOH B . 
G 4 HOH 48  1080 178  HOH HOH B . 
G 4 HOH 49  1081 179  HOH HOH B . 
G 4 HOH 50  1082 180  HOH HOH B . 
G 4 HOH 51  1083 181  HOH HOH B . 
G 4 HOH 52  1084 182  HOH HOH B . 
G 4 HOH 53  1085 183  HOH HOH B . 
G 4 HOH 54  1086 184  HOH HOH B . 
G 4 HOH 55  1087 185  HOH HOH B . 
G 4 HOH 56  1088 186  HOH HOH B . 
G 4 HOH 57  1089 187  HOH HOH B . 
G 4 HOH 58  1090 188  HOH HOH B . 
G 4 HOH 59  1091 189  HOH HOH B . 
G 4 HOH 60  1092 190  HOH HOH B . 
G 4 HOH 61  1093 191  HOH HOH B . 
G 4 HOH 62  1094 192  HOH HOH B . 
G 4 HOH 63  1095 193  HOH HOH B . 
G 4 HOH 64  1096 194  HOH HOH B . 
G 4 HOH 65  1097 195  HOH HOH B . 
G 4 HOH 66  1098 196  HOH HOH B . 
G 4 HOH 67  1099 197  HOH HOH B . 
G 4 HOH 68  1100 198  HOH HOH B . 
G 4 HOH 69  1101 199  HOH HOH B . 
G 4 HOH 70  1102 200  HOH HOH B . 
G 4 HOH 71  1103 201  HOH HOH B . 
G 4 HOH 72  1104 202  HOH HOH B . 
G 4 HOH 73  1105 203  HOH HOH B . 
G 4 HOH 74  1106 204  HOH HOH B . 
G 4 HOH 75  1107 205  HOH HOH B . 
G 4 HOH 76  1108 206  HOH HOH B . 
G 4 HOH 77  1109 207  HOH HOH B . 
G 4 HOH 78  1110 208  HOH HOH B . 
G 4 HOH 79  1111 209  HOH HOH B . 
G 4 HOH 80  1112 210  HOH HOH B . 
G 4 HOH 81  1113 211  HOH HOH B . 
G 4 HOH 82  1114 212  HOH HOH B . 
G 4 HOH 83  1115 213  HOH HOH B . 
G 4 HOH 84  1116 214  HOH HOH B . 
G 4 HOH 85  1117 215  HOH HOH B . 
G 4 HOH 86  1118 216  HOH HOH B . 
G 4 HOH 87  1119 217  HOH HOH B . 
G 4 HOH 88  1120 218  HOH HOH B . 
G 4 HOH 89  1121 219  HOH HOH B . 
G 4 HOH 90  1122 220  HOH HOH B . 
G 4 HOH 91  1123 221  HOH HOH B . 
G 4 HOH 92  1124 222  HOH HOH B . 
G 4 HOH 93  1125 223  HOH HOH B . 
G 4 HOH 94  1126 224  HOH HOH B . 
G 4 HOH 95  1127 225  HOH HOH B . 
G 4 HOH 96  1128 226  HOH HOH B . 
G 4 HOH 97  1129 227  HOH HOH B . 
G 4 HOH 98  1130 228  HOH HOH B . 
G 4 HOH 99  1131 229  HOH HOH B . 
G 4 HOH 100 1132 230  HOH HOH B . 
G 4 HOH 101 1133 231  HOH HOH B . 
G 4 HOH 102 1134 232  HOH HOH B . 
G 4 HOH 103 1135 233  HOH HOH B . 
G 4 HOH 104 1136 234  HOH HOH B . 
G 4 HOH 105 1137 235  HOH HOH B . 
G 4 HOH 106 1138 236  HOH HOH B . 
G 4 HOH 107 1139 237  HOH HOH B . 
G 4 HOH 108 1140 238  HOH HOH B . 
G 4 HOH 109 1141 239  HOH HOH B . 
G 4 HOH 110 1142 240  HOH HOH B . 
G 4 HOH 111 1143 241  HOH HOH B . 
G 4 HOH 112 1144 242  HOH HOH B . 
G 4 HOH 113 1145 243  HOH HOH B . 
G 4 HOH 114 1146 244  HOH HOH B . 
G 4 HOH 115 1147 245  HOH HOH B . 
G 4 HOH 116 1148 246  HOH HOH B . 
G 4 HOH 117 1149 247  HOH HOH B . 
G 4 HOH 118 1150 248  HOH HOH B . 
G 4 HOH 119 1151 249  HOH HOH B . 
G 4 HOH 120 1152 250  HOH HOH B . 
G 4 HOH 121 1153 251  HOH HOH B . 
G 4 HOH 122 1154 252  HOH HOH B . 
G 4 HOH 123 1155 253  HOH HOH B . 
G 4 HOH 124 1156 254  HOH HOH B . 
G 4 HOH 125 1157 255  HOH HOH B . 
G 4 HOH 126 1158 256  HOH HOH B . 
G 4 HOH 127 1159 257  HOH HOH B . 
G 4 HOH 128 1160 258  HOH HOH B . 
G 4 HOH 129 1161 259  HOH HOH B . 
G 4 HOH 130 1162 260  HOH HOH B . 
G 4 HOH 131 1163 261  HOH HOH B . 
G 4 HOH 132 1164 262  HOH HOH B . 
G 4 HOH 133 1165 263  HOH HOH B . 
G 4 HOH 134 1166 264  HOH HOH B . 
G 4 HOH 135 1167 265  HOH HOH B . 
G 4 HOH 136 1168 266  HOH HOH B . 
G 4 HOH 137 1169 267  HOH HOH B . 
G 4 HOH 138 1170 268  HOH HOH B . 
G 4 HOH 139 1171 269  HOH HOH B . 
G 4 HOH 140 1172 270  HOH HOH B . 
G 4 HOH 141 1173 271  HOH HOH B . 
G 4 HOH 142 1174 272  HOH HOH B . 
G 4 HOH 143 1175 273  HOH HOH B . 
G 4 HOH 144 1176 306  HOH HOH B . 
G 4 HOH 145 1177 307  HOH HOH B . 
G 4 HOH 146 1178 308  HOH HOH B . 
G 4 HOH 147 1179 310  HOH HOH B . 
G 4 HOH 148 1180 311  HOH HOH B . 
G 4 HOH 149 1181 313  HOH HOH B . 
G 4 HOH 150 1182 314  HOH HOH B . 
G 4 HOH 151 1183 315  HOH HOH B . 
G 4 HOH 152 1184 316  HOH HOH B . 
G 4 HOH 153 1185 317  HOH HOH B . 
G 4 HOH 154 1186 318  HOH HOH B . 
G 4 HOH 155 1187 319  HOH HOH B . 
G 4 HOH 156 1188 320  HOH HOH B . 
G 4 HOH 157 1189 321  HOH HOH B . 
G 4 HOH 158 1190 322  HOH HOH B . 
G 4 HOH 159 1191 323  HOH HOH B . 
G 4 HOH 160 1192 324  HOH HOH B . 
G 4 HOH 161 1193 325  HOH HOH B . 
G 4 HOH 162 1194 326  HOH HOH B . 
G 4 HOH 163 1195 327  HOH HOH B . 
G 4 HOH 164 1196 328  HOH HOH B . 
G 4 HOH 165 1197 329  HOH HOH B . 
G 4 HOH 166 1198 330  HOH HOH B . 
G 4 HOH 167 1199 331  HOH HOH B . 
G 4 HOH 168 1200 332  HOH HOH B . 
G 4 HOH 169 1201 333  HOH HOH B . 
G 4 HOH 170 1202 334  HOH HOH B . 
G 4 HOH 171 1203 335  HOH HOH B . 
G 4 HOH 172 1204 336  HOH HOH B . 
G 4 HOH 173 1205 343  HOH HOH B . 
G 4 HOH 174 1206 344  HOH HOH B . 
G 4 HOH 175 1207 347  HOH HOH B . 
G 4 HOH 176 1208 348  HOH HOH B . 
G 4 HOH 177 1209 350  HOH HOH B . 
G 4 HOH 178 1210 352  HOH HOH B . 
G 4 HOH 179 1211 353  HOH HOH B . 
G 4 HOH 180 1212 356  HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-04-25 
2 'Structure model' 1 1 2008-04-21 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' Advisory                    
3 3 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined 27.5188 7.9195  6.7282  -0.0294 -0.0271 -0.0220 -0.0155 -0.0025 0.0017 1.1542 0.6432 0.5324 -0.5825 0.1045 0.1305 
-0.0486 -0.0451 0.1186  0.0422  0.0546  -0.0610 -0.0209 0.0185 -0.0060 'X-RAY DIFFRACTION' 
2 ? refined 19.5023 -7.4347 -7.4523 -0.0266 -0.0123 -0.0306 -0.0058 -0.0070 0.0031 1.2066 0.5605 0.7070 -0.6356 0.0389 0.0693 
0.0890  0.1627  -0.0643 -0.0589 -0.0870 0.0620  -0.0053 0.0149 -0.0021 'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1 1 A 3    A 3 A 180  A 180 ? 'X-RAY DIFFRACTION' ? 
2 1 A 1031 D 1 A 1031 D 1   ? 'X-RAY DIFFRACTION' ? 
3 2 B 2    B 2 B 180  B 180 ? 'X-RAY DIFFRACTION' ? 
4 2 B 1032 E 1 B 1032 E 1   ? 'X-RAY DIFFRACTION' ? 
# 
_software.name             REFMAC 
_software.classification   refinement 
_software.version          5.2.0005 
_software.citation_id      ? 
_software.pdbx_ordinal     1 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 OE1 A GLU 180  ? C O A HOH 1038 ? ? 2.02 
2 1 OE2 A GLU 118  ? B O A HOH 1039 ? ? 2.05 
3 1 O   B HOH 1102 ? ? O B HOH 1168 ? ? 2.12 
4 1 O   A THR 53   ? ? O A HOH 1152 ? ? 2.15 
5 1 O   B HOH 1080 ? ? O B HOH 1170 ? ? 2.15 
6 1 O   B HOH 1141 ? ? O B HOH 1201 ? ? 2.15 
7 1 NE  B ARG 57   ? B O B HOH 1126 ? ? 2.17 
8 1 OD2 A ASP 128  ? ? O A HOH 1158 ? ? 2.19 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CA A LEU 129 ? ? CB A LEU 129 ? ? CG  A LEU 129 ? ? 133.58 115.30 18.28 2.30 N 
2 1 CB A LEU 162 ? ? CG A LEU 162 ? ? CD1 A LEU 162 ? ? 121.25 111.00 10.25 1.70 N 
3 1 CA B LEU 129 ? ? CB B LEU 129 ? ? CG  B LEU 129 ? ? 132.67 115.30 17.37 2.30 N 
4 1 CB B LEU 129 ? ? CG B LEU 129 ? ? CD1 B LEU 129 ? ? 125.53 111.00 14.53 1.70 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 GLU A 104 ? ? 56.22   -123.92 
2 1 ALA A 131 ? ? -117.93 -101.76 
3 1 GLU B 104 ? ? 47.26   -113.13 
4 1 ALA B 131 ? ? -117.01 -100.17 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLN 7   ? CD  ? A GLN 7   CD  
2  1 Y 1 A GLN 7   ? OE1 ? A GLN 7   OE1 
3  1 Y 1 A GLN 7   ? NE2 ? A GLN 7   NE2 
4  1 Y 1 A ARG 40  ? NE  ? A ARG 40  NE  
5  1 Y 1 A ARG 40  ? CZ  ? A ARG 40  CZ  
6  1 Y 1 A ARG 40  ? NH1 ? A ARG 40  NH1 
7  1 Y 1 A ARG 40  ? NH2 ? A ARG 40  NH2 
8  1 Y 1 A LYS 91  ? CE  ? A LYS 91  CE  
9  1 Y 1 A LYS 91  ? NZ  ? A LYS 91  NZ  
10 1 Y 1 A GLU 104 ? CD  ? A GLU 104 CD  
11 1 Y 1 A GLU 104 ? OE1 ? A GLU 104 OE1 
12 1 Y 1 A GLU 104 ? OE2 ? A GLU 104 OE2 
13 1 Y 1 A LYS 107 ? CE  ? A LYS 107 CE  
14 1 Y 1 A LYS 107 ? NZ  ? A LYS 107 NZ  
15 1 Y 1 B GLN 7   ? CD  ? B GLN 7   CD  
16 1 Y 1 B GLN 7   ? OE1 ? B GLN 7   OE1 
17 1 Y 1 B GLN 7   ? NE2 ? B GLN 7   NE2 
18 1 Y 1 B ARG 40  ? NE  ? B ARG 40  NE  
19 1 Y 1 B ARG 40  ? CZ  ? B ARG 40  CZ  
20 1 Y 1 B ARG 40  ? NH1 ? B ARG 40  NH1 
21 1 Y 1 B ARG 40  ? NH2 ? B ARG 40  NH2 
22 1 Y 1 B LYS 91  ? CD  ? B LYS 91  CD  
23 1 Y 1 B LYS 91  ? CE  ? B LYS 91  CE  
24 1 Y 1 B LYS 91  ? NZ  ? B LYS 91  NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A MET 1 ? A MET 1 
2 1 Y 1 A ALA 2 ? A ALA 2 
3 1 Y 1 B MET 1 ? B MET 1 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'ADENOSINE MONOPHOSPHATE' AMP 
3 'CHLORIDE ION'            CL  
4 water                     HOH 
#