data_1ZSV
# 
_entry.id   1ZSV 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1ZSV         
RCSB  RCSB033078   
WWPDB D_1000033078 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1ZSV 
_pdbx_database_status.recvd_initial_deposition_date   2005-05-25 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Turnbull, A.P.'                       1  
'Johansson, C.'                        2  
'Savitsky, P.'                         3  
'Guo, K.'                              4  
'Edwards, A.'                          5  
'Arrowsmith, C.'                       6  
'Sundstrom, M.'                        7  
'von Delft, F.'                        8  
'Oppermann, U.'                        9  
'Structural Genomics Consortium (SGC)' 10 
# 
_citation.id                        primary 
_citation.title                     'Crystal structure of human NADP-dependent leukotriene B4 12-hydroxydehydrogenase' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Turnbull, A.P.' 1 
primary 'Johansson, C.'  2 
primary 'Savitsky, P.'   3 
primary 'Guo, K.'        4 
primary 'Edwards, A.'    5 
primary 'Arrowsmith, C.' 6 
primary 'Sundstrom, M.'  7 
primary 'von Delft, F.'  8 
primary 'Oppermann, U.'  9 
# 
_cell.entry_id           1ZSV 
_cell.length_a           92.543 
_cell.length_b           92.543 
_cell.length_c           202.770 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1ZSV 
_symmetry.space_group_name_H-M             'P 43' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                78 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'NADP-dependent leukotriene B4 12-hydroxydehydrogenase' 38229.164 4   ? ? ? ? 
2 non-polymer syn 'CHLORIDE ION'                                          35.453    22  ? ? ? ? 
3 water       nat water                                                   18.015    315 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MHHHHHHSSGVDLGTENLYFQSMTKTWTLKKHFVGYPTNSDFELKTSELPPLKNGEVLLEALFLTVDPYMRVAAKRLKEG
DTMMGQQVAKVVESKNVALPKGTIVLASPGWTTHSISDGKDLEKLLTEWPDTIPLSLALGTVGMPGLTAYFGLLEICGVK
GGETVMVNAAAGAVGSVVGQIAKLKGCKVVGAVGSDEKVAYLQKLGFDVVFNYKTVESLEETLKKASPDGYDCYFDNVGG
EFSNTVIGQMKKFGRIAICGAISTYNRTGPLPPGPPPEIVIYQELRMEAFVVYRWQGDARQKALKDLLKWVLEGKIQYKE
YIIEGFENMPAAFMGMLKGDNLGKTIVKA
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MHHHHHHSSGVDLGTENLYFQSMTKTWTLKKHFVGYPTNSDFELKTSELPPLKNGEVLLEALFLTVDPYMRVAAKRLKEG
DTMMGQQVAKVVESKNVALPKGTIVLASPGWTTHSISDGKDLEKLLTEWPDTIPLSLALGTVGMPGLTAYFGLLEICGVK
GGETVMVNAAAGAVGSVVGQIAKLKGCKVVGAVGSDEKVAYLQKLGFDVVFNYKTVESLEETLKKASPDGYDCYFDNVGG
EFSNTVIGQMKKFGRIAICGAISTYNRTGPLPPGPPPEIVIYQELRMEAFVVYRWQGDARQKALKDLLKWVLEGKIQYKE
YIIEGFENMPAAFMGMLKGDNLGKTIVKA
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   HIS n 
1 3   HIS n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   SER n 
1 9   SER n 
1 10  GLY n 
1 11  VAL n 
1 12  ASP n 
1 13  LEU n 
1 14  GLY n 
1 15  THR n 
1 16  GLU n 
1 17  ASN n 
1 18  LEU n 
1 19  TYR n 
1 20  PHE n 
1 21  GLN n 
1 22  SER n 
1 23  MET n 
1 24  THR n 
1 25  LYS n 
1 26  THR n 
1 27  TRP n 
1 28  THR n 
1 29  LEU n 
1 30  LYS n 
1 31  LYS n 
1 32  HIS n 
1 33  PHE n 
1 34  VAL n 
1 35  GLY n 
1 36  TYR n 
1 37  PRO n 
1 38  THR n 
1 39  ASN n 
1 40  SER n 
1 41  ASP n 
1 42  PHE n 
1 43  GLU n 
1 44  LEU n 
1 45  LYS n 
1 46  THR n 
1 47  SER n 
1 48  GLU n 
1 49  LEU n 
1 50  PRO n 
1 51  PRO n 
1 52  LEU n 
1 53  LYS n 
1 54  ASN n 
1 55  GLY n 
1 56  GLU n 
1 57  VAL n 
1 58  LEU n 
1 59  LEU n 
1 60  GLU n 
1 61  ALA n 
1 62  LEU n 
1 63  PHE n 
1 64  LEU n 
1 65  THR n 
1 66  VAL n 
1 67  ASP n 
1 68  PRO n 
1 69  TYR n 
1 70  MET n 
1 71  ARG n 
1 72  VAL n 
1 73  ALA n 
1 74  ALA n 
1 75  LYS n 
1 76  ARG n 
1 77  LEU n 
1 78  LYS n 
1 79  GLU n 
1 80  GLY n 
1 81  ASP n 
1 82  THR n 
1 83  MET n 
1 84  MET n 
1 85  GLY n 
1 86  GLN n 
1 87  GLN n 
1 88  VAL n 
1 89  ALA n 
1 90  LYS n 
1 91  VAL n 
1 92  VAL n 
1 93  GLU n 
1 94  SER n 
1 95  LYS n 
1 96  ASN n 
1 97  VAL n 
1 98  ALA n 
1 99  LEU n 
1 100 PRO n 
1 101 LYS n 
1 102 GLY n 
1 103 THR n 
1 104 ILE n 
1 105 VAL n 
1 106 LEU n 
1 107 ALA n 
1 108 SER n 
1 109 PRO n 
1 110 GLY n 
1 111 TRP n 
1 112 THR n 
1 113 THR n 
1 114 HIS n 
1 115 SER n 
1 116 ILE n 
1 117 SER n 
1 118 ASP n 
1 119 GLY n 
1 120 LYS n 
1 121 ASP n 
1 122 LEU n 
1 123 GLU n 
1 124 LYS n 
1 125 LEU n 
1 126 LEU n 
1 127 THR n 
1 128 GLU n 
1 129 TRP n 
1 130 PRO n 
1 131 ASP n 
1 132 THR n 
1 133 ILE n 
1 134 PRO n 
1 135 LEU n 
1 136 SER n 
1 137 LEU n 
1 138 ALA n 
1 139 LEU n 
1 140 GLY n 
1 141 THR n 
1 142 VAL n 
1 143 GLY n 
1 144 MET n 
1 145 PRO n 
1 146 GLY n 
1 147 LEU n 
1 148 THR n 
1 149 ALA n 
1 150 TYR n 
1 151 PHE n 
1 152 GLY n 
1 153 LEU n 
1 154 LEU n 
1 155 GLU n 
1 156 ILE n 
1 157 CYS n 
1 158 GLY n 
1 159 VAL n 
1 160 LYS n 
1 161 GLY n 
1 162 GLY n 
1 163 GLU n 
1 164 THR n 
1 165 VAL n 
1 166 MET n 
1 167 VAL n 
1 168 ASN n 
1 169 ALA n 
1 170 ALA n 
1 171 ALA n 
1 172 GLY n 
1 173 ALA n 
1 174 VAL n 
1 175 GLY n 
1 176 SER n 
1 177 VAL n 
1 178 VAL n 
1 179 GLY n 
1 180 GLN n 
1 181 ILE n 
1 182 ALA n 
1 183 LYS n 
1 184 LEU n 
1 185 LYS n 
1 186 GLY n 
1 187 CYS n 
1 188 LYS n 
1 189 VAL n 
1 190 VAL n 
1 191 GLY n 
1 192 ALA n 
1 193 VAL n 
1 194 GLY n 
1 195 SER n 
1 196 ASP n 
1 197 GLU n 
1 198 LYS n 
1 199 VAL n 
1 200 ALA n 
1 201 TYR n 
1 202 LEU n 
1 203 GLN n 
1 204 LYS n 
1 205 LEU n 
1 206 GLY n 
1 207 PHE n 
1 208 ASP n 
1 209 VAL n 
1 210 VAL n 
1 211 PHE n 
1 212 ASN n 
1 213 TYR n 
1 214 LYS n 
1 215 THR n 
1 216 VAL n 
1 217 GLU n 
1 218 SER n 
1 219 LEU n 
1 220 GLU n 
1 221 GLU n 
1 222 THR n 
1 223 LEU n 
1 224 LYS n 
1 225 LYS n 
1 226 ALA n 
1 227 SER n 
1 228 PRO n 
1 229 ASP n 
1 230 GLY n 
1 231 TYR n 
1 232 ASP n 
1 233 CYS n 
1 234 TYR n 
1 235 PHE n 
1 236 ASP n 
1 237 ASN n 
1 238 VAL n 
1 239 GLY n 
1 240 GLY n 
1 241 GLU n 
1 242 PHE n 
1 243 SER n 
1 244 ASN n 
1 245 THR n 
1 246 VAL n 
1 247 ILE n 
1 248 GLY n 
1 249 GLN n 
1 250 MET n 
1 251 LYS n 
1 252 LYS n 
1 253 PHE n 
1 254 GLY n 
1 255 ARG n 
1 256 ILE n 
1 257 ALA n 
1 258 ILE n 
1 259 CYS n 
1 260 GLY n 
1 261 ALA n 
1 262 ILE n 
1 263 SER n 
1 264 THR n 
1 265 TYR n 
1 266 ASN n 
1 267 ARG n 
1 268 THR n 
1 269 GLY n 
1 270 PRO n 
1 271 LEU n 
1 272 PRO n 
1 273 PRO n 
1 274 GLY n 
1 275 PRO n 
1 276 PRO n 
1 277 PRO n 
1 278 GLU n 
1 279 ILE n 
1 280 VAL n 
1 281 ILE n 
1 282 TYR n 
1 283 GLN n 
1 284 GLU n 
1 285 LEU n 
1 286 ARG n 
1 287 MET n 
1 288 GLU n 
1 289 ALA n 
1 290 PHE n 
1 291 VAL n 
1 292 VAL n 
1 293 TYR n 
1 294 ARG n 
1 295 TRP n 
1 296 GLN n 
1 297 GLY n 
1 298 ASP n 
1 299 ALA n 
1 300 ARG n 
1 301 GLN n 
1 302 LYS n 
1 303 ALA n 
1 304 LEU n 
1 305 LYS n 
1 306 ASP n 
1 307 LEU n 
1 308 LEU n 
1 309 LYS n 
1 310 TRP n 
1 311 VAL n 
1 312 LEU n 
1 313 GLU n 
1 314 GLY n 
1 315 LYS n 
1 316 ILE n 
1 317 GLN n 
1 318 TYR n 
1 319 LYS n 
1 320 GLU n 
1 321 TYR n 
1 322 ILE n 
1 323 ILE n 
1 324 GLU n 
1 325 GLY n 
1 326 PHE n 
1 327 GLU n 
1 328 ASN n 
1 329 MET n 
1 330 PRO n 
1 331 ALA n 
1 332 ALA n 
1 333 PHE n 
1 334 MET n 
1 335 GLY n 
1 336 MET n 
1 337 LEU n 
1 338 LYS n 
1 339 GLY n 
1 340 ASP n 
1 341 ASN n 
1 342 LEU n 
1 343 GLY n 
1 344 LYS n 
1 345 THR n 
1 346 ILE n 
1 347 VAL n 
1 348 LYS n 
1 349 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 LTB4DH 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)-R3' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pNIC-Bsa4 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    LTB4D_HUMAN 
_struct_ref.pdbx_db_accession          Q14914 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;TKTWTLKKHFVGYPTNSDFELKTSELPPLKNGEVLLEALFLTVDPYMRVAAKRLKEGDTMMGQQVAKVVESKNVALPKGT
IVLASPGWTTHSISDGKDLEKLLTEWPDTIPLSLALGTVGMPGLTAYFGLLEICGVKGGETVMVNAAAGAVGSVVGQIAK
LKGCKVVGAVGSDEKVAYLQKLGFDVVFNYKTVESLEETLKKASPDGYDCYFDNVGGEFSNTVIGQMKKFGRIAICGAIS
TYNRTGPLPPGPPPEIVIYQELRMEAFVVYRWQGDARQKALKDLLKWVLEGKIQYKEYIIEGFENMPAAFMGMLKGDNLG
KTIVKA
;
_struct_ref.pdbx_align_begin           4 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1ZSV A 24 ? 349 ? Q14914 4 ? 329 ? 4 329 
2 1 1ZSV B 24 ? 349 ? Q14914 4 ? 329 ? 4 329 
3 1 1ZSV C 24 ? 349 ? Q14914 4 ? 329 ? 4 329 
4 1 1ZSV D 24 ? 349 ? Q14914 4 ? 329 ? 4 329 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1ZSV MET A 1  ? UNP Q14914 ? ? 'CLONING ARTIFACT' -19 1  
1 1ZSV HIS A 2  ? UNP Q14914 ? ? 'EXPRESSION TAG'   -18 2  
1 1ZSV HIS A 3  ? UNP Q14914 ? ? 'EXPRESSION TAG'   -17 3  
1 1ZSV HIS A 4  ? UNP Q14914 ? ? 'EXPRESSION TAG'   -16 4  
1 1ZSV HIS A 5  ? UNP Q14914 ? ? 'EXPRESSION TAG'   -15 5  
1 1ZSV HIS A 6  ? UNP Q14914 ? ? 'EXPRESSION TAG'   -14 6  
1 1ZSV HIS A 7  ? UNP Q14914 ? ? 'EXPRESSION TAG'   -13 7  
1 1ZSV SER A 8  ? UNP Q14914 ? ? 'CLONING ARTIFACT' -12 8  
1 1ZSV SER A 9  ? UNP Q14914 ? ? 'CLONING ARTIFACT' -11 9  
1 1ZSV GLY A 10 ? UNP Q14914 ? ? 'CLONING ARTIFACT' -10 10 
1 1ZSV VAL A 11 ? UNP Q14914 ? ? 'CLONING ARTIFACT' -9  11 
1 1ZSV ASP A 12 ? UNP Q14914 ? ? 'CLONING ARTIFACT' -8  12 
1 1ZSV LEU A 13 ? UNP Q14914 ? ? 'CLONING ARTIFACT' -7  13 
1 1ZSV GLY A 14 ? UNP Q14914 ? ? 'CLONING ARTIFACT' -6  14 
1 1ZSV THR A 15 ? UNP Q14914 ? ? 'CLONING ARTIFACT' -5  15 
1 1ZSV GLU A 16 ? UNP Q14914 ? ? 'CLONING ARTIFACT' -4  16 
1 1ZSV ASN A 17 ? UNP Q14914 ? ? 'CLONING ARTIFACT' -3  17 
1 1ZSV LEU A 18 ? UNP Q14914 ? ? 'CLONING ARTIFACT' -2  18 
1 1ZSV TYR A 19 ? UNP Q14914 ? ? 'CLONING ARTIFACT' -1  19 
1 1ZSV PHE A 20 ? UNP Q14914 ? ? 'CLONING ARTIFACT' 0   20 
1 1ZSV GLN A 21 ? UNP Q14914 ? ? 'CLONING ARTIFACT' 1   21 
1 1ZSV SER A 22 ? UNP Q14914 ? ? 'CLONING ARTIFACT' 2   22 
1 1ZSV MET A 23 ? UNP Q14914 ? ? 'CLONING ARTIFACT' 3   23 
2 1ZSV MET B 1  ? UNP Q14914 ? ? 'CLONING ARTIFACT' -19 24 
2 1ZSV HIS B 2  ? UNP Q14914 ? ? 'EXPRESSION TAG'   -18 25 
2 1ZSV HIS B 3  ? UNP Q14914 ? ? 'EXPRESSION TAG'   -17 26 
2 1ZSV HIS B 4  ? UNP Q14914 ? ? 'EXPRESSION TAG'   -16 27 
2 1ZSV HIS B 5  ? UNP Q14914 ? ? 'EXPRESSION TAG'   -15 28 
2 1ZSV HIS B 6  ? UNP Q14914 ? ? 'EXPRESSION TAG'   -14 29 
2 1ZSV HIS B 7  ? UNP Q14914 ? ? 'EXPRESSION TAG'   -13 30 
2 1ZSV SER B 8  ? UNP Q14914 ? ? 'CLONING ARTIFACT' -12 31 
2 1ZSV SER B 9  ? UNP Q14914 ? ? 'CLONING ARTIFACT' -11 32 
2 1ZSV GLY B 10 ? UNP Q14914 ? ? 'CLONING ARTIFACT' -10 33 
2 1ZSV VAL B 11 ? UNP Q14914 ? ? 'CLONING ARTIFACT' -9  34 
2 1ZSV ASP B 12 ? UNP Q14914 ? ? 'CLONING ARTIFACT' -8  35 
2 1ZSV LEU B 13 ? UNP Q14914 ? ? 'CLONING ARTIFACT' -7  36 
2 1ZSV GLY B 14 ? UNP Q14914 ? ? 'CLONING ARTIFACT' -6  37 
2 1ZSV THR B 15 ? UNP Q14914 ? ? 'CLONING ARTIFACT' -5  38 
2 1ZSV GLU B 16 ? UNP Q14914 ? ? 'CLONING ARTIFACT' -4  39 
2 1ZSV ASN B 17 ? UNP Q14914 ? ? 'CLONING ARTIFACT' -3  40 
2 1ZSV LEU B 18 ? UNP Q14914 ? ? 'CLONING ARTIFACT' -2  41 
2 1ZSV TYR B 19 ? UNP Q14914 ? ? 'CLONING ARTIFACT' -1  42 
2 1ZSV PHE B 20 ? UNP Q14914 ? ? 'CLONING ARTIFACT' 0   43 
2 1ZSV GLN B 21 ? UNP Q14914 ? ? 'CLONING ARTIFACT' 1   44 
2 1ZSV SER B 22 ? UNP Q14914 ? ? 'CLONING ARTIFACT' 2   45 
2 1ZSV MET B 23 ? UNP Q14914 ? ? 'CLONING ARTIFACT' 3   46 
3 1ZSV MET C 1  ? UNP Q14914 ? ? 'CLONING ARTIFACT' -19 47 
3 1ZSV HIS C 2  ? UNP Q14914 ? ? 'EXPRESSION TAG'   -18 48 
3 1ZSV HIS C 3  ? UNP Q14914 ? ? 'EXPRESSION TAG'   -17 49 
3 1ZSV HIS C 4  ? UNP Q14914 ? ? 'EXPRESSION TAG'   -16 50 
3 1ZSV HIS C 5  ? UNP Q14914 ? ? 'EXPRESSION TAG'   -15 51 
3 1ZSV HIS C 6  ? UNP Q14914 ? ? 'EXPRESSION TAG'   -14 52 
3 1ZSV HIS C 7  ? UNP Q14914 ? ? 'EXPRESSION TAG'   -13 53 
3 1ZSV SER C 8  ? UNP Q14914 ? ? 'CLONING ARTIFACT' -12 54 
3 1ZSV SER C 9  ? UNP Q14914 ? ? 'CLONING ARTIFACT' -11 55 
3 1ZSV GLY C 10 ? UNP Q14914 ? ? 'CLONING ARTIFACT' -10 56 
3 1ZSV VAL C 11 ? UNP Q14914 ? ? 'CLONING ARTIFACT' -9  57 
3 1ZSV ASP C 12 ? UNP Q14914 ? ? 'CLONING ARTIFACT' -8  58 
3 1ZSV LEU C 13 ? UNP Q14914 ? ? 'CLONING ARTIFACT' -7  59 
3 1ZSV GLY C 14 ? UNP Q14914 ? ? 'CLONING ARTIFACT' -6  60 
3 1ZSV THR C 15 ? UNP Q14914 ? ? 'CLONING ARTIFACT' -5  61 
3 1ZSV GLU C 16 ? UNP Q14914 ? ? 'CLONING ARTIFACT' -4  62 
3 1ZSV ASN C 17 ? UNP Q14914 ? ? 'CLONING ARTIFACT' -3  63 
3 1ZSV LEU C 18 ? UNP Q14914 ? ? 'CLONING ARTIFACT' -2  64 
3 1ZSV TYR C 19 ? UNP Q14914 ? ? 'CLONING ARTIFACT' -1  65 
3 1ZSV PHE C 20 ? UNP Q14914 ? ? 'CLONING ARTIFACT' 0   66 
3 1ZSV GLN C 21 ? UNP Q14914 ? ? 'CLONING ARTIFACT' 1   67 
3 1ZSV SER C 22 ? UNP Q14914 ? ? 'CLONING ARTIFACT' 2   68 
3 1ZSV MET C 23 ? UNP Q14914 ? ? 'CLONING ARTIFACT' 3   69 
4 1ZSV MET D 1  ? UNP Q14914 ? ? 'CLONING ARTIFACT' -19 70 
4 1ZSV HIS D 2  ? UNP Q14914 ? ? 'EXPRESSION TAG'   -18 71 
4 1ZSV HIS D 3  ? UNP Q14914 ? ? 'EXPRESSION TAG'   -17 72 
4 1ZSV HIS D 4  ? UNP Q14914 ? ? 'EXPRESSION TAG'   -16 73 
4 1ZSV HIS D 5  ? UNP Q14914 ? ? 'EXPRESSION TAG'   -15 74 
4 1ZSV HIS D 6  ? UNP Q14914 ? ? 'EXPRESSION TAG'   -14 75 
4 1ZSV HIS D 7  ? UNP Q14914 ? ? 'EXPRESSION TAG'   -13 76 
4 1ZSV SER D 8  ? UNP Q14914 ? ? 'CLONING ARTIFACT' -12 77 
4 1ZSV SER D 9  ? UNP Q14914 ? ? 'CLONING ARTIFACT' -11 78 
4 1ZSV GLY D 10 ? UNP Q14914 ? ? 'CLONING ARTIFACT' -10 79 
4 1ZSV VAL D 11 ? UNP Q14914 ? ? 'CLONING ARTIFACT' -9  80 
4 1ZSV ASP D 12 ? UNP Q14914 ? ? 'CLONING ARTIFACT' -8  81 
4 1ZSV LEU D 13 ? UNP Q14914 ? ? 'CLONING ARTIFACT' -7  82 
4 1ZSV GLY D 14 ? UNP Q14914 ? ? 'CLONING ARTIFACT' -6  83 
4 1ZSV THR D 15 ? UNP Q14914 ? ? 'CLONING ARTIFACT' -5  84 
4 1ZSV GLU D 16 ? UNP Q14914 ? ? 'CLONING ARTIFACT' -4  85 
4 1ZSV ASN D 17 ? UNP Q14914 ? ? 'CLONING ARTIFACT' -3  86 
4 1ZSV LEU D 18 ? UNP Q14914 ? ? 'CLONING ARTIFACT' -2  87 
4 1ZSV TYR D 19 ? UNP Q14914 ? ? 'CLONING ARTIFACT' -1  88 
4 1ZSV PHE D 20 ? UNP Q14914 ? ? 'CLONING ARTIFACT' 0   89 
4 1ZSV GLN D 21 ? UNP Q14914 ? ? 'CLONING ARTIFACT' 1   90 
4 1ZSV SER D 22 ? UNP Q14914 ? ? 'CLONING ARTIFACT' 2   91 
4 1ZSV MET D 23 ? UNP Q14914 ? ? 'CLONING ARTIFACT' 3   92 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CL  non-polymer         . 'CHLORIDE ION'  ? 'Cl -1'          35.453  
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1ZSV 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.8 
_exptl_crystal.density_percent_sol   56.4 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pdbx_details    'PEG3350, NaI, ethylene glycol, pH 8.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2005-05-09 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si (111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.98402 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X10SA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X10SA 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.98402 
# 
_reflns.entry_id                     1ZSV 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.d_resolution_high            2.3 
_reflns.d_resolution_low             67.57 
_reflns.number_all                   74944 
_reflns.number_obs                   74944 
_reflns.percent_possible_obs         99.4 
_reflns.pdbx_Rmerge_I_obs            0.139 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.3 
_reflns_shell.d_res_low              2.42 
_reflns_shell.percent_possible_all   97.1 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1ZSV 
_refine.ls_number_reflns_obs                     72302 
_refine.ls_number_reflns_all                     72302 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             62.3 
_refine.ls_d_res_high                            2.30 
_refine.ls_percent_reflns_obs                    98.42 
_refine.ls_R_factor_obs                          0.1969 
_refine.ls_R_factor_all                          0.1969 
_refine.ls_R_factor_R_work                       0.19511 
_refine.ls_R_factor_R_free                       0.24933 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 2.6 
_refine.ls_number_reflns_R_free                  1920 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.962 
_refine.correlation_coeff_Fo_to_Fc_free          0.935 
_refine.B_iso_mean                               43.497 
_refine.aniso_B[1][1]                            -0.55 
_refine.aniso_B[2][2]                            -0.55 
_refine.aniso_B[3][3]                            1.11 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      1V3V.pdb 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.258 
_refine.pdbx_overall_ESU_R_Free                  0.218 
_refine.overall_SU_ML                            0.185 
_refine.overall_SU_B                             14.847 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        9834 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         22 
_refine_hist.number_atoms_solvent             315 
_refine_hist.number_atoms_total               10171 
_refine_hist.d_res_high                       2.30 
_refine_hist.d_res_low                        62.3 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d       0.017  0.022  ? 10040 'X-RAY DIFFRACTION' ? 
r_bond_other_d         0.001  0.020  ? 9388  'X-RAY DIFFRACTION' ? 
r_angle_refined_deg    1.618  1.981  ? 13619 'X-RAY DIFFRACTION' ? 
r_angle_other_deg      0.843  3.000  ? 21844 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg 7.384  5.000  ? 1308  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg 39.289 25.101 ? 347   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg 16.573 15.000 ? 1708  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg 15.973 15.000 ? 24    'X-RAY DIFFRACTION' ? 
r_chiral_restr         0.088  0.200  ? 1564  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined   0.005  0.020  ? 11100 'X-RAY DIFFRACTION' ? 
r_gen_planes_other     0.001  0.020  ? 1876  'X-RAY DIFFRACTION' ? 
r_nbd_refined          0.190  0.200  ? 1821  'X-RAY DIFFRACTION' ? 
r_nbd_other            0.169  0.200  ? 8928  'X-RAY DIFFRACTION' ? 
r_nbtor_refined        0.175  0.200  ? 4749  'X-RAY DIFFRACTION' ? 
r_nbtor_other          0.088  0.200  ? 5940  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined  0.156  0.200  ? 300   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined 0.152  0.200  ? 2     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other   0.159  0.200  ? 15    'X-RAY DIFFRACTION' ? 
r_mcbond_it            1.991  3.000  ? 7037  'X-RAY DIFFRACTION' ? 
r_mcbond_other         0.523  3.000  ? 2704  'X-RAY DIFFRACTION' ? 
r_mcangle_it           2.905  5.000  ? 10404 'X-RAY DIFFRACTION' ? 
r_scbond_it            5.181  7.000  ? 4008  'X-RAY DIFFRACTION' ? 
r_scangle_it           7.035  11.000 ? 3215  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1 A 1913 0.13 0.50  'medium positional' 1 'X-RAY DIFFRACTION' 1  ? ? ? 
2 B 1913 0.13 0.50  'medium positional' 1 'X-RAY DIFFRACTION' 2  ? ? ? 
3 C 1913 0.13 0.50  'medium positional' 1 'X-RAY DIFFRACTION' 3  ? ? ? 
4 D 1913 0.13 0.50  'medium positional' 1 'X-RAY DIFFRACTION' 4  ? ? ? 
1 A 2838 0.37 5.00  'loose positional'  1 'X-RAY DIFFRACTION' 5  ? ? ? 
2 B 2838 0.39 5.00  'loose positional'  1 'X-RAY DIFFRACTION' 6  ? ? ? 
3 C 2838 0.38 5.00  'loose positional'  1 'X-RAY DIFFRACTION' 7  ? ? ? 
4 D 2838 0.39 5.00  'loose positional'  1 'X-RAY DIFFRACTION' 8  ? ? ? 
1 A 1913 0.73 2.00  'medium thermal'    1 'X-RAY DIFFRACTION' 9  ? ? ? 
2 B 1913 0.75 2.00  'medium thermal'    1 'X-RAY DIFFRACTION' 10 ? ? ? 
3 C 1913 0.75 2.00  'medium thermal'    1 'X-RAY DIFFRACTION' 11 ? ? ? 
4 D 1913 0.73 2.00  'medium thermal'    1 'X-RAY DIFFRACTION' 12 ? ? ? 
1 A 2838 1.91 10.00 'loose thermal'     1 'X-RAY DIFFRACTION' 13 ? ? ? 
2 B 2838 1.89 10.00 'loose thermal'     1 'X-RAY DIFFRACTION' 14 ? ? ? 
3 C 2838 1.80 10.00 'loose thermal'     1 'X-RAY DIFFRACTION' 15 ? ? ? 
4 D 2838 1.87 10.00 'loose thermal'     1 'X-RAY DIFFRACTION' 16 ? ? ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.300 
_refine_ls_shell.d_res_low                        2.360 
_refine_ls_shell.number_reflns_R_work             4456 
_refine_ls_shell.R_factor_R_work                  0.317 
_refine_ls_shell.percent_reflns_obs               82.30 
_refine_ls_shell.R_factor_R_free                  0.37 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             105 
_refine_ls_shell.number_reflns_obs                4456 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.id 
_struct_ncs_dom.details 
1 1 A 
1 2 B 
1 3 C 
1 4 D 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1 A 2 A 329 1 5 A SER 22 ? A ALA 349 ? 1 ? 
2 B 2 B 329 1 5 B SER 22 ? B ALA 349 ? 1 ? 
3 C 2 C 329 1 5 C SER 22 ? C ALA 349 ? 1 ? 
4 D 2 D 329 1 5 D SER 22 ? D ALA 349 ? 1 ? 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                  1ZSV 
_struct.title                     'Crystal structure of human NADP-dependent leukotriene B4 12-hydroxydehydrogenase' 
_struct.pdbx_descriptor           'NADP-dependent leukotriene B4 12-hydroxydehydrogenase' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1ZSV 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            
;medium-chain dehydrogenase/reductase family, leukotriene B4, human, Structural Genomics, Structural Genomics Consortium, SGC, OXIDOREDUCTASE
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 2 ? 
F  N N 2 ? 
G  N N 2 ? 
H  N N 2 ? 
I  N N 2 ? 
J  N N 2 ? 
K  N N 2 ? 
L  N N 2 ? 
M  N N 2 ? 
N  N N 2 ? 
O  N N 2 ? 
P  N N 2 ? 
Q  N N 2 ? 
R  N N 2 ? 
S  N N 2 ? 
T  N N 2 ? 
U  N N 2 ? 
V  N N 2 ? 
W  N N 2 ? 
X  N N 2 ? 
Y  N N 2 ? 
Z  N N 2 ? 
AA N N 3 ? 
BA N N 3 ? 
CA N N 3 ? 
DA N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 38  ? SER A 40  ? THR A 18  SER A 20  5 ? 3  
HELX_P HELX_P2  2  PRO A 68  ? ALA A 74  ? PRO A 48  ALA A 54  1 ? 7  
HELX_P HELX_P3  3  LYS A 75  ? LEU A 77  ? LYS A 55  LEU A 57  5 ? 3  
HELX_P HELX_P4  4  PRO A 134 ? GLY A 140 ? PRO A 114 GLY A 120 5 ? 7  
HELX_P HELX_P5  5  GLY A 143 ? ILE A 156 ? GLY A 123 ILE A 136 1 ? 14 
HELX_P HELX_P6  6  VAL A 174 ? LEU A 184 ? VAL A 154 LEU A 164 1 ? 11 
HELX_P HELX_P7  7  SER A 195 ? LEU A 205 ? SER A 175 LEU A 185 1 ? 11 
HELX_P HELX_P8  8  SER A 218 ? SER A 227 ? SER A 198 SER A 207 1 ? 10 
HELX_P HELX_P9  9  GLY A 239 ? GLY A 248 ? GLY A 219 GLY A 228 1 ? 10 
HELX_P HELX_P10 10 ALA A 261 ? TYR A 265 ? ALA A 241 TYR A 245 5 ? 5  
HELX_P HELX_P11 11 PRO A 276 ? GLN A 283 ? PRO A 256 GLN A 263 1 ? 8  
HELX_P HELX_P12 12 VAL A 291 ? TRP A 295 ? VAL A 271 TRP A 275 5 ? 5  
HELX_P HELX_P13 13 GLN A 296 ? GLU A 313 ? GLN A 276 GLU A 293 1 ? 18 
HELX_P HELX_P14 14 ASN A 328 ? LYS A 338 ? ASN A 308 LYS A 318 1 ? 11 
HELX_P HELX_P15 15 THR B 38  ? SER B 40  ? THR B 18  SER B 20  5 ? 3  
HELX_P HELX_P16 16 PRO B 68  ? ALA B 74  ? PRO B 48  ALA B 54  1 ? 7  
HELX_P HELX_P17 17 LYS B 75  ? LEU B 77  ? LYS B 55  LEU B 57  5 ? 3  
HELX_P HELX_P18 18 PRO B 134 ? GLY B 140 ? PRO B 114 GLY B 120 5 ? 7  
HELX_P HELX_P19 19 GLY B 143 ? GLU B 155 ? GLY B 123 GLU B 135 1 ? 13 
HELX_P HELX_P20 20 VAL B 174 ? LYS B 185 ? VAL B 154 LYS B 165 1 ? 12 
HELX_P HELX_P21 21 SER B 195 ? LEU B 205 ? SER B 175 LEU B 185 1 ? 11 
HELX_P HELX_P22 22 SER B 218 ? SER B 227 ? SER B 198 SER B 207 1 ? 10 
HELX_P HELX_P23 23 GLY B 239 ? GLY B 248 ? GLY B 219 GLY B 228 1 ? 10 
HELX_P HELX_P24 24 ALA B 261 ? TYR B 265 ? ALA B 241 TYR B 245 5 ? 5  
HELX_P HELX_P25 25 PRO B 276 ? GLN B 283 ? PRO B 256 GLN B 263 1 ? 8  
HELX_P HELX_P26 26 VAL B 291 ? TRP B 295 ? VAL B 271 TRP B 275 5 ? 5  
HELX_P HELX_P27 27 GLN B 296 ? GLU B 313 ? GLN B 276 GLU B 293 1 ? 18 
HELX_P HELX_P28 28 ASN B 328 ? LYS B 338 ? ASN B 308 LYS B 318 1 ? 11 
HELX_P HELX_P29 29 THR C 38  ? SER C 40  ? THR C 18  SER C 20  5 ? 3  
HELX_P HELX_P30 30 PRO C 68  ? ALA C 74  ? PRO C 48  ALA C 54  1 ? 7  
HELX_P HELX_P31 31 LYS C 75  ? LEU C 77  ? LYS C 55  LEU C 57  5 ? 3  
HELX_P HELX_P32 32 PRO C 134 ? GLY C 140 ? PRO C 114 GLY C 120 5 ? 7  
HELX_P HELX_P33 33 GLY C 143 ? GLU C 155 ? GLY C 123 GLU C 135 1 ? 13 
HELX_P HELX_P34 34 GLY C 172 ? LYS C 185 ? GLY C 152 LYS C 165 1 ? 14 
HELX_P HELX_P35 35 SER C 195 ? LEU C 205 ? SER C 175 LEU C 185 1 ? 11 
HELX_P HELX_P36 36 SER C 218 ? SER C 227 ? SER C 198 SER C 207 1 ? 10 
HELX_P HELX_P37 37 GLY C 239 ? GLY C 248 ? GLY C 219 GLY C 228 1 ? 10 
HELX_P HELX_P38 38 ALA C 261 ? TYR C 265 ? ALA C 241 TYR C 245 5 ? 5  
HELX_P HELX_P39 39 PRO C 276 ? GLN C 283 ? PRO C 256 GLN C 263 1 ? 8  
HELX_P HELX_P40 40 VAL C 291 ? TRP C 295 ? VAL C 271 TRP C 275 5 ? 5  
HELX_P HELX_P41 41 GLN C 296 ? GLU C 313 ? GLN C 276 GLU C 293 1 ? 18 
HELX_P HELX_P42 42 ASN C 328 ? GLY C 339 ? ASN C 308 GLY C 319 1 ? 12 
HELX_P HELX_P43 43 THR D 38  ? SER D 40  ? THR D 18  SER D 20  5 ? 3  
HELX_P HELX_P44 44 PRO D 68  ? ALA D 74  ? PRO D 48  ALA D 54  1 ? 7  
HELX_P HELX_P45 45 LYS D 75  ? LEU D 77  ? LYS D 55  LEU D 57  5 ? 3  
HELX_P HELX_P46 46 PRO D 134 ? GLY D 140 ? PRO D 114 GLY D 120 5 ? 7  
HELX_P HELX_P47 47 GLY D 143 ? GLU D 155 ? GLY D 123 GLU D 135 1 ? 13 
HELX_P HELX_P48 48 VAL D 174 ? LEU D 184 ? VAL D 154 LEU D 164 1 ? 11 
HELX_P HELX_P49 49 SER D 195 ? LEU D 205 ? SER D 175 LEU D 185 1 ? 11 
HELX_P HELX_P50 50 SER D 218 ? SER D 227 ? SER D 198 SER D 207 1 ? 10 
HELX_P HELX_P51 51 GLY D 239 ? GLY D 248 ? GLY D 219 GLY D 228 1 ? 10 
HELX_P HELX_P52 52 PRO D 276 ? GLN D 283 ? PRO D 256 GLN D 263 1 ? 8  
HELX_P HELX_P53 53 VAL D 291 ? TRP D 295 ? VAL D 271 TRP D 275 5 ? 5  
HELX_P HELX_P54 54 GLN D 296 ? GLU D 313 ? GLN D 276 GLU D 293 1 ? 18 
HELX_P HELX_P55 55 ASN D 328 ? LYS D 338 ? ASN D 308 LYS D 318 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2  ? 
B ? 5  ? 
C ? 4  ? 
D ? 12 ? 
E ? 2  ? 
F ? 5  ? 
G ? 4  ? 
H ? 2  ? 
I ? 5  ? 
J ? 4  ? 
K ? 12 ? 
L ? 2  ? 
M ? 5  ? 
N ? 4  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1  2  ? anti-parallel 
B 1  2  ? anti-parallel 
B 2  3  ? anti-parallel 
B 3  4  ? anti-parallel 
B 4  5  ? anti-parallel 
C 1  2  ? anti-parallel 
C 2  3  ? anti-parallel 
C 3  4  ? parallel      
D 1  2  ? parallel      
D 2  3  ? parallel      
D 3  4  ? parallel      
D 4  5  ? parallel      
D 5  6  ? parallel      
D 6  7  ? anti-parallel 
D 7  8  ? parallel      
D 8  9  ? parallel      
D 9  10 ? parallel      
D 10 11 ? parallel      
D 11 12 ? parallel      
E 1  2  ? anti-parallel 
F 1  2  ? anti-parallel 
F 2  3  ? anti-parallel 
F 3  4  ? anti-parallel 
F 4  5  ? anti-parallel 
G 1  2  ? anti-parallel 
G 2  3  ? anti-parallel 
G 3  4  ? parallel      
H 1  2  ? anti-parallel 
I 1  2  ? anti-parallel 
I 2  3  ? anti-parallel 
I 3  4  ? anti-parallel 
I 4  5  ? anti-parallel 
J 1  2  ? anti-parallel 
J 2  3  ? anti-parallel 
J 3  4  ? parallel      
K 1  2  ? parallel      
K 2  3  ? parallel      
K 3  4  ? parallel      
K 4  5  ? parallel      
K 5  6  ? parallel      
K 6  7  ? anti-parallel 
K 7  8  ? parallel      
K 8  9  ? parallel      
K 9  10 ? parallel      
K 10 11 ? parallel      
K 11 12 ? parallel      
L 1  2  ? anti-parallel 
M 1  2  ? anti-parallel 
M 2  3  ? anti-parallel 
M 3  4  ? anti-parallel 
M 4  5  ? anti-parallel 
N 1  2  ? anti-parallel 
N 2  3  ? anti-parallel 
N 3  4  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  MET A 23  ? LEU A 29  ? MET A 3   LEU A 9   
A 2  PHE A 42  ? GLU A 48  ? PHE A 22  GLU A 28  
B 1  HIS A 114 ? SER A 117 ? HIS A 94  SER A 97  
B 2  VAL A 57  ? THR A 65  ? VAL A 37  THR A 45  
B 3  GLN A 87  ? SER A 94  ? GLN A 67  SER A 74  
B 4  ILE A 104 ? ALA A 107 ? ILE A 84  ALA A 87  
B 5  GLU A 123 ? LYS A 124 ? GLU A 103 LYS A 104 
C 1  HIS A 114 ? SER A 117 ? HIS A 94  SER A 97  
C 2  VAL A 57  ? THR A 65  ? VAL A 37  THR A 45  
C 3  LYS A 344 ? LYS A 348 ? LYS A 324 LYS A 328 
C 4  GLU A 320 ? GLU A 324 ? GLU A 300 GLU A 304 
D 1  VAL A 209 ? ASN A 212 ? VAL A 189 ASN A 192 
D 2  LYS A 188 ? VAL A 193 ? LYS A 168 VAL A 173 
D 3  THR A 164 ? VAL A 167 ? THR A 144 VAL A 147 
D 4  TYR A 231 ? ASP A 236 ? TYR A 211 ASP A 216 
D 5  MET A 250 ? ILE A 258 ? MET A 230 ILE A 238 
D 6  ARG A 286 ? ALA A 289 ? ARG A 266 ALA A 269 
D 7  ARG B 286 ? ALA B 289 ? ARG B 266 ALA B 269 
D 8  MET B 250 ? ILE B 258 ? MET B 230 ILE B 238 
D 9  TYR B 231 ? ASP B 236 ? TYR B 211 ASP B 216 
D 10 THR B 164 ? VAL B 167 ? THR B 144 VAL B 147 
D 11 LYS B 188 ? VAL B 193 ? LYS B 168 VAL B 173 
D 12 VAL B 209 ? ASN B 212 ? VAL B 189 ASN B 192 
E 1  MET B 23  ? LEU B 29  ? MET B 3   LEU B 9   
E 2  PHE B 42  ? GLU B 48  ? PHE B 22  GLU B 28  
F 1  HIS B 114 ? SER B 117 ? HIS B 94  SER B 97  
F 2  VAL B 57  ? THR B 65  ? VAL B 37  THR B 45  
F 3  GLN B 87  ? SER B 94  ? GLN B 67  SER B 74  
F 4  ILE B 104 ? ALA B 107 ? ILE B 84  ALA B 87  
F 5  GLU B 123 ? LYS B 124 ? GLU B 103 LYS B 104 
G 1  HIS B 114 ? SER B 117 ? HIS B 94  SER B 97  
G 2  VAL B 57  ? THR B 65  ? VAL B 37  THR B 45  
G 3  LYS B 344 ? LYS B 348 ? LYS B 324 LYS B 328 
G 4  GLU B 320 ? GLU B 324 ? GLU B 300 GLU B 304 
H 1  MET C 23  ? LEU C 29  ? MET C 3   LEU C 9   
H 2  PHE C 42  ? GLU C 48  ? PHE C 22  GLU C 28  
I 1  HIS C 114 ? SER C 117 ? HIS C 94  SER C 97  
I 2  VAL C 57  ? THR C 65  ? VAL C 37  THR C 45  
I 3  GLN C 87  ? SER C 94  ? GLN C 67  SER C 74  
I 4  ILE C 104 ? ALA C 107 ? ILE C 84  ALA C 87  
I 5  GLU C 123 ? LYS C 124 ? GLU C 103 LYS C 104 
J 1  HIS C 114 ? SER C 117 ? HIS C 94  SER C 97  
J 2  VAL C 57  ? THR C 65  ? VAL C 37  THR C 45  
J 3  LYS C 344 ? LYS C 348 ? LYS C 324 LYS C 328 
J 4  GLU C 320 ? GLU C 324 ? GLU C 300 GLU C 304 
K 1  VAL C 209 ? ASN C 212 ? VAL C 189 ASN C 192 
K 2  LYS C 188 ? VAL C 193 ? LYS C 168 VAL C 173 
K 3  THR C 164 ? VAL C 167 ? THR C 144 VAL C 147 
K 4  TYR C 231 ? ASP C 236 ? TYR C 211 ASP C 216 
K 5  MET C 250 ? ILE C 258 ? MET C 230 ILE C 238 
K 6  ARG C 286 ? ALA C 289 ? ARG C 266 ALA C 269 
K 7  ARG D 286 ? ALA D 289 ? ARG D 266 ALA D 269 
K 8  MET D 250 ? ILE D 258 ? MET D 230 ILE D 238 
K 9  TYR D 231 ? ASP D 236 ? TYR D 211 ASP D 216 
K 10 THR D 164 ? VAL D 167 ? THR D 144 VAL D 147 
K 11 LYS D 188 ? VAL D 193 ? LYS D 168 VAL D 173 
K 12 VAL D 209 ? ASN D 212 ? VAL D 189 ASN D 192 
L 1  MET D 23  ? LEU D 29  ? MET D 3   LEU D 9   
L 2  PHE D 42  ? GLU D 48  ? PHE D 22  GLU D 28  
M 1  HIS D 114 ? SER D 117 ? HIS D 94  SER D 97  
M 2  VAL D 57  ? THR D 65  ? VAL D 37  THR D 45  
M 3  GLN D 87  ? SER D 94  ? GLN D 67  SER D 74  
M 4  ILE D 104 ? ALA D 107 ? ILE D 84  ALA D 87  
M 5  GLU D 123 ? LYS D 124 ? GLU D 103 LYS D 104 
N 1  HIS D 114 ? SER D 117 ? HIS D 94  SER D 97  
N 2  VAL D 57  ? THR D 65  ? VAL D 37  THR D 45  
N 3  LYS D 344 ? LYS D 348 ? LYS D 324 LYS D 328 
N 4  GLU D 320 ? GLU D 324 ? GLU D 300 GLU D 304 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1  2  N THR A 26  ? N THR A 6   O LYS A 45  ? O LYS A 25  
B 1  2  O SER A 115 ? O SER A 95  N LEU A 59  ? N LEU A 39  
B 2  3  N LEU A 62  ? N LEU A 42  O VAL A 88  ? O VAL A 68  
B 3  4  N GLN A 87  ? N GLN A 67  O ALA A 107 ? O ALA A 87  
B 4  5  N LEU A 106 ? N LEU A 86  O GLU A 123 ? O GLU A 103 
C 1  2  O SER A 115 ? O SER A 95  N LEU A 59  ? N LEU A 39  
C 2  3  N LEU A 64  ? N LEU A 44  O VAL A 347 ? O VAL A 327 
C 3  4  O LYS A 344 ? O LYS A 324 N TYR A 321 ? N TYR A 301 
D 1  2  O VAL A 209 ? O VAL A 189 N GLY A 191 ? N GLY A 171 
D 2  3  O VAL A 190 ? O VAL A 170 N VAL A 167 ? N VAL A 147 
D 3  4  N MET A 166 ? N MET A 146 O PHE A 235 ? O PHE A 215 
D 4  5  N TYR A 231 ? N TYR A 211 O LYS A 251 ? O LYS A 231 
D 5  6  N ILE A 256 ? N ILE A 236 O GLU A 288 ? O GLU A 268 
D 6  7  N MET A 287 ? N MET A 267 O MET B 287 ? O MET B 267 
D 7  8  O GLU B 288 ? O GLU B 268 N ILE B 258 ? N ILE B 238 
D 8  9  O LYS B 251 ? O LYS B 231 N TYR B 231 ? N TYR B 211 
D 9  10 O CYS B 233 ? O CYS B 213 N MET B 166 ? N MET B 146 
D 10 11 N VAL B 165 ? N VAL B 145 O LYS B 188 ? O LYS B 168 
D 11 12 N GLY B 191 ? N GLY B 171 O VAL B 209 ? O VAL B 189 
E 1  2  N THR B 28  ? N THR B 8   O GLU B 43  ? O GLU B 23  
F 1  2  O SER B 115 ? O SER B 95  N LEU B 59  ? N LEU B 39  
F 2  3  N LEU B 62  ? N LEU B 42  O VAL B 88  ? O VAL B 68  
F 3  4  N GLN B 87  ? N GLN B 67  O ALA B 107 ? O ALA B 87  
F 4  5  N LEU B 106 ? N LEU B 86  O GLU B 123 ? O GLU B 103 
G 1  2  O SER B 115 ? O SER B 95  N LEU B 59  ? N LEU B 39  
G 2  3  N LEU B 64  ? N LEU B 44  O VAL B 347 ? O VAL B 327 
G 3  4  O LYS B 344 ? O LYS B 324 N TYR B 321 ? N TYR B 301 
H 1  2  N THR C 26  ? N THR C 6   O LYS C 45  ? O LYS C 25  
I 1  2  O SER C 115 ? O SER C 95  N LEU C 59  ? N LEU C 39  
I 2  3  N LEU C 62  ? N LEU C 42  O VAL C 88  ? O VAL C 68  
I 3  4  N GLN C 87  ? N GLN C 67  O ALA C 107 ? O ALA C 87  
I 4  5  N LEU C 106 ? N LEU C 86  O GLU C 123 ? O GLU C 103 
J 1  2  O SER C 115 ? O SER C 95  N LEU C 59  ? N LEU C 39  
J 2  3  N LEU C 64  ? N LEU C 44  O VAL C 347 ? O VAL C 327 
J 3  4  O LYS C 344 ? O LYS C 324 N TYR C 321 ? N TYR C 301 
K 1  2  O VAL C 209 ? O VAL C 189 N GLY C 191 ? N GLY C 171 
K 2  3  O VAL C 190 ? O VAL C 170 N VAL C 165 ? N VAL C 145 
K 3  4  N MET C 166 ? N MET C 146 O PHE C 235 ? O PHE C 215 
K 4  5  N TYR C 231 ? N TYR C 211 O LYS C 251 ? O LYS C 231 
K 5  6  N ILE C 256 ? N ILE C 236 O ARG C 286 ? O ARG C 266 
K 6  7  N MET C 287 ? N MET C 267 O MET D 287 ? O MET D 267 
K 7  8  O GLU D 288 ? O GLU D 268 N ILE D 258 ? N ILE D 238 
K 8  9  O LYS D 251 ? O LYS D 231 N TYR D 231 ? N TYR D 211 
K 9  10 O CYS D 233 ? O CYS D 213 N MET D 166 ? N MET D 146 
K 10 11 N VAL D 165 ? N VAL D 145 O VAL D 190 ? O VAL D 170 
K 11 12 N GLY D 191 ? N GLY D 171 O VAL D 209 ? O VAL D 189 
L 1  2  N THR D 24  ? N THR D 4   O SER D 47  ? O SER D 27  
M 1  2  O SER D 115 ? O SER D 95  N LEU D 59  ? N LEU D 39  
M 2  3  N LEU D 58  ? N LEU D 38  O GLU D 93  ? O GLU D 73  
M 3  4  N ALA D 89  ? N ALA D 69  O VAL D 105 ? O VAL D 85  
M 4  5  N LEU D 106 ? N LEU D 86  O GLU D 123 ? O GLU D 103 
N 1  2  O SER D 115 ? O SER D 95  N LEU D 59  ? N LEU D 39  
N 2  3  N LEU D 64  ? N LEU D 44  O VAL D 347 ? O VAL D 327 
N 3  4  O LYS D 344 ? O LYS D 324 N TYR D 321 ? N TYR D 301 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CL D 401' 
AC2 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE CL B 402' 
AC3 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL D 403' 
AC4 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL C 404' 
AC5 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CL C 405' 
AC6 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE CL C 406' 
AC7 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE CL A 407' 
AC8 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CL A 408' 
AC9 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL B 409' 
BC1 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CL D 414' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 2 ALA D  169 ? ALA D 149 . ? 1_555 ? 
2  AC1 2 TYR D  213 ? TYR D 193 . ? 1_555 ? 
3  AC2 1 TYR B  213 ? TYR B 193 . ? 1_555 ? 
4  AC3 3 THR A  38  ? THR A 18  . ? 1_555 ? 
5  AC3 3 SER A  40  ? SER A 20  . ? 1_555 ? 
6  AC3 3 ASN D  39  ? ASN D 19  . ? 1_555 ? 
7  AC4 3 ASN B  39  ? ASN B 19  . ? 1_555 ? 
8  AC4 3 ALA B  331 ? ALA B 311 . ? 1_555 ? 
9  AC4 3 SER C  40  ? SER C 20  . ? 1_555 ? 
10 AC5 5 VAL C  66  ? VAL C 46  . ? 1_555 ? 
11 AC5 5 MET C  336 ? MET C 316 . ? 1_555 ? 
12 AC5 5 LYS C  344 ? LYS C 324 . ? 1_555 ? 
13 AC5 5 THR C  345 ? THR C 325 . ? 1_555 ? 
14 AC5 5 HOH CA .   ? HOH C 451 . ? 1_555 ? 
15 AC6 1 TYR C  213 ? TYR C 193 . ? 1_555 ? 
16 AC7 1 TYR A  213 ? TYR A 193 . ? 1_555 ? 
17 AC8 4 MET A  336 ? MET A 316 . ? 1_555 ? 
18 AC8 4 LYS A  344 ? LYS A 324 . ? 1_555 ? 
19 AC8 4 THR A  345 ? THR A 325 . ? 1_555 ? 
20 AC8 4 HOH AA .   ? HOH A 447 . ? 1_555 ? 
21 AC9 3 VAL B  66  ? VAL B 46  . ? 1_555 ? 
22 AC9 3 LYS B  344 ? LYS B 324 . ? 1_555 ? 
23 AC9 3 THR B  345 ? THR B 325 . ? 1_555 ? 
24 BC1 2 LYS D  344 ? LYS D 324 . ? 1_555 ? 
25 BC1 2 THR D  345 ? THR D 325 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1ZSV 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1ZSV 
_atom_sites.fract_transf_matrix[1][1]   0.010806 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010806 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004932 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . SER A  1 22  ? 44.869 24.498  48.434  1.00 61.65 ? 2   SER A N   1 
ATOM   2     C  CA  . SER A  1 22  ? 43.965 24.063  47.312  1.00 62.45 ? 2   SER A CA  1 
ATOM   3     C  C   . SER A  1 22  ? 44.715 23.214  46.252  1.00 62.22 ? 2   SER A C   1 
ATOM   4     O  O   . SER A  1 22  ? 45.643 23.690  45.573  1.00 59.68 ? 2   SER A O   1 
ATOM   5     C  CB  . SER A  1 22  ? 43.279 25.280  46.661  1.00 63.23 ? 2   SER A CB  1 
ATOM   6     O  OG  . SER A  1 22  ? 42.409 24.886  45.606  1.00 63.78 ? 2   SER A OG  1 
ATOM   7     N  N   . MET A  1 23  ? 44.303 21.952  46.127  1.00 62.00 ? 3   MET A N   1 
ATOM   8     C  CA  . MET A  1 23  ? 44.968 20.995  45.242  1.00 61.52 ? 3   MET A CA  1 
ATOM   9     C  C   . MET A  1 23  ? 44.021 20.414  44.185  1.00 59.05 ? 3   MET A C   1 
ATOM   10    O  O   . MET A  1 23  ? 42.795 20.383  44.366  1.00 57.58 ? 3   MET A O   1 
ATOM   11    C  CB  . MET A  1 23  ? 45.577 19.857  46.068  1.00 64.14 ? 3   MET A CB  1 
ATOM   12    C  CG  . MET A  1 23  ? 46.615 20.321  47.113  1.00 68.74 ? 3   MET A CG  1 
ATOM   13    S  SD  . MET A  1 23  ? 48.287 20.547  46.433  1.00 78.11 ? 3   MET A SD  1 
ATOM   14    C  CE  . MET A  1 23  ? 48.831 18.839  46.229  1.00 77.50 ? 3   MET A CE  1 
ATOM   15    N  N   . THR A  1 24  ? 44.620 19.951  43.088  1.00 55.49 ? 4   THR A N   1 
ATOM   16    C  CA  . THR A  1 24  ? 43.900 19.362  41.971  1.00 51.61 ? 4   THR A CA  1 
ATOM   17    C  C   . THR A  1 24  ? 44.678 18.174  41.413  1.00 49.63 ? 4   THR A C   1 
ATOM   18    O  O   . THR A  1 24  ? 45.903 18.123  41.534  1.00 48.04 ? 4   THR A O   1 
ATOM   19    C  CB  . THR A  1 24  ? 43.687 20.399  40.837  1.00 50.59 ? 4   THR A CB  1 
ATOM   20    O  OG1 . THR A  1 24  ? 42.892 19.822  39.800  1.00 49.55 ? 4   THR A OG1 1 
ATOM   21    C  CG2 . THR A  1 24  ? 45.003 20.854  40.225  1.00 49.92 ? 4   THR A CG2 1 
ATOM   22    N  N   . LYS A  1 25  ? 43.959 17.238  40.788  1.00 47.74 ? 5   LYS A N   1 
ATOM   23    C  CA  . LYS A  1 25  ? 44.573 16.119  40.036  1.00 45.70 ? 5   LYS A CA  1 
ATOM   24    C  C   . LYS A  1 25  ? 44.231 16.219  38.536  1.00 43.67 ? 5   LYS A C   1 
ATOM   25    O  O   . LYS A  1 25  ? 43.120 16.506  38.165  1.00 42.30 ? 5   LYS A O   1 
ATOM   26    C  CB  . LYS A  1 25  ? 44.116 14.768  40.610  1.00 43.98 ? 5   LYS A CB  1 
ATOM   27    C  CG  . LYS A  1 25  ? 44.892 14.316  41.822  1.00 43.43 ? 5   LYS A CG  1 
ATOM   28    C  CD  . LYS A  1 25  ? 44.137 13.272  42.667  1.00 49.13 ? 5   LYS A CD  1 
ATOM   29    N  N   . THR A  1 26  ? 45.191 15.948  37.669  1.00 44.97 ? 6   THR A N   1 
ATOM   30    C  CA  . THR A  1 26  ? 45.020 16.188  36.234  1.00 43.89 ? 6   THR A CA  1 
ATOM   31    C  C   . THR A  1 26  ? 45.631 15.083  35.379  1.00 41.24 ? 6   THR A C   1 
ATOM   32    O  O   . THR A  1 26  ? 46.752 14.681  35.634  1.00 42.74 ? 6   THR A O   1 
ATOM   33    C  CB  . THR A  1 26  ? 45.653 17.565  35.906  1.00 44.29 ? 6   THR A CB  1 
ATOM   34    O  OG1 . THR A  1 26  ? 44.883 18.574  36.567  1.00 52.73 ? 6   THR A OG1 1 
ATOM   35    C  CG2 . THR A  1 26  ? 45.664 17.871  34.440  1.00 44.34 ? 6   THR A CG2 1 
ATOM   36    N  N   . TRP A  1 27  ? 44.888 14.607  34.371  1.00 40.70 ? 7   TRP A N   1 
ATOM   37    C  CA  . TRP A  1 27  ? 45.410 13.696  33.336  1.00 40.29 ? 7   TRP A CA  1 
ATOM   38    C  C   . TRP A  1 27  ? 46.012 14.384  32.126  1.00 39.86 ? 7   TRP A C   1 
ATOM   39    O  O   . TRP A  1 27  ? 45.328 15.106  31.406  1.00 42.36 ? 7   TRP A O   1 
ATOM   40    C  CB  . TRP A  1 27  ? 44.334 12.764  32.804  1.00 40.15 ? 7   TRP A CB  1 
ATOM   41    C  CG  . TRP A  1 27  ? 43.959 11.681  33.765  1.00 39.75 ? 7   TRP A CG  1 
ATOM   42    C  CD1 . TRP A  1 27  ? 42.824 11.619  34.489  1.00 36.34 ? 7   TRP A CD1 1 
ATOM   43    C  CD2 . TRP A  1 27  ? 44.738 10.533  34.121  1.00 33.83 ? 7   TRP A CD2 1 
ATOM   44    N  NE1 . TRP A  1 27  ? 42.838 10.516  35.283  1.00 39.53 ? 7   TRP A NE1 1 
ATOM   45    C  CE2 . TRP A  1 27  ? 44.000 9.819   35.068  1.00 38.06 ? 7   TRP A CE2 1 
ATOM   46    C  CE3 . TRP A  1 27  ? 45.990 10.038  33.720  1.00 36.52 ? 7   TRP A CE3 1 
ATOM   47    C  CZ2 . TRP A  1 27  ? 44.445 8.599   35.609  1.00 38.36 ? 7   TRP A CZ2 1 
ATOM   48    C  CZ3 . TRP A  1 27  ? 46.437 8.858   34.252  1.00 35.72 ? 7   TRP A CZ3 1 
ATOM   49    C  CH2 . TRP A  1 27  ? 45.672 8.142   35.196  1.00 36.14 ? 7   TRP A CH2 1 
ATOM   50    N  N   . THR A  1 28  ? 47.285 14.086  31.892  1.00 40.40 ? 8   THR A N   1 
ATOM   51    C  CA  . THR A  1 28  ? 48.053 14.654  30.809  1.00 41.47 ? 8   THR A CA  1 
ATOM   52    C  C   . THR A  1 28  ? 48.332 13.590  29.760  1.00 41.69 ? 8   THR A C   1 
ATOM   53    O  O   . THR A  1 28  ? 48.121 12.414  29.971  1.00 42.20 ? 8   THR A O   1 
ATOM   54    C  CB  . THR A  1 28  ? 49.368 15.343  31.317  1.00 41.02 ? 8   THR A CB  1 
ATOM   55    O  OG1 . THR A  1 28  ? 50.231 14.399  31.974  1.00 45.08 ? 8   THR A OG1 1 
ATOM   56    C  CG2 . THR A  1 28  ? 49.024 16.461  32.299  1.00 40.82 ? 8   THR A CG2 1 
ATOM   57    N  N   . LEU A  1 29  ? 48.698 14.055  28.582  1.00 44.84 ? 9   LEU A N   1 
ATOM   58    C  CA  . LEU A  1 29  ? 49.206 13.231  27.539  1.00 44.92 ? 9   LEU A CA  1 
ATOM   59    C  C   . LEU A  1 29  ? 50.717 13.121  27.794  1.00 46.13 ? 9   LEU A C   1 
ATOM   60    O  O   . LEU A  1 29  ? 51.449 14.078  27.586  1.00 47.31 ? 9   LEU A O   1 
ATOM   61    C  CB  . LEU A  1 29  ? 48.900 13.897  26.209  1.00 46.12 ? 9   LEU A CB  1 
ATOM   62    C  CG  . LEU A  1 29  ? 49.153 13.075  24.945  1.00 50.01 ? 9   LEU A CG  1 
ATOM   63    C  CD1 . LEU A  1 29  ? 48.213 11.887  24.896  1.00 48.01 ? 9   LEU A CD1 1 
ATOM   64    C  CD2 . LEU A  1 29  ? 49.006 13.961  23.725  1.00 45.95 ? 9   LEU A CD2 1 
ATOM   65    N  N   . LYS A  1 30  ? 51.159 11.976  28.317  1.00 45.21 ? 10  LYS A N   1 
ATOM   66    C  CA  . LYS A  1 30  ? 52.587 11.630  28.378  1.00 45.54 ? 10  LYS A CA  1 
ATOM   67    C  C   . LYS A  1 30  ? 53.182 11.346  26.984  1.00 44.27 ? 10  LYS A C   1 
ATOM   68    O  O   . LYS A  1 30  ? 54.368 11.615  26.745  1.00 43.25 ? 10  LYS A O   1 
ATOM   69    C  CB  . LYS A  1 30  ? 52.840 10.433  29.333  1.00 44.80 ? 10  LYS A CB  1 
ATOM   70    C  CG  . LYS A  1 30  ? 54.336 10.066  29.559  1.00 46.03 ? 10  LYS A CG  1 
ATOM   71    C  CD  . LYS A  1 30  ? 54.581 9.288   30.850  1.00 48.61 ? 10  LYS A CD  1 
ATOM   72    C  CE  . LYS A  1 30  ? 53.841 7.926   30.861  1.00 61.41 ? 10  LYS A CE  1 
ATOM   73    N  NZ  . LYS A  1 30  ? 52.884 7.677   32.042  1.00 62.04 ? 10  LYS A NZ  1 
ATOM   74    N  N   . LYS A  1 31  ? 52.371 10.807  26.069  1.00 43.85 ? 11  LYS A N   1 
ATOM   75    C  CA  . LYS A  1 31  ? 52.878 10.409  24.776  1.00 44.38 ? 11  LYS A CA  1 
ATOM   76    C  C   . LYS A  1 31  ? 51.814 10.410  23.705  1.00 42.65 ? 11  LYS A C   1 
ATOM   77    O  O   . LYS A  1 31  ? 50.688 10.052  23.972  1.00 44.75 ? 11  LYS A O   1 
ATOM   78    C  CB  . LYS A  1 31  ? 53.569 9.037   24.870  1.00 45.89 ? 11  LYS A CB  1 
ATOM   79    C  CG  . LYS A  1 31  ? 54.403 8.780   23.629  1.00 48.69 ? 11  LYS A CG  1 
ATOM   80    C  CD  . LYS A  1 31  ? 55.400 7.656   23.769  1.00 51.93 ? 11  LYS A CD  1 
ATOM   81    C  CE  . LYS A  1 31  ? 56.268 7.579   22.510  1.00 55.49 ? 11  LYS A CE  1 
ATOM   82    N  NZ  . LYS A  1 31  ? 56.719 6.192   22.263  1.00 60.92 ? 11  LYS A NZ  1 
ATOM   83    N  N   . HIS A  1 32  ? 52.154 10.826  22.487  1.00 41.98 ? 12  HIS A N   1 
ATOM   84    C  CA  . HIS A  1 32  ? 51.165 10.780  21.398  1.00 43.21 ? 12  HIS A CA  1 
ATOM   85    C  C   . HIS A  1 32  ? 50.749 9.346   21.129  1.00 40.81 ? 12  HIS A C   1 
ATOM   86    O  O   . HIS A  1 32  ? 51.587 8.466   21.162  1.00 41.73 ? 12  HIS A O   1 
ATOM   87    C  CB  . HIS A  1 32  ? 51.651 11.519  20.120  1.00 45.26 ? 12  HIS A CB  1 
ATOM   88    C  CG  . HIS A  1 32  ? 51.456 13.003  20.217  1.00 48.97 ? 12  HIS A CG  1 
ATOM   89    N  ND1 . HIS A  1 32  ? 50.213 13.586  20.118  1.00 45.81 ? 12  HIS A ND1 1 
ATOM   90    C  CD2 . HIS A  1 32  ? 52.317 14.001  20.535  1.00 49.59 ? 12  HIS A CD2 1 
ATOM   91    C  CE1 . HIS A  1 32  ? 50.321 14.885  20.326  1.00 42.31 ? 12  HIS A CE1 1 
ATOM   92    N  NE2 . HIS A  1 32  ? 51.587 15.160  20.584  1.00 48.04 ? 12  HIS A NE2 1 
ATOM   93    N  N   . PHE A  1 33  ? 49.439 9.133   20.920  1.00 40.65 ? 13  PHE A N   1 
ATOM   94    C  CA  . PHE A  1 33  ? 48.868 7.801   20.719  1.00 38.87 ? 13  PHE A CA  1 
ATOM   95    C  C   . PHE A  1 33  ? 49.272 7.220   19.370  1.00 40.43 ? 13  PHE A C   1 
ATOM   96    O  O   . PHE A  1 33  ? 49.337 7.921   18.345  1.00 38.44 ? 13  PHE A O   1 
ATOM   97    C  CB  . PHE A  1 33  ? 47.341 7.796   20.715  1.00 38.38 ? 13  PHE A CB  1 
ATOM   98    C  CG  . PHE A  1 33  ? 46.706 8.498   21.846  1.00 36.41 ? 13  PHE A CG  1 
ATOM   99    C  CD1 . PHE A  1 33  ? 47.089 8.240   23.151  1.00 39.06 ? 13  PHE A CD1 1 
ATOM   100   C  CD2 . PHE A  1 33  ? 45.645 9.375   21.607  1.00 45.19 ? 13  PHE A CD2 1 
ATOM   101   C  CE1 . PHE A  1 33  ? 46.474 8.859   24.186  1.00 35.06 ? 13  PHE A CE1 1 
ATOM   102   C  CE2 . PHE A  1 33  ? 44.995 10.007  22.653  1.00 33.50 ? 13  PHE A CE2 1 
ATOM   103   C  CZ  . PHE A  1 33  ? 45.406 9.751   23.939  1.00 42.31 ? 13  PHE A CZ  1 
ATOM   104   N  N   . VAL A  1 34  ? 49.501 5.912   19.376  1.00 41.79 ? 14  VAL A N   1 
ATOM   105   C  CA  . VAL A  1 34  ? 49.822 5.179   18.147  1.00 42.09 ? 14  VAL A CA  1 
ATOM   106   C  C   . VAL A  1 34  ? 48.831 4.012   18.094  1.00 42.20 ? 14  VAL A C   1 
ATOM   107   O  O   . VAL A  1 34  ? 48.878 3.087   18.894  1.00 43.54 ? 14  VAL A O   1 
ATOM   108   C  CB  . VAL A  1 34  ? 51.289 4.736   18.098  1.00 42.14 ? 14  VAL A CB  1 
ATOM   109   C  CG1 . VAL A  1 34  ? 51.607 4.038   16.745  1.00 42.02 ? 14  VAL A CG1 1 
ATOM   110   C  CG2 . VAL A  1 34  ? 52.194 5.924   18.300  1.00 36.37 ? 14  VAL A CG2 1 
ATOM   111   N  N   . GLY A  1 35  ? 47.908 4.111   17.150  1.00 42.90 ? 15  GLY A N   1 
ATOM   112   C  CA  . GLY A  1 35  ? 46.691 3.324   17.190  1.00 42.70 ? 15  GLY A CA  1 
ATOM   113   C  C   . GLY A  1 35  ? 45.909 3.632   18.428  1.00 39.31 ? 15  GLY A C   1 
ATOM   114   O  O   . GLY A  1 35  ? 45.817 4.809   18.821  1.00 42.88 ? 15  GLY A O   1 
ATOM   115   N  N   . TYR A  1 36  ? 45.364 2.593   19.083  1.00 38.76 ? 16  TYR A N   1 
ATOM   116   C  CA  . TYR A  1 36  ? 44.569 2.799   20.311  1.00 36.86 ? 16  TYR A CA  1 
ATOM   117   C  C   . TYR A  1 36  ? 45.427 3.343   21.416  1.00 37.69 ? 16  TYR A C   1 
ATOM   118   O  O   . TYR A  1 36  ? 46.559 2.902   21.595  1.00 38.39 ? 16  TYR A O   1 
ATOM   119   C  CB  . TYR A  1 36  ? 43.849 1.513   20.769  1.00 39.17 ? 16  TYR A CB  1 
ATOM   120   C  CG  . TYR A  1 36  ? 42.631 1.214   19.940  1.00 38.23 ? 16  TYR A CG  1 
ATOM   121   C  CD1 . TYR A  1 36  ? 42.713 0.339   18.851  1.00 44.52 ? 16  TYR A CD1 1 
ATOM   122   C  CD2 . TYR A  1 36  ? 41.419 1.876   20.173  1.00 38.17 ? 16  TYR A CD2 1 
ATOM   123   C  CE1 . TYR A  1 36  ? 41.624 0.102   18.006  1.00 47.04 ? 16  TYR A CE1 1 
ATOM   124   C  CE2 . TYR A  1 36  ? 40.293 1.644   19.336  1.00 36.69 ? 16  TYR A CE2 1 
ATOM   125   C  CZ  . TYR A  1 36  ? 40.417 0.728   18.262  1.00 47.38 ? 16  TYR A CZ  1 
ATOM   126   O  OH  . TYR A  1 36  ? 39.370 0.450   17.438  1.00 46.37 ? 16  TYR A OH  1 
ATOM   127   N  N   . PRO A  1 37  ? 44.881 4.286   22.206  1.00 38.54 ? 17  PRO A N   1 
ATOM   128   C  CA  . PRO A  1 37  ? 45.619 4.645   23.387  1.00 36.50 ? 17  PRO A CA  1 
ATOM   129   C  C   . PRO A  1 37  ? 45.888 3.450   24.317  1.00 38.76 ? 17  PRO A C   1 
ATOM   130   O  O   . PRO A  1 37  ? 45.238 2.405   24.209  1.00 37.69 ? 17  PRO A O   1 
ATOM   131   C  CB  . PRO A  1 37  ? 44.709 5.661   24.068  1.00 35.41 ? 17  PRO A CB  1 
ATOM   132   C  CG  . PRO A  1 37  ? 43.873 6.190   22.956  1.00 31.68 ? 17  PRO A CG  1 
ATOM   133   C  CD  . PRO A  1 37  ? 43.604 5.026   22.132  1.00 38.62 ? 17  PRO A CD  1 
ATOM   134   N  N   . THR A  1 38  ? 46.840 3.665   25.227  1.00 38.04 ? 18  THR A N   1 
ATOM   135   C  CA  . THR A  1 38  ? 47.330 2.671   26.144  1.00 38.57 ? 18  THR A CA  1 
ATOM   136   C  C   . THR A  1 38  ? 47.592 3.393   27.479  1.00 38.03 ? 18  THR A C   1 
ATOM   137   O  O   . THR A  1 38  ? 47.695 4.638   27.533  1.00 37.85 ? 18  THR A O   1 
ATOM   138   C  CB  . THR A  1 38  ? 48.538 2.001   25.476  1.00 40.88 ? 18  THR A CB  1 
ATOM   139   O  OG1 . THR A  1 38  ? 48.477 0.613   25.714  1.00 50.20 ? 18  THR A OG1 1 
ATOM   140   C  CG2 . THR A  1 38  ? 49.887 2.565   25.919  1.00 36.45 ? 18  THR A CG2 1 
ATOM   141   N  N   . ASN A  1 39  ? 47.562 2.664   28.576  1.00 37.89 ? 19  ASN A N   1 
ATOM   142   C  CA  . ASN A  1 39  ? 47.749 3.278   29.898  1.00 37.31 ? 19  ASN A CA  1 
ATOM   143   C  C   . ASN A  1 39  ? 49.009 4.170   29.964  1.00 38.68 ? 19  ASN A C   1 
ATOM   144   O  O   . ASN A  1 39  ? 48.990 5.241   30.558  1.00 38.71 ? 19  ASN A O   1 
ATOM   145   C  CB  . ASN A  1 39  ? 47.849 2.207   30.977  1.00 38.94 ? 19  ASN A CB  1 
ATOM   146   C  CG  . ASN A  1 39  ? 46.491 1.690   31.452  1.00 40.99 ? 19  ASN A CG  1 
ATOM   147   O  OD1 . ASN A  1 39  ? 45.437 2.303   31.244  1.00 51.80 ? 19  ASN A OD1 1 
ATOM   148   N  ND2 . ASN A  1 39  ? 46.531 0.565   32.148  1.00 39.46 ? 19  ASN A ND2 1 
ATOM   149   N  N   . SER A  1 40  ? 50.084 3.725   29.318  1.00 37.99 ? 20  SER A N   1 
ATOM   150   C  CA  . SER A  1 40  ? 51.366 4.422   29.306  1.00 37.90 ? 20  SER A CA  1 
ATOM   151   C  C   . SER A  1 40  ? 51.398 5.764   28.553  1.00 39.78 ? 20  SER A C   1 
ATOM   152   O  O   . SER A  1 40  ? 52.393 6.465   28.628  1.00 40.67 ? 20  SER A O   1 
ATOM   153   C  CB  . SER A  1 40  ? 52.461 3.514   28.703  1.00 37.54 ? 20  SER A CB  1 
ATOM   154   O  OG  . SER A  1 40  ? 52.367 3.479   27.287  1.00 27.91 ? 20  SER A OG  1 
ATOM   155   N  N   . ASP A  1 41  ? 50.350 6.103   27.809  1.00 40.90 ? 21  ASP A N   1 
ATOM   156   C  CA  . ASP A  1 41  ? 50.258 7.400   27.105  1.00 39.74 ? 21  ASP A CA  1 
ATOM   157   C  C   . ASP A  1 41  ? 49.665 8.513   27.975  1.00 39.41 ? 21  ASP A C   1 
ATOM   158   O  O   . ASP A  1 41  ? 49.630 9.649   27.551  1.00 38.82 ? 21  ASP A O   1 
ATOM   159   C  CB  . ASP A  1 41  ? 49.366 7.287   25.875  1.00 41.16 ? 21  ASP A CB  1 
ATOM   160   C  CG  . ASP A  1 41  ? 49.810 6.194   24.904  1.00 40.67 ? 21  ASP A CG  1 
ATOM   161   O  OD1 . ASP A  1 41  ? 48.911 5.654   24.239  1.00 40.40 ? 21  ASP A OD1 1 
ATOM   162   O  OD2 . ASP A  1 41  ? 51.026 5.876   24.802  1.00 45.33 ? 21  ASP A OD2 1 
ATOM   163   N  N   . PHE A  1 42  ? 49.183 8.153   29.161  1.00 39.23 ? 22  PHE A N   1 
ATOM   164   C  CA  . PHE A  1 42  ? 48.592 9.051   30.109  1.00 42.38 ? 22  PHE A CA  1 
ATOM   165   C  C   . PHE A  1 42  ? 49.422 9.184   31.386  1.00 42.90 ? 22  PHE A C   1 
ATOM   166   O  O   . PHE A  1 42  ? 50.056 8.226   31.802  1.00 45.01 ? 22  PHE A O   1 
ATOM   167   C  CB  . PHE A  1 42  ? 47.224 8.506   30.510  1.00 46.20 ? 22  PHE A CB  1 
ATOM   168   C  CG  . PHE A  1 42  ? 46.267 8.392   29.367  1.00 45.41 ? 22  PHE A CG  1 
ATOM   169   C  CD1 . PHE A  1 42  ? 45.571 9.523   28.919  1.00 44.11 ? 22  PHE A CD1 1 
ATOM   170   C  CD2 . PHE A  1 42  ? 46.056 7.167   28.743  1.00 40.65 ? 22  PHE A CD2 1 
ATOM   171   C  CE1 . PHE A  1 42  ? 44.698 9.436   27.863  1.00 39.27 ? 22  PHE A CE1 1 
ATOM   172   C  CE2 . PHE A  1 42  ? 45.173 7.065   27.676  1.00 47.61 ? 22  PHE A CE2 1 
ATOM   173   C  CZ  . PHE A  1 42  ? 44.489 8.211   27.231  1.00 49.65 ? 22  PHE A CZ  1 
ATOM   174   N  N   . GLU A  1 43  ? 49.374 10.364  32.021  1.00 43.69 ? 23  GLU A N   1 
ATOM   175   C  CA  . GLU A  1 43  ? 50.040 10.592  33.300  1.00 42.23 ? 23  GLU A CA  1 
ATOM   176   C  C   . GLU A  1 43  ? 49.212 11.481  34.204  1.00 39.04 ? 23  GLU A C   1 
ATOM   177   O  O   . GLU A  1 43  ? 48.868 12.571  33.814  1.00 34.26 ? 23  GLU A O   1 
ATOM   178   C  CB  . GLU A  1 43  ? 51.415 11.227  33.069  1.00 42.84 ? 23  GLU A CB  1 
ATOM   179   C  CG  . GLU A  1 43  ? 52.261 11.428  34.339  1.00 44.28 ? 23  GLU A CG  1 
ATOM   180   C  CD  . GLU A  1 43  ? 53.716 11.859  34.052  1.00 49.97 ? 23  GLU A CD  1 
ATOM   181   O  OE1 . GLU A  1 43  ? 54.580 11.726  34.962  1.00 64.33 ? 23  GLU A OE1 1 
ATOM   182   O  OE2 . GLU A  1 43  ? 53.996 12.326  32.918  1.00 65.22 ? 23  GLU A OE2 1 
ATOM   183   N  N   . LEU A  1 44  ? 48.957 11.002  35.431  1.00 41.37 ? 24  LEU A N   1 
ATOM   184   C  CA  . LEU A  1 44  ? 48.284 11.750  36.500  1.00 43.33 ? 24  LEU A CA  1 
ATOM   185   C  C   . LEU A  1 44  ? 49.273 12.609  37.276  1.00 44.23 ? 24  LEU A C   1 
ATOM   186   O  O   . LEU A  1 44  ? 50.299 12.122  37.734  1.00 46.34 ? 24  LEU A O   1 
ATOM   187   C  CB  . LEU A  1 44  ? 47.593 10.779  37.446  1.00 42.43 ? 24  LEU A CB  1 
ATOM   188   C  CG  . LEU A  1 44  ? 46.506 11.212  38.464  1.00 43.35 ? 24  LEU A CG  1 
ATOM   189   C  CD1 . LEU A  1 44  ? 45.476 12.097  37.937  1.00 38.19 ? 24  LEU A CD1 1 
ATOM   190   C  CD2 . LEU A  1 44  ? 45.794 9.942   38.999  1.00 48.83 ? 24  LEU A CD2 1 
ATOM   191   N  N   . LYS A  1 45  ? 48.974 13.901  37.367  1.00 47.59 ? 25  LYS A N   1 
ATOM   192   C  CA  . LYS A  1 45  ? 49.802 14.876  38.067  1.00 48.12 ? 25  LYS A CA  1 
ATOM   193   C  C   . LYS A  1 45  ? 48.943 15.564  39.084  1.00 47.77 ? 25  LYS A C   1 
ATOM   194   O  O   . LYS A  1 45  ? 47.816 15.894  38.786  1.00 45.57 ? 25  LYS A O   1 
ATOM   195   C  CB  . LYS A  1 45  ? 50.367 15.936  37.117  1.00 50.40 ? 25  LYS A CB  1 
ATOM   196   C  CG  . LYS A  1 45  ? 51.179 15.374  35.936  1.00 51.03 ? 25  LYS A CG  1 
ATOM   197   C  CD  . LYS A  1 45  ? 52.395 16.226  35.630  1.00 52.33 ? 25  LYS A CD  1 
ATOM   198   C  CE  . LYS A  1 45  ? 52.915 15.965  34.218  1.00 60.27 ? 25  LYS A CE  1 
ATOM   199   N  NZ  . LYS A  1 45  ? 54.402 16.156  34.116  1.00 64.49 ? 25  LYS A NZ  1 
ATOM   200   N  N   . THR A  1 46  ? 49.502 15.746  40.284  1.00 50.54 ? 26  THR A N   1 
ATOM   201   C  CA  . THR A  1 46  ? 48.903 16.471  41.406  1.00 51.12 ? 26  THR A CA  1 
ATOM   202   C  C   . THR A  1 46  ? 49.569 17.862  41.458  1.00 51.81 ? 26  THR A C   1 
ATOM   203   O  O   . THR A  1 46  ? 50.741 18.019  41.130  1.00 51.59 ? 26  THR A O   1 
ATOM   204   C  CB  . THR A  1 46  ? 49.097 15.669  42.714  1.00 51.76 ? 26  THR A CB  1 
ATOM   205   O  OG1 . THR A  1 46  ? 48.230 14.533  42.701  1.00 49.89 ? 26  THR A OG1 1 
ATOM   206   C  CG2 . THR A  1 46  ? 48.784 16.494  43.936  1.00 56.16 ? 26  THR A CG2 1 
ATOM   207   N  N   . SER A  1 47  ? 48.818 18.874  41.855  1.00 53.07 ? 27  SER A N   1 
ATOM   208   C  CA  . SER A  1 47  ? 49.164 20.250  41.515  1.00 53.60 ? 27  SER A CA  1 
ATOM   209   C  C   . SER A  1 47  ? 48.462 21.209  42.504  1.00 53.26 ? 27  SER A C   1 
ATOM   210   O  O   . SER A  1 47  ? 47.367 20.914  42.983  1.00 51.88 ? 27  SER A O   1 
ATOM   211   C  CB  . SER A  1 47  ? 48.704 20.453  40.066  1.00 53.20 ? 27  SER A CB  1 
ATOM   212   O  OG  . SER A  1 47  ? 49.001 21.713  39.527  1.00 58.67 ? 27  SER A OG  1 
ATOM   213   N  N   . GLU A  1 48  ? 49.105 22.323  42.846  1.00 54.26 ? 28  GLU A N   1 
ATOM   214   C  CA  . GLU A  1 48  ? 48.530 23.288  43.817  1.00 54.59 ? 28  GLU A CA  1 
ATOM   215   C  C   . GLU A  1 48  ? 47.850 24.384  43.029  1.00 54.16 ? 28  GLU A C   1 
ATOM   216   O  O   . GLU A  1 48  ? 48.456 24.976  42.148  1.00 52.87 ? 28  GLU A O   1 
ATOM   217   C  CB  . GLU A  1 48  ? 49.586 23.893  44.768  1.00 53.51 ? 28  GLU A CB  1 
ATOM   218   N  N   . LEU A  1 49  ? 46.580 24.632  43.333  1.00 54.83 ? 29  LEU A N   1 
ATOM   219   C  CA  . LEU A  1 49  ? 45.827 25.667  42.642  1.00 54.56 ? 29  LEU A CA  1 
ATOM   220   C  C   . LEU A  1 49  ? 46.019 27.034  43.316  1.00 54.11 ? 29  LEU A C   1 
ATOM   221   O  O   . LEU A  1 49  ? 46.005 27.134  44.558  1.00 52.47 ? 29  LEU A O   1 
ATOM   222   C  CB  . LEU A  1 49  ? 44.344 25.297  42.558  1.00 55.16 ? 29  LEU A CB  1 
ATOM   223   C  CG  . LEU A  1 49  ? 43.946 24.382  41.393  1.00 55.30 ? 29  LEU A CG  1 
ATOM   224   C  CD1 . LEU A  1 49  ? 42.438 24.265  41.399  1.00 57.37 ? 29  LEU A CD1 1 
ATOM   225   C  CD2 . LEU A  1 49  ? 44.447 24.862  40.003  1.00 51.46 ? 29  LEU A CD2 1 
ATOM   226   N  N   . PRO A  1 50  ? 46.195 28.093  42.498  1.00 53.26 ? 30  PRO A N   1 
ATOM   227   C  CA  . PRO A  1 50  ? 46.426 29.398  43.093  1.00 53.55 ? 30  PRO A CA  1 
ATOM   228   C  C   . PRO A  1 50  ? 45.192 29.898  43.837  1.00 53.83 ? 30  PRO A C   1 
ATOM   229   O  O   . PRO A  1 50  ? 44.116 29.282  43.752  1.00 51.95 ? 30  PRO A O   1 
ATOM   230   C  CB  . PRO A  1 50  ? 46.751 30.287  41.881  1.00 53.66 ? 30  PRO A CB  1 
ATOM   231   C  CG  . PRO A  1 50  ? 46.171 29.606  40.720  1.00 51.79 ? 30  PRO A CG  1 
ATOM   232   C  CD  . PRO A  1 50  ? 46.166 28.151  41.022  1.00 52.00 ? 30  PRO A CD  1 
ATOM   233   N  N   . PRO A  1 51  ? 45.344 31.003  44.580  1.00 55.64 ? 31  PRO A N   1 
ATOM   234   C  CA  . PRO A  1 51  ? 44.171 31.602  45.210  1.00 55.97 ? 31  PRO A CA  1 
ATOM   235   C  C   . PRO A  1 51  ? 43.324 32.352  44.173  1.00 54.65 ? 31  PRO A C   1 
ATOM   236   O  O   . PRO A  1 51  ? 43.811 32.701  43.086  1.00 53.71 ? 31  PRO A O   1 
ATOM   237   C  CB  . PRO A  1 51  ? 44.774 32.558  46.244  1.00 56.19 ? 31  PRO A CB  1 
ATOM   238   C  CG  . PRO A  1 51  ? 46.086 32.961  45.660  1.00 55.79 ? 31  PRO A CG  1 
ATOM   239   C  CD  . PRO A  1 51  ? 46.574 31.767  44.860  1.00 57.11 ? 31  PRO A CD  1 
ATOM   240   N  N   . LEU A  1 52  ? 42.064 32.586  44.517  1.00 53.60 ? 32  LEU A N   1 
ATOM   241   C  CA  . LEU A  1 52  ? 41.153 33.286  43.628  1.00 51.82 ? 32  LEU A CA  1 
ATOM   242   C  C   . LEU A  1 52  ? 41.372 34.787  43.618  1.00 50.48 ? 32  LEU A C   1 
ATOM   243   O  O   . LEU A  1 52  ? 41.394 35.428  44.663  1.00 53.30 ? 32  LEU A O   1 
ATOM   244   C  CB  . LEU A  1 52  ? 39.714 33.036  44.045  1.00 52.03 ? 32  LEU A CB  1 
ATOM   245   C  CG  . LEU A  1 52  ? 39.191 31.617  44.167  1.00 46.79 ? 32  LEU A CG  1 
ATOM   246   C  CD1 . LEU A  1 52  ? 37.677 31.697  44.375  1.00 44.97 ? 32  LEU A CD1 1 
ATOM   247   C  CD2 . LEU A  1 52  ? 39.557 30.814  42.938  1.00 48.91 ? 32  LEU A CD2 1 
ATOM   248   N  N   . LYS A  1 53  ? 41.513 35.338  42.422  1.00 50.50 ? 33  LYS A N   1 
ATOM   249   C  CA  . LYS A  1 53  ? 41.451 36.774  42.207  1.00 51.32 ? 33  LYS A CA  1 
ATOM   250   C  C   . LYS A  1 53  ? 39.970 37.166  42.190  1.00 51.25 ? 33  LYS A C   1 
ATOM   251   O  O   . LYS A  1 53  ? 39.116 36.273  42.205  1.00 50.92 ? 33  LYS A O   1 
ATOM   252   C  CB  . LYS A  1 53  ? 42.194 37.121  40.909  1.00 52.05 ? 33  LYS A CB  1 
ATOM   253   C  CG  . LYS A  1 53  ? 43.731 36.972  41.088  1.00 51.21 ? 33  LYS A CG  1 
ATOM   254   C  CD  . LYS A  1 53  ? 44.462 36.564  39.813  1.00 51.94 ? 33  LYS A CD  1 
ATOM   255   C  CE  . LYS A  1 53  ? 45.755 35.766  40.135  1.00 56.53 ? 33  LYS A CE  1 
ATOM   256   N  NZ  . LYS A  1 53  ? 45.825 34.431  39.424  1.00 56.45 ? 33  LYS A NZ  1 
ATOM   257   N  N   . ASN A  1 54  ? 39.648 38.469  42.218  1.00 50.80 ? 34  ASN A N   1 
ATOM   258   C  CA  . ASN A  1 54  ? 38.231 38.901  42.060  1.00 49.63 ? 34  ASN A CA  1 
ATOM   259   C  C   . ASN A  1 54  ? 37.670 38.483  40.702  1.00 47.32 ? 34  ASN A C   1 
ATOM   260   O  O   . ASN A  1 54  ? 38.379 38.547  39.696  1.00 47.82 ? 34  ASN A O   1 
ATOM   261   C  CB  . ASN A  1 54  ? 38.052 40.410  42.236  1.00 48.11 ? 34  ASN A CB  1 
ATOM   262   C  CG  . ASN A  1 54  ? 38.133 40.834  43.674  1.00 52.51 ? 34  ASN A CG  1 
ATOM   263   O  OD1 . ASN A  1 54  ? 37.592 40.183  44.569  1.00 55.58 ? 34  ASN A OD1 1 
ATOM   264   N  ND2 . ASN A  1 54  ? 38.809 41.941  43.913  1.00 59.39 ? 34  ASN A ND2 1 
ATOM   265   N  N   . GLY A  1 55  ? 36.410 38.040  40.686  1.00 45.42 ? 35  GLY A N   1 
ATOM   266   C  CA  . GLY A  1 55  ? 35.741 37.606  39.450  1.00 44.62 ? 35  GLY A CA  1 
ATOM   267   C  C   . GLY A  1 55  ? 35.971 36.145  39.124  1.00 46.12 ? 35  GLY A C   1 
ATOM   268   O  O   . GLY A  1 55  ? 35.443 35.637  38.132  1.00 47.40 ? 35  GLY A O   1 
ATOM   269   N  N   . GLU A  1 56  ? 36.746 35.454  39.960  1.00 44.09 ? 36  GLU A N   1 
ATOM   270   C  CA  . GLU A  1 56  ? 37.040 34.066  39.732  1.00 43.48 ? 36  GLU A CA  1 
ATOM   271   C  C   . GLU A  1 56  ? 36.265 33.130  40.680  1.00 41.65 ? 36  GLU A C   1 
ATOM   272   O  O   . GLU A  1 56  ? 35.842 33.530  41.774  1.00 39.91 ? 36  GLU A O   1 
ATOM   273   C  CB  . GLU A  1 56  ? 38.550 33.818  39.865  1.00 46.72 ? 36  GLU A CB  1 
ATOM   274   C  CG  . GLU A  1 56  ? 39.424 34.382  38.734  1.00 45.70 ? 36  GLU A CG  1 
ATOM   275   C  CD  . GLU A  1 56  ? 40.915 34.036  38.904  1.00 48.37 ? 36  GLU A CD  1 
ATOM   276   O  OE1 . GLU A  1 56  ? 41.376 33.742  40.036  1.00 44.96 ? 36  GLU A OE1 1 
ATOM   277   O  OE2 . GLU A  1 56  ? 41.640 34.061  37.890  1.00 58.93 ? 36  GLU A OE2 1 
ATOM   278   N  N   . VAL A  1 57  ? 36.116 31.873  40.235  1.00 39.75 ? 37  VAL A N   1 
ATOM   279   C  CA  . VAL A  1 57  ? 35.491 30.783  41.001  1.00 37.82 ? 37  VAL A CA  1 
ATOM   280   C  C   . VAL A  1 57  ? 36.387 29.528  40.951  1.00 38.27 ? 37  VAL A C   1 
ATOM   281   O  O   . VAL A  1 57  ? 37.058 29.280  39.940  1.00 37.96 ? 37  VAL A O   1 
ATOM   282   C  CB  . VAL A  1 57  ? 34.045 30.437  40.485  1.00 34.02 ? 37  VAL A CB  1 
ATOM   283   C  CG1 . VAL A  1 57  ? 33.097 31.669  40.607  1.00 36.73 ? 37  VAL A CG1 1 
ATOM   284   C  CG2 . VAL A  1 57  ? 34.072 29.933  39.079  1.00 31.92 ? 37  VAL A CG2 1 
ATOM   285   N  N   . LEU A  1 58  ? 36.414 28.760  42.048  1.00 39.19 ? 38  LEU A N   1 
ATOM   286   C  CA  . LEU A  1 58  ? 36.962 27.403  42.028  1.00 39.33 ? 38  LEU A CA  1 
ATOM   287   C  C   . LEU A  1 58  ? 35.826 26.432  41.749  1.00 38.64 ? 38  LEU A C   1 
ATOM   288   O  O   . LEU A  1 58  ? 34.804 26.445  42.419  1.00 35.04 ? 38  LEU A O   1 
ATOM   289   C  CB  . LEU A  1 58  ? 37.648 27.052  43.344  1.00 40.57 ? 38  LEU A CB  1 
ATOM   290   C  CG  . LEU A  1 58  ? 38.244 25.642  43.536  1.00 40.09 ? 38  LEU A CG  1 
ATOM   291   C  CD1 . LEU A  1 58  ? 39.453 25.386  42.649  1.00 37.31 ? 38  LEU A CD1 1 
ATOM   292   C  CD2 . LEU A  1 58  ? 38.625 25.446  45.028  1.00 42.20 ? 38  LEU A CD2 1 
ATOM   293   N  N   . LEU A  1 59  ? 36.034 25.612  40.722  1.00 42.81 ? 39  LEU A N   1 
ATOM   294   C  CA  . LEU A  1 59  ? 35.094 24.594  40.253  1.00 42.38 ? 39  LEU A CA  1 
ATOM   295   C  C   . LEU A  1 59  ? 35.513 23.175  40.637  1.00 41.69 ? 39  LEU A C   1 
ATOM   296   O  O   . LEU A  1 59  ? 36.657 22.780  40.412  1.00 41.85 ? 39  LEU A O   1 
ATOM   297   C  CB  . LEU A  1 59  ? 35.018 24.668  38.734  1.00 43.96 ? 39  LEU A CB  1 
ATOM   298   C  CG  . LEU A  1 59  ? 34.467 25.934  38.110  1.00 39.73 ? 39  LEU A CG  1 
ATOM   299   C  CD1 . LEU A  1 59  ? 34.549 25.788  36.608  1.00 43.37 ? 39  LEU A CD1 1 
ATOM   300   C  CD2 . LEU A  1 59  ? 33.042 26.158  38.559  1.00 42.45 ? 39  LEU A CD2 1 
ATOM   301   N  N   . GLU A  1 60  ? 34.583 22.422  41.211  1.00 41.62 ? 40  GLU A N   1 
ATOM   302   C  CA  . GLU A  1 60  ? 34.777 21.013  41.497  1.00 44.57 ? 40  GLU A CA  1 
ATOM   303   C  C   . GLU A  1 60  ? 34.021 20.120  40.496  1.00 43.69 ? 40  GLU A C   1 
ATOM   304   O  O   . GLU A  1 60  ? 32.785 20.105  40.458  1.00 40.67 ? 40  GLU A O   1 
ATOM   305   C  CB  . GLU A  1 60  ? 34.290 20.675  42.900  1.00 44.58 ? 40  GLU A CB  1 
ATOM   306   C  CG  . GLU A  1 60  ? 34.741 19.300  43.384  1.00 49.11 ? 40  GLU A CG  1 
ATOM   307   C  CD  . GLU A  1 60  ? 34.664 19.138  44.905  1.00 55.47 ? 40  GLU A CD  1 
ATOM   308   O  OE1 . GLU A  1 60  ? 35.542 18.427  45.465  1.00 73.58 ? 40  GLU A OE1 1 
ATOM   309   O  OE2 . GLU A  1 60  ? 33.730 19.695  45.547  1.00 65.78 ? 40  GLU A OE2 1 
ATOM   310   N  N   . ALA A  1 61  ? 34.790 19.352  39.723  1.00 44.41 ? 41  ALA A N   1 
ATOM   311   C  CA  . ALA A  1 61  ? 34.246 18.325  38.857  1.00 43.67 ? 41  ALA A CA  1 
ATOM   312   C  C   . ALA A  1 61  ? 33.343 17.349  39.605  1.00 44.29 ? 41  ALA A C   1 
ATOM   313   O  O   . ALA A  1 61  ? 33.760 16.737  40.590  1.00 45.22 ? 41  ALA A O   1 
ATOM   314   C  CB  . ALA A  1 61  ? 35.358 17.576  38.182  1.00 44.64 ? 41  ALA A CB  1 
ATOM   315   N  N   . LEU A  1 62  ? 32.111 17.219  39.096  1.00 44.84 ? 42  LEU A N   1 
ATOM   316   C  CA  . LEU A  1 62  ? 31.118 16.231  39.526  1.00 42.64 ? 42  LEU A CA  1 
ATOM   317   C  C   . LEU A  1 62  ? 31.023 15.072  38.517  1.00 41.16 ? 42  LEU A C   1 
ATOM   318   O  O   . LEU A  1 62  ? 30.957 13.901  38.885  1.00 40.60 ? 42  LEU A O   1 
ATOM   319   C  CB  . LEU A  1 62  ? 29.739 16.902  39.626  1.00 43.37 ? 42  LEU A CB  1 
ATOM   320   C  CG  . LEU A  1 62  ? 29.539 18.103  40.542  1.00 43.79 ? 42  LEU A CG  1 
ATOM   321   C  CD1 . LEU A  1 62  ? 28.052 18.437  40.605  1.00 39.01 ? 42  LEU A CD1 1 
ATOM   322   C  CD2 . LEU A  1 62  ? 30.079 17.806  41.953  1.00 43.77 ? 42  LEU A CD2 1 
ATOM   323   N  N   . PHE A  1 63  ? 30.995 15.417  37.234  1.00 43.24 ? 43  PHE A N   1 
ATOM   324   C  CA  . PHE A  1 63  ? 30.797 14.449  36.148  1.00 42.32 ? 43  PHE A CA  1 
ATOM   325   C  C   . PHE A  1 63  ? 31.664 14.922  35.003  1.00 44.11 ? 43  PHE A C   1 
ATOM   326   O  O   . PHE A  1 63  ? 31.593 16.094  34.631  1.00 42.13 ? 43  PHE A O   1 
ATOM   327   C  CB  . PHE A  1 63  ? 29.330 14.429  35.666  1.00 42.68 ? 43  PHE A CB  1 
ATOM   328   C  CG  . PHE A  1 63  ? 28.356 13.838  36.662  1.00 42.48 ? 43  PHE A CG  1 
ATOM   329   C  CD1 . PHE A  1 63  ? 28.347 12.468  36.923  1.00 41.21 ? 43  PHE A CD1 1 
ATOM   330   C  CD2 . PHE A  1 63  ? 27.434 14.648  37.323  1.00 44.31 ? 43  PHE A CD2 1 
ATOM   331   C  CE1 . PHE A  1 63  ? 27.468 11.923  37.833  1.00 43.53 ? 43  PHE A CE1 1 
ATOM   332   C  CE2 . PHE A  1 63  ? 26.549 14.102  38.240  1.00 43.15 ? 43  PHE A CE2 1 
ATOM   333   C  CZ  . PHE A  1 63  ? 26.565 12.738  38.497  1.00 40.60 ? 43  PHE A CZ  1 
ATOM   334   N  N   . LEU A  1 64  ? 32.485 14.011  34.464  1.00 44.44 ? 44  LEU A N   1 
ATOM   335   C  CA  . LEU A  1 64  ? 33.369 14.288  33.348  1.00 41.86 ? 44  LEU A CA  1 
ATOM   336   C  C   . LEU A  1 64  ? 33.019 13.329  32.225  1.00 44.13 ? 44  LEU A C   1 
ATOM   337   O  O   . LEU A  1 64  ? 32.729 12.161  32.428  1.00 46.17 ? 44  LEU A O   1 
ATOM   338   C  CB  . LEU A  1 64  ? 34.838 14.094  33.728  1.00 42.71 ? 44  LEU A CB  1 
ATOM   339   C  CG  . LEU A  1 64  ? 35.485 14.760  34.959  1.00 40.04 ? 44  LEU A CG  1 
ATOM   340   C  CD1 . LEU A  1 64  ? 35.612 13.802  36.116  1.00 40.28 ? 44  LEU A CD1 1 
ATOM   341   C  CD2 . LEU A  1 64  ? 36.890 15.364  34.668  1.00 38.08 ? 44  LEU A CD2 1 
ATOM   342   N  N   . THR A  1 65  ? 33.045 13.841  31.019  1.00 46.72 ? 45  THR A N   1 
ATOM   343   C  CA  . THR A  1 65  ? 32.727 13.050  29.842  1.00 47.75 ? 45  THR A CA  1 
ATOM   344   C  C   . THR A  1 65  ? 33.993 12.595  29.097  1.00 45.08 ? 45  THR A C   1 
ATOM   345   O  O   . THR A  1 65  ? 35.052 13.248  29.151  1.00 41.80 ? 45  THR A O   1 
ATOM   346   C  CB  . THR A  1 65  ? 31.797 13.888  28.883  1.00 47.78 ? 45  THR A CB  1 
ATOM   347   O  OG1 . THR A  1 65  ? 31.340 13.074  27.809  1.00 49.12 ? 45  THR A OG1 1 
ATOM   348   C  CG2 . THR A  1 65  ? 32.499 15.083  28.310  1.00 45.07 ? 45  THR A CG2 1 
ATOM   349   N  N   . VAL A  1 66  ? 33.851 11.464  28.409  1.00 45.74 ? 46  VAL A N   1 
ATOM   350   C  CA  . VAL A  1 66  ? 34.792 11.009  27.377  1.00 45.53 ? 46  VAL A CA  1 
ATOM   351   C  C   . VAL A  1 66  ? 34.028 10.805  26.074  1.00 45.57 ? 46  VAL A C   1 
ATOM   352   O  O   . VAL A  1 66  ? 32.887 10.347  26.078  1.00 47.42 ? 46  VAL A O   1 
ATOM   353   C  CB  . VAL A  1 66  ? 35.552 9.720   27.750  1.00 44.49 ? 46  VAL A CB  1 
ATOM   354   C  CG1 . VAL A  1 66  ? 36.408 9.960   28.980  1.00 41.24 ? 46  VAL A CG1 1 
ATOM   355   C  CG2 . VAL A  1 66  ? 34.622 8.542   27.920  1.00 47.79 ? 46  VAL A CG2 1 
ATOM   356   N  N   . ASP A  1 67  ? 34.669 11.173  24.978  1.00 46.42 ? 47  ASP A N   1 
ATOM   357   C  CA  . ASP A  1 67  ? 34.025 11.319  23.675  1.00 48.47 ? 47  ASP A CA  1 
ATOM   358   C  C   . ASP A  1 67  ? 34.988 10.899  22.578  1.00 46.31 ? 47  ASP A C   1 
ATOM   359   O  O   . ASP A  1 67  ? 36.181 11.138  22.706  1.00 45.55 ? 47  ASP A O   1 
ATOM   360   C  CB  . ASP A  1 67  ? 33.692 12.803  23.454  1.00 49.49 ? 47  ASP A CB  1 
ATOM   361   C  CG  . ASP A  1 67  ? 32.718 13.361  24.515  1.00 54.60 ? 47  ASP A CG  1 
ATOM   362   O  OD1 . ASP A  1 67  ? 33.176 14.184  25.371  1.00 52.34 ? 47  ASP A OD1 1 
ATOM   363   O  OD2 . ASP A  1 67  ? 31.513 12.964  24.486  1.00 48.16 ? 47  ASP A OD2 1 
ATOM   364   N  N   . PRO A  1 68  ? 34.481 10.336  21.464  1.00 48.72 ? 48  PRO A N   1 
ATOM   365   C  CA  . PRO A  1 68  ? 35.389 9.939   20.341  1.00 49.05 ? 48  PRO A CA  1 
ATOM   366   C  C   . PRO A  1 68  ? 36.328 11.010  19.792  1.00 47.61 ? 48  PRO A C   1 
ATOM   367   O  O   . PRO A  1 68  ? 37.468 10.688  19.452  1.00 54.23 ? 48  PRO A O   1 
ATOM   368   C  CB  . PRO A  1 68  ? 34.418 9.450   19.270  1.00 48.66 ? 48  PRO A CB  1 
ATOM   369   C  CG  . PRO A  1 68  ? 33.276 8.933   20.037  1.00 51.47 ? 48  PRO A CG  1 
ATOM   370   C  CD  . PRO A  1 68  ? 33.089 9.971   21.151  1.00 49.32 ? 48  PRO A CD  1 
ATOM   371   N  N   . TYR A  1 69  ? 35.868 12.261  19.736  1.00 48.17 ? 49  TYR A N   1 
ATOM   372   C  CA  . TYR A  1 69  ? 36.629 13.365  19.156  1.00 46.93 ? 49  TYR A CA  1 
ATOM   373   C  C   . TYR A  1 69  ? 37.960 13.578  19.840  1.00 43.29 ? 49  TYR A C   1 
ATOM   374   O  O   . TYR A  1 69  ? 38.836 14.171  19.248  1.00 42.43 ? 49  TYR A O   1 
ATOM   375   C  CB  . TYR A  1 69  ? 35.811 14.712  19.161  1.00 50.67 ? 49  TYR A CB  1 
ATOM   376   C  CG  . TYR A  1 69  ? 35.750 15.450  20.500  1.00 45.35 ? 49  TYR A CG  1 
ATOM   377   C  CD1 . TYR A  1 69  ? 36.780 16.301  20.893  1.00 48.86 ? 49  TYR A CD1 1 
ATOM   378   C  CD2 . TYR A  1 69  ? 34.678 15.286  21.349  1.00 40.21 ? 49  TYR A CD2 1 
ATOM   379   C  CE1 . TYR A  1 69  ? 36.765 16.940  22.112  1.00 43.86 ? 49  TYR A CE1 1 
ATOM   380   C  CE2 . TYR A  1 69  ? 34.639 15.911  22.574  1.00 49.62 ? 49  TYR A CE2 1 
ATOM   381   C  CZ  . TYR A  1 69  ? 35.689 16.748  22.963  1.00 53.72 ? 49  TYR A CZ  1 
ATOM   382   O  OH  . TYR A  1 69  ? 35.648 17.425  24.181  1.00 47.66 ? 49  TYR A OH  1 
ATOM   383   N  N   . MET A  1 70  ? 38.082 13.128  21.090  1.00 42.75 ? 50  MET A N   1 
ATOM   384   C  CA  . MET A  1 70  ? 39.275 13.334  21.905  1.00 42.98 ? 50  MET A CA  1 
ATOM   385   C  C   . MET A  1 70  ? 40.477 12.536  21.407  1.00 44.09 ? 50  MET A C   1 
ATOM   386   O  O   . MET A  1 70  ? 41.612 12.903  21.685  1.00 42.40 ? 50  MET A O   1 
ATOM   387   C  CB  . MET A  1 70  ? 39.023 12.963  23.375  1.00 44.20 ? 50  MET A CB  1 
ATOM   388   C  CG  . MET A  1 70  ? 38.041 13.825  24.113  1.00 44.80 ? 50  MET A CG  1 
ATOM   389   S  SD  . MET A  1 70  ? 37.656 13.172  25.758  1.00 43.79 ? 50  MET A SD  1 
ATOM   390   C  CE  . MET A  1 70  ? 36.373 14.302  26.217  1.00 44.32 ? 50  MET A CE  1 
ATOM   391   N  N   . ARG A  1 71  ? 40.220 11.443  20.690  1.00 42.56 ? 51  ARG A N   1 
ATOM   392   C  CA  . ARG A  1 71  ? 41.257 10.700  20.013  1.00 40.55 ? 51  ARG A CA  1 
ATOM   393   C  C   . ARG A  1 71  ? 41.946 11.562  18.943  1.00 43.42 ? 51  ARG A C   1 
ATOM   394   O  O   . ARG A  1 71  ? 43.188 11.542  18.741  1.00 42.38 ? 51  ARG A O   1 
ATOM   395   C  CB  . ARG A  1 71  ? 40.644 9.416   19.412  1.00 37.76 ? 51  ARG A CB  1 
ATOM   396   C  CG  . ARG A  1 71  ? 41.629 8.574   18.659  1.00 38.75 ? 51  ARG A CG  1 
ATOM   397   C  CD  . ARG A  1 71  ? 42.841 8.035   19.532  1.00 36.11 ? 51  ARG A CD  1 
ATOM   398   N  NE  . ARG A  1 71  ? 43.828 7.342   18.707  1.00 38.56 ? 51  ARG A NE  1 
ATOM   399   C  CZ  . ARG A  1 71  ? 44.810 7.930   18.028  1.00 35.85 ? 51  ARG A CZ  1 
ATOM   400   N  NH1 . ARG A  1 71  ? 44.971 9.240   18.048  1.00 40.08 ? 51  ARG A NH1 1 
ATOM   401   N  NH2 . ARG A  1 71  ? 45.674 7.201   17.356  1.00 40.54 ? 51  ARG A NH2 1 
ATOM   402   N  N   . VAL A  1 72  ? 41.116 12.335  18.272  1.00 43.92 ? 52  VAL A N   1 
ATOM   403   C  CA  . VAL A  1 72  ? 41.531 13.245  17.234  1.00 46.74 ? 52  VAL A CA  1 
ATOM   404   C  C   . VAL A  1 72  ? 42.098 14.571  17.791  1.00 44.21 ? 52  VAL A C   1 
ATOM   405   O  O   . VAL A  1 72  ? 43.139 15.030  17.373  1.00 45.18 ? 52  VAL A O   1 
ATOM   406   C  CB  . VAL A  1 72  ? 40.300 13.493  16.305  1.00 48.58 ? 52  VAL A CB  1 
ATOM   407   C  CG1 . VAL A  1 72  ? 40.528 14.684  15.363  1.00 53.67 ? 52  VAL A CG1 1 
ATOM   408   C  CG2 . VAL A  1 72  ? 40.056 12.253  15.532  1.00 46.78 ? 52  VAL A CG2 1 
ATOM   409   N  N   . ALA A  1 73  ? 41.385 15.183  18.727  1.00 47.24 ? 53  ALA A N   1 
ATOM   410   C  CA  . ALA A  1 73  ? 41.774 16.473  19.285  1.00 47.12 ? 53  ALA A CA  1 
ATOM   411   C  C   . ALA A  1 73  ? 43.147 16.385  19.989  1.00 48.49 ? 53  ALA A C   1 
ATOM   412   O  O   . ALA A  1 73  ? 43.931 17.330  19.942  1.00 49.39 ? 53  ALA A O   1 
ATOM   413   C  CB  . ALA A  1 73  ? 40.673 16.975  20.216  1.00 45.89 ? 53  ALA A CB  1 
ATOM   414   N  N   . ALA A  1 74  ? 43.419 15.222  20.589  1.00 48.45 ? 54  ALA A N   1 
ATOM   415   C  CA  . ALA A  1 74  ? 44.682 14.866  21.222  1.00 48.26 ? 54  ALA A CA  1 
ATOM   416   C  C   . ALA A  1 74  ? 45.948 14.951  20.342  1.00 47.76 ? 54  ALA A C   1 
ATOM   417   O  O   . ALA A  1 74  ? 47.024 15.140  20.889  1.00 45.06 ? 54  ALA A O   1 
ATOM   418   C  CB  . ALA A  1 74  ? 44.581 13.471  21.819  1.00 47.14 ? 54  ALA A CB  1 
ATOM   419   N  N   . LYS A  1 75  ? 45.839 14.759  19.024  1.00 49.18 ? 55  LYS A N   1 
ATOM   420   C  CA  . LYS A  1 75  ? 46.970 15.021  18.110  1.00 50.42 ? 55  LYS A CA  1 
ATOM   421   C  C   . LYS A  1 75  ? 47.417 16.508  18.083  1.00 52.19 ? 55  LYS A C   1 
ATOM   422   O  O   . LYS A  1 75  ? 48.566 16.804  17.790  1.00 53.39 ? 55  LYS A O   1 
ATOM   423   C  CB  . LYS A  1 75  ? 46.610 14.601  16.692  1.00 50.54 ? 55  LYS A CB  1 
ATOM   424   C  CG  . LYS A  1 75  ? 46.642 13.116  16.439  1.00 55.93 ? 55  LYS A CG  1 
ATOM   425   C  CD  . LYS A  1 75  ? 45.292 12.554  15.974  1.00 63.10 ? 55  LYS A CD  1 
ATOM   426   C  CE  . LYS A  1 75  ? 44.912 12.978  14.570  1.00 65.84 ? 55  LYS A CE  1 
ATOM   427   N  NZ  . LYS A  1 75  ? 45.994 12.770  13.565  1.00 63.70 ? 55  LYS A NZ  1 
ATOM   428   N  N   . ARG A  1 76  ? 46.495 17.431  18.375  1.00 54.12 ? 56  ARG A N   1 
ATOM   429   C  CA  . ARG A  1 76  ? 46.789 18.880  18.421  1.00 53.63 ? 56  ARG A CA  1 
ATOM   430   C  C   . ARG A  1 76  ? 47.528 19.300  19.730  1.00 53.37 ? 56  ARG A C   1 
ATOM   431   O  O   . ARG A  1 76  ? 48.107 20.386  19.790  1.00 53.91 ? 56  ARG A O   1 
ATOM   432   C  CB  . ARG A  1 76  ? 45.498 19.740  18.176  1.00 54.36 ? 56  ARG A CB  1 
ATOM   433   C  CG  . ARG A  1 76  ? 45.163 20.120  16.677  1.00 61.29 ? 56  ARG A CG  1 
ATOM   434   C  CD  . ARG A  1 76  ? 43.905 19.448  15.981  1.00 69.50 ? 56  ARG A CD  1 
ATOM   435   N  NE  . ARG A  1 76  ? 42.627 19.608  16.703  1.00 77.18 ? 56  ARG A NE  1 
ATOM   436   C  CZ  . ARG A  1 76  ? 41.425 19.069  16.370  1.00 76.16 ? 56  ARG A CZ  1 
ATOM   437   N  NH1 . ARG A  1 76  ? 41.214 18.318  15.263  1.00 62.81 ? 56  ARG A NH1 1 
ATOM   438   N  NH2 . ARG A  1 76  ? 40.387 19.306  17.181  1.00 77.08 ? 56  ARG A NH2 1 
ATOM   439   N  N   . LEU A  1 77  ? 47.531 18.433  20.749  1.00 52.02 ? 57  LEU A N   1 
ATOM   440   C  CA  . LEU A  1 77  ? 48.269 18.663  22.023  1.00 49.55 ? 57  LEU A CA  1 
ATOM   441   C  C   . LEU A  1 77  ? 49.779 18.425  21.971  1.00 47.41 ? 57  LEU A C   1 
ATOM   442   O  O   . LEU A  1 77  ? 50.296 17.735  21.116  1.00 46.87 ? 57  LEU A O   1 
ATOM   443   C  CB  . LEU A  1 77  ? 47.724 17.752  23.141  1.00 46.07 ? 57  LEU A CB  1 
ATOM   444   C  CG  . LEU A  1 77  ? 46.254 17.834  23.545  1.00 49.57 ? 57  LEU A CG  1 
ATOM   445   C  CD1 . LEU A  1 77  ? 45.939 16.895  24.743  1.00 44.34 ? 57  LEU A CD1 1 
ATOM   446   C  CD2 . LEU A  1 77  ? 45.844 19.280  23.877  1.00 47.60 ? 57  LEU A CD2 1 
ATOM   447   N  N   . LYS A  1 78  ? 50.475 19.013  22.929  1.00 48.58 ? 58  LYS A N   1 
ATOM   448   C  CA  . LYS A  1 78  ? 51.857 18.684  23.188  1.00 49.54 ? 58  LYS A CA  1 
ATOM   449   C  C   . LYS A  1 78  ? 51.881 17.680  24.336  1.00 48.77 ? 58  LYS A C   1 
ATOM   450   O  O   . LYS A  1 78  ? 51.060 17.712  25.260  1.00 47.10 ? 58  LYS A O   1 
ATOM   451   C  CB  . LYS A  1 78  ? 52.691 19.921  23.575  1.00 50.50 ? 58  LYS A CB  1 
ATOM   452   C  CG  . LYS A  1 78  ? 52.665 21.088  22.577  1.00 56.09 ? 58  LYS A CG  1 
ATOM   453   C  CD  . LYS A  1 78  ? 53.562 20.898  21.348  1.00 58.87 ? 58  LYS A CD  1 
ATOM   454   C  CE  . LYS A  1 78  ? 53.117 21.842  20.193  1.00 61.64 ? 58  LYS A CE  1 
ATOM   455   N  NZ  . LYS A  1 78  ? 51.814 21.419  19.491  1.00 50.98 ? 58  LYS A NZ  1 
ATOM   456   N  N   . GLU A  1 79  ? 52.839 16.782  24.262  1.00 47.66 ? 59  GLU A N   1 
ATOM   457   C  CA  . GLU A  1 79  ? 53.069 15.862  25.332  1.00 49.73 ? 59  GLU A CA  1 
ATOM   458   C  C   . GLU A  1 79  ? 53.353 16.725  26.590  1.00 49.35 ? 59  GLU A C   1 
ATOM   459   O  O   . GLU A  1 79  ? 54.089 17.711  26.516  1.00 48.93 ? 59  GLU A O   1 
ATOM   460   C  CB  . GLU A  1 79  ? 54.196 14.882  24.941  1.00 47.86 ? 59  GLU A CB  1 
ATOM   461   C  CG  . GLU A  1 79  ? 53.893 14.130  23.623  1.00 48.97 ? 59  GLU A CG  1 
ATOM   462   C  CD  . GLU A  1 79  ? 55.009 13.162  23.165  1.00 55.78 ? 59  GLU A CD  1 
ATOM   463   O  OE1 . GLU A  1 79  ? 54.743 12.301  22.268  1.00 61.71 ? 59  GLU A OE1 1 
ATOM   464   O  OE2 . GLU A  1 79  ? 56.151 13.262  23.685  1.00 63.07 ? 59  GLU A OE2 1 
ATOM   465   N  N   . GLY A  1 80  ? 52.716 16.373  27.712  1.00 48.33 ? 60  GLY A N   1 
ATOM   466   C  CA  . GLY A  1 80  ? 52.641 17.230  28.897  1.00 47.45 ? 60  GLY A CA  1 
ATOM   467   C  C   . GLY A  1 80  ? 51.338 18.019  29.029  1.00 45.93 ? 60  GLY A C   1 
ATOM   468   O  O   . GLY A  1 80  ? 50.989 18.438  30.108  1.00 45.75 ? 60  GLY A O   1 
ATOM   469   N  N   . ASP A  1 81  ? 50.616 18.252  27.938  1.00 47.38 ? 61  ASP A N   1 
ATOM   470   C  CA  . ASP A  1 81  ? 49.349 19.016  28.011  1.00 47.53 ? 61  ASP A CA  1 
ATOM   471   C  C   . ASP A  1 81  ? 48.257 18.167  28.646  1.00 46.48 ? 61  ASP A C   1 
ATOM   472   O  O   . ASP A  1 81  ? 48.273 16.933  28.586  1.00 45.09 ? 61  ASP A O   1 
ATOM   473   C  CB  . ASP A  1 81  ? 48.839 19.462  26.624  1.00 48.44 ? 61  ASP A CB  1 
ATOM   474   C  CG  . ASP A  1 81  ? 49.643 20.628  25.994  1.00 54.38 ? 61  ASP A CG  1 
ATOM   475   O  OD1 . ASP A  1 81  ? 49.296 20.986  24.826  1.00 54.60 ? 61  ASP A OD1 1 
ATOM   476   O  OD2 . ASP A  1 81  ? 50.580 21.206  26.631  1.00 55.16 ? 61  ASP A OD2 1 
ATOM   477   N  N   . THR A  1 82  ? 47.300 18.859  29.237  1.00 45.26 ? 62  THR A N   1 
ATOM   478   C  CA  . THR A  1 82  ? 46.127 18.262  29.840  1.00 44.56 ? 62  THR A CA  1 
ATOM   479   C  C   . THR A  1 82  ? 45.225 17.757  28.726  1.00 44.46 ? 62  THR A C   1 
ATOM   480   O  O   . THR A  1 82  ? 45.091 18.397  27.676  1.00 43.78 ? 62  THR A O   1 
ATOM   481   C  CB  . THR A  1 82  ? 45.378 19.332  30.694  1.00 44.92 ? 62  THR A CB  1 
ATOM   482   O  OG1 . THR A  1 82  ? 46.287 19.889  31.645  1.00 40.84 ? 62  THR A OG1 1 
ATOM   483   C  CG2 . THR A  1 82  ? 44.167 18.767  31.428  1.00 41.78 ? 62  THR A CG2 1 
ATOM   484   N  N   . MET A  1 83  ? 44.609 16.606  28.942  1.00 44.84 ? 63  MET A N   1 
ATOM   485   C  CA  . MET A  1 83  ? 43.614 16.113  27.991  1.00 44.99 ? 63  MET A CA  1 
ATOM   486   C  C   . MET A  1 83  ? 42.374 17.024  27.936  1.00 44.83 ? 63  MET A C   1 
ATOM   487   O  O   . MET A  1 83  ? 41.807 17.369  28.985  1.00 47.63 ? 63  MET A O   1 
ATOM   488   C  CB  . MET A  1 83  ? 43.212 14.697  28.382  1.00 44.69 ? 63  MET A CB  1 
ATOM   489   C  CG  . MET A  1 83  ? 44.281 13.674  28.147  1.00 43.20 ? 63  MET A CG  1 
ATOM   490   S  SD  . MET A  1 83  ? 44.663 13.386  26.385  1.00 46.18 ? 63  MET A SD  1 
ATOM   491   C  CE  . MET A  1 83  ? 43.066 12.930  25.667  1.00 36.42 ? 63  MET A CE  1 
ATOM   492   N  N   . MET A  1 84  ? 41.934 17.415  26.737  1.00 43.13 ? 64  MET A N   1 
ATOM   493   C  CA  . MET A  1 84  ? 40.736 18.280  26.621  1.00 44.59 ? 64  MET A CA  1 
ATOM   494   C  C   . MET A  1 84  ? 39.474 17.506  26.995  1.00 43.12 ? 64  MET A C   1 
ATOM   495   O  O   . MET A  1 84  ? 39.403 16.301  26.830  1.00 43.48 ? 64  MET A O   1 
ATOM   496   C  CB  . MET A  1 84  ? 40.550 18.844  25.177  1.00 45.82 ? 64  MET A CB  1 
ATOM   497   C  CG  . MET A  1 84  ? 40.151 17.783  24.081  1.00 52.77 ? 64  MET A CG  1 
ATOM   498   S  SD  . MET A  1 84  ? 41.441 16.505  23.843  1.00 60.33 ? 64  MET A SD  1 
ATOM   499   C  CE  . MET A  1 84  ? 42.748 17.563  23.270  1.00 62.74 ? 64  MET A CE  1 
ATOM   500   N  N   . GLY A  1 85  ? 38.456 18.227  27.403  1.00 43.71 ? 65  GLY A N   1 
ATOM   501   C  CA  . GLY A  1 85  ? 37.176 17.628  27.727  1.00 44.25 ? 65  GLY A CA  1 
ATOM   502   C  C   . GLY A  1 85  ? 36.273 18.536  28.578  1.00 42.92 ? 65  GLY A C   1 
ATOM   503   O  O   . GLY A  1 85  ? 36.757 19.426  29.295  1.00 43.48 ? 65  GLY A O   1 
ATOM   504   N  N   . GLN A  1 86  ? 34.965 18.254  28.497  1.00 42.21 ? 66  GLN A N   1 
ATOM   505   C  CA  . GLN A  1 86  ? 33.927 18.926  29.264  1.00 43.44 ? 66  GLN A CA  1 
ATOM   506   C  C   . GLN A  1 86  ? 33.501 18.245  30.572  1.00 44.00 ? 66  GLN A C   1 
ATOM   507   O  O   . GLN A  1 86  ? 33.565 17.019  30.712  1.00 41.87 ? 66  GLN A O   1 
ATOM   508   C  CB  . GLN A  1 86  ? 32.702 19.069  28.382  1.00 43.59 ? 66  GLN A CB  1 
ATOM   509   C  CG  . GLN A  1 86  ? 31.719 20.009  28.929  1.00 39.76 ? 66  GLN A CG  1 
ATOM   510   C  CD  . GLN A  1 86  ? 30.621 20.289  27.955  1.00 45.77 ? 66  GLN A CD  1 
ATOM   511   O  OE1 . GLN A  1 86  ? 30.069 19.357  27.360  1.00 50.13 ? 66  GLN A OE1 1 
ATOM   512   N  NE2 . GLN A  1 86  ? 30.295 21.574  27.765  1.00 36.57 ? 66  GLN A NE2 1 
ATOM   513   N  N   . GLN A  1 87  ? 33.006 19.048  31.515  1.00 44.10 ? 67  GLN A N   1 
ATOM   514   C  CA  . GLN A  1 87  ? 32.453 18.505  32.757  1.00 42.23 ? 67  GLN A CA  1 
ATOM   515   C  C   . GLN A  1 87  ? 31.234 19.291  33.283  1.00 41.42 ? 67  GLN A C   1 
ATOM   516   O  O   . GLN A  1 87  ? 30.885 20.336  32.779  1.00 42.34 ? 67  GLN A O   1 
ATOM   517   C  CB  . GLN A  1 87  ? 33.552 18.422  33.852  1.00 41.98 ? 67  GLN A CB  1 
ATOM   518   C  CG  . GLN A  1 87  ? 34.356 19.719  34.042  1.00 44.83 ? 67  GLN A CG  1 
ATOM   519   C  CD  . GLN A  1 87  ? 35.385 19.629  35.133  1.00 44.93 ? 67  GLN A CD  1 
ATOM   520   O  OE1 . GLN A  1 87  ? 35.201 20.202  36.208  1.00 40.66 ? 67  GLN A OE1 1 
ATOM   521   N  NE2 . GLN A  1 87  ? 36.494 18.903  34.868  1.00 45.44 ? 67  GLN A NE2 1 
ATOM   522   N  N   . VAL A  1 88  ? 30.578 18.699  34.277  1.00 41.99 ? 68  VAL A N   1 
ATOM   523   C  CA  . VAL A  1 88  ? 29.631 19.354  35.143  1.00 41.13 ? 68  VAL A CA  1 
ATOM   524   C  C   . VAL A  1 88  ? 30.423 19.597  36.379  1.00 38.94 ? 68  VAL A C   1 
ATOM   525   O  O   . VAL A  1 88  ? 30.950 18.658  36.937  1.00 39.55 ? 68  VAL A O   1 
ATOM   526   C  CB  . VAL A  1 88  ? 28.421 18.449  35.495  1.00 39.78 ? 68  VAL A CB  1 
ATOM   527   C  CG1 . VAL A  1 88  ? 27.607 19.041  36.656  1.00 39.66 ? 68  VAL A CG1 1 
ATOM   528   C  CG2 . VAL A  1 88  ? 27.529 18.242  34.249  1.00 40.92 ? 68  VAL A CG2 1 
ATOM   529   N  N   . ALA A  1 89  ? 30.507 20.855  36.802  1.00 40.37 ? 69  ALA A N   1 
ATOM   530   C  CA  . ALA A  1 89  ? 31.218 21.240  38.016  1.00 37.90 ? 69  ALA A CA  1 
ATOM   531   C  C   . ALA A  1 89  ? 30.314 22.010  38.965  1.00 36.68 ? 69  ALA A C   1 
ATOM   532   O  O   . ALA A  1 89  ? 29.338 22.602  38.554  1.00 35.85 ? 69  ALA A O   1 
ATOM   533   C  CB  . ALA A  1 89  ? 32.413 22.061  37.672  1.00 37.79 ? 69  ALA A CB  1 
ATOM   534   N  N   . LYS A  1 90  ? 30.654 21.946  40.252  1.00 38.42 ? 70  LYS A N   1 
ATOM   535   C  CA  . LYS A  1 90  ? 30.019 22.712  41.278  1.00 39.44 ? 70  LYS A CA  1 
ATOM   536   C  C   . LYS A  1 90  ? 30.964 23.866  41.617  1.00 38.11 ? 70  LYS A C   1 
ATOM   537   O  O   . LYS A  1 90  ? 32.145 23.671  41.779  1.00 33.89 ? 70  LYS A O   1 
ATOM   538   C  CB  . LYS A  1 90  ? 29.734 21.849  42.532  1.00 38.61 ? 70  LYS A CB  1 
ATOM   539   C  CG  . LYS A  1 90  ? 28.782 22.505  43.549  1.00 42.79 ? 70  LYS A CG  1 
ATOM   540   C  CD  . LYS A  1 90  ? 28.323 21.539  44.675  1.00 45.14 ? 70  LYS A CD  1 
ATOM   541   N  N   . VAL A  1 91  ? 30.429 25.074  41.732  1.00 40.24 ? 71  VAL A N   1 
ATOM   542   C  CA  . VAL A  1 91  ? 31.191 26.179  42.300  1.00 40.08 ? 71  VAL A CA  1 
ATOM   543   C  C   . VAL A  1 91  ? 31.325 25.934  43.809  1.00 40.01 ? 71  VAL A C   1 
ATOM   544   O  O   . VAL A  1 91  ? 30.344 25.923  44.542  1.00 39.52 ? 71  VAL A O   1 
ATOM   545   C  CB  . VAL A  1 91  ? 30.532 27.514  42.015  1.00 36.13 ? 71  VAL A CB  1 
ATOM   546   C  CG1 . VAL A  1 91  ? 31.289 28.636  42.693  1.00 41.29 ? 71  VAL A CG1 1 
ATOM   547   C  CG2 . VAL A  1 91  ? 30.490 27.736  40.558  1.00 41.46 ? 71  VAL A CG2 1 
ATOM   548   N  N   . VAL A  1 92  ? 32.554 25.703  44.256  1.00 42.02 ? 72  VAL A N   1 
ATOM   549   C  CA  . VAL A  1 92  ? 32.829 25.431  45.670  1.00 43.16 ? 72  VAL A CA  1 
ATOM   550   C  C   . VAL A  1 92  ? 33.354 26.694  46.411  1.00 44.60 ? 72  VAL A C   1 
ATOM   551   O  O   . VAL A  1 92  ? 33.141 26.848  47.623  1.00 45.73 ? 72  VAL A O   1 
ATOM   552   C  CB  . VAL A  1 92  ? 33.787 24.209  45.814  1.00 43.82 ? 72  VAL A CB  1 
ATOM   553   C  CG1 . VAL A  1 92  ? 33.069 22.900  45.368  1.00 40.91 ? 72  VAL A CG1 1 
ATOM   554   C  CG2 . VAL A  1 92  ? 35.098 24.409  45.022  1.00 41.13 ? 72  VAL A CG2 1 
ATOM   555   N  N   . GLU A  1 93  ? 34.007 27.584  45.652  1.00 44.20 ? 73  GLU A N   1 
ATOM   556   C  CA  . GLU A  1 93  ? 34.539 28.847  46.133  1.00 42.64 ? 73  GLU A CA  1 
ATOM   557   C  C   . GLU A  1 93  ? 34.198 29.924  45.077  1.00 41.74 ? 73  GLU A C   1 
ATOM   558   O  O   . GLU A  1 93  ? 34.397 29.697  43.904  1.00 40.29 ? 73  GLU A O   1 
ATOM   559   C  CB  . GLU A  1 93  ? 36.059 28.715  46.346  1.00 42.77 ? 73  GLU A CB  1 
ATOM   560   C  CG  . GLU A  1 93  ? 36.629 29.387  47.605  1.00 45.62 ? 73  GLU A CG  1 
ATOM   561   N  N   . SER A  1 94  ? 33.683 31.088  45.493  1.00 43.19 ? 74  SER A N   1 
ATOM   562   C  CA  . SER A  1 94  ? 33.306 32.167  44.559  1.00 41.41 ? 74  SER A CA  1 
ATOM   563   C  C   . SER A  1 94  ? 33.797 33.559  44.985  1.00 39.33 ? 74  SER A C   1 
ATOM   564   O  O   . SER A  1 94  ? 33.713 33.948  46.131  1.00 37.11 ? 74  SER A O   1 
ATOM   565   C  CB  . SER A  1 94  ? 31.781 32.212  44.374  1.00 41.66 ? 74  SER A CB  1 
ATOM   566   O  OG  . SER A  1 94  ? 31.403 33.095  43.319  1.00 35.79 ? 74  SER A OG  1 
ATOM   567   N  N   . LYS A  1 95  ? 34.344 34.286  44.025  1.00 39.31 ? 75  LYS A N   1 
ATOM   568   C  CA  . LYS A  1 95  ? 34.469 35.729  44.103  1.00 36.64 ? 75  LYS A CA  1 
ATOM   569   C  C   . LYS A  1 95  ? 33.739 36.355  42.882  1.00 36.17 ? 75  LYS A C   1 
ATOM   570   O  O   . LYS A  1 95  ? 34.007 37.489  42.506  1.00 33.15 ? 75  LYS A O   1 
ATOM   571   C  CB  . LYS A  1 95  ? 35.943 36.133  44.117  1.00 36.33 ? 75  LYS A CB  1 
ATOM   572   C  CG  . LYS A  1 95  ? 36.682 35.852  45.396  1.00 34.95 ? 75  LYS A CG  1 
ATOM   573   C  CD  . LYS A  1 95  ? 37.994 36.680  45.454  1.00 37.94 ? 75  LYS A CD  1 
ATOM   574   C  CE  . LYS A  1 95  ? 38.714 36.606  46.826  1.00 43.08 ? 75  LYS A CE  1 
ATOM   575   N  NZ  . LYS A  1 95  ? 39.613 35.411  46.959  1.00 34.61 ? 75  LYS A NZ  1 
ATOM   576   N  N   . ASN A  1 96  ? 32.829 35.597  42.263  1.00 35.41 ? 76  ASN A N   1 
ATOM   577   C  CA  . ASN A  1 96  ? 32.018 36.079  41.154  1.00 35.54 ? 76  ASN A CA  1 
ATOM   578   C  C   . ASN A  1 96  ? 30.533 36.054  41.558  1.00 35.99 ? 76  ASN A C   1 
ATOM   579   O  O   . ASN A  1 96  ? 29.956 34.978  41.758  1.00 35.85 ? 76  ASN A O   1 
ATOM   580   C  CB  . ASN A  1 96  ? 32.285 35.193  39.947  1.00 34.00 ? 76  ASN A CB  1 
ATOM   581   C  CG  . ASN A  1 96  ? 31.569 35.646  38.667  1.00 34.34 ? 76  ASN A CG  1 
ATOM   582   O  OD1 . ASN A  1 96  ? 30.577 36.326  38.715  1.00 36.14 ? 76  ASN A OD1 1 
ATOM   583   N  ND2 . ASN A  1 96  ? 32.060 35.189  37.510  1.00 35.56 ? 76  ASN A ND2 1 
ATOM   584   N  N   . VAL A  1 97  ? 29.914 37.232  41.642  1.00 35.48 ? 77  VAL A N   1 
ATOM   585   C  CA  . VAL A  1 97  ? 28.505 37.344  42.067  1.00 38.02 ? 77  VAL A CA  1 
ATOM   586   C  C   . VAL A  1 97  ? 27.471 36.682  41.109  1.00 39.30 ? 77  VAL A C   1 
ATOM   587   O  O   . VAL A  1 97  ? 26.326 36.423  41.498  1.00 40.49 ? 77  VAL A O   1 
ATOM   588   C  CB  . VAL A  1 97  ? 28.080 38.824  42.308  1.00 39.14 ? 77  VAL A CB  1 
ATOM   589   C  CG1 . VAL A  1 97  ? 28.981 39.532  43.373  1.00 34.80 ? 77  VAL A CG1 1 
ATOM   590   C  CG2 . VAL A  1 97  ? 27.998 39.595  40.966  1.00 39.45 ? 77  VAL A CG2 1 
ATOM   591   N  N   . ALA A  1 98  ? 27.873 36.435  39.864  1.00 38.46 ? 78  ALA A N   1 
ATOM   592   C  CA  . ALA A  1 98  ? 27.047 35.705  38.896  1.00 38.20 ? 78  ALA A CA  1 
ATOM   593   C  C   . ALA A  1 98  ? 26.976 34.219  39.212  1.00 39.48 ? 78  ALA A C   1 
ATOM   594   O  O   . ALA A  1 98  ? 26.084 33.521  38.721  1.00 40.71 ? 78  ALA A O   1 
ATOM   595   C  CB  . ALA A  1 98  ? 27.619 35.887  37.467  1.00 37.47 ? 78  ALA A CB  1 
ATOM   596   N  N   . LEU A  1 99  ? 27.951 33.736  39.984  1.00 40.06 ? 79  LEU A N   1 
ATOM   597   C  CA  . LEU A  1 99  ? 28.176 32.314  40.193  1.00 40.64 ? 79  LEU A CA  1 
ATOM   598   C  C   . LEU A  1 99  ? 28.527 32.034  41.652  1.00 39.38 ? 79  LEU A C   1 
ATOM   599   O  O   . LEU A  1 99  ? 29.685 31.721  41.930  1.00 40.81 ? 79  LEU A O   1 
ATOM   600   C  CB  . LEU A  1 99  ? 29.323 31.823  39.292  1.00 41.80 ? 79  LEU A CB  1 
ATOM   601   C  CG  . LEU A  1 99  ? 29.172 31.945  37.761  1.00 45.85 ? 79  LEU A CG  1 
ATOM   602   C  CD1 . LEU A  1 99  ? 30.538 31.889  37.057  1.00 44.01 ? 79  LEU A CD1 1 
ATOM   603   C  CD2 . LEU A  1 99  ? 28.234 30.894  37.170  1.00 41.05 ? 79  LEU A CD2 1 
ATOM   604   N  N   . PRO A  1 100 ? 27.527 32.107  42.570  1.00 36.53 ? 80  PRO A N   1 
ATOM   605   C  CA  . PRO A  1 100 ? 27.727 31.815  44.004  1.00 38.59 ? 80  PRO A CA  1 
ATOM   606   C  C   . PRO A  1 100 ? 28.128 30.357  44.299  1.00 39.57 ? 80  PRO A C   1 
ATOM   607   O  O   . PRO A  1 100 ? 27.961 29.491  43.429  1.00 37.70 ? 80  PRO A O   1 
ATOM   608   C  CB  . PRO A  1 100 ? 26.353 32.123  44.634  1.00 36.48 ? 80  PRO A CB  1 
ATOM   609   C  CG  . PRO A  1 100 ? 25.587 32.850  43.606  1.00 34.18 ? 80  PRO A CG  1 
ATOM   610   C  CD  . PRO A  1 100 ? 26.119 32.433  42.281  1.00 33.15 ? 80  PRO A CD  1 
ATOM   611   N  N   . LYS A  1 101 ? 28.674 30.097  45.498  1.00 41.02 ? 81  LYS A N   1 
ATOM   612   C  CA  . LYS A  1 101 ? 28.935 28.716  45.955  1.00 41.12 ? 81  LYS A CA  1 
ATOM   613   C  C   . LYS A  1 101 ? 27.678 27.884  45.659  1.00 41.48 ? 81  LYS A C   1 
ATOM   614   O  O   . LYS A  1 101 ? 26.548 28.366  45.832  1.00 42.44 ? 81  LYS A O   1 
ATOM   615   C  CB  . LYS A  1 101 ? 29.260 28.642  47.470  1.00 41.83 ? 81  LYS A CB  1 
ATOM   616   C  CG  . LYS A  1 101 ? 30.698 28.979  47.877  1.00 44.31 ? 81  LYS A CG  1 
ATOM   617   C  CD  . LYS A  1 101 ? 31.115 28.356  49.230  1.00 39.53 ? 81  LYS A CD  1 
ATOM   618   N  N   . GLY A  1 102 ? 27.862 26.653  45.199  1.00 40.64 ? 82  GLY A N   1 
ATOM   619   C  CA  . GLY A  1 102 ? 26.732 25.746  44.981  1.00 41.84 ? 82  GLY A CA  1 
ATOM   620   C  C   . GLY A  1 102 ? 26.281 25.637  43.532  1.00 42.78 ? 82  GLY A C   1 
ATOM   621   O  O   . GLY A  1 102 ? 25.759 24.596  43.134  1.00 45.54 ? 82  GLY A O   1 
ATOM   622   N  N   . THR A  1 103 ? 26.492 26.704  42.759  1.00 40.84 ? 83  THR A N   1 
ATOM   623   C  CA  . THR A  1 103 ? 26.126 26.774  41.348  1.00 40.38 ? 83  THR A CA  1 
ATOM   624   C  C   . THR A  1 103 ? 26.717 25.635  40.521  1.00 41.87 ? 83  THR A C   1 
ATOM   625   O  O   . THR A  1 103 ? 27.919 25.341  40.605  1.00 41.42 ? 83  THR A O   1 
ATOM   626   C  CB  . THR A  1 103 ? 26.607 28.094  40.702  1.00 39.88 ? 83  THR A CB  1 
ATOM   627   O  OG1 . THR A  1 103 ? 26.203 29.188  41.523  1.00 31.15 ? 83  THR A OG1 1 
ATOM   628   C  CG2 . THR A  1 103 ? 26.060 28.256  39.253  1.00 35.30 ? 83  THR A CG2 1 
ATOM   629   N  N   . ILE A  1 104 ? 25.841 25.030  39.711  1.00 42.05 ? 84  ILE A N   1 
ATOM   630   C  CA  . ILE A  1 104 ? 26.188 23.967  38.795  1.00 41.31 ? 84  ILE A CA  1 
ATOM   631   C  C   . ILE A  1 104 ? 26.382 24.582  37.416  1.00 39.79 ? 84  ILE A C   1 
ATOM   632   O  O   . ILE A  1 104 ? 25.575 25.392  36.960  1.00 35.45 ? 84  ILE A O   1 
ATOM   633   C  CB  . ILE A  1 104 ? 25.103 22.855  38.713  1.00 41.38 ? 84  ILE A CB  1 
ATOM   634   C  CG1 . ILE A  1 104 ? 24.774 22.285  40.104  1.00 37.84 ? 84  ILE A CG1 1 
ATOM   635   C  CG2 . ILE A  1 104 ? 25.566 21.733  37.765  1.00 43.90 ? 84  ILE A CG2 1 
ATOM   636   C  CD1 . ILE A  1 104 ? 25.933 21.669  40.775  1.00 34.59 ? 84  ILE A CD1 1 
ATOM   637   N  N   . VAL A  1 105 ? 27.480 24.178  36.772  1.00 39.37 ? 85  VAL A N   1 
ATOM   638   C  CA  . VAL A  1 105 ? 27.847 24.714  35.480  1.00 38.34 ? 85  VAL A CA  1 
ATOM   639   C  C   . VAL A  1 105 ? 28.463 23.635  34.604  1.00 38.72 ? 85  VAL A C   1 
ATOM   640   O  O   . VAL A  1 105 ? 28.936 22.608  35.093  1.00 38.33 ? 85  VAL A O   1 
ATOM   641   C  CB  . VAL A  1 105 ? 28.877 25.902  35.588  1.00 37.69 ? 85  VAL A CB  1 
ATOM   642   C  CG1 . VAL A  1 105 ? 28.368 26.999  36.488  1.00 41.27 ? 85  VAL A CG1 1 
ATOM   643   C  CG2 . VAL A  1 105 ? 30.282 25.408  36.064  1.00 42.77 ? 85  VAL A CG2 1 
ATOM   644   N  N   . LEU A  1 106 ? 28.438 23.904  33.302  1.00 40.38 ? 86  LEU A N   1 
ATOM   645   C  CA  . LEU A  1 106 ? 29.275 23.249  32.346  1.00 41.09 ? 86  LEU A CA  1 
ATOM   646   C  C   . LEU A  1 106 ? 30.569 24.020  32.142  1.00 41.61 ? 86  LEU A C   1 
ATOM   647   O  O   . LEU A  1 106 ? 30.559 25.236  31.980  1.00 41.46 ? 86  LEU A O   1 
ATOM   648   C  CB  . LEU A  1 106 ? 28.579 23.153  31.000  1.00 42.70 ? 86  LEU A CB  1 
ATOM   649   C  CG  . LEU A  1 106 ? 27.507 22.096  30.857  1.00 46.05 ? 86  LEU A CG  1 
ATOM   650   C  CD1 . LEU A  1 106 ? 26.857 22.299  29.525  1.00 51.71 ? 86  LEU A CD1 1 
ATOM   651   C  CD2 . LEU A  1 106 ? 28.085 20.693  30.971  1.00 52.12 ? 86  LEU A CD2 1 
ATOM   652   N  N   . ALA A  1 107 ? 31.671 23.271  32.109  1.00 41.46 ? 87  ALA A N   1 
ATOM   653   C  CA  . ALA A  1 107 ? 33.006 23.826  31.919  1.00 41.25 ? 87  ALA A CA  1 
ATOM   654   C  C   . ALA A  1 107 ? 33.900 22.816  31.159  1.00 41.01 ? 87  ALA A C   1 
ATOM   655   O  O   . ALA A  1 107 ? 33.733 21.601  31.273  1.00 36.12 ? 87  ALA A O   1 
ATOM   656   C  CB  . ALA A  1 107 ? 33.623 24.185  33.286  1.00 38.45 ? 87  ALA A CB  1 
ATOM   657   N  N   . SER A  1 108 ? 34.861 23.334  30.409  1.00 43.79 ? 88  SER A N   1 
ATOM   658   C  CA  . SER A  1 108 ? 35.825 22.502  29.710  1.00 43.22 ? 88  SER A CA  1 
ATOM   659   C  C   . SER A  1 108 ? 37.272 22.823  30.100  1.00 41.36 ? 88  SER A C   1 
ATOM   660   O  O   . SER A  1 108 ? 38.062 23.226  29.267  1.00 43.68 ? 88  SER A O   1 
ATOM   661   C  CB  . SER A  1 108 ? 35.597 22.698  28.225  1.00 43.81 ? 88  SER A CB  1 
ATOM   662   O  OG  . SER A  1 108 ? 34.214 22.652  27.983  1.00 43.64 ? 88  SER A OG  1 
ATOM   663   N  N   . PRO A  1 109 ? 37.636 22.597  31.363  1.00 41.13 ? 89  PRO A N   1 
ATOM   664   C  CA  . PRO A  1 109 ? 39.029 22.748  31.752  1.00 42.63 ? 89  PRO A CA  1 
ATOM   665   C  C   . PRO A  1 109 ? 39.905 21.532  31.403  1.00 45.16 ? 89  PRO A C   1 
ATOM   666   O  O   . PRO A  1 109 ? 41.082 21.492  31.763  1.00 48.60 ? 89  PRO A O   1 
ATOM   667   C  CB  . PRO A  1 109 ? 38.925 22.867  33.276  1.00 42.38 ? 89  PRO A CB  1 
ATOM   668   C  CG  . PRO A  1 109 ? 37.800 22.024  33.630  1.00 39.45 ? 89  PRO A CG  1 
ATOM   669   C  CD  . PRO A  1 109 ? 36.812 22.153  32.506  1.00 40.33 ? 89  PRO A CD  1 
ATOM   670   N  N   . GLY A  1 110 ? 39.333 20.538  30.735  1.00 46.45 ? 90  GLY A N   1 
ATOM   671   C  CA  . GLY A  1 110 ? 40.003 19.283  30.518  1.00 44.64 ? 90  GLY A CA  1 
ATOM   672   C  C   . GLY A  1 110 ? 39.805 18.285  31.639  1.00 43.92 ? 90  GLY A C   1 
ATOM   673   O  O   . GLY A  1 110 ? 38.960 18.454  32.519  1.00 43.22 ? 90  GLY A O   1 
ATOM   674   N  N   . TRP A  1 111 ? 40.624 17.238  31.602  1.00 43.83 ? 91  TRP A N   1 
ATOM   675   C  CA  . TRP A  1 111 ? 40.547 16.129  32.562  1.00 42.41 ? 91  TRP A CA  1 
ATOM   676   C  C   . TRP A  1 111 ? 41.208 16.498  33.882  1.00 42.71 ? 91  TRP A C   1 
ATOM   677   O  O   . TRP A  1 111 ? 42.365 16.160  34.129  1.00 40.03 ? 91  TRP A O   1 
ATOM   678   C  CB  . TRP A  1 111 ? 41.238 14.897  32.005  1.00 43.21 ? 91  TRP A CB  1 
ATOM   679   C  CG  . TRP A  1 111 ? 40.640 14.298  30.763  1.00 42.60 ? 91  TRP A CG  1 
ATOM   680   C  CD1 . TRP A  1 111 ? 39.772 14.887  29.876  1.00 44.17 ? 91  TRP A CD1 1 
ATOM   681   C  CD2 . TRP A  1 111 ? 40.928 12.997  30.245  1.00 41.80 ? 91  TRP A CD2 1 
ATOM   682   N  NE1 . TRP A  1 111 ? 39.491 14.006  28.856  1.00 42.89 ? 91  TRP A NE1 1 
ATOM   683   C  CE2 . TRP A  1 111 ? 40.174 12.838  29.068  1.00 40.78 ? 91  TRP A CE2 1 
ATOM   684   C  CE3 . TRP A  1 111 ? 41.736 11.932  30.682  1.00 40.11 ? 91  TRP A CE3 1 
ATOM   685   C  CZ2 . TRP A  1 111 ? 40.216 11.660  28.306  1.00 42.07 ? 91  TRP A CZ2 1 
ATOM   686   C  CZ3 . TRP A  1 111 ? 41.758 10.773  29.949  1.00 42.20 ? 91  TRP A CZ3 1 
ATOM   687   C  CH2 . TRP A  1 111 ? 40.996 10.643  28.767  1.00 41.47 ? 91  TRP A CH2 1 
ATOM   688   N  N   . THR A  1 112 ? 40.438 17.162  34.739  1.00 42.71 ? 92  THR A N   1 
ATOM   689   C  CA  . THR A  1 112 ? 40.949 17.724  35.956  1.00 41.90 ? 92  THR A CA  1 
ATOM   690   C  C   . THR A  1 112 ? 39.819 17.734  36.983  1.00 41.90 ? 92  THR A C   1 
ATOM   691   O  O   . THR A  1 112 ? 38.647 17.864  36.633  1.00 40.57 ? 92  THR A O   1 
ATOM   692   C  CB  . THR A  1 112 ? 41.580 19.133  35.674  1.00 41.90 ? 92  THR A CB  1 
ATOM   693   O  OG1 . THR A  1 112 ? 42.334 19.548  36.809  1.00 44.62 ? 92  THR A OG1 1 
ATOM   694   C  CG2 . THR A  1 112 ? 40.523 20.184  35.326  1.00 43.60 ? 92  THR A CG2 1 
ATOM   695   N  N   . THR A  1 113 ? 40.183 17.525  38.241  1.00 40.39 ? 93  THR A N   1 
ATOM   696   C  CA  . THR A  1 113 ? 39.223 17.469  39.324  1.00 41.63 ? 93  THR A CA  1 
ATOM   697   C  C   . THR A  1 113 ? 38.793 18.865  39.836  1.00 43.25 ? 93  THR A C   1 
ATOM   698   O  O   . THR A  1 113 ? 37.673 19.035  40.337  1.00 42.60 ? 93  THR A O   1 
ATOM   699   C  CB  . THR A  1 113 ? 39.798 16.683  40.532  1.00 41.81 ? 93  THR A CB  1 
ATOM   700   O  OG1 . THR A  1 113 ? 40.920 17.381  41.103  1.00 40.48 ? 93  THR A OG1 1 
ATOM   701   C  CG2 . THR A  1 113 ? 40.207 15.326  40.112  1.00 42.28 ? 93  THR A CG2 1 
ATOM   702   N  N   . HIS A  1 114 ? 39.716 19.828  39.757  1.00 43.45 ? 94  HIS A N   1 
ATOM   703   C  CA  . HIS A  1 114 ? 39.483 21.195  40.182  1.00 43.06 ? 94  HIS A CA  1 
ATOM   704   C  C   . HIS A  1 114 ? 40.118 22.161  39.179  1.00 43.44 ? 94  HIS A C   1 
ATOM   705   O  O   . HIS A  1 114 ? 41.126 21.856  38.518  1.00 44.83 ? 94  HIS A O   1 
ATOM   706   C  CB  . HIS A  1 114 ? 40.026 21.429  41.602  1.00 43.26 ? 94  HIS A CB  1 
ATOM   707   C  CG  . HIS A  1 114 ? 39.386 20.560  42.639  1.00 44.62 ? 94  HIS A CG  1 
ATOM   708   N  ND1 . HIS A  1 114 ? 39.444 19.181  42.595  1.00 55.06 ? 94  HIS A ND1 1 
ATOM   709   C  CD2 . HIS A  1 114 ? 38.672 20.868  43.747  1.00 51.69 ? 94  HIS A CD2 1 
ATOM   710   C  CE1 . HIS A  1 114 ? 38.790 18.677  43.625  1.00 52.24 ? 94  HIS A CE1 1 
ATOM   711   N  NE2 . HIS A  1 114 ? 38.312 19.681  44.340  1.00 52.01 ? 94  HIS A NE2 1 
ATOM   712   N  N   . SER A  1 115 ? 39.480 23.316  39.042  1.00 45.19 ? 95  SER A N   1 
ATOM   713   C  CA  . SER A  1 115 ? 39.866 24.305  38.053  1.00 45.75 ? 95  SER A CA  1 
ATOM   714   C  C   . SER A  1 115 ? 39.340 25.678  38.453  1.00 44.71 ? 95  SER A C   1 
ATOM   715   O  O   . SER A  1 115 ? 38.299 25.799  39.085  1.00 43.70 ? 95  SER A O   1 
ATOM   716   C  CB  . SER A  1 115 ? 39.379 23.913  36.644  1.00 45.53 ? 95  SER A CB  1 
ATOM   717   O  OG  . SER A  1 115 ? 38.050 24.335  36.400  1.00 50.35 ? 95  SER A OG  1 
ATOM   718   N  N   . ILE A  1 116 ? 40.107 26.697  38.077  1.00 44.71 ? 96  ILE A N   1 
ATOM   719   C  CA  . ILE A  1 116 ? 39.798 28.073  38.348  1.00 45.58 ? 96  ILE A CA  1 
ATOM   720   C  C   . ILE A  1 116 ? 39.348 28.675  37.035  1.00 46.34 ? 96  ILE A C   1 
ATOM   721   O  O   . ILE A  1 116 ? 39.972 28.474  35.997  1.00 45.15 ? 96  ILE A O   1 
ATOM   722   C  CB  . ILE A  1 116 ? 41.015 28.835  38.906  1.00 45.74 ? 96  ILE A CB  1 
ATOM   723   C  CG1 . ILE A  1 116 ? 41.365 28.304  40.306  1.00 44.31 ? 96  ILE A CG1 1 
ATOM   724   C  CG2 . ILE A  1 116 ? 40.741 30.351  38.938  1.00 49.74 ? 96  ILE A CG2 1 
ATOM   725   C  CD1 . ILE A  1 116 ? 42.707 28.763  40.811  1.00 45.66 ? 96  ILE A CD1 1 
ATOM   726   N  N   . SER A  1 117 ? 38.239 29.399  37.115  1.00 47.57 ? 97  SER A N   1 
ATOM   727   C  CA  . SER A  1 117 ? 37.565 29.963  35.958  1.00 48.61 ? 97  SER A CA  1 
ATOM   728   C  C   . SER A  1 117 ? 37.253 31.431  36.274  1.00 46.43 ? 97  SER A C   1 
ATOM   729   O  O   . SER A  1 117 ? 36.989 31.769  37.406  1.00 43.19 ? 97  SER A O   1 
ATOM   730   C  CB  . SER A  1 117 ? 36.290 29.163  35.651  1.00 48.90 ? 97  SER A CB  1 
ATOM   731   O  OG  . SER A  1 117 ? 35.706 29.562  34.431  1.00 51.27 ? 97  SER A OG  1 
ATOM   732   N  N   . ASP A  1 118 ? 37.339 32.280  35.264  1.00 47.93 ? 98  ASP A N   1 
ATOM   733   C  CA  . ASP A  1 118 ? 37.017 33.707  35.363  1.00 51.00 ? 98  ASP A CA  1 
ATOM   734   C  C   . ASP A  1 118 ? 35.535 33.982  35.046  1.00 51.43 ? 98  ASP A C   1 
ATOM   735   O  O   . ASP A  1 118 ? 35.105 35.144  35.016  1.00 51.82 ? 98  ASP A O   1 
ATOM   736   C  CB  . ASP A  1 118 ? 37.909 34.515  34.405  1.00 51.71 ? 98  ASP A CB  1 
ATOM   737   C  CG  . ASP A  1 118 ? 37.688 34.153  32.917  1.00 55.70 ? 98  ASP A CG  1 
ATOM   738   O  OD1 . ASP A  1 118 ? 37.397 32.975  32.561  1.00 60.60 ? 98  ASP A OD1 1 
ATOM   739   O  OD2 . ASP A  1 118 ? 37.832 35.072  32.084  1.00 71.43 ? 98  ASP A OD2 1 
ATOM   740   N  N   . GLY A  1 119 ? 34.778 32.909  34.790  1.00 52.17 ? 99  GLY A N   1 
ATOM   741   C  CA  . GLY A  1 119 ? 33.344 32.972  34.562  1.00 51.95 ? 99  GLY A CA  1 
ATOM   742   C  C   . GLY A  1 119 ? 32.979 32.966  33.096  1.00 54.15 ? 99  GLY A C   1 
ATOM   743   O  O   . GLY A  1 119 ? 31.890 32.537  32.735  1.00 57.12 ? 99  GLY A O   1 
ATOM   744   N  N   . LYS A  1 120 ? 33.882 33.420  32.231  1.00 55.10 ? 100 LYS A N   1 
ATOM   745   C  CA  . LYS A  1 120 ? 33.499 33.756  30.860  1.00 54.84 ? 100 LYS A CA  1 
ATOM   746   C  C   . LYS A  1 120 ? 33.544 32.543  29.913  1.00 55.68 ? 100 LYS A C   1 
ATOM   747   O  O   . LYS A  1 120 ? 33.071 32.634  28.797  1.00 57.11 ? 100 LYS A O   1 
ATOM   748   C  CB  . LYS A  1 120 ? 34.322 34.967  30.376  1.00 54.85 ? 100 LYS A CB  1 
ATOM   749   C  CG  . LYS A  1 120 ? 34.211 36.176  31.375  1.00 55.11 ? 100 LYS A CG  1 
ATOM   750   C  CD  . LYS A  1 120 ? 34.972 37.447  30.998  1.00 53.01 ? 100 LYS A CD  1 
ATOM   751   C  CE  . LYS A  1 120 ? 34.916 38.468  32.152  1.00 51.77 ? 100 LYS A CE  1 
ATOM   752   N  NZ  . LYS A  1 120 ? 34.724 39.916  31.710  1.00 43.70 ? 100 LYS A NZ  1 
ATOM   753   N  N   . ASP A  1 121 ? 34.035 31.400  30.397  1.00 55.28 ? 101 ASP A N   1 
ATOM   754   C  CA  . ASP A  1 121 ? 34.118 30.140  29.632  1.00 56.10 ? 101 ASP A CA  1 
ATOM   755   C  C   . ASP A  1 121 ? 33.126 29.057  30.108  1.00 55.01 ? 101 ASP A C   1 
ATOM   756   O  O   . ASP A  1 121 ? 33.341 27.847  29.899  1.00 56.18 ? 101 ASP A O   1 
ATOM   757   C  CB  . ASP A  1 121 ? 35.577 29.581  29.673  1.00 58.33 ? 101 ASP A CB  1 
ATOM   758   C  CG  . ASP A  1 121 ? 36.213 29.558  31.119  1.00 60.93 ? 101 ASP A CG  1 
ATOM   759   O  OD1 . ASP A  1 121 ? 35.615 30.088  32.084  1.00 57.49 ? 101 ASP A OD1 1 
ATOM   760   O  OD2 . ASP A  1 121 ? 37.342 29.024  31.280  1.00 60.60 ? 101 ASP A OD2 1 
ATOM   761   N  N   . LEU A  1 122 ? 32.059 29.495  30.765  1.00 53.34 ? 102 LEU A N   1 
ATOM   762   C  CA  . LEU A  1 122 ? 31.151 28.608  31.510  1.00 53.13 ? 102 LEU A CA  1 
ATOM   763   C  C   . LEU A  1 122 ? 29.729 28.730  31.005  1.00 53.17 ? 102 LEU A C   1 
ATOM   764   O  O   . LEU A  1 122 ? 29.392 29.666  30.306  1.00 55.61 ? 102 LEU A O   1 
ATOM   765   C  CB  . LEU A  1 122 ? 31.123 28.966  32.997  1.00 51.80 ? 102 LEU A CB  1 
ATOM   766   C  CG  . LEU A  1 122 ? 32.441 29.058  33.743  1.00 49.35 ? 102 LEU A CG  1 
ATOM   767   C  CD1 . LEU A  1 122 ? 32.146 29.289  35.209  1.00 44.48 ? 102 LEU A CD1 1 
ATOM   768   C  CD2 . LEU A  1 122 ? 33.293 27.789  33.532  1.00 60.41 ? 102 LEU A CD2 1 
ATOM   769   N  N   . GLU A  1 123 ? 28.885 27.801  31.412  1.00 52.26 ? 103 GLU A N   1 
ATOM   770   C  CA  . GLU A  1 123 ? 27.515 27.771  30.982  1.00 51.51 ? 103 GLU A CA  1 
ATOM   771   C  C   . GLU A  1 123 ? 26.696 27.242  32.149  1.00 50.27 ? 103 GLU A C   1 
ATOM   772   O  O   . GLU A  1 123 ? 26.966 26.149  32.658  1.00 48.11 ? 103 GLU A O   1 
ATOM   773   C  CB  . GLU A  1 123 ? 27.450 26.811  29.815  1.00 52.20 ? 103 GLU A CB  1 
ATOM   774   C  CG  . GLU A  1 123 ? 26.421 27.081  28.747  1.00 56.64 ? 103 GLU A CG  1 
ATOM   775   C  CD  . GLU A  1 123 ? 26.355 25.895  27.775  1.00 59.40 ? 103 GLU A CD  1 
ATOM   776   O  OE1 . GLU A  1 123 ? 27.448 25.487  27.267  1.00 65.22 ? 103 GLU A OE1 1 
ATOM   777   O  OE2 . GLU A  1 123 ? 25.229 25.356  27.546  1.00 62.71 ? 103 GLU A OE2 1 
ATOM   778   N  N   . LYS A  1 124 ? 25.708 28.007  32.599  1.00 51.17 ? 104 LYS A N   1 
ATOM   779   C  CA  . LYS A  1 124 ? 24.766 27.490  33.587  1.00 50.86 ? 104 LYS A CA  1 
ATOM   780   C  C   . LYS A  1 124 ? 23.829 26.587  32.810  1.00 50.64 ? 104 LYS A C   1 
ATOM   781   O  O   . LYS A  1 124 ? 23.800 26.624  31.574  1.00 50.28 ? 104 LYS A O   1 
ATOM   782   C  CB  . LYS A  1 124 ? 24.008 28.619  34.330  1.00 50.05 ? 104 LYS A CB  1 
ATOM   783   C  CG  . LYS A  1 124 ? 24.932 29.659  34.955  1.00 52.28 ? 104 LYS A CG  1 
ATOM   784   C  CD  . LYS A  1 124 ? 24.217 30.620  35.941  1.00 53.14 ? 104 LYS A CD  1 
ATOM   785   C  CE  . LYS A  1 124 ? 24.725 32.080  35.785  1.00 57.97 ? 104 LYS A CE  1 
ATOM   786   N  NZ  . LYS A  1 124 ? 24.052 33.044  36.723  1.00 51.95 ? 104 LYS A NZ  1 
ATOM   787   N  N   . LEU A  1 125 ? 23.074 25.765  33.524  1.00 53.79 ? 105 LEU A N   1 
ATOM   788   C  CA  . LEU A  1 125 ? 22.170 24.824  32.874  1.00 55.17 ? 105 LEU A CA  1 
ATOM   789   C  C   . LEU A  1 125 ? 20.893 25.537  32.490  1.00 53.42 ? 105 LEU A C   1 
ATOM   790   O  O   . LEU A  1 125 ? 20.654 26.662  32.911  1.00 56.32 ? 105 LEU A O   1 
ATOM   791   C  CB  . LEU A  1 125 ? 21.865 23.617  33.774  1.00 55.50 ? 105 LEU A CB  1 
ATOM   792   C  CG  . LEU A  1 125 ? 23.040 22.758  34.266  1.00 56.57 ? 105 LEU A CG  1 
ATOM   793   C  CD1 . LEU A  1 125 ? 22.662 21.281  34.215  1.00 58.99 ? 105 LEU A CD1 1 
ATOM   794   C  CD2 . LEU A  1 125 ? 24.343 22.981  33.489  1.00 54.58 ? 105 LEU A CD2 1 
ATOM   795   N  N   . LEU A  1 126 ? 20.084 24.883  31.672  1.00 52.95 ? 106 LEU A N   1 
ATOM   796   C  CA  . LEU A  1 126 ? 18.773 25.404  31.338  1.00 53.21 ? 106 LEU A CA  1 
ATOM   797   C  C   . LEU A  1 126 ? 18.006 25.790  32.607  1.00 52.26 ? 106 LEU A C   1 
ATOM   798   O  O   . LEU A  1 126 ? 18.086 25.099  33.618  1.00 51.68 ? 106 LEU A O   1 
ATOM   799   C  CB  . LEU A  1 126 ? 18.009 24.359  30.539  1.00 53.57 ? 106 LEU A CB  1 
ATOM   800   C  CG  . LEU A  1 126 ? 18.502 24.102  29.108  1.00 53.12 ? 106 LEU A CG  1 
ATOM   801   C  CD1 . LEU A  1 126 ? 17.774 22.881  28.585  1.00 53.08 ? 106 LEU A CD1 1 
ATOM   802   C  CD2 . LEU A  1 126 ? 18.305 25.309  28.147  1.00 50.20 ? 106 LEU A CD2 1 
ATOM   803   N  N   . THR A  1 127 ? 17.304 26.917  32.556  1.00 53.15 ? 107 THR A N   1 
ATOM   804   C  CA  . THR A  1 127 ? 16.530 27.415  33.692  1.00 55.01 ? 107 THR A CA  1 
ATOM   805   C  C   . THR A  1 127 ? 15.481 26.403  34.128  1.00 56.02 ? 107 THR A C   1 
ATOM   806   O  O   . THR A  1 127 ? 15.338 26.083  35.308  1.00 55.40 ? 107 THR A O   1 
ATOM   807   C  CB  . THR A  1 127 ? 15.819 28.704  33.313  1.00 54.76 ? 107 THR A CB  1 
ATOM   808   O  OG1 . THR A  1 127 ? 16.807 29.668  32.976  1.00 54.42 ? 107 THR A OG1 1 
ATOM   809   C  CG2 . THR A  1 127 ? 14.959 29.245  34.465  1.00 58.39 ? 107 THR A CG2 1 
ATOM   810   N  N   . GLU A  1 128 ? 14.775 25.886  33.136  1.00 56.10 ? 108 GLU A N   1 
ATOM   811   C  CA  . GLU A  1 128 ? 13.692 24.946  33.336  1.00 55.48 ? 108 GLU A CA  1 
ATOM   812   C  C   . GLU A  1 128 ? 14.179 23.518  33.680  1.00 54.66 ? 108 GLU A C   1 
ATOM   813   O  O   . GLU A  1 128 ? 13.354 22.600  33.740  1.00 54.57 ? 108 GLU A O   1 
ATOM   814   C  CB  . GLU A  1 128 ? 12.842 24.924  32.056  1.00 55.30 ? 108 GLU A CB  1 
ATOM   815   C  CG  . GLU A  1 128 ? 13.666 24.567  30.745  1.00 61.22 ? 108 GLU A CG  1 
ATOM   816   C  CD  . GLU A  1 128 ? 14.139 25.792  29.913  1.00 62.16 ? 108 GLU A CD  1 
ATOM   817   O  OE1 . GLU A  1 128 ? 13.419 26.153  28.957  1.00 67.22 ? 108 GLU A OE1 1 
ATOM   818   O  OE2 . GLU A  1 128 ? 15.214 26.384  30.196  1.00 49.48 ? 108 GLU A OE2 1 
ATOM   819   N  N   . TRP A  1 129 ? 15.488 23.331  33.915  1.00 53.42 ? 109 TRP A N   1 
ATOM   820   C  CA  . TRP A  1 129 ? 16.103 21.985  34.084  1.00 54.07 ? 109 TRP A CA  1 
ATOM   821   C  C   . TRP A  1 129 ? 15.572 21.219  35.291  1.00 54.03 ? 109 TRP A C   1 
ATOM   822   O  O   . TRP A  1 129 ? 15.724 21.681  36.408  1.00 55.32 ? 109 TRP A O   1 
ATOM   823   C  CB  . TRP A  1 129 ? 17.641 22.093  34.202  1.00 53.89 ? 109 TRP A CB  1 
ATOM   824   C  CG  . TRP A  1 129 ? 18.375 20.755  34.215  1.00 51.99 ? 109 TRP A CG  1 
ATOM   825   C  CD1 . TRP A  1 129 ? 18.561 19.942  35.287  1.00 49.59 ? 109 TRP A CD1 1 
ATOM   826   C  CD2 . TRP A  1 129 ? 19.008 20.100  33.102  1.00 51.54 ? 109 TRP A CD2 1 
ATOM   827   N  NE1 . TRP A  1 129 ? 19.264 18.825  34.928  1.00 46.51 ? 109 TRP A NE1 1 
ATOM   828   C  CE2 . TRP A  1 129 ? 19.554 18.889  33.590  1.00 50.22 ? 109 TRP A CE2 1 
ATOM   829   C  CE3 . TRP A  1 129 ? 19.163 20.415  31.742  1.00 49.18 ? 109 TRP A CE3 1 
ATOM   830   C  CZ2 . TRP A  1 129 ? 20.251 17.977  32.760  1.00 53.52 ? 109 TRP A CZ2 1 
ATOM   831   C  CZ3 . TRP A  1 129 ? 19.863 19.515  30.915  1.00 50.72 ? 109 TRP A CZ3 1 
ATOM   832   C  CH2 . TRP A  1 129 ? 20.394 18.309  31.429  1.00 52.28 ? 109 TRP A CH2 1 
ATOM   833   N  N   . PRO A  1 130 ? 14.978 20.027  35.078  1.00 55.71 ? 110 PRO A N   1 
ATOM   834   C  CA  . PRO A  1 130 ? 14.327 19.336  36.209  1.00 56.37 ? 110 PRO A CA  1 
ATOM   835   C  C   . PRO A  1 130 ? 15.253 18.512  37.131  1.00 57.60 ? 110 PRO A C   1 
ATOM   836   O  O   . PRO A  1 130 ? 16.308 18.036  36.703  1.00 57.62 ? 110 PRO A O   1 
ATOM   837   C  CB  . PRO A  1 130 ? 13.315 18.423  35.514  1.00 56.05 ? 110 PRO A CB  1 
ATOM   838   C  CG  . PRO A  1 130 ? 13.916 18.137  34.143  1.00 55.96 ? 110 PRO A CG  1 
ATOM   839   C  CD  . PRO A  1 130 ? 14.858 19.269  33.813  1.00 54.64 ? 110 PRO A CD  1 
ATOM   840   N  N   . ASP A  1 131 ? 14.831 18.344  38.391  1.00 59.13 ? 111 ASP A N   1 
ATOM   841   C  CA  . ASP A  1 131 ? 15.536 17.474  39.363  1.00 58.75 ? 111 ASP A CA  1 
ATOM   842   C  C   . ASP A  1 131 ? 15.302 15.976  39.063  1.00 58.91 ? 111 ASP A C   1 
ATOM   843   O  O   . ASP A  1 131 ? 16.011 15.111  39.571  1.00 58.48 ? 111 ASP A O   1 
ATOM   844   C  CB  . ASP A  1 131 ? 15.105 17.810  40.802  1.00 57.65 ? 111 ASP A CB  1 
ATOM   845   N  N   . THR A  1 132 ? 14.310 15.687  38.225  1.00 58.53 ? 112 THR A N   1 
ATOM   846   C  CA  . THR A  1 132 ? 13.926 14.323  37.888  1.00 58.04 ? 112 THR A CA  1 
ATOM   847   C  C   . THR A  1 132 ? 14.812 13.665  36.808  1.00 57.96 ? 112 THR A C   1 
ATOM   848   O  O   . THR A  1 132 ? 14.671 12.470  36.531  1.00 57.71 ? 112 THR A O   1 
ATOM   849   C  CB  . THR A  1 132 ? 12.457 14.300  37.413  1.00 58.21 ? 112 THR A CB  1 
ATOM   850   O  OG1 . THR A  1 132 ? 12.329 15.059  36.209  1.00 58.00 ? 112 THR A OG1 1 
ATOM   851   C  CG2 . THR A  1 132 ? 11.546 14.898  38.476  1.00 57.14 ? 112 THR A CG2 1 
ATOM   852   N  N   . ILE A  1 133 ? 15.702 14.436  36.182  1.00 56.19 ? 113 ILE A N   1 
ATOM   853   C  CA  . ILE A  1 133 ? 16.690 13.863  35.270  1.00 54.47 ? 113 ILE A CA  1 
ATOM   854   C  C   . ILE A  1 133 ? 18.115 14.052  35.829  1.00 52.98 ? 113 ILE A C   1 
ATOM   855   O  O   . ILE A  1 133 ? 18.373 15.032  36.558  1.00 53.21 ? 113 ILE A O   1 
ATOM   856   C  CB  . ILE A  1 133 ? 16.604 14.421  33.800  1.00 53.98 ? 113 ILE A CB  1 
ATOM   857   C  CG1 . ILE A  1 133 ? 17.035 15.886  33.717  1.00 52.22 ? 113 ILE A CG1 1 
ATOM   858   C  CG2 . ILE A  1 133 ? 15.212 14.217  33.184  1.00 50.84 ? 113 ILE A CG2 1 
ATOM   859   C  CD1 . ILE A  1 133 ? 17.024 16.400  32.281  1.00 56.61 ? 113 ILE A CD1 1 
ATOM   860   N  N   . PRO A  1 134 ? 19.040 13.119  35.479  1.00 48.54 ? 114 PRO A N   1 
ATOM   861   C  CA  . PRO A  1 134 ? 20.410 13.211  35.958  1.00 47.71 ? 114 PRO A CA  1 
ATOM   862   C  C   . PRO A  1 134 ? 21.192 14.387  35.330  1.00 48.52 ? 114 PRO A C   1 
ATOM   863   O  O   . PRO A  1 134 ? 20.996 14.727  34.146  1.00 46.66 ? 114 PRO A O   1 
ATOM   864   C  CB  . PRO A  1 134 ? 21.036 11.855  35.570  1.00 47.69 ? 114 PRO A CB  1 
ATOM   865   C  CG  . PRO A  1 134 ? 19.987 11.066  34.890  1.00 44.81 ? 114 PRO A CG  1 
ATOM   866   C  CD  . PRO A  1 134 ? 18.833 11.952  34.598  1.00 46.48 ? 114 PRO A CD  1 
ATOM   867   N  N   . LEU A  1 135 ? 22.069 14.987  36.142  1.00 49.39 ? 115 LEU A N   1 
ATOM   868   C  CA  . LEU A  1 135 ? 22.798 16.202  35.771  1.00 50.34 ? 115 LEU A CA  1 
ATOM   869   C  C   . LEU A  1 135 ? 23.743 15.906  34.612  1.00 48.19 ? 115 LEU A C   1 
ATOM   870   O  O   . LEU A  1 135 ? 23.999 16.782  33.790  1.00 46.85 ? 115 LEU A O   1 
ATOM   871   C  CB  . LEU A  1 135 ? 23.579 16.793  36.979  1.00 52.06 ? 115 LEU A CB  1 
ATOM   872   C  CG  . LEU A  1 135 ? 22.858 17.745  37.944  1.00 57.40 ? 115 LEU A CG  1 
ATOM   873   C  CD1 . LEU A  1 135 ? 23.782 18.148  39.093  1.00 61.84 ? 115 LEU A CD1 1 
ATOM   874   C  CD2 . LEU A  1 135 ? 22.329 18.990  37.248  1.00 58.47 ? 115 LEU A CD2 1 
ATOM   875   N  N   . SER A  1 136 ? 24.218 14.659  34.551  1.00 48.27 ? 116 SER A N   1 
ATOM   876   C  CA  . SER A  1 136 ? 25.154 14.180  33.509  1.00 47.20 ? 116 SER A CA  1 
ATOM   877   C  C   . SER A  1 136 ? 24.584 14.131  32.089  1.00 45.70 ? 116 SER A C   1 
ATOM   878   O  O   . SER A  1 136 ? 25.357 14.026  31.115  1.00 44.73 ? 116 SER A O   1 
ATOM   879   C  CB  . SER A  1 136 ? 25.719 12.806  33.903  1.00 49.34 ? 116 SER A CB  1 
ATOM   880   O  OG  . SER A  1 136 ? 24.720 12.008  34.540  1.00 48.65 ? 116 SER A OG  1 
ATOM   881   N  N   . LEU A  1 137 ? 23.259 14.229  31.950  1.00 44.27 ? 117 LEU A N   1 
ATOM   882   C  CA  . LEU A  1 137 ? 22.626 14.433  30.625  1.00 44.38 ? 117 LEU A CA  1 
ATOM   883   C  C   . LEU A  1 137 ? 23.038 15.712  29.949  1.00 42.09 ? 117 LEU A C   1 
ATOM   884   O  O   . LEU A  1 137 ? 22.905 15.847  28.733  1.00 41.75 ? 117 LEU A O   1 
ATOM   885   C  CB  . LEU A  1 137 ? 21.097 14.441  30.709  1.00 46.38 ? 117 LEU A CB  1 
ATOM   886   C  CG  . LEU A  1 137 ? 20.350 13.138  30.976  1.00 47.76 ? 117 LEU A CG  1 
ATOM   887   C  CD1 . LEU A  1 137 ? 18.984 13.230  30.306  1.00 49.81 ? 117 LEU A CD1 1 
ATOM   888   C  CD2 . LEU A  1 137 ? 21.121 11.922  30.465  1.00 50.79 ? 117 LEU A CD2 1 
ATOM   889   N  N   . ALA A  1 138 ? 23.513 16.663  30.738  1.00 42.23 ? 118 ALA A N   1 
ATOM   890   C  CA  . ALA A  1 138 ? 24.034 17.923  30.207  1.00 43.69 ? 118 ALA A CA  1 
ATOM   891   C  C   . ALA A  1 138 ? 25.325 17.708  29.401  1.00 43.31 ? 118 ALA A C   1 
ATOM   892   O  O   . ALA A  1 138 ? 25.782 18.595  28.670  1.00 45.57 ? 118 ALA A O   1 
ATOM   893   C  CB  . ALA A  1 138 ? 24.255 18.941  31.362  1.00 44.47 ? 118 ALA A CB  1 
ATOM   894   N  N   . LEU A  1 139 ? 25.901 16.518  29.543  1.00 43.77 ? 119 LEU A N   1 
ATOM   895   C  CA  . LEU A  1 139 ? 27.088 16.111  28.810  1.00 44.00 ? 119 LEU A CA  1 
ATOM   896   C  C   . LEU A  1 139 ? 26.778 15.115  27.694  1.00 44.23 ? 119 LEU A C   1 
ATOM   897   O  O   . LEU A  1 139 ? 27.694 14.693  27.002  1.00 48.30 ? 119 LEU A O   1 
ATOM   898   C  CB  . LEU A  1 139 ? 28.067 15.463  29.781  1.00 43.84 ? 119 LEU A CB  1 
ATOM   899   C  CG  . LEU A  1 139 ? 28.599 16.285  30.947  1.00 34.93 ? 119 LEU A CG  1 
ATOM   900   C  CD1 . LEU A  1 139 ? 29.349 15.354  31.900  1.00 38.50 ? 119 LEU A CD1 1 
ATOM   901   C  CD2 . LEU A  1 139 ? 29.474 17.371  30.394  1.00 32.43 ? 119 LEU A CD2 1 
ATOM   902   N  N   . GLY A  1 140 ? 25.495 14.763  27.528  1.00 45.42 ? 120 GLY A N   1 
ATOM   903   C  CA  . GLY A  1 140 ? 25.044 13.738  26.581  1.00 43.99 ? 120 GLY A CA  1 
ATOM   904   C  C   . GLY A  1 140 ? 23.824 14.201  25.819  1.00 43.87 ? 120 GLY A C   1 
ATOM   905   O  O   . GLY A  1 140 ? 23.865 15.221  25.111  1.00 44.19 ? 120 GLY A O   1 
ATOM   906   N  N   . THR A  1 141 ? 22.738 13.466  25.995  1.00 45.99 ? 121 THR A N   1 
ATOM   907   C  CA  . THR A  1 141 ? 21.461 13.691  25.290  1.00 47.11 ? 121 THR A CA  1 
ATOM   908   C  C   . THR A  1 141 ? 20.962 15.152  25.245  1.00 46.08 ? 121 THR A C   1 
ATOM   909   O  O   . THR A  1 141 ? 20.413 15.582  24.223  1.00 46.82 ? 121 THR A O   1 
ATOM   910   C  CB  . THR A  1 141 ? 20.321 12.782  25.882  1.00 46.73 ? 121 THR A CB  1 
ATOM   911   O  OG1 . THR A  1 141 ? 20.692 11.396  25.776  1.00 51.39 ? 121 THR A OG1 1 
ATOM   912   C  CG2 . THR A  1 141 ? 19.005 13.011  25.138  1.00 48.60 ? 121 THR A CG2 1 
ATOM   913   N  N   . VAL A  1 142 ? 21.151 15.897  26.337  1.00 45.18 ? 122 VAL A N   1 
ATOM   914   C  CA  . VAL A  1 142 ? 20.750 17.323  26.407  1.00 44.41 ? 122 VAL A CA  1 
ATOM   915   C  C   . VAL A  1 142 ? 22.024 18.138  26.591  1.00 43.71 ? 122 VAL A C   1 
ATOM   916   O  O   . VAL A  1 142 ? 22.147 19.002  27.455  1.00 45.25 ? 122 VAL A O   1 
ATOM   917   C  CB  . VAL A  1 142 ? 19.725 17.593  27.531  1.00 41.40 ? 122 VAL A CB  1 
ATOM   918   C  CG1 . VAL A  1 142 ? 19.081 18.983  27.375  1.00 44.41 ? 122 VAL A CG1 1 
ATOM   919   C  CG2 . VAL A  1 142 ? 18.685 16.511  27.538  1.00 39.55 ? 122 VAL A CG2 1 
ATOM   920   N  N   . GLY A  1 143 ? 22.971 17.831  25.735  1.00 43.93 ? 123 GLY A N   1 
ATOM   921   C  CA  . GLY A  1 143 ? 24.257 18.442  25.747  1.00 42.97 ? 123 GLY A CA  1 
ATOM   922   C  C   . GLY A  1 143 ? 24.787 18.310  24.361  1.00 40.98 ? 123 GLY A C   1 
ATOM   923   O  O   . GLY A  1 143 ? 24.038 18.266  23.411  1.00 42.36 ? 123 GLY A O   1 
ATOM   924   N  N   . MET A  1 144 ? 26.088 18.189  24.260  1.00 43.98 ? 124 MET A N   1 
ATOM   925   C  CA  . MET A  1 144 ? 26.794 18.314  22.984  1.00 44.28 ? 124 MET A CA  1 
ATOM   926   C  C   . MET A  1 144 ? 26.476 17.228  21.919  1.00 43.29 ? 124 MET A C   1 
ATOM   927   O  O   . MET A  1 144 ? 26.303 17.544  20.732  1.00 44.47 ? 124 MET A O   1 
ATOM   928   C  CB  . MET A  1 144 ? 28.315 18.445  23.301  1.00 45.16 ? 124 MET A CB  1 
ATOM   929   C  CG  . MET A  1 144 ? 29.212 18.664  22.108  1.00 49.26 ? 124 MET A CG  1 
ATOM   930   S  SD  . MET A  1 144 ? 29.685 17.113  21.309  1.00 56.23 ? 124 MET A SD  1 
ATOM   931   C  CE  . MET A  1 144 ? 30.969 16.348  22.345  1.00 59.65 ? 124 MET A CE  1 
ATOM   932   N  N   . PRO A  1 145 ? 26.495 15.953  22.309  1.00 42.73 ? 125 PRO A N   1 
ATOM   933   C  CA  . PRO A  1 145 ? 26.084 14.881  21.399  1.00 41.15 ? 125 PRO A CA  1 
ATOM   934   C  C   . PRO A  1 145 ? 24.635 14.918  20.906  1.00 38.62 ? 125 PRO A C   1 
ATOM   935   O  O   . PRO A  1 145 ? 24.363 14.523  19.786  1.00 39.33 ? 125 PRO A O   1 
ATOM   936   C  CB  . PRO A  1 145 ? 26.316 13.594  22.240  1.00 43.37 ? 125 PRO A CB  1 
ATOM   937   C  CG  . PRO A  1 145 ? 27.261 13.956  23.327  1.00 39.96 ? 125 PRO A CG  1 
ATOM   938   C  CD  . PRO A  1 145 ? 26.951 15.416  23.618  1.00 45.15 ? 125 PRO A CD  1 
ATOM   939   N  N   . GLY A  1 146 ? 23.699 15.317  21.751  1.00 38.73 ? 126 GLY A N   1 
ATOM   940   C  CA  . GLY A  1 146 ? 22.322 15.552  21.311  1.00 38.38 ? 126 GLY A CA  1 
ATOM   941   C  C   . GLY A  1 146 ? 22.190 16.709  20.332  1.00 37.30 ? 126 GLY A C   1 
ATOM   942   O  O   . GLY A  1 146 ? 21.413 16.646  19.398  1.00 37.78 ? 126 GLY A O   1 
ATOM   943   N  N   . LEU A  1 147 ? 22.959 17.769  20.553  1.00 37.07 ? 127 LEU A N   1 
ATOM   944   C  CA  . LEU A  1 147 ? 23.009 18.883  19.665  1.00 37.52 ? 127 LEU A CA  1 
ATOM   945   C  C   . LEU A  1 147 ? 23.628 18.504  18.315  1.00 41.06 ? 127 LEU A C   1 
ATOM   946   O  O   . LEU A  1 147 ? 23.218 19.044  17.254  1.00 44.52 ? 127 LEU A O   1 
ATOM   947   C  CB  . LEU A  1 147 ? 23.799 20.017  20.320  1.00 38.52 ? 127 LEU A CB  1 
ATOM   948   C  CG  . LEU A  1 147 ? 23.088 20.778  21.440  1.00 40.54 ? 127 LEU A CG  1 
ATOM   949   C  CD1 . LEU A  1 147 ? 24.012 21.783  22.122  1.00 35.99 ? 127 LEU A CD1 1 
ATOM   950   C  CD2 . LEU A  1 147 ? 21.791 21.439  20.942  1.00 42.16 ? 127 LEU A CD2 1 
ATOM   951   N  N   . THR A  1 148 ? 24.627 17.619  18.360  1.00 39.63 ? 128 THR A N   1 
ATOM   952   C  CA  . THR A  1 148 ? 25.260 17.078  17.163  1.00 40.08 ? 128 THR A CA  1 
ATOM   953   C  C   . THR A  1 148 ? 24.253 16.291  16.307  1.00 41.53 ? 128 THR A C   1 
ATOM   954   O  O   . THR A  1 148 ? 24.098 16.562  15.102  1.00 40.85 ? 128 THR A O   1 
ATOM   955   C  CB  . THR A  1 148 ? 26.414 16.180  17.560  1.00 39.59 ? 128 THR A CB  1 
ATOM   956   O  OG1 . THR A  1 148 ? 27.261 16.867  18.468  1.00 39.19 ? 128 THR A OG1 1 
ATOM   957   C  CG2 . THR A  1 148 ? 27.234 15.804  16.374  1.00 44.21 ? 128 THR A CG2 1 
ATOM   958   N  N   . ALA A  1 149 ? 23.574 15.332  16.942  1.00 41.28 ? 129 ALA A N   1 
ATOM   959   C  CA  . ALA A  1 149 ? 22.398 14.618  16.336  1.00 41.02 ? 129 ALA A CA  1 
ATOM   960   C  C   . ALA A  1 149 ? 21.334 15.535  15.779  1.00 38.90 ? 129 ALA A C   1 
ATOM   961   O  O   . ALA A  1 149 ? 20.937 15.428  14.625  1.00 38.87 ? 129 ALA A O   1 
ATOM   962   C  CB  . ALA A  1 149 ? 21.768 13.722  17.333  1.00 41.10 ? 129 ALA A CB  1 
ATOM   963   N  N   . TYR A  1 150 ? 20.870 16.440  16.629  1.00 38.85 ? 130 TYR A N   1 
ATOM   964   C  CA  . TYR A  1 150 ? 19.809 17.367  16.261  1.00 36.40 ? 130 TYR A CA  1 
ATOM   965   C  C   . TYR A  1 150 ? 20.195 18.167  15.008  1.00 36.94 ? 130 TYR A C   1 
ATOM   966   O  O   . TYR A  1 150 ? 19.451 18.203  14.045  1.00 38.11 ? 130 TYR A O   1 
ATOM   967   C  CB  . TYR A  1 150 ? 19.491 18.265  17.479  1.00 35.39 ? 130 TYR A CB  1 
ATOM   968   C  CG  . TYR A  1 150 ? 18.393 19.313  17.355  1.00 35.67 ? 130 TYR A CG  1 
ATOM   969   C  CD1 . TYR A  1 150 ? 17.148 19.160  17.990  1.00 38.85 ? 130 TYR A CD1 1 
ATOM   970   C  CD2 . TYR A  1 150 ? 18.610 20.489  16.631  1.00 44.15 ? 130 TYR A CD2 1 
ATOM   971   C  CE1 . TYR A  1 150 ? 16.129 20.169  17.900  1.00 36.16 ? 130 TYR A CE1 1 
ATOM   972   C  CE2 . TYR A  1 150 ? 17.625 21.510  16.540  1.00 34.78 ? 130 TYR A CE2 1 
ATOM   973   C  CZ  . TYR A  1 150 ? 16.382 21.357  17.175  1.00 44.92 ? 130 TYR A CZ  1 
ATOM   974   O  OH  . TYR A  1 150 ? 15.432 22.421  17.067  1.00 41.23 ? 130 TYR A OH  1 
ATOM   975   N  N   . PHE A  1 151 ? 21.351 18.821  15.010  1.00 37.64 ? 131 PHE A N   1 
ATOM   976   C  CA  . PHE A  1 151 ? 21.651 19.762  13.922  1.00 35.84 ? 131 PHE A CA  1 
ATOM   977   C  C   . PHE A  1 151 ? 22.114 19.022  12.701  1.00 35.85 ? 131 PHE A C   1 
ATOM   978   O  O   . PHE A  1 151 ? 21.821 19.408  11.603  1.00 37.49 ? 131 PHE A O   1 
ATOM   979   C  CB  . PHE A  1 151 ? 22.676 20.830  14.348  1.00 38.36 ? 131 PHE A CB  1 
ATOM   980   C  CG  . PHE A  1 151 ? 22.106 21.944  15.188  1.00 34.06 ? 131 PHE A CG  1 
ATOM   981   C  CD1 . PHE A  1 151 ? 21.143 22.794  14.673  1.00 38.45 ? 131 PHE A CD1 1 
ATOM   982   C  CD2 . PHE A  1 151 ? 22.546 22.145  16.504  1.00 37.93 ? 131 PHE A CD2 1 
ATOM   983   C  CE1 . PHE A  1 151 ? 20.582 23.833  15.453  1.00 37.86 ? 131 PHE A CE1 1 
ATOM   984   C  CE2 . PHE A  1 151 ? 21.983 23.171  17.310  1.00 33.11 ? 131 PHE A CE2 1 
ATOM   985   C  CZ  . PHE A  1 151 ? 21.016 24.009  16.773  1.00 35.32 ? 131 PHE A CZ  1 
ATOM   986   N  N   . GLY A  1 152 ? 22.837 17.933  12.889  1.00 41.06 ? 132 GLY A N   1 
ATOM   987   C  CA  . GLY A  1 152 ? 23.287 17.118  11.776  1.00 41.90 ? 132 GLY A CA  1 
ATOM   988   C  C   . GLY A  1 152 ? 22.090 16.592  11.035  1.00 41.32 ? 132 GLY A C   1 
ATOM   989   O  O   . GLY A  1 152 ? 22.005 16.710  9.831   1.00 44.07 ? 132 GLY A O   1 
ATOM   990   N  N   . LEU A  1 153 ? 21.142 16.055  11.776  1.00 42.21 ? 133 LEU A N   1 
ATOM   991   C  CA  . LEU A  1 153 ? 19.928 15.518  11.174  1.00 43.67 ? 133 LEU A CA  1 
ATOM   992   C  C   . LEU A  1 153 ? 18.965 16.569  10.631  1.00 42.31 ? 133 LEU A C   1 
ATOM   993   O  O   . LEU A  1 153 ? 18.501 16.461  9.502   1.00 43.33 ? 133 LEU A O   1 
ATOM   994   C  CB  . LEU A  1 153 ? 19.213 14.628  12.198  1.00 44.86 ? 133 LEU A CB  1 
ATOM   995   C  CG  . LEU A  1 153 ? 18.043 13.747  11.723  1.00 44.63 ? 133 LEU A CG  1 
ATOM   996   C  CD1 . LEU A  1 153 ? 18.510 12.675  10.752  1.00 42.51 ? 133 LEU A CD1 1 
ATOM   997   C  CD2 . LEU A  1 153 ? 17.381 13.125  12.940  1.00 44.84 ? 133 LEU A CD2 1 
ATOM   998   N  N   . LEU A  1 154 ? 18.662 17.591  11.426  1.00 42.14 ? 134 LEU A N   1 
ATOM   999   C  CA  . LEU A  1 154 ? 17.630 18.518  11.053  1.00 44.70 ? 134 LEU A CA  1 
ATOM   1000  C  C   . LEU A  1 154 ? 18.120 19.622  10.118  1.00 47.52 ? 134 LEU A C   1 
ATOM   1001  O  O   . LEU A  1 154 ? 17.355 20.015  9.235   1.00 48.45 ? 134 LEU A O   1 
ATOM   1002  C  CB  . LEU A  1 154 ? 16.875 19.072  12.289  1.00 44.99 ? 134 LEU A CB  1 
ATOM   1003  C  CG  . LEU A  1 154 ? 16.186 18.029  13.211  1.00 41.39 ? 134 LEU A CG  1 
ATOM   1004  C  CD1 . LEU A  1 154 ? 15.273 18.721  14.222  1.00 35.89 ? 134 LEU A CD1 1 
ATOM   1005  C  CD2 . LEU A  1 154 ? 15.414 16.923  12.436  1.00 32.32 ? 134 LEU A CD2 1 
ATOM   1006  N  N   . GLU A  1 155 ? 19.360 20.109  10.270  1.00 47.72 ? 135 GLU A N   1 
ATOM   1007  C  CA  . GLU A  1 155 ? 19.869 21.158  9.382   1.00 49.05 ? 135 GLU A CA  1 
ATOM   1008  C  C   . GLU A  1 155 ? 20.734 20.655  8.235   1.00 49.56 ? 135 GLU A C   1 
ATOM   1009  O  O   . GLU A  1 155 ? 20.754 21.279  7.187   1.00 49.20 ? 135 GLU A O   1 
ATOM   1010  C  CB  . GLU A  1 155 ? 20.690 22.211  10.138  1.00 51.11 ? 135 GLU A CB  1 
ATOM   1011  C  CG  . GLU A  1 155 ? 20.049 22.776  11.404  1.00 61.57 ? 135 GLU A CG  1 
ATOM   1012  C  CD  . GLU A  1 155 ? 19.088 23.945  11.168  1.00 74.16 ? 135 GLU A CD  1 
ATOM   1013  O  OE1 . GLU A  1 155 ? 19.574 24.980  10.647  1.00 81.61 ? 135 GLU A OE1 1 
ATOM   1014  O  OE2 . GLU A  1 155 ? 17.877 23.838  11.533  1.00 70.50 ? 135 GLU A OE2 1 
ATOM   1015  N  N   . ILE A  1 156 ? 21.507 19.593  8.442   1.00 50.52 ? 136 ILE A N   1 
ATOM   1016  C  CA  . ILE A  1 156 ? 22.492 19.156  7.428   1.00 52.03 ? 136 ILE A CA  1 
ATOM   1017  C  C   . ILE A  1 156 ? 21.917 18.056  6.530   1.00 53.85 ? 136 ILE A C   1 
ATOM   1018  O  O   . ILE A  1 156 ? 21.983 18.174  5.305   1.00 56.38 ? 136 ILE A O   1 
ATOM   1019  C  CB  . ILE A  1 156 ? 23.919 18.831  8.021   1.00 48.88 ? 136 ILE A CB  1 
ATOM   1020  C  CG1 . ILE A  1 156 ? 24.793 20.087  8.079   1.00 55.26 ? 136 ILE A CG1 1 
ATOM   1021  C  CG2 . ILE A  1 156 ? 24.708 17.922  7.106   1.00 49.28 ? 136 ILE A CG2 1 
ATOM   1022  C  CD1 . ILE A  1 156 ? 24.467 21.008  9.086   1.00 58.66 ? 136 ILE A CD1 1 
ATOM   1023  N  N   . CYS A  1 157 ? 21.350 17.000  7.109   1.00 54.60 ? 137 CYS A N   1 
ATOM   1024  C  CA  . CYS A  1 157 ? 20.555 16.067  6.295   1.00 56.67 ? 137 CYS A CA  1 
ATOM   1025  C  C   . CYS A  1 157 ? 19.294 16.741  5.834   1.00 56.16 ? 137 CYS A C   1 
ATOM   1026  O  O   . CYS A  1 157 ? 18.836 16.469  4.738   1.00 57.53 ? 137 CYS A O   1 
ATOM   1027  C  CB  . CYS A  1 157 ? 20.120 14.825  7.055   1.00 58.39 ? 137 CYS A CB  1 
ATOM   1028  S  SG  . CYS A  1 157 ? 21.411 13.660  7.420   1.00 62.37 ? 137 CYS A SG  1 
ATOM   1029  N  N   . GLY A  1 158 ? 18.716 17.587  6.687   1.00 56.11 ? 138 GLY A N   1 
ATOM   1030  C  CA  . GLY A  1 158 ? 17.492 18.326  6.363   1.00 55.65 ? 138 GLY A CA  1 
ATOM   1031  C  C   . GLY A  1 158 ? 16.269 17.429  6.227   1.00 56.24 ? 138 GLY A C   1 
ATOM   1032  O  O   . GLY A  1 158 ? 15.434 17.649  5.347   1.00 56.23 ? 138 GLY A O   1 
ATOM   1033  N  N   . VAL A  1 159 ? 16.153 16.417  7.085   1.00 57.15 ? 139 VAL A N   1 
ATOM   1034  C  CA  . VAL A  1 159 ? 15.050 15.476  6.933   1.00 59.00 ? 139 VAL A CA  1 
ATOM   1035  C  C   . VAL A  1 159 ? 13.767 16.214  7.170   1.00 60.79 ? 139 VAL A C   1 
ATOM   1036  O  O   . VAL A  1 159 ? 13.711 17.095  8.029   1.00 60.14 ? 139 VAL A O   1 
ATOM   1037  C  CB  . VAL A  1 159 ? 15.095 14.212  7.857   1.00 57.77 ? 139 VAL A CB  1 
ATOM   1038  C  CG1 . VAL A  1 159 ? 16.250 13.346  7.480   1.00 56.13 ? 139 VAL A CG1 1 
ATOM   1039  C  CG2 . VAL A  1 159 ? 15.109 14.581  9.331   1.00 55.88 ? 139 VAL A CG2 1 
ATOM   1040  N  N   . LYS A  1 160 ? 12.760 15.850  6.368   1.00 64.54 ? 140 LYS A N   1 
ATOM   1041  C  CA  . LYS A  1 160 ? 11.426 16.456  6.389   1.00 65.60 ? 140 LYS A CA  1 
ATOM   1042  C  C   . LYS A  1 160 ? 10.420 15.513  7.046   1.00 65.31 ? 140 LYS A C   1 
ATOM   1043  O  O   . LYS A  1 160 ? 9.578  15.966  7.823   1.00 67.48 ? 140 LYS A O   1 
ATOM   1044  C  CB  . LYS A  1 160 ? 10.974 16.808  4.953   1.00 66.65 ? 140 LYS A CB  1 
ATOM   1045  C  CG  . LYS A  1 160 ? 11.827 17.904  4.256   1.00 69.64 ? 140 LYS A CG  1 
ATOM   1046  C  CD  . LYS A  1 160 ? 11.505 19.304  4.833   1.00 73.32 ? 140 LYS A CD  1 
ATOM   1047  C  CE  . LYS A  1 160 ? 12.750 20.204  4.993   1.00 74.72 ? 140 LYS A CE  1 
ATOM   1048  N  NZ  . LYS A  1 160 ? 12.710 20.929  6.310   1.00 67.94 ? 140 LYS A NZ  1 
ATOM   1049  N  N   . GLY A  1 161 ? 10.521 14.215  6.750   1.00 62.50 ? 141 GLY A N   1 
ATOM   1050  C  CA  . GLY A  1 161 ? 9.518  13.240  7.179   1.00 61.46 ? 141 GLY A CA  1 
ATOM   1051  C  C   . GLY A  1 161 ? 9.175  12.346  6.005   1.00 60.64 ? 141 GLY A C   1 
ATOM   1052  O  O   . GLY A  1 161 ? 9.121  12.808  4.859   1.00 61.32 ? 141 GLY A O   1 
ATOM   1053  N  N   . GLY A  1 162 ? 8.979  11.061  6.268   1.00 57.61 ? 142 GLY A N   1 
ATOM   1054  C  CA  . GLY A  1 162 ? 8.872  10.094  5.184   1.00 55.59 ? 142 GLY A CA  1 
ATOM   1055  C  C   . GLY A  1 162 ? 10.194 9.500   4.716   1.00 54.95 ? 142 GLY A C   1 
ATOM   1056  O  O   . GLY A  1 162 ? 10.202 8.394   4.164   1.00 55.63 ? 142 GLY A O   1 
ATOM   1057  N  N   . GLU A  1 163 ? 11.305 10.213  4.941   1.00 53.51 ? 143 GLU A N   1 
ATOM   1058  C  CA  . GLU A  1 163 ? 12.653 9.777   4.495   1.00 52.37 ? 143 GLU A CA  1 
ATOM   1059  C  C   . GLU A  1 163 ? 13.162 8.501   5.172   1.00 47.27 ? 143 GLU A C   1 
ATOM   1060  O  O   . GLU A  1 163 ? 12.731 8.175   6.268   1.00 43.04 ? 143 GLU A O   1 
ATOM   1061  C  CB  . GLU A  1 163 ? 13.672 10.890  4.746   1.00 52.96 ? 143 GLU A CB  1 
ATOM   1062  C  CG  . GLU A  1 163 ? 13.757 11.908  3.609   1.00 61.94 ? 143 GLU A CG  1 
ATOM   1063  C  CD  . GLU A  1 163 ? 13.581 13.342  4.057   1.00 68.63 ? 143 GLU A CD  1 
ATOM   1064  O  OE1 . GLU A  1 163 ? 13.179 13.556  5.230   1.00 75.42 ? 143 GLU A OE1 1 
ATOM   1065  O  OE2 . GLU A  1 163 ? 13.803 14.249  3.212   1.00 66.69 ? 143 GLU A OE2 1 
ATOM   1066  N  N   . THR A  1 164 ? 14.072 7.793   4.499   1.00 45.64 ? 144 THR A N   1 
ATOM   1067  C  CA  . THR A  1 164 ? 14.812 6.663   5.103   1.00 45.00 ? 144 THR A CA  1 
ATOM   1068  C  C   . THR A  1 164 ? 16.234 7.075   5.407   1.00 43.44 ? 144 THR A C   1 
ATOM   1069  O  O   . THR A  1 164 ? 17.018 7.397   4.511   1.00 40.28 ? 144 THR A O   1 
ATOM   1070  C  CB  . THR A  1 164 ? 14.871 5.400   4.223   1.00 45.94 ? 144 THR A CB  1 
ATOM   1071  O  OG1 . THR A  1 164 ? 13.583 5.134   3.686   1.00 47.22 ? 144 THR A OG1 1 
ATOM   1072  C  CG2 . THR A  1 164 ? 15.317 4.186   5.028   1.00 45.68 ? 144 THR A CG2 1 
ATOM   1073  N  N   . VAL A  1 165 ? 16.530 7.051   6.703   1.00 43.80 ? 145 VAL A N   1 
ATOM   1074  C  CA  . VAL A  1 165 ? 17.773 7.521   7.263   1.00 43.24 ? 145 VAL A CA  1 
ATOM   1075  C  C   . VAL A  1 165 ? 18.595 6.311   7.665   1.00 40.74 ? 145 VAL A C   1 
ATOM   1076  O  O   . VAL A  1 165 ? 18.106 5.439   8.315   1.00 38.40 ? 145 VAL A O   1 
ATOM   1077  C  CB  . VAL A  1 165 ? 17.543 8.378   8.527   1.00 43.72 ? 145 VAL A CB  1 
ATOM   1078  C  CG1 . VAL A  1 165 ? 18.883 8.926   9.064   1.00 44.64 ? 145 VAL A CG1 1 
ATOM   1079  C  CG2 . VAL A  1 165 ? 16.589 9.512   8.246   1.00 42.47 ? 145 VAL A CG2 1 
ATOM   1080  N  N   . MET A  1 166 ? 19.853 6.292   7.256   1.00 40.40 ? 146 MET A N   1 
ATOM   1081  C  CA  . MET A  1 166 ? 20.809 5.350   7.746   1.00 40.80 ? 146 MET A CA  1 
ATOM   1082  C  C   . MET A  1 166 ? 21.660 6.026   8.822   1.00 39.12 ? 146 MET A C   1 
ATOM   1083  O  O   . MET A  1 166 ? 22.196 7.087   8.599   1.00 38.89 ? 146 MET A O   1 
ATOM   1084  C  CB  . MET A  1 166 ? 21.683 4.880   6.589   1.00 42.35 ? 146 MET A CB  1 
ATOM   1085  C  CG  . MET A  1 166 ? 22.928 4.088   7.026   1.00 54.00 ? 146 MET A CG  1 
ATOM   1086  S  SD  . MET A  1 166 ? 22.483 2.446   7.519   1.00 69.13 ? 146 MET A SD  1 
ATOM   1087  C  CE  . MET A  1 166 ? 23.797 2.128   8.691   1.00 61.33 ? 146 MET A CE  1 
ATOM   1088  N  N   . VAL A  1 167 ? 21.767 5.430   9.999   1.00 41.30 ? 147 VAL A N   1 
ATOM   1089  C  CA  . VAL A  1 167 ? 22.688 5.943   11.010  1.00 41.62 ? 147 VAL A CA  1 
ATOM   1090  C  C   . VAL A  1 167 ? 23.567 4.828   11.539  1.00 40.91 ? 147 VAL A C   1 
ATOM   1091  O  O   . VAL A  1 167 ? 23.103 3.769   11.867  1.00 41.42 ? 147 VAL A O   1 
ATOM   1092  C  CB  . VAL A  1 167 ? 21.958 6.720   12.167  1.00 43.27 ? 147 VAL A CB  1 
ATOM   1093  C  CG1 . VAL A  1 167 ? 20.949 5.934   12.837  1.00 45.29 ? 147 VAL A CG1 1 
ATOM   1094  C  CG2 . VAL A  1 167 ? 22.972 7.195   13.190  1.00 46.79 ? 147 VAL A CG2 1 
ATOM   1095  N  N   . ASN A  1 168 ? 24.861 5.071   11.545  1.00 41.84 ? 148 ASN A N   1 
ATOM   1096  C  CA  . ASN A  1 168 ? 25.814 4.139   12.025  1.00 44.48 ? 148 ASN A CA  1 
ATOM   1097  C  C   . ASN A  1 168 ? 26.377 4.656   13.386  1.00 48.12 ? 148 ASN A C   1 
ATOM   1098  O  O   . ASN A  1 168 ? 26.108 5.802   13.788  1.00 47.84 ? 148 ASN A O   1 
ATOM   1099  C  CB  . ASN A  1 168 ? 26.872 3.867   10.955  1.00 43.46 ? 148 ASN A CB  1 
ATOM   1100  C  CG  . ASN A  1 168 ? 27.671 5.107   10.550  1.00 43.52 ? 148 ASN A CG  1 
ATOM   1101  O  OD1 . ASN A  1 168 ? 27.742 6.119   11.272  1.00 37.66 ? 148 ASN A OD1 1 
ATOM   1102  N  ND2 . ASN A  1 168 ? 28.325 5.007   9.403   1.00 43.81 ? 148 ASN A ND2 1 
ATOM   1103  N  N   . ALA A  1 169 ? 27.149 3.799   14.077  1.00 49.12 ? 149 ALA A N   1 
ATOM   1104  C  CA  . ALA A  1 169 ? 27.435 3.918   15.534  1.00 45.68 ? 149 ALA A CA  1 
ATOM   1105  C  C   . ALA A  1 169 ? 26.167 4.385   16.263  1.00 44.49 ? 149 ALA A C   1 
ATOM   1106  O  O   . ALA A  1 169 ? 26.164 5.398   17.015  1.00 47.84 ? 149 ALA A O   1 
ATOM   1107  C  CB  . ALA A  1 169 ? 28.642 4.822   15.805  1.00 45.80 ? 149 ALA A CB  1 
ATOM   1108  N  N   . ALA A  1 170 ? 25.097 3.620   16.025  1.00 42.20 ? 150 ALA A N   1 
ATOM   1109  C  CA  . ALA A  1 170 ? 23.736 4.068   16.315  1.00 41.69 ? 150 ALA A CA  1 
ATOM   1110  C  C   . ALA A  1 170 ? 23.297 3.854   17.759  1.00 43.50 ? 150 ALA A C   1 
ATOM   1111  O  O   . ALA A  1 170 ? 22.215 4.275   18.123  1.00 47.49 ? 150 ALA A O   1 
ATOM   1112  C  CB  . ALA A  1 170 ? 22.749 3.443   15.314  1.00 37.43 ? 150 ALA A CB  1 
ATOM   1113  N  N   . ALA A  1 171 ? 24.130 3.188   18.565  1.00 46.53 ? 151 ALA A N   1 
ATOM   1114  C  CA  . ALA A  1 171 ? 23.914 3.062   20.009  1.00 48.59 ? 151 ALA A CA  1 
ATOM   1115  C  C   . ALA A  1 171 ? 24.885 3.960   20.745  1.00 49.46 ? 151 ALA A C   1 
ATOM   1116  O  O   . ALA A  1 171 ? 25.037 3.851   21.976  1.00 54.17 ? 151 ALA A O   1 
ATOM   1117  C  CB  . ALA A  1 171 ? 24.074 1.571   20.490  1.00 47.97 ? 151 ALA A CB  1 
ATOM   1118  N  N   . GLY A  1 172 ? 25.574 4.806   19.980  1.00 47.60 ? 152 GLY A N   1 
ATOM   1119  C  CA  . GLY A  1 172 ? 26.478 5.764   20.521  1.00 46.36 ? 152 GLY A CA  1 
ATOM   1120  C  C   . GLY A  1 172 ? 25.675 6.977   20.896  1.00 47.10 ? 152 GLY A C   1 
ATOM   1121  O  O   . GLY A  1 172 ? 24.523 7.137   20.493  1.00 48.38 ? 152 GLY A O   1 
ATOM   1122  N  N   . ALA A  1 173 ? 26.305 7.852   21.654  1.00 47.61 ? 153 ALA A N   1 
ATOM   1123  C  CA  . ALA A  1 173 ? 25.652 9.057   22.169  1.00 45.91 ? 153 ALA A CA  1 
ATOM   1124  C  C   . ALA A  1 173 ? 25.020 10.000  21.095  1.00 46.51 ? 153 ALA A C   1 
ATOM   1125  O  O   . ALA A  1 173 ? 23.973 10.637  21.334  1.00 47.08 ? 153 ALA A O   1 
ATOM   1126  C  CB  . ALA A  1 173 ? 26.674 9.826   23.022  1.00 44.59 ? 153 ALA A CB  1 
ATOM   1127  N  N   . VAL A  1 174 ? 25.664 10.112  19.929  1.00 46.20 ? 154 VAL A N   1 
ATOM   1128  C  CA  . VAL A  1 174 ? 25.126 10.907  18.824  1.00 43.17 ? 154 VAL A CA  1 
ATOM   1129  C  C   . VAL A  1 174 ? 24.060 10.070  18.135  1.00 43.53 ? 154 VAL A C   1 
ATOM   1130  O  O   . VAL A  1 174 ? 22.896 10.494  18.095  1.00 43.92 ? 154 VAL A O   1 
ATOM   1131  C  CB  . VAL A  1 174 ? 26.220 11.389  17.894  1.00 40.18 ? 154 VAL A CB  1 
ATOM   1132  C  CG1 . VAL A  1 174 ? 25.662 12.228  16.735  1.00 33.96 ? 154 VAL A CG1 1 
ATOM   1133  C  CG2 . VAL A  1 174 ? 27.204 12.225  18.678  1.00 42.49 ? 154 VAL A CG2 1 
ATOM   1134  N  N   . GLY A  1 175 ? 24.454 8.863   17.711  1.00 43.38 ? 155 GLY A N   1 
ATOM   1135  C  CA  . GLY A  1 175 ? 23.662 7.951   16.872  1.00 41.11 ? 155 GLY A CA  1 
ATOM   1136  C  C   . GLY A  1 175 ? 22.272 7.664   17.361  1.00 40.69 ? 155 GLY A C   1 
ATOM   1137  O  O   . GLY A  1 175 ? 21.322 7.604   16.595  1.00 42.59 ? 155 GLY A O   1 
ATOM   1138  N  N   . SER A  1 176 ? 22.153 7.451   18.655  1.00 41.66 ? 156 SER A N   1 
ATOM   1139  C  CA  . SER A  1 176 ? 20.912 7.010   19.243  1.00 40.58 ? 156 SER A CA  1 
ATOM   1140  C  C   . SER A  1 176 ? 19.934 8.135   19.404  1.00 38.82 ? 156 SER A C   1 
ATOM   1141  O  O   . SER A  1 176 ? 18.727 7.910   19.441  1.00 40.57 ? 156 SER A O   1 
ATOM   1142  C  CB  . SER A  1 176 ? 21.186 6.360   20.620  1.00 42.16 ? 156 SER A CB  1 
ATOM   1143  O  OG  . SER A  1 176 ? 21.868 7.259   21.455  1.00 35.68 ? 156 SER A OG  1 
ATOM   1144  N  N   . VAL A  1 177 ? 20.466 9.340   19.583  1.00 39.30 ? 157 VAL A N   1 
ATOM   1145  C  CA  . VAL A  1 177 ? 19.653 10.530  19.555  1.00 40.30 ? 157 VAL A CA  1 
ATOM   1146  C  C   . VAL A  1 177 ? 19.174 10.770  18.112  1.00 38.41 ? 157 VAL A C   1 
ATOM   1147  O  O   . VAL A  1 177 ? 18.017 11.017  17.907  1.00 40.67 ? 157 VAL A O   1 
ATOM   1148  C  CB  . VAL A  1 177 ? 20.360 11.797  20.142  1.00 42.42 ? 157 VAL A CB  1 
ATOM   1149  C  CG1 . VAL A  1 177 ? 19.342 12.965  20.215  1.00 46.03 ? 157 VAL A CG1 1 
ATOM   1150  C  CG2 . VAL A  1 177 ? 20.885 11.551  21.529  1.00 45.42 ? 157 VAL A CG2 1 
ATOM   1151  N  N   . VAL A  1 178 ? 20.061 10.682  17.128  1.00 38.98 ? 158 VAL A N   1 
ATOM   1152  C  CA  . VAL A  1 178 ? 19.708 10.863  15.712  1.00 38.08 ? 158 VAL A CA  1 
ATOM   1153  C  C   . VAL A  1 178 ? 18.505 10.000  15.288  1.00 39.66 ? 158 VAL A C   1 
ATOM   1154  O  O   . VAL A  1 178 ? 17.573 10.489  14.642  1.00 39.48 ? 158 VAL A O   1 
ATOM   1155  C  CB  . VAL A  1 178 ? 20.863 10.488  14.779  1.00 35.65 ? 158 VAL A CB  1 
ATOM   1156  C  CG1 . VAL A  1 178 ? 20.423 10.609  13.313  1.00 37.12 ? 158 VAL A CG1 1 
ATOM   1157  C  CG2 . VAL A  1 178 ? 22.033 11.343  15.022  1.00 39.44 ? 158 VAL A CG2 1 
ATOM   1158  N  N   . GLY A  1 179 ? 18.542 8.721   15.649  1.00 41.82 ? 159 GLY A N   1 
ATOM   1159  C  CA  . GLY A  1 179 ? 17.467 7.813   15.307  1.00 42.39 ? 159 GLY A CA  1 
ATOM   1160  C  C   . GLY A  1 179 ? 16.155 8.112   15.996  1.00 42.57 ? 159 GLY A C   1 
ATOM   1161  O  O   . GLY A  1 179 ? 15.077 7.993   15.396  1.00 44.90 ? 159 GLY A O   1 
ATOM   1162  N  N   . GLN A  1 180 ? 16.240 8.465   17.270  1.00 43.21 ? 160 GLN A N   1 
ATOM   1163  C  CA  . GLN A  1 180 ? 15.061 8.875   18.034  1.00 40.59 ? 160 GLN A CA  1 
ATOM   1164  C  C   . GLN A  1 180 ? 14.442 10.196  17.547  1.00 40.34 ? 160 GLN A C   1 
ATOM   1165  O  O   . GLN A  1 180 ? 13.237 10.329  17.540  1.00 42.56 ? 160 GLN A O   1 
ATOM   1166  C  CB  . GLN A  1 180 ? 15.408 8.936   19.521  1.00 41.08 ? 160 GLN A CB  1 
ATOM   1167  C  CG  . GLN A  1 180 ? 15.691 7.540   20.104  1.00 39.30 ? 160 GLN A CG  1 
ATOM   1168  C  CD  . GLN A  1 180 ? 15.889 7.544   21.573  1.00 33.54 ? 160 GLN A CD  1 
ATOM   1169  O  OE1 . GLN A  1 180 ? 14.962 7.239   22.329  1.00 47.54 ? 160 GLN A OE1 1 
ATOM   1170  N  NE2 . GLN A  1 180 ? 17.093 7.912   22.016  1.00 37.52 ? 160 GLN A NE2 1 
ATOM   1171  N  N   . ILE A  1 181 ? 15.243 11.155  17.113  1.00 39.76 ? 161 ILE A N   1 
ATOM   1172  C  CA  . ILE A  1 181 ? 14.685 12.357  16.466  1.00 40.59 ? 161 ILE A CA  1 
ATOM   1173  C  C   . ILE A  1 181 ? 14.056 12.051  15.100  1.00 41.20 ? 161 ILE A C   1 
ATOM   1174  O  O   . ILE A  1 181 ? 13.035 12.632  14.740  1.00 43.66 ? 161 ILE A O   1 
ATOM   1175  C  CB  . ILE A  1 181 ? 15.730 13.527  16.328  1.00 41.10 ? 161 ILE A CB  1 
ATOM   1176  C  CG1 . ILE A  1 181 ? 16.168 14.043  17.709  1.00 41.78 ? 161 ILE A CG1 1 
ATOM   1177  C  CG2 . ILE A  1 181 ? 15.154 14.706  15.498  1.00 39.78 ? 161 ILE A CG2 1 
ATOM   1178  C  CD1 . ILE A  1 181 ? 17.391 14.980  17.673  1.00 38.99 ? 161 ILE A CD1 1 
ATOM   1179  N  N   . ALA A  1 182 ? 14.659 11.156  14.333  1.00 40.36 ? 162 ALA A N   1 
ATOM   1180  C  CA  . ALA A  1 182 ? 14.121 10.819  13.024  1.00 40.12 ? 162 ALA A CA  1 
ATOM   1181  C  C   . ALA A  1 182 ? 12.807 10.084  13.158  1.00 41.27 ? 162 ALA A C   1 
ATOM   1182  O  O   . ALA A  1 182 ? 11.939 10.268  12.322  1.00 44.65 ? 162 ALA A O   1 
ATOM   1183  C  CB  . ALA A  1 182 ? 15.118 10.000  12.187  1.00 38.26 ? 162 ALA A CB  1 
ATOM   1184  N  N   . LYS A  1 183 ? 12.641 9.273   14.199  1.00 42.12 ? 163 LYS A N   1 
ATOM   1185  C  CA  . LYS A  1 183 ? 11.377 8.546   14.420  1.00 43.63 ? 163 LYS A CA  1 
ATOM   1186  C  C   . LYS A  1 183 ? 10.237 9.478   14.765  1.00 42.65 ? 163 LYS A C   1 
ATOM   1187  O  O   . LYS A  1 183 ? 9.140  9.312   14.238  1.00 43.95 ? 163 LYS A O   1 
ATOM   1188  C  CB  . LYS A  1 183 ? 11.502 7.475   15.529  1.00 43.31 ? 163 LYS A CB  1 
ATOM   1189  C  CG  . LYS A  1 183 ? 12.237 6.188   15.124  1.00 48.32 ? 163 LYS A CG  1 
ATOM   1190  C  CD  . LYS A  1 183 ? 11.771 5.587   13.805  1.00 48.49 ? 163 LYS A CD  1 
ATOM   1191  C  CE  . LYS A  1 183 ? 10.277 5.372   13.746  1.00 53.39 ? 163 LYS A CE  1 
ATOM   1192  N  NZ  . LYS A  1 183 ? 9.834  5.093   12.350  1.00 58.80 ? 163 LYS A NZ  1 
ATOM   1193  N  N   . LEU A  1 184 ? 10.492 10.441  15.652  1.00 43.37 ? 164 LEU A N   1 
ATOM   1194  C  CA  . LEU A  1 184 ? 9.518  11.503  15.960  1.00 44.32 ? 164 LEU A CA  1 
ATOM   1195  C  C   . LEU A  1 184 ? 9.387  12.600  14.868  1.00 45.91 ? 164 LEU A C   1 
ATOM   1196  O  O   . LEU A  1 184 ? 8.612  13.522  15.022  1.00 49.38 ? 164 LEU A O   1 
ATOM   1197  C  CB  . LEU A  1 184 ? 9.797  12.131  17.342  1.00 44.39 ? 164 LEU A CB  1 
ATOM   1198  C  CG  . LEU A  1 184 ? 10.916 13.170  17.526  1.00 47.45 ? 164 LEU A CG  1 
ATOM   1199  C  CD1 . LEU A  1 184 ? 10.403 14.607  17.536  1.00 49.20 ? 164 LEU A CD1 1 
ATOM   1200  C  CD2 . LEU A  1 184 ? 11.686 12.918  18.819  1.00 46.22 ? 164 LEU A CD2 1 
ATOM   1201  N  N   . LYS A  1 185 ? 10.133 12.514  13.775  1.00 47.79 ? 165 LYS A N   1 
ATOM   1202  C  CA  . LYS A  1 185 ? 9.803  13.276  12.572  1.00 48.41 ? 165 LYS A CA  1 
ATOM   1203  C  C   . LYS A  1 185 ? 9.204  12.340  11.518  1.00 48.19 ? 165 LYS A C   1 
ATOM   1204  O  O   . LYS A  1 185 ? 8.982  12.761  10.395  1.00 50.15 ? 165 LYS A O   1 
ATOM   1205  C  CB  . LYS A  1 185 ? 11.041 13.983  11.991  1.00 49.24 ? 165 LYS A CB  1 
ATOM   1206  C  CG  . LYS A  1 185 ? 11.749 14.967  12.923  1.00 50.88 ? 165 LYS A CG  1 
ATOM   1207  C  CD  . LYS A  1 185 ? 10.890 16.200  13.263  1.00 51.73 ? 165 LYS A CD  1 
ATOM   1208  C  CE  . LYS A  1 185 ? 11.653 17.125  14.225  1.00 51.76 ? 165 LYS A CE  1 
ATOM   1209  N  NZ  . LYS A  1 185 ? 10.807 18.057  15.014  1.00 48.80 ? 165 LYS A NZ  1 
ATOM   1210  N  N   . GLY A  1 186 ? 8.979  11.073  11.861  1.00 47.15 ? 166 GLY A N   1 
ATOM   1211  C  CA  . GLY A  1 186 ? 8.274  10.149  10.973  1.00 47.48 ? 166 GLY A CA  1 
ATOM   1212  C  C   . GLY A  1 186 ? 9.090  9.607   9.820   1.00 48.26 ? 166 GLY A C   1 
ATOM   1213  O  O   . GLY A  1 186 ? 8.629  9.572   8.681   1.00 49.60 ? 166 GLY A O   1 
ATOM   1214  N  N   . CYS A  1 187 ? 10.301 9.165   10.123  1.00 48.01 ? 167 CYS A N   1 
ATOM   1215  C  CA  . CYS A  1 187 ? 11.187 8.541   9.145   1.00 48.32 ? 167 CYS A CA  1 
ATOM   1216  C  C   . CYS A  1 187 ? 11.404 7.076   9.456   1.00 46.62 ? 167 CYS A C   1 
ATOM   1217  O  O   . CYS A  1 187 ? 11.331 6.662   10.606  1.00 47.14 ? 167 CYS A O   1 
ATOM   1218  C  CB  . CYS A  1 187 ? 12.563 9.188   9.208   1.00 49.92 ? 167 CYS A CB  1 
ATOM   1219  S  SG  . CYS A  1 187 ? 12.587 10.947  9.001   1.00 57.35 ? 167 CYS A SG  1 
ATOM   1220  N  N   . LYS A  1 188 ? 11.713 6.291   8.435   1.00 44.90 ? 168 LYS A N   1 
ATOM   1221  C  CA  . LYS A  1 188 ? 12.227 4.961   8.677   1.00 44.35 ? 168 LYS A CA  1 
ATOM   1222  C  C   . LYS A  1 188 ? 13.712 5.119   9.040   1.00 44.37 ? 168 LYS A C   1 
ATOM   1223  O  O   . LYS A  1 188 ? 14.431 5.869   8.392   1.00 45.55 ? 168 LYS A O   1 
ATOM   1224  C  CB  . LYS A  1 188 ? 12.005 4.070   7.461   1.00 43.97 ? 168 LYS A CB  1 
ATOM   1225  C  CG  . LYS A  1 188 ? 12.652 2.716   7.606   1.00 47.10 ? 168 LYS A CG  1 
ATOM   1226  C  CD  . LYS A  1 188 ? 12.235 1.819   6.480   1.00 49.94 ? 168 LYS A CD  1 
ATOM   1227  C  CE  . LYS A  1 188 ? 13.162 0.631   6.354   1.00 51.49 ? 168 LYS A CE  1 
ATOM   1228  N  NZ  . LYS A  1 188 ? 12.792 -0.237  5.202   1.00 48.42 ? 168 LYS A NZ  1 
ATOM   1229  N  N   . VAL A  1 189 ? 14.159 4.453   10.101  1.00 43.82 ? 169 VAL A N   1 
ATOM   1230  C  CA  . VAL A  1 189 ? 15.544 4.552   10.566  1.00 42.04 ? 169 VAL A CA  1 
ATOM   1231  C  C   . VAL A  1 189 ? 16.247 3.197   10.537  1.00 41.93 ? 169 VAL A C   1 
ATOM   1232  O  O   . VAL A  1 189 ? 15.782 2.238   11.114  1.00 39.42 ? 169 VAL A O   1 
ATOM   1233  C  CB  . VAL A  1 189 ? 15.654 5.139   12.009  1.00 43.52 ? 169 VAL A CB  1 
ATOM   1234  C  CG1 . VAL A  1 189 ? 17.138 5.231   12.457  1.00 42.66 ? 169 VAL A CG1 1 
ATOM   1235  C  CG2 . VAL A  1 189 ? 15.025 6.525   12.041  1.00 48.72 ? 169 VAL A CG2 1 
ATOM   1236  N  N   . VAL A  1 190 ? 17.399 3.148   9.873   1.00 41.98 ? 170 VAL A N   1 
ATOM   1237  C  CA  . VAL A  1 190 ? 18.174 1.927   9.811   1.00 42.03 ? 170 VAL A CA  1 
ATOM   1238  C  C   . VAL A  1 190 ? 19.482 2.184   10.557  1.00 41.47 ? 170 VAL A C   1 
ATOM   1239  O  O   . VAL A  1 190 ? 20.195 3.136   10.263  1.00 42.38 ? 170 VAL A O   1 
ATOM   1240  C  CB  . VAL A  1 190 ? 18.372 1.483   8.356   1.00 42.73 ? 170 VAL A CB  1 
ATOM   1241  C  CG1 . VAL A  1 190 ? 19.179 0.209   8.282   1.00 39.65 ? 170 VAL A CG1 1 
ATOM   1242  C  CG2 . VAL A  1 190 ? 17.013 1.314   7.698   1.00 43.67 ? 170 VAL A CG2 1 
ATOM   1243  N  N   . GLY A  1 191 ? 19.756 1.342   11.548  1.00 42.58 ? 171 GLY A N   1 
ATOM   1244  C  CA  . GLY A  1 191 ? 20.815 1.576   12.527  1.00 42.60 ? 171 GLY A CA  1 
ATOM   1245  C  C   . GLY A  1 191 ? 21.777 0.408   12.548  1.00 40.40 ? 171 GLY A C   1 
ATOM   1246  O  O   . GLY A  1 191 ? 21.391 -0.724  12.408  1.00 39.70 ? 171 GLY A O   1 
ATOM   1247  N  N   . ALA A  1 192 ? 23.050 0.724   12.676  1.00 42.61 ? 172 ALA A N   1 
ATOM   1248  C  CA  . ALA A  1 192 ? 24.115 -0.251  12.673  1.00 40.92 ? 172 ALA A CA  1 
ATOM   1249  C  C   . ALA A  1 192 ? 24.976 -0.008  13.905  1.00 40.05 ? 172 ALA A C   1 
ATOM   1250  O  O   . ALA A  1 192 ? 25.286 1.117   14.280  1.00 40.74 ? 172 ALA A O   1 
ATOM   1251  C  CB  . ALA A  1 192 ? 24.909 -0.169  11.426  1.00 37.67 ? 172 ALA A CB  1 
ATOM   1252  N  N   . VAL A  1 193 ? 25.389 -1.123  14.471  1.00 44.40 ? 173 VAL A N   1 
ATOM   1253  C  CA  . VAL A  1 193 ? 25.730 -1.257  15.872  1.00 45.79 ? 173 VAL A CA  1 
ATOM   1254  C  C   . VAL A  1 193 ? 26.858 -2.288  15.952  1.00 44.30 ? 173 VAL A C   1 
ATOM   1255  O  O   . VAL A  1 193 ? 26.975 -3.114  15.065  1.00 45.63 ? 173 VAL A O   1 
ATOM   1256  C  CB  . VAL A  1 193 ? 24.430 -1.643  16.617  1.00 44.16 ? 173 VAL A CB  1 
ATOM   1257  C  CG1 . VAL A  1 193 ? 24.648 -2.717  17.578  1.00 50.53 ? 173 VAL A CG1 1 
ATOM   1258  C  CG2 . VAL A  1 193 ? 23.799 -0.416  17.239  1.00 39.73 ? 173 VAL A CG2 1 
ATOM   1259  N  N   . GLY A  1 194 ? 27.694 -2.220  16.986  1.00 46.14 ? 174 GLY A N   1 
ATOM   1260  C  CA  . GLY A  1 194 ? 28.854 -3.131  17.118  1.00 47.84 ? 174 GLY A CA  1 
ATOM   1261  C  C   . GLY A  1 194 ? 28.721 -4.295  18.107  1.00 49.53 ? 174 GLY A C   1 
ATOM   1262  O  O   . GLY A  1 194 ? 29.709 -5.004  18.372  1.00 50.53 ? 174 GLY A O   1 
ATOM   1263  N  N   . SER A  1 195 ? 27.524 -4.495  18.661  1.00 49.19 ? 175 SER A N   1 
ATOM   1264  C  CA  . SER A  1 195 ? 27.272 -5.548  19.654  1.00 50.40 ? 175 SER A CA  1 
ATOM   1265  C  C   . SER A  1 195 ? 25.777 -5.827  19.703  1.00 50.17 ? 175 SER A C   1 
ATOM   1266  O  O   . SER A  1 195 ? 24.991 -5.007  19.239  1.00 45.50 ? 175 SER A O   1 
ATOM   1267  C  CB  . SER A  1 195 ? 27.811 -5.182  21.067  1.00 51.54 ? 175 SER A CB  1 
ATOM   1268  O  OG  . SER A  1 195 ? 26.920 -4.395  21.854  1.00 54.65 ? 175 SER A OG  1 
ATOM   1269  N  N   . ASP A  1 196 ? 25.428 -6.996  20.254  1.00 51.39 ? 176 ASP A N   1 
ATOM   1270  C  CA  . ASP A  1 196 ? 24.061 -7.513  20.306  1.00 52.78 ? 176 ASP A CA  1 
ATOM   1271  C  C   . ASP A  1 196 ? 23.265 -7.020  21.506  1.00 51.91 ? 176 ASP A C   1 
ATOM   1272  O  O   . ASP A  1 196 ? 22.045 -6.965  21.422  1.00 51.14 ? 176 ASP A O   1 
ATOM   1273  C  CB  . ASP A  1 196 ? 24.092 -9.033  20.343  1.00 53.44 ? 176 ASP A CB  1 
ATOM   1274  C  CG  . ASP A  1 196 ? 24.699 -9.627  19.088  1.00 61.53 ? 176 ASP A CG  1 
ATOM   1275  O  OD1 . ASP A  1 196 ? 24.400 -9.127  17.977  1.00 61.49 ? 176 ASP A OD1 1 
ATOM   1276  O  OD2 . ASP A  1 196 ? 25.467 -10.607 19.215  1.00 70.16 ? 176 ASP A OD2 1 
ATOM   1277  N  N   . GLU A  1 197 ? 23.937 -6.719  22.624  1.00 51.30 ? 177 GLU A N   1 
ATOM   1278  C  CA  . GLU A  1 197 ? 23.350 -5.848  23.660  1.00 52.10 ? 177 GLU A CA  1 
ATOM   1279  C  C   . GLU A  1 197 ? 22.803 -4.584  22.970  1.00 49.82 ? 177 GLU A C   1 
ATOM   1280  O  O   . GLU A  1 197 ? 21.599 -4.293  23.071  1.00 50.36 ? 177 GLU A O   1 
ATOM   1281  C  CB  . GLU A  1 197 ? 24.373 -5.421  24.752  1.00 53.09 ? 177 GLU A CB  1 
ATOM   1282  C  CG  . GLU A  1 197 ? 24.687 -6.491  25.812  1.00 54.52 ? 177 GLU A CG  1 
ATOM   1283  N  N   . LYS A  1 198 ? 23.686 -3.875  22.257  1.00 45.23 ? 178 LYS A N   1 
ATOM   1284  C  CA  . LYS A  1 198 ? 23.310 -2.640  21.525  1.00 46.09 ? 178 LYS A CA  1 
ATOM   1285  C  C   . LYS A  1 198 ? 22.167 -2.794  20.500  1.00 43.32 ? 178 LYS A C   1 
ATOM   1286  O  O   . LYS A  1 198 ? 21.345 -1.894  20.354  1.00 44.33 ? 178 LYS A O   1 
ATOM   1287  C  CB  . LYS A  1 198 ? 24.525 -1.997  20.857  1.00 46.21 ? 178 LYS A CB  1 
ATOM   1288  C  CG  . LYS A  1 198 ? 25.519 -1.359  21.817  1.00 47.98 ? 178 LYS A CG  1 
ATOM   1289  C  CD  . LYS A  1 198 ? 26.805 -0.987  21.090  1.00 47.90 ? 178 LYS A CD  1 
ATOM   1290  C  CE  . LYS A  1 198 ? 27.822 -0.356  22.038  1.00 54.55 ? 178 LYS A CE  1 
ATOM   1291  N  NZ  . LYS A  1 198 ? 29.180 -0.173  21.435  1.00 58.74 ? 178 LYS A NZ  1 
ATOM   1292  N  N   . VAL A  1 199 ? 22.096 -3.931  19.822  1.00 43.03 ? 179 VAL A N   1 
ATOM   1293  C  CA  . VAL A  1 199 ? 20.958 -4.245  18.946  1.00 43.35 ? 179 VAL A CA  1 
ATOM   1294  C  C   . VAL A  1 199 ? 19.642 -4.212  19.721  1.00 45.42 ? 179 VAL A C   1 
ATOM   1295  O  O   . VAL A  1 199 ? 18.723 -3.485  19.357  1.00 48.11 ? 179 VAL A O   1 
ATOM   1296  C  CB  . VAL A  1 199 ? 21.112 -5.629  18.236  1.00 40.68 ? 179 VAL A CB  1 
ATOM   1297  C  CG1 . VAL A  1 199 ? 19.785 -6.061  17.580  1.00 35.14 ? 179 VAL A CG1 1 
ATOM   1298  C  CG2 . VAL A  1 199 ? 22.241 -5.594  17.211  1.00 33.46 ? 179 VAL A CG2 1 
ATOM   1299  N  N   . ALA A  1 200 ? 19.555 -5.003  20.784  1.00 46.52 ? 180 ALA A N   1 
ATOM   1300  C  CA  . ALA A  1 200 ? 18.351 -5.054  21.601  1.00 47.61 ? 180 ALA A CA  1 
ATOM   1301  C  C   . ALA A  1 200 ? 17.960 -3.663  22.115  1.00 47.71 ? 180 ALA A C   1 
ATOM   1302  O  O   . ALA A  1 200 ? 16.809 -3.248  21.988  1.00 46.67 ? 180 ALA A O   1 
ATOM   1303  C  CB  . ALA A  1 200 ? 18.560 -5.998  22.766  1.00 48.73 ? 180 ALA A CB  1 
ATOM   1304  N  N   . TYR A  1 201 ? 18.921 -2.949  22.687  1.00 48.75 ? 181 TYR A N   1 
ATOM   1305  C  CA  . TYR A  1 201 ? 18.670 -1.590  23.144  1.00 50.43 ? 181 TYR A CA  1 
ATOM   1306  C  C   . TYR A  1 201 ? 17.954 -0.693  22.085  1.00 51.51 ? 181 TYR A C   1 
ATOM   1307  O  O   . TYR A  1 201 ? 16.965 -0.035  22.433  1.00 51.60 ? 181 TYR A O   1 
ATOM   1308  C  CB  . TYR A  1 201 ? 19.976 -0.921  23.648  1.00 53.73 ? 181 TYR A CB  1 
ATOM   1309  C  CG  . TYR A  1 201 ? 19.781 0.521   24.131  1.00 56.13 ? 181 TYR A CG  1 
ATOM   1310  C  CD1 . TYR A  1 201 ? 18.875 0.805   25.166  1.00 63.10 ? 181 TYR A CD1 1 
ATOM   1311  C  CD2 . TYR A  1 201 ? 20.488 1.597   23.558  1.00 63.87 ? 181 TYR A CD2 1 
ATOM   1312  C  CE1 . TYR A  1 201 ? 18.668 2.099   25.617  1.00 58.39 ? 181 TYR A CE1 1 
ATOM   1313  C  CE2 . TYR A  1 201 ? 20.286 2.915   24.019  1.00 61.84 ? 181 TYR A CE2 1 
ATOM   1314  C  CZ  . TYR A  1 201 ? 19.355 3.135   25.050  1.00 58.16 ? 181 TYR A CZ  1 
ATOM   1315  O  OH  . TYR A  1 201 ? 19.109 4.390   25.546  1.00 64.08 ? 181 TYR A OH  1 
ATOM   1316  N  N   . LEU A  1 202 ? 18.438 -0.661  20.828  1.00 49.55 ? 182 LEU A N   1 
ATOM   1317  C  CA  . LEU A  1 202 ? 17.879 0.262   19.808  1.00 48.98 ? 182 LEU A CA  1 
ATOM   1318  C  C   . LEU A  1 202 ? 16.542 -0.134  19.244  1.00 47.60 ? 182 LEU A C   1 
ATOM   1319  O  O   . LEU A  1 202 ? 15.821 0.703   18.685  1.00 44.96 ? 182 LEU A O   1 
ATOM   1320  C  CB  . LEU A  1 202 ? 18.801 0.437   18.598  1.00 49.07 ? 182 LEU A CB  1 
ATOM   1321  C  CG  . LEU A  1 202 ? 20.201 0.914   18.821  1.00 39.27 ? 182 LEU A CG  1 
ATOM   1322  C  CD1 . LEU A  1 202 ? 20.769 1.430   17.478  1.00 46.37 ? 182 LEU A CD1 1 
ATOM   1323  C  CD2 . LEU A  1 202 ? 20.221 1.967   19.913  1.00 47.30 ? 182 LEU A CD2 1 
ATOM   1324  N  N   . GLN A  1 203 ? 16.253 -1.418  19.327  1.00 49.63 ? 183 GLN A N   1 
ATOM   1325  C  CA  . GLN A  1 203 ? 14.914 -1.921  19.088  1.00 52.33 ? 183 GLN A CA  1 
ATOM   1326  C  C   . GLN A  1 203 ? 13.915 -1.500  20.161  1.00 53.56 ? 183 GLN A C   1 
ATOM   1327  O  O   . GLN A  1 203 ? 12.765 -1.223  19.830  1.00 56.18 ? 183 GLN A O   1 
ATOM   1328  C  CB  . GLN A  1 203 ? 14.948 -3.437  18.992  1.00 53.51 ? 183 GLN A CB  1 
ATOM   1329  C  CG  . GLN A  1 203 ? 15.602 -3.900  17.708  1.00 55.06 ? 183 GLN A CG  1 
ATOM   1330  C  CD  . GLN A  1 203 ? 15.916 -5.370  17.712  1.00 50.32 ? 183 GLN A CD  1 
ATOM   1331  O  OE1 . GLN A  1 203 ? 16.070 -5.975  18.764  1.00 42.97 ? 183 GLN A OE1 1 
ATOM   1332  N  NE2 . GLN A  1 203 ? 16.044 -5.949  16.524  1.00 41.54 ? 183 GLN A NE2 1 
ATOM   1333  N  N   . LYS A  1 204 ? 14.334 -1.474  21.427  1.00 53.49 ? 184 LYS A N   1 
ATOM   1334  C  CA  . LYS A  1 204 ? 13.498 -0.905  22.494  1.00 54.59 ? 184 LYS A CA  1 
ATOM   1335  C  C   . LYS A  1 204 ? 13.136 0.541   22.117  1.00 55.00 ? 184 LYS A C   1 
ATOM   1336  O  O   . LYS A  1 204 ? 11.960 0.905   22.109  1.00 57.29 ? 184 LYS A O   1 
ATOM   1337  C  CB  . LYS A  1 204 ? 14.170 -0.988  23.890  1.00 52.97 ? 184 LYS A CB  1 
ATOM   1338  N  N   . LEU A  1 205 ? 14.136 1.335   21.742  1.00 54.75 ? 185 LEU A N   1 
ATOM   1339  C  CA  . LEU A  1 205 ? 13.934 2.743   21.337  1.00 54.29 ? 185 LEU A CA  1 
ATOM   1340  C  C   . LEU A  1 205 ? 13.154 2.945   20.008  1.00 55.63 ? 185 LEU A C   1 
ATOM   1341  O  O   . LEU A  1 205 ? 12.947 4.093   19.607  1.00 57.92 ? 185 LEU A O   1 
ATOM   1342  C  CB  . LEU A  1 205 ? 15.289 3.489   21.241  1.00 52.52 ? 185 LEU A CB  1 
ATOM   1343  C  CG  . LEU A  1 205 ? 16.335 3.382   22.373  1.00 50.78 ? 185 LEU A CG  1 
ATOM   1344  C  CD1 . LEU A  1 205 ? 17.452 4.393   22.217  1.00 49.97 ? 185 LEU A CD1 1 
ATOM   1345  C  CD2 . LEU A  1 205 ? 15.713 3.544   23.719  1.00 53.65 ? 185 LEU A CD2 1 
ATOM   1346  N  N   . GLY A  1 206 ? 12.758 1.863   19.319  1.00 55.51 ? 186 GLY A N   1 
ATOM   1347  C  CA  . GLY A  1 206 ? 11.852 1.931   18.154  1.00 53.85 ? 186 GLY A CA  1 
ATOM   1348  C  C   . GLY A  1 206 ? 12.476 2.183   16.773  1.00 53.88 ? 186 GLY A C   1 
ATOM   1349  O  O   . GLY A  1 206 ? 11.783 2.629   15.841  1.00 54.78 ? 186 GLY A O   1 
ATOM   1350  N  N   . PHE A  1 207 ? 13.765 1.898   16.614  1.00 51.20 ? 187 PHE A N   1 
ATOM   1351  C  CA  . PHE A  1 207 ? 14.381 1.924   15.286  1.00 50.08 ? 187 PHE A CA  1 
ATOM   1352  C  C   . PHE A  1 207 ? 13.781 0.781   14.449  1.00 49.21 ? 187 PHE A C   1 
ATOM   1353  O  O   . PHE A  1 207 ? 13.765 -0.377  14.905  1.00 46.98 ? 187 PHE A O   1 
ATOM   1354  C  CB  . PHE A  1 207 ? 15.891 1.679   15.345  1.00 50.26 ? 187 PHE A CB  1 
ATOM   1355  C  CG  . PHE A  1 207 ? 16.717 2.823   15.869  1.00 48.04 ? 187 PHE A CG  1 
ATOM   1356  C  CD1 . PHE A  1 207 ? 18.001 3.046   15.325  1.00 50.27 ? 187 PHE A CD1 1 
ATOM   1357  C  CD2 . PHE A  1 207 ? 16.260 3.669   16.901  1.00 50.04 ? 187 PHE A CD2 1 
ATOM   1358  C  CE1 . PHE A  1 207 ? 18.847 4.107   15.805  1.00 48.26 ? 187 PHE A CE1 1 
ATOM   1359  C  CE2 . PHE A  1 207 ? 17.084 4.725   17.382  1.00 54.80 ? 187 PHE A CE2 1 
ATOM   1360  C  CZ  . PHE A  1 207 ? 18.406 4.917   16.836  1.00 47.85 ? 187 PHE A CZ  1 
ATOM   1361  N  N   . ASP A  1 208 ? 13.347 1.118   13.229  1.00 48.44 ? 188 ASP A N   1 
ATOM   1362  C  CA  . ASP A  1 208 ? 12.751 0.173   12.262  1.00 47.96 ? 188 ASP A CA  1 
ATOM   1363  C  C   . ASP A  1 208 ? 13.610 -1.060  11.972  1.00 46.60 ? 188 ASP A C   1 
ATOM   1364  O  O   . ASP A  1 208 ? 13.115 -2.173  11.998  1.00 45.57 ? 188 ASP A O   1 
ATOM   1365  C  CB  . ASP A  1 208 ? 12.491 0.862   10.909  1.00 50.13 ? 188 ASP A CB  1 
ATOM   1366  C  CG  . ASP A  1 208 ? 11.409 1.953   10.982  1.00 56.37 ? 188 ASP A CG  1 
ATOM   1367  O  OD1 . ASP A  1 208 ? 10.262 1.690   10.548  1.00 66.47 ? 188 ASP A OD1 1 
ATOM   1368  O  OD2 . ASP A  1 208 ? 11.716 3.072   11.453  1.00 58.55 ? 188 ASP A OD2 1 
ATOM   1369  N  N   . VAL A  1 209 ? 14.879 -0.850  11.632  1.00 46.34 ? 189 VAL A N   1 
ATOM   1370  C  CA  . VAL A  1 209 ? 15.834 -1.951  11.407  1.00 45.40 ? 189 VAL A CA  1 
ATOM   1371  C  C   . VAL A  1 209 ? 17.158 -1.664  12.114  1.00 44.76 ? 189 VAL A C   1 
ATOM   1372  O  O   . VAL A  1 209 ? 17.749 -0.608  11.911  1.00 43.18 ? 189 VAL A O   1 
ATOM   1373  C  CB  . VAL A  1 209 ? 16.148 -2.111  9.934   1.00 44.19 ? 189 VAL A CB  1 
ATOM   1374  C  CG1 . VAL A  1 209 ? 17.009 -3.354  9.702   1.00 45.59 ? 189 VAL A CG1 1 
ATOM   1375  C  CG2 . VAL A  1 209 ? 14.870 -2.127  9.138   1.00 45.25 ? 189 VAL A CG2 1 
ATOM   1376  N  N   . VAL A  1 210 ? 17.587 -2.599  12.957  1.00 44.11 ? 190 VAL A N   1 
ATOM   1377  C  CA  . VAL A  1 210 ? 18.886 -2.551  13.631  1.00 43.79 ? 190 VAL A CA  1 
ATOM   1378  C  C   . VAL A  1 210 ? 19.635 -3.845  13.327  1.00 42.36 ? 190 VAL A C   1 
ATOM   1379  O  O   . VAL A  1 210 ? 19.048 -4.912  13.343  1.00 43.11 ? 190 VAL A O   1 
ATOM   1380  C  CB  . VAL A  1 210 ? 18.774 -2.444  15.182  1.00 43.70 ? 190 VAL A CB  1 
ATOM   1381  C  CG1 . VAL A  1 210 ? 20.131 -1.984  15.793  1.00 41.47 ? 190 VAL A CG1 1 
ATOM   1382  C  CG2 . VAL A  1 210 ? 17.639 -1.506  15.587  1.00 42.39 ? 190 VAL A CG2 1 
ATOM   1383  N  N   . PHE A  1 211 ? 20.922 -3.732  13.037  1.00 41.60 ? 191 PHE A N   1 
ATOM   1384  C  CA  . PHE A  1 211 ? 21.790 -4.885  12.941  1.00 39.60 ? 191 PHE A CA  1 
ATOM   1385  C  C   . PHE A  1 211 ? 23.197 -4.656  13.512  1.00 40.32 ? 191 PHE A C   1 
ATOM   1386  O  O   . PHE A  1 211 ? 23.663 -3.513  13.659  1.00 39.06 ? 191 PHE A O   1 
ATOM   1387  C  CB  . PHE A  1 211 ? 21.875 -5.361  11.494  1.00 39.19 ? 191 PHE A CB  1 
ATOM   1388  C  CG  . PHE A  1 211 ? 22.485 -4.368  10.566  1.00 40.76 ? 191 PHE A CG  1 
ATOM   1389  C  CD1 . PHE A  1 211 ? 23.852 -4.362  10.343  1.00 40.73 ? 191 PHE A CD1 1 
ATOM   1390  C  CD2 . PHE A  1 211 ? 21.679 -3.454  9.881   1.00 39.54 ? 191 PHE A CD2 1 
ATOM   1391  C  CE1 . PHE A  1 211 ? 24.427 -3.425  9.464   1.00 46.04 ? 191 PHE A CE1 1 
ATOM   1392  C  CE2 . PHE A  1 211 ? 22.233 -2.533  8.996   1.00 44.89 ? 191 PHE A CE2 1 
ATOM   1393  C  CZ  . PHE A  1 211 ? 23.613 -2.508  8.791   1.00 41.15 ? 191 PHE A CZ  1 
ATOM   1394  N  N   . ASN A  1 212 ? 23.821 -5.777  13.896  1.00 44.47 ? 192 ASN A N   1 
ATOM   1395  C  CA  . ASN A  1 212 ? 25.232 -5.851  14.271  1.00 44.81 ? 192 ASN A CA  1 
ATOM   1396  C  C   . ASN A  1 212 ? 26.141 -6.007  13.014  1.00 45.86 ? 192 ASN A C   1 
ATOM   1397  O  O   . ASN A  1 212 ? 26.091 -7.028  12.340  1.00 44.94 ? 192 ASN A O   1 
ATOM   1398  C  CB  . ASN A  1 212 ? 25.448 -7.010  15.233  1.00 40.29 ? 192 ASN A CB  1 
ATOM   1399  C  CG  . ASN A  1 212 ? 26.834 -7.010  15.804  1.00 38.04 ? 192 ASN A CG  1 
ATOM   1400  O  OD1 . ASN A  1 212 ? 27.692 -6.253  15.358  1.00 49.30 ? 192 ASN A OD1 1 
ATOM   1401  N  ND2 . ASN A  1 212 ? 27.062 -7.809  16.803  1.00 36.94 ? 192 ASN A ND2 1 
ATOM   1402  N  N   . TYR A  1 213 ? 26.940 -4.977  12.702  1.00 48.55 ? 193 TYR A N   1 
ATOM   1403  C  CA  . TYR A  1 213 ? 27.773 -4.976  11.498  1.00 51.62 ? 193 TYR A CA  1 
ATOM   1404  C  C   . TYR A  1 213 ? 28.934 -5.954  11.647  1.00 52.16 ? 193 TYR A C   1 
ATOM   1405  O  O   . TYR A  1 213 ? 29.383 -6.528  10.665  1.00 54.03 ? 193 TYR A O   1 
ATOM   1406  C  CB  . TYR A  1 213 ? 28.284 -3.557  11.112  1.00 57.69 ? 193 TYR A CB  1 
ATOM   1407  C  CG  . TYR A  1 213 ? 29.348 -3.034  12.039  1.00 64.61 ? 193 TYR A CG  1 
ATOM   1408  C  CD1 . TYR A  1 213 ? 30.715 -3.187  11.765  1.00 70.59 ? 193 TYR A CD1 1 
ATOM   1409  C  CD2 . TYR A  1 213 ? 28.982 -2.428  13.235  1.00 73.77 ? 193 TYR A CD2 1 
ATOM   1410  C  CE1 . TYR A  1 213 ? 31.692 -2.741  12.699  1.00 71.34 ? 193 TYR A CE1 1 
ATOM   1411  C  CE2 . TYR A  1 213 ? 29.927 -1.961  14.151  1.00 75.66 ? 193 TYR A CE2 1 
ATOM   1412  C  CZ  . TYR A  1 213 ? 31.274 -2.115  13.895  1.00 74.31 ? 193 TYR A CZ  1 
ATOM   1413  O  OH  . TYR A  1 213 ? 32.144 -1.624  14.863  1.00 69.10 ? 193 TYR A OH  1 
ATOM   1414  N  N   . LYS A  1 214 ? 29.397 -6.167  12.876  1.00 52.71 ? 194 LYS A N   1 
ATOM   1415  C  CA  . LYS A  1 214 ? 30.489 -7.109  13.135  1.00 53.03 ? 194 LYS A CA  1 
ATOM   1416  C  C   . LYS A  1 214 ? 30.135 -8.564  12.869  1.00 52.89 ? 194 LYS A C   1 
ATOM   1417  O  O   . LYS A  1 214 ? 31.044 -9.355  12.677  1.00 55.18 ? 194 LYS A O   1 
ATOM   1418  C  CB  . LYS A  1 214 ? 30.986 -6.993  14.576  1.00 53.07 ? 194 LYS A CB  1 
ATOM   1419  C  CG  . LYS A  1 214 ? 31.556 -5.648  14.904  1.00 57.08 ? 194 LYS A CG  1 
ATOM   1420  C  CD  . LYS A  1 214 ? 32.471 -5.766  16.089  1.00 64.02 ? 194 LYS A CD  1 
ATOM   1421  C  CE  . LYS A  1 214 ? 32.904 -4.387  16.586  1.00 70.96 ? 194 LYS A CE  1 
ATOM   1422  N  NZ  . LYS A  1 214 ? 33.528 -4.516  17.939  1.00 73.51 ? 194 LYS A NZ  1 
ATOM   1423  N  N   . THR A  1 215 ? 28.844 -8.918  12.895  1.00 52.48 ? 195 THR A N   1 
ATOM   1424  C  CA  . THR A  1 215 ? 28.396 -10.299 12.666  1.00 52.22 ? 195 THR A CA  1 
ATOM   1425  C  C   . THR A  1 215 ? 27.734 -10.553 11.299  1.00 52.34 ? 195 THR A C   1 
ATOM   1426  O  O   . THR A  1 215 ? 27.655 -11.712 10.885  1.00 52.19 ? 195 THR A O   1 
ATOM   1427  C  CB  . THR A  1 215 ? 27.409 -10.845 13.774  1.00 52.22 ? 195 THR A CB  1 
ATOM   1428  O  OG1 . THR A  1 215 ? 26.052 -10.443 13.506  1.00 55.07 ? 195 THR A OG1 1 
ATOM   1429  C  CG2 . THR A  1 215 ? 27.834 -10.433 15.174  1.00 54.00 ? 195 THR A CG2 1 
ATOM   1430  N  N   . VAL A  1 216 ? 27.236 -9.525  10.608  1.00 53.02 ? 196 VAL A N   1 
ATOM   1431  C  CA  . VAL A  1 216 ? 26.506 -9.793  9.354   1.00 53.34 ? 196 VAL A CA  1 
ATOM   1432  C  C   . VAL A  1 216 ? 27.438 -10.416 8.342   1.00 54.44 ? 196 VAL A C   1 
ATOM   1433  O  O   . VAL A  1 216 ? 28.634 -10.088 8.320   1.00 55.76 ? 196 VAL A O   1 
ATOM   1434  C  CB  . VAL A  1 216 ? 25.809 -8.550  8.700   1.00 53.62 ? 196 VAL A CB  1 
ATOM   1435  C  CG1 . VAL A  1 216 ? 24.628 -8.087  9.573   1.00 54.77 ? 196 VAL A CG1 1 
ATOM   1436  C  CG2 . VAL A  1 216 ? 26.813 -7.411  8.364   1.00 52.34 ? 196 VAL A CG2 1 
ATOM   1437  N  N   . GLU A  1 217 ? 26.882 -11.307 7.519   1.00 52.84 ? 197 GLU A N   1 
ATOM   1438  C  CA  . GLU A  1 217 ? 27.640 -11.953 6.476   1.00 54.03 ? 197 GLU A CA  1 
ATOM   1439  C  C   . GLU A  1 217 ? 27.992 -10.956 5.395   1.00 53.17 ? 197 GLU A C   1 
ATOM   1440  O  O   . GLU A  1 217 ? 29.080 -11.025 4.842   1.00 55.44 ? 197 GLU A O   1 
ATOM   1441  C  CB  . GLU A  1 217 ? 26.858 -13.140 5.907   1.00 55.16 ? 197 GLU A CB  1 
ATOM   1442  C  CG  . GLU A  1 217 ? 27.435 -13.772 4.630   1.00 59.59 ? 197 GLU A CG  1 
ATOM   1443  C  CD  . GLU A  1 217 ? 26.669 -15.040 4.209   1.00 61.48 ? 197 GLU A CD  1 
ATOM   1444  O  OE1 . GLU A  1 217 ? 25.953 -15.642 5.051   1.00 71.57 ? 197 GLU A OE1 1 
ATOM   1445  O  OE2 . GLU A  1 217 ? 26.787 -15.451 3.034   1.00 72.06 ? 197 GLU A OE2 1 
ATOM   1446  N  N   . SER A  1 218 ? 27.085 -10.033 5.088   1.00 52.30 ? 198 SER A N   1 
ATOM   1447  C  CA  . SER A  1 218 ? 27.352 -9.013  4.066   1.00 51.49 ? 198 SER A CA  1 
ATOM   1448  C  C   . SER A  1 218 ? 26.649 -7.710  4.401   1.00 51.18 ? 198 SER A C   1 
ATOM   1449  O  O   . SER A  1 218 ? 25.409 -7.667  4.384   1.00 51.71 ? 198 SER A O   1 
ATOM   1450  C  CB  . SER A  1 218 ? 26.895 -9.491  2.667   1.00 52.63 ? 198 SER A CB  1 
ATOM   1451  O  OG  . SER A  1 218 ? 27.001 -8.464  1.677   1.00 47.26 ? 198 SER A OG  1 
ATOM   1452  N  N   . LEU A  1 219 ? 27.433 -6.659  4.681   1.00 48.36 ? 199 LEU A N   1 
ATOM   1453  C  CA  . LEU A  1 219 ? 26.877 -5.314  4.895   1.00 48.82 ? 199 LEU A CA  1 
ATOM   1454  C  C   . LEU A  1 219 ? 26.034 -4.867  3.709   1.00 48.11 ? 199 LEU A C   1 
ATOM   1455  O  O   . LEU A  1 219 ? 24.957 -4.278  3.908   1.00 47.82 ? 199 LEU A O   1 
ATOM   1456  C  CB  . LEU A  1 219 ? 27.981 -4.262  5.169   1.00 48.07 ? 199 LEU A CB  1 
ATOM   1457  C  CG  . LEU A  1 219 ? 27.546 -2.821  5.519   1.00 45.33 ? 199 LEU A CG  1 
ATOM   1458  C  CD1 . LEU A  1 219 ? 26.761 -2.766  6.801   1.00 41.29 ? 199 LEU A CD1 1 
ATOM   1459  C  CD2 . LEU A  1 219 ? 28.740 -1.853  5.617   1.00 50.36 ? 199 LEU A CD2 1 
ATOM   1460  N  N   . GLU A  1 220 ? 26.527 -5.160  2.500   1.00 45.86 ? 200 GLU A N   1 
ATOM   1461  C  CA  . GLU A  1 220 ? 25.863 -4.787  1.269   1.00 46.29 ? 200 GLU A CA  1 
ATOM   1462  C  C   . GLU A  1 220 ? 24.455 -5.371  1.203   1.00 43.67 ? 200 GLU A C   1 
ATOM   1463  O  O   . GLU A  1 220 ? 23.490 -4.644  1.033   1.00 42.87 ? 200 GLU A O   1 
ATOM   1464  C  CB  . GLU A  1 220 ? 26.730 -5.206  0.056   1.00 45.60 ? 200 GLU A CB  1 
ATOM   1465  C  CG  . GLU A  1 220 ? 26.258 -4.639  -1.306  1.00 46.98 ? 200 GLU A CG  1 
ATOM   1466  C  CD  . GLU A  1 220 ? 26.420 -5.590  -2.540  1.00 55.63 ? 200 GLU A CD  1 
ATOM   1467  O  OE1 . GLU A  1 220 ? 26.715 -6.829  -2.399  1.00 68.48 ? 200 GLU A OE1 1 
ATOM   1468  O  OE2 . GLU A  1 220 ? 26.214 -5.079  -3.680  1.00 58.62 ? 200 GLU A OE2 1 
ATOM   1469  N  N   . GLU A  1 221 ? 24.360 -6.690  1.356   1.00 47.60 ? 201 GLU A N   1 
ATOM   1470  C  CA  . GLU A  1 221 ? 23.098 -7.448  1.307   1.00 48.19 ? 201 GLU A CA  1 
ATOM   1471  C  C   . GLU A  1 221 ? 22.138 -7.118  2.440   1.00 44.61 ? 201 GLU A C   1 
ATOM   1472  O  O   . GLU A  1 221 ? 20.938 -7.038  2.245   1.00 43.21 ? 201 GLU A O   1 
ATOM   1473  C  CB  . GLU A  1 221 ? 23.402 -8.940  1.372   1.00 50.02 ? 201 GLU A CB  1 
ATOM   1474  C  CG  . GLU A  1 221 ? 24.177 -9.481  0.163   1.00 57.12 ? 201 GLU A CG  1 
ATOM   1475  C  CD  . GLU A  1 221 ? 24.376 -10.997 0.223   1.00 57.62 ? 201 GLU A CD  1 
ATOM   1476  O  OE1 . GLU A  1 221 ? 25.534 -11.443 0.378   1.00 77.48 ? 201 GLU A OE1 1 
ATOM   1477  O  OE2 . GLU A  1 221 ? 23.379 -11.756 0.132   1.00 71.16 ? 201 GLU A OE2 1 
ATOM   1478  N  N   . THR A  1 222 ? 22.678 -6.962  3.638   1.00 44.03 ? 202 THR A N   1 
ATOM   1479  C  CA  . THR A  1 222 ? 21.904 -6.497  4.787   1.00 45.30 ? 202 THR A CA  1 
ATOM   1480  C  C   . THR A  1 222 ? 21.260 -5.104  4.600   1.00 46.87 ? 202 THR A C   1 
ATOM   1481  O  O   . THR A  1 222 ? 20.074 -4.906  4.937   1.00 47.56 ? 202 THR A O   1 
ATOM   1482  C  CB  . THR A  1 222 ? 22.807 -6.369  6.013   1.00 45.61 ? 202 THR A CB  1 
ATOM   1483  O  OG1 . THR A  1 222 ? 23.569 -7.574  6.183   1.00 48.56 ? 202 THR A OG1 1 
ATOM   1484  C  CG2 . THR A  1 222 ? 21.976 -6.074  7.250   1.00 44.61 ? 202 THR A CG2 1 
ATOM   1485  N  N   . LEU A  1 223 ? 22.054 -4.150  4.099   1.00 43.79 ? 203 LEU A N   1 
ATOM   1486  C  CA  . LEU A  1 223 ? 21.570 -2.803  3.844   1.00 41.67 ? 203 LEU A CA  1 
ATOM   1487  C  C   . LEU A  1 223 ? 20.557 -2.797  2.737   1.00 40.25 ? 203 LEU A C   1 
ATOM   1488  O  O   . LEU A  1 223 ? 19.684 -1.937  2.739   1.00 40.26 ? 203 LEU A O   1 
ATOM   1489  C  CB  . LEU A  1 223 ? 22.698 -1.863  3.423   1.00 42.33 ? 203 LEU A CB  1 
ATOM   1490  C  CG  . LEU A  1 223 ? 23.733 -1.368  4.436   1.00 46.46 ? 203 LEU A CG  1 
ATOM   1491  C  CD1 . LEU A  1 223 ? 24.835 -0.591  3.713   1.00 44.62 ? 203 LEU A CD1 1 
ATOM   1492  C  CD2 . LEU A  1 223 ? 23.096 -0.539  5.527   1.00 47.88 ? 203 LEU A CD2 1 
ATOM   1493  N  N   . LYS A  1 224 ? 20.726 -3.689  1.758   1.00 39.95 ? 204 LYS A N   1 
ATOM   1494  C  CA  . LYS A  1 224 ? 19.753 -3.874  0.656   1.00 42.58 ? 204 LYS A CA  1 
ATOM   1495  C  C   . LYS A  1 224 ? 18.398 -4.437  1.158   1.00 42.57 ? 204 LYS A C   1 
ATOM   1496  O  O   . LYS A  1 224 ? 17.339 -3.948  0.796   1.00 43.07 ? 204 LYS A O   1 
ATOM   1497  C  CB  . LYS A  1 224 ? 20.331 -4.828  -0.408  1.00 43.86 ? 204 LYS A CB  1 
ATOM   1498  C  CG  . LYS A  1 224 ? 20.699 -4.198  -1.756  1.00 54.63 ? 204 LYS A CG  1 
ATOM   1499  C  CD  . LYS A  1 224 ? 19.509 -4.230  -2.770  1.00 59.91 ? 204 LYS A CD  1 
ATOM   1500  C  CE  . LYS A  1 224 ? 18.824 -2.845  -2.880  1.00 64.21 ? 204 LYS A CE  1 
ATOM   1501  N  NZ  . LYS A  1 224 ? 17.540 -2.834  -3.650  1.00 57.17 ? 204 LYS A NZ  1 
ATOM   1502  N  N   . LYS A  1 225 ? 18.453 -5.481  1.990   1.00 43.68 ? 205 LYS A N   1 
ATOM   1503  C  CA  . LYS A  1 225 ? 17.260 -6.069  2.601   1.00 44.25 ? 205 LYS A CA  1 
ATOM   1504  C  C   . LYS A  1 225 ? 16.576 -5.064  3.571   1.00 44.40 ? 205 LYS A C   1 
ATOM   1505  O  O   . LYS A  1 225 ? 15.363 -5.116  3.755   1.00 45.95 ? 205 LYS A O   1 
ATOM   1506  C  CB  . LYS A  1 225 ? 17.624 -7.385  3.326   1.00 45.41 ? 205 LYS A CB  1 
ATOM   1507  C  CG  . LYS A  1 225 ? 16.531 -8.475  3.370   1.00 46.10 ? 205 LYS A CG  1 
ATOM   1508  N  N   . ALA A  1 226 ? 17.341 -4.158  4.176   1.00 43.25 ? 206 ALA A N   1 
ATOM   1509  C  CA  . ALA A  1 226 ? 16.801 -3.237  5.180   1.00 43.40 ? 206 ALA A CA  1 
ATOM   1510  C  C   . ALA A  1 226 ? 16.031 -2.049  4.556   1.00 45.08 ? 206 ALA A C   1 
ATOM   1511  O  O   . ALA A  1 226 ? 15.102 -1.503  5.173   1.00 46.96 ? 206 ALA A O   1 
ATOM   1512  C  CB  . ALA A  1 226 ? 17.913 -2.740  6.069   1.00 41.10 ? 206 ALA A CB  1 
ATOM   1513  N  N   . SER A  1 227 ? 16.441 -1.639  3.358   1.00 44.83 ? 207 SER A N   1 
ATOM   1514  C  CA  . SER A  1 227 ? 15.707 -0.658  2.536   1.00 44.37 ? 207 SER A CA  1 
ATOM   1515  C  C   . SER A  1 227 ? 15.988 -0.927  1.064   1.00 45.72 ? 207 SER A C   1 
ATOM   1516  O  O   . SER A  1 227 ? 16.936 -0.372  0.516   1.00 47.70 ? 207 SER A O   1 
ATOM   1517  C  CB  . SER A  1 227 ? 16.134 0.773   2.856   1.00 43.79 ? 207 SER A CB  1 
ATOM   1518  O  OG  . SER A  1 227 ? 15.393 1.704   2.072   1.00 44.93 ? 207 SER A OG  1 
ATOM   1519  N  N   . PRO A  1 228 ? 15.186 -1.796  0.415   1.00 46.49 ? 208 PRO A N   1 
ATOM   1520  C  CA  . PRO A  1 228 ? 15.453 -2.139  -0.997  1.00 46.06 ? 208 PRO A CA  1 
ATOM   1521  C  C   . PRO A  1 228 ? 15.406 -0.942  -1.974  1.00 45.48 ? 208 PRO A C   1 
ATOM   1522  O  O   . PRO A  1 228 ? 15.989 -0.987  -3.036  1.00 44.32 ? 208 PRO A O   1 
ATOM   1523  C  CB  . PRO A  1 228 ? 14.356 -3.177  -1.304  1.00 46.79 ? 208 PRO A CB  1 
ATOM   1524  C  CG  . PRO A  1 228 ? 13.974 -3.736  0.049   1.00 46.79 ? 208 PRO A CG  1 
ATOM   1525  C  CD  . PRO A  1 228 ? 14.013 -2.527  0.931   1.00 45.78 ? 208 PRO A CD  1 
ATOM   1526  N  N   . ASP A  1 229 ? 14.627 0.054   -1.593  1.00 46.75 ? 209 ASP A N   1 
ATOM   1527  C  CA  . ASP A  1 229 ? 14.551 1.412   -2.124  1.00 48.18 ? 209 ASP A CA  1 
ATOM   1528  C  C   . ASP A  1 229 ? 15.887 2.195   -2.134  1.00 45.27 ? 209 ASP A C   1 
ATOM   1529  O  O   . ASP A  1 229 ? 16.105 3.037   -2.974  1.00 47.49 ? 209 ASP A O   1 
ATOM   1530  C  CB  . ASP A  1 229 ? 13.653 2.160   -1.098  1.00 51.68 ? 209 ASP A CB  1 
ATOM   1531  C  CG  . ASP A  1 229 ? 12.536 2.937   -1.709  1.00 60.62 ? 209 ASP A CG  1 
ATOM   1532  O  OD1 . ASP A  1 229 ? 12.210 3.998   -1.114  1.00 65.32 ? 209 ASP A OD1 1 
ATOM   1533  O  OD2 . ASP A  1 229 ? 11.955 2.471   -2.720  1.00 74.94 ? 209 ASP A OD2 1 
ATOM   1534  N  N   . GLY A  1 230 ? 16.732 1.960   -1.130  1.00 43.12 ? 210 GLY A N   1 
ATOM   1535  C  CA  . GLY A  1 230 ? 17.876 2.811   -0.819  1.00 41.58 ? 210 GLY A CA  1 
ATOM   1536  C  C   . GLY A  1 230 ? 17.605 3.832   0.285   1.00 41.16 ? 210 GLY A C   1 
ATOM   1537  O  O   . GLY A  1 230 ? 16.499 3.877   0.855   1.00 39.74 ? 210 GLY A O   1 
ATOM   1538  N  N   . TYR A  1 231 ? 18.625 4.655   0.564   1.00 42.26 ? 211 TYR A N   1 
ATOM   1539  C  CA  . TYR A  1 231 ? 18.619 5.650   1.657   1.00 40.68 ? 211 TYR A CA  1 
ATOM   1540  C  C   . TYR A  1 231 ? 18.617 7.085   1.154   1.00 40.00 ? 211 TYR A C   1 
ATOM   1541  O  O   . TYR A  1 231 ? 19.390 7.461   0.278   1.00 38.73 ? 211 TYR A O   1 
ATOM   1542  C  CB  . TYR A  1 231 ? 19.798 5.403   2.591   1.00 40.78 ? 211 TYR A CB  1 
ATOM   1543  C  CG  . TYR A  1 231 ? 19.747 3.997   3.084   1.00 45.70 ? 211 TYR A CG  1 
ATOM   1544  C  CD1 . TYR A  1 231 ? 19.060 3.667   4.267   1.00 36.71 ? 211 TYR A CD1 1 
ATOM   1545  C  CD2 . TYR A  1 231 ? 20.300 2.965   2.322   1.00 46.54 ? 211 TYR A CD2 1 
ATOM   1546  C  CE1 . TYR A  1 231 ? 18.942 2.335   4.679   1.00 42.38 ? 211 TYR A CE1 1 
ATOM   1547  C  CE2 . TYR A  1 231 ? 20.191 1.648   2.729   1.00 41.24 ? 211 TYR A CE2 1 
ATOM   1548  C  CZ  . TYR A  1 231 ? 19.507 1.340   3.896   1.00 40.07 ? 211 TYR A CZ  1 
ATOM   1549  O  OH  . TYR A  1 231 ? 19.448 0.033   4.299   1.00 43.15 ? 211 TYR A OH  1 
ATOM   1550  N  N   . ASP A  1 232 ? 17.705 7.880   1.707   1.00 41.96 ? 212 ASP A N   1 
ATOM   1551  C  CA  . ASP A  1 232 ? 17.590 9.294   1.381   1.00 41.92 ? 212 ASP A CA  1 
ATOM   1552  C  C   . ASP A  1 232 ? 18.704 10.048  2.062   1.00 43.16 ? 212 ASP A C   1 
ATOM   1553  O  O   . ASP A  1 232 ? 19.277 10.957  1.467   1.00 40.32 ? 212 ASP A O   1 
ATOM   1554  C  CB  . ASP A  1 232 ? 16.256 9.858   1.870   1.00 42.95 ? 212 ASP A CB  1 
ATOM   1555  C  CG  . ASP A  1 232 ? 15.054 9.255   1.128   1.00 48.83 ? 212 ASP A CG  1 
ATOM   1556  O  OD1 . ASP A  1 232 ? 14.408 8.302   1.677   1.00 51.03 ? 212 ASP A OD1 1 
ATOM   1557  O  OD2 . ASP A  1 232 ? 14.781 9.727   -0.007  1.00 51.96 ? 212 ASP A OD2 1 
ATOM   1558  N  N   . CYS A  1 233 ? 18.983 9.646   3.307   1.00 43.01 ? 213 CYS A N   1 
ATOM   1559  C  CA  . CYS A  1 233 ? 19.927 10.306  4.189   1.00 43.60 ? 213 CYS A CA  1 
ATOM   1560  C  C   . CYS A  1 233 ? 20.818 9.328   4.869   1.00 40.74 ? 213 CYS A C   1 
ATOM   1561  O  O   . CYS A  1 233 ? 20.375 8.268   5.257   1.00 41.65 ? 213 CYS A O   1 
ATOM   1562  C  CB  . CYS A  1 233 ? 19.187 11.028  5.313   1.00 44.40 ? 213 CYS A CB  1 
ATOM   1563  S  SG  . CYS A  1 233 ? 18.134 12.275  4.673   1.00 58.65 ? 213 CYS A SG  1 
ATOM   1564  N  N   . TYR A  1 234 ? 22.053 9.747   5.077   1.00 39.48 ? 214 TYR A N   1 
ATOM   1565  C  CA  . TYR A  1 234 ? 23.022 9.002   5.814   1.00 39.27 ? 214 TYR A CA  1 
ATOM   1566  C  C   . TYR A  1 234 ? 23.669 9.913   6.853   1.00 38.44 ? 214 TYR A C   1 
ATOM   1567  O  O   . TYR A  1 234 ? 24.329 10.847  6.517   1.00 36.64 ? 214 TYR A O   1 
ATOM   1568  C  CB  . TYR A  1 234 ? 24.070 8.536   4.798   1.00 41.93 ? 214 TYR A CB  1 
ATOM   1569  C  CG  . TYR A  1 234 ? 25.212 7.724   5.328   1.00 41.96 ? 214 TYR A CG  1 
ATOM   1570  C  CD1 . TYR A  1 234 ? 25.049 6.874   6.425   1.00 38.28 ? 214 TYR A CD1 1 
ATOM   1571  C  CD2 . TYR A  1 234 ? 26.459 7.791   4.718   1.00 39.83 ? 214 TYR A CD2 1 
ATOM   1572  C  CE1 . TYR A  1 234 ? 26.098 6.131   6.899   1.00 43.77 ? 214 TYR A CE1 1 
ATOM   1573  C  CE2 . TYR A  1 234 ? 27.498 7.048   5.182   1.00 47.99 ? 214 TYR A CE2 1 
ATOM   1574  C  CZ  . TYR A  1 234 ? 27.314 6.208   6.283   1.00 37.41 ? 214 TYR A CZ  1 
ATOM   1575  O  OH  . TYR A  1 234 ? 28.379 5.447   6.744   1.00 40.95 ? 214 TYR A OH  1 
ATOM   1576  N  N   . PHE A  1 235 ? 23.466 9.623   8.123   1.00 39.26 ? 215 PHE A N   1 
ATOM   1577  C  CA  . PHE A  1 235 ? 24.229 10.244  9.174   1.00 37.47 ? 215 PHE A CA  1 
ATOM   1578  C  C   . PHE A  1 235 ? 25.472 9.378   9.517   1.00 38.20 ? 215 PHE A C   1 
ATOM   1579  O  O   . PHE A  1 235 ? 25.384 8.332   10.155  1.00 37.47 ? 215 PHE A O   1 
ATOM   1580  C  CB  . PHE A  1 235 ? 23.325 10.464  10.365  1.00 37.64 ? 215 PHE A CB  1 
ATOM   1581  C  CG  . PHE A  1 235 ? 23.837 11.469  11.365  1.00 40.04 ? 215 PHE A CG  1 
ATOM   1582  C  CD1 . PHE A  1 235 ? 23.186 12.678  11.535  1.00 44.93 ? 215 PHE A CD1 1 
ATOM   1583  C  CD2 . PHE A  1 235 ? 24.928 11.170  12.207  1.00 36.45 ? 215 PHE A CD2 1 
ATOM   1584  C  CE1 . PHE A  1 235 ? 23.638 13.583  12.482  1.00 43.05 ? 215 PHE A CE1 1 
ATOM   1585  C  CE2 . PHE A  1 235 ? 25.360 12.048  13.142  1.00 36.61 ? 215 PHE A CE2 1 
ATOM   1586  C  CZ  . PHE A  1 235 ? 24.732 13.240  13.299  1.00 48.56 ? 215 PHE A CZ  1 
ATOM   1587  N  N   . ASP A  1 236 ? 26.630 9.861   9.083   1.00 39.99 ? 216 ASP A N   1 
ATOM   1588  C  CA  . ASP A  1 236 ? 27.885 9.139   9.131   1.00 40.37 ? 216 ASP A CA  1 
ATOM   1589  C  C   . ASP A  1 236 ? 28.755 9.584   10.313  1.00 42.56 ? 216 ASP A C   1 
ATOM   1590  O  O   . ASP A  1 236 ? 29.190 10.746  10.388  1.00 41.37 ? 216 ASP A O   1 
ATOM   1591  C  CB  . ASP A  1 236 ? 28.653 9.341   7.837   1.00 36.98 ? 216 ASP A CB  1 
ATOM   1592  C  CG  . ASP A  1 236 ? 29.898 8.418   7.726   1.00 49.23 ? 216 ASP A CG  1 
ATOM   1593  O  OD1 . ASP A  1 236 ? 30.111 7.484   8.570   1.00 44.44 ? 216 ASP A OD1 1 
ATOM   1594  O  OD2 . ASP A  1 236 ? 30.701 8.665   6.800   1.00 45.46 ? 216 ASP A OD2 1 
ATOM   1595  N  N   . ASN A  1 237 ? 28.990 8.610   11.202  1.00 44.10 ? 217 ASN A N   1 
ATOM   1596  C  CA  . ASN A  1 237 ? 29.859 8.712   12.358  1.00 47.16 ? 217 ASN A CA  1 
ATOM   1597  C  C   . ASN A  1 237 ? 31.149 7.913   12.229  1.00 45.24 ? 217 ASN A C   1 
ATOM   1598  O  O   . ASN A  1 237 ? 32.073 8.181   12.987  1.00 43.15 ? 217 ASN A O   1 
ATOM   1599  C  CB  . ASN A  1 237 ? 29.170 8.161   13.600  1.00 50.62 ? 217 ASN A CB  1 
ATOM   1600  C  CG  . ASN A  1 237 ? 28.066 9.029   14.080  1.00 51.80 ? 217 ASN A CG  1 
ATOM   1601  O  OD1 . ASN A  1 237 ? 28.292 10.215  14.328  1.00 53.45 ? 217 ASN A OD1 1 
ATOM   1602  N  ND2 . ASN A  1 237 ? 26.838 8.442   14.230  1.00 42.50 ? 217 ASN A ND2 1 
ATOM   1603  N  N   . VAL A  1 238 ? 31.194 6.937   11.306  1.00 46.39 ? 218 VAL A N   1 
ATOM   1604  C  CA  . VAL A  1 238 ? 32.266 5.939   11.284  1.00 44.29 ? 218 VAL A CA  1 
ATOM   1605  C  C   . VAL A  1 238 ? 33.215 5.986   10.109  1.00 42.58 ? 218 VAL A C   1 
ATOM   1606  O  O   . VAL A  1 238 ? 34.349 5.599   10.253  1.00 45.53 ? 218 VAL A O   1 
ATOM   1607  C  CB  . VAL A  1 238 ? 31.789 4.408   11.543  1.00 46.92 ? 218 VAL A CB  1 
ATOM   1608  C  CG1 . VAL A  1 238 ? 30.556 4.305   12.435  1.00 42.53 ? 218 VAL A CG1 1 
ATOM   1609  C  CG2 . VAL A  1 238 ? 31.646 3.606   10.297  1.00 50.17 ? 218 VAL A CG2 1 
ATOM   1610  N  N   . GLY A  1 239 ? 32.742 6.404   8.946   1.00 45.24 ? 219 GLY A N   1 
ATOM   1611  C  CA  . GLY A  1 239 ? 33.556 6.502   7.746   1.00 43.17 ? 219 GLY A CA  1 
ATOM   1612  C  C   . GLY A  1 239 ? 34.080 5.172   7.213   1.00 46.00 ? 219 GLY A C   1 
ATOM   1613  O  O   . GLY A  1 239 ? 33.536 4.070   7.491   1.00 43.39 ? 219 GLY A O   1 
ATOM   1614  N  N   . GLY A  1 240 ? 35.157 5.289   6.440   1.00 46.08 ? 220 GLY A N   1 
ATOM   1615  C  CA  . GLY A  1 240 ? 35.847 4.139   5.864   1.00 49.04 ? 220 GLY A CA  1 
ATOM   1616  C  C   . GLY A  1 240 ? 35.048 3.310   4.876   1.00 50.69 ? 220 GLY A C   1 
ATOM   1617  O  O   . GLY A  1 240 ? 34.248 3.844   4.094   1.00 52.54 ? 220 GLY A O   1 
ATOM   1618  N  N   . GLU A  1 241 ? 35.281 1.997   4.906   1.00 51.71 ? 221 GLU A N   1 
ATOM   1619  C  CA  . GLU A  1 241 ? 34.701 1.098   3.915   1.00 53.95 ? 221 GLU A CA  1 
ATOM   1620  C  C   . GLU A  1 241 ? 33.225 0.804   4.205   1.00 48.64 ? 221 GLU A C   1 
ATOM   1621  O  O   . GLU A  1 241 ? 32.439 0.513   3.310   1.00 47.70 ? 221 GLU A O   1 
ATOM   1622  C  CB  . GLU A  1 241 ? 35.632 -0.117  3.671   1.00 52.09 ? 221 GLU A CB  1 
ATOM   1623  C  CG  . GLU A  1 241 ? 36.491 0.220   2.378   1.00 63.17 ? 221 GLU A CG  1 
ATOM   1624  C  CD  . GLU A  1 241 ? 37.664 -0.714  2.050   1.00 67.58 ? 221 GLU A CD  1 
ATOM   1625  O  OE1 . GLU A  1 241 ? 38.345 -1.243  2.971   1.00 87.53 ? 221 GLU A OE1 1 
ATOM   1626  O  OE2 . GLU A  1 241 ? 37.935 -0.890  0.840   1.00 83.33 ? 221 GLU A OE2 1 
ATOM   1627  N  N   . PHE A  1 242 ? 32.840 0.960   5.460   1.00 47.47 ? 222 PHE A N   1 
ATOM   1628  C  CA  . PHE A  1 242 ? 31.436 0.983   5.838   1.00 46.73 ? 222 PHE A CA  1 
ATOM   1629  C  C   . PHE A  1 242 ? 30.665 2.072   5.056   1.00 45.64 ? 222 PHE A C   1 
ATOM   1630  O  O   . PHE A  1 242 ? 29.586 1.795   4.511   1.00 43.46 ? 222 PHE A O   1 
ATOM   1631  C  CB  . PHE A  1 242 ? 31.291 1.219   7.362   1.00 47.73 ? 222 PHE A CB  1 
ATOM   1632  C  CG  . PHE A  1 242 ? 29.893 1.040   7.864   1.00 47.84 ? 222 PHE A CG  1 
ATOM   1633  C  CD1 . PHE A  1 242 ? 29.559 -0.046  8.670   1.00 50.08 ? 222 PHE A CD1 1 
ATOM   1634  C  CD2 . PHE A  1 242 ? 28.884 1.931   7.496   1.00 46.15 ? 222 PHE A CD2 1 
ATOM   1635  C  CE1 . PHE A  1 242 ? 28.235 -0.231  9.128   1.00 45.46 ? 222 PHE A CE1 1 
ATOM   1636  C  CE2 . PHE A  1 242 ? 27.577 1.762   7.943   1.00 43.84 ? 222 PHE A CE2 1 
ATOM   1637  C  CZ  . PHE A  1 242 ? 27.246 0.679   8.754   1.00 48.00 ? 222 PHE A CZ  1 
ATOM   1638  N  N   . SER A  1 243 ? 31.215 3.294   5.017   1.00 41.85 ? 223 SER A N   1 
ATOM   1639  C  CA  . SER A  1 243 ? 30.591 4.392   4.283   1.00 42.40 ? 223 SER A CA  1 
ATOM   1640  C  C   . SER A  1 243 ? 30.640 4.203   2.778   1.00 39.15 ? 223 SER A C   1 
ATOM   1641  O  O   . SER A  1 243 ? 29.757 4.699   2.055   1.00 38.08 ? 223 SER A O   1 
ATOM   1642  C  CB  . SER A  1 243 ? 31.202 5.773   4.639   1.00 41.48 ? 223 SER A CB  1 
ATOM   1643  O  OG  . SER A  1 243 ? 30.931 6.133   5.985   1.00 41.69 ? 223 SER A OG  1 
ATOM   1644  N  N   . ASN A  1 244 ? 31.674 3.554   2.277   1.00 40.08 ? 224 ASN A N   1 
ATOM   1645  C  CA  . ASN A  1 244 ? 31.733 3.249   0.833   1.00 41.05 ? 224 ASN A CA  1 
ATOM   1646  C  C   . ASN A  1 244 ? 30.595 2.336   0.463   1.00 42.65 ? 224 ASN A C   1 
ATOM   1647  O  O   . ASN A  1 244 ? 30.069 2.426   -0.612  1.00 47.77 ? 224 ASN A O   1 
ATOM   1648  C  CB  . ASN A  1 244 ? 33.048 2.564   0.438   1.00 42.86 ? 224 ASN A CB  1 
ATOM   1649  C  CG  . ASN A  1 244 ? 34.242 3.468   0.613   1.00 43.99 ? 224 ASN A CG  1 
ATOM   1650  O  OD1 . ASN A  1 244 ? 34.075 4.677   0.668   1.00 45.77 ? 224 ASN A OD1 1 
ATOM   1651  N  ND2 . ASN A  1 244 ? 35.448 2.889   0.746   1.00 42.17 ? 224 ASN A ND2 1 
ATOM   1652  N  N   . THR A  1 245 ? 30.189 1.459   1.365   1.00 45.27 ? 225 THR A N   1 
ATOM   1653  C  CA  . THR A  1 245 ? 29.107 0.521   1.067   1.00 45.19 ? 225 THR A CA  1 
ATOM   1654  C  C   . THR A  1 245 ? 27.751 1.213   1.108   1.00 43.85 ? 225 THR A C   1 
ATOM   1655  O  O   . THR A  1 245 ? 26.937 1.076   0.187   1.00 42.65 ? 225 THR A O   1 
ATOM   1656  C  CB  . THR A  1 245 ? 29.178 -0.662  1.984   1.00 47.22 ? 225 THR A CB  1 
ATOM   1657  O  OG1 . THR A  1 245 ? 30.495 -1.219  1.867   1.00 48.38 ? 225 THR A OG1 1 
ATOM   1658  C  CG2 . THR A  1 245 ? 28.121 -1.707  1.618   1.00 47.44 ? 225 THR A CG2 1 
ATOM   1659  N  N   . VAL A  1 246 ? 27.541 2.028   2.128   1.00 45.26 ? 226 VAL A N   1 
ATOM   1660  C  CA  . VAL A  1 246 ? 26.334 2.875   2.193   1.00 43.51 ? 226 VAL A CA  1 
ATOM   1661  C  C   . VAL A  1 246 ? 26.146 3.803   0.962   1.00 42.59 ? 226 VAL A C   1 
ATOM   1662  O  O   . VAL A  1 246 ? 25.078 3.861   0.355   1.00 42.12 ? 226 VAL A O   1 
ATOM   1663  C  CB  . VAL A  1 246 ? 26.306 3.673   3.461   1.00 41.94 ? 226 VAL A CB  1 
ATOM   1664  C  CG1 . VAL A  1 246 ? 24.994 4.501   3.530   1.00 47.52 ? 226 VAL A CG1 1 
ATOM   1665  C  CG2 . VAL A  1 246 ? 26.391 2.727   4.671   1.00 37.03 ? 226 VAL A CG2 1 
ATOM   1666  N  N   . ILE A  1 247 ? 27.196 4.502   0.590   1.00 41.70 ? 227 ILE A N   1 
ATOM   1667  C  CA  . ILE A  1 247 ? 27.176 5.365   -0.598  1.00 43.38 ? 227 ILE A CA  1 
ATOM   1668  C  C   . ILE A  1 247 ? 26.697 4.646   -1.852  1.00 43.62 ? 227 ILE A C   1 
ATOM   1669  O  O   . ILE A  1 247 ? 26.102 5.286   -2.731  1.00 48.14 ? 227 ILE A O   1 
ATOM   1670  C  CB  . ILE A  1 247 ? 28.583 6.005   -0.838  1.00 44.07 ? 227 ILE A CB  1 
ATOM   1671  C  CG1 . ILE A  1 247 ? 28.711 7.270   0.007   1.00 47.64 ? 227 ILE A CG1 1 
ATOM   1672  C  CG2 . ILE A  1 247 ? 28.841 6.311   -2.294  1.00 45.35 ? 227 ILE A CG2 1 
ATOM   1673  C  CD1 . ILE A  1 247 ? 30.141 7.580   0.394   1.00 50.93 ? 227 ILE A CD1 1 
ATOM   1674  N  N   . GLY A  1 248 ? 26.955 3.342   -1.957  1.00 39.91 ? 228 GLY A N   1 
ATOM   1675  C  CA  . GLY A  1 248 ? 26.472 2.572   -3.096  1.00 40.55 ? 228 GLY A CA  1 
ATOM   1676  C  C   . GLY A  1 248 ? 24.977 2.251   -3.091  1.00 40.96 ? 228 GLY A C   1 
ATOM   1677  O  O   . GLY A  1 248 ? 24.443 1.747   -4.068  1.00 39.20 ? 228 GLY A O   1 
ATOM   1678  N  N   . GLN A  1 249 ? 24.297 2.549   -1.987  1.00 42.99 ? 229 GLN A N   1 
ATOM   1679  C  CA  . GLN A  1 249 ? 22.856 2.396   -1.912  1.00 43.98 ? 229 GLN A CA  1 
ATOM   1680  C  C   . GLN A  1 249 ? 22.101 3.673   -1.584  1.00 41.28 ? 229 GLN A C   1 
ATOM   1681  O  O   . GLN A  1 249 ? 20.932 3.615   -1.248  1.00 37.56 ? 229 GLN A O   1 
ATOM   1682  C  CB  . GLN A  1 249 ? 22.539 1.345   -0.865  1.00 48.47 ? 229 GLN A CB  1 
ATOM   1683  C  CG  . GLN A  1 249 ? 23.342 0.086   -1.067  1.00 51.99 ? 229 GLN A CG  1 
ATOM   1684  C  CD  . GLN A  1 249 ? 22.824 -1.034  -0.312  1.00 50.16 ? 229 GLN A CD  1 
ATOM   1685  O  OE1 . GLN A  1 249 ? 21.732 -0.961  0.241   1.00 56.94 ? 229 GLN A OE1 1 
ATOM   1686  N  NE2 . GLN A  1 249 ? 23.591 -2.109  -0.266  1.00 55.30 ? 229 GLN A NE2 1 
ATOM   1687  N  N   . MET A  1 250 ? 22.774 4.818   -1.699  1.00 41.78 ? 230 MET A N   1 
ATOM   1688  C  CA  . MET A  1 250 ? 22.136 6.145   -1.589  1.00 40.03 ? 230 MET A CA  1 
ATOM   1689  C  C   . MET A  1 250 ? 21.192 6.393   -2.749  1.00 41.24 ? 230 MET A C   1 
ATOM   1690  O  O   . MET A  1 250 ? 21.492 6.041   -3.889  1.00 42.13 ? 230 MET A O   1 
ATOM   1691  C  CB  . MET A  1 250 ? 23.160 7.269   -1.575  1.00 37.01 ? 230 MET A CB  1 
ATOM   1692  C  CG  . MET A  1 250 ? 24.013 7.375   -0.298  1.00 43.73 ? 230 MET A CG  1 
ATOM   1693  S  SD  . MET A  1 250 ? 23.111 7.481   1.244   1.00 43.05 ? 230 MET A SD  1 
ATOM   1694  C  CE  . MET A  1 250 ? 22.354 9.071   1.095   1.00 41.27 ? 230 MET A CE  1 
ATOM   1695  N  N   . LYS A  1 251 ? 20.050 7.005   -2.453  1.00 41.94 ? 231 LYS A N   1 
ATOM   1696  C  CA  . LYS A  1 251 ? 19.136 7.414   -3.490  1.00 42.67 ? 231 LYS A CA  1 
ATOM   1697  C  C   . LYS A  1 251 ? 19.737 8.610   -4.267  1.00 42.44 ? 231 LYS A C   1 
ATOM   1698  O  O   . LYS A  1 251 ? 20.680 9.297   -3.804  1.00 39.00 ? 231 LYS A O   1 
ATOM   1699  C  CB  . LYS A  1 251 ? 17.790 7.818   -2.881  1.00 42.88 ? 231 LYS A CB  1 
ATOM   1700  C  CG  . LYS A  1 251 ? 16.936 6.651   -2.369  1.00 44.40 ? 231 LYS A CG  1 
ATOM   1701  C  CD  . LYS A  1 251 ? 15.508 7.113   -2.061  1.00 43.62 ? 231 LYS A CD  1 
ATOM   1702  C  CE  . LYS A  1 251 ? 14.922 6.305   -0.917  1.00 55.77 ? 231 LYS A CE  1 
ATOM   1703  N  NZ  . LYS A  1 251 ? 13.423 6.402   -0.731  1.00 57.07 ? 231 LYS A NZ  1 
ATOM   1704  N  N   . LYS A  1 252 ? 19.175 8.859   -5.442  1.00 41.38 ? 232 LYS A N   1 
ATOM   1705  C  CA  . LYS A  1 252 ? 19.574 9.998   -6.223  1.00 40.57 ? 232 LYS A CA  1 
ATOM   1706  C  C   . LYS A  1 252 ? 19.359 11.298  -5.450  1.00 38.59 ? 232 LYS A C   1 
ATOM   1707  O  O   . LYS A  1 252 ? 18.323 11.493  -4.835  1.00 38.48 ? 232 LYS A O   1 
ATOM   1708  C  CB  . LYS A  1 252 ? 18.858 10.022  -7.569  1.00 39.79 ? 232 LYS A CB  1 
ATOM   1709  C  CG  . LYS A  1 252 ? 19.536 10.961  -8.515  1.00 46.43 ? 232 LYS A CG  1 
ATOM   1710  C  CD  . LYS A  1 252 ? 19.301 10.624  -9.930  1.00 52.53 ? 232 LYS A CD  1 
ATOM   1711  C  CE  . LYS A  1 252 ? 19.968 11.666  -10.810 1.00 57.26 ? 232 LYS A CE  1 
ATOM   1712  N  NZ  . LYS A  1 252 ? 19.103 11.940  -12.026 1.00 71.61 ? 232 LYS A NZ  1 
ATOM   1713  N  N   . PHE A  1 253 ? 20.366 12.174  -5.500  1.00 37.76 ? 233 PHE A N   1 
ATOM   1714  C  CA  . PHE A  1 253 ? 20.486 13.362  -4.641  1.00 36.58 ? 233 PHE A CA  1 
ATOM   1715  C  C   . PHE A  1 253 ? 20.412 13.049  -3.150  1.00 37.78 ? 233 PHE A C   1 
ATOM   1716  O  O   . PHE A  1 253 ? 19.935 13.862  -2.363  1.00 41.01 ? 233 PHE A O   1 
ATOM   1717  C  CB  . PHE A  1 253 ? 19.455 14.428  -4.988  1.00 37.12 ? 233 PHE A CB  1 
ATOM   1718  C  CG  . PHE A  1 253 ? 19.254 14.633  -6.474  1.00 39.17 ? 233 PHE A CG  1 
ATOM   1719  C  CD1 . PHE A  1 253 ? 20.206 15.308  -7.230  1.00 36.93 ? 233 PHE A CD1 1 
ATOM   1720  C  CD2 . PHE A  1 253 ? 18.085 14.201  -7.089  1.00 31.10 ? 233 PHE A CD2 1 
ATOM   1721  C  CE1 . PHE A  1 253 ? 20.018 15.511  -8.574  1.00 43.60 ? 233 PHE A CE1 1 
ATOM   1722  C  CE2 . PHE A  1 253 ? 17.894 14.399  -8.445  1.00 40.72 ? 233 PHE A CE2 1 
ATOM   1723  C  CZ  . PHE A  1 253 ? 18.857 15.063  -9.187  1.00 38.54 ? 233 PHE A CZ  1 
ATOM   1724  N  N   . GLY A  1 254 ? 20.882 11.876  -2.755  1.00 38.69 ? 234 GLY A N   1 
ATOM   1725  C  CA  . GLY A  1 254 ? 21.014 11.538  -1.329  1.00 39.29 ? 234 GLY A CA  1 
ATOM   1726  C  C   . GLY A  1 254 ? 21.939 12.516  -0.624  1.00 37.94 ? 234 GLY A C   1 
ATOM   1727  O  O   . GLY A  1 254 ? 22.838 13.059  -1.216  1.00 36.91 ? 234 GLY A O   1 
ATOM   1728  N  N   . ARG A  1 255 ? 21.676 12.732  0.652   1.00 41.91 ? 235 ARG A N   1 
ATOM   1729  C  CA  . ARG A  1 255 ? 22.410 13.646  1.496   1.00 42.35 ? 235 ARG A CA  1 
ATOM   1730  C  C   . ARG A  1 255 ? 23.110 12.847  2.544   1.00 42.70 ? 235 ARG A C   1 
ATOM   1731  O  O   . ARG A  1 255 ? 22.520 11.966  3.131   1.00 39.68 ? 235 ARG A O   1 
ATOM   1732  C  CB  . ARG A  1 255 ? 21.473 14.604  2.220   1.00 42.25 ? 235 ARG A CB  1 
ATOM   1733  C  CG  . ARG A  1 255 ? 20.924 15.701  1.355   1.00 45.78 ? 235 ARG A CG  1 
ATOM   1734  C  CD  . ARG A  1 255 ? 19.482 15.965  1.694   1.00 57.17 ? 235 ARG A CD  1 
ATOM   1735  N  NE  . ARG A  1 255 ? 18.617 14.921  1.148   1.00 61.84 ? 235 ARG A NE  1 
ATOM   1736  C  CZ  . ARG A  1 255 ? 17.459 14.486  1.675   1.00 68.02 ? 235 ARG A CZ  1 
ATOM   1737  N  NH1 . ARG A  1 255 ? 16.821 13.519  1.039   1.00 64.72 ? 235 ARG A NH1 1 
ATOM   1738  N  NH2 . ARG A  1 255 ? 16.934 14.959  2.827   1.00 60.97 ? 235 ARG A NH2 1 
ATOM   1739  N  N   . ILE A  1 256 ? 24.374 13.211  2.765   1.00 41.52 ? 236 ILE A N   1 
ATOM   1740  C  CA  . ILE A  1 256 ? 25.206 12.634  3.764   1.00 42.11 ? 236 ILE A CA  1 
ATOM   1741  C  C   . ILE A  1 256 ? 25.663 13.713  4.731   1.00 42.22 ? 236 ILE A C   1 
ATOM   1742  O  O   . ILE A  1 256 ? 26.248 14.707  4.315   1.00 41.67 ? 236 ILE A O   1 
ATOM   1743  C  CB  . ILE A  1 256 ? 26.415 11.970  3.089   1.00 42.64 ? 236 ILE A CB  1 
ATOM   1744  C  CG1 . ILE A  1 256 ? 25.890 11.076  1.936   1.00 40.42 ? 236 ILE A CG1 1 
ATOM   1745  C  CG2 . ILE A  1 256 ? 27.284 11.232  4.137   1.00 38.37 ? 236 ILE A CG2 1 
ATOM   1746  C  CD1 . ILE A  1 256 ? 26.910 10.124  1.349   1.00 45.59 ? 236 ILE A CD1 1 
ATOM   1747  N  N   . ALA A  1 257 ? 25.406 13.498  6.027   1.00 43.75 ? 237 ALA A N   1 
ATOM   1748  C  CA  . ALA A  1 257 ? 25.958 14.347  7.102   1.00 43.87 ? 237 ALA A CA  1 
ATOM   1749  C  C   . ALA A  1 257 ? 27.208 13.670  7.646   1.00 42.57 ? 237 ALA A C   1 
ATOM   1750  O  O   . ALA A  1 257 ? 27.135 12.612  8.267   1.00 42.96 ? 237 ALA A O   1 
ATOM   1751  C  CB  . ALA A  1 257 ? 24.906 14.573  8.253   1.00 42.21 ? 237 ALA A CB  1 
ATOM   1752  N  N   . ILE A  1 258 ? 28.346 14.309  7.447   1.00 43.71 ? 238 ILE A N   1 
ATOM   1753  C  CA  . ILE A  1 258 ? 29.616 13.794  7.936   1.00 43.97 ? 238 ILE A CA  1 
ATOM   1754  C  C   . ILE A  1 258 ? 29.902 14.413  9.299   1.00 39.96 ? 238 ILE A C   1 
ATOM   1755  O  O   . ILE A  1 258 ? 30.231 15.557  9.458   1.00 38.79 ? 238 ILE A O   1 
ATOM   1756  C  CB  . ILE A  1 258 ? 30.746 14.036  6.921   1.00 43.34 ? 238 ILE A CB  1 
ATOM   1757  C  CG1 . ILE A  1 258 ? 30.368 13.428  5.566   1.00 50.24 ? 238 ILE A CG1 1 
ATOM   1758  C  CG2 . ILE A  1 258 ? 32.026 13.414  7.419   1.00 47.05 ? 238 ILE A CG2 1 
ATOM   1759  C  CD1 . ILE A  1 258 ? 31.161 13.992  4.368   1.00 49.72 ? 238 ILE A CD1 1 
ATOM   1760  N  N   . CYS A  1 259 ? 29.761 13.573  10.292  1.00 46.34 ? 239 CYS A N   1 
ATOM   1761  C  CA  . CYS A  1 259 ? 29.861 13.939  11.683  1.00 45.85 ? 239 CYS A CA  1 
ATOM   1762  C  C   . CYS A  1 259 ? 31.188 13.408  12.284  1.00 45.82 ? 239 CYS A C   1 
ATOM   1763  O  O   . CYS A  1 259 ? 31.909 14.130  12.952  1.00 46.43 ? 239 CYS A O   1 
ATOM   1764  C  CB  . CYS A  1 259 ? 28.663 13.304  12.366  1.00 48.30 ? 239 CYS A CB  1 
ATOM   1765  S  SG  . CYS A  1 259 ? 28.556 13.667  14.045  1.00 46.85 ? 239 CYS A SG  1 
ATOM   1766  N  N   . GLY A  1 260 ? 31.504 12.145  12.039  1.00 44.20 ? 240 GLY A N   1 
ATOM   1767  C  CA  . GLY A  1 260 ? 32.802 11.616  12.408  1.00 43.80 ? 240 GLY A CA  1 
ATOM   1768  C  C   . GLY A  1 260 ? 33.251 10.530  11.486  1.00 44.24 ? 240 GLY A C   1 
ATOM   1769  O  O   . GLY A  1 260 ? 32.576 10.201  10.490  1.00 45.65 ? 240 GLY A O   1 
ATOM   1770  N  N   . ALA A  1 261 ? 34.397 9.960   11.831  1.00 43.01 ? 241 ALA A N   1 
ATOM   1771  C  CA  . ALA A  1 261 ? 34.981 8.840   11.103  1.00 42.13 ? 241 ALA A CA  1 
ATOM   1772  C  C   . ALA A  1 261 ? 35.697 7.956   12.094  1.00 41.13 ? 241 ALA A C   1 
ATOM   1773  O  O   . ALA A  1 261 ? 36.923 7.833   12.013  1.00 39.54 ? 241 ALA A O   1 
ATOM   1774  C  CB  . ALA A  1 261 ? 35.953 9.328   10.062  1.00 42.05 ? 241 ALA A CB  1 
ATOM   1775  N  N   . ILE A  1 262 ? 34.943 7.420   13.052  1.00 40.70 ? 242 ILE A N   1 
ATOM   1776  C  CA  . ILE A  1 262 ? 35.539 6.775   14.189  1.00 44.85 ? 242 ILE A CA  1 
ATOM   1777  C  C   . ILE A  1 262 ? 36.392 5.593   13.785  1.00 44.95 ? 242 ILE A C   1 
ATOM   1778  O  O   . ILE A  1 262 ? 37.467 5.375   14.371  1.00 46.16 ? 242 ILE A O   1 
ATOM   1779  C  CB  . ILE A  1 262 ? 34.542 6.378   15.351  1.00 44.43 ? 242 ILE A CB  1 
ATOM   1780  C  CG1 . ILE A  1 262 ? 33.388 5.516   14.897  1.00 49.83 ? 242 ILE A CG1 1 
ATOM   1781  C  CG2 . ILE A  1 262 ? 33.968 7.590   16.056  1.00 45.70 ? 242 ILE A CG2 1 
ATOM   1782  C  CD1 . ILE A  1 262 ? 32.542 5.057   16.118  1.00 48.90 ? 242 ILE A CD1 1 
ATOM   1783  N  N   . SER A  1 263 ? 35.967 4.872   12.756  1.00 43.96 ? 243 SER A N   1 
ATOM   1784  C  CA  . SER A  1 263 ? 36.697 3.696   12.306  1.00 42.43 ? 243 SER A CA  1 
ATOM   1785  C  C   . SER A  1 263 ? 38.117 4.064   11.855  1.00 42.51 ? 243 SER A C   1 
ATOM   1786  O  O   . SER A  1 263 ? 38.947 3.199   11.688  1.00 41.92 ? 243 SER A O   1 
ATOM   1787  C  CB  . SER A  1 263 ? 35.971 3.034   11.128  1.00 41.70 ? 243 SER A CB  1 
ATOM   1788  O  OG  . SER A  1 263 ? 36.118 3.838   9.976   1.00 49.62 ? 243 SER A OG  1 
ATOM   1789  N  N   . THR A  1 264 ? 38.399 5.348   11.646  1.00 42.11 ? 244 THR A N   1 
ATOM   1790  C  CA  . THR A  1 264 ? 39.700 5.757   11.140  1.00 41.49 ? 244 THR A CA  1 
ATOM   1791  C  C   . THR A  1 264 ? 40.581 6.321   12.210  1.00 39.87 ? 244 THR A C   1 
ATOM   1792  O  O   . THR A  1 264 ? 41.739 6.423   11.977  1.00 43.46 ? 244 THR A O   1 
ATOM   1793  C  CB  . THR A  1 264 ? 39.610 6.821   9.980   1.00 41.40 ? 244 THR A CB  1 
ATOM   1794  O  OG1 . THR A  1 264 ? 39.237 8.089   10.497  1.00 38.05 ? 244 THR A OG1 1 
ATOM   1795  C  CG2 . THR A  1 264 ? 38.643 6.395   8.914   1.00 41.37 ? 244 THR A CG2 1 
ATOM   1796  N  N   . TYR A  1 265 ? 40.058 6.663   13.385  1.00 42.62 ? 245 TYR A N   1 
ATOM   1797  C  CA  . TYR A  1 265 ? 40.848 7.464   14.329  1.00 45.17 ? 245 TYR A CA  1 
ATOM   1798  C  C   . TYR A  1 265 ? 42.051 6.752   14.934  1.00 43.10 ? 245 TYR A C   1 
ATOM   1799  O  O   . TYR A  1 265 ? 42.986 7.418   15.346  1.00 43.27 ? 245 TYR A O   1 
ATOM   1800  C  CB  . TYR A  1 265 ? 40.016 8.045   15.484  1.00 44.27 ? 245 TYR A CB  1 
ATOM   1801  C  CG  . TYR A  1 265 ? 38.892 8.951   15.099  1.00 50.85 ? 245 TYR A CG  1 
ATOM   1802  C  CD1 . TYR A  1 265 ? 38.859 9.596   13.860  1.00 51.94 ? 245 TYR A CD1 1 
ATOM   1803  C  CD2 . TYR A  1 265 ? 37.852 9.197   16.008  1.00 49.57 ? 245 TYR A CD2 1 
ATOM   1804  C  CE1 . TYR A  1 265 ? 37.796 10.466  13.537  1.00 54.50 ? 245 TYR A CE1 1 
ATOM   1805  C  CE2 . TYR A  1 265 ? 36.819 10.048  15.700  1.00 51.18 ? 245 TYR A CE2 1 
ATOM   1806  C  CZ  . TYR A  1 265 ? 36.788 10.666  14.468  1.00 47.61 ? 245 TYR A CZ  1 
ATOM   1807  O  OH  . TYR A  1 265 ? 35.737 11.462  14.160  1.00 47.55 ? 245 TYR A OH  1 
ATOM   1808  N  N   . ASN A  1 266 ? 41.997 5.423   15.000  1.00 43.30 ? 246 ASN A N   1 
ATOM   1809  C  CA  . ASN A  1 266 ? 42.943 4.643   15.755  1.00 41.93 ? 246 ASN A CA  1 
ATOM   1810  C  C   . ASN A  1 266 ? 43.747 3.715   14.863  1.00 43.75 ? 246 ASN A C   1 
ATOM   1811  O  O   . ASN A  1 266 ? 44.387 2.769   15.316  1.00 46.21 ? 246 ASN A O   1 
ATOM   1812  C  CB  . ASN A  1 266 ? 42.164 3.810   16.755  1.00 43.69 ? 246 ASN A CB  1 
ATOM   1813  C  CG  . ASN A  1 266 ? 41.635 4.616   17.894  1.00 37.67 ? 246 ASN A CG  1 
ATOM   1814  O  OD1 . ASN A  1 266 ? 42.403 5.054   18.733  1.00 40.34 ? 246 ASN A OD1 1 
ATOM   1815  N  ND2 . ASN A  1 266 ? 40.324 4.789   17.960  1.00 39.03 ? 246 ASN A ND2 1 
ATOM   1816  N  N   . ARG A  1 267 ? 43.695 3.979   13.579  1.00 43.87 ? 247 ARG A N   1 
ATOM   1817  C  CA  . ARG A  1 267 ? 44.374 3.168   12.607  1.00 43.30 ? 247 ARG A CA  1 
ATOM   1818  C  C   . ARG A  1 267 ? 45.892 3.301   12.683  1.00 43.64 ? 247 ARG A C   1 
ATOM   1819  O  O   . ARG A  1 267 ? 46.446 4.245   13.233  1.00 42.61 ? 247 ARG A O   1 
ATOM   1820  C  CB  . ARG A  1 267 ? 43.920 3.576   11.207  1.00 44.24 ? 247 ARG A CB  1 
ATOM   1821  C  CG  . ARG A  1 267 ? 44.454 4.940   10.762  1.00 40.42 ? 247 ARG A CG  1 
ATOM   1822  C  CD  . ARG A  1 267 ? 44.023 5.210   9.310   1.00 47.37 ? 247 ARG A CD  1 
ATOM   1823  N  NE  . ARG A  1 267 ? 44.632 6.426   8.803   1.00 43.67 ? 247 ARG A NE  1 
ATOM   1824  C  CZ  . ARG A  1 267 ? 44.253 7.646   9.149   1.00 53.58 ? 247 ARG A CZ  1 
ATOM   1825  N  NH1 . ARG A  1 267 ? 43.252 7.832   10.006  1.00 61.50 ? 247 ARG A NH1 1 
ATOM   1826  N  NH2 . ARG A  1 267 ? 44.874 8.691   8.638   1.00 52.72 ? 247 ARG A NH2 1 
ATOM   1827  N  N   . THR A  1 268 ? 46.570 2.312   12.109  1.00 44.47 ? 248 THR A N   1 
ATOM   1828  C  CA  . THR A  1 268 ? 48.015 2.257   12.148  1.00 41.31 ? 248 THR A CA  1 
ATOM   1829  C  C   . THR A  1 268 ? 48.556 2.223   10.705  1.00 44.00 ? 248 THR A C   1 
ATOM   1830  O  O   . THR A  1 268 ? 49.759 2.221   10.520  1.00 44.82 ? 248 THR A O   1 
ATOM   1831  C  CB  . THR A  1 268 ? 48.538 1.059   12.988  1.00 38.47 ? 248 THR A CB  1 
ATOM   1832  O  OG1 . THR A  1 268 ? 48.174 -0.201  12.386  1.00 32.76 ? 248 THR A OG1 1 
ATOM   1833  C  CG2 . THR A  1 268 ? 48.027 1.119   14.334  1.00 31.47 ? 248 THR A CG2 1 
ATOM   1834  N  N   . GLY A  1 269 ? 47.673 2.237   9.709   1.00 42.23 ? 249 GLY A N   1 
ATOM   1835  C  CA  . GLY A  1 269 ? 48.083 2.181   8.332   1.00 44.90 ? 249 GLY A CA  1 
ATOM   1836  C  C   . GLY A  1 269 ? 47.535 3.358   7.579   1.00 46.27 ? 249 GLY A C   1 
ATOM   1837  O  O   . GLY A  1 269 ? 47.052 4.305   8.180   1.00 47.40 ? 249 GLY A O   1 
ATOM   1838  N  N   . PRO A  1 270 ? 47.568 3.294   6.247   1.00 46.63 ? 250 PRO A N   1 
ATOM   1839  C  CA  . PRO A  1 270 ? 46.885 4.357   5.474   1.00 46.73 ? 250 PRO A CA  1 
ATOM   1840  C  C   . PRO A  1 270 ? 45.358 4.217   5.521   1.00 48.50 ? 250 PRO A C   1 
ATOM   1841  O  O   . PRO A  1 270 ? 44.822 3.135   5.852   1.00 51.22 ? 250 PRO A O   1 
ATOM   1842  C  CB  . PRO A  1 270 ? 47.398 4.167   4.048   1.00 43.66 ? 250 PRO A CB  1 
ATOM   1843  C  CG  . PRO A  1 270 ? 47.799 2.714   3.978   1.00 47.94 ? 250 PRO A CG  1 
ATOM   1844  C  CD  . PRO A  1 270 ? 48.166 2.257   5.397   1.00 44.44 ? 250 PRO A CD  1 
ATOM   1845  N  N   . LEU A  1 271 ? 44.672 5.307   5.195   1.00 47.88 ? 251 LEU A N   1 
ATOM   1846  C  CA  . LEU A  1 271 ? 43.224 5.301   5.052   1.00 47.89 ? 251 LEU A CA  1 
ATOM   1847  C  C   . LEU A  1 271 ? 42.791 4.320   3.989   1.00 47.81 ? 251 LEU A C   1 
ATOM   1848  O  O   . LEU A  1 271 ? 43.532 4.077   3.011   1.00 47.88 ? 251 LEU A O   1 
ATOM   1849  C  CB  . LEU A  1 271 ? 42.711 6.690   4.682   1.00 47.08 ? 251 LEU A CB  1 
ATOM   1850  C  CG  . LEU A  1 271 ? 42.781 7.732   5.795   1.00 46.50 ? 251 LEU A CG  1 
ATOM   1851  C  CD1 . LEU A  1 271 ? 42.803 9.170   5.250   1.00 49.56 ? 251 LEU A CD1 1 
ATOM   1852  C  CD2 . LEU A  1 271 ? 41.640 7.545   6.763   1.00 52.00 ? 251 LEU A CD2 1 
ATOM   1853  N  N   . PRO A  1 272 ? 41.590 3.739   4.165   1.00 47.52 ? 252 PRO A N   1 
ATOM   1854  C  CA  . PRO A  1 272 ? 41.012 2.889   3.114   1.00 49.34 ? 252 PRO A CA  1 
ATOM   1855  C  C   . PRO A  1 272 ? 40.683 3.691   1.833   1.00 49.52 ? 252 PRO A C   1 
ATOM   1856  O  O   . PRO A  1 272 ? 40.620 4.933   1.881   1.00 45.63 ? 252 PRO A O   1 
ATOM   1857  C  CB  . PRO A  1 272 ? 39.702 2.351   3.746   1.00 47.65 ? 252 PRO A CB  1 
ATOM   1858  C  CG  . PRO A  1 272 ? 39.450 3.151   4.893   1.00 45.83 ? 252 PRO A CG  1 
ATOM   1859  C  CD  . PRO A  1 272 ? 40.709 3.866   5.333   1.00 45.29 ? 252 PRO A CD  1 
ATOM   1860  N  N   . PRO A  1 273 ? 40.465 2.984   0.703   1.00 53.02 ? 253 PRO A N   1 
ATOM   1861  C  CA  . PRO A  1 273 ? 39.888 3.584   -0.498  1.00 54.43 ? 253 PRO A CA  1 
ATOM   1862  C  C   . PRO A  1 273 ? 38.761 4.523   -0.191  1.00 57.16 ? 253 PRO A C   1 
ATOM   1863  O  O   . PRO A  1 273 ? 38.062 4.372   0.814   1.00 59.17 ? 253 PRO A O   1 
ATOM   1864  C  CB  . PRO A  1 273 ? 39.355 2.377   -1.266  1.00 55.84 ? 253 PRO A CB  1 
ATOM   1865  C  CG  . PRO A  1 273 ? 40.353 1.314   -0.970  1.00 56.44 ? 253 PRO A CG  1 
ATOM   1866  C  CD  . PRO A  1 273 ? 40.808 1.570   0.472   1.00 53.61 ? 253 PRO A CD  1 
ATOM   1867  N  N   . GLY A  1 274 ? 38.570 5.499   -1.054  1.00 59.14 ? 254 GLY A N   1 
ATOM   1868  C  CA  . GLY A  1 274 ? 37.503 6.447   -0.835  1.00 59.44 ? 254 GLY A CA  1 
ATOM   1869  C  C   . GLY A  1 274 ? 36.226 5.934   -1.469  1.00 61.41 ? 254 GLY A C   1 
ATOM   1870  O  O   . GLY A  1 274 ? 36.230 4.844   -2.132  1.00 59.86 ? 254 GLY A O   1 
ATOM   1871  N  N   . PRO A  1 275 ? 35.135 6.734   -1.300  1.00 63.39 ? 255 PRO A N   1 
ATOM   1872  C  CA  . PRO A  1 275 ? 33.831 6.561   -1.936  1.00 63.26 ? 255 PRO A CA  1 
ATOM   1873  C  C   . PRO A  1 275 ? 34.027 6.347   -3.416  1.00 63.98 ? 255 PRO A C   1 
ATOM   1874  O  O   . PRO A  1 275 ? 34.750 7.132   -4.049  1.00 66.13 ? 255 PRO A O   1 
ATOM   1875  C  CB  . PRO A  1 275 ? 33.145 7.906   -1.692  1.00 65.50 ? 255 PRO A CB  1 
ATOM   1876  C  CG  . PRO A  1 275 ? 33.752 8.445   -0.429  1.00 65.05 ? 255 PRO A CG  1 
ATOM   1877  C  CD  . PRO A  1 275 ? 35.166 7.936   -0.425  1.00 65.01 ? 255 PRO A CD  1 
ATOM   1878  N  N   . PRO A  1 276 ? 33.399 5.310   -3.987  1.00 62.27 ? 256 PRO A N   1 
ATOM   1879  C  CA  . PRO A  1 276 ? 33.693 5.026   -5.411  1.00 60.99 ? 256 PRO A CA  1 
ATOM   1880  C  C   . PRO A  1 276 ? 33.097 6.144   -6.277  1.00 59.49 ? 256 PRO A C   1 
ATOM   1881  O  O   . PRO A  1 276 ? 31.882 6.423   -6.184  1.00 58.20 ? 256 PRO A O   1 
ATOM   1882  C  CB  . PRO A  1 276 ? 33.005 3.676   -5.679  1.00 61.27 ? 256 PRO A CB  1 
ATOM   1883  C  CG  . PRO A  1 276 ? 32.521 3.198   -4.294  1.00 66.78 ? 256 PRO A CG  1 
ATOM   1884  C  CD  . PRO A  1 276 ? 32.374 4.421   -3.429  1.00 61.27 ? 256 PRO A CD  1 
ATOM   1885  N  N   . PRO A  1 277 ? 33.924 6.778   -7.130  1.00 57.76 ? 257 PRO A N   1 
ATOM   1886  C  CA  . PRO A  1 277 ? 33.591 8.185   -7.505  1.00 53.67 ? 257 PRO A CA  1 
ATOM   1887  C  C   . PRO A  1 277 ? 32.503 8.269   -8.593  1.00 49.13 ? 257 PRO A C   1 
ATOM   1888  O  O   . PRO A  1 277 ? 31.762 9.223   -8.630  1.00 48.38 ? 257 PRO A O   1 
ATOM   1889  C  CB  . PRO A  1 277 ? 34.948 8.758   -7.967  1.00 52.50 ? 257 PRO A CB  1 
ATOM   1890  C  CG  . PRO A  1 277 ? 35.876 7.532   -8.152  1.00 56.66 ? 257 PRO A CG  1 
ATOM   1891  C  CD  . PRO A  1 277 ? 35.085 6.266   -7.886  1.00 57.23 ? 257 PRO A CD  1 
ATOM   1892  N  N   . GLU A  1 278 ? 32.413 7.234   -9.431  1.00 47.70 ? 258 GLU A N   1 
ATOM   1893  C  CA  . GLU A  1 278 ? 31.420 7.084   -10.467 1.00 48.01 ? 258 GLU A CA  1 
ATOM   1894  C  C   . GLU A  1 278 ? 29.994 6.998   -9.898  1.00 48.61 ? 258 GLU A C   1 
ATOM   1895  O  O   . GLU A  1 278 ? 29.053 7.485   -10.486 1.00 47.77 ? 258 GLU A O   1 
ATOM   1896  C  CB  . GLU A  1 278 ? 31.755 5.819   -11.266 1.00 49.00 ? 258 GLU A CB  1 
ATOM   1897  N  N   . ILE A  1 279 ? 29.859 6.386   -8.729  1.00 48.61 ? 259 ILE A N   1 
ATOM   1898  C  CA  . ILE A  1 279 ? 28.589 6.222   -8.040  1.00 45.38 ? 259 ILE A CA  1 
ATOM   1899  C  C   . ILE A  1 279 ? 28.139 7.516   -7.380  1.00 40.09 ? 259 ILE A C   1 
ATOM   1900  O  O   . ILE A  1 279 ? 26.948 7.899   -7.402  1.00 36.92 ? 259 ILE A O   1 
ATOM   1901  C  CB  . ILE A  1 279 ? 28.724 5.136   -6.927  1.00 44.87 ? 259 ILE A CB  1 
ATOM   1902  C  CG1 . ILE A  1 279 ? 29.072 3.773   -7.551  1.00 45.51 ? 259 ILE A CG1 1 
ATOM   1903  C  CG2 . ILE A  1 279 ? 27.438 5.070   -6.071  1.00 48.62 ? 259 ILE A CG2 1 
ATOM   1904  C  CD1 . ILE A  1 279 ? 29.271 2.672   -6.507  1.00 48.67 ? 259 ILE A CD1 1 
ATOM   1905  N  N   . VAL A  1 280 ? 29.090 8.141   -6.712  1.00 39.11 ? 260 VAL A N   1 
ATOM   1906  C  CA  . VAL A  1 280 ? 28.860 9.455   -6.117  1.00 40.18 ? 260 VAL A CA  1 
ATOM   1907  C  C   . VAL A  1 280 ? 28.398 10.475  -7.179  1.00 36.85 ? 260 VAL A C   1 
ATOM   1908  O  O   . VAL A  1 280 ? 27.538 11.280  -6.914  1.00 36.82 ? 260 VAL A O   1 
ATOM   1909  C  CB  . VAL A  1 280 ? 30.131 9.946   -5.426  1.00 39.45 ? 260 VAL A CB  1 
ATOM   1910  C  CG1 . VAL A  1 280 ? 30.062 11.441  -5.134  1.00 42.84 ? 260 VAL A CG1 1 
ATOM   1911  C  CG2 . VAL A  1 280 ? 30.359 9.140   -4.145  1.00 41.02 ? 260 VAL A CG2 1 
ATOM   1912  N  N   . ILE A  1 281 ? 28.958 10.398  -8.378  1.00 35.23 ? 261 ILE A N   1 
ATOM   1913  C  CA  . ILE A  1 281 ? 28.641 11.325  -9.424  1.00 35.88 ? 261 ILE A CA  1 
ATOM   1914  C  C   . ILE A  1 281 ? 27.341 10.966  -10.097 1.00 38.38 ? 261 ILE A C   1 
ATOM   1915  O  O   . ILE A  1 281 ? 26.510 11.865  -10.349 1.00 40.38 ? 261 ILE A O   1 
ATOM   1916  C  CB  . ILE A  1 281 ? 29.795 11.414  -10.461 1.00 35.57 ? 261 ILE A CB  1 
ATOM   1917  C  CG1 . ILE A  1 281 ? 30.984 12.221  -9.886  1.00 34.66 ? 261 ILE A CG1 1 
ATOM   1918  C  CG2 . ILE A  1 281 ? 29.307 12.033  -11.733 1.00 28.79 ? 261 ILE A CG2 1 
ATOM   1919  C  CD1 . ILE A  1 281 ? 32.341 11.839  -10.452 1.00 36.27 ? 261 ILE A CD1 1 
ATOM   1920  N  N   . TYR A  1 282 ? 27.153 9.675   -10.396 1.00 38.57 ? 262 TYR A N   1 
ATOM   1921  C  CA  . TYR A  1 282 ? 25.960 9.222   -11.140 1.00 39.39 ? 262 TYR A CA  1 
ATOM   1922  C  C   . TYR A  1 282 ? 24.744 9.539   -10.259 1.00 36.70 ? 262 TYR A C   1 
ATOM   1923  O  O   . TYR A  1 282 ? 23.722 9.982   -10.746 1.00 38.28 ? 262 TYR A O   1 
ATOM   1924  C  CB  . TYR A  1 282 ? 26.063 7.721   -11.512 1.00 40.03 ? 262 TYR A CB  1 
ATOM   1925  C  CG  . TYR A  1 282 ? 25.295 7.286   -12.733 1.00 46.03 ? 262 TYR A CG  1 
ATOM   1926  N  N   . GLN A  1 283 ? 24.888 9.367   -8.949  1.00 36.48 ? 263 GLN A N   1 
ATOM   1927  C  CA  . GLN A  1 283 ? 23.801 9.632   -8.006  1.00 37.53 ? 263 GLN A CA  1 
ATOM   1928  C  C   . GLN A  1 283 ? 23.649 11.076  -7.581  1.00 35.91 ? 263 GLN A C   1 
ATOM   1929  O  O   . GLN A  1 283 ? 22.707 11.401  -6.866  1.00 37.73 ? 263 GLN A O   1 
ATOM   1930  C  CB  . GLN A  1 283 ? 23.962 8.757   -6.753  1.00 40.44 ? 263 GLN A CB  1 
ATOM   1931  C  CG  . GLN A  1 283 ? 23.757 7.247   -6.968  1.00 40.10 ? 263 GLN A CG  1 
ATOM   1932  C  CD  . GLN A  1 283 ? 22.388 6.883   -7.555  1.00 41.00 ? 263 GLN A CD  1 
ATOM   1933  O  OE1 . GLN A  1 283 ? 22.210 6.949   -8.758  1.00 40.27 ? 263 GLN A OE1 1 
ATOM   1934  N  NE2 . GLN A  1 283 ? 21.427 6.479   -6.703  1.00 39.15 ? 263 GLN A NE2 1 
ATOM   1935  N  N   . GLU A  1 284 ? 24.628 11.908  -7.923  1.00 36.20 ? 264 GLU A N   1 
ATOM   1936  C  CA  . GLU A  1 284 ? 24.645 13.328  -7.569  1.00 35.43 ? 264 GLU A CA  1 
ATOM   1937  C  C   . GLU A  1 284 ? 24.439 13.581  -6.082  1.00 35.85 ? 264 GLU A C   1 
ATOM   1938  O  O   . GLU A  1 284 ? 23.530 14.290  -5.694  1.00 39.62 ? 264 GLU A O   1 
ATOM   1939  C  CB  . GLU A  1 284 ? 23.615 14.082  -8.377  1.00 35.31 ? 264 GLU A CB  1 
ATOM   1940  C  CG  . GLU A  1 284 ? 23.813 13.861  -9.870  1.00 36.01 ? 264 GLU A CG  1 
ATOM   1941  C  CD  . GLU A  1 284 ? 22.965 14.774  -10.723 1.00 43.33 ? 264 GLU A CD  1 
ATOM   1942  O  OE1 . GLU A  1 284 ? 23.280 16.004  -10.815 1.00 52.31 ? 264 GLU A OE1 1 
ATOM   1943  O  OE2 . GLU A  1 284 ? 21.996 14.248  -11.330 1.00 57.24 ? 264 GLU A OE2 1 
ATOM   1944  N  N   . LEU A  1 285 ? 25.316 13.009  -5.271  1.00 35.55 ? 265 LEU A N   1 
ATOM   1945  C  CA  . LEU A  1 285 ? 25.224 13.091  -3.840  1.00 38.34 ? 265 LEU A CA  1 
ATOM   1946  C  C   . LEU A  1 285 ? 25.688 14.442  -3.310  1.00 39.85 ? 265 LEU A C   1 
ATOM   1947  O  O   . LEU A  1 285 ? 26.565 15.067  -3.889  1.00 37.94 ? 265 LEU A O   1 
ATOM   1948  C  CB  . LEU A  1 285 ? 26.019 11.931  -3.183  1.00 38.51 ? 265 LEU A CB  1 
ATOM   1949  C  CG  . LEU A  1 285 ? 25.599 10.493  -3.594  1.00 38.67 ? 265 LEU A CG  1 
ATOM   1950  C  CD1 . LEU A  1 285 ? 26.407 9.430   -2.800  1.00 43.08 ? 265 LEU A CD1 1 
ATOM   1951  C  CD2 . LEU A  1 285 ? 24.087 10.158  -3.494  1.00 37.22 ? 265 LEU A CD2 1 
ATOM   1952  N  N   . ARG A  1 286 ? 25.067 14.872  -2.205  1.00 42.56 ? 266 ARG A N   1 
ATOM   1953  C  CA  . ARG A  1 286 ? 25.522 16.005  -1.420  1.00 42.87 ? 266 ARG A CA  1 
ATOM   1954  C  C   . ARG A  1 286 ? 26.113 15.467  -0.140  1.00 43.44 ? 266 ARG A C   1 
ATOM   1955  O  O   . ARG A  1 286 ? 25.461 14.784  0.595   1.00 41.88 ? 266 ARG A O   1 
ATOM   1956  C  CB  . ARG A  1 286 ? 24.369 16.949  -1.084  1.00 44.38 ? 266 ARG A CB  1 
ATOM   1957  C  CG  . ARG A  1 286 ? 24.744 18.082  -0.091  1.00 45.19 ? 266 ARG A CG  1 
ATOM   1958  C  CD  . ARG A  1 286 ? 23.914 19.380  -0.279  1.00 45.18 ? 266 ARG A CD  1 
ATOM   1959  N  N   . MET A  1 287 ? 27.365 15.785  0.133   1.00 47.57 ? 267 MET A N   1 
ATOM   1960  C  CA  . MET A  1 287 ? 27.953 15.426  1.408   1.00 51.35 ? 267 MET A CA  1 
ATOM   1961  C  C   . MET A  1 287 ? 28.416 16.695  2.046   1.00 47.61 ? 267 MET A C   1 
ATOM   1962  O  O   . MET A  1 287 ? 29.049 17.521  1.425   1.00 48.78 ? 267 MET A O   1 
ATOM   1963  C  CB  . MET A  1 287 ? 29.102 14.468  1.223   1.00 51.57 ? 267 MET A CB  1 
ATOM   1964  C  CG  . MET A  1 287 ? 28.787 13.339  0.227   1.00 56.94 ? 267 MET A CG  1 
ATOM   1965  S  SD  . MET A  1 287 ? 30.341 12.594  -0.268  1.00 68.14 ? 267 MET A SD  1 
ATOM   1966  C  CE  . MET A  1 287 ? 29.982 10.860  -0.587  1.00 67.68 ? 267 MET A CE  1 
ATOM   1967  N  N   . GLU A  1 288 ? 28.062 16.871  3.297   1.00 44.34 ? 268 GLU A N   1 
ATOM   1968  C  CA  . GLU A  1 288 ? 28.454 18.061  3.987   1.00 41.95 ? 268 GLU A CA  1 
ATOM   1969  C  C   . GLU A  1 288 ? 28.876 17.677  5.370   1.00 37.73 ? 268 GLU A C   1 
ATOM   1970  O  O   . GLU A  1 288 ? 28.159 16.921  6.075   1.00 34.54 ? 268 GLU A O   1 
ATOM   1971  C  CB  . GLU A  1 288 ? 27.300 19.067  3.997   1.00 40.98 ? 268 GLU A CB  1 
ATOM   1972  C  CG  . GLU A  1 288 ? 27.581 20.285  4.848   1.00 45.01 ? 268 GLU A CG  1 
ATOM   1973  C  CD  . GLU A  1 288 ? 26.526 21.399  4.710   1.00 51.13 ? 268 GLU A CD  1 
ATOM   1974  O  OE1 . GLU A  1 288 ? 26.743 22.488  5.316   1.00 66.55 ? 268 GLU A OE1 1 
ATOM   1975  O  OE2 . GLU A  1 288 ? 25.496 21.207  4.002   1.00 65.67 ? 268 GLU A OE2 1 
ATOM   1976  N  N   . ALA A  1 289 ? 30.061 18.166  5.744   1.00 35.82 ? 269 ALA A N   1 
ATOM   1977  C  CA  . ALA A  1 289 ? 30.592 17.957  7.100   1.00 36.07 ? 269 ALA A CA  1 
ATOM   1978  C  C   . ALA A  1 289 ? 30.245 19.147  7.975   1.00 38.25 ? 269 ALA A C   1 
ATOM   1979  O  O   . ALA A  1 289 ? 29.832 20.199  7.488   1.00 40.15 ? 269 ALA A O   1 
ATOM   1980  C  CB  . ALA A  1 289 ? 32.077 17.733  7.080   1.00 32.53 ? 269 ALA A CB  1 
ATOM   1981  N  N   . PHE A  1 290 ? 30.365 18.940  9.277   1.00 40.68 ? 270 PHE A N   1 
ATOM   1982  C  CA  . PHE A  1 290 ? 29.815 19.859  10.262  1.00 42.83 ? 270 PHE A CA  1 
ATOM   1983  C  C   . PHE A  1 290 ? 30.438 19.532  11.605  1.00 42.26 ? 270 PHE A C   1 
ATOM   1984  O  O   . PHE A  1 290 ? 30.903 18.407  11.840  1.00 41.65 ? 270 PHE A O   1 
ATOM   1985  C  CB  . PHE A  1 290 ? 28.218 19.876  10.304  1.00 42.82 ? 270 PHE A CB  1 
ATOM   1986  C  CG  . PHE A  1 290 ? 27.590 18.686  11.001  1.00 44.62 ? 270 PHE A CG  1 
ATOM   1987  C  CD1 . PHE A  1 290 ? 27.224 18.764  12.358  1.00 44.18 ? 270 PHE A CD1 1 
ATOM   1988  C  CD2 . PHE A  1 290 ? 27.378 17.488  10.318  1.00 40.96 ? 270 PHE A CD2 1 
ATOM   1989  C  CE1 . PHE A  1 290 ? 26.689 17.674  13.018  1.00 47.92 ? 270 PHE A CE1 1 
ATOM   1990  C  CE2 . PHE A  1 290 ? 26.826 16.355  10.982  1.00 42.43 ? 270 PHE A CE2 1 
ATOM   1991  C  CZ  . PHE A  1 290 ? 26.508 16.441  12.331  1.00 47.92 ? 270 PHE A CZ  1 
ATOM   1992  N  N   . VAL A  1 291 ? 30.472 20.575  12.431  1.00 45.73 ? 271 VAL A N   1 
ATOM   1993  C  CA  . VAL A  1 291 ? 30.859 20.534  13.816  1.00 46.13 ? 271 VAL A CA  1 
ATOM   1994  C  C   . VAL A  1 291 ? 29.716 21.226  14.561  1.00 45.25 ? 271 VAL A C   1 
ATOM   1995  O  O   . VAL A  1 291 ? 29.336 22.330  14.147  1.00 40.15 ? 271 VAL A O   1 
ATOM   1996  C  CB  . VAL A  1 291 ? 32.212 21.287  14.048  1.00 47.49 ? 271 VAL A CB  1 
ATOM   1997  C  CG1 . VAL A  1 291 ? 32.628 21.262  15.528  1.00 52.95 ? 271 VAL A CG1 1 
ATOM   1998  C  CG2 . VAL A  1 291 ? 33.338 20.628  13.249  1.00 53.53 ? 271 VAL A CG2 1 
ATOM   1999  N  N   . VAL A  1 292 ? 29.191 20.568  15.632  1.00 44.88 ? 272 VAL A N   1 
ATOM   2000  C  CA  . VAL A  1 292 ? 28.233 21.174  16.584  1.00 45.99 ? 272 VAL A CA  1 
ATOM   2001  C  C   . VAL A  1 292 ? 28.402 22.671  16.902  1.00 45.70 ? 272 VAL A C   1 
ATOM   2002  O  O   . VAL A  1 292 ? 27.411 23.381  17.011  1.00 44.60 ? 272 VAL A O   1 
ATOM   2003  C  CB  . VAL A  1 292 ? 28.189 20.562  18.047  1.00 46.15 ? 272 VAL A CB  1 
ATOM   2004  C  CG1 . VAL A  1 292 ? 26.834 20.059  18.375  1.00 48.76 ? 272 VAL A CG1 1 
ATOM   2005  C  CG2 . VAL A  1 292 ? 29.250 19.615  18.333  1.00 54.73 ? 272 VAL A CG2 1 
ATOM   2006  N  N   . TYR A  1 293 ? 29.635 23.121  17.120  1.00 47.40 ? 273 TYR A N   1 
ATOM   2007  C  CA  . TYR A  1 293 ? 29.899 24.485  17.647  1.00 45.99 ? 273 TYR A CA  1 
ATOM   2008  C  C   . TYR A  1 293 ? 29.565 25.587  16.688  1.00 44.59 ? 273 TYR A C   1 
ATOM   2009  O  O   . TYR A  1 293 ? 29.596 26.717  17.061  1.00 46.47 ? 273 TYR A O   1 
ATOM   2010  C  CB  . TYR A  1 293 ? 31.343 24.619  18.114  1.00 48.62 ? 273 TYR A CB  1 
ATOM   2011  C  CG  . TYR A  1 293 ? 31.757 23.454  18.988  1.00 52.93 ? 273 TYR A CG  1 
ATOM   2012  C  CD1 . TYR A  1 293 ? 31.091 23.189  20.191  1.00 56.09 ? 273 TYR A CD1 1 
ATOM   2013  C  CD2 . TYR A  1 293 ? 32.789 22.581  18.589  1.00 61.58 ? 273 TYR A CD2 1 
ATOM   2014  C  CE1 . TYR A  1 293 ? 31.439 22.076  20.999  1.00 62.06 ? 273 TYR A CE1 1 
ATOM   2015  C  CE2 . TYR A  1 293 ? 33.161 21.486  19.380  1.00 59.50 ? 273 TYR A CE2 1 
ATOM   2016  C  CZ  . TYR A  1 293 ? 32.476 21.238  20.599  1.00 61.49 ? 273 TYR A CZ  1 
ATOM   2017  O  OH  . TYR A  1 293 ? 32.824 20.148  21.391  1.00 63.93 ? 273 TYR A OH  1 
ATOM   2018  N  N   . ARG A  1 294 ? 29.240 25.259  15.449  1.00 45.78 ? 274 ARG A N   1 
ATOM   2019  C  CA  . ARG A  1 294 ? 28.772 26.243  14.487  1.00 43.88 ? 274 ARG A CA  1 
ATOM   2020  C  C   . ARG A  1 294 ? 27.534 26.966  15.005  1.00 46.05 ? 274 ARG A C   1 
ATOM   2021  O  O   . ARG A  1 294 ? 27.404 28.152  14.791  1.00 49.05 ? 274 ARG A O   1 
ATOM   2022  C  CB  . ARG A  1 294 ? 28.410 25.558  13.178  1.00 42.71 ? 274 ARG A CB  1 
ATOM   2023  C  CG  . ARG A  1 294 ? 27.934 26.499  12.095  1.00 38.40 ? 274 ARG A CG  1 
ATOM   2024  C  CD  . ARG A  1 294 ? 27.236 25.778  10.911  1.00 43.06 ? 274 ARG A CD  1 
ATOM   2025  N  NE  . ARG A  1 294 ? 27.997 24.618  10.387  1.00 50.60 ? 274 ARG A NE  1 
ATOM   2026  C  CZ  . ARG A  1 294 ? 27.800 24.052  9.185   1.00 45.39 ? 274 ARG A CZ  1 
ATOM   2027  N  NH1 . ARG A  1 294 ? 26.893 24.523  8.347   1.00 48.98 ? 274 ARG A NH1 1 
ATOM   2028  N  NH2 . ARG A  1 294 ? 28.524 23.012  8.794   1.00 43.87 ? 274 ARG A NH2 1 
ATOM   2029  N  N   . TRP A  1 295 ? 26.615 26.247  15.652  1.00 45.30 ? 275 TRP A N   1 
ATOM   2030  C  CA  . TRP A  1 295 ? 25.336 26.843  16.069  1.00 44.54 ? 275 TRP A CA  1 
ATOM   2031  C  C   . TRP A  1 295 ? 25.416 27.354  17.486  1.00 43.67 ? 275 TRP A C   1 
ATOM   2032  O  O   . TRP A  1 295 ? 25.696 26.598  18.401  1.00 44.49 ? 275 TRP A O   1 
ATOM   2033  C  CB  . TRP A  1 295 ? 24.206 25.830  15.972  1.00 43.81 ? 275 TRP A CB  1 
ATOM   2034  C  CG  . TRP A  1 295 ? 23.914 25.399  14.600  1.00 38.22 ? 275 TRP A CG  1 
ATOM   2035  C  CD1 . TRP A  1 295 ? 23.022 25.951  13.747  1.00 41.32 ? 275 TRP A CD1 1 
ATOM   2036  C  CD2 . TRP A  1 295 ? 24.518 24.286  13.908  1.00 39.61 ? 275 TRP A CD2 1 
ATOM   2037  N  NE1 . TRP A  1 295 ? 23.028 25.253  12.538  1.00 42.57 ? 275 TRP A NE1 1 
ATOM   2038  C  CE2 . TRP A  1 295 ? 23.941 24.227  12.622  1.00 44.19 ? 275 TRP A CE2 1 
ATOM   2039  C  CE3 . TRP A  1 295 ? 25.468 23.321  14.266  1.00 37.71 ? 275 TRP A CE3 1 
ATOM   2040  C  CZ2 . TRP A  1 295 ? 24.287 23.230  11.684  1.00 41.08 ? 275 TRP A CZ2 1 
ATOM   2041  C  CZ3 . TRP A  1 295 ? 25.824 22.349  13.326  1.00 42.75 ? 275 TRP A CZ3 1 
ATOM   2042  C  CH2 . TRP A  1 295 ? 25.238 22.318  12.054  1.00 40.84 ? 275 TRP A CH2 1 
ATOM   2043  N  N   . GLN A  1 296 ? 25.208 28.652  17.647  1.00 47.58 ? 276 GLN A N   1 
ATOM   2044  C  CA  . GLN A  1 296 ? 25.272 29.308  18.955  1.00 48.92 ? 276 GLN A CA  1 
ATOM   2045  C  C   . GLN A  1 296 ? 24.026 30.146  19.051  1.00 48.30 ? 276 GLN A C   1 
ATOM   2046  O  O   . GLN A  1 296 ? 23.178 30.067  18.161  1.00 49.72 ? 276 GLN A O   1 
ATOM   2047  C  CB  . GLN A  1 296 ? 26.537 30.176  19.061  1.00 50.55 ? 276 GLN A CB  1 
ATOM   2048  C  CG  . GLN A  1 296 ? 27.871 29.423  18.846  1.00 52.68 ? 276 GLN A CG  1 
ATOM   2049  C  CD  . GLN A  1 296 ? 28.136 28.368  19.914  1.00 57.02 ? 276 GLN A CD  1 
ATOM   2050  O  OE1 . GLN A  1 296 ? 27.495 28.360  20.956  1.00 60.14 ? 276 GLN A OE1 1 
ATOM   2051  N  NE2 . GLN A  1 296 ? 29.081 27.476  19.652  1.00 55.99 ? 276 GLN A NE2 1 
ATOM   2052  N  N   . GLY A  1 297 ? 23.886 30.923  20.131  1.00 49.68 ? 277 GLY A N   1 
ATOM   2053  C  CA  . GLY A  1 297 ? 22.782 31.887  20.247  1.00 47.81 ? 277 GLY A CA  1 
ATOM   2054  C  C   . GLY A  1 297 ? 21.425 31.228  20.383  1.00 47.84 ? 277 GLY A C   1 
ATOM   2055  O  O   . GLY A  1 297 ? 21.299 30.213  21.042  1.00 47.94 ? 277 GLY A O   1 
ATOM   2056  N  N   . ASP A  1 298 ? 20.413 31.805  19.751  1.00 49.63 ? 278 ASP A N   1 
ATOM   2057  C  CA  . ASP A  1 298 ? 19.040 31.292  19.847  1.00 51.75 ? 278 ASP A CA  1 
ATOM   2058  C  C   . ASP A  1 298 ? 18.850 29.913  19.262  1.00 50.18 ? 278 ASP A C   1 
ATOM   2059  O  O   . ASP A  1 298 ? 18.035 29.135  19.772  1.00 48.27 ? 278 ASP A O   1 
ATOM   2060  C  CB  . ASP A  1 298 ? 18.058 32.204  19.100  1.00 54.20 ? 278 ASP A CB  1 
ATOM   2061  C  CG  . ASP A  1 298 ? 17.983 33.584  19.681  1.00 64.08 ? 278 ASP A CG  1 
ATOM   2062  O  OD1 . ASP A  1 298 ? 18.508 33.769  20.815  1.00 70.04 ? 278 ASP A OD1 1 
ATOM   2063  O  OD2 . ASP A  1 298 ? 17.398 34.475  18.995  1.00 75.37 ? 278 ASP A OD2 1 
ATOM   2064  N  N   . ALA A  1 299 ? 19.551 29.635  18.159  1.00 49.45 ? 279 ALA A N   1 
ATOM   2065  C  CA  . ALA A  1 299 ? 19.372 28.362  17.448  1.00 49.00 ? 279 ALA A CA  1 
ATOM   2066  C  C   . ALA A  1 299 ? 19.723 27.218  18.381  1.00 45.49 ? 279 ALA A C   1 
ATOM   2067  O  O   . ALA A  1 299 ? 18.954 26.248  18.503  1.00 45.25 ? 279 ALA A O   1 
ATOM   2068  C  CB  . ALA A  1 299 ? 20.227 28.305  16.165  1.00 49.65 ? 279 ALA A CB  1 
ATOM   2069  N  N   . ARG A  1 300 ? 20.856 27.378  19.060  1.00 40.21 ? 280 ARG A N   1 
ATOM   2070  C  CA  . ARG A  1 300 ? 21.327 26.423  20.045  1.00 40.87 ? 280 ARG A CA  1 
ATOM   2071  C  C   . ARG A  1 300 ? 20.453 26.224  21.316  1.00 41.57 ? 280 ARG A C   1 
ATOM   2072  O  O   . ARG A  1 300 ? 20.300 25.111  21.814  1.00 40.69 ? 280 ARG A O   1 
ATOM   2073  C  CB  . ARG A  1 300 ? 22.727 26.834  20.442  1.00 39.15 ? 280 ARG A CB  1 
ATOM   2074  C  CG  . ARG A  1 300 ? 23.376 25.880  21.383  1.00 42.41 ? 280 ARG A CG  1 
ATOM   2075  C  CD  . ARG A  1 300 ? 24.722 26.376  21.701  1.00 39.90 ? 280 ARG A CD  1 
ATOM   2076  N  NE  . ARG A  1 300 ? 25.373 25.482  22.623  1.00 46.03 ? 280 ARG A NE  1 
ATOM   2077  C  CZ  . ARG A  1 300 ? 25.357 25.607  23.951  1.00 54.59 ? 280 ARG A CZ  1 
ATOM   2078  N  NH1 . ARG A  1 300 ? 24.694 26.590  24.576  1.00 56.50 ? 280 ARG A NH1 1 
ATOM   2079  N  NH2 . ARG A  1 300 ? 26.014 24.707  24.666  1.00 49.89 ? 280 ARG A NH2 1 
ATOM   2080  N  N   . GLN A  1 301 ? 19.918 27.315  21.842  1.00 43.08 ? 281 GLN A N   1 
ATOM   2081  C  CA  . GLN A  1 301 ? 19.064 27.297  23.015  1.00 43.55 ? 281 GLN A CA  1 
ATOM   2082  C  C   . GLN A  1 301 ? 17.699 26.649  22.694  1.00 41.75 ? 281 GLN A C   1 
ATOM   2083  O  O   . GLN A  1 301 ? 17.183 25.902  23.508  1.00 38.52 ? 281 GLN A O   1 
ATOM   2084  C  CB  . GLN A  1 301 ? 18.883 28.732  23.562  1.00 44.43 ? 281 GLN A CB  1 
ATOM   2085  C  CG  . GLN A  1 301 ? 18.267 28.810  24.998  1.00 48.91 ? 281 GLN A CG  1 
ATOM   2086  C  CD  . GLN A  1 301 ? 19.266 28.579  26.168  1.00 57.11 ? 281 GLN A CD  1 
ATOM   2087  O  OE1 . GLN A  1 301 ? 20.184 27.734  26.114  1.00 58.27 ? 281 GLN A OE1 1 
ATOM   2088  N  NE2 . GLN A  1 301 ? 19.048 29.321  27.247  1.00 60.12 ? 281 GLN A NE2 1 
ATOM   2089  N  N   . LYS A  1 302 ? 17.157 26.928  21.505  1.00 40.77 ? 282 LYS A N   1 
ATOM   2090  C  CA  . LYS A  1 302 ? 15.970 26.247  21.003  1.00 43.54 ? 282 LYS A CA  1 
ATOM   2091  C  C   . LYS A  1 302 ? 16.168 24.755  20.842  1.00 41.63 ? 282 LYS A C   1 
ATOM   2092  O  O   . LYS A  1 302 ? 15.287 23.969  21.186  1.00 42.54 ? 282 LYS A O   1 
ATOM   2093  C  CB  . LYS A  1 302 ? 15.493 26.822  19.659  1.00 44.09 ? 282 LYS A CB  1 
ATOM   2094  C  CG  . LYS A  1 302 ? 13.988 26.501  19.387  1.00 52.15 ? 282 LYS A CG  1 
ATOM   2095  C  CD  . LYS A  1 302 ? 13.674 26.133  17.921  1.00 52.31 ? 282 LYS A CD  1 
ATOM   2096  C  CE  . LYS A  1 302 ? 13.108 27.326  17.140  1.00 63.11 ? 282 LYS A CE  1 
ATOM   2097  N  NZ  . LYS A  1 302 ? 13.272 27.153  15.666  1.00 62.14 ? 282 LYS A NZ  1 
ATOM   2098  N  N   . ALA A  1 303 ? 17.322 24.365  20.320  1.00 43.37 ? 283 ALA A N   1 
ATOM   2099  C  CA  . ALA A  1 303 ? 17.675 22.933  20.194  1.00 42.28 ? 283 ALA A CA  1 
ATOM   2100  C  C   . ALA A  1 303 ? 17.745 22.247  21.540  1.00 40.25 ? 283 ALA A C   1 
ATOM   2101  O  O   . ALA A  1 303 ? 17.166 21.189  21.695  1.00 39.37 ? 283 ALA A O   1 
ATOM   2102  C  CB  . ALA A  1 303 ? 18.997 22.728  19.414  1.00 43.27 ? 283 ALA A CB  1 
ATOM   2103  N  N   . LEU A  1 304 ? 18.458 22.844  22.496  1.00 39.70 ? 284 LEU A N   1 
ATOM   2104  C  CA  . LEU A  1 304 ? 18.512 22.328  23.865  1.00 40.60 ? 284 LEU A CA  1 
ATOM   2105  C  C   . LEU A  1 304 ? 17.155 22.160  24.543  1.00 41.57 ? 284 LEU A C   1 
ATOM   2106  O  O   . LEU A  1 304 ? 16.933 21.209  25.316  1.00 40.97 ? 284 LEU A O   1 
ATOM   2107  C  CB  . LEU A  1 304 ? 19.349 23.249  24.755  1.00 41.55 ? 284 LEU A CB  1 
ATOM   2108  C  CG  . LEU A  1 304 ? 20.840 23.076  24.665  1.00 41.16 ? 284 LEU A CG  1 
ATOM   2109  C  CD1 . LEU A  1 304 ? 21.555 24.135  25.499  1.00 43.28 ? 284 LEU A CD1 1 
ATOM   2110  C  CD2 . LEU A  1 304 ? 21.188 21.692  25.109  1.00 40.62 ? 284 LEU A CD2 1 
ATOM   2111  N  N   . LYS A  1 305 ? 16.278 23.119  24.298  1.00 42.48 ? 285 LYS A N   1 
ATOM   2112  C  CA  . LYS A  1 305 ? 14.980 23.113  24.916  1.00 43.65 ? 285 LYS A CA  1 
ATOM   2113  C  C   . LYS A  1 305 ? 14.121 22.019  24.320  1.00 42.07 ? 285 LYS A C   1 
ATOM   2114  O  O   . LYS A  1 305 ? 13.293 21.468  25.028  1.00 42.46 ? 285 LYS A O   1 
ATOM   2115  C  CB  . LYS A  1 305 ? 14.301 24.491  24.796  1.00 45.48 ? 285 LYS A CB  1 
ATOM   2116  C  CG  . LYS A  1 305 ? 14.775 25.497  25.847  1.00 46.16 ? 285 LYS A CG  1 
ATOM   2117  C  CD  . LYS A  1 305 ? 14.215 26.893  25.596  1.00 46.65 ? 285 LYS A CD  1 
ATOM   2118  C  CE  . LYS A  1 305 ? 14.887 27.902  26.517  1.00 51.05 ? 285 LYS A CE  1 
ATOM   2119  N  NZ  . LYS A  1 305 ? 14.448 29.272  26.197  1.00 56.04 ? 285 LYS A NZ  1 
ATOM   2120  N  N   . ASP A  1 306 ? 14.292 21.748  23.023  1.00 40.67 ? 286 ASP A N   1 
ATOM   2121  C  CA  . ASP A  1 306 ? 13.632 20.623  22.323  1.00 41.52 ? 286 ASP A CA  1 
ATOM   2122  C  C   . ASP A  1 306 ? 14.068 19.252  22.841  1.00 41.08 ? 286 ASP A C   1 
ATOM   2123  O  O   . ASP A  1 306 ? 13.249 18.358  23.016  1.00 40.05 ? 286 ASP A O   1 
ATOM   2124  C  CB  . ASP A  1 306 ? 13.948 20.647  20.814  1.00 44.06 ? 286 ASP A CB  1 
ATOM   2125  C  CG  . ASP A  1 306 ? 13.220 21.751  20.083  1.00 46.54 ? 286 ASP A CG  1 
ATOM   2126  O  OD1 . ASP A  1 306 ? 12.331 22.307  20.706  1.00 43.07 ? 286 ASP A OD1 1 
ATOM   2127  O  OD2 . ASP A  1 306 ? 13.534 22.062  18.904  1.00 56.40 ? 286 ASP A OD2 1 
ATOM   2128  N  N   . LEU A  1 307 ? 15.380 19.090  23.013  1.00 40.67 ? 287 LEU A N   1 
ATOM   2129  C  CA  . LEU A  1 307 ? 15.956 17.878  23.563  1.00 40.04 ? 287 LEU A CA  1 
ATOM   2130  C  C   . LEU A  1 307 ? 15.466 17.651  24.970  1.00 38.94 ? 287 LEU A C   1 
ATOM   2131  O  O   . LEU A  1 307 ? 15.111 16.548  25.300  1.00 37.28 ? 287 LEU A O   1 
ATOM   2132  C  CB  . LEU A  1 307 ? 17.482 17.938  23.559  1.00 39.44 ? 287 LEU A CB  1 
ATOM   2133  C  CG  . LEU A  1 307 ? 18.118 17.980  22.165  1.00 38.81 ? 287 LEU A CG  1 
ATOM   2134  C  CD1 . LEU A  1 307 ? 19.598 18.402  22.262  1.00 38.46 ? 287 LEU A CD1 1 
ATOM   2135  C  CD2 . LEU A  1 307 ? 17.940 16.656  21.452  1.00 34.36 ? 287 LEU A CD2 1 
ATOM   2136  N  N   . LEU A  1 308 ? 15.448 18.691  25.793  1.00 40.03 ? 288 LEU A N   1 
ATOM   2137  C  CA  . LEU A  1 308 ? 14.747 18.614  27.100  1.00 41.45 ? 288 LEU A CA  1 
ATOM   2138  C  C   . LEU A  1 308 ? 13.230 18.225  27.009  1.00 41.26 ? 288 LEU A C   1 
ATOM   2139  O  O   . LEU A  1 308 ? 12.797 17.252  27.619  1.00 40.83 ? 288 LEU A O   1 
ATOM   2140  C  CB  . LEU A  1 308 ? 14.962 19.905  27.910  1.00 39.06 ? 288 LEU A CB  1 
ATOM   2141  C  CG  . LEU A  1 308 ? 14.702 19.799  29.419  1.00 39.23 ? 288 LEU A CG  1 
ATOM   2142  C  CD1 . LEU A  1 308 ? 15.453 18.610  30.024  1.00 38.25 ? 288 LEU A CD1 1 
ATOM   2143  C  CD2 . LEU A  1 308 ? 15.047 21.124  30.125  1.00 40.03 ? 288 LEU A CD2 1 
ATOM   2144  N  N   . LYS A  1 309 ? 12.437 18.966  26.249  1.00 42.15 ? 289 LYS A N   1 
ATOM   2145  C  CA  . LYS A  1 309 ? 11.042 18.598  26.011  1.00 44.31 ? 289 LYS A CA  1 
ATOM   2146  C  C   . LYS A  1 309 ? 10.919 17.109  25.706  1.00 43.86 ? 289 LYS A C   1 
ATOM   2147  O  O   . LYS A  1 309 ? 10.148 16.388  26.339  1.00 45.30 ? 289 LYS A O   1 
ATOM   2148  C  CB  . LYS A  1 309 ? 10.465 19.361  24.804  1.00 46.52 ? 289 LYS A CB  1 
ATOM   2149  C  CG  . LYS A  1 309 ? 9.598  20.586  25.082  1.00 48.42 ? 289 LYS A CG  1 
ATOM   2150  C  CD  . LYS A  1 309 ? 9.251  21.267  23.741  1.00 49.93 ? 289 LYS A CD  1 
ATOM   2151  N  N   . TRP A  1 310 ? 11.667 16.672  24.698  1.00 44.17 ? 290 TRP A N   1 
ATOM   2152  C  CA  . TRP A  1 310 ? 11.538 15.320  24.136  1.00 44.09 ? 290 TRP A CA  1 
ATOM   2153  C  C   . TRP A  1 310 ? 11.978 14.219  25.071  1.00 43.93 ? 290 TRP A C   1 
ATOM   2154  O  O   . TRP A  1 310 ? 11.429 13.128  25.010  1.00 43.31 ? 290 TRP A O   1 
ATOM   2155  C  CB  . TRP A  1 310 ? 12.320 15.217  22.824  1.00 43.90 ? 290 TRP A CB  1 
ATOM   2156  C  CG  . TRP A  1 310 ? 11.722 16.007  21.681  1.00 46.29 ? 290 TRP A CG  1 
ATOM   2157  C  CD1 . TRP A  1 310 ? 10.395 16.314  21.494  1.00 45.41 ? 290 TRP A CD1 1 
ATOM   2158  C  CD2 . TRP A  1 310 ? 12.421 16.534  20.538  1.00 42.31 ? 290 TRP A CD2 1 
ATOM   2159  N  NE1 . TRP A  1 310 ? 10.242 17.020  20.331  1.00 48.71 ? 290 TRP A NE1 1 
ATOM   2160  C  CE2 . TRP A  1 310 ? 11.462 17.161  19.717  1.00 45.03 ? 290 TRP A CE2 1 
ATOM   2161  C  CE3 . TRP A  1 310 ? 13.761 16.554  20.145  1.00 43.79 ? 290 TRP A CE3 1 
ATOM   2162  C  CZ2 . TRP A  1 310 ? 11.797 17.794  18.521  1.00 43.28 ? 290 TRP A CZ2 1 
ATOM   2163  C  CZ3 . TRP A  1 310 ? 14.097 17.173  18.950  1.00 45.22 ? 290 TRP A CZ3 1 
ATOM   2164  C  CH2 . TRP A  1 310 ? 13.115 17.781  18.149  1.00 47.94 ? 290 TRP A CH2 1 
ATOM   2165  N  N   . VAL A  1 311 ? 12.973 14.505  25.916  1.00 44.45 ? 291 VAL A N   1 
ATOM   2166  C  CA  . VAL A  1 311 ? 13.360 13.602  27.005  1.00 44.12 ? 291 VAL A CA  1 
ATOM   2167  C  C   . VAL A  1 311 ? 12.212 13.414  28.004  1.00 45.00 ? 291 VAL A C   1 
ATOM   2168  O  O   . VAL A  1 311 ? 11.811 12.286  28.295  1.00 46.10 ? 291 VAL A O   1 
ATOM   2169  C  CB  . VAL A  1 311 ? 14.672 14.067  27.710  1.00 42.73 ? 291 VAL A CB  1 
ATOM   2170  C  CG1 . VAL A  1 311 ? 14.886 13.352  29.044  1.00 40.37 ? 291 VAL A CG1 1 
ATOM   2171  C  CG2 . VAL A  1 311 ? 15.872 13.811  26.789  1.00 43.37 ? 291 VAL A CG2 1 
ATOM   2172  N  N   . LEU A  1 312 ? 11.661 14.521  28.483  1.00 46.66 ? 292 LEU A N   1 
ATOM   2173  C  CA  . LEU A  1 312 ? 10.594 14.526  29.493  1.00 46.50 ? 292 LEU A CA  1 
ATOM   2174  C  C   . LEU A  1 312 ? 9.282  13.944  28.992  1.00 47.01 ? 292 LEU A C   1 
ATOM   2175  O  O   . LEU A  1 312 ? 8.521  13.356  29.758  1.00 48.45 ? 292 LEU A O   1 
ATOM   2176  C  CB  . LEU A  1 312 ? 10.360 15.954  30.007  1.00 45.46 ? 292 LEU A CB  1 
ATOM   2177  C  CG  . LEU A  1 312 ? 11.610 16.585  30.644  1.00 49.50 ? 292 LEU A CG  1 
ATOM   2178  C  CD1 . LEU A  1 312 ? 11.353 18.014  31.125  1.00 49.02 ? 292 LEU A CD1 1 
ATOM   2179  C  CD2 . LEU A  1 312 ? 12.160 15.710  31.788  1.00 52.05 ? 292 LEU A CD2 1 
ATOM   2180  N  N   . GLU A  1 313 ? 9.007  14.108  27.715  1.00 47.47 ? 293 GLU A N   1 
ATOM   2181  C  CA  . GLU A  1 313 ? 7.852  13.456  27.107  1.00 49.77 ? 293 GLU A CA  1 
ATOM   2182  C  C   . GLU A  1 313 ? 8.070  11.962  26.838  1.00 49.33 ? 293 GLU A C   1 
ATOM   2183  O  O   . GLU A  1 313 ? 7.119  11.268  26.481  1.00 48.87 ? 293 GLU A O   1 
ATOM   2184  C  CB  . GLU A  1 313 ? 7.515  14.138  25.778  1.00 50.48 ? 293 GLU A CB  1 
ATOM   2185  C  CG  . GLU A  1 313 ? 6.987  15.538  25.952  1.00 52.82 ? 293 GLU A CG  1 
ATOM   2186  C  CD  . GLU A  1 313 ? 6.754  16.250  24.640  1.00 54.19 ? 293 GLU A CD  1 
ATOM   2187  O  OE1 . GLU A  1 313 ? 7.170  15.735  23.571  1.00 54.19 ? 293 GLU A OE1 1 
ATOM   2188  O  OE2 . GLU A  1 313 ? 6.148  17.342  24.692  1.00 63.76 ? 293 GLU A OE2 1 
ATOM   2189  N  N   . GLY A  1 314 ? 9.316  11.485  26.957  1.00 48.17 ? 294 GLY A N   1 
ATOM   2190  C  CA  . GLY A  1 314 ? 9.651  10.074  26.744  1.00 45.94 ? 294 GLY A CA  1 
ATOM   2191  C  C   . GLY A  1 314 ? 9.974  9.775   25.300  1.00 45.70 ? 294 GLY A C   1 
ATOM   2192  O  O   . GLY A  1 314 ? 10.254 8.636   24.956  1.00 45.49 ? 294 GLY A O   1 
ATOM   2193  N  N   . LYS A  1 315 ? 9.953  10.808  24.456  1.00 46.55 ? 295 LYS A N   1 
ATOM   2194  C  CA  . LYS A  1 315 ? 10.226 10.678  23.012  1.00 44.15 ? 295 LYS A CA  1 
ATOM   2195  C  C   . LYS A  1 315 ? 11.701 10.425  22.708  1.00 43.02 ? 295 LYS A C   1 
ATOM   2196  O  O   . LYS A  1 315 ? 12.040 9.840   21.668  1.00 41.58 ? 295 LYS A O   1 
ATOM   2197  C  CB  . LYS A  1 315 ? 9.689  11.899  22.247  1.00 43.27 ? 295 LYS A CB  1 
ATOM   2198  C  CG  . LYS A  1 315 ? 8.272  11.701  21.699  1.00 48.37 ? 295 LYS A CG  1 
ATOM   2199  C  CD  . LYS A  1 315 ? 7.386  12.911  21.946  1.00 54.94 ? 295 LYS A CD  1 
ATOM   2200  C  CE  . LYS A  1 315 ? 6.028  12.796  21.236  1.00 54.20 ? 295 LYS A CE  1 
ATOM   2201  N  NZ  . LYS A  1 315 ? 4.864  13.200  22.131  1.00 57.90 ? 295 LYS A NZ  1 
ATOM   2202  N  N   . ILE A  1 316 ? 12.574 10.884  23.598  1.00 42.47 ? 296 ILE A N   1 
ATOM   2203  C  CA  . ILE A  1 316 ? 13.997 10.531  23.549  1.00 42.58 ? 296 ILE A CA  1 
ATOM   2204  C  C   . ILE A  1 316 ? 14.351 9.826   24.855  1.00 43.53 ? 296 ILE A C   1 
ATOM   2205  O  O   . ILE A  1 316 ? 14.175 10.362  25.936  1.00 43.49 ? 296 ILE A O   1 
ATOM   2206  C  CB  . ILE A  1 316 ? 14.912 11.767  23.292  1.00 42.74 ? 296 ILE A CB  1 
ATOM   2207  C  CG1 . ILE A  1 316 ? 14.711 12.264  21.859  1.00 43.62 ? 296 ILE A CG1 1 
ATOM   2208  C  CG2 . ILE A  1 316 ? 16.369 11.412  23.438  1.00 43.34 ? 296 ILE A CG2 1 
ATOM   2209  C  CD1 . ILE A  1 316 ? 15.453 13.518  21.528  1.00 41.33 ? 296 ILE A CD1 1 
ATOM   2210  N  N   . GLN A  1 317 ? 14.791 8.587   24.748  1.00 44.53 ? 297 GLN A N   1 
ATOM   2211  C  CA  . GLN A  1 317 ? 15.230 7.858   25.898  1.00 47.35 ? 297 GLN A CA  1 
ATOM   2212  C  C   . GLN A  1 317 ? 16.742 7.890   25.938  1.00 47.19 ? 297 GLN A C   1 
ATOM   2213  O  O   . GLN A  1 317 ? 17.408 7.901   24.909  1.00 52.19 ? 297 GLN A O   1 
ATOM   2214  C  CB  . GLN A  1 317 ? 14.723 6.422   25.850  1.00 47.25 ? 297 GLN A CB  1 
ATOM   2215  C  CG  . GLN A  1 317 ? 13.237 6.313   25.741  1.00 48.23 ? 297 GLN A CG  1 
ATOM   2216  C  CD  . GLN A  1 317 ? 12.806 4.871   25.698  1.00 52.26 ? 297 GLN A CD  1 
ATOM   2217  O  OE1 . GLN A  1 317 ? 12.926 4.150   26.695  1.00 54.28 ? 297 GLN A OE1 1 
ATOM   2218  N  NE2 . GLN A  1 317 ? 12.317 4.425   24.532  1.00 55.48 ? 297 GLN A NE2 1 
ATOM   2219  N  N   . TYR A  1 318 ? 17.256 7.896   27.151  1.00 47.45 ? 298 TYR A N   1 
ATOM   2220  C  CA  . TYR A  1 318 ? 18.658 8.037   27.437  1.00 47.90 ? 298 TYR A CA  1 
ATOM   2221  C  C   . TYR A  1 318 ? 19.169 6.825   28.262  1.00 47.54 ? 298 TYR A C   1 
ATOM   2222  O  O   . TYR A  1 318 ? 18.388 6.090   28.852  1.00 44.19 ? 298 TYR A O   1 
ATOM   2223  C  CB  . TYR A  1 318 ? 18.892 9.372   28.170  1.00 46.53 ? 298 TYR A CB  1 
ATOM   2224  C  CG  . TYR A  1 318 ? 18.239 9.489   29.534  1.00 46.21 ? 298 TYR A CG  1 
ATOM   2225  C  CD1 . TYR A  1 318 ? 18.900 9.078   30.697  1.00 50.38 ? 298 TYR A CD1 1 
ATOM   2226  C  CD2 . TYR A  1 318 ? 16.968 10.031  29.669  1.00 49.18 ? 298 TYR A CD2 1 
ATOM   2227  C  CE1 . TYR A  1 318 ? 18.294 9.214   31.974  1.00 51.50 ? 298 TYR A CE1 1 
ATOM   2228  C  CE2 . TYR A  1 318 ? 16.350 10.155  30.918  1.00 53.71 ? 298 TYR A CE2 1 
ATOM   2229  C  CZ  . TYR A  1 318 ? 17.014 9.757   32.066  1.00 54.47 ? 298 TYR A CZ  1 
ATOM   2230  O  OH  . TYR A  1 318 ? 16.375 9.902   33.284  1.00 55.01 ? 298 TYR A OH  1 
ATOM   2231  N  N   . LYS A  1 319 ? 20.484 6.626   28.230  1.00 49.25 ? 299 LYS A N   1 
ATOM   2232  C  CA  . LYS A  1 319 ? 21.186 5.618   29.007  1.00 50.47 ? 299 LYS A CA  1 
ATOM   2233  C  C   . LYS A  1 319 ? 22.640 6.055   29.236  1.00 48.82 ? 299 LYS A C   1 
ATOM   2234  O  O   . LYS A  1 319 ? 23.275 6.616   28.364  1.00 49.40 ? 299 LYS A O   1 
ATOM   2235  C  CB  . LYS A  1 319 ? 21.171 4.290   28.278  1.00 51.89 ? 299 LYS A CB  1 
ATOM   2236  C  CG  . LYS A  1 319 ? 21.753 3.159   29.102  1.00 53.57 ? 299 LYS A CG  1 
ATOM   2237  C  CD  . LYS A  1 319 ? 21.524 1.829   28.429  1.00 54.50 ? 299 LYS A CD  1 
ATOM   2238  C  CE  . LYS A  1 319 ? 21.545 0.710   29.458  1.00 60.29 ? 299 LYS A CE  1 
ATOM   2239  N  NZ  . LYS A  1 319 ? 20.380 0.793   30.406  1.00 57.06 ? 299 LYS A NZ  1 
ATOM   2240  N  N   . GLU A  1 320 ? 23.158 5.782   30.418  1.00 49.43 ? 300 GLU A N   1 
ATOM   2241  C  CA  . GLU A  1 320 ? 24.476 6.234   30.810  1.00 51.34 ? 300 GLU A CA  1 
ATOM   2242  C  C   . GLU A  1 320 ? 25.289 5.037   31.271  1.00 49.48 ? 300 GLU A C   1 
ATOM   2243  O  O   . GLU A  1 320 ? 24.739 4.101   31.840  1.00 50.10 ? 300 GLU A O   1 
ATOM   2244  C  CB  . GLU A  1 320 ? 24.356 7.276   31.935  1.00 51.40 ? 300 GLU A CB  1 
ATOM   2245  C  CG  . GLU A  1 320 ? 23.729 8.611   31.475  1.00 57.48 ? 300 GLU A CG  1 
ATOM   2246  C  CD  . GLU A  1 320 ? 23.401 9.589   32.619  1.00 56.21 ? 300 GLU A CD  1 
ATOM   2247  O  OE1 . GLU A  1 320 ? 22.649 9.221   33.553  1.00 68.02 ? 300 GLU A OE1 1 
ATOM   2248  O  OE2 . GLU A  1 320 ? 23.868 10.746  32.559  1.00 63.49 ? 300 GLU A OE2 1 
ATOM   2249  N  N   . TYR A  1 321 ? 26.585 5.074   31.001  1.00 47.80 ? 301 TYR A N   1 
ATOM   2250  C  CA  . TYR A  1 321 ? 27.545 4.164   31.594  1.00 49.06 ? 301 TYR A CA  1 
ATOM   2251  C  C   . TYR A  1 321 ? 28.437 4.998   32.521  1.00 48.15 ? 301 TYR A C   1 
ATOM   2252  O  O   . TYR A  1 321 ? 29.354 5.689   32.065  1.00 43.21 ? 301 TYR A O   1 
ATOM   2253  C  CB  . TYR A  1 321 ? 28.389 3.463   30.506  1.00 54.63 ? 301 TYR A CB  1 
ATOM   2254  C  CG  . TYR A  1 321 ? 29.212 2.296   31.007  1.00 55.72 ? 301 TYR A CG  1 
ATOM   2255  C  CD1 . TYR A  1 321 ? 28.664 1.025   31.103  1.00 59.59 ? 301 TYR A CD1 1 
ATOM   2256  C  CD2 . TYR A  1 321 ? 30.530 2.473   31.414  1.00 64.13 ? 301 TYR A CD2 1 
ATOM   2257  C  CE1 . TYR A  1 321 ? 29.423 -0.060  31.585  1.00 65.70 ? 301 TYR A CE1 1 
ATOM   2258  C  CE2 . TYR A  1 321 ? 31.299 1.395   31.913  1.00 62.10 ? 301 TYR A CE2 1 
ATOM   2259  C  CZ  . TYR A  1 321 ? 30.740 0.141   31.988  1.00 64.12 ? 301 TYR A CZ  1 
ATOM   2260  O  OH  . TYR A  1 321 ? 31.493 -0.912  32.469  1.00 65.46 ? 301 TYR A OH  1 
ATOM   2261  N  N   . ILE A  1 322 ? 28.152 4.927   33.823  1.00 48.75 ? 302 ILE A N   1 
ATOM   2262  C  CA  . ILE A  1 322 ? 28.862 5.712   34.828  1.00 48.98 ? 302 ILE A CA  1 
ATOM   2263  C  C   . ILE A  1 322 ? 30.031 4.896   35.395  1.00 48.70 ? 302 ILE A C   1 
ATOM   2264  O  O   . ILE A  1 322 ? 29.849 3.819   35.909  1.00 48.52 ? 302 ILE A O   1 
ATOM   2265  C  CB  . ILE A  1 322 ? 27.929 6.162   35.995  1.00 49.15 ? 302 ILE A CB  1 
ATOM   2266  C  CG1 . ILE A  1 322 ? 26.661 6.864   35.477  1.00 48.51 ? 302 ILE A CG1 1 
ATOM   2267  C  CG2 . ILE A  1 322 ? 28.698 7.022   37.027  1.00 50.72 ? 302 ILE A CG2 1 
ATOM   2268  C  CD1 . ILE A  1 322 ? 26.869 8.179   34.839  1.00 49.96 ? 302 ILE A CD1 1 
ATOM   2269  N  N   . ILE A  1 323 ? 31.235 5.435   35.283  1.00 51.23 ? 303 ILE A N   1 
ATOM   2270  C  CA  . ILE A  1 323 ? 32.429 4.842   35.858  1.00 50.70 ? 303 ILE A CA  1 
ATOM   2271  C  C   . ILE A  1 323 ? 32.850 5.666   37.056  1.00 49.80 ? 303 ILE A C   1 
ATOM   2272  O  O   . ILE A  1 323 ? 33.148 6.822   36.917  1.00 49.47 ? 303 ILE A O   1 
ATOM   2273  C  CB  . ILE A  1 323 ? 33.533 4.846   34.806  1.00 51.94 ? 303 ILE A CB  1 
ATOM   2274  C  CG1 . ILE A  1 323 ? 33.176 3.829   33.739  1.00 53.38 ? 303 ILE A CG1 1 
ATOM   2275  C  CG2 . ILE A  1 323 ? 34.901 4.535   35.417  1.00 50.10 ? 303 ILE A CG2 1 
ATOM   2276  C  CD1 . ILE A  1 323 ? 33.755 4.161   32.400  1.00 63.90 ? 303 ILE A CD1 1 
ATOM   2277  N  N   . GLU A  1 324 ? 32.879 5.062   38.234  1.00 51.91 ? 304 GLU A N   1 
ATOM   2278  C  CA  . GLU A  1 324 ? 33.257 5.786   39.441  1.00 52.75 ? 304 GLU A CA  1 
ATOM   2279  C  C   . GLU A  1 324 ? 34.768 6.047   39.454  1.00 50.69 ? 304 GLU A C   1 
ATOM   2280  O  O   . GLU A  1 324 ? 35.571 5.127   39.217  1.00 49.50 ? 304 GLU A O   1 
ATOM   2281  C  CB  . GLU A  1 324 ? 32.884 5.006   40.706  1.00 55.38 ? 304 GLU A CB  1 
ATOM   2282  C  CG  . GLU A  1 324 ? 31.414 4.559   40.833  1.00 66.36 ? 304 GLU A CG  1 
ATOM   2283  C  CD  . GLU A  1 324 ? 30.465 5.706   41.138  1.00 78.65 ? 304 GLU A CD  1 
ATOM   2284  O  OE1 . GLU A  1 324 ? 30.758 6.507   42.077  1.00 79.53 ? 304 GLU A OE1 1 
ATOM   2285  O  OE2 . GLU A  1 324 ? 29.423 5.788   40.432  1.00 87.28 ? 304 GLU A OE2 1 
ATOM   2286  N  N   . GLY A  1 325 ? 35.150 7.294   39.713  1.00 46.38 ? 305 GLY A N   1 
ATOM   2287  C  CA  . GLY A  1 325 ? 36.514 7.596   40.104  1.00 46.22 ? 305 GLY A CA  1 
ATOM   2288  C  C   . GLY A  1 325 ? 37.331 8.180   38.977  1.00 46.19 ? 305 GLY A C   1 
ATOM   2289  O  O   . GLY A  1 325 ? 37.379 7.647   37.861  1.00 43.13 ? 305 GLY A O   1 
ATOM   2290  N  N   . PHE A  1 326 ? 37.987 9.294   39.295  1.00 47.46 ? 306 PHE A N   1 
ATOM   2291  C  CA  . PHE A  1 326 ? 38.744 10.096  38.307  1.00 46.40 ? 306 PHE A CA  1 
ATOM   2292  C  C   . PHE A  1 326 ? 40.040 9.374   37.859  1.00 44.99 ? 306 PHE A C   1 
ATOM   2293  O  O   . PHE A  1 326 ? 40.474 9.519   36.720  1.00 43.14 ? 306 PHE A O   1 
ATOM   2294  C  CB  . PHE A  1 326 ? 38.987 11.482  38.927  1.00 46.11 ? 306 PHE A CB  1 
ATOM   2295  C  CG  . PHE A  1 326 ? 39.887 12.346  38.144  1.00 44.19 ? 306 PHE A CG  1 
ATOM   2296  C  CD1 . PHE A  1 326 ? 39.409 13.070  37.082  1.00 40.61 ? 306 PHE A CD1 1 
ATOM   2297  C  CD2 . PHE A  1 326 ? 41.223 12.459  38.483  1.00 43.75 ? 306 PHE A CD2 1 
ATOM   2298  C  CE1 . PHE A  1 326 ? 40.251 13.866  36.355  1.00 42.51 ? 306 PHE A CE1 1 
ATOM   2299  C  CE2 . PHE A  1 326 ? 42.060 13.266  37.744  1.00 43.38 ? 306 PHE A CE2 1 
ATOM   2300  C  CZ  . PHE A  1 326 ? 41.572 13.959  36.697  1.00 37.23 ? 306 PHE A CZ  1 
ATOM   2301  N  N   . GLU A  1 327 ? 40.608 8.568   38.767  1.00 45.62 ? 307 GLU A N   1 
ATOM   2302  C  CA  . GLU A  1 327 ? 41.658 7.576   38.445  1.00 46.54 ? 307 GLU A CA  1 
ATOM   2303  C  C   . GLU A  1 327 ? 41.326 6.669   37.249  1.00 45.52 ? 307 GLU A C   1 
ATOM   2304  O  O   . GLU A  1 327 ? 42.224 6.231   36.541  1.00 48.08 ? 307 GLU A O   1 
ATOM   2305  C  CB  . GLU A  1 327 ? 42.048 6.721   39.676  1.00 46.34 ? 307 GLU A CB  1 
ATOM   2306  C  CG  . GLU A  1 327 ? 40.889 6.096   40.491  1.00 54.58 ? 307 GLU A CG  1 
ATOM   2307  C  CD  . GLU A  1 327 ? 40.156 7.102   41.416  1.00 67.67 ? 307 GLU A CD  1 
ATOM   2308  O  OE1 . GLU A  1 327 ? 40.526 8.325   41.491  1.00 65.92 ? 307 GLU A OE1 1 
ATOM   2309  O  OE2 . GLU A  1 327 ? 39.183 6.655   42.060  1.00 73.94 ? 307 GLU A OE2 1 
ATOM   2310  N  N   . ASN A  1 328 ? 40.043 6.422   37.007  1.00 46.02 ? 308 ASN A N   1 
ATOM   2311  C  CA  . ASN A  1 328 ? 39.594 5.541   35.928  1.00 44.79 ? 308 ASN A CA  1 
ATOM   2312  C  C   . ASN A  1 328 ? 39.215 6.197   34.589  1.00 44.79 ? 308 ASN A C   1 
ATOM   2313  O  O   . ASN A  1 328 ? 38.587 5.559   33.748  1.00 44.84 ? 308 ASN A O   1 
ATOM   2314  C  CB  . ASN A  1 328 ? 38.421 4.727   36.437  1.00 43.95 ? 308 ASN A CB  1 
ATOM   2315  C  CG  . ASN A  1 328 ? 38.761 3.954   37.698  1.00 43.55 ? 308 ASN A CG  1 
ATOM   2316  O  OD1 . ASN A  1 328 ? 39.781 3.265   37.773  1.00 39.64 ? 308 ASN A OD1 1 
ATOM   2317  N  ND2 . ASN A  1 328 ? 37.896 4.055   38.689  1.00 38.30 ? 308 ASN A ND2 1 
ATOM   2318  N  N   . MET A  1 329 ? 39.635 7.443   34.366  1.00 45.68 ? 309 MET A N   1 
ATOM   2319  C  CA  . MET A  1 329 ? 39.265 8.169   33.152  1.00 45.37 ? 309 MET A CA  1 
ATOM   2320  C  C   . MET A  1 329 ? 39.925 7.674   31.889  1.00 41.69 ? 309 MET A C   1 
ATOM   2321  O  O   . MET A  1 329 ? 39.267 7.545   30.851  1.00 41.13 ? 309 MET A O   1 
ATOM   2322  C  CB  . MET A  1 329 ? 39.557 9.657   33.284  1.00 46.81 ? 309 MET A CB  1 
ATOM   2323  C  CG  . MET A  1 329 ? 38.367 10.464  33.602  1.00 53.94 ? 309 MET A CG  1 
ATOM   2324  S  SD  . MET A  1 329 ? 38.556 12.189  33.210  1.00 53.70 ? 309 MET A SD  1 
ATOM   2325  C  CE  . MET A  1 329 ? 37.426 12.254  31.820  1.00 55.74 ? 309 MET A CE  1 
ATOM   2326  N  N   . PRO A  1 330 ? 41.251 7.497   31.915  1.00 42.56 ? 310 PRO A N   1 
ATOM   2327  C  CA  . PRO A  1 330 ? 41.878 6.862   30.736  1.00 40.85 ? 310 PRO A CA  1 
ATOM   2328  C  C   . PRO A  1 330 ? 41.237 5.526   30.341  1.00 38.35 ? 310 PRO A C   1 
ATOM   2329  O  O   . PRO A  1 330 ? 41.046 5.276   29.158  1.00 35.41 ? 310 PRO A O   1 
ATOM   2330  C  CB  . PRO A  1 330 ? 43.331 6.661   31.195  1.00 41.93 ? 310 PRO A CB  1 
ATOM   2331  C  CG  . PRO A  1 330 ? 43.560 7.788   32.156  1.00 39.25 ? 310 PRO A CG  1 
ATOM   2332  C  CD  . PRO A  1 330 ? 42.261 7.870   32.920  1.00 39.72 ? 310 PRO A CD  1 
ATOM   2333  N  N   . ALA A  1 331 ? 40.890 4.699   31.326  1.00 38.87 ? 311 ALA A N   1 
ATOM   2334  C  CA  . ALA A  1 331 ? 40.171 3.437   31.074  1.00 39.09 ? 311 ALA A CA  1 
ATOM   2335  C  C   . ALA A  1 331 ? 38.778 3.663   30.496  1.00 40.70 ? 311 ALA A C   1 
ATOM   2336  O  O   . ALA A  1 331 ? 38.345 2.968   29.569  1.00 43.87 ? 311 ALA A O   1 
ATOM   2337  C  CB  . ALA A  1 331 ? 40.074 2.628   32.326  1.00 38.68 ? 311 ALA A CB  1 
ATOM   2338  N  N   . ALA A  1 332 ? 38.065 4.626   31.045  1.00 40.88 ? 312 ALA A N   1 
ATOM   2339  C  CA  . ALA A  1 332 ? 36.766 5.018   30.486  1.00 40.71 ? 312 ALA A CA  1 
ATOM   2340  C  C   . ALA A  1 332 ? 36.881 5.384   29.031  1.00 38.89 ? 312 ALA A C   1 
ATOM   2341  O  O   . ALA A  1 332 ? 36.090 4.958   28.234  1.00 39.88 ? 312 ALA A O   1 
ATOM   2342  C  CB  . ALA A  1 332 ? 36.192 6.196   31.273  1.00 41.50 ? 312 ALA A CB  1 
ATOM   2343  N  N   . PHE A  1 333 ? 37.877 6.193   28.702  1.00 39.42 ? 313 PHE A N   1 
ATOM   2344  C  CA  . PHE A  1 333 ? 38.126 6.668   27.327  1.00 39.47 ? 313 PHE A CA  1 
ATOM   2345  C  C   . PHE A  1 333 ? 38.457 5.540   26.363  1.00 41.78 ? 313 PHE A C   1 
ATOM   2346  O  O   . PHE A  1 333 ? 37.902 5.460   25.233  1.00 40.83 ? 313 PHE A O   1 
ATOM   2347  C  CB  . PHE A  1 333 ? 39.269 7.684   27.363  1.00 38.97 ? 313 PHE A CB  1 
ATOM   2348  C  CG  . PHE A  1 333 ? 39.660 8.266   26.015  1.00 41.53 ? 313 PHE A CG  1 
ATOM   2349  C  CD1 . PHE A  1 333 ? 38.706 8.742   25.128  1.00 43.37 ? 313 PHE A CD1 1 
ATOM   2350  C  CD2 . PHE A  1 333 ? 41.004 8.392   25.674  1.00 40.64 ? 313 PHE A CD2 1 
ATOM   2351  C  CE1 . PHE A  1 333 ? 39.085 9.280   23.917  1.00 40.92 ? 313 PHE A CE1 1 
ATOM   2352  C  CE2 . PHE A  1 333 ? 41.384 8.950   24.485  1.00 41.85 ? 313 PHE A CE2 1 
ATOM   2353  C  CZ  . PHE A  1 333 ? 40.435 9.407   23.617  1.00 47.75 ? 313 PHE A CZ  1 
ATOM   2354  N  N   . MET A  1 334 ? 39.373 4.690   26.822  1.00 41.67 ? 314 MET A N   1 
ATOM   2355  C  CA  . MET A  1 334 ? 39.812 3.530   26.097  1.00 43.50 ? 314 MET A CA  1 
ATOM   2356  C  C   . MET A  1 334 ? 38.696 2.507   25.915  1.00 44.02 ? 314 MET A C   1 
ATOM   2357  O  O   . MET A  1 334 ? 38.581 1.898   24.824  1.00 44.46 ? 314 MET A O   1 
ATOM   2358  C  CB  . MET A  1 334 ? 41.029 2.902   26.776  1.00 41.15 ? 314 MET A CB  1 
ATOM   2359  C  CG  . MET A  1 334 ? 42.298 3.725   26.558  1.00 39.11 ? 314 MET A CG  1 
ATOM   2360  S  SD  . MET A  1 334 ? 43.751 3.024   27.349  1.00 48.91 ? 314 MET A SD  1 
ATOM   2361  C  CE  . MET A  1 334 ? 43.730 3.614   29.026  1.00 46.40 ? 314 MET A CE  1 
ATOM   2362  N  N   . GLY A  1 335 ? 37.856 2.361   26.938  1.00 40.79 ? 315 GLY A N   1 
ATOM   2363  C  CA  . GLY A  1 335 ? 36.705 1.470   26.865  1.00 41.15 ? 315 GLY A CA  1 
ATOM   2364  C  C   . GLY A  1 335 ? 35.678 1.921   25.854  1.00 41.77 ? 315 GLY A C   1 
ATOM   2365  O  O   . GLY A  1 335 ? 35.198 1.150   25.039  1.00 44.16 ? 315 GLY A O   1 
ATOM   2366  N  N   . MET A  1 336 ? 35.356 3.194   25.919  1.00 43.65 ? 316 MET A N   1 
ATOM   2367  C  CA  . MET A  1 336 ? 34.455 3.834   24.995  1.00 43.31 ? 316 MET A CA  1 
ATOM   2368  C  C   . MET A  1 336 ? 34.983 3.700   23.570  1.00 44.52 ? 316 MET A C   1 
ATOM   2369  O  O   . MET A  1 336 ? 34.228 3.362   22.640  1.00 45.70 ? 316 MET A O   1 
ATOM   2370  C  CB  . MET A  1 336 ? 34.328 5.279   25.459  1.00 44.58 ? 316 MET A CB  1 
ATOM   2371  C  CG  . MET A  1 336 ? 33.427 6.227   24.662  1.00 50.22 ? 316 MET A CG  1 
ATOM   2372  S  SD  . MET A  1 336 ? 34.251 7.036   23.274  1.00 51.64 ? 316 MET A SD  1 
ATOM   2373  C  CE  . MET A  1 336 ? 35.642 7.895   23.991  1.00 48.55 ? 316 MET A CE  1 
ATOM   2374  N  N   . LEU A  1 337 ? 36.287 3.905   23.389  1.00 43.80 ? 317 LEU A N   1 
ATOM   2375  C  CA  . LEU A  1 337 ? 36.875 3.846   22.048  1.00 42.36 ? 317 LEU A CA  1 
ATOM   2376  C  C   . LEU A  1 337 ? 36.835 2.461   21.472  1.00 45.89 ? 317 LEU A C   1 
ATOM   2377  O  O   . LEU A  1 337 ? 36.669 2.306   20.272  1.00 50.38 ? 317 LEU A O   1 
ATOM   2378  C  CB  . LEU A  1 337 ? 38.323 4.277   22.056  1.00 43.31 ? 317 LEU A CB  1 
ATOM   2379  C  CG  . LEU A  1 337 ? 38.671 5.748   22.185  1.00 38.86 ? 317 LEU A CG  1 
ATOM   2380  C  CD1 . LEU A  1 337 ? 40.180 5.839   22.364  1.00 36.86 ? 317 LEU A CD1 1 
ATOM   2381  C  CD2 . LEU A  1 337 ? 38.209 6.549   20.991  1.00 41.80 ? 317 LEU A CD2 1 
ATOM   2382  N  N   . LYS A  1 338 ? 37.052 1.460   22.312  1.00 47.79 ? 318 LYS A N   1 
ATOM   2383  C  CA  . LYS A  1 338 ? 36.895 0.071   21.918  1.00 51.19 ? 318 LYS A CA  1 
ATOM   2384  C  C   . LYS A  1 338 ? 35.429 -0.356  21.728  1.00 54.65 ? 318 LYS A C   1 
ATOM   2385  O  O   . LYS A  1 338 ? 35.185 -1.482  21.308  1.00 55.47 ? 318 LYS A O   1 
ATOM   2386  C  CB  . LYS A  1 338 ? 37.603 -0.875  22.933  1.00 47.34 ? 318 LYS A CB  1 
ATOM   2387  C  CG  . LYS A  1 338 ? 39.118 -1.002  22.718  1.00 41.08 ? 318 LYS A CG  1 
ATOM   2388  C  CD  . LYS A  1 338 ? 39.392 -1.742  21.357  1.00 40.49 ? 318 LYS A CD  1 
ATOM   2389  C  CE  . LYS A  1 338 ? 40.827 -2.329  21.188  1.00 38.21 ? 318 LYS A CE  1 
ATOM   2390  N  NZ  . LYS A  1 338 ? 41.231 -2.610  19.712  1.00 38.27 ? 318 LYS A NZ  1 
ATOM   2391  N  N   . GLY A  1 339 ? 34.456 0.509   22.020  1.00 56.91 ? 319 GLY A N   1 
ATOM   2392  C  CA  . GLY A  1 339 ? 33.051 0.120   21.917  1.00 56.74 ? 319 GLY A CA  1 
ATOM   2393  C  C   . GLY A  1 339 ? 32.548 -0.770  23.052  1.00 59.43 ? 319 GLY A C   1 
ATOM   2394  O  O   . GLY A  1 339 ? 31.501 -1.410  22.931  1.00 57.28 ? 319 GLY A O   1 
ATOM   2395  N  N   . ASP A  1 340 ? 33.263 -0.786  24.170  1.00 62.97 ? 320 ASP A N   1 
ATOM   2396  C  CA  . ASP A  1 340 ? 32.938 -1.693  25.271  1.00 67.41 ? 320 ASP A CA  1 
ATOM   2397  C  C   . ASP A  1 340 ? 31.672 -1.336  26.065  1.00 66.97 ? 320 ASP A C   1 
ATOM   2398  O  O   . ASP A  1 340 ? 31.141 -2.157  26.788  1.00 67.10 ? 320 ASP A O   1 
ATOM   2399  C  CB  . ASP A  1 340 ? 34.117 -1.767  26.254  1.00 68.64 ? 320 ASP A CB  1 
ATOM   2400  C  CG  . ASP A  1 340 ? 35.356 -2.431  25.655  1.00 74.51 ? 320 ASP A CG  1 
ATOM   2401  O  OD1 . ASP A  1 340 ? 35.275 -2.974  24.522  1.00 78.79 ? 320 ASP A OD1 1 
ATOM   2402  O  OD2 . ASP A  1 340 ? 36.413 -2.413  26.336  1.00 75.94 ? 320 ASP A OD2 1 
ATOM   2403  N  N   . ASN A  1 341 ? 31.205 -0.107  25.949  1.00 67.82 ? 321 ASN A N   1 
ATOM   2404  C  CA  . ASN A  1 341 ? 30.210 0.415   26.879  1.00 65.85 ? 321 ASN A CA  1 
ATOM   2405  C  C   . ASN A  1 341 ? 28.836 0.633   26.199  1.00 64.72 ? 321 ASN A C   1 
ATOM   2406  O  O   . ASN A  1 341 ? 28.775 1.077   25.047  1.00 64.62 ? 321 ASN A O   1 
ATOM   2407  C  CB  . ASN A  1 341 ? 30.762 1.714   27.505  1.00 66.80 ? 321 ASN A CB  1 
ATOM   2408  C  CG  . ASN A  1 341 ? 32.134 1.509   28.237  1.00 66.35 ? 321 ASN A CG  1 
ATOM   2409  O  OD1 . ASN A  1 341 ? 32.922 2.467   28.412  1.00 57.03 ? 321 ASN A OD1 1 
ATOM   2410  N  ND2 . ASN A  1 341 ? 32.399 0.268   28.682  1.00 52.35 ? 321 ASN A ND2 1 
ATOM   2411  N  N   . LEU A  1 342 ? 27.751 0.277   26.899  1.00 61.52 ? 322 LEU A N   1 
ATOM   2412  C  CA  . LEU A  1 342 ? 26.374 0.628   26.480  1.00 59.84 ? 322 LEU A CA  1 
ATOM   2413  C  C   . LEU A  1 342 ? 25.832 1.872   27.248  1.00 54.89 ? 322 LEU A C   1 
ATOM   2414  O  O   . LEU A  1 342 ? 25.559 1.822   28.446  1.00 52.50 ? 322 LEU A O   1 
ATOM   2415  C  CB  . LEU A  1 342 ? 25.443 -0.579  26.649  1.00 59.45 ? 322 LEU A CB  1 
ATOM   2416  C  CG  . LEU A  1 342 ? 23.944 -0.441  26.358  1.00 60.41 ? 322 LEU A CG  1 
ATOM   2417  C  CD1 . LEU A  1 342 ? 23.659 0.138   24.989  1.00 59.79 ? 322 LEU A CD1 1 
ATOM   2418  C  CD2 . LEU A  1 342 ? 23.275 -1.810  26.529  1.00 62.21 ? 322 LEU A CD2 1 
ATOM   2419  N  N   . GLY A  1 343 ? 25.687 2.982   26.531  1.00 51.62 ? 323 GLY A N   1 
ATOM   2420  C  CA  . GLY A  1 343 ? 25.297 4.256   27.114  1.00 51.51 ? 323 GLY A CA  1 
ATOM   2421  C  C   . GLY A  1 343 ? 26.366 5.306   26.869  1.00 51.01 ? 323 GLY A C   1 
ATOM   2422  O  O   . GLY A  1 343 ? 27.431 5.007   26.384  1.00 55.33 ? 323 GLY A O   1 
ATOM   2423  N  N   . LYS A  1 344 ? 26.065 6.549   27.185  1.00 48.49 ? 324 LYS A N   1 
ATOM   2424  C  CA  . LYS A  1 344 ? 27.059 7.601   27.236  1.00 47.94 ? 324 LYS A CA  1 
ATOM   2425  C  C   . LYS A  1 344 ? 28.038 7.298   28.366  1.00 46.00 ? 324 LYS A C   1 
ATOM   2426  O  O   . LYS A  1 344 ? 27.623 7.069   29.509  1.00 43.15 ? 324 LYS A O   1 
ATOM   2427  C  CB  . LYS A  1 344 ? 26.352 8.958   27.477  1.00 48.16 ? 324 LYS A CB  1 
ATOM   2428  C  CG  . LYS A  1 344 ? 27.247 10.183  27.576  1.00 46.09 ? 324 LYS A CG  1 
ATOM   2429  C  CD  . LYS A  1 344 ? 27.849 10.548  26.274  1.00 41.59 ? 324 LYS A CD  1 
ATOM   2430  C  CE  . LYS A  1 344 ? 28.980 11.566  26.465  1.00 45.70 ? 324 LYS A CE  1 
ATOM   2431  N  NZ  . LYS A  1 344 ? 30.322 10.871  26.560  1.00 42.42 ? 324 LYS A NZ  1 
ATOM   2432  N  N   . THR A  1 345 ? 29.333 7.297   28.036  1.00 46.09 ? 325 THR A N   1 
ATOM   2433  C  CA  . THR A  1 345 ? 30.365 7.106   29.026  1.00 45.04 ? 325 THR A CA  1 
ATOM   2434  C  C   . THR A  1 345 ? 30.634 8.435   29.753  1.00 43.10 ? 325 THR A C   1 
ATOM   2435  O  O   . THR A  1 345 ? 30.879 9.471   29.128  1.00 43.14 ? 325 THR A O   1 
ATOM   2436  C  CB  . THR A  1 345 ? 31.668 6.509   28.460  1.00 45.60 ? 325 THR A CB  1 
ATOM   2437  O  OG1 . THR A  1 345 ? 31.403 5.303   27.751  1.00 45.83 ? 325 THR A OG1 1 
ATOM   2438  C  CG2 . THR A  1 345 ? 32.604 6.183   29.603  1.00 48.46 ? 325 THR A CG2 1 
ATOM   2439  N  N   . ILE A  1 346 ? 30.576 8.337   31.080  1.00 43.61 ? 326 ILE A N   1 
ATOM   2440  C  CA  . ILE A  1 346 ? 30.590 9.436   32.046  1.00 45.62 ? 326 ILE A CA  1 
ATOM   2441  C  C   . ILE A  1 346 ? 31.359 8.959   33.256  1.00 44.25 ? 326 ILE A C   1 
ATOM   2442  O  O   . ILE A  1 346 ? 31.097 7.882   33.767  1.00 42.25 ? 326 ILE A O   1 
ATOM   2443  C  CB  . ILE A  1 346 ? 29.165 9.739   32.612  1.00 47.36 ? 326 ILE A CB  1 
ATOM   2444  C  CG1 . ILE A  1 346 ? 28.204 10.256  31.516  1.00 46.93 ? 326 ILE A CG1 1 
ATOM   2445  C  CG2 . ILE A  1 346 ? 29.253 10.690  33.796  1.00 48.53 ? 326 ILE A CG2 1 
ATOM   2446  C  CD1 . ILE A  1 346 ? 28.623 11.536  30.864  1.00 45.41 ? 326 ILE A CD1 1 
ATOM   2447  N  N   . VAL A  1 347 ? 32.295 9.770   33.721  1.00 44.75 ? 327 VAL A N   1 
ATOM   2448  C  CA  . VAL A  1 347 ? 33.074 9.436   34.891  1.00 44.94 ? 327 VAL A CA  1 
ATOM   2449  C  C   . VAL A  1 347 ? 32.554 10.258  36.038  1.00 44.39 ? 327 VAL A C   1 
ATOM   2450  O  O   . VAL A  1 347 ? 32.552 11.460  35.977  1.00 41.93 ? 327 VAL A O   1 
ATOM   2451  C  CB  . VAL A  1 347 ? 34.581 9.718   34.654  1.00 45.21 ? 327 VAL A CB  1 
ATOM   2452  C  CG1 . VAL A  1 347 ? 35.379 9.617   35.954  1.00 47.47 ? 327 VAL A CG1 1 
ATOM   2453  C  CG2 . VAL A  1 347 ? 35.141 8.763   33.608  1.00 51.43 ? 327 VAL A CG2 1 
ATOM   2454  N  N   . LYS A  1 348 ? 32.113 9.593   37.092  1.00 47.99 ? 328 LYS A N   1 
ATOM   2455  C  CA  . LYS A  1 348 ? 31.682 10.259  38.318  1.00 48.85 ? 328 LYS A CA  1 
ATOM   2456  C  C   . LYS A  1 348 ? 32.880 10.462  39.226  1.00 49.09 ? 328 LYS A C   1 
ATOM   2457  O  O   . LYS A  1 348 ? 33.485 9.511   39.647  1.00 49.30 ? 328 LYS A O   1 
ATOM   2458  C  CB  . LYS A  1 348 ? 30.630 9.417   39.047  1.00 48.74 ? 328 LYS A CB  1 
ATOM   2459  C  CG  . LYS A  1 348 ? 29.948 10.164  40.151  1.00 50.45 ? 328 LYS A CG  1 
ATOM   2460  C  CD  . LYS A  1 348 ? 28.906 9.330   40.885  1.00 50.28 ? 328 LYS A CD  1 
ATOM   2461  C  CE  . LYS A  1 348 ? 28.035 10.235  41.723  1.00 53.26 ? 328 LYS A CE  1 
ATOM   2462  N  NZ  . LYS A  1 348 ? 27.343 9.441   42.745  1.00 65.07 ? 328 LYS A NZ  1 
ATOM   2463  N  N   . ALA A  1 349 ? 33.212 11.710  39.521  1.00 52.12 ? 329 ALA A N   1 
ATOM   2464  C  CA  . ALA A  1 349 ? 34.280 12.041  40.455  1.00 53.37 ? 329 ALA A CA  1 
ATOM   2465  C  CB  . ALA A  1 349 ? 34.558 13.551  40.398  1.00 54.31 ? 329 ALA A CB  1 
ATOM   2466  N  N   . SER B  1 22  ? 21.513 1.949   -47.987 1.00 61.05 ? 2   SER B N   1 
ATOM   2467  C  CA  . SER B  1 22  ? 22.542 2.799   -47.305 1.00 61.82 ? 2   SER B CA  1 
ATOM   2468  C  C   . SER B  1 22  ? 23.315 2.056   -46.184 1.00 61.68 ? 2   SER B C   1 
ATOM   2469  O  O   . SER B  1 22  ? 22.744 1.285   -45.387 1.00 58.45 ? 2   SER B O   1 
ATOM   2470  C  CB  . SER B  1 22  ? 21.908 4.085   -46.746 1.00 62.91 ? 2   SER B CB  1 
ATOM   2471  O  OG  . SER B  1 22  ? 20.989 3.799   -45.702 1.00 60.55 ? 2   SER B OG  1 
ATOM   2472  N  N   . MET B  1 23  ? 24.626 2.310   -46.149 1.00 62.59 ? 3   MET B N   1 
ATOM   2473  C  CA  . MET B  1 23  ? 25.551 1.657   -45.214 1.00 61.41 ? 3   MET B CA  1 
ATOM   2474  C  C   . MET B  1 23  ? 25.961 2.614   -44.123 1.00 58.34 ? 3   MET B C   1 
ATOM   2475  O  O   . MET B  1 23  ? 25.848 3.828   -44.265 1.00 57.56 ? 3   MET B O   1 
ATOM   2476  C  CB  . MET B  1 23  ? 26.813 1.149   -45.927 1.00 62.50 ? 3   MET B CB  1 
ATOM   2477  C  CG  . MET B  1 23  ? 26.542 0.196   -47.110 1.00 69.69 ? 3   MET B CG  1 
ATOM   2478  S  SD  . MET B  1 23  ? 25.781 -1.401  -46.698 1.00 76.12 ? 3   MET B SD  1 
ATOM   2479  C  CE  . MET B  1 23  ? 27.104 -2.281  -45.843 1.00 71.69 ? 3   MET B CE  1 
ATOM   2480  N  N   . THR B  1 24  ? 26.433 2.037   -43.025 1.00 56.24 ? 4   THR B N   1 
ATOM   2481  C  CA  . THR B  1 24  ? 27.053 2.791   -41.941 1.00 52.84 ? 4   THR B CA  1 
ATOM   2482  C  C   . THR B  1 24  ? 28.279 2.015   -41.429 1.00 51.36 ? 4   THR B C   1 
ATOM   2483  O  O   . THR B  1 24  ? 28.355 0.774   -41.536 1.00 49.07 ? 4   THR B O   1 
ATOM   2484  C  CB  . THR B  1 24  ? 26.052 3.074   -40.785 1.00 51.92 ? 4   THR B CB  1 
ATOM   2485  O  OG1 . THR B  1 24  ? 26.711 3.814   -39.753 1.00 49.79 ? 4   THR B OG1 1 
ATOM   2486  C  CG2 . THR B  1 24  ? 25.466 1.781   -40.185 1.00 50.03 ? 4   THR B CG2 1 
ATOM   2487  N  N   . LYS B  1 25  ? 29.243 2.757   -40.893 1.00 49.10 ? 5   LYS B N   1 
ATOM   2488  C  CA  . LYS B  1 25  ? 30.333 2.150   -40.149 1.00 47.75 ? 5   LYS B CA  1 
ATOM   2489  C  C   . LYS B  1 25  ? 30.161 2.495   -38.674 1.00 44.02 ? 5   LYS B C   1 
ATOM   2490  O  O   . LYS B  1 25  ? 29.762 3.591   -38.310 1.00 41.23 ? 5   LYS B O   1 
ATOM   2491  C  CB  . LYS B  1 25  ? 31.698 2.579   -40.710 1.00 50.19 ? 5   LYS B CB  1 
ATOM   2492  C  CG  . LYS B  1 25  ? 31.925 2.151   -42.171 1.00 48.76 ? 5   LYS B CG  1 
ATOM   2493  C  CD  . LYS B  1 25  ? 33.185 2.772   -42.788 1.00 51.98 ? 5   LYS B CD  1 
ATOM   2494  N  N   . THR B  1 26  ? 30.433 1.516   -37.826 1.00 45.13 ? 6   THR B N   1 
ATOM   2495  C  CA  . THR B  1 26  ? 30.250 1.656   -36.388 1.00 43.92 ? 6   THR B CA  1 
ATOM   2496  C  C   . THR B  1 26  ? 31.439 1.098   -35.616 1.00 40.85 ? 6   THR B C   1 
ATOM   2497  O  O   . THR B  1 26  ? 31.948 0.044   -35.937 1.00 43.22 ? 6   THR B O   1 
ATOM   2498  C  CB  . THR B  1 26  ? 28.917 0.995   -35.944 1.00 43.91 ? 6   THR B CB  1 
ATOM   2499  O  OG1 . THR B  1 26  ? 27.833 1.695   -36.570 1.00 46.27 ? 6   THR B OG1 1 
ATOM   2500  C  CG2 . THR B  1 26  ? 28.717 1.053   -34.412 1.00 43.30 ? 6   THR B CG2 1 
ATOM   2501  N  N   . TRP B  1 27  ? 31.866 1.835   -34.594 1.00 39.91 ? 7   TRP B N   1 
ATOM   2502  C  CA  . TRP B  1 27  ? 32.900 1.414   -33.646 1.00 38.58 ? 7   TRP B CA  1 
ATOM   2503  C  C   . TRP B  1 27  ? 32.240 0.781   -32.425 1.00 40.42 ? 7   TRP B C   1 
ATOM   2504  O  O   . TRP B  1 27  ? 31.479 1.442   -31.744 1.00 44.09 ? 7   TRP B O   1 
ATOM   2505  C  CB  . TRP B  1 27  ? 33.742 2.622   -33.195 1.00 36.48 ? 7   TRP B CB  1 
ATOM   2506  C  CG  . TRP B  1 27  ? 34.845 2.962   -34.141 1.00 36.94 ? 7   TRP B CG  1 
ATOM   2507  C  CD1 . TRP B  1 27  ? 34.990 4.098   -34.907 1.00 36.46 ? 7   TRP B CD1 1 
ATOM   2508  C  CD2 . TRP B  1 27  ? 35.973 2.130   -34.436 1.00 39.64 ? 7   TRP B CD2 1 
ATOM   2509  N  NE1 . TRP B  1 27  ? 36.146 4.011   -35.660 1.00 35.46 ? 7   TRP B NE1 1 
ATOM   2510  C  CE2 . TRP B  1 27  ? 36.767 2.816   -35.374 1.00 36.53 ? 7   TRP B CE2 1 
ATOM   2511  C  CE3 . TRP B  1 27  ? 36.385 0.861   -33.990 1.00 33.67 ? 7   TRP B CE3 1 
ATOM   2512  C  CZ2 . TRP B  1 27  ? 37.947 2.281   -35.858 1.00 30.92 ? 7   TRP B CZ2 1 
ATOM   2513  C  CZ3 . TRP B  1 27  ? 37.539 0.360   -34.446 1.00 34.04 ? 7   TRP B CZ3 1 
ATOM   2514  C  CH2 . TRP B  1 27  ? 38.311 1.054   -35.387 1.00 32.49 ? 7   TRP B CH2 1 
ATOM   2515  N  N   . THR B  1 28  ? 32.528 -0.498  -32.175 1.00 41.71 ? 8   THR B N   1 
ATOM   2516  C  CA  . THR B  1 28  ? 31.990 -1.233  -31.046 1.00 43.17 ? 8   THR B CA  1 
ATOM   2517  C  C   . THR B  1 28  ? 33.073 -1.533  -29.999 1.00 45.19 ? 8   THR B C   1 
ATOM   2518  O  O   . THR B  1 28  ? 34.280 -1.413  -30.252 1.00 42.42 ? 8   THR B O   1 
ATOM   2519  C  CB  . THR B  1 28  ? 31.305 -2.560  -31.503 1.00 43.42 ? 8   THR B CB  1 
ATOM   2520  O  OG1 . THR B  1 28  ? 32.254 -3.449  -32.113 1.00 48.82 ? 8   THR B OG1 1 
ATOM   2521  C  CG2 . THR B  1 28  ? 30.206 -2.258  -32.513 1.00 43.89 ? 8   THR B CG2 1 
ATOM   2522  N  N   . LEU B  1 29  ? 32.606 -1.895  -28.812 1.00 45.60 ? 9   LEU B N   1 
ATOM   2523  C  CA  . LEU B  1 29  ? 33.449 -2.419  -27.785 1.00 47.32 ? 9   LEU B CA  1 
ATOM   2524  C  C   . LEU B  1 29  ? 33.589 -3.914  -28.030 1.00 47.22 ? 9   LEU B C   1 
ATOM   2525  O  O   . LEU B  1 29  ? 32.624 -4.654  -27.924 1.00 48.68 ? 9   LEU B O   1 
ATOM   2526  C  CB  . LEU B  1 29  ? 32.816 -2.145  -26.418 1.00 48.80 ? 9   LEU B CB  1 
ATOM   2527  C  CG  . LEU B  1 29  ? 33.682 -2.528  -25.223 1.00 46.02 ? 9   LEU B CG  1 
ATOM   2528  C  CD1 . LEU B  1 29  ? 34.743 -1.479  -25.007 1.00 47.20 ? 9   LEU B CD1 1 
ATOM   2529  C  CD2 . LEU B  1 29  ? 32.824 -2.692  -24.001 1.00 52.02 ? 9   LEU B CD2 1 
ATOM   2530  N  N   . LYS B  1 30  ? 34.802 -4.337  -28.397 1.00 49.54 ? 10  LYS B N   1 
ATOM   2531  C  CA  . LYS B  1 30  ? 35.144 -5.756  -28.599 1.00 47.38 ? 10  LYS B CA  1 
ATOM   2532  C  C   . LYS B  1 30  ? 35.354 -6.382  -27.246 1.00 45.32 ? 10  LYS B C   1 
ATOM   2533  O  O   . LYS B  1 30  ? 34.932 -7.519  -27.013 1.00 45.26 ? 10  LYS B O   1 
ATOM   2534  C  CB  . LYS B  1 30  ? 36.440 -5.922  -29.425 1.00 48.12 ? 10  LYS B CB  1 
ATOM   2535  C  CG  . LYS B  1 30  ? 36.417 -7.042  -30.499 1.00 49.30 ? 10  LYS B CG  1 
ATOM   2536  C  CD  . LYS B  1 30  ? 37.765 -7.751  -30.757 1.00 48.08 ? 10  LYS B CD  1 
ATOM   2537  C  CE  . LYS B  1 30  ? 38.888 -6.841  -31.245 1.00 57.22 ? 10  LYS B CE  1 
ATOM   2538  N  NZ  . LYS B  1 30  ? 39.006 -6.647  -32.740 1.00 62.90 ? 10  LYS B NZ  1 
ATOM   2539  N  N   . LYS B  1 31  ? 36.047 -5.639  -26.376 1.00 44.47 ? 11  LYS B N   1 
ATOM   2540  C  CA  . LYS B  1 31  ? 36.567 -6.158  -25.108 1.00 44.50 ? 11  LYS B CA  1 
ATOM   2541  C  C   . LYS B  1 31  ? 36.611 -5.034  -24.086 1.00 43.32 ? 11  LYS B C   1 
ATOM   2542  O  O   . LYS B  1 31  ? 36.959 -3.923  -24.394 1.00 47.18 ? 11  LYS B O   1 
ATOM   2543  C  CB  . LYS B  1 31  ? 37.970 -6.803  -25.281 1.00 45.00 ? 11  LYS B CB  1 
ATOM   2544  C  CG  . LYS B  1 31  ? 37.964 -8.332  -25.583 1.00 46.62 ? 11  LYS B CG  1 
ATOM   2545  N  N   . HIS B  1 32  ? 36.220 -5.330  -22.860 1.00 43.55 ? 12  HIS B N   1 
ATOM   2546  C  CA  . HIS B  1 32  ? 36.254 -4.352  -21.793 1.00 43.61 ? 12  HIS B CA  1 
ATOM   2547  C  C   . HIS B  1 32  ? 37.674 -3.831  -21.516 1.00 41.33 ? 12  HIS B C   1 
ATOM   2548  O  O   . HIS B  1 32  ? 38.637 -4.593  -21.510 1.00 41.14 ? 12  HIS B O   1 
ATOM   2549  C  CB  . HIS B  1 32  ? 35.589 -4.966  -20.529 1.00 45.41 ? 12  HIS B CB  1 
ATOM   2550  C  CG  . HIS B  1 32  ? 34.095 -4.821  -20.527 1.00 49.79 ? 12  HIS B CG  1 
ATOM   2551  N  ND1 . HIS B  1 32  ? 33.477 -3.586  -20.590 1.00 46.49 ? 12  HIS B ND1 1 
ATOM   2552  C  CD2 . HIS B  1 32  ? 33.103 -5.744  -20.517 1.00 47.48 ? 12  HIS B CD2 1 
ATOM   2553  C  CE1 . HIS B  1 32  ? 32.168 -3.761  -20.616 1.00 51.57 ? 12  HIS B CE1 1 
ATOM   2554  N  NE2 . HIS B  1 32  ? 31.915 -5.059  -20.581 1.00 46.44 ? 12  HIS B NE2 1 
ATOM   2555  N  N   . PHE B  1 33  ? 37.802 -2.537  -21.276 1.00 40.38 ? 13  PHE B N   1 
ATOM   2556  C  CA  . PHE B  1 33  ? 39.115 -1.942  -21.099 1.00 37.65 ? 13  PHE B CA  1 
ATOM   2557  C  C   . PHE B  1 33  ? 39.730 -2.384  -19.784 1.00 38.44 ? 13  PHE B C   1 
ATOM   2558  O  O   . PHE B  1 33  ? 39.055 -2.423  -18.768 1.00 38.32 ? 13  PHE B O   1 
ATOM   2559  C  CB  . PHE B  1 33  ? 39.069 -0.433  -21.156 1.00 36.59 ? 13  PHE B CB  1 
ATOM   2560  C  CG  . PHE B  1 33  ? 38.269 0.131   -22.306 1.00 30.68 ? 13  PHE B CG  1 
ATOM   2561  C  CD1 . PHE B  1 33  ? 38.507 -0.266  -23.592 1.00 35.87 ? 13  PHE B CD1 1 
ATOM   2562  C  CD2 . PHE B  1 33  ? 37.302 1.117   -22.074 1.00 33.29 ? 13  PHE B CD2 1 
ATOM   2563  C  CE1 . PHE B  1 33  ? 37.788 0.277   -24.665 1.00 40.54 ? 13  PHE B CE1 1 
ATOM   2564  C  CE2 . PHE B  1 33  ? 36.579 1.686   -23.124 1.00 34.24 ? 13  PHE B CE2 1 
ATOM   2565  C  CZ  . PHE B  1 33  ? 36.824 1.283   -24.423 1.00 38.19 ? 13  PHE B CZ  1 
ATOM   2566  N  N   . VAL B  1 34  ? 41.010 -2.764  -19.821 1.00 38.89 ? 14  VAL B N   1 
ATOM   2567  C  CA  . VAL B  1 34  ? 41.790 -2.983  -18.589 1.00 39.57 ? 14  VAL B CA  1 
ATOM   2568  C  C   . VAL B  1 34  ? 42.868 -1.896  -18.484 1.00 40.90 ? 14  VAL B C   1 
ATOM   2569  O  O   . VAL B  1 34  ? 43.747 -1.788  -19.366 1.00 42.40 ? 14  VAL B O   1 
ATOM   2570  C  CB  . VAL B  1 34  ? 42.347 -4.387  -18.505 1.00 36.72 ? 14  VAL B CB  1 
ATOM   2571  C  CG1 . VAL B  1 34  ? 43.054 -4.616  -17.165 1.00 35.48 ? 14  VAL B CG1 1 
ATOM   2572  C  CG2 . VAL B  1 34  ? 41.180 -5.411  -18.676 1.00 33.32 ? 14  VAL B CG2 1 
ATOM   2573  N  N   . GLY B  1 35  ? 42.727 -1.064  -17.433 1.00 40.48 ? 15  GLY B N   1 
ATOM   2574  C  CA  . GLY B  1 35  ? 43.364 0.251   -17.356 1.00 38.30 ? 15  GLY B CA  1 
ATOM   2575  C  C   . GLY B  1 35  ? 43.021 1.145   -18.521 1.00 35.49 ? 15  GLY B C   1 
ATOM   2576  O  O   . GLY B  1 35  ? 41.868 1.383   -18.773 1.00 39.19 ? 15  GLY B O   1 
ATOM   2577  N  N   . TYR B  1 36  ? 44.008 1.645   -19.258 1.00 34.54 ? 16  TYR B N   1 
ATOM   2578  C  CA  . TYR B  1 36  ? 43.710 2.331   -20.530 1.00 34.21 ? 16  TYR B CA  1 
ATOM   2579  C  C   . TYR B  1 36  ? 43.178 1.375   -21.620 1.00 35.57 ? 16  TYR B C   1 
ATOM   2580  O  O   . TYR B  1 36  ? 43.532 0.204   -21.683 1.00 40.34 ? 16  TYR B O   1 
ATOM   2581  C  CB  . TYR B  1 36  ? 44.931 3.145   -21.063 1.00 31.42 ? 16  TYR B CB  1 
ATOM   2582  C  CG  . TYR B  1 36  ? 45.326 4.287   -20.183 1.00 34.83 ? 16  TYR B CG  1 
ATOM   2583  C  CD1 . TYR B  1 36  ? 46.228 4.114   -19.128 1.00 37.47 ? 16  TYR B CD1 1 
ATOM   2584  C  CD2 . TYR B  1 36  ? 44.756 5.541   -20.343 1.00 37.37 ? 16  TYR B CD2 1 
ATOM   2585  C  CE1 . TYR B  1 36  ? 46.579 5.182   -18.291 1.00 38.28 ? 16  TYR B CE1 1 
ATOM   2586  C  CE2 . TYR B  1 36  ? 45.078 6.596   -19.487 1.00 35.91 ? 16  TYR B CE2 1 
ATOM   2587  C  CZ  . TYR B  1 36  ? 46.002 6.406   -18.486 1.00 34.61 ? 16  TYR B CZ  1 
ATOM   2588  O  OH  . TYR B  1 36  ? 46.307 7.463   -17.683 1.00 43.73 ? 16  TYR B OH  1 
ATOM   2589  N  N   . PRO B  1 37  ? 42.340 1.879   -22.518 1.00 36.55 ? 17  PRO B N   1 
ATOM   2590  C  CA  . PRO B  1 37  ? 42.073 1.096   -23.712 1.00 35.51 ? 17  PRO B CA  1 
ATOM   2591  C  C   . PRO B  1 37  ? 43.325 0.870   -24.567 1.00 38.73 ? 17  PRO B C   1 
ATOM   2592  O  O   . PRO B  1 37  ? 44.338 1.580   -24.421 1.00 38.16 ? 17  PRO B O   1 
ATOM   2593  C  CB  . PRO B  1 37  ? 41.094 1.968   -24.465 1.00 35.51 ? 17  PRO B CB  1 
ATOM   2594  C  CG  . PRO B  1 37  ? 40.550 2.869   -23.431 1.00 38.35 ? 17  PRO B CG  1 
ATOM   2595  C  CD  . PRO B  1 37  ? 41.588 3.137   -22.497 1.00 34.31 ? 17  PRO B CD  1 
ATOM   2596  N  N   . THR B  1 38  ? 43.244 -0.134  -25.433 1.00 38.47 ? 18  THR B N   1 
ATOM   2597  C  CA  . THR B  1 38  ? 44.233 -0.372  -26.450 1.00 39.64 ? 18  THR B CA  1 
ATOM   2598  C  C   . THR B  1 38  ? 43.413 -0.650  -27.713 1.00 37.64 ? 18  THR B C   1 
ATOM   2599  O  O   . THR B  1 38  ? 42.183 -0.801  -27.644 1.00 37.68 ? 18  THR B O   1 
ATOM   2600  C  CB  . THR B  1 38  ? 45.255 -1.507  -26.038 1.00 42.53 ? 18  THR B CB  1 
ATOM   2601  O  OG1 . THR B  1 38  ? 46.342 -1.575  -26.987 1.00 45.05 ? 18  THR B OG1 1 
ATOM   2602  C  CG2 . THR B  1 38  ? 44.560 -2.892  -25.918 1.00 46.33 ? 18  THR B CG2 1 
ATOM   2603  N  N   . ASN B  1 39  ? 44.067 -0.642  -28.862 1.00 36.31 ? 19  ASN B N   1 
ATOM   2604  C  CA  . ASN B  1 39  ? 43.351 -0.666  -30.169 1.00 37.62 ? 19  ASN B CA  1 
ATOM   2605  C  C   . ASN B  1 39  ? 42.460 -1.898  -30.295 1.00 37.98 ? 19  ASN B C   1 
ATOM   2606  O  O   . ASN B  1 39  ? 41.387 -1.827  -30.834 1.00 38.08 ? 19  ASN B O   1 
ATOM   2607  C  CB  . ASN B  1 39  ? 44.347 -0.550  -31.370 1.00 36.43 ? 19  ASN B CB  1 
ATOM   2608  C  CG  . ASN B  1 39  ? 45.330 0.632   -31.198 1.00 41.41 ? 19  ASN B CG  1 
ATOM   2609  O  OD1 . ASN B  1 39  ? 46.274 0.554   -30.386 1.00 40.34 ? 19  ASN B OD1 1 
ATOM   2610  N  ND2 . ASN B  1 39  ? 45.069 1.750   -31.887 1.00 33.58 ? 19  ASN B ND2 1 
ATOM   2611  N  N   . SER B  1 40  ? 42.900 -3.001  -29.689 1.00 41.57 ? 20  SER B N   1 
ATOM   2612  C  CA  . SER B  1 40  ? 42.313 -4.328  -29.864 1.00 40.96 ? 20  SER B CA  1 
ATOM   2613  C  C   . SER B  1 40  ? 41.012 -4.490  -29.059 1.00 41.42 ? 20  SER B C   1 
ATOM   2614  O  O   . SER B  1 40  ? 40.299 -5.492  -29.200 1.00 42.54 ? 20  SER B O   1 
ATOM   2615  C  CB  . SER B  1 40  ? 43.370 -5.401  -29.467 1.00 38.71 ? 20  SER B CB  1 
ATOM   2616  O  OG  . SER B  1 40  ? 43.548 -5.467  -28.060 1.00 39.64 ? 20  SER B OG  1 
ATOM   2617  N  N   . ASP B  1 41  ? 40.724 -3.510  -28.200 1.00 40.56 ? 21  ASP B N   1 
ATOM   2618  C  CA  . ASP B  1 41  ? 39.471 -3.446  -27.445 1.00 39.42 ? 21  ASP B CA  1 
ATOM   2619  C  C   . ASP B  1 41  ? 38.273 -2.885  -28.247 1.00 37.91 ? 21  ASP B C   1 
ATOM   2620  O  O   . ASP B  1 41  ? 37.186 -2.779  -27.718 1.00 38.53 ? 21  ASP B O   1 
ATOM   2621  C  CB  . ASP B  1 41  ? 39.659 -2.566  -26.185 1.00 39.11 ? 21  ASP B CB  1 
ATOM   2622  C  CG  . ASP B  1 41  ? 40.705 -3.113  -25.211 1.00 37.27 ? 21  ASP B CG  1 
ATOM   2623  O  OD1 . ASP B  1 41  ? 41.333 -2.291  -24.509 1.00 40.96 ? 21  ASP B OD1 1 
ATOM   2624  O  OD2 . ASP B  1 41  ? 40.891 -4.345  -25.093 1.00 34.84 ? 21  ASP B OD2 1 
ATOM   2625  N  N   . PHE B  1 42  ? 38.501 -2.492  -29.491 1.00 38.29 ? 22  PHE B N   1 
ATOM   2626  C  CA  . PHE B  1 42  ? 37.513 -1.845  -30.348 1.00 41.13 ? 22  PHE B CA  1 
ATOM   2627  C  C   . PHE B  1 42  ? 37.418 -2.643  -31.638 1.00 41.50 ? 22  PHE B C   1 
ATOM   2628  O  O   . PHE B  1 42  ? 38.392 -3.246  -32.060 1.00 42.59 ? 22  PHE B O   1 
ATOM   2629  C  CB  . PHE B  1 42  ? 37.917 -0.392  -30.733 1.00 41.59 ? 22  PHE B CB  1 
ATOM   2630  C  CG  . PHE B  1 42  ? 38.186 0.513   -29.556 1.00 43.80 ? 22  PHE B CG  1 
ATOM   2631  C  CD1 . PHE B  1 42  ? 37.156 1.282   -28.996 1.00 50.07 ? 22  PHE B CD1 1 
ATOM   2632  C  CD2 . PHE B  1 42  ? 39.467 0.638   -29.041 1.00 42.49 ? 22  PHE B CD2 1 
ATOM   2633  C  CE1 . PHE B  1 42  ? 37.398 2.121   -27.916 1.00 48.30 ? 22  PHE B CE1 1 
ATOM   2634  C  CE2 . PHE B  1 42  ? 39.731 1.494   -27.950 1.00 46.54 ? 22  PHE B CE2 1 
ATOM   2635  C  CZ  . PHE B  1 42  ? 38.700 2.239   -27.399 1.00 48.42 ? 22  PHE B CZ  1 
ATOM   2636  N  N   . GLU B  1 43  ? 36.257 -2.618  -32.266 1.00 40.79 ? 23  GLU B N   1 
ATOM   2637  C  CA  . GLU B  1 43  ? 36.045 -3.300  -33.522 1.00 42.65 ? 23  GLU B CA  1 
ATOM   2638  C  C   . GLU B  1 43  ? 35.146 -2.469  -34.435 1.00 40.23 ? 23  GLU B C   1 
ATOM   2639  O  O   . GLU B  1 43  ? 34.100 -2.018  -34.008 1.00 36.34 ? 23  GLU B O   1 
ATOM   2640  C  CB  . GLU B  1 43  ? 35.380 -4.635  -33.270 1.00 43.69 ? 23  GLU B CB  1 
ATOM   2641  C  CG  . GLU B  1 43  ? 35.262 -5.443  -34.553 1.00 49.06 ? 23  GLU B CG  1 
ATOM   2642  C  CD  . GLU B  1 43  ? 34.760 -6.857  -34.349 1.00 50.12 ? 23  GLU B CD  1 
ATOM   2643  O  OE1 . GLU B  1 43  ? 35.041 -7.485  -33.304 1.00 60.00 ? 23  GLU B OE1 1 
ATOM   2644  O  OE2 . GLU B  1 43  ? 34.094 -7.355  -35.279 1.00 71.07 ? 23  GLU B OE2 1 
ATOM   2645  N  N   . LEU B  1 44  ? 35.568 -2.279  -35.681 1.00 40.51 ? 24  LEU B N   1 
ATOM   2646  C  CA  . LEU B  1 44  ? 34.808 -1.510  -36.642 1.00 42.95 ? 24  LEU B CA  1 
ATOM   2647  C  C   . LEU B  1 44  ? 33.951 -2.484  -37.416 1.00 43.92 ? 24  LEU B C   1 
ATOM   2648  O  O   . LEU B  1 44  ? 34.433 -3.503  -37.869 1.00 45.83 ? 24  LEU B O   1 
ATOM   2649  C  CB  . LEU B  1 44  ? 35.744 -0.726  -37.575 1.00 44.43 ? 24  LEU B CB  1 
ATOM   2650  C  CG  . LEU B  1 44  ? 35.167 0.269   -38.609 1.00 41.61 ? 24  LEU B CG  1 
ATOM   2651  C  CD1 . LEU B  1 44  ? 34.482 1.360   -37.934 1.00 42.16 ? 24  LEU B CD1 1 
ATOM   2652  C  CD2 . LEU B  1 44  ? 36.270 0.841   -39.478 1.00 44.52 ? 24  LEU B CD2 1 
ATOM   2653  N  N   . LYS B  1 45  ? 32.668 -2.175  -37.532 1.00 46.65 ? 25  LYS B N   1 
ATOM   2654  C  CA  . LYS B  1 45  ? 31.699 -3.005  -38.257 1.00 48.70 ? 25  LYS B CA  1 
ATOM   2655  C  C   . LYS B  1 45  ? 30.972 -2.170  -39.308 1.00 47.56 ? 25  LYS B C   1 
ATOM   2656  O  O   . LYS B  1 45  ? 30.728 -0.998  -39.087 1.00 45.66 ? 25  LYS B O   1 
ATOM   2657  C  CB  . LYS B  1 45  ? 30.684 -3.602  -37.272 1.00 46.79 ? 25  LYS B CB  1 
ATOM   2658  C  CG  . LYS B  1 45  ? 31.312 -4.533  -36.258 1.00 51.58 ? 25  LYS B CG  1 
ATOM   2659  C  CD  . LYS B  1 45  ? 30.280 -5.302  -35.429 1.00 53.39 ? 25  LYS B CD  1 
ATOM   2660  C  CE  . LYS B  1 45  ? 30.943 -6.253  -34.404 1.00 58.00 ? 25  LYS B CE  1 
ATOM   2661  N  NZ  . LYS B  1 45  ? 30.168 -6.363  -33.099 1.00 63.41 ? 25  LYS B NZ  1 
ATOM   2662  N  N   . THR B  1 46  ? 30.662 -2.781  -40.449 1.00 50.16 ? 26  THR B N   1 
ATOM   2663  C  CA  . THR B  1 46  ? 29.797 -2.189  -41.479 1.00 52.47 ? 26  THR B CA  1 
ATOM   2664  C  C   . THR B  1 46  ? 28.423 -2.864  -41.453 1.00 53.02 ? 26  THR B C   1 
ATOM   2665  O  O   . THR B  1 46  ? 28.306 -4.089  -41.356 1.00 53.54 ? 26  THR B O   1 
ATOM   2666  C  CB  . THR B  1 46  ? 30.369 -2.345  -42.891 1.00 52.93 ? 26  THR B CB  1 
ATOM   2667  O  OG1 . THR B  1 46  ? 31.769 -2.082  -42.876 1.00 56.95 ? 26  THR B OG1 1 
ATOM   2668  C  CG2 . THR B  1 46  ? 29.714 -1.358  -43.840 1.00 58.61 ? 26  THR B CG2 1 
ATOM   2669  N  N   . SER B  1 47  ? 27.394 -2.044  -41.587 1.00 54.59 ? 27  SER B N   1 
ATOM   2670  C  CA  . SER B  1 47  ? 26.009 -2.430  -41.335 1.00 54.79 ? 27  SER B CA  1 
ATOM   2671  C  C   . SER B  1 47  ? 25.140 -1.726  -42.391 1.00 54.36 ? 27  SER B C   1 
ATOM   2672  O  O   . SER B  1 47  ? 25.441 -0.595  -42.765 1.00 55.01 ? 27  SER B O   1 
ATOM   2673  C  CB  . SER B  1 47  ? 25.673 -1.989  -39.897 1.00 54.74 ? 27  SER B CB  1 
ATOM   2674  O  OG  . SER B  1 47  ? 24.317 -2.138  -39.559 1.00 57.42 ? 27  SER B OG  1 
ATOM   2675  N  N   . GLU B  1 48  ? 24.120 -2.397  -42.925 1.00 55.06 ? 28  GLU B N   1 
ATOM   2676  C  CA  . GLU B  1 48  ? 23.152 -1.726  -43.824 1.00 55.12 ? 28  GLU B CA  1 
ATOM   2677  C  C   . GLU B  1 48  ? 22.041 -1.118  -42.970 1.00 55.28 ? 28  GLU B C   1 
ATOM   2678  O  O   . GLU B  1 48  ? 21.650 -1.681  -41.933 1.00 54.55 ? 28  GLU B O   1 
ATOM   2679  C  CB  . GLU B  1 48  ? 22.562 -2.680  -44.880 1.00 55.21 ? 28  GLU B CB  1 
ATOM   2680  N  N   . LEU B  1 49  ? 21.547 0.045   -43.382 1.00 55.96 ? 29  LEU B N   1 
ATOM   2681  C  CA  . LEU B  1 49  ? 20.455 0.706   -42.646 1.00 54.89 ? 29  LEU B CA  1 
ATOM   2682  C  C   . LEU B  1 49  ? 19.095 0.512   -43.334 1.00 54.31 ? 29  LEU B C   1 
ATOM   2683  O  O   . LEU B  1 49  ? 19.002 0.457   -44.573 1.00 53.04 ? 29  LEU B O   1 
ATOM   2684  C  CB  . LEU B  1 49  ? 20.740 2.198   -42.439 1.00 54.59 ? 29  LEU B CB  1 
ATOM   2685  C  CG  . LEU B  1 49  ? 21.847 2.550   -41.444 1.00 51.85 ? 29  LEU B CG  1 
ATOM   2686  C  CD1 . LEU B  1 49  ? 22.178 4.028   -41.557 1.00 56.34 ? 29  LEU B CD1 1 
ATOM   2687  C  CD2 . LEU B  1 49  ? 21.484 2.173   -40.009 1.00 45.62 ? 29  LEU B CD2 1 
ATOM   2688  N  N   . PRO B  1 50  ? 18.029 0.410   -42.518 1.00 53.98 ? 30  PRO B N   1 
ATOM   2689  C  CA  . PRO B  1 50  ? 16.715 0.239   -43.101 1.00 53.28 ? 30  PRO B CA  1 
ATOM   2690  C  C   . PRO B  1 50  ? 16.282 1.502   -43.855 1.00 54.28 ? 30  PRO B C   1 
ATOM   2691  O  O   . PRO B  1 50  ? 16.831 2.596   -43.620 1.00 52.56 ? 30  PRO B O   1 
ATOM   2692  C  CB  . PRO B  1 50  ? 15.826 -0.027  -41.887 1.00 52.94 ? 30  PRO B CB  1 
ATOM   2693  C  CG  . PRO B  1 50  ? 16.529 0.580   -40.728 1.00 52.67 ? 30  PRO B CG  1 
ATOM   2694  C  CD  . PRO B  1 50  ? 17.990 0.471   -41.039 1.00 53.70 ? 30  PRO B CD  1 
ATOM   2695  N  N   . PRO B  1 51  ? 15.354 1.352   -44.812 1.00 55.86 ? 31  PRO B N   1 
ATOM   2696  C  CA  . PRO B  1 51  ? 14.661 2.552   -45.319 1.00 56.10 ? 31  PRO B CA  1 
ATOM   2697  C  C   . PRO B  1 51  ? 13.898 3.311   -44.219 1.00 54.75 ? 31  PRO B C   1 
ATOM   2698  O  O   . PRO B  1 51  ? 13.467 2.721   -43.212 1.00 54.42 ? 31  PRO B O   1 
ATOM   2699  C  CB  . PRO B  1 51  ? 13.728 1.993   -46.415 1.00 56.14 ? 31  PRO B CB  1 
ATOM   2700  C  CG  . PRO B  1 51  ? 14.423 0.705   -46.867 1.00 56.86 ? 31  PRO B CG  1 
ATOM   2701  C  CD  . PRO B  1 51  ? 14.959 0.138   -45.551 1.00 56.76 ? 31  PRO B CD  1 
ATOM   2702  N  N   . LEU B  1 52  ? 13.770 4.621   -44.407 1.00 53.70 ? 32  LEU B N   1 
ATOM   2703  C  CA  . LEU B  1 52  ? 13.119 5.474   -43.411 1.00 52.10 ? 32  LEU B CA  1 
ATOM   2704  C  C   . LEU B  1 52  ? 11.622 5.218   -43.412 1.00 50.17 ? 32  LEU B C   1 
ATOM   2705  O  O   . LEU B  1 52  ? 11.018 5.120   -44.464 1.00 51.56 ? 32  LEU B O   1 
ATOM   2706  C  CB  . LEU B  1 52  ? 13.366 6.968   -43.696 1.00 51.97 ? 32  LEU B CB  1 
ATOM   2707  C  CG  . LEU B  1 52  ? 14.771 7.560   -43.882 1.00 47.36 ? 32  LEU B CG  1 
ATOM   2708  C  CD1 . LEU B  1 52  ? 14.666 8.996   -44.397 1.00 42.02 ? 32  LEU B CD1 1 
ATOM   2709  C  CD2 . LEU B  1 52  ? 15.589 7.507   -42.609 1.00 47.56 ? 32  LEU B CD2 1 
ATOM   2710  N  N   . LYS B  1 53  ? 11.051 5.079   -42.223 1.00 50.52 ? 33  LYS B N   1 
ATOM   2711  C  CA  . LYS B  1 53  ? 9.599  5.149   -42.000 1.00 51.55 ? 33  LYS B CA  1 
ATOM   2712  C  C   . LYS B  1 53  ? 9.176  6.647   -41.978 1.00 51.67 ? 33  LYS B C   1 
ATOM   2713  O  O   . LYS B  1 53  ? 10.045 7.524   -41.956 1.00 52.91 ? 33  LYS B O   1 
ATOM   2714  C  CB  . LYS B  1 53  ? 9.246  4.454   -40.661 1.00 51.63 ? 33  LYS B CB  1 
ATOM   2715  C  CG  . LYS B  1 53  ? 9.633  2.950   -40.595 1.00 52.72 ? 33  LYS B CG  1 
ATOM   2716  C  CD  . LYS B  1 53  ? 9.763  2.430   -39.153 1.00 50.50 ? 33  LYS B CD  1 
ATOM   2717  N  N   . ASN B  1 54  ? 7.871  6.946   -41.997 1.00 51.27 ? 34  ASN B N   1 
ATOM   2718  C  CA  . ASN B  1 54  ? 7.395  8.345   -41.869 1.00 49.22 ? 34  ASN B CA  1 
ATOM   2719  C  C   . ASN B  1 54  ? 7.815  8.979   -40.537 1.00 46.53 ? 34  ASN B C   1 
ATOM   2720  O  O   . ASN B  1 54  ? 7.617  8.386   -39.482 1.00 44.61 ? 34  ASN B O   1 
ATOM   2721  C  CB  . ASN B  1 54  ? 5.864  8.443   -41.997 1.00 46.86 ? 34  ASN B CB  1 
ATOM   2722  C  CG  . ASN B  1 54  ? 5.398  8.572   -43.419 1.00 48.82 ? 34  ASN B CG  1 
ATOM   2723  O  OD1 . ASN B  1 54  ? 6.088  9.112   -44.289 1.00 51.96 ? 34  ASN B OD1 1 
ATOM   2724  N  ND2 . ASN B  1 54  ? 4.198  8.074   -43.672 1.00 54.24 ? 34  ASN B ND2 1 
ATOM   2725  N  N   . GLY B  1 55  ? 8.374  10.189  -40.602 1.00 45.54 ? 35  GLY B N   1 
ATOM   2726  C  CA  . GLY B  1 55  ? 8.771  10.949  -39.410 1.00 44.72 ? 35  GLY B CA  1 
ATOM   2727  C  C   . GLY B  1 55  ? 10.227 10.763  -39.021 1.00 45.48 ? 35  GLY B C   1 
ATOM   2728  O  O   . GLY B  1 55  ? 10.713 11.409  -38.078 1.00 43.87 ? 35  GLY B O   1 
ATOM   2729  N  N   . GLU B  1 56  ? 10.914 9.887   -39.763 1.00 44.66 ? 36  GLU B N   1 
ATOM   2730  C  CA  . GLU B  1 56  ? 12.318 9.588   -39.547 1.00 44.29 ? 36  GLU B CA  1 
ATOM   2731  C  C   . GLU B  1 56  ? 13.239 10.381  -40.465 1.00 41.31 ? 36  GLU B C   1 
ATOM   2732  O  O   . GLU B  1 56  ? 12.835 10.855  -41.532 1.00 38.69 ? 36  GLU B O   1 
ATOM   2733  C  CB  . GLU B  1 56  ? 12.585 8.087   -39.746 1.00 46.02 ? 36  GLU B CB  1 
ATOM   2734  C  CG  . GLU B  1 56  ? 12.171 7.179   -38.558 1.00 48.76 ? 36  GLU B CG  1 
ATOM   2735  C  CD  . GLU B  1 56  ? 12.285 5.667   -38.866 1.00 49.42 ? 36  GLU B CD  1 
ATOM   2736  O  OE1 . GLU B  1 56  ? 12.820 5.258   -39.937 1.00 47.28 ? 36  GLU B OE1 1 
ATOM   2737  O  OE2 . GLU B  1 56  ? 11.821 4.875   -38.021 1.00 61.26 ? 36  GLU B OE2 1 
ATOM   2738  N  N   . VAL B  1 57  ? 14.499 10.498  -40.035 1.00 40.47 ? 37  VAL B N   1 
ATOM   2739  C  CA  . VAL B  1 57  ? 15.567 11.124  -40.836 1.00 37.71 ? 37  VAL B CA  1 
ATOM   2740  C  C   . VAL B  1 57  ? 16.848 10.315  -40.803 1.00 38.14 ? 37  VAL B C   1 
ATOM   2741  O  O   . VAL B  1 57  ? 17.145 9.633   -39.817 1.00 38.72 ? 37  VAL B O   1 
ATOM   2742  C  CB  . VAL B  1 57  ? 15.877 12.544  -40.371 1.00 36.21 ? 37  VAL B CB  1 
ATOM   2743  C  CG1 . VAL B  1 57  ? 14.615 13.420  -40.463 1.00 37.09 ? 37  VAL B CG1 1 
ATOM   2744  C  CG2 . VAL B  1 57  ? 16.478 12.548  -38.939 1.00 41.98 ? 37  VAL B CG2 1 
ATOM   2745  N  N   . LEU B  1 58  ? 17.614 10.408  -41.885 1.00 40.05 ? 38  LEU B N   1 
ATOM   2746  C  CA  . LEU B  1 58  ? 18.959 9.833   -41.943 1.00 41.59 ? 38  LEU B CA  1 
ATOM   2747  C  C   . LEU B  1 58  ? 19.973 10.916  -41.614 1.00 40.72 ? 38  LEU B C   1 
ATOM   2748  O  O   . LEU B  1 58  ? 20.007 11.962  -42.264 1.00 40.45 ? 38  LEU B O   1 
ATOM   2749  C  CB  . LEU B  1 58  ? 19.250 9.241   -43.325 1.00 40.56 ? 38  LEU B CB  1 
ATOM   2750  C  CG  . LEU B  1 58  ? 20.534 8.413   -43.415 1.00 44.05 ? 38  LEU B CG  1 
ATOM   2751  C  CD1 . LEU B  1 58  ? 20.454 7.135   -42.585 1.00 42.45 ? 38  LEU B CD1 1 
ATOM   2752  C  CD2 . LEU B  1 58  ? 20.800 8.106   -44.899 1.00 47.49 ? 38  LEU B CD2 1 
ATOM   2753  N  N   . LEU B  1 59  ? 20.783 10.656  -40.592 1.00 42.23 ? 39  LEU B N   1 
ATOM   2754  C  CA  . LEU B  1 59  ? 21.837 11.567  -40.160 1.00 42.40 ? 39  LEU B CA  1 
ATOM   2755  C  C   . LEU B  1 59  ? 23.188 11.090  -40.625 1.00 42.33 ? 39  LEU B C   1 
ATOM   2756  O  O   . LEU B  1 59  ? 23.527 9.935   -40.413 1.00 42.03 ? 39  LEU B O   1 
ATOM   2757  C  CB  . LEU B  1 59  ? 21.865 11.660  -38.643 1.00 44.10 ? 39  LEU B CB  1 
ATOM   2758  C  CG  . LEU B  1 59  ? 20.562 12.113  -37.987 1.00 44.45 ? 39  LEU B CG  1 
ATOM   2759  C  CD1 . LEU B  1 59  ? 20.834 12.325  -36.499 1.00 46.38 ? 39  LEU B CD1 1 
ATOM   2760  C  CD2 . LEU B  1 59  ? 20.050 13.369  -38.665 1.00 46.15 ? 39  LEU B CD2 1 
ATOM   2761  N  N   . GLU B  1 60  ? 23.933 11.977  -41.281 1.00 42.95 ? 40  GLU B N   1 
ATOM   2762  C  CA  . GLU B  1 60  ? 25.340 11.772  -41.542 1.00 46.62 ? 40  GLU B CA  1 
ATOM   2763  C  C   . GLU B  1 60  ? 26.180 12.560  -40.534 1.00 42.36 ? 40  GLU B C   1 
ATOM   2764  O  O   . GLU B  1 60  ? 26.021 13.756  -40.416 1.00 41.68 ? 40  GLU B O   1 
ATOM   2765  C  CB  . GLU B  1 60  ? 25.670 12.273  -42.938 1.00 48.94 ? 40  GLU B CB  1 
ATOM   2766  C  CG  . GLU B  1 60  ? 27.052 11.866  -43.408 1.00 53.53 ? 40  GLU B CG  1 
ATOM   2767  C  CD  . GLU B  1 60  ? 27.521 12.630  -44.662 1.00 56.67 ? 40  GLU B CD  1 
ATOM   2768  O  OE1 . GLU B  1 60  ? 28.484 12.126  -45.300 1.00 73.02 ? 40  GLU B OE1 1 
ATOM   2769  O  OE2 . GLU B  1 60  ? 26.957 13.714  -45.000 1.00 57.30 ? 40  GLU B OE2 1 
ATOM   2770  N  N   . ALA B  1 61  ? 27.094 11.888  -39.852 1.00 42.55 ? 41  ALA B N   1 
ATOM   2771  C  CA  . ALA B  1 61  ? 28.048 12.542  -38.941 1.00 42.81 ? 41  ALA B CA  1 
ATOM   2772  C  C   . ALA B  1 61  ? 29.022 13.430  -39.685 1.00 42.82 ? 41  ALA B C   1 
ATOM   2773  O  O   . ALA B  1 61  ? 29.625 13.019  -40.687 1.00 43.85 ? 41  ALA B O   1 
ATOM   2774  C  CB  . ALA B  1 61  ? 28.820 11.515  -38.130 1.00 42.55 ? 41  ALA B CB  1 
ATOM   2775  N  N   . LEU B  1 62  ? 29.157 14.643  -39.156 1.00 42.83 ? 42  LEU B N   1 
ATOM   2776  C  CA  . LEU B  1 62  ? 30.097 15.662  -39.610 1.00 42.21 ? 42  LEU B CA  1 
ATOM   2777  C  C   . LEU B  1 62  ? 31.272 15.759  -38.622 1.00 40.92 ? 42  LEU B C   1 
ATOM   2778  O  O   . LEU B  1 62  ? 32.428 15.764  -39.023 1.00 42.14 ? 42  LEU B O   1 
ATOM   2779  C  CB  . LEU B  1 62  ? 29.385 17.029  -39.685 1.00 43.43 ? 42  LEU B CB  1 
ATOM   2780  C  CG  . LEU B  1 62  ? 28.268 17.291  -40.691 1.00 40.46 ? 42  LEU B CG  1 
ATOM   2781  C  CD1 . LEU B  1 62  ? 27.729 18.703  -40.498 1.00 45.58 ? 42  LEU B CD1 1 
ATOM   2782  C  CD2 . LEU B  1 62  ? 28.807 17.136  -42.108 1.00 38.08 ? 42  LEU B CD2 1 
ATOM   2783  N  N   . PHE B  1 63  ? 30.951 15.843  -37.331 1.00 42.11 ? 43  PHE B N   1 
ATOM   2784  C  CA  . PHE B  1 63  ? 31.925 15.950  -36.253 1.00 40.57 ? 43  PHE B CA  1 
ATOM   2785  C  C   . PHE B  1 63  ? 31.456 15.066  -35.129 1.00 41.24 ? 43  PHE B C   1 
ATOM   2786  O  O   . PHE B  1 63  ? 30.338 15.183  -34.676 1.00 42.98 ? 43  PHE B O   1 
ATOM   2787  C  CB  . PHE B  1 63  ? 32.066 17.401  -35.744 1.00 38.41 ? 43  PHE B CB  1 
ATOM   2788  C  CG  . PHE B  1 63  ? 32.535 18.386  -36.809 1.00 42.64 ? 43  PHE B CG  1 
ATOM   2789  C  CD1 . PHE B  1 63  ? 33.878 18.397  -37.225 1.00 43.02 ? 43  PHE B CD1 1 
ATOM   2790  C  CD2 . PHE B  1 63  ? 31.643 19.297  -37.387 1.00 38.21 ? 43  PHE B CD2 1 
ATOM   2791  C  CE1 . PHE B  1 63  ? 34.321 19.252  -38.211 1.00 34.30 ? 43  PHE B CE1 1 
ATOM   2792  C  CE2 . PHE B  1 63  ? 32.083 20.167  -38.385 1.00 46.51 ? 43  PHE B CE2 1 
ATOM   2793  C  CZ  . PHE B  1 63  ? 33.425 20.146  -38.803 1.00 39.91 ? 43  PHE B CZ  1 
ATOM   2794  N  N   . LEU B  1 64  ? 32.324 14.179  -34.667 1.00 44.81 ? 44  LEU B N   1 
ATOM   2795  C  CA  . LEU B  1 64  ? 32.040 13.341  -33.486 1.00 42.63 ? 44  LEU B CA  1 
ATOM   2796  C  C   . LEU B  1 64  ? 32.974 13.762  -32.386 1.00 42.74 ? 44  LEU B C   1 
ATOM   2797  O  O   . LEU B  1 64  ? 34.114 14.160  -32.643 1.00 43.44 ? 44  LEU B O   1 
ATOM   2798  C  CB  . LEU B  1 64  ? 32.259 11.854  -33.783 1.00 40.58 ? 44  LEU B CB  1 
ATOM   2799  C  CG  . LEU B  1 64  ? 31.470 11.293  -34.958 1.00 41.50 ? 44  LEU B CG  1 
ATOM   2800  C  CD1 . LEU B  1 64  ? 32.287 11.319  -36.261 1.00 48.20 ? 44  LEU B CD1 1 
ATOM   2801  C  CD2 . LEU B  1 64  ? 31.002 9.892   -34.647 1.00 45.67 ? 44  LEU B CD2 1 
ATOM   2802  N  N   . THR B  1 65  ? 32.492 13.650  -31.156 1.00 45.31 ? 45  THR B N   1 
ATOM   2803  C  CA  . THR B  1 65  ? 33.320 13.923  -29.973 1.00 46.51 ? 45  THR B CA  1 
ATOM   2804  C  C   . THR B  1 65  ? 33.814 12.650  -29.263 1.00 43.42 ? 45  THR B C   1 
ATOM   2805  O  O   . THR B  1 65  ? 33.150 11.620  -29.263 1.00 40.14 ? 45  THR B O   1 
ATOM   2806  C  CB  . THR B  1 65  ? 32.557 14.850  -28.963 1.00 45.35 ? 45  THR B CB  1 
ATOM   2807  O  OG1 . THR B  1 65  ? 33.401 15.213  -27.868 1.00 56.02 ? 45  THR B OG1 1 
ATOM   2808  C  CG2 . THR B  1 65  ? 31.314 14.228  -28.459 1.00 45.88 ? 45  THR B CG2 1 
ATOM   2809  N  N   . VAL B  1 66  ? 34.987 12.782  -28.656 1.00 43.39 ? 46  VAL B N   1 
ATOM   2810  C  CA  . VAL B  1 66  ? 35.449 11.912  -27.547 1.00 44.32 ? 46  VAL B CA  1 
ATOM   2811  C  C   . VAL B  1 66  ? 35.671 12.710  -26.242 1.00 43.43 ? 46  VAL B C   1 
ATOM   2812  O  O   . VAL B  1 66  ? 36.198 13.845  -26.234 1.00 43.82 ? 46  VAL B O   1 
ATOM   2813  C  CB  . VAL B  1 66  ? 36.736 11.132  -27.938 1.00 44.79 ? 46  VAL B CB  1 
ATOM   2814  C  CG1 . VAL B  1 66  ? 36.382 10.135  -29.073 1.00 42.15 ? 46  VAL B CG1 1 
ATOM   2815  C  CG2 . VAL B  1 66  ? 37.918 12.111  -28.324 1.00 38.77 ? 46  VAL B CG2 1 
ATOM   2816  N  N   . ASP B  1 67  ? 35.282 12.082  -25.147 1.00 45.99 ? 47  ASP B N   1 
ATOM   2817  C  CA  . ASP B  1 67  ? 35.150 12.716  -23.813 1.00 48.46 ? 47  ASP B CA  1 
ATOM   2818  C  C   . ASP B  1 67  ? 35.528 11.691  -22.711 1.00 45.45 ? 47  ASP B C   1 
ATOM   2819  O  O   . ASP B  1 67  ? 35.230 10.512  -22.854 1.00 43.41 ? 47  ASP B O   1 
ATOM   2820  C  CB  . ASP B  1 67  ? 33.705 13.128  -23.581 1.00 51.56 ? 47  ASP B CB  1 
ATOM   2821  C  CG  . ASP B  1 67  ? 33.203 14.181  -24.584 1.00 58.39 ? 47  ASP B CG  1 
ATOM   2822  O  OD1 . ASP B  1 67  ? 32.374 13.785  -25.450 1.00 52.28 ? 47  ASP B OD1 1 
ATOM   2823  O  OD2 . ASP B  1 67  ? 33.610 15.380  -24.475 1.00 63.80 ? 47  ASP B OD2 1 
ATOM   2824  N  N   . PRO B  1 68  ? 36.200 12.141  -21.634 1.00 46.20 ? 48  PRO B N   1 
ATOM   2825  C  CA  . PRO B  1 68  ? 36.644 11.290  -20.526 1.00 49.06 ? 48  PRO B CA  1 
ATOM   2826  C  C   . PRO B  1 68  ? 35.613 10.343  -19.940 1.00 46.42 ? 48  PRO B C   1 
ATOM   2827  O  O   . PRO B  1 68  ? 35.957 9.235   -19.578 1.00 52.55 ? 48  PRO B O   1 
ATOM   2828  C  CB  . PRO B  1 68  ? 37.104 12.302  -19.467 1.00 49.89 ? 48  PRO B CB  1 
ATOM   2829  C  CG  . PRO B  1 68  ? 37.521 13.473  -20.218 1.00 47.60 ? 48  PRO B CG  1 
ATOM   2830  C  CD  . PRO B  1 68  ? 36.696 13.523  -21.469 1.00 49.72 ? 48  PRO B CD  1 
ATOM   2831  N  N   . TYR B  1 69  ? 34.369 10.785  -19.854 1.00 48.31 ? 49  TYR B N   1 
ATOM   2832  C  CA  . TYR B  1 69  ? 33.287 10.011  -19.260 1.00 46.84 ? 49  TYR B CA  1 
ATOM   2833  C  C   . TYR B  1 69  ? 33.032 8.719   -20.013 1.00 43.84 ? 49  TYR B C   1 
ATOM   2834  O  O   . TYR B  1 69  ? 32.527 7.782   -19.431 1.00 45.21 ? 49  TYR B O   1 
ATOM   2835  C  CB  . TYR B  1 69  ? 31.974 10.849  -19.171 1.00 49.03 ? 49  TYR B CB  1 
ATOM   2836  C  CG  . TYR B  1 69  ? 31.201 10.936  -20.494 1.00 50.40 ? 49  TYR B CG  1 
ATOM   2837  C  CD1 . TYR B  1 69  ? 30.363 9.900   -20.893 1.00 49.90 ? 49  TYR B CD1 1 
ATOM   2838  C  CD2 . TYR B  1 69  ? 31.347 12.030  -21.349 1.00 52.90 ? 49  TYR B CD2 1 
ATOM   2839  C  CE1 . TYR B  1 69  ? 29.696 9.937   -22.094 1.00 43.94 ? 49  TYR B CE1 1 
ATOM   2840  C  CE2 . TYR B  1 69  ? 30.672 12.081  -22.542 1.00 49.30 ? 49  TYR B CE2 1 
ATOM   2841  C  CZ  . TYR B  1 69  ? 29.847 11.025  -22.913 1.00 50.44 ? 49  TYR B CZ  1 
ATOM   2842  O  OH  . TYR B  1 69  ? 29.156 11.039  -24.122 1.00 53.47 ? 49  TYR B OH  1 
ATOM   2843  N  N   . MET B  1 70  ? 33.311 8.696   -21.316 1.00 43.71 ? 50  MET B N   1 
ATOM   2844  C  CA  . MET B  1 70  ? 33.197 7.459   -22.116 1.00 44.64 ? 50  MET B CA  1 
ATOM   2845  C  C   . MET B  1 70  ? 34.029 6.263   -21.575 1.00 44.98 ? 50  MET B C   1 
ATOM   2846  O  O   . MET B  1 70  ? 33.688 5.103   -21.806 1.00 45.35 ? 50  MET B O   1 
ATOM   2847  C  CB  . MET B  1 70  ? 33.614 7.731   -23.548 1.00 43.96 ? 50  MET B CB  1 
ATOM   2848  C  CG  . MET B  1 70  ? 32.733 8.709   -24.242 1.00 43.94 ? 50  MET B CG  1 
ATOM   2849  S  SD  . MET B  1 70  ? 33.257 9.061   -25.922 1.00 44.65 ? 50  MET B SD  1 
ATOM   2850  C  CE  . MET B  1 70  ? 32.085 10.350  -26.410 1.00 51.03 ? 50  MET B CE  1 
ATOM   2851  N  N   . ARG B  1 71  ? 35.114 6.552   -20.864 1.00 42.05 ? 51  ARG B N   1 
ATOM   2852  C  CA  . ARG B  1 71  ? 35.888 5.512   -20.233 1.00 43.28 ? 51  ARG B CA  1 
ATOM   2853  C  C   . ARG B  1 71  ? 35.068 4.781   -19.165 1.00 43.81 ? 51  ARG B C   1 
ATOM   2854  O  O   . ARG B  1 71  ? 35.128 3.554   -19.049 1.00 43.16 ? 51  ARG B O   1 
ATOM   2855  C  CB  . ARG B  1 71  ? 37.138 6.117   -19.609 1.00 39.56 ? 51  ARG B CB  1 
ATOM   2856  C  CG  . ARG B  1 71  ? 38.012 5.132   -18.916 1.00 37.44 ? 51  ARG B CG  1 
ATOM   2857  C  CD  . ARG B  1 71  ? 38.437 3.971   -19.826 1.00 35.36 ? 51  ARG B CD  1 
ATOM   2858  N  NE  . ARG B  1 71  ? 39.234 2.996   -19.107 1.00 32.18 ? 51  ARG B NE  1 
ATOM   2859  C  CZ  . ARG B  1 71  ? 38.711 2.006   -18.393 1.00 41.05 ? 51  ARG B CZ  1 
ATOM   2860  N  NH1 . ARG B  1 71  ? 37.406 1.828   -18.312 1.00 46.96 ? 51  ARG B NH1 1 
ATOM   2861  N  NH2 . ARG B  1 71  ? 39.491 1.163   -17.769 1.00 35.71 ? 51  ARG B NH2 1 
ATOM   2862  N  N   . VAL B  1 72  ? 34.313 5.571   -18.401 1.00 45.95 ? 52  VAL B N   1 
ATOM   2863  C  CA  . VAL B  1 72  ? 33.475 5.096   -17.289 1.00 46.66 ? 52  VAL B CA  1 
ATOM   2864  C  C   . VAL B  1 72  ? 32.232 4.469   -17.842 1.00 43.37 ? 52  VAL B C   1 
ATOM   2865  O  O   . VAL B  1 72  ? 31.857 3.397   -17.464 1.00 46.11 ? 52  VAL B O   1 
ATOM   2866  C  CB  . VAL B  1 72  ? 33.039 6.271   -16.332 1.00 47.77 ? 52  VAL B CB  1 
ATOM   2867  C  CG1 . VAL B  1 72  ? 32.021 5.780   -15.291 1.00 53.86 ? 52  VAL B CG1 1 
ATOM   2868  C  CG2 . VAL B  1 72  ? 34.184 6.835   -15.637 1.00 47.89 ? 52  VAL B CG2 1 
ATOM   2869  N  N   . ALA B  1 73  ? 31.584 5.173   -18.749 1.00 46.50 ? 53  ALA B N   1 
ATOM   2870  C  CA  . ALA B  1 73  ? 30.316 4.725   -19.303 1.00 47.68 ? 53  ALA B CA  1 
ATOM   2871  C  C   . ALA B  1 73  ? 30.440 3.382   -20.020 1.00 48.02 ? 53  ALA B C   1 
ATOM   2872  O  O   . ALA B  1 73  ? 29.507 2.577   -20.020 1.00 48.39 ? 53  ALA B O   1 
ATOM   2873  C  CB  . ALA B  1 73  ? 29.758 5.800   -20.231 1.00 46.45 ? 53  ALA B CB  1 
ATOM   2874  N  N   . ALA B  1 74  ? 31.602 3.162   -20.641 1.00 49.34 ? 54  ALA B N   1 
ATOM   2875  C  CA  . ALA B  1 74  ? 31.866 1.968   -21.436 1.00 47.63 ? 54  ALA B CA  1 
ATOM   2876  C  C   . ALA B  1 74  ? 31.904 0.723   -20.575 1.00 47.99 ? 54  ALA B C   1 
ATOM   2877  O  O   . ALA B  1 74  ? 31.703 -0.393  -21.080 1.00 47.41 ? 54  ALA B O   1 
ATOM   2878  C  CB  . ALA B  1 74  ? 33.152 2.121   -22.198 1.00 48.75 ? 54  ALA B CB  1 
ATOM   2879  N  N   . LYS B  1 75  ? 32.157 0.907   -19.277 1.00 49.74 ? 55  LYS B N   1 
ATOM   2880  C  CA  . LYS B  1 75  ? 32.067 -0.183  -18.314 1.00 51.21 ? 55  LYS B CA  1 
ATOM   2881  C  C   . LYS B  1 75  ? 30.659 -0.778  -18.198 1.00 52.38 ? 55  LYS B C   1 
ATOM   2882  O  O   . LYS B  1 75  ? 30.509 -1.879  -17.686 1.00 54.69 ? 55  LYS B O   1 
ATOM   2883  C  CB  . LYS B  1 75  ? 32.518 0.295   -16.942 1.00 52.08 ? 55  LYS B CB  1 
ATOM   2884  C  CG  . LYS B  1 75  ? 33.999 0.330   -16.763 1.00 56.20 ? 55  LYS B CG  1 
ATOM   2885  C  CD  . LYS B  1 75  ? 34.489 1.524   -15.951 1.00 65.02 ? 55  LYS B CD  1 
ATOM   2886  C  CE  . LYS B  1 75  ? 34.041 1.503   -14.513 1.00 67.11 ? 55  LYS B CE  1 
ATOM   2887  N  NZ  . LYS B  1 75  ? 34.610 0.344   -13.802 1.00 71.91 ? 55  LYS B NZ  1 
ATOM   2888  N  N   . ARG B  1 76  ? 29.636 -0.040  -18.646 1.00 54.46 ? 56  ARG B N   1 
ATOM   2889  C  CA  . ARG B  1 76  ? 28.230 -0.467  -18.571 1.00 54.83 ? 56  ARG B CA  1 
ATOM   2890  C  C   . ARG B  1 76  ? 27.748 -1.151  -19.854 1.00 54.14 ? 56  ARG B C   1 
ATOM   2891  O  O   . ARG B  1 76  ? 26.621 -1.659  -19.900 1.00 57.49 ? 56  ARG B O   1 
ATOM   2892  C  CB  . ARG B  1 76  ? 27.335 0.728   -18.198 1.00 57.30 ? 56  ARG B CB  1 
ATOM   2893  C  CG  . ARG B  1 76  ? 27.045 0.884   -16.648 1.00 62.07 ? 56  ARG B CG  1 
ATOM   2894  C  CD  . ARG B  1 76  ? 27.200 2.321   -16.069 1.00 66.69 ? 56  ARG B CD  1 
ATOM   2895  N  NE  . ARG B  1 76  ? 26.966 3.415   -17.035 1.00 78.20 ? 56  ARG B NE  1 
ATOM   2896  C  CZ  . ARG B  1 76  ? 27.423 4.684   -16.929 1.00 83.34 ? 56  ARG B CZ  1 
ATOM   2897  N  NH1 . ARG B  1 76  ? 28.155 5.121   -15.882 1.00 78.12 ? 56  ARG B NH1 1 
ATOM   2898  N  NH2 . ARG B  1 76  ? 27.136 5.551   -17.906 1.00 83.54 ? 56  ARG B NH2 1 
ATOM   2899  N  N   . LEU B  1 77  ? 28.607 -1.197  -20.881 1.00 52.47 ? 57  LEU B N   1 
ATOM   2900  C  CA  . LEU B  1 77  ? 28.280 -1.815  -22.169 1.00 50.10 ? 57  LEU B CA  1 
ATOM   2901  C  C   . LEU B  1 77  ? 28.472 -3.354  -22.118 1.00 47.82 ? 57  LEU B C   1 
ATOM   2902  O  O   . LEU B  1 77  ? 29.183 -3.863  -21.283 1.00 48.63 ? 57  LEU B O   1 
ATOM   2903  C  CB  . LEU B  1 77  ? 29.126 -1.206  -23.295 1.00 48.23 ? 57  LEU B CB  1 
ATOM   2904  C  CG  . LEU B  1 77  ? 29.018 0.285   -23.643 1.00 53.50 ? 57  LEU B CG  1 
ATOM   2905  C  CD1 . LEU B  1 77  ? 29.969 0.724   -24.809 1.00 49.64 ? 57  LEU B CD1 1 
ATOM   2906  C  CD2 . LEU B  1 77  ? 27.574 0.689   -23.962 1.00 54.38 ? 57  LEU B CD2 1 
ATOM   2907  N  N   . LYS B  1 78  ? 27.754 -4.074  -22.967 1.00 47.91 ? 58  LYS B N   1 
ATOM   2908  C  CA  . LYS B  1 78  ? 28.010 -5.464  -23.216 1.00 49.16 ? 58  LYS B CA  1 
ATOM   2909  C  C   . LYS B  1 78  ? 28.922 -5.427  -24.446 1.00 50.59 ? 58  LYS B C   1 
ATOM   2910  O  O   . LYS B  1 78  ? 28.834 -4.515  -25.285 1.00 50.27 ? 58  LYS B O   1 
ATOM   2911  C  CB  . LYS B  1 78  ? 26.717 -6.255  -23.462 1.00 48.61 ? 58  LYS B CB  1 
ATOM   2912  C  CG  . LYS B  1 78  ? 25.617 -5.981  -22.440 1.00 49.44 ? 58  LYS B CG  1 
ATOM   2913  N  N   . GLU B  1 79  ? 29.841 -6.383  -24.512 1.00 50.25 ? 59  GLU B N   1 
ATOM   2914  C  CA  . GLU B  1 79  ? 30.860 -6.399  -25.534 1.00 50.92 ? 59  GLU B CA  1 
ATOM   2915  C  C   . GLU B  1 79  ? 30.087 -6.680  -26.805 1.00 48.63 ? 59  GLU B C   1 
ATOM   2916  O  O   . GLU B  1 79  ? 29.178 -7.479  -26.794 1.00 48.50 ? 59  GLU B O   1 
ATOM   2917  C  CB  . GLU B  1 79  ? 31.932 -7.456  -25.190 1.00 50.74 ? 59  GLU B CB  1 
ATOM   2918  C  CG  . GLU B  1 79  ? 32.681 -7.134  -23.833 1.00 54.54 ? 59  GLU B CG  1 
ATOM   2919  C  CD  . GLU B  1 79  ? 33.749 -8.184  -23.392 1.00 57.41 ? 59  GLU B CD  1 
ATOM   2920  O  OE1 . GLU B  1 79  ? 34.519 -7.864  -22.433 1.00 64.50 ? 59  GLU B OE1 1 
ATOM   2921  O  OE2 . GLU B  1 79  ? 33.823 -9.309  -23.983 1.00 57.02 ? 59  GLU B OE2 1 
ATOM   2922  N  N   . GLY B  1 80  ? 30.403 -5.963  -27.871 1.00 47.71 ? 60  GLY B N   1 
ATOM   2923  C  CA  . GLY B  1 80  ? 29.580 -5.951  -29.070 1.00 47.08 ? 60  GLY B CA  1 
ATOM   2924  C  C   . GLY B  1 80  ? 28.797 -4.654  -29.185 1.00 45.95 ? 60  GLY B C   1 
ATOM   2925  O  O   . GLY B  1 80  ? 28.416 -4.246  -30.282 1.00 45.50 ? 60  GLY B O   1 
ATOM   2926  N  N   . ASP B  1 81  ? 28.559 -4.004  -28.048 1.00 47.49 ? 61  ASP B N   1 
ATOM   2927  C  CA  . ASP B  1 81  ? 27.773 -2.763  -28.023 1.00 48.20 ? 61  ASP B CA  1 
ATOM   2928  C  C   . ASP B  1 81  ? 28.507 -1.635  -28.700 1.00 47.31 ? 61  ASP B C   1 
ATOM   2929  O  O   . ASP B  1 81  ? 29.732 -1.600  -28.734 1.00 44.68 ? 61  ASP B O   1 
ATOM   2930  C  CB  . ASP B  1 81  ? 27.440 -2.322  -26.584 1.00 49.94 ? 61  ASP B CB  1 
ATOM   2931  C  CG  . ASP B  1 81  ? 26.268 -3.105  -25.957 1.00 51.67 ? 61  ASP B CG  1 
ATOM   2932  O  OD1 . ASP B  1 81  ? 25.960 -2.874  -24.754 1.00 56.77 ? 61  ASP B OD1 1 
ATOM   2933  O  OD2 . ASP B  1 81  ? 25.649 -3.930  -26.651 1.00 48.55 ? 61  ASP B OD2 1 
ATOM   2934  N  N   . THR B  1 82  ? 27.728 -0.693  -29.230 1.00 49.00 ? 62  THR B N   1 
ATOM   2935  C  CA  . THR B  1 82  ? 28.282 0.513   -29.850 1.00 46.80 ? 62  THR B CA  1 
ATOM   2936  C  C   . THR B  1 82  ? 28.838 1.460   -28.787 1.00 44.86 ? 62  THR B C   1 
ATOM   2937  O  O   . THR B  1 82  ? 28.273 1.604   -27.720 1.00 41.66 ? 62  THR B O   1 
ATOM   2938  C  CB  . THR B  1 82  ? 27.225 1.185   -30.727 1.00 46.17 ? 62  THR B CB  1 
ATOM   2939  O  OG1 . THR B  1 82  ? 26.930 0.288   -31.794 1.00 43.14 ? 62  THR B OG1 1 
ATOM   2940  C  CG2 . THR B  1 82  ? 27.719 2.553   -31.308 1.00 47.07 ? 62  THR B CG2 1 
ATOM   2941  N  N   . MET B  1 83  ? 29.970 2.087   -29.093 1.00 46.29 ? 63  MET B N   1 
ATOM   2942  C  CA  . MET B  1 83  ? 30.524 3.106   -28.217 1.00 45.56 ? 63  MET B CA  1 
ATOM   2943  C  C   . MET B  1 83  ? 29.592 4.300   -28.189 1.00 43.17 ? 63  MET B C   1 
ATOM   2944  O  O   . MET B  1 83  ? 29.089 4.717   -29.209 1.00 44.32 ? 63  MET B O   1 
ATOM   2945  C  CB  . MET B  1 83  ? 31.951 3.501   -28.660 1.00 47.12 ? 63  MET B CB  1 
ATOM   2946  C  CG  . MET B  1 83  ? 33.043 2.506   -28.263 1.00 46.70 ? 63  MET B CG  1 
ATOM   2947  S  SD  . MET B  1 83  ? 33.292 2.282   -26.438 1.00 50.78 ? 63  MET B SD  1 
ATOM   2948  C  CE  . MET B  1 83  ? 33.631 3.926   -25.781 1.00 44.41 ? 63  MET B CE  1 
ATOM   2949  N  N   . MET B  1 84  ? 29.366 4.851   -27.008 1.00 42.16 ? 64  MET B N   1 
ATOM   2950  C  CA  . MET B  1 84  ? 28.403 5.908   -26.836 1.00 43.67 ? 64  MET B CA  1 
ATOM   2951  C  C   . MET B  1 84  ? 29.057 7.268   -27.091 1.00 44.56 ? 64  MET B C   1 
ATOM   2952  O  O   . MET B  1 84  ? 30.264 7.404   -27.018 1.00 44.06 ? 64  MET B O   1 
ATOM   2953  C  CB  . MET B  1 84  ? 27.755 5.859   -25.424 1.00 45.00 ? 64  MET B CB  1 
ATOM   2954  C  CG  . MET B  1 84  ? 28.626 6.377   -24.237 1.00 54.21 ? 64  MET B CG  1 
ATOM   2955  S  SD  . MET B  1 84  ? 30.059 5.324   -23.774 1.00 55.39 ? 64  MET B SD  1 
ATOM   2956  C  CE  . MET B  1 84  ? 29.229 3.765   -23.428 1.00 58.62 ? 64  MET B CE  1 
ATOM   2957  N  N   . GLY B  1 85  ? 28.246 8.273   -27.412 1.00 45.70 ? 65  GLY B N   1 
ATOM   2958  C  CA  . GLY B  1 85  ? 28.780 9.577   -27.794 1.00 44.79 ? 65  GLY B CA  1 
ATOM   2959  C  C   . GLY B  1 85  ? 27.875 10.433  -28.655 1.00 42.48 ? 65  GLY B C   1 
ATOM   2960  O  O   . GLY B  1 85  ? 26.999 9.926   -29.394 1.00 42.06 ? 65  GLY B O   1 
ATOM   2961  N  N   . GLN B  1 86  ? 28.151 11.737  -28.571 1.00 42.23 ? 66  GLN B N   1 
ATOM   2962  C  CA  . GLN B  1 86  ? 27.428 12.776  -29.289 1.00 42.23 ? 66  GLN B CA  1 
ATOM   2963  C  C   . GLN B  1 86  ? 28.138 13.190  -30.618 1.00 41.97 ? 66  GLN B C   1 
ATOM   2964  O  O   . GLN B  1 86  ? 29.358 13.058  -30.772 1.00 41.49 ? 66  GLN B O   1 
ATOM   2965  C  CB  . GLN B  1 86  ? 27.212 13.967  -28.342 1.00 36.25 ? 66  GLN B CB  1 
ATOM   2966  C  CG  . GLN B  1 86  ? 26.162 14.887  -28.794 1.00 42.60 ? 66  GLN B CG  1 
ATOM   2967  C  CD  . GLN B  1 86  ? 25.964 16.102  -27.907 1.00 48.10 ? 66  GLN B CD  1 
ATOM   2968  O  OE1 . GLN B  1 86  ? 26.935 16.752  -27.453 1.00 54.70 ? 66  GLN B OE1 1 
ATOM   2969  N  NE2 . GLN B  1 86  ? 24.685 16.464  -27.709 1.00 45.06 ? 66  GLN B NE2 1 
ATOM   2970  N  N   . GLN B  1 87  ? 27.356 13.684  -31.575 1.00 42.25 ? 67  GLN B N   1 
ATOM   2971  C  CA  . GLN B  1 87  ? 27.903 14.203  -32.813 1.00 40.73 ? 67  GLN B CA  1 
ATOM   2972  C  C   . GLN B  1 87  ? 27.080 15.380  -33.341 1.00 40.28 ? 67  GLN B C   1 
ATOM   2973  O  O   . GLN B  1 87  ? 25.944 15.574  -32.966 1.00 38.82 ? 67  GLN B O   1 
ATOM   2974  C  CB  . GLN B  1 87  ? 27.987 13.094  -33.875 1.00 39.49 ? 67  GLN B CB  1 
ATOM   2975  C  CG  . GLN B  1 87  ? 26.633 12.427  -34.172 1.00 42.11 ? 67  GLN B CG  1 
ATOM   2976  C  CD  . GLN B  1 87  ? 26.680 11.367  -35.269 1.00 40.75 ? 67  GLN B CD  1 
ATOM   2977  O  OE1 . GLN B  1 87  ? 25.929 11.433  -36.251 1.00 43.39 ? 67  GLN B OE1 1 
ATOM   2978  N  NE2 . GLN B  1 87  ? 27.518 10.359  -35.076 1.00 45.52 ? 67  GLN B NE2 1 
ATOM   2979  N  N   . VAL B  1 88  ? 27.713 16.165  -34.211 1.00 42.30 ? 68  VAL B N   1 
ATOM   2980  C  CA  . VAL B  1 88  ? 27.029 17.108  -35.088 1.00 41.64 ? 68  VAL B CA  1 
ATOM   2981  C  C   . VAL B  1 88  ? 26.789 16.348  -36.381 1.00 40.37 ? 68  VAL B C   1 
ATOM   2982  O  O   . VAL B  1 88  ? 27.707 15.747  -36.921 1.00 40.98 ? 68  VAL B O   1 
ATOM   2983  C  CB  . VAL B  1 88  ? 27.883 18.364  -35.332 1.00 41.28 ? 68  VAL B CB  1 
ATOM   2984  C  CG1 . VAL B  1 88  ? 27.368 19.175  -36.514 1.00 38.47 ? 68  VAL B CG1 1 
ATOM   2985  C  CG2 . VAL B  1 88  ? 27.928 19.214  -34.047 1.00 42.29 ? 68  VAL B CG2 1 
ATOM   2986  N  N   . ALA B  1 89  ? 25.548 16.340  -36.844 1.00 40.69 ? 69  ALA B N   1 
ATOM   2987  C  CA  . ALA B  1 89  ? 25.164 15.552  -38.002 1.00 38.34 ? 69  ALA B CA  1 
ATOM   2988  C  C   . ALA B  1 89  ? 24.255 16.376  -38.913 1.00 36.61 ? 69  ALA B C   1 
ATOM   2989  O  O   . ALA B  1 89  ? 23.614 17.304  -38.465 1.00 35.22 ? 69  ALA B O   1 
ATOM   2990  C  CB  . ALA B  1 89  ? 24.471 14.269  -37.539 1.00 38.05 ? 69  ALA B CB  1 
ATOM   2991  N  N   . LYS B  1 90  ? 24.249 16.034  -40.197 1.00 38.73 ? 70  LYS B N   1 
ATOM   2992  C  CA  . LYS B  1 90  ? 23.456 16.686  -41.206 1.00 38.86 ? 70  LYS B CA  1 
ATOM   2993  C  C   . LYS B  1 90  ? 22.346 15.727  -41.585 1.00 38.37 ? 70  LYS B C   1 
ATOM   2994  O  O   . LYS B  1 90  ? 22.592 14.545  -41.775 1.00 35.69 ? 70  LYS B O   1 
ATOM   2995  C  CB  . LYS B  1 90  ? 24.300 17.003  -42.456 1.00 38.27 ? 70  LYS B CB  1 
ATOM   2996  C  CG  . LYS B  1 90  ? 23.763 18.183  -43.321 1.00 41.07 ? 70  LYS B CG  1 
ATOM   2997  C  CD  . LYS B  1 90  ? 24.724 18.610  -44.457 1.00 42.34 ? 70  LYS B CD  1 
ATOM   2998  N  N   . VAL B  1 91  ? 21.124 16.248  -41.719 1.00 40.19 ? 71  VAL B N   1 
ATOM   2999  C  CA  . VAL B  1 91  ? 20.003 15.474  -42.287 1.00 40.00 ? 71  VAL B CA  1 
ATOM   3000  C  C   . VAL B  1 91  ? 20.219 15.364  -43.802 1.00 39.97 ? 71  VAL B C   1 
ATOM   3001  O  O   . VAL B  1 91  ? 20.219 16.366  -44.523 1.00 39.00 ? 71  VAL B O   1 
ATOM   3002  C  CB  . VAL B  1 91  ? 18.607 16.095  -41.978 1.00 37.37 ? 71  VAL B CB  1 
ATOM   3003  C  CG1 . VAL B  1 91  ? 17.518 15.159  -42.452 1.00 40.10 ? 71  VAL B CG1 1 
ATOM   3004  C  CG2 . VAL B  1 91  ? 18.420 16.404  -40.491 1.00 37.34 ? 71  VAL B CG2 1 
ATOM   3005  N  N   . VAL B  1 92  ? 20.471 14.146  -44.275 1.00 43.22 ? 72  VAL B N   1 
ATOM   3006  C  CA  . VAL B  1 92  ? 20.782 13.913  -45.708 1.00 43.91 ? 72  VAL B CA  1 
ATOM   3007  C  C   . VAL B  1 92  ? 19.618 13.266  -46.435 1.00 45.11 ? 72  VAL B C   1 
ATOM   3008  O  O   . VAL B  1 92  ? 19.541 13.365  -47.658 1.00 49.11 ? 72  VAL B O   1 
ATOM   3009  C  CB  . VAL B  1 92  ? 22.090 13.076  -45.928 1.00 44.25 ? 72  VAL B CB  1 
ATOM   3010  C  CG1 . VAL B  1 92  ? 23.325 13.893  -45.568 1.00 45.06 ? 72  VAL B CG1 1 
ATOM   3011  C  CG2 . VAL B  1 92  ? 22.092 11.758  -45.118 1.00 46.43 ? 72  VAL B CG2 1 
ATOM   3012  N  N   . GLU B  1 93  ? 18.721 12.616  -45.680 1.00 45.04 ? 73  GLU B N   1 
ATOM   3013  C  CA  . GLU B  1 93  ? 17.436 12.094  -46.191 1.00 43.09 ? 73  GLU B CA  1 
ATOM   3014  C  C   . GLU B  1 93  ? 16.330 12.352  -45.138 1.00 41.84 ? 73  GLU B C   1 
ATOM   3015  O  O   . GLU B  1 93  ? 16.475 11.972  -44.000 1.00 39.18 ? 73  GLU B O   1 
ATOM   3016  C  CB  . GLU B  1 93  ? 17.561 10.592  -46.525 1.00 41.37 ? 73  GLU B CB  1 
ATOM   3017  C  CG  . GLU B  1 93  ? 16.647 10.111  -47.648 1.00 47.82 ? 73  GLU B CG  1 
ATOM   3018  N  N   . SER B  1 94  ? 15.228 13.010  -45.520 1.00 43.99 ? 74  SER B N   1 
ATOM   3019  C  CA  . SER B  1 94  ? 14.139 13.318  -44.562 1.00 42.71 ? 74  SER B CA  1 
ATOM   3020  C  C   . SER B  1 94  ? 12.778 12.743  -44.936 1.00 39.57 ? 74  SER B C   1 
ATOM   3021  O  O   . SER B  1 94  ? 12.391 12.732  -46.102 1.00 38.35 ? 74  SER B O   1 
ATOM   3022  C  CB  . SER B  1 94  ? 14.005 14.835  -44.366 1.00 44.13 ? 74  SER B CB  1 
ATOM   3023  O  OG  . SER B  1 94  ? 13.182 15.146  -43.242 1.00 45.06 ? 74  SER B OG  1 
ATOM   3024  N  N   . LYS B  1 95  ? 12.067 12.245  -43.926 1.00 39.23 ? 75  LYS B N   1 
ATOM   3025  C  CA  . LYS B  1 95  ? 10.598 12.058  -44.015 1.00 39.48 ? 75  LYS B CA  1 
ATOM   3026  C  C   . LYS B  1 95  ? 9.907  12.777  -42.821 1.00 37.87 ? 75  LYS B C   1 
ATOM   3027  O  O   . LYS B  1 95  ? 8.859  12.337  -42.349 1.00 35.74 ? 75  LYS B O   1 
ATOM   3028  C  CB  . LYS B  1 95  ? 10.234 10.564  -44.050 1.00 40.79 ? 75  LYS B CB  1 
ATOM   3029  C  CG  . LYS B  1 95  ? 10.516 9.877   -45.361 1.00 39.07 ? 75  LYS B CG  1 
ATOM   3030  C  CD  . LYS B  1 95  ? 10.105 8.417   -45.302 1.00 39.98 ? 75  LYS B CD  1 
ATOM   3031  C  CE  . LYS B  1 95  ? 10.001 7.809   -46.705 1.00 42.15 ? 75  LYS B CE  1 
ATOM   3032  N  NZ  . LYS B  1 95  ? 10.728 6.509   -46.833 1.00 44.20 ? 75  LYS B NZ  1 
ATOM   3033  N  N   . ASN B  1 96  ? 10.530 13.874  -42.370 1.00 35.52 ? 76  ASN B N   1 
ATOM   3034  C  CA  . ASN B  1 96  ? 10.143 14.629  -41.202 1.00 35.69 ? 76  ASN B CA  1 
ATOM   3035  C  C   . ASN B  1 96  ? 10.181 16.133  -41.504 1.00 36.61 ? 76  ASN B C   1 
ATOM   3036  O  O   . ASN B  1 96  ? 11.245 16.734  -41.565 1.00 37.94 ? 76  ASN B O   1 
ATOM   3037  C  CB  . ASN B  1 96  ? 11.095 14.315  -40.034 1.00 37.07 ? 76  ASN B CB  1 
ATOM   3038  C  CG  . ASN B  1 96  ? 10.639 14.916  -38.712 1.00 37.37 ? 76  ASN B CG  1 
ATOM   3039  O  OD1 . ASN B  1 96  ? 10.106 16.018  -38.661 1.00 46.86 ? 76  ASN B OD1 1 
ATOM   3040  N  ND2 . ASN B  1 96  ? 10.853 14.188  -37.639 1.00 39.22 ? 76  ASN B ND2 1 
ATOM   3041  N  N   . VAL B  1 97  ? 9.017  16.747  -41.634 1.00 38.14 ? 77  VAL B N   1 
ATOM   3042  C  CA  . VAL B  1 97  ? 8.929  18.178  -41.950 1.00 40.20 ? 77  VAL B CA  1 
ATOM   3043  C  C   . VAL B  1 97  ? 9.632  19.179  -40.983 1.00 40.99 ? 77  VAL B C   1 
ATOM   3044  O  O   . VAL B  1 97  ? 9.809  20.346  -41.336 1.00 45.11 ? 77  VAL B O   1 
ATOM   3045  C  CB  . VAL B  1 97  ? 7.454  18.642  -42.129 1.00 38.95 ? 77  VAL B CB  1 
ATOM   3046  C  CG1 . VAL B  1 97  ? 6.774  17.869  -43.262 1.00 38.55 ? 77  VAL B CG1 1 
ATOM   3047  C  CG2 . VAL B  1 97  ? 6.669  18.528  -40.819 1.00 39.09 ? 77  VAL B CG2 1 
ATOM   3048  N  N   . ALA B  1 98  ? 9.982  18.780  -39.774 1.00 38.41 ? 78  ALA B N   1 
ATOM   3049  C  CA  . ALA B  1 98  ? 10.718 19.691  -38.903 1.00 39.52 ? 78  ALA B CA  1 
ATOM   3050  C  C   . ALA B  1 98  ? 12.219 19.634  -39.232 1.00 39.77 ? 78  ALA B C   1 
ATOM   3051  O  O   . ALA B  1 98  ? 13.001 20.526  -38.856 1.00 38.21 ? 78  ALA B O   1 
ATOM   3052  C  CB  . ALA B  1 98  ? 10.481 19.327  -37.442 1.00 40.43 ? 78  ALA B CB  1 
ATOM   3053  N  N   . LEU B  1 99  ? 12.602 18.571  -39.935 1.00 40.26 ? 79  LEU B N   1 
ATOM   3054  C  CA  . LEU B  1 99  ? 13.997 18.253  -40.199 1.00 41.34 ? 79  LEU B CA  1 
ATOM   3055  C  C   . LEU B  1 99  ? 14.202 17.929  -41.678 1.00 41.22 ? 79  LEU B C   1 
ATOM   3056  O  O   . LEU B  1 99  ? 14.449 16.751  -42.020 1.00 41.72 ? 79  LEU B O   1 
ATOM   3057  C  CB  . LEU B  1 99  ? 14.425 17.068  -39.325 1.00 40.79 ? 79  LEU B CB  1 
ATOM   3058  C  CG  . LEU B  1 99  ? 14.262 17.309  -37.816 1.00 45.34 ? 79  LEU B CG  1 
ATOM   3059  C  CD1 . LEU B  1 99  ? 14.385 16.016  -37.019 1.00 47.15 ? 79  LEU B CD1 1 
ATOM   3060  C  CD2 . LEU B  1 99  ? 15.262 18.353  -37.317 1.00 47.47 ? 79  LEU B CD2 1 
ATOM   3061  N  N   . PRO B  1 100 ? 14.123 18.975  -42.553 1.00 39.19 ? 80  PRO B N   1 
ATOM   3062  C  CA  . PRO B  1 100 ? 14.378 18.802  -44.000 1.00 39.84 ? 80  PRO B CA  1 
ATOM   3063  C  C   . PRO B  1 100 ? 15.870 18.542  -44.345 1.00 40.30 ? 80  PRO B C   1 
ATOM   3064  O  O   . PRO B  1 100 ? 16.755 18.838  -43.535 1.00 38.33 ? 80  PRO B O   1 
ATOM   3065  C  CB  . PRO B  1 100 ? 13.845 20.110  -44.609 1.00 39.00 ? 80  PRO B CB  1 
ATOM   3066  C  CG  . PRO B  1 100 ? 13.932 21.119  -43.512 1.00 37.34 ? 80  PRO B CG  1 
ATOM   3067  C  CD  . PRO B  1 100 ? 13.802 20.378  -42.207 1.00 36.93 ? 80  PRO B CD  1 
ATOM   3068  N  N   . LYS B  1 101 ? 16.135 17.953  -45.516 1.00 42.02 ? 81  LYS B N   1 
ATOM   3069  C  CA  . LYS B  1 101 ? 17.518 17.724  -45.998 1.00 42.11 ? 81  LYS B CA  1 
ATOM   3070  C  C   . LYS B  1 101 ? 18.402 18.942  -45.686 1.00 41.49 ? 81  LYS B C   1 
ATOM   3071  O  O   . LYS B  1 101 ? 17.983 20.064  -45.919 1.00 41.30 ? 81  LYS B O   1 
ATOM   3072  C  CB  . LYS B  1 101 ? 17.531 17.507  -47.530 1.00 42.28 ? 81  LYS B CB  1 
ATOM   3073  C  CG  . LYS B  1 101 ? 17.470 16.063  -48.025 1.00 43.49 ? 81  LYS B CG  1 
ATOM   3074  C  CD  . LYS B  1 101 ? 17.791 15.991  -49.546 1.00 45.39 ? 81  LYS B CD  1 
ATOM   3075  N  N   . GLY B  1 102 ? 19.617 18.734  -45.186 1.00 40.51 ? 82  GLY B N   1 
ATOM   3076  C  CA  . GLY B  1 102 ? 20.530 19.851  -44.921 1.00 41.46 ? 82  GLY B CA  1 
ATOM   3077  C  C   . GLY B  1 102 ? 20.563 20.414  -43.503 1.00 41.97 ? 82  GLY B C   1 
ATOM   3078  O  O   . GLY B  1 102 ? 21.522 21.080  -43.119 1.00 42.77 ? 82  GLY B O   1 
ATOM   3079  N  N   . THR B  1 103 ? 19.515 20.157  -42.730 1.00 41.92 ? 83  THR B N   1 
ATOM   3080  C  CA  . THR B  1 103 ? 19.453 20.565  -41.329 1.00 41.19 ? 83  THR B CA  1 
ATOM   3081  C  C   . THR B  1 103 ? 20.589 19.985  -40.514 1.00 42.13 ? 83  THR B C   1 
ATOM   3082  O  O   . THR B  1 103 ? 20.928 18.810  -40.663 1.00 42.69 ? 83  THR B O   1 
ATOM   3083  C  CB  . THR B  1 103 ? 18.145 20.090  -40.644 1.00 42.38 ? 83  THR B CB  1 
ATOM   3084  O  OG1 . THR B  1 103 ? 17.013 20.369  -41.496 1.00 35.77 ? 83  THR B OG1 1 
ATOM   3085  C  CG2 . THR B  1 103 ? 17.967 20.763  -39.235 1.00 39.20 ? 83  THR B CG2 1 
ATOM   3086  N  N   . ILE B  1 104 ? 21.126 20.824  -39.621 1.00 41.69 ? 84  ILE B N   1 
ATOM   3087  C  CA  . ILE B  1 104 ? 22.220 20.484  -38.734 1.00 41.08 ? 84  ILE B CA  1 
ATOM   3088  C  C   . ILE B  1 104 ? 21.634 20.285  -37.363 1.00 40.06 ? 84  ILE B C   1 
ATOM   3089  O  O   . ILE B  1 104 ? 20.812 21.104  -36.921 1.00 39.35 ? 84  ILE B O   1 
ATOM   3090  C  CB  . ILE B  1 104 ? 23.261 21.616  -38.656 1.00 41.75 ? 84  ILE B CB  1 
ATOM   3091  C  CG1 . ILE B  1 104 ? 23.878 21.870  -40.037 1.00 45.57 ? 84  ILE B CG1 1 
ATOM   3092  C  CG2 . ILE B  1 104 ? 24.340 21.271  -37.678 1.00 44.63 ? 84  ILE B CG2 1 
ATOM   3093  C  CD1 . ILE B  1 104 ? 24.501 20.614  -40.700 1.00 38.65 ? 84  ILE B CD1 1 
ATOM   3094  N  N   . VAL B  1 105 ? 22.056 19.189  -36.716 1.00 39.03 ? 85  VAL B N   1 
ATOM   3095  C  CA  . VAL B  1 105 ? 21.530 18.760  -35.427 1.00 37.77 ? 85  VAL B CA  1 
ATOM   3096  C  C   . VAL B  1 105 ? 22.627 18.174  -34.550 1.00 37.65 ? 85  VAL B C   1 
ATOM   3097  O  O   . VAL B  1 105 ? 23.622 17.694  -35.049 1.00 34.93 ? 85  VAL B O   1 
ATOM   3098  C  CB  . VAL B  1 105 ? 20.440 17.656  -35.577 1.00 36.49 ? 85  VAL B CB  1 
ATOM   3099  C  CG1 . VAL B  1 105 ? 19.265 18.137  -36.407 1.00 36.21 ? 85  VAL B CG1 1 
ATOM   3100  C  CG2 . VAL B  1 105 ? 21.038 16.374  -36.153 1.00 38.25 ? 85  VAL B CG2 1 
ATOM   3101  N  N   . LEU B  1 106 ? 22.414 18.237  -33.238 1.00 40.53 ? 86  LEU B N   1 
ATOM   3102  C  CA  . LEU B  1 106 ? 23.088 17.358  -32.288 1.00 42.04 ? 86  LEU B CA  1 
ATOM   3103  C  C   . LEU B  1 106 ? 22.286 16.065  -32.122 1.00 42.27 ? 86  LEU B C   1 
ATOM   3104  O  O   . LEU B  1 106 ? 21.065 16.087  -32.052 1.00 41.95 ? 86  LEU B O   1 
ATOM   3105  C  CB  . LEU B  1 106 ? 23.271 18.025  -30.926 1.00 41.24 ? 86  LEU B CB  1 
ATOM   3106  C  CG  . LEU B  1 106 ? 24.291 19.140  -31.012 1.00 45.68 ? 86  LEU B CG  1 
ATOM   3107  C  CD1 . LEU B  1 106 ? 23.860 20.352  -30.200 1.00 57.65 ? 86  LEU B CD1 1 
ATOM   3108  C  CD2 . LEU B  1 106 ? 25.665 18.624  -30.587 1.00 52.63 ? 86  LEU B CD2 1 
ATOM   3109  N  N   . ALA B  1 107 ? 23.017 14.954  -32.078 1.00 42.93 ? 87  ALA B N   1 
ATOM   3110  C  CA  . ALA B  1 107 ? 22.472 13.622  -32.003 1.00 42.53 ? 87  ALA B CA  1 
ATOM   3111  C  C   . ALA B  1 107 ? 23.436 12.755  -31.165 1.00 41.74 ? 87  ALA B C   1 
ATOM   3112  O  O   . ALA B  1 107 ? 24.620 13.037  -31.095 1.00 36.94 ? 87  ALA B O   1 
ATOM   3113  C  CB  . ALA B  1 107 ? 22.358 13.067  -33.395 1.00 43.02 ? 87  ALA B CB  1 
ATOM   3114  N  N   . SER B  1 108 ? 22.931 11.693  -30.554 1.00 43.60 ? 88  SER B N   1 
ATOM   3115  C  CA  . SER B  1 108 ? 23.789 10.756  -29.829 1.00 43.98 ? 88  SER B CA  1 
ATOM   3116  C  C   . SER B  1 108 ? 23.553 9.280   -30.205 1.00 43.82 ? 88  SER B C   1 
ATOM   3117  O  O   . SER B  1 108 ? 23.222 8.457   -29.349 1.00 47.80 ? 88  SER B O   1 
ATOM   3118  C  CB  . SER B  1 108 ? 23.624 10.953  -28.310 1.00 44.01 ? 88  SER B CB  1 
ATOM   3119  O  OG  . SER B  1 108 ? 23.930 12.285  -27.978 1.00 43.23 ? 88  SER B OG  1 
ATOM   3120  N  N   . PRO B  1 109 ? 23.786 8.920   -31.469 1.00 41.95 ? 89  PRO B N   1 
ATOM   3121  C  CA  . PRO B  1 109 ? 23.675 7.530   -31.849 1.00 40.49 ? 89  PRO B CA  1 
ATOM   3122  C  C   . PRO B  1 109 ? 24.900 6.680   -31.505 1.00 44.16 ? 89  PRO B C   1 
ATOM   3123  O  O   . PRO B  1 109 ? 24.945 5.513   -31.898 1.00 46.99 ? 89  PRO B O   1 
ATOM   3124  C  CB  . PRO B  1 109 ? 23.540 7.627   -33.363 1.00 39.03 ? 89  PRO B CB  1 
ATOM   3125  C  CG  . PRO B  1 109 ? 24.346 8.800   -33.707 1.00 36.97 ? 89  PRO B CG  1 
ATOM   3126  C  CD  . PRO B  1 109 ? 24.148 9.772   -32.617 1.00 41.77 ? 89  PRO B CD  1 
ATOM   3127  N  N   . GLY B  1 110 ? 25.880 7.245   -30.796 1.00 45.38 ? 90  GLY B N   1 
ATOM   3128  C  CA  . GLY B  1 110 ? 27.161 6.591   -30.594 1.00 43.75 ? 90  GLY B CA  1 
ATOM   3129  C  C   . GLY B  1 110 ? 28.176 6.807   -31.719 1.00 43.23 ? 90  GLY B C   1 
ATOM   3130  O  O   . GLY B  1 110 ? 27.983 7.641   -32.643 1.00 41.75 ? 90  GLY B O   1 
ATOM   3131  N  N   . TRP B  1 111 ? 29.263 6.037   -31.664 1.00 41.58 ? 91  TRP B N   1 
ATOM   3132  C  CA  . TRP B  1 111 ? 30.380 6.231   -32.616 1.00 41.08 ? 91  TRP B CA  1 
ATOM   3133  C  C   . TRP B  1 111 ? 30.036 5.564   -33.935 1.00 41.82 ? 91  TRP B C   1 
ATOM   3134  O  O   . TRP B  1 111 ? 30.508 4.466   -34.228 1.00 39.32 ? 91  TRP B O   1 
ATOM   3135  C  CB  . TRP B  1 111 ? 31.700 5.670   -32.120 1.00 39.24 ? 91  TRP B CB  1 
ATOM   3136  C  CG  . TRP B  1 111 ? 32.254 6.236   -30.852 1.00 40.14 ? 91  TRP B CG  1 
ATOM   3137  C  CD1 . TRP B  1 111 ? 31.631 7.045   -29.920 1.00 37.52 ? 91  TRP B CD1 1 
ATOM   3138  C  CD2 . TRP B  1 111 ? 33.542 5.952   -30.337 1.00 41.47 ? 91  TRP B CD2 1 
ATOM   3139  N  NE1 . TRP B  1 111 ? 32.492 7.304   -28.877 1.00 37.45 ? 91  TRP B NE1 1 
ATOM   3140  C  CE2 . TRP B  1 111 ? 33.677 6.661   -29.117 1.00 39.52 ? 91  TRP B CE2 1 
ATOM   3141  C  CE3 . TRP B  1 111 ? 34.633 5.212   -30.818 1.00 36.01 ? 91  TRP B CE3 1 
ATOM   3142  C  CZ2 . TRP B  1 111 ? 34.850 6.605   -28.353 1.00 38.81 ? 91  TRP B CZ2 1 
ATOM   3143  C  CZ3 . TRP B  1 111 ? 35.779 5.169   -30.065 1.00 34.73 ? 91  TRP B CZ3 1 
ATOM   3144  C  CH2 . TRP B  1 111 ? 35.883 5.850   -28.854 1.00 40.46 ? 91  TRP B CH2 1 
ATOM   3145  N  N   . THR B  1 112 ? 29.208 6.254   -34.708 1.00 40.21 ? 92  THR B N   1 
ATOM   3146  C  CA  . THR B  1 112 ? 28.734 5.774   -35.982 1.00 41.70 ? 92  THR B CA  1 
ATOM   3147  C  C   . THR B  1 112 ? 28.709 6.941   -36.988 1.00 41.56 ? 92  THR B C   1 
ATOM   3148  O  O   . THR B  1 112 ? 28.592 8.109   -36.599 1.00 39.63 ? 92  THR B O   1 
ATOM   3149  C  CB  . THR B  1 112 ? 27.340 5.130   -35.824 1.00 40.38 ? 92  THR B CB  1 
ATOM   3150  O  OG1 . THR B  1 112 ? 26.996 4.466   -37.027 1.00 43.70 ? 92  THR B OG1 1 
ATOM   3151  C  CG2 . THR B  1 112 ? 26.285 6.156   -35.526 1.00 43.95 ? 92  THR B CG2 1 
ATOM   3152  N  N   . THR B  1 113 ? 28.861 6.611   -38.274 1.00 43.02 ? 93  THR B N   1 
ATOM   3153  C  CA  . THR B  1 113 ? 28.877 7.615   -39.346 1.00 43.39 ? 93  THR B CA  1 
ATOM   3154  C  C   . THR B  1 113 ? 27.499 7.996   -39.885 1.00 42.81 ? 93  THR B C   1 
ATOM   3155  O  O   . THR B  1 113 ? 27.374 9.047   -40.515 1.00 42.40 ? 93  THR B O   1 
ATOM   3156  C  CB  . THR B  1 113 ? 29.677 7.142   -40.558 1.00 41.60 ? 93  THR B CB  1 
ATOM   3157  O  OG1 . THR B  1 113 ? 29.091 5.937   -41.086 1.00 46.80 ? 93  THR B OG1 1 
ATOM   3158  C  CG2 . THR B  1 113 ? 31.086 6.929   -40.165 1.00 38.57 ? 93  THR B CG2 1 
ATOM   3159  N  N   . HIS B  1 114 ? 26.515 7.107   -39.710 1.00 43.02 ? 94  HIS B N   1 
ATOM   3160  C  CA  . HIS B  1 114 ? 25.157 7.288   -40.234 1.00 43.93 ? 94  HIS B CA  1 
ATOM   3161  C  C   . HIS B  1 114 ? 24.231 6.629   -39.272 1.00 44.79 ? 94  HIS B C   1 
ATOM   3162  O  O   . HIS B  1 114 ? 24.524 5.553   -38.805 1.00 45.01 ? 94  HIS B O   1 
ATOM   3163  C  CB  . HIS B  1 114 ? 24.953 6.630   -41.614 1.00 45.50 ? 94  HIS B CB  1 
ATOM   3164  C  CG  . HIS B  1 114 ? 25.763 7.251   -42.708 1.00 45.20 ? 94  HIS B CG  1 
ATOM   3165  N  ND1 . HIS B  1 114 ? 27.116 7.014   -42.859 1.00 47.28 ? 94  HIS B ND1 1 
ATOM   3166  C  CD2 . HIS B  1 114 ? 25.418 8.112   -43.692 1.00 48.62 ? 94  HIS B CD2 1 
ATOM   3167  C  CE1 . HIS B  1 114 ? 27.565 7.700   -43.891 1.00 46.78 ? 94  HIS B CE1 1 
ATOM   3168  N  NE2 . HIS B  1 114 ? 26.556 8.379   -44.410 1.00 51.00 ? 94  HIS B NE2 1 
ATOM   3169  N  N   . SER B  1 115 ? 23.102 7.267   -38.991 1.00 45.73 ? 95  SER B N   1 
ATOM   3170  C  CA  . SER B  1 115 ? 22.131 6.717   -38.070 1.00 44.12 ? 95  SER B CA  1 
ATOM   3171  C  C   . SER B  1 115 ? 20.719 7.204   -38.438 1.00 43.67 ? 95  SER B C   1 
ATOM   3172  O  O   . SER B  1 115 ? 20.555 8.114   -39.227 1.00 40.46 ? 95  SER B O   1 
ATOM   3173  C  CB  . SER B  1 115 ? 22.514 7.106   -36.646 1.00 44.10 ? 95  SER B CB  1 
ATOM   3174  O  OG  . SER B  1 115 ? 22.596 8.510   -36.509 1.00 46.91 ? 95  SER B OG  1 
ATOM   3175  N  N   . ILE B  1 116 ? 19.706 6.545   -37.889 1.00 44.45 ? 96  ILE B N   1 
ATOM   3176  C  CA  . ILE B  1 116 ? 18.334 6.934   -38.109 1.00 44.97 ? 96  ILE B CA  1 
ATOM   3177  C  C   . ILE B  1 116 ? 17.680 7.443   -36.828 1.00 45.91 ? 96  ILE B C   1 
ATOM   3178  O  O   . ILE B  1 116 ? 17.767 6.824   -35.771 1.00 48.00 ? 96  ILE B O   1 
ATOM   3179  C  CB  . ILE B  1 116 ? 17.525 5.780   -38.711 1.00 45.19 ? 96  ILE B CB  1 
ATOM   3180  C  CG1 . ILE B  1 116 ? 18.032 5.477   -40.132 1.00 44.47 ? 96  ILE B CG1 1 
ATOM   3181  C  CG2 . ILE B  1 116 ? 16.031 6.135   -38.746 1.00 43.42 ? 96  ILE B CG2 1 
ATOM   3182  C  CD1 . ILE B  1 116 ? 17.432 4.255   -40.738 1.00 47.11 ? 96  ILE B CD1 1 
ATOM   3183  N  N   . SER B  1 117 ? 17.009 8.579   -36.950 1.00 47.57 ? 97  SER B N   1 
ATOM   3184  C  CA  . SER B  1 117 ? 16.264 9.180   -35.854 1.00 47.54 ? 97  SER B CA  1 
ATOM   3185  C  C   . SER B  1 117 ? 14.751 9.328   -36.177 1.00 46.61 ? 97  SER B C   1 
ATOM   3186  O  O   . SER B  1 117 ? 14.354 9.594   -37.298 1.00 41.77 ? 97  SER B O   1 
ATOM   3187  C  CB  . SER B  1 117 ? 16.887 10.544  -35.513 1.00 47.58 ? 97  SER B CB  1 
ATOM   3188  O  OG  . SER B  1 117 ? 16.292 11.131  -34.366 1.00 43.06 ? 97  SER B OG  1 
ATOM   3189  N  N   . ASP B  1 118 ? 13.927 9.124   -35.156 1.00 48.93 ? 98  ASP B N   1 
ATOM   3190  C  CA  . ASP B  1 118 ? 12.508 9.506   -35.160 1.00 50.00 ? 98  ASP B CA  1 
ATOM   3191  C  C   . ASP B  1 118 ? 12.365 11.029  -35.024 1.00 50.14 ? 98  ASP B C   1 
ATOM   3192  O  O   . ASP B  1 118 ? 11.296 11.570  -35.242 1.00 50.73 ? 98  ASP B O   1 
ATOM   3193  C  CB  . ASP B  1 118 ? 11.751 8.813   -34.012 1.00 50.78 ? 98  ASP B CB  1 
ATOM   3194  C  CG  . ASP B  1 118 ? 12.282 9.209   -32.611 1.00 56.98 ? 98  ASP B CG  1 
ATOM   3195  O  OD1 . ASP B  1 118 ? 13.470 8.913   -32.273 1.00 65.21 ? 98  ASP B OD1 1 
ATOM   3196  O  OD2 . ASP B  1 118 ? 11.500 9.810   -31.838 1.00 63.87 ? 98  ASP B OD2 1 
ATOM   3197  N  N   . GLY B  1 119 ? 13.451 11.700  -34.654 1.00 51.19 ? 99  GLY B N   1 
ATOM   3198  C  CA  . GLY B  1 119 ? 13.524 13.140  -34.608 1.00 51.28 ? 99  GLY B CA  1 
ATOM   3199  C  C   . GLY B  1 119 ? 13.340 13.695  -33.221 1.00 53.82 ? 99  GLY B C   1 
ATOM   3200  O  O   . GLY B  1 119 ? 13.560 14.886  -33.011 1.00 56.30 ? 99  GLY B O   1 
ATOM   3201  N  N   . LYS B  1 120 ? 12.934 12.858  -32.265 1.00 55.56 ? 100 LYS B N   1 
ATOM   3202  C  CA  . LYS B  1 120 ? 12.526 13.375  -30.934 1.00 56.75 ? 100 LYS B CA  1 
ATOM   3203  C  C   . LYS B  1 120 ? 13.655 13.290  -29.913 1.00 55.83 ? 100 LYS B C   1 
ATOM   3204  O  O   . LYS B  1 120 ? 13.471 13.689  -28.788 1.00 57.44 ? 100 LYS B O   1 
ATOM   3205  C  CB  . LYS B  1 120 ? 11.249 12.684  -30.408 1.00 55.26 ? 100 LYS B CB  1 
ATOM   3206  N  N   . ASP B  1 121 ? 14.818 12.806  -30.337 1.00 55.63 ? 101 ASP B N   1 
ATOM   3207  C  CA  . ASP B  1 121 ? 16.015 12.677  -29.504 1.00 56.73 ? 101 ASP B CA  1 
ATOM   3208  C  C   . ASP B  1 121 ? 17.184 13.574  -30.008 1.00 56.07 ? 101 ASP B C   1 
ATOM   3209  O  O   . ASP B  1 121 ? 18.376 13.323  -29.714 1.00 56.24 ? 101 ASP B O   1 
ATOM   3210  C  CB  . ASP B  1 121 ? 16.451 11.190  -29.494 1.00 60.01 ? 101 ASP B CB  1 
ATOM   3211  C  CG  . ASP B  1 121 ? 16.552 10.577  -30.924 1.00 66.57 ? 101 ASP B CG  1 
ATOM   3212  O  OD1 . ASP B  1 121 ? 15.938 11.131  -31.861 1.00 73.13 ? 101 ASP B OD1 1 
ATOM   3213  O  OD2 . ASP B  1 121 ? 17.230 9.540   -31.114 1.00 68.38 ? 101 ASP B OD2 1 
ATOM   3214  N  N   . LEU B  1 122 ? 16.834 14.590  -30.793 1.00 53.67 ? 102 LEU B N   1 
ATOM   3215  C  CA  . LEU B  1 122 ? 17.793 15.446  -31.486 1.00 53.87 ? 102 LEU B CA  1 
ATOM   3216  C  C   . LEU B  1 122 ? 17.686 16.855  -30.969 1.00 53.77 ? 102 LEU B C   1 
ATOM   3217  O  O   . LEU B  1 122 ? 16.750 17.210  -30.262 1.00 55.72 ? 102 LEU B O   1 
ATOM   3218  C  CB  . LEU B  1 122 ? 17.499 15.498  -32.988 1.00 53.34 ? 102 LEU B CB  1 
ATOM   3219  C  CG  . LEU B  1 122 ? 17.419 14.191  -33.767 1.00 51.46 ? 102 LEU B CG  1 
ATOM   3220  C  CD1 . LEU B  1 122 ? 17.226 14.536  -35.252 1.00 50.99 ? 102 LEU B CD1 1 
ATOM   3221  C  CD2 . LEU B  1 122 ? 18.651 13.298  -33.532 1.00 48.63 ? 102 LEU B CD2 1 
ATOM   3222  N  N   . GLU B  1 123 ? 18.621 17.686  -31.378 1.00 53.27 ? 103 GLU B N   1 
ATOM   3223  C  CA  . GLU B  1 123 ? 18.661 19.049  -30.912 1.00 51.76 ? 103 GLU B CA  1 
ATOM   3224  C  C   . GLU B  1 123 ? 19.217 19.894  -32.048 1.00 48.99 ? 103 GLU B C   1 
ATOM   3225  O  O   . GLU B  1 123 ? 20.343 19.712  -32.460 1.00 47.60 ? 103 GLU B O   1 
ATOM   3226  C  CB  . GLU B  1 123 ? 19.549 19.067  -29.677 1.00 50.76 ? 103 GLU B CB  1 
ATOM   3227  C  CG  . GLU B  1 123 ? 19.666 20.362  -28.901 1.00 52.81 ? 103 GLU B CG  1 
ATOM   3228  C  CD  . GLU B  1 123 ? 20.723 20.234  -27.784 1.00 56.65 ? 103 GLU B CD  1 
ATOM   3229  O  OE1 . GLU B  1 123 ? 20.913 19.094  -27.255 1.00 64.54 ? 103 GLU B OE1 1 
ATOM   3230  O  OE2 . GLU B  1 123 ? 21.383 21.256  -27.443 1.00 60.81 ? 103 GLU B OE2 1 
ATOM   3231  N  N   . LYS B  1 124 ? 18.410 20.800  -32.577 1.00 50.40 ? 104 LYS B N   1 
ATOM   3232  C  CA  . LYS B  1 124 ? 18.902 21.768  -33.538 1.00 49.65 ? 104 LYS B CA  1 
ATOM   3233  C  C   . LYS B  1 124 ? 19.814 22.725  -32.779 1.00 50.33 ? 104 LYS B C   1 
ATOM   3234  O  O   . LYS B  1 124 ? 19.708 22.886  -31.555 1.00 46.29 ? 104 LYS B O   1 
ATOM   3235  C  CB  . LYS B  1 124 ? 17.751 22.538  -34.218 1.00 50.14 ? 104 LYS B CB  1 
ATOM   3236  C  CG  . LYS B  1 124 ? 16.728 21.678  -34.999 1.00 50.85 ? 104 LYS B CG  1 
ATOM   3237  C  CD  . LYS B  1 124 ? 15.609 22.529  -35.666 1.00 46.67 ? 104 LYS B CD  1 
ATOM   3238  N  N   . LEU B  1 125 ? 20.714 23.363  -33.513 1.00 53.33 ? 105 LEU B N   1 
ATOM   3239  C  CA  . LEU B  1 125 ? 21.577 24.378  -32.926 1.00 54.58 ? 105 LEU B CA  1 
ATOM   3240  C  C   . LEU B  1 125 ? 20.811 25.654  -32.528 1.00 53.73 ? 105 LEU B C   1 
ATOM   3241  O  O   . LEU B  1 125 ? 19.640 25.853  -32.884 1.00 54.66 ? 105 LEU B O   1 
ATOM   3242  C  CB  . LEU B  1 125 ? 22.707 24.734  -33.897 1.00 55.61 ? 105 LEU B CB  1 
ATOM   3243  C  CG  . LEU B  1 125 ? 23.656 23.636  -34.374 1.00 56.05 ? 105 LEU B CG  1 
ATOM   3244  C  CD1 . LEU B  1 125 ? 25.024 24.250  -34.588 1.00 58.33 ? 105 LEU B CD1 1 
ATOM   3245  C  CD2 . LEU B  1 125 ? 23.767 22.473  -33.398 1.00 60.95 ? 105 LEU B CD2 1 
ATOM   3246  N  N   . LEU B  1 126 ? 21.476 26.510  -31.767 1.00 53.13 ? 106 LEU B N   1 
ATOM   3247  C  CA  . LEU B  1 126 ? 20.908 27.789  -31.400 1.00 53.75 ? 106 LEU B CA  1 
ATOM   3248  C  C   . LEU B  1 126 ? 20.480 28.559  -32.662 1.00 53.08 ? 106 LEU B C   1 
ATOM   3249  O  O   . LEU B  1 126 ? 21.216 28.581  -33.650 1.00 52.14 ? 106 LEU B O   1 
ATOM   3250  C  CB  . LEU B  1 126 ? 21.938 28.593  -30.608 1.00 55.20 ? 106 LEU B CB  1 
ATOM   3251  C  CG  . LEU B  1 126 ? 22.269 28.182  -29.161 1.00 53.96 ? 106 LEU B CG  1 
ATOM   3252  C  CD1 . LEU B  1 126 ? 23.235 29.197  -28.574 1.00 58.68 ? 106 LEU B CD1 1 
ATOM   3253  C  CD2 . LEU B  1 126 ? 21.041 28.095  -28.297 1.00 41.93 ? 106 LEU B CD2 1 
ATOM   3254  N  N   . THR B  1 127 ? 19.270 29.130  -32.620 1.00 53.90 ? 107 THR B N   1 
ATOM   3255  C  CA  . THR B  1 127 ? 18.730 30.021  -33.648 1.00 54.67 ? 107 THR B CA  1 
ATOM   3256  C  C   . THR B  1 127 ? 19.757 31.052  -34.116 1.00 55.95 ? 107 THR B C   1 
ATOM   3257  O  O   . THR B  1 127 ? 20.021 31.216  -35.319 1.00 56.34 ? 107 THR B O   1 
ATOM   3258  C  CB  . THR B  1 127 ? 17.519 30.812  -33.074 1.00 55.56 ? 107 THR B CB  1 
ATOM   3259  O  OG1 . THR B  1 127 ? 16.393 29.938  -32.937 1.00 51.00 ? 107 THR B OG1 1 
ATOM   3260  C  CG2 . THR B  1 127 ? 17.127 32.057  -33.969 1.00 55.71 ? 107 THR B CG2 1 
ATOM   3261  N  N   . GLU B  1 128 ? 20.327 31.736  -33.128 1.00 56.62 ? 108 GLU B N   1 
ATOM   3262  C  CA  . GLU B  1 128 ? 21.288 32.829  -33.322 1.00 56.72 ? 108 GLU B CA  1 
ATOM   3263  C  C   . GLU B  1 128 ? 22.754 32.349  -33.535 1.00 54.79 ? 108 GLU B C   1 
ATOM   3264  O  O   . GLU B  1 128 ? 23.699 33.072  -33.215 1.00 53.63 ? 108 GLU B O   1 
ATOM   3265  C  CB  . GLU B  1 128 ? 21.195 33.778  -32.101 1.00 57.73 ? 108 GLU B CB  1 
ATOM   3266  C  CG  . GLU B  1 128 ? 21.742 33.188  -30.731 1.00 67.15 ? 108 GLU B CG  1 
ATOM   3267  C  CD  . GLU B  1 128 ? 20.681 32.506  -29.836 1.00 68.13 ? 108 GLU B CD  1 
ATOM   3268  O  OE1 . GLU B  1 128 ? 20.497 32.972  -28.692 1.00 66.76 ? 108 GLU B OE1 1 
ATOM   3269  O  OE2 . GLU B  1 128 ? 20.043 31.514  -30.268 1.00 67.67 ? 108 GLU B OE2 1 
ATOM   3270  N  N   . TRP B  1 129 ? 22.932 31.143  -34.075 1.00 53.88 ? 109 TRP B N   1 
ATOM   3271  C  CA  . TRP B  1 129 ? 24.253 30.529  -34.210 1.00 54.08 ? 109 TRP B CA  1 
ATOM   3272  C  C   . TRP B  1 129 ? 25.004 31.044  -35.435 1.00 53.74 ? 109 TRP B C   1 
ATOM   3273  O  O   . TRP B  1 129 ? 24.587 30.772  -36.553 1.00 53.70 ? 109 TRP B O   1 
ATOM   3274  C  CB  . TRP B  1 129 ? 24.131 29.007  -34.334 1.00 53.51 ? 109 TRP B CB  1 
ATOM   3275  C  CG  . TRP B  1 129 ? 25.496 28.308  -34.331 1.00 52.11 ? 109 TRP B CG  1 
ATOM   3276  C  CD1 . TRP B  1 129 ? 26.390 28.195  -35.383 1.00 46.60 ? 109 TRP B CD1 1 
ATOM   3277  C  CD2 . TRP B  1 129 ? 26.105 27.654  -33.218 1.00 51.33 ? 109 TRP B CD2 1 
ATOM   3278  N  NE1 . TRP B  1 129 ? 27.505 27.496  -34.976 1.00 47.93 ? 109 TRP B NE1 1 
ATOM   3279  C  CE2 . TRP B  1 129 ? 27.356 27.149  -33.657 1.00 50.77 ? 109 TRP B CE2 1 
ATOM   3280  C  CE3 . TRP B  1 129 ? 25.705 27.416  -31.893 1.00 50.18 ? 109 TRP B CE3 1 
ATOM   3281  C  CZ2 . TRP B  1 129 ? 28.215 26.441  -32.803 1.00 48.67 ? 109 TRP B CZ2 1 
ATOM   3282  C  CZ3 . TRP B  1 129 ? 26.561 26.710  -31.050 1.00 46.97 ? 109 TRP B CZ3 1 
ATOM   3283  C  CH2 . TRP B  1 129 ? 27.803 26.242  -31.508 1.00 48.33 ? 109 TRP B CH2 1 
ATOM   3284  N  N   . PRO B  1 130 ? 26.141 31.739  -35.238 1.00 54.36 ? 110 PRO B N   1 
ATOM   3285  C  CA  . PRO B  1 130 ? 26.754 32.395  -36.397 1.00 55.19 ? 110 PRO B CA  1 
ATOM   3286  C  C   . PRO B  1 130 ? 27.619 31.487  -37.284 1.00 57.13 ? 110 PRO B C   1 
ATOM   3287  O  O   . PRO B  1 130 ? 28.074 30.421  -36.853 1.00 57.80 ? 110 PRO B O   1 
ATOM   3288  C  CB  . PRO B  1 130 ? 27.609 33.503  -35.764 1.00 54.52 ? 110 PRO B CB  1 
ATOM   3289  C  CG  . PRO B  1 130 ? 27.878 33.057  -34.365 1.00 52.17 ? 110 PRO B CG  1 
ATOM   3290  C  CD  . PRO B  1 130 ? 26.919 31.955  -34.006 1.00 53.51 ? 110 PRO B CD  1 
ATOM   3291  N  N   . ASP B  1 131 ? 27.824 31.945  -38.520 1.00 59.14 ? 111 ASP B N   1 
ATOM   3292  C  CA  . ASP B  1 131 ? 28.768 31.356  -39.485 1.00 59.42 ? 111 ASP B CA  1 
ATOM   3293  C  C   . ASP B  1 131 ? 30.235 31.529  -39.043 1.00 59.85 ? 111 ASP B C   1 
ATOM   3294  O  O   . ASP B  1 131 ? 31.106 30.758  -39.465 1.00 61.16 ? 111 ASP B O   1 
ATOM   3295  C  CB  . ASP B  1 131 ? 28.574 32.018  -40.872 1.00 59.62 ? 111 ASP B CB  1 
ATOM   3296  N  N   . THR B  1 132 ? 30.503 32.530  -38.196 1.00 58.71 ? 112 THR B N   1 
ATOM   3297  C  CA  . THR B  1 132 ? 31.873 32.898  -37.819 1.00 58.58 ? 112 THR B CA  1 
ATOM   3298  C  C   . THR B  1 132 ? 32.462 32.049  -36.702 1.00 57.93 ? 112 THR B C   1 
ATOM   3299  O  O   . THR B  1 132 ? 33.543 32.362  -36.207 1.00 58.15 ? 112 THR B O   1 
ATOM   3300  C  CB  . THR B  1 132 ? 31.980 34.379  -37.364 1.00 59.17 ? 112 THR B CB  1 
ATOM   3301  O  OG1 . THR B  1 132 ? 31.449 34.522  -36.034 1.00 60.88 ? 112 THR B OG1 1 
ATOM   3302  C  CG2 . THR B  1 132 ? 31.260 35.313  -38.346 1.00 58.61 ? 112 THR B CG2 1 
ATOM   3303  N  N   . ILE B  1 133 ? 31.753 31.005  -36.280 1.00 56.58 ? 113 ILE B N   1 
ATOM   3304  C  CA  . ILE B  1 133 ? 32.308 30.041  -35.345 1.00 55.12 ? 113 ILE B CA  1 
ATOM   3305  C  C   . ILE B  1 133 ? 32.141 28.623  -35.919 1.00 52.92 ? 113 ILE B C   1 
ATOM   3306  O  O   . ILE B  1 133 ? 31.209 28.385  -36.717 1.00 53.70 ? 113 ILE B O   1 
ATOM   3307  C  CB  . ILE B  1 133 ? 31.672 30.141  -33.923 1.00 55.70 ? 113 ILE B CB  1 
ATOM   3308  C  CG1 . ILE B  1 133 ? 30.169 29.866  -33.957 1.00 57.44 ? 113 ILE B CG1 1 
ATOM   3309  C  CG2 . ILE B  1 133 ? 31.951 31.505  -33.279 1.00 56.22 ? 113 ILE B CG2 1 
ATOM   3310  C  CD1 . ILE B  1 133 ? 29.613 29.500  -32.593 1.00 58.38 ? 113 ILE B CD1 1 
ATOM   3311  N  N   . PRO B  1 134 ? 33.056 27.689  -35.539 1.00 47.80 ? 114 PRO B N   1 
ATOM   3312  C  CA  . PRO B  1 134 ? 32.953 26.325  -36.013 1.00 46.43 ? 114 PRO B CA  1 
ATOM   3313  C  C   . PRO B  1 134 ? 31.814 25.526  -35.354 1.00 47.22 ? 114 PRO B C   1 
ATOM   3314  O  O   . PRO B  1 134 ? 31.595 25.625  -34.131 1.00 44.05 ? 114 PRO B O   1 
ATOM   3315  C  CB  . PRO B  1 134 ? 34.334 25.733  -35.694 1.00 45.72 ? 114 PRO B CB  1 
ATOM   3316  C  CG  . PRO B  1 134 ? 34.892 26.563  -34.636 1.00 45.78 ? 114 PRO B CG  1 
ATOM   3317  C  CD  . PRO B  1 134 ? 34.248 27.888  -34.689 1.00 44.92 ? 114 PRO B CD  1 
ATOM   3318  N  N   . LEU B  1 135 ? 31.127 24.738  -36.187 1.00 47.09 ? 115 LEU B N   1 
ATOM   3319  C  CA  . LEU B  1 135 ? 30.003 23.911  -35.774 1.00 49.05 ? 115 LEU B CA  1 
ATOM   3320  C  C   . LEU B  1 135 ? 30.363 23.016  -34.621 1.00 47.03 ? 115 LEU B C   1 
ATOM   3321  O  O   . LEU B  1 135 ? 29.500 22.658  -33.820 1.00 44.09 ? 115 LEU B O   1 
ATOM   3322  C  CB  . LEU B  1 135 ? 29.567 22.986  -36.908 1.00 49.98 ? 115 LEU B CB  1 
ATOM   3323  C  CG  . LEU B  1 135 ? 28.884 23.580  -38.124 1.00 55.35 ? 115 LEU B CG  1 
ATOM   3324  C  CD1 . LEU B  1 135 ? 28.522 22.428  -39.049 1.00 60.69 ? 115 LEU B CD1 1 
ATOM   3325  C  CD2 . LEU B  1 135 ? 27.661 24.356  -37.718 1.00 54.26 ? 115 LEU B CD2 1 
ATOM   3326  N  N   . SER B  1 136 ? 31.633 22.623  -34.582 1.00 47.00 ? 116 SER B N   1 
ATOM   3327  C  CA  . SER B  1 136 ? 32.130 21.671  -33.589 1.00 47.18 ? 116 SER B CA  1 
ATOM   3328  C  C   . SER B  1 136 ? 32.215 22.241  -32.148 1.00 45.72 ? 116 SER B C   1 
ATOM   3329  O  O   . SER B  1 136 ? 32.384 21.477  -31.162 1.00 45.60 ? 116 SER B O   1 
ATOM   3330  C  CB  . SER B  1 136 ? 33.480 21.071  -34.058 1.00 48.80 ? 116 SER B CB  1 
ATOM   3331  O  OG  . SER B  1 136 ? 34.266 22.019  -34.788 1.00 47.11 ? 116 SER B OG  1 
ATOM   3332  N  N   . LEU B  1 137 ? 32.067 23.555  -32.009 1.00 43.56 ? 117 LEU B N   1 
ATOM   3333  C  CA  . LEU B  1 137 ? 31.907 24.159  -30.677 1.00 44.97 ? 117 LEU B CA  1 
ATOM   3334  C  C   . LEU B  1 137 ? 30.631 23.739  -29.999 1.00 44.75 ? 117 LEU B C   1 
ATOM   3335  O  O   . LEU B  1 137 ? 30.486 23.894  -28.781 1.00 45.04 ? 117 LEU B O   1 
ATOM   3336  C  CB  . LEU B  1 137 ? 31.885 25.680  -30.736 1.00 46.86 ? 117 LEU B CB  1 
ATOM   3337  C  CG  . LEU B  1 137 ? 33.208 26.415  -30.850 1.00 53.02 ? 117 LEU B CG  1 
ATOM   3338  C  CD1 . LEU B  1 137 ? 32.980 27.878  -30.471 1.00 58.70 ? 117 LEU B CD1 1 
ATOM   3339  C  CD2 . LEU B  1 137 ? 34.260 25.787  -29.974 1.00 55.46 ? 117 LEU B CD2 1 
ATOM   3340  N  N   . ALA B  1 138 ? 29.687 23.251  -30.795 1.00 44.56 ? 118 ALA B N   1 
ATOM   3341  C  CA  . ALA B  1 138 ? 28.457 22.715  -30.266 1.00 43.42 ? 118 ALA B CA  1 
ATOM   3342  C  C   . ALA B  1 138 ? 28.709 21.429  -29.459 1.00 40.98 ? 118 ALA B C   1 
ATOM   3343  O  O   . ALA B  1 138 ? 27.882 21.061  -28.658 1.00 41.67 ? 118 ALA B O   1 
ATOM   3344  C  CB  . ALA B  1 138 ? 27.438 22.498  -31.408 1.00 42.10 ? 118 ALA B CB  1 
ATOM   3345  N  N   . LEU B  1 139 ? 29.845 20.771  -29.680 1.00 41.92 ? 119 LEU B N   1 
ATOM   3346  C  CA  . LEU B  1 139 ? 30.255 19.578  -28.926 1.00 42.99 ? 119 LEU B CA  1 
ATOM   3347  C  C   . LEU B  1 139 ? 31.227 19.873  -27.774 1.00 44.29 ? 119 LEU B C   1 
ATOM   3348  O  O   . LEU B  1 139 ? 31.717 18.942  -27.098 1.00 48.31 ? 119 LEU B O   1 
ATOM   3349  C  CB  . LEU B  1 139 ? 30.944 18.577  -29.858 1.00 42.03 ? 119 LEU B CB  1 
ATOM   3350  C  CG  . LEU B  1 139 ? 30.233 18.113  -31.109 1.00 34.59 ? 119 LEU B CG  1 
ATOM   3351  C  CD1 . LEU B  1 139 ? 31.196 17.401  -31.987 1.00 41.45 ? 119 LEU B CD1 1 
ATOM   3352  C  CD2 . LEU B  1 139 ? 29.101 17.226  -30.741 1.00 39.91 ? 119 LEU B CD2 1 
ATOM   3353  N  N   . GLY B  1 140 ? 31.502 21.154  -27.560 1.00 44.90 ? 120 GLY B N   1 
ATOM   3354  C  CA  . GLY B  1 140 ? 32.558 21.625  -26.648 1.00 45.42 ? 120 GLY B CA  1 
ATOM   3355  C  C   . GLY B  1 140 ? 32.144 22.852  -25.849 1.00 45.02 ? 120 GLY B C   1 
ATOM   3356  O  O   . GLY B  1 140 ? 31.237 22.782  -25.030 1.00 45.02 ? 120 GLY B O   1 
ATOM   3357  N  N   . THR B  1 141 ? 32.774 23.981  -26.133 1.00 45.49 ? 121 THR B N   1 
ATOM   3358  C  CA  . THR B  1 141 ? 32.605 25.205  -25.351 1.00 46.20 ? 121 THR B CA  1 
ATOM   3359  C  C   . THR B  1 141 ? 31.130 25.704  -25.264 1.00 45.87 ? 121 THR B C   1 
ATOM   3360  O  O   . THR B  1 141 ? 30.699 26.099  -24.187 1.00 43.69 ? 121 THR B O   1 
ATOM   3361  C  CB  . THR B  1 141 ? 33.570 26.341  -25.899 1.00 49.45 ? 121 THR B CB  1 
ATOM   3362  O  OG1 . THR B  1 141 ? 34.954 25.994  -25.672 1.00 46.76 ? 121 THR B OG1 1 
ATOM   3363  C  CG2 . THR B  1 141 ? 33.271 27.738  -25.259 1.00 47.06 ? 121 THR B CG2 1 
ATOM   3364  N  N   . VAL B  1 142 ? 30.405 25.696  -26.399 1.00 44.36 ? 122 VAL B N   1 
ATOM   3365  C  CA  . VAL B  1 142 ? 28.993 26.062  -26.480 1.00 44.51 ? 122 VAL B CA  1 
ATOM   3366  C  C   . VAL B  1 142 ? 28.172 24.780  -26.662 1.00 44.33 ? 122 VAL B C   1 
ATOM   3367  O  O   . VAL B  1 142 ? 27.357 24.631  -27.606 1.00 42.42 ? 122 VAL B O   1 
ATOM   3368  C  CB  . VAL B  1 142 ? 28.678 27.070  -27.661 1.00 46.01 ? 122 VAL B CB  1 
ATOM   3369  C  CG1 . VAL B  1 142 ? 27.277 27.664  -27.520 1.00 43.56 ? 122 VAL B CG1 1 
ATOM   3370  C  CG2 . VAL B  1 142 ? 29.693 28.202  -27.728 1.00 45.91 ? 122 VAL B CG2 1 
ATOM   3371  N  N   . GLY B  1 143 ? 28.380 23.876  -25.709 1.00 43.49 ? 123 GLY B N   1 
ATOM   3372  C  CA  . GLY B  1 143 ? 27.857 22.536  -25.749 1.00 41.42 ? 123 GLY B CA  1 
ATOM   3373  C  C   . GLY B  1 143 ? 28.071 21.903  -24.408 1.00 38.71 ? 123 GLY B C   1 
ATOM   3374  O  O   . GLY B  1 143 ? 28.297 22.585  -23.438 1.00 36.86 ? 123 GLY B O   1 
ATOM   3375  N  N   . MET B  1 144 ? 28.038 20.584  -24.367 1.00 41.88 ? 124 MET B N   1 
ATOM   3376  C  CA  . MET B  1 144 ? 28.016 19.821  -23.097 1.00 42.45 ? 124 MET B CA  1 
ATOM   3377  C  C   . MET B  1 144 ? 29.116 20.160  -22.036 1.00 42.27 ? 124 MET B C   1 
ATOM   3378  O  O   . MET B  1 144 ? 28.815 20.374  -20.854 1.00 43.51 ? 124 MET B O   1 
ATOM   3379  C  CB  . MET B  1 144 ? 27.949 18.306  -23.434 1.00 43.27 ? 124 MET B CB  1 
ATOM   3380  C  CG  . MET B  1 144 ? 27.779 17.345  -22.249 1.00 44.20 ? 124 MET B CG  1 
ATOM   3381  S  SD  . MET B  1 144 ? 29.376 17.021  -21.397 1.00 57.51 ? 124 MET B SD  1 
ATOM   3382  C  CE  . MET B  1 144 ? 30.024 15.617  -22.295 1.00 54.03 ? 124 MET B CE  1 
ATOM   3383  N  N   . PRO B  1 145 ? 30.385 20.174  -22.441 1.00 42.46 ? 125 PRO B N   1 
ATOM   3384  C  CA  . PRO B  1 145 ? 31.458 20.587  -21.514 1.00 40.93 ? 125 PRO B CA  1 
ATOM   3385  C  C   . PRO B  1 145 ? 31.409 22.031  -20.991 1.00 38.78 ? 125 PRO B C   1 
ATOM   3386  O  O   . PRO B  1 145 ? 31.809 22.271  -19.855 1.00 37.25 ? 125 PRO B O   1 
ATOM   3387  C  CB  . PRO B  1 145 ? 32.733 20.397  -22.338 1.00 40.11 ? 125 PRO B CB  1 
ATOM   3388  C  CG  . PRO B  1 145 ? 32.359 19.460  -23.463 1.00 43.09 ? 125 PRO B CG  1 
ATOM   3389  C  CD  . PRO B  1 145 ? 30.917 19.765  -23.761 1.00 42.53 ? 125 PRO B CD  1 
ATOM   3390  N  N   . GLY B  1 146 ? 30.982 22.985  -21.826 1.00 36.75 ? 126 GLY B N   1 
ATOM   3391  C  CA  . GLY B  1 146 ? 30.782 24.353  -21.395 1.00 36.53 ? 126 GLY B CA  1 
ATOM   3392  C  C   . GLY B  1 146 ? 29.647 24.473  -20.396 1.00 36.98 ? 126 GLY B C   1 
ATOM   3393  O  O   . GLY B  1 146 ? 29.751 25.192  -19.412 1.00 35.93 ? 126 GLY B O   1 
ATOM   3394  N  N   . LEU B  1 147 ? 28.553 23.763  -20.650 1.00 38.36 ? 127 LEU B N   1 
ATOM   3395  C  CA  . LEU B  1 147 ? 27.446 23.676  -19.697 1.00 39.42 ? 127 LEU B CA  1 
ATOM   3396  C  C   . LEU B  1 147 ? 27.848 23.070  -18.358 1.00 40.25 ? 127 LEU B C   1 
ATOM   3397  O  O   . LEU B  1 147 ? 27.402 23.527  -17.296 1.00 41.13 ? 127 LEU B O   1 
ATOM   3398  C  CB  . LEU B  1 147 ? 26.288 22.878  -20.307 1.00 40.85 ? 127 LEU B CB  1 
ATOM   3399  C  CG  . LEU B  1 147 ? 25.568 23.528  -21.505 1.00 43.69 ? 127 LEU B CG  1 
ATOM   3400  C  CD1 . LEU B  1 147 ? 24.504 22.606  -22.042 1.00 45.20 ? 127 LEU B CD1 1 
ATOM   3401  C  CD2 . LEU B  1 147 ? 24.968 24.887  -21.137 1.00 30.87 ? 127 LEU B CD2 1 
ATOM   3402  N  N   . THR B  1 148 ? 28.656 22.020  -18.423 1.00 39.97 ? 128 THR B N   1 
ATOM   3403  C  CA  . THR B  1 148 ? 29.228 21.365  -17.225 1.00 39.41 ? 128 THR B CA  1 
ATOM   3404  C  C   . THR B  1 148 ? 29.954 22.360  -16.329 1.00 40.59 ? 128 THR B C   1 
ATOM   3405  O  O   . THR B  1 148 ? 29.690 22.454  -15.124 1.00 40.04 ? 128 THR B O   1 
ATOM   3406  C  CB  . THR B  1 148 ? 30.144 20.182  -17.641 1.00 39.68 ? 128 THR B CB  1 
ATOM   3407  O  OG1 . THR B  1 148 ? 29.383 19.279  -18.445 1.00 37.88 ? 128 THR B OG1 1 
ATOM   3408  C  CG2 . THR B  1 148 ? 30.646 19.383  -16.428 1.00 44.76 ? 128 THR B CG2 1 
ATOM   3409  N  N   . ALA B  1 149 ? 30.811 23.157  -16.951 1.00 42.72 ? 129 ALA B N   1 
ATOM   3410  C  CA  . ALA B  1 149 ? 31.546 24.219  -16.287 1.00 40.55 ? 129 ALA B CA  1 
ATOM   3411  C  C   . ALA B  1 149 ? 30.617 25.252  -15.699 1.00 40.49 ? 129 ALA B C   1 
ATOM   3412  O  O   . ALA B  1 149 ? 30.742 25.661  -14.525 1.00 39.91 ? 129 ALA B O   1 
ATOM   3413  C  CB  . ALA B  1 149 ? 32.492 24.863  -17.281 1.00 39.03 ? 129 ALA B CB  1 
ATOM   3414  N  N   . TYR B  1 150 ? 29.692 25.696  -16.546 1.00 40.32 ? 130 TYR B N   1 
ATOM   3415  C  CA  . TYR B  1 150 ? 28.766 26.782  -16.225 1.00 39.09 ? 130 TYR B CA  1 
ATOM   3416  C  C   . TYR B  1 150 ? 28.005 26.420  -14.926 1.00 40.50 ? 130 TYR B C   1 
ATOM   3417  O  O   . TYR B  1 150 ? 28.085 27.142  -13.942 1.00 41.31 ? 130 TYR B O   1 
ATOM   3418  C  CB  . TYR B  1 150 ? 27.828 26.997  -17.443 1.00 39.32 ? 130 TYR B CB  1 
ATOM   3419  C  CG  . TYR B  1 150 ? 26.820 28.109  -17.328 1.00 38.95 ? 130 TYR B CG  1 
ATOM   3420  C  CD1 . TYR B  1 150 ? 27.031 29.333  -17.955 1.00 41.30 ? 130 TYR B CD1 1 
ATOM   3421  C  CD2 . TYR B  1 150 ? 25.639 27.943  -16.585 1.00 45.40 ? 130 TYR B CD2 1 
ATOM   3422  C  CE1 . TYR B  1 150 ? 26.111 30.366  -17.844 1.00 34.73 ? 130 TYR B CE1 1 
ATOM   3423  C  CE2 . TYR B  1 150 ? 24.704 28.975  -16.462 1.00 34.82 ? 130 TYR B CE2 1 
ATOM   3424  C  CZ  . TYR B  1 150 ? 24.940 30.182  -17.098 1.00 42.67 ? 130 TYR B CZ  1 
ATOM   3425  O  OH  . TYR B  1 150 ? 24.002 31.220  -16.989 1.00 43.20 ? 130 TYR B OH  1 
ATOM   3426  N  N   . PHE B  1 151 ? 27.290 25.291  -14.937 1.00 39.35 ? 131 PHE B N   1 
ATOM   3427  C  CA  . PHE B  1 151 ? 26.465 24.851  -13.804 1.00 38.84 ? 131 PHE B CA  1 
ATOM   3428  C  C   . PHE B  1 151 ? 27.261 24.361  -12.594 1.00 38.34 ? 131 PHE B C   1 
ATOM   3429  O  O   . PHE B  1 151 ? 26.875 24.590  -11.477 1.00 39.91 ? 131 PHE B O   1 
ATOM   3430  C  CB  . PHE B  1 151 ? 25.457 23.776  -14.259 1.00 38.29 ? 131 PHE B CB  1 
ATOM   3431  C  CG  . PHE B  1 151 ? 24.401 24.311  -15.177 1.00 38.25 ? 131 PHE B CG  1 
ATOM   3432  C  CD1 . PHE B  1 151 ? 23.572 25.352  -14.766 1.00 38.14 ? 131 PHE B CD1 1 
ATOM   3433  C  CD2 . PHE B  1 151 ? 24.269 23.811  -16.482 1.00 46.72 ? 131 PHE B CD2 1 
ATOM   3434  C  CE1 . PHE B  1 151 ? 22.581 25.882  -15.643 1.00 39.61 ? 131 PHE B CE1 1 
ATOM   3435  C  CE2 . PHE B  1 151 ? 23.315 24.331  -17.367 1.00 43.38 ? 131 PHE B CE2 1 
ATOM   3436  C  CZ  . PHE B  1 151 ? 22.460 25.363  -16.941 1.00 40.71 ? 131 PHE B CZ  1 
ATOM   3437  N  N   . GLY B  1 152 ? 28.373 23.699  -12.808 1.00 39.68 ? 132 GLY B N   1 
ATOM   3438  C  CA  . GLY B  1 152 ? 29.206 23.307  -11.691 1.00 41.47 ? 132 GLY B CA  1 
ATOM   3439  C  C   . GLY B  1 152 ? 29.760 24.483  -10.916 1.00 41.63 ? 132 GLY B C   1 
ATOM   3440  O  O   . GLY B  1 152 ? 29.813 24.461  -9.703  1.00 42.69 ? 132 GLY B O   1 
ATOM   3441  N  N   . LEU B  1 153 ? 30.151 25.510  -11.644 1.00 42.44 ? 133 LEU B N   1 
ATOM   3442  C  CA  . LEU B  1 153 ? 30.737 26.716  -11.079 1.00 43.24 ? 133 LEU B CA  1 
ATOM   3443  C  C   . LEU B  1 153 ? 29.680 27.644  -10.477 1.00 43.32 ? 133 LEU B C   1 
ATOM   3444  O  O   . LEU B  1 153 ? 29.756 28.012  -9.284  1.00 42.38 ? 133 LEU B O   1 
ATOM   3445  C  CB  . LEU B  1 153 ? 31.568 27.470  -12.155 1.00 41.28 ? 133 LEU B CB  1 
ATOM   3446  C  CG  . LEU B  1 153 ? 32.391 28.627  -11.566 1.00 44.18 ? 133 LEU B CG  1 
ATOM   3447  C  CD1 . LEU B  1 153 ? 33.444 28.152  -10.534 1.00 40.92 ? 133 LEU B CD1 1 
ATOM   3448  C  CD2 . LEU B  1 153 ? 33.019 29.400  -12.630 1.00 42.04 ? 133 LEU B CD2 1 
ATOM   3449  N  N   . LEU B  1 154 ? 28.693 28.017  -11.288 1.00 42.62 ? 134 LEU B N   1 
ATOM   3450  C  CA  . LEU B  1 154 ? 27.766 29.040  -10.888 1.00 43.39 ? 134 LEU B CA  1 
ATOM   3451  C  C   . LEU B  1 154 ? 26.669 28.511  -9.978  1.00 45.12 ? 134 LEU B C   1 
ATOM   3452  O  O   . LEU B  1 154 ? 26.188 29.266  -9.148  1.00 46.28 ? 134 LEU B O   1 
ATOM   3453  C  CB  . LEU B  1 154 ? 27.198 29.804  -12.101 1.00 44.39 ? 134 LEU B CB  1 
ATOM   3454  C  CG  . LEU B  1 154 ? 28.224 30.406  -13.084 1.00 39.15 ? 134 LEU B CG  1 
ATOM   3455  C  CD1 . LEU B  1 154 ? 27.540 30.984  -14.289 1.00 34.96 ? 134 LEU B CD1 1 
ATOM   3456  C  CD2 . LEU B  1 154 ? 29.109 31.433  -12.390 1.00 42.08 ? 134 LEU B CD2 1 
ATOM   3457  N  N   . GLU B  1 155 ? 26.303 27.235  -10.084 1.00 47.40 ? 135 GLU B N   1 
ATOM   3458  C  CA  . GLU B  1 155 ? 25.279 26.637  -9.211  1.00 49.24 ? 135 GLU B CA  1 
ATOM   3459  C  C   . GLU B  1 155 ? 25.809 25.771  -8.073  1.00 50.41 ? 135 GLU B C   1 
ATOM   3460  O  O   . GLU B  1 155 ? 25.333 25.860  -6.961  1.00 50.44 ? 135 GLU B O   1 
ATOM   3461  C  CB  . GLU B  1 155 ? 24.383 25.734  -10.019 1.00 52.44 ? 135 GLU B CB  1 
ATOM   3462  C  CG  . GLU B  1 155 ? 23.713 26.414  -11.175 1.00 60.20 ? 135 GLU B CG  1 
ATOM   3463  C  CD  . GLU B  1 155 ? 22.221 26.526  -10.993 1.00 68.17 ? 135 GLU B CD  1 
ATOM   3464  O  OE1 . GLU B  1 155 ? 21.627 25.630  -10.329 1.00 70.11 ? 135 GLU B OE1 1 
ATOM   3465  O  OE2 . GLU B  1 155 ? 21.652 27.509  -11.523 1.00 71.94 ? 135 GLU B OE2 1 
ATOM   3466  N  N   . ILE B  1 156 ? 26.763 24.897  -8.348  1.00 50.02 ? 136 ILE B N   1 
ATOM   3467  C  CA  . ILE B  1 156 ? 27.199 23.975  -7.315  1.00 51.38 ? 136 ILE B CA  1 
ATOM   3468  C  C   . ILE B  1 156 ? 28.249 24.614  -6.393  1.00 53.97 ? 136 ILE B C   1 
ATOM   3469  O  O   . ILE B  1 156 ? 28.036 24.659  -5.186  1.00 55.72 ? 136 ILE B O   1 
ATOM   3470  C  CB  . ILE B  1 156 ? 27.592 22.556  -7.893  1.00 50.14 ? 136 ILE B CB  1 
ATOM   3471  C  CG1 . ILE B  1 156 ? 26.338 21.791  -8.247  1.00 48.73 ? 136 ILE B CG1 1 
ATOM   3472  C  CG2 . ILE B  1 156 ? 28.277 21.700  -6.861  1.00 42.85 ? 136 ILE B CG2 1 
ATOM   3473  C  CD1 . ILE B  1 156 ? 25.825 22.104  -9.469  1.00 51.87 ? 136 ILE B CD1 1 
ATOM   3474  N  N   . CYS B  1 157 ? 29.348 25.124  -6.954  1.00 54.48 ? 137 CYS B N   1 
ATOM   3475  C  CA  . CYS B  1 157 ? 30.293 25.956  -6.197  1.00 56.18 ? 137 CYS B CA  1 
ATOM   3476  C  C   . CYS B  1 157 ? 29.652 27.256  -5.808  1.00 56.40 ? 137 CYS B C   1 
ATOM   3477  O  O   . CYS B  1 157 ? 30.064 27.867  -4.831  1.00 58.39 ? 137 CYS B O   1 
ATOM   3478  C  CB  . CYS B  1 157 ? 31.530 26.335  -7.017  1.00 58.06 ? 137 CYS B CB  1 
ATOM   3479  S  SG  . CYS B  1 157 ? 32.716 25.036  -7.289  1.00 61.42 ? 137 CYS B SG  1 
ATOM   3480  N  N   . GLY B  1 158 ? 28.708 27.726  -6.620  1.00 56.22 ? 138 GLY B N   1 
ATOM   3481  C  CA  . GLY B  1 158 ? 27.967 28.954  -6.322  1.00 55.05 ? 138 GLY B CA  1 
ATOM   3482  C  C   . GLY B  1 158 ? 28.849 30.178  -6.184  1.00 55.91 ? 138 GLY B C   1 
ATOM   3483  O  O   . GLY B  1 158 ? 28.593 31.012  -5.316  1.00 57.31 ? 138 GLY B O   1 
ATOM   3484  N  N   . VAL B  1 159 ? 29.890 30.307  -7.020  1.00 57.85 ? 139 VAL B N   1 
ATOM   3485  C  CA  . VAL B  1 159 ? 30.813 31.457  -6.906  1.00 58.33 ? 139 VAL B CA  1 
ATOM   3486  C  C   . VAL B  1 159 ? 30.021 32.761  -7.067  1.00 59.82 ? 139 VAL B C   1 
ATOM   3487  O  O   . VAL B  1 159 ? 29.141 32.854  -7.921  1.00 58.98 ? 139 VAL B O   1 
ATOM   3488  C  CB  . VAL B  1 159 ? 32.024 31.447  -7.925  1.00 56.38 ? 139 VAL B CB  1 
ATOM   3489  C  CG1 . VAL B  1 159 ? 32.916 30.255  -7.710  1.00 51.18 ? 139 VAL B CG1 1 
ATOM   3490  C  CG2 . VAL B  1 159 ? 31.536 31.562  -9.367  1.00 54.63 ? 139 VAL B CG2 1 
ATOM   3491  N  N   . LYS B  1 160 ? 30.314 33.736  -6.210  1.00 62.72 ? 140 LYS B N   1 
ATOM   3492  C  CA  . LYS B  1 160 ? 29.682 35.060  -6.277  1.00 64.93 ? 140 LYS B CA  1 
ATOM   3493  C  C   . LYS B  1 160 ? 30.694 36.092  -6.810  1.00 65.09 ? 140 LYS B C   1 
ATOM   3494  O  O   . LYS B  1 160 ? 30.303 37.014  -7.524  1.00 67.06 ? 140 LYS B O   1 
ATOM   3495  C  CB  . LYS B  1 160 ? 29.113 35.492  -4.901  1.00 65.12 ? 140 LYS B CB  1 
ATOM   3496  C  CG  . LYS B  1 160 ? 28.346 34.380  -4.094  1.00 67.73 ? 140 LYS B CG  1 
ATOM   3497  C  CD  . LYS B  1 160 ? 26.957 34.036  -4.673  1.00 63.74 ? 140 LYS B CD  1 
ATOM   3498  N  N   . GLY B  1 161 ? 31.981 35.923  -6.481  1.00 63.22 ? 141 GLY B N   1 
ATOM   3499  C  CA  . GLY B  1 161 ? 33.024 36.877  -6.880  1.00 62.47 ? 141 GLY B CA  1 
ATOM   3500  C  C   . GLY B  1 161 ? 33.844 37.330  -5.684  1.00 61.02 ? 141 GLY B C   1 
ATOM   3501  O  O   . GLY B  1 161 ? 33.292 37.559  -4.603  1.00 61.32 ? 141 GLY B O   1 
ATOM   3502  N  N   . GLY B  1 162 ? 35.159 37.454  -5.883  1.00 58.57 ? 142 GLY B N   1 
ATOM   3503  C  CA  . GLY B  1 162 ? 36.117 37.698  -4.801  1.00 56.58 ? 142 GLY B CA  1 
ATOM   3504  C  C   . GLY B  1 162 ? 36.712 36.407  -4.244  1.00 56.19 ? 142 GLY B C   1 
ATOM   3505  O  O   . GLY B  1 162 ? 37.645 36.445  -3.430  1.00 55.77 ? 142 GLY B O   1 
ATOM   3506  N  N   . GLU B  1 163 ? 36.178 35.262  -4.685  1.00 54.76 ? 143 GLU B N   1 
ATOM   3507  C  CA  . GLU B  1 163 ? 36.611 33.956  -4.184  1.00 53.07 ? 143 GLU B CA  1 
ATOM   3508  C  C   . GLU B  1 163 ? 37.812 33.440  -4.967  1.00 48.88 ? 143 GLU B C   1 
ATOM   3509  O  O   . GLU B  1 163 ? 38.017 33.794  -6.131  1.00 44.99 ? 143 GLU B O   1 
ATOM   3510  C  CB  . GLU B  1 163 ? 35.481 32.936  -4.295  1.00 55.93 ? 143 GLU B CB  1 
ATOM   3511  C  CG  . GLU B  1 163 ? 34.255 33.289  -3.458  1.00 62.40 ? 143 GLU B CG  1 
ATOM   3512  C  CD  . GLU B  1 163 ? 32.938 33.103  -4.216  1.00 70.49 ? 143 GLU B CD  1 
ATOM   3513  O  OE1 . GLU B  1 163 ? 32.886 33.484  -5.412  1.00 75.26 ? 143 GLU B OE1 1 
ATOM   3514  O  OE2 . GLU B  1 163 ? 31.946 32.619  -3.609  1.00 61.55 ? 143 GLU B OE2 1 
ATOM   3515  N  N   . THR B  1 164 ? 38.615 32.624  -4.294  1.00 47.31 ? 144 THR B N   1 
ATOM   3516  C  CA  . THR B  1 164 ? 39.702 31.887  -4.945  1.00 46.07 ? 144 THR B CA  1 
ATOM   3517  C  C   . THR B  1 164 ? 39.250 30.471  -5.295  1.00 43.01 ? 144 THR B C   1 
ATOM   3518  O  O   . THR B  1 164 ? 38.889 29.682  -4.425  1.00 40.97 ? 144 THR B O   1 
ATOM   3519  C  CB  . THR B  1 164 ? 40.964 31.806  -4.071  1.00 46.54 ? 144 THR B CB  1 
ATOM   3520  O  OG1 . THR B  1 164 ? 41.349 33.126  -3.635  1.00 49.23 ? 144 THR B OG1 1 
ATOM   3521  C  CG2 . THR B  1 164 ? 42.098 31.159  -4.852  1.00 45.72 ? 144 THR B CG2 1 
ATOM   3522  N  N   . VAL B  1 165 ? 39.296 30.181  -6.587  1.00 42.88 ? 145 VAL B N   1 
ATOM   3523  C  CA  . VAL B  1 165 ? 38.870 28.924  -7.169  1.00 43.13 ? 145 VAL B CA  1 
ATOM   3524  C  C   . VAL B  1 165 ? 40.035 28.036  -7.601  1.00 40.26 ? 145 VAL B C   1 
ATOM   3525  O  O   . VAL B  1 165 ? 40.857 28.429  -8.406  1.00 39.83 ? 145 VAL B O   1 
ATOM   3526  C  CB  . VAL B  1 165 ? 37.992 29.201  -8.430  1.00 43.57 ? 145 VAL B CB  1 
ATOM   3527  C  CG1 . VAL B  1 165 ? 37.388 27.891  -8.986  1.00 47.67 ? 145 VAL B CG1 1 
ATOM   3528  C  CG2 . VAL B  1 165 ? 36.861 30.173  -8.076  1.00 44.66 ? 145 VAL B CG2 1 
ATOM   3529  N  N   . MET B  1 166 ? 40.068 26.812  -7.111  1.00 40.39 ? 146 MET B N   1 
ATOM   3530  C  CA  . MET B  1 166 ? 40.996 25.819  -7.638  1.00 39.93 ? 146 MET B CA  1 
ATOM   3531  C  C   . MET B  1 166 ? 40.338 24.997  -8.756  1.00 39.26 ? 146 MET B C   1 
ATOM   3532  O  O   . MET B  1 166 ? 39.319 24.376  -8.540  1.00 37.34 ? 146 MET B O   1 
ATOM   3533  C  CB  . MET B  1 166 ? 41.410 24.887  -6.516  1.00 42.67 ? 146 MET B CB  1 
ATOM   3534  C  CG  . MET B  1 166 ? 42.172 23.654  -6.975  1.00 50.02 ? 146 MET B CG  1 
ATOM   3535  S  SD  . MET B  1 166 ? 43.826 24.126  -7.269  1.00 64.39 ? 146 MET B SD  1 
ATOM   3536  C  CE  . MET B  1 166 ? 44.130 23.329  -8.837  1.00 55.45 ? 146 MET B CE  1 
ATOM   3537  N  N   . VAL B  1 167 ? 40.907 24.973  -9.956  1.00 40.83 ? 147 VAL B N   1 
ATOM   3538  C  CA  . VAL B  1 167 ? 40.414 24.031  -10.972 1.00 41.90 ? 147 VAL B CA  1 
ATOM   3539  C  C   . VAL B  1 167 ? 41.535 23.115  -11.504 1.00 41.38 ? 147 VAL B C   1 
ATOM   3540  O  O   . VAL B  1 167 ? 42.597 23.557  -11.810 1.00 41.25 ? 147 VAL B O   1 
ATOM   3541  C  CB  . VAL B  1 167 ? 39.642 24.734  -12.125 1.00 43.78 ? 147 VAL B CB  1 
ATOM   3542  C  CG1 . VAL B  1 167 ? 40.385 25.888  -12.695 1.00 48.07 ? 147 VAL B CG1 1 
ATOM   3543  C  CG2 . VAL B  1 167 ? 39.296 23.725  -13.247 1.00 46.86 ? 147 VAL B CG2 1 
ATOM   3544  N  N   . ASN B  1 168 ? 41.266 21.819  -11.573 1.00 44.67 ? 148 ASN B N   1 
ATOM   3545  C  CA  . ASN B  1 168 ? 42.179 20.833  -12.141 1.00 45.72 ? 148 ASN B CA  1 
ATOM   3546  C  C   . ASN B  1 168 ? 41.624 20.287  -13.471 1.00 46.69 ? 148 ASN B C   1 
ATOM   3547  O  O   . ASN B  1 168 ? 40.458 20.504  -13.805 1.00 49.59 ? 148 ASN B O   1 
ATOM   3548  C  CB  . ASN B  1 168 ? 42.475 19.700  -11.126 1.00 44.94 ? 148 ASN B CB  1 
ATOM   3549  C  CG  . ASN B  1 168 ? 41.226 18.989  -10.664 1.00 42.89 ? 148 ASN B CG  1 
ATOM   3550  O  OD1 . ASN B  1 168 ? 40.269 18.838  -11.433 1.00 36.63 ? 148 ASN B OD1 1 
ATOM   3551  N  ND2 . ASN B  1 168 ? 41.229 18.526  -9.408  1.00 35.82 ? 148 ASN B ND2 1 
ATOM   3552  N  N   . ALA B  1 169 ? 42.469 19.550  -14.193 1.00 47.65 ? 149 ALA B N   1 
ATOM   3553  C  CA  . ALA B  1 169 ? 42.337 19.319  -15.643 1.00 44.79 ? 149 ALA B CA  1 
ATOM   3554  C  C   . ALA B  1 169 ? 41.882 20.604  -16.324 1.00 42.63 ? 149 ALA B C   1 
ATOM   3555  O  O   . ALA B  1 169 ? 40.962 20.601  -17.138 1.00 43.35 ? 149 ALA B O   1 
ATOM   3556  C  CB  . ALA B  1 169 ? 41.431 18.155  -15.931 1.00 46.47 ? 149 ALA B CB  1 
ATOM   3557  N  N   . ALA B  1 170 ? 42.612 21.679  -16.010 1.00 41.25 ? 150 ALA B N   1 
ATOM   3558  C  CA  . ALA B  1 170 ? 42.181 23.073  -16.223 1.00 41.90 ? 150 ALA B CA  1 
ATOM   3559  C  C   . ALA B  1 170 ? 42.348 23.602  -17.636 1.00 44.89 ? 150 ALA B C   1 
ATOM   3560  O  O   . ALA B  1 170 ? 41.946 24.725  -17.921 1.00 47.27 ? 150 ALA B O   1 
ATOM   3561  C  CB  . ALA B  1 170 ? 42.931 24.012  -15.243 1.00 40.79 ? 150 ALA B CB  1 
ATOM   3562  N  N   . ALA B  1 171 ? 43.002 22.829  -18.489 1.00 46.32 ? 151 ALA B N   1 
ATOM   3563  C  CA  . ALA B  1 171 ? 43.129 23.139  -19.910 1.00 48.63 ? 151 ALA B CA  1 
ATOM   3564  C  C   . ALA B  1 171 ? 42.320 22.148  -20.714 1.00 49.26 ? 151 ALA B C   1 
ATOM   3565  O  O   . ALA B  1 171 ? 42.410 22.134  -21.937 1.00 53.53 ? 151 ALA B O   1 
ATOM   3566  C  CB  . ALA B  1 171 ? 44.613 23.109  -20.367 1.00 49.05 ? 151 ALA B CB  1 
ATOM   3567  N  N   . GLY B  1 172 ? 41.521 21.339  -20.017 1.00 49.00 ? 152 GLY B N   1 
ATOM   3568  C  CA  . GLY B  1 172 ? 40.619 20.413  -20.638 1.00 46.29 ? 152 GLY B CA  1 
ATOM   3569  C  C   . GLY B  1 172 ? 39.364 21.160  -21.028 1.00 47.94 ? 152 GLY B C   1 
ATOM   3570  O  O   . GLY B  1 172 ? 39.225 22.372  -20.778 1.00 48.47 ? 152 GLY B O   1 
ATOM   3571  N  N   . ALA B  1 173 ? 38.442 20.410  -21.619 1.00 47.50 ? 153 ALA B N   1 
ATOM   3572  C  CA  . ALA B  1 173 ? 37.198 20.935  -22.150 1.00 47.73 ? 153 ALA B CA  1 
ATOM   3573  C  C   . ALA B  1 173 ? 36.373 21.725  -21.102 1.00 45.46 ? 153 ALA B C   1 
ATOM   3574  O  O   . ALA B  1 173 ? 35.928 22.846  -21.373 1.00 47.48 ? 153 ALA B O   1 
ATOM   3575  C  CB  . ALA B  1 173 ? 36.372 19.746  -22.730 1.00 49.51 ? 153 ALA B CB  1 
ATOM   3576  N  N   . VAL B  1 174 ? 36.208 21.114  -19.927 1.00 44.43 ? 154 VAL B N   1 
ATOM   3577  C  CA  . VAL B  1 174 ? 35.432 21.621  -18.816 1.00 42.52 ? 154 VAL B CA  1 
ATOM   3578  C  C   . VAL B  1 174 ? 36.269 22.660  -18.094 1.00 42.24 ? 154 VAL B C   1 
ATOM   3579  O  O   . VAL B  1 174 ? 35.835 23.812  -17.955 1.00 41.44 ? 154 VAL B O   1 
ATOM   3580  C  CB  . VAL B  1 174 ? 34.991 20.486  -17.844 1.00 42.64 ? 154 VAL B CB  1 
ATOM   3581  C  CG1 . VAL B  1 174 ? 34.228 21.036  -16.612 1.00 37.92 ? 154 VAL B CG1 1 
ATOM   3582  C  CG2 . VAL B  1 174 ? 34.138 19.366  -18.574 1.00 44.84 ? 154 VAL B CG2 1 
ATOM   3583  N  N   . GLY B  1 175 ? 37.474 22.271  -17.666 1.00 42.37 ? 155 GLY B N   1 
ATOM   3584  C  CA  . GLY B  1 175 ? 38.320 23.133  -16.808 1.00 40.67 ? 155 GLY B CA  1 
ATOM   3585  C  C   . GLY B  1 175 ? 38.690 24.536  -17.316 1.00 41.18 ? 155 GLY B C   1 
ATOM   3586  O  O   . GLY B  1 175 ? 38.763 25.496  -16.506 1.00 37.74 ? 155 GLY B O   1 
ATOM   3587  N  N   . SER B  1 176 ? 38.942 24.645  -18.638 1.00 40.33 ? 156 SER B N   1 
ATOM   3588  C  CA  . SER B  1 176 ? 39.258 25.923  -19.287 1.00 42.64 ? 156 SER B CA  1 
ATOM   3589  C  C   . SER B  1 176 ? 38.066 26.825  -19.335 1.00 42.07 ? 156 SER B C   1 
ATOM   3590  O  O   . SER B  1 176 ? 38.224 28.033  -19.337 1.00 43.02 ? 156 SER B O   1 
ATOM   3591  C  CB  . SER B  1 176 ? 39.758 25.746  -20.724 1.00 42.89 ? 156 SER B CB  1 
ATOM   3592  O  OG  . SER B  1 176 ? 38.949 24.800  -21.385 1.00 45.72 ? 156 SER B OG  1 
ATOM   3593  N  N   . VAL B  1 177 ? 36.864 26.261  -19.403 1.00 40.83 ? 157 VAL B N   1 
ATOM   3594  C  CA  . VAL B  1 177 ? 35.724 27.139  -19.422 1.00 40.72 ? 157 VAL B CA  1 
ATOM   3595  C  C   . VAL B  1 177 ? 35.459 27.625  -17.997 1.00 40.43 ? 157 VAL B C   1 
ATOM   3596  O  O   . VAL B  1 177 ? 35.198 28.835  -17.764 1.00 39.67 ? 157 VAL B O   1 
ATOM   3597  C  CB  . VAL B  1 177 ? 34.527 26.480  -20.029 1.00 42.04 ? 157 VAL B CB  1 
ATOM   3598  C  CG1 . VAL B  1 177 ? 33.282 27.374  -19.819 1.00 39.53 ? 157 VAL B CG1 1 
ATOM   3599  C  CG2 . VAL B  1 177 ? 34.799 26.227  -21.503 1.00 41.64 ? 157 VAL B CG2 1 
ATOM   3600  N  N   . VAL B  1 178 ? 35.545 26.688  -17.053 1.00 39.73 ? 158 VAL B N   1 
ATOM   3601  C  CA  . VAL B  1 178 ? 35.333 27.002  -15.627 1.00 41.13 ? 158 VAL B CA  1 
ATOM   3602  C  C   . VAL B  1 178 ? 36.190 28.216  -15.267 1.00 42.75 ? 158 VAL B C   1 
ATOM   3603  O  O   . VAL B  1 178 ? 35.713 29.173  -14.622 1.00 43.34 ? 158 VAL B O   1 
ATOM   3604  C  CB  . VAL B  1 178 ? 35.710 25.821  -14.710 1.00 40.90 ? 158 VAL B CB  1 
ATOM   3605  C  CG1 . VAL B  1 178 ? 35.768 26.249  -13.232 1.00 43.90 ? 158 VAL B CG1 1 
ATOM   3606  C  CG2 . VAL B  1 178 ? 34.763 24.684  -14.893 1.00 46.25 ? 158 VAL B CG2 1 
ATOM   3607  N  N   . GLY B  1 179 ? 37.447 28.162  -15.711 1.00 42.97 ? 159 GLY B N   1 
ATOM   3608  C  CA  . GLY B  1 179 ? 38.447 29.147  -15.352 1.00 43.28 ? 159 GLY B CA  1 
ATOM   3609  C  C   . GLY B  1 179 ? 38.179 30.510  -15.921 1.00 41.64 ? 159 GLY B C   1 
ATOM   3610  O  O   . GLY B  1 179 ? 38.435 31.496  -15.268 1.00 41.28 ? 159 GLY B O   1 
ATOM   3611  N  N   . GLN B  1 180 ? 37.680 30.537  -17.153 1.00 43.90 ? 160 GLN B N   1 
ATOM   3612  C  CA  . GLN B  1 180 ? 37.355 31.766  -17.881 1.00 41.41 ? 160 GLN B CA  1 
ATOM   3613  C  C   . GLN B  1 180 ? 36.039 32.426  -17.416 1.00 42.38 ? 160 GLN B C   1 
ATOM   3614  O  O   . GLN B  1 180 ? 35.927 33.648  -17.384 1.00 45.08 ? 160 GLN B O   1 
ATOM   3615  C  CB  . GLN B  1 180 ? 37.262 31.447  -19.369 1.00 42.71 ? 160 GLN B CB  1 
ATOM   3616  C  CG  . GLN B  1 180 ? 38.596 31.027  -19.971 1.00 42.73 ? 160 GLN B CG  1 
ATOM   3617  C  CD  . GLN B  1 180 ? 38.501 30.698  -21.427 1.00 37.31 ? 160 GLN B CD  1 
ATOM   3618  O  OE1 . GLN B  1 180 ? 38.754 31.549  -22.266 1.00 42.38 ? 160 GLN B OE1 1 
ATOM   3619  N  NE2 . GLN B  1 180 ? 38.139 29.462  -21.749 1.00 44.71 ? 160 GLN B NE2 1 
ATOM   3620  N  N   . ILE B  1 181 ? 35.043 31.623  -17.088 1.00 41.32 ? 161 ILE B N   1 
ATOM   3621  C  CA  . ILE B  1 181 ? 33.840 32.133  -16.458 1.00 40.89 ? 161 ILE B CA  1 
ATOM   3622  C  C   . ILE B  1 181 ? 34.174 32.687  -15.079 1.00 42.08 ? 161 ILE B C   1 
ATOM   3623  O  O   . ILE B  1 181 ? 33.603 33.663  -14.642 1.00 42.57 ? 161 ILE B O   1 
ATOM   3624  C  CB  . ILE B  1 181 ? 32.763 31.007  -16.284 1.00 43.02 ? 161 ILE B CB  1 
ATOM   3625  C  CG1 . ILE B  1 181 ? 32.206 30.560  -17.649 1.00 36.97 ? 161 ILE B CG1 1 
ATOM   3626  C  CG2 . ILE B  1 181 ? 31.606 31.470  -15.324 1.00 44.44 ? 161 ILE B CG2 1 
ATOM   3627  C  CD1 . ILE B  1 181 ? 31.469 29.210  -17.600 1.00 39.32 ? 161 ILE B CD1 1 
ATOM   3628  N  N   . ALA B  1 182 ? 35.070 32.021  -14.367 1.00 43.21 ? 162 ALA B N   1 
ATOM   3629  C  CA  . ALA B  1 182 ? 35.431 32.423  -13.024 1.00 42.17 ? 162 ALA B CA  1 
ATOM   3630  C  C   . ALA B  1 182 ? 36.189 33.751  -13.048 1.00 42.10 ? 162 ALA B C   1 
ATOM   3631  O  O   . ALA B  1 182 ? 35.953 34.664  -12.241 1.00 43.21 ? 162 ALA B O   1 
ATOM   3632  C  CB  . ALA B  1 182 ? 36.244 31.330  -12.367 1.00 42.43 ? 162 ALA B CB  1 
ATOM   3633  N  N   . LYS B  1 183 ? 37.082 33.872  -14.002 1.00 41.31 ? 163 LYS B N   1 
ATOM   3634  C  CA  . LYS B  1 183 ? 37.786 35.125  -14.210 1.00 43.28 ? 163 LYS B CA  1 
ATOM   3635  C  C   . LYS B  1 183 ? 36.828 36.273  -14.474 1.00 43.44 ? 163 LYS B C   1 
ATOM   3636  O  O   . LYS B  1 183 ? 36.936 37.331  -13.855 1.00 46.99 ? 163 LYS B O   1 
ATOM   3637  C  CB  . LYS B  1 183 ? 38.801 35.009  -15.371 1.00 42.23 ? 163 LYS B CB  1 
ATOM   3638  C  CG  . LYS B  1 183 ? 40.122 34.348  -15.004 1.00 43.28 ? 163 LYS B CG  1 
ATOM   3639  C  CD  . LYS B  1 183 ? 40.687 34.825  -13.661 1.00 48.37 ? 163 LYS B CD  1 
ATOM   3640  C  CE  . LYS B  1 183 ? 40.891 36.346  -13.576 1.00 50.54 ? 163 LYS B CE  1 
ATOM   3641  N  NZ  . LYS B  1 183 ? 40.763 36.841  -12.155 1.00 51.63 ? 163 LYS B NZ  1 
ATOM   3642  N  N   . LEU B  1 184 ? 35.900 36.073  -15.391 1.00 42.83 ? 164 LEU B N   1 
ATOM   3643  C  CA  . LEU B  1 184 ? 34.972 37.118  -15.734 1.00 45.59 ? 164 LEU B CA  1 
ATOM   3644  C  C   . LEU B  1 184 ? 33.933 37.443  -14.654 1.00 45.31 ? 164 LEU B C   1 
ATOM   3645  O  O   . LEU B  1 184 ? 33.341 38.497  -14.709 1.00 49.72 ? 164 LEU B O   1 
ATOM   3646  C  CB  . LEU B  1 184 ? 34.308 36.826  -17.081 1.00 45.41 ? 164 LEU B CB  1 
ATOM   3647  C  CG  . LEU B  1 184 ? 33.184 35.814  -17.156 1.00 48.51 ? 164 LEU B CG  1 
ATOM   3648  C  CD1 . LEU B  1 184 ? 31.880 36.313  -16.511 1.00 49.19 ? 164 LEU B CD1 1 
ATOM   3649  C  CD2 . LEU B  1 184 ? 32.992 35.491  -18.613 1.00 48.47 ? 164 LEU B CD2 1 
ATOM   3650  N  N   . LYS B  1 185 ? 33.713 36.566  -13.684 1.00 47.09 ? 165 LYS B N   1 
ATOM   3651  C  CA  . LYS B  1 185 ? 32.874 36.870  -12.516 1.00 47.36 ? 165 LYS B CA  1 
ATOM   3652  C  C   . LYS B  1 185 ? 33.711 37.455  -11.356 1.00 48.70 ? 165 LYS B C   1 
ATOM   3653  O  O   . LYS B  1 185 ? 33.184 37.640  -10.259 1.00 51.81 ? 165 LYS B O   1 
ATOM   3654  C  CB  . LYS B  1 185 ? 32.134 35.616  -12.016 1.00 47.94 ? 165 LYS B CB  1 
ATOM   3655  C  CG  . LYS B  1 185 ? 31.201 34.937  -13.033 1.00 49.17 ? 165 LYS B CG  1 
ATOM   3656  C  CD  . LYS B  1 185 ? 29.805 35.561  -13.081 1.00 50.68 ? 165 LYS B CD  1 
ATOM   3657  C  CE  . LYS B  1 185 ? 29.018 35.088  -14.311 1.00 52.49 ? 165 LYS B CE  1 
ATOM   3658  N  NZ  . LYS B  1 185 ? 27.695 35.789  -14.448 1.00 52.96 ? 165 LYS B NZ  1 
ATOM   3659  N  N   . GLY B  1 186 ? 35.008 37.694  -11.587 1.00 47.92 ? 166 GLY B N   1 
ATOM   3660  C  CA  . GLY B  1 186 ? 35.904 38.356  -10.629 1.00 47.41 ? 166 GLY B CA  1 
ATOM   3661  C  C   . GLY B  1 186 ? 36.497 37.445  -9.576  1.00 48.61 ? 166 GLY B C   1 
ATOM   3662  O  O   . GLY B  1 186 ? 36.556 37.804  -8.400  1.00 48.13 ? 166 GLY B O   1 
ATOM   3663  N  N   . CYS B  1 187 ? 36.933 36.259  -9.988  1.00 48.43 ? 167 CYS B N   1 
ATOM   3664  C  CA  . CYS B  1 187 ? 37.594 35.323  -9.071  1.00 49.00 ? 167 CYS B CA  1 
ATOM   3665  C  C   . CYS B  1 187 ? 39.064 35.195  -9.381  1.00 46.86 ? 167 CYS B C   1 
ATOM   3666  O  O   . CYS B  1 187 ? 39.467 35.344  -10.521 1.00 48.48 ? 167 CYS B O   1 
ATOM   3667  C  CB  . CYS B  1 187 ? 36.958 33.937  -9.170  1.00 49.34 ? 167 CYS B CB  1 
ATOM   3668  S  SG  . CYS B  1 187 ? 35.193 34.004  -8.881  1.00 58.73 ? 167 CYS B SG  1 
ATOM   3669  N  N   . LYS B  1 188 ? 39.858 34.905  -8.360  1.00 45.13 ? 168 LYS B N   1 
ATOM   3670  C  CA  . LYS B  1 188 ? 41.211 34.401  -8.553  1.00 44.27 ? 168 LYS B CA  1 
ATOM   3671  C  C   . LYS B  1 188 ? 41.127 32.920  -8.925  1.00 43.30 ? 168 LYS B C   1 
ATOM   3672  O  O   . LYS B  1 188 ? 40.457 32.146  -8.266  1.00 42.77 ? 168 LYS B O   1 
ATOM   3673  C  CB  . LYS B  1 188 ? 42.039 34.582  -7.279  1.00 44.09 ? 168 LYS B CB  1 
ATOM   3674  C  CG  . LYS B  1 188 ? 43.519 34.386  -7.485  1.00 47.07 ? 168 LYS B CG  1 
ATOM   3675  C  CD  . LYS B  1 188 ? 44.287 34.438  -6.190  1.00 47.73 ? 168 LYS B CD  1 
ATOM   3676  C  CE  . LYS B  1 188 ? 45.463 33.453  -6.212  1.00 51.60 ? 168 LYS B CE  1 
ATOM   3677  N  NZ  . LYS B  1 188 ? 46.369 33.624  -5.036  1.00 48.75 ? 168 LYS B NZ  1 
ATOM   3678  N  N   . VAL B  1 189 ? 41.796 32.528  -9.994  1.00 43.31 ? 169 VAL B N   1 
ATOM   3679  C  CA  . VAL B  1 189 ? 41.708 31.166  -10.473 1.00 43.91 ? 169 VAL B CA  1 
ATOM   3680  C  C   . VAL B  1 189 ? 43.094 30.546  -10.438 1.00 42.19 ? 169 VAL B C   1 
ATOM   3681  O  O   . VAL B  1 189 ? 44.029 31.106  -10.995 1.00 42.63 ? 169 VAL B O   1 
ATOM   3682  C  CB  . VAL B  1 189 ? 41.135 31.104  -11.923 1.00 46.59 ? 169 VAL B CB  1 
ATOM   3683  C  CG1 . VAL B  1 189 ? 41.211 29.692  -12.490 1.00 50.56 ? 169 VAL B CG1 1 
ATOM   3684  C  CG2 . VAL B  1 189 ? 39.696 31.592  -11.948 1.00 50.85 ? 169 VAL B CG2 1 
ATOM   3685  N  N   . VAL B  1 190 ? 43.195 29.380  -9.797  1.00 41.89 ? 170 VAL B N   1 
ATOM   3686  C  CA  . VAL B  1 190 ? 44.423 28.595  -9.739  1.00 41.97 ? 170 VAL B CA  1 
ATOM   3687  C  C   . VAL B  1 190 ? 44.163 27.295  -10.489 1.00 41.02 ? 170 VAL B C   1 
ATOM   3688  O  O   . VAL B  1 190 ? 43.339 26.517  -10.068 1.00 40.26 ? 170 VAL B O   1 
ATOM   3689  C  CB  . VAL B  1 190 ? 44.879 28.297  -8.264  1.00 40.22 ? 170 VAL B CB  1 
ATOM   3690  C  CG1 . VAL B  1 190 ? 46.210 27.521  -8.243  1.00 36.51 ? 170 VAL B CG1 1 
ATOM   3691  C  CG2 . VAL B  1 190 ? 44.994 29.598  -7.468  1.00 37.23 ? 170 VAL B CG2 1 
ATOM   3692  N  N   . GLY B  1 191 ? 44.897 27.086  -11.588 1.00 43.40 ? 171 GLY B N   1 
ATOM   3693  C  CA  . GLY B  1 191 ? 44.723 25.931  -12.470 1.00 42.09 ? 171 GLY B CA  1 
ATOM   3694  C  C   . GLY B  1 191 ? 45.887 24.954  -12.470 1.00 40.11 ? 171 GLY B C   1 
ATOM   3695  O  O   . GLY B  1 191 ? 47.025 25.346  -12.520 1.00 41.01 ? 171 GLY B O   1 
ATOM   3696  N  N   . ALA B  1 192 ? 45.577 23.668  -12.418 1.00 41.37 ? 172 ALA B N   1 
ATOM   3697  C  CA  . ALA B  1 192 ? 46.562 22.595  -12.642 1.00 41.22 ? 172 ALA B CA  1 
ATOM   3698  C  C   . ALA B  1 192 ? 46.359 21.907  -13.995 1.00 42.24 ? 172 ALA B C   1 
ATOM   3699  O  O   . ALA B  1 192 ? 45.244 21.591  -14.427 1.00 42.51 ? 172 ALA B O   1 
ATOM   3700  C  CB  . ALA B  1 192 ? 46.553 21.564  -11.539 1.00 36.51 ? 172 ALA B CB  1 
ATOM   3701  N  N   . VAL B  1 193 ? 47.491 21.617  -14.605 1.00 43.03 ? 173 VAL B N   1 
ATOM   3702  C  CA  . VAL B  1 193 ? 47.556 21.249  -15.997 1.00 45.19 ? 173 VAL B CA  1 
ATOM   3703  C  C   . VAL B  1 193 ? 48.629 20.169  -16.124 1.00 46.30 ? 173 VAL B C   1 
ATOM   3704  O  O   . VAL B  1 193 ? 49.451 20.021  -15.207 1.00 47.65 ? 173 VAL B O   1 
ATOM   3705  C  CB  . VAL B  1 193 ? 47.897 22.508  -16.774 1.00 42.66 ? 173 VAL B CB  1 
ATOM   3706  C  CG1 . VAL B  1 193 ? 48.871 22.235  -17.807 1.00 46.53 ? 173 VAL B CG1 1 
ATOM   3707  C  CG2 . VAL B  1 193 ? 46.623 23.184  -17.276 1.00 35.43 ? 173 VAL B CG2 1 
ATOM   3708  N  N   . GLY B  1 194 ? 48.618 19.422  -17.230 1.00 47.50 ? 174 GLY B N   1 
ATOM   3709  C  CA  . GLY B  1 194 ? 49.550 18.297  -17.420 1.00 49.00 ? 174 GLY B CA  1 
ATOM   3710  C  C   . GLY B  1 194 ? 50.762 18.507  -18.324 1.00 48.49 ? 174 GLY B C   1 
ATOM   3711  O  O   . GLY B  1 194 ? 51.627 17.645  -18.388 1.00 48.68 ? 174 GLY B O   1 
ATOM   3712  N  N   . SER B  1 195 ? 50.815 19.627  -19.040 1.00 49.72 ? 175 SER B N   1 
ATOM   3713  C  CA  . SER B  1 195 ? 51.961 19.968  -19.903 1.00 49.10 ? 175 SER B CA  1 
ATOM   3714  C  C   . SER B  1 195 ? 52.314 21.446  -19.768 1.00 48.91 ? 175 SER B C   1 
ATOM   3715  O  O   . SER B  1 195 ? 51.506 22.240  -19.313 1.00 45.90 ? 175 SER B O   1 
ATOM   3716  C  CB  . SER B  1 195 ? 51.681 19.583  -21.378 1.00 49.08 ? 175 SER B CB  1 
ATOM   3717  O  OG  . SER B  1 195 ? 50.728 20.422  -22.034 1.00 49.13 ? 175 SER B OG  1 
ATOM   3718  N  N   . ASP B  1 196 ? 53.544 21.796  -20.133 1.00 52.10 ? 176 ASP B N   1 
ATOM   3719  C  CA  . ASP B  1 196 ? 53.984 23.200  -20.121 1.00 53.64 ? 176 ASP B CA  1 
ATOM   3720  C  C   . ASP B  1 196 ? 53.459 24.006  -21.332 1.00 52.02 ? 176 ASP B C   1 
ATOM   3721  O  O   . ASP B  1 196 ? 53.456 25.236  -21.283 1.00 50.78 ? 176 ASP B O   1 
ATOM   3722  C  CB  . ASP B  1 196 ? 55.521 23.336  -19.939 1.00 53.83 ? 176 ASP B CB  1 
ATOM   3723  C  CG  . ASP B  1 196 ? 55.991 23.071  -18.449 1.00 65.71 ? 176 ASP B CG  1 
ATOM   3724  O  OD1 . ASP B  1 196 ? 55.616 23.818  -17.483 1.00 59.73 ? 176 ASP B OD1 1 
ATOM   3725  O  OD2 . ASP B  1 196 ? 56.773 22.107  -18.245 1.00 76.42 ? 176 ASP B OD2 1 
ATOM   3726  N  N   . GLU B  1 197 ? 52.981 23.327  -22.382 1.00 51.58 ? 177 GLU B N   1 
ATOM   3727  C  CA  . GLU B  1 197 ? 52.244 23.994  -23.477 1.00 51.68 ? 177 GLU B CA  1 
ATOM   3728  C  C   . GLU B  1 197 ? 50.905 24.505  -22.950 1.00 50.74 ? 177 GLU B C   1 
ATOM   3729  O  O   . GLU B  1 197 ? 50.451 25.591  -23.322 1.00 51.47 ? 177 GLU B O   1 
ATOM   3730  C  CB  . GLU B  1 197 ? 51.993 23.035  -24.662 1.00 52.61 ? 177 GLU B CB  1 
ATOM   3731  C  CG  . GLU B  1 197 ? 51.930 23.702  -26.061 1.00 55.87 ? 177 GLU B CG  1 
ATOM   3732  N  N   . LYS B  1 198 ? 50.264 23.686  -22.110 1.00 48.72 ? 178 LYS B N   1 
ATOM   3733  C  CA  . LYS B  1 198 ? 48.983 24.018  -21.481 1.00 46.79 ? 178 LYS B CA  1 
ATOM   3734  C  C   . LYS B  1 198 ? 49.126 25.091  -20.404 1.00 44.76 ? 178 LYS B C   1 
ATOM   3735  O  O   . LYS B  1 198 ? 48.213 25.912  -20.182 1.00 43.81 ? 178 LYS B O   1 
ATOM   3736  C  CB  . LYS B  1 198 ? 48.385 22.766  -20.884 1.00 46.86 ? 178 LYS B CB  1 
ATOM   3737  C  CG  . LYS B  1 198 ? 47.818 21.777  -21.905 1.00 51.30 ? 178 LYS B CG  1 
ATOM   3738  C  CD  . LYS B  1 198 ? 47.523 20.414  -21.283 1.00 49.26 ? 178 LYS B CD  1 
ATOM   3739  C  CE  . LYS B  1 198 ? 47.016 19.428  -22.323 1.00 51.75 ? 178 LYS B CE  1 
ATOM   3740  N  NZ  . LYS B  1 198 ? 46.606 18.113  -21.721 1.00 57.60 ? 178 LYS B NZ  1 
ATOM   3741  N  N   . VAL B  1 199 ? 50.281 25.102  -19.748 1.00 44.50 ? 179 VAL B N   1 
ATOM   3742  C  CA  . VAL B  1 199 ? 50.590 26.158  -18.792 1.00 44.87 ? 179 VAL B CA  1 
ATOM   3743  C  C   . VAL B  1 199 ? 50.662 27.457  -19.538 1.00 47.10 ? 179 VAL B C   1 
ATOM   3744  O  O   . VAL B  1 199 ? 50.020 28.436  -19.139 1.00 50.04 ? 179 VAL B O   1 
ATOM   3745  C  CB  . VAL B  1 199 ? 51.910 25.948  -18.036 1.00 42.90 ? 179 VAL B CB  1 
ATOM   3746  C  CG1 . VAL B  1 199 ? 52.280 27.219  -17.237 1.00 41.81 ? 179 VAL B CG1 1 
ATOM   3747  C  CG2 . VAL B  1 199 ? 51.801 24.755  -17.108 1.00 42.55 ? 179 VAL B CG2 1 
ATOM   3748  N  N   . ALA B  1 200 ? 51.456 27.468  -20.611 1.00 48.49 ? 180 ALA B N   1 
ATOM   3749  C  CA  . ALA B  1 200 ? 51.564 28.651  -21.485 1.00 48.71 ? 180 ALA B CA  1 
ATOM   3750  C  C   . ALA B  1 200 ? 50.193 29.144  -21.947 1.00 47.59 ? 180 ALA B C   1 
ATOM   3751  O  O   . ALA B  1 200 ? 49.901 30.331  -21.910 1.00 47.26 ? 180 ALA B O   1 
ATOM   3752  C  CB  . ALA B  1 200 ? 52.438 28.339  -22.703 1.00 48.85 ? 180 ALA B CB  1 
ATOM   3753  N  N   . TYR B  1 201 ? 49.364 28.203  -22.372 1.00 47.85 ? 181 TYR B N   1 
ATOM   3754  C  CA  . TYR B  1 201 ? 48.144 28.518  -23.046 1.00 49.34 ? 181 TYR B CA  1 
ATOM   3755  C  C   . TYR B  1 201 ? 47.172 29.210  -22.094 1.00 50.87 ? 181 TYR B C   1 
ATOM   3756  O  O   . TYR B  1 201 ? 46.721 30.318  -22.392 1.00 51.52 ? 181 TYR B O   1 
ATOM   3757  C  CB  . TYR B  1 201 ? 47.567 27.243  -23.651 1.00 51.39 ? 181 TYR B CB  1 
ATOM   3758  C  CG  . TYR B  1 201 ? 46.180 27.444  -24.133 1.00 58.60 ? 181 TYR B CG  1 
ATOM   3759  C  CD1 . TYR B  1 201 ? 45.921 28.313  -25.212 1.00 58.82 ? 181 TYR B CD1 1 
ATOM   3760  C  CD2 . TYR B  1 201 ? 45.108 26.804  -23.502 1.00 53.89 ? 181 TYR B CD2 1 
ATOM   3761  C  CE1 . TYR B  1 201 ? 44.617 28.523  -25.663 1.00 60.90 ? 181 TYR B CE1 1 
ATOM   3762  C  CE2 . TYR B  1 201 ? 43.815 26.994  -23.941 1.00 58.29 ? 181 TYR B CE2 1 
ATOM   3763  C  CZ  . TYR B  1 201 ? 43.569 27.856  -25.018 1.00 59.33 ? 181 TYR B CZ  1 
ATOM   3764  O  OH  . TYR B  1 201 ? 42.282 28.054  -25.446 1.00 59.61 ? 181 TYR B OH  1 
ATOM   3765  N  N   . LEU B  1 202 ? 46.886 28.569  -20.948 1.00 50.83 ? 182 LEU B N   1 
ATOM   3766  C  CA  . LEU B  1 202 ? 46.049 29.148  -19.877 1.00 49.06 ? 182 LEU B CA  1 
ATOM   3767  C  C   . LEU B  1 202 ? 46.523 30.489  -19.275 1.00 48.19 ? 182 LEU B C   1 
ATOM   3768  O  O   . LEU B  1 202 ? 45.707 31.281  -18.782 1.00 46.07 ? 182 LEU B O   1 
ATOM   3769  C  CB  . LEU B  1 202 ? 45.912 28.145  -18.743 1.00 49.06 ? 182 LEU B CB  1 
ATOM   3770  C  CG  . LEU B  1 202 ? 45.259 26.812  -19.086 1.00 44.73 ? 182 LEU B CG  1 
ATOM   3771  C  CD1 . LEU B  1 202 ? 45.006 26.058  -17.788 1.00 38.44 ? 182 LEU B CD1 1 
ATOM   3772  C  CD2 . LEU B  1 202 ? 44.007 27.028  -19.876 1.00 42.33 ? 182 LEU B CD2 1 
ATOM   3773  N  N   . GLN B  1 203 ? 47.823 30.734  -19.285 1.00 48.67 ? 183 GLN B N   1 
ATOM   3774  C  CA  . GLN B  1 203 ? 48.330 32.056  -18.921 1.00 52.63 ? 183 GLN B CA  1 
ATOM   3775  C  C   . GLN B  1 203 ? 47.924 33.119  -19.937 1.00 53.42 ? 183 GLN B C   1 
ATOM   3776  O  O   . GLN B  1 203 ? 47.668 34.255  -19.542 1.00 53.89 ? 183 GLN B O   1 
ATOM   3777  C  CB  . GLN B  1 203 ? 49.844 32.051  -18.802 1.00 52.30 ? 183 GLN B CB  1 
ATOM   3778  C  CG  . GLN B  1 203 ? 50.339 31.270  -17.611 1.00 54.08 ? 183 GLN B CG  1 
ATOM   3779  C  CD  . GLN B  1 203 ? 51.841 31.075  -17.621 1.00 52.43 ? 183 GLN B CD  1 
ATOM   3780  O  OE1 . GLN B  1 203 ? 52.518 31.187  -18.660 1.00 53.79 ? 183 GLN B OE1 1 
ATOM   3781  N  NE2 . GLN B  1 203 ? 52.372 30.769  -16.457 1.00 49.17 ? 183 GLN B NE2 1 
ATOM   3782  N  N   . LYS B  1 204 ? 47.877 32.757  -21.227 1.00 54.57 ? 184 LYS B N   1 
ATOM   3783  C  CA  . LYS B  1 204 ? 47.305 33.634  -22.281 1.00 55.65 ? 184 LYS B CA  1 
ATOM   3784  C  C   . LYS B  1 204 ? 45.796 33.873  -22.026 1.00 56.23 ? 184 LYS B C   1 
ATOM   3785  O  O   . LYS B  1 204 ? 45.334 35.013  -22.111 1.00 57.91 ? 184 LYS B O   1 
ATOM   3786  C  CB  . LYS B  1 204 ? 47.530 33.076  -23.703 1.00 55.45 ? 184 LYS B CB  1 
ATOM   3787  N  N   . LEU B  1 205 ? 45.049 32.818  -21.699 1.00 53.99 ? 185 LEU B N   1 
ATOM   3788  C  CA  . LEU B  1 205 ? 43.644 32.960  -21.266 1.00 55.36 ? 185 LEU B CA  1 
ATOM   3789  C  C   . LEU B  1 205 ? 43.408 33.765  -19.968 1.00 55.88 ? 185 LEU B C   1 
ATOM   3790  O  O   . LEU B  1 205 ? 42.257 33.997  -19.608 1.00 57.46 ? 185 LEU B O   1 
ATOM   3791  C  CB  . LEU B  1 205 ? 42.981 31.587  -21.075 1.00 54.90 ? 185 LEU B CB  1 
ATOM   3792  C  CG  . LEU B  1 205 ? 42.940 30.642  -22.273 1.00 57.89 ? 185 LEU B CG  1 
ATOM   3793  C  CD1 . LEU B  1 205 ? 41.922 29.542  -22.024 1.00 59.73 ? 185 LEU B CD1 1 
ATOM   3794  C  CD2 . LEU B  1 205 ? 42.643 31.390  -23.572 1.00 60.96 ? 185 LEU B CD2 1 
ATOM   3795  N  N   . GLY B  1 206 ? 44.461 34.163  -19.255 1.00 55.11 ? 186 GLY B N   1 
ATOM   3796  C  CA  . GLY B  1 206 ? 44.315 35.049  -18.095 1.00 53.55 ? 186 GLY B CA  1 
ATOM   3797  C  C   . GLY B  1 206 ? 44.074 34.401  -16.723 1.00 52.61 ? 186 GLY B C   1 
ATOM   3798  O  O   . GLY B  1 206 ? 43.676 35.102  -15.780 1.00 51.46 ? 186 GLY B O   1 
ATOM   3799  N  N   . PHE B  1 207 ? 44.333 33.094  -16.583 1.00 50.66 ? 187 PHE B N   1 
ATOM   3800  C  CA  . PHE B  1 207 ? 44.332 32.447  -15.241 1.00 50.62 ? 187 PHE B CA  1 
ATOM   3801  C  C   . PHE B  1 207 ? 45.364 33.131  -14.311 1.00 50.27 ? 187 PHE B C   1 
ATOM   3802  O  O   . PHE B  1 207 ? 46.432 33.560  -14.774 1.00 48.53 ? 187 PHE B O   1 
ATOM   3803  C  CB  . PHE B  1 207 ? 44.710 30.980  -15.333 1.00 48.64 ? 187 PHE B CB  1 
ATOM   3804  C  CG  . PHE B  1 207 ? 43.608 30.080  -15.772 1.00 48.41 ? 187 PHE B CG  1 
ATOM   3805  C  CD1 . PHE B  1 207 ? 43.404 28.865  -15.113 1.00 51.43 ? 187 PHE B CD1 1 
ATOM   3806  C  CD2 . PHE B  1 207 ? 42.782 30.410  -16.842 1.00 48.78 ? 187 PHE B CD2 1 
ATOM   3807  C  CE1 . PHE B  1 207 ? 42.379 27.985  -15.518 1.00 53.91 ? 187 PHE B CE1 1 
ATOM   3808  C  CE2 . PHE B  1 207 ? 41.771 29.541  -17.260 1.00 49.30 ? 187 PHE B CE2 1 
ATOM   3809  C  CZ  . PHE B  1 207 ? 41.573 28.321  -16.611 1.00 44.53 ? 187 PHE B CZ  1 
ATOM   3810  N  N   . ASP B  1 208 ? 45.064 33.201  -13.013 1.00 48.90 ? 188 ASP B N   1 
ATOM   3811  C  CA  . ASP B  1 208 ? 45.972 33.856  -12.052 1.00 48.27 ? 188 ASP B CA  1 
ATOM   3812  C  C   . ASP B  1 208 ? 47.239 32.986  -11.776 1.00 47.26 ? 188 ASP B C   1 
ATOM   3813  O  O   . ASP B  1 208 ? 48.365 33.439  -11.963 1.00 46.13 ? 188 ASP B O   1 
ATOM   3814  C  CB  . ASP B  1 208 ? 45.230 34.221  -10.751 1.00 48.63 ? 188 ASP B CB  1 
ATOM   3815  C  CG  . ASP B  1 208 ? 43.977 35.109  -10.996 1.00 53.28 ? 188 ASP B CG  1 
ATOM   3816  O  OD1 . ASP B  1 208 ? 43.988 36.316  -10.643 1.00 61.06 ? 188 ASP B OD1 1 
ATOM   3817  O  OD2 . ASP B  1 208 ? 42.969 34.595  -11.529 1.00 58.53 ? 188 ASP B OD2 1 
ATOM   3818  N  N   . VAL B  1 209 ? 47.056 31.734  -11.360 1.00 47.93 ? 189 VAL B N   1 
ATOM   3819  C  CA  . VAL B  1 209 ? 48.173 30.780  -11.297 1.00 45.51 ? 189 VAL B CA  1 
ATOM   3820  C  C   . VAL B  1 209 ? 47.862 29.536  -12.130 1.00 45.35 ? 189 VAL B C   1 
ATOM   3821  O  O   . VAL B  1 209 ? 46.734 29.022  -12.137 1.00 46.42 ? 189 VAL B O   1 
ATOM   3822  C  CB  . VAL B  1 209 ? 48.503 30.341  -9.871  1.00 44.93 ? 189 VAL B CB  1 
ATOM   3823  C  CG1 . VAL B  1 209 ? 49.830 29.602  -9.861  1.00 41.53 ? 189 VAL B CG1 1 
ATOM   3824  C  CG2 . VAL B  1 209 ? 48.539 31.527  -8.925  1.00 40.71 ? 189 VAL B CG2 1 
ATOM   3825  N  N   . VAL B  1 210 ? 48.868 29.092  -12.871 1.00 44.23 ? 190 VAL B N   1 
ATOM   3826  C  CA  . VAL B  1 210 ? 48.812 27.848  -13.615 1.00 44.44 ? 190 VAL B CA  1 
ATOM   3827  C  C   . VAL B  1 210 ? 50.107 27.082  -13.413 1.00 43.38 ? 190 VAL B C   1 
ATOM   3828  O  O   . VAL B  1 210 ? 51.174 27.678  -13.453 1.00 43.45 ? 190 VAL B O   1 
ATOM   3829  C  CB  . VAL B  1 210 ? 48.577 28.051  -15.115 1.00 44.00 ? 190 VAL B CB  1 
ATOM   3830  C  CG1 . VAL B  1 210 ? 48.359 26.688  -15.782 1.00 40.91 ? 190 VAL B CG1 1 
ATOM   3831  C  CG2 . VAL B  1 210 ? 47.358 28.953  -15.338 1.00 44.37 ? 190 VAL B CG2 1 
ATOM   3832  N  N   . PHE B  1 211 ? 49.989 25.777  -13.161 1.00 41.60 ? 191 PHE B N   1 
ATOM   3833  C  CA  . PHE B  1 211 ? 51.144 24.913  -13.081 1.00 39.75 ? 191 PHE B CA  1 
ATOM   3834  C  C   . PHE B  1 211 ? 50.936 23.514  -13.650 1.00 40.48 ? 191 PHE B C   1 
ATOM   3835  O  O   . PHE B  1 211 ? 49.807 23.037  -13.859 1.00 39.84 ? 191 PHE B O   1 
ATOM   3836  C  CB  . PHE B  1 211 ? 51.664 24.836  -11.647 1.00 39.40 ? 191 PHE B CB  1 
ATOM   3837  C  CG  . PHE B  1 211 ? 50.702 24.220  -10.673 1.00 42.58 ? 191 PHE B CG  1 
ATOM   3838  C  CD1 . PHE B  1 211 ? 50.819 22.872  -10.326 1.00 38.17 ? 191 PHE B CD1 1 
ATOM   3839  C  CD2 . PHE B  1 211 ? 49.702 25.000  -10.074 1.00 40.05 ? 191 PHE B CD2 1 
ATOM   3840  C  CE1 . PHE B  1 211 ? 49.967 22.300  -9.413  1.00 38.08 ? 191 PHE B CE1 1 
ATOM   3841  C  CE2 . PHE B  1 211 ? 48.815 24.438  -9.186  1.00 45.66 ? 191 PHE B CE2 1 
ATOM   3842  C  CZ  . PHE B  1 211 ? 48.953 23.079  -8.832  1.00 46.81 ? 191 PHE B CZ  1 
ATOM   3843  N  N   . ASN B  1 212 ? 52.072 22.890  -13.917 1.00 42.07 ? 192 ASN B N   1 
ATOM   3844  C  CA  . ASN B  1 212 ? 52.162 21.542  -14.404 1.00 43.48 ? 192 ASN B CA  1 
ATOM   3845  C  C   . ASN B  1 212 ? 52.249 20.641  -13.168 1.00 46.83 ? 192 ASN B C   1 
ATOM   3846  O  O   . ASN B  1 212 ? 53.256 20.662  -12.451 1.00 49.36 ? 192 ASN B O   1 
ATOM   3847  C  CB  . ASN B  1 212 ? 53.419 21.438  -15.265 1.00 41.92 ? 192 ASN B CB  1 
ATOM   3848  C  CG  . ASN B  1 212 ? 53.440 20.214  -16.143 1.00 42.76 ? 192 ASN B CG  1 
ATOM   3849  O  OD1 . ASN B  1 212 ? 52.993 19.148  -15.744 1.00 39.45 ? 192 ASN B OD1 1 
ATOM   3850  N  ND2 . ASN B  1 212 ? 53.982 20.364  -17.367 1.00 50.16 ? 192 ASN B ND2 1 
ATOM   3851  N  N   . TYR B  1 213 ? 51.196 19.880  -12.891 1.00 49.32 ? 193 TYR B N   1 
ATOM   3852  C  CA  . TYR B  1 213 ? 51.177 19.018  -11.714 1.00 53.34 ? 193 TYR B CA  1 
ATOM   3853  C  C   . TYR B  1 213 ? 52.184 17.880  -11.859 1.00 52.92 ? 193 TYR B C   1 
ATOM   3854  O  O   . TYR B  1 213 ? 52.503 17.241  -10.872 1.00 53.11 ? 193 TYR B O   1 
ATOM   3855  C  CB  . TYR B  1 213 ? 49.752 18.439  -11.418 1.00 57.86 ? 193 TYR B CB  1 
ATOM   3856  C  CG  . TYR B  1 213 ? 49.398 17.261  -12.316 1.00 63.12 ? 193 TYR B CG  1 
ATOM   3857  C  CD1 . TYR B  1 213 ? 49.589 15.941  -11.901 1.00 67.75 ? 193 TYR B CD1 1 
ATOM   3858  C  CD2 . TYR B  1 213 ? 48.927 17.476  -13.616 1.00 71.79 ? 193 TYR B CD2 1 
ATOM   3859  C  CE1 . TYR B  1 213 ? 49.307 14.856  -12.776 1.00 69.03 ? 193 TYR B CE1 1 
ATOM   3860  C  CE2 . TYR B  1 213 ? 48.632 16.414  -14.496 1.00 68.86 ? 193 TYR B CE2 1 
ATOM   3861  C  CZ  . TYR B  1 213 ? 48.825 15.112  -14.076 1.00 69.98 ? 193 TYR B CZ  1 
ATOM   3862  O  OH  . TYR B  1 213 ? 48.524 14.090  -14.962 1.00 68.96 ? 193 TYR B OH  1 
ATOM   3863  N  N   . LYS B  1 214 ? 52.653 17.604  -13.080 1.00 53.01 ? 194 LYS B N   1 
ATOM   3864  C  CA  . LYS B  1 214 ? 53.601 16.510  -13.308 1.00 53.13 ? 194 LYS B CA  1 
ATOM   3865  C  C   . LYS B  1 214 ? 55.037 16.885  -12.973 1.00 51.74 ? 194 LYS B C   1 
ATOM   3866  O  O   . LYS B  1 214 ? 55.815 16.027  -12.598 1.00 52.26 ? 194 LYS B O   1 
ATOM   3867  C  CB  . LYS B  1 214 ? 53.536 16.029  -14.754 1.00 53.95 ? 194 LYS B CB  1 
ATOM   3868  C  CG  . LYS B  1 214 ? 52.482 14.982  -15.029 1.00 60.07 ? 194 LYS B CG  1 
ATOM   3869  C  CD  . LYS B  1 214 ? 52.366 14.688  -16.540 1.00 57.93 ? 194 LYS B CD  1 
ATOM   3870  C  CE  . LYS B  1 214 ? 50.913 14.321  -16.879 1.00 68.13 ? 194 LYS B CE  1 
ATOM   3871  N  NZ  . LYS B  1 214 ? 50.668 14.225  -18.341 1.00 71.47 ? 194 LYS B NZ  1 
ATOM   3872  N  N   . THR B  1 215 ? 55.396 18.154  -13.138 1.00 51.22 ? 195 THR B N   1 
ATOM   3873  C  CA  . THR B  1 215 ? 56.761 18.598  -12.906 1.00 50.82 ? 195 THR B CA  1 
ATOM   3874  C  C   . THR B  1 215 ? 56.985 19.122  -11.490 1.00 51.93 ? 195 THR B C   1 
ATOM   3875  O  O   . THR B  1 215 ? 58.118 19.090  -11.026 1.00 54.49 ? 195 THR B O   1 
ATOM   3876  C  CB  . THR B  1 215 ? 57.243 19.692  -13.928 1.00 48.66 ? 195 THR B CB  1 
ATOM   3877  O  OG1 . THR B  1 215 ? 56.586 20.941  -13.669 1.00 52.28 ? 195 THR B OG1 1 
ATOM   3878  C  CG2 . THR B  1 215 ? 56.994 19.268  -15.355 1.00 43.19 ? 195 THR B CG2 1 
ATOM   3879  N  N   . VAL B  1 216 ? 55.945 19.615  -10.807 1.00 53.02 ? 196 VAL B N   1 
ATOM   3880  C  CA  . VAL B  1 216 ? 56.149 20.249  -9.487  1.00 52.87 ? 196 VAL B CA  1 
ATOM   3881  C  C   . VAL B  1 216 ? 56.725 19.271  -8.473  1.00 53.37 ? 196 VAL B C   1 
ATOM   3882  O  O   . VAL B  1 216 ? 56.305 18.103  -8.451  1.00 54.93 ? 196 VAL B O   1 
ATOM   3883  C  CB  . VAL B  1 216 ? 54.858 20.870  -8.858  1.00 53.06 ? 196 VAL B CB  1 
ATOM   3884  C  CG1 . VAL B  1 216 ? 54.394 22.068  -9.676  1.00 57.21 ? 196 VAL B CG1 1 
ATOM   3885  C  CG2 . VAL B  1 216 ? 53.764 19.824  -8.644  1.00 51.91 ? 196 VAL B CG2 1 
ATOM   3886  N  N   . GLU B  1 217 ? 57.648 19.765  -7.632  1.00 51.25 ? 197 GLU B N   1 
ATOM   3887  C  CA  . GLU B  1 217 ? 58.318 18.937  -6.621  1.00 51.47 ? 197 GLU B CA  1 
ATOM   3888  C  C   . GLU B  1 217 ? 57.298 18.431  -5.623  1.00 51.42 ? 197 GLU B C   1 
ATOM   3889  O  O   . GLU B  1 217 ? 57.171 17.236  -5.448  1.00 53.44 ? 197 GLU B O   1 
ATOM   3890  C  CB  . GLU B  1 217 ? 59.445 19.694  -5.904  1.00 49.26 ? 197 GLU B CB  1 
ATOM   3891  N  N   . SER B  1 218 ? 56.562 19.347  -4.997  1.00 51.80 ? 198 SER B N   1 
ATOM   3892  C  CA  . SER B  1 218 ? 55.482 19.013  -4.040  1.00 51.05 ? 198 SER B CA  1 
ATOM   3893  C  C   . SER B  1 218 ? 54.189 19.758  -4.414  1.00 50.03 ? 198 SER B C   1 
ATOM   3894  O  O   . SER B  1 218 ? 54.175 20.988  -4.472  1.00 49.66 ? 198 SER B O   1 
ATOM   3895  C  CB  . SER B  1 218 ? 55.913 19.373  -2.604  1.00 49.49 ? 198 SER B CB  1 
ATOM   3896  O  OG  . SER B  1 218 ? 54.926 19.051  -1.634  1.00 49.43 ? 198 SER B OG  1 
ATOM   3897  N  N   . LEU B  1 219 ? 53.114 19.020  -4.677  1.00 49.54 ? 199 LEU B N   1 
ATOM   3898  C  CA  . LEU B  1 219 ? 51.799 19.632  -4.929  1.00 48.33 ? 199 LEU B CA  1 
ATOM   3899  C  C   . LEU B  1 219 ? 51.329 20.498  -3.743  1.00 48.01 ? 199 LEU B C   1 
ATOM   3900  O  O   . LEU B  1 219 ? 50.906 21.649  -3.927  1.00 47.57 ? 199 LEU B O   1 
ATOM   3901  C  CB  . LEU B  1 219 ? 50.759 18.548  -5.216  1.00 49.41 ? 199 LEU B CB  1 
ATOM   3902  C  CG  . LEU B  1 219 ? 49.324 19.024  -5.539  1.00 50.65 ? 199 LEU B CG  1 
ATOM   3903  C  CD1 . LEU B  1 219 ? 49.339 20.022  -6.691  1.00 56.28 ? 199 LEU B CD1 1 
ATOM   3904  C  CD2 . LEU B  1 219 ? 48.368 17.871  -5.841  1.00 48.01 ? 199 LEU B CD2 1 
ATOM   3905  N  N   . GLU B  1 220 ? 51.409 19.936  -2.540  1.00 44.29 ? 200 GLU B N   1 
ATOM   3906  C  CA  . GLU B  1 220 ? 51.083 20.647  -1.326  1.00 46.64 ? 200 GLU B CA  1 
ATOM   3907  C  C   . GLU B  1 220 ? 51.627 22.086  -1.296  1.00 45.70 ? 200 GLU B C   1 
ATOM   3908  O  O   . GLU B  1 220 ? 50.886 23.047  -1.055  1.00 43.34 ? 200 GLU B O   1 
ATOM   3909  C  CB  . GLU B  1 220 ? 51.645 19.866  -0.135  1.00 46.92 ? 200 GLU B CB  1 
ATOM   3910  C  CG  . GLU B  1 220 ? 51.136 20.326  1.202   1.00 50.49 ? 200 GLU B CG  1 
ATOM   3911  C  CD  . GLU B  1 220 ? 52.092 20.093  2.383   1.00 55.39 ? 200 GLU B CD  1 
ATOM   3912  O  OE1 . GLU B  1 220 ? 53.362 20.170  2.249   1.00 68.60 ? 200 GLU B OE1 1 
ATOM   3913  O  OE2 . GLU B  1 220 ? 51.540 19.893  3.492   1.00 63.25 ? 200 GLU B OE2 1 
ATOM   3914  N  N   . GLU B  1 221 ? 52.931 22.214  -1.552  1.00 46.89 ? 201 GLU B N   1 
ATOM   3915  C  CA  . GLU B  1 221 ? 53.667 23.480  -1.431  1.00 46.92 ? 201 GLU B CA  1 
ATOM   3916  C  C   . GLU B  1 221 ? 53.364 24.477  -2.562  1.00 43.67 ? 201 GLU B C   1 
ATOM   3917  O  O   . GLU B  1 221 ? 53.304 25.670  -2.351  1.00 43.30 ? 201 GLU B O   1 
ATOM   3918  C  CB  . GLU B  1 221 ? 55.148 23.151  -1.351  1.00 47.84 ? 201 GLU B CB  1 
ATOM   3919  C  CG  . GLU B  1 221 ? 55.381 22.059  -0.266  1.00 57.13 ? 201 GLU B CG  1 
ATOM   3920  C  CD  . GLU B  1 221 ? 56.829 21.891  0.211   1.00 55.60 ? 201 GLU B CD  1 
ATOM   3921  O  OE1 . GLU B  1 221 ? 56.995 21.338  1.329   1.00 69.32 ? 201 GLU B OE1 1 
ATOM   3922  O  OE2 . GLU B  1 221 ? 57.783 22.290  -0.503  1.00 57.30 ? 201 GLU B OE2 1 
ATOM   3923  N  N   . THR B  1 222 ? 53.156 23.975  -3.768  1.00 43.53 ? 202 THR B N   1 
ATOM   3924  C  CA  . THR B  1 222 ? 52.692 24.783  -4.897  1.00 42.78 ? 202 THR B CA  1 
ATOM   3925  C  C   . THR B  1 222 ? 51.312 25.402  -4.641  1.00 43.57 ? 202 THR B C   1 
ATOM   3926  O  O   . THR B  1 222 ? 51.085 26.566  -4.953  1.00 44.92 ? 202 THR B O   1 
ATOM   3927  C  CB  . THR B  1 222 ? 52.557 23.905  -6.134  1.00 41.87 ? 202 THR B CB  1 
ATOM   3928  O  OG1 . THR B  1 222 ? 53.721 23.084  -6.264  1.00 41.16 ? 202 THR B OG1 1 
ATOM   3929  C  CG2 . THR B  1 222 ? 52.375 24.710  -7.349  1.00 38.52 ? 202 THR B CG2 1 
ATOM   3930  N  N   . LEU B  1 223 ? 50.386 24.611  -4.097  1.00 42.80 ? 203 LEU B N   1 
ATOM   3931  C  CA  . LEU B  1 223 ? 49.060 25.097  -3.790  1.00 39.37 ? 203 LEU B CA  1 
ATOM   3932  C  C   . LEU B  1 223 ? 49.135 26.084  -2.665  1.00 38.88 ? 203 LEU B C   1 
ATOM   3933  O  O   . LEU B  1 223 ? 48.360 27.039  -2.632  1.00 40.45 ? 203 LEU B O   1 
ATOM   3934  C  CB  . LEU B  1 223 ? 48.148 23.956  -3.354  1.00 41.12 ? 203 LEU B CB  1 
ATOM   3935  C  CG  . LEU B  1 223 ? 47.829 22.888  -4.368  1.00 40.31 ? 203 LEU B CG  1 
ATOM   3936  C  CD1 . LEU B  1 223 ? 47.083 21.784  -3.676  1.00 39.74 ? 203 LEU B CD1 1 
ATOM   3937  C  CD2 . LEU B  1 223 ? 47.018 23.498  -5.501  1.00 46.47 ? 203 LEU B CD2 1 
ATOM   3938  N  N   . LYS B  1 224 ? 50.044 25.854  -1.724  1.00 38.60 ? 204 LYS B N   1 
ATOM   3939  C  CA  . LYS B  1 224 ? 50.202 26.773  -0.585  1.00 40.99 ? 204 LYS B CA  1 
ATOM   3940  C  C   . LYS B  1 224 ? 50.753 28.161  -1.008  1.00 42.59 ? 204 LYS B C   1 
ATOM   3941  O  O   . LYS B  1 224 ? 50.302 29.179  -0.492  1.00 43.97 ? 204 LYS B O   1 
ATOM   3942  C  CB  . LYS B  1 224 ? 51.069 26.111  0.504   1.00 42.20 ? 204 LYS B CB  1 
ATOM   3943  C  CG  . LYS B  1 224 ? 51.343 26.980  1.746   1.00 42.01 ? 204 LYS B CG  1 
ATOM   3944  C  CD  . LYS B  1 224 ? 50.160 26.969  2.690   1.00 54.69 ? 204 LYS B CD  1 
ATOM   3945  C  CE  . LYS B  1 224 ? 50.244 28.058  3.756   1.00 54.42 ? 204 LYS B CE  1 
ATOM   3946  N  NZ  . LYS B  1 224 ? 48.922 28.157  4.472   1.00 57.60 ? 204 LYS B NZ  1 
ATOM   3947  N  N   . LYS B  1 225 ? 51.714 28.195  -1.943  1.00 41.72 ? 205 LYS B N   1 
ATOM   3948  C  CA  . LYS B  1 225 ? 52.263 29.452  -2.463  1.00 42.29 ? 205 LYS B CA  1 
ATOM   3949  C  C   . LYS B  1 225 ? 51.271 30.112  -3.428  1.00 42.34 ? 205 LYS B C   1 
ATOM   3950  O  O   . LYS B  1 225 ? 51.268 31.325  -3.579  1.00 42.45 ? 205 LYS B O   1 
ATOM   3951  C  CB  . LYS B  1 225 ? 53.629 29.227  -3.162  1.00 40.11 ? 205 LYS B CB  1 
ATOM   3952  N  N   . ALA B  1 226 ? 50.423 29.312  -4.072  1.00 42.20 ? 206 ALA B N   1 
ATOM   3953  C  CA  . ALA B  1 226 ? 49.485 29.829  -5.094  1.00 42.84 ? 206 ALA B CA  1 
ATOM   3954  C  C   . ALA B  1 226 ? 48.267 30.556  -4.482  1.00 44.74 ? 206 ALA B C   1 
ATOM   3955  O  O   . ALA B  1 226 ? 47.728 31.497  -5.072  1.00 45.24 ? 206 ALA B O   1 
ATOM   3956  C  CB  . ALA B  1 226 ? 49.040 28.714  -6.017  1.00 39.83 ? 206 ALA B CB  1 
ATOM   3957  N  N   . SER B  1 227 ? 47.826 30.085  -3.316  1.00 44.77 ? 207 SER B N   1 
ATOM   3958  C  CA  . SER B  1 227 ? 46.890 30.814  -2.484  1.00 43.73 ? 207 SER B CA  1 
ATOM   3959  C  C   . SER B  1 227 ? 47.200 30.560  -1.015  1.00 44.33 ? 207 SER B C   1 
ATOM   3960  O  O   . SER B  1 227 ? 46.696 29.584  -0.453  1.00 45.44 ? 207 SER B O   1 
ATOM   3961  C  CB  . SER B  1 227 ? 45.475 30.405  -2.792  1.00 42.30 ? 207 SER B CB  1 
ATOM   3962  O  OG  . SER B  1 227 ? 44.601 31.140  -1.976  1.00 45.80 ? 207 SER B OG  1 
ATOM   3963  N  N   . PRO B  1 228 ? 48.054 31.421  -0.394  1.00 44.34 ? 208 PRO B N   1 
ATOM   3964  C  CA  . PRO B  1 228 ? 48.404 31.287  1.018   1.00 44.70 ? 208 PRO B CA  1 
ATOM   3965  C  C   . PRO B  1 228 ? 47.177 31.184  1.963   1.00 45.97 ? 208 PRO B C   1 
ATOM   3966  O  O   . PRO B  1 228 ? 47.244 30.512  2.996   1.00 44.57 ? 208 PRO B O   1 
ATOM   3967  C  CB  . PRO B  1 228 ? 49.217 32.561  1.300   1.00 45.23 ? 208 PRO B CB  1 
ATOM   3968  C  CG  . PRO B  1 228 ? 49.770 32.961  -0.009  1.00 40.85 ? 208 PRO B CG  1 
ATOM   3969  C  CD  . PRO B  1 228 ? 48.750 32.569  -1.013  1.00 45.03 ? 208 PRO B CD  1 
ATOM   3970  N  N   . ASP B  1 229 ? 46.071 31.811  1.569   1.00 46.01 ? 209 ASP B N   1 
ATOM   3971  C  CA  . ASP B  1 229 ? 44.886 31.929  2.398   1.00 48.99 ? 209 ASP B CA  1 
ATOM   3972  C  C   . ASP B  1 229 ? 43.890 30.769  2.223   1.00 45.83 ? 209 ASP B C   1 
ATOM   3973  O  O   . ASP B  1 229 ? 42.889 30.719  2.911   1.00 45.64 ? 209 ASP B O   1 
ATOM   3974  C  CB  . ASP B  1 229 ? 44.219 33.295  2.115   1.00 52.03 ? 209 ASP B CB  1 
ATOM   3975  C  CG  . ASP B  1 229 ? 45.260 34.430  1.987   1.00 63.59 ? 209 ASP B CG  1 
ATOM   3976  O  OD1 . ASP B  1 229 ? 45.360 35.263  2.927   1.00 66.72 ? 209 ASP B OD1 1 
ATOM   3977  O  OD2 . ASP B  1 229 ? 46.017 34.444  0.960   1.00 66.02 ? 209 ASP B OD2 1 
ATOM   3978  N  N   . GLY B  1 230 ? 44.191 29.840  1.321   1.00 43.94 ? 210 GLY B N   1 
ATOM   3979  C  CA  . GLY B  1 230 ? 43.301 28.742  1.006   1.00 42.65 ? 210 GLY B CA  1 
ATOM   3980  C  C   . GLY B  1 230 ? 42.400 28.954  -0.205  1.00 41.61 ? 210 GLY B C   1 
ATOM   3981  O  O   . GLY B  1 230 ? 42.459 29.970  -0.898  1.00 40.55 ? 210 GLY B O   1 
ATOM   3982  N  N   . TYR B  1 231 ? 41.564 27.957  -0.447  1.00 42.02 ? 211 TYR B N   1 
ATOM   3983  C  CA  . TYR B  1 231 ? 40.641 27.941  -1.569  1.00 42.20 ? 211 TYR B CA  1 
ATOM   3984  C  C   . TYR B  1 231 ? 39.193 27.922  -1.061  1.00 40.42 ? 211 TYR B C   1 
ATOM   3985  O  O   . TYR B  1 231 ? 38.840 27.145  -0.182  1.00 39.02 ? 211 TYR B O   1 
ATOM   3986  C  CB  . TYR B  1 231 ? 40.935 26.734  -2.482  1.00 43.66 ? 211 TYR B CB  1 
ATOM   3987  C  CG  . TYR B  1 231 ? 42.343 26.783  -3.010  1.00 41.54 ? 211 TYR B CG  1 
ATOM   3988  C  CD1 . TYR B  1 231 ? 42.621 27.394  -4.215  1.00 40.36 ? 211 TYR B CD1 1 
ATOM   3989  C  CD2 . TYR B  1 231 ? 43.410 26.267  -2.270  1.00 42.73 ? 211 TYR B CD2 1 
ATOM   3990  C  CE1 . TYR B  1 231 ? 43.923 27.504  -4.667  1.00 42.24 ? 211 TYR B CE1 1 
ATOM   3991  C  CE2 . TYR B  1 231 ? 44.723 26.367  -2.724  1.00 32.83 ? 211 TYR B CE2 1 
ATOM   3992  C  CZ  . TYR B  1 231 ? 44.974 26.988  -3.917  1.00 34.41 ? 211 TYR B CZ  1 
ATOM   3993  O  OH  . TYR B  1 231 ? 46.259 27.070  -4.423  1.00 40.81 ? 211 TYR B OH  1 
ATOM   3994  N  N   . ASP B  1 232 ? 38.396 28.838  -1.611  1.00 40.56 ? 212 ASP B N   1 
ATOM   3995  C  CA  . ASP B  1 232 ? 36.980 28.958  -1.332  1.00 41.50 ? 212 ASP B CA  1 
ATOM   3996  C  C   . ASP B  1 232 ? 36.191 27.865  -2.031  1.00 42.06 ? 212 ASP B C   1 
ATOM   3997  O  O   . ASP B  1 232 ? 35.249 27.304  -1.460  1.00 40.62 ? 212 ASP B O   1 
ATOM   3998  C  CB  . ASP B  1 232 ? 36.442 30.293  -1.852  1.00 40.71 ? 212 ASP B CB  1 
ATOM   3999  C  CG  . ASP B  1 232 ? 36.981 31.480  -1.105  1.00 44.61 ? 212 ASP B CG  1 
ATOM   4000  O  OD1 . ASP B  1 232 ? 37.735 32.276  -1.733  1.00 51.98 ? 212 ASP B OD1 1 
ATOM   4001  O  OD2 . ASP B  1 232 ? 36.638 31.636  0.097   1.00 53.68 ? 212 ASP B OD2 1 
ATOM   4002  N  N   . CYS B  1 233 ? 36.570 27.607  -3.282  1.00 42.49 ? 213 CYS B N   1 
ATOM   4003  C  CA  . CYS B  1 233 ? 35.879 26.666  -4.168  1.00 44.27 ? 213 CYS B CA  1 
ATOM   4004  C  C   . CYS B  1 233 ? 36.882 25.795  -4.881  1.00 39.62 ? 213 CYS B C   1 
ATOM   4005  O  O   . CYS B  1 233 ? 37.933 26.239  -5.213  1.00 39.97 ? 213 CYS B O   1 
ATOM   4006  C  CB  . CYS B  1 233 ? 35.060 27.425  -5.230  1.00 43.88 ? 213 CYS B CB  1 
ATOM   4007  S  SG  . CYS B  1 233 ? 33.738 28.418  -4.504  1.00 58.54 ? 213 CYS B SG  1 
ATOM   4008  N  N   . TYR B  1 234 ? 36.505 24.552  -5.122  1.00 41.03 ? 214 TYR B N   1 
ATOM   4009  C  CA  . TYR B  1 234 ? 37.289 23.601  -5.886  1.00 39.57 ? 214 TYR B CA  1 
ATOM   4010  C  C   . TYR B  1 234 ? 36.357 22.910  -6.869  1.00 37.07 ? 214 TYR B C   1 
ATOM   4011  O  O   . TYR B  1 234 ? 35.422 22.259  -6.496  1.00 37.16 ? 214 TYR B O   1 
ATOM   4012  C  CB  . TYR B  1 234 ? 37.910 22.595  -4.913  1.00 41.75 ? 214 TYR B CB  1 
ATOM   4013  C  CG  . TYR B  1 234 ? 38.743 21.477  -5.489  1.00 34.31 ? 214 TYR B CG  1 
ATOM   4014  C  CD1 . TYR B  1 234 ? 39.498 21.625  -6.666  1.00 37.19 ? 214 TYR B CD1 1 
ATOM   4015  C  CD2 . TYR B  1 234 ? 38.782 20.263  -4.839  1.00 37.75 ? 214 TYR B CD2 1 
ATOM   4016  C  CE1 . TYR B  1 234 ? 40.256 20.563  -7.167  1.00 33.88 ? 214 TYR B CE1 1 
ATOM   4017  C  CE2 . TYR B  1 234 ? 39.534 19.203  -5.313  1.00 41.53 ? 214 TYR B CE2 1 
ATOM   4018  C  CZ  . TYR B  1 234 ? 40.272 19.329  -6.460  1.00 41.33 ? 214 TYR B CZ  1 
ATOM   4019  O  OH  . TYR B  1 234 ? 41.038 18.204  -6.818  1.00 40.96 ? 214 TYR B OH  1 
ATOM   4020  N  N   . PHE B  1 235 ? 36.645 23.074  -8.138  1.00 38.92 ? 215 PHE B N   1 
ATOM   4021  C  CA  . PHE B  1 235 ? 35.984 22.366  -9.200  1.00 36.88 ? 215 PHE B CA  1 
ATOM   4022  C  C   . PHE B  1 235 ? 36.846 21.154  -9.598  1.00 38.40 ? 215 PHE B C   1 
ATOM   4023  O  O   . PHE B  1 235 ? 37.914 21.260  -10.224 1.00 36.82 ? 215 PHE B O   1 
ATOM   4024  C  CB  . PHE B  1 235 ? 35.785 23.328  -10.359 1.00 37.85 ? 215 PHE B CB  1 
ATOM   4025  C  CG  . PHE B  1 235 ? 34.863 22.818  -11.409 1.00 37.28 ? 215 PHE B CG  1 
ATOM   4026  C  CD1 . PHE B  1 235 ? 33.610 23.379  -11.568 1.00 36.14 ? 215 PHE B CD1 1 
ATOM   4027  C  CD2 . PHE B  1 235 ? 35.258 21.759  -12.259 1.00 43.26 ? 215 PHE B CD2 1 
ATOM   4028  C  CE1 . PHE B  1 235 ? 32.743 22.918  -12.550 1.00 40.91 ? 215 PHE B CE1 1 
ATOM   4029  C  CE2 . PHE B  1 235 ? 34.400 21.293  -13.239 1.00 46.58 ? 215 PHE B CE2 1 
ATOM   4030  C  CZ  . PHE B  1 235 ? 33.136 21.892  -13.399 1.00 43.75 ? 215 PHE B CZ  1 
ATOM   4031  N  N   . ASP B  1 236 ? 36.360 19.983  -9.198  1.00 42.83 ? 216 ASP B N   1 
ATOM   4032  C  CA  . ASP B  1 236 ? 37.136 18.755  -9.200  1.00 42.25 ? 216 ASP B CA  1 
ATOM   4033  C  C   . ASP B  1 236 ? 36.743 17.792  -10.320 1.00 44.39 ? 216 ASP B C   1 
ATOM   4034  O  O   . ASP B  1 236 ? 35.641 17.198  -10.283 1.00 43.30 ? 216 ASP B O   1 
ATOM   4035  C  CB  . ASP B  1 236 ? 36.976 18.032  -7.860  1.00 42.87 ? 216 ASP B CB  1 
ATOM   4036  C  CG  . ASP B  1 236 ? 37.916 16.812  -7.738  1.00 48.49 ? 216 ASP B CG  1 
ATOM   4037  O  OD1 . ASP B  1 236 ? 38.972 16.751  -8.446  1.00 47.61 ? 216 ASP B OD1 1 
ATOM   4038  O  OD2 . ASP B  1 236 ? 37.584 15.912  -6.947  1.00 48.38 ? 216 ASP B OD2 1 
ATOM   4039  N  N   . ASN B  1 237 ? 37.695 17.608  -11.258 1.00 44.89 ? 217 ASN B N   1 
ATOM   4040  C  CA  . ASN B  1 237 ? 37.576 16.700  -12.379 1.00 44.82 ? 217 ASN B CA  1 
ATOM   4041  C  C   . ASN B  1 237 ? 38.466 15.520  -12.267 1.00 44.16 ? 217 ASN B C   1 
ATOM   4042  O  O   . ASN B  1 237 ? 38.387 14.683  -13.153 1.00 45.36 ? 217 ASN B O   1 
ATOM   4043  C  CB  . ASN B  1 237 ? 37.988 17.363  -13.702 1.00 45.57 ? 217 ASN B CB  1 
ATOM   4044  C  CG  . ASN B  1 237 ? 37.035 18.404  -14.134 1.00 49.93 ? 217 ASN B CG  1 
ATOM   4045  O  OD1 . ASN B  1 237 ? 35.868 18.085  -14.394 1.00 58.89 ? 217 ASN B OD1 1 
ATOM   4046  N  ND2 . ASN B  1 237 ? 37.491 19.671  -14.180 1.00 42.29 ? 217 ASN B ND2 1 
ATOM   4047  N  N   . VAL B  1 238 ? 39.372 15.472  -11.285 1.00 45.10 ? 218 VAL B N   1 
ATOM   4048  C  CA  . VAL B  1 238 ? 40.413 14.438  -11.324 1.00 44.46 ? 218 VAL B CA  1 
ATOM   4049  C  C   . VAL B  1 238 ? 40.308 13.434  -10.197 1.00 43.63 ? 218 VAL B C   1 
ATOM   4050  O  O   . VAL B  1 238 ? 40.432 12.237  -10.422 1.00 45.15 ? 218 VAL B O   1 
ATOM   4051  C  CB  . VAL B  1 238 ? 41.917 14.961  -11.547 1.00 47.74 ? 218 VAL B CB  1 
ATOM   4052  C  CG1 . VAL B  1 238 ? 41.992 16.086  -12.585 1.00 43.46 ? 218 VAL B CG1 1 
ATOM   4053  C  CG2 . VAL B  1 238 ? 42.640 15.302  -10.256 1.00 56.06 ? 218 VAL B CG2 1 
ATOM   4054  N  N   . GLY B  1 239 ? 40.063 13.895  -8.990  1.00 44.03 ? 219 GLY B N   1 
ATOM   4055  C  CA  . GLY B  1 239 ? 39.909 12.985  -7.879  1.00 45.86 ? 219 GLY B CA  1 
ATOM   4056  C  C   . GLY B  1 239 ? 41.242 12.464  -7.339  1.00 46.39 ? 219 GLY B C   1 
ATOM   4057  O  O   . GLY B  1 239 ? 42.289 13.077  -7.532  1.00 45.41 ? 219 GLY B O   1 
ATOM   4058  N  N   . GLY B  1 240 ? 41.174 11.344  -6.624  1.00 49.60 ? 220 GLY B N   1 
ATOM   4059  C  CA  . GLY B  1 240 ? 42.371 10.650  -6.072  1.00 49.03 ? 220 GLY B CA  1 
ATOM   4060  C  C   . GLY B  1 240 ? 43.217 11.500  -5.141  1.00 52.35 ? 220 GLY B C   1 
ATOM   4061  O  O   . GLY B  1 240 ? 42.706 12.435  -4.491  1.00 54.49 ? 220 GLY B O   1 
ATOM   4062  N  N   . GLU B  1 241 ? 44.520 11.190  -5.103  1.00 52.78 ? 221 GLU B N   1 
ATOM   4063  C  CA  . GLU B  1 241 ? 45.474 11.852  -4.217  1.00 54.60 ? 221 GLU B CA  1 
ATOM   4064  C  C   . GLU B  1 241 ? 45.619 13.353  -4.480  1.00 49.27 ? 221 GLU B C   1 
ATOM   4065  O  O   . GLU B  1 241 ? 45.934 14.125  -3.565  1.00 48.03 ? 221 GLU B O   1 
ATOM   4066  C  CB  . GLU B  1 241 ? 46.837 11.107  -4.239  1.00 54.23 ? 221 GLU B CB  1 
ATOM   4067  C  CG  . GLU B  1 241 ? 46.958 10.076  -3.057  1.00 65.59 ? 221 GLU B CG  1 
ATOM   4068  C  CD  . GLU B  1 241 ? 48.093 8.998   -3.191  1.00 69.17 ? 221 GLU B CD  1 
ATOM   4069  O  OE1 . GLU B  1 241 ? 49.159 9.244   -3.841  1.00 81.20 ? 221 GLU B OE1 1 
ATOM   4070  O  OE2 . GLU B  1 241 ? 47.903 7.890   -2.603  1.00 84.36 ? 221 GLU B OE2 1 
ATOM   4071  N  N   . PHE B  1 242 ? 45.381 13.774  -5.721  1.00 47.77 ? 222 PHE B N   1 
ATOM   4072  C  CA  . PHE B  1 242 ? 45.384 15.197  -6.047  1.00 46.65 ? 222 PHE B CA  1 
ATOM   4073  C  C   . PHE B  1 242 ? 44.346 15.922  -5.229  1.00 44.21 ? 222 PHE B C   1 
ATOM   4074  O  O   . PHE B  1 242 ? 44.608 16.991  -4.712  1.00 43.16 ? 222 PHE B O   1 
ATOM   4075  C  CB  . PHE B  1 242 ? 45.058 15.445  -7.532  1.00 50.74 ? 222 PHE B CB  1 
ATOM   4076  C  CG  . PHE B  1 242 ? 45.231 16.881  -7.940  1.00 52.07 ? 222 PHE B CG  1 
ATOM   4077  C  CD1 . PHE B  1 242 ? 46.359 17.280  -8.652  1.00 58.38 ? 222 PHE B CD1 1 
ATOM   4078  C  CD2 . PHE B  1 242 ? 44.321 17.851  -7.530  1.00 52.68 ? 222 PHE B CD2 1 
ATOM   4079  C  CE1 . PHE B  1 242 ? 46.551 18.609  -8.987  1.00 57.03 ? 222 PHE B CE1 1 
ATOM   4080  C  CE2 . PHE B  1 242 ? 44.497 19.176  -7.857  1.00 56.03 ? 222 PHE B CE2 1 
ATOM   4081  C  CZ  . PHE B  1 242 ? 45.626 19.565  -8.578  1.00 56.51 ? 222 PHE B CZ  1 
ATOM   4082  N  N   . SER B  1 243 ? 43.149 15.343  -5.143  1.00 41.78 ? 223 SER B N   1 
ATOM   4083  C  CA  . SER B  1 243 ? 42.067 15.968  -4.406  1.00 41.08 ? 223 SER B CA  1 
ATOM   4084  C  C   . SER B  1 243 ? 42.278 15.995  -2.876  1.00 40.38 ? 223 SER B C   1 
ATOM   4085  O  O   . SER B  1 243 ? 41.859 16.948  -2.187  1.00 40.31 ? 223 SER B O   1 
ATOM   4086  C  CB  . SER B  1 243 ? 40.729 15.335  -4.814  1.00 41.61 ? 223 SER B CB  1 
ATOM   4087  O  OG  . SER B  1 243 ? 40.399 15.765  -6.149  1.00 43.71 ? 223 SER B OG  1 
ATOM   4088  N  N   . ASN B  1 244 ? 42.934 14.973  -2.354  1.00 38.37 ? 224 ASN B N   1 
ATOM   4089  C  CA  . ASN B  1 244 ? 43.233 14.889  -0.940  1.00 41.43 ? 224 ASN B CA  1 
ATOM   4090  C  C   . ASN B  1 244 ? 44.139 16.015  -0.481  1.00 43.79 ? 224 ASN B C   1 
ATOM   4091  O  O   . ASN B  1 244 ? 44.031 16.491  0.659   1.00 45.73 ? 224 ASN B O   1 
ATOM   4092  C  CB  . ASN B  1 244 ? 43.877 13.529  -0.614  1.00 42.71 ? 224 ASN B CB  1 
ATOM   4093  C  CG  . ASN B  1 244 ? 42.958 12.381  -0.937  1.00 40.67 ? 224 ASN B CG  1 
ATOM   4094  O  OD1 . ASN B  1 244 ? 41.758 12.580  -1.152  1.00 46.76 ? 224 ASN B OD1 1 
ATOM   4095  N  ND2 . ASN B  1 244 ? 43.512 11.190  -1.033  1.00 42.79 ? 224 ASN B ND2 1 
ATOM   4096  N  N   . THR B  1 245 ? 45.015 16.434  -1.387  1.00 44.79 ? 225 THR B N   1 
ATOM   4097  C  CA  . THR B  1 245 ? 45.968 17.489  -1.134  1.00 44.38 ? 225 THR B CA  1 
ATOM   4098  C  C   . THR B  1 245 ? 45.250 18.825  -1.144  1.00 43.50 ? 225 THR B C   1 
ATOM   4099  O  O   . THR B  1 245 ? 45.477 19.664  -0.277  1.00 45.23 ? 225 THR B O   1 
ATOM   4100  C  CB  . THR B  1 245 ? 47.076 17.460  -2.189  1.00 45.59 ? 225 THR B CB  1 
ATOM   4101  O  OG1 . THR B  1 245 ? 47.567 16.111  -2.322  1.00 41.22 ? 225 THR B OG1 1 
ATOM   4102  C  CG2 . THR B  1 245 ? 48.212 18.407  -1.827  1.00 46.50 ? 225 THR B CG2 1 
ATOM   4103  N  N   . VAL B  1 246 ? 44.355 19.003  -2.101  1.00 42.03 ? 226 VAL B N   1 
ATOM   4104  C  CA  . VAL B  1 246 ? 43.571 20.227  -2.207  1.00 42.45 ? 226 VAL B CA  1 
ATOM   4105  C  C   . VAL B  1 246 ? 42.668 20.424  -0.965  1.00 42.79 ? 226 VAL B C   1 
ATOM   4106  O  O   . VAL B  1 246 ? 42.635 21.483  -0.389  1.00 43.48 ? 226 VAL B O   1 
ATOM   4107  C  CB  . VAL B  1 246 ? 42.686 20.239  -3.490  1.00 41.14 ? 226 VAL B CB  1 
ATOM   4108  C  CG1 . VAL B  1 246 ? 41.850 21.478  -3.514  1.00 41.39 ? 226 VAL B CG1 1 
ATOM   4109  C  CG2 . VAL B  1 246 ? 43.544 20.191  -4.733  1.00 39.11 ? 226 VAL B CG2 1 
ATOM   4110  N  N   . ILE B  1 247 ? 41.977 19.373  -0.563  1.00 42.89 ? 227 ILE B N   1 
ATOM   4111  C  CA  . ILE B  1 247 ? 41.142 19.367  0.623   1.00 44.72 ? 227 ILE B CA  1 
ATOM   4112  C  C   . ILE B  1 247 ? 41.845 19.893  1.882   1.00 45.13 ? 227 ILE B C   1 
ATOM   4113  O  O   . ILE B  1 247 ? 41.224 20.613  2.719   1.00 48.51 ? 227 ILE B O   1 
ATOM   4114  C  CB  . ILE B  1 247 ? 40.529 17.944  0.816   1.00 46.41 ? 227 ILE B CB  1 
ATOM   4115  C  CG1 . ILE B  1 247 ? 39.392 17.778  -0.215  1.00 46.78 ? 227 ILE B CG1 1 
ATOM   4116  C  CG2 . ILE B  1 247 ? 40.019 17.708  2.246   1.00 40.60 ? 227 ILE B CG2 1 
ATOM   4117  C  CD1 . ILE B  1 247 ? 38.837 16.417  -0.325  1.00 48.61 ? 227 ILE B CD1 1 
ATOM   4118  N  N   . GLY B  1 248 ? 43.123 19.554  2.008   1.00 42.38 ? 228 GLY B N   1 
ATOM   4119  C  CA  . GLY B  1 248 ? 43.965 20.076  3.068   1.00 42.36 ? 228 GLY B CA  1 
ATOM   4120  C  C   . GLY B  1 248 ? 44.186 21.583  3.005   1.00 41.27 ? 228 GLY B C   1 
ATOM   4121  O  O   . GLY B  1 248 ? 44.708 22.148  3.961   1.00 39.47 ? 228 GLY B O   1 
ATOM   4122  N  N   . GLN B  1 249 ? 43.760 22.224  1.905   1.00 41.60 ? 229 GLN B N   1 
ATOM   4123  C  CA  . GLN B  1 249 ? 43.947 23.660  1.671   1.00 43.95 ? 229 GLN B CA  1 
ATOM   4124  C  C   . GLN B  1 249 ? 42.645 24.443  1.537   1.00 42.87 ? 229 GLN B C   1 
ATOM   4125  O  O   . GLN B  1 249 ? 42.651 25.633  1.195   1.00 39.97 ? 229 GLN B O   1 
ATOM   4126  C  CB  . GLN B  1 249 ? 44.731 23.870  0.357   1.00 48.08 ? 229 GLN B CB  1 
ATOM   4127  C  CG  . GLN B  1 249 ? 45.964 22.983  0.175   1.00 53.72 ? 229 GLN B CG  1 
ATOM   4128  C  CD  . GLN B  1 249 ? 47.234 23.685  0.529   1.00 52.55 ? 229 GLN B CD  1 
ATOM   4129  O  OE1 . GLN B  1 249 ? 47.221 24.853  0.901   1.00 57.89 ? 229 GLN B OE1 1 
ATOM   4130  N  NE2 . GLN B  1 249 ? 48.347 22.991  0.379   1.00 45.43 ? 229 GLN B NE2 1 
ATOM   4131  N  N   . MET B  1 250 ? 41.523 23.781  1.771   1.00 42.97 ? 230 MET B N   1 
ATOM   4132  C  CA  . MET B  1 250 ? 40.229 24.415  1.600   1.00 40.82 ? 230 MET B CA  1 
ATOM   4133  C  C   . MET B  1 250 ? 39.964 25.363  2.747   1.00 41.37 ? 230 MET B C   1 
ATOM   4134  O  O   . MET B  1 250 ? 40.243 25.038  3.893   1.00 40.94 ? 230 MET B O   1 
ATOM   4135  C  CB  . MET B  1 250 ? 39.095 23.367  1.526   1.00 38.85 ? 230 MET B CB  1 
ATOM   4136  C  CG  . MET B  1 250 ? 39.079 22.510  0.254   1.00 40.53 ? 230 MET B CG  1 
ATOM   4137  S  SD  . MET B  1 250 ? 39.000 23.425  -1.271  1.00 43.93 ? 230 MET B SD  1 
ATOM   4138  C  CE  . MET B  1 250 ? 37.330 24.066  -1.127  1.00 39.66 ? 230 MET B CE  1 
ATOM   4139  N  N   . LYS B  1 251 ? 39.372 26.523  2.450   1.00 44.02 ? 231 LYS B N   1 
ATOM   4140  C  CA  . LYS B  1 251 ? 38.955 27.434  3.532   1.00 44.36 ? 231 LYS B CA  1 
ATOM   4141  C  C   . LYS B  1 251 ? 37.829 26.756  4.344   1.00 42.72 ? 231 LYS B C   1 
ATOM   4142  O  O   . LYS B  1 251 ? 37.253 25.768  3.903   1.00 42.28 ? 231 LYS B O   1 
ATOM   4143  C  CB  . LYS B  1 251 ? 38.522 28.806  2.986   1.00 44.30 ? 231 LYS B CB  1 
ATOM   4144  C  CG  . LYS B  1 251 ? 39.681 29.671  2.506   1.00 41.98 ? 231 LYS B CG  1 
ATOM   4145  C  CD  . LYS B  1 251 ? 39.242 31.037  1.941   1.00 43.80 ? 231 LYS B CD  1 
ATOM   4146  C  CE  . LYS B  1 251 ? 40.490 31.800  1.395   1.00 50.61 ? 231 LYS B CE  1 
ATOM   4147  N  NZ  . LYS B  1 251 ? 40.300 32.753  0.243   1.00 57.09 ? 231 LYS B NZ  1 
ATOM   4148  N  N   . LYS B  1 252 ? 37.553 27.266  5.541   1.00 41.23 ? 232 LYS B N   1 
ATOM   4149  C  CA  . LYS B  1 252 ? 36.450 26.767  6.312   1.00 39.63 ? 232 LYS B CA  1 
ATOM   4150  C  C   . LYS B  1 252 ? 35.169 27.019  5.523   1.00 37.89 ? 232 LYS B C   1 
ATOM   4151  O  O   . LYS B  1 252 ? 35.008 28.111  4.995   1.00 39.79 ? 232 LYS B O   1 
ATOM   4152  C  CB  . LYS B  1 252 ? 36.433 27.382  7.712   1.00 39.44 ? 232 LYS B CB  1 
ATOM   4153  C  CG  . LYS B  1 252 ? 35.647 26.536  8.722   1.00 42.04 ? 232 LYS B CG  1 
ATOM   4154  C  CD  . LYS B  1 252 ? 35.892 26.964  10.136  1.00 47.04 ? 232 LYS B CD  1 
ATOM   4155  C  CE  . LYS B  1 252 ? 34.674 26.704  11.055  1.00 56.97 ? 232 LYS B CE  1 
ATOM   4156  N  NZ  . LYS B  1 252 ? 34.278 27.938  11.878  1.00 60.32 ? 232 LYS B NZ  1 
ATOM   4157  N  N   . PHE B  1 253 ? 34.293 26.001  5.443   1.00 35.25 ? 233 PHE B N   1 
ATOM   4158  C  CA  . PHE B  1 253 ? 33.034 26.001  4.676   1.00 36.16 ? 233 PHE B CA  1 
ATOM   4159  C  C   . PHE B  1 253 ? 33.267 25.992  3.164   1.00 38.09 ? 233 PHE B C   1 
ATOM   4160  O  O   . PHE B  1 253 ? 32.371 26.351  2.405   1.00 40.72 ? 233 PHE B O   1 
ATOM   4161  C  CB  . PHE B  1 253 ? 32.052 27.147  5.017   1.00 37.22 ? 233 PHE B CB  1 
ATOM   4162  C  CG  . PHE B  1 253 ? 31.792 27.339  6.505   1.00 36.61 ? 233 PHE B CG  1 
ATOM   4163  C  CD1 . PHE B  1 253 ? 31.243 26.332  7.257   1.00 37.71 ? 233 PHE B CD1 1 
ATOM   4164  C  CD2 . PHE B  1 253 ? 32.105 28.545  7.128   1.00 29.43 ? 233 PHE B CD2 1 
ATOM   4165  C  CE1 . PHE B  1 253 ? 31.025 26.496  8.611   1.00 42.57 ? 233 PHE B CE1 1 
ATOM   4166  C  CE2 . PHE B  1 253 ? 31.910 28.711  8.478   1.00 28.40 ? 233 PHE B CE2 1 
ATOM   4167  C  CZ  . PHE B  1 253 ? 31.373 27.683  9.219   1.00 42.01 ? 233 PHE B CZ  1 
ATOM   4168  N  N   . GLY B  1 254 ? 34.440 25.552  2.731   1.00 38.34 ? 234 GLY B N   1 
ATOM   4169  C  CA  . GLY B  1 254 ? 34.776 25.464  1.308   1.00 39.13 ? 234 GLY B CA  1 
ATOM   4170  C  C   . GLY B  1 254 ? 33.869 24.499  0.578   1.00 39.53 ? 234 GLY B C   1 
ATOM   4171  O  O   . GLY B  1 254 ? 33.334 23.567  1.166   1.00 40.77 ? 234 GLY B O   1 
ATOM   4172  N  N   . ARG B  1 255 ? 33.725 24.729  -0.715  1.00 41.06 ? 235 ARG B N   1 
ATOM   4173  C  CA  . ARG B  1 255 ? 32.775 24.058  -1.560  1.00 43.61 ? 235 ARG B CA  1 
ATOM   4174  C  C   . ARG B  1 255 ? 33.501 23.360  -2.675  1.00 43.75 ? 235 ARG B C   1 
ATOM   4175  O  O   . ARG B  1 255 ? 34.264 23.985  -3.406  1.00 42.81 ? 235 ARG B O   1 
ATOM   4176  C  CB  . ARG B  1 255 ? 31.806 25.089  -2.121  1.00 46.45 ? 235 ARG B CB  1 
ATOM   4177  C  CG  . ARG B  1 255 ? 31.167 25.842  -0.963  1.00 48.32 ? 235 ARG B CG  1 
ATOM   4178  C  CD  . ARG B  1 255 ? 30.187 26.883  -1.294  1.00 49.92 ? 235 ARG B CD  1 
ATOM   4179  N  NE  . ARG B  1 255 ? 30.624 28.026  -2.120  1.00 71.14 ? 235 ARG B NE  1 
ATOM   4180  C  CZ  . ARG B  1 255 ? 31.515 28.991  -1.822  1.00 62.53 ? 235 ARG B CZ  1 
ATOM   4181  N  NH1 . ARG B  1 255 ? 32.230 29.016  -0.692  1.00 59.57 ? 235 ARG B NH1 1 
ATOM   4182  N  NH2 . ARG B  1 255 ? 31.693 29.956  -2.712  1.00 55.70 ? 235 ARG B NH2 1 
ATOM   4183  N  N   . ILE B  1 256 ? 33.258 22.043  -2.772  1.00 42.69 ? 236 ILE B N   1 
ATOM   4184  C  CA  . ILE B  1 256 ? 33.766 21.209  -3.839  1.00 40.09 ? 236 ILE B CA  1 
ATOM   4185  C  C   . ILE B  1 256 ? 32.615 20.811  -4.735  1.00 37.56 ? 236 ILE B C   1 
ATOM   4186  O  O   . ILE B  1 256 ? 31.641 20.332  -4.269  1.00 36.39 ? 236 ILE B O   1 
ATOM   4187  C  CB  . ILE B  1 256 ? 34.467 19.955  -3.271  1.00 39.10 ? 236 ILE B CB  1 
ATOM   4188  C  CG1 . ILE B  1 256 ? 35.363 20.388  -2.103  1.00 35.13 ? 236 ILE B CG1 1 
ATOM   4189  C  CG2 . ILE B  1 256 ? 35.228 19.215  -4.384  1.00 41.93 ? 236 ILE B CG2 1 
ATOM   4190  C  CD1 . ILE B  1 256 ? 36.188 19.308  -1.513  1.00 41.88 ? 236 ILE B CD1 1 
ATOM   4191  N  N   . ALA B  1 257 ? 32.754 21.064  -6.028  1.00 40.67 ? 237 ALA B N   1 
ATOM   4192  C  CA  . ALA B  1 257 ? 31.873 20.545  -7.060  1.00 39.69 ? 237 ALA B CA  1 
ATOM   4193  C  C   . ALA B  1 257 ? 32.559 19.333  -7.622  1.00 39.26 ? 237 ALA B C   1 
ATOM   4194  O  O   . ALA B  1 257 ? 33.576 19.461  -8.238  1.00 40.73 ? 237 ALA B O   1 
ATOM   4195  C  CB  . ALA B  1 257 ? 31.688 21.576  -8.154  1.00 40.37 ? 237 ALA B CB  1 
ATOM   4196  N  N   . ILE B  1 258 ? 31.994 18.156  -7.409  1.00 41.97 ? 238 ILE B N   1 
ATOM   4197  C  CA  . ILE B  1 258 ? 32.521 16.915  -7.961  1.00 42.59 ? 238 ILE B CA  1 
ATOM   4198  C  C   . ILE B  1 258 ? 31.877 16.626  -9.320  1.00 41.00 ? 238 ILE B C   1 
ATOM   4199  O  O   . ILE B  1 258 ? 30.736 16.268  -9.468  1.00 40.46 ? 238 ILE B O   1 
ATOM   4200  C  CB  . ILE B  1 258 ? 32.362 15.742  -6.987  1.00 42.55 ? 238 ILE B CB  1 
ATOM   4201  C  CG1 . ILE B  1 258 ? 32.976 16.109  -5.637  1.00 46.19 ? 238 ILE B CG1 1 
ATOM   4202  C  CG2 . ILE B  1 258 ? 33.034 14.472  -7.543  1.00 43.69 ? 238 ILE B CG2 1 
ATOM   4203  C  CD1 . ILE B  1 258 ? 32.347 15.377  -4.521  1.00 47.85 ? 238 ILE B CD1 1 
ATOM   4204  N  N   . CYS B  1 259 ? 32.684 16.791  -10.323 1.00 46.35 ? 239 CYS B N   1 
ATOM   4205  C  CA  . CYS B  1 259 ? 32.259 16.735  -11.690 1.00 46.59 ? 239 CYS B CA  1 
ATOM   4206  C  C   . CYS B  1 259 ? 32.760 15.400  -12.345 1.00 46.83 ? 239 CYS B C   1 
ATOM   4207  O  O   . CYS B  1 259 ? 31.998 14.674  -12.997 1.00 46.17 ? 239 CYS B O   1 
ATOM   4208  C  CB  . CYS B  1 259 ? 32.854 17.991  -12.324 1.00 47.75 ? 239 CYS B CB  1 
ATOM   4209  S  SG  . CYS B  1 259 ? 32.722 18.022  -14.019 1.00 50.11 ? 239 CYS B SG  1 
ATOM   4210  N  N   . GLY B  1 260 ? 34.035 15.084  -12.126 1.00 43.89 ? 240 GLY B N   1 
ATOM   4211  C  CA  . GLY B  1 260 ? 34.627 13.835  -12.557 1.00 43.60 ? 240 GLY B CA  1 
ATOM   4212  C  C   . GLY B  1 260 ? 35.750 13.440  -11.617 1.00 42.59 ? 240 GLY B C   1 
ATOM   4213  O  O   . GLY B  1 260 ? 36.044 14.125  -10.650 1.00 40.03 ? 240 GLY B O   1 
ATOM   4214  N  N   . ALA B  1 261 ? 36.311 12.274  -11.896 1.00 43.90 ? 241 ALA B N   1 
ATOM   4215  C  CA  . ALA B  1 261 ? 37.445 11.728  -11.195 1.00 43.83 ? 241 ALA B CA  1 
ATOM   4216  C  C   . ALA B  1 261 ? 38.328 11.006  -12.199 1.00 42.57 ? 241 ALA B C   1 
ATOM   4217  O  O   . ALA B  1 261 ? 38.489 9.805   -12.088 1.00 43.29 ? 241 ALA B O   1 
ATOM   4218  C  CB  . ALA B  1 261 ? 36.985 10.759  -10.129 1.00 44.10 ? 241 ALA B CB  1 
ATOM   4219  N  N   . ILE B  1 262 ? 38.891 11.736  -13.162 1.00 43.22 ? 242 ILE B N   1 
ATOM   4220  C  CA  . ILE B  1 262 ? 39.561 11.116  -14.313 1.00 46.18 ? 242 ILE B CA  1 
ATOM   4221  C  C   . ILE B  1 262 ? 40.821 10.340  -13.993 1.00 44.35 ? 242 ILE B C   1 
ATOM   4222  O  O   . ILE B  1 262 ? 41.214 9.464   -14.754 1.00 42.49 ? 242 ILE B O   1 
ATOM   4223  C  CB  . ILE B  1 262 ? 39.911 12.128  -15.453 1.00 46.75 ? 242 ILE B CB  1 
ATOM   4224  C  CG1 . ILE B  1 262 ? 41.053 13.020  -15.035 1.00 49.05 ? 242 ILE B CG1 1 
ATOM   4225  C  CG2 . ILE B  1 262 ? 38.704 12.958  -15.876 1.00 50.18 ? 242 ILE B CG2 1 
ATOM   4226  C  CD1 . ILE B  1 262 ? 41.299 14.129  -16.012 1.00 49.73 ? 242 ILE B CD1 1 
ATOM   4227  N  N   . SER B  1 263 ? 41.462 10.684  -12.881 1.00 44.76 ? 243 SER B N   1 
ATOM   4228  C  CA  . SER B  1 263 ? 42.689 10.025  -12.447 1.00 42.46 ? 243 SER B CA  1 
ATOM   4229  C  C   . SER B  1 263 ? 42.390 8.573   -12.063 1.00 42.71 ? 243 SER B C   1 
ATOM   4230  O  O   . SER B  1 263 ? 43.286 7.711   -12.034 1.00 42.07 ? 243 SER B O   1 
ATOM   4231  C  CB  . SER B  1 263 ? 43.326 10.748  -11.236 1.00 41.74 ? 243 SER B CB  1 
ATOM   4232  O  OG  . SER B  1 263 ? 42.643 10.409  -10.025 1.00 47.78 ? 243 SER B OG  1 
ATOM   4233  N  N   . THR B  1 264 ? 41.123 8.301   -11.764 1.00 43.67 ? 244 THR B N   1 
ATOM   4234  C  CA  . THR B  1 264 ? 40.729 6.972   -11.351 1.00 42.78 ? 244 THR B CA  1 
ATOM   4235  C  C   . THR B  1 264 ? 40.185 6.122   -12.466 1.00 42.12 ? 244 THR B C   1 
ATOM   4236  O  O   . THR B  1 264 ? 40.075 4.938   -12.270 1.00 43.31 ? 244 THR B O   1 
ATOM   4237  C  CB  . THR B  1 264 ? 39.695 7.008   -10.172 1.00 42.08 ? 244 THR B CB  1 
ATOM   4238  O  OG1 . THR B  1 264 ? 38.366 7.267   -10.642 1.00 44.98 ? 244 THR B OG1 1 
ATOM   4239  C  CG2 . THR B  1 264 ? 40.113 8.033   -9.123  1.00 36.03 ? 244 THR B CG2 1 
ATOM   4240  N  N   . TYR B  1 265 ? 39.833 6.700   -13.617 1.00 43.80 ? 245 TYR B N   1 
ATOM   4241  C  CA  . TYR B  1 265 ? 39.092 5.925   -14.640 1.00 45.75 ? 245 TYR B CA  1 
ATOM   4242  C  C   . TYR B  1 265 ? 39.907 4.766   -15.250 1.00 44.50 ? 245 TYR B C   1 
ATOM   4243  O  O   . TYR B  1 265 ? 39.381 3.707   -15.612 1.00 43.39 ? 245 TYR B O   1 
ATOM   4244  C  CB  . TYR B  1 265 ? 38.601 6.815   -15.778 1.00 45.51 ? 245 TYR B CB  1 
ATOM   4245  C  CG  . TYR B  1 265 ? 37.660 7.922   -15.388 1.00 48.17 ? 245 TYR B CG  1 
ATOM   4246  C  CD1 . TYR B  1 265 ? 36.948 7.893   -14.182 1.00 48.15 ? 245 TYR B CD1 1 
ATOM   4247  C  CD2 . TYR B  1 265 ? 37.428 8.985   -16.274 1.00 49.50 ? 245 TYR B CD2 1 
ATOM   4248  C  CE1 . TYR B  1 265 ? 36.071 8.917   -13.850 1.00 48.01 ? 245 TYR B CE1 1 
ATOM   4249  C  CE2 . TYR B  1 265 ? 36.551 10.005  -15.948 1.00 51.93 ? 245 TYR B CE2 1 
ATOM   4250  C  CZ  . TYR B  1 265 ? 35.892 9.969   -14.728 1.00 49.19 ? 245 TYR B CZ  1 
ATOM   4251  O  OH  . TYR B  1 265 ? 35.052 10.992  -14.386 1.00 50.88 ? 245 TYR B OH  1 
ATOM   4252  N  N   . ASN B  1 266 ? 41.196 5.005   -15.372 1.00 43.68 ? 246 ASN B N   1 
ATOM   4253  C  CA  . ASN B  1 266 ? 42.076 4.117   -16.083 1.00 42.95 ? 246 ASN B CA  1 
ATOM   4254  C  C   . ASN B  1 266 ? 43.015 3.417   -15.133 1.00 43.10 ? 246 ASN B C   1 
ATOM   4255  O  O   . ASN B  1 266 ? 43.952 2.780   -15.573 1.00 44.27 ? 246 ASN B O   1 
ATOM   4256  C  CB  . ASN B  1 266 ? 42.836 4.910   -17.145 1.00 39.76 ? 246 ASN B CB  1 
ATOM   4257  C  CG  . ASN B  1 266 ? 41.931 5.389   -18.241 1.00 41.19 ? 246 ASN B CG  1 
ATOM   4258  O  OD1 . ASN B  1 266 ? 41.343 4.588   -18.972 1.00 45.12 ? 246 ASN B OD1 1 
ATOM   4259  N  ND2 . ASN B  1 266 ? 41.778 6.688   -18.351 1.00 38.16 ? 246 ASN B ND2 1 
ATOM   4260  N  N   . ARG B  1 267 ? 42.747 3.543   -13.834 1.00 44.53 ? 247 ARG B N   1 
ATOM   4261  C  CA  . ARG B  1 267 ? 43.625 3.045   -12.786 1.00 45.40 ? 247 ARG B CA  1 
ATOM   4262  C  C   . ARG B  1 267 ? 43.297 1.576   -12.578 1.00 45.78 ? 247 ARG B C   1 
ATOM   4263  O  O   . ARG B  1 267 ? 42.154 1.238   -12.332 1.00 47.56 ? 247 ARG B O   1 
ATOM   4264  C  CB  . ARG B  1 267 ? 43.400 3.832   -11.479 1.00 45.52 ? 247 ARG B CB  1 
ATOM   4265  C  CG  . ARG B  1 267 ? 44.252 3.400   -10.304 1.00 47.44 ? 247 ARG B CG  1 
ATOM   4266  C  CD  . ARG B  1 267 ? 44.113 4.326   -9.090  1.00 49.98 ? 247 ARG B CD  1 
ATOM   4267  N  NE  . ARG B  1 267 ? 44.722 3.753   -7.869  1.00 49.77 ? 247 ARG B NE  1 
ATOM   4268  C  CZ  . ARG B  1 267 ? 45.819 4.201   -7.234  1.00 49.06 ? 247 ARG B CZ  1 
ATOM   4269  N  NH1 . ARG B  1 267 ? 46.516 5.215   -7.701  1.00 49.50 ? 247 ARG B NH1 1 
ATOM   4270  N  NH2 . ARG B  1 267 ? 46.246 3.606   -6.105  1.00 45.16 ? 247 ARG B NH2 1 
ATOM   4271  N  N   . THR B  1 268 ? 44.317 0.714   -12.622 1.00 48.17 ? 248 THR B N   1 
ATOM   4272  C  CA  . THR B  1 268 ? 44.139 -0.741  -12.506 1.00 44.72 ? 248 THR B CA  1 
ATOM   4273  C  C   . THR B  1 268 ? 44.080 -1.324  -11.082 1.00 47.13 ? 248 THR B C   1 
ATOM   4274  O  O   . THR B  1 268 ? 43.752 -2.529  -10.917 1.00 50.44 ? 248 THR B O   1 
ATOM   4275  C  CB  . THR B  1 268 ? 45.225 -1.535  -13.303 1.00 43.71 ? 248 THR B CB  1 
ATOM   4276  O  OG1 . THR B  1 268 ? 46.550 -1.133  -12.921 1.00 36.39 ? 248 THR B OG1 1 
ATOM   4277  C  CG2 . THR B  1 268 ? 45.036 -1.357  -14.784 1.00 46.31 ? 248 THR B CG2 1 
ATOM   4278  N  N   . GLY B  1 269 ? 44.410 -0.593  -10.031 1.00 44.10 ? 249 GLY B N   1 
ATOM   4279  C  CA  . GLY B  1 269 ? 44.346 -1.332  -8.744  1.00 46.67 ? 249 GLY B CA  1 
ATOM   4280  C  C   . GLY B  1 269 ? 43.087 -1.117  -7.905  1.00 47.73 ? 249 GLY B C   1 
ATOM   4281  O  O   . GLY B  1 269 ? 42.028 -0.742  -8.418  1.00 48.10 ? 249 GLY B O   1 
ATOM   4282  N  N   . PRO B  1 270 ? 43.201 -1.305  -6.581  1.00 48.98 ? 250 PRO B N   1 
ATOM   4283  C  CA  . PRO B  1 270 ? 42.193 -0.619  -5.748  1.00 48.37 ? 250 PRO B CA  1 
ATOM   4284  C  C   . PRO B  1 270 ? 42.251 0.903   -5.922  1.00 50.98 ? 250 PRO B C   1 
ATOM   4285  O  O   . PRO B  1 270 ? 43.197 1.435   -6.523  1.00 52.44 ? 250 PRO B O   1 
ATOM   4286  C  CB  . PRO B  1 270 ? 42.577 -1.007  -4.324  1.00 46.33 ? 250 PRO B CB  1 
ATOM   4287  C  CG  . PRO B  1 270 ? 44.022 -1.425  -4.419  1.00 51.46 ? 250 PRO B CG  1 
ATOM   4288  C  CD  . PRO B  1 270 ? 44.158 -2.076  -5.778  1.00 47.14 ? 250 PRO B CD  1 
ATOM   4289  N  N   . LEU B  1 271 ? 41.223 1.595   -5.433  1.00 51.20 ? 251 LEU B N   1 
ATOM   4290  C  CA  . LEU B  1 271 ? 41.205 3.052   -5.446  1.00 51.22 ? 251 LEU B CA  1 
ATOM   4291  C  C   . LEU B  1 271 ? 42.196 3.560   -4.409  1.00 49.18 ? 251 LEU B C   1 
ATOM   4292  O  O   . LEU B  1 271 ? 42.484 2.851   -3.444  1.00 49.72 ? 251 LEU B O   1 
ATOM   4293  C  CB  . LEU B  1 271 ? 39.800 3.570   -5.121  1.00 53.82 ? 251 LEU B CB  1 
ATOM   4294  C  CG  . LEU B  1 271 ? 38.796 3.585   -6.282  1.00 55.87 ? 251 LEU B CG  1 
ATOM   4295  C  CD1 . LEU B  1 271 ? 37.339 3.615   -5.753  1.00 56.28 ? 251 LEU B CD1 1 
ATOM   4296  C  CD2 . LEU B  1 271 ? 39.112 4.771   -7.198  1.00 60.19 ? 251 LEU B CD2 1 
ATOM   4297  N  N   . PRO B  1 272 ? 42.709 4.794   -4.594  1.00 49.43 ? 252 PRO B N   1 
ATOM   4298  C  CA  . PRO B  1 272 ? 43.636 5.333   -3.593  1.00 50.05 ? 252 PRO B CA  1 
ATOM   4299  C  C   . PRO B  1 272 ? 42.889 5.780   -2.305  1.00 50.74 ? 252 PRO B C   1 
ATOM   4300  O  O   . PRO B  1 272 ? 41.640 5.907   -2.333  1.00 47.03 ? 252 PRO B O   1 
ATOM   4301  C  CB  . PRO B  1 272 ? 44.260 6.550   -4.300  1.00 48.53 ? 252 PRO B CB  1 
ATOM   4302  C  CG  . PRO B  1 272 ? 43.300 6.936   -5.307  1.00 46.28 ? 252 PRO B CG  1 
ATOM   4303  C  CD  . PRO B  1 272 ? 42.416 5.772   -5.664  1.00 45.96 ? 252 PRO B CD  1 
ATOM   4304  N  N   . PRO B  1 273 ? 43.655 6.073   -1.220  1.00 53.27 ? 253 PRO B N   1 
ATOM   4305  C  CA  . PRO B  1 273 ? 43.102 6.545   0.057   1.00 54.46 ? 253 PRO B CA  1 
ATOM   4306  C  C   . PRO B  1 273 ? 42.136 7.680   -0.165  1.00 57.18 ? 253 PRO B C   1 
ATOM   4307  O  O   . PRO B  1 273 ? 42.436 8.597   -0.946  1.00 58.22 ? 253 PRO B O   1 
ATOM   4308  C  CB  . PRO B  1 273 ? 44.332 7.048   0.839   1.00 53.58 ? 253 PRO B CB  1 
ATOM   4309  C  CG  . PRO B  1 273 ? 45.459 6.224   0.311   1.00 55.68 ? 253 PRO B CG  1 
ATOM   4310  C  CD  . PRO B  1 273 ? 45.137 5.970   -1.164  1.00 54.84 ? 253 PRO B CD  1 
ATOM   4311  N  N   . GLY B  1 274 ? 40.984 7.602   0.500   1.00 57.47 ? 254 GLY B N   1 
ATOM   4312  C  CA  . GLY B  1 274 ? 40.011 8.652   0.424   1.00 58.92 ? 254 GLY B CA  1 
ATOM   4313  C  C   . GLY B  1 274 ? 40.520 9.932   1.067   1.00 59.64 ? 254 GLY B C   1 
ATOM   4314  O  O   . GLY B  1 274 ? 41.632 9.964   1.642   1.00 56.74 ? 254 GLY B O   1 
ATOM   4315  N  N   . PRO B  1 275 ? 39.693 10.994  0.999   1.00 62.84 ? 255 PRO B N   1 
ATOM   4316  C  CA  . PRO B  1 275 ? 40.092 12.255  1.628   1.00 62.78 ? 255 PRO B CA  1 
ATOM   4317  C  C   . PRO B  1 275 ? 40.157 12.098  3.148   1.00 62.77 ? 255 PRO B C   1 
ATOM   4318  O  O   . PRO B  1 275 ? 39.405 11.298  3.725   1.00 63.93 ? 255 PRO B O   1 
ATOM   4319  C  CB  . PRO B  1 275 ? 39.026 13.249  1.175   1.00 65.14 ? 255 PRO B CB  1 
ATOM   4320  C  CG  . PRO B  1 275 ? 37.848 12.419  0.702   1.00 66.72 ? 255 PRO B CG  1 
ATOM   4321  C  CD  . PRO B  1 275 ? 38.360 11.056  0.354   1.00 62.96 ? 255 PRO B CD  1 
ATOM   4322  N  N   . PRO B  1 276 ? 41.081 12.828  3.790   1.00 61.20 ? 256 PRO B N   1 
ATOM   4323  C  CA  . PRO B  1 276 ? 41.338 12.685  5.236   1.00 59.00 ? 256 PRO B CA  1 
ATOM   4324  C  C   . PRO B  1 276 ? 40.188 13.331  6.082   1.00 57.77 ? 256 PRO B C   1 
ATOM   4325  O  O   . PRO B  1 276 ? 40.040 14.577  6.103   1.00 52.28 ? 256 PRO B O   1 
ATOM   4326  C  CB  . PRO B  1 276 ? 42.683 13.398  5.448   1.00 59.30 ? 256 PRO B CB  1 
ATOM   4327  C  CG  . PRO B  1 276 ? 42.788 14.376  4.283   1.00 64.25 ? 256 PRO B CG  1 
ATOM   4328  C  CD  . PRO B  1 276 ? 41.864 13.915  3.167   1.00 60.45 ? 256 PRO B CD  1 
ATOM   4329  N  N   . PRO B  1 277 ? 39.398 12.482  6.784   1.00 54.69 ? 257 PRO B N   1 
ATOM   4330  C  CA  . PRO B  1 277 ? 38.074 12.860  7.305   1.00 53.05 ? 257 PRO B CA  1 
ATOM   4331  C  C   . PRO B  1 277 ? 38.165 13.898  8.392   1.00 48.25 ? 257 PRO B C   1 
ATOM   4332  O  O   . PRO B  1 277 ? 37.271 14.698  8.549   1.00 49.14 ? 257 PRO B O   1 
ATOM   4333  C  CB  . PRO B  1 277 ? 37.544 11.554  7.931   1.00 53.07 ? 257 PRO B CB  1 
ATOM   4334  C  CG  . PRO B  1 277 ? 38.481 10.473  7.449   1.00 54.06 ? 257 PRO B CG  1 
ATOM   4335  C  CD  . PRO B  1 277 ? 39.789 11.132  7.235   1.00 53.76 ? 257 PRO B CD  1 
ATOM   4336  N  N   . GLU B  1 278 ? 39.246 13.879  9.142   1.00 46.01 ? 258 GLU B N   1 
ATOM   4337  C  CA  . GLU B  1 278 ? 39.412 14.788  10.242  1.00 50.08 ? 258 GLU B CA  1 
ATOM   4338  C  C   . GLU B  1 278 ? 39.536 16.230  9.753   1.00 49.27 ? 258 GLU B C   1 
ATOM   4339  O  O   . GLU B  1 278 ? 39.075 17.147  10.425  1.00 46.48 ? 258 GLU B O   1 
ATOM   4340  C  CB  . GLU B  1 278 ? 40.598 14.331  11.095  1.00 52.15 ? 258 GLU B CB  1 
ATOM   4341  C  CG  . GLU B  1 278 ? 40.312 12.934  11.777  1.00 60.96 ? 258 GLU B CG  1 
ATOM   4342  C  CD  . GLU B  1 278 ? 41.566 12.020  11.918  1.00 62.20 ? 258 GLU B CD  1 
ATOM   4343  O  OE1 . GLU B  1 278 ? 42.588 12.538  12.463  1.00 66.40 ? 258 GLU B OE1 1 
ATOM   4344  O  OE2 . GLU B  1 278 ? 41.511 10.809  11.483  1.00 66.32 ? 258 GLU B OE2 1 
ATOM   4345  N  N   . ILE B  1 279 ? 40.114 16.414  8.560   1.00 48.64 ? 259 ILE B N   1 
ATOM   4346  C  CA  . ILE B  1 279 ? 40.264 17.732  7.926   1.00 45.26 ? 259 ILE B CA  1 
ATOM   4347  C  C   . ILE B  1 279 ? 38.965 18.201  7.305   1.00 40.49 ? 259 ILE B C   1 
ATOM   4348  O  O   . ILE B  1 279 ? 38.598 19.349  7.443   1.00 37.13 ? 259 ILE B O   1 
ATOM   4349  C  CB  . ILE B  1 279 ? 41.374 17.707  6.840   1.00 45.04 ? 259 ILE B CB  1 
ATOM   4350  C  CG1 . ILE B  1 279 ? 42.736 17.496  7.522   1.00 43.80 ? 259 ILE B CG1 1 
ATOM   4351  C  CG2 . ILE B  1 279 ? 41.384 19.017  6.048   1.00 46.92 ? 259 ILE B CG2 1 
ATOM   4352  C  CD1 . ILE B  1 279 ? 43.805 16.969  6.625   1.00 47.68 ? 259 ILE B CD1 1 
ATOM   4353  N  N   . VAL B  1 280 ? 38.285 17.296  6.615   1.00 38.52 ? 260 VAL B N   1 
ATOM   4354  C  CA  . VAL B  1 280 ? 36.971 17.574  6.024   1.00 38.46 ? 260 VAL B CA  1 
ATOM   4355  C  C   . VAL B  1 280 ? 35.970 18.027  7.058   1.00 36.13 ? 260 VAL B C   1 
ATOM   4356  O  O   . VAL B  1 280 ? 35.301 19.069  6.872   1.00 38.14 ? 260 VAL B O   1 
ATOM   4357  C  CB  . VAL B  1 280 ? 36.430 16.338  5.335   1.00 38.10 ? 260 VAL B CB  1 
ATOM   4358  C  CG1 . VAL B  1 280 ? 35.007 16.564  4.942   1.00 46.60 ? 260 VAL B CG1 1 
ATOM   4359  C  CG2 . VAL B  1 280 ? 37.329 15.987  4.097   1.00 39.62 ? 260 VAL B CG2 1 
ATOM   4360  N  N   . ILE B  1 281 ? 35.915 17.288  8.169   1.00 33.83 ? 261 ILE B N   1 
ATOM   4361  C  CA  . ILE B  1 281 ? 35.038 17.608  9.294   1.00 36.28 ? 261 ILE B CA  1 
ATOM   4362  C  C   . ILE B  1 281 ? 35.424 18.910  9.952   1.00 36.67 ? 261 ILE B C   1 
ATOM   4363  O  O   . ILE B  1 281 ? 34.588 19.754  10.217  1.00 37.56 ? 261 ILE B O   1 
ATOM   4364  C  CB  . ILE B  1 281 ? 35.008 16.461  10.340  1.00 36.74 ? 261 ILE B CB  1 
ATOM   4365  C  CG1 . ILE B  1 281 ? 34.302 15.212  9.779   1.00 38.50 ? 261 ILE B CG1 1 
ATOM   4366  C  CG2 . ILE B  1 281 ? 34.322 16.906  11.602  1.00 33.22 ? 261 ILE B CG2 1 
ATOM   4367  C  CD1 . ILE B  1 281 ? 34.803 13.918  10.414  1.00 39.87 ? 261 ILE B CD1 1 
ATOM   4368  N  N   . TYR B  1 282 ? 36.704 19.081  10.209  1.00 38.86 ? 262 TYR B N   1 
ATOM   4369  C  CA  . TYR B  1 282 ? 37.186 20.306  10.842  1.00 40.40 ? 262 TYR B CA  1 
ATOM   4370  C  C   . TYR B  1 282 ? 36.920 21.595  10.072  1.00 36.96 ? 262 TYR B C   1 
ATOM   4371  O  O   . TYR B  1 282 ? 36.685 22.616  10.660  1.00 38.96 ? 262 TYR B O   1 
ATOM   4372  C  CB  . TYR B  1 282 ? 38.694 20.201  11.072  1.00 44.56 ? 262 TYR B CB  1 
ATOM   4373  C  CG  . TYR B  1 282 ? 39.183 21.088  12.168  1.00 44.77 ? 262 TYR B CG  1 
ATOM   4374  C  CD1 . TYR B  1 282 ? 38.960 20.746  13.501  1.00 50.12 ? 262 TYR B CD1 1 
ATOM   4375  C  CD2 . TYR B  1 282 ? 39.865 22.291  11.876  1.00 56.93 ? 262 TYR B CD2 1 
ATOM   4376  C  CE1 . TYR B  1 282 ? 39.417 21.577  14.554  1.00 56.12 ? 262 TYR B CE1 1 
ATOM   4377  C  CE2 . TYR B  1 282 ? 40.333 23.137  12.902  1.00 61.98 ? 262 TYR B CE2 1 
ATOM   4378  C  CZ  . TYR B  1 282 ? 40.104 22.768  14.248  1.00 60.62 ? 262 TYR B CZ  1 
ATOM   4379  O  OH  . TYR B  1 282 ? 40.551 23.572  15.273  1.00 57.04 ? 262 TYR B OH  1 
ATOM   4380  N  N   . GLN B  1 283 ? 37.054 21.533  8.761   1.00 36.59 ? 263 GLN B N   1 
ATOM   4381  C  CA  . GLN B  1 283 ? 36.827 22.635  7.843   1.00 33.64 ? 263 GLN B CA  1 
ATOM   4382  C  C   . GLN B  1 283 ? 35.380 22.790  7.404   1.00 34.94 ? 263 GLN B C   1 
ATOM   4383  O  O   . GLN B  1 283 ? 35.061 23.684  6.631   1.00 35.27 ? 263 GLN B O   1 
ATOM   4384  C  CB  . GLN B  1 283 ? 37.704 22.398  6.612   1.00 34.84 ? 263 GLN B CB  1 
ATOM   4385  C  CG  . GLN B  1 283 ? 39.246 22.576  6.875   1.00 38.36 ? 263 GLN B CG  1 
ATOM   4386  C  CD  . GLN B  1 283 ? 39.600 23.943  7.503   1.00 41.73 ? 263 GLN B CD  1 
ATOM   4387  O  OE1 . GLN B  1 283 ? 39.727 24.049  8.715   1.00 47.74 ? 263 GLN B OE1 1 
ATOM   4388  N  NE2 . GLN B  1 283 ? 39.750 24.978  6.679   1.00 42.62 ? 263 GLN B NE2 1 
ATOM   4389  N  N   . GLU B  1 284 ? 34.516 21.864  7.842   1.00 37.75 ? 264 GLU B N   1 
ATOM   4390  C  CA  . GLU B  1 284 ? 33.094 21.821  7.494   1.00 33.75 ? 264 GLU B CA  1 
ATOM   4391  C  C   . GLU B  1 284 ? 32.817 21.996  6.001   1.00 36.05 ? 264 GLU B C   1 
ATOM   4392  O  O   . GLU B  1 284 ? 31.998 22.820  5.578   1.00 37.45 ? 264 GLU B O   1 
ATOM   4393  C  CB  . GLU B  1 284 ? 32.340 22.831  8.337   1.00 32.22 ? 264 GLU B CB  1 
ATOM   4394  C  CG  . GLU B  1 284 ? 32.581 22.592  9.806   1.00 28.59 ? 264 GLU B CG  1 
ATOM   4395  C  CD  . GLU B  1 284 ? 31.744 23.467  10.726  1.00 37.41 ? 264 GLU B CD  1 
ATOM   4396  O  OE1 . GLU B  1 284 ? 30.524 23.175  10.923  1.00 44.59 ? 264 GLU B OE1 1 
ATOM   4397  O  OE2 . GLU B  1 284 ? 32.339 24.405  11.328  1.00 48.22 ? 264 GLU B OE2 1 
ATOM   4398  N  N   . LEU B  1 285 ? 33.481 21.165  5.210   1.00 37.23 ? 265 LEU B N   1 
ATOM   4399  C  CA  . LEU B  1 285 ? 33.401 21.260  3.777   1.00 37.65 ? 265 LEU B CA  1 
ATOM   4400  C  C   . LEU B  1 285 ? 32.081 20.730  3.263   1.00 38.35 ? 265 LEU B C   1 
ATOM   4401  O  O   . LEU B  1 285 ? 31.464 19.878  3.901   1.00 37.73 ? 265 LEU B O   1 
ATOM   4402  C  CB  . LEU B  1 285 ? 34.601 20.531  3.144   1.00 38.71 ? 265 LEU B CB  1 
ATOM   4403  C  CG  . LEU B  1 285 ? 36.007 21.048  3.498   1.00 33.92 ? 265 LEU B CG  1 
ATOM   4404  C  CD1 . LEU B  1 285 ? 37.098 20.314  2.710   1.00 36.77 ? 265 LEU B CD1 1 
ATOM   4405  C  CD2 . LEU B  1 285 ? 36.139 22.532  3.288   1.00 43.19 ? 265 LEU B CD2 1 
ATOM   4406  N  N   . ARG B  1 286 ? 31.625 21.308  2.145   1.00 43.96 ? 266 ARG B N   1 
ATOM   4407  C  CA  . ARG B  1 286 ? 30.442 20.854  1.389   1.00 43.84 ? 266 ARG B CA  1 
ATOM   4408  C  C   . ARG B  1 286 ? 30.921 20.307  0.073   1.00 43.18 ? 266 ARG B C   1 
ATOM   4409  O  O   . ARG B  1 286 ? 31.609 20.987  -0.642  1.00 45.19 ? 266 ARG B O   1 
ATOM   4410  C  CB  . ARG B  1 286 ? 29.465 21.997  1.112   1.00 44.61 ? 266 ARG B CB  1 
ATOM   4411  C  CG  . ARG B  1 286 ? 28.096 21.530  0.473   1.00 47.90 ? 266 ARG B CG  1 
ATOM   4412  C  CD  . ARG B  1 286 ? 27.117 22.691  0.202   1.00 48.44 ? 266 ARG B CD  1 
ATOM   4413  N  N   . MET B  1 287 ? 30.593 19.059  -0.234  1.00 46.70 ? 267 MET B N   1 
ATOM   4414  C  CA  . MET B  1 287 ? 30.956 18.449  -1.509  1.00 49.99 ? 267 MET B CA  1 
ATOM   4415  C  C   . MET B  1 287 ? 29.712 17.982  -2.190  1.00 46.51 ? 267 MET B C   1 
ATOM   4416  O  O   . MET B  1 287 ? 28.888 17.283  -1.620  1.00 49.44 ? 267 MET B O   1 
ATOM   4417  C  CB  . MET B  1 287 ? 31.904 17.293  -1.301  1.00 49.13 ? 267 MET B CB  1 
ATOM   4418  C  CG  . MET B  1 287 ? 32.854 17.629  -0.171  1.00 58.44 ? 267 MET B CG  1 
ATOM   4419  S  SD  . MET B  1 287 ? 34.164 16.477  0.210   1.00 61.62 ? 267 MET B SD  1 
ATOM   4420  C  CE  . MET B  1 287 ? 34.949 17.458  1.480   1.00 66.67 ? 267 MET B CE  1 
ATOM   4421  N  N   . GLU B  1 288 ? 29.566 18.379  -3.422  1.00 41.92 ? 268 GLU B N   1 
ATOM   4422  C  CA  . GLU B  1 288 ? 28.392 18.015  -4.124  1.00 40.77 ? 268 GLU B CA  1 
ATOM   4423  C  C   . GLU B  1 288 ? 28.729 17.601  -5.531  1.00 37.19 ? 268 GLU B C   1 
ATOM   4424  O  O   . GLU B  1 288 ? 29.459 18.271  -6.221  1.00 36.76 ? 268 GLU B O   1 
ATOM   4425  C  CB  . GLU B  1 288 ? 27.426 19.177  -4.104  1.00 41.77 ? 268 GLU B CB  1 
ATOM   4426  C  CG  . GLU B  1 288 ? 26.070 18.757  -4.563  1.00 51.26 ? 268 GLU B CG  1 
ATOM   4427  C  CD  . GLU B  1 288 ? 25.086 19.878  -4.492  1.00 60.74 ? 268 GLU B CD  1 
ATOM   4428  O  OE1 . GLU B  1 288 ? 24.043 19.730  -5.158  1.00 60.62 ? 268 GLU B OE1 1 
ATOM   4429  O  OE2 . GLU B  1 288 ? 25.364 20.887  -3.778  1.00 71.64 ? 268 GLU B OE2 1 
ATOM   4430  N  N   . ALA B  1 289 ? 28.212 16.455  -5.905  1.00 37.38 ? 269 ALA B N   1 
ATOM   4431  C  CA  . ALA B  1 289 ? 28.416 15.831  -7.197  1.00 38.87 ? 269 ALA B CA  1 
ATOM   4432  C  C   . ALA B  1 289 ? 27.300 16.189  -8.137  1.00 37.83 ? 269 ALA B C   1 
ATOM   4433  O  O   . ALA B  1 289 ? 26.226 16.573  -7.732  1.00 40.29 ? 269 ALA B O   1 
ATOM   4434  C  CB  . ALA B  1 289 ? 28.518 14.327  -7.050  1.00 39.54 ? 269 ALA B CB  1 
ATOM   4435  N  N   . PHE B  1 290 ? 27.582 16.178  -9.417  1.00 39.99 ? 270 PHE B N   1 
ATOM   4436  C  CA  . PHE B  1 290 ? 26.569 16.662  -10.342 1.00 41.55 ? 270 PHE B CA  1 
ATOM   4437  C  C   . PHE B  1 290 ? 26.854 16.041  -11.685 1.00 40.35 ? 270 PHE B C   1 
ATOM   4438  O  O   . PHE B  1 290 ? 27.985 15.677  -11.962 1.00 38.33 ? 270 PHE B O   1 
ATOM   4439  C  CB  . PHE B  1 290 ? 26.472 18.230  -10.385 1.00 38.35 ? 270 PHE B CB  1 
ATOM   4440  C  CG  . PHE B  1 290 ? 27.652 18.886  -11.004 1.00 39.85 ? 270 PHE B CG  1 
ATOM   4441  C  CD1 . PHE B  1 290 ? 27.597 19.346  -12.326 1.00 41.56 ? 270 PHE B CD1 1 
ATOM   4442  C  CD2 . PHE B  1 290 ? 28.838 19.011  -10.296 1.00 44.20 ? 270 PHE B CD2 1 
ATOM   4443  C  CE1 . PHE B  1 290 ? 28.677 19.903  -12.906 1.00 47.74 ? 270 PHE B CE1 1 
ATOM   4444  C  CE2 . PHE B  1 290 ? 29.951 19.595  -10.873 1.00 41.62 ? 270 PHE B CE2 1 
ATOM   4445  C  CZ  . PHE B  1 290 ? 29.887 20.021  -12.178 1.00 49.31 ? 270 PHE B CZ  1 
ATOM   4446  N  N   . VAL B  1 291 ? 25.780 15.902  -12.453 1.00 44.35 ? 271 VAL B N   1 
ATOM   4447  C  CA  . VAL B  1 291 ? 25.795 15.599  -13.867 1.00 46.49 ? 271 VAL B CA  1 
ATOM   4448  C  C   . VAL B  1 291 ? 25.091 16.741  -14.625 1.00 44.04 ? 271 VAL B C   1 
ATOM   4449  O  O   . VAL B  1 291 ? 24.020 17.154  -14.218 1.00 42.18 ? 271 VAL B O   1 
ATOM   4450  C  CB  . VAL B  1 291 ? 25.087 14.258  -14.113 1.00 50.46 ? 271 VAL B CB  1 
ATOM   4451  C  CG1 . VAL B  1 291 ? 25.168 13.872  -15.571 1.00 56.72 ? 271 VAL B CG1 1 
ATOM   4452  C  CG2 . VAL B  1 291 ? 25.775 13.161  -13.277 1.00 52.12 ? 271 VAL B CG2 1 
ATOM   4453  N  N   . VAL B  1 292 ? 25.692 17.215  -15.729 1.00 44.33 ? 272 VAL B N   1 
ATOM   4454  C  CA  . VAL B  1 292 ? 25.096 18.255  -16.572 1.00 45.39 ? 272 VAL B CA  1 
ATOM   4455  C  C   . VAL B  1 292 ? 23.613 18.131  -16.959 1.00 46.08 ? 272 VAL B C   1 
ATOM   4456  O  O   . VAL B  1 292 ? 22.905 19.163  -17.049 1.00 45.86 ? 272 VAL B O   1 
ATOM   4457  C  CB  . VAL B  1 292 ? 25.758 18.429  -17.970 1.00 45.02 ? 272 VAL B CB  1 
ATOM   4458  C  CG1 . VAL B  1 292 ? 26.295 19.814  -18.121 1.00 50.79 ? 272 VAL B CG1 1 
ATOM   4459  C  CG2 . VAL B  1 292 ? 26.683 17.308  -18.363 1.00 48.60 ? 272 VAL B CG2 1 
ATOM   4460  N  N   . TYR B  1 293 ? 23.186 16.909  -17.278 1.00 45.31 ? 273 TYR B N   1 
ATOM   4461  C  CA  . TYR B  1 293 ? 21.841 16.647  -17.784 1.00 46.37 ? 273 TYR B CA  1 
ATOM   4462  C  C   . TYR B  1 293 ? 20.747 16.935  -16.773 1.00 45.74 ? 273 TYR B C   1 
ATOM   4463  O  O   . TYR B  1 293 ? 19.577 16.852  -17.110 1.00 45.17 ? 273 TYR B O   1 
ATOM   4464  C  CB  . TYR B  1 293 ? 21.732 15.209  -18.282 1.00 50.45 ? 273 TYR B CB  1 
ATOM   4465  C  CG  . TYR B  1 293 ? 22.932 14.844  -19.126 1.00 50.92 ? 273 TYR B CG  1 
ATOM   4466  C  CD1 . TYR B  1 293 ? 23.132 15.417  -20.405 1.00 57.05 ? 273 TYR B CD1 1 
ATOM   4467  C  CD2 . TYR B  1 293 ? 23.894 13.973  -18.636 1.00 55.39 ? 273 TYR B CD2 1 
ATOM   4468  C  CE1 . TYR B  1 293 ? 24.274 15.088  -21.194 1.00 56.36 ? 273 TYR B CE1 1 
ATOM   4469  C  CE2 . TYR B  1 293 ? 25.031 13.656  -19.381 1.00 60.85 ? 273 TYR B CE2 1 
ATOM   4470  C  CZ  . TYR B  1 293 ? 25.221 14.202  -20.665 1.00 58.84 ? 273 TYR B CZ  1 
ATOM   4471  O  OH  . TYR B  1 293 ? 26.380 13.857  -21.358 1.00 58.36 ? 273 TYR B OH  1 
ATOM   4472  N  N   . ARG B  1 294 ? 21.129 17.275  -15.540 1.00 44.95 ? 274 ARG B N   1 
ATOM   4473  C  CA  . ARG B  1 294 ? 20.173 17.774  -14.570 1.00 46.19 ? 274 ARG B CA  1 
ATOM   4474  C  C   . ARG B  1 294 ? 19.452 19.037  -15.051 1.00 46.68 ? 274 ARG B C   1 
ATOM   4475  O  O   . ARG B  1 294 ? 18.261 19.196  -14.793 1.00 49.59 ? 274 ARG B O   1 
ATOM   4476  C  CB  . ARG B  1 294 ? 20.853 18.126  -13.246 1.00 47.34 ? 274 ARG B CB  1 
ATOM   4477  C  CG  . ARG B  1 294 ? 19.846 18.374  -12.106 1.00 45.71 ? 274 ARG B CG  1 
ATOM   4478  C  CD  . ARG B  1 294 ? 20.432 19.178  -10.966 1.00 44.52 ? 274 ARG B CD  1 
ATOM   4479  N  NE  . ARG B  1 294 ? 21.580 18.522  -10.392 1.00 47.92 ? 274 ARG B NE  1 
ATOM   4480  C  CZ  . ARG B  1 294 ? 22.092 18.786  -9.188  1.00 46.94 ? 274 ARG B CZ  1 
ATOM   4481  N  NH1 . ARG B  1 294 ? 21.584 19.735  -8.419  1.00 37.99 ? 274 ARG B NH1 1 
ATOM   4482  N  NH2 . ARG B  1 294 ? 23.112 18.069  -8.742  1.00 38.59 ? 274 ARG B NH2 1 
ATOM   4483  N  N   . TRP B  1 295 ? 20.182 19.960  -15.669 1.00 45.62 ? 275 TRP B N   1 
ATOM   4484  C  CA  . TRP B  1 295 ? 19.594 21.247  -16.077 1.00 45.22 ? 275 TRP B CA  1 
ATOM   4485  C  C   . TRP B  1 295 ? 19.057 21.172  -17.483 1.00 44.75 ? 275 TRP B C   1 
ATOM   4486  O  O   . TRP B  1 295 ? 19.805 20.873  -18.410 1.00 46.46 ? 275 TRP B O   1 
ATOM   4487  C  CB  . TRP B  1 295 ? 20.619 22.368  -15.957 1.00 42.72 ? 275 TRP B CB  1 
ATOM   4488  C  CG  . TRP B  1 295 ? 21.018 22.592  -14.531 1.00 38.56 ? 275 TRP B CG  1 
ATOM   4489  C  CD1 . TRP B  1 295 ? 20.419 23.397  -13.654 1.00 39.81 ? 275 TRP B CD1 1 
ATOM   4490  C  CD2 . TRP B  1 295 ? 22.121 21.986  -13.836 1.00 41.91 ? 275 TRP B CD2 1 
ATOM   4491  N  NE1 . TRP B  1 295 ? 21.056 23.342  -12.438 1.00 40.95 ? 275 TRP B NE1 1 
ATOM   4492  C  CE2 . TRP B  1 295 ? 22.125 22.497  -12.536 1.00 39.97 ? 275 TRP B CE2 1 
ATOM   4493  C  CE3 . TRP B  1 295 ? 23.096 21.059  -14.190 1.00 37.61 ? 275 TRP B CE3 1 
ATOM   4494  C  CZ2 . TRP B  1 295 ? 23.074 22.125  -11.593 1.00 39.54 ? 275 TRP B CZ2 1 
ATOM   4495  C  CZ3 . TRP B  1 295 ? 24.014 20.676  -13.250 1.00 37.33 ? 275 TRP B CZ3 1 
ATOM   4496  C  CH2 . TRP B  1 295 ? 24.008 21.207  -11.984 1.00 40.71 ? 275 TRP B CH2 1 
ATOM   4497  N  N   . GLN B  1 296 ? 17.753 21.393  -17.615 1.00 47.81 ? 276 GLN B N   1 
ATOM   4498  C  CA  . GLN B  1 296 ? 17.041 21.303  -18.891 1.00 48.40 ? 276 GLN B CA  1 
ATOM   4499  C  C   . GLN B  1 296 ? 16.207 22.570  -19.079 1.00 49.33 ? 276 GLN B C   1 
ATOM   4500  O  O   . GLN B  1 296 ? 16.356 23.530  -18.312 1.00 51.62 ? 276 GLN B O   1 
ATOM   4501  C  CB  . GLN B  1 296 ? 16.169 20.040  -18.906 1.00 47.65 ? 276 GLN B CB  1 
ATOM   4502  C  CG  . GLN B  1 296 ? 16.964 18.709  -18.773 1.00 49.81 ? 276 GLN B CG  1 
ATOM   4503  C  CD  . GLN B  1 296 ? 18.030 18.542  -19.865 1.00 49.40 ? 276 GLN B CD  1 
ATOM   4504  O  OE1 . GLN B  1 296 ? 17.901 19.096  -20.942 1.00 51.43 ? 276 GLN B OE1 1 
ATOM   4505  N  NE2 . GLN B  1 296 ? 19.096 17.813  -19.567 1.00 44.18 ? 276 GLN B NE2 1 
ATOM   4506  N  N   . GLY B  1 297 ? 15.362 22.602  -20.107 1.00 49.79 ? 277 GLY B N   1 
ATOM   4507  C  CA  . GLY B  1 297 ? 14.395 23.682  -20.259 1.00 48.10 ? 277 GLY B CA  1 
ATOM   4508  C  C   . GLY B  1 297 ? 15.050 25.031  -20.445 1.00 49.09 ? 277 GLY B C   1 
ATOM   4509  O  O   . GLY B  1 297 ? 15.997 25.148  -21.200 1.00 51.49 ? 277 GLY B O   1 
ATOM   4510  N  N   . ASP B  1 298 ? 14.546 26.044  -19.748 1.00 51.34 ? 278 ASP B N   1 
ATOM   4511  C  CA  . ASP B  1 298 ? 14.994 27.436  -19.899 1.00 52.41 ? 278 ASP B CA  1 
ATOM   4512  C  C   . ASP B  1 298 ? 16.342 27.686  -19.304 1.00 49.39 ? 278 ASP B C   1 
ATOM   4513  O  O   . ASP B  1 298 ? 17.084 28.526  -19.792 1.00 47.43 ? 278 ASP B O   1 
ATOM   4514  C  CB  . ASP B  1 298 ? 14.034 28.399  -19.188 1.00 54.17 ? 278 ASP B CB  1 
ATOM   4515  C  CG  . ASP B  1 298 ? 12.693 28.512  -19.880 1.00 63.64 ? 278 ASP B CG  1 
ATOM   4516  O  OD1 . ASP B  1 298 ? 12.574 28.006  -21.028 1.00 62.88 ? 278 ASP B OD1 1 
ATOM   4517  O  OD2 . ASP B  1 298 ? 11.766 29.117  -19.264 1.00 72.38 ? 278 ASP B OD2 1 
ATOM   4518  N  N   . ALA B  1 299 ? 16.630 27.000  -18.206 1.00 49.36 ? 279 ALA B N   1 
ATOM   4519  C  CA  . ALA B  1 299 ? 17.892 27.206  -17.483 1.00 48.99 ? 279 ALA B CA  1 
ATOM   4520  C  C   . ALA B  1 299 ? 19.057 26.797  -18.377 1.00 44.89 ? 279 ALA B C   1 
ATOM   4521  O  O   . ALA B  1 299 ? 20.061 27.524  -18.486 1.00 42.07 ? 279 ALA B O   1 
ATOM   4522  C  CB  . ALA B  1 299 ? 17.910 26.413  -16.154 1.00 49.43 ? 279 ALA B CB  1 
ATOM   4523  N  N   . ARG B  1 300 ? 18.874 25.644  -19.020 1.00 41.11 ? 280 ARG B N   1 
ATOM   4524  C  CA  . ARG B  1 300 ? 19.831 25.102  -19.957 1.00 41.53 ? 280 ARG B CA  1 
ATOM   4525  C  C   . ARG B  1 300 ? 20.023 25.993  -21.176 1.00 41.11 ? 280 ARG B C   1 
ATOM   4526  O  O   . ARG B  1 300 ? 21.144 26.192  -21.635 1.00 40.75 ? 280 ARG B O   1 
ATOM   4527  C  CB  . ARG B  1 300 ? 19.388 23.725  -20.397 1.00 40.51 ? 280 ARG B CB  1 
ATOM   4528  C  CG  . ARG B  1 300 ? 20.376 23.063  -21.314 1.00 42.94 ? 280 ARG B CG  1 
ATOM   4529  C  CD  . ARG B  1 300 ? 19.924 21.705  -21.689 1.00 42.46 ? 280 ARG B CD  1 
ATOM   4530  N  NE  . ARG B  1 300 ? 20.943 21.014  -22.459 1.00 45.57 ? 280 ARG B NE  1 
ATOM   4531  C  CZ  . ARG B  1 300 ? 21.044 21.036  -23.785 1.00 52.53 ? 280 ARG B CZ  1 
ATOM   4532  N  NH1 . ARG B  1 300 ? 20.213 21.758  -24.539 1.00 52.31 ? 280 ARG B NH1 1 
ATOM   4533  N  NH2 . ARG B  1 300 ? 22.006 20.339  -24.369 1.00 53.77 ? 280 ARG B NH2 1 
ATOM   4534  N  N   . GLN B  1 301 ? 18.923 26.505  -21.705 1.00 42.92 ? 281 GLN B N   1 
ATOM   4535  C  CA  . GLN B  1 301 ? 18.942 27.418  -22.855 1.00 44.02 ? 281 GLN B CA  1 
ATOM   4536  C  C   . GLN B  1 301 ? 19.581 28.792  -22.548 1.00 42.16 ? 281 GLN B C   1 
ATOM   4537  O  O   . GLN B  1 301 ? 20.294 29.343  -23.384 1.00 40.52 ? 281 GLN B O   1 
ATOM   4538  C  CB  . GLN B  1 301 ? 17.502 27.636  -23.378 1.00 44.63 ? 281 GLN B CB  1 
ATOM   4539  C  CG  . GLN B  1 301 ? 17.418 27.964  -24.864 1.00 49.71 ? 281 GLN B CG  1 
ATOM   4540  C  CD  . GLN B  1 301 ? 18.074 26.892  -25.728 1.00 59.38 ? 281 GLN B CD  1 
ATOM   4541  O  OE1 . GLN B  1 301 ? 18.545 27.180  -26.818 1.00 70.47 ? 281 GLN B OE1 1 
ATOM   4542  N  NE2 . GLN B  1 301 ? 18.119 25.655  -25.233 1.00 68.89 ? 281 GLN B NE2 1 
ATOM   4543  N  N   . LYS B  1 302 ? 19.286 29.345  -21.374 1.00 40.54 ? 282 LYS B N   1 
ATOM   4544  C  CA  . LYS B  1 302 ? 19.920 30.579  -20.910 1.00 42.20 ? 282 LYS B CA  1 
ATOM   4545  C  C   . LYS B  1 302 ? 21.436 30.409  -20.797 1.00 41.17 ? 282 LYS B C   1 
ATOM   4546  O  O   . LYS B  1 302 ? 22.209 31.335  -21.063 1.00 42.89 ? 282 LYS B O   1 
ATOM   4547  C  CB  . LYS B  1 302 ? 19.344 31.013  -19.550 1.00 41.21 ? 282 LYS B CB  1 
ATOM   4548  C  CG  . LYS B  1 302 ? 19.719 32.430  -19.188 1.00 46.21 ? 282 LYS B CG  1 
ATOM   4549  C  CD  . LYS B  1 302 ? 20.022 32.651  -17.698 1.00 52.81 ? 282 LYS B CD  1 
ATOM   4550  C  CE  . LYS B  1 302 ? 21.004 33.849  -17.483 1.00 52.13 ? 282 LYS B CE  1 
ATOM   4551  N  NZ  . LYS B  1 302 ? 20.963 34.882  -18.593 1.00 43.01 ? 282 LYS B NZ  1 
ATOM   4552  N  N   . ALA B  1 303 ? 21.856 29.219  -20.409 1.00 41.93 ? 283 ALA B N   1 
ATOM   4553  C  CA  . ALA B  1 303 ? 23.286 28.899  -20.300 1.00 40.00 ? 283 ALA B CA  1 
ATOM   4554  C  C   . ALA B  1 303 ? 23.972 28.772  -21.647 1.00 38.68 ? 283 ALA B C   1 
ATOM   4555  O  O   . ALA B  1 303 ? 25.029 29.340  -21.841 1.00 40.59 ? 283 ALA B O   1 
ATOM   4556  C  CB  . ALA B  1 303 ? 23.475 27.672  -19.490 1.00 39.13 ? 283 ALA B CB  1 
ATOM   4557  N  N   . LEU B  1 304 ? 23.380 28.043  -22.577 1.00 37.49 ? 284 LEU B N   1 
ATOM   4558  C  CA  . LEU B  1 304 ? 23.884 28.007  -23.948 1.00 40.48 ? 284 LEU B CA  1 
ATOM   4559  C  C   . LEU B  1 304 ? 24.005 29.388  -24.613 1.00 42.65 ? 284 LEU B C   1 
ATOM   4560  O  O   . LEU B  1 304 ? 24.975 29.654  -25.315 1.00 45.18 ? 284 LEU B O   1 
ATOM   4561  C  CB  . LEU B  1 304 ? 22.990 27.113  -24.830 1.00 41.92 ? 284 LEU B CB  1 
ATOM   4562  C  CG  . LEU B  1 304 ? 23.234 25.621  -24.728 1.00 43.31 ? 284 LEU B CG  1 
ATOM   4563  C  CD1 . LEU B  1 304 ? 22.244 24.827  -25.598 1.00 47.08 ? 284 LEU B CD1 1 
ATOM   4564  C  CD2 . LEU B  1 304 ? 24.689 25.319  -25.072 1.00 39.64 ? 284 LEU B CD2 1 
ATOM   4565  N  N   . LYS B  1 305 ? 22.999 30.234  -24.437 1.00 41.89 ? 285 LYS B N   1 
ATOM   4566  C  CA  . LYS B  1 305 ? 23.058 31.598  -24.915 1.00 44.44 ? 285 LYS B CA  1 
ATOM   4567  C  C   . LYS B  1 305 ? 24.092 32.474  -24.185 1.00 43.18 ? 285 LYS B C   1 
ATOM   4568  O  O   . LYS B  1 305 ? 24.718 33.339  -24.803 1.00 44.48 ? 285 LYS B O   1 
ATOM   4569  C  CB  . LYS B  1 305 ? 21.674 32.239  -24.832 1.00 45.72 ? 285 LYS B CB  1 
ATOM   4570  C  CG  . LYS B  1 305 ? 20.650 31.592  -25.777 1.00 49.57 ? 285 LYS B CG  1 
ATOM   4571  C  CD  . LYS B  1 305 ? 19.244 32.166  -25.555 1.00 49.55 ? 285 LYS B CD  1 
ATOM   4572  C  CE  . LYS B  1 305 ? 18.231 31.554  -26.535 1.00 56.16 ? 285 LYS B CE  1 
ATOM   4573  N  NZ  . LYS B  1 305 ? 16.850 31.491  -25.958 1.00 58.35 ? 285 LYS B NZ  1 
ATOM   4574  N  N   . ASP B  1 306 ? 24.250 32.297  -22.876 1.00 43.27 ? 286 ASP B N   1 
ATOM   4575  C  CA  . ASP B  1 306 ? 25.353 32.982  -22.145 1.00 43.88 ? 286 ASP B CA  1 
ATOM   4576  C  C   . ASP B  1 306 ? 26.774 32.582  -22.605 1.00 42.24 ? 286 ASP B C   1 
ATOM   4577  O  O   . ASP B  1 306 ? 27.664 33.426  -22.680 1.00 39.98 ? 286 ASP B O   1 
ATOM   4578  C  CB  . ASP B  1 306 ? 25.239 32.720  -20.641 1.00 45.39 ? 286 ASP B CB  1 
ATOM   4579  C  CG  . ASP B  1 306 ? 24.227 33.603  -19.978 1.00 47.64 ? 286 ASP B CG  1 
ATOM   4580  O  OD1 . ASP B  1 306 ? 23.551 34.372  -20.710 1.00 52.68 ? 286 ASP B OD1 1 
ATOM   4581  O  OD2 . ASP B  1 306 ? 24.111 33.532  -18.719 1.00 57.37 ? 286 ASP B OD2 1 
ATOM   4582  N  N   . LEU B  1 307 ? 26.966 31.288  -22.882 1.00 40.91 ? 287 LEU B N   1 
ATOM   4583  C  CA  . LEU B  1 307 ? 28.249 30.755  -23.357 1.00 40.86 ? 287 LEU B CA  1 
ATOM   4584  C  C   . LEU B  1 307 ? 28.621 31.262  -24.751 1.00 40.14 ? 287 LEU B C   1 
ATOM   4585  O  O   . LEU B  1 307 ? 29.761 31.673  -24.988 1.00 37.69 ? 287 LEU B O   1 
ATOM   4586  C  CB  . LEU B  1 307 ? 28.217 29.223  -23.368 1.00 39.19 ? 287 LEU B CB  1 
ATOM   4587  C  CG  . LEU B  1 307 ? 28.277 28.560  -21.998 1.00 36.30 ? 287 LEU B CG  1 
ATOM   4588  C  CD1 . LEU B  1 307 ? 27.660 27.143  -22.112 1.00 28.94 ? 287 LEU B CD1 1 
ATOM   4589  C  CD2 . LEU B  1 307 ? 29.702 28.547  -21.377 1.00 34.57 ? 287 LEU B CD2 1 
ATOM   4590  N  N   . LEU B  1 308 ? 27.647 31.216  -25.660 1.00 42.69 ? 288 LEU B N   1 
ATOM   4591  C  CA  . LEU B  1 308 ? 27.809 31.725  -27.019 1.00 42.90 ? 288 LEU B CA  1 
ATOM   4592  C  C   . LEU B  1 308 ? 28.041 33.242  -27.010 1.00 41.88 ? 288 LEU B C   1 
ATOM   4593  O  O   . LEU B  1 308 ? 28.849 33.744  -27.778 1.00 40.99 ? 288 LEU B O   1 
ATOM   4594  C  CB  . LEU B  1 308 ? 26.600 31.329  -27.893 1.00 43.15 ? 288 LEU B CB  1 
ATOM   4595  C  CG  . LEU B  1 308 ? 26.589 31.861  -29.342 1.00 46.06 ? 288 LEU B CG  1 
ATOM   4596  C  CD1 . LEU B  1 308 ? 27.415 30.979  -30.285 1.00 48.64 ? 288 LEU B CD1 1 
ATOM   4597  C  CD2 . LEU B  1 308 ? 25.145 32.029  -29.848 1.00 44.89 ? 288 LEU B CD2 1 
ATOM   4598  N  N   . LYS B  1 309 ? 27.329 33.962  -26.145 1.00 42.68 ? 289 LYS B N   1 
ATOM   4599  C  CA  . LYS B  1 309 ? 27.528 35.404  -26.002 1.00 43.38 ? 289 LYS B CA  1 
ATOM   4600  C  C   . LYS B  1 309 ? 28.976 35.661  -25.596 1.00 42.61 ? 289 LYS B C   1 
ATOM   4601  O  O   . LYS B  1 309 ? 29.675 36.434  -26.240 1.00 41.80 ? 289 LYS B O   1 
ATOM   4602  C  CB  . LYS B  1 309 ? 26.545 36.016  -24.967 1.00 44.42 ? 289 LYS B CB  1 
ATOM   4603  C  CG  . LYS B  1 309 ? 26.669 37.561  -24.740 1.00 43.40 ? 289 LYS B CG  1 
ATOM   4604  N  N   . TRP B  1 310 ? 29.415 34.998  -24.528 1.00 42.74 ? 290 TRP B N   1 
ATOM   4605  C  CA  . TRP B  1 310 ? 30.768 35.177  -24.009 1.00 43.96 ? 290 TRP B CA  1 
ATOM   4606  C  C   . TRP B  1 310 ? 31.872 34.831  -25.017 1.00 44.17 ? 290 TRP B C   1 
ATOM   4607  O  O   . TRP B  1 310 ? 32.934 35.458  -24.994 1.00 43.18 ? 290 TRP B O   1 
ATOM   4608  C  CB  . TRP B  1 310 ? 30.957 34.380  -22.711 1.00 45.20 ? 290 TRP B CB  1 
ATOM   4609  C  CG  . TRP B  1 310 ? 30.246 34.986  -21.524 1.00 48.54 ? 290 TRP B CG  1 
ATOM   4610  C  CD1 . TRP B  1 310 ? 30.036 36.323  -21.285 1.00 46.85 ? 290 TRP B CD1 1 
ATOM   4611  C  CD2 . TRP B  1 310 ? 29.667 34.284  -20.404 1.00 45.08 ? 290 TRP B CD2 1 
ATOM   4612  N  NE1 . TRP B  1 310 ? 29.359 36.488  -20.094 1.00 48.95 ? 290 TRP B NE1 1 
ATOM   4613  C  CE2 . TRP B  1 310 ? 29.127 35.259  -19.533 1.00 45.63 ? 290 TRP B CE2 1 
ATOM   4614  C  CE3 . TRP B  1 310 ? 29.569 32.925  -20.050 1.00 48.84 ? 290 TRP B CE3 1 
ATOM   4615  C  CZ2 . TRP B  1 310 ? 28.489 34.925  -18.346 1.00 48.57 ? 290 TRP B CZ2 1 
ATOM   4616  C  CZ3 . TRP B  1 310 ? 28.946 32.588  -18.877 1.00 46.34 ? 290 TRP B CZ3 1 
ATOM   4617  C  CH2 . TRP B  1 310 ? 28.408 33.586  -18.031 1.00 52.96 ? 290 TRP B CH2 1 
ATOM   4618  N  N   . VAL B  1 311 ? 31.621 33.853  -25.895 1.00 45.00 ? 291 VAL B N   1 
ATOM   4619  C  CA  . VAL B  1 311 ? 32.575 33.480  -26.971 1.00 43.92 ? 291 VAL B CA  1 
ATOM   4620  C  C   . VAL B  1 311 ? 32.752 34.608  -28.005 1.00 44.05 ? 291 VAL B C   1 
ATOM   4621  O  O   . VAL B  1 311 ? 33.874 35.028  -28.295 1.00 40.46 ? 291 VAL B O   1 
ATOM   4622  C  CB  . VAL B  1 311 ? 32.184 32.114  -27.646 1.00 42.97 ? 291 VAL B CB  1 
ATOM   4623  C  CG1 . VAL B  1 311 ? 32.908 31.904  -28.950 1.00 44.16 ? 291 VAL B CG1 1 
ATOM   4624  C  CG2 . VAL B  1 311 ? 32.491 30.930  -26.702 1.00 38.90 ? 291 VAL B CG2 1 
ATOM   4625  N  N   . LEU B  1 312 ? 31.628 35.113  -28.502 1.00 45.54 ? 292 LEU B N   1 
ATOM   4626  C  CA  . LEU B  1 312 ? 31.596 36.222  -29.459 1.00 46.70 ? 292 LEU B CA  1 
ATOM   4627  C  C   . LEU B  1 312 ? 32.247 37.491  -28.906 1.00 47.75 ? 292 LEU B C   1 
ATOM   4628  O  O   . LEU B  1 312 ? 33.014 38.156  -29.612 1.00 47.99 ? 292 LEU B O   1 
ATOM   4629  C  CB  . LEU B  1 312 ? 30.158 36.510  -29.902 1.00 46.53 ? 292 LEU B CB  1 
ATOM   4630  C  CG  . LEU B  1 312 ? 29.385 35.296  -30.462 1.00 50.30 ? 292 LEU B CG  1 
ATOM   4631  C  CD1 . LEU B  1 312 ? 27.933 35.677  -30.741 1.00 47.65 ? 292 LEU B CD1 1 
ATOM   4632  C  CD2 . LEU B  1 312 ? 30.052 34.672  -31.706 1.00 49.69 ? 292 LEU B CD2 1 
ATOM   4633  N  N   . GLU B  1 313 ? 31.966 37.806  -27.646 1.00 48.34 ? 293 GLU B N   1 
ATOM   4634  C  CA  . GLU B  1 313 ? 32.645 38.910  -26.958 1.00 50.32 ? 293 GLU B CA  1 
ATOM   4635  C  C   . GLU B  1 313 ? 34.140 38.662  -26.676 1.00 48.58 ? 293 GLU B C   1 
ATOM   4636  O  O   . GLU B  1 313 ? 34.853 39.591  -26.312 1.00 48.42 ? 293 GLU B O   1 
ATOM   4637  C  CB  . GLU B  1 313 ? 31.935 39.225  -25.638 1.00 50.31 ? 293 GLU B CB  1 
ATOM   4638  C  CG  . GLU B  1 313 ? 30.518 39.725  -25.844 1.00 54.01 ? 293 GLU B CG  1 
ATOM   4639  C  CD  . GLU B  1 313 ? 29.747 39.959  -24.539 1.00 55.85 ? 293 GLU B CD  1 
ATOM   4640  O  OE1 . GLU B  1 313 ? 29.956 39.225  -23.537 1.00 49.48 ? 293 GLU B OE1 1 
ATOM   4641  O  OE2 . GLU B  1 313 ? 28.909 40.892  -24.541 1.00 65.96 ? 293 GLU B OE2 1 
ATOM   4642  N  N   . GLY B  1 314 ? 34.605 37.423  -26.816 1.00 47.74 ? 294 GLY B N   1 
ATOM   4643  C  CA  . GLY B  1 314 ? 36.008 37.095  -26.588 1.00 46.11 ? 294 GLY B CA  1 
ATOM   4644  C  C   . GLY B  1 314 ? 36.323 36.822  -25.130 1.00 45.89 ? 294 GLY B C   1 
ATOM   4645  O  O   . GLY B  1 314 ? 37.481 36.636  -24.776 1.00 46.30 ? 294 GLY B O   1 
ATOM   4646  N  N   . LYS B  1 315 ? 35.298 36.762  -24.275 1.00 46.61 ? 295 LYS B N   1 
ATOM   4647  C  CA  . LYS B  1 315 ? 35.494 36.517  -22.832 1.00 44.50 ? 295 LYS B CA  1 
ATOM   4648  C  C   . LYS B  1 315 ? 35.744 35.020  -22.548 1.00 44.60 ? 295 LYS B C   1 
ATOM   4649  O  O   . LYS B  1 315 ? 36.172 34.636  -21.445 1.00 43.19 ? 295 LYS B O   1 
ATOM   4650  C  CB  . LYS B  1 315 ? 34.312 37.072  -22.010 1.00 43.38 ? 295 LYS B CB  1 
ATOM   4651  C  CG  . LYS B  1 315 ? 34.134 38.588  -22.063 1.00 45.43 ? 295 LYS B CG  1 
ATOM   4652  N  N   . ILE B  1 316 ? 35.431 34.188  -23.544 1.00 45.62 ? 296 ILE B N   1 
ATOM   4653  C  CA  . ILE B  1 316 ? 35.751 32.758  -23.556 1.00 44.97 ? 296 ILE B CA  1 
ATOM   4654  C  C   . ILE B  1 316 ? 36.446 32.400  -24.900 1.00 46.17 ? 296 ILE B C   1 
ATOM   4655  O  O   . ILE B  1 316 ? 35.866 32.497  -26.003 1.00 44.90 ? 296 ILE B O   1 
ATOM   4656  C  CB  . ILE B  1 316 ? 34.500 31.879  -23.284 1.00 45.53 ? 296 ILE B CB  1 
ATOM   4657  C  CG1 . ILE B  1 316 ? 33.969 32.170  -21.885 1.00 43.57 ? 296 ILE B CG1 1 
ATOM   4658  C  CG2 . ILE B  1 316 ? 34.823 30.370  -23.317 1.00 47.61 ? 296 ILE B CG2 1 
ATOM   4659  C  CD1 . ILE B  1 316 ? 32.801 31.263  -21.495 1.00 43.57 ? 296 ILE B CD1 1 
ATOM   4660  N  N   . GLN B  1 317 ? 37.722 32.048  -24.775 1.00 45.03 ? 297 GLN B N   1 
ATOM   4661  C  CA  . GLN B  1 317 ? 38.470 31.521  -25.873 1.00 47.74 ? 297 GLN B CA  1 
ATOM   4662  C  C   . GLN B  1 317 ? 38.357 29.989  -25.915 1.00 48.45 ? 297 GLN B C   1 
ATOM   4663  O  O   . GLN B  1 317 ? 38.092 29.347  -24.912 1.00 52.19 ? 297 GLN B O   1 
ATOM   4664  C  CB  . GLN B  1 317 ? 39.914 31.971  -25.773 1.00 47.31 ? 297 GLN B CB  1 
ATOM   4665  C  CG  . GLN B  1 317 ? 40.183 33.258  -26.528 1.00 53.90 ? 297 GLN B CG  1 
ATOM   4666  C  CD  . GLN B  1 317 ? 41.558 33.749  -26.236 1.00 58.23 ? 297 GLN B CD  1 
ATOM   4667  O  OE1 . GLN B  1 317 ? 42.444 33.734  -27.103 1.00 49.40 ? 297 GLN B OE1 1 
ATOM   4668  N  NE2 . GLN B  1 317 ? 41.778 34.134  -24.975 1.00 55.36 ? 297 GLN B NE2 1 
ATOM   4669  N  N   . TYR B  1 318 ? 38.540 29.425  -27.097 1.00 48.53 ? 298 TYR B N   1 
ATOM   4670  C  CA  . TYR B  1 318 ? 38.378 27.997  -27.318 1.00 48.60 ? 298 TYR B CA  1 
ATOM   4671  C  C   . TYR B  1 318 ? 39.543 27.503  -28.172 1.00 47.90 ? 298 TYR B C   1 
ATOM   4672  O  O   . TYR B  1 318 ? 40.114 28.261  -28.971 1.00 46.35 ? 298 TYR B O   1 
ATOM   4673  C  CB  . TYR B  1 318 ? 37.011 27.687  -27.981 1.00 49.41 ? 298 TYR B CB  1 
ATOM   4674  C  CG  . TYR B  1 318 ? 36.795 28.383  -29.288 1.00 53.45 ? 298 TYR B CG  1 
ATOM   4675  C  CD1 . TYR B  1 318 ? 37.040 27.741  -30.505 1.00 55.06 ? 298 TYR B CD1 1 
ATOM   4676  C  CD2 . TYR B  1 318 ? 36.385 29.706  -29.323 1.00 57.12 ? 298 TYR B CD2 1 
ATOM   4677  C  CE1 . TYR B  1 318 ? 36.867 28.413  -31.730 1.00 51.00 ? 298 TYR B CE1 1 
ATOM   4678  C  CE2 . TYR B  1 318 ? 36.212 30.372  -30.537 1.00 58.35 ? 298 TYR B CE2 1 
ATOM   4679  C  CZ  . TYR B  1 318 ? 36.449 29.723  -31.733 1.00 53.69 ? 298 TYR B CZ  1 
ATOM   4680  O  OH  . TYR B  1 318 ? 36.262 30.425  -32.925 1.00 56.21 ? 298 TYR B OH  1 
ATOM   4681  N  N   . LYS B  1 319 ? 39.922 26.252  -27.954 1.00 48.24 ? 299 LYS B N   1 
ATOM   4682  C  CA  . LYS B  1 319 ? 40.904 25.582  -28.769 1.00 49.95 ? 299 LYS B CA  1 
ATOM   4683  C  C   . LYS B  1 319 ? 40.345 24.216  -29.102 1.00 48.30 ? 299 LYS B C   1 
ATOM   4684  O  O   . LYS B  1 319 ? 39.830 23.559  -28.224 1.00 49.49 ? 299 LYS B O   1 
ATOM   4685  C  CB  . LYS B  1 319 ? 42.254 25.473  -28.027 1.00 50.54 ? 299 LYS B CB  1 
ATOM   4686  C  CG  . LYS B  1 319 ? 43.451 25.633  -28.968 1.00 52.74 ? 299 LYS B CG  1 
ATOM   4687  C  CD  . LYS B  1 319 ? 44.731 26.028  -28.268 1.00 53.53 ? 299 LYS B CD  1 
ATOM   4688  C  CE  . LYS B  1 319 ? 45.855 26.306  -29.299 1.00 57.87 ? 299 LYS B CE  1 
ATOM   4689  N  NZ  . LYS B  1 319 ? 47.073 27.018  -28.731 1.00 57.97 ? 299 LYS B NZ  1 
ATOM   4690  N  N   . GLU B  1 320 ? 40.439 23.805  -30.362 1.00 46.72 ? 300 GLU B N   1 
ATOM   4691  C  CA  . GLU B  1 320 ? 40.024 22.485  -30.800 1.00 49.79 ? 300 GLU B CA  1 
ATOM   4692  C  C   . GLU B  1 320 ? 41.210 21.645  -31.293 1.00 50.05 ? 300 GLU B C   1 
ATOM   4693  O  O   . GLU B  1 320 ? 42.121 22.166  -31.942 1.00 49.55 ? 300 GLU B O   1 
ATOM   4694  C  CB  . GLU B  1 320 ? 39.024 22.604  -31.940 1.00 49.24 ? 300 GLU B CB  1 
ATOM   4695  C  CG  . GLU B  1 320 ? 37.633 23.021  -31.514 1.00 55.95 ? 300 GLU B CG  1 
ATOM   4696  C  CD  . GLU B  1 320 ? 36.705 23.310  -32.708 1.00 54.84 ? 300 GLU B CD  1 
ATOM   4697  O  OE1 . GLU B  1 320 ? 37.051 24.177  -33.564 1.00 66.32 ? 300 GLU B OE1 1 
ATOM   4698  O  OE2 . GLU B  1 320 ? 35.625 22.670  -32.778 1.00 59.32 ? 300 GLU B OE2 1 
ATOM   4699  N  N   . TYR B  1 321 ? 41.189 20.341  -31.018 1.00 49.45 ? 301 TYR B N   1 
ATOM   4700  C  CA  . TYR B  1 321 ? 42.185 19.433  -31.610 1.00 49.57 ? 301 TYR B CA  1 
ATOM   4701  C  C   . TYR B  1 321 ? 41.434 18.508  -32.549 1.00 46.62 ? 301 TYR B C   1 
ATOM   4702  O  O   . TYR B  1 321 ? 40.860 17.526  -32.120 1.00 45.44 ? 301 TYR B O   1 
ATOM   4703  C  CB  . TYR B  1 321 ? 42.986 18.670  -30.505 1.00 54.07 ? 301 TYR B CB  1 
ATOM   4704  C  CG  . TYR B  1 321 ? 44.128 17.826  -31.035 1.00 53.56 ? 301 TYR B CG  1 
ATOM   4705  C  CD1 . TYR B  1 321 ? 45.375 18.391  -31.334 1.00 58.06 ? 301 TYR B CD1 1 
ATOM   4706  C  CD2 . TYR B  1 321 ? 43.955 16.462  -31.262 1.00 56.97 ? 301 TYR B CD2 1 
ATOM   4707  C  CE1 . TYR B  1 321 ? 46.422 17.601  -31.854 1.00 60.28 ? 301 TYR B CE1 1 
ATOM   4708  C  CE2 . TYR B  1 321 ? 44.981 15.670  -31.801 1.00 61.30 ? 301 TYR B CE2 1 
ATOM   4709  C  CZ  . TYR B  1 321 ? 46.217 16.228  -32.089 1.00 64.47 ? 301 TYR B CZ  1 
ATOM   4710  O  OH  . TYR B  1 321 ? 47.217 15.400  -32.618 1.00 60.23 ? 301 TYR B OH  1 
ATOM   4711  N  N   . ILE B  1 322 ? 41.401 18.864  -33.822 1.00 47.57 ? 302 ILE B N   1 
ATOM   4712  C  CA  . ILE B  1 322 ? 40.649 18.118  -34.849 1.00 49.13 ? 302 ILE B CA  1 
ATOM   4713  C  C   . ILE B  1 322 ? 41.463 16.948  -35.461 1.00 49.44 ? 302 ILE B C   1 
ATOM   4714  O  O   . ILE B  1 322 ? 42.585 17.130  -35.927 1.00 49.56 ? 302 ILE B O   1 
ATOM   4715  C  CB  . ILE B  1 322 ? 40.226 19.045  -36.037 1.00 49.44 ? 302 ILE B CB  1 
ATOM   4716  C  CG1 . ILE B  1 322 ? 39.593 20.361  -35.555 1.00 48.49 ? 302 ILE B CG1 1 
ATOM   4717  C  CG2 . ILE B  1 322 ? 39.259 18.309  -36.978 1.00 49.52 ? 302 ILE B CG2 1 
ATOM   4718  C  CD1 . ILE B  1 322 ? 38.274 20.176  -34.845 1.00 52.16 ? 302 ILE B CD1 1 
ATOM   4719  N  N   . ILE B  1 323 ? 40.870 15.763  -35.482 1.00 50.23 ? 303 ILE B N   1 
ATOM   4720  C  CA  . ILE B  1 323 ? 41.471 14.572  -36.055 1.00 48.39 ? 303 ILE B CA  1 
ATOM   4721  C  C   . ILE B  1 323 ? 40.638 14.119  -37.247 1.00 48.74 ? 303 ILE B C   1 
ATOM   4722  O  O   . ILE B  1 323 ? 39.435 13.928  -37.151 1.00 50.09 ? 303 ILE B O   1 
ATOM   4723  C  CB  . ILE B  1 323 ? 41.538 13.490  -34.970 1.00 49.52 ? 303 ILE B CB  1 
ATOM   4724  C  CG1 . ILE B  1 323 ? 42.580 13.898  -33.934 1.00 51.27 ? 303 ILE B CG1 1 
ATOM   4725  C  CG2 . ILE B  1 323 ? 41.896 12.110  -35.525 1.00 50.63 ? 303 ILE B CG2 1 
ATOM   4726  C  CD1 . ILE B  1 323 ? 42.469 13.142  -32.658 1.00 57.24 ? 303 ILE B CD1 1 
ATOM   4727  N  N   . GLU B  1 324 ? 41.260 13.975  -38.398 1.00 51.04 ? 304 GLU B N   1 
ATOM   4728  C  CA  . GLU B  1 324 ? 40.519 13.575  -39.583 1.00 51.68 ? 304 GLU B CA  1 
ATOM   4729  C  C   . GLU B  1 324 ? 40.351 12.067  -39.628 1.00 48.97 ? 304 GLU B C   1 
ATOM   4730  O  O   . GLU B  1 324 ? 41.303 11.326  -39.399 1.00 46.70 ? 304 GLU B O   1 
ATOM   4731  C  CB  . GLU B  1 324 ? 41.189 14.100  -40.848 1.00 53.93 ? 304 GLU B CB  1 
ATOM   4732  C  CG  . GLU B  1 324 ? 41.167 15.627  -40.926 1.00 62.63 ? 304 GLU B CG  1 
ATOM   4733  C  CD  . GLU B  1 324 ? 40.922 16.149  -42.341 1.00 77.20 ? 304 GLU B CD  1 
ATOM   4734  O  OE1 . GLU B  1 324 ? 41.779 15.933  -43.248 1.00 78.93 ? 304 GLU B OE1 1 
ATOM   4735  O  OE2 . GLU B  1 324 ? 39.867 16.796  -42.538 1.00 83.95 ? 304 GLU B OE2 1 
ATOM   4736  N  N   . GLY B  1 325 ? 39.109 11.637  -39.862 1.00 46.87 ? 305 GLY B N   1 
ATOM   4737  C  CA  . GLY B  1 325 ? 38.797 10.270  -40.216 1.00 45.95 ? 305 GLY B CA  1 
ATOM   4738  C  C   . GLY B  1 325 ? 38.148 9.475   -39.102 1.00 44.90 ? 305 GLY B C   1 
ATOM   4739  O  O   . GLY B  1 325 ? 38.688 9.392   -37.997 1.00 43.86 ? 305 GLY B O   1 
ATOM   4740  N  N   . PHE B  1 326 ? 37.028 8.835   -39.431 1.00 44.30 ? 306 PHE B N   1 
ATOM   4741  C  CA  . PHE B  1 326 ? 36.230 8.048   -38.475 1.00 45.72 ? 306 PHE B CA  1 
ATOM   4742  C  C   . PHE B  1 326 ? 36.935 6.775   -37.992 1.00 45.73 ? 306 PHE B C   1 
ATOM   4743  O  O   . PHE B  1 326 ? 36.748 6.352   -36.841 1.00 45.50 ? 306 PHE B O   1 
ATOM   4744  C  CB  . PHE B  1 326 ? 34.872 7.727   -39.125 1.00 47.70 ? 306 PHE B CB  1 
ATOM   4745  C  CG  . PHE B  1 326 ? 33.968 6.847   -38.300 1.00 49.80 ? 306 PHE B CG  1 
ATOM   4746  C  CD1 . PHE B  1 326 ? 33.217 7.380   -37.263 1.00 44.21 ? 306 PHE B CD1 1 
ATOM   4747  C  CD2 . PHE B  1 326 ? 33.852 5.477   -38.594 1.00 45.56 ? 306 PHE B CD2 1 
ATOM   4748  C  CE1 . PHE B  1 326 ? 32.407 6.570   -36.521 1.00 42.98 ? 306 PHE B CE1 1 
ATOM   4749  C  CE2 . PHE B  1 326 ? 33.036 4.660   -37.852 1.00 42.45 ? 306 PHE B CE2 1 
ATOM   4750  C  CZ  . PHE B  1 326 ? 32.299 5.199   -36.829 1.00 41.28 ? 306 PHE B CZ  1 
ATOM   4751  N  N   . GLU B  1 327 ? 37.736 6.176   -38.871 1.00 45.35 ? 307 GLU B N   1 
ATOM   4752  C  CA  . GLU B  1 327 ? 38.678 5.090   -38.521 1.00 45.70 ? 307 GLU B CA  1 
ATOM   4753  C  C   . GLU B  1 327 ? 39.772 5.458   -37.509 1.00 45.01 ? 307 GLU B C   1 
ATOM   4754  O  O   . GLU B  1 327 ? 40.409 4.583   -36.936 1.00 45.99 ? 307 GLU B O   1 
ATOM   4755  C  CB  . GLU B  1 327 ? 39.369 4.580   -39.788 1.00 47.68 ? 307 GLU B CB  1 
ATOM   4756  C  CG  . GLU B  1 327 ? 40.354 5.584   -40.438 1.00 55.55 ? 307 GLU B CG  1 
ATOM   4757  C  CD  . GLU B  1 327 ? 39.712 6.635   -41.389 1.00 65.77 ? 307 GLU B CD  1 
ATOM   4758  O  OE1 . GLU B  1 327 ? 38.448 6.704   -41.569 1.00 58.82 ? 307 GLU B OE1 1 
ATOM   4759  O  OE2 . GLU B  1 327 ? 40.535 7.396   -41.961 1.00 68.54 ? 307 GLU B OE2 1 
ATOM   4760  N  N   . ASN B  1 328 ? 40.000 6.746   -37.285 1.00 45.79 ? 308 ASN B N   1 
ATOM   4761  C  CA  . ASN B  1 328 ? 40.946 7.189   -36.256 1.00 44.07 ? 308 ASN B CA  1 
ATOM   4762  C  C   . ASN B  1 328 ? 40.351 7.464   -34.898 1.00 43.77 ? 308 ASN B C   1 
ATOM   4763  O  O   . ASN B  1 328 ? 41.018 8.022   -34.023 1.00 46.38 ? 308 ASN B O   1 
ATOM   4764  C  CB  . ASN B  1 328 ? 41.668 8.424   -36.757 1.00 42.52 ? 308 ASN B CB  1 
ATOM   4765  C  CG  . ASN B  1 328 ? 42.411 8.142   -38.014 1.00 40.77 ? 308 ASN B CG  1 
ATOM   4766  O  OD1 . ASN B  1 328 ? 43.252 7.239   -38.039 1.00 36.25 ? 308 ASN B OD1 1 
ATOM   4767  N  ND2 . ASN B  1 328 ? 42.063 8.852   -39.100 1.00 32.15 ? 308 ASN B ND2 1 
ATOM   4768  N  N   . MET B  1 329 ? 39.103 7.059   -34.709 1.00 44.63 ? 309 MET B N   1 
ATOM   4769  C  CA  . MET B  1 329 ? 38.364 7.463   -33.521 1.00 44.77 ? 309 MET B CA  1 
ATOM   4770  C  C   . MET B  1 329 ? 38.828 6.823   -32.209 1.00 42.21 ? 309 MET B C   1 
ATOM   4771  O  O   . MET B  1 329 ? 38.970 7.503   -31.205 1.00 43.91 ? 309 MET B O   1 
ATOM   4772  C  CB  . MET B  1 329 ? 36.876 7.250   -33.725 1.00 45.61 ? 309 MET B CB  1 
ATOM   4773  C  CG  . MET B  1 329 ? 36.103 8.273   -32.926 1.00 50.92 ? 309 MET B CG  1 
ATOM   4774  S  SD  . MET B  1 329 ? 34.376 8.334   -33.236 1.00 51.86 ? 309 MET B SD  1 
ATOM   4775  C  CE  . MET B  1 329 ? 34.036 9.503   -31.928 1.00 53.37 ? 309 MET B CE  1 
ATOM   4776  N  N   . PRO B  1 330 ? 39.073 5.508   -32.204 1.00 41.98 ? 310 PRO B N   1 
ATOM   4777  C  CA  . PRO B  1 330 ? 39.703 4.942   -31.008 1.00 40.72 ? 310 PRO B CA  1 
ATOM   4778  C  C   . PRO B  1 330 ? 41.059 5.599   -30.607 1.00 37.96 ? 310 PRO B C   1 
ATOM   4779  O  O   . PRO B  1 330 ? 41.273 5.890   -29.449 1.00 37.25 ? 310 PRO B O   1 
ATOM   4780  C  CB  . PRO B  1 330 ? 39.896 3.464   -31.391 1.00 42.93 ? 310 PRO B CB  1 
ATOM   4781  C  CG  . PRO B  1 330 ? 38.832 3.196   -32.490 1.00 37.03 ? 310 PRO B CG  1 
ATOM   4782  C  CD  . PRO B  1 330 ? 38.813 4.489   -33.250 1.00 41.51 ? 310 PRO B CD  1 
ATOM   4783  N  N   . ALA B  1 331 ? 41.933 5.856   -31.560 1.00 37.92 ? 311 ALA B N   1 
ATOM   4784  C  CA  . ALA B  1 331 ? 43.232 6.462   -31.293 1.00 37.80 ? 311 ALA B CA  1 
ATOM   4785  C  C   . ALA B  1 331 ? 43.089 7.868   -30.741 1.00 39.69 ? 311 ALA B C   1 
ATOM   4786  O  O   . ALA B  1 331 ? 43.800 8.277   -29.811 1.00 42.40 ? 311 ALA B O   1 
ATOM   4787  C  CB  . ALA B  1 331 ? 44.061 6.468   -32.566 1.00 38.42 ? 311 ALA B CB  1 
ATOM   4788  N  N   . ALA B  1 332 ? 42.147 8.592   -31.313 1.00 40.92 ? 312 ALA B N   1 
ATOM   4789  C  CA  . ALA B  1 332 ? 41.662 9.883   -30.778 1.00 41.35 ? 312 ALA B CA  1 
ATOM   4790  C  C   . ALA B  1 332 ? 41.245 9.828   -29.329 1.00 40.47 ? 312 ALA B C   1 
ATOM   4791  O  O   . ALA B  1 332 ? 41.618 10.683  -28.554 1.00 41.83 ? 312 ALA B O   1 
ATOM   4792  C  CB  . ALA B  1 332 ? 40.463 10.377  -31.613 1.00 40.39 ? 312 ALA B CB  1 
ATOM   4793  N  N   . PHE B  1 333 ? 40.398 8.854   -29.008 1.00 40.84 ? 313 PHE B N   1 
ATOM   4794  C  CA  . PHE B  1 333 ? 39.928 8.593   -27.654 1.00 39.32 ? 313 PHE B CA  1 
ATOM   4795  C  C   . PHE B  1 333 ? 41.066 8.256   -26.720 1.00 40.88 ? 313 PHE B C   1 
ATOM   4796  O  O   . PHE B  1 333 ? 41.119 8.735   -25.578 1.00 42.39 ? 313 PHE B O   1 
ATOM   4797  C  CB  . PHE B  1 333 ? 38.922 7.420   -27.688 1.00 40.53 ? 313 PHE B CB  1 
ATOM   4798  C  CG  . PHE B  1 333 ? 38.321 7.062   -26.342 1.00 39.21 ? 313 PHE B CG  1 
ATOM   4799  C  CD1 . PHE B  1 333 ? 37.746 8.039   -25.541 1.00 37.53 ? 313 PHE B CD1 1 
ATOM   4800  C  CD2 . PHE B  1 333 ? 38.329 5.736   -25.881 1.00 36.33 ? 313 PHE B CD2 1 
ATOM   4801  C  CE1 . PHE B  1 333 ? 37.172 7.717   -24.275 1.00 40.02 ? 313 PHE B CE1 1 
ATOM   4802  C  CE2 . PHE B  1 333 ? 37.764 5.404   -24.678 1.00 36.44 ? 313 PHE B CE2 1 
ATOM   4803  C  CZ  . PHE B  1 333 ? 37.167 6.400   -23.856 1.00 37.67 ? 313 PHE B CZ  1 
ATOM   4804  N  N   . MET B  1 334 ? 41.963 7.390   -27.185 1.00 42.25 ? 314 MET B N   1 
ATOM   4805  C  CA  . MET B  1 334 ? 43.088 6.989   -26.371 1.00 43.67 ? 314 MET B CA  1 
ATOM   4806  C  C   . MET B  1 334 ? 44.042 8.165   -26.156 1.00 43.43 ? 314 MET B C   1 
ATOM   4807  O  O   . MET B  1 334 ? 44.546 8.360   -25.060 1.00 45.46 ? 314 MET B O   1 
ATOM   4808  C  CB  . MET B  1 334 ? 43.794 5.779   -26.992 1.00 44.76 ? 314 MET B CB  1 
ATOM   4809  C  CG  . MET B  1 334 ? 42.947 4.527   -26.882 1.00 45.32 ? 314 MET B CG  1 
ATOM   4810  S  SD  . MET B  1 334 ? 43.628 3.063   -27.675 1.00 43.60 ? 314 MET B SD  1 
ATOM   4811  C  CE  . MET B  1 334 ? 43.194 3.192   -29.395 1.00 38.71 ? 314 MET B CE  1 
ATOM   4812  N  N   . GLY B  1 335 ? 44.273 8.943   -27.204 1.00 40.96 ? 315 GLY B N   1 
ATOM   4813  C  CA  . GLY B  1 335 ? 45.065 10.162  -27.109 1.00 42.17 ? 315 GLY B CA  1 
ATOM   4814  C  C   . GLY B  1 335 ? 44.470 11.210  -26.186 1.00 41.75 ? 315 GLY B C   1 
ATOM   4815  O  O   . GLY B  1 335 ? 45.197 11.919  -25.476 1.00 45.45 ? 315 GLY B O   1 
ATOM   4816  N  N   . MET B  1 336 ? 43.154 11.313  -26.172 1.00 43.33 ? 316 MET B N   1 
ATOM   4817  C  CA  . MET B  1 336 ? 42.508 12.218  -25.220 1.00 44.56 ? 316 MET B CA  1 
ATOM   4818  C  C   . MET B  1 336 ? 42.724 11.740  -23.776 1.00 45.64 ? 316 MET B C   1 
ATOM   4819  O  O   . MET B  1 336 ? 43.170 12.501  -22.924 1.00 46.89 ? 316 MET B O   1 
ATOM   4820  C  CB  . MET B  1 336 ? 41.036 12.424  -25.585 1.00 46.37 ? 316 MET B CB  1 
ATOM   4821  C  CG  . MET B  1 336 ? 40.160 13.108  -24.495 1.00 48.17 ? 316 MET B CG  1 
ATOM   4822  S  SD  . MET B  1 336 ? 39.303 11.952  -23.403 1.00 55.18 ? 316 MET B SD  1 
ATOM   4823  C  CE  . MET B  1 336 ? 38.422 11.025  -24.614 1.00 55.01 ? 316 MET B CE  1 
ATOM   4824  N  N   . LEU B  1 337 ? 42.485 10.462  -23.515 1.00 46.50 ? 317 LEU B N   1 
ATOM   4825  C  CA  . LEU B  1 337 ? 42.594 9.917   -22.159 1.00 45.49 ? 317 LEU B CA  1 
ATOM   4826  C  C   . LEU B  1 337 ? 43.981 9.971   -21.547 1.00 46.48 ? 317 LEU B C   1 
ATOM   4827  O  O   . LEU B  1 337 ? 44.102 10.108  -20.332 1.00 45.40 ? 317 LEU B O   1 
ATOM   4828  C  CB  . LEU B  1 337 ? 42.171 8.456   -22.149 1.00 48.24 ? 317 LEU B CB  1 
ATOM   4829  C  CG  . LEU B  1 337 ? 40.714 8.156   -22.405 1.00 39.13 ? 317 LEU B CG  1 
ATOM   4830  C  CD1 . LEU B  1 337 ? 40.597 6.634   -22.463 1.00 35.85 ? 317 LEU B CD1 1 
ATOM   4831  C  CD2 . LEU B  1 337 ? 39.851 8.760   -21.323 1.00 39.50 ? 317 LEU B CD2 1 
ATOM   4832  N  N   . LYS B  1 338 ? 44.984 9.814   -22.399 1.00 47.62 ? 318 LYS B N   1 
ATOM   4833  C  CA  . LYS B  1 338 ? 46.395 9.812   -22.051 1.00 52.38 ? 318 LYS B CA  1 
ATOM   4834  C  C   . LYS B  1 338 ? 47.044 11.197  -21.983 1.00 55.89 ? 318 LYS B C   1 
ATOM   4835  O  O   . LYS B  1 338 ? 48.257 11.265  -21.849 1.00 54.80 ? 318 LYS B O   1 
ATOM   4836  C  CB  . LYS B  1 338 ? 47.160 8.989   -23.104 1.00 50.94 ? 318 LYS B CB  1 
ATOM   4837  C  CG  . LYS B  1 338 ? 46.771 7.528   -23.128 1.00 51.21 ? 318 LYS B CG  1 
ATOM   4838  C  CD  . LYS B  1 338 ? 47.709 6.654   -22.245 1.00 52.65 ? 318 LYS B CD  1 
ATOM   4839  C  CE  . LYS B  1 338 ? 48.670 5.736   -23.086 1.00 55.98 ? 318 LYS B CE  1 
ATOM   4840  N  NZ  . LYS B  1 338 ? 48.329 4.265   -23.211 1.00 45.23 ? 318 LYS B NZ  1 
ATOM   4841  N  N   . GLY B  1 339 ? 46.251 12.280  -22.110 1.00 60.42 ? 319 GLY B N   1 
ATOM   4842  C  CA  . GLY B  1 339 ? 46.746 13.679  -22.098 1.00 59.55 ? 319 GLY B CA  1 
ATOM   4843  C  C   . GLY B  1 339 ? 47.514 14.173  -23.335 1.00 62.50 ? 319 GLY B C   1 
ATOM   4844  O  O   . GLY B  1 339 ? 48.101 15.275  -23.335 1.00 60.91 ? 319 GLY B O   1 
ATOM   4845  N  N   . ASP B  1 340 ? 47.522 13.376  -24.400 1.00 67.24 ? 320 ASP B N   1 
ATOM   4846  C  CA  . ASP B  1 340 ? 48.198 13.780  -25.650 1.00 70.83 ? 320 ASP B CA  1 
ATOM   4847  C  C   . ASP B  1 340 ? 48.014 15.291  -26.058 1.00 71.12 ? 320 ASP B C   1 
ATOM   4848  O  O   . ASP B  1 340 ? 48.982 15.949  -26.439 1.00 72.92 ? 320 ASP B O   1 
ATOM   4849  C  CB  . ASP B  1 340 ? 47.724 12.889  -26.846 1.00 74.17 ? 320 ASP B CB  1 
ATOM   4850  C  CG  . ASP B  1 340 ? 48.441 11.513  -26.930 1.00 81.09 ? 320 ASP B CG  1 
ATOM   4851  O  OD1 . ASP B  1 340 ? 48.956 11.020  -25.895 1.00 89.92 ? 320 ASP B OD1 1 
ATOM   4852  O  OD2 . ASP B  1 340 ? 48.481 10.934  -28.056 1.00 78.80 ? 320 ASP B OD2 1 
ATOM   4853  N  N   . ASN B  1 341 ? 46.792 15.823  -25.963 1.00 70.28 ? 321 ASN B N   1 
ATOM   4854  C  CA  . ASN B  1 341 ? 46.338 16.935  -26.821 1.00 67.87 ? 321 ASN B CA  1 
ATOM   4855  C  C   . ASN B  1 341 ? 45.991 18.278  -26.140 1.00 65.26 ? 321 ASN B C   1 
ATOM   4856  O  O   . ASN B  1 341 ? 45.323 18.295  -25.094 1.00 64.26 ? 321 ASN B O   1 
ATOM   4857  C  CB  . ASN B  1 341 ? 45.031 16.493  -27.537 1.00 70.52 ? 321 ASN B CB  1 
ATOM   4858  C  CG  . ASN B  1 341 ? 45.115 15.096  -28.171 1.00 74.86 ? 321 ASN B CG  1 
ATOM   4859  O  OD1 . ASN B  1 341 ? 44.127 14.318  -28.094 1.00 66.95 ? 321 ASN B OD1 1 
ATOM   4860  N  ND2 . ASN B  1 341 ? 46.274 14.781  -28.840 1.00 63.59 ? 321 ASN B ND2 1 
ATOM   4861  N  N   . LEU B  1 342 ? 46.310 19.390  -26.809 1.00 60.44 ? 322 LEU B N   1 
ATOM   4862  C  CA  . LEU B  1 342 ? 45.796 20.716  -26.410 1.00 59.22 ? 322 LEU B CA  1 
ATOM   4863  C  C   . LEU B  1 342 ? 44.517 21.193  -27.173 1.00 55.32 ? 322 LEU B C   1 
ATOM   4864  O  O   . LEU B  1 342 ? 44.539 21.493  -28.364 1.00 51.55 ? 322 LEU B O   1 
ATOM   4865  C  CB  . LEU B  1 342 ? 46.912 21.766  -26.514 1.00 59.05 ? 322 LEU B CB  1 
ATOM   4866  C  CG  . LEU B  1 342 ? 46.537 23.205  -26.151 1.00 59.80 ? 322 LEU B CG  1 
ATOM   4867  C  CD1 . LEU B  1 342 ? 46.185 23.357  -24.692 1.00 60.31 ? 322 LEU B CD1 1 
ATOM   4868  C  CD2 . LEU B  1 342 ? 47.668 24.142  -26.548 1.00 61.80 ? 322 LEU B CD2 1 
ATOM   4869  N  N   . GLY B  1 343 ? 43.412 21.306  -26.452 1.00 52.83 ? 323 GLY B N   1 
ATOM   4870  C  CA  . GLY B  1 343 ? 42.123 21.665  -27.057 1.00 52.55 ? 323 GLY B CA  1 
ATOM   4871  C  C   . GLY B  1 343 ? 41.158 20.485  -27.067 1.00 51.77 ? 323 GLY B C   1 
ATOM   4872  O  O   . GLY B  1 343 ? 41.572 19.342  -26.885 1.00 55.95 ? 323 GLY B O   1 
ATOM   4873  N  N   . LYS B  1 344 ? 39.874 20.769  -27.261 1.00 48.14 ? 324 LYS B N   1 
ATOM   4874  C  CA  . LYS B  1 344 ? 38.830 19.754  -27.341 1.00 46.27 ? 324 LYS B CA  1 
ATOM   4875  C  C   . LYS B  1 344 ? 39.033 18.822  -28.535 1.00 45.63 ? 324 LYS B C   1 
ATOM   4876  O  O   . LYS B  1 344 ? 39.185 19.250  -29.682 1.00 45.66 ? 324 LYS B O   1 
ATOM   4877  C  CB  . LYS B  1 344 ? 37.457 20.433  -27.457 1.00 47.46 ? 324 LYS B CB  1 
ATOM   4878  C  CG  . LYS B  1 344 ? 36.255 19.518  -27.606 1.00 42.82 ? 324 LYS B CG  1 
ATOM   4879  C  CD  . LYS B  1 344 ? 35.865 18.910  -26.299 1.00 40.11 ? 324 LYS B CD  1 
ATOM   4880  C  CE  . LYS B  1 344 ? 34.884 17.747  -26.528 1.00 41.60 ? 324 LYS B CE  1 
ATOM   4881  N  NZ  . LYS B  1 344 ? 35.584 16.519  -26.948 1.00 46.79 ? 324 LYS B NZ  1 
ATOM   4882  N  N   . THR B  1 345 ? 38.984 17.533  -28.238 1.00 46.72 ? 325 THR B N   1 
ATOM   4883  C  CA  . THR B  1 345 ? 39.289 16.500  -29.187 1.00 45.18 ? 325 THR B CA  1 
ATOM   4884  C  C   . THR B  1 345 ? 38.041 16.195  -29.948 1.00 43.37 ? 325 THR B C   1 
ATOM   4885  O  O   . THR B  1 345 ? 37.070 15.727  -29.377 1.00 39.14 ? 325 THR B O   1 
ATOM   4886  C  CB  . THR B  1 345 ? 39.847 15.239  -28.489 1.00 45.30 ? 325 THR B CB  1 
ATOM   4887  O  OG1 . THR B  1 345 ? 41.001 15.605  -27.719 1.00 48.92 ? 325 THR B OG1 1 
ATOM   4888  C  CG2 . THR B  1 345 ? 40.261 14.234  -29.515 1.00 40.88 ? 325 THR B CG2 1 
ATOM   4889  N  N   . ILE B  1 346 ? 38.102 16.479  -31.254 1.00 45.72 ? 326 ILE B N   1 
ATOM   4890  C  CA  . ILE B  1 346 ? 37.002 16.293  -32.179 1.00 44.72 ? 326 ILE B CA  1 
ATOM   4891  C  C   . ILE B  1 346 ? 37.495 15.454  -33.344 1.00 42.64 ? 326 ILE B C   1 
ATOM   4892  O  O   . ILE B  1 346 ? 38.594 15.659  -33.848 1.00 41.26 ? 326 ILE B O   1 
ATOM   4893  C  CB  . ILE B  1 346 ? 36.514 17.683  -32.775 1.00 48.94 ? 326 ILE B CB  1 
ATOM   4894  C  CG1 . ILE B  1 346 ? 35.986 18.655  -31.690 1.00 44.75 ? 326 ILE B CG1 1 
ATOM   4895  C  CG2 . ILE B  1 346 ? 35.508 17.461  -33.911 1.00 44.98 ? 326 ILE B CG2 1 
ATOM   4896  C  CD1 . ILE B  1 346 ? 34.805 18.115  -30.913 1.00 50.85 ? 326 ILE B CD1 1 
ATOM   4897  N  N   . VAL B  1 347 ? 36.658 14.521  -33.786 1.00 44.01 ? 327 VAL B N   1 
ATOM   4898  C  CA  . VAL B  1 347 ? 36.925 13.744  -34.987 1.00 44.02 ? 327 VAL B CA  1 
ATOM   4899  C  C   . VAL B  1 347 ? 36.056 14.258  -36.120 1.00 43.03 ? 327 VAL B C   1 
ATOM   4900  O  O   . VAL B  1 347 ? 34.840 14.252  -36.028 1.00 40.75 ? 327 VAL B O   1 
ATOM   4901  C  CB  . VAL B  1 347 ? 36.694 12.237  -34.774 1.00 44.68 ? 327 VAL B CB  1 
ATOM   4902  C  CG1 . VAL B  1 347 ? 36.819 11.458  -36.104 1.00 41.07 ? 327 VAL B CG1 1 
ATOM   4903  C  CG2 . VAL B  1 347 ? 37.658 11.727  -33.758 1.00 43.42 ? 327 VAL B CG2 1 
ATOM   4904  N  N   . LYS B  1 348 ? 36.710 14.689  -37.193 1.00 46.49 ? 328 LYS B N   1 
ATOM   4905  C  CA  . LYS B  1 348 ? 36.028 15.128  -38.402 1.00 49.00 ? 328 LYS B CA  1 
ATOM   4906  C  C   . LYS B  1 348 ? 35.815 13.937  -39.331 1.00 49.35 ? 328 LYS B C   1 
ATOM   4907  O  O   . LYS B  1 348 ? 36.763 13.232  -39.678 1.00 48.29 ? 328 LYS B O   1 
ATOM   4908  C  CB  . LYS B  1 348 ? 36.839 16.235  -39.089 1.00 49.63 ? 328 LYS B CB  1 
ATOM   4909  C  CG  . LYS B  1 348 ? 36.124 16.963  -40.218 1.00 51.65 ? 328 LYS B CG  1 
ATOM   4910  C  CD  . LYS B  1 348 ? 37.044 17.996  -40.862 1.00 51.77 ? 328 LYS B CD  1 
ATOM   4911  C  CE  . LYS B  1 348 ? 36.393 18.704  -42.072 1.00 55.52 ? 328 LYS B CE  1 
ATOM   4912  N  NZ  . LYS B  1 348 ? 37.417 19.500  -42.870 1.00 58.26 ? 328 LYS B NZ  1 
ATOM   4913  N  N   . ALA B  1 349 ? 34.554 13.705  -39.695 1.00 51.24 ? 329 ALA B N   1 
ATOM   4914  C  CA  . ALA B  1 349 ? 34.199 12.803  -40.802 1.00 54.05 ? 329 ALA B CA  1 
ATOM   4915  C  CB  . ALA B  1 349 ? 33.106 11.800  -40.344 1.00 55.00 ? 329 ALA B CB  1 
ATOM   4916  N  N   . SER C  1 22  ? 70.873 -1.556  -50.515 1.00 61.46 ? 2   SER C N   1 
ATOM   4917  C  CA  . SER C  1 22  ? 70.383 -2.319  -49.316 1.00 62.11 ? 2   SER C CA  1 
ATOM   4918  C  C   . SER C  1 22  ? 69.447 -1.503  -48.386 1.00 61.20 ? 2   SER C C   1 
ATOM   4919  O  O   . SER C  1 22  ? 69.839 -0.463  -47.845 1.00 58.74 ? 2   SER C O   1 
ATOM   4920  C  CB  . SER C  1 22  ? 71.580 -2.845  -48.523 1.00 62.33 ? 2   SER C CB  1 
ATOM   4921  O  OG  . SER C  1 22  ? 71.162 -3.816  -47.591 1.00 66.04 ? 2   SER C OG  1 
ATOM   4922  N  N   . MET C  1 23  ? 68.217 -1.993  -48.209 1.00 61.03 ? 3   MET C N   1 
ATOM   4923  C  CA  . MET C  1 23  ? 67.191 -1.321  -47.382 1.00 60.94 ? 3   MET C CA  1 
ATOM   4924  C  C   . MET C  1 23  ? 66.561 -2.249  -46.313 1.00 57.83 ? 3   MET C C   1 
ATOM   4925  O  O   . MET C  1 23  ? 66.543 -3.476  -46.451 1.00 55.53 ? 3   MET C O   1 
ATOM   4926  C  CB  . MET C  1 23  ? 66.083 -0.728  -48.275 1.00 63.40 ? 3   MET C CB  1 
ATOM   4927  C  CG  . MET C  1 23  ? 66.561 0.338   -49.321 1.00 67.12 ? 3   MET C CG  1 
ATOM   4928  S  SD  . MET C  1 23  ? 66.803 2.015   -48.632 1.00 72.94 ? 3   MET C SD  1 
ATOM   4929  C  CE  . MET C  1 23  ? 65.120 2.625   -48.466 1.00 74.31 ? 3   MET C CE  1 
ATOM   4930  N  N   . THR C  1 24  ? 66.034 -1.632  -45.258 1.00 54.76 ? 4   THR C N   1 
ATOM   4931  C  CA  . THR C  1 24  ? 65.530 -2.336  -44.081 1.00 50.63 ? 4   THR C CA  1 
ATOM   4932  C  C   . THR C  1 24  ? 64.330 -1.568  -43.490 1.00 50.08 ? 4   THR C C   1 
ATOM   4933  O  O   . THR C  1 24  ? 64.357 -0.339  -43.446 1.00 48.94 ? 4   THR C O   1 
ATOM   4934  C  CB  . THR C  1 24  ? 66.694 -2.501  -43.032 1.00 49.91 ? 4   THR C CB  1 
ATOM   4935  O  OG1 . THR C  1 24  ? 66.237 -3.141  -41.836 1.00 48.38 ? 4   THR C OG1 1 
ATOM   4936  C  CG2 . THR C  1 24  ? 67.297 -1.178  -42.655 1.00 49.75 ? 4   THR C CG2 1 
ATOM   4937  N  N   . LYS C  1 25  ? 63.276 -2.280  -43.069 1.00 48.86 ? 5   LYS C N   1 
ATOM   4938  C  CA  . LYS C  1 25  ? 62.183 -1.682  -42.267 1.00 46.45 ? 5   LYS C CA  1 
ATOM   4939  C  C   . LYS C  1 25  ? 62.408 -2.027  -40.750 1.00 45.06 ? 5   LYS C C   1 
ATOM   4940  O  O   . LYS C  1 25  ? 62.785 -3.125  -40.376 1.00 43.59 ? 5   LYS C O   1 
ATOM   4941  C  CB  . LYS C  1 25  ? 60.771 -2.112  -42.765 1.00 45.34 ? 5   LYS C CB  1 
ATOM   4942  C  CG  . LYS C  1 25  ? 60.385 -1.829  -44.265 1.00 43.35 ? 5   LYS C CG  1 
ATOM   4943  C  CD  . LYS C  1 25  ? 58.813 -1.856  -44.576 1.00 48.85 ? 5   LYS C CD  1 
ATOM   4944  C  CE  . LYS C  1 25  ? 58.051 -3.249  -44.299 1.00 55.52 ? 5   LYS C CE  1 
ATOM   4945  N  NZ  . LYS C  1 25  ? 56.610 -3.313  -43.682 1.00 27.92 ? 5   LYS C NZ  1 
ATOM   4946  N  N   . THR C  1 26  ? 62.194 -1.063  -39.877 1.00 44.64 ? 6   THR C N   1 
ATOM   4947  C  CA  . THR C  1 26  ? 62.457 -1.236  -38.462 1.00 44.49 ? 6   THR C CA  1 
ATOM   4948  C  C   . THR C  1 26  ? 61.343 -0.627  -37.600 1.00 40.89 ? 6   THR C C   1 
ATOM   4949  O  O   . THR C  1 26  ? 60.934 0.500   -37.829 1.00 41.68 ? 6   THR C O   1 
ATOM   4950  C  CB  . THR C  1 26  ? 63.802 -0.565  -38.115 1.00 46.50 ? 6   THR C CB  1 
ATOM   4951  O  OG1 . THR C  1 26  ? 64.842 -1.182  -38.895 1.00 54.06 ? 6   THR C OG1 1 
ATOM   4952  C  CG2 . THR C  1 26  ? 64.131 -0.692  -36.616 1.00 46.11 ? 6   THR C CG2 1 
ATOM   4953  N  N   . TRP C  1 27  ? 60.862 -1.392  -36.621 1.00 40.33 ? 7   TRP C N   1 
ATOM   4954  C  CA  . TRP C  1 27  ? 59.984 -0.894  -35.550 1.00 39.35 ? 7   TRP C CA  1 
ATOM   4955  C  C   . TRP C  1 27  ? 60.716 -0.298  -34.368 1.00 40.03 ? 7   TRP C C   1 
ATOM   4956  O  O   . TRP C  1 27  ? 61.563 -0.939  -33.755 1.00 42.66 ? 7   TRP C O   1 
ATOM   4957  C  CB  . TRP C  1 27  ? 59.089 -2.012  -35.025 1.00 39.62 ? 7   TRP C CB  1 
ATOM   4958  C  CG  . TRP C  1 27  ? 57.998 -2.331  -35.976 1.00 39.63 ? 7   TRP C CG  1 
ATOM   4959  C  CD1 . TRP C  1 27  ? 57.904 -3.425  -36.767 1.00 35.41 ? 7   TRP C CD1 1 
ATOM   4960  C  CD2 . TRP C  1 27  ? 56.860 -1.518  -36.268 1.00 36.81 ? 7   TRP C CD2 1 
ATOM   4961  N  NE1 . TRP C  1 27  ? 56.777 -3.353  -37.536 1.00 36.49 ? 7   TRP C NE1 1 
ATOM   4962  C  CE2 . TRP C  1 27  ? 56.107 -2.195  -37.235 1.00 39.46 ? 7   TRP C CE2 1 
ATOM   4963  C  CE3 . TRP C  1 27  ? 56.394 -0.296  -35.786 1.00 39.21 ? 7   TRP C CE3 1 
ATOM   4964  C  CZ2 . TRP C  1 27  ? 54.909 -1.693  -37.726 1.00 32.82 ? 7   TRP C CZ2 1 
ATOM   4965  C  CZ3 . TRP C  1 27  ? 55.214 0.196   -36.263 1.00 34.70 ? 7   TRP C CZ3 1 
ATOM   4966  C  CH2 . TRP C  1 27  ? 54.484 -0.492  -37.229 1.00 37.45 ? 7   TRP C CH2 1 
ATOM   4967  N  N   . THR C  1 28  ? 60.363 0.942   -34.066 1.00 41.58 ? 8   THR C N   1 
ATOM   4968  C  CA  . THR C  1 28  ? 60.975 1.716   -33.003 1.00 43.28 ? 8   THR C CA  1 
ATOM   4969  C  C   . THR C  1 28  ? 59.917 2.035   -31.977 1.00 43.22 ? 8   THR C C   1 
ATOM   4970  O  O   . THR C  1 28  ? 58.733 1.837   -32.216 1.00 43.48 ? 8   THR C O   1 
ATOM   4971  C  CB  . THR C  1 28  ? 61.640 3.056   -33.521 1.00 43.86 ? 8   THR C CB  1 
ATOM   4972  O  OG1 . THR C  1 28  ? 60.665 3.906   -34.133 1.00 46.12 ? 8   THR C OG1 1 
ATOM   4973  C  CG2 . THR C  1 28  ? 62.754 2.764   -34.541 1.00 46.25 ? 8   THR C CG2 1 
ATOM   4974  N  N   . LEU C  1 29  ? 60.380 2.475   -30.813 1.00 44.12 ? 9   LEU C N   1 
ATOM   4975  C  CA  . LEU C  1 29  ? 59.534 2.934   -29.746 1.00 45.10 ? 9   LEU C CA  1 
ATOM   4976  C  C   . LEU C  1 29  ? 59.356 4.444   -29.940 1.00 45.81 ? 9   LEU C C   1 
ATOM   4977  O  O   . LEU C  1 29  ? 60.285 5.204   -29.699 1.00 46.62 ? 9   LEU C O   1 
ATOM   4978  C  CB  . LEU C  1 29  ? 60.178 2.595   -28.404 1.00 45.37 ? 9   LEU C CB  1 
ATOM   4979  C  CG  . LEU C  1 29  ? 59.395 2.922   -27.133 1.00 47.74 ? 9   LEU C CG  1 
ATOM   4980  C  CD1 . LEU C  1 29  ? 58.181 2.015   -26.985 1.00 46.11 ? 9   LEU C CD1 1 
ATOM   4981  C  CD2 . LEU C  1 29  ? 60.321 2.835   -25.952 1.00 44.49 ? 9   LEU C CD2 1 
ATOM   4982  N  N   . LYS C  1 30  ? 58.181 4.860   -30.433 1.00 45.88 ? 10  LYS C N   1 
ATOM   4983  C  CA  . LYS C  1 30  ? 57.813 6.293   -30.528 1.00 46.63 ? 10  LYS C CA  1 
ATOM   4984  C  C   . LYS C  1 30  ? 57.567 6.928   -29.154 1.00 43.89 ? 10  LYS C C   1 
ATOM   4985  O  O   . LYS C  1 30  ? 57.975 8.067   -28.920 1.00 44.79 ? 10  LYS C O   1 
ATOM   4986  C  CB  . LYS C  1 30  ? 56.584 6.525   -31.456 1.00 45.92 ? 10  LYS C CB  1 
ATOM   4987  C  CG  . LYS C  1 30  ? 56.407 7.969   -32.002 1.00 47.95 ? 10  LYS C CG  1 
ATOM   4988  C  CD  . LYS C  1 30  ? 55.079 8.210   -32.802 1.00 51.64 ? 10  LYS C CD  1 
ATOM   4989  C  CE  . LYS C  1 30  ? 54.612 6.914   -33.550 1.00 60.84 ? 10  LYS C CE  1 
ATOM   4990  N  NZ  . LYS C  1 30  ? 53.767 7.070   -34.784 1.00 61.90 ? 10  LYS C NZ  1 
ATOM   4991  N  N   . LYS C  1 31  ? 56.894 6.202   -28.261 1.00 43.11 ? 11  LYS C N   1 
ATOM   4992  C  CA  . LYS C  1 31  ? 56.535 6.721   -26.938 1.00 42.83 ? 11  LYS C CA  1 
ATOM   4993  C  C   . LYS C  1 31  ? 56.633 5.600   -25.910 1.00 41.48 ? 11  LYS C C   1 
ATOM   4994  O  O   . LYS C  1 31  ? 56.295 4.479   -26.221 1.00 42.50 ? 11  LYS C O   1 
ATOM   4995  C  CB  . LYS C  1 31  ? 55.130 7.327   -26.976 1.00 43.85 ? 11  LYS C CB  1 
ATOM   4996  C  CG  . LYS C  1 31  ? 54.943 8.601   -26.095 1.00 49.60 ? 11  LYS C CG  1 
ATOM   4997  N  N   . HIS C  1 32  ? 57.150 5.880   -24.714 1.00 41.10 ? 12  HIS C N   1 
ATOM   4998  C  CA  . HIS C  1 32  ? 57.092 4.889   -23.620 1.00 41.81 ? 12  HIS C CA  1 
ATOM   4999  C  C   . HIS C  1 32  ? 55.649 4.501   -23.327 1.00 39.94 ? 12  HIS C C   1 
ATOM   5000  O  O   . HIS C  1 32  ? 54.792 5.352   -23.243 1.00 40.96 ? 12  HIS C O   1 
ATOM   5001  C  CB  . HIS C  1 32  ? 57.834 5.362   -22.330 1.00 42.47 ? 12  HIS C CB  1 
ATOM   5002  C  CG  . HIS C  1 32  ? 59.310 5.095   -22.379 1.00 42.69 ? 12  HIS C CG  1 
ATOM   5003  N  ND1 . HIS C  1 32  ? 59.834 3.826   -22.258 1.00 47.11 ? 12  HIS C ND1 1 
ATOM   5004  C  CD2 . HIS C  1 32  ? 60.353 5.903   -22.686 1.00 46.13 ? 12  HIS C CD2 1 
ATOM   5005  C  CE1 . HIS C  1 32  ? 61.143 3.875   -22.431 1.00 43.36 ? 12  HIS C CE1 1 
ATOM   5006  N  NE2 . HIS C  1 32  ? 61.481 5.124   -22.692 1.00 44.26 ? 12  HIS C NE2 1 
ATOM   5007  N  N   . PHE C  1 33  ? 55.417 3.195   -23.181 1.00 40.96 ? 13  PHE C N   1 
ATOM   5008  C  CA  . PHE C  1 33  ? 54.102 2.613   -22.867 1.00 38.80 ? 13  PHE C CA  1 
ATOM   5009  C  C   . PHE C  1 33  ? 53.538 3.047   -21.520 1.00 39.77 ? 13  PHE C C   1 
ATOM   5010  O  O   . PHE C  1 33  ? 54.242 3.145   -20.483 1.00 38.08 ? 13  PHE C O   1 
ATOM   5011  C  CB  . PHE C  1 33  ? 54.146 1.081   -22.807 1.00 37.34 ? 13  PHE C CB  1 
ATOM   5012  C  CG  . PHE C  1 33  ? 54.797 0.427   -23.961 1.00 36.01 ? 13  PHE C CG  1 
ATOM   5013  C  CD1 . PHE C  1 33  ? 54.560 0.856   -25.259 1.00 41.53 ? 13  PHE C CD1 1 
ATOM   5014  C  CD2 . PHE C  1 33  ? 55.645 -0.660  -23.750 1.00 45.51 ? 13  PHE C CD2 1 
ATOM   5015  C  CE1 . PHE C  1 33  ? 55.162 0.232   -26.316 1.00 35.15 ? 13  PHE C CE1 1 
ATOM   5016  C  CE2 . PHE C  1 33  ? 56.245 -1.327  -24.818 1.00 32.33 ? 13  PHE C CE2 1 
ATOM   5017  C  CZ  . PHE C  1 33  ? 56.006 -0.878  -26.099 1.00 35.59 ? 13  PHE C CZ  1 
ATOM   5018  N  N   . VAL C  1 34  ? 52.234 3.260   -21.546 1.00 39.71 ? 14  VAL C N   1 
ATOM   5019  C  CA  . VAL C  1 34  ? 51.462 3.554   -20.328 1.00 40.79 ? 14  VAL C CA  1 
ATOM   5020  C  C   . VAL C  1 34  ? 50.271 2.593   -20.341 1.00 39.68 ? 14  VAL C C   1 
ATOM   5021  O  O   . VAL C  1 34  ? 49.335 2.719   -21.132 1.00 42.25 ? 14  VAL C O   1 
ATOM   5022  C  CB  . VAL C  1 34  ? 51.007 5.042   -20.236 1.00 38.85 ? 14  VAL C CB  1 
ATOM   5023  C  CG1 . VAL C  1 34  ? 50.167 5.283   -18.960 1.00 40.02 ? 14  VAL C CG1 1 
ATOM   5024  C  CG2 . VAL C  1 34  ? 52.191 5.959   -20.236 1.00 35.23 ? 14  VAL C CG2 1 
ATOM   5025  N  N   . GLY C  1 35  ? 50.328 1.630   -19.456 1.00 40.27 ? 15  GLY C N   1 
ATOM   5026  C  CA  . GLY C  1 35  ? 49.442 0.494   -19.545 1.00 42.30 ? 15  GLY C CA  1 
ATOM   5027  C  C   . GLY C  1 35  ? 49.837 -0.393  -20.687 1.00 38.50 ? 15  GLY C C   1 
ATOM   5028  O  O   . GLY C  1 35  ? 51.026 -0.563  -20.983 1.00 42.03 ? 15  GLY C O   1 
ATOM   5029  N  N   . TYR C  1 36  ? 48.849 -0.962  -21.358 1.00 38.45 ? 16  TYR C N   1 
ATOM   5030  C  CA  . TYR C  1 36  ? 49.147 -1.754  -22.557 1.00 38.04 ? 16  TYR C CA  1 
ATOM   5031  C  C   . TYR C  1 36  ? 49.671 -0.861  -23.660 1.00 38.01 ? 16  TYR C C   1 
ATOM   5032  O  O   . TYR C  1 36  ? 49.266 0.291   -23.764 1.00 38.01 ? 16  TYR C O   1 
ATOM   5033  C  CB  . TYR C  1 36  ? 47.912 -2.515  -23.030 1.00 39.97 ? 16  TYR C CB  1 
ATOM   5034  C  CG  . TYR C  1 36  ? 47.561 -3.681  -22.147 1.00 35.73 ? 16  TYR C CG  1 
ATOM   5035  C  CD1 . TYR C  1 36  ? 46.678 -3.524  -21.088 1.00 44.14 ? 16  TYR C CD1 1 
ATOM   5036  C  CD2 . TYR C  1 36  ? 48.144 -4.935  -22.347 1.00 40.00 ? 16  TYR C CD2 1 
ATOM   5037  C  CE1 . TYR C  1 36  ? 46.352 -4.572  -20.248 1.00 44.77 ? 16  TYR C CE1 1 
ATOM   5038  C  CE2 . TYR C  1 36  ? 47.826 -6.017  -21.512 1.00 41.59 ? 16  TYR C CE2 1 
ATOM   5039  C  CZ  . TYR C  1 36  ? 46.909 -5.813  -20.472 1.00 44.73 ? 16  TYR C CZ  1 
ATOM   5040  O  OH  . TYR C  1 36  ? 46.553 -6.829  -19.652 1.00 45.82 ? 16  TYR C OH  1 
ATOM   5041  N  N   . PRO C  1 37  ? 50.609 -1.378  -24.474 1.00 39.42 ? 17  PRO C N   1 
ATOM   5042  C  CA  . PRO C  1 37  ? 50.980 -0.643  -25.659 1.00 37.05 ? 17  PRO C CA  1 
ATOM   5043  C  C   . PRO C  1 37  ? 49.773 -0.286  -26.524 1.00 38.32 ? 17  PRO C C   1 
ATOM   5044  O  O   . PRO C  1 37  ? 48.722 -0.913  -26.408 1.00 37.71 ? 17  PRO C O   1 
ATOM   5045  C  CB  . PRO C  1 37  ? 51.947 -1.602  -26.375 1.00 38.25 ? 17  PRO C CB  1 
ATOM   5046  C  CG  . PRO C  1 37  ? 52.472 -2.460  -25.310 1.00 38.11 ? 17  PRO C CG  1 
ATOM   5047  C  CD  . PRO C  1 37  ? 51.377 -2.633  -24.340 1.00 40.65 ? 17  PRO C CD  1 
ATOM   5048  N  N   . THR C  1 38  ? 49.912 0.772   -27.320 1.00 39.30 ? 18  THR C N   1 
ATOM   5049  C  CA  . THR C  1 38  ? 48.928 1.116   -28.357 1.00 39.33 ? 18  THR C CA  1 
ATOM   5050  C  C   . THR C  1 38  ? 49.695 1.279   -29.669 1.00 37.85 ? 18  THR C C   1 
ATOM   5051  O  O   . THR C  1 38  ? 50.942 1.346   -29.670 1.00 40.30 ? 18  THR C O   1 
ATOM   5052  C  CB  . THR C  1 38  ? 48.123 2.379   -28.029 1.00 40.44 ? 18  THR C CB  1 
ATOM   5053  O  OG1 . THR C  1 38  ? 48.987 3.524   -27.835 1.00 42.71 ? 18  THR C OG1 1 
ATOM   5054  C  CG2 . THR C  1 38  ? 47.299 2.146   -26.778 1.00 46.34 ? 18  THR C CG2 1 
ATOM   5055  N  N   . ASN C  1 39  ? 48.979 1.293   -30.779 1.00 37.03 ? 19  ASN C N   1 
ATOM   5056  C  CA  . ASN C  1 39  ? 49.613 1.469   -32.085 1.00 38.25 ? 19  ASN C CA  1 
ATOM   5057  C  C   . ASN C  1 39  ? 50.485 2.723   -32.115 1.00 38.71 ? 19  ASN C C   1 
ATOM   5058  O  O   . ASN C  1 39  ? 51.530 2.712   -32.706 1.00 40.61 ? 19  ASN C O   1 
ATOM   5059  C  CB  . ASN C  1 39  ? 48.564 1.578   -33.191 1.00 39.14 ? 19  ASN C CB  1 
ATOM   5060  C  CG  . ASN C  1 39  ? 47.946 0.242   -33.579 1.00 37.62 ? 19  ASN C CG  1 
ATOM   5061  O  OD1 . ASN C  1 39  ? 48.528 -0.830  -33.405 1.00 51.42 ? 19  ASN C OD1 1 
ATOM   5062  N  ND2 . ASN C  1 39  ? 46.763 0.317   -34.151 1.00 44.47 ? 19  ASN C ND2 1 
ATOM   5063  N  N   . SER C  1 40  ? 50.061 3.779   -31.428 1.00 37.26 ? 20  SER C N   1 
ATOM   5064  C  CA  . SER C  1 40  ? 50.729 5.069   -31.445 1.00 38.22 ? 20  SER C CA  1 
ATOM   5065  C  C   . SER C  1 40  ? 52.058 5.083   -30.707 1.00 39.50 ? 20  SER C C   1 
ATOM   5066  O  O   . SER C  1 40  ? 52.809 6.024   -30.845 1.00 41.93 ? 20  SER C O   1 
ATOM   5067  C  CB  . SER C  1 40  ? 49.815 6.159   -30.820 1.00 39.46 ? 20  SER C CB  1 
ATOM   5068  O  OG  . SER C  1 40  ? 49.547 5.860   -29.434 1.00 36.54 ? 20  SER C OG  1 
ATOM   5069  N  N   . ASP C  1 41  ? 52.344 4.050   -29.917 1.00 41.77 ? 21  ASP C N   1 
ATOM   5070  C  CA  . ASP C  1 41  ? 53.645 3.887   -29.224 1.00 40.24 ? 21  ASP C CA  1 
ATOM   5071  C  C   . ASP C  1 41  ? 54.800 3.382   -30.094 1.00 38.71 ? 21  ASP C C   1 
ATOM   5072  O  O   . ASP C  1 41  ? 55.918 3.353   -29.632 1.00 38.68 ? 21  ASP C O   1 
ATOM   5073  C  CB  . ASP C  1 41  ? 53.474 2.952   -28.026 1.00 40.28 ? 21  ASP C CB  1 
ATOM   5074  C  CG  . ASP C  1 41  ? 52.485 3.506   -27.004 1.00 41.86 ? 21  ASP C CG  1 
ATOM   5075  O  OD1 . ASP C  1 41  ? 51.768 2.714   -26.343 1.00 47.89 ? 21  ASP C OD1 1 
ATOM   5076  O  OD2 . ASP C  1 41  ? 52.421 4.751   -26.879 1.00 49.05 ? 21  ASP C OD2 1 
ATOM   5077  N  N   . PHE C  1 42  ? 54.504 3.019   -31.336 1.00 37.45 ? 22  PHE C N   1 
ATOM   5078  C  CA  . PHE C  1 42  ? 55.417 2.385   -32.230 1.00 40.89 ? 22  PHE C CA  1 
ATOM   5079  C  C   . PHE C  1 42  ? 55.558 3.189   -33.511 1.00 41.10 ? 22  PHE C C   1 
ATOM   5080  O  O   . PHE C  1 42  ? 54.640 3.864   -33.911 1.00 41.99 ? 22  PHE C O   1 
ATOM   5081  C  CB  . PHE C  1 42  ? 54.877 1.019   -32.654 1.00 40.72 ? 22  PHE C CB  1 
ATOM   5082  C  CG  . PHE C  1 42  ? 54.718 0.048   -31.536 1.00 39.21 ? 22  PHE C CG  1 
ATOM   5083  C  CD1 . PHE C  1 42  ? 55.785 -0.774  -31.162 1.00 44.31 ? 22  PHE C CD1 1 
ATOM   5084  C  CD2 . PHE C  1 42  ? 53.493 -0.102  -30.898 1.00 36.15 ? 22  PHE C CD2 1 
ATOM   5085  C  CE1 . PHE C  1 42  ? 55.648 -1.702  -30.131 1.00 40.65 ? 22  PHE C CE1 1 
ATOM   5086  C  CE2 . PHE C  1 42  ? 53.337 -1.028  -29.872 1.00 43.21 ? 22  PHE C CE2 1 
ATOM   5087  C  CZ  . PHE C  1 42  ? 54.437 -1.841  -29.490 1.00 43.78 ? 22  PHE C CZ  1 
ATOM   5088  N  N   . GLU C  1 43  ? 56.684 3.032   -34.200 1.00 42.86 ? 23  GLU C N   1 
ATOM   5089  C  CA  . GLU C  1 43  ? 56.900 3.737   -35.447 1.00 42.83 ? 23  GLU C CA  1 
ATOM   5090  C  C   . GLU C  1 43  ? 57.755 2.907   -36.372 1.00 38.75 ? 23  GLU C C   1 
ATOM   5091  O  O   . GLU C  1 43  ? 58.819 2.505   -35.978 1.00 33.40 ? 23  GLU C O   1 
ATOM   5092  C  CB  . GLU C  1 43  ? 57.563 5.092   -35.185 1.00 41.90 ? 23  GLU C CB  1 
ATOM   5093  C  CG  . GLU C  1 43  ? 57.705 5.976   -36.449 1.00 45.34 ? 23  GLU C CG  1 
ATOM   5094  C  CD  . GLU C  1 43  ? 58.087 7.431   -36.130 1.00 51.39 ? 23  GLU C CD  1 
ATOM   5095  O  OE1 . GLU C  1 43  ? 57.581 8.355   -36.824 1.00 69.55 ? 23  GLU C OE1 1 
ATOM   5096  O  OE2 . GLU C  1 43  ? 58.873 7.657   -35.178 1.00 65.55 ? 23  GLU C OE2 1 
ATOM   5097  N  N   . LEU C  1 44  ? 57.269 2.693   -37.605 1.00 41.50 ? 24  LEU C N   1 
ATOM   5098  C  CA  . LEU C  1 44  ? 58.007 2.010   -38.666 1.00 43.14 ? 24  LEU C CA  1 
ATOM   5099  C  C   . LEU C  1 44  ? 58.910 2.980   -39.402 1.00 44.20 ? 24  LEU C C   1 
ATOM   5100  O  O   . LEU C  1 44  ? 58.466 4.024   -39.873 1.00 46.64 ? 24  LEU C O   1 
ATOM   5101  C  CB  . LEU C  1 44  ? 57.043 1.372   -39.647 1.00 42.18 ? 24  LEU C CB  1 
ATOM   5102  C  CG  . LEU C  1 44  ? 57.567 0.290   -40.607 1.00 43.75 ? 24  LEU C CG  1 
ATOM   5103  C  CD1 . LEU C  1 44  ? 58.231 -0.821  -39.927 1.00 37.86 ? 24  LEU C CD1 1 
ATOM   5104  C  CD2 . LEU C  1 44  ? 56.408 -0.282  -41.424 1.00 49.50 ? 24  LEU C CD2 1 
ATOM   5105  N  N   . LYS C  1 45  ? 60.194 2.656   -39.461 1.00 47.82 ? 25  LYS C N   1 
ATOM   5106  C  CA  . LYS C  1 45  ? 61.167 3.466   -40.191 1.00 48.46 ? 25  LYS C CA  1 
ATOM   5107  C  C   . LYS C  1 45  ? 61.805 2.627   -41.254 1.00 47.59 ? 25  LYS C C   1 
ATOM   5108  O  O   . LYS C  1 45  ? 62.117 1.484   -40.998 1.00 45.36 ? 25  LYS C O   1 
ATOM   5109  C  CB  . LYS C  1 45  ? 62.247 4.013   -39.254 1.00 49.98 ? 25  LYS C CB  1 
ATOM   5110  C  CG  . LYS C  1 45  ? 61.691 4.726   -38.028 1.00 52.77 ? 25  LYS C CG  1 
ATOM   5111  C  CD  . LYS C  1 45  ? 62.418 6.026   -37.750 1.00 56.34 ? 25  LYS C CD  1 
ATOM   5112  C  CE  . LYS C  1 45  ? 62.079 6.552   -36.355 1.00 62.78 ? 25  LYS C CE  1 
ATOM   5113  N  NZ  . LYS C  1 45  ? 62.483 7.990   -36.178 1.00 63.32 ? 25  LYS C NZ  1 
ATOM   5114  N  N   . THR C  1 46  ? 61.968 3.203   -42.451 1.00 51.30 ? 26  THR C N   1 
ATOM   5115  C  CA  . THR C  1 46  ? 62.766 2.613   -43.544 1.00 51.56 ? 26  THR C CA  1 
ATOM   5116  C  C   . THR C  1 46  ? 64.149 3.278   -43.616 1.00 52.14 ? 26  THR C C   1 
ATOM   5117  O  O   . THR C  1 46  ? 64.301 4.462   -43.338 1.00 53.05 ? 26  THR C O   1 
ATOM   5118  C  CB  . THR C  1 46  ? 62.050 2.717   -44.894 1.00 51.32 ? 26  THR C CB  1 
ATOM   5119  O  OG1 . THR C  1 46  ? 60.771 2.083   -44.800 1.00 52.47 ? 26  THR C OG1 1 
ATOM   5120  C  CG2 . THR C  1 46  ? 62.857 2.024   -45.983 1.00 53.52 ? 26  THR C CG2 1 
ATOM   5121  N  N   . SER C  1 47  ? 65.159 2.503   -43.984 1.00 52.75 ? 27  SER C N   1 
ATOM   5122  C  CA  . SER C  1 47  ? 66.528 2.894   -43.751 1.00 53.02 ? 27  SER C CA  1 
ATOM   5123  C  C   . SER C  1 47  ? 67.476 2.138   -44.700 1.00 53.41 ? 27  SER C C   1 
ATOM   5124  O  O   . SER C  1 47  ? 67.159 1.045   -45.174 1.00 51.72 ? 27  SER C O   1 
ATOM   5125  C  CB  . SER C  1 47  ? 66.837 2.576   -42.299 1.00 53.37 ? 27  SER C CB  1 
ATOM   5126  O  OG  . SER C  1 47  ? 68.052 3.127   -41.884 1.00 60.87 ? 27  SER C OG  1 
ATOM   5127  N  N   . GLU C  1 48  ? 68.616 2.751   -45.010 1.00 54.22 ? 28  GLU C N   1 
ATOM   5128  C  CA  . GLU C  1 48  ? 69.590 2.157   -45.936 1.00 54.56 ? 28  GLU C CA  1 
ATOM   5129  C  C   . GLU C  1 48  ? 70.676 1.536   -45.095 1.00 54.25 ? 28  GLU C C   1 
ATOM   5130  O  O   . GLU C  1 48  ? 71.204 2.181   -44.197 1.00 52.53 ? 28  GLU C O   1 
ATOM   5131  C  CB  . GLU C  1 48  ? 70.191 3.190   -46.904 1.00 54.33 ? 28  GLU C CB  1 
ATOM   5132  N  N   . LEU C  1 49  ? 70.985 0.272   -45.371 1.00 54.53 ? 29  LEU C N   1 
ATOM   5133  C  CA  . LEU C  1 49  ? 72.040 -0.416  -44.654 1.00 54.19 ? 29  LEU C CA  1 
ATOM   5134  C  C   . LEU C  1 49  ? 73.385 -0.126  -45.299 1.00 53.64 ? 29  LEU C C   1 
ATOM   5135  O  O   . LEU C  1 49  ? 73.481 -0.003  -46.528 1.00 52.43 ? 29  LEU C O   1 
ATOM   5136  C  CB  . LEU C  1 49  ? 71.779 -1.918  -44.628 1.00 54.75 ? 29  LEU C CB  1 
ATOM   5137  C  CG  . LEU C  1 49  ? 70.640 -2.353  -43.705 1.00 53.96 ? 29  LEU C CG  1 
ATOM   5138  C  CD1 . LEU C  1 49  ? 70.352 -3.829  -43.929 1.00 54.22 ? 29  LEU C CD1 1 
ATOM   5139  C  CD2 . LEU C  1 49  ? 70.965 -2.056  -42.221 1.00 50.55 ? 29  LEU C CD2 1 
ATOM   5140  N  N   . PRO C  1 50  ? 74.444 -0.032  -44.473 1.00 53.39 ? 30  PRO C N   1 
ATOM   5141  C  CA  . PRO C  1 50  ? 75.747 0.200   -45.090 1.00 53.39 ? 30  PRO C CA  1 
ATOM   5142  C  C   . PRO C  1 50  ? 76.184 -0.993  -45.942 1.00 53.25 ? 30  PRO C C   1 
ATOM   5143  O  O   . PRO C  1 50  ? 75.529 -2.046  -45.928 1.00 51.11 ? 30  PRO C O   1 
ATOM   5144  C  CB  . PRO C  1 50  ? 76.672 0.429   -43.891 1.00 53.74 ? 30  PRO C CB  1 
ATOM   5145  C  CG  . PRO C  1 50  ? 75.965 -0.154  -42.703 1.00 50.58 ? 30  PRO C CG  1 
ATOM   5146  C  CD  . PRO C  1 50  ? 74.513 -0.143  -43.000 1.00 51.52 ? 30  PRO C CD  1 
ATOM   5147  N  N   . PRO C  1 51  ? 77.268 -0.825  -46.711 1.00 55.53 ? 31  PRO C N   1 
ATOM   5148  C  CA  . PRO C  1 51  ? 77.855 -2.002  -47.377 1.00 55.80 ? 31  PRO C CA  1 
ATOM   5149  C  C   . PRO C  1 51  ? 78.628 -2.862  -46.352 1.00 54.45 ? 31  PRO C C   1 
ATOM   5150  O  O   . PRO C  1 51  ? 79.015 -2.366  -45.275 1.00 52.94 ? 31  PRO C O   1 
ATOM   5151  C  CB  . PRO C  1 51  ? 78.778 -1.390  -48.427 1.00 54.92 ? 31  PRO C CB  1 
ATOM   5152  C  CG  . PRO C  1 51  ? 79.213 -0.092  -47.816 1.00 56.19 ? 31  PRO C CG  1 
ATOM   5153  C  CD  . PRO C  1 51  ? 78.028 0.406   -46.996 1.00 57.31 ? 31  PRO C CD  1 
ATOM   5154  N  N   . LEU C  1 52  ? 78.812 -4.139  -46.675 1.00 53.01 ? 32  LEU C N   1 
ATOM   5155  C  CA  . LEU C  1 52  ? 79.515 -5.054  -45.781 1.00 51.86 ? 32  LEU C CA  1 
ATOM   5156  C  C   . LEU C  1 52  ? 81.017 -4.798  -45.767 1.00 51.00 ? 32  LEU C C   1 
ATOM   5157  O  O   . LEU C  1 52  ? 81.660 -4.723  -46.822 1.00 53.10 ? 32  LEU C O   1 
ATOM   5158  C  CB  . LEU C  1 52  ? 79.305 -6.498  -46.218 1.00 51.89 ? 32  LEU C CB  1 
ATOM   5159  C  CG  . LEU C  1 52  ? 77.912 -7.095  -46.297 1.00 48.66 ? 32  LEU C CG  1 
ATOM   5160  C  CD1 . LEU C  1 52  ? 78.028 -8.568  -46.674 1.00 46.91 ? 32  LEU C CD1 1 
ATOM   5161  C  CD2 . LEU C  1 52  ? 77.199 -6.923  -44.994 1.00 45.97 ? 32  LEU C CD2 1 
ATOM   5162  N  N   . LYS C  1 53  ? 81.577 -4.683  -44.573 1.00 50.67 ? 33  LYS C N   1 
ATOM   5163  C  CA  . LYS C  1 53  ? 83.024 -4.708  -44.400 1.00 51.03 ? 33  LYS C CA  1 
ATOM   5164  C  C   . LYS C  1 53  ? 83.442 -6.192  -44.301 1.00 50.47 ? 33  LYS C C   1 
ATOM   5165  O  O   . LYS C  1 53  ? 82.566 -7.060  -44.213 1.00 48.48 ? 33  LYS C O   1 
ATOM   5166  C  CB  . LYS C  1 53  ? 83.394 -3.869  -43.166 1.00 52.57 ? 33  LYS C CB  1 
ATOM   5167  C  CG  . LYS C  1 53  ? 82.990 -2.363  -43.303 1.00 51.57 ? 33  LYS C CG  1 
ATOM   5168  C  CD  . LYS C  1 53  ? 83.065 -1.623  -41.968 1.00 50.11 ? 33  LYS C CD  1 
ATOM   5169  N  N   . ASN C  1 54  ? 84.748 -6.498  -44.373 1.00 51.02 ? 34  ASN C N   1 
ATOM   5170  C  CA  . ASN C  1 54  ? 85.221 -7.904  -44.226 1.00 49.72 ? 34  ASN C CA  1 
ATOM   5171  C  C   . ASN C  1 54  ? 84.804 -8.524  -42.897 1.00 47.95 ? 34  ASN C C   1 
ATOM   5172  O  O   . ASN C  1 54  ? 84.826 -7.851  -41.859 1.00 49.24 ? 34  ASN C O   1 
ATOM   5173  C  CB  . ASN C  1 54  ? 86.745 -8.035  -44.383 1.00 48.95 ? 34  ASN C CB  1 
ATOM   5174  C  CG  . ASN C  1 54  ? 87.163 -8.203  -45.815 1.00 52.72 ? 34  ASN C CG  1 
ATOM   5175  O  OD1 . ASN C  1 54  ? 86.383 -8.646  -46.665 1.00 54.30 ? 34  ASN C OD1 1 
ATOM   5176  N  ND2 . ASN C  1 54  ? 88.407 -7.845  -46.104 1.00 58.26 ? 34  ASN C ND2 1 
ATOM   5177  N  N   . GLY C  1 55  ? 84.396 -9.793  -42.929 1.00 46.21 ? 35  GLY C N   1 
ATOM   5178  C  CA  . GLY C  1 55  ? 84.011 -10.516 -41.702 1.00 44.80 ? 35  GLY C CA  1 
ATOM   5179  C  C   . GLY C  1 55  ? 82.556 -10.402 -41.357 1.00 46.18 ? 35  GLY C C   1 
ATOM   5180  O  O   . GLY C  1 55  ? 82.095 -11.039 -40.402 1.00 49.44 ? 35  GLY C O   1 
ATOM   5181  N  N   . GLU C  1 56  ? 81.812 -9.586  -42.111 1.00 44.63 ? 36  GLU C N   1 
ATOM   5182  C  CA  . GLU C  1 56  ? 80.401 -9.351  -41.821 1.00 44.01 ? 36  GLU C CA  1 
ATOM   5183  C  C   . GLU C  1 56  ? 79.459 -10.069 -42.785 1.00 41.26 ? 36  GLU C C   1 
ATOM   5184  O  O   . GLU C  1 56  ? 79.849 -10.462 -43.897 1.00 39.21 ? 36  GLU C O   1 
ATOM   5185  C  CB  . GLU C  1 56  ? 80.069 -7.855  -41.869 1.00 45.67 ? 36  GLU C CB  1 
ATOM   5186  C  CG  . GLU C  1 56  ? 80.739 -6.999  -40.811 1.00 44.64 ? 36  GLU C CG  1 
ATOM   5187  C  CD  . GLU C  1 56  ? 80.412 -5.509  -40.967 1.00 49.12 ? 36  GLU C CD  1 
ATOM   5188  O  OE1 . GLU C  1 56  ? 79.951 -5.068  -42.063 1.00 46.37 ? 36  GLU C OE1 1 
ATOM   5189  O  OE2 . GLU C  1 56  ? 80.624 -4.779  -39.970 1.00 54.44 ? 36  GLU C OE2 1 
ATOM   5190  N  N   . VAL C  1 57  ? 78.202 -10.177 -42.343 1.00 38.88 ? 37  VAL C N   1 
ATOM   5191  C  CA  . VAL C  1 57  ? 77.094 -10.746 -43.126 1.00 37.24 ? 37  VAL C CA  1 
ATOM   5192  C  C   . VAL C  1 57  ? 75.838 -9.866  -43.077 1.00 36.68 ? 37  VAL C C   1 
ATOM   5193  O  O   . VAL C  1 57  ? 75.612 -9.147  -42.115 1.00 36.17 ? 37  VAL C O   1 
ATOM   5194  C  CB  . VAL C  1 57  ? 76.710 -12.171 -42.648 1.00 34.19 ? 37  VAL C CB  1 
ATOM   5195  C  CG1 . VAL C  1 57  ? 77.923 -13.139 -42.776 1.00 38.52 ? 37  VAL C CG1 1 
ATOM   5196  C  CG2 . VAL C  1 57  ? 76.148 -12.146 -41.262 1.00 32.03 ? 37  VAL C CG2 1 
ATOM   5197  N  N   . LEU C  1 58  ? 75.036 -9.935  -44.134 1.00 38.58 ? 38  LEU C N   1 
ATOM   5198  C  CA  . LEU C  1 58  ? 73.700 -9.381  -44.131 1.00 39.31 ? 38  LEU C CA  1 
ATOM   5199  C  C   . LEU C  1 58  ? 72.703 -10.506 -43.890 1.00 39.19 ? 38  LEU C C   1 
ATOM   5200  O  O   . LEU C  1 58  ? 72.725 -11.548 -44.550 1.00 38.23 ? 38  LEU C O   1 
ATOM   5201  C  CB  . LEU C  1 58  ? 73.398 -8.679  -45.453 1.00 39.75 ? 38  LEU C CB  1 
ATOM   5202  C  CG  . LEU C  1 58  ? 72.013 -8.032  -45.674 1.00 40.63 ? 38  LEU C CG  1 
ATOM   5203  C  CD1 . LEU C  1 58  ? 71.740 -6.926  -44.706 1.00 34.61 ? 38  LEU C CD1 1 
ATOM   5204  C  CD2 . LEU C  1 58  ? 71.959 -7.488  -47.114 1.00 43.67 ? 38  LEU C CD2 1 
ATOM   5205  N  N   . LEU C  1 59  ? 71.807 -10.243 -42.950 1.00 43.48 ? 39  LEU C N   1 
ATOM   5206  C  CA  . LEU C  1 59  ? 70.806 -11.180 -42.467 1.00 42.58 ? 39  LEU C CA  1 
ATOM   5207  C  C   . LEU C  1 59  ? 69.404 -10.713 -42.834 1.00 42.50 ? 39  LEU C C   1 
ATOM   5208  O  O   . LEU C  1 59  ? 69.037 -9.570  -42.577 1.00 40.54 ? 39  LEU C O   1 
ATOM   5209  C  CB  . LEU C  1 59  ? 70.922 -11.267 -40.949 1.00 43.96 ? 39  LEU C CB  1 
ATOM   5210  C  CG  . LEU C  1 59  ? 72.215 -11.800 -40.312 1.00 42.23 ? 39  LEU C CG  1 
ATOM   5211  C  CD1 . LEU C  1 59  ? 72.039 -11.833 -38.817 1.00 42.01 ? 39  LEU C CD1 1 
ATOM   5212  C  CD2 . LEU C  1 59  ? 72.565 -13.202 -40.833 1.00 42.56 ? 39  LEU C CD2 1 
ATOM   5213  N  N   . GLU C  1 60  ? 68.636 -11.602 -43.458 1.00 44.18 ? 40  GLU C N   1 
ATOM   5214  C  CA  . GLU C  1 60  ? 67.216 -11.391 -43.729 1.00 45.81 ? 40  GLU C CA  1 
ATOM   5215  C  C   . GLU C  1 60  ? 66.400 -12.192 -42.714 1.00 43.98 ? 40  GLU C C   1 
ATOM   5216  O  O   . GLU C  1 60  ? 66.517 -13.427 -42.636 1.00 40.97 ? 40  GLU C O   1 
ATOM   5217  C  CB  . GLU C  1 60  ? 66.872 -11.872 -45.142 1.00 46.54 ? 40  GLU C CB  1 
ATOM   5218  C  CG  . GLU C  1 60  ? 65.428 -11.631 -45.587 1.00 48.80 ? 40  GLU C CG  1 
ATOM   5219  C  CD  . GLU C  1 60  ? 64.954 -12.614 -46.688 1.00 55.99 ? 40  GLU C CD  1 
ATOM   5220  O  OE1 . GLU C  1 60  ? 65.790 -13.101 -47.498 1.00 64.13 ? 40  GLU C OE1 1 
ATOM   5221  O  OE2 . GLU C  1 60  ? 63.726 -12.910 -46.724 1.00 67.92 ? 40  GLU C OE2 1 
ATOM   5222  N  N   . ALA C  1 61  ? 65.565 -11.483 -41.948 1.00 44.49 ? 41  ALA C N   1 
ATOM   5223  C  CA  . ALA C  1 61  ? 64.608 -12.132 -41.061 1.00 42.88 ? 41  ALA C CA  1 
ATOM   5224  C  C   . ALA C  1 61  ? 63.600 -13.030 -41.804 1.00 43.57 ? 41  ALA C C   1 
ATOM   5225  O  O   . ALA C  1 61  ? 62.970 -12.620 -42.809 1.00 42.95 ? 41  ALA C O   1 
ATOM   5226  C  CB  . ALA C  1 61  ? 63.880 -11.107 -40.218 1.00 41.62 ? 41  ALA C CB  1 
ATOM   5227  N  N   . LEU C  1 62  ? 63.463 -14.251 -41.274 1.00 44.14 ? 42  LEU C N   1 
ATOM   5228  C  CA  . LEU C  1 62  ? 62.454 -15.233 -41.689 1.00 42.49 ? 42  LEU C CA  1 
ATOM   5229  C  C   . LEU C  1 62  ? 61.293 -15.330 -40.694 1.00 40.66 ? 42  LEU C C   1 
ATOM   5230  O  O   . LEU C  1 62  ? 60.112 -15.416 -41.071 1.00 40.86 ? 42  LEU C O   1 
ATOM   5231  C  CB  . LEU C  1 62  ? 63.094 -16.611 -41.786 1.00 43.91 ? 42  LEU C CB  1 
ATOM   5232  C  CG  . LEU C  1 62  ? 64.349 -16.787 -42.632 1.00 43.92 ? 42  LEU C CG  1 
ATOM   5233  C  CD1 . LEU C  1 62  ? 64.635 -18.283 -42.712 1.00 43.33 ? 42  LEU C CD1 1 
ATOM   5234  C  CD2 . LEU C  1 62  ? 64.179 -16.179 -44.022 1.00 41.53 ? 42  LEU C CD2 1 
ATOM   5235  N  N   . PHE C  1 63  ? 61.650 -15.346 -39.416 1.00 43.91 ? 43  PHE C N   1 
ATOM   5236  C  CA  . PHE C  1 63  ? 60.699 -15.494 -38.296 1.00 41.66 ? 43  PHE C CA  1 
ATOM   5237  C  C   . PHE C  1 63  ? 61.185 -14.606 -37.158 1.00 42.90 ? 43  PHE C C   1 
ATOM   5238  O  O   . PHE C  1 63  ? 62.348 -14.693 -36.753 1.00 42.51 ? 43  PHE C O   1 
ATOM   5239  C  CB  . PHE C  1 63  ? 60.621 -16.963 -37.838 1.00 41.67 ? 43  PHE C CB  1 
ATOM   5240  C  CG  . PHE C  1 63  ? 60.049 -17.924 -38.896 1.00 40.13 ? 43  PHE C CG  1 
ATOM   5241  C  CD1 . PHE C  1 63  ? 58.684 -17.916 -39.214 1.00 40.29 ? 43  PHE C CD1 1 
ATOM   5242  C  CD2 . PHE C  1 63  ? 60.881 -18.822 -39.569 1.00 40.75 ? 43  PHE C CD2 1 
ATOM   5243  C  CE1 . PHE C  1 63  ? 58.140 -18.790 -40.181 1.00 41.65 ? 43  PHE C CE1 1 
ATOM   5244  C  CE2 . PHE C  1 63  ? 60.358 -19.713 -40.552 1.00 38.86 ? 43  PHE C CE2 1 
ATOM   5245  C  CZ  . PHE C  1 63  ? 58.989 -19.701 -40.862 1.00 36.00 ? 43  PHE C CZ  1 
ATOM   5246  N  N   . LEU C  1 64  ? 60.315 -13.717 -36.678 1.00 43.51 ? 44  LEU C N   1 
ATOM   5247  C  CA  . LEU C  1 64  ? 60.591 -12.872 -35.532 1.00 41.38 ? 44  LEU C CA  1 
ATOM   5248  C  C   . LEU C  1 64  ? 59.654 -13.274 -34.412 1.00 44.30 ? 44  LEU C C   1 
ATOM   5249  O  O   . LEU C  1 64  ? 58.517 -13.694 -34.634 1.00 46.46 ? 44  LEU C O   1 
ATOM   5250  C  CB  . LEU C  1 64  ? 60.394 -11.397 -35.857 1.00 41.07 ? 44  LEU C CB  1 
ATOM   5251  C  CG  . LEU C  1 64  ? 61.120 -10.773 -37.068 1.00 44.15 ? 44  LEU C CG  1 
ATOM   5252  C  CD1 . LEU C  1 64  ? 60.235 -10.734 -38.308 1.00 44.60 ? 44  LEU C CD1 1 
ATOM   5253  C  CD2 . LEU C  1 64  ? 61.615 -9.356  -36.786 1.00 42.09 ? 44  LEU C CD2 1 
ATOM   5254  N  N   . THR C  1 65  ? 60.137 -13.153 -33.192 1.00 46.34 ? 45  THR C N   1 
ATOM   5255  C  CA  . THR C  1 65  ? 59.344 -13.512 -32.032 1.00 47.03 ? 45  THR C CA  1 
ATOM   5256  C  C   . THR C  1 65  ? 58.878 -12.257 -31.317 1.00 44.91 ? 45  THR C C   1 
ATOM   5257  O  O   . THR C  1 65  ? 59.532 -11.208 -31.408 1.00 42.14 ? 45  THR C O   1 
ATOM   5258  C  CB  . THR C  1 65  ? 60.155 -14.451 -31.047 1.00 47.76 ? 45  THR C CB  1 
ATOM   5259  O  OG1 . THR C  1 65  ? 59.286 -14.912 -30.009 1.00 50.26 ? 45  THR C OG1 1 
ATOM   5260  C  CG2 . THR C  1 65  ? 61.359 -13.777 -30.436 1.00 45.64 ? 45  THR C CG2 1 
ATOM   5261  N  N   . VAL C  1 66  ? 57.749 -12.381 -30.614 1.00 45.17 ? 46  VAL C N   1 
ATOM   5262  C  CA  . VAL C  1 66  ? 57.337 -11.423 -29.570 1.00 45.03 ? 46  VAL C CA  1 
ATOM   5263  C  C   . VAL C  1 66  ? 57.080 -12.200 -28.292 1.00 45.69 ? 46  VAL C C   1 
ATOM   5264  O  O   . VAL C  1 66  ? 56.594 -13.338 -28.325 1.00 46.25 ? 46  VAL C O   1 
ATOM   5265  C  CB  . VAL C  1 66  ? 56.120 -10.547 -29.936 1.00 44.11 ? 46  VAL C CB  1 
ATOM   5266  C  CG1 . VAL C  1 66  ? 56.479 -9.608  -31.109 1.00 50.22 ? 46  VAL C CG1 1 
ATOM   5267  C  CG2 . VAL C  1 66  ? 54.914 -11.379 -30.237 1.00 49.14 ? 46  VAL C CG2 1 
ATOM   5268  N  N   . ASP C  1 67  ? 57.435 -11.568 -27.180 1.00 48.16 ? 47  ASP C N   1 
ATOM   5269  C  CA  . ASP C  1 67  ? 57.584 -12.216 -25.872 1.00 49.36 ? 47  ASP C CA  1 
ATOM   5270  C  C   . ASP C  1 67  ? 57.215 -11.210 -24.785 1.00 46.80 ? 47  ASP C C   1 
ATOM   5271  O  O   . ASP C  1 67  ? 57.528 -10.029 -24.929 1.00 44.14 ? 47  ASP C O   1 
ATOM   5272  C  CB  . ASP C  1 67  ? 59.046 -12.617 -25.666 1.00 50.99 ? 47  ASP C CB  1 
ATOM   5273  C  CG  . ASP C  1 67  ? 59.549 -13.608 -26.726 1.00 56.37 ? 47  ASP C CG  1 
ATOM   5274  O  OD1 . ASP C  1 67  ? 60.447 -13.196 -27.504 1.00 54.90 ? 47  ASP C OD1 1 
ATOM   5275  O  OD2 . ASP C  1 67  ? 59.041 -14.773 -26.781 1.00 56.08 ? 47  ASP C OD2 1 
ATOM   5276  N  N   . PRO C  1 68  ? 56.610 -11.682 -23.670 1.00 47.80 ? 48  PRO C N   1 
ATOM   5277  C  CA  . PRO C  1 68  ? 56.171 -10.814 -22.536 1.00 49.62 ? 48  PRO C CA  1 
ATOM   5278  C  C   . PRO C  1 68  ? 57.265 -9.938  -21.907 1.00 48.94 ? 48  PRO C C   1 
ATOM   5279  O  O   . PRO C  1 68  ? 56.987 -8.816  -21.487 1.00 53.83 ? 48  PRO C O   1 
ATOM   5280  C  CB  . PRO C  1 68  ? 55.641 -11.830 -21.501 1.00 50.35 ? 48  PRO C CB  1 
ATOM   5281  C  CG  . PRO C  1 68  ? 55.248 -13.003 -22.296 1.00 49.85 ? 48  PRO C CG  1 
ATOM   5282  C  CD  . PRO C  1 68  ? 56.297 -13.095 -23.398 1.00 48.22 ? 48  PRO C CD  1 
ATOM   5283  N  N   . TYR C  1 69  ? 58.502 -10.447 -21.875 1.00 49.56 ? 49  TYR C N   1 
ATOM   5284  C  CA  . TYR C  1 69  ? 59.629 -9.719  -21.309 1.00 47.27 ? 49  TYR C CA  1 
ATOM   5285  C  C   . TYR C  1 69  ? 59.830 -8.369  -21.995 1.00 43.85 ? 49  TYR C C   1 
ATOM   5286  O  O   . TYR C  1 69  ? 60.334 -7.449  -21.364 1.00 45.86 ? 49  TYR C O   1 
ATOM   5287  C  CB  . TYR C  1 69  ? 60.932 -10.582 -21.351 1.00 51.20 ? 49  TYR C CB  1 
ATOM   5288  C  CG  . TYR C  1 69  ? 61.679 -10.543 -22.682 1.00 45.24 ? 49  TYR C CG  1 
ATOM   5289  C  CD1 . TYR C  1 69  ? 62.520 -9.473  -22.997 1.00 50.34 ? 49  TYR C CD1 1 
ATOM   5290  C  CD2 . TYR C  1 69  ? 61.521 -11.535 -23.601 1.00 39.50 ? 49  TYR C CD2 1 
ATOM   5291  C  CE1 . TYR C  1 69  ? 63.176 -9.388  -24.219 1.00 40.78 ? 49  TYR C CE1 1 
ATOM   5292  C  CE2 . TYR C  1 69  ? 62.173 -11.478 -24.833 1.00 52.78 ? 49  TYR C CE2 1 
ATOM   5293  C  CZ  . TYR C  1 69  ? 62.997 -10.391 -25.136 1.00 50.57 ? 49  TYR C CZ  1 
ATOM   5294  O  OH  . TYR C  1 69  ? 63.655 -10.323 -26.340 1.00 44.01 ? 49  TYR C OH  1 
ATOM   5295  N  N   . MET C  1 70  ? 59.430 -8.239  -23.262 1.00 42.28 ? 50  MET C N   1 
ATOM   5296  C  CA  . MET C  1 70  ? 59.597 -6.962  -24.010 1.00 43.99 ? 50  MET C CA  1 
ATOM   5297  C  C   . MET C  1 70  ? 58.787 -5.746  -23.447 1.00 45.48 ? 50  MET C C   1 
ATOM   5298  O  O   . MET C  1 70  ? 59.215 -4.585  -23.607 1.00 43.76 ? 50  MET C O   1 
ATOM   5299  C  CB  . MET C  1 70  ? 59.262 -7.135  -25.506 1.00 45.39 ? 50  MET C CB  1 
ATOM   5300  C  CG  . MET C  1 70  ? 59.973 -8.304  -26.198 1.00 40.99 ? 50  MET C CG  1 
ATOM   5301  S  SD  . MET C  1 70  ? 59.365 -8.501  -27.869 1.00 43.78 ? 50  MET C SD  1 
ATOM   5302  C  CE  . MET C  1 70  ? 60.427 -9.799  -28.482 1.00 43.31 ? 50  MET C CE  1 
ATOM   5303  N  N   . ARG C  1 71  ? 57.648 -6.003  -22.792 1.00 42.18 ? 51  ARG C N   1 
ATOM   5304  C  CA  . ARG C  1 71  ? 56.916 -4.941  -22.121 1.00 41.87 ? 51  ARG C CA  1 
ATOM   5305  C  C   . ARG C  1 71  ? 57.795 -4.229  -21.058 1.00 43.12 ? 51  ARG C C   1 
ATOM   5306  O  O   . ARG C  1 71  ? 57.830 -2.991  -20.934 1.00 40.93 ? 51  ARG C O   1 
ATOM   5307  C  CB  . ARG C  1 71  ? 55.637 -5.527  -21.507 1.00 37.48 ? 51  ARG C CB  1 
ATOM   5308  C  CG  . ARG C  1 71  ? 54.784 -4.514  -20.817 1.00 37.45 ? 51  ARG C CG  1 
ATOM   5309  C  CD  . ARG C  1 71  ? 54.356 -3.305  -21.688 1.00 34.04 ? 51  ARG C CD  1 
ATOM   5310  N  NE  . ARG C  1 71  ? 53.650 -2.302  -20.913 1.00 36.07 ? 51  ARG C NE  1 
ATOM   5311  C  CZ  . ARG C  1 71  ? 54.211 -1.334  -20.188 1.00 39.04 ? 51  ARG C CZ  1 
ATOM   5312  N  NH1 . ARG C  1 71  ? 55.514 -1.171  -20.130 1.00 45.44 ? 51  ARG C NH1 1 
ATOM   5313  N  NH2 . ARG C  1 71  ? 53.450 -0.459  -19.565 1.00 43.36 ? 51  ARG C NH2 1 
ATOM   5314  N  N   . VAL C  1 72  ? 58.529 -5.055  -20.329 1.00 44.49 ? 52  VAL C N   1 
ATOM   5315  C  CA  . VAL C  1 72  ? 59.483 -4.655  -19.322 1.00 44.74 ? 52  VAL C CA  1 
ATOM   5316  C  C   . VAL C  1 72  ? 60.803 -4.115  -19.889 1.00 43.39 ? 52  VAL C C   1 
ATOM   5317  O  O   . VAL C  1 72  ? 61.281 -3.066  -19.516 1.00 46.25 ? 52  VAL C O   1 
ATOM   5318  C  CB  . VAL C  1 72  ? 59.721 -5.880  -18.394 1.00 44.26 ? 52  VAL C CB  1 
ATOM   5319  C  CG1 . VAL C  1 72  ? 61.000 -5.716  -17.540 1.00 51.21 ? 52  VAL C CG1 1 
ATOM   5320  C  CG2 . VAL C  1 72  ? 58.523 -6.014  -17.516 1.00 42.22 ? 52  VAL C CG2 1 
ATOM   5321  N  N   . ALA C  1 73  ? 61.402 -4.856  -20.797 1.00 47.16 ? 53  ALA C N   1 
ATOM   5322  C  CA  . ALA C  1 73  ? 62.696 -4.481  -21.366 1.00 47.22 ? 53  ALA C CA  1 
ATOM   5323  C  C   . ALA C  1 73  ? 62.640 -3.108  -22.044 1.00 48.15 ? 53  ALA C C   1 
ATOM   5324  O  O   . ALA C  1 73  ? 63.638 -2.385  -22.087 1.00 49.74 ? 53  ALA C O   1 
ATOM   5325  C  CB  . ALA C  1 73  ? 63.165 -5.585  -22.336 1.00 45.45 ? 53  ALA C CB  1 
ATOM   5326  N  N   . ALA C  1 74  ? 61.453 -2.767  -22.545 1.00 48.93 ? 54  ALA C N   1 
ATOM   5327  C  CA  . ALA C  1 74  ? 61.175 -1.562  -23.323 1.00 48.17 ? 54  ALA C CA  1 
ATOM   5328  C  C   . ALA C  1 74  ? 61.310 -0.292  -22.515 1.00 48.29 ? 54  ALA C C   1 
ATOM   5329  O  O   . ALA C  1 74  ? 61.551 0.768   -23.085 1.00 45.95 ? 54  ALA C O   1 
ATOM   5330  C  CB  . ALA C  1 74  ? 59.771 -1.633  -23.898 1.00 49.03 ? 54  ALA C CB  1 
ATOM   5331  N  N   . LYS C  1 75  ? 61.090 -0.381  -21.202 1.00 50.02 ? 55  LYS C N   1 
ATOM   5332  C  CA  . LYS C  1 75  ? 61.333 0.744   -20.297 1.00 49.72 ? 55  LYS C CA  1 
ATOM   5333  C  C   . LYS C  1 75  ? 62.814 1.156   -20.204 1.00 51.90 ? 55  LYS C C   1 
ATOM   5334  O  O   . LYS C  1 75  ? 63.131 2.296   -19.890 1.00 53.21 ? 55  LYS C O   1 
ATOM   5335  C  CB  . LYS C  1 75  ? 60.814 0.386   -18.921 1.00 49.96 ? 55  LYS C CB  1 
ATOM   5336  C  CG  . LYS C  1 75  ? 59.312 0.268   -18.892 1.00 54.30 ? 55  LYS C CG  1 
ATOM   5337  C  CD  . LYS C  1 75  ? 58.828 -1.099  -18.452 1.00 61.39 ? 55  LYS C CD  1 
ATOM   5338  C  CE  . LYS C  1 75  ? 59.235 -1.416  -17.031 1.00 64.27 ? 55  LYS C CE  1 
ATOM   5339  N  NZ  . LYS C  1 75  ? 59.006 -0.269  -16.151 1.00 50.09 ? 55  LYS C NZ  1 
ATOM   5340  N  N   . ARG C  1 76  ? 63.717 0.218   -20.488 1.00 54.20 ? 56  ARG C N   1 
ATOM   5341  C  CA  . ARG C  1 76  ? 65.155 0.494   -20.517 1.00 54.49 ? 56  ARG C CA  1 
ATOM   5342  C  C   . ARG C  1 76  ? 65.572 1.244   -21.806 1.00 52.73 ? 56  ARG C C   1 
ATOM   5343  O  O   . ARG C  1 76  ? 66.654 1.799   -21.848 1.00 54.53 ? 56  ARG C O   1 
ATOM   5344  C  CB  . ARG C  1 76  ? 65.979 -0.810  -20.295 1.00 57.06 ? 56  ARG C CB  1 
ATOM   5345  C  CG  . ARG C  1 76  ? 66.475 -1.042  -18.833 1.00 65.82 ? 56  ARG C CG  1 
ATOM   5346  C  CD  . ARG C  1 76  ? 66.045 -2.381  -18.133 1.00 72.43 ? 56  ARG C CD  1 
ATOM   5347  N  NE  . ARG C  1 76  ? 65.994 -3.570  -18.997 1.00 78.05 ? 56  ARG C NE  1 
ATOM   5348  C  CZ  . ARG C  1 76  ? 65.366 -4.734  -18.714 1.00 80.53 ? 56  ARG C CZ  1 
ATOM   5349  N  NH1 . ARG C  1 76  ? 64.681 -4.952  -17.568 1.00 74.72 ? 56  ARG C NH1 1 
ATOM   5350  N  NH2 . ARG C  1 76  ? 65.425 -5.718  -19.611 1.00 79.04 ? 56  ARG C NH2 1 
ATOM   5351  N  N   . LEU C  1 77  ? 64.709 1.298   -22.820 1.00 51.01 ? 57  LEU C N   1 
ATOM   5352  C  CA  . LEU C  1 77  ? 64.978 2.047   -24.076 1.00 49.91 ? 57  LEU C CA  1 
ATOM   5353  C  C   . LEU C  1 77  ? 64.750 3.555   -24.014 1.00 47.00 ? 57  LEU C C   1 
ATOM   5354  O  O   . LEU C  1 77  ? 64.030 4.061   -23.182 1.00 48.07 ? 57  LEU C O   1 
ATOM   5355  C  CB  . LEU C  1 77  ? 64.093 1.534   -25.227 1.00 49.25 ? 57  LEU C CB  1 
ATOM   5356  C  CG  . LEU C  1 77  ? 64.040 0.052   -25.569 1.00 48.42 ? 57  LEU C CG  1 
ATOM   5357  C  CD1 . LEU C  1 77  ? 63.072 -0.169  -26.741 1.00 46.39 ? 57  LEU C CD1 1 
ATOM   5358  C  CD2 . LEU C  1 77  ? 65.414 -0.480  -25.902 1.00 45.25 ? 57  LEU C CD2 1 
ATOM   5359  N  N   . LYS C  1 78  ? 65.383 4.262   -24.928 1.00 46.72 ? 58  LYS C N   1 
ATOM   5360  C  CA  . LYS C  1 78  ? 65.065 5.636   -25.170 1.00 48.15 ? 58  LYS C CA  1 
ATOM   5361  C  C   . LYS C  1 78  ? 64.061 5.650   -26.321 1.00 46.82 ? 58  LYS C C   1 
ATOM   5362  O  O   . LYS C  1 78  ? 64.126 4.846   -27.230 1.00 45.75 ? 58  LYS C O   1 
ATOM   5363  C  CB  . LYS C  1 78  ? 66.330 6.460   -25.536 1.00 48.26 ? 58  LYS C CB  1 
ATOM   5364  C  CG  . LYS C  1 78  ? 67.440 6.501   -24.471 1.00 51.41 ? 58  LYS C CG  1 
ATOM   5365  C  CD  . LYS C  1 78  ? 67.256 7.628   -23.458 1.00 55.47 ? 58  LYS C CD  1 
ATOM   5366  N  N   . GLU C  1 79  ? 63.116 6.567   -26.269 1.00 47.92 ? 59  GLU C N   1 
ATOM   5367  C  CA  . GLU C  1 79  ? 62.214 6.769   -27.384 1.00 49.88 ? 59  GLU C CA  1 
ATOM   5368  C  C   . GLU C  1 79  ? 63.085 7.002   -28.641 1.00 48.80 ? 59  GLU C C   1 
ATOM   5369  O  O   . GLU C  1 79  ? 64.138 7.647   -28.572 1.00 46.98 ? 59  GLU C O   1 
ATOM   5370  C  CB  . GLU C  1 79  ? 61.238 7.932   -27.086 1.00 48.65 ? 59  GLU C CB  1 
ATOM   5371  C  CG  . GLU C  1 79  ? 60.312 7.662   -25.862 1.00 53.07 ? 59  GLU C CG  1 
ATOM   5372  C  CD  . GLU C  1 79  ? 59.412 8.866   -25.460 1.00 55.88 ? 59  GLU C CD  1 
ATOM   5373  O  OE1 . GLU C  1 79  ? 58.540 8.705   -24.543 1.00 61.27 ? 59  GLU C OE1 1 
ATOM   5374  O  OE2 . GLU C  1 79  ? 59.587 9.970   -26.046 1.00 61.66 ? 59  GLU C OE2 1 
ATOM   5375  N  N   . GLY C  1 80  ? 62.654 6.435   -29.770 1.00 48.86 ? 60  GLY C N   1 
ATOM   5376  C  CA  . GLY C  1 80  ? 63.471 6.367   -30.995 1.00 47.82 ? 60  GLY C CA  1 
ATOM   5377  C  C   . GLY C  1 80  ? 64.235 5.060   -31.162 1.00 46.37 ? 60  GLY C C   1 
ATOM   5378  O  O   . GLY C  1 80  ? 64.558 4.674   -32.270 1.00 47.03 ? 60  GLY C O   1 
ATOM   5379  N  N   . ASP C  1 81  ? 64.538 4.365   -30.069 1.00 47.19 ? 61  ASP C N   1 
ATOM   5380  C  CA  . ASP C  1 81  ? 65.296 3.098   -30.163 1.00 47.33 ? 61  ASP C CA  1 
ATOM   5381  C  C   . ASP C  1 81  ? 64.463 1.999   -30.818 1.00 45.36 ? 61  ASP C C   1 
ATOM   5382  O  O   . ASP C  1 81  ? 63.242 2.000   -30.795 1.00 41.93 ? 61  ASP C O   1 
ATOM   5383  C  CB  . ASP C  1 81  ? 65.752 2.573   -28.786 1.00 47.00 ? 61  ASP C CB  1 
ATOM   5384  C  CG  . ASP C  1 81  ? 66.891 3.394   -28.139 1.00 52.69 ? 61  ASP C CG  1 
ATOM   5385  O  OD1 . ASP C  1 81  ? 67.207 3.054   -26.956 1.00 54.77 ? 61  ASP C OD1 1 
ATOM   5386  O  OD2 . ASP C  1 81  ? 67.477 4.334   -28.775 1.00 46.15 ? 61  ASP C OD2 1 
ATOM   5387  N  N   . THR C  1 82  ? 65.174 1.044   -31.382 1.00 45.06 ? 62  THR C N   1 
ATOM   5388  C  CA  . THR C  1 82  ? 64.585 -0.137  -31.974 1.00 44.92 ? 62  THR C CA  1 
ATOM   5389  C  C   . THR C  1 82  ? 64.046 -1.053  -30.881 1.00 43.44 ? 62  THR C C   1 
ATOM   5390  O  O   . THR C  1 82  ? 64.670 -1.246  -29.834 1.00 43.19 ? 62  THR C O   1 
ATOM   5391  C  CB  . THR C  1 82  ? 65.652 -0.873  -32.799 1.00 42.28 ? 62  THR C CB  1 
ATOM   5392  O  OG1 . THR C  1 82  ? 66.367 0.095   -33.560 1.00 47.69 ? 62  THR C OG1 1 
ATOM   5393  C  CG2 . THR C  1 82  ? 65.058 -1.917  -33.730 1.00 40.05 ? 62  THR C CG2 1 
ATOM   5394  N  N   . MET C  1 83  ? 62.889 -1.626  -31.134 1.00 43.27 ? 63  MET C N   1 
ATOM   5395  C  CA  . MET C  1 83  ? 62.386 -2.670  -30.245 1.00 45.76 ? 63  MET C CA  1 
ATOM   5396  C  C   . MET C  1 83  ? 63.308 -3.910  -30.229 1.00 45.74 ? 63  MET C C   1 
ATOM   5397  O  O   . MET C  1 83  ? 63.719 -4.409  -31.298 1.00 48.11 ? 63  MET C O   1 
ATOM   5398  C  CB  . MET C  1 83  ? 60.968 -3.040  -30.672 1.00 46.52 ? 63  MET C CB  1 
ATOM   5399  C  CG  . MET C  1 83  ? 59.942 -1.951  -30.365 1.00 42.45 ? 63  MET C CG  1 
ATOM   5400  S  SD  . MET C  1 83  ? 59.638 -1.648  -28.593 1.00 49.89 ? 63  MET C SD  1 
ATOM   5401  C  CE  . MET C  1 83  ? 59.214 -3.263  -27.940 1.00 42.90 ? 63  MET C CE  1 
ATOM   5402  N  N   . MET C  1 84  ? 63.641 -4.401  -29.032 1.00 43.18 ? 64  MET C N   1 
ATOM   5403  C  CA  . MET C  1 84  ? 64.474 -5.580  -28.881 1.00 43.40 ? 64  MET C CA  1 
ATOM   5404  C  C   . MET C  1 84  ? 63.745 -6.875  -29.224 1.00 43.16 ? 64  MET C C   1 
ATOM   5405  O  O   . MET C  1 84  ? 62.522 -7.007  -29.076 1.00 43.78 ? 64  MET C O   1 
ATOM   5406  C  CB  . MET C  1 84  ? 65.025 -5.699  -27.437 1.00 45.73 ? 64  MET C CB  1 
ATOM   5407  C  CG  . MET C  1 84  ? 63.917 -5.981  -26.341 1.00 55.56 ? 64  MET C CG  1 
ATOM   5408  S  SD  . MET C  1 84  ? 62.892 -4.508  -26.055 1.00 59.22 ? 64  MET C SD  1 
ATOM   5409  C  CE  . MET C  1 84  ? 64.097 -3.616  -25.076 1.00 65.70 ? 64  MET C CE  1 
ATOM   5410  N  N   . GLY C  1 85  ? 64.514 -7.858  -29.633 1.00 42.94 ? 65  GLY C N   1 
ATOM   5411  C  CA  . GLY C  1 85  ? 63.928 -9.141  -29.976 1.00 44.28 ? 65  GLY C CA  1 
ATOM   5412  C  C   . GLY C  1 85  ? 64.852 -10.059 -30.762 1.00 42.95 ? 65  GLY C C   1 
ATOM   5413  O  O   . GLY C  1 85  ? 65.772 -9.593  -31.453 1.00 41.49 ? 65  GLY C O   1 
ATOM   5414  N  N   . GLN C  1 86  ? 64.561 -11.358 -30.653 1.00 42.24 ? 66  GLN C N   1 
ATOM   5415  C  CA  . GLN C  1 86  ? 65.226 -12.394 -31.406 1.00 43.24 ? 66  GLN C CA  1 
ATOM   5416  C  C   . GLN C  1 86  ? 64.523 -12.809 -32.719 1.00 43.88 ? 66  GLN C C   1 
ATOM   5417  O  O   . GLN C  1 86  ? 63.297 -12.738 -32.871 1.00 43.55 ? 66  GLN C O   1 
ATOM   5418  C  CB  . GLN C  1 86  ? 65.387 -13.608 -30.513 1.00 42.95 ? 66  GLN C CB  1 
ATOM   5419  C  CG  . GLN C  1 86  ? 66.245 -14.650 -31.097 1.00 42.37 ? 66  GLN C CG  1 
ATOM   5420  C  CD  . GLN C  1 86  ? 66.606 -15.668 -30.082 1.00 48.40 ? 66  GLN C CD  1 
ATOM   5421  O  OE1 . GLN C  1 86  ? 65.714 -16.248 -29.454 1.00 50.06 ? 66  GLN C OE1 1 
ATOM   5422  N  NE2 . GLN C  1 86  ? 67.922 -15.894 -29.883 1.00 41.27 ? 66  GLN C NE2 1 
ATOM   5423  N  N   . GLN C  1 87  ? 65.322 -13.273 -33.668 1.00 44.11 ? 67  GLN C N   1 
ATOM   5424  C  CA  . GLN C  1 87  ? 64.780 -13.821 -34.906 1.00 41.29 ? 67  GLN C CA  1 
ATOM   5425  C  C   . GLN C  1 87  ? 65.615 -14.993 -35.443 1.00 40.26 ? 67  GLN C C   1 
ATOM   5426  O  O   . GLN C  1 87  ? 66.754 -15.192 -35.068 1.00 41.17 ? 67  GLN C O   1 
ATOM   5427  C  CB  . GLN C  1 87  ? 64.662 -12.713 -35.962 1.00 41.34 ? 67  GLN C CB  1 
ATOM   5428  C  CG  . GLN C  1 87  ? 65.997 -12.102 -36.370 1.00 40.80 ? 67  GLN C CG  1 
ATOM   5429  C  CD  . GLN C  1 87  ? 65.889 -10.948 -37.297 1.00 40.72 ? 67  GLN C CD  1 
ATOM   5430  O  OE1 . GLN C  1 87  ? 66.562 -10.916 -38.339 1.00 40.96 ? 67  GLN C OE1 1 
ATOM   5431  N  NE2 . GLN C  1 87  ? 65.087 -9.940  -36.911 1.00 44.61 ? 67  GLN C NE2 1 
ATOM   5432  N  N   . VAL C  1 88  ? 64.977 -15.758 -36.321 1.00 41.95 ? 68  VAL C N   1 
ATOM   5433  C  CA  . VAL C  1 88  ? 65.608 -16.679 -37.228 1.00 40.99 ? 68  VAL C CA  1 
ATOM   5434  C  C   . VAL C  1 88  ? 65.844 -15.897 -38.497 1.00 39.64 ? 68  VAL C C   1 
ATOM   5435  O  O   . VAL C  1 88  ? 64.893 -15.407 -39.081 1.00 39.53 ? 68  VAL C O   1 
ATOM   5436  C  CB  . VAL C  1 88  ? 64.685 -17.880 -37.559 1.00 39.30 ? 68  VAL C CB  1 
ATOM   5437  C  CG1 . VAL C  1 88  ? 65.272 -18.722 -38.681 1.00 37.77 ? 68  VAL C CG1 1 
ATOM   5438  C  CG2 . VAL C  1 88  ? 64.459 -18.742 -36.313 1.00 39.92 ? 68  VAL C CG2 1 
ATOM   5439  N  N   . ALA C  1 89  ? 67.106 -15.788 -38.908 1.00 41.12 ? 69  ALA C N   1 
ATOM   5440  C  CA  . ALA C  1 89  ? 67.524 -15.066 -40.120 1.00 38.90 ? 69  ALA C CA  1 
ATOM   5441  C  C   . ALA C  1 89  ? 68.304 -15.956 -41.066 1.00 36.65 ? 69  ALA C C   1 
ATOM   5442  O  O   . ALA C  1 89  ? 68.875 -16.930 -40.662 1.00 37.05 ? 69  ALA C O   1 
ATOM   5443  C  CB  . ALA C  1 89  ? 68.365 -13.842 -39.751 1.00 37.33 ? 69  ALA C CB  1 
ATOM   5444  N  N   . LYS C  1 90  ? 68.274 -15.606 -42.345 1.00 39.73 ? 70  LYS C N   1 
ATOM   5445  C  CA  . LYS C  1 90  ? 69.057 -16.245 -43.379 1.00 40.98 ? 70  LYS C CA  1 
ATOM   5446  C  C   . LYS C  1 90  ? 70.219 -15.307 -43.771 1.00 38.89 ? 70  LYS C C   1 
ATOM   5447  O  O   . LYS C  1 90  ? 70.051 -14.113 -43.904 1.00 36.10 ? 70  LYS C O   1 
ATOM   5448  C  CB  . LYS C  1 90  ? 68.191 -16.566 -44.617 1.00 40.97 ? 70  LYS C CB  1 
ATOM   5449  C  CG  . LYS C  1 90  ? 68.765 -17.701 -45.502 1.00 43.01 ? 70  LYS C CG  1 
ATOM   5450  C  CD  . LYS C  1 90  ? 68.112 -17.769 -46.890 1.00 48.50 ? 70  LYS C CD  1 
ATOM   5451  C  CE  . LYS C  1 90  ? 66.667 -18.322 -46.889 1.00 55.98 ? 70  LYS C CE  1 
ATOM   5452  N  NZ  . LYS C  1 90  ? 65.877 -17.969 -48.145 1.00 49.76 ? 70  LYS C NZ  1 
ATOM   5453  N  N   . VAL C  1 91  ? 71.407 -15.854 -43.930 1.00 39.89 ? 71  VAL C N   1 
ATOM   5454  C  CA  . VAL C  1 91  ? 72.526 -15.081 -44.451 1.00 40.45 ? 71  VAL C CA  1 
ATOM   5455  C  C   . VAL C  1 91  ? 72.316 -14.940 -45.968 1.00 41.85 ? 71  VAL C C   1 
ATOM   5456  O  O   . VAL C  1 91  ? 72.457 -15.907 -46.723 1.00 40.16 ? 71  VAL C O   1 
ATOM   5457  C  CB  . VAL C  1 91  ? 73.832 -15.783 -44.148 1.00 39.19 ? 71  VAL C CB  1 
ATOM   5458  C  CG1 . VAL C  1 91  ? 75.000 -15.074 -44.826 1.00 44.94 ? 71  VAL C CG1 1 
ATOM   5459  C  CG2 . VAL C  1 91  ? 74.033 -15.857 -42.654 1.00 40.55 ? 71  VAL C CG2 1 
ATOM   5460  N  N   . VAL C  1 92  ? 71.943 -13.735 -46.405 1.00 43.14 ? 72  VAL C N   1 
ATOM   5461  C  CA  . VAL C  1 92  ? 71.693 -13.473 -47.832 1.00 43.98 ? 72  VAL C CA  1 
ATOM   5462  C  C   . VAL C  1 92  ? 72.907 -12.855 -48.576 1.00 44.82 ? 72  VAL C C   1 
ATOM   5463  O  O   . VAL C  1 92  ? 72.944 -12.838 -49.821 1.00 46.64 ? 72  VAL C O   1 
ATOM   5464  C  CB  . VAL C  1 92  ? 70.419 -12.612 -48.002 1.00 44.64 ? 72  VAL C CB  1 
ATOM   5465  C  CG1 . VAL C  1 92  ? 69.167 -13.403 -47.513 1.00 43.50 ? 72  VAL C CG1 1 
ATOM   5466  C  CG2 . VAL C  1 92  ? 70.551 -11.270 -47.257 1.00 43.71 ? 72  VAL C CG2 1 
ATOM   5467  N  N   . GLU C  1 93  ? 73.876 -12.358 -47.792 1.00 43.93 ? 73  GLU C N   1 
ATOM   5468  C  CA  . GLU C  1 93  ? 75.119 -11.779 -48.274 1.00 42.69 ? 73  GLU C CA  1 
ATOM   5469  C  C   . GLU C  1 93  ? 76.220 -12.069 -47.223 1.00 43.09 ? 73  GLU C C   1 
ATOM   5470  O  O   . GLU C  1 93  ? 75.982 -11.953 -46.019 1.00 41.26 ? 73  GLU C O   1 
ATOM   5471  C  CB  . GLU C  1 93  ? 74.934 -10.271 -48.496 1.00 42.20 ? 73  GLU C CB  1 
ATOM   5472  C  CG  . GLU C  1 93  ? 75.756 -9.653  -49.625 1.00 47.72 ? 73  GLU C CG  1 
ATOM   5473  N  N   . SER C  1 94  ? 77.420 -12.464 -47.670 1.00 43.94 ? 74  SER C N   1 
ATOM   5474  C  CA  . SER C  1 94  ? 78.504 -12.800 -46.736 1.00 41.88 ? 74  SER C CA  1 
ATOM   5475  C  C   . SER C  1 94  ? 79.881 -12.292 -47.147 1.00 40.12 ? 74  SER C C   1 
ATOM   5476  O  O   . SER C  1 94  ? 80.260 -12.296 -48.313 1.00 36.98 ? 74  SER C O   1 
ATOM   5477  C  CB  . SER C  1 94  ? 78.582 -14.317 -46.528 1.00 42.52 ? 74  SER C CB  1 
ATOM   5478  O  OG  . SER C  1 94  ? 79.472 -14.650 -45.470 1.00 38.89 ? 74  SER C OG  1 
ATOM   5479  N  N   . LYS C  1 95  ? 80.613 -11.832 -46.143 1.00 39.81 ? 75  LYS C N   1 
ATOM   5480  C  CA  . LYS C  1 95  ? 82.060 -11.737 -46.202 1.00 37.38 ? 75  LYS C CA  1 
ATOM   5481  C  C   . LYS C  1 95  ? 82.658 -12.508 -45.019 1.00 36.53 ? 75  LYS C C   1 
ATOM   5482  O  O   . LYS C  1 95  ? 83.803 -12.289 -44.640 1.00 36.00 ? 75  LYS C O   1 
ATOM   5483  C  CB  . LYS C  1 95  ? 82.497 -10.276 -46.191 1.00 36.26 ? 75  LYS C CB  1 
ATOM   5484  C  CG  . LYS C  1 95  ? 82.079 -9.547  -47.418 1.00 35.83 ? 75  LYS C CG  1 
ATOM   5485  C  CD  . LYS C  1 95  ? 82.732 -8.175  -47.531 1.00 39.40 ? 75  LYS C CD  1 
ATOM   5486  C  CE  . LYS C  1 95  ? 82.226 -7.469  -48.789 1.00 45.13 ? 75  LYS C CE  1 
ATOM   5487  N  NZ  . LYS C  1 95  ? 82.677 -6.065  -48.879 1.00 45.76 ? 75  LYS C NZ  1 
ATOM   5488  N  N   . ASN C  1 96  ? 81.880 -13.432 -44.460 1.00 36.83 ? 76  ASN C N   1 
ATOM   5489  C  CA  . ASN C  1 96  ? 82.322 -14.281 -43.369 1.00 36.23 ? 76  ASN C CA  1 
ATOM   5490  C  C   . ASN C  1 96  ? 82.287 -15.759 -43.779 1.00 36.37 ? 76  ASN C C   1 
ATOM   5491  O  O   . ASN C  1 96  ? 81.224 -16.284 -44.080 1.00 36.59 ? 76  ASN C O   1 
ATOM   5492  C  CB  . ASN C  1 96  ? 81.427 -14.045 -42.170 1.00 36.44 ? 76  ASN C CB  1 
ATOM   5493  C  CG  . ASN C  1 96  ? 81.913 -14.756 -40.917 1.00 36.62 ? 76  ASN C CG  1 
ATOM   5494  O  OD1 . ASN C  1 96  ? 82.274 -15.919 -40.951 1.00 48.85 ? 76  ASN C OD1 1 
ATOM   5495  N  ND2 . ASN C  1 96  ? 81.894 -14.061 -39.804 1.00 33.29 ? 76  ASN C ND2 1 
ATOM   5496  N  N   . VAL C  1 97  ? 83.438 -16.430 -43.743 1.00 37.34 ? 77  VAL C N   1 
ATOM   5497  C  CA  . VAL C  1 97  ? 83.538 -17.846 -44.174 1.00 38.99 ? 77  VAL C CA  1 
ATOM   5498  C  C   . VAL C  1 97  ? 82.955 -18.886 -43.176 1.00 40.16 ? 77  VAL C C   1 
ATOM   5499  O  O   . VAL C  1 97  ? 82.763 -20.063 -43.522 1.00 40.61 ? 77  VAL C O   1 
ATOM   5500  C  CB  . VAL C  1 97  ? 84.991 -18.242 -44.523 1.00 38.01 ? 77  VAL C CB  1 
ATOM   5501  C  CG1 . VAL C  1 97  ? 85.586 -17.288 -45.563 1.00 38.71 ? 77  VAL C CG1 1 
ATOM   5502  C  CG2 . VAL C  1 97  ? 85.851 -18.318 -43.263 1.00 37.59 ? 77  VAL C CG2 1 
ATOM   5503  N  N   . ALA C  1 98  ? 82.694 -18.462 -41.943 1.00 39.32 ? 78  ALA C N   1 
ATOM   5504  C  CA  . ALA C  1 98  ? 81.929 -19.280 -41.012 1.00 40.14 ? 78  ALA C CA  1 
ATOM   5505  C  C   . ALA C  1 98  ? 80.455 -19.310 -41.419 1.00 40.06 ? 78  ALA C C   1 
ATOM   5506  O  O   . ALA C  1 98  ? 79.709 -20.183 -40.985 1.00 41.77 ? 78  ALA C O   1 
ATOM   5507  C  CB  . ALA C  1 98  ? 82.048 -18.722 -39.558 1.00 40.52 ? 78  ALA C CB  1 
ATOM   5508  N  N   . LEU C  1 99  ? 80.030 -18.326 -42.207 1.00 40.12 ? 79  LEU C N   1 
ATOM   5509  C  CA  . LEU C  1 99  ? 78.605 -18.061 -42.426 1.00 41.04 ? 79  LEU C CA  1 
ATOM   5510  C  C   . LEU C  1 99  ? 78.360 -17.747 -43.889 1.00 39.17 ? 79  LEU C C   1 
ATOM   5511  O  O   . LEU C  1 99  ? 78.149 -16.591 -44.243 1.00 41.11 ? 79  LEU C O   1 
ATOM   5512  C  CB  . LEU C  1 99  ? 78.137 -16.874 -41.573 1.00 41.15 ? 79  LEU C CB  1 
ATOM   5513  C  CG  . LEU C  1 99  ? 78.338 -16.892 -40.043 1.00 43.92 ? 79  LEU C CG  1 
ATOM   5514  C  CD1 . LEU C  1 99  ? 78.186 -15.460 -39.459 1.00 43.63 ? 79  LEU C CD1 1 
ATOM   5515  C  CD2 . LEU C  1 99  ? 77.383 -17.870 -39.330 1.00 42.03 ? 79  LEU C CD2 1 
ATOM   5516  N  N   . PRO C  1 100 ? 78.397 -18.771 -44.749 1.00 38.17 ? 80  PRO C N   1 
ATOM   5517  C  CA  . PRO C  1 100 ? 78.115 -18.506 -46.161 1.00 39.15 ? 80  PRO C CA  1 
ATOM   5518  C  C   . PRO C  1 100 ? 76.637 -18.149 -46.428 1.00 39.81 ? 80  PRO C C   1 
ATOM   5519  O  O   . PRO C  1 100 ? 75.796 -18.290 -45.532 1.00 35.67 ? 80  PRO C O   1 
ATOM   5520  C  CB  . PRO C  1 100 ? 78.568 -19.785 -46.867 1.00 36.13 ? 80  PRO C CB  1 
ATOM   5521  C  CG  . PRO C  1 100 ? 78.681 -20.817 -45.807 1.00 35.89 ? 80  PRO C CG  1 
ATOM   5522  C  CD  . PRO C  1 100 ? 78.721 -20.184 -44.480 1.00 36.35 ? 80  PRO C CD  1 
ATOM   5523  N  N   . LYS C  1 101 ? 76.333 -17.660 -47.637 1.00 42.04 ? 81  LYS C N   1 
ATOM   5524  C  CA  . LYS C  1 101 ? 74.933 -17.376 -48.021 1.00 42.51 ? 81  LYS C CA  1 
ATOM   5525  C  C   . LYS C  1 101 ? 74.085 -18.655 -47.830 1.00 42.31 ? 81  LYS C C   1 
ATOM   5526  O  O   . LYS C  1 101 ? 74.568 -19.777 -48.088 1.00 41.75 ? 81  LYS C O   1 
ATOM   5527  C  CB  . LYS C  1 101 ? 74.827 -16.837 -49.477 1.00 43.98 ? 81  LYS C CB  1 
ATOM   5528  C  CG  . LYS C  1 101 ? 75.613 -15.527 -49.712 1.00 46.84 ? 81  LYS C CG  1 
ATOM   5529  C  CD  . LYS C  1 101 ? 75.214 -14.708 -50.981 1.00 45.91 ? 81  LYS C CD  1 
ATOM   5530  C  CE  . LYS C  1 101 ? 76.481 -14.075 -51.702 1.00 46.45 ? 81  LYS C CE  1 
ATOM   5531  N  NZ  . LYS C  1 101 ? 77.691 -13.681 -50.830 1.00 27.53 ? 81  LYS C NZ  1 
ATOM   5532  N  N   . GLY C  1 102 ? 72.845 -18.486 -47.359 1.00 41.04 ? 82  GLY C N   1 
ATOM   5533  C  CA  . GLY C  1 102 ? 71.934 -19.618 -47.124 1.00 41.34 ? 82  GLY C CA  1 
ATOM   5534  C  C   . GLY C  1 102 ? 71.913 -20.095 -45.675 1.00 42.61 ? 82  GLY C C   1 
ATOM   5535  O  O   . GLY C  1 102 ? 70.925 -20.673 -45.229 1.00 43.38 ? 82  GLY C O   1 
ATOM   5536  N  N   . THR C  1 103 ? 73.008 -19.873 -44.947 1.00 42.38 ? 83  THR C N   1 
ATOM   5537  C  CA  . THR C  1 103 ? 73.084 -20.177 -43.519 1.00 40.88 ? 83  THR C CA  1 
ATOM   5538  C  C   . THR C  1 103 ? 71.935 -19.557 -42.713 1.00 41.64 ? 83  THR C C   1 
ATOM   5539  O  O   . THR C  1 103 ? 71.635 -18.372 -42.871 1.00 41.90 ? 83  THR C O   1 
ATOM   5540  C  CB  . THR C  1 103 ? 74.369 -19.632 -42.893 1.00 39.37 ? 83  THR C CB  1 
ATOM   5541  O  OG1 . THR C  1 103 ? 75.479 -19.961 -43.728 1.00 35.62 ? 83  THR C OG1 1 
ATOM   5542  C  CG2 . THR C  1 103 ? 74.548 -20.179 -41.472 1.00 30.99 ? 83  THR C CG2 1 
ATOM   5543  N  N   . ILE C  1 104 ? 71.352 -20.388 -41.837 1.00 41.05 ? 84  ILE C N   1 
ATOM   5544  C  CA  . ILE C  1 104 ? 70.269 -20.040 -40.939 1.00 40.25 ? 84  ILE C CA  1 
ATOM   5545  C  C   . ILE C  1 104 ? 70.844 -19.887 -39.536 1.00 39.09 ? 84  ILE C C   1 
ATOM   5546  O  O   . ILE C  1 104 ? 71.563 -20.745 -39.048 1.00 37.25 ? 84  ILE C O   1 
ATOM   5547  C  CB  . ILE C  1 104 ? 69.175 -21.136 -40.889 1.00 39.37 ? 84  ILE C CB  1 
ATOM   5548  C  CG1 . ILE C  1 104 ? 68.623 -21.451 -42.289 1.00 39.60 ? 84  ILE C CG1 1 
ATOM   5549  C  CG2 . ILE C  1 104 ? 68.053 -20.735 -39.953 1.00 45.12 ? 84  ILE C CG2 1 
ATOM   5550  C  CD1 . ILE C  1 104 ? 67.960 -20.298 -42.986 1.00 36.19 ? 84  ILE C CD1 1 
ATOM   5551  N  N   . VAL C  1 105 ? 70.500 -18.779 -38.897 1.00 38.70 ? 85  VAL C N   1 
ATOM   5552  C  CA  . VAL C  1 105 ? 71.072 -18.424 -37.629 1.00 38.61 ? 85  VAL C CA  1 
ATOM   5553  C  C   . VAL C  1 105 ? 69.978 -17.804 -36.766 1.00 37.70 ? 85  VAL C C   1 
ATOM   5554  O  O   . VAL C  1 105 ? 68.990 -17.322 -37.282 1.00 35.80 ? 85  VAL C O   1 
ATOM   5555  C  CB  . VAL C  1 105 ? 72.242 -17.363 -37.777 1.00 37.93 ? 85  VAL C CB  1 
ATOM   5556  C  CG1 . VAL C  1 105 ? 73.350 -17.863 -38.667 1.00 39.73 ? 85  VAL C CG1 1 
ATOM   5557  C  CG2 . VAL C  1 105 ? 71.710 -16.008 -38.305 1.00 41.67 ? 85  VAL C CG2 1 
ATOM   5558  N  N   . LEU C  1 106 ? 70.189 -17.845 -35.458 1.00 39.26 ? 86  LEU C N   1 
ATOM   5559  C  CA  . LEU C  1 106 ? 69.522 -16.975 -34.517 1.00 41.48 ? 86  LEU C CA  1 
ATOM   5560  C  C   . LEU C  1 106 ? 70.260 -15.656 -34.351 1.00 41.16 ? 86  LEU C C   1 
ATOM   5561  O  O   . LEU C  1 106 ? 71.470 -15.637 -34.186 1.00 40.79 ? 86  LEU C O   1 
ATOM   5562  C  CB  . LEU C  1 106 ? 69.467 -17.629 -33.152 1.00 41.57 ? 86  LEU C CB  1 
ATOM   5563  C  CG  . LEU C  1 106 ? 68.508 -18.785 -33.080 1.00 47.35 ? 86  LEU C CG  1 
ATOM   5564  C  CD1 . LEU C  1 106 ? 68.548 -19.298 -31.680 1.00 51.41 ? 86  LEU C CD1 1 
ATOM   5565  C  CD2 . LEU C  1 106 ? 67.085 -18.346 -33.485 1.00 52.75 ? 86  LEU C CD2 1 
ATOM   5566  N  N   . ALA C  1 107 ? 69.500 -14.566 -34.350 1.00 41.81 ? 87  ALA C N   1 
ATOM   5567  C  CA  . ALA C  1 107 ? 70.064 -13.239 -34.143 1.00 41.67 ? 87  ALA C CA  1 
ATOM   5568  C  C   . ALA C  1 107 ? 69.099 -12.343 -33.336 1.00 42.49 ? 87  ALA C C   1 
ATOM   5569  O  O   . ALA C  1 107 ? 67.881 -12.491 -33.390 1.00 38.54 ? 87  ALA C O   1 
ATOM   5570  C  CB  . ALA C  1 107 ? 70.433 -12.599 -35.501 1.00 41.08 ? 87  ALA C CB  1 
ATOM   5571  N  N   . SER C  1 108 ? 69.658 -11.402 -32.586 1.00 45.39 ? 88  SER C N   1 
ATOM   5572  C  CA  . SER C  1 108 ? 68.844 -10.462 -31.819 1.00 45.85 ? 88  SER C CA  1 
ATOM   5573  C  C   . SER C  1 108 ? 69.077 -8.993  -32.209 1.00 43.31 ? 88  SER C C   1 
ATOM   5574  O  O   . SER C  1 108 ? 69.395 -8.196  -31.353 1.00 44.32 ? 88  SER C O   1 
ATOM   5575  C  CB  . SER C  1 108 ? 69.136 -10.672 -30.313 1.00 46.19 ? 88  SER C CB  1 
ATOM   5576  O  OG  . SER C  1 108 ? 68.952 -12.033 -29.960 1.00 48.97 ? 88  SER C OG  1 
ATOM   5577  N  N   . PRO C  1 109 ? 68.895 -8.629  -33.487 1.00 43.23 ? 89  PRO C N   1 
ATOM   5578  C  CA  . PRO C  1 109 ? 69.060 -7.227  -33.881 1.00 44.12 ? 89  PRO C CA  1 
ATOM   5579  C  C   . PRO C  1 109 ? 67.858 -6.323  -33.565 1.00 46.62 ? 89  PRO C C   1 
ATOM   5580  O  O   . PRO C  1 109 ? 67.874 -5.126  -33.878 1.00 48.56 ? 89  PRO C O   1 
ATOM   5581  C  CB  . PRO C  1 109 ? 69.225 -7.325  -35.386 1.00 42.32 ? 89  PRO C CB  1 
ATOM   5582  C  CG  . PRO C  1 109 ? 68.390 -8.455  -35.766 1.00 43.92 ? 89  PRO C CG  1 
ATOM   5583  C  CD  . PRO C  1 109 ? 68.533 -9.460  -34.645 1.00 44.93 ? 89  PRO C CD  1 
ATOM   5584  N  N   . GLY C  1 110 ? 66.828 -6.892  -32.951 1.00 47.11 ? 90  GLY C N   1 
ATOM   5585  C  CA  . GLY C  1 110 ? 65.588 -6.194  -32.720 1.00 44.95 ? 90  GLY C CA  1 
ATOM   5586  C  C   . GLY C  1 110 ? 64.543 -6.438  -33.783 1.00 43.45 ? 90  GLY C C   1 
ATOM   5587  O  O   . GLY C  1 110 ? 64.679 -7.313  -34.633 1.00 42.21 ? 90  GLY C O   1 
ATOM   5588  N  N   . TRP C  1 111 ? 63.487 -5.629  -33.737 1.00 43.49 ? 91  TRP C N   1 
ATOM   5589  C  CA  . TRP C  1 111 ? 62.387 -5.711  -34.703 1.00 41.69 ? 91  TRP C CA  1 
ATOM   5590  C  C   . TRP C  1 111 ? 62.775 -5.052  -36.006 1.00 41.72 ? 91  TRP C C   1 
ATOM   5591  O  O   . TRP C  1 111 ? 62.433 -3.895  -36.244 1.00 40.15 ? 91  TRP C O   1 
ATOM   5592  C  CB  . TRP C  1 111 ? 61.136 -5.018  -34.173 1.00 41.68 ? 91  TRP C CB  1 
ATOM   5593  C  CG  . TRP C  1 111 ? 60.547 -5.617  -32.937 1.00 43.45 ? 91  TRP C CG  1 
ATOM   5594  C  CD1 . TRP C  1 111 ? 61.134 -6.508  -32.083 1.00 40.08 ? 91  TRP C CD1 1 
ATOM   5595  C  CD2 . TRP C  1 111 ? 59.251 -5.335  -32.406 1.00 36.41 ? 91  TRP C CD2 1 
ATOM   5596  N  NE1 . TRP C  1 111 ? 60.277 -6.799  -31.067 1.00 37.80 ? 91  TRP C NE1 1 
ATOM   5597  C  CE2 . TRP C  1 111 ? 59.114 -6.093  -31.234 1.00 41.29 ? 91  TRP C CE2 1 
ATOM   5598  C  CE3 . TRP C  1 111 ? 58.180 -4.524  -32.823 1.00 42.69 ? 91  TRP C CE3 1 
ATOM   5599  C  CZ2 . TRP C  1 111 ? 57.942 -6.071  -30.460 1.00 37.37 ? 91  TRP C CZ2 1 
ATOM   5600  C  CZ3 . TRP C  1 111 ? 57.024 -4.501  -32.060 1.00 40.24 ? 91  TRP C CZ3 1 
ATOM   5601  C  CH2 . TRP C  1 111 ? 56.921 -5.276  -30.897 1.00 43.95 ? 91  TRP C CH2 1 
ATOM   5602  N  N   . THR C  1 112 ? 63.457 -5.817  -36.859 1.00 43.03 ? 92  THR C N   1 
ATOM   5603  C  CA  . THR C  1 112 ? 63.982 -5.322  -38.119 1.00 42.21 ? 92  THR C CA  1 
ATOM   5604  C  C   . THR C  1 112 ? 64.040 -6.453  -39.135 1.00 41.74 ? 92  THR C C   1 
ATOM   5605  O  O   . THR C  1 112 ? 64.267 -7.619  -38.783 1.00 41.25 ? 92  THR C O   1 
ATOM   5606  C  CB  . THR C  1 112 ? 65.366 -4.601  -37.916 1.00 43.01 ? 92  THR C CB  1 
ATOM   5607  O  OG1 . THR C  1 112 ? 65.725 -3.923  -39.129 1.00 44.69 ? 92  THR C OG1 1 
ATOM   5608  C  CG2 . THR C  1 112 ? 66.466 -5.573  -37.509 1.00 44.72 ? 92  THR C CG2 1 
ATOM   5609  N  N   . THR C  1 113 ? 63.774 -6.098  -40.389 1.00 40.59 ? 93  THR C N   1 
ATOM   5610  C  CA  . THR C  1 113 ? 63.749 -7.051  -41.480 1.00 41.53 ? 93  THR C CA  1 
ATOM   5611  C  C   . THR C  1 113 ? 65.134 -7.475  -41.981 1.00 43.15 ? 93  THR C C   1 
ATOM   5612  O  O   . THR C  1 113 ? 65.296 -8.567  -42.564 1.00 43.22 ? 93  THR C O   1 
ATOM   5613  C  CB  . THR C  1 113 ? 63.003 -6.467  -42.704 1.00 42.95 ? 93  THR C CB  1 
ATOM   5614  O  OG1 . THR C  1 113 ? 63.649 -5.260  -43.145 1.00 41.14 ? 93  THR C OG1 1 
ATOM   5615  C  CG2 . THR C  1 113 ? 61.550 -6.230  -42.369 1.00 37.33 ? 93  THR C CG2 1 
ATOM   5616  N  N   . HIS C  1 114 ? 66.106 -6.576  -41.815 1.00 43.28 ? 94  HIS C N   1 
ATOM   5617  C  CA  . HIS C  1 114 ? 67.455 -6.773  -42.306 1.00 42.78 ? 94  HIS C CA  1 
ATOM   5618  C  C   . HIS C  1 114 ? 68.450 -6.168  -41.316 1.00 42.97 ? 94  HIS C C   1 
ATOM   5619  O  O   . HIS C  1 114 ? 68.183 -5.147  -40.688 1.00 43.35 ? 94  HIS C O   1 
ATOM   5620  C  CB  . HIS C  1 114 ? 67.622 -6.167  -43.705 1.00 42.41 ? 94  HIS C CB  1 
ATOM   5621  C  CG  . HIS C  1 114 ? 66.776 -6.813  -44.763 1.00 40.96 ? 94  HIS C CG  1 
ATOM   5622  N  ND1 . HIS C  1 114 ? 65.413 -6.626  -44.853 1.00 46.67 ? 94  HIS C ND1 1 
ATOM   5623  C  CD2 . HIS C  1 114 ? 67.110 -7.617  -45.802 1.00 47.63 ? 94  HIS C CD2 1 
ATOM   5624  C  CE1 . HIS C  1 114 ? 64.939 -7.297  -45.888 1.00 43.61 ? 94  HIS C CE1 1 
ATOM   5625  N  NE2 . HIS C  1 114 ? 65.950 -7.907  -46.481 1.00 48.27 ? 94  HIS C NE2 1 
ATOM   5626  N  N   . SER C  1 115 ? 69.584 -6.839  -41.151 1.00 44.47 ? 95  SER C N   1 
ATOM   5627  C  CA  . SER C  1 115 ? 70.582 -6.425  -40.175 1.00 45.39 ? 95  SER C CA  1 
ATOM   5628  C  C   . SER C  1 115 ? 71.982 -6.903  -40.571 1.00 45.26 ? 95  SER C C   1 
ATOM   5629  O  O   . SER C  1 115 ? 72.155 -7.967  -41.179 1.00 45.76 ? 95  SER C O   1 
ATOM   5630  C  CB  . SER C  1 115 ? 70.204 -6.906  -38.767 1.00 43.48 ? 95  SER C CB  1 
ATOM   5631  O  OG  . SER C  1 115 ? 70.736 -8.188  -38.482 1.00 49.50 ? 95  SER C OG  1 
ATOM   5632  N  N   . ILE C  1 116 ? 72.976 -6.091  -40.245 1.00 44.67 ? 96  ILE C N   1 
ATOM   5633  C  CA  . ILE C  1 116 ? 74.348 -6.452  -40.499 1.00 44.86 ? 96  ILE C CA  1 
ATOM   5634  C  C   . ILE C  1 116 ? 74.936 -6.973  -39.191 1.00 47.25 ? 96  ILE C C   1 
ATOM   5635  O  O   . ILE C  1 116 ? 74.640 -6.455  -38.105 1.00 49.01 ? 96  ILE C O   1 
ATOM   5636  C  CB  . ILE C  1 116 ? 75.165 -5.283  -41.092 1.00 45.37 ? 96  ILE C CB  1 
ATOM   5637  C  CG1 . ILE C  1 116 ? 74.636 -4.936  -42.493 1.00 40.91 ? 96  ILE C CG1 1 
ATOM   5638  C  CG2 . ILE C  1 116 ? 76.678 -5.665  -41.173 1.00 49.35 ? 96  ILE C CG2 1 
ATOM   5639  C  CD1 . ILE C  1 116 ? 75.180 -3.640  -43.040 1.00 43.57 ? 96  ILE C CD1 1 
ATOM   5640  N  N   . SER C  1 117 ? 75.733 -8.030  -39.312 1.00 47.87 ? 97  SER C N   1 
ATOM   5641  C  CA  . SER C  1 117 ? 76.300 -8.707  -38.163 1.00 48.54 ? 97  SER C CA  1 
ATOM   5642  C  C   . SER C  1 117 ? 77.779 -9.019  -38.443 1.00 46.90 ? 97  SER C C   1 
ATOM   5643  O  O   . SER C  1 117 ? 78.156 -9.324  -39.558 1.00 41.06 ? 97  SER C O   1 
ATOM   5644  C  CB  . SER C  1 117 ? 75.505 -9.982  -37.844 1.00 49.14 ? 97  SER C CB  1 
ATOM   5645  O  OG  . SER C  1 117 ? 76.059 -10.663 -36.732 1.00 52.34 ? 97  SER C OG  1 
ATOM   5646  N  N   . ASP C  1 118 ? 78.592 -8.905  -37.405 1.00 48.58 ? 98  ASP C N   1 
ATOM   5647  C  CA  . ASP C  1 118 ? 80.015 -9.203  -37.460 1.00 51.43 ? 98  ASP C CA  1 
ATOM   5648  C  C   . ASP C  1 118 ? 80.303 -10.690 -37.190 1.00 52.10 ? 98  ASP C C   1 
ATOM   5649  O  O   . ASP C  1 118 ? 81.474 -11.123 -37.169 1.00 53.38 ? 98  ASP C O   1 
ATOM   5650  C  CB  . ASP C  1 118 ? 80.769 -8.313  -36.458 1.00 53.15 ? 98  ASP C CB  1 
ATOM   5651  C  CG  . ASP C  1 118 ? 80.503 -8.682  -34.986 1.00 57.37 ? 98  ASP C CG  1 
ATOM   5652  O  OD1 . ASP C  1 118 ? 79.455 -9.298  -34.642 1.00 63.40 ? 98  ASP C OD1 1 
ATOM   5653  O  OD2 . ASP C  1 118 ? 81.369 -8.327  -34.154 1.00 69.42 ? 98  ASP C OD2 1 
ATOM   5654  N  N   . GLY C  1 119 ? 79.229 -11.450 -36.972 1.00 53.13 ? 99  GLY C N   1 
ATOM   5655  C  CA  . GLY C  1 119 ? 79.299 -12.881 -36.793 1.00 53.21 ? 99  GLY C CA  1 
ATOM   5656  C  C   . GLY C  1 119 ? 79.242 -13.309 -35.343 1.00 54.70 ? 99  GLY C C   1 
ATOM   5657  O  O   . GLY C  1 119 ? 78.819 -14.418 -35.059 1.00 57.73 ? 99  GLY C O   1 
ATOM   5658  N  N   . LYS C  1 120 ? 79.649 -12.467 -34.399 1.00 55.89 ? 100 LYS C N   1 
ATOM   5659  C  CA  . LYS C  1 120 ? 79.877 -12.998 -33.050 1.00 56.55 ? 100 LYS C CA  1 
ATOM   5660  C  C   . LYS C  1 120 ? 78.727 -12.818 -32.076 1.00 55.46 ? 100 LYS C C   1 
ATOM   5661  O  O   . LYS C  1 120 ? 78.849 -13.156 -30.929 1.00 57.40 ? 100 LYS C O   1 
ATOM   5662  C  CB  . LYS C  1 120 ? 81.259 -12.599 -32.468 1.00 58.18 ? 100 LYS C CB  1 
ATOM   5663  C  CG  . LYS C  1 120 ? 81.738 -11.159 -32.633 1.00 57.21 ? 100 LYS C CG  1 
ATOM   5664  C  CD  . LYS C  1 120 ? 83.275 -11.117 -32.803 1.00 56.80 ? 100 LYS C CD  1 
ATOM   5665  C  CE  . LYS C  1 120 ? 83.745 -11.440 -34.236 1.00 52.44 ? 100 LYS C CE  1 
ATOM   5666  N  NZ  . LYS C  1 120 ? 85.232 -11.647 -34.292 1.00 55.13 ? 100 LYS C NZ  1 
ATOM   5667  N  N   . ASP C  1 121 ? 77.593 -12.340 -32.560 1.00 56.52 ? 101 ASP C N   1 
ATOM   5668  C  CA  . ASP C  1 121 ? 76.366 -12.202 -31.765 1.00 57.82 ? 101 ASP C CA  1 
ATOM   5669  C  C   . ASP C  1 121 ? 75.278 -13.175 -32.257 1.00 56.16 ? 101 ASP C C   1 
ATOM   5670  O  O   . ASP C  1 121 ? 74.076 -12.971 -32.013 1.00 55.19 ? 101 ASP C O   1 
ATOM   5671  C  CB  . ASP C  1 121 ? 75.848 -10.750 -31.869 1.00 60.70 ? 101 ASP C CB  1 
ATOM   5672  C  CG  . ASP C  1 121 ? 75.784 -10.237 -33.332 1.00 63.84 ? 101 ASP C CG  1 
ATOM   5673  O  OD1 . ASP C  1 121 ? 76.829 -10.255 -34.013 1.00 64.64 ? 101 ASP C OD1 1 
ATOM   5674  O  OD2 . ASP C  1 121 ? 74.697 -9.815  -33.795 1.00 78.97 ? 101 ASP C OD2 1 
ATOM   5675  N  N   . LEU C  1 122 ? 75.709 -14.202 -32.985 1.00 53.86 ? 102 LEU C N   1 
ATOM   5676  C  CA  . LEU C  1 122 ? 74.814 -15.097 -33.710 1.00 53.22 ? 102 LEU C CA  1 
ATOM   5677  C  C   . LEU C  1 122 ? 74.971 -16.519 -33.214 1.00 52.56 ? 102 LEU C C   1 
ATOM   5678  O  O   . LEU C  1 122 ? 75.982 -16.880 -32.655 1.00 53.98 ? 102 LEU C O   1 
ATOM   5679  C  CB  . LEU C  1 122 ? 75.137 -15.114 -35.208 1.00 52.03 ? 102 LEU C CB  1 
ATOM   5680  C  CG  . LEU C  1 122 ? 75.218 -13.810 -35.980 1.00 50.30 ? 102 LEU C CG  1 
ATOM   5681  C  CD1 . LEU C  1 122 ? 75.514 -14.131 -37.407 1.00 41.46 ? 102 LEU C CD1 1 
ATOM   5682  C  CD2 . LEU C  1 122 ? 73.915 -12.983 -35.844 1.00 59.45 ? 102 LEU C CD2 1 
ATOM   5683  N  N   . GLU C  1 123 ? 73.975 -17.333 -33.495 1.00 51.31 ? 103 GLU C N   1 
ATOM   5684  C  CA  . GLU C  1 123 ? 73.972 -18.698 -33.094 1.00 50.32 ? 103 GLU C CA  1 
ATOM   5685  C  C   . GLU C  1 123 ? 73.473 -19.517 -34.274 1.00 48.86 ? 103 GLU C C   1 
ATOM   5686  O  O   . GLU C  1 123 ? 72.353 -19.365 -34.724 1.00 47.53 ? 103 GLU C O   1 
ATOM   5687  C  CB  . GLU C  1 123 ? 73.045 -18.811 -31.910 1.00 47.44 ? 103 GLU C CB  1 
ATOM   5688  C  CG  . GLU C  1 123 ? 73.188 -20.018 -31.025 1.00 54.38 ? 103 GLU C CG  1 
ATOM   5689  C  CD  . GLU C  1 123 ? 71.977 -20.150 -30.067 1.00 58.03 ? 103 GLU C CD  1 
ATOM   5690  O  OE1 . GLU C  1 123 ? 71.501 -19.099 -29.524 1.00 59.21 ? 103 GLU C OE1 1 
ATOM   5691  O  OE2 . GLU C  1 123 ? 71.494 -21.301 -29.873 1.00 64.46 ? 103 GLU C OE2 1 
ATOM   5692  N  N   . LYS C  1 124 ? 74.326 -20.377 -34.807 1.00 52.05 ? 104 LYS C N   1 
ATOM   5693  C  CA  . LYS C  1 124 ? 73.847 -21.425 -35.692 1.00 51.10 ? 104 LYS C CA  1 
ATOM   5694  C  C   . LYS C  1 124 ? 72.917 -22.333 -34.891 1.00 51.19 ? 104 LYS C C   1 
ATOM   5695  O  O   . LYS C  1 124 ? 73.013 -22.436 -33.659 1.00 49.29 ? 104 LYS C O   1 
ATOM   5696  C  CB  . LYS C  1 124 ? 75.001 -22.239 -36.289 1.00 50.87 ? 104 LYS C CB  1 
ATOM   5697  C  CG  . LYS C  1 124 ? 75.724 -21.571 -37.451 1.00 52.74 ? 104 LYS C CG  1 
ATOM   5698  C  CD  . LYS C  1 124 ? 77.048 -22.310 -37.792 1.00 49.90 ? 104 LYS C CD  1 
ATOM   5699  C  CE  . LYS C  1 124 ? 77.863 -21.545 -38.829 1.00 53.49 ? 104 LYS C CE  1 
ATOM   5700  N  NZ  . LYS C  1 124 ? 79.285 -22.001 -38.983 1.00 41.21 ? 104 LYS C NZ  1 
ATOM   5701  N  N   . LEU C  1 125 ? 72.009 -22.981 -35.609 1.00 54.48 ? 105 LEU C N   1 
ATOM   5702  C  CA  . LEU C  1 125 ? 71.117 -23.956 -35.015 1.00 55.41 ? 105 LEU C CA  1 
ATOM   5703  C  C   . LEU C  1 125 ? 71.869 -25.240 -34.709 1.00 54.47 ? 105 LEU C C   1 
ATOM   5704  O  O   . LEU C  1 125 ? 72.969 -25.498 -35.235 1.00 55.55 ? 105 LEU C O   1 
ATOM   5705  C  CB  . LEU C  1 125 ? 69.934 -24.263 -35.939 1.00 57.23 ? 105 LEU C CB  1 
ATOM   5706  C  CG  . LEU C  1 125 ? 69.176 -23.090 -36.563 1.00 59.02 ? 105 LEU C CG  1 
ATOM   5707  C  CD1 . LEU C  1 125 ? 67.996 -23.642 -37.327 1.00 63.17 ? 105 LEU C CD1 1 
ATOM   5708  C  CD2 . LEU C  1 125 ? 68.726 -22.075 -35.541 1.00 60.61 ? 105 LEU C CD2 1 
ATOM   5709  N  N   . LEU C  1 126 ? 71.264 -26.032 -33.834 1.00 53.83 ? 106 LEU C N   1 
ATOM   5710  C  CA  . LEU C  1 126 ? 71.753 -27.362 -33.513 1.00 53.46 ? 106 LEU C CA  1 
ATOM   5711  C  C   . LEU C  1 126 ? 72.107 -28.146 -34.776 1.00 53.16 ? 106 LEU C C   1 
ATOM   5712  O  O   . LEU C  1 126 ? 71.363 -28.128 -35.757 1.00 52.21 ? 106 LEU C O   1 
ATOM   5713  C  CB  . LEU C  1 126 ? 70.680 -28.105 -32.731 1.00 53.87 ? 106 LEU C CB  1 
ATOM   5714  C  CG  . LEU C  1 126 ? 70.492 -27.616 -31.294 1.00 53.78 ? 106 LEU C CG  1 
ATOM   5715  C  CD1 . LEU C  1 126 ? 69.123 -28.046 -30.794 1.00 60.52 ? 106 LEU C CD1 1 
ATOM   5716  C  CD2 . LEU C  1 126 ? 71.580 -28.136 -30.379 1.00 50.32 ? 106 LEU C CD2 1 
ATOM   5717  N  N   . THR C  1 127 ? 73.248 -28.826 -34.748 1.00 53.36 ? 107 THR C N   1 
ATOM   5718  C  CA  . THR C  1 127 ? 73.711 -29.587 -35.898 1.00 54.99 ? 107 THR C CA  1 
ATOM   5719  C  C   . THR C  1 127 ? 72.709 -30.660 -36.328 1.00 55.99 ? 107 THR C C   1 
ATOM   5720  O  O   . THR C  1 127 ? 72.487 -30.880 -37.527 1.00 56.15 ? 107 THR C O   1 
ATOM   5721  C  CB  . THR C  1 127 ? 75.070 -30.267 -35.624 1.00 54.33 ? 107 THR C CB  1 
ATOM   5722  O  OG1 . THR C  1 127 ? 75.927 -29.338 -34.971 1.00 52.09 ? 107 THR C OG1 1 
ATOM   5723  C  CG2 . THR C  1 127 ? 75.733 -30.718 -36.936 1.00 53.83 ? 107 THR C CG2 1 
ATOM   5724  N  N   . GLU C  1 128 ? 72.105 -31.313 -35.344 1.00 55.51 ? 108 GLU C N   1 
ATOM   5725  C  CA  . GLU C  1 128 ? 71.195 -32.423 -35.592 1.00 55.72 ? 108 GLU C CA  1 
ATOM   5726  C  C   . GLU C  1 128 ? 69.757 -31.958 -35.894 1.00 55.11 ? 108 GLU C C   1 
ATOM   5727  O  O   . GLU C  1 128 ? 68.829 -32.771 -35.813 1.00 54.28 ? 108 GLU C O   1 
ATOM   5728  C  CB  . GLU C  1 128 ? 71.202 -33.355 -34.373 1.00 56.27 ? 108 GLU C CB  1 
ATOM   5729  C  CG  . GLU C  1 128 ? 70.810 -32.650 -33.031 1.00 62.87 ? 108 GLU C CG  1 
ATOM   5730  C  CD  . GLU C  1 128 ? 72.008 -32.215 -32.157 1.00 65.21 ? 108 GLU C CD  1 
ATOM   5731  O  OE1 . GLU C  1 128 ? 72.298 -32.942 -31.173 1.00 68.96 ? 108 GLU C OE1 1 
ATOM   5732  O  OE2 . GLU C  1 128 ? 72.642 -31.161 -32.437 1.00 52.44 ? 108 GLU C OE2 1 
ATOM   5733  N  N   . TRP C  1 129 ? 69.576 -30.677 -36.255 1.00 53.96 ? 109 TRP C N   1 
ATOM   5734  C  CA  . TRP C  1 129 ? 68.243 -30.061 -36.339 1.00 54.33 ? 109 TRP C CA  1 
ATOM   5735  C  C   . TRP C  1 129 ? 67.497 -30.545 -37.566 1.00 54.59 ? 109 TRP C C   1 
ATOM   5736  O  O   . TRP C  1 129 ? 67.944 -30.288 -38.680 1.00 55.81 ? 109 TRP C O   1 
ATOM   5737  C  CB  . TRP C  1 129 ? 68.343 -28.528 -36.376 1.00 53.45 ? 109 TRP C CB  1 
ATOM   5738  C  CG  . TRP C  1 129 ? 67.015 -27.824 -36.424 1.00 51.70 ? 109 TRP C CG  1 
ATOM   5739  C  CD1 . TRP C  1 129 ? 66.227 -27.625 -37.528 1.00 49.86 ? 109 TRP C CD1 1 
ATOM   5740  C  CD2 . TRP C  1 129 ? 66.318 -27.223 -35.320 1.00 51.34 ? 109 TRP C CD2 1 
ATOM   5741  N  NE1 . TRP C  1 129 ? 65.093 -26.931 -37.181 1.00 47.77 ? 109 TRP C NE1 1 
ATOM   5742  C  CE2 . TRP C  1 129 ? 65.119 -26.668 -35.836 1.00 51.91 ? 109 TRP C CE2 1 
ATOM   5743  C  CE3 . TRP C  1 129 ? 66.595 -27.085 -33.946 1.00 49.56 ? 109 TRP C CE3 1 
ATOM   5744  C  CZ2 . TRP C  1 129 ? 64.181 -25.988 -35.015 1.00 51.30 ? 109 TRP C CZ2 1 
ATOM   5745  C  CZ3 . TRP C  1 129 ? 65.675 -26.414 -33.144 1.00 50.93 ? 109 TRP C CZ3 1 
ATOM   5746  C  CH2 . TRP C  1 129 ? 64.473 -25.882 -33.682 1.00 49.56 ? 109 TRP C CH2 1 
ATOM   5747  N  N   . PRO C  1 130 ? 66.339 -31.213 -37.377 1.00 55.82 ? 110 PRO C N   1 
ATOM   5748  C  CA  . PRO C  1 130 ? 65.693 -31.868 -38.529 1.00 56.30 ? 110 PRO C CA  1 
ATOM   5749  C  C   . PRO C  1 130 ? 64.810 -30.933 -39.385 1.00 57.42 ? 110 PRO C C   1 
ATOM   5750  O  O   . PRO C  1 130 ? 64.305 -29.909 -38.895 1.00 57.06 ? 110 PRO C O   1 
ATOM   5751  C  CB  . PRO C  1 130 ? 64.849 -32.964 -37.867 1.00 55.76 ? 110 PRO C CB  1 
ATOM   5752  C  CG  . PRO C  1 130 ? 64.522 -32.421 -36.478 1.00 55.97 ? 110 PRO C CG  1 
ATOM   5753  C  CD  . PRO C  1 130 ? 65.556 -31.377 -36.132 1.00 54.75 ? 110 PRO C CD  1 
ATOM   5754  N  N   . ASP C  1 131 ? 64.628 -31.300 -40.657 1.00 58.95 ? 111 ASP C N   1 
ATOM   5755  C  CA  . ASP C  1 131 ? 63.696 -30.593 -41.562 1.00 58.69 ? 111 ASP C CA  1 
ATOM   5756  C  C   . ASP C  1 131 ? 62.210 -30.901 -41.234 1.00 59.41 ? 111 ASP C C   1 
ATOM   5757  O  O   . ASP C  1 131 ? 61.308 -30.241 -41.752 1.00 59.44 ? 111 ASP C O   1 
ATOM   5758  C  CB  . ASP C  1 131 ? 64.005 -30.936 -43.029 1.00 58.86 ? 111 ASP C CB  1 
ATOM   5759  N  N   . THR C  1 132 ? 61.965 -31.890 -40.372 1.00 58.18 ? 112 THR C N   1 
ATOM   5760  C  CA  . THR C  1 132 ? 60.613 -32.319 -40.041 1.00 57.94 ? 112 THR C CA  1 
ATOM   5761  C  C   . THR C  1 132 ? 59.919 -31.419 -38.998 1.00 58.14 ? 112 THR C C   1 
ATOM   5762  O  O   . THR C  1 132 ? 58.700 -31.478 -38.841 1.00 58.07 ? 112 THR C O   1 
ATOM   5763  C  CB  . THR C  1 132 ? 60.621 -33.764 -39.532 1.00 57.52 ? 112 THR C CB  1 
ATOM   5764  O  OG1 . THR C  1 132 ? 61.300 -33.824 -38.279 1.00 60.58 ? 112 THR C OG1 1 
ATOM   5765  C  CG2 . THR C  1 132 ? 61.324 -34.678 -40.522 1.00 57.33 ? 112 THR C CG2 1 
ATOM   5766  N  N   . ILE C  1 133 ? 60.694 -30.603 -38.276 1.00 56.76 ? 113 ILE C N   1 
ATOM   5767  C  CA  . ILE C  1 133 ? 60.125 -29.559 -37.420 1.00 53.53 ? 113 ILE C CA  1 
ATOM   5768  C  C   . ILE C  1 133 ? 60.314 -28.152 -38.036 1.00 51.67 ? 113 ILE C C   1 
ATOM   5769  O  O   . ILE C  1 133 ? 61.293 -27.901 -38.764 1.00 51.92 ? 113 ILE C O   1 
ATOM   5770  C  CB  . ILE C  1 133 ? 60.695 -29.578 -35.954 1.00 52.97 ? 113 ILE C CB  1 
ATOM   5771  C  CG1 . ILE C  1 133 ? 62.194 -29.263 -35.920 1.00 54.42 ? 113 ILE C CG1 1 
ATOM   5772  C  CG2 . ILE C  1 133 ? 60.400 -30.897 -35.243 1.00 50.66 ? 113 ILE C CG2 1 
ATOM   5773  C  CD1 . ILE C  1 133 ? 62.733 -29.139 -34.496 1.00 56.97 ? 113 ILE C CD1 1 
ATOM   5774  N  N   . PRO C  1 134 ? 59.380 -27.228 -37.725 1.00 48.43 ? 114 PRO C N   1 
ATOM   5775  C  CA  . PRO C  1 134 ? 59.496 -25.844 -38.176 1.00 48.45 ? 114 PRO C CA  1 
ATOM   5776  C  C   . PRO C  1 134 ? 60.667 -25.075 -37.518 1.00 48.77 ? 114 PRO C C   1 
ATOM   5777  O  O   . PRO C  1 134 ? 61.037 -25.339 -36.356 1.00 46.55 ? 114 PRO C O   1 
ATOM   5778  C  CB  . PRO C  1 134 ? 58.136 -25.217 -37.811 1.00 46.42 ? 114 PRO C CB  1 
ATOM   5779  C  CG  . PRO C  1 134 ? 57.482 -26.153 -36.876 1.00 46.64 ? 114 PRO C CG  1 
ATOM   5780  C  CD  . PRO C  1 134 ? 58.158 -27.468 -36.926 1.00 47.08 ? 114 PRO C CD  1 
ATOM   5781  N  N   . LEU C  1 135 ? 61.221 -24.129 -38.278 1.00 49.01 ? 115 LEU C N   1 
ATOM   5782  C  CA  . LEU C  1 135 ? 62.417 -23.393 -37.886 1.00 50.37 ? 115 LEU C CA  1 
ATOM   5783  C  C   . LEU C  1 135 ? 62.126 -22.497 -36.718 1.00 49.13 ? 115 LEU C C   1 
ATOM   5784  O  O   . LEU C  1 135 ? 63.012 -22.232 -35.887 1.00 47.60 ? 115 LEU C O   1 
ATOM   5785  C  CB  . LEU C  1 135 ? 62.924 -22.510 -39.042 1.00 52.61 ? 115 LEU C CB  1 
ATOM   5786  C  CG  . LEU C  1 135 ? 63.731 -23.172 -40.149 1.00 55.43 ? 115 LEU C CG  1 
ATOM   5787  C  CD1 . LEU C  1 135 ? 64.011 -22.140 -41.251 1.00 58.24 ? 115 LEU C CD1 1 
ATOM   5788  C  CD2 . LEU C  1 135 ? 65.032 -23.787 -39.604 1.00 56.07 ? 115 LEU C CD2 1 
ATOM   5789  N  N   . SER C  1 136 ? 60.885 -22.005 -36.685 1.00 48.54 ? 116 SER C N   1 
ATOM   5790  C  CA  . SER C  1 136 ? 60.417 -21.089 -35.626 1.00 47.65 ? 116 SER C CA  1 
ATOM   5791  C  C   . SER C  1 136 ? 60.391 -21.722 -34.220 1.00 45.19 ? 116 SER C C   1 
ATOM   5792  O  O   . SER C  1 136 ? 60.248 -21.001 -33.228 1.00 42.80 ? 116 SER C O   1 
ATOM   5793  C  CB  . SER C  1 136 ? 59.049 -20.485 -36.003 1.00 48.26 ? 116 SER C CB  1 
ATOM   5794  O  OG  . SER C  1 136 ? 58.215 -21.449 -36.641 1.00 44.43 ? 116 SER C OG  1 
ATOM   5795  N  N   . LEU C  1 137 ? 60.533 -23.050 -34.138 1.00 43.24 ? 117 LEU C N   1 
ATOM   5796  C  CA  . LEU C  1 137 ? 60.721 -23.725 -32.839 1.00 45.08 ? 117 LEU C CA  1 
ATOM   5797  C  C   . LEU C  1 137 ? 61.959 -23.300 -32.110 1.00 42.62 ? 117 LEU C C   1 
ATOM   5798  O  O   . LEU C  1 137 ? 62.034 -23.460 -30.902 1.00 42.47 ? 117 LEU C O   1 
ATOM   5799  C  CB  . LEU C  1 137 ? 60.780 -25.256 -32.983 1.00 47.55 ? 117 LEU C CB  1 
ATOM   5800  C  CG  . LEU C  1 137 ? 59.467 -26.012 -33.191 1.00 48.25 ? 117 LEU C CG  1 
ATOM   5801  C  CD1 . LEU C  1 137 ? 59.627 -27.394 -32.605 1.00 47.94 ? 117 LEU C CD1 1 
ATOM   5802  C  CD2 . LEU C  1 137 ? 58.297 -25.297 -32.541 1.00 48.47 ? 117 LEU C CD2 1 
ATOM   5803  N  N   . ALA C  1 138 ? 62.936 -22.787 -32.848 1.00 42.38 ? 118 ALA C N   1 
ATOM   5804  C  CA  . ALA C  1 138 ? 64.169 -22.289 -32.263 1.00 43.44 ? 118 ALA C CA  1 
ATOM   5805  C  C   . ALA C  1 138 ? 63.965 -20.958 -31.493 1.00 42.16 ? 118 ALA C C   1 
ATOM   5806  O  O   . ALA C  1 138 ? 64.840 -20.516 -30.748 1.00 42.19 ? 118 ALA C O   1 
ATOM   5807  C  CB  . ALA C  1 138 ? 65.256 -22.141 -33.370 1.00 42.82 ? 118 ALA C CB  1 
ATOM   5808  N  N   . LEU C  1 139 ? 62.812 -20.327 -31.689 1.00 43.45 ? 119 LEU C N   1 
ATOM   5809  C  CA  . LEU C  1 139 ? 62.412 -19.120 -30.943 1.00 42.39 ? 119 LEU C CA  1 
ATOM   5810  C  C   . LEU C  1 139 ? 61.436 -19.422 -29.811 1.00 45.01 ? 119 LEU C C   1 
ATOM   5811  O  O   . LEU C  1 139 ? 61.003 -18.490 -29.095 1.00 47.00 ? 119 LEU C O   1 
ATOM   5812  C  CB  . LEU C  1 139 ? 61.740 -18.128 -31.899 1.00 41.81 ? 119 LEU C CB  1 
ATOM   5813  C  CG  . LEU C  1 139 ? 62.546 -17.619 -33.096 1.00 32.81 ? 119 LEU C CG  1 
ATOM   5814  C  CD1 . LEU C  1 139 ? 61.652 -16.883 -34.040 1.00 40.19 ? 119 LEU C CD1 1 
ATOM   5815  C  CD2 . LEU C  1 139 ? 63.639 -16.749 -32.574 1.00 32.90 ? 119 LEU C CD2 1 
ATOM   5816  N  N   . GLY C  1 140 ? 61.089 -20.708 -29.668 1.00 45.42 ? 120 GLY C N   1 
ATOM   5817  C  CA  . GLY C  1 140 ? 60.055 -21.170 -28.736 1.00 44.97 ? 120 GLY C CA  1 
ATOM   5818  C  C   . GLY C  1 140 ? 60.508 -22.403 -27.988 1.00 44.98 ? 120 GLY C C   1 
ATOM   5819  O  O   . GLY C  1 140 ? 61.493 -22.368 -27.232 1.00 45.98 ? 120 GLY C O   1 
ATOM   5820  N  N   . THR C  1 141 ? 59.829 -23.505 -28.253 1.00 45.92 ? 121 THR C N   1 
ATOM   5821  C  CA  . THR C  1 141 ? 60.017 -24.771 -27.518 1.00 47.41 ? 121 THR C CA  1 
ATOM   5822  C  C   . THR C  1 141 ? 61.467 -25.275 -27.470 1.00 45.09 ? 121 THR C C   1 
ATOM   5823  O  O   . THR C  1 141 ? 61.927 -25.735 -26.420 1.00 45.12 ? 121 THR C O   1 
ATOM   5824  C  CB  . THR C  1 141 ? 59.079 -25.884 -28.081 1.00 48.49 ? 121 THR C CB  1 
ATOM   5825  O  OG1 . THR C  1 141 ? 57.703 -25.465 -27.954 1.00 53.25 ? 121 THR C OG1 1 
ATOM   5826  C  CG2 . THR C  1 141 ? 59.296 -27.208 -27.341 1.00 47.99 ? 121 THR C CG2 1 
ATOM   5827  N  N   . VAL C  1 142 ? 62.184 -25.158 -28.582 1.00 43.74 ? 122 VAL C N   1 
ATOM   5828  C  CA  . VAL C  1 142 ? 63.617 -25.508 -28.629 1.00 44.26 ? 122 VAL C CA  1 
ATOM   5829  C  C   . VAL C  1 142 ? 64.449 -24.214 -28.784 1.00 44.37 ? 122 VAL C C   1 
ATOM   5830  O  O   . VAL C  1 142 ? 65.272 -24.039 -29.688 1.00 44.17 ? 122 VAL C O   1 
ATOM   5831  C  CB  . VAL C  1 142 ? 63.912 -26.567 -29.734 1.00 43.15 ? 122 VAL C CB  1 
ATOM   5832  C  CG1 . VAL C  1 142 ? 65.298 -27.182 -29.539 1.00 41.45 ? 122 VAL C CG1 1 
ATOM   5833  C  CG2 . VAL C  1 142 ? 62.834 -27.660 -29.695 1.00 40.00 ? 122 VAL C CG2 1 
ATOM   5834  N  N   . GLY C  1 143 ? 64.199 -23.310 -27.857 1.00 44.54 ? 123 GLY C N   1 
ATOM   5835  C  CA  . GLY C  1 143 ? 64.785 -22.011 -27.868 1.00 43.23 ? 123 GLY C CA  1 
ATOM   5836  C  C   . GLY C  1 143 ? 64.546 -21.425 -26.517 1.00 42.01 ? 123 GLY C C   1 
ATOM   5837  O  O   . GLY C  1 143 ? 64.431 -22.143 -25.545 1.00 42.90 ? 123 GLY C O   1 
ATOM   5838  N  N   . MET C  1 144 ? 64.427 -20.116 -26.462 1.00 42.59 ? 124 MET C N   1 
ATOM   5839  C  CA  . MET C  1 144 ? 64.582 -19.414 -25.192 1.00 43.12 ? 124 MET C CA  1 
ATOM   5840  C  C   . MET C  1 144 ? 63.469 -19.739 -24.154 1.00 43.22 ? 124 MET C C   1 
ATOM   5841  O  O   . MET C  1 144 ? 63.753 -19.936 -22.956 1.00 43.29 ? 124 MET C O   1 
ATOM   5842  C  CB  . MET C  1 144 ? 64.794 -17.895 -25.473 1.00 41.42 ? 124 MET C CB  1 
ATOM   5843  C  CG  . MET C  1 144 ? 64.923 -16.976 -24.218 1.00 44.93 ? 124 MET C CG  1 
ATOM   5844  S  SD  . MET C  1 144 ? 63.296 -16.631 -23.452 1.00 59.33 ? 124 MET C SD  1 
ATOM   5845  C  CE  . MET C  1 144 ? 62.411 -15.500 -24.543 1.00 54.30 ? 124 MET C CE  1 
ATOM   5846  N  N   . PRO C  1 145 ? 62.200 -19.751 -24.591 1.00 42.21 ? 125 PRO C N   1 
ATOM   5847  C  CA  . PRO C  1 145 ? 61.146 -20.166 -23.671 1.00 40.31 ? 125 PRO C CA  1 
ATOM   5848  C  C   . PRO C  1 145 ? 61.224 -21.586 -23.134 1.00 38.38 ? 125 PRO C C   1 
ATOM   5849  O  O   . PRO C  1 145 ? 60.877 -21.829 -21.977 1.00 40.11 ? 125 PRO C O   1 
ATOM   5850  C  CB  . PRO C  1 145 ? 59.847 -19.954 -24.488 1.00 40.17 ? 125 PRO C CB  1 
ATOM   5851  C  CG  . PRO C  1 145 ? 60.192 -18.969 -25.555 1.00 41.38 ? 125 PRO C CG  1 
ATOM   5852  C  CD  . PRO C  1 145 ? 61.644 -19.292 -25.885 1.00 44.49 ? 125 PRO C CD  1 
ATOM   5853  N  N   . GLY C  1 146 ? 61.588 -22.535 -23.972 1.00 38.11 ? 126 GLY C N   1 
ATOM   5854  C  CA  . GLY C  1 146 ? 61.797 -23.904 -23.511 1.00 40.62 ? 126 GLY C CA  1 
ATOM   5855  C  C   . GLY C  1 146 ? 62.952 -24.046 -22.532 1.00 39.60 ? 126 GLY C C   1 
ATOM   5856  O  O   . GLY C  1 146 ? 62.860 -24.802 -21.567 1.00 38.57 ? 126 GLY C O   1 
ATOM   5857  N  N   . LEU C  1 147 ? 64.039 -23.309 -22.798 1.00 38.40 ? 127 LEU C N   1 
ATOM   5858  C  CA  . LEU C  1 147 ? 65.152 -23.210 -21.905 1.00 37.43 ? 127 LEU C CA  1 
ATOM   5859  C  C   . LEU C  1 147 ? 64.794 -22.604 -20.538 1.00 40.71 ? 127 LEU C C   1 
ATOM   5860  O  O   . LEU C  1 147 ? 65.346 -23.034 -19.501 1.00 42.68 ? 127 LEU C O   1 
ATOM   5861  C  CB  . LEU C  1 147 ? 66.246 -22.378 -22.566 1.00 39.59 ? 127 LEU C CB  1 
ATOM   5862  C  CG  . LEU C  1 147 ? 67.091 -23.110 -23.610 1.00 39.23 ? 127 LEU C CG  1 
ATOM   5863  C  CD1 . LEU C  1 147 ? 68.075 -22.183 -24.338 1.00 37.05 ? 127 LEU C CD1 1 
ATOM   5864  C  CD2 . LEU C  1 147 ? 67.805 -24.309 -22.967 1.00 41.81 ? 127 LEU C CD2 1 
ATOM   5865  N  N   . THR C  1 148 ? 63.905 -21.601 -20.554 1.00 38.98 ? 128 THR C N   1 
ATOM   5866  C  CA  . THR C  1 148 ? 63.397 -20.957 -19.349 1.00 40.16 ? 128 THR C CA  1 
ATOM   5867  C  C   . THR C  1 148 ? 62.644 -21.984 -18.490 1.00 41.38 ? 128 THR C C   1 
ATOM   5868  O  O   . THR C  1 148 ? 62.812 -22.077 -17.262 1.00 39.45 ? 128 THR C O   1 
ATOM   5869  C  CB  . THR C  1 148 ? 62.448 -19.807 -19.728 1.00 41.45 ? 128 THR C CB  1 
ATOM   5870  O  OG1 . THR C  1 148 ? 63.081 -18.934 -20.646 1.00 37.35 ? 128 THR C OG1 1 
ATOM   5871  C  CG2 . THR C  1 148 ? 62.059 -19.012 -18.539 1.00 44.93 ? 128 THR C CG2 1 
ATOM   5872  N  N   . ALA C  1 149 ? 61.785 -22.738 -19.161 1.00 41.94 ? 129 ALA C N   1 
ATOM   5873  C  CA  . ALA C  1 149 ? 61.019 -23.822 -18.516 1.00 41.40 ? 129 ALA C CA  1 
ATOM   5874  C  C   . ALA C  1 149 ? 61.898 -24.919 -17.955 1.00 38.77 ? 129 ALA C C   1 
ATOM   5875  O  O   . ALA C  1 149 ? 61.744 -25.324 -16.807 1.00 38.41 ? 129 ALA C O   1 
ATOM   5876  C  CB  . ALA C  1 149 ? 60.026 -24.414 -19.480 1.00 38.40 ? 129 ALA C CB  1 
ATOM   5877  N  N   . TYR C  1 150 ? 62.790 -25.418 -18.806 1.00 39.01 ? 130 TYR C N   1 
ATOM   5878  C  CA  . TYR C  1 150 ? 63.705 -26.497 -18.448 1.00 36.82 ? 130 TYR C CA  1 
ATOM   5879  C  C   . TYR C  1 150 ? 64.516 -26.125 -17.199 1.00 37.81 ? 130 TYR C C   1 
ATOM   5880  O  O   . TYR C  1 150 ? 64.492 -26.870 -16.243 1.00 38.48 ? 130 TYR C O   1 
ATOM   5881  C  CB  . TYR C  1 150 ? 64.575 -26.850 -19.672 1.00 36.67 ? 130 TYR C CB  1 
ATOM   5882  C  CG  . TYR C  1 150 ? 65.679 -27.886 -19.504 1.00 35.41 ? 130 TYR C CG  1 
ATOM   5883  C  CD1 . TYR C  1 150 ? 65.574 -29.168 -20.071 1.00 36.13 ? 130 TYR C CD1 1 
ATOM   5884  C  CD2 . TYR C  1 150 ? 66.859 -27.584 -18.796 1.00 38.57 ? 130 TYR C CD2 1 
ATOM   5885  C  CE1 . TYR C  1 150 ? 66.638 -30.142 -19.932 1.00 35.18 ? 130 TYR C CE1 1 
ATOM   5886  C  CE2 . TYR C  1 150 ? 67.925 -28.531 -18.673 1.00 33.54 ? 130 TYR C CE2 1 
ATOM   5887  C  CZ  . TYR C  1 150 ? 67.818 -29.809 -19.246 1.00 38.57 ? 130 TYR C CZ  1 
ATOM   5888  O  OH  . TYR C  1 150 ? 68.914 -30.744 -19.117 1.00 42.45 ? 130 TYR C OH  1 
ATOM   5889  N  N   . PHE C  1 151 ? 65.199 -24.966 -17.178 1.00 38.49 ? 131 PHE C N   1 
ATOM   5890  C  CA  . PHE C  1 151 ? 66.094 -24.644 -16.045 1.00 36.95 ? 131 PHE C CA  1 
ATOM   5891  C  C   . PHE C  1 151 ? 65.358 -24.155 -14.826 1.00 37.71 ? 131 PHE C C   1 
ATOM   5892  O  O   . PHE C  1 151 ? 65.753 -24.429 -13.729 1.00 38.54 ? 131 PHE C O   1 
ATOM   5893  C  CB  . PHE C  1 151 ? 67.162 -23.631 -16.443 1.00 40.42 ? 131 PHE C CB  1 
ATOM   5894  C  CG  . PHE C  1 151 ? 68.226 -24.180 -17.352 1.00 35.95 ? 131 PHE C CG  1 
ATOM   5895  C  CD1 . PHE C  1 151 ? 69.091 -25.183 -16.901 1.00 41.43 ? 131 PHE C CD1 1 
ATOM   5896  C  CD2 . PHE C  1 151 ? 68.388 -23.670 -18.636 1.00 34.02 ? 131 PHE C CD2 1 
ATOM   5897  C  CE1 . PHE C  1 151 ? 70.068 -25.687 -17.734 1.00 41.73 ? 131 PHE C CE1 1 
ATOM   5898  C  CE2 . PHE C  1 151 ? 69.359 -24.186 -19.493 1.00 34.29 ? 131 PHE C CE2 1 
ATOM   5899  C  CZ  . PHE C  1 151 ? 70.182 -25.182 -19.051 1.00 37.37 ? 131 PHE C CZ  1 
ATOM   5900  N  N   . GLY C  1 152 ? 64.279 -23.421 -15.020 1.00 40.67 ? 132 GLY C N   1 
ATOM   5901  C  CA  . GLY C  1 152 ? 63.460 -22.984 -13.916 1.00 41.38 ? 132 GLY C CA  1 
ATOM   5902  C  C   . GLY C  1 152 ? 62.877 -24.163 -13.177 1.00 41.75 ? 132 GLY C C   1 
ATOM   5903  O  O   . GLY C  1 152 ? 62.882 -24.208 -11.951 1.00 39.83 ? 132 GLY C O   1 
ATOM   5904  N  N   . LEU C  1 153 ? 62.362 -25.125 -13.931 1.00 42.01 ? 133 LEU C N   1 
ATOM   5905  C  CA  . LEU C  1 153 ? 61.795 -26.308 -13.315 1.00 43.31 ? 133 LEU C CA  1 
ATOM   5906  C  C   . LEU C  1 153 ? 62.849 -27.287 -12.727 1.00 42.02 ? 133 LEU C C   1 
ATOM   5907  O  O   . LEU C  1 153 ? 62.779 -27.670 -11.557 1.00 41.78 ? 133 LEU C O   1 
ATOM   5908  C  CB  . LEU C  1 153 ? 60.839 -26.993 -14.320 1.00 42.96 ? 133 LEU C CB  1 
ATOM   5909  C  CG  . LEU C  1 153 ? 60.115 -28.224 -13.731 1.00 41.60 ? 133 LEU C CG  1 
ATOM   5910  C  CD1 . LEU C  1 153 ? 58.978 -27.786 -12.807 1.00 40.58 ? 133 LEU C CD1 1 
ATOM   5911  C  CD2 . LEU C  1 153 ? 59.614 -29.122 -14.827 1.00 45.25 ? 133 LEU C CD2 1 
ATOM   5912  N  N   . LEU C  1 154 ? 63.817 -27.687 -13.548 1.00 42.22 ? 134 LEU C N   1 
ATOM   5913  C  CA  . LEU C  1 154 ? 64.778 -28.700 -13.164 1.00 44.19 ? 134 LEU C CA  1 
ATOM   5914  C  C   . LEU C  1 154 ? 65.884 -28.188 -12.233 1.00 46.04 ? 134 LEU C C   1 
ATOM   5915  O  O   . LEU C  1 154 ? 66.311 -28.933 -11.381 1.00 45.99 ? 134 LEU C O   1 
ATOM   5916  C  CB  . LEU C  1 154 ? 65.346 -29.419 -14.406 1.00 43.96 ? 134 LEU C CB  1 
ATOM   5917  C  CG  . LEU C  1 154 ? 64.260 -30.079 -15.293 1.00 40.20 ? 134 LEU C CG  1 
ATOM   5918  C  CD1 . LEU C  1 154 ? 64.825 -30.842 -16.430 1.00 34.53 ? 134 LEU C CD1 1 
ATOM   5919  C  CD2 . LEU C  1 154 ? 63.349 -30.964 -14.467 1.00 37.23 ? 134 LEU C CD2 1 
ATOM   5920  N  N   . GLU C  1 155 ? 66.302 -26.922 -12.359 1.00 48.12 ? 135 GLU C N   1 
ATOM   5921  C  CA  . GLU C  1 155 ? 67.373 -26.364 -11.532 1.00 49.12 ? 135 GLU C CA  1 
ATOM   5922  C  C   . GLU C  1 155 ? 66.890 -25.468 -10.388 1.00 50.65 ? 135 GLU C C   1 
ATOM   5923  O  O   . GLU C  1 155 ? 67.488 -25.489 -9.321  1.00 49.35 ? 135 GLU C O   1 
ATOM   5924  C  CB  . GLU C  1 155 ? 68.349 -25.556 -12.381 1.00 50.41 ? 135 GLU C CB  1 
ATOM   5925  C  CG  . GLU C  1 155 ? 69.310 -26.386 -13.225 1.00 60.15 ? 135 GLU C CG  1 
ATOM   5926  C  CD  . GLU C  1 155 ? 70.731 -26.355 -12.684 1.00 75.23 ? 135 GLU C CD  1 
ATOM   5927  O  OE1 . GLU C  1 155 ? 71.220 -25.237 -12.320 1.00 73.52 ? 135 GLU C OE1 1 
ATOM   5928  O  OE2 . GLU C  1 155 ? 71.347 -27.454 -12.620 1.00 79.25 ? 135 GLU C OE2 1 
ATOM   5929  N  N   . ILE C  1 156 ? 65.850 -24.660 -10.602 1.00 50.14 ? 136 ILE C N   1 
ATOM   5930  C  CA  . ILE C  1 156 ? 65.419 -23.710 -9.558  1.00 51.17 ? 136 ILE C CA  1 
ATOM   5931  C  C   . ILE C  1 156 ? 64.351 -24.348 -8.660  1.00 53.59 ? 136 ILE C C   1 
ATOM   5932  O  O   . ILE C  1 156 ? 64.512 -24.372 -7.440  1.00 55.06 ? 136 ILE C O   1 
ATOM   5933  C  CB  . ILE C  1 156 ? 64.984 -22.309 -10.112 1.00 47.34 ? 136 ILE C CB  1 
ATOM   5934  C  CG1 . ILE C  1 156 ? 66.161 -21.367 -10.402 1.00 50.67 ? 136 ILE C CG1 1 
ATOM   5935  C  CG2 . ILE C  1 156 ? 64.203 -21.568 -9.074  1.00 47.22 ? 136 ILE C CG2 1 
ATOM   5936  C  CD1 . ILE C  1 156 ? 67.315 -21.913 -11.015 1.00 55.17 ? 136 ILE C CD1 1 
ATOM   5937  N  N   . CYS C  1 157 ? 63.278 -24.874 -9.249  1.00 54.07 ? 137 CYS C N   1 
ATOM   5938  C  CA  . CYS C  1 157 ? 62.333 -25.675 -8.470  1.00 55.70 ? 137 CYS C CA  1 
ATOM   5939  C  C   . CYS C  1 157 ? 63.028 -26.914 -7.950  1.00 55.90 ? 137 CYS C C   1 
ATOM   5940  O  O   . CYS C  1 157 ? 62.824 -27.305 -6.810  1.00 56.06 ? 137 CYS C O   1 
ATOM   5941  C  CB  . CYS C  1 157 ? 61.130 -26.108 -9.293  1.00 56.50 ? 137 CYS C CB  1 
ATOM   5942  S  SG  . CYS C  1 157 ? 59.885 -24.828 -9.518  1.00 60.93 ? 137 CYS C SG  1 
ATOM   5943  N  N   . GLY C  1 158 ? 63.852 -27.521 -8.804  1.00 57.40 ? 138 GLY C N   1 
ATOM   5944  C  CA  . GLY C  1 158 ? 64.623 -28.732 -8.469  1.00 55.79 ? 138 GLY C CA  1 
ATOM   5945  C  C   . GLY C  1 158 ? 63.724 -29.950 -8.346  1.00 55.94 ? 138 GLY C C   1 
ATOM   5946  O  O   . GLY C  1 158 ? 63.954 -30.794 -7.465  1.00 55.33 ? 138 GLY C O   1 
ATOM   5947  N  N   . VAL C  1 159 ? 62.699 -30.046 -9.203  1.00 56.37 ? 139 VAL C N   1 
ATOM   5948  C  CA  . VAL C  1 159 ? 61.734 -31.152 -9.062  1.00 59.04 ? 139 VAL C CA  1 
ATOM   5949  C  C   . VAL C  1 159 ? 62.447 -32.456 -9.367  1.00 59.81 ? 139 VAL C C   1 
ATOM   5950  O  O   . VAL C  1 159 ? 63.350 -32.496 -10.205 1.00 59.20 ? 139 VAL C O   1 
ATOM   5951  C  CB  . VAL C  1 159 ? 60.434 -31.052 -9.941  1.00 57.74 ? 139 VAL C CB  1 
ATOM   5952  C  CG1 . VAL C  1 159 ? 59.688 -29.757 -9.670  1.00 60.37 ? 139 VAL C CG1 1 
ATOM   5953  C  CG2 . VAL C  1 159 ? 60.751 -31.245 -11.433 1.00 56.88 ? 139 VAL C CG2 1 
ATOM   5954  N  N   . LYS C  1 160 ? 62.027 -33.496 -8.646  1.00 63.62 ? 140 LYS C N   1 
ATOM   5955  C  CA  . LYS C  1 160 ? 62.683 -34.810 -8.609  1.00 64.95 ? 140 LYS C CA  1 
ATOM   5956  C  C   . LYS C  1 160 ? 61.825 -35.894 -9.242  1.00 64.88 ? 140 LYS C C   1 
ATOM   5957  O  O   . LYS C  1 160 ? 62.357 -36.839 -9.831  1.00 67.33 ? 140 LYS C O   1 
ATOM   5958  C  CB  . LYS C  1 160 ? 63.013 -35.191 -7.145  1.00 66.22 ? 140 LYS C CB  1 
ATOM   5959  C  CG  . LYS C  1 160 ? 64.223 -34.427 -6.546  1.00 67.53 ? 140 LYS C CG  1 
ATOM   5960  C  CD  . LYS C  1 160 ? 65.543 -34.886 -7.216  1.00 68.83 ? 140 LYS C CD  1 
ATOM   5961  C  CE  . LYS C  1 160 ? 66.362 -33.725 -7.817  1.00 73.32 ? 140 LYS C CE  1 
ATOM   5962  N  NZ  . LYS C  1 160 ? 66.988 -34.136 -9.121  1.00 67.24 ? 140 LYS C NZ  1 
ATOM   5963  N  N   . GLY C  1 161 ? 60.506 -35.740 -9.139  1.00 62.91 ? 141 GLY C N   1 
ATOM   5964  C  CA  . GLY C  1 161 ? 59.563 -36.773 -9.527  1.00 61.85 ? 141 GLY C CA  1 
ATOM   5965  C  C   . GLY C  1 161 ? 58.752 -37.106 -8.295  1.00 60.54 ? 141 GLY C C   1 
ATOM   5966  O  O   . GLY C  1 161 ? 59.304 -37.200 -7.197  1.00 61.21 ? 141 GLY C O   1 
ATOM   5967  N  N   . GLY C  1 162 ? 57.441 -37.253 -8.466  1.00 58.30 ? 142 GLY C N   1 
ATOM   5968  C  CA  . GLY C  1 162 ? 56.538 -37.409 -7.331  1.00 56.49 ? 142 GLY C CA  1 
ATOM   5969  C  C   . GLY C  1 162 ? 55.907 -36.117 -6.848  1.00 55.06 ? 142 GLY C C   1 
ATOM   5970  O  O   . GLY C  1 162 ? 54.878 -36.149 -6.174  1.00 56.65 ? 142 GLY C O   1 
ATOM   5971  N  N   . GLU C  1 163 ? 56.499 -34.979 -7.198  1.00 53.94 ? 143 GLU C N   1 
ATOM   5972  C  CA  . GLU C  1 163 ? 56.034 -33.660 -6.703  1.00 52.90 ? 143 GLU C CA  1 
ATOM   5973  C  C   . GLU C  1 163 ? 54.750 -33.149 -7.365  1.00 47.82 ? 143 GLU C C   1 
ATOM   5974  O  O   . GLU C  1 163 ? 54.413 -33.561 -8.471  1.00 45.29 ? 143 GLU C O   1 
ATOM   5975  C  CB  . GLU C  1 163 ? 57.133 -32.600 -6.885  1.00 54.05 ? 143 GLU C CB  1 
ATOM   5976  C  CG  . GLU C  1 163 ? 58.190 -32.643 -5.776  1.00 59.88 ? 143 GLU C CG  1 
ATOM   5977  C  CD  . GLU C  1 163 ? 59.585 -32.796 -6.305  1.00 66.58 ? 143 GLU C CD  1 
ATOM   5978  O  OE1 . GLU C  1 163 ? 59.731 -33.385 -7.405  1.00 70.66 ? 143 GLU C OE1 1 
ATOM   5979  O  OE2 . GLU C  1 163 ? 60.535 -32.373 -5.600  1.00 65.79 ? 143 GLU C OE2 1 
ATOM   5980  N  N   . THR C  1 164 ? 54.043 -32.265 -6.665  1.00 44.78 ? 144 THR C N   1 
ATOM   5981  C  CA  . THR C  1 164 ? 52.890 -31.544 -7.245  1.00 45.57 ? 144 THR C CA  1 
ATOM   5982  C  C   . THR C  1 164 ? 53.251 -30.097 -7.584  1.00 42.50 ? 144 THR C C   1 
ATOM   5983  O  O   . THR C  1 164 ? 53.568 -29.307 -6.717  1.00 38.12 ? 144 THR C O   1 
ATOM   5984  C  CB  . THR C  1 164 ? 51.669 -31.568 -6.331  1.00 45.13 ? 144 THR C CB  1 
ATOM   5985  O  OG1 . THR C  1 164 ? 51.391 -32.931 -5.986  1.00 50.81 ? 144 THR C OG1 1 
ATOM   5986  C  CG2 . THR C  1 164 ? 50.445 -30.950 -7.020  1.00 44.95 ? 144 THR C CG2 1 
ATOM   5987  N  N   . VAL C  1 165 ? 53.220 -29.801 -8.878  1.00 43.03 ? 145 VAL C N   1 
ATOM   5988  C  CA  . VAL C  1 165 ? 53.669 -28.528 -9.395  1.00 44.25 ? 145 VAL C CA  1 
ATOM   5989  C  C   . VAL C  1 165 ? 52.508 -27.652 -9.829  1.00 40.30 ? 145 VAL C C   1 
ATOM   5990  O  O   . VAL C  1 165 ? 51.635 -28.068 -10.547 1.00 38.05 ? 145 VAL C O   1 
ATOM   5991  C  CB  . VAL C  1 165 ? 54.645 -28.695 -10.588 1.00 44.79 ? 145 VAL C CB  1 
ATOM   5992  C  CG1 . VAL C  1 165 ? 55.259 -27.340 -10.939 1.00 47.23 ? 145 VAL C CG1 1 
ATOM   5993  C  CG2 . VAL C  1 165 ? 55.730 -29.685 -10.251 1.00 43.33 ? 145 VAL C CG2 1 
ATOM   5994  N  N   . MET C  1 166 ? 52.541 -26.412 -9.381  1.00 40.72 ? 146 MET C N   1 
ATOM   5995  C  CA  . MET C  1 166 ? 51.649 -25.405 -9.869  1.00 39.49 ? 146 MET C CA  1 
ATOM   5996  C  C   . MET C  1 166 ? 52.322 -24.603 -10.974 1.00 38.55 ? 146 MET C C   1 
ATOM   5997  O  O   . MET C  1 166 ? 53.404 -24.085 -10.780 1.00 40.39 ? 146 MET C O   1 
ATOM   5998  C  CB  . MET C  1 166 ? 51.268 -24.478 -8.731  1.00 39.88 ? 146 MET C CB  1 
ATOM   5999  C  CG  . MET C  1 166 ? 50.406 -23.281 -9.209  1.00 51.45 ? 146 MET C CG  1 
ATOM   6000  S  SD  . MET C  1 166 ? 48.782 -23.912 -9.443  1.00 66.54 ? 146 MET C SD  1 
ATOM   6001  C  CE  . MET C  1 166 ? 48.275 -23.111 -10.980 1.00 54.04 ? 146 MET C CE  1 
ATOM   6002  N  N   . VAL C  1 167 ? 51.683 -24.465 -12.119 1.00 40.22 ? 147 VAL C N   1 
ATOM   6003  C  CA  . VAL C  1 167 ? 52.170 -23.525 -13.128 1.00 41.98 ? 147 VAL C CA  1 
ATOM   6004  C  C   . VAL C  1 167 ? 51.063 -22.637 -13.683 1.00 41.83 ? 147 VAL C C   1 
ATOM   6005  O  O   . VAL C  1 167 ? 50.045 -23.111 -14.095 1.00 42.97 ? 147 VAL C O   1 
ATOM   6006  C  CB  . VAL C  1 167 ? 52.984 -24.214 -14.261 1.00 44.21 ? 147 VAL C CB  1 
ATOM   6007  C  CG1 . VAL C  1 167 ? 52.317 -25.409 -14.818 1.00 43.98 ? 147 VAL C CG1 1 
ATOM   6008  C  CG2 . VAL C  1 167 ? 53.322 -23.205 -15.348 1.00 50.80 ? 147 VAL C CG2 1 
ATOM   6009  N  N   . ASN C  1 168 ? 51.287 -21.330 -13.634 1.00 43.23 ? 148 ASN C N   1 
ATOM   6010  C  CA  . ASN C  1 168 ? 50.361 -20.359 -14.149 1.00 46.73 ? 148 ASN C CA  1 
ATOM   6011  C  C   . ASN C  1 168 ? 50.861 -19.895 -15.548 1.00 48.85 ? 148 ASN C C   1 
ATOM   6012  O  O   . ASN C  1 168 ? 51.926 -20.325 -16.002 1.00 50.89 ? 148 ASN C O   1 
ATOM   6013  C  CB  . ASN C  1 168 ? 50.138 -19.223 -13.135 1.00 42.71 ? 148 ASN C CB  1 
ATOM   6014  C  CG  . ASN C  1 168 ? 51.424 -18.594 -12.672 1.00 48.00 ? 148 ASN C CG  1 
ATOM   6015  O  OD1 . ASN C  1 168 ? 52.427 -18.594 -13.402 1.00 38.86 ? 148 ASN C OD1 1 
ATOM   6016  N  ND2 . ASN C  1 168 ? 51.399 -18.009 -11.466 1.00 36.20 ? 148 ASN C ND2 1 
ATOM   6017  N  N   . ALA C  1 169 ? 50.069 -19.069 -16.239 1.00 50.46 ? 149 ALA C N   1 
ATOM   6018  C  CA  . ALA C  1 169 ? 50.292 -18.734 -17.668 1.00 47.60 ? 149 ALA C CA  1 
ATOM   6019  C  C   . ALA C  1 169 ? 50.703 -19.995 -18.440 1.00 45.39 ? 149 ALA C C   1 
ATOM   6020  O  O   . ALA C  1 169 ? 51.714 -20.023 -19.201 1.00 48.90 ? 149 ALA C O   1 
ATOM   6021  C  CB  . ALA C  1 169 ? 51.329 -17.580 -17.800 1.00 50.52 ? 149 ALA C CB  1 
ATOM   6022  N  N   . ALA C  1 170 ? 49.892 -21.033 -18.236 1.00 43.03 ? 150 ALA C N   1 
ATOM   6023  C  CA  . ALA C  1 170 ? 50.303 -22.413 -18.518 1.00 43.27 ? 150 ALA C CA  1 
ATOM   6024  C  C   . ALA C  1 170 ? 50.076 -22.897 -19.971 1.00 43.93 ? 150 ALA C C   1 
ATOM   6025  O  O   . ALA C  1 170 ? 50.562 -23.959 -20.332 1.00 46.05 ? 150 ALA C O   1 
ATOM   6026  C  CB  . ALA C  1 170 ? 49.675 -23.392 -17.465 1.00 39.22 ? 150 ALA C CB  1 
ATOM   6027  N  N   . ALA C  1 171 ? 49.361 -22.128 -20.793 1.00 46.49 ? 151 ALA C N   1 
ATOM   6028  C  CA  . ALA C  1 171 ? 49.305 -22.382 -22.261 1.00 47.08 ? 151 ALA C CA  1 
ATOM   6029  C  C   . ALA C  1 171 ? 50.239 -21.418 -22.970 1.00 49.25 ? 151 ALA C C   1 
ATOM   6030  O  O   . ALA C  1 171 ? 50.244 -21.341 -24.212 1.00 54.12 ? 151 ALA C O   1 
ATOM   6031  C  CB  . ALA C  1 171 ? 47.860 -22.222 -22.821 1.00 44.20 ? 151 ALA C CB  1 
ATOM   6032  N  N   . GLY C  1 172 ? 50.986 -20.662 -22.166 1.00 47.34 ? 152 GLY C N   1 
ATOM   6033  C  CA  . GLY C  1 172 ? 51.994 -19.774 -22.649 1.00 47.27 ? 152 GLY C CA  1 
ATOM   6034  C  C   . GLY C  1 172 ? 53.225 -20.565 -23.023 1.00 47.12 ? 152 GLY C C   1 
ATOM   6035  O  O   . GLY C  1 172 ? 53.366 -21.746 -22.682 1.00 48.35 ? 152 GLY C O   1 
ATOM   6036  N  N   . ALA C  1 173 ? 54.117 -19.901 -23.736 1.00 47.22 ? 153 ALA C N   1 
ATOM   6037  C  CA  . ALA C  1 173 ? 55.323 -20.533 -24.295 1.00 45.85 ? 153 ALA C CA  1 
ATOM   6038  C  C   . ALA C  1 173 ? 56.252 -21.196 -23.246 1.00 44.25 ? 153 ALA C C   1 
ATOM   6039  O  O   . ALA C  1 173 ? 56.788 -22.291 -23.456 1.00 45.79 ? 153 ALA C O   1 
ATOM   6040  C  CB  . ALA C  1 173 ? 56.082 -19.486 -25.101 1.00 45.01 ? 153 ALA C CB  1 
ATOM   6041  N  N   . VAL C  1 174 ? 56.443 -20.527 -22.114 1.00 44.90 ? 154 VAL C N   1 
ATOM   6042  C  CA  . VAL C  1 174 ? 57.199 -21.109 -21.001 1.00 42.91 ? 154 VAL C CA  1 
ATOM   6043  C  C   . VAL C  1 174 ? 56.357 -22.180 -20.277 1.00 43.63 ? 154 VAL C C   1 
ATOM   6044  O  O   . VAL C  1 174 ? 56.779 -23.355 -20.219 1.00 43.52 ? 154 VAL C O   1 
ATOM   6045  C  CB  . VAL C  1 174 ? 57.758 -20.041 -20.080 1.00 39.71 ? 154 VAL C CB  1 
ATOM   6046  C  CG1 . VAL C  1 174 ? 58.502 -20.656 -18.908 1.00 35.79 ? 154 VAL C CG1 1 
ATOM   6047  C  CG2 . VAL C  1 174 ? 58.703 -19.127 -20.884 1.00 45.17 ? 154 VAL C CG2 1 
ATOM   6048  N  N   . GLY C  1 175 ? 55.166 -21.793 -19.813 1.00 42.66 ? 155 GLY C N   1 
ATOM   6049  C  CA  . GLY C  1 175 ? 54.315 -22.647 -18.978 1.00 41.79 ? 155 GLY C CA  1 
ATOM   6050  C  C   . GLY C  1 175 ? 53.961 -23.999 -19.548 1.00 40.49 ? 155 GLY C C   1 
ATOM   6051  O  O   . GLY C  1 175 ? 53.852 -24.993 -18.833 1.00 42.12 ? 155 GLY C O   1 
ATOM   6052  N  N   . SER C  1 176 ? 53.756 -24.051 -20.847 1.00 41.49 ? 156 SER C N   1 
ATOM   6053  C  CA  . SER C  1 176 ? 53.266 -25.273 -21.483 1.00 41.01 ? 156 SER C CA  1 
ATOM   6054  C  C   . SER C  1 176 ? 54.377 -26.291 -21.598 1.00 39.18 ? 156 SER C C   1 
ATOM   6055  O  O   . SER C  1 176 ? 54.114 -27.468 -21.600 1.00 40.34 ? 156 SER C O   1 
ATOM   6056  C  CB  . SER C  1 176 ? 52.700 -24.959 -22.872 1.00 40.59 ? 156 SER C CB  1 
ATOM   6057  O  OG  . SER C  1 176 ? 53.670 -24.277 -23.616 1.00 40.04 ? 156 SER C OG  1 
ATOM   6058  N  N   . VAL C  1 177 ? 55.614 -25.815 -21.727 1.00 38.90 ? 157 VAL C N   1 
ATOM   6059  C  CA  . VAL C  1 177 ? 56.787 -26.664 -21.640 1.00 39.47 ? 157 VAL C CA  1 
ATOM   6060  C  C   . VAL C  1 177 ? 57.059 -27.119 -20.214 1.00 37.35 ? 157 VAL C C   1 
ATOM   6061  O  O   . VAL C  1 177 ? 57.399 -28.258 -20.018 1.00 37.23 ? 157 VAL C O   1 
ATOM   6062  C  CB  . VAL C  1 177 ? 58.093 -25.997 -22.205 1.00 42.87 ? 157 VAL C CB  1 
ATOM   6063  C  CG1 . VAL C  1 177 ? 59.276 -27.010 -22.160 1.00 43.69 ? 157 VAL C CG1 1 
ATOM   6064  C  CG2 . VAL C  1 177 ? 57.899 -25.487 -23.651 1.00 44.19 ? 157 VAL C CG2 1 
ATOM   6065  N  N   . VAL C  1 178 ? 56.945 -26.223 -19.234 1.00 38.14 ? 158 VAL C N   1 
ATOM   6066  C  CA  . VAL C  1 178 ? 57.139 -26.583 -17.826 1.00 37.70 ? 158 VAL C CA  1 
ATOM   6067  C  C   . VAL C  1 178 ? 56.259 -27.763 -17.450 1.00 38.58 ? 158 VAL C C   1 
ATOM   6068  O  O   . VAL C  1 178 ? 56.720 -28.738 -16.859 1.00 41.00 ? 158 VAL C O   1 
ATOM   6069  C  CB  . VAL C  1 178 ? 56.814 -25.422 -16.836 1.00 34.82 ? 158 VAL C CB  1 
ATOM   6070  C  CG1 . VAL C  1 178 ? 56.981 -25.915 -15.407 1.00 34.63 ? 158 VAL C CG1 1 
ATOM   6071  C  CG2 . VAL C  1 178 ? 57.702 -24.260 -17.069 1.00 36.17 ? 158 VAL C CG2 1 
ATOM   6072  N  N   . GLY C  1 179 ? 54.987 -27.655 -17.801 1.00 41.04 ? 159 GLY C N   1 
ATOM   6073  C  CA  . GLY C  1 179 ? 54.031 -28.715 -17.572 1.00 42.02 ? 159 GLY C CA  1 
ATOM   6074  C  C   . GLY C  1 179 ? 54.365 -30.050 -18.187 1.00 41.11 ? 159 GLY C C   1 
ATOM   6075  O  O   . GLY C  1 179 ? 54.143 -31.087 -17.576 1.00 41.04 ? 159 GLY C O   1 
ATOM   6076  N  N   . GLN C  1 180 ? 54.867 -30.019 -19.415 1.00 42.13 ? 160 GLN C N   1 
ATOM   6077  C  CA  . GLN C  1 180 ? 55.231 -31.245 -20.135 1.00 39.58 ? 160 GLN C CA  1 
ATOM   6078  C  C   . GLN C  1 180 ? 56.550 -31.856 -19.666 1.00 39.93 ? 160 GLN C C   1 
ATOM   6079  O  O   . GLN C  1 180 ? 56.686 -33.063 -19.642 1.00 41.89 ? 160 GLN C O   1 
ATOM   6080  C  CB  . GLN C  1 180 ? 55.266 -30.964 -21.633 1.00 38.76 ? 160 GLN C CB  1 
ATOM   6081  C  CG  . GLN C  1 180 ? 53.873 -30.661 -22.175 1.00 39.62 ? 160 GLN C CG  1 
ATOM   6082  C  CD  . GLN C  1 180 ? 53.857 -30.353 -23.635 1.00 37.40 ? 160 GLN C CD  1 
ATOM   6083  O  OE1 . GLN C  1 180 ? 53.527 -31.203 -24.448 1.00 40.49 ? 160 GLN C OE1 1 
ATOM   6084  N  NE2 . GLN C  1 180 ? 54.250 -29.138 -23.990 1.00 43.92 ? 160 GLN C NE2 1 
ATOM   6085  N  N   . ILE C  1 181 ? 57.511 -31.048 -19.238 1.00 39.51 ? 161 ILE C N   1 
ATOM   6086  C  CA  . ILE C  1 181 ? 58.697 -31.615 -18.597 1.00 41.25 ? 161 ILE C CA  1 
ATOM   6087  C  C   . ILE C  1 181 ? 58.352 -32.230 -17.213 1.00 42.53 ? 161 ILE C C   1 
ATOM   6088  O  O   . ILE C  1 181 ? 58.850 -33.301 -16.855 1.00 44.68 ? 161 ILE C O   1 
ATOM   6089  C  CB  . ILE C  1 181 ? 59.856 -30.574 -18.490 1.00 42.60 ? 161 ILE C CB  1 
ATOM   6090  C  CG1 . ILE C  1 181 ? 60.400 -30.215 -19.892 1.00 43.82 ? 161 ILE C CG1 1 
ATOM   6091  C  CG2 . ILE C  1 181 ? 60.977 -31.087 -17.581 1.00 39.52 ? 161 ILE C CG2 1 
ATOM   6092  C  CD1 . ILE C  1 181 ? 61.279 -28.929 -19.929 1.00 36.37 ? 161 ILE C CD1 1 
ATOM   6093  N  N   . ALA C  1 182 ? 57.488 -31.571 -16.457 1.00 41.53 ? 162 ALA C N   1 
ATOM   6094  C  CA  . ALA C  1 182 ? 57.053 -32.105 -15.174 1.00 41.60 ? 162 ALA C CA  1 
ATOM   6095  C  C   . ALA C  1 182 ? 56.339 -33.429 -15.306 1.00 42.01 ? 162 ALA C C   1 
ATOM   6096  O  O   . ALA C  1 182 ? 56.476 -34.277 -14.437 1.00 45.48 ? 162 ALA C O   1 
ATOM   6097  C  CB  . ALA C  1 182 ? 56.162 -31.116 -14.455 1.00 40.27 ? 162 ALA C CB  1 
ATOM   6098  N  N   . LYS C  1 183 ? 55.564 -33.625 -16.362 1.00 43.25 ? 163 LYS C N   1 
ATOM   6099  C  CA  . LYS C  1 183 ? 54.843 -34.905 -16.552 1.00 42.74 ? 163 LYS C CA  1 
ATOM   6100  C  C   . LYS C  1 183 ? 55.805 -36.037 -16.873 1.00 42.95 ? 163 LYS C C   1 
ATOM   6101  O  O   . LYS C  1 183 ? 55.695 -37.127 -16.308 1.00 43.81 ? 163 LYS C O   1 
ATOM   6102  C  CB  . LYS C  1 183 ? 53.770 -34.802 -17.662 1.00 42.41 ? 163 LYS C CB  1 
ATOM   6103  C  CG  . LYS C  1 183 ? 52.498 -34.021 -17.297 1.00 43.09 ? 163 LYS C CG  1 
ATOM   6104  C  CD  . LYS C  1 183 ? 51.880 -34.422 -15.941 1.00 47.33 ? 163 LYS C CD  1 
ATOM   6105  C  CE  . LYS C  1 183 ? 51.462 -35.868 -15.892 1.00 55.16 ? 163 LYS C CE  1 
ATOM   6106  N  NZ  . LYS C  1 183 ? 51.462 -36.391 -14.488 1.00 59.93 ? 163 LYS C NZ  1 
ATOM   6107  N  N   . LEU C  1 184 ? 56.746 -35.782 -17.780 1.00 43.57 ? 164 LEU C N   1 
ATOM   6108  C  CA  . LEU C  1 184 ? 57.784 -36.766 -18.095 1.00 44.99 ? 164 LEU C CA  1 
ATOM   6109  C  C   . LEU C  1 184 ? 58.849 -36.950 -16.974 1.00 45.49 ? 164 LEU C C   1 
ATOM   6110  O  O   . LEU C  1 184 ? 59.649 -37.866 -17.036 1.00 47.73 ? 164 LEU C O   1 
ATOM   6111  C  CB  . LEU C  1 184 ? 58.424 -36.477 -19.466 1.00 42.36 ? 164 LEU C CB  1 
ATOM   6112  C  CG  . LEU C  1 184 ? 59.477 -35.371 -19.596 1.00 47.77 ? 164 LEU C CG  1 
ATOM   6113  C  CD1 . LEU C  1 184 ? 60.919 -35.832 -19.323 1.00 47.25 ? 164 LEU C CD1 1 
ATOM   6114  C  CD2 . LEU C  1 184 ? 59.373 -34.785 -20.992 1.00 46.78 ? 164 LEU C CD2 1 
ATOM   6115  N  N   . LYS C  1 185 ? 58.876 -36.097 -15.963 1.00 46.70 ? 165 LYS C N   1 
ATOM   6116  C  CA  . LYS C  1 185 ? 59.654 -36.393 -14.759 1.00 47.45 ? 165 LYS C CA  1 
ATOM   6117  C  C   . LYS C  1 185 ? 58.768 -37.105 -13.725 1.00 48.43 ? 165 LYS C C   1 
ATOM   6118  O  O   . LYS C  1 185 ? 59.269 -37.502 -12.669 1.00 50.51 ? 165 LYS C O   1 
ATOM   6119  C  CB  . LYS C  1 185 ? 60.286 -35.124 -14.139 1.00 48.83 ? 165 LYS C CB  1 
ATOM   6120  C  CG  . LYS C  1 185 ? 61.301 -34.376 -15.034 1.00 51.87 ? 165 LYS C CG  1 
ATOM   6121  C  CD  . LYS C  1 185 ? 62.596 -35.192 -15.334 1.00 54.46 ? 165 LYS C CD  1 
ATOM   6122  C  CE  . LYS C  1 185 ? 63.322 -34.641 -16.576 1.00 51.24 ? 165 LYS C CE  1 
ATOM   6123  N  NZ  . LYS C  1 185 ? 64.422 -35.512 -17.058 1.00 48.14 ? 165 LYS C NZ  1 
ATOM   6124  N  N   . GLY C  1 186 ? 57.470 -37.258 -14.023 1.00 46.78 ? 166 GLY C N   1 
ATOM   6125  C  CA  . GLY C  1 186 ? 56.529 -37.939 -13.134 1.00 46.79 ? 166 GLY C CA  1 
ATOM   6126  C  C   . GLY C  1 186 ? 55.967 -37.120 -11.981 1.00 47.78 ? 166 GLY C C   1 
ATOM   6127  O  O   . GLY C  1 186 ? 55.917 -37.588 -10.843 1.00 47.73 ? 166 GLY C O   1 
ATOM   6128  N  N   . CYS C  1 187 ? 55.539 -35.898 -12.276 1.00 48.00 ? 167 CYS C N   1 
ATOM   6129  C  CA  . CYS C  1 187 ? 54.856 -35.042 -11.311 1.00 48.48 ? 167 CYS C CA  1 
ATOM   6130  C  C   . CYS C  1 187 ? 53.393 -34.875 -11.651 1.00 47.69 ? 167 CYS C C   1 
ATOM   6131  O  O   . CYS C  1 187 ? 52.990 -35.006 -12.805 1.00 48.53 ? 167 CYS C O   1 
ATOM   6132  C  CB  . CYS C  1 187 ? 55.449 -33.639 -11.317 1.00 48.62 ? 167 CYS C CB  1 
ATOM   6133  S  SG  . CYS C  1 187 ? 57.212 -33.580 -11.278 1.00 57.79 ? 167 CYS C SG  1 
ATOM   6134  N  N   . LYS C  1 188 ? 52.601 -34.549 -10.638 1.00 45.85 ? 168 LYS C N   1 
ATOM   6135  C  CA  . LYS C  1 188 ? 51.266 -34.043 -10.853 1.00 44.94 ? 168 LYS C CA  1 
ATOM   6136  C  C   . LYS C  1 188 ? 51.415 -32.544 -11.235 1.00 44.83 ? 168 LYS C C   1 
ATOM   6137  O  O   . LYS C  1 188 ? 52.170 -31.830 -10.623 1.00 45.83 ? 168 LYS C O   1 
ATOM   6138  C  CB  . LYS C  1 188 ? 50.415 -34.248 -9.597  1.00 43.14 ? 168 LYS C CB  1 
ATOM   6139  C  CG  . LYS C  1 188 ? 49.056 -33.599 -9.697  1.00 46.34 ? 168 LYS C CG  1 
ATOM   6140  C  CD  . LYS C  1 188 ? 48.267 -33.833 -8.443  1.00 47.35 ? 168 LYS C CD  1 
ATOM   6141  C  CE  . LYS C  1 188 ? 46.860 -33.304 -8.583  1.00 44.14 ? 168 LYS C CE  1 
ATOM   6142  N  NZ  . LYS C  1 188 ? 46.095 -33.519 -7.335  1.00 43.93 ? 168 LYS C NZ  1 
ATOM   6143  N  N   . VAL C  1 189 ? 50.705 -32.086 -12.259 1.00 44.44 ? 169 VAL C N   1 
ATOM   6144  C  CA  . VAL C  1 189 ? 50.831 -30.717 -12.737 1.00 43.51 ? 169 VAL C CA  1 
ATOM   6145  C  C   . VAL C  1 189 ? 49.491 -30.014 -12.738 1.00 42.08 ? 169 VAL C C   1 
ATOM   6146  O  O   . VAL C  1 189 ? 48.546 -30.456 -13.382 1.00 39.77 ? 169 VAL C O   1 
ATOM   6147  C  CB  . VAL C  1 189 ? 51.395 -30.653 -14.180 1.00 46.71 ? 169 VAL C CB  1 
ATOM   6148  C  CG1 . VAL C  1 189 ? 51.529 -29.181 -14.639 1.00 45.37 ? 169 VAL C CG1 1 
ATOM   6149  C  CG2 . VAL C  1 189 ? 52.748 -31.367 -14.254 1.00 49.05 ? 169 VAL C CG2 1 
ATOM   6150  N  N   . VAL C  1 190 ? 49.424 -28.904 -12.011 1.00 42.09 ? 170 VAL C N   1 
ATOM   6151  C  CA  . VAL C  1 190 ? 48.206 -28.124 -11.965 1.00 41.24 ? 170 VAL C CA  1 
ATOM   6152  C  C   . VAL C  1 190 ? 48.473 -26.834 -12.689 1.00 40.49 ? 170 VAL C C   1 
ATOM   6153  O  O   . VAL C  1 190 ? 49.476 -26.165 -12.423 1.00 40.71 ? 170 VAL C O   1 
ATOM   6154  C  CB  . VAL C  1 190 ? 47.715 -27.896 -10.536 1.00 40.36 ? 170 VAL C CB  1 
ATOM   6155  C  CG1 . VAL C  1 190 ? 46.409 -27.128 -10.547 1.00 34.27 ? 170 VAL C CG1 1 
ATOM   6156  C  CG2 . VAL C  1 190 ? 47.572 -29.218 -9.834  1.00 38.99 ? 170 VAL C CG2 1 
ATOM   6157  N  N   . GLY C  1 191 ? 47.562 -26.496 -13.609 1.00 42.89 ? 171 GLY C N   1 
ATOM   6158  C  CA  . GLY C  1 191 ? 47.797 -25.458 -14.627 1.00 41.67 ? 171 GLY C CA  1 
ATOM   6159  C  C   . GLY C  1 191 ? 46.631 -24.501 -14.750 1.00 40.50 ? 171 GLY C C   1 
ATOM   6160  O  O   . GLY C  1 191 ? 45.485 -24.894 -14.778 1.00 41.53 ? 171 GLY C O   1 
ATOM   6161  N  N   . ALA C  1 192 ? 46.959 -23.223 -14.837 1.00 42.04 ? 172 ALA C N   1 
ATOM   6162  C  CA  . ALA C  1 192 ? 45.995 -22.147 -14.819 1.00 40.35 ? 172 ALA C CA  1 
ATOM   6163  C  C   . ALA C  1 192 ? 46.236 -21.278 -16.051 1.00 40.18 ? 172 ALA C C   1 
ATOM   6164  O  O   . ALA C  1 192 ? 47.370 -20.943 -16.425 1.00 40.09 ? 172 ALA C O   1 
ATOM   6165  C  CB  . ALA C  1 192 ? 46.105 -21.364 -13.564 1.00 36.73 ? 172 ALA C CB  1 
ATOM   6166  N  N   . VAL C  1 193 ? 45.117 -20.902 -16.635 1.00 42.74 ? 173 VAL C N   1 
ATOM   6167  C  CA  . VAL C  1 193 ? 45.006 -20.598 -18.029 1.00 44.32 ? 173 VAL C CA  1 
ATOM   6168  C  C   . VAL C  1 193 ? 43.972 -19.491 -18.184 1.00 44.08 ? 173 VAL C C   1 
ATOM   6169  O  O   . VAL C  1 193 ? 43.055 -19.409 -17.405 1.00 46.56 ? 173 VAL C O   1 
ATOM   6170  C  CB  . VAL C  1 193 ? 44.675 -21.919 -18.729 1.00 43.98 ? 173 VAL C CB  1 
ATOM   6171  C  CG1 . VAL C  1 193 ? 43.459 -21.842 -19.541 1.00 44.56 ? 173 VAL C CG1 1 
ATOM   6172  C  CG2 . VAL C  1 193 ? 45.894 -22.432 -19.486 1.00 41.80 ? 173 VAL C CG2 1 
ATOM   6173  N  N   . GLY C  1 194 ? 44.155 -18.617 -19.162 1.00 46.81 ? 174 GLY C N   1 
ATOM   6174  C  CA  . GLY C  1 194 ? 43.265 -17.459 -19.365 1.00 48.50 ? 174 GLY C CA  1 
ATOM   6175  C  C   . GLY C  1 194 ? 42.069 -17.624 -20.306 1.00 48.72 ? 174 GLY C C   1 
ATOM   6176  O  O   . GLY C  1 194 ? 41.328 -16.672 -20.519 1.00 50.82 ? 174 GLY C O   1 
ATOM   6177  N  N   . SER C  1 195 ? 41.875 -18.806 -20.882 1.00 48.90 ? 175 SER C N   1 
ATOM   6178  C  CA  . SER C  1 195 ? 40.740 -19.055 -21.781 1.00 49.88 ? 175 SER C CA  1 
ATOM   6179  C  C   . SER C  1 195 ? 40.436 -20.545 -21.832 1.00 50.30 ? 175 SER C C   1 
ATOM   6180  O  O   . SER C  1 195 ? 41.212 -21.352 -21.331 1.00 46.86 ? 175 SER C O   1 
ATOM   6181  C  CB  . SER C  1 195 ? 40.954 -18.466 -23.207 1.00 49.60 ? 175 SER C CB  1 
ATOM   6182  O  OG  . SER C  1 195 ? 41.767 -19.264 -24.082 1.00 51.87 ? 175 SER C OG  1 
ATOM   6183  N  N   . ASP C  1 196 ? 39.292 -20.863 -22.436 1.00 51.60 ? 176 ASP C N   1 
ATOM   6184  C  CA  . ASP C  1 196 ? 38.743 -22.208 -22.519 1.00 53.26 ? 176 ASP C CA  1 
ATOM   6185  C  C   . ASP C  1 196 ? 39.272 -23.044 -23.688 1.00 52.45 ? 176 ASP C C   1 
ATOM   6186  O  O   . ASP C  1 196 ? 39.306 -24.260 -23.576 1.00 52.66 ? 176 ASP C O   1 
ATOM   6187  C  CB  . ASP C  1 196 ? 37.219 -22.115 -22.640 1.00 54.99 ? 176 ASP C CB  1 
ATOM   6188  C  CG  . ASP C  1 196 ? 36.576 -21.341 -21.483 1.00 63.47 ? 176 ASP C CG  1 
ATOM   6189  O  OD1 . ASP C  1 196 ? 37.199 -21.207 -20.407 1.00 66.94 ? 176 ASP C OD1 1 
ATOM   6190  O  OD2 . ASP C  1 196 ? 35.429 -20.864 -21.657 1.00 73.57 ? 176 ASP C OD2 1 
ATOM   6191  N  N   . GLU C  1 197 ? 39.618 -22.413 -24.816 1.00 52.25 ? 177 GLU C N   1 
ATOM   6192  C  CA  . GLU C  1 197 ? 40.494 -23.051 -25.825 1.00 52.68 ? 177 GLU C CA  1 
ATOM   6193  C  C   . GLU C  1 197 ? 41.809 -23.523 -25.144 1.00 51.20 ? 177 GLU C C   1 
ATOM   6194  O  O   . GLU C  1 197 ? 42.223 -24.687 -25.308 1.00 53.02 ? 177 GLU C O   1 
ATOM   6195  C  CB  . GLU C  1 197 ? 40.877 -22.091 -26.988 1.00 53.79 ? 177 GLU C CB  1 
ATOM   6196  C  CG  . GLU C  1 197 ? 39.727 -21.472 -27.775 1.00 53.94 ? 177 GLU C CG  1 
ATOM   6197  N  N   . LYS C  1 198 ? 42.464 -22.621 -24.409 1.00 47.56 ? 178 LYS C N   1 
ATOM   6198  C  CA  . LYS C  1 198 ? 43.683 -22.971 -23.645 1.00 47.20 ? 178 LYS C CA  1 
ATOM   6199  C  C   . LYS C  1 198 ? 43.504 -24.105 -22.620 1.00 44.20 ? 178 LYS C C   1 
ATOM   6200  O  O   . LYS C  1 198 ? 44.367 -24.963 -22.497 1.00 44.33 ? 178 LYS C O   1 
ATOM   6201  C  CB  . LYS C  1 198 ? 44.290 -21.742 -22.968 1.00 48.34 ? 178 LYS C CB  1 
ATOM   6202  C  CG  . LYS C  1 198 ? 45.006 -20.792 -23.914 1.00 49.37 ? 178 LYS C CG  1 
ATOM   6203  C  CD  . LYS C  1 198 ? 45.357 -19.495 -23.220 1.00 50.85 ? 178 LYS C CD  1 
ATOM   6204  C  CE  . LYS C  1 198 ? 45.997 -18.492 -24.166 1.00 55.50 ? 178 LYS C CE  1 
ATOM   6205  N  NZ  . LYS C  1 198 ? 46.014 -17.098 -23.604 1.00 63.43 ? 178 LYS C NZ  1 
ATOM   6206  N  N   . VAL C  1 199 ? 42.395 -24.123 -21.890 1.00 44.93 ? 179 VAL C N   1 
ATOM   6207  C  CA  . VAL C  1 199 ? 42.055 -25.284 -21.045 1.00 45.10 ? 179 VAL C CA  1 
ATOM   6208  C  C   . VAL C  1 199 ? 42.077 -26.560 -21.908 1.00 46.40 ? 179 VAL C C   1 
ATOM   6209  O  O   . VAL C  1 199 ? 42.847 -27.459 -21.636 1.00 49.80 ? 179 VAL C O   1 
ATOM   6210  C  CB  . VAL C  1 199 ? 40.674 -25.136 -20.299 1.00 43.67 ? 179 VAL C CB  1 
ATOM   6211  C  CG1 . VAL C  1 199 ? 40.241 -26.474 -19.657 1.00 40.55 ? 179 VAL C CG1 1 
ATOM   6212  C  CG2 . VAL C  1 199 ? 40.725 -24.044 -19.230 1.00 37.07 ? 179 VAL C CG2 1 
ATOM   6213  N  N   . ALA C  1 200 ? 41.260 -26.623 -22.954 1.00 46.33 ? 180 ALA C N   1 
ATOM   6214  C  CA  . ALA C  1 200 ? 41.271 -27.773 -23.882 1.00 47.44 ? 180 ALA C CA  1 
ATOM   6215  C  C   . ALA C  1 200 ? 42.664 -28.210 -24.389 1.00 46.46 ? 180 ALA C C   1 
ATOM   6216  O  O   . ALA C  1 200 ? 43.027 -29.383 -24.300 1.00 45.38 ? 180 ALA C O   1 
ATOM   6217  C  CB  . ALA C  1 200 ? 40.357 -27.487 -25.071 1.00 47.77 ? 180 ALA C CB  1 
ATOM   6218  N  N   . TYR C  1 201 ? 43.425 -27.273 -24.931 1.00 48.07 ? 181 TYR C N   1 
ATOM   6219  C  CA  . TYR C  1 201 ? 44.804 -27.552 -25.382 1.00 50.24 ? 181 TYR C CA  1 
ATOM   6220  C  C   . TYR C  1 201 ? 45.675 -28.244 -24.309 1.00 50.81 ? 181 TYR C C   1 
ATOM   6221  O  O   . TYR C  1 201 ? 46.335 -29.238 -24.602 1.00 51.23 ? 181 TYR C O   1 
ATOM   6222  C  CB  . TYR C  1 201 ? 45.448 -26.243 -25.910 1.00 51.80 ? 181 TYR C CB  1 
ATOM   6223  C  CG  . TYR C  1 201 ? 46.974 -26.196 -26.140 1.00 53.75 ? 181 TYR C CG  1 
ATOM   6224  C  CD1 . TYR C  1 201 ? 47.646 -27.097 -27.006 1.00 57.06 ? 181 TYR C CD1 1 
ATOM   6225  C  CD2 . TYR C  1 201 ? 47.730 -25.175 -25.538 1.00 57.46 ? 181 TYR C CD2 1 
ATOM   6226  C  CE1 . TYR C  1 201 ? 49.050 -27.001 -27.209 1.00 51.96 ? 181 TYR C CE1 1 
ATOM   6227  C  CE2 . TYR C  1 201 ? 49.105 -25.055 -25.741 1.00 58.18 ? 181 TYR C CE2 1 
ATOM   6228  C  CZ  . TYR C  1 201 ? 49.768 -25.959 -26.561 1.00 62.40 ? 181 TYR C CZ  1 
ATOM   6229  O  OH  . TYR C  1 201 ? 51.139 -25.749 -26.689 1.00 61.64 ? 181 TYR C OH  1 
ATOM   6230  N  N   . LEU C  1 202 ? 45.652 -27.736 -23.076 1.00 49.55 ? 182 LEU C N   1 
ATOM   6231  C  CA  . LEU C  1 202 ? 46.487 -28.285 -22.000 1.00 49.59 ? 182 LEU C CA  1 
ATOM   6232  C  C   . LEU C  1 202 ? 46.047 -29.635 -21.487 1.00 47.25 ? 182 LEU C C   1 
ATOM   6233  O  O   . LEU C  1 202 ? 46.832 -30.384 -20.929 1.00 45.38 ? 182 LEU C O   1 
ATOM   6234  C  CB  . LEU C  1 202 ? 46.532 -27.339 -20.810 1.00 49.91 ? 182 LEU C CB  1 
ATOM   6235  C  CG  . LEU C  1 202 ? 47.194 -25.999 -21.026 1.00 48.19 ? 182 LEU C CG  1 
ATOM   6236  C  CD1 . LEU C  1 202 ? 47.533 -25.431 -19.657 1.00 48.71 ? 182 LEU C CD1 1 
ATOM   6237  C  CD2 . LEU C  1 202 ? 48.422 -26.121 -21.912 1.00 49.04 ? 182 LEU C CD2 1 
ATOM   6238  N  N   . GLN C  1 203 ? 44.777 -29.921 -21.640 1.00 49.94 ? 183 GLN C N   1 
ATOM   6239  C  CA  . GLN C  1 203 ? 44.266 -31.258 -21.382 1.00 53.87 ? 183 GLN C CA  1 
ATOM   6240  C  C   . GLN C  1 203 ? 44.762 -32.296 -22.413 1.00 53.99 ? 183 GLN C C   1 
ATOM   6241  O  O   . GLN C  1 203 ? 45.153 -33.401 -22.015 1.00 54.60 ? 183 GLN C O   1 
ATOM   6242  C  CB  . GLN C  1 203 ? 42.744 -31.205 -21.306 1.00 54.33 ? 183 GLN C CB  1 
ATOM   6243  C  CG  . GLN C  1 203 ? 42.304 -30.401 -20.096 1.00 54.48 ? 183 GLN C CG  1 
ATOM   6244  C  CD  . GLN C  1 203 ? 40.819 -30.297 -19.966 1.00 53.74 ? 183 GLN C CD  1 
ATOM   6245  O  OE1 . GLN C  1 203 ? 40.093 -30.474 -20.940 1.00 48.15 ? 183 GLN C OE1 1 
ATOM   6246  N  NE2 . GLN C  1 203 ? 40.350 -29.987 -18.759 1.00 50.70 ? 183 GLN C NE2 1 
ATOM   6247  N  N   . LYS C  1 204 ? 44.778 -31.935 -23.703 1.00 53.86 ? 184 LYS C N   1 
ATOM   6248  C  CA  . LYS C  1 204 ? 45.431 -32.778 -24.728 1.00 54.91 ? 184 LYS C CA  1 
ATOM   6249  C  C   . LYS C  1 204 ? 46.889 -33.082 -24.303 1.00 55.42 ? 184 LYS C C   1 
ATOM   6250  O  O   . LYS C  1 204 ? 47.322 -34.230 -24.334 1.00 58.09 ? 184 LYS C O   1 
ATOM   6251  C  CB  . LYS C  1 204 ? 45.366 -32.157 -26.144 1.00 52.34 ? 184 LYS C CB  1 
ATOM   6252  N  N   . LEU C  1 205 ? 47.616 -32.072 -23.837 1.00 55.51 ? 185 LEU C N   1 
ATOM   6253  C  CA  . LEU C  1 205 ? 49.031 -32.239 -23.426 1.00 54.25 ? 185 LEU C CA  1 
ATOM   6254  C  C   . LEU C  1 205 ? 49.258 -33.034 -22.111 1.00 55.57 ? 185 LEU C C   1 
ATOM   6255  O  O   . LEU C  1 205 ? 50.416 -33.171 -21.673 1.00 57.35 ? 185 LEU C O   1 
ATOM   6256  C  CB  . LEU C  1 205 ? 49.712 -30.869 -23.310 1.00 52.15 ? 185 LEU C CB  1 
ATOM   6257  C  CG  . LEU C  1 205 ? 49.576 -29.866 -24.466 1.00 48.94 ? 185 LEU C CG  1 
ATOM   6258  C  CD1 . LEU C  1 205 ? 50.542 -28.716 -24.295 1.00 51.13 ? 185 LEU C CD1 1 
ATOM   6259  C  CD2 . LEU C  1 205 ? 49.826 -30.520 -25.756 1.00 53.40 ? 185 LEU C CD2 1 
ATOM   6260  N  N   . GLY C  1 206 ? 48.181 -33.528 -21.477 1.00 55.39 ? 186 GLY C N   1 
ATOM   6261  C  CA  . GLY C  1 206 ? 48.274 -34.417 -20.296 1.00 53.69 ? 186 GLY C CA  1 
ATOM   6262  C  C   . GLY C  1 206 ? 48.519 -33.801 -18.904 1.00 53.44 ? 186 GLY C C   1 
ATOM   6263  O  O   . GLY C  1 206 ? 48.909 -34.523 -17.963 1.00 54.29 ? 186 GLY C O   1 
ATOM   6264  N  N   . PHE C  1 207 ? 48.287 -32.496 -18.753 1.00 51.07 ? 187 PHE C N   1 
ATOM   6265  C  CA  . PHE C  1 207 ? 48.290 -31.848 -17.425 1.00 50.43 ? 187 PHE C CA  1 
ATOM   6266  C  C   . PHE C  1 207 ? 47.195 -32.490 -16.551 1.00 49.97 ? 187 PHE C C   1 
ATOM   6267  O  O   . PHE C  1 207 ? 46.043 -32.580 -16.985 1.00 47.72 ? 187 PHE C O   1 
ATOM   6268  C  CB  . PHE C  1 207 ? 47.919 -30.374 -17.529 1.00 50.80 ? 187 PHE C CB  1 
ATOM   6269  C  CG  . PHE C  1 207 ? 49.020 -29.450 -17.993 1.00 51.95 ? 187 PHE C CG  1 
ATOM   6270  C  CD1 . PHE C  1 207 ? 49.202 -28.223 -17.338 1.00 50.51 ? 187 PHE C CD1 1 
ATOM   6271  C  CD2 . PHE C  1 207 ? 49.830 -29.748 -19.103 1.00 55.94 ? 187 PHE C CD2 1 
ATOM   6272  C  CE1 . PHE C  1 207 ? 50.197 -27.311 -17.752 1.00 52.00 ? 187 PHE C CE1 1 
ATOM   6273  C  CE2 . PHE C  1 207 ? 50.831 -28.827 -19.526 1.00 52.13 ? 187 PHE C CE2 1 
ATOM   6274  C  CZ  . PHE C  1 207 ? 50.989 -27.601 -18.857 1.00 46.35 ? 187 PHE C CZ  1 
ATOM   6275  N  N   . ASP C  1 208 ? 47.536 -32.877 -15.321 1.00 49.06 ? 188 ASP C N   1 
ATOM   6276  C  CA  . ASP C  1 208 ? 46.568 -33.470 -14.375 1.00 48.36 ? 188 ASP C CA  1 
ATOM   6277  C  C   . ASP C  1 208 ? 45.332 -32.589 -14.097 1.00 47.01 ? 188 ASP C C   1 
ATOM   6278  O  O   . ASP C  1 208 ? 44.216 -33.057 -14.177 1.00 47.56 ? 188 ASP C O   1 
ATOM   6279  C  CB  . ASP C  1 208 ? 47.243 -33.802 -13.032 1.00 49.89 ? 188 ASP C CB  1 
ATOM   6280  C  CG  . ASP C  1 208 ? 48.355 -34.850 -13.165 1.00 55.97 ? 188 ASP C CG  1 
ATOM   6281  O  OD1 . ASP C  1 208 ? 48.115 -36.025 -12.795 1.00 64.59 ? 188 ASP C OD1 1 
ATOM   6282  O  OD2 . ASP C  1 208 ? 49.467 -34.496 -13.633 1.00 56.21 ? 188 ASP C OD2 1 
ATOM   6283  N  N   . VAL C  1 209 ? 45.522 -31.331 -13.729 1.00 46.67 ? 189 VAL C N   1 
ATOM   6284  C  CA  . VAL C  1 209 ? 44.396 -30.394 -13.622 1.00 45.50 ? 189 VAL C CA  1 
ATOM   6285  C  C   . VAL C  1 209 ? 44.665 -29.074 -14.350 1.00 45.25 ? 189 VAL C C   1 
ATOM   6286  O  O   . VAL C  1 209 ? 45.708 -28.433 -14.150 1.00 43.42 ? 189 VAL C O   1 
ATOM   6287  C  CB  . VAL C  1 209 ? 44.078 -30.051 -12.176 1.00 44.03 ? 189 VAL C CB  1 
ATOM   6288  C  CG1 . VAL C  1 209 ? 42.828 -29.154 -12.109 1.00 43.55 ? 189 VAL C CG1 1 
ATOM   6289  C  CG2 . VAL C  1 209 ? 43.909 -31.311 -11.356 1.00 45.27 ? 189 VAL C CG2 1 
ATOM   6290  N  N   . VAL C  1 210 ? 43.707 -28.678 -15.182 1.00 44.60 ? 190 VAL C N   1 
ATOM   6291  C  CA  . VAL C  1 210 ? 43.718 -27.377 -15.835 1.00 44.04 ? 190 VAL C CA  1 
ATOM   6292  C  C   . VAL C  1 210 ? 42.421 -26.636 -15.526 1.00 43.17 ? 190 VAL C C   1 
ATOM   6293  O  O   . VAL C  1 210 ? 41.354 -27.231 -15.420 1.00 44.33 ? 190 VAL C O   1 
ATOM   6294  C  CB  . VAL C  1 210 ? 43.851 -27.500 -17.366 1.00 44.49 ? 190 VAL C CB  1 
ATOM   6295  C  CG1 . VAL C  1 210 ? 44.302 -26.150 -17.968 1.00 42.68 ? 190 VAL C CG1 1 
ATOM   6296  C  CG2 . VAL C  1 210 ? 44.806 -28.638 -17.719 1.00 42.79 ? 190 VAL C CG2 1 
ATOM   6297  N  N   . PHE C  1 211 ? 42.536 -25.330 -15.345 1.00 43.49 ? 191 PHE C N   1 
ATOM   6298  C  CA  . PHE C  1 211 ? 41.368 -24.489 -15.193 1.00 40.72 ? 191 PHE C CA  1 
ATOM   6299  C  C   . PHE C  1 211 ? 41.580 -23.066 -15.715 1.00 40.97 ? 191 PHE C C   1 
ATOM   6300  O  O   . PHE C  1 211 ? 42.710 -22.581 -15.851 1.00 38.00 ? 191 PHE C O   1 
ATOM   6301  C  CB  . PHE C  1 211 ? 40.915 -24.478 -13.739 1.00 40.49 ? 191 PHE C CB  1 
ATOM   6302  C  CG  . PHE C  1 211 ? 41.881 -23.859 -12.822 1.00 40.24 ? 191 PHE C CG  1 
ATOM   6303  C  CD1 . PHE C  1 211 ? 41.861 -22.472 -12.601 1.00 40.98 ? 191 PHE C CD1 1 
ATOM   6304  C  CD2 . PHE C  1 211 ? 42.810 -24.652 -12.145 1.00 41.86 ? 191 PHE C CD2 1 
ATOM   6305  C  CE1 . PHE C  1 211 ? 42.780 -21.865 -11.725 1.00 37.66 ? 191 PHE C CE1 1 
ATOM   6306  C  CE2 . PHE C  1 211 ? 43.708 -24.082 -11.270 1.00 41.12 ? 191 PHE C CE2 1 
ATOM   6307  C  CZ  . PHE C  1 211 ? 43.701 -22.670 -11.055 1.00 43.81 ? 191 PHE C CZ  1 
ATOM   6308  N  N   . ASN C  1 212 ? 40.457 -22.442 -16.078 1.00 43.78 ? 192 ASN C N   1 
ATOM   6309  C  CA  . ASN C  1 212 ? 40.437 -21.069 -16.511 1.00 44.17 ? 192 ASN C CA  1 
ATOM   6310  C  C   . ASN C  1 212 ? 40.272 -20.189 -15.277 1.00 46.32 ? 192 ASN C C   1 
ATOM   6311  O  O   . ASN C  1 212 ? 39.237 -20.254 -14.601 1.00 47.43 ? 192 ASN C O   1 
ATOM   6312  C  CB  . ASN C  1 212 ? 39.304 -20.824 -17.496 1.00 41.93 ? 192 ASN C CB  1 
ATOM   6313  C  CG  . ASN C  1 212 ? 39.325 -19.408 -18.029 1.00 40.80 ? 192 ASN C CG  1 
ATOM   6314  O  OD1 . ASN C  1 212 ? 40.073 -18.570 -17.529 1.00 47.72 ? 192 ASN C OD1 1 
ATOM   6315  N  ND2 . ASN C  1 212 ? 38.543 -19.136 -19.045 1.00 39.82 ? 192 ASN C ND2 1 
ATOM   6316  N  N   . TYR C  1 213 ? 41.300 -19.397 -14.970 1.00 49.19 ? 193 TYR C N   1 
ATOM   6317  C  CA  . TYR C  1 213 ? 41.325 -18.615 -13.733 1.00 52.77 ? 193 TYR C CA  1 
ATOM   6318  C  C   . TYR C  1 213 ? 40.390 -17.402 -13.861 1.00 52.52 ? 193 TYR C C   1 
ATOM   6319  O  O   . TYR C  1 213 ? 39.951 -16.861 -12.856 1.00 53.65 ? 193 TYR C O   1 
ATOM   6320  C  CB  . TYR C  1 213 ? 42.767 -18.202 -13.325 1.00 58.28 ? 193 TYR C CB  1 
ATOM   6321  C  CG  . TYR C  1 213 ? 43.278 -17.049 -14.129 1.00 65.79 ? 193 TYR C CG  1 
ATOM   6322  C  CD1 . TYR C  1 213 ? 43.194 -15.736 -13.653 1.00 71.03 ? 193 TYR C CD1 1 
ATOM   6323  C  CD2 . TYR C  1 213 ? 43.778 -17.261 -15.409 1.00 74.51 ? 193 TYR C CD2 1 
ATOM   6324  C  CE1 . TYR C  1 213 ? 43.612 -14.662 -14.454 1.00 76.71 ? 193 TYR C CE1 1 
ATOM   6325  C  CE2 . TYR C  1 213 ? 44.211 -16.207 -16.212 1.00 78.60 ? 193 TYR C CE2 1 
ATOM   6326  C  CZ  . TYR C  1 213 ? 44.130 -14.912 -15.739 1.00 76.79 ? 193 TYR C CZ  1 
ATOM   6327  O  OH  . TYR C  1 213 ? 44.568 -13.897 -16.574 1.00 73.71 ? 193 TYR C OH  1 
ATOM   6328  N  N   . LYS C  1 214 ? 40.055 -17.009 -15.087 1.00 52.26 ? 194 LYS C N   1 
ATOM   6329  C  CA  . LYS C  1 214 ? 39.117 -15.900 -15.321 1.00 52.52 ? 194 LYS C CA  1 
ATOM   6330  C  C   . LYS C  1 214 ? 37.655 -16.236 -15.061 1.00 52.03 ? 194 LYS C C   1 
ATOM   6331  O  O   . LYS C  1 214 ? 36.868 -15.331 -14.841 1.00 53.57 ? 194 LYS C O   1 
ATOM   6332  C  CB  . LYS C  1 214 ? 39.246 -15.371 -16.747 1.00 51.30 ? 194 LYS C CB  1 
ATOM   6333  C  CG  . LYS C  1 214 ? 40.519 -14.635 -16.969 1.00 58.24 ? 194 LYS C CG  1 
ATOM   6334  C  CD  . LYS C  1 214 ? 40.567 -14.059 -18.361 1.00 62.98 ? 194 LYS C CD  1 
ATOM   6335  C  CE  . LYS C  1 214 ? 41.987 -13.561 -18.633 1.00 69.93 ? 194 LYS C CE  1 
ATOM   6336  N  NZ  . LYS C  1 214 ? 42.105 -12.931 -19.969 1.00 76.76 ? 194 LYS C NZ  1 
ATOM   6337  N  N   . THR C  1 215 ? 37.295 -17.519 -15.113 1.00 51.79 ? 195 THR C N   1 
ATOM   6338  C  CA  . THR C  1 215 ? 35.922 -17.947 -14.911 1.00 51.97 ? 195 THR C CA  1 
ATOM   6339  C  C   . THR C  1 215 ? 35.653 -18.609 -13.564 1.00 51.91 ? 195 THR C C   1 
ATOM   6340  O  O   . THR C  1 215 ? 34.486 -18.709 -13.193 1.00 53.92 ? 195 THR C O   1 
ATOM   6341  C  CB  . THR C  1 215 ? 35.376 -18.907 -16.045 1.00 53.97 ? 195 THR C CB  1 
ATOM   6342  O  OG1 . THR C  1 215 ? 35.678 -20.291 -15.754 1.00 56.55 ? 195 THR C OG1 1 
ATOM   6343  C  CG2 . THR C  1 215 ? 35.877 -18.507 -17.438 1.00 55.43 ? 195 THR C CG2 1 
ATOM   6344  N  N   . VAL C  1 216 ? 36.676 -19.073 -12.833 1.00 53.00 ? 196 VAL C N   1 
ATOM   6345  C  CA  . VAL C  1 216 ? 36.416 -19.763 -11.547 1.00 52.26 ? 196 VAL C CA  1 
ATOM   6346  C  C   . VAL C  1 216 ? 35.841 -18.810 -10.516 1.00 53.11 ? 196 VAL C C   1 
ATOM   6347  O  O   . VAL C  1 216 ? 36.286 -17.652 -10.439 1.00 53.71 ? 196 VAL C O   1 
ATOM   6348  C  CB  . VAL C  1 216 ? 37.662 -20.468 -10.919 1.00 52.68 ? 196 VAL C CB  1 
ATOM   6349  C  CG1 . VAL C  1 216 ? 38.042 -21.705 -11.758 1.00 54.89 ? 196 VAL C CG1 1 
ATOM   6350  C  CG2 . VAL C  1 216 ? 38.848 -19.483 -10.690 1.00 48.21 ? 196 VAL C CG2 1 
ATOM   6351  N  N   . GLU C  1 217 ? 34.873 -19.317 -9.730  1.00 52.59 ? 197 GLU C N   1 
ATOM   6352  C  CA  . GLU C  1 217 ? 34.222 -18.547 -8.671  1.00 52.69 ? 197 GLU C CA  1 
ATOM   6353  C  C   . GLU C  1 217 ? 35.192 -18.171 -7.573  1.00 53.27 ? 197 GLU C C   1 
ATOM   6354  O  O   . GLU C  1 217 ? 35.092 -17.074 -7.046  1.00 56.87 ? 197 GLU C O   1 
ATOM   6355  C  CB  . GLU C  1 217 ? 33.003 -19.276 -8.071  1.00 52.82 ? 197 GLU C CB  1 
ATOM   6356  N  N   . SER C  1 218 ? 36.127 -19.053 -7.231  1.00 52.60 ? 198 SER C N   1 
ATOM   6357  C  CA  . SER C  1 218 ? 37.149 -18.748 -6.206  1.00 51.81 ? 198 SER C CA  1 
ATOM   6358  C  C   . SER C  1 218 ? 38.435 -19.468 -6.557  1.00 51.43 ? 198 SER C C   1 
ATOM   6359  O  O   . SER C  1 218 ? 38.457 -20.705 -6.554  1.00 52.12 ? 198 SER C O   1 
ATOM   6360  C  CB  . SER C  1 218 ? 36.666 -19.180 -4.790  1.00 52.04 ? 198 SER C CB  1 
ATOM   6361  O  OG  . SER C  1 218 ? 37.728 -19.321 -3.829  1.00 49.55 ? 198 SER C OG  1 
ATOM   6362  N  N   . LEU C  1 219 ? 39.492 -18.708 -6.871  1.00 50.04 ? 199 LEU C N   1 
ATOM   6363  C  CA  . LEU C  1 219 ? 40.817 -19.285 -7.102  1.00 49.29 ? 199 LEU C CA  1 
ATOM   6364  C  C   . LEU C  1 219 ? 41.299 -20.143 -5.920  1.00 48.54 ? 199 LEU C C   1 
ATOM   6365  O  O   . LEU C  1 219 ? 41.875 -21.230 -6.130  1.00 48.39 ? 199 LEU C O   1 
ATOM   6366  C  CB  . LEU C  1 219 ? 41.865 -18.184 -7.392  1.00 50.91 ? 199 LEU C CB  1 
ATOM   6367  C  CG  . LEU C  1 219 ? 43.319 -18.645 -7.678  1.00 49.57 ? 199 LEU C CG  1 
ATOM   6368  C  CD1 . LEU C  1 219 ? 43.380 -19.580 -8.870  1.00 46.22 ? 199 LEU C CD1 1 
ATOM   6369  C  CD2 . LEU C  1 219 ? 44.323 -17.470 -7.872  1.00 49.45 ? 199 LEU C CD2 1 
ATOM   6370  N  N   . GLU C  1 220 ? 41.068 -19.644 -4.701  1.00 46.01 ? 200 GLU C N   1 
ATOM   6371  C  CA  . GLU C  1 220 ? 41.444 -20.340 -3.475  1.00 46.34 ? 200 GLU C CA  1 
ATOM   6372  C  C   . GLU C  1 220 ? 40.877 -21.763 -3.413  1.00 43.90 ? 200 GLU C C   1 
ATOM   6373  O  O   . GLU C  1 220 ? 41.619 -22.733 -3.310  1.00 42.09 ? 200 GLU C O   1 
ATOM   6374  C  CB  . GLU C  1 220 ? 40.972 -19.520 -2.261  1.00 46.76 ? 200 GLU C CB  1 
ATOM   6375  C  CG  . GLU C  1 220 ? 41.712 -19.820 -0.962  1.00 52.15 ? 200 GLU C CG  1 
ATOM   6376  C  CD  . GLU C  1 220 ? 40.827 -19.873 0.302   1.00 53.23 ? 200 GLU C CD  1 
ATOM   6377  O  OE1 . GLU C  1 220 ? 39.591 -19.598 0.236   1.00 72.26 ? 200 GLU C OE1 1 
ATOM   6378  O  OE2 . GLU C  1 220 ? 41.382 -20.202 1.384   1.00 55.14 ? 200 GLU C OE2 1 
ATOM   6379  N  N   . GLU C  1 221 ? 39.549 -21.866 -3.503  1.00 46.94 ? 201 GLU C N   1 
ATOM   6380  C  CA  . GLU C  1 221 ? 38.835 -23.148 -3.488  1.00 46.58 ? 201 GLU C CA  1 
ATOM   6381  C  C   . GLU C  1 221 ? 39.235 -24.091 -4.615  1.00 43.39 ? 201 GLU C C   1 
ATOM   6382  O  O   . GLU C  1 221 ? 39.451 -25.260 -4.404  1.00 41.63 ? 201 GLU C O   1 
ATOM   6383  C  CB  . GLU C  1 221 ? 37.334 -22.894 -3.582  1.00 49.15 ? 201 GLU C CB  1 
ATOM   6384  C  CG  . GLU C  1 221 ? 36.642 -22.792 -2.228  1.00 59.75 ? 201 GLU C CG  1 
ATOM   6385  C  CD  . GLU C  1 221 ? 35.550 -21.722 -2.207  1.00 70.59 ? 201 GLU C CD  1 
ATOM   6386  O  OE1 . GLU C  1 221 ? 35.930 -20.527 -2.264  1.00 77.29 ? 201 GLU C OE1 1 
ATOM   6387  O  OE2 . GLU C  1 221 ? 34.335 -22.067 -2.123  1.00 71.64 ? 201 GLU C OE2 1 
ATOM   6388  N  N   . THR C  1 222 ? 39.277 -23.587 -5.832  1.00 42.34 ? 202 THR C N   1 
ATOM   6389  C  CA  . THR C  1 222 ? 39.791 -24.370 -6.945  1.00 44.22 ? 202 THR C CA  1 
ATOM   6390  C  C   . THR C  1 222 ? 41.196 -24.991 -6.721  1.00 45.84 ? 202 THR C C   1 
ATOM   6391  O  O   . THR C  1 222 ? 41.432 -26.174 -7.047  1.00 46.97 ? 202 THR C O   1 
ATOM   6392  C  CB  . THR C  1 222 ? 39.964 -23.481 -8.169  1.00 45.08 ? 202 THR C CB  1 
ATOM   6393  O  OG1 . THR C  1 222 ? 38.835 -22.613 -8.293  1.00 44.68 ? 202 THR C OG1 1 
ATOM   6394  C  CG2 . THR C  1 222 ? 40.159 -24.324 -9.387  1.00 40.05 ? 202 THR C CG2 1 
ATOM   6395  N  N   . LEU C  1 223 ? 42.135 -24.179 -6.236  1.00 42.54 ? 203 LEU C N   1 
ATOM   6396  C  CA  . LEU C  1 223 ? 43.495 -24.670 -6.022  1.00 41.63 ? 203 LEU C CA  1 
ATOM   6397  C  C   . LEU C  1 223 ? 43.491 -25.708 -4.946  1.00 40.83 ? 203 LEU C C   1 
ATOM   6398  O  O   . LEU C  1 223 ? 44.334 -26.627 -4.999  1.00 40.97 ? 203 LEU C O   1 
ATOM   6399  C  CB  . LEU C  1 223 ? 44.448 -23.576 -5.588  1.00 40.52 ? 203 LEU C CB  1 
ATOM   6400  C  CG  . LEU C  1 223 ? 44.865 -22.520 -6.601  1.00 45.91 ? 203 LEU C CG  1 
ATOM   6401  C  CD1 . LEU C  1 223 ? 45.539 -21.358 -5.879  1.00 45.93 ? 203 LEU C CD1 1 
ATOM   6402  C  CD2 . LEU C  1 223 ? 45.771 -23.090 -7.694  1.00 48.75 ? 203 LEU C CD2 1 
ATOM   6403  N  N   . LYS C  1 224 ? 42.575 -25.541 -3.973  1.00 39.77 ? 204 LYS C N   1 
ATOM   6404  C  CA  . LYS C  1 224 ? 42.431 -26.467 -2.837  1.00 41.60 ? 204 LYS C CA  1 
ATOM   6405  C  C   . LYS C  1 224 ? 41.842 -27.844 -3.215  1.00 42.27 ? 204 LYS C C   1 
ATOM   6406  O  O   . LYS C  1 224 ? 42.249 -28.843 -2.653  1.00 46.27 ? 204 LYS C O   1 
ATOM   6407  C  CB  . LYS C  1 224 ? 41.605 -25.820 -1.701  1.00 42.84 ? 204 LYS C CB  1 
ATOM   6408  C  CG  . LYS C  1 224 ? 41.863 -26.379 -0.286  1.00 43.52 ? 204 LYS C CG  1 
ATOM   6409  N  N   . LYS C  1 225 ? 40.867 -27.896 -4.128  1.00 43.47 ? 205 LYS C N   1 
ATOM   6410  C  CA  . LYS C  1 225 ? 40.320 -29.157 -4.627  1.00 42.73 ? 205 LYS C CA  1 
ATOM   6411  C  C   . LYS C  1 225 ? 41.275 -29.803 -5.657  1.00 42.58 ? 205 LYS C C   1 
ATOM   6412  O  O   . LYS C  1 225 ? 41.284 -31.017 -5.822  1.00 45.07 ? 205 LYS C O   1 
ATOM   6413  C  CB  . LYS C  1 225 ? 38.903 -28.966 -5.223  1.00 42.41 ? 205 LYS C CB  1 
ATOM   6414  N  N   . ALA C  1 226 ? 42.075 -29.004 -6.341  1.00 41.96 ? 206 ALA C N   1 
ATOM   6415  C  CA  . ALA C  1 226 ? 43.033 -29.512 -7.338  1.00 42.55 ? 206 ALA C CA  1 
ATOM   6416  C  C   . ALA C  1 226 ? 44.235 -30.246 -6.719  1.00 44.25 ? 206 ALA C C   1 
ATOM   6417  O  O   . ALA C  1 226 ? 44.814 -31.135 -7.341  1.00 46.96 ? 206 ALA C O   1 
ATOM   6418  C  CB  . ALA C  1 226 ? 43.519 -28.379 -8.222  1.00 39.58 ? 206 ALA C CB  1 
ATOM   6419  N  N   . SER C  1 227 ? 44.629 -29.843 -5.517  1.00 44.37 ? 207 SER C N   1 
ATOM   6420  C  CA  . SER C  1 227 ? 45.633 -30.560 -4.739  1.00 44.65 ? 207 SER C CA  1 
ATOM   6421  C  C   . SER C  1 227 ? 45.399 -30.252 -3.266  1.00 45.55 ? 207 SER C C   1 
ATOM   6422  O  O   . SER C  1 227 ? 45.951 -29.276 -2.748  1.00 47.20 ? 207 SER C O   1 
ATOM   6423  C  CB  . SER C  1 227 ? 47.047 -30.129 -5.125  1.00 43.89 ? 207 SER C CB  1 
ATOM   6424  O  OG  . SER C  1 227 ? 47.998 -30.831 -4.337  1.00 44.80 ? 207 SER C OG  1 
ATOM   6425  N  N   . PRO C  1 228 ? 44.578 -31.071 -2.583  1.00 46.38 ? 208 PRO C N   1 
ATOM   6426  C  CA  . PRO C  1 228 ? 44.200 -30.742 -1.197  1.00 46.58 ? 208 PRO C CA  1 
ATOM   6427  C  C   . PRO C  1 228 ? 45.347 -30.793 -0.172  1.00 45.27 ? 208 PRO C C   1 
ATOM   6428  O  O   . PRO C  1 228 ? 45.223 -30.213 0.905   1.00 45.31 ? 208 PRO C O   1 
ATOM   6429  C  CB  . PRO C  1 228 ? 43.127 -31.794 -0.881  1.00 46.27 ? 208 PRO C CB  1 
ATOM   6430  C  CG  . PRO C  1 228 ? 42.693 -32.318 -2.197  1.00 45.54 ? 208 PRO C CG  1 
ATOM   6431  C  CD  . PRO C  1 228 ? 43.928 -32.319 -3.019  1.00 46.29 ? 208 PRO C CD  1 
ATOM   6432  N  N   . ASP C  1 229 ? 46.366 -31.566 -0.531  1.00 45.62 ? 209 ASP C N   1 
ATOM   6433  C  CA  . ASP C  1 229 ? 47.705 -31.688 0.053   1.00 47.47 ? 209 ASP C CA  1 
ATOM   6434  C  C   . ASP C  1 229 ? 48.553 -30.392 -0.042  1.00 46.34 ? 209 ASP C C   1 
ATOM   6435  O  O   . ASP C  1 229 ? 49.480 -30.171 0.737   1.00 47.27 ? 209 ASP C O   1 
ATOM   6436  C  CB  . ASP C  1 229 ? 48.432 -32.697 -0.863  1.00 51.18 ? 209 ASP C CB  1 
ATOM   6437  C  CG  . ASP C  1 229 ? 49.007 -33.879 -0.143  1.00 61.51 ? 209 ASP C CG  1 
ATOM   6438  O  OD1 . ASP C  1 229 ? 50.208 -34.149 -0.417  1.00 72.28 ? 209 ASP C OD1 1 
ATOM   6439  O  OD2 . ASP C  1 229 ? 48.258 -34.567 0.612   1.00 67.98 ? 209 ASP C OD2 1 
ATOM   6440  N  N   . GLY C  1 230 ? 48.295 -29.593 -1.073  1.00 42.84 ? 210 GLY C N   1 
ATOM   6441  C  CA  . GLY C  1 230 ? 49.091 -28.421 -1.358  1.00 42.78 ? 210 GLY C CA  1 
ATOM   6442  C  C   . GLY C  1 230 ? 50.118 -28.683 -2.442  1.00 41.98 ? 210 GLY C C   1 
ATOM   6443  O  O   . GLY C  1 230 ? 50.111 -29.754 -3.063  1.00 40.71 ? 210 GLY C O   1 
ATOM   6444  N  N   . TYR C  1 231 ? 51.015 -27.706 -2.635  1.00 43.11 ? 211 TYR C N   1 
ATOM   6445  C  CA  . TYR C  1 231 ? 51.984 -27.704 -3.748  1.00 43.04 ? 211 TYR C CA  1 
ATOM   6446  C  C   . TYR C  1 231 ? 53.417 -27.725 -3.261  1.00 41.99 ? 211 TYR C C   1 
ATOM   6447  O  O   . TYR C  1 231 ? 53.799 -26.949 -2.381  1.00 41.27 ? 211 TYR C O   1 
ATOM   6448  C  CB  . TYR C  1 231 ? 51.739 -26.497 -4.648  1.00 44.60 ? 211 TYR C CB  1 
ATOM   6449  C  CG  . TYR C  1 231 ? 50.348 -26.537 -5.190  1.00 47.73 ? 211 TYR C CG  1 
ATOM   6450  C  CD1 . TYR C  1 231 ? 50.089 -27.117 -6.427  1.00 45.47 ? 211 TYR C CD1 1 
ATOM   6451  C  CD2 . TYR C  1 231 ? 49.271 -26.075 -4.429  1.00 49.91 ? 211 TYR C CD2 1 
ATOM   6452  C  CE1 . TYR C  1 231 ? 48.801 -27.220 -6.914  1.00 45.48 ? 211 TYR C CE1 1 
ATOM   6453  C  CE2 . TYR C  1 231 ? 47.971 -26.176 -4.907  1.00 42.70 ? 211 TYR C CE2 1 
ATOM   6454  C  CZ  . TYR C  1 231 ? 47.748 -26.751 -6.151  1.00 42.55 ? 211 TYR C CZ  1 
ATOM   6455  O  OH  . TYR C  1 231 ? 46.486 -26.846 -6.666  1.00 40.07 ? 211 TYR C OH  1 
ATOM   6456  N  N   . ASP C  1 232 ? 54.206 -28.621 -3.845  1.00 42.21 ? 212 ASP C N   1 
ATOM   6457  C  CA  . ASP C  1 232 ? 55.635 -28.718 -3.554  1.00 43.69 ? 212 ASP C CA  1 
ATOM   6458  C  C   . ASP C  1 232 ? 56.383 -27.589 -4.222  1.00 43.73 ? 212 ASP C C   1 
ATOM   6459  O  O   . ASP C  1 232 ? 57.246 -26.998 -3.601  1.00 42.29 ? 212 ASP C O   1 
ATOM   6460  C  CB  . ASP C  1 232 ? 56.198 -30.047 -4.080  1.00 45.49 ? 212 ASP C CB  1 
ATOM   6461  C  CG  . ASP C  1 232 ? 55.617 -31.253 -3.354  1.00 49.86 ? 212 ASP C CG  1 
ATOM   6462  O  OD1 . ASP C  1 232 ? 54.901 -32.067 -4.003  1.00 51.00 ? 212 ASP C OD1 1 
ATOM   6463  O  OD2 . ASP C  1 232 ? 55.862 -31.357 -2.123  1.00 55.39 ? 212 ASP C OD2 1 
ATOM   6464  N  N   . CYS C  1 233 ? 56.028 -27.329 -5.488  1.00 43.42 ? 213 CYS C N   1 
ATOM   6465  C  CA  . CYS C  1 233 ? 56.713 -26.386 -6.371  1.00 43.45 ? 213 CYS C CA  1 
ATOM   6466  C  C   . CYS C  1 233 ? 55.747 -25.495 -7.079  1.00 40.20 ? 213 CYS C C   1 
ATOM   6467  O  O   . CYS C  1 233 ? 54.726 -25.945 -7.518  1.00 38.97 ? 213 CYS C O   1 
ATOM   6468  C  CB  . CYS C  1 233 ? 57.467 -27.131 -7.464  1.00 44.64 ? 213 CYS C CB  1 
ATOM   6469  S  SG  . CYS C  1 233 ? 58.707 -28.237 -6.770  1.00 58.81 ? 213 CYS C SG  1 
ATOM   6470  N  N   . TYR C  1 234 ? 56.115 -24.229 -7.213  1.00 39.64 ? 214 TYR C N   1 
ATOM   6471  C  CA  . TYR C  1 234 ? 55.340 -23.250 -7.939  1.00 40.71 ? 214 TYR C CA  1 
ATOM   6472  C  C   . TYR C  1 234 ? 56.239 -22.593 -8.969  1.00 38.44 ? 214 TYR C C   1 
ATOM   6473  O  O   . TYR C  1 234 ? 57.261 -22.071 -8.651  1.00 39.97 ? 214 TYR C O   1 
ATOM   6474  C  CB  . TYR C  1 234 ? 54.780 -22.203 -6.954  1.00 39.92 ? 214 TYR C CB  1 
ATOM   6475  C  CG  . TYR C  1 234 ? 53.923 -21.079 -7.532  1.00 37.80 ? 214 TYR C CG  1 
ATOM   6476  C  CD1 . TYR C  1 234 ? 53.122 -21.247 -8.671  1.00 39.64 ? 214 TYR C CD1 1 
ATOM   6477  C  CD2 . TYR C  1 234 ? 53.895 -19.848 -6.904  1.00 32.02 ? 214 TYR C CD2 1 
ATOM   6478  C  CE1 . TYR C  1 234 ? 52.385 -20.179 -9.173  1.00 39.45 ? 214 TYR C CE1 1 
ATOM   6479  C  CE2 . TYR C  1 234 ? 53.175 -18.800 -7.397  1.00 43.81 ? 214 TYR C CE2 1 
ATOM   6480  C  CZ  . TYR C  1 234 ? 52.410 -18.952 -8.504  1.00 35.64 ? 214 TYR C CZ  1 
ATOM   6481  O  OH  . TYR C  1 234 ? 51.664 -17.839 -8.902  1.00 39.06 ? 214 TYR C OH  1 
ATOM   6482  N  N   . PHE C  1 235 ? 55.819 -22.641 -10.210 1.00 38.49 ? 215 PHE C N   1 
ATOM   6483  C  CA  . PHE C  1 235 ? 56.494 -22.000 -11.277 1.00 37.31 ? 215 PHE C CA  1 
ATOM   6484  C  C   . PHE C  1 235 ? 55.649 -20.767 -11.720 1.00 37.94 ? 215 PHE C C   1 
ATOM   6485  O  O   . PHE C  1 235 ? 54.632 -20.853 -12.432 1.00 35.07 ? 215 PHE C O   1 
ATOM   6486  C  CB  . PHE C  1 235 ? 56.788 -23.011 -12.386 1.00 37.32 ? 215 PHE C CB  1 
ATOM   6487  C  CG  . PHE C  1 235 ? 57.724 -22.481 -13.462 1.00 42.67 ? 215 PHE C CG  1 
ATOM   6488  C  CD1 . PHE C  1 235 ? 58.954 -23.041 -13.657 1.00 44.23 ? 215 PHE C CD1 1 
ATOM   6489  C  CD2 . PHE C  1 235 ? 57.339 -21.428 -14.294 1.00 39.47 ? 215 PHE C CD2 1 
ATOM   6490  C  CE1 . PHE C  1 235 ? 59.771 -22.560 -14.634 1.00 44.05 ? 215 PHE C CE1 1 
ATOM   6491  C  CE2 . PHE C  1 235 ? 58.159 -20.954 -15.255 1.00 39.91 ? 215 PHE C CE2 1 
ATOM   6492  C  CZ  . PHE C  1 235 ? 59.357 -21.496 -15.437 1.00 41.05 ? 215 PHE C CZ  1 
ATOM   6493  N  N   . ASP C  1 236 ? 56.122 -19.617 -11.259 1.00 38.93 ? 216 ASP C N   1 
ATOM   6494  C  CA  . ASP C  1 236 ? 55.405 -18.385 -11.304 1.00 39.55 ? 216 ASP C CA  1 
ATOM   6495  C  C   . ASP C  1 236 ? 55.861 -17.505 -12.479 1.00 40.76 ? 216 ASP C C   1 
ATOM   6496  O  O   . ASP C  1 236 ? 57.039 -17.064 -12.557 1.00 37.28 ? 216 ASP C O   1 
ATOM   6497  C  CB  . ASP C  1 236 ? 55.567 -17.629 -9.979  1.00 38.48 ? 216 ASP C CB  1 
ATOM   6498  C  CG  . ASP C  1 236 ? 54.682 -16.359 -9.908  1.00 45.55 ? 216 ASP C CG  1 
ATOM   6499  O  OD1 . ASP C  1 236 ? 53.747 -16.182 -10.745 1.00 45.37 ? 216 ASP C OD1 1 
ATOM   6500  O  OD2 . ASP C  1 236 ? 54.948 -15.518 -9.022  1.00 42.14 ? 216 ASP C OD2 1 
ATOM   6501  N  N   . ASN C  1 237 ? 54.865 -17.228 -13.333 1.00 40.67 ? 217 ASN C N   1 
ATOM   6502  C  CA  . ASN C  1 237 ? 54.966 -16.371 -14.493 1.00 44.93 ? 217 ASN C CA  1 
ATOM   6503  C  C   . ASN C  1 237 ? 54.209 -15.056 -14.383 1.00 45.58 ? 217 ASN C C   1 
ATOM   6504  O  O   . ASN C  1 237 ? 54.501 -14.118 -15.154 1.00 45.15 ? 217 ASN C O   1 
ATOM   6505  C  CB  . ASN C  1 237 ? 54.384 -17.096 -15.690 1.00 45.37 ? 217 ASN C CB  1 
ATOM   6506  C  CG  . ASN C  1 237 ? 55.289 -18.142 -16.196 1.00 48.10 ? 217 ASN C CG  1 
ATOM   6507  O  OD1 . ASN C  1 237 ? 56.462 -17.833 -16.469 1.00 47.03 ? 217 ASN C OD1 1 
ATOM   6508  N  ND2 . ASN C  1 237 ? 54.782 -19.404 -16.322 1.00 38.42 ? 217 ASN C ND2 1 
ATOM   6509  N  N   . VAL C  1 238 ? 53.234 -15.013 -13.461 1.00 46.30 ? 218 VAL C N   1 
ATOM   6510  C  CA  . VAL C  1 238 ? 52.192 -13.995 -13.473 1.00 45.01 ? 218 VAL C CA  1 
ATOM   6511  C  C   . VAL C  1 238 ? 52.273 -13.057 -12.290 1.00 43.48 ? 218 VAL C C   1 
ATOM   6512  O  O   . VAL C  1 238 ? 51.970 -11.905 -12.424 1.00 46.49 ? 218 VAL C O   1 
ATOM   6513  C  CB  . VAL C  1 238 ? 50.705 -14.551 -13.671 1.00 46.43 ? 218 VAL C CB  1 
ATOM   6514  C  CG1 . VAL C  1 238 ? 50.630 -15.678 -14.688 1.00 44.38 ? 218 VAL C CG1 1 
ATOM   6515  C  CG2 . VAL C  1 238 ? 50.014 -14.929 -12.383 1.00 53.44 ? 218 VAL C CG2 1 
ATOM   6516  N  N   . GLY C  1 239 ? 52.641 -13.556 -11.121 1.00 44.60 ? 219 GLY C N   1 
ATOM   6517  C  CA  . GLY C  1 239 ? 52.784 -12.710 -9.941  1.00 44.36 ? 219 GLY C CA  1 
ATOM   6518  C  C   . GLY C  1 239 ? 51.455 -12.174 -9.432  1.00 44.22 ? 219 GLY C C   1 
ATOM   6519  O  O   . GLY C  1 239 ? 50.386 -12.720 -9.726  1.00 42.38 ? 219 GLY C O   1 
ATOM   6520  N  N   . GLY C  1 240 ? 51.540 -11.089 -8.665  1.00 47.23 ? 220 GLY C N   1 
ATOM   6521  C  CA  . GLY C  1 240 ? 50.361 -10.382 -8.143  1.00 48.86 ? 220 GLY C CA  1 
ATOM   6522  C  C   . GLY C  1 240 ? 49.544 -11.196 -7.154  1.00 50.32 ? 220 GLY C C   1 
ATOM   6523  O  O   . GLY C  1 240 ? 50.086 -12.018 -6.400  1.00 54.18 ? 220 GLY C O   1 
ATOM   6524  N  N   . GLU C  1 241 ? 48.240 -10.966 -7.165  1.00 51.37 ? 221 GLU C N   1 
ATOM   6525  C  CA  . GLU C  1 241 ? 47.338 -11.576 -6.193  1.00 54.12 ? 221 GLU C CA  1 
ATOM   6526  C  C   . GLU C  1 241 ? 47.084 -13.066 -6.469  1.00 48.48 ? 221 GLU C C   1 
ATOM   6527  O  O   . GLU C  1 241 ? 46.826 -13.844 -5.572  1.00 46.15 ? 221 GLU C O   1 
ATOM   6528  C  CB  . GLU C  1 241 ? 46.056 -10.728 -6.047  1.00 50.63 ? 221 GLU C CB  1 
ATOM   6529  C  CG  . GLU C  1 241 ? 46.109 -9.831  -4.783  1.00 61.61 ? 221 GLU C CG  1 
ATOM   6530  C  CD  . GLU C  1 241 ? 44.829 -8.978  -4.558  1.00 69.65 ? 221 GLU C CD  1 
ATOM   6531  O  OE1 . GLU C  1 241 ? 44.917 -7.894  -3.901  1.00 82.33 ? 221 GLU C OE1 1 
ATOM   6532  O  OE2 . GLU C  1 241 ? 43.732 -9.387  -5.041  1.00 89.85 ? 221 GLU C OE2 1 
ATOM   6533  N  N   . PHE C  1 242 ? 47.219 -13.472 -7.715  1.00 48.06 ? 222 PHE C N   1 
ATOM   6534  C  CA  . PHE C  1 242 ? 47.255 -14.888 -8.058  1.00 46.69 ? 222 PHE C CA  1 
ATOM   6535  C  C   . PHE C  1 242 ? 48.373 -15.641 -7.308  1.00 44.82 ? 222 PHE C C   1 
ATOM   6536  O  O   . PHE C  1 242 ? 48.124 -16.708 -6.758  1.00 42.66 ? 222 PHE C O   1 
ATOM   6537  C  CB  . PHE C  1 242 ? 47.447 -15.045 -9.576  1.00 49.78 ? 222 PHE C CB  1 
ATOM   6538  C  CG  . PHE C  1 242 ? 47.265 -16.447 -10.062 1.00 50.98 ? 222 PHE C CG  1 
ATOM   6539  C  CD1 . PHE C  1 242 ? 46.166 -16.791 -10.841 1.00 54.35 ? 222 PHE C CD1 1 
ATOM   6540  C  CD2 . PHE C  1 242 ? 48.177 -17.441 -9.727  1.00 50.04 ? 222 PHE C CD2 1 
ATOM   6541  C  CE1 . PHE C  1 242 ? 45.987 -18.106 -11.279 1.00 47.93 ? 222 PHE C CE1 1 
ATOM   6542  C  CE2 . PHE C  1 242 ? 48.000 -18.731 -10.158 1.00 51.43 ? 222 PHE C CE2 1 
ATOM   6543  C  CZ  . PHE C  1 242 ? 46.904 -19.068 -10.930 1.00 48.15 ? 222 PHE C CZ  1 
ATOM   6544  N  N   . SER C  1 243 ? 49.600 -15.097 -7.302  1.00 41.77 ? 223 SER C N   1 
ATOM   6545  C  CA  . SER C  1 243 ? 50.666 -15.636 -6.459  1.00 41.69 ? 223 SER C CA  1 
ATOM   6546  C  C   . SER C  1 243 ? 50.389 -15.563 -4.955  1.00 40.33 ? 223 SER C C   1 
ATOM   6547  O  O   . SER C  1 243 ? 50.728 -16.511 -4.225  1.00 41.11 ? 223 SER C O   1 
ATOM   6548  C  CB  . SER C  1 243 ? 52.040 -15.021 -6.768  1.00 40.86 ? 223 SER C CB  1 
ATOM   6549  O  OG  . SER C  1 243 ? 52.381 -15.185 -8.136  1.00 44.46 ? 223 SER C OG  1 
ATOM   6550  N  N   . ASN C  1 244 ? 49.805 -14.484 -4.450  1.00 39.81 ? 224 ASN C N   1 
ATOM   6551  C  CA  . ASN C  1 244 ? 49.474 -14.478 -2.999  1.00 40.91 ? 224 ASN C CA  1 
ATOM   6552  C  C   . ASN C  1 244 ? 48.548 -15.628 -2.601  1.00 43.36 ? 224 ASN C C   1 
ATOM   6553  O  O   . ASN C  1 244 ? 48.644 -16.160 -1.505  1.00 47.20 ? 224 ASN C O   1 
ATOM   6554  C  CB  . ASN C  1 244 ? 48.847 -13.160 -2.569  1.00 41.94 ? 224 ASN C CB  1 
ATOM   6555  C  CG  . ASN C  1 244 ? 49.749 -12.007 -2.822  1.00 40.19 ? 224 ASN C CG  1 
ATOM   6556  O  OD1 . ASN C  1 244 ? 50.936 -12.217 -2.957  1.00 36.27 ? 224 ASN C OD1 1 
ATOM   6557  N  ND2 . ASN C  1 244 ? 49.195 -10.783 -2.953  1.00 41.84 ? 224 ASN C ND2 1 
ATOM   6558  N  N   . THR C  1 245 ? 47.653 -16.013 -3.498  1.00 45.40 ? 225 THR C N   1 
ATOM   6559  C  CA  . THR C  1 245 ? 46.731 -17.110 -3.239  1.00 46.35 ? 225 THR C CA  1 
ATOM   6560  C  C   . THR C  1 245 ? 47.458 -18.456 -3.225  1.00 44.36 ? 225 THR C C   1 
ATOM   6561  O  O   . THR C  1 245 ? 47.372 -19.215 -2.265  1.00 45.98 ? 225 THR C O   1 
ATOM   6562  C  CB  . THR C  1 245 ? 45.587 -17.127 -4.260  1.00 48.67 ? 225 THR C CB  1 
ATOM   6563  O  OG1 . THR C  1 245 ? 45.064 -15.795 -4.397  1.00 50.95 ? 225 THR C OG1 1 
ATOM   6564  C  CG2 . THR C  1 245 ? 44.462 -18.085 -3.813  1.00 49.57 ? 225 THR C CG2 1 
ATOM   6565  N  N   . VAL C  1 246 ? 48.194 -18.742 -4.278  1.00 44.29 ? 226 VAL C N   1 
ATOM   6566  C  CA  . VAL C  1 246 ? 49.028 -19.939 -4.312  1.00 43.79 ? 226 VAL C CA  1 
ATOM   6567  C  C   . VAL C  1 246 ? 49.959 -20.133 -3.093  1.00 43.27 ? 226 VAL C C   1 
ATOM   6568  O  O   . VAL C  1 246 ? 50.027 -21.215 -2.525  1.00 43.48 ? 226 VAL C O   1 
ATOM   6569  C  CB  . VAL C  1 246 ? 49.897 -19.931 -5.524  1.00 42.52 ? 226 VAL C CB  1 
ATOM   6570  C  CG1 . VAL C  1 246 ? 50.816 -21.184 -5.504  1.00 44.20 ? 226 VAL C CG1 1 
ATOM   6571  C  CG2 . VAL C  1 246 ? 49.019 -19.904 -6.786  1.00 41.88 ? 226 VAL C CG2 1 
ATOM   6572  N  N   . ILE C  1 247 ? 50.671 -19.087 -2.718  1.00 42.05 ? 227 ILE C N   1 
ATOM   6573  C  CA  . ILE C  1 247 ? 51.550 -19.106 -1.535  1.00 45.21 ? 227 ILE C CA  1 
ATOM   6574  C  C   . ILE C  1 247 ? 50.859 -19.614 -0.278  1.00 43.93 ? 227 ILE C C   1 
ATOM   6575  O  O   . ILE C  1 247 ? 51.495 -20.278 0.560   1.00 48.19 ? 227 ILE C O   1 
ATOM   6576  C  CB  . ILE C  1 247 ? 52.199 -17.692 -1.273  1.00 42.43 ? 227 ILE C CB  1 
ATOM   6577  C  CG1 . ILE C  1 247 ? 53.444 -17.551 -2.145  1.00 50.00 ? 227 ILE C CG1 1 
ATOM   6578  C  CG2 . ILE C  1 247 ? 52.578 -17.521 0.142   1.00 44.32 ? 227 ILE C CG2 1 
ATOM   6579  C  CD1 . ILE C  1 247 ? 53.881 -16.122 -2.405  1.00 50.93 ? 227 ILE C CD1 1 
ATOM   6580  N  N   . GLY C  1 248 ? 49.570 -19.312 -0.139  1.00 42.08 ? 228 GLY C N   1 
ATOM   6581  C  CA  . GLY C  1 248 ? 48.762 -19.872 0.946   1.00 41.11 ? 228 GLY C CA  1 
ATOM   6582  C  C   . GLY C  1 248 ? 48.528 -21.385 0.876   1.00 41.03 ? 228 GLY C C   1 
ATOM   6583  O  O   . GLY C  1 248 ? 47.932 -21.952 1.781   1.00 38.22 ? 228 GLY C O   1 
ATOM   6584  N  N   . GLN C  1 249 ? 48.970 -22.037 -0.206  1.00 41.78 ? 229 GLN C N   1 
ATOM   6585  C  CA  . GLN C  1 249 ? 48.788 -23.461 -0.364  1.00 42.92 ? 229 GLN C CA  1 
ATOM   6586  C  C   . GLN C  1 249 ? 50.046 -24.256 -0.660  1.00 41.51 ? 229 GLN C C   1 
ATOM   6587  O  O   . GLN C  1 249 ? 49.985 -25.463 -0.893  1.00 40.81 ? 229 GLN C O   1 
ATOM   6588  C  CB  . GLN C  1 249 ? 47.734 -23.681 -1.433  1.00 47.70 ? 229 GLN C CB  1 
ATOM   6589  C  CG  . GLN C  1 249 ? 46.472 -22.909 -1.091  1.00 49.87 ? 229 GLN C CG  1 
ATOM   6590  C  CD  . GLN C  1 249 ? 45.287 -23.434 -1.752  1.00 48.49 ? 229 GLN C CD  1 
ATOM   6591  O  OE1 . GLN C  1 249 ? 45.296 -24.560 -2.226  1.00 49.82 ? 229 GLN C OE1 1 
ATOM   6592  N  NE2 . GLN C  1 249 ? 44.233 -22.623 -1.811  1.00 50.29 ? 229 GLN C NE2 1 
ATOM   6593  N  N   . MET C  1 250 ? 51.190 -23.590 -0.567  1.00 42.44 ? 230 MET C N   1 
ATOM   6594  C  CA  . MET C  1 250 ? 52.490 -24.237 -0.635  1.00 39.68 ? 230 MET C CA  1 
ATOM   6595  C  C   . MET C  1 250 ? 52.687 -25.138 0.557   1.00 41.11 ? 230 MET C C   1 
ATOM   6596  O  O   . MET C  1 250 ? 52.336 -24.789 1.682   1.00 42.22 ? 230 MET C O   1 
ATOM   6597  C  CB  . MET C  1 250 ? 53.626 -23.229 -0.656  1.00 38.37 ? 230 MET C CB  1 
ATOM   6598  C  CG  . MET C  1 250 ? 53.686 -22.295 -1.856  1.00 41.11 ? 230 MET C CG  1 
ATOM   6599  S  SD  . MET C  1 250 ? 53.686 -23.095 -3.443  1.00 42.77 ? 230 MET C SD  1 
ATOM   6600  C  CE  . MET C  1 250 ? 55.305 -23.850 -3.395  1.00 42.30 ? 230 MET C CE  1 
ATOM   6601  N  N   . LYS C  1 251 ? 53.270 -26.296 0.293   1.00 41.22 ? 231 LYS C N   1 
ATOM   6602  C  CA  . LYS C  1 251 ? 53.748 -27.152 1.330   1.00 43.00 ? 231 LYS C CA  1 
ATOM   6603  C  C   . LYS C  1 251 ? 54.941 -26.502 2.080   1.00 42.83 ? 231 LYS C C   1 
ATOM   6604  O  O   . LYS C  1 251 ? 55.624 -25.570 1.578   1.00 41.83 ? 231 LYS C O   1 
ATOM   6605  C  CB  . LYS C  1 251 ? 54.159 -28.505 0.733   1.00 43.15 ? 231 LYS C CB  1 
ATOM   6606  C  CG  . LYS C  1 251 ? 52.987 -29.388 0.331   1.00 40.79 ? 231 LYS C CG  1 
ATOM   6607  C  CD  . LYS C  1 251 ? 53.449 -30.813 0.081   1.00 44.49 ? 231 LYS C CD  1 
ATOM   6608  C  CE  . LYS C  1 251 ? 52.727 -31.427 -1.085  1.00 53.36 ? 231 LYS C CE  1 
ATOM   6609  N  NZ  . LYS C  1 251 ? 52.942 -32.912 -1.116  1.00 65.01 ? 231 LYS C NZ  1 
ATOM   6610  N  N   . LYS C  1 252 ? 55.152 -27.013 3.285   1.00 40.35 ? 232 LYS C N   1 
ATOM   6611  C  CA  . LYS C  1 252 ? 56.281 -26.662 4.117   1.00 39.50 ? 232 LYS C CA  1 
ATOM   6612  C  C   . LYS C  1 252 ? 57.599 -26.850 3.349   1.00 38.69 ? 232 LYS C C   1 
ATOM   6613  O  O   . LYS C  1 252 ? 57.801 -27.904 2.783   1.00 39.62 ? 232 LYS C O   1 
ATOM   6614  C  CB  . LYS C  1 252 ? 56.218 -27.541 5.360   1.00 39.57 ? 232 LYS C CB  1 
ATOM   6615  C  CG  . LYS C  1 252 ? 57.234 -27.254 6.439   1.00 47.82 ? 232 LYS C CG  1 
ATOM   6616  C  CD  . LYS C  1 252 ? 56.622 -26.505 7.573   1.00 49.51 ? 232 LYS C CD  1 
ATOM   6617  C  CE  . LYS C  1 252 ? 57.657 -26.247 8.685   1.00 49.19 ? 232 LYS C CE  1 
ATOM   6618  N  NZ  . LYS C  1 252 ? 56.996 -26.526 10.043  1.00 54.46 ? 232 LYS C NZ  1 
ATOM   6619  N  N   . PHE C  1 253 ? 58.483 -25.840 3.334   1.00 36.43 ? 233 PHE C N   1 
ATOM   6620  C  CA  . PHE C  1 253 ? 59.709 -25.824 2.501   1.00 37.01 ? 233 PHE C CA  1 
ATOM   6621  C  C   . PHE C  1 253 ? 59.415 -25.900 0.990   1.00 40.19 ? 233 PHE C C   1 
ATOM   6622  O  O   . PHE C  1 253 ? 60.192 -26.491 0.212   1.00 44.82 ? 233 PHE C O   1 
ATOM   6623  C  CB  . PHE C  1 253 ? 60.704 -26.952 2.862   1.00 37.82 ? 233 PHE C CB  1 
ATOM   6624  C  CG  . PHE C  1 253 ? 60.906 -27.163 4.352   1.00 32.53 ? 233 PHE C CG  1 
ATOM   6625  C  CD1 . PHE C  1 253 ? 61.654 -26.265 5.099   1.00 37.58 ? 233 PHE C CD1 1 
ATOM   6626  C  CD2 . PHE C  1 253 ? 60.374 -28.276 4.984   1.00 32.45 ? 233 PHE C CD2 1 
ATOM   6627  C  CE1 . PHE C  1 253 ? 61.847 -26.457 6.472   1.00 39.42 ? 233 PHE C CE1 1 
ATOM   6628  C  CE2 . PHE C  1 253 ? 60.549 -28.471 6.364   1.00 40.62 ? 233 PHE C CE2 1 
ATOM   6629  C  CZ  . PHE C  1 253 ? 61.292 -27.564 7.096   1.00 40.89 ? 233 PHE C CZ  1 
ATOM   6630  N  N   . GLY C  1 254 ? 58.302 -25.329 0.578   1.00 38.02 ? 234 GLY C N   1 
ATOM   6631  C  CA  . GLY C  1 254 ? 57.908 -25.301 -0.818  1.00 40.05 ? 234 GLY C CA  1 
ATOM   6632  C  C   . GLY C  1 254 ? 58.813 -24.348 -1.555  1.00 39.16 ? 234 GLY C C   1 
ATOM   6633  O  O   . GLY C  1 254 ? 59.304 -23.401 -0.977  1.00 39.26 ? 234 GLY C O   1 
ATOM   6634  N  N   . ARG C  1 255 ? 59.037 -24.651 -2.831  1.00 42.35 ? 235 ARG C N   1 
ATOM   6635  C  CA  . ARG C  1 255 ? 59.923 -23.927 -3.715  1.00 42.61 ? 235 ARG C CA  1 
ATOM   6636  C  C   . ARG C  1 255 ? 59.154 -23.194 -4.774  1.00 41.54 ? 235 ARG C C   1 
ATOM   6637  O  O   . ARG C  1 255 ? 58.365 -23.778 -5.473  1.00 39.39 ? 235 ARG C O   1 
ATOM   6638  C  CB  . ARG C  1 255 ? 60.904 -24.863 -4.412  1.00 44.00 ? 235 ARG C CB  1 
ATOM   6639  C  CG  . ARG C  1 255 ? 61.968 -25.430 -3.502  1.00 44.15 ? 235 ARG C CG  1 
ATOM   6640  C  CD  . ARG C  1 255 ? 61.536 -26.813 -3.042  1.00 51.36 ? 235 ARG C CD  1 
ATOM   6641  N  NE  . ARG C  1 255 ? 61.567 -27.741 -4.170  1.00 66.63 ? 235 ARG C NE  1 
ATOM   6642  C  CZ  . ARG C  1 255 ? 60.922 -28.909 -4.247  1.00 64.67 ? 235 ARG C CZ  1 
ATOM   6643  N  NH1 . ARG C  1 255 ? 60.158 -29.346 -3.243  1.00 59.55 ? 235 ARG C NH1 1 
ATOM   6644  N  NH2 . ARG C  1 255 ? 61.053 -29.644 -5.356  1.00 55.95 ? 235 ARG C NH2 1 
ATOM   6645  N  N   . ILE C  1 256 ? 59.429 -21.898 -4.869  1.00 40.50 ? 236 ILE C N   1 
ATOM   6646  C  CA  . ILE C  1 256 ? 58.933 -21.053 -5.904  1.00 39.79 ? 236 ILE C CA  1 
ATOM   6647  C  C   . ILE C  1 256 ? 60.072 -20.631 -6.821  1.00 39.73 ? 236 ILE C C   1 
ATOM   6648  O  O   . ILE C  1 256 ? 61.066 -20.078 -6.369  1.00 39.69 ? 236 ILE C O   1 
ATOM   6649  C  CB  . ILE C  1 256 ? 58.240 -19.802 -5.286  1.00 38.75 ? 236 ILE C CB  1 
ATOM   6650  C  CG1 . ILE C  1 256 ? 57.305 -20.255 -4.155  1.00 40.97 ? 236 ILE C CG1 1 
ATOM   6651  C  CG2 . ILE C  1 256 ? 57.465 -18.976 -6.350  1.00 34.98 ? 236 ILE C CG2 1 
ATOM   6652  C  CD1 . ILE C  1 256 ? 56.389 -19.182 -3.643  1.00 44.80 ? 236 ILE C CD1 1 
ATOM   6653  N  N   . ALA C  1 257 ? 59.874 -20.877 -8.119  1.00 41.94 ? 237 ALA C N   1 
ATOM   6654  C  CA  . ALA C  1 257 ? 60.652 -20.300 -9.205  1.00 41.02 ? 237 ALA C CA  1 
ATOM   6655  C  C   . ALA C  1 257 ? 59.956 -19.060 -9.749  1.00 39.48 ? 237 ALA C C   1 
ATOM   6656  O  O   . ALA C  1 257 ? 58.922 -19.146 -10.427 1.00 40.71 ? 237 ALA C O   1 
ATOM   6657  C  CB  . ALA C  1 257 ? 60.866 -21.341 -10.361 1.00 41.65 ? 237 ALA C CB  1 
ATOM   6658  N  N   . ILE C  1 258 ? 60.571 -17.911 -9.516  1.00 40.06 ? 238 ILE C N   1 
ATOM   6659  C  CA  . ILE C  1 258 ? 60.097 -16.660 -10.074 1.00 41.85 ? 238 ILE C CA  1 
ATOM   6660  C  C   . ILE C  1 258 ? 60.720 -16.362 -11.441 1.00 40.21 ? 238 ILE C C   1 
ATOM   6661  O  O   . ILE C  1 258 ? 61.862 -15.994 -11.597 1.00 40.68 ? 238 ILE C O   1 
ATOM   6662  C  CB  . ILE C  1 258 ? 60.260 -15.515 -9.087  1.00 41.79 ? 238 ILE C CB  1 
ATOM   6663  C  CG1 . ILE C  1 258 ? 59.704 -15.938 -7.733  1.00 45.37 ? 238 ILE C CG1 1 
ATOM   6664  C  CG2 . ILE C  1 258 ? 59.527 -14.297 -9.611  1.00 46.83 ? 238 ILE C CG2 1 
ATOM   6665  C  CD1 . ILE C  1 258 ? 60.397 -15.283 -6.573  1.00 51.57 ? 238 ILE C CD1 1 
ATOM   6666  N  N   . CYS C  1 259 ? 59.892 -16.566 -12.435 1.00 45.44 ? 239 CYS C N   1 
ATOM   6667  C  CA  . CYS C  1 259 ? 60.219 -16.425 -13.836 1.00 46.60 ? 239 CYS C CA  1 
ATOM   6668  C  C   . CYS C  1 259 ? 59.706 -15.073 -14.440 1.00 45.92 ? 239 CYS C C   1 
ATOM   6669  O  O   . CYS C  1 259 ? 60.430 -14.314 -15.094 1.00 46.49 ? 239 CYS C O   1 
ATOM   6670  C  CB  . CYS C  1 259 ? 59.510 -17.586 -14.519 1.00 49.04 ? 239 CYS C CB  1 
ATOM   6671  S  SG  . CYS C  1 259 ? 59.949 -17.758 -16.179 1.00 44.37 ? 239 CYS C SG  1 
ATOM   6672  N  N   . GLY C  1 260 ? 58.452 -14.779 -14.191 1.00 43.13 ? 240 GLY C N   1 
ATOM   6673  C  CA  . GLY C  1 260 ? 57.884 -13.524 -14.629 1.00 43.66 ? 240 GLY C CA  1 
ATOM   6674  C  C   . GLY C  1 260 ? 56.826 -13.079 -13.672 1.00 43.67 ? 240 GLY C C   1 
ATOM   6675  O  O   . GLY C  1 260 ? 56.522 -13.765 -12.669 1.00 43.68 ? 240 GLY C O   1 
ATOM   6676  N  N   . ALA C  1 261 ? 56.284 -11.907 -13.983 1.00 42.51 ? 241 ALA C N   1 
ATOM   6677  C  CA  . ALA C  1 261 ? 55.214 -11.315 -13.237 1.00 40.95 ? 241 ALA C CA  1 
ATOM   6678  C  C   . ALA C  1 261 ? 54.287 -10.570 -14.191 1.00 40.66 ? 241 ALA C C   1 
ATOM   6679  O  O   . ALA C  1 261 ? 54.066 -9.381  -13.991 1.00 39.49 ? 241 ALA C O   1 
ATOM   6680  C  CB  . ALA C  1 261 ? 55.797 -10.382 -12.221 1.00 42.02 ? 241 ALA C CB  1 
ATOM   6681  N  N   . ILE C  1 262 ? 53.767 -11.269 -15.211 1.00 40.81 ? 242 ILE C N   1 
ATOM   6682  C  CA  . ILE C  1 262 ? 53.085 -10.629 -16.328 1.00 43.30 ? 242 ILE C CA  1 
ATOM   6683  C  C   . ILE C  1 262 ? 51.843 -9.845  -15.948 1.00 44.72 ? 242 ILE C C   1 
ATOM   6684  O  O   . ILE C  1 262 ? 51.469 -8.872  -16.611 1.00 44.63 ? 242 ILE C O   1 
ATOM   6685  C  CB  . ILE C  1 262 ? 52.704 -11.611 -17.507 1.00 43.62 ? 242 ILE C CB  1 
ATOM   6686  C  CG1 . ILE C  1 262 ? 51.806 -12.749 -17.069 1.00 47.54 ? 242 ILE C CG1 1 
ATOM   6687  C  CG2 . ILE C  1 262 ? 53.950 -12.206 -18.197 1.00 45.11 ? 242 ILE C CG2 1 
ATOM   6688  C  CD1 . ILE C  1 262 ? 51.303 -13.607 -18.273 1.00 44.60 ? 242 ILE C CD1 1 
ATOM   6689  N  N   . SER C  1 263 ? 51.174 -10.268 -14.891 1.00 44.90 ? 243 SER C N   1 
ATOM   6690  C  CA  . SER C  1 263 ? 49.969 -9.602  -14.481 1.00 42.57 ? 243 SER C CA  1 
ATOM   6691  C  C   . SER C  1 263 ? 50.332 -8.174  -14.051 1.00 42.96 ? 243 SER C C   1 
ATOM   6692  O  O   . SER C  1 263 ? 49.451 -7.347  -13.903 1.00 41.59 ? 243 SER C O   1 
ATOM   6693  C  CB  . SER C  1 263 ? 49.336 -10.331 -13.304 1.00 44.12 ? 243 SER C CB  1 
ATOM   6694  O  OG  . SER C  1 263 ? 50.158 -10.139 -12.168 1.00 44.22 ? 243 SER C OG  1 
ATOM   6695  N  N   . THR C  1 264 ? 51.620 -7.892  -13.829 1.00 43.10 ? 244 THR C N   1 
ATOM   6696  C  CA  . THR C  1 264 ? 52.035 -6.589  -13.343 1.00 41.83 ? 244 THR C CA  1 
ATOM   6697  C  C   . THR C  1 264 ? 52.622 -5.694  -14.403 1.00 41.57 ? 244 THR C C   1 
ATOM   6698  O  O   . THR C  1 264 ? 52.725 -4.520  -14.175 1.00 44.64 ? 244 THR C O   1 
ATOM   6699  C  CB  . THR C  1 264 ? 53.081 -6.677  -12.238 1.00 41.50 ? 244 THR C CB  1 
ATOM   6700  O  OG1 . THR C  1 264 ? 54.328 -7.047  -12.795 1.00 38.49 ? 244 THR C OG1 1 
ATOM   6701  C  CG2 . THR C  1 264 ? 52.657 -7.617  -11.111 1.00 41.68 ? 244 THR C CG2 1 
ATOM   6702  N  N   . TYR C  1 265 ? 52.987 -6.208  -15.566 1.00 41.76 ? 245 TYR C N   1 
ATOM   6703  C  CA  . TYR C  1 265 ? 53.758 -5.371  -16.489 1.00 44.06 ? 245 TYR C CA  1 
ATOM   6704  C  C   . TYR C  1 265 ? 53.006 -4.182  -17.092 1.00 43.05 ? 245 TYR C C   1 
ATOM   6705  O  O   . TYR C  1 265 ? 53.661 -3.252  -17.516 1.00 44.87 ? 245 TYR C O   1 
ATOM   6706  C  CB  . TYR C  1 265 ? 54.355 -6.183  -17.648 1.00 41.71 ? 245 TYR C CB  1 
ATOM   6707  C  CG  . TYR C  1 265 ? 55.233 -7.338  -17.275 1.00 46.43 ? 245 TYR C CG  1 
ATOM   6708  C  CD1 . TYR C  1 265 ? 55.808 -7.445  -16.008 1.00 49.28 ? 245 TYR C CD1 1 
ATOM   6709  C  CD2 . TYR C  1 265 ? 55.553 -8.307  -18.227 1.00 40.76 ? 245 TYR C CD2 1 
ATOM   6710  C  CE1 . TYR C  1 265 ? 56.637 -8.507  -15.696 1.00 52.40 ? 245 TYR C CE1 1 
ATOM   6711  C  CE2 . TYR C  1 265 ? 56.379 -9.346  -17.922 1.00 46.35 ? 245 TYR C CE2 1 
ATOM   6712  C  CZ  . TYR C  1 265 ? 56.912 -9.445  -16.655 1.00 44.69 ? 245 TYR C CZ  1 
ATOM   6713  O  OH  . TYR C  1 265 ? 57.719 -10.498 -16.346 1.00 45.73 ? 245 TYR C OH  1 
ATOM   6714  N  N   . ASN C  1 266 ? 51.668 -4.253  -17.170 1.00 41.87 ? 246 ASN C N   1 
ATOM   6715  C  CA  . ASN C  1 266 ? 50.858 -3.282  -17.891 1.00 42.34 ? 246 ASN C CA  1 
ATOM   6716  C  C   . ASN C  1 266 ? 49.976 -2.446  -16.999 1.00 43.52 ? 246 ASN C C   1 
ATOM   6717  O  O   . ASN C  1 266 ? 49.063 -1.747  -17.449 1.00 44.84 ? 246 ASN C O   1 
ATOM   6718  C  CB  . ASN C  1 266 ? 49.975 -4.004  -18.901 1.00 41.66 ? 246 ASN C CB  1 
ATOM   6719  C  CG  . ASN C  1 266 ? 50.776 -4.620  -20.008 1.00 39.76 ? 246 ASN C CG  1 
ATOM   6720  O  OD1 . ASN C  1 266 ? 51.372 -3.901  -20.784 1.00 37.35 ? 246 ASN C OD1 1 
ATOM   6721  N  ND2 . ASN C  1 266 ? 50.850 -5.950  -20.054 1.00 37.15 ? 246 ASN C ND2 1 
ATOM   6722  N  N   . ARG C  1 267 ? 50.270 -2.513  -15.726 1.00 43.54 ? 247 ARG C N   1 
ATOM   6723  C  CA  . ARG C  1 267 ? 49.464 -1.885  -14.740 1.00 43.98 ? 247 ARG C CA  1 
ATOM   6724  C  C   . ARG C  1 267 ? 49.576 -0.370  -14.828 1.00 43.57 ? 247 ARG C C   1 
ATOM   6725  O  O   . ARG C  1 267 ? 50.530 0.181   -15.373 1.00 46.01 ? 247 ARG C O   1 
ATOM   6726  C  CB  . ARG C  1 267 ? 49.896 -2.378  -13.359 1.00 43.31 ? 247 ARG C CB  1 
ATOM   6727  C  CG  . ARG C  1 267 ? 51.221 -1.765  -12.885 1.00 43.52 ? 247 ARG C CG  1 
ATOM   6728  C  CD  . ARG C  1 267 ? 51.518 -2.217  -11.464 1.00 46.85 ? 247 ARG C CD  1 
ATOM   6729  N  NE  . ARG C  1 267 ? 52.759 -1.640  -10.983 1.00 47.81 ? 247 ARG C NE  1 
ATOM   6730  C  CZ  . ARG C  1 267 ? 53.973 -2.038  -11.334 1.00 53.89 ? 247 ARG C CZ  1 
ATOM   6731  N  NH1 . ARG C  1 267 ? 54.150 -3.025  -12.201 1.00 60.61 ? 247 ARG C NH1 1 
ATOM   6732  N  NH2 . ARG C  1 267 ? 55.025 -1.435  -10.817 1.00 51.06 ? 247 ARG C NH2 1 
ATOM   6733  N  N   . THR C  1 268 ? 48.582 0.305   -14.267 1.00 43.63 ? 248 THR C N   1 
ATOM   6734  C  CA  . THR C  1 268 ? 48.498 1.749   -14.351 1.00 41.51 ? 248 THR C CA  1 
ATOM   6735  C  C   . THR C  1 268 ? 48.425 2.357   -12.933 1.00 42.60 ? 248 THR C C   1 
ATOM   6736  O  O   . THR C  1 268 ? 48.348 3.564   -12.814 1.00 40.24 ? 248 THR C O   1 
ATOM   6737  C  CB  . THR C  1 268 ? 47.315 2.211   -15.235 1.00 38.77 ? 248 THR C CB  1 
ATOM   6738  O  OG1 . THR C  1 268 ? 46.072 1.798   -14.655 1.00 28.59 ? 248 THR C OG1 1 
ATOM   6739  C  CG2 . THR C  1 268 ? 47.419 1.669   -16.613 1.00 36.57 ? 248 THR C CG2 1 
ATOM   6740  N  N   . GLY C  1 269 ? 48.518 1.521   -11.896 1.00 41.28 ? 249 GLY C N   1 
ATOM   6741  C  CA  . GLY C  1 269 ? 48.553 1.977   -10.518 1.00 44.49 ? 249 GLY C CA  1 
ATOM   6742  C  C   . GLY C  1 269 ? 49.656 1.275   -9.759  1.00 46.15 ? 249 GLY C C   1 
ATOM   6743  O  O   . GLY C  1 269 ? 50.540 0.690   -10.359 1.00 45.92 ? 249 GLY C O   1 
ATOM   6744  N  N   . PRO C  1 270 ? 49.617 1.325   -8.425  1.00 47.43 ? 250 PRO C N   1 
ATOM   6745  C  CA  . PRO C  1 270 ? 50.617 0.569   -7.646  1.00 46.91 ? 250 PRO C CA  1 
ATOM   6746  C  C   . PRO C  1 270 ? 50.504 -0.961  -7.750  1.00 49.84 ? 250 PRO C C   1 
ATOM   6747  O  O   . PRO C  1 270 ? 49.464 -1.501  -8.203  1.00 52.86 ? 250 PRO C O   1 
ATOM   6748  C  CB  . PRO C  1 270 ? 50.355 1.004   -6.205  1.00 46.51 ? 250 PRO C CB  1 
ATOM   6749  C  CG  . PRO C  1 270 ? 48.954 1.550   -6.190  1.00 49.25 ? 250 PRO C CG  1 
ATOM   6750  C  CD  . PRO C  1 270 ? 48.718 2.123   -7.574  1.00 47.15 ? 250 PRO C CD  1 
ATOM   6751  N  N   . LEU C  1 271 ? 51.559 -1.648  -7.310  1.00 48.58 ? 251 LEU C N   1 
ATOM   6752  C  CA  . LEU C  1 271 ? 51.557 -3.105  -7.204  1.00 48.53 ? 251 LEU C CA  1 
ATOM   6753  C  C   . LEU C  1 271 ? 50.588 -3.541  -6.127  1.00 48.29 ? 251 LEU C C   1 
ATOM   6754  O  O   . LEU C  1 271 ? 50.319 -2.794  -5.153  1.00 47.74 ? 251 LEU C O   1 
ATOM   6755  C  CB  . LEU C  1 271 ? 52.957 -3.668  -6.894  1.00 47.96 ? 251 LEU C CB  1 
ATOM   6756  C  CG  . LEU C  1 271 ? 54.008 -3.499  -8.002  1.00 46.48 ? 251 LEU C CG  1 
ATOM   6757  C  CD1 . LEU C  1 271 ? 55.446 -3.472  -7.445  1.00 41.62 ? 251 LEU C CD1 1 
ATOM   6758  C  CD2 . LEU C  1 271 ? 53.888 -4.567  -9.099  1.00 53.03 ? 251 LEU C CD2 1 
ATOM   6759  N  N   . PRO C  1 272 ? 50.026 -4.748  -6.298  1.00 49.10 ? 252 PRO C N   1 
ATOM   6760  C  CA  . PRO C  1 272 ? 49.193 -5.289  -5.235  1.00 49.78 ? 252 PRO C CA  1 
ATOM   6761  C  C   . PRO C  1 272 ? 50.013 -5.698  -3.986  1.00 50.76 ? 252 PRO C C   1 
ATOM   6762  O  O   . PRO C  1 272 ? 51.265 -5.791  -4.048  1.00 46.82 ? 252 PRO C O   1 
ATOM   6763  C  CB  . PRO C  1 272 ? 48.538 -6.530  -5.880  1.00 49.38 ? 252 PRO C CB  1 
ATOM   6764  C  CG  . PRO C  1 272 ? 49.347 -6.879  -6.963  1.00 45.20 ? 252 PRO C CG  1 
ATOM   6765  C  CD  . PRO C  1 272 ? 50.114 -5.662  -7.446  1.00 48.89 ? 252 PRO C CD  1 
ATOM   6766  N  N   . PRO C  1 273 ? 49.307 -5.942  -2.868  1.00 53.66 ? 253 PRO C N   1 
ATOM   6767  C  CA  . PRO C  1 273 ? 49.874 -6.478  -1.650  1.00 56.09 ? 253 PRO C CA  1 
ATOM   6768  C  C   . PRO C  1 273 ? 50.836 -7.589  -1.923  1.00 58.32 ? 253 PRO C C   1 
ATOM   6769  O  O   . PRO C  1 273 ? 50.645 -8.395  -2.839  1.00 61.41 ? 253 PRO C O   1 
ATOM   6770  C  CB  . PRO C  1 273 ? 48.646 -7.010  -0.912  1.00 57.51 ? 253 PRO C CB  1 
ATOM   6771  C  CG  . PRO C  1 273 ? 47.620 -6.009  -1.218  1.00 57.97 ? 253 PRO C CG  1 
ATOM   6772  C  CD  . PRO C  1 273 ? 47.874 -5.650  -2.687  1.00 55.20 ? 253 PRO C CD  1 
ATOM   6773  N  N   . GLY C  1 274 ? 51.894 -7.637  -1.146  1.00 59.44 ? 254 GLY C N   1 
ATOM   6774  C  CA  . GLY C  1 274 ? 52.838 -8.697  -1.325  1.00 60.05 ? 254 GLY C CA  1 
ATOM   6775  C  C   . GLY C  1 274 ? 52.295 -9.984  -0.728  1.00 61.68 ? 254 GLY C C   1 
ATOM   6776  O  O   . GLY C  1 274 ? 51.206 -9.996  -0.069  1.00 59.09 ? 254 GLY C O   1 
ATOM   6777  N  N   . PRO C  1 275 ? 53.073 -11.071 -0.931  1.00 63.86 ? 255 PRO C N   1 
ATOM   6778  C  CA  . PRO C  1 275 ? 52.888 -12.354 -0.248  1.00 63.81 ? 255 PRO C CA  1 
ATOM   6779  C  C   . PRO C  1 275 ? 52.634 -12.116 1.241   1.00 64.02 ? 255 PRO C C   1 
ATOM   6780  O  O   . PRO C  1 275 ? 53.392 -11.378 1.897   1.00 65.30 ? 255 PRO C O   1 
ATOM   6781  C  CB  . PRO C  1 275 ? 54.235 -13.055 -0.446  1.00 66.32 ? 255 PRO C CB  1 
ATOM   6782  C  CG  . PRO C  1 275 ? 54.830 -12.453 -1.729  1.00 64.78 ? 255 PRO C CG  1 
ATOM   6783  C  CD  . PRO C  1 275 ? 54.250 -11.068 -1.846  1.00 65.03 ? 255 PRO C CD  1 
ATOM   6784  N  N   . PRO C  1 276 ? 51.578 -12.732 1.786   1.00 62.28 ? 256 PRO C N   1 
ATOM   6785  C  CA  . PRO C  1 276 ? 51.274 -12.529 3.225   1.00 60.90 ? 256 PRO C CA  1 
ATOM   6786  C  C   . PRO C  1 276 ? 52.403 -13.141 4.083   1.00 59.33 ? 256 PRO C C   1 
ATOM   6787  O  O   . PRO C  1 276 ? 52.743 -14.335 3.919   1.00 55.51 ? 256 PRO C O   1 
ATOM   6788  C  CB  . PRO C  1 276 ? 49.931 -13.252 3.434   1.00 62.66 ? 256 PRO C CB  1 
ATOM   6789  C  CG  . PRO C  1 276 ? 49.776 -14.164 2.176   1.00 65.46 ? 256 PRO C CG  1 
ATOM   6790  C  CD  . PRO C  1 276 ? 50.697 -13.699 1.103   1.00 59.60 ? 256 PRO C CD  1 
ATOM   6791  N  N   . PRO C  1 277 ? 52.998 -12.335 4.982   1.00 57.81 ? 257 PRO C N   1 
ATOM   6792  C  CA  . PRO C  1 277 ? 54.388 -12.673 5.407   1.00 53.76 ? 257 PRO C CA  1 
ATOM   6793  C  C   . PRO C  1 277 ? 54.441 -13.766 6.481   1.00 49.03 ? 257 PRO C C   1 
ATOM   6794  O  O   . PRO C  1 277 ? 55.374 -14.535 6.499   1.00 48.04 ? 257 PRO C O   1 
ATOM   6795  C  CB  . PRO C  1 277 ? 54.940 -11.331 5.928   1.00 54.27 ? 257 PRO C CB  1 
ATOM   6796  C  CG  . PRO C  1 277 ? 53.719 -10.343 5.906   1.00 58.28 ? 257 PRO C CG  1 
ATOM   6797  C  CD  . PRO C  1 277 ? 52.471 -11.168 5.715   1.00 56.88 ? 257 PRO C CD  1 
ATOM   6798  N  N   . GLU C  1 278 ? 53.433 -13.811 7.346   1.00 47.75 ? 258 GLU C N   1 
ATOM   6799  C  CA  . GLU C  1 278 ? 53.199 -14.875 8.322   1.00 48.87 ? 258 GLU C CA  1 
ATOM   6800  C  C   . GLU C  1 278 ? 53.185 -16.277 7.688   1.00 48.43 ? 258 GLU C C   1 
ATOM   6801  O  O   . GLU C  1 278 ? 53.653 -17.223 8.272   1.00 45.41 ? 258 GLU C O   1 
ATOM   6802  C  CB  . GLU C  1 278 ? 51.839 -14.630 8.997   1.00 47.79 ? 258 GLU C CB  1 
ATOM   6803  N  N   . ILE C  1 279 ? 52.629 -16.384 6.476   1.00 47.32 ? 259 ILE C N   1 
ATOM   6804  C  CA  . ILE C  1 279 ? 52.463 -17.655 5.783   1.00 44.06 ? 259 ILE C CA  1 
ATOM   6805  C  C   . ILE C  1 279 ? 53.776 -18.068 5.148   1.00 40.31 ? 259 ILE C C   1 
ATOM   6806  O  O   . ILE C  1 279 ? 54.182 -19.245 5.203   1.00 37.86 ? 259 ILE C O   1 
ATOM   6807  C  CB  . ILE C  1 279 ? 51.345 -17.527 4.682   1.00 45.56 ? 259 ILE C CB  1 
ATOM   6808  C  CG1 . ILE C  1 279 ? 50.000 -17.200 5.335   1.00 42.86 ? 259 ILE C CG1 1 
ATOM   6809  C  CG2 . ILE C  1 279 ? 51.222 -18.797 3.831   1.00 44.92 ? 259 ILE C CG2 1 
ATOM   6810  C  CD1 . ILE C  1 279 ? 48.915 -16.983 4.348   1.00 45.83 ? 259 ILE C CD1 1 
ATOM   6811  N  N   . VAL C  1 280 ? 54.427 -17.112 4.496   1.00 37.70 ? 260 VAL C N   1 
ATOM   6812  C  CA  . VAL C  1 280 ? 55.750 -17.382 3.933   1.00 38.92 ? 260 VAL C CA  1 
ATOM   6813  C  C   . VAL C  1 280 ? 56.745 -17.859 5.005   1.00 36.60 ? 260 VAL C C   1 
ATOM   6814  O  O   . VAL C  1 280 ? 57.544 -18.765 4.748   1.00 36.54 ? 260 VAL C O   1 
ATOM   6815  C  CB  . VAL C  1 280 ? 56.288 -16.162 3.213   1.00 41.36 ? 260 VAL C CB  1 
ATOM   6816  C  CG1 . VAL C  1 280 ? 57.799 -16.355 2.853   1.00 41.85 ? 260 VAL C CG1 1 
ATOM   6817  C  CG2 . VAL C  1 280 ? 55.406 -15.862 1.958   1.00 37.84 ? 260 VAL C CG2 1 
ATOM   6818  N  N   . ILE C  1 281 ? 56.638 -17.304 6.214   1.00 34.72 ? 261 ILE C N   1 
ATOM   6819  C  CA  . ILE C  1 281 ? 57.552 -17.629 7.281   1.00 35.37 ? 261 ILE C CA  1 
ATOM   6820  C  C   . ILE C  1 281 ? 57.192 -18.961 7.908   1.00 37.98 ? 261 ILE C C   1 
ATOM   6821  O  O   . ILE C  1 281 ? 58.060 -19.843 8.012   1.00 38.61 ? 261 ILE C O   1 
ATOM   6822  C  CB  . ILE C  1 281 ? 57.657 -16.475 8.323   1.00 36.55 ? 261 ILE C CB  1 
ATOM   6823  C  CG1 . ILE C  1 281 ? 58.440 -15.289 7.719   1.00 33.67 ? 261 ILE C CG1 1 
ATOM   6824  C  CG2 . ILE C  1 281 ? 58.352 -16.938 9.576   1.00 31.89 ? 261 ILE C CG2 1 
ATOM   6825  C  CD1 . ILE C  1 281 ? 58.143 -13.976 8.343   1.00 36.30 ? 261 ILE C CD1 1 
ATOM   6826  N  N   . TYR C  1 282 ? 55.918 -19.130 8.282   1.00 39.15 ? 262 TYR C N   1 
ATOM   6827  C  CA  . TYR C  1 282 ? 55.461 -20.354 8.955   1.00 38.48 ? 262 TYR C CA  1 
ATOM   6828  C  C   . TYR C  1 282 ? 55.797 -21.556 8.075   1.00 37.02 ? 262 TYR C C   1 
ATOM   6829  O  O   . TYR C  1 282 ? 56.232 -22.566 8.573   1.00 40.67 ? 262 TYR C O   1 
ATOM   6830  C  CB  . TYR C  1 282 ? 53.957 -20.253 9.308   1.00 39.63 ? 262 TYR C CB  1 
ATOM   6831  C  CG  . TYR C  1 282 ? 53.442 -21.267 10.310  1.00 42.06 ? 262 TYR C CG  1 
ATOM   6832  N  N   . GLN C  1 283 ? 55.659 -21.417 6.759   1.00 37.43 ? 263 GLN C N   1 
ATOM   6833  C  CA  . GLN C  1 283 ? 55.918 -22.493 5.802   1.00 37.55 ? 263 GLN C CA  1 
ATOM   6834  C  C   . GLN C  1 283 ? 57.369 -22.663 5.315   1.00 37.09 ? 263 GLN C C   1 
ATOM   6835  O  O   . GLN C  1 283 ? 57.659 -23.534 4.479   1.00 38.34 ? 263 GLN C O   1 
ATOM   6836  C  CB  . GLN C  1 283 ? 55.006 -22.275 4.587   1.00 40.10 ? 263 GLN C CB  1 
ATOM   6837  C  CG  . GLN C  1 283 ? 53.533 -22.455 4.872   1.00 39.81 ? 263 GLN C CG  1 
ATOM   6838  C  CD  . GLN C  1 283 ? 53.238 -23.839 5.417   1.00 45.08 ? 263 GLN C CD  1 
ATOM   6839  O  OE1 . GLN C  1 283 ? 53.247 -24.031 6.625   1.00 47.94 ? 263 GLN C OE1 1 
ATOM   6840  N  NE2 . GLN C  1 283 ? 53.013 -24.820 4.526   1.00 43.89 ? 263 GLN C NE2 1 
ATOM   6841  N  N   . GLU C  1 284 ? 58.227 -21.759 5.756   1.00 37.56 ? 264 GLU C N   1 
ATOM   6842  C  CA  . GLU C  1 284 ? 59.629 -21.662 5.372   1.00 35.70 ? 264 GLU C CA  1 
ATOM   6843  C  C   . GLU C  1 284 ? 59.880 -21.829 3.870   1.00 36.34 ? 264 GLU C C   1 
ATOM   6844  O  O   . GLU C  1 284 ? 60.600 -22.723 3.445   1.00 39.40 ? 264 GLU C O   1 
ATOM   6845  C  CB  . GLU C  1 284 ? 60.431 -22.644 6.190   1.00 35.64 ? 264 GLU C CB  1 
ATOM   6846  C  CG  . GLU C  1 284 ? 60.148 -22.475 7.659   1.00 31.79 ? 264 GLU C CG  1 
ATOM   6847  C  CD  . GLU C  1 284 ? 60.986 -23.368 8.559   1.00 45.04 ? 264 GLU C CD  1 
ATOM   6848  O  OE1 . GLU C  1 284 ? 62.229 -23.120 8.703   1.00 52.57 ? 264 GLU C OE1 1 
ATOM   6849  O  OE2 . GLU C  1 284 ? 60.375 -24.286 9.167   1.00 57.20 ? 264 GLU C OE2 1 
ATOM   6850  N  N   . LEU C  1 285 ? 59.330 -20.913 3.083   1.00 36.17 ? 265 LEU C N   1 
ATOM   6851  C  CA  . LEU C  1 285 ? 59.383 -21.024 1.660   1.00 37.09 ? 265 LEU C CA  1 
ATOM   6852  C  C   . LEU C  1 285 ? 60.729 -20.568 1.122   1.00 38.83 ? 265 LEU C C   1 
ATOM   6853  O  O   . LEU C  1 285 ? 61.355 -19.730 1.718   1.00 36.73 ? 265 LEU C O   1 
ATOM   6854  C  CB  . LEU C  1 285 ? 58.193 -20.267 1.027   1.00 39.71 ? 265 LEU C CB  1 
ATOM   6855  C  CG  . LEU C  1 285 ? 56.797 -20.780 1.434   1.00 34.38 ? 265 LEU C CG  1 
ATOM   6856  C  CD1 . LEU C  1 285 ? 55.683 -20.014 0.706   1.00 43.02 ? 265 LEU C CD1 1 
ATOM   6857  C  CD2 . LEU C  1 285 ? 56.634 -22.260 1.200   1.00 40.61 ? 265 LEU C CD2 1 
ATOM   6858  N  N   . ARG C  1 286 ? 61.187 -21.208 0.034   1.00 44.24 ? 266 ARG C N   1 
ATOM   6859  C  CA  . ARG C  1 286 ? 62.326 -20.748 -0.770  1.00 43.93 ? 266 ARG C CA  1 
ATOM   6860  C  C   . ARG C  1 286 ? 61.768 -20.183 -2.059  1.00 44.46 ? 266 ARG C C   1 
ATOM   6861  O  O   . ARG C  1 286 ? 61.051 -20.840 -2.785  1.00 42.42 ? 266 ARG C O   1 
ATOM   6862  C  CB  . ARG C  1 286 ? 63.283 -21.899 -1.093  1.00 45.35 ? 266 ARG C CB  1 
ATOM   6863  C  CG  . ARG C  1 286 ? 64.618 -21.477 -1.827  1.00 50.67 ? 266 ARG C CG  1 
ATOM   6864  C  CD  . ARG C  1 286 ? 65.601 -22.670 -2.093  1.00 47.25 ? 266 ARG C CD  1 
ATOM   6865  N  N   . MET C  1 287 ? 62.085 -18.933 -2.332  1.00 48.71 ? 267 MET C N   1 
ATOM   6866  C  CA  . MET C  1 287 ? 61.694 -18.305 -3.576  1.00 51.85 ? 267 MET C CA  1 
ATOM   6867  C  C   . MET C  1 287 ? 62.939 -17.853 -4.246  1.00 46.71 ? 267 MET C C   1 
ATOM   6868  O  O   . MET C  1 287 ? 63.774 -17.246 -3.663  1.00 49.13 ? 267 MET C O   1 
ATOM   6869  C  CB  . MET C  1 287 ? 60.809 -17.122 -3.310  1.00 53.78 ? 267 MET C CB  1 
ATOM   6870  C  CG  . MET C  1 287 ? 59.793 -17.427 -2.224  1.00 62.79 ? 267 MET C CG  1 
ATOM   6871  S  SD  . MET C  1 287 ? 58.715 -16.031 -1.989  1.00 67.96 ? 267 MET C SD  1 
ATOM   6872  C  CE  . MET C  1 287 ? 57.601 -16.698 -0.757  1.00 72.47 ? 267 MET C CE  1 
ATOM   6873  N  N   . GLU C  1 288 ? 63.081 -18.167 -5.499  1.00 44.22 ? 268 GLU C N   1 
ATOM   6874  C  CA  . GLU C  1 288 ? 64.280 -17.784 -6.158  1.00 41.89 ? 268 GLU C CA  1 
ATOM   6875  C  C   . GLU C  1 288 ? 63.890 -17.386 -7.558  1.00 37.77 ? 268 GLU C C   1 
ATOM   6876  O  O   . GLU C  1 288 ? 63.093 -18.083 -8.237  1.00 35.74 ? 268 GLU C O   1 
ATOM   6877  C  CB  . GLU C  1 288 ? 65.282 -18.947 -6.103  1.00 38.11 ? 268 GLU C CB  1 
ATOM   6878  C  CG  . GLU C  1 288 ? 66.461 -18.756 -7.002  1.00 45.35 ? 268 GLU C CG  1 
ATOM   6879  C  CD  . GLU C  1 288 ? 67.570 -19.789 -6.801  1.00 51.86 ? 268 GLU C CD  1 
ATOM   6880  O  OE1 . GLU C  1 288 ? 68.665 -19.585 -7.396  1.00 64.57 ? 268 GLU C OE1 1 
ATOM   6881  O  OE2 . GLU C  1 288 ? 67.366 -20.793 -6.055  1.00 69.70 ? 268 GLU C OE2 1 
ATOM   6882  N  N   . ALA C  1 289 ? 64.443 -16.261 -7.973  1.00 35.91 ? 269 ALA C N   1 
ATOM   6883  C  CA  . ALA C  1 289 ? 64.215 -15.717 -9.301  1.00 36.29 ? 269 ALA C CA  1 
ATOM   6884  C  C   . ALA C  1 289 ? 65.392 -16.029 -10.183 1.00 37.86 ? 269 ALA C C   1 
ATOM   6885  O  O   . ALA C  1 289 ? 66.466 -16.348 -9.704  1.00 40.36 ? 269 ALA C O   1 
ATOM   6886  C  CB  . ALA C  1 289 ? 63.989 -14.215 -9.232  1.00 36.00 ? 269 ALA C CB  1 
ATOM   6887  N  N   . PHE C  1 290 ? 65.163 -15.975 -11.489 1.00 40.76 ? 270 PHE C N   1 
ATOM   6888  C  CA  . PHE C  1 290 ? 66.128 -16.459 -12.431 1.00 41.47 ? 270 PHE C CA  1 
ATOM   6889  C  C   . PHE C  1 290 ? 65.848 -15.809 -13.778 1.00 41.95 ? 270 PHE C C   1 
ATOM   6890  O  O   . PHE C  1 290 ? 64.723 -15.385 -14.065 1.00 44.69 ? 270 PHE C O   1 
ATOM   6891  C  CB  . PHE C  1 290 ? 66.186 -18.049 -12.483 1.00 42.67 ? 270 PHE C CB  1 
ATOM   6892  C  CG  . PHE C  1 290 ? 65.011 -18.693 -13.189 1.00 46.33 ? 270 PHE C CG  1 
ATOM   6893  C  CD1 . PHE C  1 290 ? 65.100 -19.040 -14.547 1.00 46.24 ? 270 PHE C CD1 1 
ATOM   6894  C  CD2 . PHE C  1 290 ? 63.795 -18.884 -12.525 1.00 43.04 ? 270 PHE C CD2 1 
ATOM   6895  C  CE1 . PHE C  1 290 ? 64.014 -19.576 -15.209 1.00 43.22 ? 270 PHE C CE1 1 
ATOM   6896  C  CE2 . PHE C  1 290 ? 62.689 -19.423 -13.178 1.00 44.67 ? 270 PHE C CE2 1 
ATOM   6897  C  CZ  . PHE C  1 290 ? 62.786 -19.759 -14.520 1.00 47.60 ? 270 PHE C CZ  1 
ATOM   6898  N  N   . VAL C  1 291 ? 66.903 -15.737 -14.577 1.00 44.99 ? 271 VAL C N   1 
ATOM   6899  C  CA  . VAL C  1 291 ? 66.846 -15.399 -15.992 1.00 47.16 ? 271 VAL C CA  1 
ATOM   6900  C  C   . VAL C  1 291 ? 67.492 -16.557 -16.795 1.00 45.04 ? 271 VAL C C   1 
ATOM   6901  O  O   . VAL C  1 291 ? 68.535 -17.021 -16.390 1.00 42.87 ? 271 VAL C O   1 
ATOM   6902  C  CB  . VAL C  1 291 ? 67.555 -14.049 -16.221 1.00 47.61 ? 271 VAL C CB  1 
ATOM   6903  C  CG1 . VAL C  1 291 ? 67.570 -13.658 -17.687 1.00 53.29 ? 271 VAL C CG1 1 
ATOM   6904  C  CG2 . VAL C  1 291 ? 66.825 -12.959 -15.427 1.00 53.91 ? 271 VAL C CG2 1 
ATOM   6905  N  N   . VAL C  1 292 ? 66.863 -17.015 -17.899 1.00 44.64 ? 272 VAL C N   1 
ATOM   6906  C  CA  . VAL C  1 292 ? 67.466 -18.048 -18.769 1.00 46.96 ? 272 VAL C CA  1 
ATOM   6907  C  C   . VAL C  1 292 ? 68.957 -17.859 -19.134 1.00 46.19 ? 272 VAL C C   1 
ATOM   6908  O  O   . VAL C  1 292 ? 69.680 -18.851 -19.303 1.00 44.43 ? 272 VAL C O   1 
ATOM   6909  C  CB  . VAL C  1 292 ? 66.887 -18.182 -20.198 1.00 47.79 ? 272 VAL C CB  1 
ATOM   6910  C  CG1 . VAL C  1 292 ? 66.612 -19.650 -20.498 1.00 50.53 ? 272 VAL C CG1 1 
ATOM   6911  C  CG2 . VAL C  1 292 ? 65.766 -17.303 -20.458 1.00 52.41 ? 272 VAL C CG2 1 
ATOM   6912  N  N   . TYR C  1 293 ? 69.391 -16.610 -19.309 1.00 47.20 ? 273 TYR C N   1 
ATOM   6913  C  CA  . TYR C  1 293 ? 70.731 -16.335 -19.876 1.00 47.63 ? 273 TYR C CA  1 
ATOM   6914  C  C   . TYR C  1 293 ? 71.838 -16.685 -18.912 1.00 46.28 ? 273 TYR C C   1 
ATOM   6915  O  O   . TYR C  1 293 ? 72.982 -16.676 -19.291 1.00 48.34 ? 273 TYR C O   1 
ATOM   6916  C  CB  . TYR C  1 293 ? 70.864 -14.892 -20.395 1.00 49.50 ? 273 TYR C CB  1 
ATOM   6917  C  CG  . TYR C  1 293 ? 69.667 -14.455 -21.245 1.00 52.61 ? 273 TYR C CG  1 
ATOM   6918  C  CD1 . TYR C  1 293 ? 69.393 -15.044 -22.484 1.00 55.63 ? 273 TYR C CD1 1 
ATOM   6919  C  CD2 . TYR C  1 293 ? 68.788 -13.472 -20.780 1.00 59.01 ? 273 TYR C CD2 1 
ATOM   6920  C  CE1 . TYR C  1 293 ? 68.249 -14.668 -23.247 1.00 56.15 ? 273 TYR C CE1 1 
ATOM   6921  C  CE2 . TYR C  1 293 ? 67.679 -13.078 -21.513 1.00 59.38 ? 273 TYR C CE2 1 
ATOM   6922  C  CZ  . TYR C  1 293 ? 67.397 -13.683 -22.759 1.00 62.81 ? 273 TYR C CZ  1 
ATOM   6923  O  OH  . TYR C  1 293 ? 66.255 -13.266 -23.483 1.00 66.17 ? 273 TYR C OH  1 
ATOM   6924  N  N   . ARG C  1 294 ? 71.489 -17.007 -17.670 1.00 47.32 ? 274 ARG C N   1 
ATOM   6925  C  CA  . ARG C  1 294 ? 72.452 -17.444 -16.671 1.00 45.71 ? 274 ARG C CA  1 
ATOM   6926  C  C   . ARG C  1 294 ? 73.252 -18.640 -17.147 1.00 46.80 ? 274 ARG C C   1 
ATOM   6927  O  O   . ARG C  1 294 ? 74.425 -18.736 -16.839 1.00 49.58 ? 274 ARG C O   1 
ATOM   6928  C  CB  . ARG C  1 294 ? 71.737 -17.850 -15.386 1.00 45.30 ? 274 ARG C CB  1 
ATOM   6929  C  CG  . ARG C  1 294 ? 72.691 -18.363 -14.301 1.00 41.64 ? 274 ARG C CG  1 
ATOM   6930  C  CD  . ARG C  1 294 ? 72.005 -19.027 -13.096 1.00 42.52 ? 274 ARG C CD  1 
ATOM   6931  N  NE  . ARG C  1 294 ? 70.893 -18.240 -12.564 1.00 47.37 ? 274 ARG C NE  1 
ATOM   6932  C  CZ  . ARG C  1 294 ? 70.307 -18.449 -11.375 1.00 47.96 ? 274 ARG C CZ  1 
ATOM   6933  N  NH1 . ARG C  1 294 ? 70.701 -19.423 -10.568 1.00 45.77 ? 274 ARG C NH1 1 
ATOM   6934  N  NH2 . ARG C  1 294 ? 69.312 -17.671 -10.975 1.00 48.06 ? 274 ARG C NH2 1 
ATOM   6935  N  N   . TRP C  1 295 ? 72.599 -19.561 -17.860 1.00 46.38 ? 275 TRP C N   1 
ATOM   6936  C  CA  . TRP C  1 295 ? 73.183 -20.871 -18.209 1.00 42.90 ? 275 TRP C CA  1 
ATOM   6937  C  C   . TRP C  1 295 ? 73.714 -20.856 -19.624 1.00 44.24 ? 275 TRP C C   1 
ATOM   6938  O  O   . TRP C  1 295 ? 72.982 -20.581 -20.576 1.00 45.53 ? 275 TRP C O   1 
ATOM   6939  C  CB  . TRP C  1 295 ? 72.135 -21.963 -18.110 1.00 41.17 ? 275 TRP C CB  1 
ATOM   6940  C  CG  . TRP C  1 295 ? 71.685 -22.275 -16.749 1.00 37.94 ? 275 TRP C CG  1 
ATOM   6941  C  CD1 . TRP C  1 295 ? 72.254 -23.144 -15.903 1.00 39.61 ? 275 TRP C CD1 1 
ATOM   6942  C  CD2 . TRP C  1 295 ? 70.537 -21.718 -16.059 1.00 38.06 ? 275 TRP C CD2 1 
ATOM   6943  N  NE1 . TRP C  1 295 ? 71.544 -23.189 -14.719 1.00 41.70 ? 275 TRP C NE1 1 
ATOM   6944  C  CE2 . TRP C  1 295 ? 70.491 -22.316 -14.785 1.00 42.86 ? 275 TRP C CE2 1 
ATOM   6945  C  CE3 . TRP C  1 295 ? 69.558 -20.780 -16.401 1.00 37.40 ? 275 TRP C CE3 1 
ATOM   6946  C  CZ2 . TRP C  1 295 ? 69.481 -22.019 -13.835 1.00 43.14 ? 275 TRP C CZ2 1 
ATOM   6947  C  CZ3 . TRP C  1 295 ? 68.557 -20.474 -15.454 1.00 42.88 ? 275 TRP C CZ3 1 
ATOM   6948  C  CH2 . TRP C  1 295 ? 68.543 -21.083 -14.183 1.00 40.07 ? 275 TRP C CH2 1 
ATOM   6949  N  N   . GLN C  1 296 ? 75.000 -21.149 -19.766 1.00 48.12 ? 276 GLN C N   1 
ATOM   6950  C  CA  . GLN C  1 296 ? 75.660 -21.069 -21.060 1.00 48.57 ? 276 GLN C CA  1 
ATOM   6951  C  C   . GLN C  1 296 ? 76.456 -22.329 -21.205 1.00 48.45 ? 276 GLN C C   1 
ATOM   6952  O  O   . GLN C  1 296 ? 76.362 -23.226 -20.348 1.00 49.07 ? 276 GLN C O   1 
ATOM   6953  C  CB  . GLN C  1 296 ? 76.541 -19.816 -21.128 1.00 49.53 ? 276 GLN C CB  1 
ATOM   6954  C  CG  . GLN C  1 296 ? 75.751 -18.474 -20.953 1.00 54.97 ? 276 GLN C CG  1 
ATOM   6955  C  CD  . GLN C  1 296 ? 74.705 -18.251 -22.043 1.00 58.08 ? 276 GLN C CD  1 
ATOM   6956  O  OE1 . GLN C  1 296 ? 74.825 -18.798 -23.121 1.00 65.79 ? 276 GLN C OE1 1 
ATOM   6957  N  NE2 . GLN C  1 296 ? 73.694 -17.423 -21.771 1.00 56.49 ? 276 GLN C NE2 1 
ATOM   6958  N  N   . GLY C  1 297 ? 77.201 -22.428 -22.306 1.00 50.07 ? 277 GLY C N   1 
ATOM   6959  C  CA  . GLY C  1 297 ? 78.154 -23.523 -22.488 1.00 49.29 ? 277 GLY C CA  1 
ATOM   6960  C  C   . GLY C  1 297 ? 77.457 -24.865 -22.568 1.00 48.52 ? 277 GLY C C   1 
ATOM   6961  O  O   . GLY C  1 297 ? 76.420 -24.981 -23.188 1.00 47.22 ? 277 GLY C O   1 
ATOM   6962  N  N   . ASP C  1 298 ? 78.009 -25.862 -21.899 1.00 49.70 ? 278 ASP C N   1 
ATOM   6963  C  CA  . ASP C  1 298 ? 77.532 -27.228 -22.055 1.00 52.40 ? 278 ASP C CA  1 
ATOM   6964  C  C   . ASP C  1 298 ? 76.204 -27.491 -21.386 1.00 50.37 ? 278 ASP C C   1 
ATOM   6965  O  O   . ASP C  1 298 ? 75.461 -28.373 -21.815 1.00 49.32 ? 278 ASP C O   1 
ATOM   6966  C  CB  . ASP C  1 298 ? 78.568 -28.209 -21.509 1.00 55.53 ? 278 ASP C CB  1 
ATOM   6967  C  CG  . ASP C  1 298 ? 79.894 -28.106 -22.227 1.00 65.72 ? 278 ASP C CG  1 
ATOM   6968  O  OD1 . ASP C  1 298 ? 79.962 -27.406 -23.274 1.00 69.89 ? 278 ASP C OD1 1 
ATOM   6969  O  OD2 . ASP C  1 298 ? 80.872 -28.725 -21.737 1.00 81.18 ? 278 ASP C OD2 1 
ATOM   6970  N  N   . ALA C  1 299 ? 75.918 -26.752 -20.322 1.00 49.95 ? 279 ALA C N   1 
ATOM   6971  C  CA  . ALA C  1 299 ? 74.648 -26.904 -19.595 1.00 49.26 ? 279 ALA C CA  1 
ATOM   6972  C  C   . ALA C  1 299 ? 73.481 -26.550 -20.507 1.00 46.13 ? 279 ALA C C   1 
ATOM   6973  O  O   . ALA C  1 299 ? 72.469 -27.266 -20.550 1.00 45.52 ? 279 ALA C O   1 
ATOM   6974  C  CB  . ALA C  1 299 ? 74.627 -26.022 -18.350 1.00 50.73 ? 279 ALA C CB  1 
ATOM   6975  N  N   . ARG C  1 300 ? 73.667 -25.459 -21.243 1.00 41.41 ? 280 ARG C N   1 
ATOM   6976  C  CA  . ARG C  1 300 ? 72.706 -24.974 -22.211 1.00 41.38 ? 280 ARG C CA  1 
ATOM   6977  C  C   . ARG C  1 300 ? 72.497 -25.886 -23.463 1.00 40.79 ? 280 ARG C C   1 
ATOM   6978  O  O   . ARG C  1 300 ? 71.382 -26.118 -23.899 1.00 40.63 ? 280 ARG C O   1 
ATOM   6979  C  CB  . ARG C  1 300 ? 73.155 -23.573 -22.616 1.00 40.04 ? 280 ARG C CB  1 
ATOM   6980  C  CG  . ARG C  1 300 ? 72.207 -22.879 -23.549 1.00 41.07 ? 280 ARG C CG  1 
ATOM   6981  C  CD  . ARG C  1 300 ? 72.678 -21.486 -23.862 1.00 40.55 ? 280 ARG C CD  1 
ATOM   6982  N  NE  . ARG C  1 300 ? 71.696 -20.848 -24.726 1.00 47.22 ? 280 ARG C NE  1 
ATOM   6983  C  CZ  . ARG C  1 300 ? 71.670 -20.931 -26.054 1.00 49.96 ? 280 ARG C CZ  1 
ATOM   6984  N  NH1 . ARG C  1 300 ? 72.597 -21.600 -26.740 1.00 59.82 ? 280 ARG C NH1 1 
ATOM   6985  N  NH2 . ARG C  1 300 ? 70.707 -20.316 -26.712 1.00 53.82 ? 280 ARG C NH2 1 
ATOM   6986  N  N   . GLN C  1 301 ? 73.592 -26.366 -24.029 1.00 43.41 ? 281 GLN C N   1 
ATOM   6987  C  CA  . GLN C  1 301 ? 73.620 -27.240 -25.207 1.00 42.96 ? 281 GLN C CA  1 
ATOM   6988  C  C   . GLN C  1 301 ? 72.962 -28.591 -24.889 1.00 41.50 ? 281 GLN C C   1 
ATOM   6989  O  O   . GLN C  1 301 ? 72.224 -29.120 -25.713 1.00 37.96 ? 281 GLN C O   1 
ATOM   6990  C  CB  . GLN C  1 301 ? 75.087 -27.420 -25.653 1.00 42.68 ? 281 GLN C CB  1 
ATOM   6991  C  CG  . GLN C  1 301 ? 75.335 -28.188 -27.009 1.00 50.29 ? 281 GLN C CG  1 
ATOM   6992  C  CD  . GLN C  1 301 ? 75.034 -27.382 -28.304 1.00 57.29 ? 281 GLN C CD  1 
ATOM   6993  O  OE1 . GLN C  1 301 ? 74.346 -26.355 -28.294 1.00 53.45 ? 281 GLN C OE1 1 
ATOM   6994  N  NE2 . GLN C  1 301 ? 75.526 -27.894 -29.425 1.00 56.64 ? 281 GLN C NE2 1 
ATOM   6995  N  N   . LYS C  1 302 ? 73.210 -29.107 -23.678 1.00 42.14 ? 282 LYS C N   1 
ATOM   6996  C  CA  . LYS C  1 302 ? 72.538 -30.306 -23.174 1.00 43.88 ? 282 LYS C CA  1 
ATOM   6997  C  C   . LYS C  1 302 ? 71.056 -30.104 -22.994 1.00 41.57 ? 282 LYS C C   1 
ATOM   6998  O  O   . LYS C  1 302 ? 70.285 -30.989 -23.301 1.00 41.49 ? 282 LYS C O   1 
ATOM   6999  C  CB  . LYS C  1 302 ? 73.128 -30.803 -21.838 1.00 41.77 ? 282 LYS C CB  1 
ATOM   7000  C  CG  . LYS C  1 302 ? 72.797 -32.303 -21.576 1.00 47.79 ? 282 LYS C CG  1 
ATOM   7001  C  CD  . LYS C  1 302 ? 72.478 -32.658 -20.105 1.00 53.57 ? 282 LYS C CD  1 
ATOM   7002  C  CE  . LYS C  1 302 ? 73.748 -32.815 -19.264 1.00 63.66 ? 282 LYS C CE  1 
ATOM   7003  N  NZ  . LYS C  1 302 ? 73.425 -33.063 -17.827 1.00 63.49 ? 282 LYS C NZ  1 
ATOM   7004  N  N   . ALA C  1 303 ? 70.652 -28.934 -22.497 1.00 43.94 ? 283 ALA C N   1 
ATOM   7005  C  CA  . ALA C  1 303 ? 69.214 -28.591 -22.382 1.00 42.03 ? 283 ALA C CA  1 
ATOM   7006  C  C   . ALA C  1 303 ? 68.505 -28.548 -23.738 1.00 41.99 ? 283 ALA C C   1 
ATOM   7007  O  O   . ALA C  1 303 ? 67.449 -29.164 -23.885 1.00 41.74 ? 283 ALA C O   1 
ATOM   7008  C  CB  . ALA C  1 303 ? 69.019 -27.276 -21.640 1.00 43.60 ? 283 ALA C CB  1 
ATOM   7009  N  N   . LEU C  1 304 ? 69.078 -27.827 -24.706 1.00 39.51 ? 284 LEU C N   1 
ATOM   7010  C  CA  . LEU C  1 304 ? 68.537 -27.768 -26.072 1.00 41.41 ? 284 LEU C CA  1 
ATOM   7011  C  C   . LEU C  1 304 ? 68.368 -29.131 -26.759 1.00 42.55 ? 284 LEU C C   1 
ATOM   7012  O  O   . LEU C  1 304 ? 67.387 -29.368 -27.482 1.00 39.67 ? 284 LEU C O   1 
ATOM   7013  C  CB  . LEU C  1 304 ? 69.443 -26.903 -26.977 1.00 43.66 ? 284 LEU C CB  1 
ATOM   7014  C  CG  . LEU C  1 304 ? 69.355 -25.394 -26.841 1.00 42.58 ? 284 LEU C CG  1 
ATOM   7015  C  CD1 . LEU C  1 304 ? 70.281 -24.698 -27.827 1.00 44.65 ? 284 LEU C CD1 1 
ATOM   7016  C  CD2 . LEU C  1 304 ? 67.926 -24.980 -27.049 1.00 39.17 ? 284 LEU C CD2 1 
ATOM   7017  N  N   . LYS C  1 305 ? 69.366 -29.989 -26.569 1.00 43.06 ? 285 LYS C N   1 
ATOM   7018  C  CA  . LYS C  1 305 ? 69.350 -31.318 -27.121 1.00 44.05 ? 285 LYS C CA  1 
ATOM   7019  C  C   . LYS C  1 305 ? 68.283 -32.197 -26.484 1.00 41.63 ? 285 LYS C C   1 
ATOM   7020  O  O   . LYS C  1 305 ? 67.696 -33.024 -27.162 1.00 41.85 ? 285 LYS C O   1 
ATOM   7021  C  CB  . LYS C  1 305 ? 70.733 -31.982 -26.976 1.00 45.66 ? 285 LYS C CB  1 
ATOM   7022  C  CG  . LYS C  1 305 ? 71.778 -31.435 -27.942 1.00 47.09 ? 285 LYS C CG  1 
ATOM   7023  C  CD  . LYS C  1 305 ? 73.141 -32.048 -27.677 1.00 46.99 ? 285 LYS C CD  1 
ATOM   7024  C  CE  . LYS C  1 305 ? 74.159 -31.477 -28.633 1.00 53.93 ? 285 LYS C CE  1 
ATOM   7025  N  NZ  . LYS C  1 305 ? 75.532 -31.840 -28.202 1.00 58.40 ? 285 LYS C NZ  1 
ATOM   7026  N  N   . ASP C  1 306 ? 68.077 -32.053 -25.183 1.00 40.90 ? 286 ASP C N   1 
ATOM   7027  C  CA  . ASP C  1 306 ? 66.973 -32.709 -24.479 1.00 41.00 ? 286 ASP C CA  1 
ATOM   7028  C  C   . ASP C  1 306 ? 65.581 -32.256 -24.975 1.00 40.66 ? 286 ASP C C   1 
ATOM   7029  O  O   . ASP C  1 306 ? 64.695 -33.084 -25.214 1.00 39.27 ? 286 ASP C O   1 
ATOM   7030  C  CB  . ASP C  1 306 ? 67.079 -32.435 -22.969 1.00 44.95 ? 286 ASP C CB  1 
ATOM   7031  C  CG  . ASP C  1 306 ? 68.204 -33.219 -22.288 1.00 47.06 ? 286 ASP C CG  1 
ATOM   7032  O  OD1 . ASP C  1 306 ? 68.688 -34.216 -22.862 1.00 52.57 ? 286 ASP C OD1 1 
ATOM   7033  O  OD2 . ASP C  1 306 ? 68.591 -32.829 -21.155 1.00 55.51 ? 286 ASP C OD2 1 
ATOM   7034  N  N   . LEU C  1 307 ? 65.396 -30.938 -25.105 1.00 40.21 ? 287 LEU C N   1 
ATOM   7035  C  CA  . LEU C  1 307 ? 64.165 -30.368 -25.632 1.00 39.27 ? 287 LEU C CA  1 
ATOM   7036  C  C   . LEU C  1 307 ? 63.904 -30.814 -27.039 1.00 39.95 ? 287 LEU C C   1 
ATOM   7037  O  O   . LEU C  1 307 ? 62.773 -31.088 -27.391 1.00 39.11 ? 287 LEU C O   1 
ATOM   7038  C  CB  . LEU C  1 307 ? 64.225 -28.857 -25.642 1.00 39.15 ? 287 LEU C CB  1 
ATOM   7039  C  CG  . LEU C  1 307 ? 64.245 -28.198 -24.276 1.00 37.11 ? 287 LEU C CG  1 
ATOM   7040  C  CD1 . LEU C  1 307 ? 64.699 -26.735 -24.446 1.00 39.07 ? 287 LEU C CD1 1 
ATOM   7041  C  CD2 . LEU C  1 307 ? 62.870 -28.356 -23.593 1.00 34.55 ? 287 LEU C CD2 1 
ATOM   7042  N  N   . LEU C  1 308 ? 64.960 -30.882 -27.844 1.00 42.12 ? 288 LEU C N   1 
ATOM   7043  C  CA  . LEU C  1 308 ? 64.868 -31.452 -29.186 1.00 42.76 ? 288 LEU C CA  1 
ATOM   7044  C  C   . LEU C  1 308 ? 64.510 -32.953 -29.187 1.00 41.72 ? 288 LEU C C   1 
ATOM   7045  O  O   . LEU C  1 308 ? 63.675 -33.385 -29.971 1.00 42.90 ? 288 LEU C O   1 
ATOM   7046  C  CB  . LEU C  1 308 ? 66.157 -31.170 -29.973 1.00 42.37 ? 288 LEU C CB  1 
ATOM   7047  C  CG  . LEU C  1 308 ? 66.109 -31.518 -31.467 1.00 41.14 ? 288 LEU C CG  1 
ATOM   7048  C  CD1 . LEU C  1 308 ? 64.975 -30.792 -32.188 1.00 41.04 ? 288 LEU C CD1 1 
ATOM   7049  C  CD2 . LEU C  1 308 ? 67.449 -31.193 -32.093 1.00 44.85 ? 288 LEU C CD2 1 
ATOM   7050  N  N   . LYS C  1 309 ? 65.136 -33.730 -28.314 1.00 42.19 ? 289 LYS C N   1 
ATOM   7051  C  CA  . LYS C  1 309 ? 64.827 -35.149 -28.165 1.00 44.10 ? 289 LYS C CA  1 
ATOM   7052  C  C   . LYS C  1 309 ? 63.362 -35.333 -27.812 1.00 43.24 ? 289 LYS C C   1 
ATOM   7053  O  O   . LYS C  1 309 ? 62.674 -36.160 -28.390 1.00 43.09 ? 289 LYS C O   1 
ATOM   7054  C  CB  . LYS C  1 309 ? 65.648 -35.781 -27.021 1.00 45.06 ? 289 LYS C CB  1 
ATOM   7055  C  CG  . LYS C  1 309 ? 66.860 -36.603 -27.419 1.00 49.06 ? 289 LYS C CG  1 
ATOM   7056  C  CD  . LYS C  1 309 ? 67.212 -37.604 -26.304 1.00 48.70 ? 289 LYS C CD  1 
ATOM   7057  N  N   . TRP C  1 310 ? 62.911 -34.586 -26.808 1.00 44.11 ? 290 TRP C N   1 
ATOM   7058  C  CA  . TRP C  1 310 ? 61.555 -34.736 -26.280 1.00 43.59 ? 290 TRP C CA  1 
ATOM   7059  C  C   . TRP C  1 310 ? 60.488 -34.251 -27.222 1.00 43.79 ? 290 TRP C C   1 
ATOM   7060  O  O   . TRP C  1 310 ? 59.390 -34.776 -27.175 1.00 44.23 ? 290 TRP C O   1 
ATOM   7061  C  CB  . TRP C  1 310 ? 61.404 -34.023 -24.949 1.00 42.85 ? 290 TRP C CB  1 
ATOM   7062  C  CG  . TRP C  1 310 ? 62.220 -34.609 -23.837 1.00 45.83 ? 290 TRP C CG  1 
ATOM   7063  C  CD1 . TRP C  1 310 ? 62.523 -35.924 -23.637 1.00 46.52 ? 290 TRP C CD1 1 
ATOM   7064  C  CD2 . TRP C  1 310 ? 62.801 -33.892 -22.738 1.00 46.00 ? 290 TRP C CD2 1 
ATOM   7065  N  NE1 . TRP C  1 310 ? 63.273 -36.065 -22.498 1.00 48.85 ? 290 TRP C NE1 1 
ATOM   7066  C  CE2 . TRP C  1 310 ? 63.452 -34.836 -21.922 1.00 48.45 ? 290 TRP C CE2 1 
ATOM   7067  C  CE3 . TRP C  1 310 ? 62.833 -32.545 -22.372 1.00 42.18 ? 290 TRP C CE3 1 
ATOM   7068  C  CZ2 . TRP C  1 310 ? 64.126 -34.479 -20.754 1.00 47.31 ? 290 TRP C CZ2 1 
ATOM   7069  C  CZ3 . TRP C  1 310 ? 63.492 -32.191 -21.215 1.00 47.46 ? 290 TRP C CZ3 1 
ATOM   7070  C  CH2 . TRP C  1 310 ? 64.138 -33.156 -20.420 1.00 48.71 ? 290 TRP C CH2 1 
ATOM   7071  N  N   . VAL C  1 311 ? 60.797 -33.258 -28.063 1.00 44.88 ? 291 VAL C N   1 
ATOM   7072  C  CA  . VAL C  1 311 ? 59.907 -32.883 -29.190 1.00 45.17 ? 291 VAL C CA  1 
ATOM   7073  C  C   . VAL C  1 311 ? 59.732 -34.037 -30.214 1.00 45.51 ? 291 VAL C C   1 
ATOM   7074  O  O   . VAL C  1 311 ? 58.602 -34.422 -30.534 1.00 46.11 ? 291 VAL C O   1 
ATOM   7075  C  CB  . VAL C  1 311 ? 60.357 -31.559 -29.883 1.00 43.98 ? 291 VAL C CB  1 
ATOM   7076  C  CG1 . VAL C  1 311 ? 59.656 -31.382 -31.232 1.00 43.82 ? 291 VAL C CG1 1 
ATOM   7077  C  CG2 . VAL C  1 311 ? 60.074 -30.339 -28.959 1.00 43.54 ? 291 VAL C CG2 1 
ATOM   7078  N  N   . LEU C  1 312 ? 60.842 -34.606 -30.677 1.00 46.45 ? 292 LEU C N   1 
ATOM   7079  C  CA  . LEU C  1 312 ? 60.847 -35.708 -31.673 1.00 46.32 ? 292 LEU C CA  1 
ATOM   7080  C  C   . LEU C  1 312 ? 60.244 -37.018 -31.173 1.00 46.92 ? 292 LEU C C   1 
ATOM   7081  O  O   . LEU C  1 312 ? 59.626 -37.770 -31.938 1.00 47.13 ? 292 LEU C O   1 
ATOM   7082  C  CB  . LEU C  1 312 ? 62.284 -35.976 -32.154 1.00 45.57 ? 292 LEU C CB  1 
ATOM   7083  C  CG  . LEU C  1 312 ? 62.914 -34.755 -32.855 1.00 52.97 ? 292 LEU C CG  1 
ATOM   7084  C  CD1 . LEU C  1 312 ? 64.389 -34.986 -33.218 1.00 51.42 ? 292 LEU C CD1 1 
ATOM   7085  C  CD2 . LEU C  1 312 ? 62.085 -34.326 -34.096 1.00 53.30 ? 292 LEU C CD2 1 
ATOM   7086  N  N   . GLU C  1 313 ? 60.453 -37.298 -29.898 1.00 48.02 ? 293 GLU C N   1 
ATOM   7087  C  CA  . GLU C  1 313 ? 59.808 -38.425 -29.235 1.00 50.39 ? 293 GLU C CA  1 
ATOM   7088  C  C   . GLU C  1 313 ? 58.311 -38.218 -29.001 1.00 48.68 ? 293 GLU C C   1 
ATOM   7089  O  O   . GLU C  1 313 ? 57.611 -39.164 -28.674 1.00 46.54 ? 293 GLU C O   1 
ATOM   7090  C  CB  . GLU C  1 313 ? 60.493 -38.693 -27.889 1.00 51.24 ? 293 GLU C CB  1 
ATOM   7091  C  CG  . GLU C  1 313 ? 61.911 -39.215 -28.052 1.00 53.90 ? 293 GLU C CG  1 
ATOM   7092  C  CD  . GLU C  1 313 ? 62.662 -39.395 -26.744 1.00 53.87 ? 293 GLU C CD  1 
ATOM   7093  O  OE1 . GLU C  1 313 ? 62.059 -39.259 -25.655 1.00 56.84 ? 293 GLU C OE1 1 
ATOM   7094  O  OE2 . GLU C  1 313 ? 63.876 -39.692 -26.822 1.00 61.78 ? 293 GLU C OE2 1 
ATOM   7095  N  N   . GLY C  1 314 ? 57.838 -36.976 -29.135 1.00 48.70 ? 294 GLY C N   1 
ATOM   7096  C  CA  . GLY C  1 314 ? 56.422 -36.650 -28.961 1.00 46.05 ? 294 GLY C CA  1 
ATOM   7097  C  C   . GLY C  1 314 ? 56.089 -36.302 -27.534 1.00 45.88 ? 294 GLY C C   1 
ATOM   7098  O  O   . GLY C  1 314 ? 54.934 -36.043 -27.218 1.00 46.48 ? 294 GLY C O   1 
ATOM   7099  N  N   . LYS C  1 315 ? 57.104 -36.256 -26.670 1.00 45.61 ? 295 LYS C N   1 
ATOM   7100  C  CA  . LYS C  1 315 ? 56.905 -35.990 -25.237 1.00 43.63 ? 295 LYS C CA  1 
ATOM   7101  C  C   . LYS C  1 315 ? 56.644 -34.516 -24.907 1.00 42.97 ? 295 LYS C C   1 
ATOM   7102  O  O   . LYS C  1 315 ? 56.096 -34.180 -23.828 1.00 38.91 ? 295 LYS C O   1 
ATOM   7103  C  CB  . LYS C  1 315 ? 58.094 -36.514 -24.443 1.00 44.11 ? 295 LYS C CB  1 
ATOM   7104  C  CG  . LYS C  1 315 ? 57.989 -38.004 -24.126 1.00 46.88 ? 295 LYS C CG  1 
ATOM   7105  C  CD  . LYS C  1 315 ? 59.347 -38.654 -24.233 1.00 58.78 ? 295 LYS C CD  1 
ATOM   7106  C  CE  . LYS C  1 315 ? 59.339 -40.101 -23.742 1.00 62.32 ? 295 LYS C CE  1 
ATOM   7107  N  NZ  . LYS C  1 315 ? 59.201 -40.132 -22.267 1.00 66.58 ? 295 LYS C NZ  1 
ATOM   7108  N  N   . ILE C  1 316 ? 57.070 -33.647 -25.823 1.00 42.86 ? 296 ILE C N   1 
ATOM   7109  C  CA  . ILE C  1 316 ? 56.739 -32.235 -25.787 1.00 42.42 ? 296 ILE C CA  1 
ATOM   7110  C  C   . ILE C  1 316 ? 56.044 -31.903 -27.097 1.00 44.30 ? 296 ILE C C   1 
ATOM   7111  O  O   . ILE C  1 316 ? 56.624 -31.969 -28.168 1.00 45.32 ? 296 ILE C O   1 
ATOM   7112  C  CB  . ILE C  1 316 ? 57.971 -31.368 -25.533 1.00 43.16 ? 296 ILE C CB  1 
ATOM   7113  C  CG1 . ILE C  1 316 ? 58.492 -31.672 -24.128 1.00 40.08 ? 296 ILE C CG1 1 
ATOM   7114  C  CG2 . ILE C  1 316 ? 57.627 -29.889 -25.582 1.00 40.90 ? 296 ILE C CG2 1 
ATOM   7115  C  CD1 . ILE C  1 316 ? 59.688 -30.892 -23.750 1.00 39.89 ? 296 ILE C CD1 1 
ATOM   7116  N  N   . GLN C  1 317 ? 54.759 -31.617 -26.999 1.00 45.03 ? 297 GLN C N   1 
ATOM   7117  C  CA  . GLN C  1 317 ? 54.022 -31.133 -28.125 1.00 47.65 ? 297 GLN C CA  1 
ATOM   7118  C  C   . GLN C  1 317 ? 54.122 -29.622 -28.132 1.00 47.44 ? 297 GLN C C   1 
ATOM   7119  O  O   . GLN C  1 317 ? 54.189 -28.984 -27.083 1.00 51.86 ? 297 GLN C O   1 
ATOM   7120  C  CB  . GLN C  1 317 ? 52.573 -31.566 -28.031 1.00 48.65 ? 297 GLN C CB  1 
ATOM   7121  C  CG  . GLN C  1 317 ? 52.384 -33.054 -27.984 1.00 50.10 ? 297 GLN C CG  1 
ATOM   7122  C  CD  . GLN C  1 317 ? 50.925 -33.391 -27.987 1.00 54.92 ? 297 GLN C CD  1 
ATOM   7123  O  OE1 . GLN C  1 317 ? 50.243 -33.215 -28.999 1.00 54.83 ? 297 GLN C OE1 1 
ATOM   7124  N  NE2 . GLN C  1 317 ? 50.414 -33.833 -26.842 1.00 56.76 ? 297 GLN C NE2 1 
ATOM   7125  N  N   . TYR C  1 318 ? 54.136 -29.067 -29.331 1.00 47.55 ? 298 TYR C N   1 
ATOM   7126  C  CA  . TYR C  1 318 ? 54.298 -27.645 -29.542 1.00 48.39 ? 298 TYR C CA  1 
ATOM   7127  C  C   . TYR C  1 318 ? 53.093 -27.113 -30.349 1.00 48.18 ? 298 TYR C C   1 
ATOM   7128  O  O   . TYR C  1 318 ? 52.332 -27.882 -30.933 1.00 45.10 ? 298 TYR C O   1 
ATOM   7129  C  CB  . TYR C  1 318 ? 55.658 -27.353 -30.226 1.00 46.49 ? 298 TYR C CB  1 
ATOM   7130  C  CG  . TYR C  1 318 ? 55.816 -28.003 -31.561 1.00 46.83 ? 298 TYR C CG  1 
ATOM   7131  C  CD1 . TYR C  1 318 ? 55.323 -27.401 -32.724 1.00 45.59 ? 298 TYR C CD1 1 
ATOM   7132  C  CD2 . TYR C  1 318 ? 56.430 -29.241 -31.676 1.00 50.87 ? 298 TYR C CD2 1 
ATOM   7133  C  CE1 . TYR C  1 318 ? 55.462 -28.020 -33.970 1.00 48.99 ? 298 TYR C CE1 1 
ATOM   7134  C  CE2 . TYR C  1 318 ? 56.556 -29.879 -32.917 1.00 50.17 ? 298 TYR C CE2 1 
ATOM   7135  C  CZ  . TYR C  1 318 ? 56.078 -29.269 -34.056 1.00 51.48 ? 298 TYR C CZ  1 
ATOM   7136  O  OH  . TYR C  1 318 ? 56.227 -29.914 -35.275 1.00 48.46 ? 298 TYR C OH  1 
ATOM   7137  N  N   . LYS C  1 319 ? 52.928 -25.795 -30.335 1.00 49.02 ? 299 LYS C N   1 
ATOM   7138  C  CA  . LYS C  1 319 ? 51.899 -25.118 -31.086 1.00 50.47 ? 299 LYS C CA  1 
ATOM   7139  C  C   . LYS C  1 319 ? 52.307 -23.662 -31.313 1.00 49.55 ? 299 LYS C C   1 
ATOM   7140  O  O   . LYS C  1 319 ? 52.797 -22.991 -30.400 1.00 51.22 ? 299 LYS C O   1 
ATOM   7141  C  CB  . LYS C  1 319 ? 50.581 -25.181 -30.336 1.00 50.65 ? 299 LYS C CB  1 
ATOM   7142  C  CG  . LYS C  1 319 ? 49.408 -24.715 -31.173 1.00 54.36 ? 299 LYS C CG  1 
ATOM   7143  C  CD  . LYS C  1 319 ? 48.095 -25.062 -30.519 1.00 55.60 ? 299 LYS C CD  1 
ATOM   7144  C  CE  . LYS C  1 319 ? 46.943 -24.905 -31.515 1.00 64.01 ? 299 LYS C CE  1 
ATOM   7145  N  NZ  . LYS C  1 319 ? 46.862 -26.015 -32.516 1.00 65.87 ? 299 LYS C NZ  1 
ATOM   7146  N  N   . GLU C  1 320 ? 52.088 -23.175 -32.524 1.00 49.96 ? 300 GLU C N   1 
ATOM   7147  C  CA  . GLU C  1 320 ? 52.534 -21.848 -32.925 1.00 52.61 ? 300 GLU C CA  1 
ATOM   7148  C  C   . GLU C  1 320 ? 51.357 -21.054 -33.471 1.00 49.94 ? 300 GLU C C   1 
ATOM   7149  O  O   . GLU C  1 320 ? 50.441 -21.624 -34.043 1.00 51.45 ? 300 GLU C O   1 
ATOM   7150  C  CB  . GLU C  1 320 ? 53.651 -21.946 -33.981 1.00 51.69 ? 300 GLU C CB  1 
ATOM   7151  C  CG  . GLU C  1 320 ? 54.843 -22.815 -33.553 1.00 57.94 ? 300 GLU C CG  1 
ATOM   7152  C  CD  . GLU C  1 320 ? 56.007 -22.794 -34.560 1.00 59.53 ? 300 GLU C CD  1 
ATOM   7153  O  OE1 . GLU C  1 320 ? 56.346 -23.846 -35.150 1.00 67.34 ? 300 GLU C OE1 1 
ATOM   7154  O  OE2 . GLU C  1 320 ? 56.591 -21.714 -34.753 1.00 72.24 ? 300 GLU C OE2 1 
ATOM   7155  N  N   . TYR C  1 321 ? 51.403 -19.744 -33.277 1.00 48.97 ? 301 TYR C N   1 
ATOM   7156  C  CA  . TYR C  1 321 ? 50.440 -18.813 -33.828 1.00 48.93 ? 301 TYR C CA  1 
ATOM   7157  C  C   . TYR C  1 321 ? 51.255 -17.863 -34.692 1.00 48.09 ? 301 TYR C C   1 
ATOM   7158  O  O   . TYR C  1 321 ? 51.954 -16.998 -34.173 1.00 44.65 ? 301 TYR C O   1 
ATOM   7159  C  CB  . TYR C  1 321 ? 49.693 -18.042 -32.696 1.00 54.63 ? 301 TYR C CB  1 
ATOM   7160  C  CG  . TYR C  1 321 ? 48.582 -17.120 -33.184 1.00 52.83 ? 301 TYR C CG  1 
ATOM   7161  C  CD1 . TYR C  1 321 ? 47.267 -17.556 -33.283 1.00 60.02 ? 301 TYR C CD1 1 
ATOM   7162  C  CD2 . TYR C  1 321 ? 48.860 -15.819 -33.573 1.00 62.29 ? 301 TYR C CD2 1 
ATOM   7163  C  CE1 . TYR C  1 321 ? 46.254 -16.704 -33.746 1.00 63.41 ? 301 TYR C CE1 1 
ATOM   7164  C  CE2 . TYR C  1 321 ? 47.858 -14.969 -34.066 1.00 60.75 ? 301 TYR C CE2 1 
ATOM   7165  C  CZ  . TYR C  1 321 ? 46.570 -15.410 -34.141 1.00 62.48 ? 301 TYR C CZ  1 
ATOM   7166  O  OH  . TYR C  1 321 ? 45.609 -14.538 -34.610 1.00 64.18 ? 301 TYR C OH  1 
ATOM   7167  N  N   . ILE C  1 322 ? 51.164 -18.056 -36.011 1.00 48.84 ? 302 ILE C N   1 
ATOM   7168  C  CA  . ILE C  1 322 ? 51.964 -17.348 -36.990 1.00 48.46 ? 302 ILE C CA  1 
ATOM   7169  C  C   . ILE C  1 322 ? 51.179 -16.168 -37.536 1.00 49.05 ? 302 ILE C C   1 
ATOM   7170  O  O   . ILE C  1 322 ? 50.151 -16.337 -38.182 1.00 50.28 ? 302 ILE C O   1 
ATOM   7171  C  CB  . ILE C  1 322 ? 52.361 -18.270 -38.200 1.00 48.91 ? 302 ILE C CB  1 
ATOM   7172  C  CG1 . ILE C  1 322 ? 53.066 -19.556 -37.745 1.00 49.20 ? 302 ILE C CG1 1 
ATOM   7173  C  CG2 . ILE C  1 322 ? 53.212 -17.505 -39.229 1.00 48.58 ? 302 ILE C CG2 1 
ATOM   7174  C  CD1 . ILE C  1 322 ? 54.386 -19.359 -37.027 1.00 52.91 ? 302 ILE C CD1 1 
ATOM   7175  N  N   . ILE C  1 323 ? 51.682 -14.968 -37.294 1.00 50.92 ? 303 ILE C N   1 
ATOM   7176  C  CA  . ILE C  1 323 ? 51.132 -13.771 -37.895 1.00 50.64 ? 303 ILE C CA  1 
ATOM   7177  C  C   . ILE C  1 323 ? 51.984 -13.374 -39.090 1.00 50.56 ? 303 ILE C C   1 
ATOM   7178  O  O   . ILE C  1 323 ? 53.180 -13.218 -38.967 1.00 51.81 ? 303 ILE C O   1 
ATOM   7179  C  CB  . ILE C  1 323 ? 51.101 -12.670 -36.879 1.00 51.62 ? 303 ILE C CB  1 
ATOM   7180  C  CG1 . ILE C  1 323 ? 50.210 -13.109 -35.732 1.00 56.88 ? 303 ILE C CG1 1 
ATOM   7181  C  CG2 . ILE C  1 323 ? 50.559 -11.373 -37.495 1.00 51.78 ? 303 ILE C CG2 1 
ATOM   7182  C  CD1 . ILE C  1 323 ? 50.444 -12.350 -34.449 1.00 61.57 ? 303 ILE C CD1 1 
ATOM   7183  N  N   . GLU C  1 324 ? 51.362 -13.222 -40.249 1.00 51.37 ? 304 GLU C N   1 
ATOM   7184  C  CA  . GLU C  1 324 ? 52.097 -12.943 -41.472 1.00 51.57 ? 304 GLU C CA  1 
ATOM   7185  C  C   . GLU C  1 324 ? 52.356 -11.455 -41.572 1.00 49.91 ? 304 GLU C C   1 
ATOM   7186  O  O   . GLU C  1 324 ? 51.442 -10.654 -41.364 1.00 49.04 ? 304 GLU C O   1 
ATOM   7187  C  CB  . GLU C  1 324 ? 51.296 -13.350 -42.706 1.00 53.67 ? 304 GLU C CB  1 
ATOM   7188  C  CG  . GLU C  1 324 ? 50.634 -14.727 -42.667 1.00 65.67 ? 304 GLU C CG  1 
ATOM   7189  C  CD  . GLU C  1 324 ? 51.566 -15.837 -43.083 1.00 75.84 ? 304 GLU C CD  1 
ATOM   7190  O  OE1 . GLU C  1 324 ? 52.317 -15.642 -44.077 1.00 76.64 ? 304 GLU C OE1 1 
ATOM   7191  O  OE2 . GLU C  1 324 ? 51.532 -16.899 -42.408 1.00 82.66 ? 304 GLU C OE2 1 
ATOM   7192  N  N   . GLY C  1 325 ? 53.589 -11.080 -41.903 1.00 47.29 ? 305 GLY C N   1 
ATOM   7193  C  CA  . GLY C  1 325 ? 53.895 -9.702  -42.260 1.00 45.60 ? 305 GLY C CA  1 
ATOM   7194  C  C   . GLY C  1 325 ? 54.496 -8.916  -41.112 1.00 45.51 ? 305 GLY C C   1 
ATOM   7195  O  O   . GLY C  1 325 ? 53.968 -8.883  -39.995 1.00 42.56 ? 305 GLY C O   1 
ATOM   7196  N  N   . PHE C  1 326 ? 55.616 -8.271  -41.419 1.00 47.05 ? 306 PHE C N   1 
ATOM   7197  C  CA  . PHE C  1 326 ? 56.401 -7.476  -40.468 1.00 45.97 ? 306 PHE C CA  1 
ATOM   7198  C  C   . PHE C  1 326 ? 55.658 -6.188  -40.052 1.00 45.23 ? 306 PHE C C   1 
ATOM   7199  O  O   . PHE C  1 326 ? 55.766 -5.723  -38.898 1.00 44.15 ? 306 PHE C O   1 
ATOM   7200  C  CB  . PHE C  1 326 ? 57.753 -7.160  -41.136 1.00 46.92 ? 306 PHE C CB  1 
ATOM   7201  C  CG  . PHE C  1 326 ? 58.650 -6.301  -40.317 1.00 44.96 ? 306 PHE C CG  1 
ATOM   7202  C  CD1 . PHE C  1 326 ? 59.364 -6.841  -39.267 1.00 38.63 ? 306 PHE C CD1 1 
ATOM   7203  C  CD2 . PHE C  1 326 ? 58.793 -4.952  -40.604 1.00 43.86 ? 306 PHE C CD2 1 
ATOM   7204  C  CE1 . PHE C  1 326 ? 60.180 -6.039  -38.498 1.00 44.11 ? 306 PHE C CE1 1 
ATOM   7205  C  CE2 . PHE C  1 326 ? 59.621 -4.157  -39.842 1.00 44.35 ? 306 PHE C CE2 1 
ATOM   7206  C  CZ  . PHE C  1 326 ? 60.299 -4.694  -38.787 1.00 38.80 ? 306 PHE C CZ  1 
ATOM   7207  N  N   . GLU C  1 327 ? 54.918 -5.623  -41.010 1.00 44.73 ? 307 GLU C N   1 
ATOM   7208  C  CA  . GLU C  1 327 ? 53.867 -4.622  -40.749 1.00 46.62 ? 307 GLU C CA  1 
ATOM   7209  C  C   . GLU C  1 327 ? 52.995 -4.936  -39.498 1.00 45.85 ? 307 GLU C C   1 
ATOM   7210  O  O   . GLU C  1 327 ? 52.708 -4.042  -38.712 1.00 48.38 ? 307 GLU C O   1 
ATOM   7211  C  CB  . GLU C  1 327 ? 53.005 -4.356  -42.014 1.00 46.95 ? 307 GLU C CB  1 
ATOM   7212  C  CG  . GLU C  1 327 ? 52.624 -5.591  -42.918 1.00 57.05 ? 307 GLU C CG  1 
ATOM   7213  C  CD  . GLU C  1 327 ? 53.827 -6.232  -43.685 1.00 68.25 ? 307 GLU C CD  1 
ATOM   7214  O  OE1 . GLU C  1 327 ? 54.966 -5.664  -43.709 1.00 67.04 ? 307 GLU C OE1 1 
ATOM   7215  O  OE2 . GLU C  1 327 ? 53.621 -7.331  -44.253 1.00 73.28 ? 307 GLU C OE2 1 
ATOM   7216  N  N   . ASN C  1 328 ? 52.659 -6.206  -39.282 1.00 45.83 ? 308 ASN C N   1 
ATOM   7217  C  CA  . ASN C  1 328 ? 51.808 -6.659  -38.159 1.00 44.21 ? 308 ASN C CA  1 
ATOM   7218  C  C   . ASN C  1 328 ? 52.494 -7.051  -36.844 1.00 44.36 ? 308 ASN C C   1 
ATOM   7219  O  O   . ASN C  1 328 ? 51.888 -7.699  -35.993 1.00 45.31 ? 308 ASN C O   1 
ATOM   7220  C  CB  . ASN C  1 328 ? 50.994 -7.845  -38.637 1.00 39.61 ? 308 ASN C CB  1 
ATOM   7221  C  CG  . ASN C  1 328 ? 50.152 -7.503  -39.822 1.00 41.45 ? 308 ASN C CG  1 
ATOM   7222  O  OD1 . ASN C  1 328 ? 49.485 -6.451  -39.854 1.00 43.74 ? 308 ASN C OD1 1 
ATOM   7223  N  ND2 . ASN C  1 328 ? 50.145 -8.387  -40.805 1.00 36.16 ? 308 ASN C ND2 1 
ATOM   7224  N  N   . MET C  1 329 ? 53.735 -6.629  -36.648 1.00 44.60 ? 309 MET C N   1 
ATOM   7225  C  CA  . MET C  1 329 ? 54.472 -7.016  -35.445 1.00 43.99 ? 309 MET C CA  1 
ATOM   7226  C  C   . MET C  1 329 ? 54.013 -6.366  -34.151 1.00 40.91 ? 309 MET C C   1 
ATOM   7227  O  O   . MET C  1 329 ? 53.964 -7.004  -33.098 1.00 38.71 ? 309 MET C O   1 
ATOM   7228  C  CB  . MET C  1 329 ? 55.942 -6.756  -35.645 1.00 43.61 ? 309 MET C CB  1 
ATOM   7229  C  CG  . MET C  1 329 ? 56.775 -7.547  -34.716 1.00 48.03 ? 309 MET C CG  1 
ATOM   7230  S  SD  . MET C  1 329 ? 58.353 -7.868  -35.404 1.00 50.43 ? 309 MET C SD  1 
ATOM   7231  C  CE  . MET C  1 329 ? 59.083 -8.748  -34.021 1.00 48.00 ? 309 MET C CE  1 
ATOM   7232  N  N   . PRO C  1 330 ? 53.740 -5.058  -34.179 1.00 44.10 ? 310 PRO C N   1 
ATOM   7233  C  CA  . PRO C  1 330 ? 53.206 -4.485  -32.917 1.00 41.96 ? 310 PRO C CA  1 
ATOM   7234  C  C   . PRO C  1 330 ? 51.828 -5.054  -32.557 1.00 39.86 ? 310 PRO C C   1 
ATOM   7235  O  O   . PRO C  1 330 ? 51.514 -5.207  -31.389 1.00 38.97 ? 310 PRO C O   1 
ATOM   7236  C  CB  . PRO C  1 330 ? 53.130 -2.978  -33.221 1.00 43.28 ? 310 PRO C CB  1 
ATOM   7237  C  CG  . PRO C  1 330 ? 54.079 -2.753  -34.380 1.00 41.55 ? 310 PRO C CG  1 
ATOM   7238  C  CD  . PRO C  1 330 ? 53.946 -4.019  -35.207 1.00 43.16 ? 310 PRO C CD  1 
ATOM   7239  N  N   . ALA C  1 331 ? 51.018 -5.366  -33.563 1.00 40.10 ? 311 ALA C N   1 
ATOM   7240  C  CA  . ALA C  1 331 ? 49.728 -6.035  -33.341 1.00 38.71 ? 311 ALA C CA  1 
ATOM   7241  C  C   . ALA C  1 331 ? 49.965 -7.418  -32.737 1.00 38.88 ? 311 ALA C C   1 
ATOM   7242  O  O   . ALA C  1 331 ? 49.272 -7.828  -31.814 1.00 41.48 ? 311 ALA C O   1 
ATOM   7243  C  CB  . ALA C  1 331 ? 48.955 -6.129  -34.644 1.00 35.43 ? 311 ALA C CB  1 
ATOM   7244  N  N   . ALA C  1 332 ? 50.950 -8.130  -33.259 1.00 40.03 ? 312 ALA C N   1 
ATOM   7245  C  CA  . ALA C  1 332 ? 51.357 -9.437  -32.679 1.00 40.58 ? 312 ALA C CA  1 
ATOM   7246  C  C   . ALA C  1 332 ? 51.704 -9.340  -31.204 1.00 39.73 ? 312 ALA C C   1 
ATOM   7247  O  O   . ALA C  1 332 ? 51.219 -10.098 -30.399 1.00 41.20 ? 312 ALA C O   1 
ATOM   7248  C  CB  . ALA C  1 332 ? 52.546 -9.984  -33.450 1.00 40.58 ? 312 ALA C CB  1 
ATOM   7249  N  N   . PHE C  1 333 ? 52.549 -8.376  -30.865 1.00 40.24 ? 313 PHE C N   1 
ATOM   7250  C  CA  . PHE C  1 333 ? 52.967 -8.107  -29.473 1.00 39.71 ? 313 PHE C CA  1 
ATOM   7251  C  C   . PHE C  1 333 ? 51.826 -7.777  -28.549 1.00 42.39 ? 313 PHE C C   1 
ATOM   7252  O  O   . PHE C  1 333 ? 51.766 -8.270  -27.399 1.00 42.90 ? 313 PHE C O   1 
ATOM   7253  C  CB  . PHE C  1 333 ? 53.931 -6.931  -29.477 1.00 39.18 ? 313 PHE C CB  1 
ATOM   7254  C  CG  . PHE C  1 333 ? 54.501 -6.579  -28.131 1.00 43.63 ? 313 PHE C CG  1 
ATOM   7255  C  CD1 . PHE C  1 333 ? 55.029 -7.557  -27.290 1.00 45.84 ? 313 PHE C CD1 1 
ATOM   7256  C  CD2 . PHE C  1 333 ? 54.556 -5.248  -27.725 1.00 43.42 ? 313 PHE C CD2 1 
ATOM   7257  C  CE1 . PHE C  1 333 ? 55.571 -7.210  -26.056 1.00 40.86 ? 313 PHE C CE1 1 
ATOM   7258  C  CE2 . PHE C  1 333 ? 55.113 -4.903  -26.516 1.00 40.07 ? 313 PHE C CE2 1 
ATOM   7259  C  CZ  . PHE C  1 333 ? 55.633 -5.865  -25.698 1.00 44.61 ? 313 PHE C CZ  1 
ATOM   7260  N  N   . MET C  1 334 ? 50.943 -6.903  -29.026 1.00 42.40 ? 314 MET C N   1 
ATOM   7261  C  CA  . MET C  1 334 ? 49.815 -6.464  -28.232 1.00 44.73 ? 314 MET C CA  1 
ATOM   7262  C  C   . MET C  1 334 ? 48.829 -7.604  -28.036 1.00 44.27 ? 314 MET C C   1 
ATOM   7263  O  O   . MET C  1 334 ? 48.240 -7.739  -26.944 1.00 44.28 ? 314 MET C O   1 
ATOM   7264  C  CB  . MET C  1 334 ? 49.140 -5.244  -28.868 1.00 42.36 ? 314 MET C CB  1 
ATOM   7265  C  CG  . MET C  1 334 ? 50.039 -3.969  -28.783 1.00 41.70 ? 314 MET C CG  1 
ATOM   7266  S  SD  . MET C  1 334 ? 49.279 -2.493  -29.496 1.00 50.03 ? 314 MET C SD  1 
ATOM   7267  C  CE  . MET C  1 334 ? 49.762 -2.568  -31.215 1.00 43.58 ? 314 MET C CE  1 
ATOM   7268  N  N   . GLY C  1 335 ? 48.682 -8.419  -29.081 1.00 41.86 ? 315 GLY C N   1 
ATOM   7269  C  CA  . GLY C  1 335 ? 47.818 -9.594  -29.046 1.00 42.39 ? 315 GLY C CA  1 
ATOM   7270  C  C   . GLY C  1 335 ? 48.271 -10.571 -27.983 1.00 41.99 ? 315 GLY C C   1 
ATOM   7271  O  O   . GLY C  1 335 ? 47.507 -11.017 -27.148 1.00 43.49 ? 315 GLY C O   1 
ATOM   7272  N  N   . MET C  1 336 ? 49.539 -10.886 -28.028 1.00 42.58 ? 316 MET C N   1 
ATOM   7273  C  CA  . MET C  1 336 ? 50.148 -11.754 -27.062 1.00 43.66 ? 316 MET C CA  1 
ATOM   7274  C  C   . MET C  1 336 ? 50.019 -11.176 -25.651 1.00 44.72 ? 316 MET C C   1 
ATOM   7275  O  O   . MET C  1 336 ? 49.670 -11.901 -24.714 1.00 46.20 ? 316 MET C O   1 
ATOM   7276  C  CB  . MET C  1 336 ? 51.598 -11.967 -27.478 1.00 43.76 ? 316 MET C CB  1 
ATOM   7277  C  CG  . MET C  1 336 ? 52.496 -12.809 -26.565 1.00 49.25 ? 316 MET C CG  1 
ATOM   7278  S  SD  . MET C  1 336 ? 53.393 -11.851 -25.336 1.00 51.80 ? 316 MET C SD  1 
ATOM   7279  C  CE  . MET C  1 336 ? 54.179 -10.561 -26.297 1.00 48.80 ? 316 MET C CE  1 
ATOM   7280  N  N   . LEU C  1 337 ? 50.241 -9.871  -25.497 1.00 43.87 ? 317 LEU C N   1 
ATOM   7281  C  CA  . LEU C  1 337 ? 50.166 -9.276  -24.186 1.00 43.26 ? 317 LEU C CA  1 
ATOM   7282  C  C   . LEU C  1 337 ? 48.770 -9.372  -23.624 1.00 45.37 ? 317 LEU C C   1 
ATOM   7283  O  O   . LEU C  1 337 ? 48.593 -9.565  -22.414 1.00 48.73 ? 317 LEU C O   1 
ATOM   7284  C  CB  . LEU C  1 337 ? 50.593 -7.826  -24.207 1.00 45.49 ? 317 LEU C CB  1 
ATOM   7285  C  CG  . LEU C  1 337 ? 52.082 -7.538  -24.322 1.00 41.46 ? 317 LEU C CG  1 
ATOM   7286  C  CD1 . LEU C  1 337 ? 52.230 -6.026  -24.312 1.00 35.56 ? 317 LEU C CD1 1 
ATOM   7287  C  CD2 . LEU C  1 337 ? 52.910 -8.206  -23.231 1.00 41.29 ? 317 LEU C CD2 1 
ATOM   7288  N  N   . LYS C  1 338 ? 47.786 -9.222  -24.484 1.00 46.10 ? 318 LYS C N   1 
ATOM   7289  C  CA  . LYS C  1 338 ? 46.394 -9.414  -24.100 1.00 50.46 ? 318 LYS C CA  1 
ATOM   7290  C  C   . LYS C  1 338 ? 46.005 -10.885 -23.856 1.00 53.84 ? 318 LYS C C   1 
ATOM   7291  O  O   . LYS C  1 338 ? 44.959 -11.134 -23.288 1.00 55.16 ? 318 LYS C O   1 
ATOM   7292  C  CB  . LYS C  1 338 ? 45.453 -8.754  -25.132 1.00 46.99 ? 318 LYS C CB  1 
ATOM   7293  C  CG  . LYS C  1 338 ? 45.336 -7.228  -24.968 1.00 45.39 ? 318 LYS C CG  1 
ATOM   7294  C  CD  . LYS C  1 338 ? 44.727 -6.884  -23.563 1.00 47.19 ? 318 LYS C CD  1 
ATOM   7295  C  CE  . LYS C  1 338 ? 44.042 -5.490  -23.466 1.00 45.68 ? 318 LYS C CE  1 
ATOM   7296  N  NZ  . LYS C  1 338 ? 43.674 -5.074  -22.001 1.00 42.08 ? 318 LYS C NZ  1 
ATOM   7297  N  N   . GLY C  1 339 ? 46.838 -11.857 -24.231 1.00 57.23 ? 319 GLY C N   1 
ATOM   7298  C  CA  . GLY C  1 339 ? 46.443 -13.264 -24.153 1.00 56.80 ? 319 GLY C CA  1 
ATOM   7299  C  C   . GLY C  1 339 ? 45.496 -13.693 -25.278 1.00 59.87 ? 319 GLY C C   1 
ATOM   7300  O  O   . GLY C  1 339 ? 44.757 -14.676 -25.149 1.00 56.64 ? 319 GLY C O   1 
ATOM   7301  N  N   . ASP C  1 340 ? 45.514 -12.970 -26.389 1.00 63.20 ? 320 ASP C N   1 
ATOM   7302  C  CA  . ASP C  1 340 ? 44.588 -13.269 -27.481 1.00 68.51 ? 320 ASP C CA  1 
ATOM   7303  C  C   . ASP C  1 340 ? 44.875 -14.600 -28.191 1.00 67.76 ? 320 ASP C C   1 
ATOM   7304  O  O   . ASP C  1 340 ? 43.970 -15.256 -28.674 1.00 67.41 ? 320 ASP C O   1 
ATOM   7305  C  CB  . ASP C  1 340 ? 44.598 -12.139 -28.531 1.00 70.84 ? 320 ASP C CB  1 
ATOM   7306  C  CG  . ASP C  1 340 ? 43.875 -10.873 -28.062 1.00 76.97 ? 320 ASP C CG  1 
ATOM   7307  O  OD1 . ASP C  1 340 ? 43.270 -10.889 -26.956 1.00 72.27 ? 320 ASP C OD1 1 
ATOM   7308  O  OD2 . ASP C  1 340 ? 43.921 -9.866  -28.821 1.00 80.58 ? 320 ASP C OD2 1 
ATOM   7309  N  N   . ASN C  1 341 ? 46.143 -14.976 -28.243 1.00 68.26 ? 321 ASN C N   1 
ATOM   7310  C  CA  . ASN C  1 341 ? 46.627 -16.016 -29.151 1.00 65.69 ? 321 ASN C CA  1 
ATOM   7311  C  C   . ASN C  1 341 ? 46.895 -17.350 -28.410 1.00 64.25 ? 321 ASN C C   1 
ATOM   7312  O  O   . ASN C  1 341 ? 47.403 -17.330 -27.261 1.00 62.52 ? 321 ASN C O   1 
ATOM   7313  C  CB  . ASN C  1 341 ? 47.916 -15.501 -29.847 1.00 67.00 ? 321 ASN C CB  1 
ATOM   7314  C  CG  . ASN C  1 341 ? 47.745 -14.083 -30.492 1.00 67.27 ? 321 ASN C CG  1 
ATOM   7315  O  OD1 . ASN C  1 341 ? 48.725 -13.308 -30.656 1.00 56.23 ? 321 ASN C OD1 1 
ATOM   7316  N  ND2 . ASN C  1 341 ? 46.500 -13.760 -30.870 1.00 59.87 ? 321 ASN C ND2 1 
ATOM   7317  N  N   . LEU C  1 342 ? 46.543 -18.478 -29.063 1.00 60.19 ? 322 LEU C N   1 
ATOM   7318  C  CA  . LEU C  1 342 ? 46.914 -19.856 -28.615 1.00 58.81 ? 322 LEU C CA  1 
ATOM   7319  C  C   . LEU C  1 342 ? 48.211 -20.456 -29.310 1.00 54.84 ? 322 LEU C C   1 
ATOM   7320  O  O   . LEU C  1 342 ? 48.217 -20.762 -30.496 1.00 50.75 ? 322 LEU C O   1 
ATOM   7321  C  CB  . LEU C  1 342 ? 45.722 -20.817 -28.790 1.00 58.25 ? 322 LEU C CB  1 
ATOM   7322  C  CG  . LEU C  1 342 ? 45.956 -22.287 -28.386 1.00 59.21 ? 322 LEU C CG  1 
ATOM   7323  C  CD1 . LEU C  1 342 ? 45.930 -22.435 -26.902 1.00 62.53 ? 322 LEU C CD1 1 
ATOM   7324  C  CD2 . LEU C  1 342 ? 44.945 -23.223 -29.006 1.00 61.46 ? 322 LEU C CD2 1 
ATOM   7325  N  N   . GLY C  1 343 ? 49.275 -20.654 -28.532 1.00 51.93 ? 323 GLY C N   1 
ATOM   7326  C  CA  . GLY C  1 343 ? 50.575 -21.087 -29.041 1.00 52.14 ? 323 GLY C CA  1 
ATOM   7327  C  C   . GLY C  1 343 ? 51.614 -19.967 -29.046 1.00 50.74 ? 323 GLY C C   1 
ATOM   7328  O  O   . GLY C  1 343 ? 51.295 -18.819 -28.827 1.00 54.44 ? 323 GLY C O   1 
ATOM   7329  N  N   . LYS C  1 344 ? 52.865 -20.294 -29.321 1.00 48.23 ? 324 LYS C N   1 
ATOM   7330  C  CA  . LYS C  1 344 ? 53.898 -19.280 -29.444 1.00 46.09 ? 324 LYS C CA  1 
ATOM   7331  C  C   . LYS C  1 344 ? 53.594 -18.300 -30.576 1.00 44.71 ? 324 LYS C C   1 
ATOM   7332  O  O   . LYS C  1 344 ? 53.320 -18.714 -31.707 1.00 44.65 ? 324 LYS C O   1 
ATOM   7333  C  CB  . LYS C  1 344 ? 55.250 -19.961 -29.671 1.00 46.25 ? 324 LYS C CB  1 
ATOM   7334  C  CG  . LYS C  1 344 ? 56.455 -19.043 -29.741 1.00 44.53 ? 324 LYS C CG  1 
ATOM   7335  C  CD  . LYS C  1 344 ? 56.831 -18.423 -28.400 1.00 40.47 ? 324 LYS C CD  1 
ATOM   7336  C  CE  . LYS C  1 344 ? 57.789 -17.230 -28.620 1.00 42.59 ? 324 LYS C CE  1 
ATOM   7337  N  NZ  . LYS C  1 344 ? 56.999 -15.976 -28.810 1.00 48.88 ? 324 LYS C NZ  1 
ATOM   7338  N  N   . THR C  1 345 ? 53.636 -17.003 -30.265 1.00 45.09 ? 325 THR C N   1 
ATOM   7339  C  CA  . THR C  1 345 ? 53.439 -15.963 -31.268 1.00 44.93 ? 325 THR C CA  1 
ATOM   7340  C  C   . THR C  1 345 ? 54.732 -15.671 -31.983 1.00 42.58 ? 325 THR C C   1 
ATOM   7341  O  O   . THR C  1 345 ? 55.777 -15.391 -31.367 1.00 38.94 ? 325 THR C O   1 
ATOM   7342  C  CB  . THR C  1 345 ? 52.929 -14.587 -30.723 1.00 46.91 ? 325 THR C CB  1 
ATOM   7343  O  OG1 . THR C  1 345 ? 51.994 -14.749 -29.665 1.00 46.92 ? 325 THR C OG1 1 
ATOM   7344  C  CG2 . THR C  1 345 ? 52.279 -13.814 -31.853 1.00 48.49 ? 325 THR C CG2 1 
ATOM   7345  N  N   . ILE C  1 346 ? 54.604 -15.655 -33.303 1.00 45.17 ? 326 ILE C N   1 
ATOM   7346  C  CA  . ILE C  1 346 ? 55.713 -15.621 -34.250 1.00 46.21 ? 326 ILE C CA  1 
ATOM   7347  C  C   . ILE C  1 346 ? 55.244 -14.841 -35.452 1.00 45.88 ? 326 ILE C C   1 
ATOM   7348  O  O   . ILE C  1 346 ? 54.150 -15.076 -35.946 1.00 44.99 ? 326 ILE C O   1 
ATOM   7349  C  CB  . ILE C  1 346 ? 56.012 -17.048 -34.761 1.00 47.79 ? 326 ILE C CB  1 
ATOM   7350  C  CG1 . ILE C  1 346 ? 56.589 -17.938 -33.632 1.00 46.85 ? 326 ILE C CG1 1 
ATOM   7351  C  CG2 . ILE C  1 346 ? 56.907 -17.027 -36.008 1.00 52.40 ? 326 ILE C CG2 1 
ATOM   7352  C  CD1 . ILE C  1 346 ? 57.933 -17.514 -33.124 1.00 46.47 ? 326 ILE C CD1 1 
ATOM   7353  N  N   . VAL C  1 347 ? 56.067 -13.914 -35.918 1.00 46.09 ? 327 VAL C N   1 
ATOM   7354  C  CA  . VAL C  1 347 ? 55.754 -13.143 -37.101 1.00 45.56 ? 327 VAL C CA  1 
ATOM   7355  C  C   . VAL C  1 347 ? 56.559 -13.711 -38.250 1.00 45.40 ? 327 VAL C C   1 
ATOM   7356  O  O   . VAL C  1 347 ? 57.768 -13.831 -38.168 1.00 42.53 ? 327 VAL C O   1 
ATOM   7357  C  CB  . VAL C  1 347 ? 56.086 -11.659 -36.875 1.00 46.12 ? 327 VAL C CB  1 
ATOM   7358  C  CG1 . VAL C  1 347 ? 55.999 -10.853 -38.173 1.00 43.43 ? 327 VAL C CG1 1 
ATOM   7359  C  CG2 . VAL C  1 347 ? 55.187 -11.087 -35.813 1.00 48.95 ? 327 VAL C CG2 1 
ATOM   7360  N  N   . LYS C  1 348 ? 55.876 -14.071 -39.323 1.00 47.84 ? 328 LYS C N   1 
ATOM   7361  C  CA  . LYS C  1 348 ? 56.535 -14.562 -40.535 1.00 49.13 ? 328 LYS C CA  1 
ATOM   7362  C  C   . LYS C  1 348 ? 56.736 -13.387 -41.471 1.00 49.42 ? 328 LYS C C   1 
ATOM   7363  O  O   . LYS C  1 348 ? 55.773 -12.840 -41.973 1.00 48.15 ? 328 LYS C O   1 
ATOM   7364  C  CB  . LYS C  1 348 ? 55.689 -15.647 -41.216 1.00 50.36 ? 328 LYS C CB  1 
ATOM   7365  C  CG  . LYS C  1 348 ? 56.232 -16.095 -42.556 1.00 49.57 ? 328 LYS C CG  1 
ATOM   7366  C  CD  . LYS C  1 348 ? 55.797 -17.514 -42.928 1.00 50.49 ? 328 LYS C CD  1 
ATOM   7367  C  CE  . LYS C  1 348 ? 56.735 -18.114 -44.003 1.00 55.41 ? 328 LYS C CE  1 
ATOM   7368  N  NZ  . LYS C  1 348 ? 57.026 -19.589 -43.813 1.00 56.21 ? 328 LYS C NZ  1 
ATOM   7369  N  N   . ALA C  1 349 ? 57.986 -12.995 -41.694 1.00 51.92 ? 329 ALA C N   1 
ATOM   7370  C  CA  . ALA C  1 349 ? 58.292 -11.893 -42.610 1.00 54.00 ? 329 ALA C CA  1 
ATOM   7371  C  CB  . ALA C  1 349 ? 59.774 -11.540 -42.533 1.00 53.99 ? 329 ALA C CB  1 
ATOM   7372  N  N   . SER D  1 22  ? 48.324 -24.185 46.365  1.00 60.97 ? 2   SER D N   1 
ATOM   7373  C  CA  . SER D  1 22  ? 49.044 -24.098 45.039  1.00 61.37 ? 2   SER D CA  1 
ATOM   7374  C  C   . SER D  1 22  ? 48.332 -23.202 43.980  1.00 61.78 ? 2   SER D C   1 
ATOM   7375  O  O   . SER D  1 22  ? 47.463 -23.661 43.213  1.00 60.38 ? 2   SER D O   1 
ATOM   7376  C  CB  . SER D  1 22  ? 49.273 -25.505 44.490  1.00 61.28 ? 2   SER D CB  1 
ATOM   7377  O  OG  . SER D  1 22  ? 50.153 -25.490 43.377  1.00 59.22 ? 2   SER D OG  1 
ATOM   7378  N  N   . MET D  1 23  ? 48.726 -21.925 43.937  1.00 62.33 ? 3   MET D N   1 
ATOM   7379  C  CA  . MET D  1 23  ? 48.078 -20.904 43.082  1.00 61.20 ? 3   MET D CA  1 
ATOM   7380  C  C   . MET D  1 23  ? 48.980 -20.362 41.977  1.00 57.87 ? 3   MET D C   1 
ATOM   7381  O  O   . MET D  1 23  ? 50.205 -20.356 42.105  1.00 56.68 ? 3   MET D O   1 
ATOM   7382  C  CB  . MET D  1 23  ? 47.578 -19.741 43.949  1.00 63.19 ? 3   MET D CB  1 
ATOM   7383  C  CG  . MET D  1 23  ? 46.476 -20.166 44.969  1.00 69.66 ? 3   MET D CG  1 
ATOM   7384  S  SD  . MET D  1 23  ? 44.801 -20.218 44.254  1.00 76.62 ? 3   MET D SD  1 
ATOM   7385  C  CE  . MET D  1 23  ? 44.427 -18.463 44.081  1.00 76.22 ? 3   MET D CE  1 
ATOM   7386  N  N   . THR D  1 24  ? 48.350 -19.921 40.885  1.00 55.24 ? 4   THR D N   1 
ATOM   7387  C  CA  . THR D  1 24  ? 49.051 -19.291 39.755  1.00 51.39 ? 4   THR D CA  1 
ATOM   7388  C  C   . THR D  1 24  ? 48.298 -18.047 39.266  1.00 50.23 ? 4   THR D C   1 
ATOM   7389  O  O   . THR D  1 24  ? 47.061 -17.942 39.391  1.00 47.66 ? 4   THR D O   1 
ATOM   7390  C  CB  . THR D  1 24  ? 49.298 -20.286 38.562  1.00 50.30 ? 4   THR D CB  1 
ATOM   7391  O  OG1 . THR D  1 24  ? 50.140 -19.667 37.581  1.00 44.93 ? 4   THR D OG1 1 
ATOM   7392  C  CG2 . THR D  1 24  ? 48.002 -20.738 37.874  1.00 47.15 ? 4   THR D CG2 1 
ATOM   7393  N  N   . LYS D  1 25  ? 49.056 -17.104 38.714  1.00 47.86 ? 5   LYS D N   1 
ATOM   7394  C  CA  . LYS D  1 25  ? 48.471 -15.981 38.015  1.00 46.71 ? 5   LYS D CA  1 
ATOM   7395  C  C   . LYS D  1 25  ? 48.819 -16.094 36.532  1.00 44.45 ? 5   LYS D C   1 
ATOM   7396  O  O   . LYS D  1 25  ? 49.927 -16.462 36.171  1.00 42.97 ? 5   LYS D O   1 
ATOM   7397  C  CB  . LYS D  1 25  ? 48.898 -14.644 38.665  1.00 48.54 ? 5   LYS D CB  1 
ATOM   7398  C  CG  . LYS D  1 25  ? 48.107 -14.328 39.966  1.00 49.78 ? 5   LYS D CG  1 
ATOM   7399  C  CD  . LYS D  1 25  ? 48.279 -12.893 40.488  1.00 49.81 ? 5   LYS D CD  1 
ATOM   7400  N  N   . THR D  1 26  ? 47.839 -15.830 35.676  1.00 44.29 ? 6   THR D N   1 
ATOM   7401  C  CA  . THR D  1 26  ? 47.978 -16.044 34.231  1.00 44.73 ? 6   THR D CA  1 
ATOM   7402  C  C   . THR D  1 26  ? 47.406 -14.865 33.451  1.00 42.06 ? 6   THR D C   1 
ATOM   7403  O  O   . THR D  1 26  ? 46.325 -14.401 33.746  1.00 42.11 ? 6   THR D O   1 
ATOM   7404  C  CB  . THR D  1 26  ? 47.274 -17.367 33.768  1.00 45.28 ? 6   THR D CB  1 
ATOM   7405  O  OG1 . THR D  1 26  ? 47.802 -18.467 34.520  1.00 45.20 ? 6   THR D OG1 1 
ATOM   7406  C  CG2 . THR D  1 26  ? 47.478 -17.636 32.260  1.00 42.62 ? 6   THR D CG2 1 
ATOM   7407  N  N   . TRP D  1 27  ? 48.167 -14.392 32.462  1.00 41.04 ? 7   TRP D N   1 
ATOM   7408  C  CA  . TRP D  1 27  ? 47.726 -13.388 31.500  1.00 38.49 ? 7   TRP D CA  1 
ATOM   7409  C  C   . TRP D  1 27  ? 47.082 -14.046 30.299  1.00 39.61 ? 7   TRP D C   1 
ATOM   7410  O  O   . TRP D  1 27  ? 47.703 -14.864 29.634  1.00 40.63 ? 7   TRP D O   1 
ATOM   7411  C  CB  . TRP D  1 27  ? 48.914 -12.540 31.044  1.00 39.06 ? 7   TRP D CB  1 
ATOM   7412  C  CG  . TRP D  1 27  ? 49.248 -11.439 31.991  1.00 35.25 ? 7   TRP D CG  1 
ATOM   7413  C  CD1 . TRP D  1 27  ? 50.383 -11.295 32.728  1.00 35.92 ? 7   TRP D CD1 1 
ATOM   7414  C  CD2 . TRP D  1 27  ? 48.422 -10.310 32.298  1.00 38.65 ? 7   TRP D CD2 1 
ATOM   7415  N  NE1 . TRP D  1 27  ? 50.316 -10.166 33.488  1.00 33.33 ? 7   TRP D NE1 1 
ATOM   7416  C  CE2 . TRP D  1 27  ? 49.122 -9.530  33.232  1.00 33.95 ? 7   TRP D CE2 1 
ATOM   7417  C  CE3 . TRP D  1 27  ? 47.155 -9.883  31.861  1.00 32.42 ? 7   TRP D CE3 1 
ATOM   7418  C  CZ2 . TRP D  1 27  ? 48.616 -8.329  33.725  1.00 30.11 ? 7   TRP D CZ2 1 
ATOM   7419  C  CZ3 . TRP D  1 27  ? 46.660 -8.714  32.361  1.00 36.39 ? 7   TRP D CZ3 1 
ATOM   7420  C  CH2 . TRP D  1 27  ? 47.383 -7.955  33.295  1.00 33.26 ? 7   TRP D CH2 1 
ATOM   7421  N  N   . THR D  1 28  ? 45.817 -13.698 30.043  1.00 41.81 ? 8   THR D N   1 
ATOM   7422  C  CA  . THR D  1 28  ? 45.047 -14.256 28.933  1.00 42.45 ? 8   THR D CA  1 
ATOM   7423  C  C   . THR D  1 28  ? 44.756 -13.208 27.861  1.00 44.25 ? 8   THR D C   1 
ATOM   7424  O  O   . THR D  1 28  ? 44.855 -11.998 28.087  1.00 43.61 ? 8   THR D O   1 
ATOM   7425  C  CB  . THR D  1 28  ? 43.701 -14.910 29.430  1.00 43.44 ? 8   THR D CB  1 
ATOM   7426  O  OG1 . THR D  1 28  ? 42.857 -13.938 30.057  1.00 42.94 ? 8   THR D OG1 1 
ATOM   7427  C  CG2 . THR D  1 28  ? 43.994 -16.045 30.428  1.00 42.40 ? 8   THR D CG2 1 
ATOM   7428  N  N   . LEU D  1 29  ? 44.390 -13.695 26.687  1.00 46.12 ? 9   LEU D N   1 
ATOM   7429  C  CA  . LEU D  1 29  ? 43.904 -12.849 25.636  1.00 46.85 ? 9   LEU D CA  1 
ATOM   7430  C  C   . LEU D  1 29  ? 42.403 -12.692 25.792  1.00 48.01 ? 9   LEU D C   1 
ATOM   7431  O  O   . LEU D  1 29  ? 41.645 -13.601 25.460  1.00 49.38 ? 9   LEU D O   1 
ATOM   7432  C  CB  . LEU D  1 29  ? 44.227 -13.480 24.293  1.00 47.06 ? 9   LEU D CB  1 
ATOM   7433  C  CG  . LEU D  1 29  ? 43.856 -12.642 23.072  1.00 45.58 ? 9   LEU D CG  1 
ATOM   7434  C  CD1 . LEU D  1 29  ? 44.842 -11.509 22.907  1.00 42.05 ? 9   LEU D CD1 1 
ATOM   7435  C  CD2 . LEU D  1 29  ? 43.835 -13.514 21.831  1.00 50.41 ? 9   LEU D CD2 1 
ATOM   7436  N  N   . LYS D  1 30  ? 41.981 -11.529 26.290  1.00 48.14 ? 10  LYS D N   1 
ATOM   7437  C  CA  . LYS D  1 30  ? 40.569 -11.197 26.441  1.00 47.28 ? 10  LYS D CA  1 
ATOM   7438  C  C   . LYS D  1 30  ? 39.947 -10.900 25.090  1.00 45.45 ? 10  LYS D C   1 
ATOM   7439  O  O   . LYS D  1 30  ? 38.817 -11.298 24.833  1.00 45.87 ? 10  LYS D O   1 
ATOM   7440  C  CB  . LYS D  1 30  ? 40.370 -9.988  27.377  1.00 47.91 ? 10  LYS D CB  1 
ATOM   7441  C  CG  . LYS D  1 30  ? 39.004 -9.951  28.103  1.00 51.21 ? 10  LYS D CG  1 
ATOM   7442  C  CD  . LYS D  1 30  ? 38.541 -8.524  28.463  1.00 52.74 ? 10  LYS D CD  1 
ATOM   7443  C  CE  . LYS D  1 30  ? 39.523 -7.816  29.395  1.00 63.56 ? 10  LYS D CE  1 
ATOM   7444  N  NZ  . LYS D  1 30  ? 39.201 -6.364  29.588  1.00 64.98 ? 10  LYS D NZ  1 
ATOM   7445  N  N   . LYS D  1 31  ? 40.679 -10.170 24.249  1.00 44.36 ? 11  LYS D N   1 
ATOM   7446  C  CA  . LYS D  1 31  ? 40.200 -9.746  22.961  1.00 42.98 ? 11  LYS D CA  1 
ATOM   7447  C  C   . LYS D  1 31  ? 41.303 -9.679  21.933  1.00 41.70 ? 11  LYS D C   1 
ATOM   7448  O  O   . LYS D  1 31  ? 42.423 -9.327  22.228  1.00 43.69 ? 11  LYS D O   1 
ATOM   7449  C  CB  . LYS D  1 31  ? 39.504 -8.384  23.052  1.00 45.79 ? 11  LYS D CB  1 
ATOM   7450  C  CG  . LYS D  1 31  ? 37.979 -8.437  22.765  1.00 51.27 ? 11  LYS D CG  1 
ATOM   7451  C  CD  . LYS D  1 31  ? 37.154 -8.521  24.051  1.00 54.19 ? 11  LYS D CD  1 
ATOM   7452  C  CE  . LYS D  1 31  ? 35.799 -7.858  23.891  1.00 60.47 ? 11  LYS D CE  1 
ATOM   7453  N  NZ  . LYS D  1 31  ? 35.444 -6.995  25.067  1.00 62.41 ? 11  LYS D NZ  1 
ATOM   7454  N  N   . HIS D  1 32  ? 40.965 -10.034 20.708  1.00 40.98 ? 12  HIS D N   1 
ATOM   7455  C  CA  . HIS D  1 32  ? 41.907 -10.023 19.616  1.00 41.39 ? 12  HIS D CA  1 
ATOM   7456  C  C   . HIS D  1 32  ? 42.395 -8.579  19.333  1.00 40.12 ? 12  HIS D C   1 
ATOM   7457  O  O   . HIS D  1 32  ? 41.610 -7.633  19.291  1.00 40.80 ? 12  HIS D O   1 
ATOM   7458  C  CB  . HIS D  1 32  ? 41.265 -10.705 18.380  1.00 39.67 ? 12  HIS D CB  1 
ATOM   7459  C  CG  . HIS D  1 32  ? 41.403 -12.200 18.380  1.00 45.86 ? 12  HIS D CG  1 
ATOM   7460  N  ND1 . HIS D  1 32  ? 42.635 -12.834 18.355  1.00 40.40 ? 12  HIS D ND1 1 
ATOM   7461  C  CD2 . HIS D  1 32  ? 40.470 -13.184 18.423  1.00 45.88 ? 12  HIS D CD2 1 
ATOM   7462  C  CE1 . HIS D  1 32  ? 42.447 -14.140 18.382  1.00 40.30 ? 12  HIS D CE1 1 
ATOM   7463  N  NE2 . HIS D  1 32  ? 41.144 -14.379 18.424  1.00 45.44 ? 12  HIS D NE2 1 
ATOM   7464  N  N   . PHE D  1 33  ? 43.698 -8.433  19.148  1.00 40.15 ? 13  PHE D N   1 
ATOM   7465  C  CA  . PHE D  1 33  ? 44.323 -7.136  18.924  1.00 38.51 ? 13  PHE D CA  1 
ATOM   7466  C  C   . PHE D  1 33  ? 43.888 -6.534  17.592  1.00 38.43 ? 13  PHE D C   1 
ATOM   7467  O  O   . PHE D  1 33  ? 43.921 -7.202  16.570  1.00 37.49 ? 13  PHE D O   1 
ATOM   7468  C  CB  . PHE D  1 33  ? 45.856 -7.234  18.930  1.00 36.80 ? 13  PHE D CB  1 
ATOM   7469  C  CG  . PHE D  1 33  ? 46.428 -8.021  20.076  1.00 32.14 ? 13  PHE D CG  1 
ATOM   7470  C  CD1 . PHE D  1 33  ? 46.025 -7.767  21.380  1.00 39.81 ? 13  PHE D CD1 1 
ATOM   7471  C  CD2 . PHE D  1 33  ? 47.393 -9.010  19.836  1.00 38.26 ? 13  PHE D CD2 1 
ATOM   7472  C  CE1 . PHE D  1 33  ? 46.554 -8.479  22.440  1.00 39.61 ? 13  PHE D CE1 1 
ATOM   7473  C  CE2 . PHE D  1 33  ? 47.942 -9.741  20.867  1.00 37.26 ? 13  PHE D CE2 1 
ATOM   7474  C  CZ  . PHE D  1 33  ? 47.539 -9.462  22.192  1.00 41.18 ? 13  PHE D CZ  1 
ATOM   7475  N  N   . VAL D  1 34  ? 43.476 -5.269  17.630  1.00 38.39 ? 14  VAL D N   1 
ATOM   7476  C  CA  . VAL D  1 34  ? 43.264 -4.480  16.409  1.00 39.78 ? 14  VAL D CA  1 
ATOM   7477  C  C   . VAL D  1 34  ? 44.337 -3.391  16.311  1.00 40.62 ? 14  VAL D C   1 
ATOM   7478  O  O   . VAL D  1 34  ? 44.421 -2.500  17.172  1.00 43.14 ? 14  VAL D O   1 
ATOM   7479  C  CB  . VAL D  1 34  ? 41.880 -3.882  16.340  1.00 36.97 ? 14  VAL D CB  1 
ATOM   7480  C  CG1 . VAL D  1 34  ? 41.663 -3.234  14.972  1.00 31.96 ? 14  VAL D CG1 1 
ATOM   7481  C  CG2 . VAL D  1 34  ? 40.842 -4.995  16.605  1.00 36.04 ? 14  VAL D CG2 1 
ATOM   7482  N  N   . GLY D  1 35  ? 45.152 -3.514  15.265  1.00 39.60 ? 15  GLY D N   1 
ATOM   7483  C  CA  . GLY D  1 35  ? 46.446 -2.876  15.198  1.00 39.90 ? 15  GLY D CA  1 
ATOM   7484  C  C   . GLY D  1 35  ? 47.361 -3.250  16.340  1.00 36.78 ? 15  GLY D C   1 
ATOM   7485  O  O   . GLY D  1 35  ? 47.626 -4.416  16.566  1.00 39.63 ? 15  GLY D O   1 
ATOM   7486  N  N   . TYR D  1 36  ? 47.861 -2.265  17.071  1.00 35.78 ? 16  TYR D N   1 
ATOM   7487  C  CA  . TYR D  1 36  ? 48.599 -2.572  18.322  1.00 36.34 ? 16  TYR D CA  1 
ATOM   7488  C  C   . TYR D  1 36  ? 47.660 -3.078  19.422  1.00 36.35 ? 16  TYR D C   1 
ATOM   7489  O  O   . TYR D  1 36  ? 46.481 -2.714  19.487  1.00 41.57 ? 16  TYR D O   1 
ATOM   7490  C  CB  . TYR D  1 36  ? 49.414 -1.364  18.859  1.00 35.94 ? 16  TYR D CB  1 
ATOM   7491  C  CG  . TYR D  1 36  ? 50.557 -0.956  17.976  1.00 35.70 ? 16  TYR D CG  1 
ATOM   7492  C  CD1 . TYR D  1 36  ? 50.378 -0.025  16.947  1.00 35.34 ? 16  TYR D CD1 1 
ATOM   7493  C  CD2 . TYR D  1 36  ? 51.828 -1.505  18.150  1.00 37.17 ? 16  TYR D CD2 1 
ATOM   7494  C  CE1 . TYR D  1 36  ? 51.446 0.331   16.101  1.00 38.21 ? 16  TYR D CE1 1 
ATOM   7495  C  CE2 . TYR D  1 36  ? 52.896 -1.164  17.286  1.00 32.58 ? 16  TYR D CE2 1 
ATOM   7496  C  CZ  . TYR D  1 36  ? 52.684 -0.246  16.288  1.00 35.74 ? 16  TYR D CZ  1 
ATOM   7497  O  OH  . TYR D  1 36  ? 53.731 0.087   15.485  1.00 47.56 ? 16  TYR D OH  1 
ATOM   7498  N  N   . PRO D  1 37  ? 48.173 -3.928  20.292  1.00 36.12 ? 17  PRO D N   1 
ATOM   7499  C  CA  . PRO D  1 37  ? 47.427 -4.173  21.504  1.00 36.06 ? 17  PRO D CA  1 
ATOM   7500  C  C   . PRO D  1 37  ? 47.139 -2.921  22.347  1.00 37.84 ? 17  PRO D C   1 
ATOM   7501  O  O   . PRO D  1 37  ? 47.792 -1.881  22.215  1.00 36.57 ? 17  PRO D O   1 
ATOM   7502  C  CB  . PRO D  1 37  ? 48.345 -5.107  22.272  1.00 35.03 ? 17  PRO D CB  1 
ATOM   7503  C  CG  . PRO D  1 37  ? 49.161 -5.741  21.235  1.00 33.86 ? 17  PRO D CG  1 
ATOM   7504  C  CD  . PRO D  1 37  ? 49.397 -4.744  20.206  1.00 32.75 ? 17  PRO D CD  1 
ATOM   7505  N  N   . THR D  1 38  ? 46.146 -3.031  23.209  1.00 38.20 ? 18  THR D N   1 
ATOM   7506  C  CA  . THR D  1 38  ? 45.957 -2.065  24.270  1.00 38.16 ? 18  THR D CA  1 
ATOM   7507  C  C   . THR D  1 38  ? 45.647 -2.874  25.521  1.00 35.65 ? 18  THR D C   1 
ATOM   7508  O  O   . THR D  1 38  ? 45.471 -4.085  25.447  1.00 37.47 ? 18  THR D O   1 
ATOM   7509  C  CB  . THR D  1 38  ? 44.894 -0.978  23.884  1.00 40.10 ? 18  THR D CB  1 
ATOM   7510  O  OG1 . THR D  1 38  ? 44.807 0.023   24.926  1.00 46.02 ? 18  THR D OG1 1 
ATOM   7511  C  CG2 . THR D  1 38  ? 43.508 -1.600  23.621  1.00 39.42 ? 18  THR D CG2 1 
ATOM   7512  N  N   . ASN D  1 39  ? 45.691 -2.242  26.676  1.00 36.14 ? 19  ASN D N   1 
ATOM   7513  C  CA  . ASN D  1 39  ? 45.618 -2.968  27.990  1.00 38.13 ? 19  ASN D CA  1 
ATOM   7514  C  C   . ASN D  1 39  ? 44.366 -3.834  28.155  1.00 38.46 ? 19  ASN D C   1 
ATOM   7515  O  O   . ASN D  1 39  ? 44.440 -4.907  28.726  1.00 39.23 ? 19  ASN D O   1 
ATOM   7516  C  CB  . ASN D  1 39  ? 45.750 -1.974  29.190  1.00 37.39 ? 19  ASN D CB  1 
ATOM   7517  C  CG  . ASN D  1 39  ? 46.872 -0.944  28.957  1.00 43.87 ? 19  ASN D CG  1 
ATOM   7518  O  OD1 . ASN D  1 39  ? 46.697 0.013   28.160  1.00 38.04 ? 19  ASN D OD1 1 
ATOM   7519  N  ND2 . ASN D  1 39  ? 48.049 -1.175  29.573  1.00 34.47 ? 19  ASN D ND2 1 
ATOM   7520  N  N   . SER D  1 40  ? 43.238 -3.372  27.600  1.00 40.81 ? 20  SER D N   1 
ATOM   7521  C  CA  . SER D  1 40  ? 41.921 -4.030  27.730  1.00 41.12 ? 20  SER D CA  1 
ATOM   7522  C  C   . SER D  1 40  ? 41.793 -5.345  26.936  1.00 41.51 ? 20  SER D C   1 
ATOM   7523  O  O   . SER D  1 40  ? 40.812 -6.077  27.074  1.00 44.14 ? 20  SER D O   1 
ATOM   7524  C  CB  . SER D  1 40  ? 40.791 -3.061  27.313  1.00 39.09 ? 20  SER D CB  1 
ATOM   7525  O  OG  . SER D  1 40  ? 40.927 -2.605  25.970  1.00 39.99 ? 20  SER D OG  1 
ATOM   7526  N  N   . ASP D  1 41  ? 42.771 -5.620  26.094  1.00 41.79 ? 21  ASP D N   1 
ATOM   7527  C  CA  . ASP D  1 41  ? 42.817 -6.838  25.282  1.00 39.78 ? 21  ASP D CA  1 
ATOM   7528  C  C   . ASP D  1 41  ? 43.369 -8.045  26.085  1.00 39.59 ? 21  ASP D C   1 
ATOM   7529  O  O   . ASP D  1 41  ? 43.457 -9.148  25.571  1.00 40.58 ? 21  ASP D O   1 
ATOM   7530  C  CB  . ASP D  1 41  ? 43.706 -6.597  24.044  1.00 37.41 ? 21  ASP D CB  1 
ATOM   7531  C  CG  . ASP D  1 41  ? 43.147 -5.548  23.075  1.00 38.75 ? 21  ASP D CG  1 
ATOM   7532  O  OD1 . ASP D  1 41  ? 43.970 -4.872  22.418  1.00 54.08 ? 21  ASP D OD1 1 
ATOM   7533  O  OD2 . ASP D  1 41  ? 41.913 -5.396  22.909  1.00 39.77 ? 21  ASP D OD2 1 
ATOM   7534  N  N   . PHE D  1 42  ? 43.774 -7.799  27.326  1.00 39.75 ? 22  PHE D N   1 
ATOM   7535  C  CA  . PHE D  1 42  ? 44.389 -8.765  28.189  1.00 41.02 ? 22  PHE D CA  1 
ATOM   7536  C  C   . PHE D  1 42  ? 43.588 -8.856  29.469  1.00 41.19 ? 22  PHE D C   1 
ATOM   7537  O  O   . PHE D  1 42  ? 42.845 -7.967  29.776  1.00 44.45 ? 22  PHE D O   1 
ATOM   7538  C  CB  . PHE D  1 42  ? 45.810 -8.327  28.587  1.00 43.96 ? 22  PHE D CB  1 
ATOM   7539  C  CG  . PHE D  1 42  ? 46.732 -8.120  27.440  1.00 42.36 ? 22  PHE D CG  1 
ATOM   7540  C  CD1 . PHE D  1 42  ? 47.508 -9.188  26.938  1.00 48.33 ? 22  PHE D CD1 1 
ATOM   7541  C  CD2 . PHE D  1 42  ? 46.875 -6.861  26.881  1.00 35.45 ? 22  PHE D CD2 1 
ATOM   7542  C  CE1 . PHE D  1 42  ? 48.388 -8.988  25.874  1.00 44.48 ? 22  PHE D CE1 1 
ATOM   7543  C  CE2 . PHE D  1 42  ? 47.762 -6.650  25.796  1.00 44.01 ? 22  PHE D CE2 1 
ATOM   7544  C  CZ  . PHE D  1 42  ? 48.522 -7.701  25.312  1.00 45.26 ? 22  PHE D CZ  1 
ATOM   7545  N  N   . GLU D  1 43  ? 43.785 -9.923  30.228  1.00 42.08 ? 23  GLU D N   1 
ATOM   7546  C  CA  . GLU D  1 43  ? 43.029 -10.168 31.441  1.00 42.70 ? 23  GLU D CA  1 
ATOM   7547  C  C   . GLU D  1 43  ? 43.813 -11.131 32.330  1.00 39.78 ? 23  GLU D C   1 
ATOM   7548  O  O   . GLU D  1 43  ? 44.190 -12.189 31.884  1.00 37.01 ? 23  GLU D O   1 
ATOM   7549  C  CB  . GLU D  1 43  ? 41.686 -10.801 31.106  1.00 42.89 ? 23  GLU D CB  1 
ATOM   7550  C  CG  . GLU D  1 43  ? 40.839 -11.081 32.333  1.00 42.40 ? 23  GLU D CG  1 
ATOM   7551  C  CD  . GLU D  1 43  ? 39.423 -11.561 32.011  1.00 50.26 ? 23  GLU D CD  1 
ATOM   7552  O  OE1 . GLU D  1 43  ? 38.658 -11.745 32.981  1.00 69.37 ? 23  GLU D OE1 1 
ATOM   7553  O  OE2 . GLU D  1 43  ? 39.068 -11.781 30.822  1.00 62.62 ? 23  GLU D OE2 1 
ATOM   7554  N  N   . LEU D  1 44  ? 44.013 -10.743 33.582  1.00 41.22 ? 24  LEU D N   1 
ATOM   7555  C  CA  . LEU D  1 44  ? 44.773 -11.498 34.552  1.00 43.91 ? 24  LEU D CA  1 
ATOM   7556  C  C   . LEU D  1 44  ? 43.799 -12.348 35.319  1.00 44.62 ? 24  LEU D C   1 
ATOM   7557  O  O   . LEU D  1 44  ? 42.797 -11.867 35.774  1.00 45.22 ? 24  LEU D O   1 
ATOM   7558  C  CB  . LEU D  1 44  ? 45.518 -10.534 35.493  1.00 46.67 ? 24  LEU D CB  1 
ATOM   7559  C  CG  . LEU D  1 44  ? 46.509 -10.992 36.582  1.00 44.10 ? 24  LEU D CG  1 
ATOM   7560  C  CD1 . LEU D  1 44  ? 47.542 -11.862 36.024  1.00 37.83 ? 24  LEU D CD1 1 
ATOM   7561  C  CD2 . LEU D  1 44  ? 47.151 -9.751  37.207  1.00 46.84 ? 24  LEU D CD2 1 
ATOM   7562  N  N   . LYS D  1 45  ? 44.117 -13.627 35.434  1.00 48.05 ? 25  LYS D N   1 
ATOM   7563  C  CA  . LYS D  1 45  ? 43.321 -14.602 36.151  1.00 49.45 ? 25  LYS D CA  1 
ATOM   7564  C  C   . LYS D  1 45  ? 44.154 -15.339 37.195  1.00 47.45 ? 25  LYS D C   1 
ATOM   7565  O  O   . LYS D  1 45  ? 45.305 -15.675 36.973  1.00 44.66 ? 25  LYS D O   1 
ATOM   7566  C  CB  . LYS D  1 45  ? 42.751 -15.604 35.157  1.00 50.56 ? 25  LYS D CB  1 
ATOM   7567  C  CG  . LYS D  1 45  ? 41.892 -14.930 34.097  1.00 55.08 ? 25  LYS D CG  1 
ATOM   7568  C  CD  . LYS D  1 45  ? 40.931 -15.909 33.423  1.00 54.46 ? 25  LYS D CD  1 
ATOM   7569  C  CE  . LYS D  1 45  ? 39.824 -15.198 32.625  1.00 56.31 ? 25  LYS D CE  1 
ATOM   7570  N  NZ  . LYS D  1 45  ? 39.751 -15.691 31.211  1.00 56.18 ? 25  LYS D NZ  1 
ATOM   7571  N  N   . THR D  1 46  ? 43.535 -15.574 38.341  1.00 50.77 ? 26  THR D N   1 
ATOM   7572  C  CA  . THR D  1 46  ? 44.106 -16.344 39.439  1.00 52.70 ? 26  THR D CA  1 
ATOM   7573  C  C   . THR D  1 46  ? 43.425 -17.721 39.414  1.00 52.88 ? 26  THR D C   1 
ATOM   7574  O  O   . THR D  1 46  ? 42.224 -17.851 39.132  1.00 51.19 ? 26  THR D O   1 
ATOM   7575  C  CB  . THR D  1 46  ? 43.896 -15.606 40.767  1.00 52.40 ? 26  THR D CB  1 
ATOM   7576  O  OG1 . THR D  1 46  ? 44.099 -14.208 40.548  1.00 60.97 ? 26  THR D OG1 1 
ATOM   7577  C  CG2 . THR D  1 46  ? 44.887 -16.055 41.802  1.00 58.48 ? 26  THR D CG2 1 
ATOM   7578  N  N   . SER D  1 47  ? 44.209 -18.748 39.697  1.00 54.70 ? 27  SER D N   1 
ATOM   7579  C  CA  . SER D  1 47  ? 43.868 -20.111 39.291  1.00 54.87 ? 27  SER D CA  1 
ATOM   7580  C  C   . SER D  1 47  ? 44.633 -21.088 40.191  1.00 55.12 ? 27  SER D C   1 
ATOM   7581  O  O   . SER D  1 47  ? 45.834 -20.924 40.378  1.00 55.48 ? 27  SER D O   1 
ATOM   7582  C  CB  . SER D  1 47  ? 44.260 -20.262 37.805  1.00 55.39 ? 27  SER D CB  1 
ATOM   7583  O  OG  . SER D  1 47  ? 44.059 -21.570 37.318  1.00 51.88 ? 27  SER D OG  1 
ATOM   7584  N  N   . GLU D  1 48  ? 43.945 -22.064 40.788  1.00 55.97 ? 28  GLU D N   1 
ATOM   7585  C  CA  . GLU D  1 48  ? 44.609 -23.048 41.659  1.00 55.62 ? 28  GLU D CA  1 
ATOM   7586  C  C   . GLU D  1 48  ? 45.200 -24.145 40.773  1.00 55.93 ? 28  GLU D C   1 
ATOM   7587  O  O   . GLU D  1 48  ? 44.593 -24.551 39.774  1.00 55.75 ? 28  GLU D O   1 
ATOM   7588  C  CB  . GLU D  1 48  ? 43.639 -23.643 42.703  1.00 56.19 ? 28  GLU D CB  1 
ATOM   7589  N  N   . LEU D  1 49  ? 46.400 -24.606 41.110  1.00 56.30 ? 29  LEU D N   1 
ATOM   7590  C  CA  . LEU D  1 49  ? 47.013 -25.722 40.375  1.00 55.39 ? 29  LEU D CA  1 
ATOM   7591  C  C   . LEU D  1 49  ? 46.812 -27.032 41.136  1.00 54.10 ? 29  LEU D C   1 
ATOM   7592  O  O   . LEU D  1 49  ? 46.786 -27.050 42.385  1.00 53.19 ? 29  LEU D O   1 
ATOM   7593  C  CB  . LEU D  1 49  ? 48.510 -25.490 40.140  1.00 56.48 ? 29  LEU D CB  1 
ATOM   7594  C  CG  . LEU D  1 49  ? 48.940 -24.342 39.225  1.00 52.06 ? 29  LEU D CG  1 
ATOM   7595  C  CD1 . LEU D  1 49  ? 50.360 -23.924 39.590  1.00 56.61 ? 29  LEU D CD1 1 
ATOM   7596  C  CD2 . LEU D  1 49  ? 48.836 -24.706 37.743  1.00 47.52 ? 29  LEU D CD2 1 
ATOM   7597  N  N   . PRO D  1 50  ? 46.685 -28.143 40.386  1.00 53.49 ? 30  PRO D N   1 
ATOM   7598  C  CA  . PRO D  1 50  ? 46.488 -29.424 41.063  1.00 53.26 ? 30  PRO D CA  1 
ATOM   7599  C  C   . PRO D  1 50  ? 47.756 -29.913 41.759  1.00 53.27 ? 30  PRO D C   1 
ATOM   7600  O  O   . PRO D  1 50  ? 48.824 -29.290 41.632  1.00 50.50 ? 30  PRO D O   1 
ATOM   7601  C  CB  . PRO D  1 50  ? 46.085 -30.363 39.927  1.00 53.82 ? 30  PRO D CB  1 
ATOM   7602  C  CG  . PRO D  1 50  ? 46.712 -29.780 38.705  1.00 50.86 ? 30  PRO D CG  1 
ATOM   7603  C  CD  . PRO D  1 50  ? 46.732 -28.287 38.917  1.00 52.02 ? 30  PRO D CD  1 
ATOM   7604  N  N   . PRO D  1 51  ? 47.631 -30.995 42.544  1.00 55.79 ? 31  PRO D N   1 
ATOM   7605  C  CA  . PRO D  1 51  ? 48.840 -31.650 43.067  1.00 56.54 ? 31  PRO D CA  1 
ATOM   7606  C  C   . PRO D  1 51  ? 49.620 -32.418 41.980  1.00 55.80 ? 31  PRO D C   1 
ATOM   7607  O  O   . PRO D  1 51  ? 49.057 -32.837 40.945  1.00 56.16 ? 31  PRO D O   1 
ATOM   7608  C  CB  . PRO D  1 51  ? 48.302 -32.587 44.177  1.00 57.47 ? 31  PRO D CB  1 
ATOM   7609  C  CG  . PRO D  1 51  ? 46.856 -32.156 44.403  1.00 57.90 ? 31  PRO D CG  1 
ATOM   7610  C  CD  . PRO D  1 51  ? 46.406 -31.631 43.057  1.00 56.48 ? 31  PRO D CD  1 
ATOM   7611  N  N   . LEU D  1 52  ? 50.916 -32.581 42.215  1.00 54.29 ? 32  LEU D N   1 
ATOM   7612  C  CA  . LEU D  1 52  ? 51.770 -33.249 41.255  1.00 52.18 ? 32  LEU D CA  1 
ATOM   7613  C  C   . LEU D  1 52  ? 51.471 -34.737 41.262  1.00 51.29 ? 32  LEU D C   1 
ATOM   7614  O  O   . LEU D  1 52  ? 51.419 -35.360 42.306  1.00 52.67 ? 32  LEU D O   1 
ATOM   7615  C  CB  . LEU D  1 52  ? 53.257 -33.021 41.573  1.00 51.86 ? 32  LEU D CB  1 
ATOM   7616  C  CG  . LEU D  1 52  ? 53.792 -31.591 41.718  1.00 46.60 ? 32  LEU D CG  1 
ATOM   7617  C  CD1 . LEU D  1 52  ? 55.246 -31.619 42.155  1.00 38.87 ? 32  LEU D CD1 1 
ATOM   7618  C  CD2 . LEU D  1 52  ? 53.635 -30.790 40.426  1.00 46.95 ? 32  LEU D CD2 1 
ATOM   7619  N  N   . LYS D  1 53  ? 51.233 -35.278 40.077  1.00 52.35 ? 33  LYS D N   1 
ATOM   7620  C  CA  . LYS D  1 53  ? 51.379 -36.706 39.811  1.00 52.03 ? 33  LYS D CA  1 
ATOM   7621  C  C   . LYS D  1 53  ? 52.875 -37.047 39.754  1.00 51.09 ? 33  LYS D C   1 
ATOM   7622  O  O   . LYS D  1 53  ? 53.723 -36.161 39.668  1.00 51.32 ? 33  LYS D O   1 
ATOM   7623  C  CB  . LYS D  1 53  ? 50.702 -37.062 38.479  1.00 51.79 ? 33  LYS D CB  1 
ATOM   7624  C  CG  . LYS D  1 53  ? 49.176 -36.863 38.517  1.00 54.42 ? 33  LYS D CG  1 
ATOM   7625  C  CD  . LYS D  1 53  ? 48.563 -36.705 37.119  1.00 54.06 ? 33  LYS D CD  1 
ATOM   7626  C  CE  . LYS D  1 53  ? 47.132 -36.140 37.197  1.00 58.90 ? 33  LYS D CE  1 
ATOM   7627  N  NZ  . LYS D  1 53  ? 46.861 -35.132 36.099  1.00 59.83 ? 33  LYS D NZ  1 
ATOM   7628  N  N   . ASN D  1 54  ? 53.197 -38.335 39.803  1.00 51.38 ? 34  ASN D N   1 
ATOM   7629  C  CA  . ASN D  1 54  ? 54.587 -38.774 39.740  1.00 49.16 ? 34  ASN D CA  1 
ATOM   7630  C  C   . ASN D  1 54  ? 55.211 -38.418 38.383  1.00 46.57 ? 34  ASN D C   1 
ATOM   7631  O  O   . ASN D  1 54  ? 54.569 -38.544 37.343  1.00 45.49 ? 34  ASN D O   1 
ATOM   7632  C  CB  . ASN D  1 54  ? 54.694 -40.270 40.028  1.00 48.23 ? 34  ASN D CB  1 
ATOM   7633  C  CG  . ASN D  1 54  ? 55.778 -40.578 41.025  1.00 52.40 ? 34  ASN D CG  1 
ATOM   7634  O  OD1 . ASN D  1 54  ? 56.841 -41.072 40.649  1.00 58.46 ? 34  ASN D OD1 1 
ATOM   7635  N  ND2 . ASN D  1 54  ? 55.537 -40.251 42.309  1.00 51.41 ? 34  ASN D ND2 1 
ATOM   7636  N  N   . GLY D  1 55  ? 56.451 -37.942 38.410  1.00 44.85 ? 35  GLY D N   1 
ATOM   7637  C  CA  . GLY D  1 55  ? 57.138 -37.496 37.198  1.00 44.65 ? 35  GLY D CA  1 
ATOM   7638  C  C   . GLY D  1 55  ? 56.967 -36.018 36.873  1.00 45.80 ? 35  GLY D C   1 
ATOM   7639  O  O   . GLY D  1 55  ? 57.646 -35.493 35.984  1.00 46.19 ? 35  GLY D O   1 
ATOM   7640  N  N   . GLU D  1 56  ? 56.073 -35.339 37.592  1.00 44.38 ? 36  GLU D N   1 
ATOM   7641  C  CA  . GLU D  1 56  ? 55.851 -33.919 37.376  1.00 44.30 ? 36  GLU D CA  1 
ATOM   7642  C  C   . GLU D  1 56  ? 56.742 -33.061 38.279  1.00 41.85 ? 36  GLU D C   1 
ATOM   7643  O  O   . GLU D  1 56  ? 57.201 -33.498 39.342  1.00 39.51 ? 36  GLU D O   1 
ATOM   7644  C  CB  . GLU D  1 56  ? 54.367 -33.545 37.591  1.00 44.79 ? 36  GLU D CB  1 
ATOM   7645  C  CG  . GLU D  1 56  ? 53.429 -33.914 36.415  1.00 47.30 ? 36  GLU D CG  1 
ATOM   7646  C  CD  . GLU D  1 56  ? 51.923 -33.852 36.765  1.00 47.82 ? 36  GLU D CD  1 
ATOM   7647  O  OE1 . GLU D  1 56  ? 51.499 -33.212 37.763  1.00 51.39 ? 36  GLU D OE1 1 
ATOM   7648  O  OE2 . GLU D  1 56  ? 51.147 -34.468 36.017  1.00 54.69 ? 36  GLU D OE2 1 
ATOM   7649  N  N   . VAL D  1 57  ? 56.982 -31.831 37.817  1.00 40.91 ? 37  VAL D N   1 
ATOM   7650  C  CA  . VAL D  1 57  ? 57.576 -30.763 38.630  1.00 38.50 ? 37  VAL D CA  1 
ATOM   7651  C  C   . VAL D  1 57  ? 56.718 -29.514 38.579  1.00 36.94 ? 37  VAL D C   1 
ATOM   7652  O  O   . VAL D  1 57  ? 55.980 -29.313 37.646  1.00 38.05 ? 37  VAL D O   1 
ATOM   7653  C  CB  . VAL D  1 57  ? 58.987 -30.413 38.189  1.00 38.01 ? 37  VAL D CB  1 
ATOM   7654  C  CG1 . VAL D  1 57  ? 59.893 -31.654 38.336  1.00 36.83 ? 37  VAL D CG1 1 
ATOM   7655  C  CG2 . VAL D  1 57  ? 58.995 -29.798 36.753  1.00 39.55 ? 37  VAL D CG2 1 
ATOM   7656  N  N   . LEU D  1 58  ? 56.806 -28.706 39.627  1.00 39.79 ? 38  LEU D N   1 
ATOM   7657  C  CA  . LEU D  1 58  ? 56.148 -27.404 39.716  1.00 40.43 ? 38  LEU D CA  1 
ATOM   7658  C  C   . LEU D  1 58  ? 57.200 -26.332 39.422  1.00 40.66 ? 38  LEU D C   1 
ATOM   7659  O  O   . LEU D  1 58  ? 58.223 -26.270 40.104  1.00 39.97 ? 38  LEU D O   1 
ATOM   7660  C  CB  . LEU D  1 58  ? 55.543 -27.209 41.110  1.00 37.88 ? 38  LEU D CB  1 
ATOM   7661  C  CG  . LEU D  1 58  ? 54.888 -25.867 41.417  1.00 42.87 ? 38  LEU D CG  1 
ATOM   7662  C  CD1 . LEU D  1 58  ? 53.657 -25.608 40.533  1.00 38.17 ? 38  LEU D CD1 1 
ATOM   7663  C  CD2 . LEU D  1 58  ? 54.539 -25.829 42.912  1.00 42.95 ? 38  LEU D CD2 1 
ATOM   7664  N  N   . LEU D  1 59  ? 56.945 -25.526 38.386  1.00 42.12 ? 39  LEU D N   1 
ATOM   7665  C  CA  . LEU D  1 59  ? 57.831 -24.434 37.959  1.00 42.54 ? 39  LEU D CA  1 
ATOM   7666  C  C   . LEU D  1 59  ? 57.348 -23.067 38.457  1.00 42.14 ? 39  LEU D C   1 
ATOM   7667  O  O   . LEU D  1 59  ? 56.178 -22.747 38.312  1.00 40.38 ? 39  LEU D O   1 
ATOM   7668  C  CB  . LEU D  1 59  ? 57.940 -24.420 36.424  1.00 42.19 ? 39  LEU D CB  1 
ATOM   7669  C  CG  . LEU D  1 59  ? 58.341 -25.788 35.868  1.00 42.93 ? 39  LEU D CG  1 
ATOM   7670  C  CD1 . LEU D  1 59  ? 58.476 -25.710 34.363  1.00 47.26 ? 39  LEU D CD1 1 
ATOM   7671  C  CD2 . LEU D  1 59  ? 59.631 -26.274 36.521  1.00 39.00 ? 39  LEU D CD2 1 
ATOM   7672  N  N   . GLU D  1 60  ? 58.256 -22.314 39.092  1.00 43.40 ? 40  GLU D N   1 
ATOM   7673  C  CA  . GLU D  1 60  ? 58.070 -20.900 39.408  1.00 44.43 ? 40  GLU D CA  1 
ATOM   7674  C  C   . GLU D  1 60  ? 58.892 -20.041 38.439  1.00 42.62 ? 40  GLU D C   1 
ATOM   7675  O  O   . GLU D  1 60  ? 60.121 -20.128 38.405  1.00 42.80 ? 40  GLU D O   1 
ATOM   7676  C  CB  . GLU D  1 60  ? 58.570 -20.608 40.813  1.00 45.41 ? 40  GLU D CB  1 
ATOM   7677  C  CG  . GLU D  1 60  ? 58.165 -19.240 41.366  1.00 47.30 ? 40  GLU D CG  1 
ATOM   7678  C  CD  . GLU D  1 60  ? 59.001 -18.789 42.584  1.00 53.02 ? 40  GLU D CD  1 
ATOM   7679  O  OE1 . GLU D  1 60  ? 58.784 -17.633 43.036  1.00 72.41 ? 40  GLU D OE1 1 
ATOM   7680  O  OE2 . GLU D  1 60  ? 59.873 -19.554 43.089  1.00 60.30 ? 40  GLU D OE2 1 
ATOM   7681  N  N   . ALA D  1 61  ? 58.220 -19.185 37.694  1.00 40.16 ? 41  ALA D N   1 
ATOM   7682  C  CA  . ALA D  1 61  ? 58.891 -18.269 36.774  1.00 42.02 ? 41  ALA D CA  1 
ATOM   7683  C  C   . ALA D  1 61  ? 59.776 -17.268 37.497  1.00 42.89 ? 41  ALA D C   1 
ATOM   7684  O  O   . ALA D  1 61  ? 59.331 -16.583 38.411  1.00 44.08 ? 41  ALA D O   1 
ATOM   7685  C  CB  . ALA D  1 61  ? 57.886 -17.536 35.908  1.00 38.92 ? 41  ALA D CB  1 
ATOM   7686  N  N   . LEU D  1 62  ? 61.031 -17.213 37.052  1.00 43.50 ? 42  LEU D N   1 
ATOM   7687  C  CA  . LEU D  1 62  ? 62.012 -16.212 37.449  1.00 42.28 ? 42  LEU D CA  1 
ATOM   7688  C  C   . LEU D  1 62  ? 61.999 -15.055 36.419  1.00 42.21 ? 42  LEU D C   1 
ATOM   7689  O  O   . LEU D  1 62  ? 61.891 -13.896 36.798  1.00 41.96 ? 42  LEU D O   1 
ATOM   7690  C  CB  . LEU D  1 62  ? 63.410 -16.863 37.528  1.00 43.81 ? 42  LEU D CB  1 
ATOM   7691  C  CG  . LEU D  1 62  ? 63.599 -18.109 38.402  1.00 38.69 ? 42  LEU D CG  1 
ATOM   7692  C  CD1 . LEU D  1 62  ? 65.049 -18.580 38.384  1.00 41.01 ? 42  LEU D CD1 1 
ATOM   7693  C  CD2 . LEU D  1 62  ? 63.151 -17.786 39.831  1.00 38.68 ? 42  LEU D CD2 1 
ATOM   7694  N  N   . PHE D  1 63  ? 62.063 -15.388 35.121  1.00 41.93 ? 43  PHE D N   1 
ATOM   7695  C  CA  . PHE D  1 63  ? 62.134 -14.399 34.047  1.00 40.33 ? 43  PHE D CA  1 
ATOM   7696  C  C   . PHE D  1 63  ? 61.251 -14.854 32.923  1.00 41.88 ? 43  PHE D C   1 
ATOM   7697  O  O   . PHE D  1 63  ? 61.307 -16.000 32.523  1.00 43.35 ? 43  PHE D O   1 
ATOM   7698  C  CB  . PHE D  1 63  ? 63.554 -14.203 33.500  1.00 39.09 ? 43  PHE D CB  1 
ATOM   7699  C  CG  . PHE D  1 63  ? 64.569 -13.752 34.540  1.00 41.02 ? 43  PHE D CG  1 
ATOM   7700  C  CD1 . PHE D  1 63  ? 64.627 -12.409 34.955  1.00 39.51 ? 43  PHE D CD1 1 
ATOM   7701  C  CD2 . PHE D  1 63  ? 65.486 -14.671 35.085  1.00 46.16 ? 43  PHE D CD2 1 
ATOM   7702  C  CE1 . PHE D  1 63  ? 65.528 -11.997 35.910  1.00 33.26 ? 43  PHE D CE1 1 
ATOM   7703  C  CE2 . PHE D  1 63  ? 66.412 -14.266 36.050  1.00 45.47 ? 43  PHE D CE2 1 
ATOM   7704  C  CZ  . PHE D  1 63  ? 66.430 -12.919 36.470  1.00 41.83 ? 43  PHE D CZ  1 
ATOM   7705  N  N   . LEU D  1 64  ? 60.418 -13.941 32.426  1.00 43.05 ? 44  LEU D N   1 
ATOM   7706  C  CA  . LEU D  1 64  ? 59.533 -14.208 31.288  1.00 42.54 ? 44  LEU D CA  1 
ATOM   7707  C  C   . LEU D  1 64  ? 59.959 -13.256 30.184  1.00 43.12 ? 44  LEU D C   1 
ATOM   7708  O  O   . LEU D  1 64  ? 60.370 -12.137 30.456  1.00 44.31 ? 44  LEU D O   1 
ATOM   7709  C  CB  . LEU D  1 64  ? 58.047 -13.993 31.651  1.00 35.17 ? 44  LEU D CB  1 
ATOM   7710  C  CG  . LEU D  1 64  ? 57.538 -14.719 32.898  1.00 40.70 ? 44  LEU D CG  1 
ATOM   7711  C  CD1 . LEU D  1 64  ? 57.782 -13.882 34.178  1.00 49.16 ? 44  LEU D CD1 1 
ATOM   7712  C  CD2 . LEU D  1 64  ? 56.053 -15.111 32.797  1.00 44.06 ? 44  LEU D CD2 1 
ATOM   7713  N  N   . THR D  1 65  ? 59.900 -13.731 28.945  1.00 45.50 ? 45  THR D N   1 
ATOM   7714  C  CA  . THR D  1 65  ? 60.232 -12.903 27.772  1.00 46.20 ? 45  THR D CA  1 
ATOM   7715  C  C   . THR D  1 65  ? 58.981 -12.429 27.021  1.00 43.13 ? 45  THR D C   1 
ATOM   7716  O  O   . THR D  1 65  ? 57.935 -13.047 27.068  1.00 40.27 ? 45  THR D O   1 
ATOM   7717  C  CB  . THR D  1 65  ? 61.184 -13.683 26.806  1.00 46.33 ? 45  THR D CB  1 
ATOM   7718  O  OG1 . THR D  1 65  ? 61.713 -12.803 25.807  1.00 56.04 ? 45  THR D OG1 1 
ATOM   7719  C  CG2 . THR D  1 65  ? 60.496 -14.889 26.135  1.00 49.19 ? 45  THR D CG2 1 
ATOM   7720  N  N   . VAL D  1 66  ? 59.126 -11.318 26.319  1.00 45.31 ? 46  VAL D N   1 
ATOM   7721  C  CA  . VAL D  1 66  ? 58.140 -10.857 25.312  1.00 43.32 ? 46  VAL D CA  1 
ATOM   7722  C  C   . VAL D  1 66  ? 58.880 -10.638 24.004  1.00 43.84 ? 46  VAL D C   1 
ATOM   7723  O  O   . VAL D  1 66  ? 60.013 -10.123 23.967  1.00 44.83 ? 46  VAL D O   1 
ATOM   7724  C  CB  . VAL D  1 66  ? 57.407 -9.546  25.747  1.00 42.58 ? 46  VAL D CB  1 
ATOM   7725  C  CG1 . VAL D  1 66  ? 56.510 -9.831  26.935  1.00 42.51 ? 46  VAL D CG1 1 
ATOM   7726  C  CG2 . VAL D  1 66  ? 58.386 -8.397  26.066  1.00 37.42 ? 46  VAL D CG2 1 
ATOM   7727  N  N   . ASP D  1 67  ? 58.234 -11.008 22.917  1.00 47.22 ? 47  ASP D N   1 
ATOM   7728  C  CA  . ASP D  1 67  ? 58.892 -11.071 21.620  1.00 49.16 ? 47  ASP D CA  1 
ATOM   7729  C  C   . ASP D  1 67  ? 57.874 -10.753 20.548  1.00 47.81 ? 47  ASP D C   1 
ATOM   7730  O  O   . ASP D  1 67  ? 56.714 -11.106 20.709  1.00 47.31 ? 47  ASP D O   1 
ATOM   7731  C  CB  . ASP D  1 67  ? 59.424 -12.488 21.373  1.00 53.00 ? 47  ASP D CB  1 
ATOM   7732  C  CG  . ASP D  1 67  ? 60.578 -12.869 22.312  1.00 58.87 ? 47  ASP D CG  1 
ATOM   7733  O  OD1 . ASP D  1 67  ? 60.281 -13.644 23.260  1.00 54.12 ? 47  ASP D OD1 1 
ATOM   7734  O  OD2 . ASP D  1 67  ? 61.748 -12.412 22.086  1.00 65.74 ? 47  ASP D OD2 1 
ATOM   7735  N  N   . PRO D  1 68  ? 58.308 -10.095 19.446  1.00 49.95 ? 48  PRO D N   1 
ATOM   7736  C  CA  . PRO D  1 68  ? 57.478 -9.654  18.313  1.00 49.26 ? 48  PRO D CA  1 
ATOM   7737  C  C   . PRO D  1 68  ? 56.506 -10.678 17.728  1.00 47.40 ? 48  PRO D C   1 
ATOM   7738  O  O   . PRO D  1 68  ? 55.372 -10.334 17.372  1.00 51.78 ? 48  PRO D O   1 
ATOM   7739  C  CB  . PRO D  1 68  ? 58.521 -9.249  17.279  1.00 49.98 ? 48  PRO D CB  1 
ATOM   7740  C  CG  . PRO D  1 68  ? 59.622 -8.720  18.090  1.00 51.96 ? 48  PRO D CG  1 
ATOM   7741  C  CD  . PRO D  1 68  ? 59.705 -9.640  19.272  1.00 51.68 ? 48  PRO D CD  1 
ATOM   7742  N  N   . TYR D  1 69  ? 56.939 -11.919 17.684  1.00 46.73 ? 49  TYR D N   1 
ATOM   7743  C  CA  . TYR D  1 69  ? 56.200 -12.987 17.064  1.00 46.30 ? 49  TYR D CA  1 
ATOM   7744  C  C   . TYR D  1 69  ? 54.919 -13.291 17.828  1.00 43.98 ? 49  TYR D C   1 
ATOM   7745  O  O   . TYR D  1 69  ? 54.010 -13.884 17.251  1.00 44.05 ? 49  TYR D O   1 
ATOM   7746  C  CB  . TYR D  1 69  ? 57.077 -14.277 16.941  1.00 46.09 ? 49  TYR D CB  1 
ATOM   7747  C  CG  . TYR D  1 69  ? 57.129 -15.071 18.248  1.00 48.08 ? 49  TYR D CG  1 
ATOM   7748  C  CD1 . TYR D  1 69  ? 56.052 -15.880 18.637  1.00 52.16 ? 49  TYR D CD1 1 
ATOM   7749  C  CD2 . TYR D  1 69  ? 58.221 -14.969 19.115  1.00 48.84 ? 49  TYR D CD2 1 
ATOM   7750  C  CE1 . TYR D  1 69  ? 56.070 -16.563 19.829  1.00 47.17 ? 49  TYR D CE1 1 
ATOM   7751  C  CE2 . TYR D  1 69  ? 58.249 -15.646 20.286  1.00 46.64 ? 49  TYR D CE2 1 
ATOM   7752  C  CZ  . TYR D  1 69  ? 57.168 -16.437 20.655  1.00 45.88 ? 49  TYR D CZ  1 
ATOM   7753  O  OH  . TYR D  1 69  ? 57.175 -17.117 21.856  1.00 47.54 ? 49  TYR D OH  1 
ATOM   7754  N  N   . MET D  1 70  ? 54.871 -12.953 19.124  1.00 43.30 ? 50  MET D N   1 
ATOM   7755  C  CA  . MET D  1 70  ? 53.620 -13.072 19.916  1.00 45.05 ? 50  MET D CA  1 
ATOM   7756  C  C   . MET D  1 70  ? 52.470 -12.208 19.359  1.00 43.74 ? 50  MET D C   1 
ATOM   7757  O  O   . MET D  1 70  ? 51.294 -12.493 19.580  1.00 44.50 ? 50  MET D O   1 
ATOM   7758  C  CB  . MET D  1 70  ? 53.849 -12.693 21.395  1.00 44.93 ? 50  MET D CB  1 
ATOM   7759  C  CG  . MET D  1 70  ? 54.915 -13.501 22.089  1.00 43.16 ? 50  MET D CG  1 
ATOM   7760  S  SD  . MET D  1 70  ? 55.346 -13.006 23.784  1.00 44.97 ? 50  MET D SD  1 
ATOM   7761  C  CE  . MET D  1 70  ? 56.614 -14.221 24.146  1.00 49.23 ? 50  MET D CE  1 
ATOM   7762  N  N   . ARG D  1 71  ? 52.797 -11.146 18.639  1.00 42.39 ? 51  ARG D N   1 
ATOM   7763  C  CA  . ARG D  1 71  ? 51.748 -10.357 18.006  1.00 42.90 ? 51  ARG D CA  1 
ATOM   7764  C  C   . ARG D  1 71  ? 51.031 -11.175 16.916  1.00 43.29 ? 51  ARG D C   1 
ATOM   7765  O  O   . ARG D  1 71  ? 49.814 -11.099 16.741  1.00 40.66 ? 51  ARG D O   1 
ATOM   7766  C  CB  . ARG D  1 71  ? 52.336 -9.090  17.410  1.00 37.34 ? 51  ARG D CB  1 
ATOM   7767  C  CG  . ARG D  1 71  ? 51.353 -8.196  16.764  1.00 38.67 ? 51  ARG D CG  1 
ATOM   7768  C  CD  . ARG D  1 71  ? 50.170 -7.769  17.678  1.00 39.45 ? 51  ARG D CD  1 
ATOM   7769  N  NE  . ARG D  1 71  ? 49.150 -7.018  16.949  1.00 35.24 ? 51  ARG D NE  1 
ATOM   7770  C  CZ  . ARG D  1 71  ? 48.222 -7.572  16.175  1.00 35.96 ? 51  ARG D CZ  1 
ATOM   7771  N  NH1 . ARG D  1 71  ? 48.118 -8.874  16.046  1.00 46.89 ? 51  ARG D NH1 1 
ATOM   7772  N  NH2 . ARG D  1 71  ? 47.328 -6.822  15.566  1.00 39.84 ? 51  ARG D NH2 1 
ATOM   7773  N  N   . VAL D  1 72  ? 51.838 -11.939 16.198  1.00 45.48 ? 52  VAL D N   1 
ATOM   7774  C  CA  . VAL D  1 72  ? 51.399 -12.796 15.094  1.00 47.32 ? 52  VAL D CA  1 
ATOM   7775  C  C   . VAL D  1 72  ? 50.811 -14.044 15.670  1.00 42.93 ? 52  VAL D C   1 
ATOM   7776  O  O   . VAL D  1 72  ? 49.720 -14.421 15.340  1.00 45.89 ? 52  VAL D O   1 
ATOM   7777  C  CB  . VAL D  1 72  ? 52.603 -13.163 14.141  1.00 46.99 ? 52  VAL D CB  1 
ATOM   7778  C  CG1 . VAL D  1 72  ? 52.254 -14.291 13.191  1.00 52.36 ? 52  VAL D CG1 1 
ATOM   7779  C  CG2 . VAL D  1 72  ? 52.974 -12.013 13.371  1.00 48.76 ? 52  VAL D CG2 1 
ATOM   7780  N  N   . ALA D  1 73  ? 51.543 -14.679 16.556  1.00 46.48 ? 53  ALA D N   1 
ATOM   7781  C  CA  . ALA D  1 73  ? 51.082 -15.931 17.131  1.00 48.07 ? 53  ALA D CA  1 
ATOM   7782  C  C   . ALA D  1 73  ? 49.733 -15.837 17.846  1.00 48.03 ? 53  ALA D C   1 
ATOM   7783  O  O   . ALA D  1 73  ? 49.011 -16.811 17.925  1.00 47.15 ? 53  ALA D O   1 
ATOM   7784  C  CB  . ALA D  1 73  ? 52.126 -16.465 18.053  1.00 48.86 ? 53  ALA D CB  1 
ATOM   7785  N  N   . ALA D  1 74  ? 49.419 -14.658 18.383  1.00 49.64 ? 54  ALA D N   1 
ATOM   7786  C  CA  . ALA D  1 74  ? 48.193 -14.451 19.149  1.00 48.66 ? 54  ALA D CA  1 
ATOM   7787  C  C   . ALA D  1 74  ? 46.960 -14.424 18.264  1.00 49.06 ? 54  ALA D C   1 
ATOM   7788  O  O   . ALA D  1 74  ? 45.857 -14.676 18.736  1.00 50.65 ? 54  ALA D O   1 
ATOM   7789  C  CB  . ALA D  1 74  ? 48.288 -13.199 19.944  1.00 49.11 ? 54  ALA D CB  1 
ATOM   7790  N  N   . LYS D  1 75  ? 47.139 -14.098 16.990  1.00 50.47 ? 55  LYS D N   1 
ATOM   7791  C  CA  . LYS D  1 75  ? 46.078 -14.172 16.020  1.00 51.27 ? 55  LYS D CA  1 
ATOM   7792  C  C   . LYS D  1 75  ? 45.462 -15.592 15.986  1.00 53.18 ? 55  LYS D C   1 
ATOM   7793  O  O   . LYS D  1 75  ? 44.292 -15.743 15.642  1.00 55.76 ? 55  LYS D O   1 
ATOM   7794  C  CB  . LYS D  1 75  ? 46.624 -13.799 14.632  1.00 52.23 ? 55  LYS D CB  1 
ATOM   7795  C  CG  . LYS D  1 75  ? 46.430 -12.343 14.196  1.00 53.19 ? 55  LYS D CG  1 
ATOM   7796  C  CD  . LYS D  1 75  ? 47.493 -11.797 13.203  1.00 55.50 ? 55  LYS D CD  1 
ATOM   7797  C  CE  . LYS D  1 75  ? 47.496 -12.481 11.815  1.00 66.96 ? 55  LYS D CE  1 
ATOM   7798  N  NZ  . LYS D  1 75  ? 46.697 -11.817 10.702  1.00 66.76 ? 55  LYS D NZ  1 
ATOM   7799  N  N   . ARG D  1 76  ? 46.260 -16.616 16.322  1.00 54.72 ? 56  ARG D N   1 
ATOM   7800  C  CA  . ARG D  1 76  ? 45.855 -18.029 16.289  1.00 54.84 ? 56  ARG D CA  1 
ATOM   7801  C  C   . ARG D  1 76  ? 45.203 -18.517 17.600  1.00 53.50 ? 56  ARG D C   1 
ATOM   7802  O  O   . ARG D  1 76  ? 44.760 -19.661 17.683  1.00 54.35 ? 56  ARG D O   1 
ATOM   7803  C  CB  . ARG D  1 76  ? 47.065 -18.925 15.920  1.00 58.01 ? 56  ARG D CB  1 
ATOM   7804  C  CG  . ARG D  1 76  ? 47.682 -18.689 14.492  1.00 59.98 ? 56  ARG D CG  1 
ATOM   7805  C  CD  . ARG D  1 76  ? 48.893 -19.648 14.146  1.00 65.06 ? 56  ARG D CD  1 
ATOM   7806  N  NE  . ARG D  1 76  ? 50.127 -19.388 14.937  1.00 76.73 ? 56  ARG D NE  1 
ATOM   7807  C  CZ  . ARG D  1 76  ? 51.242 -18.730 14.529  1.00 79.67 ? 56  ARG D CZ  1 
ATOM   7808  N  NH1 . ARG D  1 76  ? 51.389 -18.211 13.297  1.00 71.62 ? 56  ARG D NH1 1 
ATOM   7809  N  NH2 . ARG D  1 76  ? 52.259 -18.585 15.384  1.00 77.50 ? 56  ARG D NH2 1 
ATOM   7810  N  N   . LEU D  1 77  ? 45.126 -17.645 18.607  1.00 51.42 ? 57  LEU D N   1 
ATOM   7811  C  CA  . LEU D  1 77  ? 44.488 -17.953 19.892  1.00 50.30 ? 57  LEU D CA  1 
ATOM   7812  C  C   . LEU D  1 77  ? 42.959 -17.749 19.916  1.00 47.89 ? 57  LEU D C   1 
ATOM   7813  O  O   . LEU D  1 77  ? 42.421 -16.963 19.176  1.00 47.89 ? 57  LEU D O   1 
ATOM   7814  C  CB  . LEU D  1 77  ? 45.088 -17.101 21.002  1.00 49.56 ? 57  LEU D CB  1 
ATOM   7815  C  CG  . LEU D  1 77  ? 46.545 -17.276 21.416  1.00 52.21 ? 57  LEU D CG  1 
ATOM   7816  C  CD1 . LEU D  1 77  ? 46.973 -16.250 22.525  1.00 52.27 ? 57  LEU D CD1 1 
ATOM   7817  C  CD2 . LEU D  1 77  ? 46.775 -18.698 21.862  1.00 52.30 ? 57  LEU D CD2 1 
ATOM   7818  N  N   . LYS D  1 78  ? 42.277 -18.516 20.760  1.00 48.18 ? 58  LYS D N   1 
ATOM   7819  C  CA  . LYS D  1 78  ? 40.889 -18.299 21.062  1.00 48.15 ? 58  LYS D CA  1 
ATOM   7820  C  C   . LYS D  1 78  ? 40.953 -17.320 22.232  1.00 49.85 ? 58  LYS D C   1 
ATOM   7821  O  O   . LYS D  1 78  ? 41.915 -17.315 23.007  1.00 49.05 ? 58  LYS D O   1 
ATOM   7822  C  CB  . LYS D  1 78  ? 40.165 -19.606 21.432  1.00 48.04 ? 58  LYS D CB  1 
ATOM   7823  C  CG  . LYS D  1 78  ? 40.309 -20.738 20.416  1.00 44.71 ? 58  LYS D CG  1 
ATOM   7824  N  N   . GLU D  1 79  ? 39.959 -16.447 22.319  1.00 49.80 ? 59  GLU D N   1 
ATOM   7825  C  CA  . GLU D  1 79  ? 39.917 -15.465 23.353  1.00 50.43 ? 59  GLU D CA  1 
ATOM   7826  C  C   . GLU D  1 79  ? 39.635 -16.235 24.630  1.00 49.04 ? 59  GLU D C   1 
ATOM   7827  O  O   . GLU D  1 79  ? 38.880 -17.186 24.604  1.00 49.63 ? 59  GLU D O   1 
ATOM   7828  C  CB  . GLU D  1 79  ? 38.861 -14.402 23.023  1.00 49.97 ? 59  GLU D CB  1 
ATOM   7829  C  CG  . GLU D  1 79  ? 39.216 -13.581 21.743  1.00 52.40 ? 59  GLU D CG  1 
ATOM   7830  C  CD  . GLU D  1 79  ? 38.130 -12.551 21.317  1.00 56.62 ? 59  GLU D CD  1 
ATOM   7831  O  OE1 . GLU D  1 79  ? 38.414 -11.718 20.396  1.00 59.70 ? 59  GLU D OE1 1 
ATOM   7832  O  OE2 . GLU D  1 79  ? 37.001 -12.573 21.896  1.00 60.42 ? 59  GLU D OE2 1 
ATOM   7833  N  N   . GLY D  1 80  ? 40.286 -15.848 25.725  1.00 48.17 ? 60  GLY D N   1 
ATOM   7834  C  CA  . GLY D  1 80  ? 40.311 -16.638 26.946  1.00 46.66 ? 60  GLY D CA  1 
ATOM   7835  C  C   . GLY D  1 80  ? 41.606 -17.412 27.058  1.00 45.57 ? 60  GLY D C   1 
ATOM   7836  O  O   . GLY D  1 80  ? 42.027 -17.795 28.150  1.00 46.24 ? 60  GLY D O   1 
ATOM   7837  N  N   . ASP D  1 81  ? 42.256 -17.649 25.929  1.00 46.68 ? 61  ASP D N   1 
ATOM   7838  C  CA  . ASP D  1 81  ? 43.478 -18.445 25.928  1.00 47.40 ? 61  ASP D CA  1 
ATOM   7839  C  C   . ASP D  1 81  ? 44.611 -17.712 26.625  1.00 47.36 ? 61  ASP D C   1 
ATOM   7840  O  O   . ASP D  1 81  ? 44.650 -16.474 26.678  1.00 44.76 ? 61  ASP D O   1 
ATOM   7841  C  CB  . ASP D  1 81  ? 43.919 -18.796 24.496  1.00 48.09 ? 61  ASP D CB  1 
ATOM   7842  C  CG  . ASP D  1 81  ? 43.172 -19.999 23.908  1.00 53.89 ? 61  ASP D CG  1 
ATOM   7843  O  OD1 . ASP D  1 81  ? 43.509 -20.418 22.761  1.00 58.17 ? 61  ASP D OD1 1 
ATOM   7844  O  OD2 . ASP D  1 81  ? 42.257 -20.528 24.579  1.00 60.70 ? 61  ASP D OD2 1 
ATOM   7845  N  N   . THR D  1 82  ? 45.544 -18.505 27.140  1.00 47.72 ? 62  THR D N   1 
ATOM   7846  C  CA  . THR D  1 82  ? 46.756 -17.993 27.762  1.00 47.04 ? 62  THR D CA  1 
ATOM   7847  C  C   . THR D  1 82  ? 47.714 -17.461 26.691  1.00 45.64 ? 62  THR D C   1 
ATOM   7848  O  O   . THR D  1 82  ? 47.767 -17.987 25.585  1.00 44.87 ? 62  THR D O   1 
ATOM   7849  C  CB  . THR D  1 82  ? 47.397 -19.082 28.634  1.00 45.80 ? 62  THR D CB  1 
ATOM   7850  O  OG1 . THR D  1 82  ? 46.509 -19.329 29.720  1.00 44.80 ? 62  THR D OG1 1 
ATOM   7851  C  CG2 . THR D  1 82  ? 48.779 -18.658 29.179  1.00 45.83 ? 62  THR D CG2 1 
ATOM   7852  N  N   . MET D  1 83  ? 48.416 -16.377 27.006  1.00 45.38 ? 63  MET D N   1 
ATOM   7853  C  CA  . MET D  1 83  ? 49.419 -15.859 26.082  1.00 45.86 ? 63  MET D CA  1 
ATOM   7854  C  C   . MET D  1 83  ? 50.603 -16.814 26.039  1.00 43.32 ? 63  MET D C   1 
ATOM   7855  O  O   . MET D  1 83  ? 51.035 -17.321 27.068  1.00 43.27 ? 63  MET D O   1 
ATOM   7856  C  CB  . MET D  1 83  ? 49.849 -14.428 26.470  1.00 46.63 ? 63  MET D CB  1 
ATOM   7857  C  CG  . MET D  1 83  ? 48.874 -13.300 26.043  1.00 47.14 ? 63  MET D CG  1 
ATOM   7858  S  SD  . MET D  1 83  ? 48.547 -13.061 24.236  1.00 49.82 ? 63  MET D SD  1 
ATOM   7859  C  CE  . MET D  1 83  ? 50.088 -12.436 23.516  1.00 37.08 ? 63  MET D CE  1 
ATOM   7860  N  N   . MET D  1 84  ? 51.128 -17.042 24.848  1.00 40.85 ? 64  MET D N   1 
ATOM   7861  C  CA  . MET D  1 84  ? 52.239 -17.967 24.655  1.00 43.36 ? 64  MET D CA  1 
ATOM   7862  C  C   . MET D  1 84  ? 53.562 -17.263 24.961  1.00 43.37 ? 64  MET D C   1 
ATOM   7863  O  O   . MET D  1 84  ? 53.637 -16.041 24.964  1.00 42.63 ? 64  MET D O   1 
ATOM   7864  C  CB  . MET D  1 84  ? 52.284 -18.520 23.211  1.00 41.84 ? 64  MET D CB  1 
ATOM   7865  C  CG  . MET D  1 84  ? 52.759 -17.526 22.096  1.00 53.66 ? 64  MET D CG  1 
ATOM   7866  S  SD  . MET D  1 84  ? 51.651 -16.088 21.689  1.00 58.29 ? 64  MET D SD  1 
ATOM   7867  C  CE  . MET D  1 84  ? 50.099 -16.906 21.316  1.00 59.19 ? 64  MET D CE  1 
ATOM   7868  N  N   . GLY D  1 85  ? 54.610 -18.045 25.206  1.00 43.42 ? 65  GLY D N   1 
ATOM   7869  C  CA  . GLY D  1 85  ? 55.862 -17.480 25.659  1.00 43.80 ? 65  GLY D CA  1 
ATOM   7870  C  C   . GLY D  1 85  ? 56.737 -18.394 26.492  1.00 41.71 ? 65  GLY D C   1 
ATOM   7871  O  O   . GLY D  1 85  ? 56.248 -19.278 27.217  1.00 42.52 ? 65  GLY D O   1 
ATOM   7872  N  N   . GLN D  1 86  ? 58.035 -18.118 26.388  1.00 41.66 ? 66  GLN D N   1 
ATOM   7873  C  CA  . GLN D  1 86  ? 59.084 -18.832 27.101  1.00 42.92 ? 66  GLN D CA  1 
ATOM   7874  C  C   . GLN D  1 86  ? 59.453 -18.115 28.402  1.00 43.71 ? 66  GLN D C   1 
ATOM   7875  O  O   . GLN D  1 86  ? 59.332 -16.886 28.533  1.00 45.12 ? 66  GLN D O   1 
ATOM   7876  C  CB  . GLN D  1 86  ? 60.316 -18.989 26.198  1.00 40.55 ? 66  GLN D CB  1 
ATOM   7877  C  CG  . GLN D  1 86  ? 61.217 -20.087 26.614  1.00 39.47 ? 66  GLN D CG  1 
ATOM   7878  C  CD  . GLN D  1 86  ? 62.403 -20.321 25.674  1.00 45.55 ? 66  GLN D CD  1 
ATOM   7879  O  OE1 . GLN D  1 86  ? 62.993 -19.377 25.113  1.00 49.45 ? 66  GLN D OE1 1 
ATOM   7880  N  NE2 . GLN D  1 86  ? 62.801 -21.590 25.552  1.00 39.86 ? 66  GLN D NE2 1 
ATOM   7881  N  N   . GLN D  1 87  ? 59.879 -18.898 29.384  1.00 44.35 ? 67  GLN D N   1 
ATOM   7882  C  CA  . GLN D  1 87  ? 60.380 -18.348 30.629  1.00 42.24 ? 67  GLN D CA  1 
ATOM   7883  C  C   . GLN D  1 87  ? 61.569 -19.161 31.108  1.00 40.60 ? 67  GLN D C   1 
ATOM   7884  O  O   . GLN D  1 87  ? 61.798 -20.264 30.615  1.00 37.92 ? 67  GLN D O   1 
ATOM   7885  C  CB  . GLN D  1 87  ? 59.280 -18.340 31.709  1.00 44.19 ? 67  GLN D CB  1 
ATOM   7886  C  CG  . GLN D  1 87  ? 58.827 -19.738 32.176  1.00 42.84 ? 67  GLN D CG  1 
ATOM   7887  C  CD  . GLN D  1 87  ? 57.634 -19.685 33.123  1.00 42.04 ? 67  GLN D CD  1 
ATOM   7888  O  OE1 . GLN D  1 87  ? 57.625 -20.358 34.152  1.00 40.84 ? 67  GLN D OE1 1 
ATOM   7889  N  NE2 . GLN D  1 87  ? 56.622 -18.887 32.769  1.00 39.66 ? 67  GLN D NE2 1 
ATOM   7890  N  N   . VAL D  1 88  ? 62.331 -18.551 32.025  1.00 40.60 ? 68  VAL D N   1 
ATOM   7891  C  CA  . VAL D  1 88  ? 63.316 -19.238 32.867  1.00 42.20 ? 68  VAL D CA  1 
ATOM   7892  C  C   . VAL D  1 88  ? 62.625 -19.476 34.194  1.00 39.38 ? 68  VAL D C   1 
ATOM   7893  O  O   . VAL D  1 88  ? 61.995 -18.587 34.753  1.00 40.60 ? 68  VAL D O   1 
ATOM   7894  C  CB  . VAL D  1 88  ? 64.599 -18.394 33.078  1.00 42.63 ? 68  VAL D CB  1 
ATOM   7895  C  CG1 . VAL D  1 88  ? 65.438 -18.930 34.228  1.00 39.42 ? 68  VAL D CG1 1 
ATOM   7896  C  CG2 . VAL D  1 88  ? 65.415 -18.368 31.769  1.00 47.11 ? 68  VAL D CG2 1 
ATOM   7897  N  N   . ALA D  1 89  ? 62.698 -20.695 34.670  1.00 39.24 ? 69  ALA D N   1 
ATOM   7898  C  CA  . ALA D  1 89  ? 61.906 -21.093 35.807  1.00 38.54 ? 69  ALA D CA  1 
ATOM   7899  C  C   . ALA D  1 89  ? 62.736 -22.023 36.677  1.00 36.40 ? 69  ALA D C   1 
ATOM   7900  O  O   . ALA D  1 89  ? 63.603 -22.699 36.178  1.00 36.64 ? 69  ALA D O   1 
ATOM   7901  C  CB  . ALA D  1 89  ? 60.621 -21.761 35.323  1.00 37.65 ? 69  ALA D CB  1 
ATOM   7902  N  N   . LYS D  1 90  ? 62.467 -21.986 37.976  1.00 37.68 ? 70  LYS D N   1 
ATOM   7903  C  CA  . LYS D  1 90  ? 63.094 -22.777 38.984  1.00 38.32 ? 70  LYS D CA  1 
ATOM   7904  C  C   . LYS D  1 90  ? 62.084 -23.835 39.378  1.00 38.31 ? 70  LYS D C   1 
ATOM   7905  O  O   . LYS D  1 90  ? 60.897 -23.540 39.544  1.00 36.14 ? 70  LYS D O   1 
ATOM   7906  C  CB  . LYS D  1 90  ? 63.424 -21.912 40.227  1.00 39.03 ? 70  LYS D CB  1 
ATOM   7907  C  CG  . LYS D  1 90  ? 64.420 -22.539 41.235  1.00 40.01 ? 70  LYS D CG  1 
ATOM   7908  C  CD  . LYS D  1 90  ? 64.994 -21.514 42.253  1.00 43.05 ? 70  LYS D CD  1 
ATOM   7909  N  N   . VAL D  1 91  ? 62.568 -25.064 39.538  1.00 39.26 ? 71  VAL D N   1 
ATOM   7910  C  CA  . VAL D  1 91  ? 61.771 -26.164 40.083  1.00 39.69 ? 71  VAL D CA  1 
ATOM   7911  C  C   . VAL D  1 91  ? 61.660 -25.950 41.600  1.00 39.62 ? 71  VAL D C   1 
ATOM   7912  O  O   . VAL D  1 91  ? 62.661 -25.983 42.339  1.00 37.17 ? 71  VAL D O   1 
ATOM   7913  C  CB  . VAL D  1 91  ? 62.397 -27.553 39.753  1.00 39.70 ? 71  VAL D CB  1 
ATOM   7914  C  CG1 . VAL D  1 91  ? 61.541 -28.677 40.305  1.00 38.50 ? 71  VAL D CG1 1 
ATOM   7915  C  CG2 . VAL D  1 91  ? 62.624 -27.726 38.224  1.00 39.87 ? 71  VAL D CG2 1 
ATOM   7916  N  N   . VAL D  1 92  ? 60.442 -25.693 42.061  1.00 42.35 ? 72  VAL D N   1 
ATOM   7917  C  CA  . VAL D  1 92  ? 60.198 -25.437 43.499  1.00 44.26 ? 72  VAL D CA  1 
ATOM   7918  C  C   . VAL D  1 92  ? 59.511 -26.601 44.211  1.00 44.59 ? 72  VAL D C   1 
ATOM   7919  O  O   . VAL D  1 92  ? 59.361 -26.558 45.432  1.00 47.20 ? 72  VAL D O   1 
ATOM   7920  C  CB  . VAL D  1 92  ? 59.401 -24.085 43.754  1.00 43.55 ? 72  VAL D CB  1 
ATOM   7921  C  CG1 . VAL D  1 92  ? 60.308 -22.882 43.508  1.00 44.11 ? 72  VAL D CG1 1 
ATOM   7922  C  CG2 . VAL D  1 92  ? 58.107 -23.976 42.900  1.00 43.71 ? 72  VAL D CG2 1 
ATOM   7923  N  N   . GLU D  1 93  ? 59.101 -27.623 43.450  1.00 44.09 ? 73  GLU D N   1 
ATOM   7924  C  CA  . GLU D  1 93  ? 58.441 -28.837 43.983  1.00 43.33 ? 73  GLU D CA  1 
ATOM   7925  C  C   . GLU D  1 93  ? 58.568 -29.940 42.919  1.00 41.76 ? 73  GLU D C   1 
ATOM   7926  O  O   . GLU D  1 93  ? 58.200 -29.729 41.778  1.00 40.23 ? 73  GLU D O   1 
ATOM   7927  C  CB  . GLU D  1 93  ? 56.957 -28.565 44.351  1.00 42.61 ? 73  GLU D CB  1 
ATOM   7928  C  CG  . GLU D  1 93  ? 56.423 -29.383 45.539  1.00 46.76 ? 73  GLU D CG  1 
ATOM   7929  N  N   . SER D  1 94  ? 59.080 -31.111 43.294  1.00 43.07 ? 74  SER D N   1 
ATOM   7930  C  CA  . SER D  1 94  ? 59.474 -32.149 42.325  1.00 42.10 ? 74  SER D CA  1 
ATOM   7931  C  C   . SER D  1 94  ? 59.002 -33.579 42.683  1.00 39.68 ? 74  SER D C   1 
ATOM   7932  O  O   . SER D  1 94  ? 59.118 -33.992 43.827  1.00 36.82 ? 74  SER D O   1 
ATOM   7933  C  CB  . SER D  1 94  ? 61.008 -32.132 42.202  1.00 43.90 ? 74  SER D CB  1 
ATOM   7934  O  OG  . SER D  1 94  ? 61.462 -32.817 41.039  1.00 45.27 ? 74  SER D OG  1 
ATOM   7935  N  N   . LYS D  1 95  ? 58.444 -34.304 41.704  1.00 39.11 ? 75  LYS D N   1 
ATOM   7936  C  CA  . LYS D  1 95  ? 58.332 -35.784 41.770  1.00 39.23 ? 75  LYS D CA  1 
ATOM   7937  C  C   . LYS D  1 95  ? 59.057 -36.429 40.548  1.00 37.37 ? 75  LYS D C   1 
ATOM   7938  O  O   . LYS D  1 95  ? 58.616 -37.442 40.006  1.00 33.76 ? 75  LYS D O   1 
ATOM   7939  C  CB  . LYS D  1 95  ? 56.868 -36.267 41.869  1.00 39.12 ? 75  LYS D CB  1 
ATOM   7940  C  CG  . LYS D  1 95  ? 56.058 -35.594 42.945  1.00 40.17 ? 75  LYS D CG  1 
ATOM   7941  C  CD  . LYS D  1 95  ? 54.741 -36.319 43.262  1.00 40.90 ? 75  LYS D CD  1 
ATOM   7942  C  CE  . LYS D  1 95  ? 54.044 -35.645 44.493  1.00 45.64 ? 75  LYS D CE  1 
ATOM   7943  N  NZ  . LYS D  1 95  ? 52.570 -35.932 44.664  1.00 42.85 ? 75  LYS D NZ  1 
ATOM   7944  N  N   . ASN D  1 96  ? 60.175 -35.813 40.155  1.00 36.29 ? 76  ASN D N   1 
ATOM   7945  C  CA  . ASN D  1 96  ? 60.945 -36.172 38.985  1.00 35.01 ? 76  ASN D CA  1 
ATOM   7946  C  C   . ASN D  1 96  ? 62.420 -36.158 39.354  1.00 36.81 ? 76  ASN D C   1 
ATOM   7947  O  O   . ASN D  1 96  ? 62.998 -35.090 39.576  1.00 37.09 ? 76  ASN D O   1 
ATOM   7948  C  CB  . ASN D  1 96  ? 60.701 -35.159 37.865  1.00 35.87 ? 76  ASN D CB  1 
ATOM   7949  C  CG  . ASN D  1 96  ? 61.177 -35.646 36.518  1.00 32.67 ? 76  ASN D CG  1 
ATOM   7950  O  OD1 . ASN D  1 96  ? 62.272 -36.180 36.388  1.00 41.36 ? 76  ASN D OD1 1 
ATOM   7951  N  ND2 . ASN D  1 96  ? 60.356 -35.460 35.507  1.00 37.69 ? 76  ASN D ND2 1 
ATOM   7952  N  N   . VAL D  1 97  ? 63.036 -37.339 39.396  1.00 37.27 ? 77  VAL D N   1 
ATOM   7953  C  CA  . VAL D  1 97  ? 64.438 -37.433 39.798  1.00 38.72 ? 77  VAL D CA  1 
ATOM   7954  C  C   . VAL D  1 97  ? 65.459 -36.714 38.874  1.00 40.24 ? 77  VAL D C   1 
ATOM   7955  O  O   . VAL D  1 97  ? 66.600 -36.506 39.280  1.00 42.69 ? 77  VAL D O   1 
ATOM   7956  C  CB  . VAL D  1 97  ? 64.871 -38.899 40.045  1.00 38.49 ? 77  VAL D CB  1 
ATOM   7957  C  CG1 . VAL D  1 97  ? 64.208 -39.440 41.325  1.00 37.58 ? 77  VAL D CG1 1 
ATOM   7958  C  CG2 . VAL D  1 97  ? 64.584 -39.787 38.841  1.00 40.31 ? 77  VAL D CG2 1 
ATOM   7959  N  N   . ALA D  1 98  ? 65.068 -36.341 37.657  1.00 37.81 ? 78  ALA D N   1 
ATOM   7960  C  CA  . ALA D  1 98  ? 65.964 -35.627 36.753  1.00 38.20 ? 78  ALA D CA  1 
ATOM   7961  C  C   . ALA D  1 98  ? 65.927 -34.130 37.044  1.00 39.16 ? 78  ALA D C   1 
ATOM   7962  O  O   . ALA D  1 98  ? 66.809 -33.363 36.624  1.00 37.40 ? 78  ALA D O   1 
ATOM   7963  C  CB  . ALA D  1 98  ? 65.538 -35.879 35.294  1.00 38.96 ? 78  ALA D CB  1 
ATOM   7964  N  N   . LEU D  1 99  ? 64.865 -33.720 37.731  1.00 39.63 ? 79  LEU D N   1 
ATOM   7965  C  CA  . LEU D  1 99  ? 64.583 -32.319 37.975  1.00 40.84 ? 79  LEU D CA  1 
ATOM   7966  C  C   . LEU D  1 99  ? 64.288 -32.107 39.454  1.00 40.04 ? 79  LEU D C   1 
ATOM   7967  O  O   . LEU D  1 99  ? 63.131 -31.862 39.808  1.00 40.30 ? 79  LEU D O   1 
ATOM   7968  C  CB  . LEU D  1 99  ? 63.389 -31.880 37.120  1.00 40.27 ? 79  LEU D CB  1 
ATOM   7969  C  CG  . LEU D  1 99  ? 63.588 -31.980 35.606  1.00 42.06 ? 79  LEU D CG  1 
ATOM   7970  C  CD1 . LEU D  1 99  ? 62.239 -31.955 34.899  1.00 46.44 ? 79  LEU D CD1 1 
ATOM   7971  C  CD2 . LEU D  1 99  ? 64.507 -30.867 35.084  1.00 38.82 ? 79  LEU D CD2 1 
ATOM   7972  N  N   . PRO D  1 100 ? 65.340 -32.200 40.317  1.00 39.50 ? 80  PRO D N   1 
ATOM   7973  C  CA  . PRO D  1 100 ? 65.173 -31.923 41.775  1.00 39.62 ? 80  PRO D CA  1 
ATOM   7974  C  C   . PRO D  1 100 ? 64.848 -30.428 42.098  1.00 40.10 ? 80  PRO D C   1 
ATOM   7975  O  O   . PRO D  1 100 ? 65.152 -29.553 41.284  1.00 38.64 ? 80  PRO D O   1 
ATOM   7976  C  CB  . PRO D  1 100 ? 66.514 -32.359 42.378  1.00 36.89 ? 80  PRO D CB  1 
ATOM   7977  C  CG  . PRO D  1 100 ? 67.494 -32.386 41.263  1.00 36.12 ? 80  PRO D CG  1 
ATOM   7978  C  CD  . PRO D  1 100 ? 66.736 -32.546 39.964  1.00 35.84 ? 80  PRO D CD  1 
ATOM   7979  N  N   . LYS D  1 101 ? 64.219 -30.157 43.250  1.00 41.18 ? 81  LYS D N   1 
ATOM   7980  C  CA  . LYS D  1 101 ? 63.984 -28.775 43.734  1.00 41.85 ? 81  LYS D CA  1 
ATOM   7981  C  C   . LYS D  1 101 ? 65.224 -27.908 43.524  1.00 40.86 ? 81  LYS D C   1 
ATOM   7982  O  O   . LYS D  1 101 ? 66.317 -28.328 43.851  1.00 40.26 ? 81  LYS D O   1 
ATOM   7983  C  CB  . LYS D  1 101 ? 63.614 -28.765 45.245  1.00 42.39 ? 81  LYS D CB  1 
ATOM   7984  C  CG  . LYS D  1 101 ? 62.106 -28.664 45.549  1.00 42.94 ? 81  LYS D CG  1 
ATOM   7985  C  CD  . LYS D  1 101 ? 61.744 -29.078 46.989  1.00 47.55 ? 81  LYS D CD  1 
ATOM   7986  C  CE  . LYS D  1 101 ? 61.446 -30.616 47.149  1.00 53.40 ? 81  LYS D CE  1 
ATOM   7987  N  NZ  . LYS D  1 101 ? 60.176 -31.112 46.461  1.00 45.50 ? 81  LYS D NZ  1 
ATOM   7988  N  N   . GLY D  1 102 ? 65.049 -26.694 43.009  1.00 40.89 ? 82  GLY D N   1 
ATOM   7989  C  CA  . GLY D  1 102 ? 66.170 -25.770 42.781  1.00 41.65 ? 82  GLY D CA  1 
ATOM   7990  C  C   . GLY D  1 102 ? 66.750 -25.728 41.365  1.00 42.67 ? 82  GLY D C   1 
ATOM   7991  O  O   . GLY D  1 102 ? 67.469 -24.788 41.014  1.00 43.89 ? 82  GLY D O   1 
ATOM   7992  N  N   . THR D  1 103 ? 66.433 -26.737 40.555  1.00 42.20 ? 83  THR D N   1 
ATOM   7993  C  CA  . THR D  1 103 ? 66.858 -26.801 39.150  1.00 41.72 ? 83  THR D CA  1 
ATOM   7994  C  C   . THR D  1 103 ? 66.269 -25.657 38.336  1.00 41.88 ? 83  THR D C   1 
ATOM   7995  O  O   . THR D  1 103 ? 65.101 -25.312 38.502  1.00 42.63 ? 83  THR D O   1 
ATOM   7996  C  CB  . THR D  1 103 ? 66.410 -28.138 38.467  1.00 41.42 ? 83  THR D CB  1 
ATOM   7997  O  OG1 . THR D  1 103 ? 66.681 -29.257 39.332  1.00 40.49 ? 83  THR D OG1 1 
ATOM   7998  C  CG2 . THR D  1 103 ? 67.104 -28.337 37.112  1.00 39.76 ? 83  THR D CG2 1 
ATOM   7999  N  N   . ILE D  1 104 ? 67.087 -25.120 37.427  1.00 41.41 ? 84  ILE D N   1 
ATOM   8000  C  CA  . ILE D  1 104 ? 66.749 -23.975 36.579  1.00 41.39 ? 84  ILE D CA  1 
ATOM   8001  C  C   . ILE D  1 104 ? 66.521 -24.524 35.178  1.00 40.98 ? 84  ILE D C   1 
ATOM   8002  O  O   . ILE D  1 104 ? 67.337 -25.288 34.664  1.00 39.86 ? 84  ILE D O   1 
ATOM   8003  C  CB  . ILE D  1 104 ? 67.910 -22.919 36.566  1.00 42.07 ? 84  ILE D CB  1 
ATOM   8004  C  CG1 . ILE D  1 104 ? 68.128 -22.317 37.963  1.00 43.04 ? 84  ILE D CG1 1 
ATOM   8005  C  CG2 . ILE D  1 104 ? 67.660 -21.845 35.573  1.00 38.74 ? 84  ILE D CG2 1 
ATOM   8006  C  CD1 . ILE D  1 104 ? 66.866 -21.729 38.583  1.00 42.89 ? 84  ILE D CD1 1 
ATOM   8007  N  N   . VAL D  1 105 ? 65.388 -24.161 34.586  1.00 40.96 ? 85  VAL D N   1 
ATOM   8008  C  CA  . VAL D  1 105 ? 64.988 -24.680 33.279  1.00 39.18 ? 85  VAL D CA  1 
ATOM   8009  C  C   . VAL D  1 105 ? 64.449 -23.576 32.386  1.00 38.21 ? 85  VAL D C   1 
ATOM   8010  O  O   . VAL D  1 105 ? 64.078 -22.520 32.876  1.00 35.75 ? 85  VAL D O   1 
ATOM   8011  C  CB  . VAL D  1 105 ? 63.889 -25.786 33.402  1.00 38.93 ? 85  VAL D CB  1 
ATOM   8012  C  CG1 . VAL D  1 105 ? 64.452 -27.010 34.064  1.00 33.75 ? 85  VAL D CG1 1 
ATOM   8013  C  CG2 . VAL D  1 105 ? 62.643 -25.254 34.140  1.00 42.22 ? 85  VAL D CG2 1 
ATOM   8014  N  N   . LEU D  1 106 ? 64.484 -23.825 31.077  1.00 39.92 ? 86  LEU D N   1 
ATOM   8015  C  CA  . LEU D  1 106 ? 63.596 -23.173 30.121  1.00 42.62 ? 86  LEU D CA  1 
ATOM   8016  C  C   . LEU D  1 106 ? 62.271 -23.960 29.949  1.00 41.18 ? 86  LEU D C   1 
ATOM   8017  O  O   . LEU D  1 106 ? 62.275 -25.160 29.735  1.00 39.03 ? 86  LEU D O   1 
ATOM   8018  C  CB  . LEU D  1 106 ? 64.270 -23.012 28.754  1.00 44.31 ? 86  LEU D CB  1 
ATOM   8019  C  CG  . LEU D  1 106 ? 65.426 -22.015 28.736  1.00 50.09 ? 86  LEU D CG  1 
ATOM   8020  C  CD1 . LEU D  1 106 ? 66.470 -22.443 27.705  1.00 55.17 ? 86  LEU D CD1 1 
ATOM   8021  C  CD2 . LEU D  1 106 ? 64.924 -20.557 28.478  1.00 53.34 ? 86  LEU D CD2 1 
ATOM   8022  N  N   . ALA D  1 107 ? 61.156 -23.240 30.054  1.00 41.81 ? 87  ALA D N   1 
ATOM   8023  C  CA  . ALA D  1 107 ? 59.827 -23.776 29.850  1.00 42.33 ? 87  ALA D CA  1 
ATOM   8024  C  C   . ALA D  1 107 ? 58.976 -22.794 29.015  1.00 42.73 ? 87  ALA D C   1 
ATOM   8025  O  O   . ALA D  1 107 ? 59.270 -21.617 28.948  1.00 38.58 ? 87  ALA D O   1 
ATOM   8026  C  CB  . ALA D  1 107 ? 59.175 -24.033 31.193  1.00 42.23 ? 87  ALA D CB  1 
ATOM   8027  N  N   . SER D  1 108 ? 57.907 -23.294 28.407  1.00 45.25 ? 88  SER D N   1 
ATOM   8028  C  CA  . SER D  1 108 ? 56.983 -22.458 27.646  1.00 44.27 ? 88  SER D CA  1 
ATOM   8029  C  C   . SER D  1 108 ? 55.511 -22.725 27.986  1.00 44.06 ? 88  SER D C   1 
ATOM   8030  O  O   . SER D  1 108 ? 54.735 -23.104 27.108  1.00 46.83 ? 88  SER D O   1 
ATOM   8031  C  CB  . SER D  1 108 ? 57.218 -22.669 26.146  1.00 44.32 ? 88  SER D CB  1 
ATOM   8032  O  OG  . SER D  1 108 ? 58.547 -22.350 25.845  1.00 39.09 ? 88  SER D OG  1 
ATOM   8033  N  N   . PRO D  1 109 ? 55.116 -22.482 29.245  1.00 42.46 ? 89  PRO D N   1 
ATOM   8034  C  CA  . PRO D  1 109 ? 53.732 -22.610 29.666  1.00 42.04 ? 89  PRO D CA  1 
ATOM   8035  C  C   . PRO D  1 109 ? 52.892 -21.368 29.330  1.00 45.24 ? 89  PRO D C   1 
ATOM   8036  O  O   . PRO D  1 109 ? 51.708 -21.306 29.719  1.00 46.27 ? 89  PRO D O   1 
ATOM   8037  C  CB  . PRO D  1 109 ? 53.863 -22.717 31.187  1.00 42.28 ? 89  PRO D CB  1 
ATOM   8038  C  CG  . PRO D  1 109 ? 55.030 -21.829 31.503  1.00 40.91 ? 89  PRO D CG  1 
ATOM   8039  C  CD  . PRO D  1 109 ? 55.987 -22.037 30.361  1.00 42.77 ? 89  PRO D CD  1 
ATOM   8040  N  N   . GLY D  1 110 ? 53.504 -20.393 28.642  1.00 45.53 ? 90  GLY D N   1 
ATOM   8041  C  CA  . GLY D  1 110 ? 52.931 -19.084 28.463  1.00 43.57 ? 90  GLY D CA  1 
ATOM   8042  C  C   . GLY D  1 110 ? 53.190 -18.077 29.583  1.00 43.45 ? 90  GLY D C   1 
ATOM   8043  O  O   . GLY D  1 110 ? 54.088 -18.259 30.435  1.00 44.72 ? 90  GLY D O   1 
ATOM   8044  N  N   . TRP D  1 111 ? 52.423 -16.986 29.556  1.00 42.24 ? 91  TRP D N   1 
ATOM   8045  C  CA  . TRP D  1 111 ? 52.573 -15.889 30.522  1.00 41.55 ? 91  TRP D CA  1 
ATOM   8046  C  C   . TRP D  1 111 ? 51.861 -16.295 31.795  1.00 41.97 ? 91  TRP D C   1 
ATOM   8047  O  O   . TRP D  1 111 ? 50.713 -15.940 32.015  1.00 40.77 ? 91  TRP D O   1 
ATOM   8048  C  CB  . TRP D  1 111 ? 51.989 -14.553 30.059  1.00 40.19 ? 91  TRP D CB  1 
ATOM   8049  C  CG  . TRP D  1 111 ? 52.513 -13.991 28.757  1.00 45.67 ? 91  TRP D CG  1 
ATOM   8050  C  CD1 . TRP D  1 111 ? 53.300 -14.625 27.822  1.00 38.92 ? 91  TRP D CD1 1 
ATOM   8051  C  CD2 . TRP D  1 111 ? 52.220 -12.691 28.219  1.00 36.61 ? 91  TRP D CD2 1 
ATOM   8052  N  NE1 . TRP D  1 111 ? 53.536 -13.777 26.777  1.00 36.12 ? 91  TRP D NE1 1 
ATOM   8053  C  CE2 . TRP D  1 111 ? 52.892 -12.589 26.989  1.00 45.00 ? 91  TRP D CE2 1 
ATOM   8054  C  CE3 . TRP D  1 111 ? 51.494 -11.585 28.685  1.00 37.72 ? 91  TRP D CE3 1 
ATOM   8055  C  CZ2 . TRP D  1 111 ? 52.825 -11.423 26.187  1.00 43.51 ? 91  TRP D CZ2 1 
ATOM   8056  C  CZ3 . TRP D  1 111 ? 51.441 -10.450 27.917  1.00 32.96 ? 91  TRP D CZ3 1 
ATOM   8057  C  CH2 . TRP D  1 111 ? 52.109 -10.368 26.685  1.00 41.06 ? 91  TRP D CH2 1 
ATOM   8058  N  N   . THR D  1 112 ? 52.570 -17.064 32.605  1.00 42.15 ? 92  THR D N   1 
ATOM   8059  C  CA  . THR D  1 112 ? 52.068 -17.569 33.840  1.00 41.61 ? 92  THR D CA  1 
ATOM   8060  C  C   . THR D  1 112 ? 53.223 -17.621 34.863  1.00 41.00 ? 92  THR D C   1 
ATOM   8061  O  O   . THR D  1 112 ? 54.389 -17.790 34.495  1.00 39.17 ? 92  THR D O   1 
ATOM   8062  C  CB  . THR D  1 112 ? 51.380 -18.928 33.617  1.00 40.73 ? 92  THR D CB  1 
ATOM   8063  O  OG1 . THR D  1 112 ? 50.852 -19.378 34.853  1.00 40.39 ? 92  THR D OG1 1 
ATOM   8064  C  CG2 . THR D  1 112 ? 52.325 -19.977 33.076  1.00 47.13 ? 92  THR D CG2 1 
ATOM   8065  N  N   . THR D  1 113 ? 52.879 -17.407 36.134  1.00 42.16 ? 93  THR D N   1 
ATOM   8066  C  CA  . THR D  1 113 ? 53.861 -17.317 37.213  1.00 43.39 ? 93  THR D CA  1 
ATOM   8067  C  C   . THR D  1 113 ? 54.248 -18.672 37.744  1.00 43.13 ? 93  THR D C   1 
ATOM   8068  O  O   . THR D  1 113 ? 55.278 -18.779 38.396  1.00 45.17 ? 93  THR D O   1 
ATOM   8069  C  CB  . THR D  1 113 ? 53.341 -16.515 38.433  1.00 42.29 ? 93  THR D CB  1 
ATOM   8070  O  OG1 . THR D  1 113 ? 52.098 -17.065 38.894  1.00 48.34 ? 93  THR D OG1 1 
ATOM   8071  C  CG2 . THR D  1 113 ? 53.175 -15.077 38.083  1.00 40.91 ? 93  THR D CG2 1 
ATOM   8072  N  N   . HIS D  1 114 ? 53.369 -19.662 37.547  1.00 44.05 ? 94  HIS D N   1 
ATOM   8073  C  CA  . HIS D  1 114 ? 53.558 -21.031 38.026  1.00 43.06 ? 94  HIS D CA  1 
ATOM   8074  C  C   . HIS D  1 114 ? 52.946 -21.978 37.026  1.00 42.69 ? 94  HIS D C   1 
ATOM   8075  O  O   . HIS D  1 114 ? 51.921 -21.697 36.479  1.00 45.20 ? 94  HIS D O   1 
ATOM   8076  C  CB  . HIS D  1 114 ? 52.910 -21.242 39.408  1.00 43.99 ? 94  HIS D CB  1 
ATOM   8077  C  CG  . HIS D  1 114 ? 53.541 -20.430 40.503  1.00 45.88 ? 94  HIS D CG  1 
ATOM   8078  N  ND1 . HIS D  1 114 ? 53.317 -19.071 40.653  1.00 47.21 ? 94  HIS D ND1 1 
ATOM   8079  C  CD2 . HIS D  1 114 ? 54.407 -20.781 41.485  1.00 43.83 ? 94  HIS D CD2 1 
ATOM   8080  C  CE1 . HIS D  1 114 ? 54.020 -18.626 41.679  1.00 45.83 ? 94  HIS D CE1 1 
ATOM   8081  N  NE2 . HIS D  1 114 ? 54.691 -19.642 42.199  1.00 46.57 ? 94  HIS D NE2 1 
ATOM   8082  N  N   . SER D  1 115 ? 53.582 -23.104 36.782  1.00 44.29 ? 95  SER D N   1 
ATOM   8083  C  CA  . SER D  1 115 ? 53.010 -24.123 35.920  1.00 44.23 ? 95  SER D CA  1 
ATOM   8084  C  C   . SER D  1 115 ? 53.517 -25.532 36.308  1.00 43.41 ? 95  SER D C   1 
ATOM   8085  O  O   . SER D  1 115 ? 54.478 -25.661 37.035  1.00 42.19 ? 95  SER D O   1 
ATOM   8086  C  CB  . SER D  1 115 ? 53.340 -23.804 34.461  1.00 43.76 ? 95  SER D CB  1 
ATOM   8087  O  OG  . SER D  1 115 ? 54.720 -23.590 34.295  1.00 44.21 ? 95  SER D OG  1 
ATOM   8088  N  N   . ILE D  1 116 ? 52.833 -26.567 35.828  1.00 43.32 ? 96  ILE D N   1 
ATOM   8089  C  CA  . ILE D  1 116 ? 53.230 -27.940 36.039  1.00 44.23 ? 96  ILE D CA  1 
ATOM   8090  C  C   . ILE D  1 116 ? 53.722 -28.559 34.752  1.00 45.26 ? 96  ILE D C   1 
ATOM   8091  O  O   . ILE D  1 116 ? 53.115 -28.408 33.696  1.00 45.84 ? 96  ILE D O   1 
ATOM   8092  C  CB  . ILE D  1 116 ? 52.071 -28.794 36.604  1.00 42.64 ? 96  ILE D CB  1 
ATOM   8093  C  CG1 . ILE D  1 116 ? 51.820 -28.428 38.075  1.00 44.08 ? 96  ILE D CG1 1 
ATOM   8094  C  CG2 . ILE D  1 116 ? 52.393 -30.272 36.490  1.00 43.71 ? 96  ILE D CG2 1 
ATOM   8095  C  CD1 . ILE D  1 116 ? 50.469 -28.843 38.587  1.00 46.71 ? 96  ILE D CD1 1 
ATOM   8096  N  N   . SER D  1 117 ? 54.821 -29.289 34.863  1.00 47.32 ? 97  SER D N   1 
ATOM   8097  C  CA  . SER D  1 117 ? 55.414 -29.975 33.725  1.00 47.26 ? 97  SER D CA  1 
ATOM   8098  C  C   . SER D  1 117 ? 55.677 -31.450 34.052  1.00 46.56 ? 97  SER D C   1 
ATOM   8099  O  O   . SER D  1 117 ? 56.029 -31.796 35.157  1.00 43.45 ? 97  SER D O   1 
ATOM   8100  C  CB  . SER D  1 117 ? 56.703 -29.269 33.324  1.00 46.22 ? 97  SER D CB  1 
ATOM   8101  O  OG  . SER D  1 117 ? 57.262 -29.852 32.170  1.00 45.26 ? 97  SER D OG  1 
ATOM   8102  N  N   . ASP D  1 118 ? 55.464 -32.301 33.058  1.00 49.12 ? 98  ASP D N   1 
ATOM   8103  C  CA  . ASP D  1 118 ? 55.905 -33.699 33.050  1.00 49.53 ? 98  ASP D CA  1 
ATOM   8104  C  C   . ASP D  1 118 ? 57.416 -33.828 32.752  1.00 50.18 ? 98  ASP D C   1 
ATOM   8105  O  O   . ASP D  1 118 ? 57.991 -34.904 32.893  1.00 51.52 ? 98  ASP D O   1 
ATOM   8106  C  CB  . ASP D  1 118 ? 55.102 -34.476 32.003  1.00 49.58 ? 98  ASP D CB  1 
ATOM   8107  C  CG  . ASP D  1 118 ? 55.377 -33.993 30.558  1.00 55.48 ? 98  ASP D CG  1 
ATOM   8108  O  OD1 . ASP D  1 118 ? 55.806 -34.837 29.744  1.00 66.84 ? 98  ASP D OD1 1 
ATOM   8109  O  OD2 . ASP D  1 118 ? 55.181 -32.784 30.225  1.00 63.22 ? 98  ASP D OD2 1 
ATOM   8110  N  N   . GLY D  1 119 ? 58.044 -32.736 32.333  1.00 51.13 ? 99  GLY D N   1 
ATOM   8111  C  CA  . GLY D  1 119 ? 59.488 -32.641 32.214  1.00 51.79 ? 99  GLY D CA  1 
ATOM   8112  C  C   . GLY D  1 119 ? 60.034 -32.943 30.833  1.00 54.44 ? 99  GLY D C   1 
ATOM   8113  O  O   . GLY D  1 119 ? 61.257 -32.962 30.655  1.00 56.58 ? 99  GLY D O   1 
ATOM   8114  N  N   . LYS D  1 120 ? 59.161 -33.202 29.855  1.00 55.35 ? 100 LYS D N   1 
ATOM   8115  C  CA  . LYS D  1 120 ? 59.628 -33.552 28.494  1.00 56.30 ? 100 LYS D CA  1 
ATOM   8116  C  C   . LYS D  1 120 ? 59.656 -32.301 27.624  1.00 56.29 ? 100 LYS D C   1 
ATOM   8117  O  O   . LYS D  1 120 ? 60.419 -32.213 26.669  1.00 57.14 ? 100 LYS D O   1 
ATOM   8118  C  CB  . LYS D  1 120 ? 58.782 -34.679 27.864  1.00 55.38 ? 100 LYS D CB  1 
ATOM   8119  N  N   . ASP D  1 121 ? 58.854 -31.315 28.001  1.00 55.87 ? 101 ASP D N   1 
ATOM   8120  C  CA  . ASP D  1 121 ? 58.784 -30.032 27.311  1.00 57.11 ? 101 ASP D CA  1 
ATOM   8121  C  C   . ASP D  1 121 ? 59.719 -28.947 27.905  1.00 56.94 ? 101 ASP D C   1 
ATOM   8122  O  O   . ASP D  1 121 ? 59.503 -27.728 27.691  1.00 57.55 ? 101 ASP D O   1 
ATOM   8123  C  CB  . ASP D  1 121 ? 57.327 -29.540 27.384  1.00 60.15 ? 101 ASP D CB  1 
ATOM   8124  C  CG  . ASP D  1 121 ? 56.766 -29.551 28.829  1.00 66.04 ? 101 ASP D CG  1 
ATOM   8125  O  OD1 . ASP D  1 121 ? 57.211 -30.402 29.643  1.00 69.52 ? 101 ASP D OD1 1 
ATOM   8126  O  OD2 . ASP D  1 121 ? 55.874 -28.727 29.138  1.00 67.52 ? 101 ASP D OD2 1 
ATOM   8127  N  N   . LEU D  1 122 ? 60.729 -29.375 28.662  1.00 54.01 ? 102 LEU D N   1 
ATOM   8128  C  CA  . LEU D  1 122 ? 61.640 -28.465 29.349  1.00 54.25 ? 102 LEU D CA  1 
ATOM   8129  C  C   . LEU D  1 122 ? 63.024 -28.585 28.756  1.00 54.11 ? 102 LEU D C   1 
ATOM   8130  O  O   . LEU D  1 122 ? 63.282 -29.450 27.934  1.00 56.97 ? 102 LEU D O   1 
ATOM   8131  C  CB  . LEU D  1 122 ? 61.734 -28.800 30.835  1.00 54.36 ? 102 LEU D CB  1 
ATOM   8132  C  CG  . LEU D  1 122 ? 60.455 -28.854 31.650  1.00 53.41 ? 102 LEU D CG  1 
ATOM   8133  C  CD1 . LEU D  1 122 ? 60.859 -29.056 33.113  1.00 56.97 ? 102 LEU D CD1 1 
ATOM   8134  C  CD2 . LEU D  1 122 ? 59.565 -27.610 31.470  1.00 54.20 ? 102 LEU D CD2 1 
ATOM   8135  N  N   . GLU D  1 123 ? 63.921 -27.728 29.210  1.00 53.55 ? 103 GLU D N   1 
ATOM   8136  C  CA  . GLU D  1 123 ? 65.279 -27.698 28.732  1.00 51.99 ? 103 GLU D CA  1 
ATOM   8137  C  C   . GLU D  1 123 ? 66.130 -27.123 29.854  1.00 49.55 ? 103 GLU D C   1 
ATOM   8138  O  O   . GLU D  1 123 ? 65.897 -26.020 30.308  1.00 49.07 ? 103 GLU D O   1 
ATOM   8139  C  CB  . GLU D  1 123 ? 65.312 -26.833 27.480  1.00 51.05 ? 103 GLU D CB  1 
ATOM   8140  C  CG  . GLU D  1 123 ? 66.682 -26.497 26.911  1.00 54.72 ? 103 GLU D CG  1 
ATOM   8141  C  CD  . GLU D  1 123 ? 66.571 -25.518 25.723  1.00 59.26 ? 103 GLU D CD  1 
ATOM   8142  O  OE1 . GLU D  1 123 ? 65.449 -25.446 25.126  1.00 64.32 ? 103 GLU D OE1 1 
ATOM   8143  O  OE2 . GLU D  1 123 ? 67.588 -24.822 25.393  1.00 59.64 ? 103 GLU D OE2 1 
ATOM   8144  N  N   . LYS D  1 124 ? 67.091 -27.897 30.335  1.00 50.58 ? 104 LYS D N   1 
ATOM   8145  C  CA  . LYS D  1 124 ? 68.060 -27.406 31.302  1.00 49.61 ? 104 LYS D CA  1 
ATOM   8146  C  C   . LYS D  1 124 ? 69.013 -26.492 30.567  1.00 50.83 ? 104 LYS D C   1 
ATOM   8147  O  O   . LYS D  1 124 ? 69.161 -26.587 29.341  1.00 48.88 ? 104 LYS D O   1 
ATOM   8148  C  CB  . LYS D  1 124 ? 68.846 -28.557 31.912  1.00 49.05 ? 104 LYS D CB  1 
ATOM   8149  C  CG  . LYS D  1 124 ? 68.061 -29.446 32.854  1.00 49.24 ? 104 LYS D CG  1 
ATOM   8150  C  CD  . LYS D  1 124 ? 68.921 -30.648 33.254  1.00 46.68 ? 104 LYS D CD  1 
ATOM   8151  C  CE  . LYS D  1 124 ? 68.361 -31.420 34.443  1.00 50.38 ? 104 LYS D CE  1 
ATOM   8152  N  NZ  . LYS D  1 124 ? 69.052 -32.769 34.642  1.00 46.04 ? 104 LYS D NZ  1 
ATOM   8153  N  N   . LEU D  1 125 ? 69.674 -25.612 31.308  1.00 53.28 ? 105 LEU D N   1 
ATOM   8154  C  CA  . LEU D  1 125 ? 70.673 -24.741 30.699  1.00 54.63 ? 105 LEU D CA  1 
ATOM   8155  C  C   . LEU D  1 125 ? 71.939 -25.507 30.288  1.00 54.31 ? 105 LEU D C   1 
ATOM   8156  O  O   . LEU D  1 125 ? 72.184 -26.646 30.720  1.00 55.44 ? 105 LEU D O   1 
ATOM   8157  C  CB  . LEU D  1 125 ? 71.025 -23.589 31.639  1.00 56.04 ? 105 LEU D CB  1 
ATOM   8158  C  CG  . LEU D  1 125 ? 69.871 -22.669 32.043  1.00 55.80 ? 105 LEU D CG  1 
ATOM   8159  C  CD1 . LEU D  1 125 ? 70.404 -21.642 32.972  1.00 59.90 ? 105 LEU D CD1 1 
ATOM   8160  C  CD2 . LEU D  1 125 ? 69.208 -21.978 30.890  1.00 60.24 ? 105 LEU D CD2 1 
ATOM   8161  N  N   . LEU D  1 126 ? 72.738 -24.888 29.427  1.00 54.14 ? 106 LEU D N   1 
ATOM   8162  C  CA  . LEU D  1 126 ? 74.058 -25.429 29.116  1.00 54.62 ? 106 LEU D CA  1 
ATOM   8163  C  C   . LEU D  1 126 ? 74.781 -25.802 30.416  1.00 53.53 ? 106 LEU D C   1 
ATOM   8164  O  O   . LEU D  1 126 ? 74.671 -25.066 31.394  1.00 51.84 ? 106 LEU D O   1 
ATOM   8165  C  CB  . LEU D  1 126 ? 74.871 -24.387 28.358  1.00 55.58 ? 106 LEU D CB  1 
ATOM   8166  C  CG  . LEU D  1 126 ? 74.464 -24.085 26.915  1.00 55.70 ? 106 LEU D CG  1 
ATOM   8167  C  CD1 . LEU D  1 126 ? 75.333 -22.923 26.441  1.00 58.73 ? 106 LEU D CD1 1 
ATOM   8168  C  CD2 . LEU D  1 126 ? 74.598 -25.314 25.987  1.00 48.15 ? 106 LEU D CD2 1 
ATOM   8169  N  N   . THR D  1 127 ? 75.484 -26.946 30.412  1.00 54.42 ? 107 THR D N   1 
ATOM   8170  C  CA  . THR D  1 127 ? 76.265 -27.434 31.569  1.00 55.52 ? 107 THR D CA  1 
ATOM   8171  C  C   . THR D  1 127 ? 77.296 -26.407 32.026  1.00 56.11 ? 107 THR D C   1 
ATOM   8172  O  O   . THR D  1 127 ? 77.430 -26.086 33.218  1.00 56.72 ? 107 THR D O   1 
ATOM   8173  C  CB  . THR D  1 127 ? 77.068 -28.690 31.194  1.00 55.89 ? 107 THR D CB  1 
ATOM   8174  O  OG1 . THR D  1 127 ? 76.172 -29.753 30.870  1.00 58.31 ? 107 THR D OG1 1 
ATOM   8175  C  CG2 . THR D  1 127 ? 77.995 -29.126 32.336  1.00 56.85 ? 107 THR D CG2 1 
ATOM   8176  N  N   . GLU D  1 128 ? 78.025 -25.918 31.030  1.00 56.29 ? 108 GLU D N   1 
ATOM   8177  C  CA  . GLU D  1 128 ? 79.096 -24.946 31.185  1.00 55.87 ? 108 GLU D CA  1 
ATOM   8178  C  C   . GLU D  1 128 ? 78.594 -23.491 31.380  1.00 54.01 ? 108 GLU D C   1 
ATOM   8179  O  O   . GLU D  1 128 ? 79.343 -22.549 31.149  1.00 52.38 ? 108 GLU D O   1 
ATOM   8180  C  CB  . GLU D  1 128 ? 80.014 -25.050 29.948  1.00 56.12 ? 108 GLU D CB  1 
ATOM   8181  C  CG  . GLU D  1 128 ? 79.362 -24.581 28.588  1.00 65.35 ? 108 GLU D CG  1 
ATOM   8182  C  CD  . GLU D  1 128 ? 78.708 -25.705 27.746  1.00 66.06 ? 108 GLU D CD  1 
ATOM   8183  O  OE1 . GLU D  1 128 ? 79.180 -25.913 26.610  1.00 65.38 ? 108 GLU D OE1 1 
ATOM   8184  O  OE2 . GLU D  1 128 ? 77.736 -26.363 28.205  1.00 64.31 ? 108 GLU D OE2 1 
ATOM   8185  N  N   . TRP D  1 129 ? 77.339 -23.320 31.799  1.00 53.48 ? 109 TRP D N   1 
ATOM   8186  C  CA  . TRP D  1 129 ? 76.751 -21.995 32.052  1.00 53.81 ? 109 TRP D CA  1 
ATOM   8187  C  C   . TRP D  1 129 ? 77.343 -21.301 33.280  1.00 52.81 ? 109 TRP D C   1 
ATOM   8188  O  O   . TRP D  1 129 ? 77.124 -21.750 34.399  1.00 51.50 ? 109 TRP D O   1 
ATOM   8189  C  CB  . TRP D  1 129 ? 75.231 -22.098 32.268  1.00 53.07 ? 109 TRP D CB  1 
ATOM   8190  C  CG  . TRP D  1 129 ? 74.542 -20.744 32.280  1.00 50.55 ? 109 TRP D CG  1 
ATOM   8191  C  CD1 . TRP D  1 129 ? 74.408 -19.875 33.343  1.00 45.51 ? 109 TRP D CD1 1 
ATOM   8192  C  CD2 . TRP D  1 129 ? 73.903 -20.115 31.159  1.00 51.91 ? 109 TRP D CD2 1 
ATOM   8193  N  NE1 . TRP D  1 129 ? 73.713 -18.743 32.936  1.00 47.94 ? 109 TRP D NE1 1 
ATOM   8194  C  CE2 . TRP D  1 129 ? 73.387 -18.874 31.608  1.00 51.30 ? 109 TRP D CE2 1 
ATOM   8195  C  CE3 . TRP D  1 129 ? 73.696 -20.492 29.818  1.00 50.38 ? 109 TRP D CE3 1 
ATOM   8196  C  CZ2 . TRP D  1 129 ? 72.697 -18.005 30.750  1.00 47.87 ? 109 TRP D CZ2 1 
ATOM   8197  C  CZ3 . TRP D  1 129 ? 73.003 -19.630 28.975  1.00 46.48 ? 109 TRP D CZ3 1 
ATOM   8198  C  CH2 . TRP D  1 129 ? 72.526 -18.402 29.439  1.00 48.70 ? 109 TRP D CH2 1 
ATOM   8199  N  N   . PRO D  1 130 ? 78.042 -20.170 33.079  1.00 54.00 ? 110 PRO D N   1 
ATOM   8200  C  CA  . PRO D  1 130 ? 78.703 -19.514 34.215  1.00 54.81 ? 110 PRO D CA  1 
ATOM   8201  C  C   . PRO D  1 130 ? 77.770 -18.592 34.992  1.00 57.00 ? 110 PRO D C   1 
ATOM   8202  O  O   . PRO D  1 130 ? 76.814 -18.048 34.419  1.00 57.76 ? 110 PRO D O   1 
ATOM   8203  C  CB  . PRO D  1 130 ? 79.814 -18.696 33.546  1.00 53.54 ? 110 PRO D CB  1 
ATOM   8204  C  CG  . PRO D  1 130 ? 79.334 -18.442 32.142  1.00 52.77 ? 110 PRO D CG  1 
ATOM   8205  C  CD  . PRO D  1 130 ? 78.230 -19.419 31.821  1.00 53.20 ? 110 PRO D CD  1 
ATOM   8206  N  N   . ASP D  1 131 ? 78.049 -18.399 36.277  1.00 58.38 ? 111 ASP D N   1 
ATOM   8207  C  CA  . ASP D  1 131 ? 77.316 -17.392 37.075  1.00 60.06 ? 111 ASP D CA  1 
ATOM   8208  C  C   . ASP D  1 131 ? 77.704 -15.926 36.743  1.00 60.32 ? 111 ASP D C   1 
ATOM   8209  O  O   . ASP D  1 131 ? 76.992 -14.988 37.151  1.00 61.00 ? 111 ASP D O   1 
ATOM   8210  C  CB  . ASP D  1 131 ? 77.467 -17.654 38.577  1.00 60.40 ? 111 ASP D CB  1 
ATOM   8211  C  CG  . ASP D  1 131 ? 78.921 -17.760 39.021  1.00 65.39 ? 111 ASP D CG  1 
ATOM   8212  O  OD1 . ASP D  1 131 ? 79.138 -18.106 40.204  1.00 72.41 ? 111 ASP D OD1 1 
ATOM   8213  O  OD2 . ASP D  1 131 ? 79.843 -17.513 38.202  1.00 69.25 ? 111 ASP D OD2 1 
ATOM   8214  N  N   . THR D  1 132 ? 78.801 -15.736 35.999  1.00 58.65 ? 112 THR D N   1 
ATOM   8215  C  CA  . THR D  1 132 ? 79.222 -14.398 35.554  1.00 58.90 ? 112 THR D CA  1 
ATOM   8216  C  C   . THR D  1 132 ? 78.309 -13.777 34.492  1.00 58.70 ? 112 THR D C   1 
ATOM   8217  O  O   . THR D  1 132 ? 78.460 -12.593 34.171  1.00 59.09 ? 112 THR D O   1 
ATOM   8218  C  CB  . THR D  1 132 ? 80.657 -14.384 34.959  1.00 59.99 ? 112 THR D CB  1 
ATOM   8219  O  OG1 . THR D  1 132 ? 80.656 -15.001 33.661  1.00 58.94 ? 112 THR D OG1 1 
ATOM   8220  C  CG2 . THR D  1 132 ? 81.668 -15.087 35.895  1.00 59.98 ? 112 THR D CG2 1 
ATOM   8221  N  N   . ILE D  1 133 ? 77.406 -14.568 33.908  1.00 57.07 ? 113 ILE D N   1 
ATOM   8222  C  CA  . ILE D  1 133 ? 76.394 -14.019 33.012  1.00 55.69 ? 113 ILE D CA  1 
ATOM   8223  C  C   . ILE D  1 133 ? 75.007 -14.196 33.643  1.00 53.68 ? 113 ILE D C   1 
ATOM   8224  O  O   . ILE D  1 133 ? 74.806 -15.143 34.427  1.00 53.88 ? 113 ILE D O   1 
ATOM   8225  C  CB  . ILE D  1 133 ? 76.433 -14.646 31.580  1.00 56.58 ? 113 ILE D CB  1 
ATOM   8226  C  CG1 . ILE D  1 133 ? 76.063 -16.132 31.594  1.00 57.48 ? 113 ILE D CG1 1 
ATOM   8227  C  CG2 . ILE D  1 133 ? 77.796 -14.431 30.912  1.00 55.86 ? 113 ILE D CG2 1 
ATOM   8228  C  CD1 . ILE D  1 133 ? 75.641 -16.644 30.198  1.00 59.28 ? 113 ILE D CD1 1 
ATOM   8229  N  N   . PRO D  1 134 ? 74.056 -13.275 33.321  1.00 49.80 ? 114 PRO D N   1 
ATOM   8230  C  CA  . PRO D  1 134 ? 72.705 -13.367 33.843  1.00 47.40 ? 114 PRO D CA  1 
ATOM   8231  C  C   . PRO D  1 134 ? 71.879 -14.481 33.176  1.00 47.45 ? 114 PRO D C   1 
ATOM   8232  O  O   . PRO D  1 134 ? 71.993 -14.700 31.966  1.00 43.79 ? 114 PRO D O   1 
ATOM   8233  C  CB  . PRO D  1 134 ? 72.123 -11.983 33.530  1.00 47.89 ? 114 PRO D CB  1 
ATOM   8234  C  CG  . PRO D  1 134 ? 72.844 -11.522 32.352  1.00 48.73 ? 114 PRO D CG  1 
ATOM   8235  C  CD  . PRO D  1 134 ? 74.223 -12.076 32.472  1.00 49.05 ? 114 PRO D CD  1 
ATOM   8236  N  N   . LEU D  1 135 ? 71.050 -15.151 33.981  1.00 47.45 ? 115 LEU D N   1 
ATOM   8237  C  CA  . LEU D  1 135 ? 70.218 -16.265 33.529  1.00 48.76 ? 115 LEU D CA  1 
ATOM   8238  C  C   . LEU D  1 135 ? 69.307 -15.876 32.390  1.00 46.79 ? 115 LEU D C   1 
ATOM   8239  O  O   . LEU D  1 135 ? 69.018 -16.685 31.528  1.00 43.40 ? 115 LEU D O   1 
ATOM   8240  C  CB  . LEU D  1 135 ? 69.352 -16.797 34.674  1.00 49.09 ? 115 LEU D CB  1 
ATOM   8241  C  CG  . LEU D  1 135 ? 70.104 -17.677 35.666  1.00 51.06 ? 115 LEU D CG  1 
ATOM   8242  C  CD1 . LEU D  1 135 ? 69.249 -17.952 36.877  1.00 51.99 ? 115 LEU D CD1 1 
ATOM   8243  C  CD2 . LEU D  1 135 ? 70.492 -18.966 34.992  1.00 51.02 ? 115 LEU D CD2 1 
ATOM   8244  N  N   . SER D  1 136 ? 68.872 -14.627 32.412  1.00 46.52 ? 116 SER D N   1 
ATOM   8245  C  CA  . SER D  1 136 ? 67.941 -14.115 31.429  1.00 46.51 ? 116 SER D CA  1 
ATOM   8246  C  C   . SER D  1 136 ? 68.526 -14.053 30.001  1.00 45.42 ? 116 SER D C   1 
ATOM   8247  O  O   . SER D  1 136 ? 67.775 -13.890 29.018  1.00 44.38 ? 116 SER D O   1 
ATOM   8248  C  CB  . SER D  1 136 ? 67.372 -12.754 31.895  1.00 46.62 ? 116 SER D CB  1 
ATOM   8249  O  OG  . SER D  1 136 ? 68.309 -11.985 32.646  1.00 44.17 ? 116 SER D OG  1 
ATOM   8250  N  N   . LEU D  1 137 ? 69.840 -14.233 29.865  1.00 43.99 ? 117 LEU D N   1 
ATOM   8251  C  CA  . LEU D  1 137 ? 70.441 -14.375 28.527  1.00 44.97 ? 117 LEU D CA  1 
ATOM   8252  C  C   . LEU D  1 137 ? 70.027 -15.658 27.832  1.00 43.81 ? 117 LEU D C   1 
ATOM   8253  O  O   . LEU D  1 137 ? 70.219 -15.823 26.620  1.00 41.88 ? 117 LEU D O   1 
ATOM   8254  C  CB  . LEU D  1 137 ? 71.964 -14.347 28.590  1.00 46.37 ? 117 LEU D CB  1 
ATOM   8255  C  CG  . LEU D  1 137 ? 72.701 -13.018 28.759  1.00 51.37 ? 117 LEU D CG  1 
ATOM   8256  C  CD1 . LEU D  1 137 ? 73.899 -13.011 27.782  1.00 53.87 ? 117 LEU D CD1 1 
ATOM   8257  C  CD2 . LEU D  1 137 ? 71.815 -11.759 28.570  1.00 53.28 ? 117 LEU D CD2 1 
ATOM   8258  N  N   . ALA D  1 138 ? 69.501 -16.588 28.619  1.00 43.97 ? 118 ALA D N   1 
ATOM   8259  C  CA  . ALA D  1 138 ? 68.990 -17.819 28.091  1.00 43.60 ? 118 ALA D CA  1 
ATOM   8260  C  C   . ALA D  1 138 ? 67.718 -17.562 27.295  1.00 41.64 ? 118 ALA D C   1 
ATOM   8261  O  O   . ALA D  1 138 ? 67.302 -18.415 26.537  1.00 43.61 ? 118 ALA D O   1 
ATOM   8262  C  CB  . ALA D  1 138 ? 68.764 -18.833 29.224  1.00 42.10 ? 118 ALA D CB  1 
ATOM   8263  N  N   . LEU D  1 139 ? 67.109 -16.394 27.452  1.00 43.04 ? 119 LEU D N   1 
ATOM   8264  C  CA  . LEU D  1 139 ? 65.895 -16.038 26.702  1.00 43.26 ? 119 LEU D CA  1 
ATOM   8265  C  C   . LEU D  1 139 ? 66.185 -15.063 25.547  1.00 44.84 ? 119 LEU D C   1 
ATOM   8266  O  O   . LEU D  1 139 ? 65.263 -14.550 24.873  1.00 48.85 ? 119 LEU D O   1 
ATOM   8267  C  CB  . LEU D  1 139 ? 64.872 -15.389 27.641  1.00 42.17 ? 119 LEU D CB  1 
ATOM   8268  C  CG  . LEU D  1 139 ? 64.368 -16.100 28.880  1.00 37.45 ? 119 LEU D CG  1 
ATOM   8269  C  CD1 . LEU D  1 139 ? 63.649 -15.130 29.764  1.00 39.72 ? 119 LEU D CD1 1 
ATOM   8270  C  CD2 . LEU D  1 139 ? 63.463 -17.201 28.483  1.00 45.22 ? 119 LEU D CD2 1 
ATOM   8271  N  N   . GLY D  1 140 ? 67.463 -14.812 25.325  1.00 45.50 ? 120 GLY D N   1 
ATOM   8272  C  CA  . GLY D  1 140 ? 67.928 -13.684 24.522  1.00 46.10 ? 120 GLY D CA  1 
ATOM   8273  C  C   . GLY D  1 140 ? 69.134 -14.072 23.679  1.00 45.24 ? 120 GLY D C   1 
ATOM   8274  O  O   . GLY D  1 140 ? 69.051 -14.965 22.856  1.00 43.18 ? 120 GLY D O   1 
ATOM   8275  N  N   . THR D  1 141 ? 70.243 -13.392 23.905  1.00 45.16 ? 121 THR D N   1 
ATOM   8276  C  CA  . THR D  1 141 ? 71.452 -13.579 23.117  1.00 46.13 ? 121 THR D CA  1 
ATOM   8277  C  C   . THR D  1 141 ? 71.926 -15.060 23.095  1.00 44.97 ? 121 THR D C   1 
ATOM   8278  O  O   . THR D  1 141 ? 72.353 -15.519 22.055  1.00 44.98 ? 121 THR D O   1 
ATOM   8279  C  CB  . THR D  1 141 ? 72.610 -12.619 23.637  1.00 49.81 ? 121 THR D CB  1 
ATOM   8280  O  OG1 . THR D  1 141 ? 72.273 -11.231 23.425  1.00 52.16 ? 121 THR D OG1 1 
ATOM   8281  C  CG2 . THR D  1 141 ? 73.987 -12.943 22.945  1.00 50.32 ? 121 THR D CG2 1 
ATOM   8282  N  N   . VAL D  1 142 ? 71.849 -15.782 24.226  1.00 44.15 ? 122 VAL D N   1 
ATOM   8283  C  CA  . VAL D  1 142 ? 72.252 -17.205 24.313  1.00 44.82 ? 122 VAL D CA  1 
ATOM   8284  C  C   . VAL D  1 142 ? 71.016 -18.102 24.488  1.00 44.31 ? 122 VAL D C   1 
ATOM   8285  O  O   . VAL D  1 142 ? 70.948 -19.026 25.341  1.00 43.37 ? 122 VAL D O   1 
ATOM   8286  C  CB  . VAL D  1 142 ? 73.322 -17.496 25.436  1.00 46.54 ? 122 VAL D CB  1 
ATOM   8287  C  CG1 . VAL D  1 142 ? 74.045 -18.830 25.182  1.00 45.03 ? 122 VAL D CG1 1 
ATOM   8288  C  CG2 . VAL D  1 142 ? 74.340 -16.349 25.546  1.00 48.94 ? 122 VAL D CG2 1 
ATOM   8289  N  N   . GLY D  1 143 ? 70.071 -17.857 23.591  1.00 43.64 ? 123 GLY D N   1 
ATOM   8290  C  CA  . GLY D  1 143 ? 68.782 -18.506 23.602  1.00 42.12 ? 123 GLY D CA  1 
ATOM   8291  C  C   . GLY D  1 143 ? 68.197 -18.233 22.256  1.00 40.10 ? 123 GLY D C   1 
ATOM   8292  O  O   . GLY D  1 143 ? 68.925 -17.957 21.307  1.00 41.08 ? 123 GLY D O   1 
ATOM   8293  N  N   . MET D  1 144 ? 66.885 -18.276 22.172  1.00 41.04 ? 124 MET D N   1 
ATOM   8294  C  CA  . MET D  1 144 ? 66.172 -18.268 20.889  1.00 41.01 ? 124 MET D CA  1 
ATOM   8295  C  C   . MET D  1 144 ? 66.474 -17.132 19.880  1.00 42.33 ? 124 MET D C   1 
ATOM   8296  O  O   . MET D  1 144 ? 66.611 -17.384 18.683  1.00 43.83 ? 124 MET D O   1 
ATOM   8297  C  CB  . MET D  1 144 ? 64.665 -18.356 21.196  1.00 42.16 ? 124 MET D CB  1 
ATOM   8298  C  CG  . MET D  1 144 ? 63.751 -18.502 20.012  1.00 44.15 ? 124 MET D CG  1 
ATOM   8299  S  SD  . MET D  1 144 ? 63.287 -16.883 19.343  1.00 61.03 ? 124 MET D SD  1 
ATOM   8300  C  CE  . MET D  1 144 ? 61.783 -16.470 20.241  1.00 58.50 ? 124 MET D CE  1 
ATOM   8301  N  N   . PRO D  1 145 ? 66.460 -15.856 20.325  1.00 43.67 ? 125 PRO D N   1 
ATOM   8302  C  CA  . PRO D  1 145 ? 66.831 -14.764 19.388  1.00 40.39 ? 125 PRO D CA  1 
ATOM   8303  C  C   . PRO D  1 145 ? 68.283 -14.808 18.841  1.00 39.65 ? 125 PRO D C   1 
ATOM   8304  O  O   . PRO D  1 145 ? 68.477 -14.423 17.711  1.00 39.84 ? 125 PRO D O   1 
ATOM   8305  C  CB  . PRO D  1 145 ? 66.600 -13.491 20.210  1.00 40.78 ? 125 PRO D CB  1 
ATOM   8306  C  CG  . PRO D  1 145 ? 65.669 -13.927 21.338  1.00 41.07 ? 125 PRO D CG  1 
ATOM   8307  C  CD  . PRO D  1 145 ? 66.041 -15.339 21.645  1.00 38.96 ? 125 PRO D CD  1 
ATOM   8308  N  N   . GLY D  1 146 ? 69.271 -15.277 19.623  1.00 37.16 ? 126 GLY D N   1 
ATOM   8309  C  CA  . GLY D  1 146 ? 70.647 -15.486 19.126  1.00 37.38 ? 126 GLY D CA  1 
ATOM   8310  C  C   . GLY D  1 146 ? 70.792 -16.653 18.156  1.00 36.30 ? 126 GLY D C   1 
ATOM   8311  O  O   . GLY D  1 146 ? 71.574 -16.604 17.215  1.00 34.58 ? 126 GLY D O   1 
ATOM   8312  N  N   . LEU D  1 147 ? 70.038 -17.717 18.407  1.00 37.22 ? 127 LEU D N   1 
ATOM   8313  C  CA  . LEU D  1 147 ? 69.928 -18.846 17.501  1.00 38.49 ? 127 LEU D CA  1 
ATOM   8314  C  C   . LEU D  1 147 ? 69.327 -18.437 16.165  1.00 39.49 ? 127 LEU D C   1 
ATOM   8315  O  O   . LEU D  1 147 ? 69.777 -18.898 15.088  1.00 41.22 ? 127 LEU D O   1 
ATOM   8316  C  CB  . LEU D  1 147 ? 69.084 -19.953 18.135  1.00 38.63 ? 127 LEU D CB  1 
ATOM   8317  C  CG  . LEU D  1 147 ? 69.787 -20.754 19.238  1.00 42.02 ? 127 LEU D CG  1 
ATOM   8318  C  CD1 . LEU D  1 147 ? 68.810 -21.634 20.007  1.00 38.09 ? 127 LEU D CD1 1 
ATOM   8319  C  CD2 . LEU D  1 147 ? 70.945 -21.587 18.680  1.00 43.23 ? 127 LEU D CD2 1 
ATOM   8320  N  N   . THR D  1 148 ? 68.332 -17.566 16.229  1.00 37.70 ? 128 THR D N   1 
ATOM   8321  C  CA  . THR D  1 148 ? 67.688 -16.999 15.006  1.00 39.98 ? 128 THR D CA  1 
ATOM   8322  C  C   . THR D  1 148 ? 68.685 -16.280 14.087  1.00 40.61 ? 128 THR D C   1 
ATOM   8323  O  O   . THR D  1 148 ? 68.808 -16.585 12.885  1.00 38.64 ? 128 THR D O   1 
ATOM   8324  C  CB  . THR D  1 148 ? 66.467 -16.139 15.402  1.00 39.23 ? 128 THR D CB  1 
ATOM   8325  O  OG1 . THR D  1 148 ? 65.569 -16.982 16.145  1.00 43.01 ? 128 THR D OG1 1 
ATOM   8326  C  CG2 . THR D  1 148 ? 65.721 -15.630 14.199  1.00 46.63 ? 128 THR D CG2 1 
ATOM   8327  N  N   . ALA D  1 149 ? 69.461 -15.404 14.703  1.00 42.38 ? 129 ALA D N   1 
ATOM   8328  C  CA  . ALA D  1 149 ? 70.512 -14.642 14.047  1.00 39.49 ? 129 ALA D CA  1 
ATOM   8329  C  C   . ALA D  1 149 ? 71.551 -15.565 13.497  1.00 39.38 ? 129 ALA D C   1 
ATOM   8330  O  O   . ALA D  1 149 ? 72.022 -15.414 12.346  1.00 37.76 ? 129 ALA D O   1 
ATOM   8331  C  CB  . ALA D  1 149 ? 71.126 -13.707 15.050  1.00 40.95 ? 129 ALA D CB  1 
ATOM   8332  N  N   . TYR D  1 150 ? 71.913 -16.530 14.337  1.00 39.74 ? 130 TYR D N   1 
ATOM   8333  C  CA  . TYR D  1 150 ? 72.996 -17.481 14.051  1.00 38.29 ? 130 TYR D CA  1 
ATOM   8334  C  C   . TYR D  1 150 ? 72.678 -18.246 12.749  1.00 39.35 ? 130 TYR D C   1 
ATOM   8335  O  O   . TYR D  1 150 ? 73.389 -18.097 11.757  1.00 38.55 ? 130 TYR D O   1 
ATOM   8336  C  CB  . TYR D  1 150 ? 73.177 -18.419 15.269  1.00 38.18 ? 130 TYR D CB  1 
ATOM   8337  C  CG  . TYR D  1 150 ? 74.302 -19.392 15.149  1.00 38.45 ? 130 TYR D CG  1 
ATOM   8338  C  CD1 . TYR D  1 150 ? 75.519 -19.161 15.770  1.00 40.01 ? 130 TYR D CD1 1 
ATOM   8339  C  CD2 . TYR D  1 150 ? 74.167 -20.543 14.370  1.00 44.31 ? 130 TYR D CD2 1 
ATOM   8340  C  CE1 . TYR D  1 150 ? 76.590 -20.061 15.631  1.00 35.45 ? 130 TYR D CE1 1 
ATOM   8341  C  CE2 . TYR D  1 150 ? 75.211 -21.456 14.221  1.00 37.63 ? 130 TYR D CE2 1 
ATOM   8342  C  CZ  . TYR D  1 150 ? 76.426 -21.212 14.853  1.00 42.32 ? 130 TYR D CZ  1 
ATOM   8343  O  OH  . TYR D  1 150 ? 77.460 -22.133 14.702  1.00 40.76 ? 130 TYR D OH  1 
ATOM   8344  N  N   . PHE D  1 151 ? 71.584 -19.021 12.755  1.00 39.46 ? 131 PHE D N   1 
ATOM   8345  C  CA  . PHE D  1 151 ? 71.169 -19.849 11.608  1.00 39.25 ? 131 PHE D CA  1 
ATOM   8346  C  C   . PHE D  1 151 ? 70.677 -19.068 10.376  1.00 37.61 ? 131 PHE D C   1 
ATOM   8347  O  O   . PHE D  1 151 ? 70.992 -19.417 9.246   1.00 39.21 ? 131 PHE D O   1 
ATOM   8348  C  CB  . PHE D  1 151 ? 70.112 -20.863 12.051  1.00 39.85 ? 131 PHE D CB  1 
ATOM   8349  C  CG  . PHE D  1 151 ? 70.638 -21.892 13.006  1.00 40.74 ? 131 PHE D CG  1 
ATOM   8350  C  CD1 . PHE D  1 151 ? 71.663 -22.746 12.628  1.00 38.14 ? 131 PHE D CD1 1 
ATOM   8351  C  CD2 . PHE D  1 151 ? 70.129 -21.984 14.302  1.00 46.18 ? 131 PHE D CD2 1 
ATOM   8352  C  CE1 . PHE D  1 151 ? 72.162 -23.719 13.520  1.00 42.41 ? 131 PHE D CE1 1 
ATOM   8353  C  CE2 . PHE D  1 151 ? 70.621 -22.926 15.201  1.00 42.04 ? 131 PHE D CE2 1 
ATOM   8354  C  CZ  . PHE D  1 151 ? 71.638 -23.798 14.805  1.00 44.60 ? 131 PHE D CZ  1 
ATOM   8355  N  N   . GLY D  1 152 ? 69.963 -17.995 10.593  1.00 38.96 ? 132 GLY D N   1 
ATOM   8356  C  CA  . GLY D  1 152 ? 69.595 -17.115 9.502   1.00 42.08 ? 132 GLY D CA  1 
ATOM   8357  C  C   . GLY D  1 152 ? 70.792 -16.545 8.766   1.00 42.54 ? 132 GLY D C   1 
ATOM   8358  O  O   . GLY D  1 152 ? 70.812 -16.503 7.548   1.00 44.13 ? 132 GLY D O   1 
ATOM   8359  N  N   . LEU D  1 153 ? 71.791 -16.112 9.517   1.00 42.65 ? 133 LEU D N   1 
ATOM   8360  C  CA  . LEU D  1 153 ? 72.953 -15.484 8.943   1.00 42.77 ? 133 LEU D CA  1 
ATOM   8361  C  C   . LEU D  1 153 ? 73.871 -16.537 8.344   1.00 43.43 ? 133 LEU D C   1 
ATOM   8362  O  O   . LEU D  1 153 ? 74.229 -16.453 7.154   1.00 44.38 ? 133 LEU D O   1 
ATOM   8363  C  CB  . LEU D  1 153 ? 73.690 -14.618 9.989   1.00 43.42 ? 133 LEU D CB  1 
ATOM   8364  C  CG  . LEU D  1 153 ? 74.887 -13.817 9.431   1.00 42.57 ? 133 LEU D CG  1 
ATOM   8365  C  CD1 . LEU D  1 153 ? 74.468 -12.812 8.364   1.00 39.08 ? 133 LEU D CD1 1 
ATOM   8366  C  CD2 . LEU D  1 153 ? 75.639 -13.165 10.511  1.00 43.61 ? 133 LEU D CD2 1 
ATOM   8367  N  N   . LEU D  1 154 ? 74.227 -17.548 9.129   1.00 42.35 ? 134 LEU D N   1 
ATOM   8368  C  CA  . LEU D  1 154 ? 75.254 -18.467 8.698   1.00 43.68 ? 134 LEU D CA  1 
ATOM   8369  C  C   . LEU D  1 154 ? 74.764 -19.598 7.783   1.00 45.63 ? 134 LEU D C   1 
ATOM   8370  O  O   . LEU D  1 154 ? 75.531 -20.053 6.943   1.00 47.28 ? 134 LEU D O   1 
ATOM   8371  C  CB  . LEU D  1 154 ? 76.048 -19.005 9.893   1.00 44.72 ? 134 LEU D CB  1 
ATOM   8372  C  CG  . LEU D  1 154 ? 76.622 -17.987 10.882  1.00 42.23 ? 134 LEU D CG  1 
ATOM   8373  C  CD1 . LEU D  1 154 ? 77.334 -18.707 11.984  1.00 42.10 ? 134 LEU D CD1 1 
ATOM   8374  C  CD2 . LEU D  1 154 ? 77.550 -16.990 10.180  1.00 46.66 ? 134 LEU D CD2 1 
ATOM   8375  N  N   . GLU D  1 155 ? 73.517 -20.044 7.913   1.00 47.35 ? 135 GLU D N   1 
ATOM   8376  C  CA  . GLU D  1 155 ? 72.949 -21.049 7.007   1.00 48.33 ? 135 GLU D CA  1 
ATOM   8377  C  C   . GLU D  1 155 ? 72.052 -20.479 5.910   1.00 49.18 ? 135 GLU D C   1 
ATOM   8378  O  O   . GLU D  1 155 ? 72.152 -20.881 4.769   1.00 49.36 ? 135 GLU D O   1 
ATOM   8379  C  CB  . GLU D  1 155 ? 72.086 -22.031 7.771   1.00 50.81 ? 135 GLU D CB  1 
ATOM   8380  C  CG  . GLU D  1 155 ? 72.704 -22.532 9.045   1.00 61.72 ? 135 GLU D CG  1 
ATOM   8381  C  CD  . GLU D  1 155 ? 73.074 -23.990 8.974   1.00 71.63 ? 135 GLU D CD  1 
ATOM   8382  O  OE1 . GLU D  1 155 ? 72.243 -24.775 8.440   1.00 75.08 ? 135 GLU D OE1 1 
ATOM   8383  O  OE2 . GLU D  1 155 ? 74.186 -24.336 9.455   1.00 75.63 ? 135 GLU D OE2 1 
ATOM   8384  N  N   . ILE D  1 156 ? 71.136 -19.582 6.251   1.00 50.11 ? 136 ILE D N   1 
ATOM   8385  C  CA  . ILE D  1 156 ? 70.191 -19.117 5.242   1.00 52.67 ? 136 ILE D CA  1 
ATOM   8386  C  C   . ILE D  1 156 ? 70.812 -18.061 4.304   1.00 54.50 ? 136 ILE D C   1 
ATOM   8387  O  O   . ILE D  1 156 ? 70.752 -18.261 3.085   1.00 56.27 ? 136 ILE D O   1 
ATOM   8388  C  CB  . ILE D  1 156 ? 68.786 -18.711 5.802   1.00 49.71 ? 136 ILE D CB  1 
ATOM   8389  C  CG1 . ILE D  1 156 ? 67.898 -19.919 6.071   1.00 51.52 ? 136 ILE D CG1 1 
ATOM   8390  C  CG2 . ILE D  1 156 ? 68.020 -17.997 4.737   1.00 48.97 ? 136 ILE D CG2 1 
ATOM   8391  C  CD1 . ILE D  1 156 ? 68.445 -20.943 6.834   1.00 53.96 ? 136 ILE D CD1 1 
ATOM   8392  N  N   . CYS D  1 157 ? 71.375 -16.960 4.833   1.00 54.63 ? 137 CYS D N   1 
ATOM   8393  C  CA  . CYS D  1 157 ? 72.238 -16.074 4.015   1.00 55.29 ? 137 CYS D CA  1 
ATOM   8394  C  C   . CYS D  1 157 ? 73.529 -16.775 3.600   1.00 56.79 ? 137 CYS D C   1 
ATOM   8395  O  O   . CYS D  1 157 ? 74.063 -16.471 2.557   1.00 58.24 ? 137 CYS D O   1 
ATOM   8396  C  CB  . CYS D  1 157 ? 72.662 -14.812 4.750   1.00 57.80 ? 137 CYS D CB  1 
ATOM   8397  S  SG  . CYS D  1 157 ? 71.347 -13.643 5.262   1.00 62.87 ? 137 CYS D SG  1 
ATOM   8398  N  N   . GLY D  1 158 ? 74.061 -17.679 4.425   1.00 56.89 ? 138 GLY D N   1 
ATOM   8399  C  CA  . GLY D  1 158 ? 75.301 -18.375 4.098   1.00 55.90 ? 138 GLY D CA  1 
ATOM   8400  C  C   . GLY D  1 158 ? 76.497 -17.447 3.935   1.00 57.17 ? 138 GLY D C   1 
ATOM   8401  O  O   . GLY D  1 158 ? 77.292 -17.610 2.984   1.00 57.11 ? 138 GLY D O   1 
ATOM   8402  N  N   . VAL D  1 159 ? 76.644 -16.468 4.842   1.00 58.47 ? 139 VAL D N   1 
ATOM   8403  C  CA  . VAL D  1 159 ? 77.784 -15.513 4.756   1.00 59.15 ? 139 VAL D CA  1 
ATOM   8404  C  C   . VAL D  1 159 ? 79.126 -16.227 4.845   1.00 60.53 ? 139 VAL D C   1 
ATOM   8405  O  O   . VAL D  1 159 ? 79.302 -17.091 5.692   1.00 60.80 ? 139 VAL D O   1 
ATOM   8406  C  CB  . VAL D  1 159 ? 77.779 -14.380 5.846   1.00 59.09 ? 139 VAL D CB  1 
ATOM   8407  C  CG1 . VAL D  1 159 ? 76.834 -13.296 5.472   1.00 56.41 ? 139 VAL D CG1 1 
ATOM   8408  C  CG2 . VAL D  1 159 ? 77.502 -14.924 7.239   1.00 59.52 ? 139 VAL D CG2 1 
ATOM   8409  N  N   . LYS D  1 160 ? 80.058 -15.876 3.961   1.00 63.04 ? 140 LYS D N   1 
ATOM   8410  C  CA  . LYS D  1 160 ? 81.406 -16.455 3.973   1.00 64.50 ? 140 LYS D CA  1 
ATOM   8411  C  C   . LYS D  1 160 ? 82.407 -15.458 4.579   1.00 64.83 ? 140 LYS D C   1 
ATOM   8412  O  O   . LYS D  1 160 ? 83.293 -15.856 5.358   1.00 67.29 ? 140 LYS D O   1 
ATOM   8413  C  CB  . LYS D  1 160 ? 81.829 -16.886 2.549   1.00 65.55 ? 140 LYS D CB  1 
ATOM   8414  C  CG  . LYS D  1 160 ? 80.879 -17.890 1.849   1.00 66.25 ? 140 LYS D CG  1 
ATOM   8415  N  N   . GLY D  1 161 ? 82.249 -14.172 4.242   1.00 62.78 ? 141 GLY D N   1 
ATOM   8416  C  CA  . GLY D  1 161 ? 83.157 -13.116 4.704   1.00 62.41 ? 141 GLY D CA  1 
ATOM   8417  C  C   . GLY D  1 161 ? 83.607 -12.207 3.567   1.00 60.88 ? 141 GLY D C   1 
ATOM   8418  O  O   . GLY D  1 161 ? 83.887 -12.686 2.462   1.00 60.76 ? 141 GLY D O   1 
ATOM   8419  N  N   . GLY D  1 162 ? 83.668 -10.901 3.840   1.00 58.16 ? 142 GLY D N   1 
ATOM   8420  C  CA  . GLY D  1 162 ? 83.876 -9.883  2.804   1.00 56.78 ? 142 GLY D CA  1 
ATOM   8421  C  C   . GLY D  1 162 ? 82.589 -9.379  2.145   1.00 56.21 ? 142 GLY D C   1 
ATOM   8422  O  O   . GLY D  1 162 ? 82.619 -8.415  1.376   1.00 56.99 ? 142 GLY D O   1 
ATOM   8423  N  N   . GLU D  1 163 ? 81.461 -10.026 2.447   1.00 54.35 ? 143 GLU D N   1 
ATOM   8424  C  CA  . GLU D  1 163 ? 80.143 -9.594  1.978   1.00 52.11 ? 143 GLU D CA  1 
ATOM   8425  C  C   . GLU D  1 163 ? 79.647 -8.389  2.786   1.00 48.49 ? 143 GLU D C   1 
ATOM   8426  O  O   . GLU D  1 163 ? 80.067 -8.159  3.924   1.00 40.99 ? 143 GLU D O   1 
ATOM   8427  C  CB  . GLU D  1 163 ? 79.128 -10.719 2.163   1.00 53.42 ? 143 GLU D CB  1 
ATOM   8428  C  CG  . GLU D  1 163 ? 79.401 -11.951 1.325   1.00 63.65 ? 143 GLU D CG  1 
ATOM   8429  C  CD  . GLU D  1 163 ? 79.289 -13.260 2.105   1.00 70.94 ? 143 GLU D CD  1 
ATOM   8430  O  OE1 . GLU D  1 163 ? 79.642 -13.285 3.307   1.00 77.72 ? 143 GLU D OE1 1 
ATOM   8431  O  OE2 . GLU D  1 163 ? 78.901 -14.283 1.496   1.00 72.15 ? 143 GLU D OE2 1 
ATOM   8432  N  N   . THR D  1 164 ? 78.741 -7.636  2.172   1.00 46.24 ? 144 THR D N   1 
ATOM   8433  C  CA  . THR D  1 164 ? 78.045 -6.540  2.847   1.00 45.70 ? 144 THR D CA  1 
ATOM   8434  C  C   . THR D  1 164 ? 76.672 -7.048  3.244   1.00 43.28 ? 144 THR D C   1 
ATOM   8435  O  O   . THR D  1 164 ? 75.921 -7.558  2.414   1.00 40.38 ? 144 THR D O   1 
ATOM   8436  C  CB  . THR D  1 164 ? 77.913 -5.284  1.955   1.00 45.63 ? 144 THR D CB  1 
ATOM   8437  O  OG1 . THR D  1 164 ? 79.207 -4.919  1.458   1.00 49.98 ? 144 THR D OG1 1 
ATOM   8438  C  CG2 . THR D  1 164 ? 77.320 -4.108  2.724   1.00 41.43 ? 144 THR D CG2 1 
ATOM   8439  N  N   . VAL D  1 165 ? 76.384 -6.912  4.533   1.00 42.76 ? 145 VAL D N   1 
ATOM   8440  C  CA  . VAL D  1 165 ? 75.156 -7.358  5.122   1.00 42.36 ? 145 VAL D CA  1 
ATOM   8441  C  C   . VAL D  1 165 ? 74.293 -6.169  5.527   1.00 40.36 ? 145 VAL D C   1 
ATOM   8442  O  O   . VAL D  1 165 ? 74.695 -5.329  6.315   1.00 35.72 ? 145 VAL D O   1 
ATOM   8443  C  CB  . VAL D  1 165 ? 75.437 -8.284  6.334   1.00 43.30 ? 145 VAL D CB  1 
ATOM   8444  C  CG1 . VAL D  1 165 ? 74.142 -8.883  6.870   1.00 48.25 ? 145 VAL D CG1 1 
ATOM   8445  C  CG2 . VAL D  1 165 ? 76.353 -9.446  5.913   1.00 42.49 ? 145 VAL D CG2 1 
ATOM   8446  N  N   . MET D  1 166 ? 73.094 -6.111  4.967   1.00 40.28 ? 146 MET D N   1 
ATOM   8447  C  CA  . MET D  1 166 ? 72.058 -5.241  5.494   1.00 40.21 ? 146 MET D CA  1 
ATOM   8448  C  C   . MET D  1 166 ? 71.280 -5.977  6.613   1.00 39.11 ? 146 MET D C   1 
ATOM   8449  O  O   . MET D  1 166 ? 70.820 -7.087  6.425   1.00 38.13 ? 146 MET D O   1 
ATOM   8450  C  CB  . MET D  1 166 ? 71.126 -4.817  4.362   1.00 41.85 ? 146 MET D CB  1 
ATOM   8451  C  CG  . MET D  1 166 ? 69.925 -3.968  4.814   1.00 50.32 ? 146 MET D CG  1 
ATOM   8452  S  SD  . MET D  1 166 ? 70.487 -2.411  5.380   1.00 66.15 ? 146 MET D SD  1 
ATOM   8453  C  CE  . MET D  1 166 ? 69.299 -2.054  6.670   1.00 62.20 ? 146 MET D CE  1 
ATOM   8454  N  N   . VAL D  1 167 ? 71.175 -5.381  7.794   1.00 38.79 ? 147 VAL D N   1 
ATOM   8455  C  CA  . VAL D  1 167 ? 70.240 -5.877  8.812   1.00 42.10 ? 147 VAL D CA  1 
ATOM   8456  C  C   . VAL D  1 167 ? 69.341 -4.724  9.325   1.00 42.05 ? 147 VAL D C   1 
ATOM   8457  O  O   . VAL D  1 167 ? 69.807 -3.644  9.564   1.00 42.80 ? 147 VAL D O   1 
ATOM   8458  C  CB  . VAL D  1 167 ? 70.966 -6.650  9.960   1.00 44.35 ? 147 VAL D CB  1 
ATOM   8459  C  CG1 . VAL D  1 167 ? 72.354 -6.144  10.214  1.00 46.28 ? 147 VAL D CG1 1 
ATOM   8460  C  CG2 . VAL D  1 167 ? 70.150 -6.679  11.237  1.00 47.96 ? 147 VAL D CG2 1 
ATOM   8461  N  N   . ASN D  1 168 ? 68.046 -4.972  9.427   1.00 42.89 ? 148 ASN D N   1 
ATOM   8462  C  CA  . ASN D  1 168 ? 67.089 -4.025  9.957   1.00 44.17 ? 148 ASN D CA  1 
ATOM   8463  C  C   . ASN D  1 168 ? 66.541 -4.551  11.295  1.00 46.57 ? 148 ASN D C   1 
ATOM   8464  O  O   . ASN D  1 168 ? 66.833 -5.684  11.712  1.00 49.46 ? 148 ASN D O   1 
ATOM   8465  C  CB  . ASN D  1 168 ? 65.979 -3.749  8.922   1.00 46.52 ? 148 ASN D CB  1 
ATOM   8466  C  CG  . ASN D  1 168 ? 65.289 -5.027  8.439   1.00 45.37 ? 148 ASN D CG  1 
ATOM   8467  O  OD1 . ASN D  1 168 ? 65.200 -6.007  9.171   1.00 38.06 ? 148 ASN D OD1 1 
ATOM   8468  N  ND2 . ASN D  1 168 ? 64.793 -5.005  7.212   1.00 40.56 ? 148 ASN D ND2 1 
ATOM   8469  N  N   . ALA D  1 169 ? 65.758 -3.728  11.983  1.00 48.30 ? 149 ALA D N   1 
ATOM   8470  C  CA  . ALA D  1 169 ? 65.594 -3.855  13.450  1.00 46.50 ? 149 ALA D CA  1 
ATOM   8471  C  C   . ALA D  1 169 ? 66.927 -4.232  14.121  1.00 44.47 ? 149 ALA D C   1 
ATOM   8472  O  O   . ALA D  1 169 ? 66.994 -5.133  14.964  1.00 45.83 ? 149 ALA D O   1 
ATOM   8473  C  CB  . ALA D  1 169 ? 64.520 -4.849  13.767  1.00 49.07 ? 149 ALA D CB  1 
ATOM   8474  N  N   . ALA D  1 170 ? 67.982 -3.514  13.749  1.00 42.13 ? 150 ALA D N   1 
ATOM   8475  C  CA  . ALA D  1 170 ? 69.369 -3.994  13.953  1.00 42.45 ? 150 ALA D CA  1 
ATOM   8476  C  C   . ALA D  1 170 ? 69.897 -3.898  15.393  1.00 44.71 ? 150 ALA D C   1 
ATOM   8477  O  O   . ALA D  1 170 ? 71.025 -4.346  15.676  1.00 44.32 ? 150 ALA D O   1 
ATOM   8478  C  CB  . ALA D  1 170 ? 70.319 -3.252  13.003  1.00 39.83 ? 150 ALA D CB  1 
ATOM   8479  N  N   . ALA D  1 171 ? 69.092 -3.283  16.266  1.00 45.31 ? 151 ALA D N   1 
ATOM   8480  C  CA  . ALA D  1 171 ? 69.370 -3.144  17.689  1.00 47.31 ? 151 ALA D CA  1 
ATOM   8481  C  C   . ALA D  1 171 ? 68.380 -3.962  18.493  1.00 47.94 ? 151 ALA D C   1 
ATOM   8482  O  O   . ALA D  1 171 ? 68.308 -3.828  19.726  1.00 51.01 ? 151 ALA D O   1 
ATOM   8483  C  CB  . ALA D  1 171 ? 69.318 -1.636  18.129  1.00 46.85 ? 151 ALA D CB  1 
ATOM   8484  N  N   . GLY D  1 172 ? 67.623 -4.805  17.787  1.00 47.86 ? 152 GLY D N   1 
ATOM   8485  C  CA  . GLY D  1 172 ? 66.696 -5.711  18.391  1.00 45.39 ? 152 GLY D CA  1 
ATOM   8486  C  C   . GLY D  1 172 ? 67.487 -6.914  18.843  1.00 46.64 ? 152 GLY D C   1 
ATOM   8487  O  O   . GLY D  1 172 ? 68.726 -6.968  18.686  1.00 47.49 ? 152 GLY D O   1 
ATOM   8488  N  N   . ALA D  1 173 ? 66.765 -7.877  19.409  1.00 45.83 ? 153 ALA D N   1 
ATOM   8489  C  CA  . ALA D  1 173 ? 67.363 -9.059  20.007  1.00 46.69 ? 153 ALA D CA  1 
ATOM   8490  C  C   . ALA D  1 173 ? 68.001 -9.986  18.959  1.00 45.71 ? 153 ALA D C   1 
ATOM   8491  O  O   . ALA D  1 173 ? 69.023 -10.611 19.223  1.00 48.60 ? 153 ALA D O   1 
ATOM   8492  C  CB  . ALA D  1 173 ? 66.291 -9.804  20.810  1.00 49.48 ? 153 ALA D CB  1 
ATOM   8493  N  N   . VAL D  1 174 ? 67.381 -10.063 17.776  1.00 44.78 ? 154 VAL D N   1 
ATOM   8494  C  CA  . VAL D  1 174 ? 67.893 -10.832 16.661  1.00 42.65 ? 154 VAL D CA  1 
ATOM   8495  C  C   . VAL D  1 174 ? 68.964 -10.006 15.974  1.00 42.89 ? 154 VAL D C   1 
ATOM   8496  O  O   . VAL D  1 174 ? 70.137 -10.410 15.953  1.00 42.17 ? 154 VAL D O   1 
ATOM   8497  C  CB  . VAL D  1 174 ? 66.783 -11.282 15.684  1.00 41.92 ? 154 VAL D CB  1 
ATOM   8498  C  CG1 . VAL D  1 174 ? 67.371 -12.145 14.568  1.00 38.32 ? 154 VAL D CG1 1 
ATOM   8499  C  CG2 . VAL D  1 174 ? 65.686 -12.096 16.428  1.00 43.98 ? 154 VAL D CG2 1 
ATOM   8500  N  N   . GLY D  1 175 ? 68.579 -8.817  15.498  1.00 43.35 ? 155 GLY D N   1 
ATOM   8501  C  CA  . GLY D  1 175 ? 69.439 -8.011  14.609  1.00 40.62 ? 155 GLY D CA  1 
ATOM   8502  C  C   . GLY D  1 175 ? 70.807 -7.608  15.135  1.00 40.46 ? 155 GLY D C   1 
ATOM   8503  O  O   . GLY D  1 175 ? 71.785 -7.485  14.344  1.00 36.24 ? 155 GLY D O   1 
ATOM   8504  N  N   . SER D  1 176 ? 70.872 -7.346  16.448  1.00 41.52 ? 156 SER D N   1 
ATOM   8505  C  CA  . SER D  1 176 ? 72.146 -7.036  17.147  1.00 41.80 ? 156 SER D CA  1 
ATOM   8506  C  C   . SER D  1 176 ? 73.059 -8.229  17.151  1.00 40.49 ? 156 SER D C   1 
ATOM   8507  O  O   . SER D  1 176 ? 74.287 -8.095  17.052  1.00 40.53 ? 156 SER D O   1 
ATOM   8508  C  CB  . SER D  1 176 ? 71.908 -6.581  18.598  1.00 42.95 ? 156 SER D CB  1 
ATOM   8509  O  OG  . SER D  1 176 ? 71.207 -7.566  19.333  1.00 48.01 ? 156 SER D OG  1 
ATOM   8510  N  N   . VAL D  1 177 ? 72.478 -9.427  17.218  1.00 40.18 ? 157 VAL D N   1 
ATOM   8511  C  CA  . VAL D  1 177 ? 73.353 -10.581 17.236  1.00 41.12 ? 157 VAL D CA  1 
ATOM   8512  C  C   . VAL D  1 177 ? 73.858 -10.862 15.820  1.00 40.39 ? 157 VAL D C   1 
ATOM   8513  O  O   . VAL D  1 177 ? 75.053 -11.186 15.613  1.00 39.43 ? 157 VAL D O   1 
ATOM   8514  C  CB  . VAL D  1 177 ? 72.690 -11.767 17.862  1.00 42.41 ? 157 VAL D CB  1 
ATOM   8515  C  CG1 . VAL D  1 177 ? 73.643 -12.960 17.811  1.00 37.30 ? 157 VAL D CG1 1 
ATOM   8516  C  CG2 . VAL D  1 177 ? 72.293 -11.424 19.305  1.00 41.05 ? 157 VAL D CG2 1 
ATOM   8517  N  N   . VAL D  1 178 ? 72.947 -10.700 14.856  1.00 38.81 ? 158 VAL D N   1 
ATOM   8518  C  CA  . VAL D  1 178 ? 73.279 -10.835 13.434  1.00 39.32 ? 158 VAL D CA  1 
ATOM   8519  C  C   . VAL D  1 178 ? 74.469 -9.934  13.089  1.00 42.07 ? 158 VAL D C   1 
ATOM   8520  O  O   . VAL D  1 178 ? 75.412 -10.350 12.390  1.00 44.19 ? 158 VAL D O   1 
ATOM   8521  C  CB  . VAL D  1 178 ? 72.122 -10.412 12.513  1.00 37.07 ? 158 VAL D CB  1 
ATOM   8522  C  CG1 . VAL D  1 178 ? 72.507 -10.604 11.032  1.00 35.49 ? 158 VAL D CG1 1 
ATOM   8523  C  CG2 . VAL D  1 178 ? 70.881 -11.175 12.823  1.00 42.63 ? 158 VAL D CG2 1 
ATOM   8524  N  N   . GLY D  1 179 ? 74.395 -8.690  13.552  1.00 43.72 ? 159 GLY D N   1 
ATOM   8525  C  CA  . GLY D  1 179 ? 75.369 -7.687  13.192  1.00 43.43 ? 159 GLY D CA  1 
ATOM   8526  C  C   . GLY D  1 179 ? 76.737 -8.022  13.704  1.00 41.16 ? 159 GLY D C   1 
ATOM   8527  O  O   . GLY D  1 179 ? 77.719 -7.783  13.031  1.00 41.85 ? 159 GLY D O   1 
ATOM   8528  N  N   . GLN D  1 180 ? 76.758 -8.597  14.896  1.00 43.09 ? 160 GLN D N   1 
ATOM   8529  C  CA  . GLN D  1 180 ? 77.967 -8.913  15.656  1.00 40.99 ? 160 GLN D CA  1 
ATOM   8530  C  C   . GLN D  1 180 ? 78.608 -10.224 15.228  1.00 42.06 ? 160 GLN D C   1 
ATOM   8531  O  O   . GLN D  1 180 ? 79.821 -10.346 15.253  1.00 44.47 ? 160 GLN D O   1 
ATOM   8532  C  CB  . GLN D  1 180 ? 77.613 -8.999  17.147  1.00 40.39 ? 160 GLN D CB  1 
ATOM   8533  C  CG  . GLN D  1 180 ? 77.232 -7.646  17.758  1.00 41.13 ? 160 GLN D CG  1 
ATOM   8534  C  CD  . GLN D  1 180 ? 76.879 -7.736  19.231  1.00 38.98 ? 160 GLN D CD  1 
ATOM   8535  O  OE1 . GLN D  1 180 ? 77.716 -7.459  20.069  1.00 37.47 ? 160 GLN D OE1 1 
ATOM   8536  N  NE2 . GLN D  1 180 ? 75.650 -8.144  19.551  1.00 38.43 ? 160 GLN D NE2 1 
ATOM   8537  N  N   . ILE D  1 181 ? 77.804 -11.216 14.879  1.00 43.01 ? 161 ILE D N   1 
ATOM   8538  C  CA  . ILE D  1 181 ? 78.337 -12.443 14.285  1.00 42.91 ? 161 ILE D CA  1 
ATOM   8539  C  C   . ILE D  1 181 ? 78.884 -12.118 12.895  1.00 43.55 ? 161 ILE D C   1 
ATOM   8540  O  O   . ILE D  1 181 ? 79.881 -12.671 12.477  1.00 44.61 ? 161 ILE D O   1 
ATOM   8541  C  CB  . ILE D  1 181 ? 77.256 -13.568 14.146  1.00 44.01 ? 161 ILE D CB  1 
ATOM   8542  C  CG1 . ILE D  1 181 ? 76.794 -14.084 15.519  1.00 41.97 ? 161 ILE D CG1 1 
ATOM   8543  C  CG2 . ILE D  1 181 ? 77.797 -14.757 13.313  1.00 45.58 ? 161 ILE D CG2 1 
ATOM   8544  C  CD1 . ILE D  1 181 ? 75.476 -14.873 15.463  1.00 43.28 ? 161 ILE D CD1 1 
ATOM   8545  N  N   . ALA D  1 182 ? 78.208 -11.237 12.167  1.00 43.22 ? 162 ALA D N   1 
ATOM   8546  C  CA  . ALA D  1 182 ? 78.645 -10.839 10.836  1.00 42.44 ? 162 ALA D CA  1 
ATOM   8547  C  C   . ALA D  1 182 ? 79.970 -10.065 10.885  1.00 41.73 ? 162 ALA D C   1 
ATOM   8548  O  O   . ALA D  1 182 ? 80.809 -10.185 10.002  1.00 41.89 ? 162 ALA D O   1 
ATOM   8549  C  CB  . ALA D  1 182 ? 77.560 -10.022 10.144  1.00 42.49 ? 162 ALA D CB  1 
ATOM   8550  N  N   . LYS D  1 183 ? 80.156 -9.281  11.927  1.00 41.83 ? 163 LYS D N   1 
ATOM   8551  C  CA  . LYS D  1 183 ? 81.421 -8.580  12.127  1.00 43.18 ? 163 LYS D CA  1 
ATOM   8552  C  C   . LYS D  1 183 ? 82.584 -9.521  12.410  1.00 43.18 ? 163 LYS D C   1 
ATOM   8553  O  O   . LYS D  1 183 ? 83.682 -9.364  11.872  1.00 45.47 ? 163 LYS D O   1 
ATOM   8554  C  CB  . LYS D  1 183 ? 81.284 -7.542  13.255  1.00 42.23 ? 163 LYS D CB  1 
ATOM   8555  C  CG  . LYS D  1 183 ? 80.595 -6.235  12.826  1.00 44.54 ? 163 LYS D CG  1 
ATOM   8556  C  CD  . LYS D  1 183 ? 81.108 -5.689  11.487  1.00 46.34 ? 163 LYS D CD  1 
ATOM   8557  C  CE  . LYS D  1 183 ? 82.634 -5.511  11.457  1.00 45.70 ? 163 LYS D CE  1 
ATOM   8558  N  NZ  . LYS D  1 183 ? 83.174 -5.422  10.071  1.00 44.60 ? 163 LYS D NZ  1 
ATOM   8559  N  N   . LEU D  1 184 ? 82.351 -10.501 13.260  1.00 44.00 ? 164 LEU D N   1 
ATOM   8560  C  CA  . LEU D  1 184 ? 83.392 -11.454 13.590  1.00 45.36 ? 164 LEU D CA  1 
ATOM   8561  C  C   . LEU D  1 184 ? 83.550 -12.593 12.588  1.00 45.90 ? 164 LEU D C   1 
ATOM   8562  O  O   . LEU D  1 184 ? 84.287 -13.514 12.864  1.00 49.00 ? 164 LEU D O   1 
ATOM   8563  C  CB  . LEU D  1 184 ? 83.164 -12.013 14.995  1.00 46.07 ? 164 LEU D CB  1 
ATOM   8564  C  CG  . LEU D  1 184 ? 82.036 -13.018 15.203  1.00 48.10 ? 164 LEU D CG  1 
ATOM   8565  C  CD1 . LEU D  1 184 ? 82.471 -14.473 14.903  1.00 52.28 ? 164 LEU D CD1 1 
ATOM   8566  C  CD2 . LEU D  1 184 ? 81.518 -12.887 16.628  1.00 46.75 ? 164 LEU D CD2 1 
ATOM   8567  N  N   . LYS D  1 185 ? 82.831 -12.564 11.468  1.00 47.57 ? 165 LYS D N   1 
ATOM   8568  C  CA  . LYS D  1 185 ? 83.174 -13.358 10.288  1.00 48.38 ? 165 LYS D CA  1 
ATOM   8569  C  C   . LYS D  1 185 ? 83.704 -12.410 9.182   1.00 48.28 ? 165 LYS D C   1 
ATOM   8570  O  O   . LYS D  1 185 ? 83.797 -12.810 8.034   1.00 50.74 ? 165 LYS D O   1 
ATOM   8571  C  CB  . LYS D  1 185 ? 81.969 -14.165 9.752   1.00 49.84 ? 165 LYS D CB  1 
ATOM   8572  C  CG  . LYS D  1 185 ? 81.217 -15.047 10.773  1.00 53.23 ? 165 LYS D CG  1 
ATOM   8573  C  CD  . LYS D  1 185 ? 81.800 -16.464 10.938  1.00 55.08 ? 165 LYS D CD  1 
ATOM   8574  C  CE  . LYS D  1 185 ? 81.210 -17.167 12.189  1.00 52.53 ? 165 LYS D CE  1 
ATOM   8575  N  NZ  . LYS D  1 185 ? 81.905 -18.435 12.594  1.00 51.02 ? 165 LYS D NZ  1 
ATOM   8576  N  N   . GLY D  1 186 ? 84.006 -11.156 9.526   1.00 47.96 ? 166 GLY D N   1 
ATOM   8577  C  CA  . GLY D  1 186 ? 84.657 -10.192 8.614   1.00 47.78 ? 166 GLY D CA  1 
ATOM   8578  C  C   . GLY D  1 186 ? 83.800 -9.676  7.480   1.00 49.40 ? 166 GLY D C   1 
ATOM   8579  O  O   . GLY D  1 186 ? 84.248 -9.626  6.333   1.00 49.43 ? 166 GLY D O   1 
ATOM   8580  N  N   . CYS D  1 187 ? 82.560 -9.306  7.797   1.00 48.82 ? 167 CYS D N   1 
ATOM   8581  C  CA  . CYS D  1 187 ? 81.657 -8.661  6.848   1.00 48.60 ? 167 CYS D CA  1 
ATOM   8582  C  C   . CYS D  1 187 ? 81.487 -7.206  7.171   1.00 47.37 ? 167 CYS D C   1 
ATOM   8583  O  O   . CYS D  1 187 ? 81.557 -6.811  8.338   1.00 48.68 ? 167 CYS D O   1 
ATOM   8584  C  CB  . CYS D  1 187 ? 80.258 -9.275  6.932   1.00 50.72 ? 167 CYS D CB  1 
ATOM   8585  S  SG  . CYS D  1 187 ? 80.256 -11.037 6.718   1.00 57.13 ? 167 CYS D SG  1 
ATOM   8586  N  N   . LYS D  1 188 ? 81.208 -6.415  6.143   1.00 45.21 ? 168 LYS D N   1 
ATOM   8587  C  CA  . LYS D  1 188 ? 80.689 -5.073  6.340   1.00 44.65 ? 168 LYS D CA  1 
ATOM   8588  C  C   . LYS D  1 188 ? 79.205 -5.154  6.703   1.00 43.10 ? 168 LYS D C   1 
ATOM   8589  O  O   . LYS D  1 188 ? 78.443 -5.892  6.116   1.00 44.97 ? 168 LYS D O   1 
ATOM   8590  C  CB  . LYS D  1 188 ? 80.906 -4.211  5.092   1.00 44.96 ? 168 LYS D CB  1 
ATOM   8591  C  CG  . LYS D  1 188 ? 80.511 -2.758  5.315   1.00 46.16 ? 168 LYS D CG  1 
ATOM   8592  C  CD  . LYS D  1 188 ? 80.700 -1.920  4.082   1.00 46.65 ? 168 LYS D CD  1 
ATOM   8593  C  CE  . LYS D  1 188 ? 80.047 -0.564  4.249   1.00 48.37 ? 168 LYS D CE  1 
ATOM   8594  N  NZ  . LYS D  1 188 ? 79.590 -0.051  2.949   1.00 49.13 ? 168 LYS D NZ  1 
ATOM   8595  N  N   . VAL D  1 189 ? 78.796 -4.399  7.695   1.00 42.83 ? 169 VAL D N   1 
ATOM   8596  C  CA  . VAL D  1 189 ? 77.459 -4.529  8.257   1.00 42.21 ? 169 VAL D CA  1 
ATOM   8597  C  C   . VAL D  1 189 ? 76.796 -3.154  8.278   1.00 40.52 ? 169 VAL D C   1 
ATOM   8598  O  O   . VAL D  1 189 ? 77.326 -2.230  8.845   1.00 41.82 ? 169 VAL D O   1 
ATOM   8599  C  CB  . VAL D  1 189 ? 77.520 -5.111  9.673   1.00 43.09 ? 169 VAL D CB  1 
ATOM   8600  C  CG1 . VAL D  1 189 ? 76.141 -5.112  10.332  1.00 47.58 ? 169 VAL D CG1 1 
ATOM   8601  C  CG2 . VAL D  1 189 ? 78.100 -6.504  9.624   1.00 49.70 ? 169 VAL D CG2 1 
ATOM   8602  N  N   . VAL D  1 190 ? 75.633 -3.057  7.646   1.00 41.27 ? 170 VAL D N   1 
ATOM   8603  C  CA  . VAL D  1 190 ? 74.841 -1.848  7.581   1.00 40.75 ? 170 VAL D CA  1 
ATOM   8604  C  C   . VAL D  1 190 ? 73.566 -2.140  8.345   1.00 41.08 ? 170 VAL D C   1 
ATOM   8605  O  O   . VAL D  1 190 ? 72.882 -3.080  8.014   1.00 38.33 ? 170 VAL D O   1 
ATOM   8606  C  CB  . VAL D  1 190 ? 74.511 -1.447  6.109   1.00 38.60 ? 170 VAL D CB  1 
ATOM   8607  C  CG1 . VAL D  1 190 ? 73.758 -0.110  6.063   1.00 33.86 ? 170 VAL D CG1 1 
ATOM   8608  C  CG2 . VAL D  1 190 ? 75.784 -1.368  5.287   1.00 36.05 ? 170 VAL D CG2 1 
ATOM   8609  N  N   . GLY D  1 191 ? 73.270 -1.329  9.371   1.00 43.12 ? 171 GLY D N   1 
ATOM   8610  C  CA  . GLY D  1 191 ? 72.122 -1.553  10.263  1.00 41.63 ? 171 GLY D CA  1 
ATOM   8611  C  C   . GLY D  1 191 ? 71.151 -0.392  10.248  1.00 39.78 ? 171 GLY D C   1 
ATOM   8612  O  O   . GLY D  1 191 ? 71.549 0.742   10.234  1.00 41.02 ? 171 GLY D O   1 
ATOM   8613  N  N   . ALA D  1 192 ? 69.861 -0.690  10.226  1.00 41.58 ? 172 ALA D N   1 
ATOM   8614  C  CA  . ALA D  1 192 ? 68.821 0.320   10.393  1.00 41.78 ? 172 ALA D CA  1 
ATOM   8615  C  C   . ALA D  1 192 ? 68.221 0.104   11.750  1.00 42.27 ? 172 ALA D C   1 
ATOM   8616  O  O   . ALA D  1 192 ? 67.956 -1.008  12.151  1.00 42.13 ? 172 ALA D O   1 
ATOM   8617  C  CB  . ALA D  1 192 ? 67.748 0.232   9.354   1.00 40.40 ? 172 ALA D CB  1 
ATOM   8618  N  N   . VAL D  1 193 ? 67.944 1.208   12.410  1.00 43.66 ? 173 VAL D N   1 
ATOM   8619  C  CA  . VAL D  1 193 ? 67.546 1.218   13.792  1.00 45.06 ? 173 VAL D CA  1 
ATOM   8620  C  C   . VAL D  1 193 ? 66.411 2.262   13.954  1.00 45.66 ? 173 VAL D C   1 
ATOM   8621  O  O   . VAL D  1 193 ? 66.183 3.059   13.044  1.00 46.38 ? 173 VAL D O   1 
ATOM   8622  C  CB  . VAL D  1 193 ? 68.807 1.547   14.584  1.00 43.96 ? 173 VAL D CB  1 
ATOM   8623  C  CG1 . VAL D  1 193 ? 68.547 2.563   15.590  1.00 45.23 ? 173 VAL D CG1 1 
ATOM   8624  C  CG2 . VAL D  1 193 ? 69.453 0.284   15.109  1.00 39.63 ? 173 VAL D CG2 1 
ATOM   8625  N  N   . GLY D  1 194 ? 65.712 2.252   15.090  1.00 46.34 ? 174 GLY D N   1 
ATOM   8626  C  CA  . GLY D  1 194 ? 64.596 3.176   15.317  1.00 47.28 ? 174 GLY D CA  1 
ATOM   8627  C  C   . GLY D  1 194 ? 64.788 4.354   16.269  1.00 46.88 ? 174 GLY D C   1 
ATOM   8628  O  O   . GLY D  1 194 ? 63.865 5.114   16.476  1.00 46.84 ? 174 GLY D O   1 
ATOM   8629  N  N   . SER D  1 195 ? 65.965 4.506   16.863  1.00 48.51 ? 175 SER D N   1 
ATOM   8630  C  CA  . SER D  1 195 ? 66.244 5.638   17.747  1.00 48.97 ? 175 SER D CA  1 
ATOM   8631  C  C   . SER D  1 195 ? 67.704 6.068   17.571  1.00 49.53 ? 175 SER D C   1 
ATOM   8632  O  O   . SER D  1 195 ? 68.523 5.300   17.077  1.00 48.18 ? 175 SER D O   1 
ATOM   8633  C  CB  . SER D  1 195 ? 65.865 5.309   19.231  1.00 48.11 ? 175 SER D CB  1 
ATOM   8634  O  OG  . SER D  1 195 ? 66.861 4.622   19.996  1.00 48.47 ? 175 SER D OG  1 
ATOM   8635  N  N   . ASP D  1 196 ? 68.017 7.305   17.928  1.00 51.52 ? 176 ASP D N   1 
ATOM   8636  C  CA  . ASP D  1 196 ? 69.417 7.751   17.920  1.00 54.20 ? 176 ASP D CA  1 
ATOM   8637  C  C   . ASP D  1 196 ? 70.243 7.239   19.125  1.00 52.89 ? 176 ASP D C   1 
ATOM   8638  O  O   . ASP D  1 196 ? 71.477 7.196   19.040  1.00 51.51 ? 176 ASP D O   1 
ATOM   8639  C  CB  . ASP D  1 196 ? 69.536 9.277   17.727  1.00 55.05 ? 176 ASP D CB  1 
ATOM   8640  C  CG  . ASP D  1 196 ? 69.223 9.710   16.272  1.00 63.66 ? 176 ASP D CG  1 
ATOM   8641  O  OD1 . ASP D  1 196 ? 70.049 9.463   15.338  1.00 60.67 ? 176 ASP D OD1 1 
ATOM   8642  O  OD2 . ASP D  1 196 ? 68.133 10.298  16.064  1.00 75.79 ? 176 ASP D OD2 1 
ATOM   8643  N  N   . GLU D  1 197 ? 69.577 6.829   20.211  1.00 52.31 ? 177 GLU D N   1 
ATOM   8644  C  CA  . GLU D  1 197 ? 70.219 6.005   21.259  1.00 52.78 ? 177 GLU D CA  1 
ATOM   8645  C  C   . GLU D  1 197 ? 70.772 4.703   20.671  1.00 50.34 ? 177 GLU D C   1 
ATOM   8646  O  O   . GLU D  1 197 ? 71.888 4.273   20.969  1.00 50.81 ? 177 GLU D O   1 
ATOM   8647  C  CB  . GLU D  1 197 ? 69.214 5.581   22.328  1.00 53.59 ? 177 GLU D CB  1 
ATOM   8648  C  CG  . GLU D  1 197 ? 69.025 6.507   23.487  1.00 61.84 ? 177 GLU D CG  1 
ATOM   8649  C  CD  . GLU D  1 197 ? 68.850 5.763   24.824  1.00 70.47 ? 177 GLU D CD  1 
ATOM   8650  O  OE1 . GLU D  1 197 ? 68.960 6.475   25.857  1.00 79.45 ? 177 GLU D OE1 1 
ATOM   8651  O  OE2 . GLU D  1 197 ? 68.620 4.506   24.851  1.00 58.83 ? 177 GLU D OE2 1 
ATOM   8652  N  N   . LYS D  1 198 ? 69.932 4.050   19.881  1.00 48.30 ? 178 LYS D N   1 
ATOM   8653  C  CA  . LYS D  1 198 ? 70.271 2.765   19.248  1.00 46.22 ? 178 LYS D CA  1 
ATOM   8654  C  C   . LYS D  1 198 ? 71.355 2.893   18.182  1.00 44.11 ? 178 LYS D C   1 
ATOM   8655  O  O   . LYS D  1 198 ? 72.177 1.990   18.003  1.00 44.51 ? 178 LYS D O   1 
ATOM   8656  C  CB  . LYS D  1 198 ? 69.018 2.169   18.664  1.00 44.09 ? 178 LYS D CB  1 
ATOM   8657  C  CG  . LYS D  1 198 ? 68.054 1.628   19.696  1.00 49.18 ? 178 LYS D CG  1 
ATOM   8658  C  CD  . LYS D  1 198 ? 66.704 1.305   19.073  1.00 48.75 ? 178 LYS D CD  1 
ATOM   8659  C  CE  . LYS D  1 198 ? 65.775 0.748   20.096  1.00 48.02 ? 178 LYS D CE  1 
ATOM   8660  N  NZ  . LYS D  1 198 ? 64.557 0.189   19.469  1.00 54.93 ? 178 LYS D NZ  1 
ATOM   8661  N  N   . VAL D  1 199 ? 71.378 4.033   17.497  1.00 44.99 ? 179 VAL D N   1 
ATOM   8662  C  CA  . VAL D  1 199 ? 72.477 4.357   16.584  1.00 44.57 ? 179 VAL D CA  1 
ATOM   8663  C  C   . VAL D  1 199 ? 73.771 4.441   17.361  1.00 47.48 ? 179 VAL D C   1 
ATOM   8664  O  O   . VAL D  1 199 ? 74.779 3.860   16.925  1.00 50.76 ? 179 VAL D O   1 
ATOM   8665  C  CB  . VAL D  1 199 ? 72.251 5.658   15.799  1.00 42.28 ? 179 VAL D CB  1 
ATOM   8666  C  CG1 . VAL D  1 199 ? 73.517 6.066   15.005  1.00 37.10 ? 179 VAL D CG1 1 
ATOM   8667  C  CG2 . VAL D  1 199 ? 71.073 5.487   14.855  1.00 41.91 ? 179 VAL D CG2 1 
ATOM   8668  N  N   . ALA D  1 200 ? 73.749 5.146   18.503  1.00 48.23 ? 180 ALA D N   1 
ATOM   8669  C  CA  . ALA D  1 200 ? 74.953 5.267   19.352  1.00 48.34 ? 180 ALA D CA  1 
ATOM   8670  C  C   . ALA D  1 200 ? 75.465 3.900   19.793  1.00 48.38 ? 180 ALA D C   1 
ATOM   8671  O  O   . ALA D  1 200 ? 76.657 3.622   19.737  1.00 48.63 ? 180 ALA D O   1 
ATOM   8672  C  CB  . ALA D  1 200 ? 74.672 6.124   20.569  1.00 48.83 ? 180 ALA D CB  1 
ATOM   8673  N  N   . TYR D  1 201 ? 74.538 3.052   20.218  1.00 49.26 ? 181 TYR D N   1 
ATOM   8674  C  CA  . TYR D  1 201 ? 74.866 1.805   20.863  1.00 50.81 ? 181 TYR D CA  1 
ATOM   8675  C  C   . TYR D  1 201 ? 75.534 0.829   19.894  1.00 52.30 ? 181 TYR D C   1 
ATOM   8676  O  O   . TYR D  1 201 ? 76.562 0.251   20.231  1.00 53.40 ? 181 TYR D O   1 
ATOM   8677  C  CB  . TYR D  1 201 ? 73.602 1.204   21.487  1.00 53.48 ? 181 TYR D CB  1 
ATOM   8678  C  CG  . TYR D  1 201 ? 73.845 -0.159  22.050  1.00 60.96 ? 181 TYR D CG  1 
ATOM   8679  C  CD1 . TYR D  1 201 ? 74.639 -0.315  23.190  1.00 62.17 ? 181 TYR D CD1 1 
ATOM   8680  C  CD2 . TYR D  1 201 ? 73.313 -1.307  21.433  1.00 62.28 ? 181 TYR D CD2 1 
ATOM   8681  C  CE1 . TYR D  1 201 ? 74.889 -1.581  23.724  1.00 66.72 ? 181 TYR D CE1 1 
ATOM   8682  C  CE2 . TYR D  1 201 ? 73.552 -2.576  21.959  1.00 62.33 ? 181 TYR D CE2 1 
ATOM   8683  C  CZ  . TYR D  1 201 ? 74.341 -2.707  23.108  1.00 63.95 ? 181 TYR D CZ  1 
ATOM   8684  O  OH  . TYR D  1 201 ? 74.617 -3.942  23.661  1.00 65.64 ? 181 TYR D OH  1 
ATOM   8685  N  N   . LEU D  1 202 ? 74.967 0.663   18.692  1.00 51.69 ? 182 LEU D N   1 
ATOM   8686  C  CA  . LEU D  1 202 ? 75.550 -0.227  17.670  1.00 49.55 ? 182 LEU D CA  1 
ATOM   8687  C  C   . LEU D  1 202 ? 76.889 0.241   17.076  1.00 49.39 ? 182 LEU D C   1 
ATOM   8688  O  O   . LEU D  1 202 ? 77.709 -0.583  16.604  1.00 46.59 ? 182 LEU D O   1 
ATOM   8689  C  CB  . LEU D  1 202 ? 74.582 -0.400  16.537  1.00 48.95 ? 182 LEU D CB  1 
ATOM   8690  C  CG  . LEU D  1 202 ? 73.219 -0.975  16.864  1.00 45.87 ? 182 LEU D CG  1 
ATOM   8691  C  CD1 . LEU D  1 202 ? 72.501 -1.153  15.532  1.00 39.20 ? 182 LEU D CD1 1 
ATOM   8692  C  CD2 . LEU D  1 202 ? 73.326 -2.271  17.650  1.00 49.24 ? 182 LEU D CD2 1 
ATOM   8693  N  N   . GLN D  1 203 ? 77.094 1.551   17.063  1.00 49.06 ? 183 GLN D N   1 
ATOM   8694  C  CA  . GLN D  1 203 ? 78.400 2.097   16.717  1.00 53.29 ? 183 GLN D CA  1 
ATOM   8695  C  C   . GLN D  1 203 ? 79.461 1.700   17.739  1.00 53.39 ? 183 GLN D C   1 
ATOM   8696  O  O   . GLN D  1 203 ? 80.605 1.452   17.354  1.00 53.38 ? 183 GLN D O   1 
ATOM   8697  C  CB  . GLN D  1 203 ? 78.345 3.614   16.622  1.00 52.76 ? 183 GLN D CB  1 
ATOM   8698  C  CG  . GLN D  1 203 ? 77.500 4.094   15.466  1.00 54.40 ? 183 GLN D CG  1 
ATOM   8699  C  CD  . GLN D  1 203 ? 77.376 5.602   15.423  1.00 53.71 ? 183 GLN D CD  1 
ATOM   8700  O  OE1 . GLN D  1 203 ? 77.449 6.309   16.457  1.00 52.25 ? 183 GLN D OE1 1 
ATOM   8701  N  NE2 . GLN D  1 203 ? 77.190 6.115   14.211  1.00 46.70 ? 183 GLN D NE2 1 
ATOM   8702  N  N   . LYS D  1 204 ? 79.067 1.653   19.018  1.00 54.76 ? 184 LYS D N   1 
ATOM   8703  C  CA  . LYS D  1 204 ? 79.888 1.090   20.127  1.00 55.89 ? 184 LYS D CA  1 
ATOM   8704  C  C   . LYS D  1 204 ? 80.188 -0.411  19.881  1.00 55.61 ? 184 LYS D C   1 
ATOM   8705  O  O   . LYS D  1 204 ? 81.326 -0.842  20.063  1.00 56.74 ? 184 LYS D O   1 
ATOM   8706  C  CB  . LYS D  1 204 ? 79.193 1.333   21.513  1.00 57.96 ? 184 LYS D CB  1 
ATOM   8707  C  CG  . LYS D  1 204 ? 79.615 0.440   22.733  1.00 57.28 ? 184 LYS D CG  1 
ATOM   8708  C  CD  . LYS D  1 204 ? 78.636 0.566   23.935  1.00 55.77 ? 184 LYS D CD  1 
ATOM   8709  N  N   . LEU D  1 205 ? 79.185 -1.178  19.448  1.00 53.59 ? 185 LEU D N   1 
ATOM   8710  C  CA  . LEU D  1 205 ? 79.368 -2.597  19.093  1.00 54.44 ? 185 LEU D CA  1 
ATOM   8711  C  C   . LEU D  1 205 ? 80.119 -2.844  17.783  1.00 55.13 ? 185 LEU D C   1 
ATOM   8712  O  O   . LEU D  1 205 ? 80.304 -4.001  17.402  1.00 55.64 ? 185 LEU D O   1 
ATOM   8713  C  CB  . LEU D  1 205 ? 78.028 -3.330  18.984  1.00 52.82 ? 185 LEU D CB  1 
ATOM   8714  C  CG  . LEU D  1 205 ? 77.058 -3.248  20.157  1.00 55.64 ? 185 LEU D CG  1 
ATOM   8715  C  CD1 . LEU D  1 205 ? 76.143 -4.466  20.146  1.00 53.68 ? 185 LEU D CD1 1 
ATOM   8716  C  CD2 . LEU D  1 205 ? 77.779 -3.105  21.515  1.00 59.28 ? 185 LEU D CD2 1 
ATOM   8717  N  N   . GLY D  1 206 ? 80.520 -1.780  17.084  1.00 54.83 ? 186 GLY D N   1 
ATOM   8718  C  CA  . GLY D  1 206 ? 81.357 -1.904  15.896  1.00 53.31 ? 186 GLY D CA  1 
ATOM   8719  C  C   . GLY D  1 206 ? 80.662 -2.207  14.567  1.00 53.00 ? 186 GLY D C   1 
ATOM   8720  O  O   . GLY D  1 206 ? 81.318 -2.700  13.646  1.00 52.95 ? 186 GLY D O   1 
ATOM   8721  N  N   . PHE D  1 207 ? 79.365 -1.908  14.424  1.00 51.16 ? 187 PHE D N   1 
ATOM   8722  C  CA  . PHE D  1 207 ? 78.739 -1.951  13.082  1.00 51.10 ? 187 PHE D CA  1 
ATOM   8723  C  C   . PHE D  1 207 ? 79.406 -0.910  12.167  1.00 50.32 ? 187 PHE D C   1 
ATOM   8724  O  O   . PHE D  1 207 ? 79.786 0.180   12.629  1.00 50.17 ? 187 PHE D O   1 
ATOM   8725  C  CB  . PHE D  1 207 ? 77.262 -1.594  13.125  1.00 51.19 ? 187 PHE D CB  1 
ATOM   8726  C  CG  . PHE D  1 207 ? 76.350 -2.701  13.576  1.00 48.46 ? 187 PHE D CG  1 
ATOM   8727  C  CD1 . PHE D  1 207 ? 75.113 -2.884  12.929  1.00 53.79 ? 187 PHE D CD1 1 
ATOM   8728  C  CD2 . PHE D  1 207 ? 76.680 -3.526  14.648  1.00 44.97 ? 187 PHE D CD2 1 
ATOM   8729  C  CE1 . PHE D  1 207 ? 74.217 -3.887  13.346  1.00 55.47 ? 187 PHE D CE1 1 
ATOM   8730  C  CE2 . PHE D  1 207 ? 75.804 -4.517  15.088  1.00 46.34 ? 187 PHE D CE2 1 
ATOM   8731  C  CZ  . PHE D  1 207 ? 74.559 -4.695  14.455  1.00 50.59 ? 187 PHE D CZ  1 
ATOM   8732  N  N   . ASP D  1 208 ? 79.502 -1.228  10.874  1.00 49.47 ? 188 ASP D N   1 
ATOM   8733  C  CA  . ASP D  1 208 ? 80.157 -0.336  9.900   1.00 48.00 ? 188 ASP D CA  1 
ATOM   8734  C  C   . ASP D  1 208 ? 79.335 0.945   9.592   1.00 47.43 ? 188 ASP D C   1 
ATOM   8735  O  O   . ASP D  1 208 ? 79.857 2.052   9.638   1.00 45.97 ? 188 ASP D O   1 
ATOM   8736  C  CB  . ASP D  1 208 ? 80.489 -1.104  8.610   1.00 48.28 ? 188 ASP D CB  1 
ATOM   8737  C  CG  . ASP D  1 208 ? 81.431 -2.302  8.858   1.00 52.40 ? 188 ASP D CG  1 
ATOM   8738  O  OD1 . ASP D  1 208 ? 82.666 -2.160  8.693   1.00 57.63 ? 188 ASP D OD1 1 
ATOM   8739  O  OD2 . ASP D  1 208 ? 80.934 -3.388  9.232   1.00 57.15 ? 188 ASP D OD2 1 
ATOM   8740  N  N   . VAL D  1 209 ? 78.058 0.782   9.260   1.00 48.29 ? 189 VAL D N   1 
ATOM   8741  C  CA  . VAL D  1 209 ? 77.133 1.912   9.109   1.00 45.78 ? 189 VAL D CA  1 
ATOM   8742  C  C   . VAL D  1 209 ? 75.878 1.599   9.918   1.00 45.60 ? 189 VAL D C   1 
ATOM   8743  O  O   . VAL D  1 209 ? 75.424 0.454   9.969   1.00 47.24 ? 189 VAL D O   1 
ATOM   8744  C  CB  . VAL D  1 209 ? 76.724 2.162   7.651   1.00 44.53 ? 189 VAL D CB  1 
ATOM   8745  C  CG1 . VAL D  1 209 ? 75.904 3.447   7.569   1.00 44.92 ? 189 VAL D CG1 1 
ATOM   8746  C  CG2 . VAL D  1 209 ? 77.942 2.241   6.745   1.00 36.74 ? 189 VAL D CG2 1 
ATOM   8747  N  N   . VAL D  1 210 ? 75.366 2.613   10.595  1.00 44.44 ? 190 VAL D N   1 
ATOM   8748  C  CA  . VAL D  1 210 ? 74.149 2.514   11.383  1.00 44.91 ? 190 VAL D CA  1 
ATOM   8749  C  C   . VAL D  1 210 ? 73.390 3.818   11.186  1.00 43.27 ? 190 VAL D C   1 
ATOM   8750  O  O   . VAL D  1 210 ? 74.001 4.868   11.129  1.00 44.48 ? 190 VAL D O   1 
ATOM   8751  C  CB  . VAL D  1 210 ? 74.417 2.318   12.883  1.00 44.79 ? 190 VAL D CB  1 
ATOM   8752  C  CG1 . VAL D  1 210 ? 73.101 1.993   13.598  1.00 44.43 ? 190 VAL D CG1 1 
ATOM   8753  C  CG2 . VAL D  1 210 ? 75.447 1.197   13.113  1.00 47.32 ? 190 VAL D CG2 1 
ATOM   8754  N  N   . PHE D  1 211 ? 72.075 3.726   11.026  1.00 43.00 ? 191 PHE D N   1 
ATOM   8755  C  CA  . PHE D  1 211 ? 71.235 4.889   10.843  1.00 40.30 ? 191 PHE D CA  1 
ATOM   8756  C  C   . PHE D  1 211 ? 69.845 4.670   11.384  1.00 40.81 ? 191 PHE D C   1 
ATOM   8757  O  O   . PHE D  1 211 ? 69.434 3.529   11.626  1.00 40.32 ? 191 PHE D O   1 
ATOM   8758  C  CB  . PHE D  1 211 ? 71.191 5.331   9.376   1.00 40.12 ? 191 PHE D CB  1 
ATOM   8759  C  CG  . PHE D  1 211 ? 70.523 4.341   8.426   1.00 44.43 ? 191 PHE D CG  1 
ATOM   8760  C  CD1 . PHE D  1 211 ? 69.156 4.431   8.153   1.00 41.50 ? 191 PHE D CD1 1 
ATOM   8761  C  CD2 . PHE D  1 211 ? 71.280 3.373   7.755   1.00 40.43 ? 191 PHE D CD2 1 
ATOM   8762  C  CE1 . PHE D  1 211 ? 68.546 3.561   7.273   1.00 39.38 ? 191 PHE D CE1 1 
ATOM   8763  C  CE2 . PHE D  1 211 ? 70.682 2.488   6.888   1.00 44.19 ? 191 PHE D CE2 1 
ATOM   8764  C  CZ  . PHE D  1 211 ? 69.309 2.587   6.630   1.00 44.01 ? 191 PHE D CZ  1 
ATOM   8765  N  N   . ASN D  1 212 ? 69.157 5.788   11.599  1.00 42.30 ? 192 ASN D N   1 
ATOM   8766  C  CA  . ASN D  1 212 ? 67.800 5.822   12.107  1.00 45.20 ? 192 ASN D CA  1 
ATOM   8767  C  C   . ASN D  1 212 ? 66.814 5.930   10.923  1.00 46.70 ? 192 ASN D C   1 
ATOM   8768  O  O   . ASN D  1 212 ? 66.747 6.976   10.271  1.00 49.46 ? 192 ASN D O   1 
ATOM   8769  C  CB  . ASN D  1 212 ? 67.678 7.021   13.063  1.00 41.31 ? 192 ASN D CB  1 
ATOM   8770  C  CG  . ASN D  1 212 ? 66.365 7.063   13.804  1.00 39.30 ? 192 ASN D CG  1 
ATOM   8771  O  OD1 . ASN D  1 212 ? 65.390 6.415   13.420  1.00 43.36 ? 192 ASN D OD1 1 
ATOM   8772  N  ND2 . ASN D  1 212 ? 66.327 7.837   14.871  1.00 34.14 ? 192 ASN D ND2 1 
ATOM   8773  N  N   . TYR D  1 213 ? 66.058 4.870   10.635  1.00 48.16 ? 193 TYR D N   1 
ATOM   8774  C  CA  . TYR D  1 213 ? 65.148 4.893   9.480   1.00 52.44 ? 193 TYR D CA  1 
ATOM   8775  C  C   . TYR D  1 213 ? 64.069 5.964   9.646   1.00 52.42 ? 193 TYR D C   1 
ATOM   8776  O  O   . TYR D  1 213 ? 63.538 6.452   8.668   1.00 52.25 ? 193 TYR D O   1 
ATOM   8777  C  CB  . TYR D  1 213 ? 64.508 3.496   9.150   1.00 57.14 ? 193 TYR D CB  1 
ATOM   8778  C  CG  . TYR D  1 213 ? 63.439 3.095   10.147  1.00 65.16 ? 193 TYR D CG  1 
ATOM   8779  C  CD1 . TYR D  1 213 ? 62.090 3.437   9.969   1.00 70.18 ? 193 TYR D CD1 1 
ATOM   8780  C  CD2 . TYR D  1 213 ? 63.794 2.427   11.314  1.00 74.02 ? 193 TYR D CD2 1 
ATOM   8781  C  CE1 . TYR D  1 213 ? 61.118 3.101   10.949  1.00 70.09 ? 193 TYR D CE1 1 
ATOM   8782  C  CE2 . TYR D  1 213 ? 62.849 2.078   12.290  1.00 76.54 ? 193 TYR D CE2 1 
ATOM   8783  C  CZ  . TYR D  1 213 ? 61.520 2.410   12.116  1.00 72.66 ? 193 TYR D CZ  1 
ATOM   8784  O  OH  . TYR D  1 213 ? 60.644 2.026   13.123  1.00 67.31 ? 193 TYR D OH  1 
ATOM   8785  N  N   . LYS D  1 214 ? 63.757 6.339   10.883  1.00 53.76 ? 194 LYS D N   1 
ATOM   8786  C  CA  . LYS D  1 214 ? 62.738 7.359   11.131  1.00 53.17 ? 194 LYS D CA  1 
ATOM   8787  C  C   . LYS D  1 214 ? 63.178 8.764   10.784  1.00 51.42 ? 194 LYS D C   1 
ATOM   8788  O  O   . LYS D  1 214 ? 62.346 9.554   10.401  1.00 53.38 ? 194 LYS D O   1 
ATOM   8789  C  CB  . LYS D  1 214 ? 62.290 7.327   12.590  1.00 53.50 ? 194 LYS D CB  1 
ATOM   8790  C  CG  . LYS D  1 214 ? 61.524 6.096   12.948  1.00 54.92 ? 194 LYS D CG  1 
ATOM   8791  C  CD  . LYS D  1 214 ? 61.288 6.034   14.438  1.00 58.66 ? 194 LYS D CD  1 
ATOM   8792  C  CE  . LYS D  1 214 ? 60.925 4.611   14.850  1.00 67.52 ? 194 LYS D CE  1 
ATOM   8793  N  NZ  . LYS D  1 214 ? 60.695 4.508   16.316  1.00 75.15 ? 194 LYS D NZ  1 
ATOM   8794  N  N   . THR D  1 215 ? 64.460 9.091   10.930  1.00 50.51 ? 195 THR D N   1 
ATOM   8795  C  CA  . THR D  1 215 ? 64.921 10.468  10.713  1.00 49.73 ? 195 THR D CA  1 
ATOM   8796  C  C   . THR D  1 215 ? 65.423 10.761  9.293   1.00 50.96 ? 195 THR D C   1 
ATOM   8797  O  O   . THR D  1 215 ? 65.358 11.904  8.870   1.00 51.26 ? 195 THR D O   1 
ATOM   8798  C  CB  . THR D  1 215 ? 66.023 10.934  11.736  1.00 47.75 ? 195 THR D CB  1 
ATOM   8799  O  OG1 . THR D  1 215 ? 67.296 10.353  11.425  1.00 48.90 ? 195 THR D OG1 1 
ATOM   8800  C  CG2 . THR D  1 215 ? 65.636 10.626  13.161  1.00 44.92 ? 195 THR D CG2 1 
ATOM   8801  N  N   . VAL D  1 216 ? 65.922 9.753   8.565   1.00 52.31 ? 196 VAL D N   1 
ATOM   8802  C  CA  . VAL D  1 216 ? 66.518 9.984   7.227   1.00 52.36 ? 196 VAL D CA  1 
ATOM   8803  C  C   . VAL D  1 216 ? 65.555 10.626  6.211   1.00 53.38 ? 196 VAL D C   1 
ATOM   8804  O  O   . VAL D  1 216 ? 64.378 10.266  6.174   1.00 56.24 ? 196 VAL D O   1 
ATOM   8805  C  CB  . VAL D  1 216 ? 67.071 8.686   6.587   1.00 52.76 ? 196 VAL D CB  1 
ATOM   8806  C  CG1 . VAL D  1 216 ? 68.193 8.106   7.438   1.00 56.57 ? 196 VAL D CG1 1 
ATOM   8807  C  CG2 . VAL D  1 216 ? 65.952 7.674   6.310   1.00 49.76 ? 196 VAL D CG2 1 
ATOM   8808  N  N   . GLU D  1 217 ? 66.054 11.550  5.383   1.00 51.34 ? 197 GLU D N   1 
ATOM   8809  C  CA  . GLU D  1 217 ? 65.216 12.175  4.345   1.00 51.67 ? 197 GLU D CA  1 
ATOM   8810  C  C   . GLU D  1 217 ? 64.718 11.114  3.370   1.00 51.15 ? 197 GLU D C   1 
ATOM   8811  O  O   . GLU D  1 217 ? 63.533 11.035  3.095   1.00 52.13 ? 197 GLU D O   1 
ATOM   8812  C  CB  . GLU D  1 217 ? 65.964 13.293  3.598   1.00 49.82 ? 197 GLU D CB  1 
ATOM   8813  N  N   . SER D  1 218 ? 65.635 10.284  2.877   1.00 51.74 ? 198 SER D N   1 
ATOM   8814  C  CA  . SER D  1 218 ? 65.327 9.223   1.894   1.00 50.67 ? 198 SER D CA  1 
ATOM   8815  C  C   . SER D  1 218 ? 66.038 7.902   2.273   1.00 49.39 ? 198 SER D C   1 
ATOM   8816  O  O   . SER D  1 218 ? 67.267 7.847   2.297   1.00 48.35 ? 198 SER D O   1 
ATOM   8817  C  CB  . SER D  1 218 ? 65.745 9.693   0.476   1.00 49.98 ? 198 SER D CB  1 
ATOM   8818  O  OG  . SER D  1 218 ? 65.538 8.715   -0.530  1.00 50.59 ? 198 SER D OG  1 
ATOM   8819  N  N   . LEU D  1 219 ? 65.280 6.850   2.574   1.00 48.30 ? 199 LEU D N   1 
ATOM   8820  C  CA  . LEU D  1 219 ? 65.901 5.529   2.802   1.00 48.97 ? 199 LEU D CA  1 
ATOM   8821  C  C   . LEU D  1 219 ? 66.784 5.069   1.621   1.00 48.25 ? 199 LEU D C   1 
ATOM   8822  O  O   . LEU D  1 219 ? 67.909 4.585   1.815   1.00 48.49 ? 199 LEU D O   1 
ATOM   8823  C  CB  . LEU D  1 219 ? 64.847 4.462   3.084   1.00 48.16 ? 199 LEU D CB  1 
ATOM   8824  C  CG  . LEU D  1 219 ? 65.421 3.068   3.384   1.00 51.68 ? 199 LEU D CG  1 
ATOM   8825  C  CD1 . LEU D  1 219 ? 66.424 3.176   4.526   1.00 57.91 ? 199 LEU D CD1 1 
ATOM   8826  C  CD2 . LEU D  1 219 ? 64.344 2.006   3.694   1.00 49.02 ? 199 LEU D CD2 1 
ATOM   8827  N  N   . GLU D  1 220 ? 66.257 5.219   0.415   1.00 45.44 ? 200 GLU D N   1 
ATOM   8828  C  CA  . GLU D  1 220 ? 66.966 4.867   -0.800  1.00 47.60 ? 200 GLU D CA  1 
ATOM   8829  C  C   . GLU D  1 220 ? 68.391 5.443   -0.847  1.00 46.74 ? 200 GLU D C   1 
ATOM   8830  O  O   . GLU D  1 220 ? 69.380 4.686   -0.902  1.00 45.95 ? 200 GLU D O   1 
ATOM   8831  C  CB  . GLU D  1 220 ? 66.164 5.383   -2.006  1.00 48.49 ? 200 GLU D CB  1 
ATOM   8832  C  CG  . GLU D  1 220 ? 66.348 4.581   -3.276  1.00 53.34 ? 200 GLU D CG  1 
ATOM   8833  C  CD  . GLU D  1 220 ? 66.286 5.409   -4.579  1.00 54.60 ? 200 GLU D CD  1 
ATOM   8834  O  OE1 . GLU D  1 220 ? 66.049 6.654   -4.559  1.00 64.49 ? 200 GLU D OE1 1 
ATOM   8835  O  OE2 . GLU D  1 220 ? 66.510 4.782   -5.646  1.00 61.66 ? 200 GLU D OE2 1 
ATOM   8836  N  N   . GLU D  1 221 ? 68.473 6.781   -0.840  1.00 46.35 ? 201 GLU D N   1 
ATOM   8837  C  CA  . GLU D  1 221 ? 69.730 7.549   -0.831  1.00 47.44 ? 201 GLU D CA  1 
ATOM   8838  C  C   . GLU D  1 221 ? 70.704 7.139   0.295   1.00 43.60 ? 201 GLU D C   1 
ATOM   8839  O  O   . GLU D  1 221 ? 71.896 7.061   0.101   1.00 43.58 ? 201 GLU D O   1 
ATOM   8840  C  CB  . GLU D  1 221 ? 69.406 9.053   -0.689  1.00 46.74 ? 201 GLU D CB  1 
ATOM   8841  C  CG  . GLU D  1 221 ? 68.570 9.646   -1.849  1.00 55.07 ? 201 GLU D CG  1 
ATOM   8842  C  CD  . GLU D  1 221 ? 68.511 11.201  -1.854  1.00 55.62 ? 201 GLU D CD  1 
ATOM   8843  O  OE1 . GLU D  1 221 ? 67.950 11.810  -0.906  1.00 71.12 ? 201 GLU D OE1 1 
ATOM   8844  O  OE2 . GLU D  1 221 ? 69.017 11.825  -2.819  1.00 63.83 ? 201 GLU D OE2 1 
ATOM   8845  N  N   . THR D  1 222 ? 70.176 6.904   1.484   1.00 44.63 ? 202 THR D N   1 
ATOM   8846  C  CA  . THR D  1 222 ? 70.963 6.492   2.641   1.00 43.38 ? 202 THR D CA  1 
ATOM   8847  C  C   . THR D  1 222 ? 71.618 5.132   2.420   1.00 43.70 ? 202 THR D C   1 
ATOM   8848  O  O   . THR D  1 222 ? 72.786 4.959   2.743   1.00 44.96 ? 202 THR D O   1 
ATOM   8849  C  CB  . THR D  1 222 ? 70.071 6.435   3.883   1.00 42.34 ? 202 THR D CB  1 
ATOM   8850  O  OG1 . THR D  1 222 ? 69.441 7.704   4.071   1.00 42.42 ? 202 THR D OG1 1 
ATOM   8851  C  CG2 . THR D  1 222 ? 70.853 6.059   5.120   1.00 39.82 ? 202 THR D CG2 1 
ATOM   8852  N  N   . LEU D  1 223 ? 70.872 4.175   1.859   1.00 43.34 ? 203 LEU D N   1 
ATOM   8853  C  CA  . LEU D  1 223 ? 71.419 2.859   1.554   1.00 39.30 ? 203 LEU D CA  1 
ATOM   8854  C  C   . LEU D  1 223 ? 72.337 2.901   0.354   1.00 39.29 ? 203 LEU D C   1 
ATOM   8855  O  O   . LEU D  1 223 ? 73.224 2.060   0.232   1.00 39.61 ? 203 LEU D O   1 
ATOM   8856  C  CB  . LEU D  1 223 ? 70.312 1.860   1.243   1.00 42.15 ? 203 LEU D CB  1 
ATOM   8857  C  CG  . LEU D  1 223 ? 69.220 1.573   2.254   1.00 33.94 ? 203 LEU D CG  1 
ATOM   8858  C  CD1 . LEU D  1 223 ? 68.101 0.871   1.555   1.00 36.53 ? 203 LEU D CD1 1 
ATOM   8859  C  CD2 . LEU D  1 223 ? 69.808 0.752   3.353   1.00 43.49 ? 203 LEU D CD2 1 
ATOM   8860  N  N   . LYS D  1 224 ? 72.121 3.824   -0.570  1.00 38.74 ? 204 LYS D N   1 
ATOM   8861  C  CA  . LYS D  1 224 ? 73.084 3.957   -1.677  1.00 41.03 ? 204 LYS D CA  1 
ATOM   8862  C  C   . LYS D  1 224 ? 74.441 4.522   -1.136  1.00 42.30 ? 204 LYS D C   1 
ATOM   8863  O  O   . LYS D  1 224 ? 75.513 4.020   -1.488  1.00 42.54 ? 204 LYS D O   1 
ATOM   8864  C  CB  . LYS D  1 224 ? 72.475 4.777   -2.834  1.00 40.64 ? 204 LYS D CB  1 
ATOM   8865  C  CG  . LYS D  1 224 ? 73.458 5.288   -3.914  1.00 42.35 ? 204 LYS D CG  1 
ATOM   8866  C  CD  . LYS D  1 224 ? 73.476 4.484   -5.228  1.00 49.46 ? 204 LYS D CD  1 
ATOM   8867  C  CE  . LYS D  1 224 ? 74.269 3.184   -5.091  1.00 51.82 ? 204 LYS D CE  1 
ATOM   8868  N  NZ  . LYS D  1 224 ? 74.275 2.351   -6.343  1.00 55.80 ? 204 LYS D NZ  1 
ATOM   8869  N  N   . LYS D  1 225 ? 74.396 5.524   -0.252  1.00 41.23 ? 205 LYS D N   1 
ATOM   8870  C  CA  . LYS D  1 225 ? 75.627 6.070   0.340   1.00 42.28 ? 205 LYS D CA  1 
ATOM   8871  C  C   . LYS D  1 225 ? 76.293 5.016   1.247   1.00 42.01 ? 205 LYS D C   1 
ATOM   8872  O  O   . LYS D  1 225 ? 77.514 4.951   1.339   1.00 42.66 ? 205 LYS D O   1 
ATOM   8873  C  CB  . LYS D  1 225 ? 75.384 7.414   1.094   1.00 38.25 ? 205 LYS D CB  1 
ATOM   8874  N  N   . ALA D  1 226 ? 75.499 4.171   1.897   1.00 42.99 ? 206 ALA D N   1 
ATOM   8875  C  CA  . ALA D  1 226 ? 76.059 3.234   2.906   1.00 43.07 ? 206 ALA D CA  1 
ATOM   8876  C  C   . ALA D  1 226 ? 76.831 2.065   2.262   1.00 44.67 ? 206 ALA D C   1 
ATOM   8877  O  O   . ALA D  1 226 ? 77.850 1.617   2.807   1.00 45.23 ? 206 ALA D O   1 
ATOM   8878  C  CB  . ALA D  1 226 ? 74.976 2.726   3.834   1.00 39.95 ? 206 ALA D CB  1 
ATOM   8879  N  N   . SER D  1 227 ? 76.322 1.584   1.120   1.00 43.34 ? 207 SER D N   1 
ATOM   8880  C  CA  . SER D  1 227 ? 77.014 0.638   0.269   1.00 42.35 ? 207 SER D CA  1 
ATOM   8881  C  C   . SER D  1 227 ? 76.724 0.930   -1.208  1.00 43.98 ? 207 SER D C   1 
ATOM   8882  O  O   . SER D  1 227 ? 75.670 0.524   -1.747  1.00 45.02 ? 207 SER D O   1 
ATOM   8883  C  CB  . SER D  1 227 ? 76.601 -0.768  0.604   1.00 40.91 ? 207 SER D CB  1 
ATOM   8884  O  OG  . SER D  1 227 ? 77.389 -1.665  -0.140  1.00 35.89 ? 207 SER D OG  1 
ATOM   8885  N  N   . PRO D  1 228 ? 77.630 1.688   -1.854  1.00 45.26 ? 208 PRO D N   1 
ATOM   8886  C  CA  . PRO D  1 228 ? 77.584 1.954   -3.288  1.00 45.56 ? 208 PRO D CA  1 
ATOM   8887  C  C   . PRO D  1 228 ? 77.547 0.707   -4.191  1.00 46.01 ? 208 PRO D C   1 
ATOM   8888  O  O   . PRO D  1 228 ? 76.937 0.748   -5.253  1.00 45.22 ? 208 PRO D O   1 
ATOM   8889  C  CB  . PRO D  1 228 ? 78.873 2.753   -3.522  1.00 45.35 ? 208 PRO D CB  1 
ATOM   8890  C  CG  . PRO D  1 228 ? 79.107 3.436   -2.249  1.00 42.82 ? 208 PRO D CG  1 
ATOM   8891  C  CD  . PRO D  1 228 ? 78.744 2.424   -1.221  1.00 45.35 ? 208 PRO D CD  1 
ATOM   8892  N  N   . ASP D  1 229 ? 78.212 -0.365  -3.772  1.00 46.92 ? 209 ASP D N   1 
ATOM   8893  C  CA  . ASP D  1 229 ? 78.262 -1.612  -4.534  1.00 49.26 ? 209 ASP D CA  1 
ATOM   8894  C  C   . ASP D  1 229 ? 76.977 -2.427  -4.384  1.00 46.65 ? 209 ASP D C   1 
ATOM   8895  O  O   . ASP D  1 229 ? 76.761 -3.392  -5.103  1.00 46.42 ? 209 ASP D O   1 
ATOM   8896  C  CB  . ASP D  1 229 ? 79.452 -2.479  -4.064  1.00 52.15 ? 209 ASP D CB  1 
ATOM   8897  C  CG  . ASP D  1 229 ? 80.804 -1.966  -4.558  1.00 64.14 ? 209 ASP D CG  1 
ATOM   8898  O  OD1 . ASP D  1 229 ? 81.783 -2.745  -4.437  1.00 76.06 ? 209 ASP D OD1 1 
ATOM   8899  O  OD2 . ASP D  1 229 ? 80.913 -0.803  -5.050  1.00 73.22 ? 209 ASP D OD2 1 
ATOM   8900  N  N   . GLY D  1 230 ? 76.128 -2.034  -3.446  1.00 44.83 ? 210 GLY D N   1 
ATOM   8901  C  CA  . GLY D  1 230 ? 74.950 -2.807  -3.116  1.00 42.70 ? 210 GLY D CA  1 
ATOM   8902  C  C   . GLY D  1 230 ? 75.208 -3.783  -1.982  1.00 41.00 ? 210 GLY D C   1 
ATOM   8903  O  O   . GLY D  1 230 ? 76.242 -3.753  -1.338  1.00 38.39 ? 210 GLY D O   1 
ATOM   8904  N  N   . TYR D  1 231 ? 74.241 -4.664  -1.767  1.00 42.42 ? 211 TYR D N   1 
ATOM   8905  C  CA  . TYR D  1 231 ? 74.214 -5.569  -0.624  1.00 42.10 ? 211 TYR D CA  1 
ATOM   8906  C  C   . TYR D  1 231 ? 74.234 -7.010  -1.086  1.00 40.24 ? 211 TYR D C   1 
ATOM   8907  O  O   . TYR D  1 231 ? 73.444 -7.411  -1.947  1.00 37.08 ? 211 TYR D O   1 
ATOM   8908  C  CB  . TYR D  1 231 ? 72.960 -5.294  0.223   1.00 42.33 ? 211 TYR D CB  1 
ATOM   8909  C  CG  . TYR D  1 231 ? 73.004 -3.907  0.754   1.00 44.86 ? 211 TYR D CG  1 
ATOM   8910  C  CD1 . TYR D  1 231 ? 73.686 -3.622  1.920   1.00 42.27 ? 211 TYR D CD1 1 
ATOM   8911  C  CD2 . TYR D  1 231 ? 72.435 -2.854  0.047   1.00 46.88 ? 211 TYR D CD2 1 
ATOM   8912  C  CE1 . TYR D  1 231 ? 73.790 -2.319  2.377   1.00 43.42 ? 211 TYR D CE1 1 
ATOM   8913  C  CE2 . TYR D  1 231 ? 72.535 -1.542  0.512   1.00 38.34 ? 211 TYR D CE2 1 
ATOM   8914  C  CZ  . TYR D  1 231 ? 73.219 -1.285  1.669   1.00 38.26 ? 211 TYR D CZ  1 
ATOM   8915  O  OH  . TYR D  1 231 ? 73.313 0.012   2.159   1.00 42.66 ? 211 TYR D OH  1 
ATOM   8916  N  N   . ASP D  1 232 ? 75.178 -7.765  -0.520  1.00 40.89 ? 212 ASP D N   1 
ATOM   8917  C  CA  . ASP D  1 232 ? 75.294 -9.199  -0.782  1.00 42.46 ? 212 ASP D CA  1 
ATOM   8918  C  C   . ASP D  1 232 ? 74.164 -9.992  -0.111  1.00 42.83 ? 212 ASP D C   1 
ATOM   8919  O  O   . ASP D  1 232 ? 73.603 -10.930 -0.714  1.00 40.54 ? 212 ASP D O   1 
ATOM   8920  C  CB  . ASP D  1 232 ? 76.655 -9.730  -0.306  1.00 40.36 ? 212 ASP D CB  1 
ATOM   8921  C  CG  . ASP D  1 232 ? 77.807 -9.285  -1.195  1.00 49.11 ? 212 ASP D CG  1 
ATOM   8922  O  OD1 . ASP D  1 232 ? 78.558 -8.352  -0.782  1.00 53.29 ? 212 ASP D OD1 1 
ATOM   8923  O  OD2 . ASP D  1 232 ? 77.958 -9.862  -2.310  1.00 48.94 ? 212 ASP D OD2 1 
ATOM   8924  N  N   . CYS D  1 233 ? 73.847 -9.576  1.122   1.00 43.38 ? 213 CYS D N   1 
ATOM   8925  C  CA  . CYS D  1 233 ? 72.896 -10.246 2.006   1.00 44.35 ? 213 CYS D CA  1 
ATOM   8926  C  C   . CYS D  1 233 ? 72.020 -9.248  2.699   1.00 40.91 ? 213 CYS D C   1 
ATOM   8927  O  O   . CYS D  1 233 ? 72.429 -8.149  2.972   1.00 38.85 ? 213 CYS D O   1 
ATOM   8928  C  CB  . CYS D  1 233 ? 73.619 -11.003 3.132   1.00 44.26 ? 213 CYS D CB  1 
ATOM   8929  S  SG  . CYS D  1 233 ? 74.561 -12.358 2.555   1.00 57.85 ? 213 CYS D SG  1 
ATOM   8930  N  N   . TYR D  1 234 ? 70.820 -9.706  3.008   1.00 41.79 ? 214 TYR D N   1 
ATOM   8931  C  CA  . TYR D  1 234 ? 69.820 -8.950  3.696   1.00 40.18 ? 214 TYR D CA  1 
ATOM   8932  C  C   . TYR D  1 234 ? 69.156 -9.900  4.699   1.00 38.56 ? 214 TYR D C   1 
ATOM   8933  O  O   . TYR D  1 234 ? 68.476 -10.841 4.320   1.00 37.14 ? 214 TYR D O   1 
ATOM   8934  C  CB  . TYR D  1 234 ? 68.822 -8.409  2.672   1.00 41.13 ? 214 TYR D CB  1 
ATOM   8935  C  CG  . TYR D  1 234 ? 67.688 -7.561  3.214   1.00 36.70 ? 214 TYR D CG  1 
ATOM   8936  C  CD1 . TYR D  1 234 ? 67.840 -6.787  4.369   1.00 39.08 ? 214 TYR D CD1 1 
ATOM   8937  C  CD2 . TYR D  1 234 ? 66.461 -7.552  2.578   1.00 37.30 ? 214 TYR D CD2 1 
ATOM   8938  C  CE1 . TYR D  1 234 ? 66.784 -6.026  4.868   1.00 37.14 ? 214 TYR D CE1 1 
ATOM   8939  C  CE2 . TYR D  1 234 ? 65.400 -6.773  3.049   1.00 43.93 ? 214 TYR D CE2 1 
ATOM   8940  C  CZ  . TYR D  1 234 ? 65.561 -6.014  4.199   1.00 37.55 ? 214 TYR D CZ  1 
ATOM   8941  O  OH  . TYR D  1 234 ? 64.507 -5.218  4.635   1.00 41.10 ? 214 TYR D OH  1 
ATOM   8942  N  N   . PHE D  1 235 ? 69.381 -9.629  5.971   1.00 38.99 ? 215 PHE D N   1 
ATOM   8943  C  CA  . PHE D  1 235 ? 68.675 -10.280 7.057   1.00 38.02 ? 215 PHE D CA  1 
ATOM   8944  C  C   . PHE D  1 235 ? 67.438 -9.439  7.417   1.00 38.70 ? 215 PHE D C   1 
ATOM   8945  O  O   . PHE D  1 235 ? 67.527 -8.419  8.069   1.00 37.75 ? 215 PHE D O   1 
ATOM   8946  C  CB  . PHE D  1 235 ? 69.606 -10.437 8.257   1.00 37.45 ? 215 PHE D CB  1 
ATOM   8947  C  CG  . PHE D  1 235 ? 69.106 -11.416 9.290   1.00 36.94 ? 215 PHE D CG  1 
ATOM   8948  C  CD1 . PHE D  1 235 ? 69.703 -12.680 9.420   1.00 39.47 ? 215 PHE D CD1 1 
ATOM   8949  C  CD2 . PHE D  1 235 ? 68.031 -11.087 10.130  1.00 40.40 ? 215 PHE D CD2 1 
ATOM   8950  C  CE1 . PHE D  1 235 ? 69.255 -13.601 10.380  1.00 38.46 ? 215 PHE D CE1 1 
ATOM   8951  C  CE2 . PHE D  1 235 ? 67.579 -11.988 11.098  1.00 44.57 ? 215 PHE D CE2 1 
ATOM   8952  C  CZ  . PHE D  1 235 ? 68.197 -13.256 11.227  1.00 42.42 ? 215 PHE D CZ  1 
ATOM   8953  N  N   . ASP D  1 236 ? 66.268 -9.902  6.970   1.00 42.55 ? 216 ASP D N   1 
ATOM   8954  C  CA  . ASP D  1 236 ? 65.030 -9.145  7.044   1.00 42.01 ? 216 ASP D CA  1 
ATOM   8955  C  C   . ASP D  1 236 ? 64.099 -9.495  8.239   1.00 44.21 ? 216 ASP D C   1 
ATOM   8956  O  O   . ASP D  1 236 ? 63.521 -10.609 8.292   1.00 41.80 ? 216 ASP D O   1 
ATOM   8957  C  CB  . ASP D  1 236 ? 64.264 -9.342  5.745   1.00 42.04 ? 216 ASP D CB  1 
ATOM   8958  C  CG  . ASP D  1 236 ? 63.067 -8.394  5.618   1.00 50.79 ? 216 ASP D CG  1 
ATOM   8959  O  OD1 . ASP D  1 236 ? 63.017 -7.325  6.320   1.00 47.31 ? 216 ASP D OD1 1 
ATOM   8960  O  OD2 . ASP D  1 236 ? 62.173 -8.740  4.810   1.00 49.82 ? 216 ASP D OD2 1 
ATOM   8961  N  N   . ASN D  1 237 ? 63.919 -8.504  9.142   1.00 43.54 ? 217 ASN D N   1 
ATOM   8962  C  CA  . ASN D  1 237 ? 62.977 -8.585  10.253  1.00 44.43 ? 217 ASN D CA  1 
ATOM   8963  C  C   . ASN D  1 237 ? 61.781 -7.699  10.093  1.00 43.68 ? 217 ASN D C   1 
ATOM   8964  O  O   . ASN D  1 237 ? 60.854 -7.795  10.887  1.00 43.57 ? 217 ASN D O   1 
ATOM   8965  C  CB  . ASN D  1 237 ? 63.646 -8.164  11.575  1.00 47.16 ? 217 ASN D CB  1 
ATOM   8966  C  CG  . ASN D  1 237 ? 64.680 -9.133  12.020  1.00 49.86 ? 217 ASN D CG  1 
ATOM   8967  O  OD1 . ASN D  1 237 ? 64.344 -10.307 12.225  1.00 53.61 ? 217 ASN D OD1 1 
ATOM   8968  N  ND2 . ASN D  1 237 ? 65.961 -8.682  12.129  1.00 40.44 ? 217 ASN D ND2 1 
ATOM   8969  N  N   . VAL D  1 238 ? 61.801 -6.771  9.148   1.00 45.15 ? 218 VAL D N   1 
ATOM   8970  C  CA  . VAL D  1 238 ? 60.756 -5.745  9.175   1.00 44.17 ? 218 VAL D CA  1 
ATOM   8971  C  C   . VAL D  1 238 ? 59.750 -5.897  8.099   1.00 42.91 ? 218 VAL D C   1 
ATOM   8972  O  O   . VAL D  1 238 ? 58.593 -5.714  8.346   1.00 45.14 ? 218 VAL D O   1 
ATOM   8973  C  CB  . VAL D  1 238 ? 61.265 -4.263  9.363   1.00 47.67 ? 218 VAL D CB  1 
ATOM   8974  C  CG1 . VAL D  1 238 ? 62.375 -4.212  10.421  1.00 44.18 ? 218 VAL D CG1 1 
ATOM   8975  C  CG2 . VAL D  1 238 ? 61.655 -3.574  8.048   1.00 55.96 ? 218 VAL D CG2 1 
ATOM   8976  N  N   . GLY D  1 239 ? 60.172 -6.284  6.916   1.00 45.36 ? 219 GLY D N   1 
ATOM   8977  C  CA  . GLY D  1 239 ? 59.255 -6.437  5.807   1.00 44.82 ? 219 GLY D CA  1 
ATOM   8978  C  C   . GLY D  1 239 ? 58.829 -5.088  5.249   1.00 47.22 ? 219 GLY D C   1 
ATOM   8979  O  O   . GLY D  1 239 ? 59.471 -4.057  5.508   1.00 47.01 ? 219 GLY D O   1 
ATOM   8980  N  N   . GLY D  1 240 ? 57.751 -5.118  4.463   1.00 48.33 ? 220 GLY D N   1 
ATOM   8981  C  CA  . GLY D  1 240 ? 57.071 -3.910  3.972   1.00 49.62 ? 220 GLY D CA  1 
ATOM   8982  C  C   . GLY D  1 240 ? 57.846 -3.114  2.938   1.00 50.64 ? 220 GLY D C   1 
ATOM   8983  O  O   . GLY D  1 240 ? 58.678 -3.659  2.222   1.00 53.25 ? 220 GLY D O   1 
ATOM   8984  N  N   . GLU D  1 241 ? 57.581 -1.811  2.910   1.00 51.89 ? 221 GLU D N   1 
ATOM   8985  C  CA  . GLU D  1 241 ? 58.226 -0.857  2.000   1.00 52.61 ? 221 GLU D CA  1 
ATOM   8986  C  C   . GLU D  1 241 ? 59.713 -0.663  2.263   1.00 47.77 ? 221 GLU D C   1 
ATOM   8987  O  O   . GLU D  1 241 ? 60.459 -0.277  1.360   1.00 46.52 ? 221 GLU D O   1 
ATOM   8988  C  CB  . GLU D  1 241 ? 57.540 0.518   2.144   1.00 54.55 ? 221 GLU D CB  1 
ATOM   8989  C  CG  . GLU D  1 241 ? 56.023 0.523   1.879   1.00 64.96 ? 221 GLU D CG  1 
ATOM   8990  C  CD  . GLU D  1 241 ? 55.641 0.762   0.411   1.00 76.29 ? 221 GLU D CD  1 
ATOM   8991  O  OE1 . GLU D  1 241 ? 54.534 1.326   0.196   1.00 80.99 ? 221 GLU D OE1 1 
ATOM   8992  O  OE2 . GLU D  1 241 ? 56.430 0.392   -0.508  1.00 79.21 ? 221 GLU D OE2 1 
ATOM   8993  N  N   . PHE D  1 242 ? 60.127 -0.841  3.516   1.00 46.32 ? 222 PHE D N   1 
ATOM   8994  C  CA  . PHE D  1 242 ? 61.555 -0.857  3.857   1.00 45.83 ? 222 PHE D CA  1 
ATOM   8995  C  C   . PHE D  1 242 ? 62.247 -1.902  3.022   1.00 43.40 ? 222 PHE D C   1 
ATOM   8996  O  O   . PHE D  1 242 ? 63.245 -1.634  2.362   1.00 40.63 ? 222 PHE D O   1 
ATOM   8997  C  CB  . PHE D  1 242 ? 61.795 -1.221  5.328   1.00 48.61 ? 222 PHE D CB  1 
ATOM   8998  C  CG  . PHE D  1 242 ? 63.211 -1.019  5.755   1.00 48.95 ? 222 PHE D CG  1 
ATOM   8999  C  CD1 . PHE D  1 242 ? 63.560 0.090   6.530   1.00 53.24 ? 222 PHE D CD1 1 
ATOM   9000  C  CD2 . PHE D  1 242 ? 64.218 -1.889  5.330   1.00 49.74 ? 222 PHE D CD2 1 
ATOM   9001  C  CE1 . PHE D  1 242 ? 64.879 0.311   6.899   1.00 49.35 ? 222 PHE D CE1 1 
ATOM   9002  C  CE2 . PHE D  1 242 ? 65.553 -1.675  5.679   1.00 50.37 ? 222 PHE D CE2 1 
ATOM   9003  C  CZ  . PHE D  1 242 ? 65.884 -0.566  6.469   1.00 49.07 ? 222 PHE D CZ  1 
ATOM   9004  N  N   . SER D  1 243 ? 61.700 -3.110  3.055   1.00 41.56 ? 223 SER D N   1 
ATOM   9005  C  CA  . SER D  1 243 ? 62.269 -4.204  2.289   1.00 41.78 ? 223 SER D CA  1 
ATOM   9006  C  C   . SER D  1 243 ? 62.241 -3.961  0.767   1.00 39.92 ? 223 SER D C   1 
ATOM   9007  O  O   . SER D  1 243 ? 63.170 -4.343  0.058   1.00 37.55 ? 223 SER D O   1 
ATOM   9008  C  CB  . SER D  1 243 ? 61.603 -5.520  2.686   1.00 42.13 ? 223 SER D CB  1 
ATOM   9009  O  OG  . SER D  1 243 ? 62.066 -5.918  3.981   1.00 45.05 ? 223 SER D OG  1 
ATOM   9010  N  N   . ASN D  1 244 ? 61.202 -3.310  0.275   1.00 39.05 ? 224 ASN D N   1 
ATOM   9011  C  CA  . ASN D  1 244 ? 61.105 -3.009  -1.151  1.00 42.73 ? 224 ASN D CA  1 
ATOM   9012  C  C   . ASN D  1 244 ? 62.270 -2.173  -1.651  1.00 43.89 ? 224 ASN D C   1 
ATOM   9013  O  O   . ASN D  1 244 ? 62.792 -2.404  -2.746  1.00 48.38 ? 224 ASN D O   1 
ATOM   9014  C  CB  . ASN D  1 244 ? 59.752 -2.349  -1.473  1.00 42.28 ? 224 ASN D CB  1 
ATOM   9015  C  CG  . ASN D  1 244 ? 58.582 -3.291  -1.200  1.00 44.22 ? 224 ASN D CG  1 
ATOM   9016  O  OD1 . ASN D  1 244 ? 58.780 -4.495  -0.930  1.00 45.99 ? 224 ASN D OD1 1 
ATOM   9017  N  ND2 . ASN D  1 244 ? 57.374 -2.750  -1.224  1.00 42.88 ? 224 ASN D ND2 1 
ATOM   9018  N  N   . THR D  1 245 ? 62.669 -1.221  -0.821  1.00 44.99 ? 225 THR D N   1 
ATOM   9019  C  CA  . THR D  1 245 ? 63.749 -0.301  -1.092  1.00 44.38 ? 225 THR D CA  1 
ATOM   9020  C  C   . THR D  1 245 ? 65.058 -1.033  -1.045  1.00 43.95 ? 225 THR D C   1 
ATOM   9021  O  O   . THR D  1 245 ? 65.887 -0.897  -1.941  1.00 46.23 ? 225 THR D O   1 
ATOM   9022  C  CB  . THR D  1 245 ? 63.712 0.812   -0.036  1.00 45.66 ? 225 THR D CB  1 
ATOM   9023  O  OG1 . THR D  1 245 ? 62.385 1.341   -0.008  1.00 45.90 ? 225 THR D OG1 1 
ATOM   9024  C  CG2 . THR D  1 245 ? 64.710 1.917   -0.311  1.00 42.94 ? 225 THR D CG2 1 
ATOM   9025  N  N   . VAL D  1 246 ? 65.247 -1.836  -0.013  1.00 43.00 ? 226 VAL D N   1 
ATOM   9026  C  CA  . VAL D  1 246 ? 66.454 -2.650  0.078   1.00 43.69 ? 226 VAL D CA  1 
ATOM   9027  C  C   . VAL D  1 246 ? 66.629 -3.567  -1.162  1.00 43.51 ? 226 VAL D C   1 
ATOM   9028  O  O   . VAL D  1 246 ? 67.703 -3.619  -1.720  1.00 44.60 ? 226 VAL D O   1 
ATOM   9029  C  CB  . VAL D  1 246 ? 66.517 -3.509  1.375   1.00 40.50 ? 226 VAL D CB  1 
ATOM   9030  C  CG1 . VAL D  1 246 ? 67.745 -4.361  1.332   1.00 45.94 ? 226 VAL D CG1 1 
ATOM   9031  C  CG2 . VAL D  1 246 ? 66.555 -2.645  2.587   1.00 39.51 ? 226 VAL D CG2 1 
ATOM   9032  N  N   . ILE D  1 247 ? 65.579 -4.263  -1.578  1.00 42.21 ? 227 ILE D N   1 
ATOM   9033  C  CA  . ILE D  1 247 ? 65.626 -5.128  -2.748  1.00 44.59 ? 227 ILE D CA  1 
ATOM   9034  C  C   . ILE D  1 247 ? 66.143 -4.443  -4.023  1.00 45.31 ? 227 ILE D C   1 
ATOM   9035  O  O   . ILE D  1 247 ? 66.834 -5.080  -4.855  1.00 47.53 ? 227 ILE D O   1 
ATOM   9036  C  CB  . ILE D  1 247 ? 64.233 -5.781  -2.995  1.00 46.21 ? 227 ILE D CB  1 
ATOM   9037  C  CG1 . ILE D  1 247 ? 64.024 -6.900  -1.976  1.00 48.28 ? 227 ILE D CG1 1 
ATOM   9038  C  CG2 . ILE D  1 247 ? 64.074 -6.329  -4.457  1.00 43.48 ? 227 ILE D CG2 1 
ATOM   9039  C  CD1 . ILE D  1 247 ? 62.592 -7.294  -1.820  1.00 49.66 ? 227 ILE D CD1 1 
ATOM   9040  N  N   . GLY D  1 248 ? 65.811 -3.164  -4.181  1.00 42.85 ? 228 GLY D N   1 
ATOM   9041  C  CA  . GLY D  1 248 ? 66.393 -2.348  -5.249  1.00 43.11 ? 228 GLY D CA  1 
ATOM   9042  C  C   . GLY D  1 248 ? 67.895 -2.084  -5.150  1.00 42.28 ? 228 GLY D C   1 
ATOM   9043  O  O   . GLY D  1 248 ? 68.467 -1.522  -6.072  1.00 40.78 ? 228 GLY D O   1 
ATOM   9044  N  N   . GLN D  1 249 ? 68.530 -2.492  -4.045  1.00 43.58 ? 229 GLN D N   1 
ATOM   9045  C  CA  . GLN D  1 249 ? 69.972 -2.275  -3.815  1.00 44.95 ? 229 GLN D CA  1 
ATOM   9046  C  C   . GLN D  1 249 ? 70.749 -3.571  -3.674  1.00 43.51 ? 229 GLN D C   1 
ATOM   9047  O  O   . GLN D  1 249 ? 71.950 -3.554  -3.369  1.00 41.96 ? 229 GLN D O   1 
ATOM   9048  C  CB  . GLN D  1 249 ? 70.209 -1.483  -2.510  1.00 48.88 ? 229 GLN D CB  1 
ATOM   9049  C  CG  . GLN D  1 249 ? 69.245 -0.334  -2.229  1.00 55.14 ? 229 GLN D CG  1 
ATOM   9050  C  CD  . GLN D  1 249 ? 69.773 1.000   -2.683  1.00 53.83 ? 229 GLN D CD  1 
ATOM   9051  O  OE1 . GLN D  1 249 ? 70.914 1.355   -2.405  1.00 55.18 ? 229 GLN D OE1 1 
ATOM   9052  N  NE2 . GLN D  1 249 ? 68.935 1.757   -3.360  1.00 51.39 ? 229 GLN D NE2 1 
ATOM   9053  N  N   . MET D  1 250 ? 70.060 -4.688  -3.850  1.00 42.43 ? 230 MET D N   1 
ATOM   9054  C  CA  . MET D  1 250 ? 70.669 -5.995  -3.735  1.00 40.51 ? 230 MET D CA  1 
ATOM   9055  C  C   . MET D  1 250 ? 71.584 -6.259  -4.919  1.00 42.52 ? 230 MET D C   1 
ATOM   9056  O  O   . MET D  1 250 ? 71.321 -5.832  -6.055  1.00 41.95 ? 230 MET D O   1 
ATOM   9057  C  CB  . MET D  1 250 ? 69.592 -7.103  -3.647  1.00 37.69 ? 230 MET D CB  1 
ATOM   9058  C  CG  . MET D  1 250 ? 68.786 -7.083  -2.315  1.00 35.45 ? 230 MET D CG  1 
ATOM   9059  S  SD  . MET D  1 250 ? 69.739 -7.349  -0.824  1.00 42.13 ? 230 MET D SD  1 
ATOM   9060  C  CE  . MET D  1 250 ? 70.457 -8.940  -1.185  1.00 36.03 ? 230 MET D CE  1 
ATOM   9061  N  N   . LYS D  1 251 ? 72.660 -6.990  -4.648  1.00 43.69 ? 231 LYS D N   1 
ATOM   9062  C  CA  . LYS D  1 251 ? 73.541 -7.417  -5.712  1.00 44.10 ? 231 LYS D CA  1 
ATOM   9063  C  C   . LYS D  1 251 ? 72.874 -8.561  -6.499  1.00 42.15 ? 231 LYS D C   1 
ATOM   9064  O  O   . LYS D  1 251 ? 71.937 -9.191  -6.031  1.00 41.35 ? 231 LYS D O   1 
ATOM   9065  C  CB  . LYS D  1 251 ? 74.902 -7.855  -5.143  1.00 45.49 ? 231 LYS D CB  1 
ATOM   9066  C  CG  . LYS D  1 251 ? 75.743 -6.698  -4.605  1.00 43.22 ? 231 LYS D CG  1 
ATOM   9067  C  CD  . LYS D  1 251 ? 77.199 -7.096  -4.374  1.00 46.48 ? 231 LYS D CD  1 
ATOM   9068  C  CE  . LYS D  1 251 ? 77.943 -6.014  -3.599  1.00 51.33 ? 231 LYS D CE  1 
ATOM   9069  N  NZ  . LYS D  1 251 ? 79.383 -6.314  -3.341  1.00 58.18 ? 231 LYS D NZ  1 
ATOM   9070  N  N   . LYS D  1 252 ? 73.363 -8.782  -7.710  1.00 39.85 ? 232 LYS D N   1 
ATOM   9071  C  CA  . LYS D  1 252 ? 72.995 -9.907  -8.511  1.00 38.04 ? 232 LYS D CA  1 
ATOM   9072  C  C   . LYS D  1 252 ? 73.211 -11.157 -7.686  1.00 38.07 ? 232 LYS D C   1 
ATOM   9073  O  O   . LYS D  1 252 ? 74.264 -11.305 -7.088  1.00 37.84 ? 232 LYS D O   1 
ATOM   9074  C  CB  . LYS D  1 252 ? 73.865 -9.915  -9.776  1.00 39.96 ? 232 LYS D CB  1 
ATOM   9075  C  CG  . LYS D  1 252 ? 73.449 -10.830 -10.888 1.00 41.86 ? 232 LYS D CG  1 
ATOM   9076  C  CD  . LYS D  1 252 ? 72.399 -10.205 -11.768 1.00 50.61 ? 232 LYS D CD  1 
ATOM   9077  C  CE  . LYS D  1 252 ? 72.303 -10.981 -13.090 1.00 56.87 ? 232 LYS D CE  1 
ATOM   9078  N  NZ  . LYS D  1 252 ? 73.393 -10.587 -14.071 1.00 55.91 ? 232 LYS D NZ  1 
ATOM   9079  N  N   . PHE D  1 253 ? 72.217 -12.058 -7.676  1.00 37.65 ? 233 PHE D N   1 
ATOM   9080  C  CA  . PHE D  1 253 ? 72.235 -13.266 -6.858  1.00 38.81 ? 233 PHE D CA  1 
ATOM   9081  C  C   . PHE D  1 253 ? 72.306 -12.992 -5.337  1.00 39.11 ? 233 PHE D C   1 
ATOM   9082  O  O   . PHE D  1 253 ? 72.803 -13.827 -4.589  1.00 40.24 ? 233 PHE D O   1 
ATOM   9083  C  CB  . PHE D  1 253 ? 73.391 -14.207 -7.216  1.00 39.01 ? 233 PHE D CB  1 
ATOM   9084  C  CG  . PHE D  1 253 ? 73.554 -14.446 -8.679  1.00 40.29 ? 233 PHE D CG  1 
ATOM   9085  C  CD1 . PHE D  1 253 ? 72.534 -15.037 -9.402  1.00 31.84 ? 233 PHE D CD1 1 
ATOM   9086  C  CD2 . PHE D  1 253 ? 74.749 -14.104 -9.328  1.00 31.69 ? 233 PHE D CD2 1 
ATOM   9087  C  CE1 . PHE D  1 253 ? 72.670 -15.261 -10.748 1.00 40.38 ? 233 PHE D CE1 1 
ATOM   9088  C  CE2 . PHE D  1 253 ? 74.872 -14.309 -10.682 1.00 35.61 ? 233 PHE D CE2 1 
ATOM   9089  C  CZ  . PHE D  1 253 ? 73.835 -14.901 -11.390 1.00 37.42 ? 233 PHE D CZ  1 
ATOM   9090  N  N   . GLY D  1 254 ? 71.790 -11.857 -4.891  1.00 37.68 ? 234 GLY D N   1 
ATOM   9091  C  CA  . GLY D  1 254 ? 71.776 -11.548 -3.479  1.00 39.42 ? 234 GLY D CA  1 
ATOM   9092  C  C   . GLY D  1 254 ? 70.772 -12.421 -2.747  1.00 40.02 ? 234 GLY D C   1 
ATOM   9093  O  O   . GLY D  1 254 ? 69.877 -12.978 -3.345  1.00 42.06 ? 234 GLY D O   1 
ATOM   9094  N  N   . ARG D  1 255 ? 70.932 -12.531 -1.442  1.00 40.63 ? 235 ARG D N   1 
ATOM   9095  C  CA  . ARG D  1 255 ? 70.244 -13.510 -0.659  1.00 44.28 ? 235 ARG D CA  1 
ATOM   9096  C  C   . ARG D  1 255 ? 69.614 -12.766 0.493   1.00 43.13 ? 235 ARG D C   1 
ATOM   9097  O  O   . ARG D  1 255 ? 70.288 -12.005 1.141   1.00 41.57 ? 235 ARG D O   1 
ATOM   9098  C  CB  . ARG D  1 255 ? 71.236 -14.563 -0.166  1.00 46.76 ? 235 ARG D CB  1 
ATOM   9099  C  CG  . ARG D  1 255 ? 72.253 -14.856 -1.234  1.00 49.85 ? 235 ARG D CG  1 
ATOM   9100  C  CD  . ARG D  1 255 ? 73.195 -15.971 -0.979  1.00 51.89 ? 235 ARG D CD  1 
ATOM   9101  N  NE  . ARG D  1 255 ? 74.285 -15.729 -0.026  1.00 66.30 ? 235 ARG D NE  1 
ATOM   9102  C  CZ  . ARG D  1 255 ? 75.287 -14.836 -0.128  1.00 64.70 ? 235 ARG D CZ  1 
ATOM   9103  N  NH1 . ARG D  1 255 ? 75.395 -13.982 -1.152  1.00 63.47 ? 235 ARG D NH1 1 
ATOM   9104  N  NH2 . ARG D  1 255 ? 76.206 -14.808 0.843   1.00 53.65 ? 235 ARG D NH2 1 
ATOM   9105  N  N   . ILE D  1 256 ? 68.300 -12.977 0.662   1.00 41.96 ? 236 ILE D N   1 
ATOM   9106  C  CA  . ILE D  1 256 ? 67.499 -12.458 1.734   1.00 41.33 ? 236 ILE D CA  1 
ATOM   9107  C  C   . ILE D  1 256 ? 67.082 -13.609 2.647   1.00 39.69 ? 236 ILE D C   1 
ATOM   9108  O  O   . ILE D  1 256 ? 66.576 -14.575 2.172   1.00 36.43 ? 236 ILE D O   1 
ATOM   9109  C  CB  . ILE D  1 256 ? 66.225 -11.802 1.183   1.00 40.80 ? 236 ILE D CB  1 
ATOM   9110  C  CG1 . ILE D  1 256 ? 66.585 -10.900 -0.008  1.00 36.80 ? 236 ILE D CG1 1 
ATOM   9111  C  CG2 . ILE D  1 256 ? 65.491 -11.068 2.299   1.00 43.85 ? 236 ILE D CG2 1 
ATOM   9112  C  CD1 . ILE D  1 256 ? 65.451 -10.178 -0.605  1.00 42.94 ? 236 ILE D CD1 1 
ATOM   9113  N  N   . ALA D  1 257 ? 67.349 -13.485 3.943   1.00 39.83 ? 237 ALA D N   1 
ATOM   9114  C  CA  . ALA D  1 257 ? 66.778 -14.362 4.946   1.00 40.50 ? 237 ALA D CA  1 
ATOM   9115  C  C   . ALA D  1 257 ? 65.542 -13.663 5.519   1.00 39.96 ? 237 ALA D C   1 
ATOM   9116  O  O   . ALA D  1 257 ? 65.649 -12.646 6.169   1.00 40.01 ? 237 ALA D O   1 
ATOM   9117  C  CB  . ALA D  1 257 ? 67.784 -14.637 6.048   1.00 40.36 ? 237 ALA D CB  1 
ATOM   9118  N  N   . ILE D  1 258 ? 64.374 -14.217 5.245   1.00 41.34 ? 238 ILE D N   1 
ATOM   9119  C  CA  . ILE D  1 258 ? 63.128 -13.739 5.799   1.00 42.76 ? 238 ILE D CA  1 
ATOM   9120  C  C   . ILE D  1 258 ? 62.859 -14.425 7.155   1.00 39.94 ? 238 ILE D C   1 
ATOM   9121  O  O   . ILE D  1 258 ? 62.512 -15.561 7.289   1.00 40.18 ? 238 ILE D O   1 
ATOM   9122  C  CB  . ILE D  1 258 ? 61.984 -13.890 4.803   1.00 40.38 ? 238 ILE D CB  1 
ATOM   9123  C  CG1 . ILE D  1 258 ? 62.413 -13.275 3.472   1.00 49.47 ? 238 ILE D CG1 1 
ATOM   9124  C  CG2 . ILE D  1 258 ? 60.729 -13.157 5.331   1.00 45.07 ? 238 ILE D CG2 1 
ATOM   9125  C  CD1 . ILE D  1 258 ? 61.463 -13.550 2.335   1.00 48.73 ? 238 ILE D CD1 1 
ATOM   9126  N  N   . CYS D  1 259 ? 63.008 -13.634 8.163   1.00 45.93 ? 239 CYS D N   1 
ATOM   9127  C  CA  . CYS D  1 259 ? 62.987 -14.051 9.516   1.00 46.14 ? 239 CYS D CA  1 
ATOM   9128  C  C   . CYS D  1 259 ? 61.649 -13.562 10.174  1.00 48.03 ? 239 CYS D C   1 
ATOM   9129  O  O   . CYS D  1 259 ? 60.960 -14.335 10.869  1.00 47.28 ? 239 CYS D O   1 
ATOM   9130  C  CB  . CYS D  1 259 ? 64.225 -13.390 10.122  1.00 46.56 ? 239 CYS D CB  1 
ATOM   9131  S  SG  . CYS D  1 259 ? 64.287 -13.560 11.811  1.00 49.84 ? 239 CYS D SG  1 
ATOM   9132  N  N   . GLY D  1 260 ? 61.307 -12.284 9.931   1.00 45.79 ? 240 GLY D N   1 
ATOM   9133  C  CA  . GLY D  1 260 ? 60.087 -11.648 10.420  1.00 44.49 ? 240 GLY D CA  1 
ATOM   9134  C  C   . GLY D  1 260 ? 59.658 -10.531 9.494   1.00 44.16 ? 240 GLY D C   1 
ATOM   9135  O  O   . GLY D  1 260 ? 60.321 -10.231 8.503   1.00 45.05 ? 240 GLY D O   1 
ATOM   9136  N  N   . ALA D  1 261 ? 58.521 -9.936  9.809   1.00 43.12 ? 241 ALA D N   1 
ATOM   9137  C  CA  . ALA D  1 261 ? 57.971 -8.833  9.057   1.00 42.31 ? 241 ALA D CA  1 
ATOM   9138  C  C   . ALA D  1 261 ? 57.203 -7.922  10.010  1.00 40.93 ? 241 ALA D C   1 
ATOM   9139  O  O   . ALA D  1 261 ? 55.993 -7.762  9.863   1.00 40.80 ? 241 ALA D O   1 
ATOM   9140  C  CB  . ALA D  1 261 ? 57.051 -9.334  7.965   1.00 42.48 ? 241 ALA D CB  1 
ATOM   9141  N  N   . ILE D  1 262 ? 57.926 -7.315  10.952  1.00 42.23 ? 242 ILE D N   1 
ATOM   9142  C  CA  . ILE D  1 262 ? 57.323 -6.722  12.145  1.00 45.18 ? 242 ILE D CA  1 
ATOM   9143  C  C   . ILE D  1 262 ? 56.614 -5.408  11.854  1.00 43.14 ? 242 ILE D C   1 
ATOM   9144  O  O   . ILE D  1 262 ? 55.818 -4.959  12.644  1.00 40.95 ? 242 ILE D O   1 
ATOM   9145  C  CB  . ILE D  1 262 ? 58.345 -6.476  13.279  1.00 44.22 ? 242 ILE D CB  1 
ATOM   9146  C  CG1 . ILE D  1 262 ? 59.246 -5.294  12.926  1.00 51.57 ? 242 ILE D CG1 1 
ATOM   9147  C  CG2 . ILE D  1 262 ? 59.182 -7.700  13.596  1.00 52.36 ? 242 ILE D CG2 1 
ATOM   9148  C  CD1 . ILE D  1 262 ? 60.380 -5.112  13.918  1.00 54.13 ? 242 ILE D CD1 1 
ATOM   9149  N  N   . SER D  1 263 ? 56.951 -4.785  10.731  1.00 44.40 ? 243 SER D N   1 
ATOM   9150  C  CA  . SER D  1 263 ? 56.302 -3.557  10.276  1.00 42.49 ? 243 SER D CA  1 
ATOM   9151  C  C   . SER D  1 263 ? 54.852 -3.830  9.881   1.00 41.80 ? 243 SER D C   1 
ATOM   9152  O  O   . SER D  1 263 ? 54.022 -2.893  9.822   1.00 41.08 ? 243 SER D O   1 
ATOM   9153  C  CB  . SER D  1 263 ? 57.034 -2.937  9.087   1.00 39.12 ? 243 SER D CB  1 
ATOM   9154  O  OG  . SER D  1 263 ? 56.749 -3.681  7.913   1.00 50.79 ? 243 SER D OG  1 
ATOM   9155  N  N   . THR D  1 264 ? 54.541 -5.102  9.660   1.00 41.06 ? 244 THR D N   1 
ATOM   9156  C  CA  . THR D  1 264 ? 53.225 -5.485  9.193   1.00 42.70 ? 244 THR D CA  1 
ATOM   9157  C  C   . THR D  1 264 ? 52.347 -6.021  10.290  1.00 42.55 ? 244 THR D C   1 
ATOM   9158  O  O   . THR D  1 264 ? 51.161 -6.115  10.085  1.00 44.19 ? 244 THR D O   1 
ATOM   9159  C  CB  . THR D  1 264 ? 53.270 -6.558  8.020   1.00 43.06 ? 244 THR D CB  1 
ATOM   9160  O  OG1 . THR D  1 264 ? 53.615 -7.844  8.530   1.00 52.41 ? 244 THR D OG1 1 
ATOM   9161  C  CG2 . THR D  1 264 ? 54.254 -6.168  6.908   1.00 40.53 ? 244 THR D CG2 1 
ATOM   9162  N  N   . TYR D  1 265 ? 52.906 -6.392  11.436  1.00 44.77 ? 245 TYR D N   1 
ATOM   9163  C  CA  . TYR D  1 265 ? 52.139 -7.170  12.422  1.00 45.46 ? 245 TYR D CA  1 
ATOM   9164  C  C   . TYR D  1 265 ? 51.010 -6.373  13.072  1.00 45.08 ? 245 TYR D C   1 
ATOM   9165  O  O   . TYR D  1 265 ? 49.916 -6.892  13.331  1.00 45.51 ? 245 TYR D O   1 
ATOM   9166  C  CB  . TYR D  1 265 ? 53.030 -7.713  13.540  1.00 45.69 ? 245 TYR D CB  1 
ATOM   9167  C  CG  . TYR D  1 265 ? 54.130 -8.667  13.128  1.00 47.63 ? 245 TYR D CG  1 
ATOM   9168  C  CD1 . TYR D  1 265 ? 54.140 -9.296  11.883  1.00 47.35 ? 245 TYR D CD1 1 
ATOM   9169  C  CD2 . TYR D  1 265 ? 55.163 -8.963  14.024  1.00 45.67 ? 245 TYR D CD2 1 
ATOM   9170  C  CE1 . TYR D  1 265 ? 55.197 -10.171 11.539  1.00 53.31 ? 245 TYR D CE1 1 
ATOM   9171  C  CE2 . TYR D  1 265 ? 56.191 -9.819  13.689  1.00 49.62 ? 245 TYR D CE2 1 
ATOM   9172  C  CZ  . TYR D  1 265 ? 56.212 -10.415 12.459  1.00 44.37 ? 245 TYR D CZ  1 
ATOM   9173  O  OH  . TYR D  1 265 ? 57.266 -11.244 12.178  1.00 49.13 ? 245 TYR D OH  1 
ATOM   9174  N  N   . ASN D  1 266 ? 51.290 -5.108  13.328  1.00 43.15 ? 246 ASN D N   1 
ATOM   9175  C  CA  . ASN D  1 266 ? 50.370 -4.263  14.016  1.00 42.99 ? 246 ASN D CA  1 
ATOM   9176  C  C   . ASN D  1 266 ? 49.672 -3.328  13.072  1.00 43.84 ? 246 ASN D C   1 
ATOM   9177  O  O   . ASN D  1 266 ? 49.118 -2.332  13.493  1.00 45.74 ? 246 ASN D O   1 
ATOM   9178  C  CB  . ASN D  1 266 ? 51.130 -3.460  15.065  1.00 42.56 ? 246 ASN D CB  1 
ATOM   9179  C  CG  . ASN D  1 266 ? 51.706 -4.338  16.119  1.00 43.89 ? 246 ASN D CG  1 
ATOM   9180  O  OD1 . ASN D  1 266 ? 50.979 -5.004  16.854  1.00 38.83 ? 246 ASN D OD1 1 
ATOM   9181  N  ND2 . ASN D  1 266 ? 53.011 -4.402  16.167  1.00 40.69 ? 246 ASN D ND2 1 
ATOM   9182  N  N   . ARG D  1 267 ? 49.694 -3.642  11.795  1.00 43.62 ? 247 ARG D N   1 
ATOM   9183  C  CA  . ARG D  1 267 ? 49.317 -2.671  10.801  1.00 45.97 ? 247 ARG D CA  1 
ATOM   9184  C  C   . ARG D  1 267 ? 47.893 -2.984  10.410  1.00 45.81 ? 247 ARG D C   1 
ATOM   9185  O  O   . ARG D  1 267 ? 47.600 -4.130  10.075  1.00 46.23 ? 247 ARG D O   1 
ATOM   9186  C  CB  . ARG D  1 267 ? 50.264 -2.770  9.614   1.00 45.39 ? 247 ARG D CB  1 
ATOM   9187  C  CG  . ARG D  1 267 ? 49.791 -2.153  8.302   1.00 48.00 ? 247 ARG D CG  1 
ATOM   9188  C  CD  . ARG D  1 267 ? 50.805 -2.510  7.196   1.00 51.31 ? 247 ARG D CD  1 
ATOM   9189  N  NE  . ARG D  1 267 ? 51.101 -1.391  6.290   1.00 58.20 ? 247 ARG D NE  1 
ATOM   9190  C  CZ  . ARG D  1 267 ? 50.275 -0.938  5.362   1.00 54.33 ? 247 ARG D CZ  1 
ATOM   9191  N  NH1 . ARG D  1 267 ? 49.080 -1.502  5.244   1.00 65.45 ? 247 ARG D NH1 1 
ATOM   9192  N  NH2 . ARG D  1 267 ? 50.628 0.078   4.557   1.00 45.75 ? 247 ARG D NH2 1 
ATOM   9193  N  N   . THR D  1 268 ? 47.032 -1.950  10.400  1.00 47.28 ? 248 THR D N   1 
ATOM   9194  C  CA  . THR D  1 268 ? 45.591 -2.125  10.179  1.00 43.47 ? 248 THR D CA  1 
ATOM   9195  C  C   . THR D  1 268 ? 45.099 -2.103  8.714   1.00 46.29 ? 248 THR D C   1 
ATOM   9196  O  O   . THR D  1 268 ? 43.925 -2.421  8.441   1.00 50.07 ? 248 THR D O   1 
ATOM   9197  C  CB  . THR D  1 268 ? 44.748 -1.113  11.000  1.00 38.86 ? 248 THR D CB  1 
ATOM   9198  O  OG1 . THR D  1 268 ? 45.182 0.235   10.771  1.00 33.25 ? 248 THR D OG1 1 
ATOM   9199  C  CG2 . THR D  1 268 ? 44.819 -1.416  12.448  1.00 41.69 ? 248 THR D CG2 1 
ATOM   9200  N  N   . GLY D  1 269 ? 45.889 -1.723  7.738   1.00 44.56 ? 249 GLY D N   1 
ATOM   9201  C  CA  . GLY D  1 269 ? 45.247 -1.747  6.390   1.00 49.07 ? 249 GLY D CA  1 
ATOM   9202  C  C   . GLY D  1 269 ? 45.239 -3.121  5.693   1.00 49.29 ? 249 GLY D C   1 
ATOM   9203  O  O   . GLY D  1 269 ? 45.551 -4.157  6.297   1.00 49.95 ? 249 GLY D O   1 
ATOM   9204  N  N   . PRO D  1 270 ? 44.935 -3.132  4.389   1.00 49.74 ? 250 PRO D N   1 
ATOM   9205  C  CA  . PRO D  1 270 ? 45.608 -4.158  3.544   1.00 49.88 ? 250 PRO D CA  1 
ATOM   9206  C  C   . PRO D  1 270 ? 47.118 -4.006  3.589   1.00 51.62 ? 250 PRO D C   1 
ATOM   9207  O  O   . PRO D  1 270 ? 47.591 -2.896  3.740   1.00 52.66 ? 250 PRO D O   1 
ATOM   9208  C  CB  . PRO D  1 270 ? 45.155 -3.820  2.124   1.00 48.01 ? 250 PRO D CB  1 
ATOM   9209  C  CG  . PRO D  1 270 ? 44.633 -2.394  2.220   1.00 54.02 ? 250 PRO D CG  1 
ATOM   9210  C  CD  . PRO D  1 270 ? 44.027 -2.288  3.607   1.00 49.37 ? 250 PRO D CD  1 
ATOM   9211  N  N   . LEU D  1 271 ? 47.859 -5.103  3.406   1.00 50.98 ? 251 LEU D N   1 
ATOM   9212  C  CA  . LEU D  1 271 ? 49.318 -5.064  3.344   1.00 51.20 ? 251 LEU D CA  1 
ATOM   9213  C  C   . LEU D  1 271 ? 49.816 -4.082  2.277   1.00 48.66 ? 251 LEU D C   1 
ATOM   9214  O  O   . LEU D  1 271 ? 49.112 -3.808  1.292   1.00 49.45 ? 251 LEU D O   1 
ATOM   9215  C  CB  . LEU D  1 271 ? 49.874 -6.462  3.021   1.00 53.36 ? 251 LEU D CB  1 
ATOM   9216  C  CG  . LEU D  1 271 ? 49.770 -7.576  4.065   1.00 55.67 ? 251 LEU D CG  1 
ATOM   9217  C  CD1 . LEU D  1 271 ? 49.960 -8.969  3.414   1.00 55.56 ? 251 LEU D CD1 1 
ATOM   9218  C  CD2 . LEU D  1 271 ? 50.764 -7.320  5.180   1.00 59.57 ? 251 LEU D CD2 1 
ATOM   9219  N  N   . PRO D  1 272 ? 51.038 -3.566  2.463   1.00 47.05 ? 252 PRO D N   1 
ATOM   9220  C  CA  . PRO D  1 272 ? 51.588 -2.640  1.491   1.00 48.47 ? 252 PRO D CA  1 
ATOM   9221  C  C   . PRO D  1 272 ? 51.991 -3.371  0.193   1.00 50.73 ? 252 PRO D C   1 
ATOM   9222  O  O   . PRO D  1 272 ? 52.051 -4.635  0.188   1.00 46.70 ? 252 PRO D O   1 
ATOM   9223  C  CB  . PRO D  1 272 ? 52.846 -2.095  2.186   1.00 46.51 ? 252 PRO D CB  1 
ATOM   9224  C  CG  . PRO D  1 272 ? 53.211 -3.098  3.144   1.00 45.90 ? 252 PRO D CG  1 
ATOM   9225  C  CD  . PRO D  1 272 ? 51.992 -3.864  3.553   1.00 44.59 ? 252 PRO D CD  1 
ATOM   9226  N  N   . PRO D  1 273 ? 52.308 -2.581  -0.878  1.00 52.90 ? 253 PRO D N   1 
ATOM   9227  C  CA  . PRO D  1 273 ? 52.780 -3.114  -2.175  1.00 52.90 ? 253 PRO D CA  1 
ATOM   9228  C  C   . PRO D  1 273 ? 53.949 -4.047  -1.988  1.00 55.83 ? 253 PRO D C   1 
ATOM   9229  O  O   . PRO D  1 273 ? 54.863 -3.763  -1.200  1.00 56.22 ? 253 PRO D O   1 
ATOM   9230  C  CB  . PRO D  1 273 ? 53.228 -1.872  -2.958  1.00 51.77 ? 253 PRO D CB  1 
ATOM   9231  C  CG  . PRO D  1 273 ? 52.446 -0.755  -2.373  1.00 55.06 ? 253 PRO D CG  1 
ATOM   9232  C  CD  . PRO D  1 273 ? 52.249 -1.101  -0.890  1.00 52.89 ? 253 PRO D CD  1 
ATOM   9233  N  N   . GLY D  1 274 ? 53.891 -5.165  -2.695  1.00 57.30 ? 254 GLY D N   1 
ATOM   9234  C  CA  . GLY D  1 274 ? 54.941 -6.136  -2.648  1.00 59.46 ? 254 GLY D CA  1 
ATOM   9235  C  C   . GLY D  1 274 ? 56.215 -5.633  -3.308  1.00 60.61 ? 254 GLY D C   1 
ATOM   9236  O  O   . GLY D  1 274 ? 56.245 -4.512  -3.897  1.00 59.39 ? 254 GLY D O   1 
ATOM   9237  N  N   . PRO D  1 275 ? 57.275 -6.462  -3.218  1.00 62.08 ? 255 PRO D N   1 
ATOM   9238  C  CA  . PRO D  1 275 ? 58.566 -6.128  -3.810  1.00 62.34 ? 255 PRO D CA  1 
ATOM   9239  C  C   . PRO D  1 275 ? 58.437 -6.016  -5.319  1.00 62.52 ? 255 PRO D C   1 
ATOM   9240  O  O   . PRO D  1 275 ? 57.675 -6.774  -5.941  1.00 65.31 ? 255 PRO D O   1 
ATOM   9241  C  CB  . PRO D  1 275 ? 59.470 -7.293  -3.398  1.00 63.58 ? 255 PRO D CB  1 
ATOM   9242  C  CG  . PRO D  1 275 ? 58.556 -8.404  -2.957  1.00 62.30 ? 255 PRO D CG  1 
ATOM   9243  C  CD  . PRO D  1 275 ? 57.276 -7.779  -2.536  1.00 62.99 ? 255 PRO D CD  1 
ATOM   9244  N  N   . PRO D  1 276 ? 59.173 -5.084  -5.915  1.00 60.24 ? 256 PRO D N   1 
ATOM   9245  C  CA  . PRO D  1 276 ? 59.017 -4.809  -7.344  1.00 59.04 ? 256 PRO D CA  1 
ATOM   9246  C  C   . PRO D  1 276 ? 59.638 -5.967  -8.172  1.00 58.20 ? 256 PRO D C   1 
ATOM   9247  O  O   . PRO D  1 276 ? 60.876 -6.160  -8.162  1.00 54.97 ? 256 PRO D O   1 
ATOM   9248  C  CB  . PRO D  1 276 ? 59.775 -3.497  -7.546  1.00 60.21 ? 256 PRO D CB  1 
ATOM   9249  C  CG  . PRO D  1 276 ? 60.759 -3.439  -6.392  1.00 62.55 ? 256 PRO D CG  1 
ATOM   9250  C  CD  . PRO D  1 276 ? 60.267 -4.329  -5.291  1.00 58.95 ? 256 PRO D CD  1 
ATOM   9251  N  N   . PRO D  1 277 ? 58.791 -6.724  -8.895  1.00 55.07 ? 257 PRO D N   1 
ATOM   9252  C  CA  . PRO D  1 277 ? 59.205 -8.061  -9.339  1.00 51.26 ? 257 PRO D CA  1 
ATOM   9253  C  C   . PRO D  1 277 ? 60.178 -8.038  -10.518 1.00 47.50 ? 257 PRO D C   1 
ATOM   9254  O  O   . PRO D  1 277 ? 60.916 -8.970  -10.706 1.00 48.70 ? 257 PRO D O   1 
ATOM   9255  C  CB  . PRO D  1 277 ? 57.884 -8.729  -9.758  1.00 51.55 ? 257 PRO D CB  1 
ATOM   9256  C  CG  . PRO D  1 277 ? 56.811 -7.684  -9.648  1.00 50.95 ? 257 PRO D CG  1 
ATOM   9257  C  CD  . PRO D  1 277 ? 57.464 -6.347  -9.430  1.00 54.23 ? 257 PRO D CD  1 
ATOM   9258  N  N   . GLU D  1 278 ? 60.168 -6.984  -11.304 1.00 44.89 ? 258 GLU D N   1 
ATOM   9259  C  CA  . GLU D  1 278 ? 61.113 -6.810  -12.376 1.00 49.26 ? 258 GLU D CA  1 
ATOM   9260  C  C   . GLU D  1 278 ? 62.554 -6.726  -11.842 1.00 47.84 ? 258 GLU D C   1 
ATOM   9261  O  O   . GLU D  1 278 ? 63.475 -7.287  -12.416 1.00 43.52 ? 258 GLU D O   1 
ATOM   9262  C  CB  . GLU D  1 278 ? 60.693 -5.588  -13.192 1.00 50.08 ? 258 GLU D CB  1 
ATOM   9263  C  CG  . GLU D  1 278 ? 59.310 -5.849  -13.936 1.00 60.95 ? 258 GLU D CG  1 
ATOM   9264  C  CD  . GLU D  1 278 ? 58.442 -4.569  -14.203 1.00 59.76 ? 258 GLU D CD  1 
ATOM   9265  O  OE1 . GLU D  1 278 ? 59.020 -3.573  -14.737 1.00 67.88 ? 258 GLU D OE1 1 
ATOM   9266  O  OE2 . GLU D  1 278 ? 57.197 -4.587  -13.894 1.00 56.33 ? 258 GLU D OE2 1 
ATOM   9267  N  N   . ILE D  1 279 ? 62.726 -6.078  -10.695 1.00 47.02 ? 259 ILE D N   1 
ATOM   9268  C  CA  . ILE D  1 279 ? 64.035 -5.968  -10.058 1.00 44.90 ? 259 ILE D CA  1 
ATOM   9269  C  C   . ILE D  1 279 ? 64.498 -7.303  -9.489  1.00 40.41 ? 259 ILE D C   1 
ATOM   9270  O  O   . ILE D  1 279 ? 65.663 -7.666  -9.631  1.00 35.66 ? 259 ILE D O   1 
ATOM   9271  C  CB  . ILE D  1 279 ? 64.030 -4.871  -8.941  1.00 44.83 ? 259 ILE D CB  1 
ATOM   9272  C  CG1 . ILE D  1 279 ? 63.833 -3.501  -9.596  1.00 43.69 ? 259 ILE D CG1 1 
ATOM   9273  C  CG2 . ILE D  1 279 ? 65.336 -4.852  -8.195  1.00 48.71 ? 259 ILE D CG2 1 
ATOM   9274  C  CD1 . ILE D  1 279 ? 63.683 -2.384  -8.654  1.00 47.84 ? 259 ILE D CD1 1 
ATOM   9275  N  N   . VAL D  1 280 ? 63.582 -8.005  -8.838  1.00 37.12 ? 260 VAL D N   1 
ATOM   9276  C  CA  . VAL D  1 280 ? 63.870 -9.293  -8.211  1.00 37.03 ? 260 VAL D CA  1 
ATOM   9277  C  C   . VAL D  1 280 ? 64.290 -10.306 -9.250  1.00 34.64 ? 260 VAL D C   1 
ATOM   9278  O  O   . VAL D  1 280 ? 65.206 -11.057 -9.033  1.00 35.25 ? 260 VAL D O   1 
ATOM   9279  C  CB  . VAL D  1 280 ? 62.638 -9.832  -7.493  1.00 38.53 ? 260 VAL D CB  1 
ATOM   9280  C  CG1 . VAL D  1 280 ? 62.878 -11.257 -7.053  1.00 42.92 ? 260 VAL D CG1 1 
ATOM   9281  C  CG2 . VAL D  1 280 ? 62.242 -8.917  -6.293  1.00 35.07 ? 260 VAL D CG2 1 
ATOM   9282  N  N   . ILE D  1 281 ? 63.638 -10.281 -10.411 1.00 35.96 ? 261 ILE D N   1 
ATOM   9283  C  CA  . ILE D  1 281 ? 63.949 -11.198 -11.506 1.00 36.84 ? 261 ILE D CA  1 
ATOM   9284  C  C   . ILE D  1 281 ? 65.280 -10.888 -12.140 1.00 37.33 ? 261 ILE D C   1 
ATOM   9285  O  O   . ILE D  1 281 ? 66.090 -11.756 -12.409 1.00 39.44 ? 261 ILE D O   1 
ATOM   9286  C  CB  . ILE D  1 281 ? 62.820 -11.203 -12.563 1.00 36.30 ? 261 ILE D CB  1 
ATOM   9287  C  CG1 . ILE D  1 281 ? 61.557 -11.854 -11.974 1.00 33.52 ? 261 ILE D CG1 1 
ATOM   9288  C  CG2 . ILE D  1 281 ? 63.268 -11.921 -13.808 1.00 30.77 ? 261 ILE D CG2 1 
ATOM   9289  C  CD1 . ILE D  1 281 ? 60.290 -11.404 -12.624 1.00 37.16 ? 261 ILE D CD1 1 
ATOM   9290  N  N   . TYR D  1 282 ? 65.496 -9.626  -12.374 1.00 39.33 ? 262 TYR D N   1 
ATOM   9291  C  CA  . TYR D  1 282 ? 66.660 -9.173  -13.075 1.00 41.91 ? 262 TYR D CA  1 
ATOM   9292  C  C   . TYR D  1 282 ? 67.924 -9.380  -12.244 1.00 37.92 ? 262 TYR D C   1 
ATOM   9293  O  O   . TYR D  1 282 ? 68.967 -9.709  -12.777 1.00 38.98 ? 262 TYR D O   1 
ATOM   9294  C  CB  . TYR D  1 282 ? 66.445 -7.700  -13.383 1.00 48.28 ? 262 TYR D CB  1 
ATOM   9295  C  CG  . TYR D  1 282 ? 67.364 -7.111  -14.399 1.00 52.43 ? 262 TYR D CG  1 
ATOM   9296  C  CD1 . TYR D  1 282 ? 67.054 -7.155  -15.758 1.00 55.22 ? 262 TYR D CD1 1 
ATOM   9297  C  CD2 . TYR D  1 282 ? 68.533 -6.455  -13.993 1.00 64.77 ? 262 TYR D CD2 1 
ATOM   9298  C  CE1 . TYR D  1 282 ? 67.910 -6.560  -16.710 1.00 63.26 ? 262 TYR D CE1 1 
ATOM   9299  C  CE2 . TYR D  1 282 ? 69.396 -5.861  -14.919 1.00 68.35 ? 262 TYR D CE2 1 
ATOM   9300  C  CZ  . TYR D  1 282 ? 69.081 -5.909  -16.274 1.00 65.38 ? 262 TYR D CZ  1 
ATOM   9301  O  OH  . TYR D  1 282 ? 69.949 -5.311  -17.163 1.00 63.70 ? 262 TYR D OH  1 
ATOM   9302  N  N   . GLN D  1 283 ? 67.803 -9.171  -10.943 1.00 36.39 ? 263 GLN D N   1 
ATOM   9303  C  CA  . GLN D  1 283 ? 68.873 -9.369  -9.990  1.00 34.93 ? 263 GLN D CA  1 
ATOM   9304  C  C   . GLN D  1 283 ? 69.010 -10.811 -9.526  1.00 35.53 ? 263 GLN D C   1 
ATOM   9305  O  O   . GLN D  1 283 ? 69.903 -11.112 -8.775  1.00 35.11 ? 263 GLN D O   1 
ATOM   9306  C  CB  . GLN D  1 283 ? 68.648 -8.456  -8.790  1.00 34.96 ? 263 GLN D CB  1 
ATOM   9307  C  CG  . GLN D  1 283 ? 68.865 -6.963  -9.132  1.00 38.97 ? 263 GLN D CG  1 
ATOM   9308  C  CD  . GLN D  1 283 ? 70.306 -6.652  -9.637  1.00 40.12 ? 263 GLN D CD  1 
ATOM   9309  O  OE1 . GLN D  1 283 ? 70.537 -6.561  -10.818 1.00 46.52 ? 263 GLN D OE1 1 
ATOM   9310  N  NE2 . GLN D  1 283 ? 71.252 -6.523  -8.726  1.00 43.76 ? 263 GLN D NE2 1 
ATOM   9311  N  N   . GLU D  1 284 ? 68.071 -11.668 -9.945  1.00 39.04 ? 264 GLU D N   1 
ATOM   9312  C  CA  . GLU D  1 284 ? 68.025 -13.111 -9.690  1.00 34.77 ? 264 GLU D CA  1 
ATOM   9313  C  C   . GLU D  1 284 ? 68.215 -13.440 -8.230  1.00 34.74 ? 264 GLU D C   1 
ATOM   9314  O  O   . GLU D  1 284 ? 69.067 -14.251 -7.847  1.00 35.65 ? 264 GLU D O   1 
ATOM   9315  C  CB  . GLU D  1 284 ? 69.014 -13.860 -10.561 1.00 33.41 ? 264 GLU D CB  1 
ATOM   9316  C  CG  . GLU D  1 284 ? 68.820 -13.611 -12.014 1.00 32.33 ? 264 GLU D CG  1 
ATOM   9317  C  CD  . GLU D  1 284 ? 69.717 -14.455 -12.893 1.00 40.17 ? 264 GLU D CD  1 
ATOM   9318  O  OE1 . GLU D  1 284 ? 69.430 -15.687 -13.050 1.00 45.94 ? 264 GLU D OE1 1 
ATOM   9319  O  OE2 . GLU D  1 284 ? 70.693 -13.875 -13.459 1.00 53.86 ? 264 GLU D OE2 1 
ATOM   9320  N  N   . LEU D  1 285 ? 67.372 -12.814 -7.423  1.00 35.31 ? 265 LEU D N   1 
ATOM   9321  C  CA  . LEU D  1 285 ? 67.488 -12.871 -5.996  1.00 37.60 ? 265 LEU D CA  1 
ATOM   9322  C  C   . LEU D  1 285 ? 66.962 -14.189 -5.455  1.00 37.26 ? 265 LEU D C   1 
ATOM   9323  O  O   . LEU D  1 285 ? 66.072 -14.780 -6.053  1.00 37.12 ? 265 LEU D O   1 
ATOM   9324  C  CB  . LEU D  1 285 ? 66.730 -11.667 -5.369  1.00 37.23 ? 265 LEU D CB  1 
ATOM   9325  C  CG  . LEU D  1 285 ? 67.197 -10.262 -5.738  1.00 37.86 ? 265 LEU D CG  1 
ATOM   9326  C  CD1 . LEU D  1 285 ? 66.431 -9.171  -4.950  1.00 39.26 ? 265 LEU D CD1 1 
ATOM   9327  C  CD2 . LEU D  1 285 ? 68.685 -10.126 -5.538  1.00 39.38 ? 265 LEU D CD2 1 
ATOM   9328  N  N   . ARG D  1 286 ? 67.551 -14.634 -4.338  1.00 42.74 ? 266 ARG D N   1 
ATOM   9329  C  CA  . ARG D  1 286 ? 67.119 -15.810 -3.556  1.00 44.04 ? 266 ARG D CA  1 
ATOM   9330  C  C   . ARG D  1 286 ? 66.580 -15.321 -2.229  1.00 43.55 ? 266 ARG D C   1 
ATOM   9331  O  O   . ARG D  1 286 ? 67.251 -14.630 -1.506  1.00 44.19 ? 266 ARG D O   1 
ATOM   9332  C  CB  . ARG D  1 286 ? 68.277 -16.772 -3.283  1.00 44.07 ? 266 ARG D CB  1 
ATOM   9333  C  CG  . ARG D  1 286 ? 67.822 -18.185 -2.745  1.00 47.29 ? 266 ARG D CG  1 
ATOM   9334  C  CD  . ARG D  1 286 ? 68.995 -19.026 -2.077  1.00 50.40 ? 266 ARG D CD  1 
ATOM   9335  N  N   . MET D  1 287 ? 65.342 -15.656 -1.923  1.00 46.46 ? 267 MET D N   1 
ATOM   9336  C  CA  . MET D  1 287 ? 64.752 -15.287 -0.673  1.00 49.67 ? 267 MET D CA  1 
ATOM   9337  C  C   . MET D  1 287 ? 64.299 -16.535 -0.010  1.00 46.78 ? 267 MET D C   1 
ATOM   9338  O  O   . MET D  1 287 ? 63.611 -17.359 -0.600  1.00 48.00 ? 267 MET D O   1 
ATOM   9339  C  CB  . MET D  1 287 ? 63.576 -14.356 -0.898  1.00 49.00 ? 267 MET D CB  1 
ATOM   9340  C  CG  . MET D  1 287 ? 63.901 -13.311 -1.971  1.00 57.90 ? 267 MET D CG  1 
ATOM   9341  S  SD  . MET D  1 287 ? 62.610 -12.079 -2.281  1.00 60.55 ? 267 MET D SD  1 
ATOM   9342  C  CE  . MET D  1 287 ? 63.322 -11.384 -3.758  1.00 70.21 ? 267 MET D CE  1 
ATOM   9343  N  N   . GLU D  1 288 ? 64.659 -16.675 1.237   1.00 42.93 ? 268 GLU D N   1 
ATOM   9344  C  CA  . GLU D  1 288 ? 64.251 -17.843 1.960   1.00 42.33 ? 268 GLU D CA  1 
ATOM   9345  C  C   . GLU D  1 288 ? 63.843 -17.466 3.359   1.00 37.17 ? 268 GLU D C   1 
ATOM   9346  O  O   . GLU D  1 288 ? 64.527 -16.715 4.031   1.00 36.57 ? 268 GLU D O   1 
ATOM   9347  C  CB  . GLU D  1 288 ? 65.411 -18.814 1.972   1.00 43.68 ? 268 GLU D CB  1 
ATOM   9348  C  CG  . GLU D  1 288 ? 65.101 -20.175 2.527   1.00 51.53 ? 268 GLU D CG  1 
ATOM   9349  C  CD  . GLU D  1 288 ? 66.258 -21.133 2.282   1.00 52.68 ? 268 GLU D CD  1 
ATOM   9350  O  OE1 . GLU D  1 288 ? 66.255 -22.210 2.916   1.00 67.32 ? 268 GLU D OE1 1 
ATOM   9351  O  OE2 . GLU D  1 288 ? 67.163 -20.811 1.443   1.00 72.20 ? 268 GLU D OE2 1 
ATOM   9352  N  N   . ALA D  1 289 ? 62.701 -17.988 3.756   1.00 36.08 ? 269 ALA D N   1 
ATOM   9353  C  CA  . ALA D  1 289 ? 62.101 -17.790 5.061   1.00 37.86 ? 269 ALA D CA  1 
ATOM   9354  C  C   . ALA D  1 289 ? 62.456 -18.916 5.982   1.00 37.81 ? 269 ALA D C   1 
ATOM   9355  O  O   . ALA D  1 289 ? 62.801 -19.987 5.561   1.00 41.44 ? 269 ALA D O   1 
ATOM   9356  C  CB  . ALA D  1 289 ? 60.573 -17.673 4.925   1.00 37.59 ? 269 ALA D CB  1 
ATOM   9357  N  N   . PHE D  1 290 ? 62.473 -18.649 7.261   1.00 40.46 ? 270 PHE D N   1 
ATOM   9358  C  CA  . PHE D  1 290 ? 62.899 -19.679 8.181   1.00 41.80 ? 270 PHE D CA  1 
ATOM   9359  C  C   . PHE D  1 290 ? 62.305 -19.386 9.550   1.00 41.54 ? 270 PHE D C   1 
ATOM   9360  O  O   . PHE D  1 290 ? 61.938 -18.266 9.857   1.00 41.55 ? 270 PHE D O   1 
ATOM   9361  C  CB  . PHE D  1 290 ? 64.466 -19.804 8.251   1.00 40.78 ? 270 PHE D CB  1 
ATOM   9362  C  CG  . PHE D  1 290 ? 65.124 -18.630 8.871   1.00 44.46 ? 270 PHE D CG  1 
ATOM   9363  C  CD1 . PHE D  1 290 ? 65.573 -18.681 10.196  1.00 46.79 ? 270 PHE D CD1 1 
ATOM   9364  C  CD2 . PHE D  1 290 ? 65.232 -17.439 8.165   1.00 44.74 ? 270 PHE D CD2 1 
ATOM   9365  C  CE1 . PHE D  1 290 ? 66.154 -17.585 10.788  1.00 50.84 ? 270 PHE D CE1 1 
ATOM   9366  C  CE2 . PHE D  1 290 ? 65.810 -16.309 8.754   1.00 48.80 ? 270 PHE D CE2 1 
ATOM   9367  C  CZ  . PHE D  1 290 ? 66.252 -16.358 10.054  1.00 49.31 ? 270 PHE D CZ  1 
ATOM   9368  N  N   . VAL D  1 291 ? 62.279 -20.443 10.343  1.00 45.85 ? 271 VAL D N   1 
ATOM   9369  C  CA  . VAL D  1 291 ? 61.899 -20.460 11.730  1.00 46.92 ? 271 VAL D CA  1 
ATOM   9370  C  C   . VAL D  1 291 ? 63.037 -21.158 12.497  1.00 44.68 ? 271 VAL D C   1 
ATOM   9371  O  O   . VAL D  1 291 ? 63.484 -22.212 12.083  1.00 44.11 ? 271 VAL D O   1 
ATOM   9372  C  CB  . VAL D  1 291 ? 60.538 -21.205 11.827  1.00 51.45 ? 271 VAL D CB  1 
ATOM   9373  C  CG1 . VAL D  1 291 ? 60.301 -21.824 13.200  1.00 56.78 ? 271 VAL D CG1 1 
ATOM   9374  C  CG2 . VAL D  1 291 ? 59.397 -20.246 11.428  1.00 45.58 ? 271 VAL D CG2 1 
ATOM   9375  N  N   . VAL D  1 292 ? 63.494 -20.567 13.604  1.00 45.17 ? 272 VAL D N   1 
ATOM   9376  C  CA  . VAL D  1 292 ? 64.568 -21.161 14.418  1.00 46.58 ? 272 VAL D CA  1 
ATOM   9377  C  C   . VAL D  1 292 ? 64.464 -22.633 14.788  1.00 45.48 ? 272 VAL D C   1 
ATOM   9378  O  O   . VAL D  1 292 ? 65.492 -23.322 14.871  1.00 43.98 ? 272 VAL D O   1 
ATOM   9379  C  CB  . VAL D  1 292 ? 64.790 -20.523 15.832  1.00 45.09 ? 272 VAL D CB  1 
ATOM   9380  C  CG1 . VAL D  1 292 ? 66.162 -19.980 15.916  1.00 50.12 ? 272 VAL D CG1 1 
ATOM   9381  C  CG2 . VAL D  1 292 ? 63.668 -19.597 16.280  1.00 49.88 ? 272 VAL D CG2 1 
ATOM   9382  N  N   . TYR D  1 293 ? 63.246 -23.077 15.058  1.00 46.09 ? 273 TYR D N   1 
ATOM   9383  C  CA  . TYR D  1 293 ? 62.986 -24.414 15.588  1.00 45.83 ? 273 TYR D CA  1 
ATOM   9384  C  C   . TYR D  1 293 ? 63.291 -25.511 14.622  1.00 44.52 ? 273 TYR D C   1 
ATOM   9385  O  O   . TYR D  1 293 ? 63.250 -26.666 14.982  1.00 46.10 ? 273 TYR D O   1 
ATOM   9386  C  CB  . TYR D  1 293 ? 61.544 -24.513 16.043  1.00 50.00 ? 273 TYR D CB  1 
ATOM   9387  C  CG  . TYR D  1 293 ? 61.143 -23.333 16.894  1.00 48.93 ? 273 TYR D CG  1 
ATOM   9388  C  CD1 . TYR D  1 293 ? 61.748 -23.092 18.148  1.00 60.72 ? 273 TYR D CD1 1 
ATOM   9389  C  CD2 . TYR D  1 293 ? 60.188 -22.426 16.440  1.00 56.73 ? 273 TYR D CD2 1 
ATOM   9390  C  CE1 . TYR D  1 293 ? 61.385 -21.954 18.939  1.00 58.27 ? 273 TYR D CE1 1 
ATOM   9391  C  CE2 . TYR D  1 293 ? 59.824 -21.328 17.193  1.00 56.88 ? 273 TYR D CE2 1 
ATOM   9392  C  CZ  . TYR D  1 293 ? 60.415 -21.082 18.446  1.00 57.13 ? 273 TYR D CZ  1 
ATOM   9393  O  OH  . TYR D  1 293 ? 60.000 -19.949 19.157  1.00 56.74 ? 273 TYR D OH  1 
ATOM   9394  N  N   . ARG D  1 294 ? 63.612 -25.156 13.384  1.00 45.90 ? 274 ARG D N   1 
ATOM   9395  C  CA  . ARG D  1 294 ? 64.067 -26.135 12.405  1.00 46.13 ? 274 ARG D CA  1 
ATOM   9396  C  C   . ARG D  1 294 ? 65.353 -26.826 12.845  1.00 46.37 ? 274 ARG D C   1 
ATOM   9397  O  O   . ARG D  1 294 ? 65.544 -28.000 12.578  1.00 48.41 ? 274 ARG D O   1 
ATOM   9398  C  CB  . ARG D  1 294 ? 64.337 -25.462 11.062  1.00 47.14 ? 274 ARG D CB  1 
ATOM   9399  C  CG  . ARG D  1 294 ? 64.662 -26.444 9.949   1.00 45.45 ? 274 ARG D CG  1 
ATOM   9400  C  CD  . ARG D  1 294 ? 65.474 -25.823 8.820   1.00 43.11 ? 274 ARG D CD  1 
ATOM   9401  N  NE  . ARG D  1 294 ? 64.823 -24.684 8.217   1.00 46.79 ? 274 ARG D NE  1 
ATOM   9402  C  CZ  . ARG D  1 294 ? 65.146 -24.155 7.039   1.00 46.64 ? 274 ARG D CZ  1 
ATOM   9403  N  NH1 . ARG D  1 294 ? 66.145 -24.643 6.334   1.00 50.86 ? 274 ARG D NH1 1 
ATOM   9404  N  NH2 . ARG D  1 294 ? 64.456 -23.129 6.565   1.00 43.18 ? 274 ARG D NH2 1 
ATOM   9405  N  N   . TRP D  1 295 ? 66.266 -26.088 13.462  1.00 46.65 ? 275 TRP D N   1 
ATOM   9406  C  CA  . TRP D  1 295 ? 67.549 -26.687 13.856  1.00 44.83 ? 275 TRP D CA  1 
ATOM   9407  C  C   . TRP D  1 295 ? 67.436 -27.262 15.243  1.00 45.07 ? 275 TRP D C   1 
ATOM   9408  O  O   . TRP D  1 295 ? 67.068 -26.549 16.179  1.00 47.28 ? 275 TRP D O   1 
ATOM   9409  C  CB  . TRP D  1 295 ? 68.683 -25.669 13.777  1.00 41.56 ? 275 TRP D CB  1 
ATOM   9410  C  CG  . TRP D  1 295 ? 68.895 -25.254 12.382  1.00 35.51 ? 275 TRP D CG  1 
ATOM   9411  C  CD1 . TRP D  1 295 ? 69.700 -25.834 11.493  1.00 34.73 ? 275 TRP D CD1 1 
ATOM   9412  C  CD2 . TRP D  1 295 ? 68.232 -24.159 11.689  1.00 43.05 ? 275 TRP D CD2 1 
ATOM   9413  N  NE1 . TRP D  1 295 ? 69.620 -25.175 10.276  1.00 41.80 ? 275 TRP D NE1 1 
ATOM   9414  C  CE2 . TRP D  1 295 ? 68.738 -24.129 10.383  1.00 39.63 ? 275 TRP D CE2 1 
ATOM   9415  C  CE3 . TRP D  1 295 ? 67.301 -23.188 12.069  1.00 40.51 ? 275 TRP D CE3 1 
ATOM   9416  C  CZ2 . TRP D  1 295 ? 68.349 -23.168 9.446   1.00 36.74 ? 275 TRP D CZ2 1 
ATOM   9417  C  CZ3 . TRP D  1 295 ? 66.884 -22.247 11.113  1.00 38.34 ? 275 TRP D CZ3 1 
ATOM   9418  C  CH2 . TRP D  1 295 ? 67.411 -22.250 9.832   1.00 35.49 ? 275 TRP D CH2 1 
ATOM   9419  N  N   . GLN D  1 296 ? 67.714 -28.558 15.344  1.00 47.96 ? 276 GLN D N   1 
ATOM   9420  C  CA  . GLN D  1 296 ? 67.579 -29.304 16.594  1.00 49.33 ? 276 GLN D CA  1 
ATOM   9421  C  C   . GLN D  1 296 ? 68.844 -30.129 16.833  1.00 48.83 ? 276 GLN D C   1 
ATOM   9422  O  O   . GLN D  1 296 ? 69.840 -29.957 16.121  1.00 50.48 ? 276 GLN D O   1 
ATOM   9423  C  CB  . GLN D  1 296 ? 66.287 -30.149 16.549  1.00 49.46 ? 276 GLN D CB  1 
ATOM   9424  C  CG  . GLN D  1 296 ? 64.965 -29.286 16.502  1.00 50.15 ? 276 GLN D CG  1 
ATOM   9425  C  CD  . GLN D  1 296 ? 64.843 -28.319 17.692  1.00 51.09 ? 276 GLN D CD  1 
ATOM   9426  O  OE1 . GLN D  1 296 ? 65.476 -28.511 18.717  1.00 54.05 ? 276 GLN D OE1 1 
ATOM   9427  N  NE2 . GLN D  1 296 ? 64.050 -27.278 17.543  1.00 48.00 ? 276 GLN D NE2 1 
ATOM   9428  N  N   . GLY D  1 297 ? 68.836 -30.979 17.853  1.00 49.53 ? 277 GLY D N   1 
ATOM   9429  C  CA  . GLY D  1 297 ? 69.935 -31.903 18.084  1.00 47.73 ? 277 GLY D CA  1 
ATOM   9430  C  C   . GLY D  1 297 ? 71.270 -31.199 18.226  1.00 48.75 ? 277 GLY D C   1 
ATOM   9431  O  O   . GLY D  1 297 ? 71.386 -30.254 18.980  1.00 50.29 ? 277 GLY D O   1 
ATOM   9432  N  N   . ASP D  1 298 ? 72.268 -31.645 17.475  1.00 50.49 ? 278 ASP D N   1 
ATOM   9433  C  CA  . ASP D  1 298 ? 73.654 -31.233 17.680  1.00 52.39 ? 278 ASP D CA  1 
ATOM   9434  C  C   . ASP D  1 298 ? 73.916 -29.866 17.140  1.00 49.96 ? 278 ASP D C   1 
ATOM   9435  O  O   . ASP D  1 298 ? 74.720 -29.108 17.704  1.00 48.28 ? 278 ASP D O   1 
ATOM   9436  C  CB  . ASP D  1 298 ? 74.633 -32.213 16.994  1.00 54.25 ? 278 ASP D CB  1 
ATOM   9437  C  CG  . ASP D  1 298 ? 74.772 -33.520 17.745  1.00 65.05 ? 278 ASP D CG  1 
ATOM   9438  O  OD1 . ASP D  1 298 ? 74.176 -33.616 18.850  1.00 73.00 ? 278 ASP D OD1 1 
ATOM   9439  O  OD2 . ASP D  1 298 ? 75.475 -34.441 17.239  1.00 73.26 ? 278 ASP D OD2 1 
ATOM   9440  N  N   . ALA D  1 299 ? 73.279 -29.573 16.012  1.00 49.16 ? 279 ALA D N   1 
ATOM   9441  C  CA  . ALA D  1 299 ? 73.499 -28.307 15.322  1.00 49.33 ? 279 ALA D CA  1 
ATOM   9442  C  C   . ALA D  1 299 ? 73.102 -27.154 16.239  1.00 44.76 ? 279 ALA D C   1 
ATOM   9443  O  O   . ALA D  1 299 ? 73.804 -26.133 16.315  1.00 41.55 ? 279 ALA D O   1 
ATOM   9444  C  CB  . ALA D  1 299 ? 72.704 -28.249 14.001  1.00 50.77 ? 279 ALA D CB  1 
ATOM   9445  N  N   . ARG D  1 300 ? 71.984 -27.351 16.932  1.00 42.20 ? 280 ARG D N   1 
ATOM   9446  C  CA  . ARG D  1 300 ? 71.459 -26.369 17.865  1.00 42.51 ? 280 ARG D CA  1 
ATOM   9447  C  C   . ARG D  1 300 ? 72.345 -26.179 19.120  1.00 42.11 ? 280 ARG D C   1 
ATOM   9448  O  O   . ARG D  1 300 ? 72.527 -25.058 19.591  1.00 41.80 ? 280 ARG D O   1 
ATOM   9449  C  CB  . ARG D  1 300 ? 70.071 -26.792 18.275  1.00 41.80 ? 280 ARG D CB  1 
ATOM   9450  C  CG  . ARG D  1 300 ? 69.459 -25.897 19.288  1.00 40.91 ? 280 ARG D CG  1 
ATOM   9451  C  CD  . ARG D  1 300 ? 68.055 -26.319 19.579  1.00 43.43 ? 280 ARG D CD  1 
ATOM   9452  N  NE  . ARG D  1 300 ? 67.362 -25.319 20.383  1.00 43.40 ? 280 ARG D NE  1 
ATOM   9453  C  CZ  . ARG D  1 300 ? 67.333 -25.295 21.710  1.00 50.12 ? 280 ARG D CZ  1 
ATOM   9454  N  NH1 . ARG D  1 300 ? 68.002 -26.190 22.425  1.00 53.25 ? 280 ARG D NH1 1 
ATOM   9455  N  NH2 . ARG D  1 300 ? 66.649 -24.338 22.336  1.00 53.30 ? 280 ARG D NH2 1 
ATOM   9456  N  N   . GLN D  1 301 ? 72.851 -27.280 19.667  1.00 42.28 ? 281 GLN D N   1 
ATOM   9457  C  CA  . GLN D  1 301 ? 73.792 -27.242 20.804  1.00 43.51 ? 281 GLN D CA  1 
ATOM   9458  C  C   . GLN D  1 301 ? 75.132 -26.584 20.440  1.00 40.44 ? 281 GLN D C   1 
ATOM   9459  O  O   . GLN D  1 301 ? 75.625 -25.783 21.224  1.00 39.66 ? 281 GLN D O   1 
ATOM   9460  C  CB  . GLN D  1 301 ? 74.026 -28.659 21.409  1.00 44.49 ? 281 GLN D CB  1 
ATOM   9461  C  CG  . GLN D  1 301 ? 73.824 -28.728 22.947  1.00 52.17 ? 281 GLN D CG  1 
ATOM   9462  C  CD  . GLN D  1 301 ? 72.448 -28.154 23.388  1.00 65.09 ? 281 GLN D CD  1 
ATOM   9463  O  OE1 . GLN D  1 301 ? 71.538 -27.939 22.556  1.00 73.54 ? 281 GLN D OE1 1 
ATOM   9464  N  NE2 . GLN D  1 301 ? 72.304 -27.885 24.691  1.00 66.27 ? 281 GLN D NE2 1 
ATOM   9465  N  N   . LYS D  1 302 ? 75.688 -26.905 19.269  1.00 39.18 ? 282 LYS D N   1 
ATOM   9466  C  CA  . LYS D  1 302 ? 76.940 -26.278 18.775  1.00 42.28 ? 282 LYS D CA  1 
ATOM   9467  C  C   . LYS D  1 302 ? 76.730 -24.760 18.629  1.00 42.13 ? 282 LYS D C   1 
ATOM   9468  O  O   . LYS D  1 302 ? 77.566 -23.944 19.051  1.00 43.24 ? 282 LYS D O   1 
ATOM   9469  C  CB  . LYS D  1 302 ? 77.489 -27.025 17.499  1.00 42.57 ? 282 LYS D CB  1 
ATOM   9470  C  CG  . LYS D  1 302 ? 78.315 -26.239 16.415  1.00 43.74 ? 282 LYS D CG  1 
ATOM   9471  C  CD  . LYS D  1 302 ? 79.825 -26.153 16.634  1.00 48.46 ? 282 LYS D CD  1 
ATOM   9472  N  N   . ALA D  1 303 ? 75.565 -24.382 18.135  1.00 42.45 ? 283 ALA D N   1 
ATOM   9473  C  CA  . ALA D  1 303 ? 75.177 -22.972 18.077  1.00 40.88 ? 283 ALA D CA  1 
ATOM   9474  C  C   . ALA D  1 303 ? 75.088 -22.288 19.443  1.00 39.53 ? 283 ALA D C   1 
ATOM   9475  O  O   . ALA D  1 303 ? 75.699 -21.256 19.625  1.00 42.08 ? 283 ALA D O   1 
ATOM   9476  C  CB  . ALA D  1 303 ? 73.875 -22.807 17.288  1.00 40.51 ? 283 ALA D CB  1 
ATOM   9477  N  N   . LEU D  1 304 ? 74.347 -22.838 20.395  1.00 37.93 ? 284 LEU D N   1 
ATOM   9478  C  CA  . LEU D  1 304 ? 74.313 -22.276 21.746  1.00 40.13 ? 284 LEU D CA  1 
ATOM   9479  C  C   . LEU D  1 304 ? 75.686 -22.143 22.402  1.00 42.22 ? 284 LEU D C   1 
ATOM   9480  O  O   . LEU D  1 304 ? 75.947 -21.159 23.097  1.00 43.65 ? 284 LEU D O   1 
ATOM   9481  C  CB  . LEU D  1 304 ? 73.437 -23.118 22.680  1.00 41.60 ? 284 LEU D CB  1 
ATOM   9482  C  CG  . LEU D  1 304 ? 71.933 -23.054 22.505  1.00 46.14 ? 284 LEU D CG  1 
ATOM   9483  C  CD1 . LEU D  1 304 ? 71.230 -24.088 23.416  1.00 48.26 ? 284 LEU D CD1 1 
ATOM   9484  C  CD2 . LEU D  1 304 ? 71.438 -21.623 22.727  1.00 41.81 ? 284 LEU D CD2 1 
ATOM   9485  N  N   . LYS D  1 305 ? 76.524 -23.159 22.240  1.00 42.28 ? 285 LYS D N   1 
ATOM   9486  C  CA  . LYS D  1 305 ? 77.899 -23.120 22.737  1.00 43.98 ? 285 LYS D CA  1 
ATOM   9487  C  C   . LYS D  1 305 ? 78.797 -22.102 22.002  1.00 42.21 ? 285 LYS D C   1 
ATOM   9488  O  O   . LYS D  1 305 ? 79.612 -21.419 22.632  1.00 41.36 ? 285 LYS D O   1 
ATOM   9489  C  CB  . LYS D  1 305 ? 78.503 -24.512 22.667  1.00 44.25 ? 285 LYS D CB  1 
ATOM   9490  C  CG  . LYS D  1 305 ? 77.806 -25.492 23.595  1.00 48.67 ? 285 LYS D CG  1 
ATOM   9491  C  CD  . LYS D  1 305 ? 78.295 -26.913 23.354  1.00 50.41 ? 285 LYS D CD  1 
ATOM   9492  C  CE  . LYS D  1 305 ? 77.901 -27.849 24.501  1.00 53.69 ? 285 LYS D CE  1 
ATOM   9493  N  NZ  . LYS D  1 305 ? 77.764 -29.256 24.035  1.00 56.33 ? 285 LYS D NZ  1 
ATOM   9494  N  N   . ASP D  1 306 ? 78.649 -21.990 20.681  1.00 42.49 ? 286 ASP D N   1 
ATOM   9495  C  CA  . ASP D  1 306 ? 79.293 -20.884 19.929  1.00 43.71 ? 286 ASP D CA  1 
ATOM   9496  C  C   . ASP D  1 306 ? 78.877 -19.493 20.446  1.00 42.32 ? 286 ASP D C   1 
ATOM   9497  O  O   . ASP D  1 306 ? 79.706 -18.591 20.554  1.00 41.87 ? 286 ASP D O   1 
ATOM   9498  C  CB  . ASP D  1 306 ? 78.961 -20.965 18.430  1.00 45.11 ? 286 ASP D CB  1 
ATOM   9499  C  CG  . ASP D  1 306 ? 79.823 -21.984 17.677  1.00 51.15 ? 286 ASP D CG  1 
ATOM   9500  O  OD1 . ASP D  1 306 ? 80.686 -22.651 18.306  1.00 55.98 ? 286 ASP D OD1 1 
ATOM   9501  O  OD2 . ASP D  1 306 ? 79.630 -22.116 16.433  1.00 58.23 ? 286 ASP D OD2 1 
ATOM   9502  N  N   . LEU D  1 307 ? 77.588 -19.343 20.756  1.00 41.04 ? 287 LEU D N   1 
ATOM   9503  C  CA  . LEU D  1 307 ? 77.015 -18.078 21.222  1.00 40.52 ? 287 LEU D CA  1 
ATOM   9504  C  C   . LEU D  1 307 ? 77.489 -17.663 22.619  1.00 40.08 ? 287 LEU D C   1 
ATOM   9505  O  O   . LEU D  1 307 ? 77.758 -16.495 22.864  1.00 37.15 ? 287 LEU D O   1 
ATOM   9506  C  CB  . LEU D  1 307 ? 75.485 -18.160 21.219  1.00 39.63 ? 287 LEU D CB  1 
ATOM   9507  C  CG  . LEU D  1 307 ? 74.777 -18.069 19.868  1.00 39.08 ? 287 LEU D CG  1 
ATOM   9508  C  CD1 . LEU D  1 307 ? 73.306 -18.500 20.038  1.00 34.04 ? 287 LEU D CD1 1 
ATOM   9509  C  CD2 . LEU D  1 307 ? 74.888 -16.678 19.220  1.00 33.55 ? 287 LEU D CD2 1 
ATOM   9510  N  N   . LEU D  1 308 ? 77.549 -18.633 23.529  1.00 42.63 ? 288 LEU D N   1 
ATOM   9511  C  CA  . LEU D  1 308 ? 78.098 -18.448 24.870  1.00 42.53 ? 288 LEU D CA  1 
ATOM   9512  C  C   . LEU D  1 308 ? 79.606 -18.145 24.822  1.00 42.48 ? 288 LEU D C   1 
ATOM   9513  O  O   . LEU D  1 308 ? 80.105 -17.280 25.551  1.00 43.52 ? 288 LEU D O   1 
ATOM   9514  C  CB  . LEU D  1 308 ? 77.815 -19.697 25.717  1.00 42.85 ? 288 LEU D CB  1 
ATOM   9515  C  CG  . LEU D  1 308 ? 78.226 -19.668 27.192  1.00 44.52 ? 288 LEU D CG  1 
ATOM   9516  C  CD1 . LEU D  1 308 ? 77.364 -18.683 27.985  1.00 44.91 ? 288 LEU D CD1 1 
ATOM   9517  C  CD2 . LEU D  1 308 ? 78.155 -21.075 27.772  1.00 44.37 ? 288 LEU D CD2 1 
ATOM   9518  N  N   . LYS D  1 309 ? 80.326 -18.850 23.963  1.00 42.59 ? 289 LYS D N   1 
ATOM   9519  C  CA  . LYS D  1 309 ? 81.752 -18.610 23.797  1.00 44.25 ? 289 LYS D CA  1 
ATOM   9520  C  C   . LYS D  1 309 ? 81.945 -17.153 23.415  1.00 42.44 ? 289 LYS D C   1 
ATOM   9521  O  O   . LYS D  1 309 ? 82.679 -16.413 24.055  1.00 40.97 ? 289 LYS D O   1 
ATOM   9522  C  CB  . LYS D  1 309 ? 82.342 -19.551 22.711  1.00 45.35 ? 289 LYS D CB  1 
ATOM   9523  C  CG  . LYS D  1 309 ? 83.864 -19.677 22.681  1.00 44.12 ? 289 LYS D CG  1 
ATOM   9524  C  CD  . LYS D  1 309 ? 84.353 -20.643 21.587  1.00 47.56 ? 289 LYS D CD  1 
ATOM   9525  N  N   . TRP D  1 310 ? 81.249 -16.752 22.364  1.00 42.85 ? 290 TRP D N   1 
ATOM   9526  C  CA  . TRP D  1 310 ? 81.387 -15.419 21.805  1.00 44.50 ? 290 TRP D CA  1 
ATOM   9527  C  C   . TRP D  1 310 ? 81.065 -14.312 22.809  1.00 44.87 ? 290 TRP D C   1 
ATOM   9528  O  O   . TRP D  1 310 ? 81.723 -13.277 22.819  1.00 44.17 ? 290 TRP D O   1 
ATOM   9529  C  CB  . TRP D  1 310 ? 80.531 -15.307 20.538  1.00 45.90 ? 290 TRP D CB  1 
ATOM   9530  C  CG  . TRP D  1 310 ? 81.137 -16.029 19.349  1.00 49.25 ? 290 TRP D CG  1 
ATOM   9531  C  CD1 . TRP D  1 310 ? 82.474 -16.275 19.129  1.00 49.14 ? 290 TRP D CD1 1 
ATOM   9532  C  CD2 . TRP D  1 310 ? 80.442 -16.575 18.211  1.00 51.65 ? 290 TRP D CD2 1 
ATOM   9533  N  NE1 . TRP D  1 310 ? 82.644 -16.936 17.939  1.00 48.89 ? 290 TRP D NE1 1 
ATOM   9534  C  CE2 . TRP D  1 310 ? 81.424 -17.132 17.352  1.00 49.93 ? 290 TRP D CE2 1 
ATOM   9535  C  CE3 . TRP D  1 310 ? 79.096 -16.620 17.822  1.00 48.98 ? 290 TRP D CE3 1 
ATOM   9536  C  CZ2 . TRP D  1 310 ? 81.104 -17.733 16.146  1.00 47.76 ? 290 TRP D CZ2 1 
ATOM   9537  C  CZ3 . TRP D  1 310 ? 78.775 -17.219 16.631  1.00 48.00 ? 290 TRP D CZ3 1 
ATOM   9538  C  CH2 . TRP D  1 310 ? 79.779 -17.769 15.801  1.00 53.50 ? 290 TRP D CH2 1 
ATOM   9539  N  N   . VAL D  1 311 ? 80.076 -14.556 23.666  1.00 45.38 ? 291 VAL D N   1 
ATOM   9540  C  CA  . VAL D  1 311 ? 79.701 -13.630 24.733  1.00 44.74 ? 291 VAL D CA  1 
ATOM   9541  C  C   . VAL D  1 311 ? 80.795 -13.465 25.798  1.00 45.29 ? 291 VAL D C   1 
ATOM   9542  O  O   . VAL D  1 311 ? 81.129 -12.338 26.182  1.00 42.99 ? 291 VAL D O   1 
ATOM   9543  C  CB  . VAL D  1 311 ? 78.346 -14.047 25.371  1.00 43.53 ? 291 VAL D CB  1 
ATOM   9544  C  CG1 . VAL D  1 311 ? 78.114 -13.359 26.712  1.00 47.88 ? 291 VAL D CG1 1 
ATOM   9545  C  CG2 . VAL D  1 311 ? 77.237 -13.710 24.441  1.00 42.50 ? 291 VAL D CG2 1 
ATOM   9546  N  N   . LEU D  1 312 ? 81.364 -14.587 26.237  1.00 46.45 ? 292 LEU D N   1 
ATOM   9547  C  CA  . LEU D  1 312 ? 82.399 -14.592 27.276  1.00 46.28 ? 292 LEU D CA  1 
ATOM   9548  C  C   . LEU D  1 312 ? 83.712 -13.995 26.790  1.00 47.61 ? 292 LEU D C   1 
ATOM   9549  O  O   . LEU D  1 312 ? 84.429 -13.343 27.561  1.00 48.06 ? 292 LEU D O   1 
ATOM   9550  C  CB  . LEU D  1 312 ? 82.640 -16.009 27.803  1.00 45.97 ? 292 LEU D CB  1 
ATOM   9551  C  CG  . LEU D  1 312 ? 81.405 -16.728 28.373  1.00 46.32 ? 292 LEU D CG  1 
ATOM   9552  C  CD1 . LEU D  1 312 ? 81.737 -18.198 28.599  1.00 48.94 ? 292 LEU D CD1 1 
ATOM   9553  C  CD2 . LEU D  1 312 ? 80.871 -16.061 29.655  1.00 41.99 ? 292 LEU D CD2 1 
ATOM   9554  N  N   . GLU D  1 313 ? 84.027 -14.216 25.518  1.00 47.80 ? 293 GLU D N   1 
ATOM   9555  C  CA  . GLU D  1 313 ? 85.194 -13.598 24.887  1.00 49.59 ? 293 GLU D CA  1 
ATOM   9556  C  C   . GLU D  1 313 ? 84.942 -12.131 24.534  1.00 47.94 ? 293 GLU D C   1 
ATOM   9557  O  O   . GLU D  1 313 ? 85.849 -11.451 24.067  1.00 47.03 ? 293 GLU D O   1 
ATOM   9558  C  CB  . GLU D  1 313 ? 85.566 -14.350 23.609  1.00 49.91 ? 293 GLU D CB  1 
ATOM   9559  C  CG  . GLU D  1 313 ? 85.792 -15.830 23.831  1.00 54.46 ? 293 GLU D CG  1 
ATOM   9560  C  CD  . GLU D  1 313 ? 86.229 -16.570 22.573  1.00 55.70 ? 293 GLU D CD  1 
ATOM   9561  O  OE1 . GLU D  1 313 ? 85.686 -16.303 21.459  1.00 46.30 ? 293 GLU D OE1 1 
ATOM   9562  O  OE2 . GLU D  1 313 ? 87.138 -17.429 22.729  1.00 67.21 ? 293 GLU D OE2 1 
ATOM   9563  N  N   . GLY D  1 314 ? 83.704 -11.664 24.710  1.00 47.17 ? 294 GLY D N   1 
ATOM   9564  C  CA  . GLY D  1 314 ? 83.343 -10.282 24.433  1.00 45.79 ? 294 GLY D CA  1 
ATOM   9565  C  C   . GLY D  1 314 ? 83.114 -9.965  22.970  1.00 44.93 ? 294 GLY D C   1 
ATOM   9566  O  O   . GLY D  1 314 ? 82.930 -8.807  22.619  1.00 44.20 ? 294 GLY D O   1 
ATOM   9567  N  N   . LYS D  1 315 ? 83.117 -10.982 22.101  1.00 45.90 ? 295 LYS D N   1 
ATOM   9568  C  CA  . LYS D  1 315 ? 82.908 -10.767 20.654  1.00 44.36 ? 295 LYS D CA  1 
ATOM   9569  C  C   . LYS D  1 315 ? 81.424 -10.426 20.368  1.00 43.07 ? 295 LYS D C   1 
ATOM   9570  O  O   . LYS D  1 315 ? 81.079 -9.842  19.320  1.00 39.84 ? 295 LYS D O   1 
ATOM   9571  C  CB  . LYS D  1 315 ? 83.393 -11.980 19.828  1.00 44.30 ? 295 LYS D CB  1 
ATOM   9572  C  CG  . LYS D  1 315 ? 84.875 -12.327 19.995  1.00 46.10 ? 295 LYS D CG  1 
ATOM   9573  N  N   . ILE D  1 316 ? 80.568 -10.809 21.317  1.00 43.24 ? 296 ILE D N   1 
ATOM   9574  C  CA  . ILE D  1 316 ? 79.150 -10.458 21.321  1.00 43.89 ? 296 ILE D CA  1 
ATOM   9575  C  C   . ILE D  1 316 ? 78.735 -9.788  22.656  1.00 44.73 ? 296 ILE D C   1 
ATOM   9576  O  O   . ILE D  1 316 ? 78.789 -10.385 23.744  1.00 43.49 ? 296 ILE D O   1 
ATOM   9577  C  CB  . ILE D  1 316 ? 78.268 -11.682 21.033  1.00 44.14 ? 296 ILE D CB  1 
ATOM   9578  C  CG1 . ILE D  1 316 ? 78.444 -12.092 19.569  1.00 41.89 ? 296 ILE D CG1 1 
ATOM   9579  C  CG2 . ILE D  1 316 ? 76.774 -11.382 21.317  1.00 49.72 ? 296 ILE D CG2 1 
ATOM   9580  C  CD1 . ILE D  1 316 ? 77.490 -13.193 19.130  1.00 42.61 ? 296 ILE D CD1 1 
ATOM   9581  N  N   . GLN D  1 317 ? 78.313 -8.537  22.536  1.00 43.70 ? 297 GLN D N   1 
ATOM   9582  C  CA  . GLN D  1 317 ? 77.773 -7.826  23.644  1.00 46.77 ? 297 GLN D CA  1 
ATOM   9583  C  C   . GLN D  1 317 ? 76.241 -7.863  23.713  1.00 48.17 ? 297 GLN D C   1 
ATOM   9584  O  O   . GLN D  1 317 ? 75.541 -7.867  22.706  1.00 51.93 ? 297 GLN D O   1 
ATOM   9585  C  CB  . GLN D  1 317 ? 78.288 -6.417  23.594  1.00 47.65 ? 297 GLN D CB  1 
ATOM   9586  C  CG  . GLN D  1 317 ? 79.728 -6.329  24.013  1.00 50.56 ? 297 GLN D CG  1 
ATOM   9587  C  CD  . GLN D  1 317 ? 80.144 -4.915  24.030  1.00 58.42 ? 297 GLN D CD  1 
ATOM   9588  O  OE1 . GLN D  1 317 ? 79.953 -4.213  25.030  1.00 55.09 ? 297 GLN D OE1 1 
ATOM   9589  N  NE2 . GLN D  1 317 ? 80.631 -4.437  22.890  1.00 60.32 ? 297 GLN D NE2 1 
ATOM   9590  N  N   . TYR D  1 318 ? 75.736 -7.886  24.934  1.00 49.06 ? 298 TYR D N   1 
ATOM   9591  C  CA  . TYR D  1 318 ? 74.311 -8.024  25.200  1.00 48.82 ? 298 TYR D CA  1 
ATOM   9592  C  C   . TYR D  1 318 ? 73.882 -6.823  26.033  1.00 48.45 ? 298 TYR D C   1 
ATOM   9593  O  O   . TYR D  1 318 ? 74.709 -6.197  26.705  1.00 44.23 ? 298 TYR D O   1 
ATOM   9594  C  CB  . TYR D  1 318 ? 74.025 -9.337  25.956  1.00 49.61 ? 298 TYR D CB  1 
ATOM   9595  C  CG  . TYR D  1 318 ? 74.806 -9.510  27.248  1.00 52.31 ? 298 TYR D CG  1 
ATOM   9596  C  CD1 . TYR D  1 318 ? 74.218 -9.242  28.489  1.00 53.68 ? 298 TYR D CD1 1 
ATOM   9597  C  CD2 . TYR D  1 318 ? 76.126 -9.929  27.235  1.00 53.24 ? 298 TYR D CD2 1 
ATOM   9598  C  CE1 . TYR D  1 318 ? 74.922 -9.401  29.679  1.00 49.11 ? 298 TYR D CE1 1 
ATOM   9599  C  CE2 . TYR D  1 318 ? 76.843 -10.086 28.427  1.00 57.14 ? 298 TYR D CE2 1 
ATOM   9600  C  CZ  . TYR D  1 318 ? 76.234 -9.820  29.651  1.00 56.05 ? 298 TYR D CZ  1 
ATOM   9601  O  OH  . TYR D  1 318 ? 76.957 -9.973  30.849  1.00 55.54 ? 298 TYR D OH  1 
ATOM   9602  N  N   . LYS D  1 319 ? 72.597 -6.492  25.934  1.00 49.76 ? 299 LYS D N   1 
ATOM   9603  C  CA  . LYS D  1 319 ? 71.957 -5.475  26.757  1.00 49.63 ? 299 LYS D CA  1 
ATOM   9604  C  C   . LYS D  1 319 ? 70.555 -5.996  27.059  1.00 48.16 ? 299 LYS D C   1 
ATOM   9605  O  O   . LYS D  1 319 ? 69.925 -6.576  26.197  1.00 48.68 ? 299 LYS D O   1 
ATOM   9606  C  CB  . LYS D  1 319 ? 71.925 -4.097  26.045  1.00 49.06 ? 299 LYS D CB  1 
ATOM   9607  C  CG  . LYS D  1 319 ? 71.690 -2.899  26.995  1.00 50.84 ? 299 LYS D CG  1 
ATOM   9608  C  CD  . LYS D  1 319 ? 72.491 -1.638  26.640  1.00 50.08 ? 299 LYS D CD  1 
ATOM   9609  N  N   . GLU D  1 320 ? 70.091 -5.802  28.286  1.00 47.68 ? 300 GLU D N   1 
ATOM   9610  C  CA  . GLU D  1 320 ? 68.748 -6.200  28.684  1.00 50.47 ? 300 GLU D CA  1 
ATOM   9611  C  C   . GLU D  1 320 ? 67.940 -5.003  29.187  1.00 50.45 ? 300 GLU D C   1 
ATOM   9612  O  O   . GLU D  1 320 ? 68.488 -4.097  29.844  1.00 50.00 ? 300 GLU D O   1 
ATOM   9613  C  CB  . GLU D  1 320 ? 68.809 -7.243  29.797  1.00 49.09 ? 300 GLU D CB  1 
ATOM   9614  C  CG  . GLU D  1 320 ? 69.265 -8.617  29.337  1.00 53.61 ? 300 GLU D CG  1 
ATOM   9615  C  CD  . GLU D  1 320 ? 69.665 -9.527  30.506  1.00 53.38 ? 300 GLU D CD  1 
ATOM   9616  O  OE1 . GLU D  1 320 ? 70.531 -9.124  31.337  1.00 63.36 ? 300 GLU D OE1 1 
ATOM   9617  O  OE2 . GLU D  1 320 ? 69.115 -10.645 30.589  1.00 54.74 ? 300 GLU D OE2 1 
ATOM   9618  N  N   . TYR D  1 321 ? 66.636 -5.025  28.911  1.00 49.13 ? 301 TYR D N   1 
ATOM   9619  C  CA  . TYR D  1 321 ? 65.699 -4.077  29.503  1.00 49.31 ? 301 TYR D CA  1 
ATOM   9620  C  C   . TYR D  1 321 ? 64.801 -4.917  30.400  1.00 47.58 ? 301 TYR D C   1 
ATOM   9621  O  O   . TYR D  1 321 ? 63.877 -5.567  29.935  1.00 43.84 ? 301 TYR D O   1 
ATOM   9622  C  CB  . TYR D  1 321 ? 64.917 -3.314  28.400  1.00 54.42 ? 301 TYR D CB  1 
ATOM   9623  C  CG  . TYR D  1 321 ? 64.096 -2.122  28.874  1.00 52.20 ? 301 TYR D CG  1 
ATOM   9624  C  CD1 . TYR D  1 321 ? 64.677 -0.859  29.045  1.00 60.91 ? 301 TYR D CD1 1 
ATOM   9625  C  CD2 . TYR D  1 321 ? 62.737 -2.258  29.139  1.00 54.56 ? 301 TYR D CD2 1 
ATOM   9626  C  CE1 . TYR D  1 321 ? 63.905 0.240   29.489  1.00 63.98 ? 301 TYR D CE1 1 
ATOM   9627  C  CE2 . TYR D  1 321 ? 61.956 -1.180  29.599  1.00 57.95 ? 301 TYR D CE2 1 
ATOM   9628  C  CZ  . TYR D  1 321 ? 62.531 0.068   29.761  1.00 65.44 ? 301 TYR D CZ  1 
ATOM   9629  O  OH  . TYR D  1 321 ? 61.735 1.121   30.216  1.00 60.86 ? 301 TYR D OH  1 
ATOM   9630  N  N   . ILE D  1 322 ? 65.124 -4.931  31.693  1.00 49.57 ? 302 ILE D N   1 
ATOM   9631  C  CA  . ILE D  1 322 ? 64.398 -5.717  32.708  1.00 49.63 ? 302 ILE D CA  1 
ATOM   9632  C  C   . ILE D  1 322 ? 63.230 -4.885  33.284  1.00 50.02 ? 302 ILE D C   1 
ATOM   9633  O  O   . ILE D  1 322 ? 63.397 -3.731  33.653  1.00 51.18 ? 302 ILE D O   1 
ATOM   9634  C  CB  . ILE D  1 322 ? 65.342 -6.122  33.863  1.00 50.11 ? 302 ILE D CB  1 
ATOM   9635  C  CG1 . ILE D  1 322 ? 66.628 -6.767  33.335  1.00 49.60 ? 302 ILE D CG1 1 
ATOM   9636  C  CG2 . ILE D  1 322 ? 64.638 -7.069  34.863  1.00 51.19 ? 302 ILE D CG2 1 
ATOM   9637  C  CD1 . ILE D  1 322 ? 66.409 -8.088  32.657  1.00 49.27 ? 302 ILE D CD1 1 
ATOM   9638  N  N   . ILE D  1 323 ? 62.040 -5.461  33.328  1.00 50.99 ? 303 ILE D N   1 
ATOM   9639  C  CA  . ILE D  1 323 ? 60.882 -4.796  33.914  1.00 50.74 ? 303 ILE D CA  1 
ATOM   9640  C  C   . ILE D  1 323 ? 60.468 -5.595  35.123  1.00 49.92 ? 303 ILE D C   1 
ATOM   9641  O  O   . ILE D  1 323 ? 60.472 -6.799  35.104  1.00 49.73 ? 303 ILE D O   1 
ATOM   9642  C  CB  . ILE D  1 323 ? 59.743 -4.705  32.879  1.00 53.15 ? 303 ILE D CB  1 
ATOM   9643  C  CG1 . ILE D  1 323 ? 60.137 -3.675  31.822  1.00 56.07 ? 303 ILE D CG1 1 
ATOM   9644  C  CG2 . ILE D  1 323 ? 58.400 -4.322  33.532  1.00 52.89 ? 303 ILE D CG2 1 
ATOM   9645  C  CD1 . ILE D  1 323 ? 59.273 -3.678  30.630  1.00 63.11 ? 303 ILE D CD1 1 
ATOM   9646  N  N   . GLU D  1 324 ? 60.149 -4.944  36.215  1.00 51.58 ? 304 GLU D N   1 
ATOM   9647  C  CA  . GLU D  1 324 ? 59.807 -5.707  37.392  1.00 51.94 ? 304 GLU D CA  1 
ATOM   9648  C  C   . GLU D  1 324 ? 58.289 -5.840  37.505  1.00 50.03 ? 304 GLU D C   1 
ATOM   9649  O  O   . GLU D  1 324 ? 57.548 -4.865  37.278  1.00 48.53 ? 304 GLU D O   1 
ATOM   9650  C  CB  . GLU D  1 324 ? 60.452 -5.103  38.640  1.00 52.89 ? 304 GLU D CB  1 
ATOM   9651  C  CG  . GLU D  1 324 ? 61.214 -6.172  39.454  1.00 62.36 ? 304 GLU D CG  1 
ATOM   9652  C  CD  . GLU D  1 324 ? 62.460 -5.627  40.157  1.00 75.79 ? 304 GLU D CD  1 
ATOM   9653  O  OE1 . GLU D  1 324 ? 62.316 -4.776  41.079  1.00 78.07 ? 304 GLU D OE1 1 
ATOM   9654  O  OE2 . GLU D  1 324 ? 63.582 -6.071  39.800  1.00 82.23 ? 304 GLU D OE2 1 
ATOM   9655  N  N   . GLY D  1 325 ? 57.848 -7.066  37.805  1.00 47.00 ? 305 GLY D N   1 
ATOM   9656  C  CA  . GLY D  1 325 ? 56.459 -7.366  38.103  1.00 45.58 ? 305 GLY D CA  1 
ATOM   9657  C  C   . GLY D  1 325 ? 55.740 -8.057  36.960  1.00 45.07 ? 305 GLY D C   1 
ATOM   9658  O  O   . GLY D  1 325 ? 55.723 -7.561  35.840  1.00 45.29 ? 305 GLY D O   1 
ATOM   9659  N  N   . PHE D  1 326 ? 55.130 -9.196  37.261  1.00 45.48 ? 306 PHE D N   1 
ATOM   9660  C  CA  . PHE D  1 326 ? 54.354 -10.009 36.301  1.00 46.10 ? 306 PHE D CA  1 
ATOM   9661  C  C   . PHE D  1 326 ? 53.080 -9.290  35.841  1.00 45.54 ? 306 PHE D C   1 
ATOM   9662  O  O   . PHE D  1 326 ? 52.650 -9.437  34.677  1.00 44.08 ? 306 PHE D O   1 
ATOM   9663  C  CB  . PHE D  1 326 ? 54.020 -11.364 36.971  1.00 45.64 ? 306 PHE D CB  1 
ATOM   9664  C  CG  . PHE D  1 326 ? 53.136 -12.270 36.145  1.00 47.99 ? 306 PHE D CG  1 
ATOM   9665  C  CD1 . PHE D  1 326 ? 53.671 -13.052 35.117  1.00 41.60 ? 306 PHE D CD1 1 
ATOM   9666  C  CD2 . PHE D  1 326 ? 51.768 -12.379 36.429  1.00 43.33 ? 306 PHE D CD2 1 
ATOM   9667  C  CE1 . PHE D  1 326 ? 52.845 -13.863 34.375  1.00 41.59 ? 306 PHE D CE1 1 
ATOM   9668  C  CE2 . PHE D  1 326 ? 50.948 -13.194 35.678  1.00 40.28 ? 306 PHE D CE2 1 
ATOM   9669  C  CZ  . PHE D  1 326 ? 51.487 -13.948 34.670  1.00 41.00 ? 306 PHE D CZ  1 
ATOM   9670  N  N   . GLU D  1 327 ? 52.496 -8.526  36.775  1.00 44.47 ? 307 GLU D N   1 
ATOM   9671  C  CA  . GLU D  1 327 ? 51.406 -7.572  36.520  1.00 45.70 ? 307 GLU D CA  1 
ATOM   9672  C  C   . GLU D  1 327 ? 51.722 -6.516  35.450  1.00 44.38 ? 307 GLU D C   1 
ATOM   9673  O  O   . GLU D  1 327 ? 50.835 -5.982  34.836  1.00 44.64 ? 307 GLU D O   1 
ATOM   9674  C  CB  . GLU D  1 327 ? 51.030 -6.865  37.828  1.00 46.84 ? 307 GLU D CB  1 
ATOM   9675  C  CG  . GLU D  1 327 ? 52.065 -5.827  38.338  1.00 53.09 ? 307 GLU D CG  1 
ATOM   9676  C  CD  . GLU D  1 327 ? 53.157 -6.371  39.296  1.00 59.32 ? 307 GLU D CD  1 
ATOM   9677  O  OE1 . GLU D  1 327 ? 53.385 -7.610  39.427  1.00 50.46 ? 307 GLU D OE1 1 
ATOM   9678  O  OE2 . GLU D  1 327 ? 53.791 -5.500  39.935  1.00 63.44 ? 307 GLU D OE2 1 
ATOM   9679  N  N   . ASN D  1 328 ? 53.001 -6.248  35.211  1.00 46.05 ? 308 ASN D N   1 
ATOM   9680  C  CA  . ASN D  1 328 ? 53.436 -5.366  34.126  1.00 45.07 ? 308 ASN D CA  1 
ATOM   9681  C  C   . ASN D  1 328 ? 53.730 -5.976  32.778  1.00 43.74 ? 308 ASN D C   1 
ATOM   9682  O  O   . ASN D  1 328 ? 54.277 -5.321  31.904  1.00 45.63 ? 308 ASN D O   1 
ATOM   9683  C  CB  . ASN D  1 328 ? 54.655 -4.610  34.603  1.00 45.31 ? 308 ASN D CB  1 
ATOM   9684  C  CG  . ASN D  1 328 ? 54.347 -3.824  35.807  1.00 41.67 ? 308 ASN D CG  1 
ATOM   9685  O  OD1 . ASN D  1 328 ? 53.525 -2.919  35.755  1.00 43.94 ? 308 ASN D OD1 1 
ATOM   9686  N  ND2 . ASN D  1 328 ? 54.926 -4.201  36.917  1.00 34.29 ? 308 ASN D ND2 1 
ATOM   9687  N  N   . MET D  1 329 ? 53.325 -7.211  32.573  1.00 45.36 ? 309 MET D N   1 
ATOM   9688  C  CA  . MET D  1 329 ? 53.758 -7.936  31.380  1.00 44.18 ? 309 MET D CA  1 
ATOM   9689  C  C   . MET D  1 329 ? 53.092 -7.495  30.036  1.00 42.66 ? 309 MET D C   1 
ATOM   9690  O  O   . MET D  1 329 ? 53.735 -7.453  28.973  1.00 42.83 ? 309 MET D O   1 
ATOM   9691  C  CB  . MET D  1 329 ? 53.607 -9.426  31.627  1.00 44.00 ? 309 MET D CB  1 
ATOM   9692  C  CG  . MET D  1 329 ? 54.373 -10.248 30.600  1.00 44.08 ? 309 MET D CG  1 
ATOM   9693  S  SD  . MET D  1 329 ? 54.625 -11.885 31.159  1.00 50.49 ? 309 MET D SD  1 
ATOM   9694  C  CE  . MET D  1 329 ? 55.644 -12.382 29.770  1.00 51.58 ? 309 MET D CE  1 
ATOM   9695  N  N   . PRO D  1 330 ? 51.786 -7.211  30.048  1.00 44.40 ? 310 PRO D N   1 
ATOM   9696  C  CA  . PRO D  1 330 ? 51.211 -6.585  28.836  1.00 42.46 ? 310 PRO D CA  1 
ATOM   9697  C  C   . PRO D  1 330 ? 51.864 -5.255  28.417  1.00 39.21 ? 310 PRO D C   1 
ATOM   9698  O  O   . PRO D  1 330 ? 52.093 -5.051  27.247  1.00 37.12 ? 310 PRO D O   1 
ATOM   9699  C  CB  . PRO D  1 330 ? 49.748 -6.400  29.226  1.00 43.43 ? 310 PRO D CB  1 
ATOM   9700  C  CG  . PRO D  1 330 ? 49.509 -7.532  30.218  1.00 37.67 ? 310 PRO D CG  1 
ATOM   9701  C  CD  . PRO D  1 330 ? 50.747 -7.535  31.046  1.00 42.63 ? 310 PRO D CD  1 
ATOM   9702  N  N   . ALA D  1 331 ? 52.175 -4.398  29.378  1.00 37.73 ? 311 ALA D N   1 
ATOM   9703  C  CA  . ALA D  1 331 ? 52.797 -3.103  29.138  1.00 37.78 ? 311 ALA D CA  1 
ATOM   9704  C  C   . ALA D  1 331 ? 54.236 -3.216  28.613  1.00 40.26 ? 311 ALA D C   1 
ATOM   9705  O  O   . ALA D  1 331 ? 54.684 -2.436  27.748  1.00 41.73 ? 311 ALA D O   1 
ATOM   9706  C  CB  . ALA D  1 331 ? 52.760 -2.300  30.414  1.00 39.24 ? 311 ALA D CB  1 
ATOM   9707  N  N   . ALA D  1 332 ? 54.953 -4.187  29.164  1.00 42.19 ? 312 ALA D N   1 
ATOM   9708  C  CA  . ALA D  1 332 ? 56.242 -4.688  28.616  1.00 41.52 ? 312 ALA D CA  1 
ATOM   9709  C  C   . ALA D  1 332 ? 56.184 -5.102  27.143  1.00 40.07 ? 312 ALA D C   1 
ATOM   9710  O  O   . ALA D  1 332 ? 57.001 -4.704  26.342  1.00 41.10 ? 312 ALA D O   1 
ATOM   9711  C  CB  . ALA D  1 332 ? 56.696 -5.894  29.456  1.00 41.43 ? 312 ALA D CB  1 
ATOM   9712  N  N   . PHE D  1 333 ? 55.217 -5.945  26.814  1.00 40.82 ? 313 PHE D N   1 
ATOM   9713  C  CA  . PHE D  1 333 ? 54.952 -6.387  25.453  1.00 38.82 ? 313 PHE D CA  1 
ATOM   9714  C  C   . PHE D  1 333 ? 54.617 -5.221  24.519  1.00 41.46 ? 313 PHE D C   1 
ATOM   9715  O  O   . PHE D  1 333 ? 55.122 -5.105  23.387  1.00 41.96 ? 313 PHE D O   1 
ATOM   9716  C  CB  . PHE D  1 333 ? 53.774 -7.383  25.522  1.00 41.36 ? 313 PHE D CB  1 
ATOM   9717  C  CG  . PHE D  1 333 ? 53.353 -7.958  24.193  1.00 41.75 ? 313 PHE D CG  1 
ATOM   9718  C  CD1 . PHE D  1 333 ? 54.281 -8.533  23.342  1.00 36.66 ? 313 PHE D CD1 1 
ATOM   9719  C  CD2 . PHE D  1 333 ? 52.021 -7.939  23.805  1.00 43.52 ? 313 PHE D CD2 1 
ATOM   9720  C  CE1 . PHE D  1 333 ? 53.896 -9.080  22.114  1.00 44.31 ? 313 PHE D CE1 1 
ATOM   9721  C  CE2 . PHE D  1 333 ? 51.625 -8.486  22.594  1.00 38.81 ? 313 PHE D CE2 1 
ATOM   9722  C  CZ  . PHE D  1 333 ? 52.560 -9.062  21.750  1.00 44.59 ? 313 PHE D CZ  1 
ATOM   9723  N  N   . MET D  1 334 ? 53.729 -4.355  24.970  1.00 43.33 ? 314 MET D N   1 
ATOM   9724  C  CA  . MET D  1 334 ? 53.334 -3.230  24.132  1.00 44.08 ? 314 MET D CA  1 
ATOM   9725  C  C   . MET D  1 334 ? 54.499 -2.218  23.930  1.00 43.44 ? 314 MET D C   1 
ATOM   9726  O  O   . MET D  1 334 ? 54.669 -1.647  22.861  1.00 43.82 ? 314 MET D O   1 
ATOM   9727  C  CB  . MET D  1 334 ? 52.076 -2.572  24.722  1.00 45.44 ? 314 MET D CB  1 
ATOM   9728  C  CG  . MET D  1 334 ? 50.805 -3.451  24.582  1.00 44.77 ? 314 MET D CG  1 
ATOM   9729  S  SD  . MET D  1 334 ? 49.313 -2.784  25.425  1.00 43.00 ? 314 MET D SD  1 
ATOM   9730  C  CE  . MET D  1 334 ? 49.609 -3.087  27.140  1.00 40.08 ? 314 MET D CE  1 
ATOM   9731  N  N   . GLY D  1 335 ? 55.293 -2.000  24.964  1.00 42.62 ? 315 GLY D N   1 
ATOM   9732  C  CA  . GLY D  1 335 ? 56.451 -1.111  24.874  1.00 42.50 ? 315 GLY D CA  1 
ATOM   9733  C  C   . GLY D  1 335 ? 57.521 -1.662  23.960  1.00 42.33 ? 315 GLY D C   1 
ATOM   9734  O  O   . GLY D  1 335 ? 58.241 -0.907  23.315  1.00 45.81 ? 315 GLY D O   1 
ATOM   9735  N  N   . MET D  1 336 ? 57.635 -2.982  23.940  1.00 41.70 ? 316 MET D N   1 
ATOM   9736  C  CA  . MET D  1 336 ? 58.518 -3.671  23.027  1.00 42.28 ? 316 MET D CA  1 
ATOM   9737  C  C   . MET D  1 336 ? 58.010 -3.463  21.587  1.00 44.43 ? 316 MET D C   1 
ATOM   9738  O  O   . MET D  1 336 ? 58.751 -3.005  20.727  1.00 46.92 ? 316 MET D O   1 
ATOM   9739  C  CB  . MET D  1 336 ? 58.622 -5.147  23.442  1.00 41.25 ? 316 MET D CB  1 
ATOM   9740  C  CG  . MET D  1 336 ? 59.287 -6.092  22.442  1.00 44.86 ? 316 MET D CG  1 
ATOM   9741  S  SD  . MET D  1 336 ? 58.205 -6.922  21.246  1.00 50.36 ? 316 MET D SD  1 
ATOM   9742  C  CE  . MET D  1 336 ? 57.182 -7.929  22.254  1.00 50.08 ? 316 MET D CE  1 
ATOM   9743  N  N   . LEU D  1 337 ? 56.740 -3.743  21.329  1.00 42.72 ? 317 LEU D N   1 
ATOM   9744  C  CA  . LEU D  1 337 ? 56.199 -3.608  19.990  1.00 43.43 ? 317 LEU D CA  1 
ATOM   9745  C  C   . LEU D  1 337 ? 56.265 -2.182  19.408  1.00 46.31 ? 317 LEU D C   1 
ATOM   9746  O  O   . LEU D  1 337 ? 56.477 -2.004  18.221  1.00 42.63 ? 317 LEU D O   1 
ATOM   9747  C  CB  . LEU D  1 337 ? 54.732 -4.026  19.998  1.00 48.03 ? 317 LEU D CB  1 
ATOM   9748  C  CG  . LEU D  1 337 ? 54.394 -5.489  20.252  1.00 35.97 ? 317 LEU D CG  1 
ATOM   9749  C  CD1 . LEU D  1 337 ? 52.901 -5.562  20.391  1.00 33.93 ? 317 LEU D CD1 1 
ATOM   9750  C  CD2 . LEU D  1 337 ? 54.892 -6.330  19.122  1.00 37.49 ? 317 LEU D CD2 1 
ATOM   9751  N  N   . LYS D  1 338 ? 56.056 -1.185  20.258  1.00 48.61 ? 318 LYS D N   1 
ATOM   9752  C  CA  . LYS D  1 338 ? 56.137 0.203   19.875  1.00 52.16 ? 318 LYS D CA  1 
ATOM   9753  C  C   . LYS D  1 338 ? 57.563 0.808   19.951  1.00 56.33 ? 318 LYS D C   1 
ATOM   9754  O  O   . LYS D  1 338 ? 57.692 2.013   20.036  1.00 55.94 ? 318 LYS D O   1 
ATOM   9755  C  CB  . LYS D  1 338 ? 55.168 0.997   20.754  1.00 51.50 ? 318 LYS D CB  1 
ATOM   9756  C  CG  . LYS D  1 338 ? 53.704 0.569   20.584  1.00 46.50 ? 318 LYS D CG  1 
ATOM   9757  C  CD  . LYS D  1 338 ? 52.761 1.786   20.411  1.00 54.54 ? 318 LYS D CD  1 
ATOM   9758  C  CE  . LYS D  1 338 ? 51.298 1.435   20.820  1.00 56.14 ? 318 LYS D CE  1 
ATOM   9759  N  NZ  . LYS D  1 338 ? 50.401 2.575   21.041  1.00 38.56 ? 318 LYS D NZ  1 
ATOM   9760  N  N   . GLY D  1 339 ? 58.615 -0.038  19.921  1.00 60.90 ? 319 GLY D N   1 
ATOM   9761  C  CA  . GLY D  1 339 ? 60.051 0.385   19.917  1.00 60.07 ? 319 GLY D CA  1 
ATOM   9762  C  C   . GLY D  1 339 ? 60.629 1.203   21.087  1.00 63.07 ? 319 GLY D C   1 
ATOM   9763  O  O   . GLY D  1 339 ? 61.715 1.809   20.982  1.00 62.07 ? 319 GLY D O   1 
ATOM   9764  N  N   . ASP D  1 340 ? 59.928 1.236   22.209  1.00 66.45 ? 320 ASP D N   1 
ATOM   9765  C  CA  . ASP D  1 340 ? 60.395 2.029   23.352  1.00 70.95 ? 320 ASP D CA  1 
ATOM   9766  C  C   . ASP D  1 340 ? 61.854 1.700   23.811  1.00 70.60 ? 320 ASP D C   1 
ATOM   9767  O  O   . ASP D  1 340 ? 62.693 2.581   23.989  1.00 71.51 ? 320 ASP D O   1 
ATOM   9768  C  CB  . ASP D  1 340 ? 59.424 1.844   24.543  1.00 73.89 ? 320 ASP D CB  1 
ATOM   9769  C  CG  . ASP D  1 340 ? 57.971 2.201   24.193  1.00 82.81 ? 320 ASP D CG  1 
ATOM   9770  O  OD1 . ASP D  1 340 ? 57.663 2.293   22.975  1.00 92.10 ? 320 ASP D OD1 1 
ATOM   9771  O  OD2 . ASP D  1 340 ? 57.145 2.370   25.131  1.00 85.18 ? 320 ASP D OD2 1 
ATOM   9772  N  N   . ASN D  1 341 ? 62.152 0.423   23.966  1.00 69.96 ? 321 ASN D N   1 
ATOM   9773  C  CA  . ASN D  1 341 ? 63.256 -0.005  24.821  1.00 67.84 ? 321 ASN D CA  1 
ATOM   9774  C  C   . ASN D  1 341 ? 64.560 -0.351  24.062  1.00 65.66 ? 321 ASN D C   1 
ATOM   9775  O  O   . ASN D  1 341 ? 64.518 -0.936  22.972  1.00 63.85 ? 321 ASN D O   1 
ATOM   9776  C  CB  . ASN D  1 341 ? 62.792 -1.250  25.625  1.00 71.07 ? 321 ASN D CB  1 
ATOM   9777  C  CG  . ASN D  1 341 ? 61.312 -1.162  26.097  1.00 74.06 ? 321 ASN D CG  1 
ATOM   9778  O  OD1 . ASN D  1 341 ? 60.532 -2.139  25.923  1.00 65.43 ? 321 ASN D OD1 1 
ATOM   9779  N  ND2 . ASN D  1 341 ? 60.930 0.000   26.709  1.00 65.77 ? 321 ASN D ND2 1 
ATOM   9780  N  N   . LEU D  1 342 ? 65.706 -0.043  24.676  1.00 61.97 ? 322 LEU D N   1 
ATOM   9781  C  CA  . LEU D  1 342 ? 67.014 -0.570  24.227  1.00 60.17 ? 322 LEU D CA  1 
ATOM   9782  C  C   . LEU D  1 342 ? 67.487 -1.804  25.038  1.00 53.77 ? 322 LEU D C   1 
ATOM   9783  O  O   . LEU D  1 342 ? 67.855 -1.725  26.190  1.00 51.01 ? 322 LEU D O   1 
ATOM   9784  C  CB  . LEU D  1 342 ? 68.072 0.545   24.249  1.00 60.18 ? 322 LEU D CB  1 
ATOM   9785  C  CG  . LEU D  1 342 ? 69.539 0.185   23.993  1.00 61.46 ? 322 LEU D CG  1 
ATOM   9786  C  CD1 . LEU D  1 342 ? 69.769 -0.513  22.649  1.00 62.78 ? 322 LEU D CD1 1 
ATOM   9787  C  CD2 . LEU D  1 342 ? 70.375 1.443   24.100  1.00 62.08 ? 322 LEU D CD2 1 
ATOM   9788  N  N   . GLY D  1 343 ? 67.491 -2.949  24.400  1.00 51.54 ? 323 GLY D N   1 
ATOM   9789  C  CA  . GLY D  1 343 ? 67.888 -4.184  25.038  1.00 51.32 ? 323 GLY D CA  1 
ATOM   9790  C  C   . GLY D  1 343 ? 66.806 -5.210  24.897  1.00 50.68 ? 323 GLY D C   1 
ATOM   9791  O  O   . GLY D  1 343 ? 65.745 -4.915  24.398  1.00 55.77 ? 323 GLY D O   1 
ATOM   9792  N  N   . LYS D  1 344 ? 67.080 -6.436  25.301  1.00 49.52 ? 324 LYS D N   1 
ATOM   9793  C  CA  . LYS D  1 344 ? 66.076 -7.494  25.230  1.00 47.37 ? 324 LYS D CA  1 
ATOM   9794  C  C   . LYS D  1 344 ? 65.077 -7.271  26.376  1.00 47.17 ? 324 LYS D C   1 
ATOM   9795  O  O   . LYS D  1 344 ? 65.464 -7.041  27.539  1.00 46.24 ? 324 LYS D O   1 
ATOM   9796  C  CB  . LYS D  1 344 ? 66.747 -8.865  25.361  1.00 45.78 ? 324 LYS D CB  1 
ATOM   9797  C  CG  . LYS D  1 344 ? 65.807 -10.015 25.474  1.00 44.20 ? 324 LYS D CG  1 
ATOM   9798  C  CD  . LYS D  1 344 ? 65.178 -10.362 24.138  1.00 41.44 ? 324 LYS D CD  1 
ATOM   9799  C  CE  . LYS D  1 344 ? 64.043 -11.358 24.341  1.00 43.23 ? 324 LYS D CE  1 
ATOM   9800  N  NZ  . LYS D  1 344 ? 62.751 -10.671 24.593  1.00 51.75 ? 324 LYS D NZ  1 
ATOM   9801  N  N   . THR D  1 345 ? 63.788 -7.340  26.051  1.00 48.22 ? 325 THR D N   1 
ATOM   9802  C  CA  . THR D  1 345 ? 62.781 -7.041  27.048  1.00 46.71 ? 325 THR D CA  1 
ATOM   9803  C  C   . THR D  1 345 ? 62.506 -8.284  27.839  1.00 42.42 ? 325 THR D C   1 
ATOM   9804  O  O   . THR D  1 345 ? 62.052 -9.263  27.287  1.00 40.72 ? 325 THR D O   1 
ATOM   9805  C  CB  . THR D  1 345 ? 61.506 -6.400  26.455  1.00 45.10 ? 325 THR D CB  1 
ATOM   9806  O  OG1 . THR D  1 345 ? 61.868 -5.137  25.919  1.00 51.45 ? 325 THR D OG1 1 
ATOM   9807  C  CG2 . THR D  1 345 ? 60.494 -6.143  27.535  1.00 39.16 ? 325 THR D CG2 1 
ATOM   9808  N  N   . ILE D  1 346 ? 62.777 -8.189  29.146  1.00 44.51 ? 326 ILE D N   1 
ATOM   9809  C  CA  . ILE D  1 346 ? 62.649 -9.280  30.101  1.00 43.65 ? 326 ILE D CA  1 
ATOM   9810  C  C   . ILE D  1 346 ? 61.776 -8.808  31.219  1.00 41.98 ? 326 ILE D C   1 
ATOM   9811  O  O   . ILE D  1 346 ? 61.908 -7.681  31.685  1.00 44.43 ? 326 ILE D O   1 
ATOM   9812  C  CB  . ILE D  1 346 ? 64.042 -9.662  30.705  1.00 46.55 ? 326 ILE D CB  1 
ATOM   9813  C  CG1 . ILE D  1 346 ? 65.036 -10.126 29.608  1.00 44.92 ? 326 ILE D CG1 1 
ATOM   9814  C  CG2 . ILE D  1 346 ? 63.888 -10.695 31.857  1.00 45.50 ? 326 ILE D CG2 1 
ATOM   9815  C  CD1 . ILE D  1 346 ? 64.562 -11.325 28.828  1.00 46.09 ? 326 ILE D CD1 1 
ATOM   9816  N  N   . VAL D  1 347 ? 60.864 -9.657  31.662  1.00 43.36 ? 327 VAL D N   1 
ATOM   9817  C  CA  . VAL D  1 347 ? 60.077 -9.332  32.839  1.00 44.79 ? 327 VAL D CA  1 
ATOM   9818  C  C   . VAL D  1 347 ? 60.541 -10.176 34.001  1.00 44.33 ? 327 VAL D C   1 
ATOM   9819  O  O   . VAL D  1 347 ? 60.566 -11.407 33.916  1.00 42.31 ? 327 VAL D O   1 
ATOM   9820  C  CB  . VAL D  1 347 ? 58.602 -9.568  32.653  1.00 46.23 ? 327 VAL D CB  1 
ATOM   9821  C  CG1 . VAL D  1 347 ? 57.878 -9.363  34.000  1.00 45.77 ? 327 VAL D CG1 1 
ATOM   9822  C  CG2 . VAL D  1 347 ? 58.071 -8.648  31.594  1.00 47.54 ? 327 VAL D CG2 1 
ATOM   9823  N  N   . LYS D  1 348 ? 60.897 -9.501  35.082  1.00 45.49 ? 328 LYS D N   1 
ATOM   9824  C  CA  . LYS D  1 348 ? 61.340 -10.163 36.279  1.00 47.59 ? 328 LYS D CA  1 
ATOM   9825  C  C   . LYS D  1 348 ? 60.155 -10.448 37.192  1.00 47.87 ? 328 LYS D C   1 
ATOM   9826  O  O   . LYS D  1 348 ? 59.451 -9.537  37.590  1.00 49.61 ? 328 LYS D O   1 
ATOM   9827  C  CB  . LYS D  1 348 ? 62.382 -9.303  36.981  1.00 49.03 ? 328 LYS D CB  1 
ATOM   9828  C  CG  . LYS D  1 348 ? 63.440 -10.084 37.721  1.00 47.52 ? 328 LYS D CG  1 
ATOM   9829  C  CD  . LYS D  1 348 ? 63.914 -9.335  38.958  1.00 51.23 ? 328 LYS D CD  1 
ATOM   9830  C  CE  . LYS D  1 348 ? 64.877 -10.158 39.790  1.00 51.87 ? 328 LYS D CE  1 
ATOM   9831  N  NZ  . LYS D  1 348 ? 65.652 -9.233  40.641  1.00 63.56 ? 328 LYS D NZ  1 
ATOM   9832  N  N   . ALA D  1 349 ? 59.928 -11.723 37.491  1.00 50.22 ? 329 ALA D N   1 
ATOM   9833  C  CA  . ALA D  1 349 ? 59.070 -12.137 38.609  1.00 53.51 ? 329 ALA D CA  1 
ATOM   9834  C  CB  . ALA D  1 349 ? 58.083 -13.218 38.146  1.00 54.83 ? 329 ALA D CB  1 
HETATM 9835  CL CL  . CL  E  2 .   ? 29.055 0.573   13.309  1.00 28.65 ? 407 CL  A CL  1 
HETATM 9836  CL CL  . CL  F  2 .   ? 30.237 8.015   24.760  1.00 40.50 ? 408 CL  A CL  1 
HETATM 9837  CL CL  . CL  G  2 .   ? 32.222 39.750  39.785  1.00 31.39 ? 411 CL  A CL  1 
HETATM 9838  CL CL  . CL  H  2 .   ? 29.154 24.227  47.771  1.00 60.21 ? 413 CL  A CL  1 
HETATM 9839  CL CL  . CL  I  2 .   ? 27.615 1.386   18.268  1.00 18.60 ? 422 CL  A CL  1 
HETATM 9840  CL CL  . CL  J  2 .   ? 45.801 18.062  -13.456 1.00 28.37 ? 402 CL  B CL  1 
HETATM 9841  CL CL  . CL  K  2 .   ? 38.421 16.395  -24.872 1.00 39.59 ? 409 CL  B CL  1 
HETATM 9842  CL CL  . CL  L  2 .   ? 6.594  14.562  -39.672 1.00 37.57 ? 412 CL  B CL  1 
HETATM 9843  CL CL  . CL  M  2 .   ? 22.177 17.568  -47.850 1.00 58.82 ? 418 CL  B CL  1 
HETATM 9844  CL CL  . CL  N  2 .   ? 44.978 19.472  -18.419 1.00 19.18 ? 420 CL  B CL  1 
HETATM 9845  CL CL  . CL  O  2 .   ? 46.686 4.701   -30.683 1.00 36.39 ? 404 CL  C CL  1 
HETATM 9846  CL CL  . CL  P  2 .   ? 54.344 -15.944 -26.984 1.00 39.49 ? 405 CL  C CL  1 
HETATM 9847  CL CL  . CL  Q  2 .   ? 46.827 -17.223 -15.450 1.00 28.28 ? 406 CL  C CL  1 
HETATM 9848  CL CL  . CL  R  2 .   ? 85.978 -14.087 -41.953 1.00 30.25 ? 410 CL  C CL  1 
HETATM 9849  CL CL  . CL  S  2 .   ? 70.617 -16.980 -49.973 1.00 55.21 ? 415 CL  C CL  1 
HETATM 9850  CL CL  . CL  T  2 .   ? 47.655 -18.673 -20.420 1.00 17.65 ? 419 CL  C CL  1 
HETATM 9851  CL CL  . CL  U  2 .   ? 64.316 -0.487  11.289  1.00 33.66 ? 401 CL  D CL  1 
HETATM 9852  CL CL  . CL  V  2 .   ? 50.872 0.393   28.567  1.00 31.77 ? 403 CL  D CL  1 
HETATM 9853  CL CL  . CL  W  2 .   ? 62.776 -7.812  22.665  1.00 39.33 ? 414 CL  D CL  1 
HETATM 9854  CL CL  . CL  X  2 .   ? 60.740 -39.667 37.507  1.00 37.19 ? 416 CL  D CL  1 
HETATM 9855  CL CL  . CL  Y  2 .   ? 64.051 -23.981 45.514  1.00 61.21 ? 417 CL  D CL  1 
HETATM 9856  CL CL  . CL  Z  2 .   ? 65.747 -1.301  16.272  1.00 19.77 ? 421 CL  D CL  1 
HETATM 9857  O  O   . HOH AA 3 .   ? 54.318 16.921  21.101  1.00 23.96 ? 423 HOH A O   1 
HETATM 9858  O  O   . HOH AA 3 .   ? 39.494 3.590   15.022  1.00 32.37 ? 424 HOH A O   1 
HETATM 9859  O  O   . HOH AA 3 .   ? 42.864 10.411  41.537  1.00 30.41 ? 425 HOH A O   1 
HETATM 9860  O  O   . HOH AA 3 .   ? 39.125 21.263  27.601  1.00 37.41 ? 426 HOH A O   1 
HETATM 9861  O  O   . HOH AA 3 .   ? 40.502 32.332  47.183  1.00 36.44 ? 427 HOH A O   1 
HETATM 9862  O  O   . HOH AA 3 .   ? 27.179 7.987   17.858  1.00 32.14 ? 428 HOH A O   1 
HETATM 9863  O  O   . HOH AA 3 .   ? 42.470 4.495   33.921  1.00 38.26 ? 429 HOH A O   1 
HETATM 9864  O  O   . HOH AA 3 .   ? 37.185 21.665  37.565  1.00 43.97 ? 430 HOH A O   1 
HETATM 9865  O  O   . HOH AA 3 .   ? 46.080 -0.034  18.190  1.00 27.77 ? 431 HOH A O   1 
HETATM 9866  O  O   . HOH AA 3 .   ? 38.471 17.625  17.041  1.00 31.10 ? 432 HOH A O   1 
HETATM 9867  O  O   . HOH AA 3 .   ? 47.960 11.951  20.456  1.00 29.93 ? 433 HOH A O   1 
HETATM 9868  O  O   . HOH AA 3 .   ? 47.409 18.749  38.347  1.00 43.33 ? 434 HOH A O   1 
HETATM 9869  O  O   . HOH AA 3 .   ? 31.957 24.230  28.527  1.00 39.58 ? 435 HOH A O   1 
HETATM 9870  O  O   . HOH AA 3 .   ? 36.059 15.580  30.304  1.00 30.49 ? 436 HOH A O   1 
HETATM 9871  O  O   . HOH AA 3 .   ? 23.887 19.447  2.452   1.00 49.66 ? 437 HOH A O   1 
HETATM 9872  O  O   . HOH AA 3 .   ? 44.177 0.090   15.327  1.00 44.58 ? 438 HOH A O   1 
HETATM 9873  O  O   . HOH AA 3 .   ? 19.410 -0.121  -0.494  1.00 41.55 ? 439 HOH A O   1 
HETATM 9874  O  O   . HOH AA 3 .   ? 26.490 -1.042  -1.397  1.00 34.04 ? 440 HOH A O   1 
HETATM 9875  O  O   . HOH AA 3 .   ? 20.278 14.659  -13.371 1.00 36.09 ? 441 HOH A O   1 
HETATM 9876  O  O   . HOH AA 3 .   ? 30.396 18.153  16.067  1.00 35.32 ? 442 HOH A O   1 
HETATM 9877  O  O   . HOH AA 3 .   ? 32.178 2.078   38.700  1.00 51.04 ? 443 HOH A O   1 
HETATM 9878  O  O   . HOH AA 3 .   ? 36.674 18.227  32.190  1.00 43.37 ? 444 HOH A O   1 
HETATM 9879  O  O   . HOH AA 3 .   ? 8.569  17.558  16.545  1.00 47.96 ? 445 HOH A O   1 
HETATM 9880  O  O   . HOH AA 3 .   ? 20.798 18.970  2.587   1.00 45.40 ? 446 HOH A O   1 
HETATM 9881  O  O   . HOH AA 3 .   ? 29.764 7.638   21.825  1.00 34.39 ? 447 HOH A O   1 
HETATM 9882  O  O   . HOH AA 3 .   ? 42.105 27.992  44.693  1.00 62.63 ? 448 HOH A O   1 
HETATM 9883  O  O   . HOH AA 3 .   ? 29.129 32.676  47.320  1.00 33.00 ? 449 HOH A O   1 
HETATM 9884  O  O   . HOH AA 3 .   ? 23.517 21.055  27.987  1.00 39.52 ? 450 HOH A O   1 
HETATM 9885  O  O   . HOH AA 3 .   ? 17.844 6.164   -7.085  1.00 35.78 ? 451 HOH A O   1 
HETATM 9886  O  O   . HOH AA 3 .   ? 27.435 19.113  26.807  1.00 30.56 ? 452 HOH A O   1 
HETATM 9887  O  O   . HOH AA 3 .   ? 33.861 16.844  26.019  1.00 29.60 ? 453 HOH A O   1 
HETATM 9888  O  O   . HOH AA 3 .   ? 22.696 14.053  39.310  1.00 37.53 ? 454 HOH A O   1 
HETATM 9889  O  O   . HOH AA 3 .   ? 32.815 9.906   7.870   1.00 35.81 ? 455 HOH A O   1 
HETATM 9890  O  O   . HOH AA 3 .   ? 47.528 38.055  41.336  1.00 51.39 ? 456 HOH A O   1 
HETATM 9891  O  O   . HOH AA 3 .   ? 37.770 26.090  34.386  1.00 44.31 ? 457 HOH A O   1 
HETATM 9892  O  O   . HOH AA 3 .   ? 41.387 -0.475  4.020   1.00 52.69 ? 458 HOH A O   1 
HETATM 9893  O  O   . HOH AA 3 .   ? 34.520 1.471   8.068   1.00 41.36 ? 459 HOH A O   1 
HETATM 9894  O  O   . HOH AA 3 .   ? 37.362 1.238   7.328   1.00 38.47 ? 460 HOH A O   1 
HETATM 9895  O  O   . HOH AA 3 .   ? 41.624 2.172   35.552  1.00 46.77 ? 461 HOH A O   1 
HETATM 9896  O  O   . HOH AA 3 .   ? 32.374 13.075  19.735  1.00 24.95 ? 462 HOH A O   1 
HETATM 9897  O  O   . HOH AA 3 .   ? 40.391 -0.770  6.278   1.00 40.69 ? 463 HOH A O   1 
HETATM 9898  O  O   . HOH AA 3 .   ? 10.821 -1.097  7.985   1.00 55.36 ? 464 HOH A O   1 
HETATM 9899  O  O   . HOH AA 3 .   ? 31.385 17.425  25.510  1.00 35.98 ? 465 HOH A O   1 
HETATM 9900  O  O   . HOH AA 3 .   ? 36.004 2.158   -2.945  1.00 51.21 ? 466 HOH A O   1 
HETATM 9901  O  O   . HOH AA 3 .   ? 47.124 5.396   32.915  1.00 38.27 ? 467 HOH A O   1 
HETATM 9902  O  O   . HOH AA 3 .   ? 23.312 11.279  28.131  1.00 37.46 ? 468 HOH A O   1 
HETATM 9903  O  O   . HOH AA 3 .   ? 35.548 26.291  30.735  1.00 49.35 ? 469 HOH A O   1 
HETATM 9904  O  O   . HOH AA 3 .   ? 21.796 -8.521  13.681  1.00 40.85 ? 470 HOH A O   1 
HETATM 9905  O  O   . HOH AA 3 .   ? 42.487 39.877  43.079  1.00 46.32 ? 471 HOH A O   1 
HETATM 9906  O  O   . HOH AA 3 .   ? 34.651 10.005  6.097   1.00 36.95 ? 472 HOH A O   1 
HETATM 9907  O  O   . HOH AA 3 .   ? 24.124 30.042  15.281  1.00 43.31 ? 473 HOH A O   1 
HETATM 9908  O  O   . HOH AA 3 .   ? 45.075 4.097   33.292  1.00 43.43 ? 474 HOH A O   1 
HETATM 9909  O  O   . HOH AA 3 .   ? 47.583 21.921  29.351  1.00 41.92 ? 475 HOH A O   1 
HETATM 9910  O  O   . HOH AA 3 .   ? 24.221 4.958   -4.682  1.00 52.57 ? 476 HOH A O   1 
HETATM 9911  O  O   . HOH AA 3 .   ? 47.881 6.042   15.178  1.00 43.44 ? 477 HOH A O   1 
HETATM 9912  O  O   . HOH AA 3 .   ? 33.732 -0.752  0.871   1.00 45.40 ? 478 HOH A O   1 
HETATM 9913  O  O   . HOH AA 3 .   ? 31.150 2.298   23.439  1.00 55.61 ? 479 HOH A O   1 
HETATM 9914  O  O   . HOH AA 3 .   ? 23.341 11.030  23.969  1.00 43.15 ? 480 HOH A O   1 
HETATM 9915  O  O   . HOH AA 3 .   ? 22.070 23.104  29.798  1.00 50.20 ? 481 HOH A O   1 
HETATM 9916  O  O   . HOH AA 3 .   ? 16.482 -6.530  -1.310  1.00 52.36 ? 482 HOH A O   1 
HETATM 9917  O  O   . HOH AA 3 .   ? 54.016 8.960   19.673  1.00 46.77 ? 483 HOH A O   1 
HETATM 9918  O  O   . HOH AA 3 .   ? 35.446 -1.389  29.171  1.00 47.10 ? 484 HOH A O   1 
HETATM 9919  O  O   . HOH AA 3 .   ? 17.596 13.200  -1.437  1.00 41.57 ? 485 HOH A O   1 
HETATM 9920  O  O   . HOH AA 3 .   ? 30.082 11.916  20.855  1.00 46.94 ? 486 HOH A O   1 
HETATM 9921  O  O   . HOH AA 3 .   ? 41.056 2.766   8.770   1.00 24.07 ? 487 HOH A O   1 
HETATM 9922  O  O   . HOH AA 3 .   ? 30.847 -1.717  29.422  1.00 50.25 ? 488 HOH A O   1 
HETATM 9923  O  O   . HOH AA 3 .   ? 34.303 21.412  25.533  1.00 47.35 ? 489 HOH A O   1 
HETATM 9924  O  O   . HOH AA 3 .   ? 14.793 19.413  8.801   1.00 43.12 ? 490 HOH A O   1 
HETATM 9925  O  O   . HOH AA 3 .   ? 12.174 20.153  15.482  1.00 52.24 ? 491 HOH A O   1 
HETATM 9926  O  O   . HOH AA 3 .   ? 22.955 25.659  39.775  1.00 35.25 ? 492 HOH A O   1 
HETATM 9927  O  O   . HOH AA 3 .   ? 29.923 1.235   -2.867  1.00 48.01 ? 493 HOH A O   1 
HETATM 9928  O  O   . HOH AA 3 .   ? 23.892 3.305   -6.788  1.00 48.24 ? 494 HOH A O   1 
HETATM 9929  O  O   . HOH AA 3 .   ? 30.812 6.003   19.434  1.00 35.85 ? 495 HOH A O   1 
HETATM 9930  O  O   . HOH AA 3 .   ? 29.108 9.464   19.858  1.00 45.41 ? 496 HOH A O   1 
HETATM 9931  O  O   . HOH AA 3 .   ? 27.347 24.244  21.028  1.00 41.99 ? 497 HOH A O   1 
HETATM 9932  O  O   . HOH AA 3 .   ? 36.280 16.616  41.515  1.00 42.28 ? 498 HOH A O   1 
HETATM 9933  O  O   . HOH AA 3 .   ? 16.949 25.026  16.586  1.00 42.31 ? 499 HOH A O   1 
HETATM 9934  O  O   . HOH AA 3 .   ? 48.538 6.038   10.591  1.00 45.09 ? 500 HOH A O   1 
HETATM 9935  O  O   . HOH AA 3 .   ? 26.332 -7.737  23.655  1.00 58.95 ? 501 HOH A O   1 
HETATM 9936  O  O   . HOH AA 3 .   ? 27.927 21.910  22.428  1.00 52.57 ? 502 HOH A O   1 
HETATM 9937  O  O   . HOH AA 3 .   ? 30.028 8.386   17.598  1.00 33.04 ? 503 HOH A O   1 
HETATM 9938  O  O   . HOH AA 3 .   ? 42.891 26.107  36.670  1.00 33.22 ? 504 HOH A O   1 
HETATM 9939  O  O   . HOH AA 3 .   ? 49.769 8.321   36.033  1.00 41.52 ? 505 HOH A O   1 
HETATM 9940  O  O   . HOH AA 3 .   ? 34.220 11.960  16.046  1.00 43.66 ? 506 HOH A O   1 
HETATM 9941  O  O   . HOH BA 3 .   ? 30.124 -7.931  -21.392 1.00 24.90 ? 421 HOH B O   1 
HETATM 9942  O  O   . HOH BA 3 .   ? 42.536 -2.276  -22.244 1.00 28.99 ? 422 HOH B O   1 
HETATM 9943  O  O   . HOH BA 3 .   ? 13.487 17.314  -47.194 1.00 30.01 ? 423 HOH B O   1 
HETATM 9944  O  O   . HOH BA 3 .   ? 44.998 12.300  -8.463  1.00 30.73 ? 424 HOH B O   1 
HETATM 9945  O  O   . HOH BA 3 .   ? 41.902 4.285   -34.530 1.00 34.33 ? 425 HOH B O   1 
HETATM 9946  O  O   . HOH BA 3 .   ? 27.678 -0.811  -38.265 1.00 47.42 ? 426 HOH B O   1 
HETATM 9947  O  O   . HOH BA 3 .   ? 46.084 -0.133  -20.412 1.00 29.63 ? 427 HOH B O   1 
HETATM 9948  O  O   . HOH BA 3 .   ? 24.942 9.584   -37.420 1.00 34.65 ? 428 HOH B O   1 
HETATM 9949  O  O   . HOH BA 3 .   ? 45.341 8.875   -7.652  1.00 27.79 ? 429 HOH B O   1 
HETATM 9950  O  O   . HOH BA 3 .   ? 42.589 1.629   -33.735 1.00 28.80 ? 430 HOH B O   1 
HETATM 9951  O  O   . HOH BA 3 .   ? 36.109 4.313   -41.924 1.00 34.91 ? 431 HOH B O   1 
HETATM 9952  O  O   . HOH BA 3 .   ? 28.446 16.229  -15.802 1.00 31.36 ? 432 HOH B O   1 
HETATM 9953  O  O   . HOH BA 3 .   ? 22.111 14.619  -28.525 1.00 39.92 ? 433 HOH B O   1 
HETATM 9954  O  O   . HOH BA 3 .   ? 20.459 3.977   -36.866 1.00 36.71 ? 434 HOH B O   1 
HETATM 9955  O  O   . HOH BA 3 .   ? 38.618 19.728  -17.907 1.00 33.82 ? 435 HOH B O   1 
HETATM 9956  O  O   . HOH BA 3 .   ? 31.029 10.721  -30.394 1.00 40.72 ? 436 HOH B O   1 
HETATM 9957  O  O   . HOH BA 3 .   ? 22.130 20.522  -19.115 1.00 30.09 ? 437 HOH B O   1 
HETATM 9958  O  O   . HOH BA 3 .   ? 35.421 10.206  -41.995 1.00 45.51 ? 438 HOH B O   1 
HETATM 9959  O  O   . HOH BA 3 .   ? 36.452 -1.347  -18.350 1.00 29.19 ? 439 HOH B O   1 
HETATM 9960  O  O   . HOH BA 3 .   ? 25.332 7.473   -27.536 1.00 42.08 ? 440 HOH B O   1 
HETATM 9961  O  O   . HOH BA 3 .   ? 38.278 -3.472  -36.346 1.00 36.38 ? 441 HOH B O   1 
HETATM 9962  O  O   . HOH BA 3 .   ? 20.280 11.502  -29.843 1.00 43.72 ? 442 HOH B O   1 
HETATM 9963  O  O   . HOH BA 3 .   ? 43.047 7.278   -14.897 1.00 42.01 ? 443 HOH B O   1 
HETATM 9964  O  O   . HOH BA 3 .   ? 36.407 13.951  -7.994  1.00 29.49 ? 444 HOH B O   1 
HETATM 9965  O  O   . HOH BA 3 .   ? 37.338 26.837  -24.055 1.00 40.20 ? 445 HOH B O   1 
HETATM 9966  O  O   . HOH BA 3 .   ? 34.951 12.653  -16.168 1.00 44.82 ? 446 HOH B O   1 
HETATM 9967  O  O   . HOH BA 3 .   ? 37.981 16.902  -17.862 1.00 26.67 ? 447 HOH B O   1 
HETATM 9968  O  O   . HOH BA 3 .   ? 54.911 24.133  -13.650 1.00 36.33 ? 448 HOH B O   1 
HETATM 9969  O  O   . HOH BA 3 .   ? 24.829 -0.995  -29.026 1.00 36.25 ? 449 HOH B O   1 
HETATM 9970  O  O   . HOH BA 3 .   ? 40.919 -0.866  -15.326 1.00 40.53 ? 450 HOH B O   1 
HETATM 9971  O  O   . HOH BA 3 .   ? 27.313 19.208  -26.651 1.00 39.57 ? 451 HOH B O   1 
HETATM 9972  O  O   . HOH BA 3 .   ? 29.583 15.429  -13.731 1.00 31.71 ? 452 HOH B O   1 
HETATM 9973  O  O   . HOH BA 3 .   ? 35.102 23.675  -28.067 1.00 45.49 ? 453 HOH B O   1 
HETATM 9974  O  O   . HOH BA 3 .   ? 52.023 17.293  -1.818  1.00 45.90 ? 454 HOH B O   1 
HETATM 9975  O  O   . HOH BA 3 .   ? 54.346 21.349  -23.701 1.00 53.29 ? 455 HOH B O   1 
HETATM 9976  O  O   . HOH BA 3 .   ? 20.931 24.157  -39.650 1.00 38.87 ? 456 HOH B O   1 
HETATM 9977  O  O   . HOH BA 3 .   ? 27.013 31.919  -8.544  1.00 41.77 ? 457 HOH B O   1 
HETATM 9978  O  O   . HOH BA 3 .   ? 40.968 -0.369  -33.173 1.00 41.89 ? 458 HOH B O   1 
HETATM 9979  O  O   . HOH BA 3 .   ? 48.769 27.937  -27.180 1.00 47.71 ? 459 HOH B O   1 
HETATM 9980  O  O   . HOH BA 3 .   ? 14.458 6.492   -47.404 1.00 40.26 ? 460 HOH B O   1 
HETATM 9981  O  O   . HOH BA 3 .   ? 40.187 8.117   -3.485  1.00 44.26 ? 461 HOH B O   1 
HETATM 9982  O  O   . HOH BA 3 .   ? 45.809 6.154   -14.033 1.00 45.60 ? 462 HOH B O   1 
HETATM 9983  O  O   . HOH BA 3 .   ? 45.967 -3.201  -29.120 1.00 29.91 ? 463 HOH B O   1 
HETATM 9984  O  O   . HOH BA 3 .   ? 47.448 20.218  1.609   1.00 40.83 ? 464 HOH B O   1 
HETATM 9985  O  O   . HOH BA 3 .   ? 28.581 -4.705  -18.556 1.00 42.40 ? 465 HOH B O   1 
HETATM 9986  O  O   . HOH BA 3 .   ? 40.045 28.684  6.795   1.00 39.67 ? 466 HOH B O   1 
HETATM 9987  O  O   . HOH BA 3 .   ? 40.923 -5.512  -22.682 1.00 39.64 ? 467 HOH B O   1 
HETATM 9988  O  O   . HOH BA 3 .   ? 31.856 26.157  13.363  1.00 43.22 ? 468 HOH B O   1 
HETATM 9989  O  O   . HOH BA 3 .   ? 50.547 27.240  -25.524 1.00 38.23 ? 469 HOH B O   1 
HETATM 9990  O  O   . HOH BA 3 .   ? 25.468 23.042  -28.332 1.00 41.04 ? 470 HOH B O   1 
HETATM 9991  O  O   . HOH BA 3 .   ? 35.094 -1.132  -20.850 1.00 31.80 ? 471 HOH B O   1 
HETATM 9992  O  O   . HOH BA 3 .   ? 27.315 23.359  -2.233  1.00 48.76 ? 472 HOH B O   1 
HETATM 9993  O  O   . HOH BA 3 .   ? 15.080 7.074   -33.039 1.00 51.92 ? 473 HOH B O   1 
HETATM 9994  O  O   . HOH BA 3 .   ? 33.465 14.268  -19.772 1.00 23.11 ? 474 HOH B O   1 
HETATM 9995  O  O   . HOH BA 3 .   ? 29.967 0.101   -14.745 1.00 58.79 ? 475 HOH B O   1 
HETATM 9996  O  O   . HOH BA 3 .   ? 29.829 16.306  -17.936 1.00 36.71 ? 476 HOH B O   1 
HETATM 9997  O  O   . HOH BA 3 .   ? 31.185 16.691  -25.945 1.00 44.04 ? 477 HOH B O   1 
HETATM 9998  O  O   . HOH BA 3 .   ? 12.657 21.144  -18.377 1.00 47.58 ? 478 HOH B O   1 
HETATM 9999  O  O   . HOH BA 3 .   ? 30.679 14.040  -43.057 1.00 45.76 ? 479 HOH B O   1 
HETATM 10000 O  O   . HOH BA 3 .   ? 40.162 -1.413  -11.136 1.00 48.80 ? 480 HOH B O   1 
HETATM 10001 O  O   . HOH BA 3 .   ? 25.633 34.265  -15.942 1.00 48.69 ? 481 HOH B O   1 
HETATM 10002 O  O   . HOH BA 3 .   ? 32.151 23.906  -39.462 1.00 39.23 ? 482 HOH B O   1 
HETATM 10003 O  O   . HOH BA 3 .   ? 39.574 31.406  -29.838 1.00 49.56 ? 483 HOH B O   1 
HETATM 10004 O  O   . HOH BA 3 .   ? 40.700 2.730   -8.968  1.00 65.60 ? 484 HOH B O   1 
HETATM 10005 O  O   . HOH BA 3 .   ? 34.665 16.522  -21.949 1.00 42.19 ? 485 HOH B O   1 
HETATM 10006 O  O   . HOH BA 3 .   ? 24.748 3.906   -28.900 1.00 47.59 ? 486 HOH B O   1 
HETATM 10007 O  O   . HOH BA 3 .   ? 36.366 17.275  -20.108 1.00 44.64 ? 487 HOH B O   1 
HETATM 10008 O  O   . HOH BA 3 .   ? 29.071 8.207   -17.222 1.00 42.48 ? 488 HOH B O   1 
HETATM 10009 O  O   . HOH BA 3 .   ? 16.965 32.150  -22.579 1.00 43.81 ? 489 HOH B O   1 
HETATM 10010 O  O   . HOH BA 3 .   ? 45.511 -5.446  -8.289  1.00 37.29 ? 490 HOH B O   1 
HETATM 10011 O  O   . HOH BA 3 .   ? 53.296 16.464  -5.275  1.00 49.93 ? 491 HOH B O   1 
HETATM 10012 O  O   . HOH CA 3 .   ? 63.112 8.132   -23.216 1.00 23.35 ? 420 HOH C O   1 
HETATM 10013 O  O   . HOH CA 3 .   ? 49.899 -6.716  -17.162 1.00 31.41 ? 421 HOH C O   1 
HETATM 10014 O  O   . HOH CA 3 .   ? 56.095 -13.526 -10.131 1.00 34.65 ? 422 HOH C O   1 
HETATM 10015 O  O   . HOH CA 3 .   ? 54.257 -19.145 -19.997 1.00 33.17 ? 423 HOH C O   1 
HETATM 10016 O  O   . HOH CA 3 .   ? 65.109 1.300   -40.450 1.00 50.28 ? 424 HOH C O   1 
HETATM 10017 O  O   . HOH CA 3 .   ? 59.288 -13.753 -21.903 1.00 28.15 ? 425 HOH C O   1 
HETATM 10018 O  O   . HOH CA 3 .   ? 61.746 -10.232 -32.364 1.00 28.20 ? 426 HOH C O   1 
HETATM 10019 O  O   . HOH CA 3 .   ? 45.173 -19.763 -0.740  1.00 35.05 ? 427 HOH C O   1 
HETATM 10020 O  O   . HOH CA 3 .   ? 70.436 -14.284 -30.754 1.00 44.50 ? 428 HOH C O   1 
HETATM 10021 O  O   . HOH CA 3 .   ? 50.703 -3.805  -36.031 1.00 39.85 ? 429 HOH C O   1 
HETATM 10022 O  O   . HOH CA 3 .   ? 59.111 -5.751  -45.067 1.00 44.57 ? 430 HOH C O   1 
HETATM 10023 O  O   . HOH CA 3 .   ? 61.007 -26.092 11.087  1.00 30.62 ? 431 HOH C O   1 
HETATM 10024 O  O   . HOH CA 3 .   ? 63.901 -7.850  -19.247 1.00 32.61 ? 432 HOH C O   1 
HETATM 10025 O  O   . HOH CA 3 .   ? 58.137 1.615   -22.512 1.00 25.63 ? 433 HOH C O   1 
HETATM 10026 O  O   . HOH CA 3 .   ? 54.787 -16.179 -19.785 1.00 29.23 ? 434 HOH C O   1 
HETATM 10027 O  O   . HOH CA 3 .   ? 78.364 -5.677  -49.467 1.00 45.20 ? 435 HOH C O   1 
HETATM 10028 O  O   . HOH CA 3 .   ? 78.885 -17.010 -49.390 1.00 30.20 ? 436 HOH C O   1 
HETATM 10029 O  O   . HOH CA 3 .   ? 50.818 2.761   -23.853 1.00 35.54 ? 437 HOH C O   1 
HETATM 10030 O  O   . HOH CA 3 .   ? 63.023 -12.409 -28.106 1.00 28.25 ? 438 HOH C O   1 
HETATM 10031 O  O   . HOH CA 3 .   ? 67.519 -7.164  -29.571 1.00 36.27 ? 439 HOH C O   1 
HETATM 10032 O  O   . HOH CA 3 .   ? 46.017 -26.895 -1.467  1.00 34.30 ? 440 HOH C O   1 
HETATM 10033 O  O   . HOH CA 3 .   ? 48.654 -14.929 -26.071 1.00 46.15 ? 441 HOH C O   1 
HETATM 10034 O  O   . HOH CA 3 .   ? 47.195 -16.600 1.073   1.00 48.46 ? 442 HOH C O   1 
HETATM 10035 O  O   . HOH CA 3 .   ? 62.926 -9.786  -43.553 1.00 37.11 ? 443 HOH C O   1 
HETATM 10036 O  O   . HOH CA 3 .   ? 54.345 3.550   -38.285 1.00 37.80 ? 444 HOH C O   1 
HETATM 10037 O  O   . HOH CA 3 .   ? 47.979 -12.450 -15.940 1.00 42.00 ? 445 HOH C O   1 
HETATM 10038 O  O   . HOH CA 3 .   ? 64.073 -16.114 -18.070 1.00 33.56 ? 446 HOH C O   1 
HETATM 10039 O  O   . HOH CA 3 .   ? 65.584 -22.239 -4.573  1.00 43.52 ? 447 HOH C O   1 
HETATM 10040 O  O   . HOH CA 3 .   ? 68.032 -9.082  -39.637 1.00 39.94 ? 448 HOH C O   1 
HETATM 10041 O  O   . HOH CA 3 .   ? 47.265 -9.154  -9.323  1.00 37.93 ? 449 HOH C O   1 
HETATM 10042 O  O   . HOH CA 3 .   ? 57.556 -23.057 -30.416 1.00 41.66 ? 450 HOH C O   1 
HETATM 10043 O  O   . HOH CA 3 .   ? 53.796 -16.441 -24.205 1.00 41.52 ? 451 HOH C O   1 
HETATM 10044 O  O   . HOH CA 3 .   ? 72.388 -10.891 -32.663 1.00 49.12 ? 452 HOH C O   1 
HETATM 10045 O  O   . HOH CA 3 .   ? 46.927 -5.744  -16.744 1.00 49.76 ? 453 HOH C O   1 
HETATM 10046 O  O   . HOH CA 3 .   ? 72.472 -7.992  -36.605 1.00 39.58 ? 454 HOH C O   1 
HETATM 10047 O  O   . HOH CA 3 .   ? 58.137 -12.156 -18.448 1.00 42.17 ? 455 HOH C O   1 
HETATM 10048 O  O   . HOH CA 3 .   ? 71.649 -29.238 -18.535 1.00 41.67 ? 456 HOH C O   1 
HETATM 10049 O  O   . HOH CA 3 .   ? 57.106 -9.041  -44.009 1.00 43.07 ? 457 HOH C O   1 
HETATM 10050 O  O   . HOH CA 3 .   ? 45.819 -12.442 -36.134 1.00 54.45 ? 458 HOH C O   1 
HETATM 10051 O  O   . HOH CA 3 .   ? 86.236 -3.660  -45.359 1.00 47.00 ? 459 HOH C O   1 
HETATM 10052 O  O   . HOH CA 3 .   ? 47.939 -11.682 -10.397 1.00 40.75 ? 460 HOH C O   1 
HETATM 10053 O  O   . HOH CA 3 .   ? 68.296 1.305   -31.405 1.00 36.61 ? 461 HOH C O   1 
HETATM 10054 O  O   . HOH CA 3 .   ? 63.599 -37.721 -18.543 1.00 47.29 ? 462 HOH C O   1 
HETATM 10055 O  O   . HOH CA 3 .   ? 76.366 -22.185 -17.390 1.00 40.08 ? 463 HOH C O   1 
HETATM 10056 O  O   . HOH CA 3 .   ? 60.100 -23.623 -41.423 1.00 38.22 ? 464 HOH C O   1 
HETATM 10057 O  O   . HOH CA 3 .   ? 65.189 -25.430 -4.764  1.00 51.02 ? 465 HOH C O   1 
HETATM 10058 O  O   . HOH CA 3 .   ? 48.306 -13.827 -40.344 1.00 51.01 ? 466 HOH C O   1 
HETATM 10059 O  O   . HOH CA 3 .   ? 41.445 -30.749 -15.763 1.00 42.01 ? 467 HOH C O   1 
HETATM 10060 O  O   . HOH CA 3 .   ? 56.657 1.691   -20.307 1.00 36.36 ? 468 HOH C O   1 
HETATM 10061 O  O   . HOH CA 3 .   ? 52.825 -28.811 4.592   1.00 32.51 ? 469 HOH C O   1 
HETATM 10062 O  O   . HOH CA 3 .   ? 38.411 -19.728 -25.899 1.00 49.11 ? 470 HOH C O   1 
HETATM 10063 O  O   . HOH CA 3 .   ? 51.358 0.722   -35.064 1.00 37.87 ? 471 HOH C O   1 
HETATM 10064 O  O   . HOH CA 3 .   ? 65.448 -18.666 -29.014 1.00 31.15 ? 472 HOH C O   1 
HETATM 10065 O  O   . HOH CA 3 .   ? 37.898 -26.419 -1.852  1.00 51.77 ? 473 HOH C O   1 
HETATM 10066 O  O   . HOH CA 3 .   ? 47.369 -10.304 -34.060 1.00 47.74 ? 474 HOH C O   1 
HETATM 10067 O  O   . HOH CA 3 .   ? 46.460 -2.319  -17.483 1.00 40.77 ? 475 HOH C O   1 
HETATM 10068 O  O   . HOH CA 3 .   ? 40.182 -30.151 -1.054  1.00 65.23 ? 476 HOH C O   1 
HETATM 10069 O  O   . HOH CA 3 .   ? 52.413 2.194   -12.662 1.00 40.97 ? 477 HOH C O   1 
HETATM 10070 O  O   . HOH CA 3 .   ? 52.065 1.761   -17.306 1.00 41.15 ? 478 HOH C O   1 
HETATM 10071 O  O   . HOH CA 3 .   ? 62.907 -2.265  -17.371 1.00 41.45 ? 479 HOH C O   1 
HETATM 10072 O  O   . HOH CA 3 .   ? 63.005 -22.207 -5.604  1.00 37.59 ? 480 HOH C O   1 
HETATM 10073 O  O   . HOH CA 3 .   ? 68.035 -4.208  -30.286 1.00 39.91 ? 481 HOH C O   1 
HETATM 10074 O  O   . HOH CA 3 .   ? 68.818 -21.825 -46.473 1.00 49.53 ? 482 HOH C O   1 
HETATM 10075 O  O   . HOH CA 3 .   ? 44.101 -14.841 -31.806 1.00 59.21 ? 483 HOH C O   1 
HETATM 10076 O  O   . HOH CA 3 .   ? 40.179 -32.696 -3.983  1.00 40.08 ? 484 HOH C O   1 
HETATM 10077 O  O   . HOH CA 3 .   ? 64.319 -9.406  -34.231 1.00 41.70 ? 485 HOH C O   1 
HETATM 10078 O  O   . HOH CA 3 .   ? 61.945 -4.606  -45.631 1.00 48.02 ? 486 HOH C O   1 
HETATM 10079 O  O   . HOH CA 3 .   ? 69.475 -36.811 -24.827 1.00 60.73 ? 487 HOH C O   1 
HETATM 10080 O  O   . HOH CA 3 .   ? 72.343 -3.473  -38.924 1.00 36.82 ? 488 HOH C O   1 
HETATM 10081 O  O   . HOH CA 3 .   ? 61.576 -16.344 -27.751 1.00 46.34 ? 489 HOH C O   1 
HETATM 10082 O  O   . HOH CA 3 .   ? 67.920 -12.486 -27.516 1.00 43.60 ? 490 HOH C O   1 
HETATM 10083 O  O   . HOH CA 3 .   ? 63.988 -0.214  -16.755 1.00 47.82 ? 491 HOH C O   1 
HETATM 10084 O  O   . HOH CA 3 .   ? 67.256 -22.719 -30.433 1.00 41.16 ? 492 HOH C O   1 
HETATM 10085 O  O   . HOH CA 3 .   ? 55.123 7.847   -21.955 1.00 36.82 ? 493 HOH C O   1 
HETATM 10086 O  O   . HOH CA 3 .   ? 53.026 2.216   -40.533 1.00 44.70 ? 494 HOH C O   1 
HETATM 10087 O  O   . HOH CA 3 .   ? 71.832 -23.520 -31.242 1.00 41.07 ? 495 HOH C O   1 
HETATM 10088 O  O   . HOH CA 3 .   ? 59.708 -15.879 -43.953 1.00 42.67 ? 496 HOH C O   1 
HETATM 10089 O  O   . HOH CA 3 .   ? 48.242 -4.885  -37.673 1.00 46.18 ? 497 HOH C O   1 
HETATM 10090 O  O   . HOH CA 3 .   ? 46.252 -12.077 -12.431 1.00 36.76 ? 498 HOH C O   1 
HETATM 10091 O  O   . HOH CA 3 .   ? 46.527 -8.533  -15.247 1.00 35.47 ? 499 HOH C O   1 
HETATM 10092 O  O   . HOH CA 3 .   ? 62.438 -39.199 -16.539 1.00 45.43 ? 500 HOH C O   1 
HETATM 10093 O  O   . HOH CA 3 .   ? 61.829 -13.459 -45.003 1.00 48.62 ? 501 HOH C O   1 
HETATM 10094 O  O   . HOH CA 3 .   ? 49.027 -5.298  -10.948 1.00 26.43 ? 502 HOH C O   1 
HETATM 10095 O  O   . HOH CA 3 .   ? 46.548 -0.044  -7.523  1.00 50.60 ? 503 HOH C O   1 
HETATM 10096 O  O   . HOH DA 3 .   ? 38.365 -16.071 19.377  1.00 26.40 ? 422 HOH D O   1 
HETATM 10097 O  O   . HOH DA 3 .   ? 55.532 -0.715  5.253   1.00 27.65 ? 423 HOH D O   1 
HETATM 10098 O  O   . HOH DA 3 .   ? 63.764 -32.576 45.118  1.00 27.25 ? 424 HOH D O   1 
HETATM 10099 O  O   . HOH DA 3 .   ? 61.036 -23.672 26.370  1.00 35.79 ? 425 HOH D O   1 
HETATM 10100 O  O   . HOH DA 3 .   ? 53.817 -21.011 25.226  1.00 31.86 ? 426 HOH D O   1 
HETATM 10101 O  O   . HOH DA 3 .   ? 65.962 -7.675  15.639  1.00 39.53 ? 427 HOH D O   1 
HETATM 10102 O  O   . HOH DA 3 .   ? 58.609 -1.219  6.040   1.00 31.80 ? 428 HOH D O   1 
HETATM 10103 O  O   . HOH DA 3 .   ? 45.276 -21.501 26.810  1.00 33.06 ? 429 HOH D O   1 
HETATM 10104 O  O   . HOH DA 3 .   ? 43.957 -3.583  20.078  1.00 30.88 ? 430 HOH D O   1 
HETATM 10105 O  O   . HOH DA 3 .   ? 50.448 -4.646  32.394  1.00 27.12 ? 431 HOH D O   1 
HETATM 10106 O  O   . HOH DA 3 .   ? 60.568 -12.738 17.606  1.00 23.57 ? 432 HOH D O   1 
HETATM 10107 O  O   . HOH DA 3 .   ? 70.087 -11.196 25.795  1.00 45.34 ? 433 HOH D O   1 
HETATM 10108 O  O   . HOH DA 3 .   ? 45.189 -5.164  13.192  1.00 41.22 ? 434 HOH D O   1 
HETATM 10109 O  O   . HOH DA 3 .   ? 60.126 -9.787  5.848   1.00 31.93 ? 435 HOH D O   1 
HETATM 10110 O  O   . HOH DA 3 .   ? 55.830 -21.487 35.441  1.00 37.54 ? 436 HOH D O   1 
HETATM 10111 O  O   . HOH DA 3 .   ? 40.700 -5.370  20.540  1.00 34.31 ? 437 HOH D O   1 
HETATM 10112 O  O   . HOH DA 3 .   ? 62.302 -17.759 13.924  1.00 33.48 ? 438 HOH D O   1 
HETATM 10113 O  O   . HOH DA 3 .   ? 65.586 -18.839 24.432  1.00 43.50 ? 439 HOH D O   1 
HETATM 10114 O  O   . HOH DA 3 .   ? 63.135 -14.898 23.600  1.00 42.83 ? 440 HOH D O   1 
HETATM 10115 O  O   . HOH DA 3 .   ? 67.330 8.494   21.309  1.00 47.02 ? 441 HOH D O   1 
HETATM 10116 O  O   . HOH DA 3 .   ? 47.939 -3.779  31.488  1.00 32.55 ? 442 HOH D O   1 
HETATM 10117 O  O   . HOH DA 3 .   ? 66.066 1.251   -3.546  1.00 44.07 ? 443 HOH D O   1 
HETATM 10118 O  O   . HOH DA 3 .   ? 52.698 -31.853 45.324  1.00 44.12 ? 444 HOH D O   1 
HETATM 10119 O  O   . HOH DA 3 .   ? 70.372 -25.399 37.559  1.00 44.94 ? 445 HOH D O   1 
HETATM 10120 O  O   . HOH DA 3 .   ? 63.013 -8.437  15.676  1.00 30.17 ? 446 HOH D O   1 
HETATM 10121 O  O   . HOH DA 3 .   ? 73.209 -9.142  21.736  1.00 46.39 ? 447 HOH D O   1 
HETATM 10122 O  O   . HOH DA 3 .   ? 52.213 -0.564  11.715  1.00 46.97 ? 448 HOH D O   1 
HETATM 10123 O  O   . HOH DA 3 .   ? 50.342 -25.690 34.746  1.00 37.56 ? 449 HOH D O   1 
HETATM 10124 O  O   . HOH DA 3 .   ? 59.334 -16.509 23.633  1.00 30.61 ? 450 HOH D O   1 
HETATM 10125 O  O   . HOH DA 3 .   ? 69.313 -21.036 26.129  1.00 44.01 ? 451 HOH D O   1 
HETATM 10126 O  O   . HOH DA 3 .   ? 48.613 -5.183  6.996   1.00 52.88 ? 452 HOH D O   1 
HETATM 10127 O  O   . HOH DA 3 .   ? 43.039 -0.352  26.923  1.00 31.95 ? 453 HOH D O   1 
HETATM 10128 O  O   . HOH DA 3 .   ? 57.126 -15.229 28.096  1.00 37.09 ? 454 HOH D O   1 
HETATM 10129 O  O   . HOH DA 3 .   ? 50.439 -10.169 39.631  1.00 35.88 ? 455 HOH D O   1 
HETATM 10130 O  O   . HOH DA 3 .   ? 61.835 -17.178 23.575  1.00 34.22 ? 456 HOH D O   1 
HETATM 10131 O  O   . HOH DA 3 .   ? 63.430 -10.146 17.890  1.00 37.70 ? 457 HOH D O   1 
HETATM 10132 O  O   . HOH DA 3 .   ? 54.119 -2.237  6.259   1.00 38.51 ? 458 HOH D O   1 
HETATM 10133 O  O   . HOH DA 3 .   ? 54.682 -17.206 15.249  1.00 39.41 ? 459 HOH D O   1 
HETATM 10134 O  O   . HOH DA 3 .   ? 81.686 -26.662 32.022  1.00 59.56 ? 460 HOH D O   1 
HETATM 10135 O  O   . HOH DA 3 .   ? 71.084 -22.684 27.642  1.00 36.08 ? 461 HOH D O   1 
HETATM 10136 O  O   . HOH DA 3 .   ? 62.789 -11.978 19.221  1.00 35.42 ? 462 HOH D O   1 
HETATM 10137 O  O   . HOH DA 3 .   ? 69.216 -29.888 12.867  1.00 42.62 ? 463 HOH D O   1 
HETATM 10138 O  O   . HOH DA 3 .   ? 66.584 -24.256 16.952  1.00 34.87 ? 464 HOH D O   1 
HETATM 10139 O  O   . HOH DA 3 .   ? 51.256 -21.525 25.900  1.00 39.76 ? 465 HOH D O   1 
HETATM 10140 O  O   . HOH DA 3 .   ? 55.159 -25.843 32.371  1.00 37.45 ? 466 HOH D O   1 
HETATM 10141 O  O   . HOH DA 3 .   ? 74.157 -25.222 33.782  1.00 50.60 ? 467 HOH D O   1 
HETATM 10142 O  O   . HOH DA 3 .   ? 35.755 -19.613 16.899  1.00 56.74 ? 468 HOH D O   1 
HETATM 10143 O  O   . HOH DA 3 .   ? 68.386 -16.903 1.184   1.00 36.74 ? 469 HOH D O   1 
HETATM 10144 O  O   . HOH DA 3 .   ? 69.155 11.592  5.597   1.00 46.03 ? 470 HOH D O   1 
HETATM 10145 O  O   . HOH DA 3 .   ? 49.000 4.526   21.919  1.00 34.70 ? 471 HOH D O   1 
HETATM 10146 O  O   . HOH DA 3 .   ? 63.317 5.597   -0.369  1.00 41.82 ? 472 HOH D O   1 
HETATM 10147 O  O   . HOH DA 3 .   ? 40.826 -13.644 28.878  1.00 53.02 ? 473 HOH D O   1 
HETATM 10148 O  O   . HOH DA 3 .   ? 45.115 -11.205 18.478  1.00 25.62 ? 474 HOH D O   1 
HETATM 10149 O  O   . HOH DA 3 .   ? 78.013 -6.852  27.210  1.00 47.68 ? 475 HOH D O   1 
HETATM 10150 O  O   . HOH DA 3 .   ? 73.308 0.374   -2.875  1.00 38.53 ? 476 HOH D O   1 
HETATM 10151 O  O   . HOH DA 3 .   ? 57.782 -25.928 27.873  1.00 43.33 ? 477 HOH D O   1 
HETATM 10152 O  O   . HOH DA 3 .   ? 53.643 -3.144  12.822  1.00 38.45 ? 478 HOH D O   1 
HETATM 10153 O  O   . HOH DA 3 .   ? 80.631 -20.930 14.026  1.00 44.75 ? 479 HOH D O   1 
HETATM 10154 O  O   . HOH DA 3 .   ? 72.585 -14.267 -15.468 1.00 40.51 ? 480 HOH D O   1 
HETATM 10155 O  O   . HOH DA 3 .   ? 46.850 -7.410  2.381   1.00 46.85 ? 481 HOH D O   1 
HETATM 10156 O  O   . HOH DA 3 .   ? 71.786 -12.776 -17.489 1.00 45.36 ? 482 HOH D O   1 
HETATM 10157 O  O   . HOH DA 3 .   ? 45.055 -9.738  16.273  1.00 29.03 ? 483 HOH D O   1 
HETATM 10158 O  O   . HOH DA 3 .   ? 68.771 -4.729  -6.866  1.00 51.77 ? 484 HOH D O   1 
HETATM 10159 O  O   . HOH DA 3 .   ? 56.304 -10.821 39.838  1.00 42.37 ? 485 HOH D O   1 
HETATM 10160 O  O   . HOH DA 3 .   ? 45.849 -5.253  31.174  1.00 45.81 ? 486 HOH D O   1 
HETATM 10161 O  O   . HOH DA 3 .   ? 47.709 0.532   21.275  1.00 40.49 ? 487 HOH D O   1 
HETATM 10162 O  O   . HOH DA 3 .   ? 55.960 -26.258 29.621  1.00 43.88 ? 488 HOH D O   1 
HETATM 10163 O  O   . HOH DA 3 .   ? 67.215 -3.279  32.726  1.00 43.06 ? 489 HOH D O   1 
HETATM 10164 O  O   . HOH DA 3 .   ? 70.356 8.590   11.542  1.00 48.75 ? 490 HOH D O   1 
HETATM 10165 O  O   . HOH DA 3 .   ? 71.546 -24.057 35.758  1.00 51.36 ? 491 HOH D O   1 
HETATM 10166 O  O   . HOH DA 3 .   ? 75.372 -6.490  -8.981  1.00 44.31 ? 492 HOH D O   1 
HETATM 10167 O  O   . HOH DA 3 .   ? 53.767 -3.082  39.735  1.00 58.21 ? 493 HOH D O   1 
HETATM 10168 O  O   . HOH DA 3 .   ? 78.250 -19.164 6.218   1.00 44.04 ? 494 HOH D O   1 
HETATM 10169 O  O   . HOH DA 3 .   ? 57.429 -0.954  28.795  1.00 48.51 ? 495 HOH D O   1 
HETATM 10170 O  O   . HOH DA 3 .   ? 69.620 -25.869 34.220  1.00 49.88 ? 496 HOH D O   1 
HETATM 10171 O  O   . HOH DA 3 .   ? 42.810 -8.063  34.191  1.00 38.24 ? 497 HOH D O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   -19 ?   ?   ?   A . n 
A 1 2   HIS 2   -18 ?   ?   ?   A . n 
A 1 3   HIS 3   -17 ?   ?   ?   A . n 
A 1 4   HIS 4   -16 ?   ?   ?   A . n 
A 1 5   HIS 5   -15 ?   ?   ?   A . n 
A 1 6   HIS 6   -14 ?   ?   ?   A . n 
A 1 7   HIS 7   -13 ?   ?   ?   A . n 
A 1 8   SER 8   -12 ?   ?   ?   A . n 
A 1 9   SER 9   -11 ?   ?   ?   A . n 
A 1 10  GLY 10  -10 ?   ?   ?   A . n 
A 1 11  VAL 11  -9  ?   ?   ?   A . n 
A 1 12  ASP 12  -8  ?   ?   ?   A . n 
A 1 13  LEU 13  -7  ?   ?   ?   A . n 
A 1 14  GLY 14  -6  ?   ?   ?   A . n 
A 1 15  THR 15  -5  ?   ?   ?   A . n 
A 1 16  GLU 16  -4  ?   ?   ?   A . n 
A 1 17  ASN 17  -3  ?   ?   ?   A . n 
A 1 18  LEU 18  -2  ?   ?   ?   A . n 
A 1 19  TYR 19  -1  ?   ?   ?   A . n 
A 1 20  PHE 20  0   ?   ?   ?   A . n 
A 1 21  GLN 21  1   ?   ?   ?   A . n 
A 1 22  SER 22  2   2   SER SER A . n 
A 1 23  MET 23  3   3   MET MET A . n 
A 1 24  THR 24  4   4   THR THR A . n 
A 1 25  LYS 25  5   5   LYS LYS A . n 
A 1 26  THR 26  6   6   THR THR A . n 
A 1 27  TRP 27  7   7   TRP TRP A . n 
A 1 28  THR 28  8   8   THR THR A . n 
A 1 29  LEU 29  9   9   LEU LEU A . n 
A 1 30  LYS 30  10  10  LYS LYS A . n 
A 1 31  LYS 31  11  11  LYS LYS A . n 
A 1 32  HIS 32  12  12  HIS HIS A . n 
A 1 33  PHE 33  13  13  PHE PHE A . n 
A 1 34  VAL 34  14  14  VAL VAL A . n 
A 1 35  GLY 35  15  15  GLY GLY A . n 
A 1 36  TYR 36  16  16  TYR TYR A . n 
A 1 37  PRO 37  17  17  PRO PRO A . n 
A 1 38  THR 38  18  18  THR THR A . n 
A 1 39  ASN 39  19  19  ASN ASN A . n 
A 1 40  SER 40  20  20  SER SER A . n 
A 1 41  ASP 41  21  21  ASP ASP A . n 
A 1 42  PHE 42  22  22  PHE PHE A . n 
A 1 43  GLU 43  23  23  GLU GLU A . n 
A 1 44  LEU 44  24  24  LEU LEU A . n 
A 1 45  LYS 45  25  25  LYS LYS A . n 
A 1 46  THR 46  26  26  THR THR A . n 
A 1 47  SER 47  27  27  SER SER A . n 
A 1 48  GLU 48  28  28  GLU GLU A . n 
A 1 49  LEU 49  29  29  LEU LEU A . n 
A 1 50  PRO 50  30  30  PRO PRO A . n 
A 1 51  PRO 51  31  31  PRO PRO A . n 
A 1 52  LEU 52  32  32  LEU LEU A . n 
A 1 53  LYS 53  33  33  LYS LYS A . n 
A 1 54  ASN 54  34  34  ASN ASN A . n 
A 1 55  GLY 55  35  35  GLY GLY A . n 
A 1 56  GLU 56  36  36  GLU GLU A . n 
A 1 57  VAL 57  37  37  VAL VAL A . n 
A 1 58  LEU 58  38  38  LEU LEU A . n 
A 1 59  LEU 59  39  39  LEU LEU A . n 
A 1 60  GLU 60  40  40  GLU GLU A . n 
A 1 61  ALA 61  41  41  ALA ALA A . n 
A 1 62  LEU 62  42  42  LEU LEU A . n 
A 1 63  PHE 63  43  43  PHE PHE A . n 
A 1 64  LEU 64  44  44  LEU LEU A . n 
A 1 65  THR 65  45  45  THR THR A . n 
A 1 66  VAL 66  46  46  VAL VAL A . n 
A 1 67  ASP 67  47  47  ASP ASP A . n 
A 1 68  PRO 68  48  48  PRO PRO A . n 
A 1 69  TYR 69  49  49  TYR TYR A . n 
A 1 70  MET 70  50  50  MET MET A . n 
A 1 71  ARG 71  51  51  ARG ARG A . n 
A 1 72  VAL 72  52  52  VAL VAL A . n 
A 1 73  ALA 73  53  53  ALA ALA A . n 
A 1 74  ALA 74  54  54  ALA ALA A . n 
A 1 75  LYS 75  55  55  LYS LYS A . n 
A 1 76  ARG 76  56  56  ARG ARG A . n 
A 1 77  LEU 77  57  57  LEU LEU A . n 
A 1 78  LYS 78  58  58  LYS LYS A . n 
A 1 79  GLU 79  59  59  GLU GLU A . n 
A 1 80  GLY 80  60  60  GLY GLY A . n 
A 1 81  ASP 81  61  61  ASP ASP A . n 
A 1 82  THR 82  62  62  THR THR A . n 
A 1 83  MET 83  63  63  MET MET A . n 
A 1 84  MET 84  64  64  MET MET A . n 
A 1 85  GLY 85  65  65  GLY GLY A . n 
A 1 86  GLN 86  66  66  GLN GLN A . n 
A 1 87  GLN 87  67  67  GLN GLN A . n 
A 1 88  VAL 88  68  68  VAL VAL A . n 
A 1 89  ALA 89  69  69  ALA ALA A . n 
A 1 90  LYS 90  70  70  LYS LYS A . n 
A 1 91  VAL 91  71  71  VAL VAL A . n 
A 1 92  VAL 92  72  72  VAL VAL A . n 
A 1 93  GLU 93  73  73  GLU GLU A . n 
A 1 94  SER 94  74  74  SER SER A . n 
A 1 95  LYS 95  75  75  LYS LYS A . n 
A 1 96  ASN 96  76  76  ASN ASN A . n 
A 1 97  VAL 97  77  77  VAL VAL A . n 
A 1 98  ALA 98  78  78  ALA ALA A . n 
A 1 99  LEU 99  79  79  LEU LEU A . n 
A 1 100 PRO 100 80  80  PRO PRO A . n 
A 1 101 LYS 101 81  81  LYS LYS A . n 
A 1 102 GLY 102 82  82  GLY GLY A . n 
A 1 103 THR 103 83  83  THR THR A . n 
A 1 104 ILE 104 84  84  ILE ILE A . n 
A 1 105 VAL 105 85  85  VAL VAL A . n 
A 1 106 LEU 106 86  86  LEU LEU A . n 
A 1 107 ALA 107 87  87  ALA ALA A . n 
A 1 108 SER 108 88  88  SER SER A . n 
A 1 109 PRO 109 89  89  PRO PRO A . n 
A 1 110 GLY 110 90  90  GLY GLY A . n 
A 1 111 TRP 111 91  91  TRP TRP A . n 
A 1 112 THR 112 92  92  THR THR A . n 
A 1 113 THR 113 93  93  THR THR A . n 
A 1 114 HIS 114 94  94  HIS HIS A . n 
A 1 115 SER 115 95  95  SER SER A . n 
A 1 116 ILE 116 96  96  ILE ILE A . n 
A 1 117 SER 117 97  97  SER SER A . n 
A 1 118 ASP 118 98  98  ASP ASP A . n 
A 1 119 GLY 119 99  99  GLY GLY A . n 
A 1 120 LYS 120 100 100 LYS LYS A . n 
A 1 121 ASP 121 101 101 ASP ASP A . n 
A 1 122 LEU 122 102 102 LEU LEU A . n 
A 1 123 GLU 123 103 103 GLU GLU A . n 
A 1 124 LYS 124 104 104 LYS LYS A . n 
A 1 125 LEU 125 105 105 LEU LEU A . n 
A 1 126 LEU 126 106 106 LEU LEU A . n 
A 1 127 THR 127 107 107 THR THR A . n 
A 1 128 GLU 128 108 108 GLU GLU A . n 
A 1 129 TRP 129 109 109 TRP TRP A . n 
A 1 130 PRO 130 110 110 PRO PRO A . n 
A 1 131 ASP 131 111 111 ASP ASP A . n 
A 1 132 THR 132 112 112 THR THR A . n 
A 1 133 ILE 133 113 113 ILE ILE A . n 
A 1 134 PRO 134 114 114 PRO PRO A . n 
A 1 135 LEU 135 115 115 LEU LEU A . n 
A 1 136 SER 136 116 116 SER SER A . n 
A 1 137 LEU 137 117 117 LEU LEU A . n 
A 1 138 ALA 138 118 118 ALA ALA A . n 
A 1 139 LEU 139 119 119 LEU LEU A . n 
A 1 140 GLY 140 120 120 GLY GLY A . n 
A 1 141 THR 141 121 121 THR THR A . n 
A 1 142 VAL 142 122 122 VAL VAL A . n 
A 1 143 GLY 143 123 123 GLY GLY A . n 
A 1 144 MET 144 124 124 MET MET A . n 
A 1 145 PRO 145 125 125 PRO PRO A . n 
A 1 146 GLY 146 126 126 GLY GLY A . n 
A 1 147 LEU 147 127 127 LEU LEU A . n 
A 1 148 THR 148 128 128 THR THR A . n 
A 1 149 ALA 149 129 129 ALA ALA A . n 
A 1 150 TYR 150 130 130 TYR TYR A . n 
A 1 151 PHE 151 131 131 PHE PHE A . n 
A 1 152 GLY 152 132 132 GLY GLY A . n 
A 1 153 LEU 153 133 133 LEU LEU A . n 
A 1 154 LEU 154 134 134 LEU LEU A . n 
A 1 155 GLU 155 135 135 GLU GLU A . n 
A 1 156 ILE 156 136 136 ILE ILE A . n 
A 1 157 CYS 157 137 137 CYS CYS A . n 
A 1 158 GLY 158 138 138 GLY GLY A . n 
A 1 159 VAL 159 139 139 VAL VAL A . n 
A 1 160 LYS 160 140 140 LYS LYS A . n 
A 1 161 GLY 161 141 141 GLY GLY A . n 
A 1 162 GLY 162 142 142 GLY GLY A . n 
A 1 163 GLU 163 143 143 GLU GLU A . n 
A 1 164 THR 164 144 144 THR THR A . n 
A 1 165 VAL 165 145 145 VAL VAL A . n 
A 1 166 MET 166 146 146 MET MET A . n 
A 1 167 VAL 167 147 147 VAL VAL A . n 
A 1 168 ASN 168 148 148 ASN ASN A . n 
A 1 169 ALA 169 149 149 ALA ALA A . n 
A 1 170 ALA 170 150 150 ALA ALA A . n 
A 1 171 ALA 171 151 151 ALA ALA A . n 
A 1 172 GLY 172 152 152 GLY GLY A . n 
A 1 173 ALA 173 153 153 ALA ALA A . n 
A 1 174 VAL 174 154 154 VAL VAL A . n 
A 1 175 GLY 175 155 155 GLY GLY A . n 
A 1 176 SER 176 156 156 SER SER A . n 
A 1 177 VAL 177 157 157 VAL VAL A . n 
A 1 178 VAL 178 158 158 VAL VAL A . n 
A 1 179 GLY 179 159 159 GLY GLY A . n 
A 1 180 GLN 180 160 160 GLN GLN A . n 
A 1 181 ILE 181 161 161 ILE ILE A . n 
A 1 182 ALA 182 162 162 ALA ALA A . n 
A 1 183 LYS 183 163 163 LYS LYS A . n 
A 1 184 LEU 184 164 164 LEU LEU A . n 
A 1 185 LYS 185 165 165 LYS LYS A . n 
A 1 186 GLY 186 166 166 GLY GLY A . n 
A 1 187 CYS 187 167 167 CYS CYS A . n 
A 1 188 LYS 188 168 168 LYS LYS A . n 
A 1 189 VAL 189 169 169 VAL VAL A . n 
A 1 190 VAL 190 170 170 VAL VAL A . n 
A 1 191 GLY 191 171 171 GLY GLY A . n 
A 1 192 ALA 192 172 172 ALA ALA A . n 
A 1 193 VAL 193 173 173 VAL VAL A . n 
A 1 194 GLY 194 174 174 GLY GLY A . n 
A 1 195 SER 195 175 175 SER SER A . n 
A 1 196 ASP 196 176 176 ASP ASP A . n 
A 1 197 GLU 197 177 177 GLU GLU A . n 
A 1 198 LYS 198 178 178 LYS LYS A . n 
A 1 199 VAL 199 179 179 VAL VAL A . n 
A 1 200 ALA 200 180 180 ALA ALA A . n 
A 1 201 TYR 201 181 181 TYR TYR A . n 
A 1 202 LEU 202 182 182 LEU LEU A . n 
A 1 203 GLN 203 183 183 GLN GLN A . n 
A 1 204 LYS 204 184 184 LYS LYS A . n 
A 1 205 LEU 205 185 185 LEU LEU A . n 
A 1 206 GLY 206 186 186 GLY GLY A . n 
A 1 207 PHE 207 187 187 PHE PHE A . n 
A 1 208 ASP 208 188 188 ASP ASP A . n 
A 1 209 VAL 209 189 189 VAL VAL A . n 
A 1 210 VAL 210 190 190 VAL VAL A . n 
A 1 211 PHE 211 191 191 PHE PHE A . n 
A 1 212 ASN 212 192 192 ASN ASN A . n 
A 1 213 TYR 213 193 193 TYR TYR A . n 
A 1 214 LYS 214 194 194 LYS LYS A . n 
A 1 215 THR 215 195 195 THR THR A . n 
A 1 216 VAL 216 196 196 VAL VAL A . n 
A 1 217 GLU 217 197 197 GLU GLU A . n 
A 1 218 SER 218 198 198 SER SER A . n 
A 1 219 LEU 219 199 199 LEU LEU A . n 
A 1 220 GLU 220 200 200 GLU GLU A . n 
A 1 221 GLU 221 201 201 GLU GLU A . n 
A 1 222 THR 222 202 202 THR THR A . n 
A 1 223 LEU 223 203 203 LEU LEU A . n 
A 1 224 LYS 224 204 204 LYS LYS A . n 
A 1 225 LYS 225 205 205 LYS LYS A . n 
A 1 226 ALA 226 206 206 ALA ALA A . n 
A 1 227 SER 227 207 207 SER SER A . n 
A 1 228 PRO 228 208 208 PRO PRO A . n 
A 1 229 ASP 229 209 209 ASP ASP A . n 
A 1 230 GLY 230 210 210 GLY GLY A . n 
A 1 231 TYR 231 211 211 TYR TYR A . n 
A 1 232 ASP 232 212 212 ASP ASP A . n 
A 1 233 CYS 233 213 213 CYS CYS A . n 
A 1 234 TYR 234 214 214 TYR TYR A . n 
A 1 235 PHE 235 215 215 PHE PHE A . n 
A 1 236 ASP 236 216 216 ASP ASP A . n 
A 1 237 ASN 237 217 217 ASN ASN A . n 
A 1 238 VAL 238 218 218 VAL VAL A . n 
A 1 239 GLY 239 219 219 GLY GLY A . n 
A 1 240 GLY 240 220 220 GLY GLY A . n 
A 1 241 GLU 241 221 221 GLU GLU A . n 
A 1 242 PHE 242 222 222 PHE PHE A . n 
A 1 243 SER 243 223 223 SER SER A . n 
A 1 244 ASN 244 224 224 ASN ASN A . n 
A 1 245 THR 245 225 225 THR THR A . n 
A 1 246 VAL 246 226 226 VAL VAL A . n 
A 1 247 ILE 247 227 227 ILE ILE A . n 
A 1 248 GLY 248 228 228 GLY GLY A . n 
A 1 249 GLN 249 229 229 GLN GLN A . n 
A 1 250 MET 250 230 230 MET MET A . n 
A 1 251 LYS 251 231 231 LYS LYS A . n 
A 1 252 LYS 252 232 232 LYS LYS A . n 
A 1 253 PHE 253 233 233 PHE PHE A . n 
A 1 254 GLY 254 234 234 GLY GLY A . n 
A 1 255 ARG 255 235 235 ARG ARG A . n 
A 1 256 ILE 256 236 236 ILE ILE A . n 
A 1 257 ALA 257 237 237 ALA ALA A . n 
A 1 258 ILE 258 238 238 ILE ILE A . n 
A 1 259 CYS 259 239 239 CYS CYS A . n 
A 1 260 GLY 260 240 240 GLY GLY A . n 
A 1 261 ALA 261 241 241 ALA ALA A . n 
A 1 262 ILE 262 242 242 ILE ILE A . n 
A 1 263 SER 263 243 243 SER SER A . n 
A 1 264 THR 264 244 244 THR THR A . n 
A 1 265 TYR 265 245 245 TYR TYR A . n 
A 1 266 ASN 266 246 246 ASN ASN A . n 
A 1 267 ARG 267 247 247 ARG ARG A . n 
A 1 268 THR 268 248 248 THR THR A . n 
A 1 269 GLY 269 249 249 GLY GLY A . n 
A 1 270 PRO 270 250 250 PRO PRO A . n 
A 1 271 LEU 271 251 251 LEU LEU A . n 
A 1 272 PRO 272 252 252 PRO PRO A . n 
A 1 273 PRO 273 253 253 PRO PRO A . n 
A 1 274 GLY 274 254 254 GLY GLY A . n 
A 1 275 PRO 275 255 255 PRO PRO A . n 
A 1 276 PRO 276 256 256 PRO PRO A . n 
A 1 277 PRO 277 257 257 PRO PRO A . n 
A 1 278 GLU 278 258 258 GLU GLU A . n 
A 1 279 ILE 279 259 259 ILE ILE A . n 
A 1 280 VAL 280 260 260 VAL VAL A . n 
A 1 281 ILE 281 261 261 ILE ILE A . n 
A 1 282 TYR 282 262 262 TYR TYR A . n 
A 1 283 GLN 283 263 263 GLN GLN A . n 
A 1 284 GLU 284 264 264 GLU GLU A . n 
A 1 285 LEU 285 265 265 LEU LEU A . n 
A 1 286 ARG 286 266 266 ARG ARG A . n 
A 1 287 MET 287 267 267 MET MET A . n 
A 1 288 GLU 288 268 268 GLU GLU A . n 
A 1 289 ALA 289 269 269 ALA ALA A . n 
A 1 290 PHE 290 270 270 PHE PHE A . n 
A 1 291 VAL 291 271 271 VAL VAL A . n 
A 1 292 VAL 292 272 272 VAL VAL A . n 
A 1 293 TYR 293 273 273 TYR TYR A . n 
A 1 294 ARG 294 274 274 ARG ARG A . n 
A 1 295 TRP 295 275 275 TRP TRP A . n 
A 1 296 GLN 296 276 276 GLN GLN A . n 
A 1 297 GLY 297 277 277 GLY GLY A . n 
A 1 298 ASP 298 278 278 ASP ASP A . n 
A 1 299 ALA 299 279 279 ALA ALA A . n 
A 1 300 ARG 300 280 280 ARG ARG A . n 
A 1 301 GLN 301 281 281 GLN GLN A . n 
A 1 302 LYS 302 282 282 LYS LYS A . n 
A 1 303 ALA 303 283 283 ALA ALA A . n 
A 1 304 LEU 304 284 284 LEU LEU A . n 
A 1 305 LYS 305 285 285 LYS LYS A . n 
A 1 306 ASP 306 286 286 ASP ASP A . n 
A 1 307 LEU 307 287 287 LEU LEU A . n 
A 1 308 LEU 308 288 288 LEU LEU A . n 
A 1 309 LYS 309 289 289 LYS LYS A . n 
A 1 310 TRP 310 290 290 TRP TRP A . n 
A 1 311 VAL 311 291 291 VAL VAL A . n 
A 1 312 LEU 312 292 292 LEU LEU A . n 
A 1 313 GLU 313 293 293 GLU GLU A . n 
A 1 314 GLY 314 294 294 GLY GLY A . n 
A 1 315 LYS 315 295 295 LYS LYS A . n 
A 1 316 ILE 316 296 296 ILE ILE A . n 
A 1 317 GLN 317 297 297 GLN GLN A . n 
A 1 318 TYR 318 298 298 TYR TYR A . n 
A 1 319 LYS 319 299 299 LYS LYS A . n 
A 1 320 GLU 320 300 300 GLU GLU A . n 
A 1 321 TYR 321 301 301 TYR TYR A . n 
A 1 322 ILE 322 302 302 ILE ILE A . n 
A 1 323 ILE 323 303 303 ILE ILE A . n 
A 1 324 GLU 324 304 304 GLU GLU A . n 
A 1 325 GLY 325 305 305 GLY GLY A . n 
A 1 326 PHE 326 306 306 PHE PHE A . n 
A 1 327 GLU 327 307 307 GLU GLU A . n 
A 1 328 ASN 328 308 308 ASN ASN A . n 
A 1 329 MET 329 309 309 MET MET A . n 
A 1 330 PRO 330 310 310 PRO PRO A . n 
A 1 331 ALA 331 311 311 ALA ALA A . n 
A 1 332 ALA 332 312 312 ALA ALA A . n 
A 1 333 PHE 333 313 313 PHE PHE A . n 
A 1 334 MET 334 314 314 MET MET A . n 
A 1 335 GLY 335 315 315 GLY GLY A . n 
A 1 336 MET 336 316 316 MET MET A . n 
A 1 337 LEU 337 317 317 LEU LEU A . n 
A 1 338 LYS 338 318 318 LYS LYS A . n 
A 1 339 GLY 339 319 319 GLY GLY A . n 
A 1 340 ASP 340 320 320 ASP ASP A . n 
A 1 341 ASN 341 321 321 ASN ASN A . n 
A 1 342 LEU 342 322 322 LEU LEU A . n 
A 1 343 GLY 343 323 323 GLY GLY A . n 
A 1 344 LYS 344 324 324 LYS LYS A . n 
A 1 345 THR 345 325 325 THR THR A . n 
A 1 346 ILE 346 326 326 ILE ILE A . n 
A 1 347 VAL 347 327 327 VAL VAL A . n 
A 1 348 LYS 348 328 328 LYS LYS A . n 
A 1 349 ALA 349 329 329 ALA ALA A . n 
B 1 1   MET 1   -19 ?   ?   ?   B . n 
B 1 2   HIS 2   -18 ?   ?   ?   B . n 
B 1 3   HIS 3   -17 ?   ?   ?   B . n 
B 1 4   HIS 4   -16 ?   ?   ?   B . n 
B 1 5   HIS 5   -15 ?   ?   ?   B . n 
B 1 6   HIS 6   -14 ?   ?   ?   B . n 
B 1 7   HIS 7   -13 ?   ?   ?   B . n 
B 1 8   SER 8   -12 ?   ?   ?   B . n 
B 1 9   SER 9   -11 ?   ?   ?   B . n 
B 1 10  GLY 10  -10 ?   ?   ?   B . n 
B 1 11  VAL 11  -9  ?   ?   ?   B . n 
B 1 12  ASP 12  -8  ?   ?   ?   B . n 
B 1 13  LEU 13  -7  ?   ?   ?   B . n 
B 1 14  GLY 14  -6  ?   ?   ?   B . n 
B 1 15  THR 15  -5  ?   ?   ?   B . n 
B 1 16  GLU 16  -4  ?   ?   ?   B . n 
B 1 17  ASN 17  -3  ?   ?   ?   B . n 
B 1 18  LEU 18  -2  ?   ?   ?   B . n 
B 1 19  TYR 19  -1  ?   ?   ?   B . n 
B 1 20  PHE 20  0   ?   ?   ?   B . n 
B 1 21  GLN 21  1   ?   ?   ?   B . n 
B 1 22  SER 22  2   2   SER SER B . n 
B 1 23  MET 23  3   3   MET MET B . n 
B 1 24  THR 24  4   4   THR THR B . n 
B 1 25  LYS 25  5   5   LYS LYS B . n 
B 1 26  THR 26  6   6   THR THR B . n 
B 1 27  TRP 27  7   7   TRP TRP B . n 
B 1 28  THR 28  8   8   THR THR B . n 
B 1 29  LEU 29  9   9   LEU LEU B . n 
B 1 30  LYS 30  10  10  LYS LYS B . n 
B 1 31  LYS 31  11  11  LYS LYS B . n 
B 1 32  HIS 32  12  12  HIS HIS B . n 
B 1 33  PHE 33  13  13  PHE PHE B . n 
B 1 34  VAL 34  14  14  VAL VAL B . n 
B 1 35  GLY 35  15  15  GLY GLY B . n 
B 1 36  TYR 36  16  16  TYR TYR B . n 
B 1 37  PRO 37  17  17  PRO PRO B . n 
B 1 38  THR 38  18  18  THR THR B . n 
B 1 39  ASN 39  19  19  ASN ASN B . n 
B 1 40  SER 40  20  20  SER SER B . n 
B 1 41  ASP 41  21  21  ASP ASP B . n 
B 1 42  PHE 42  22  22  PHE PHE B . n 
B 1 43  GLU 43  23  23  GLU GLU B . n 
B 1 44  LEU 44  24  24  LEU LEU B . n 
B 1 45  LYS 45  25  25  LYS LYS B . n 
B 1 46  THR 46  26  26  THR THR B . n 
B 1 47  SER 47  27  27  SER SER B . n 
B 1 48  GLU 48  28  28  GLU GLU B . n 
B 1 49  LEU 49  29  29  LEU LEU B . n 
B 1 50  PRO 50  30  30  PRO PRO B . n 
B 1 51  PRO 51  31  31  PRO PRO B . n 
B 1 52  LEU 52  32  32  LEU LEU B . n 
B 1 53  LYS 53  33  33  LYS LYS B . n 
B 1 54  ASN 54  34  34  ASN ASN B . n 
B 1 55  GLY 55  35  35  GLY GLY B . n 
B 1 56  GLU 56  36  36  GLU GLU B . n 
B 1 57  VAL 57  37  37  VAL VAL B . n 
B 1 58  LEU 58  38  38  LEU LEU B . n 
B 1 59  LEU 59  39  39  LEU LEU B . n 
B 1 60  GLU 60  40  40  GLU GLU B . n 
B 1 61  ALA 61  41  41  ALA ALA B . n 
B 1 62  LEU 62  42  42  LEU LEU B . n 
B 1 63  PHE 63  43  43  PHE PHE B . n 
B 1 64  LEU 64  44  44  LEU LEU B . n 
B 1 65  THR 65  45  45  THR THR B . n 
B 1 66  VAL 66  46  46  VAL VAL B . n 
B 1 67  ASP 67  47  47  ASP ASP B . n 
B 1 68  PRO 68  48  48  PRO PRO B . n 
B 1 69  TYR 69  49  49  TYR TYR B . n 
B 1 70  MET 70  50  50  MET MET B . n 
B 1 71  ARG 71  51  51  ARG ARG B . n 
B 1 72  VAL 72  52  52  VAL VAL B . n 
B 1 73  ALA 73  53  53  ALA ALA B . n 
B 1 74  ALA 74  54  54  ALA ALA B . n 
B 1 75  LYS 75  55  55  LYS LYS B . n 
B 1 76  ARG 76  56  56  ARG ARG B . n 
B 1 77  LEU 77  57  57  LEU LEU B . n 
B 1 78  LYS 78  58  58  LYS LYS B . n 
B 1 79  GLU 79  59  59  GLU GLU B . n 
B 1 80  GLY 80  60  60  GLY GLY B . n 
B 1 81  ASP 81  61  61  ASP ASP B . n 
B 1 82  THR 82  62  62  THR THR B . n 
B 1 83  MET 83  63  63  MET MET B . n 
B 1 84  MET 84  64  64  MET MET B . n 
B 1 85  GLY 85  65  65  GLY GLY B . n 
B 1 86  GLN 86  66  66  GLN GLN B . n 
B 1 87  GLN 87  67  67  GLN GLN B . n 
B 1 88  VAL 88  68  68  VAL VAL B . n 
B 1 89  ALA 89  69  69  ALA ALA B . n 
B 1 90  LYS 90  70  70  LYS LYS B . n 
B 1 91  VAL 91  71  71  VAL VAL B . n 
B 1 92  VAL 92  72  72  VAL VAL B . n 
B 1 93  GLU 93  73  73  GLU GLU B . n 
B 1 94  SER 94  74  74  SER SER B . n 
B 1 95  LYS 95  75  75  LYS LYS B . n 
B 1 96  ASN 96  76  76  ASN ASN B . n 
B 1 97  VAL 97  77  77  VAL VAL B . n 
B 1 98  ALA 98  78  78  ALA ALA B . n 
B 1 99  LEU 99  79  79  LEU LEU B . n 
B 1 100 PRO 100 80  80  PRO PRO B . n 
B 1 101 LYS 101 81  81  LYS LYS B . n 
B 1 102 GLY 102 82  82  GLY GLY B . n 
B 1 103 THR 103 83  83  THR THR B . n 
B 1 104 ILE 104 84  84  ILE ILE B . n 
B 1 105 VAL 105 85  85  VAL VAL B . n 
B 1 106 LEU 106 86  86  LEU LEU B . n 
B 1 107 ALA 107 87  87  ALA ALA B . n 
B 1 108 SER 108 88  88  SER SER B . n 
B 1 109 PRO 109 89  89  PRO PRO B . n 
B 1 110 GLY 110 90  90  GLY GLY B . n 
B 1 111 TRP 111 91  91  TRP TRP B . n 
B 1 112 THR 112 92  92  THR THR B . n 
B 1 113 THR 113 93  93  THR THR B . n 
B 1 114 HIS 114 94  94  HIS HIS B . n 
B 1 115 SER 115 95  95  SER SER B . n 
B 1 116 ILE 116 96  96  ILE ILE B . n 
B 1 117 SER 117 97  97  SER SER B . n 
B 1 118 ASP 118 98  98  ASP ASP B . n 
B 1 119 GLY 119 99  99  GLY GLY B . n 
B 1 120 LYS 120 100 100 LYS LYS B . n 
B 1 121 ASP 121 101 101 ASP ASP B . n 
B 1 122 LEU 122 102 102 LEU LEU B . n 
B 1 123 GLU 123 103 103 GLU GLU B . n 
B 1 124 LYS 124 104 104 LYS LYS B . n 
B 1 125 LEU 125 105 105 LEU LEU B . n 
B 1 126 LEU 126 106 106 LEU LEU B . n 
B 1 127 THR 127 107 107 THR THR B . n 
B 1 128 GLU 128 108 108 GLU GLU B . n 
B 1 129 TRP 129 109 109 TRP TRP B . n 
B 1 130 PRO 130 110 110 PRO PRO B . n 
B 1 131 ASP 131 111 111 ASP ASP B . n 
B 1 132 THR 132 112 112 THR THR B . n 
B 1 133 ILE 133 113 113 ILE ILE B . n 
B 1 134 PRO 134 114 114 PRO PRO B . n 
B 1 135 LEU 135 115 115 LEU LEU B . n 
B 1 136 SER 136 116 116 SER SER B . n 
B 1 137 LEU 137 117 117 LEU LEU B . n 
B 1 138 ALA 138 118 118 ALA ALA B . n 
B 1 139 LEU 139 119 119 LEU LEU B . n 
B 1 140 GLY 140 120 120 GLY GLY B . n 
B 1 141 THR 141 121 121 THR THR B . n 
B 1 142 VAL 142 122 122 VAL VAL B . n 
B 1 143 GLY 143 123 123 GLY GLY B . n 
B 1 144 MET 144 124 124 MET MET B . n 
B 1 145 PRO 145 125 125 PRO PRO B . n 
B 1 146 GLY 146 126 126 GLY GLY B . n 
B 1 147 LEU 147 127 127 LEU LEU B . n 
B 1 148 THR 148 128 128 THR THR B . n 
B 1 149 ALA 149 129 129 ALA ALA B . n 
B 1 150 TYR 150 130 130 TYR TYR B . n 
B 1 151 PHE 151 131 131 PHE PHE B . n 
B 1 152 GLY 152 132 132 GLY GLY B . n 
B 1 153 LEU 153 133 133 LEU LEU B . n 
B 1 154 LEU 154 134 134 LEU LEU B . n 
B 1 155 GLU 155 135 135 GLU GLU B . n 
B 1 156 ILE 156 136 136 ILE ILE B . n 
B 1 157 CYS 157 137 137 CYS CYS B . n 
B 1 158 GLY 158 138 138 GLY GLY B . n 
B 1 159 VAL 159 139 139 VAL VAL B . n 
B 1 160 LYS 160 140 140 LYS LYS B . n 
B 1 161 GLY 161 141 141 GLY GLY B . n 
B 1 162 GLY 162 142 142 GLY GLY B . n 
B 1 163 GLU 163 143 143 GLU GLU B . n 
B 1 164 THR 164 144 144 THR THR B . n 
B 1 165 VAL 165 145 145 VAL VAL B . n 
B 1 166 MET 166 146 146 MET MET B . n 
B 1 167 VAL 167 147 147 VAL VAL B . n 
B 1 168 ASN 168 148 148 ASN ASN B . n 
B 1 169 ALA 169 149 149 ALA ALA B . n 
B 1 170 ALA 170 150 150 ALA ALA B . n 
B 1 171 ALA 171 151 151 ALA ALA B . n 
B 1 172 GLY 172 152 152 GLY GLY B . n 
B 1 173 ALA 173 153 153 ALA ALA B . n 
B 1 174 VAL 174 154 154 VAL VAL B . n 
B 1 175 GLY 175 155 155 GLY GLY B . n 
B 1 176 SER 176 156 156 SER SER B . n 
B 1 177 VAL 177 157 157 VAL VAL B . n 
B 1 178 VAL 178 158 158 VAL VAL B . n 
B 1 179 GLY 179 159 159 GLY GLY B . n 
B 1 180 GLN 180 160 160 GLN GLN B . n 
B 1 181 ILE 181 161 161 ILE ILE B . n 
B 1 182 ALA 182 162 162 ALA ALA B . n 
B 1 183 LYS 183 163 163 LYS LYS B . n 
B 1 184 LEU 184 164 164 LEU LEU B . n 
B 1 185 LYS 185 165 165 LYS LYS B . n 
B 1 186 GLY 186 166 166 GLY GLY B . n 
B 1 187 CYS 187 167 167 CYS CYS B . n 
B 1 188 LYS 188 168 168 LYS LYS B . n 
B 1 189 VAL 189 169 169 VAL VAL B . n 
B 1 190 VAL 190 170 170 VAL VAL B . n 
B 1 191 GLY 191 171 171 GLY GLY B . n 
B 1 192 ALA 192 172 172 ALA ALA B . n 
B 1 193 VAL 193 173 173 VAL VAL B . n 
B 1 194 GLY 194 174 174 GLY GLY B . n 
B 1 195 SER 195 175 175 SER SER B . n 
B 1 196 ASP 196 176 176 ASP ASP B . n 
B 1 197 GLU 197 177 177 GLU GLU B . n 
B 1 198 LYS 198 178 178 LYS LYS B . n 
B 1 199 VAL 199 179 179 VAL VAL B . n 
B 1 200 ALA 200 180 180 ALA ALA B . n 
B 1 201 TYR 201 181 181 TYR TYR B . n 
B 1 202 LEU 202 182 182 LEU LEU B . n 
B 1 203 GLN 203 183 183 GLN GLN B . n 
B 1 204 LYS 204 184 184 LYS LYS B . n 
B 1 205 LEU 205 185 185 LEU LEU B . n 
B 1 206 GLY 206 186 186 GLY GLY B . n 
B 1 207 PHE 207 187 187 PHE PHE B . n 
B 1 208 ASP 208 188 188 ASP ASP B . n 
B 1 209 VAL 209 189 189 VAL VAL B . n 
B 1 210 VAL 210 190 190 VAL VAL B . n 
B 1 211 PHE 211 191 191 PHE PHE B . n 
B 1 212 ASN 212 192 192 ASN ASN B . n 
B 1 213 TYR 213 193 193 TYR TYR B . n 
B 1 214 LYS 214 194 194 LYS LYS B . n 
B 1 215 THR 215 195 195 THR THR B . n 
B 1 216 VAL 216 196 196 VAL VAL B . n 
B 1 217 GLU 217 197 197 GLU GLU B . n 
B 1 218 SER 218 198 198 SER SER B . n 
B 1 219 LEU 219 199 199 LEU LEU B . n 
B 1 220 GLU 220 200 200 GLU GLU B . n 
B 1 221 GLU 221 201 201 GLU GLU B . n 
B 1 222 THR 222 202 202 THR THR B . n 
B 1 223 LEU 223 203 203 LEU LEU B . n 
B 1 224 LYS 224 204 204 LYS LYS B . n 
B 1 225 LYS 225 205 205 LYS LYS B . n 
B 1 226 ALA 226 206 206 ALA ALA B . n 
B 1 227 SER 227 207 207 SER SER B . n 
B 1 228 PRO 228 208 208 PRO PRO B . n 
B 1 229 ASP 229 209 209 ASP ASP B . n 
B 1 230 GLY 230 210 210 GLY GLY B . n 
B 1 231 TYR 231 211 211 TYR TYR B . n 
B 1 232 ASP 232 212 212 ASP ASP B . n 
B 1 233 CYS 233 213 213 CYS CYS B . n 
B 1 234 TYR 234 214 214 TYR TYR B . n 
B 1 235 PHE 235 215 215 PHE PHE B . n 
B 1 236 ASP 236 216 216 ASP ASP B . n 
B 1 237 ASN 237 217 217 ASN ASN B . n 
B 1 238 VAL 238 218 218 VAL VAL B . n 
B 1 239 GLY 239 219 219 GLY GLY B . n 
B 1 240 GLY 240 220 220 GLY GLY B . n 
B 1 241 GLU 241 221 221 GLU GLU B . n 
B 1 242 PHE 242 222 222 PHE PHE B . n 
B 1 243 SER 243 223 223 SER SER B . n 
B 1 244 ASN 244 224 224 ASN ASN B . n 
B 1 245 THR 245 225 225 THR THR B . n 
B 1 246 VAL 246 226 226 VAL VAL B . n 
B 1 247 ILE 247 227 227 ILE ILE B . n 
B 1 248 GLY 248 228 228 GLY GLY B . n 
B 1 249 GLN 249 229 229 GLN GLN B . n 
B 1 250 MET 250 230 230 MET MET B . n 
B 1 251 LYS 251 231 231 LYS LYS B . n 
B 1 252 LYS 252 232 232 LYS LYS B . n 
B 1 253 PHE 253 233 233 PHE PHE B . n 
B 1 254 GLY 254 234 234 GLY GLY B . n 
B 1 255 ARG 255 235 235 ARG ARG B . n 
B 1 256 ILE 256 236 236 ILE ILE B . n 
B 1 257 ALA 257 237 237 ALA ALA B . n 
B 1 258 ILE 258 238 238 ILE ILE B . n 
B 1 259 CYS 259 239 239 CYS CYS B . n 
B 1 260 GLY 260 240 240 GLY GLY B . n 
B 1 261 ALA 261 241 241 ALA ALA B . n 
B 1 262 ILE 262 242 242 ILE ILE B . n 
B 1 263 SER 263 243 243 SER SER B . n 
B 1 264 THR 264 244 244 THR THR B . n 
B 1 265 TYR 265 245 245 TYR TYR B . n 
B 1 266 ASN 266 246 246 ASN ASN B . n 
B 1 267 ARG 267 247 247 ARG ARG B . n 
B 1 268 THR 268 248 248 THR THR B . n 
B 1 269 GLY 269 249 249 GLY GLY B . n 
B 1 270 PRO 270 250 250 PRO PRO B . n 
B 1 271 LEU 271 251 251 LEU LEU B . n 
B 1 272 PRO 272 252 252 PRO PRO B . n 
B 1 273 PRO 273 253 253 PRO PRO B . n 
B 1 274 GLY 274 254 254 GLY GLY B . n 
B 1 275 PRO 275 255 255 PRO PRO B . n 
B 1 276 PRO 276 256 256 PRO PRO B . n 
B 1 277 PRO 277 257 257 PRO PRO B . n 
B 1 278 GLU 278 258 258 GLU GLU B . n 
B 1 279 ILE 279 259 259 ILE ILE B . n 
B 1 280 VAL 280 260 260 VAL VAL B . n 
B 1 281 ILE 281 261 261 ILE ILE B . n 
B 1 282 TYR 282 262 262 TYR TYR B . n 
B 1 283 GLN 283 263 263 GLN GLN B . n 
B 1 284 GLU 284 264 264 GLU GLU B . n 
B 1 285 LEU 285 265 265 LEU LEU B . n 
B 1 286 ARG 286 266 266 ARG ARG B . n 
B 1 287 MET 287 267 267 MET MET B . n 
B 1 288 GLU 288 268 268 GLU GLU B . n 
B 1 289 ALA 289 269 269 ALA ALA B . n 
B 1 290 PHE 290 270 270 PHE PHE B . n 
B 1 291 VAL 291 271 271 VAL VAL B . n 
B 1 292 VAL 292 272 272 VAL VAL B . n 
B 1 293 TYR 293 273 273 TYR TYR B . n 
B 1 294 ARG 294 274 274 ARG ARG B . n 
B 1 295 TRP 295 275 275 TRP TRP B . n 
B 1 296 GLN 296 276 276 GLN GLN B . n 
B 1 297 GLY 297 277 277 GLY GLY B . n 
B 1 298 ASP 298 278 278 ASP ASP B . n 
B 1 299 ALA 299 279 279 ALA ALA B . n 
B 1 300 ARG 300 280 280 ARG ARG B . n 
B 1 301 GLN 301 281 281 GLN GLN B . n 
B 1 302 LYS 302 282 282 LYS LYS B . n 
B 1 303 ALA 303 283 283 ALA ALA B . n 
B 1 304 LEU 304 284 284 LEU LEU B . n 
B 1 305 LYS 305 285 285 LYS LYS B . n 
B 1 306 ASP 306 286 286 ASP ASP B . n 
B 1 307 LEU 307 287 287 LEU LEU B . n 
B 1 308 LEU 308 288 288 LEU LEU B . n 
B 1 309 LYS 309 289 289 LYS LYS B . n 
B 1 310 TRP 310 290 290 TRP TRP B . n 
B 1 311 VAL 311 291 291 VAL VAL B . n 
B 1 312 LEU 312 292 292 LEU LEU B . n 
B 1 313 GLU 313 293 293 GLU GLU B . n 
B 1 314 GLY 314 294 294 GLY GLY B . n 
B 1 315 LYS 315 295 295 LYS LYS B . n 
B 1 316 ILE 316 296 296 ILE ILE B . n 
B 1 317 GLN 317 297 297 GLN GLN B . n 
B 1 318 TYR 318 298 298 TYR TYR B . n 
B 1 319 LYS 319 299 299 LYS LYS B . n 
B 1 320 GLU 320 300 300 GLU GLU B . n 
B 1 321 TYR 321 301 301 TYR TYR B . n 
B 1 322 ILE 322 302 302 ILE ILE B . n 
B 1 323 ILE 323 303 303 ILE ILE B . n 
B 1 324 GLU 324 304 304 GLU GLU B . n 
B 1 325 GLY 325 305 305 GLY GLY B . n 
B 1 326 PHE 326 306 306 PHE PHE B . n 
B 1 327 GLU 327 307 307 GLU GLU B . n 
B 1 328 ASN 328 308 308 ASN ASN B . n 
B 1 329 MET 329 309 309 MET MET B . n 
B 1 330 PRO 330 310 310 PRO PRO B . n 
B 1 331 ALA 331 311 311 ALA ALA B . n 
B 1 332 ALA 332 312 312 ALA ALA B . n 
B 1 333 PHE 333 313 313 PHE PHE B . n 
B 1 334 MET 334 314 314 MET MET B . n 
B 1 335 GLY 335 315 315 GLY GLY B . n 
B 1 336 MET 336 316 316 MET MET B . n 
B 1 337 LEU 337 317 317 LEU LEU B . n 
B 1 338 LYS 338 318 318 LYS LYS B . n 
B 1 339 GLY 339 319 319 GLY GLY B . n 
B 1 340 ASP 340 320 320 ASP ASP B . n 
B 1 341 ASN 341 321 321 ASN ASN B . n 
B 1 342 LEU 342 322 322 LEU LEU B . n 
B 1 343 GLY 343 323 323 GLY GLY B . n 
B 1 344 LYS 344 324 324 LYS LYS B . n 
B 1 345 THR 345 325 325 THR THR B . n 
B 1 346 ILE 346 326 326 ILE ILE B . n 
B 1 347 VAL 347 327 327 VAL VAL B . n 
B 1 348 LYS 348 328 328 LYS LYS B . n 
B 1 349 ALA 349 329 329 ALA ALA B . n 
C 1 1   MET 1   -19 ?   ?   ?   C . n 
C 1 2   HIS 2   -18 ?   ?   ?   C . n 
C 1 3   HIS 3   -17 ?   ?   ?   C . n 
C 1 4   HIS 4   -16 ?   ?   ?   C . n 
C 1 5   HIS 5   -15 ?   ?   ?   C . n 
C 1 6   HIS 6   -14 ?   ?   ?   C . n 
C 1 7   HIS 7   -13 ?   ?   ?   C . n 
C 1 8   SER 8   -12 ?   ?   ?   C . n 
C 1 9   SER 9   -11 ?   ?   ?   C . n 
C 1 10  GLY 10  -10 ?   ?   ?   C . n 
C 1 11  VAL 11  -9  ?   ?   ?   C . n 
C 1 12  ASP 12  -8  ?   ?   ?   C . n 
C 1 13  LEU 13  -7  ?   ?   ?   C . n 
C 1 14  GLY 14  -6  ?   ?   ?   C . n 
C 1 15  THR 15  -5  ?   ?   ?   C . n 
C 1 16  GLU 16  -4  ?   ?   ?   C . n 
C 1 17  ASN 17  -3  ?   ?   ?   C . n 
C 1 18  LEU 18  -2  ?   ?   ?   C . n 
C 1 19  TYR 19  -1  ?   ?   ?   C . n 
C 1 20  PHE 20  0   ?   ?   ?   C . n 
C 1 21  GLN 21  1   ?   ?   ?   C . n 
C 1 22  SER 22  2   2   SER SER C . n 
C 1 23  MET 23  3   3   MET MET C . n 
C 1 24  THR 24  4   4   THR THR C . n 
C 1 25  LYS 25  5   5   LYS LYS C . n 
C 1 26  THR 26  6   6   THR THR C . n 
C 1 27  TRP 27  7   7   TRP TRP C . n 
C 1 28  THR 28  8   8   THR THR C . n 
C 1 29  LEU 29  9   9   LEU LEU C . n 
C 1 30  LYS 30  10  10  LYS LYS C . n 
C 1 31  LYS 31  11  11  LYS LYS C . n 
C 1 32  HIS 32  12  12  HIS HIS C . n 
C 1 33  PHE 33  13  13  PHE PHE C . n 
C 1 34  VAL 34  14  14  VAL VAL C . n 
C 1 35  GLY 35  15  15  GLY GLY C . n 
C 1 36  TYR 36  16  16  TYR TYR C . n 
C 1 37  PRO 37  17  17  PRO PRO C . n 
C 1 38  THR 38  18  18  THR THR C . n 
C 1 39  ASN 39  19  19  ASN ASN C . n 
C 1 40  SER 40  20  20  SER SER C . n 
C 1 41  ASP 41  21  21  ASP ASP C . n 
C 1 42  PHE 42  22  22  PHE PHE C . n 
C 1 43  GLU 43  23  23  GLU GLU C . n 
C 1 44  LEU 44  24  24  LEU LEU C . n 
C 1 45  LYS 45  25  25  LYS LYS C . n 
C 1 46  THR 46  26  26  THR THR C . n 
C 1 47  SER 47  27  27  SER SER C . n 
C 1 48  GLU 48  28  28  GLU GLU C . n 
C 1 49  LEU 49  29  29  LEU LEU C . n 
C 1 50  PRO 50  30  30  PRO PRO C . n 
C 1 51  PRO 51  31  31  PRO PRO C . n 
C 1 52  LEU 52  32  32  LEU LEU C . n 
C 1 53  LYS 53  33  33  LYS LYS C . n 
C 1 54  ASN 54  34  34  ASN ASN C . n 
C 1 55  GLY 55  35  35  GLY GLY C . n 
C 1 56  GLU 56  36  36  GLU GLU C . n 
C 1 57  VAL 57  37  37  VAL VAL C . n 
C 1 58  LEU 58  38  38  LEU LEU C . n 
C 1 59  LEU 59  39  39  LEU LEU C . n 
C 1 60  GLU 60  40  40  GLU GLU C . n 
C 1 61  ALA 61  41  41  ALA ALA C . n 
C 1 62  LEU 62  42  42  LEU LEU C . n 
C 1 63  PHE 63  43  43  PHE PHE C . n 
C 1 64  LEU 64  44  44  LEU LEU C . n 
C 1 65  THR 65  45  45  THR THR C . n 
C 1 66  VAL 66  46  46  VAL VAL C . n 
C 1 67  ASP 67  47  47  ASP ASP C . n 
C 1 68  PRO 68  48  48  PRO PRO C . n 
C 1 69  TYR 69  49  49  TYR TYR C . n 
C 1 70  MET 70  50  50  MET MET C . n 
C 1 71  ARG 71  51  51  ARG ARG C . n 
C 1 72  VAL 72  52  52  VAL VAL C . n 
C 1 73  ALA 73  53  53  ALA ALA C . n 
C 1 74  ALA 74  54  54  ALA ALA C . n 
C 1 75  LYS 75  55  55  LYS LYS C . n 
C 1 76  ARG 76  56  56  ARG ARG C . n 
C 1 77  LEU 77  57  57  LEU LEU C . n 
C 1 78  LYS 78  58  58  LYS LYS C . n 
C 1 79  GLU 79  59  59  GLU GLU C . n 
C 1 80  GLY 80  60  60  GLY GLY C . n 
C 1 81  ASP 81  61  61  ASP ASP C . n 
C 1 82  THR 82  62  62  THR THR C . n 
C 1 83  MET 83  63  63  MET MET C . n 
C 1 84  MET 84  64  64  MET MET C . n 
C 1 85  GLY 85  65  65  GLY GLY C . n 
C 1 86  GLN 86  66  66  GLN GLN C . n 
C 1 87  GLN 87  67  67  GLN GLN C . n 
C 1 88  VAL 88  68  68  VAL VAL C . n 
C 1 89  ALA 89  69  69  ALA ALA C . n 
C 1 90  LYS 90  70  70  LYS LYS C . n 
C 1 91  VAL 91  71  71  VAL VAL C . n 
C 1 92  VAL 92  72  72  VAL VAL C . n 
C 1 93  GLU 93  73  73  GLU GLU C . n 
C 1 94  SER 94  74  74  SER SER C . n 
C 1 95  LYS 95  75  75  LYS LYS C . n 
C 1 96  ASN 96  76  76  ASN ASN C . n 
C 1 97  VAL 97  77  77  VAL VAL C . n 
C 1 98  ALA 98  78  78  ALA ALA C . n 
C 1 99  LEU 99  79  79  LEU LEU C . n 
C 1 100 PRO 100 80  80  PRO PRO C . n 
C 1 101 LYS 101 81  81  LYS LYS C . n 
C 1 102 GLY 102 82  82  GLY GLY C . n 
C 1 103 THR 103 83  83  THR THR C . n 
C 1 104 ILE 104 84  84  ILE ILE C . n 
C 1 105 VAL 105 85  85  VAL VAL C . n 
C 1 106 LEU 106 86  86  LEU LEU C . n 
C 1 107 ALA 107 87  87  ALA ALA C . n 
C 1 108 SER 108 88  88  SER SER C . n 
C 1 109 PRO 109 89  89  PRO PRO C . n 
C 1 110 GLY 110 90  90  GLY GLY C . n 
C 1 111 TRP 111 91  91  TRP TRP C . n 
C 1 112 THR 112 92  92  THR THR C . n 
C 1 113 THR 113 93  93  THR THR C . n 
C 1 114 HIS 114 94  94  HIS HIS C . n 
C 1 115 SER 115 95  95  SER SER C . n 
C 1 116 ILE 116 96  96  ILE ILE C . n 
C 1 117 SER 117 97  97  SER SER C . n 
C 1 118 ASP 118 98  98  ASP ASP C . n 
C 1 119 GLY 119 99  99  GLY GLY C . n 
C 1 120 LYS 120 100 100 LYS LYS C . n 
C 1 121 ASP 121 101 101 ASP ASP C . n 
C 1 122 LEU 122 102 102 LEU LEU C . n 
C 1 123 GLU 123 103 103 GLU GLU C . n 
C 1 124 LYS 124 104 104 LYS LYS C . n 
C 1 125 LEU 125 105 105 LEU LEU C . n 
C 1 126 LEU 126 106 106 LEU LEU C . n 
C 1 127 THR 127 107 107 THR THR C . n 
C 1 128 GLU 128 108 108 GLU GLU C . n 
C 1 129 TRP 129 109 109 TRP TRP C . n 
C 1 130 PRO 130 110 110 PRO PRO C . n 
C 1 131 ASP 131 111 111 ASP ASP C . n 
C 1 132 THR 132 112 112 THR THR C . n 
C 1 133 ILE 133 113 113 ILE ILE C . n 
C 1 134 PRO 134 114 114 PRO PRO C . n 
C 1 135 LEU 135 115 115 LEU LEU C . n 
C 1 136 SER 136 116 116 SER SER C . n 
C 1 137 LEU 137 117 117 LEU LEU C . n 
C 1 138 ALA 138 118 118 ALA ALA C . n 
C 1 139 LEU 139 119 119 LEU LEU C . n 
C 1 140 GLY 140 120 120 GLY GLY C . n 
C 1 141 THR 141 121 121 THR THR C . n 
C 1 142 VAL 142 122 122 VAL VAL C . n 
C 1 143 GLY 143 123 123 GLY GLY C . n 
C 1 144 MET 144 124 124 MET MET C . n 
C 1 145 PRO 145 125 125 PRO PRO C . n 
C 1 146 GLY 146 126 126 GLY GLY C . n 
C 1 147 LEU 147 127 127 LEU LEU C . n 
C 1 148 THR 148 128 128 THR THR C . n 
C 1 149 ALA 149 129 129 ALA ALA C . n 
C 1 150 TYR 150 130 130 TYR TYR C . n 
C 1 151 PHE 151 131 131 PHE PHE C . n 
C 1 152 GLY 152 132 132 GLY GLY C . n 
C 1 153 LEU 153 133 133 LEU LEU C . n 
C 1 154 LEU 154 134 134 LEU LEU C . n 
C 1 155 GLU 155 135 135 GLU GLU C . n 
C 1 156 ILE 156 136 136 ILE ILE C . n 
C 1 157 CYS 157 137 137 CYS CYS C . n 
C 1 158 GLY 158 138 138 GLY GLY C . n 
C 1 159 VAL 159 139 139 VAL VAL C . n 
C 1 160 LYS 160 140 140 LYS LYS C . n 
C 1 161 GLY 161 141 141 GLY GLY C . n 
C 1 162 GLY 162 142 142 GLY GLY C . n 
C 1 163 GLU 163 143 143 GLU GLU C . n 
C 1 164 THR 164 144 144 THR THR C . n 
C 1 165 VAL 165 145 145 VAL VAL C . n 
C 1 166 MET 166 146 146 MET MET C . n 
C 1 167 VAL 167 147 147 VAL VAL C . n 
C 1 168 ASN 168 148 148 ASN ASN C . n 
C 1 169 ALA 169 149 149 ALA ALA C . n 
C 1 170 ALA 170 150 150 ALA ALA C . n 
C 1 171 ALA 171 151 151 ALA ALA C . n 
C 1 172 GLY 172 152 152 GLY GLY C . n 
C 1 173 ALA 173 153 153 ALA ALA C . n 
C 1 174 VAL 174 154 154 VAL VAL C . n 
C 1 175 GLY 175 155 155 GLY GLY C . n 
C 1 176 SER 176 156 156 SER SER C . n 
C 1 177 VAL 177 157 157 VAL VAL C . n 
C 1 178 VAL 178 158 158 VAL VAL C . n 
C 1 179 GLY 179 159 159 GLY GLY C . n 
C 1 180 GLN 180 160 160 GLN GLN C . n 
C 1 181 ILE 181 161 161 ILE ILE C . n 
C 1 182 ALA 182 162 162 ALA ALA C . n 
C 1 183 LYS 183 163 163 LYS LYS C . n 
C 1 184 LEU 184 164 164 LEU LEU C . n 
C 1 185 LYS 185 165 165 LYS LYS C . n 
C 1 186 GLY 186 166 166 GLY GLY C . n 
C 1 187 CYS 187 167 167 CYS CYS C . n 
C 1 188 LYS 188 168 168 LYS LYS C . n 
C 1 189 VAL 189 169 169 VAL VAL C . n 
C 1 190 VAL 190 170 170 VAL VAL C . n 
C 1 191 GLY 191 171 171 GLY GLY C . n 
C 1 192 ALA 192 172 172 ALA ALA C . n 
C 1 193 VAL 193 173 173 VAL VAL C . n 
C 1 194 GLY 194 174 174 GLY GLY C . n 
C 1 195 SER 195 175 175 SER SER C . n 
C 1 196 ASP 196 176 176 ASP ASP C . n 
C 1 197 GLU 197 177 177 GLU GLU C . n 
C 1 198 LYS 198 178 178 LYS LYS C . n 
C 1 199 VAL 199 179 179 VAL VAL C . n 
C 1 200 ALA 200 180 180 ALA ALA C . n 
C 1 201 TYR 201 181 181 TYR TYR C . n 
C 1 202 LEU 202 182 182 LEU LEU C . n 
C 1 203 GLN 203 183 183 GLN GLN C . n 
C 1 204 LYS 204 184 184 LYS LYS C . n 
C 1 205 LEU 205 185 185 LEU LEU C . n 
C 1 206 GLY 206 186 186 GLY GLY C . n 
C 1 207 PHE 207 187 187 PHE PHE C . n 
C 1 208 ASP 208 188 188 ASP ASP C . n 
C 1 209 VAL 209 189 189 VAL VAL C . n 
C 1 210 VAL 210 190 190 VAL VAL C . n 
C 1 211 PHE 211 191 191 PHE PHE C . n 
C 1 212 ASN 212 192 192 ASN ASN C . n 
C 1 213 TYR 213 193 193 TYR TYR C . n 
C 1 214 LYS 214 194 194 LYS LYS C . n 
C 1 215 THR 215 195 195 THR THR C . n 
C 1 216 VAL 216 196 196 VAL VAL C . n 
C 1 217 GLU 217 197 197 GLU GLU C . n 
C 1 218 SER 218 198 198 SER SER C . n 
C 1 219 LEU 219 199 199 LEU LEU C . n 
C 1 220 GLU 220 200 200 GLU GLU C . n 
C 1 221 GLU 221 201 201 GLU GLU C . n 
C 1 222 THR 222 202 202 THR THR C . n 
C 1 223 LEU 223 203 203 LEU LEU C . n 
C 1 224 LYS 224 204 204 LYS LYS C . n 
C 1 225 LYS 225 205 205 LYS LYS C . n 
C 1 226 ALA 226 206 206 ALA ALA C . n 
C 1 227 SER 227 207 207 SER SER C . n 
C 1 228 PRO 228 208 208 PRO PRO C . n 
C 1 229 ASP 229 209 209 ASP ASP C . n 
C 1 230 GLY 230 210 210 GLY GLY C . n 
C 1 231 TYR 231 211 211 TYR TYR C . n 
C 1 232 ASP 232 212 212 ASP ASP C . n 
C 1 233 CYS 233 213 213 CYS CYS C . n 
C 1 234 TYR 234 214 214 TYR TYR C . n 
C 1 235 PHE 235 215 215 PHE PHE C . n 
C 1 236 ASP 236 216 216 ASP ASP C . n 
C 1 237 ASN 237 217 217 ASN ASN C . n 
C 1 238 VAL 238 218 218 VAL VAL C . n 
C 1 239 GLY 239 219 219 GLY GLY C . n 
C 1 240 GLY 240 220 220 GLY GLY C . n 
C 1 241 GLU 241 221 221 GLU GLU C . n 
C 1 242 PHE 242 222 222 PHE PHE C . n 
C 1 243 SER 243 223 223 SER SER C . n 
C 1 244 ASN 244 224 224 ASN ASN C . n 
C 1 245 THR 245 225 225 THR THR C . n 
C 1 246 VAL 246 226 226 VAL VAL C . n 
C 1 247 ILE 247 227 227 ILE ILE C . n 
C 1 248 GLY 248 228 228 GLY GLY C . n 
C 1 249 GLN 249 229 229 GLN GLN C . n 
C 1 250 MET 250 230 230 MET MET C . n 
C 1 251 LYS 251 231 231 LYS LYS C . n 
C 1 252 LYS 252 232 232 LYS LYS C . n 
C 1 253 PHE 253 233 233 PHE PHE C . n 
C 1 254 GLY 254 234 234 GLY GLY C . n 
C 1 255 ARG 255 235 235 ARG ARG C . n 
C 1 256 ILE 256 236 236 ILE ILE C . n 
C 1 257 ALA 257 237 237 ALA ALA C . n 
C 1 258 ILE 258 238 238 ILE ILE C . n 
C 1 259 CYS 259 239 239 CYS CYS C . n 
C 1 260 GLY 260 240 240 GLY GLY C . n 
C 1 261 ALA 261 241 241 ALA ALA C . n 
C 1 262 ILE 262 242 242 ILE ILE C . n 
C 1 263 SER 263 243 243 SER SER C . n 
C 1 264 THR 264 244 244 THR THR C . n 
C 1 265 TYR 265 245 245 TYR TYR C . n 
C 1 266 ASN 266 246 246 ASN ASN C . n 
C 1 267 ARG 267 247 247 ARG ARG C . n 
C 1 268 THR 268 248 248 THR THR C . n 
C 1 269 GLY 269 249 249 GLY GLY C . n 
C 1 270 PRO 270 250 250 PRO PRO C . n 
C 1 271 LEU 271 251 251 LEU LEU C . n 
C 1 272 PRO 272 252 252 PRO PRO C . n 
C 1 273 PRO 273 253 253 PRO PRO C . n 
C 1 274 GLY 274 254 254 GLY GLY C . n 
C 1 275 PRO 275 255 255 PRO PRO C . n 
C 1 276 PRO 276 256 256 PRO PRO C . n 
C 1 277 PRO 277 257 257 PRO PRO C . n 
C 1 278 GLU 278 258 258 GLU GLU C . n 
C 1 279 ILE 279 259 259 ILE ILE C . n 
C 1 280 VAL 280 260 260 VAL VAL C . n 
C 1 281 ILE 281 261 261 ILE ILE C . n 
C 1 282 TYR 282 262 262 TYR TYR C . n 
C 1 283 GLN 283 263 263 GLN GLN C . n 
C 1 284 GLU 284 264 264 GLU GLU C . n 
C 1 285 LEU 285 265 265 LEU LEU C . n 
C 1 286 ARG 286 266 266 ARG ARG C . n 
C 1 287 MET 287 267 267 MET MET C . n 
C 1 288 GLU 288 268 268 GLU GLU C . n 
C 1 289 ALA 289 269 269 ALA ALA C . n 
C 1 290 PHE 290 270 270 PHE PHE C . n 
C 1 291 VAL 291 271 271 VAL VAL C . n 
C 1 292 VAL 292 272 272 VAL VAL C . n 
C 1 293 TYR 293 273 273 TYR TYR C . n 
C 1 294 ARG 294 274 274 ARG ARG C . n 
C 1 295 TRP 295 275 275 TRP TRP C . n 
C 1 296 GLN 296 276 276 GLN GLN C . n 
C 1 297 GLY 297 277 277 GLY GLY C . n 
C 1 298 ASP 298 278 278 ASP ASP C . n 
C 1 299 ALA 299 279 279 ALA ALA C . n 
C 1 300 ARG 300 280 280 ARG ARG C . n 
C 1 301 GLN 301 281 281 GLN GLN C . n 
C 1 302 LYS 302 282 282 LYS LYS C . n 
C 1 303 ALA 303 283 283 ALA ALA C . n 
C 1 304 LEU 304 284 284 LEU LEU C . n 
C 1 305 LYS 305 285 285 LYS LYS C . n 
C 1 306 ASP 306 286 286 ASP ASP C . n 
C 1 307 LEU 307 287 287 LEU LEU C . n 
C 1 308 LEU 308 288 288 LEU LEU C . n 
C 1 309 LYS 309 289 289 LYS LYS C . n 
C 1 310 TRP 310 290 290 TRP TRP C . n 
C 1 311 VAL 311 291 291 VAL VAL C . n 
C 1 312 LEU 312 292 292 LEU LEU C . n 
C 1 313 GLU 313 293 293 GLU GLU C . n 
C 1 314 GLY 314 294 294 GLY GLY C . n 
C 1 315 LYS 315 295 295 LYS LYS C . n 
C 1 316 ILE 316 296 296 ILE ILE C . n 
C 1 317 GLN 317 297 297 GLN GLN C . n 
C 1 318 TYR 318 298 298 TYR TYR C . n 
C 1 319 LYS 319 299 299 LYS LYS C . n 
C 1 320 GLU 320 300 300 GLU GLU C . n 
C 1 321 TYR 321 301 301 TYR TYR C . n 
C 1 322 ILE 322 302 302 ILE ILE C . n 
C 1 323 ILE 323 303 303 ILE ILE C . n 
C 1 324 GLU 324 304 304 GLU GLU C . n 
C 1 325 GLY 325 305 305 GLY GLY C . n 
C 1 326 PHE 326 306 306 PHE PHE C . n 
C 1 327 GLU 327 307 307 GLU GLU C . n 
C 1 328 ASN 328 308 308 ASN ASN C . n 
C 1 329 MET 329 309 309 MET MET C . n 
C 1 330 PRO 330 310 310 PRO PRO C . n 
C 1 331 ALA 331 311 311 ALA ALA C . n 
C 1 332 ALA 332 312 312 ALA ALA C . n 
C 1 333 PHE 333 313 313 PHE PHE C . n 
C 1 334 MET 334 314 314 MET MET C . n 
C 1 335 GLY 335 315 315 GLY GLY C . n 
C 1 336 MET 336 316 316 MET MET C . n 
C 1 337 LEU 337 317 317 LEU LEU C . n 
C 1 338 LYS 338 318 318 LYS LYS C . n 
C 1 339 GLY 339 319 319 GLY GLY C . n 
C 1 340 ASP 340 320 320 ASP ASP C . n 
C 1 341 ASN 341 321 321 ASN ASN C . n 
C 1 342 LEU 342 322 322 LEU LEU C . n 
C 1 343 GLY 343 323 323 GLY GLY C . n 
C 1 344 LYS 344 324 324 LYS LYS C . n 
C 1 345 THR 345 325 325 THR THR C . n 
C 1 346 ILE 346 326 326 ILE ILE C . n 
C 1 347 VAL 347 327 327 VAL VAL C . n 
C 1 348 LYS 348 328 328 LYS LYS C . n 
C 1 349 ALA 349 329 329 ALA ALA C . n 
D 1 1   MET 1   -19 ?   ?   ?   D . n 
D 1 2   HIS 2   -18 ?   ?   ?   D . n 
D 1 3   HIS 3   -17 ?   ?   ?   D . n 
D 1 4   HIS 4   -16 ?   ?   ?   D . n 
D 1 5   HIS 5   -15 ?   ?   ?   D . n 
D 1 6   HIS 6   -14 ?   ?   ?   D . n 
D 1 7   HIS 7   -13 ?   ?   ?   D . n 
D 1 8   SER 8   -12 ?   ?   ?   D . n 
D 1 9   SER 9   -11 ?   ?   ?   D . n 
D 1 10  GLY 10  -10 ?   ?   ?   D . n 
D 1 11  VAL 11  -9  ?   ?   ?   D . n 
D 1 12  ASP 12  -8  ?   ?   ?   D . n 
D 1 13  LEU 13  -7  ?   ?   ?   D . n 
D 1 14  GLY 14  -6  ?   ?   ?   D . n 
D 1 15  THR 15  -5  ?   ?   ?   D . n 
D 1 16  GLU 16  -4  ?   ?   ?   D . n 
D 1 17  ASN 17  -3  ?   ?   ?   D . n 
D 1 18  LEU 18  -2  ?   ?   ?   D . n 
D 1 19  TYR 19  -1  ?   ?   ?   D . n 
D 1 20  PHE 20  0   ?   ?   ?   D . n 
D 1 21  GLN 21  1   ?   ?   ?   D . n 
D 1 22  SER 22  2   2   SER SER D . n 
D 1 23  MET 23  3   3   MET MET D . n 
D 1 24  THR 24  4   4   THR THR D . n 
D 1 25  LYS 25  5   5   LYS LYS D . n 
D 1 26  THR 26  6   6   THR THR D . n 
D 1 27  TRP 27  7   7   TRP TRP D . n 
D 1 28  THR 28  8   8   THR THR D . n 
D 1 29  LEU 29  9   9   LEU LEU D . n 
D 1 30  LYS 30  10  10  LYS LYS D . n 
D 1 31  LYS 31  11  11  LYS LYS D . n 
D 1 32  HIS 32  12  12  HIS HIS D . n 
D 1 33  PHE 33  13  13  PHE PHE D . n 
D 1 34  VAL 34  14  14  VAL VAL D . n 
D 1 35  GLY 35  15  15  GLY GLY D . n 
D 1 36  TYR 36  16  16  TYR TYR D . n 
D 1 37  PRO 37  17  17  PRO PRO D . n 
D 1 38  THR 38  18  18  THR THR D . n 
D 1 39  ASN 39  19  19  ASN ASN D . n 
D 1 40  SER 40  20  20  SER SER D . n 
D 1 41  ASP 41  21  21  ASP ASP D . n 
D 1 42  PHE 42  22  22  PHE PHE D . n 
D 1 43  GLU 43  23  23  GLU GLU D . n 
D 1 44  LEU 44  24  24  LEU LEU D . n 
D 1 45  LYS 45  25  25  LYS LYS D . n 
D 1 46  THR 46  26  26  THR THR D . n 
D 1 47  SER 47  27  27  SER SER D . n 
D 1 48  GLU 48  28  28  GLU GLU D . n 
D 1 49  LEU 49  29  29  LEU LEU D . n 
D 1 50  PRO 50  30  30  PRO PRO D . n 
D 1 51  PRO 51  31  31  PRO PRO D . n 
D 1 52  LEU 52  32  32  LEU LEU D . n 
D 1 53  LYS 53  33  33  LYS LYS D . n 
D 1 54  ASN 54  34  34  ASN ASN D . n 
D 1 55  GLY 55  35  35  GLY GLY D . n 
D 1 56  GLU 56  36  36  GLU GLU D . n 
D 1 57  VAL 57  37  37  VAL VAL D . n 
D 1 58  LEU 58  38  38  LEU LEU D . n 
D 1 59  LEU 59  39  39  LEU LEU D . n 
D 1 60  GLU 60  40  40  GLU GLU D . n 
D 1 61  ALA 61  41  41  ALA ALA D . n 
D 1 62  LEU 62  42  42  LEU LEU D . n 
D 1 63  PHE 63  43  43  PHE PHE D . n 
D 1 64  LEU 64  44  44  LEU LEU D . n 
D 1 65  THR 65  45  45  THR THR D . n 
D 1 66  VAL 66  46  46  VAL VAL D . n 
D 1 67  ASP 67  47  47  ASP ASP D . n 
D 1 68  PRO 68  48  48  PRO PRO D . n 
D 1 69  TYR 69  49  49  TYR TYR D . n 
D 1 70  MET 70  50  50  MET MET D . n 
D 1 71  ARG 71  51  51  ARG ARG D . n 
D 1 72  VAL 72  52  52  VAL VAL D . n 
D 1 73  ALA 73  53  53  ALA ALA D . n 
D 1 74  ALA 74  54  54  ALA ALA D . n 
D 1 75  LYS 75  55  55  LYS LYS D . n 
D 1 76  ARG 76  56  56  ARG ARG D . n 
D 1 77  LEU 77  57  57  LEU LEU D . n 
D 1 78  LYS 78  58  58  LYS LYS D . n 
D 1 79  GLU 79  59  59  GLU GLU D . n 
D 1 80  GLY 80  60  60  GLY GLY D . n 
D 1 81  ASP 81  61  61  ASP ASP D . n 
D 1 82  THR 82  62  62  THR THR D . n 
D 1 83  MET 83  63  63  MET MET D . n 
D 1 84  MET 84  64  64  MET MET D . n 
D 1 85  GLY 85  65  65  GLY GLY D . n 
D 1 86  GLN 86  66  66  GLN GLN D . n 
D 1 87  GLN 87  67  67  GLN GLN D . n 
D 1 88  VAL 88  68  68  VAL VAL D . n 
D 1 89  ALA 89  69  69  ALA ALA D . n 
D 1 90  LYS 90  70  70  LYS LYS D . n 
D 1 91  VAL 91  71  71  VAL VAL D . n 
D 1 92  VAL 92  72  72  VAL VAL D . n 
D 1 93  GLU 93  73  73  GLU GLU D . n 
D 1 94  SER 94  74  74  SER SER D . n 
D 1 95  LYS 95  75  75  LYS LYS D . n 
D 1 96  ASN 96  76  76  ASN ASN D . n 
D 1 97  VAL 97  77  77  VAL VAL D . n 
D 1 98  ALA 98  78  78  ALA ALA D . n 
D 1 99  LEU 99  79  79  LEU LEU D . n 
D 1 100 PRO 100 80  80  PRO PRO D . n 
D 1 101 LYS 101 81  81  LYS LYS D . n 
D 1 102 GLY 102 82  82  GLY GLY D . n 
D 1 103 THR 103 83  83  THR THR D . n 
D 1 104 ILE 104 84  84  ILE ILE D . n 
D 1 105 VAL 105 85  85  VAL VAL D . n 
D 1 106 LEU 106 86  86  LEU LEU D . n 
D 1 107 ALA 107 87  87  ALA ALA D . n 
D 1 108 SER 108 88  88  SER SER D . n 
D 1 109 PRO 109 89  89  PRO PRO D . n 
D 1 110 GLY 110 90  90  GLY GLY D . n 
D 1 111 TRP 111 91  91  TRP TRP D . n 
D 1 112 THR 112 92  92  THR THR D . n 
D 1 113 THR 113 93  93  THR THR D . n 
D 1 114 HIS 114 94  94  HIS HIS D . n 
D 1 115 SER 115 95  95  SER SER D . n 
D 1 116 ILE 116 96  96  ILE ILE D . n 
D 1 117 SER 117 97  97  SER SER D . n 
D 1 118 ASP 118 98  98  ASP ASP D . n 
D 1 119 GLY 119 99  99  GLY GLY D . n 
D 1 120 LYS 120 100 100 LYS LYS D . n 
D 1 121 ASP 121 101 101 ASP ASP D . n 
D 1 122 LEU 122 102 102 LEU LEU D . n 
D 1 123 GLU 123 103 103 GLU GLU D . n 
D 1 124 LYS 124 104 104 LYS LYS D . n 
D 1 125 LEU 125 105 105 LEU LEU D . n 
D 1 126 LEU 126 106 106 LEU LEU D . n 
D 1 127 THR 127 107 107 THR THR D . n 
D 1 128 GLU 128 108 108 GLU GLU D . n 
D 1 129 TRP 129 109 109 TRP TRP D . n 
D 1 130 PRO 130 110 110 PRO PRO D . n 
D 1 131 ASP 131 111 111 ASP ASP D . n 
D 1 132 THR 132 112 112 THR THR D . n 
D 1 133 ILE 133 113 113 ILE ILE D . n 
D 1 134 PRO 134 114 114 PRO PRO D . n 
D 1 135 LEU 135 115 115 LEU LEU D . n 
D 1 136 SER 136 116 116 SER SER D . n 
D 1 137 LEU 137 117 117 LEU LEU D . n 
D 1 138 ALA 138 118 118 ALA ALA D . n 
D 1 139 LEU 139 119 119 LEU LEU D . n 
D 1 140 GLY 140 120 120 GLY GLY D . n 
D 1 141 THR 141 121 121 THR THR D . n 
D 1 142 VAL 142 122 122 VAL VAL D . n 
D 1 143 GLY 143 123 123 GLY GLY D . n 
D 1 144 MET 144 124 124 MET MET D . n 
D 1 145 PRO 145 125 125 PRO PRO D . n 
D 1 146 GLY 146 126 126 GLY GLY D . n 
D 1 147 LEU 147 127 127 LEU LEU D . n 
D 1 148 THR 148 128 128 THR THR D . n 
D 1 149 ALA 149 129 129 ALA ALA D . n 
D 1 150 TYR 150 130 130 TYR TYR D . n 
D 1 151 PHE 151 131 131 PHE PHE D . n 
D 1 152 GLY 152 132 132 GLY GLY D . n 
D 1 153 LEU 153 133 133 LEU LEU D . n 
D 1 154 LEU 154 134 134 LEU LEU D . n 
D 1 155 GLU 155 135 135 GLU GLU D . n 
D 1 156 ILE 156 136 136 ILE ILE D . n 
D 1 157 CYS 157 137 137 CYS CYS D . n 
D 1 158 GLY 158 138 138 GLY GLY D . n 
D 1 159 VAL 159 139 139 VAL VAL D . n 
D 1 160 LYS 160 140 140 LYS LYS D . n 
D 1 161 GLY 161 141 141 GLY GLY D . n 
D 1 162 GLY 162 142 142 GLY GLY D . n 
D 1 163 GLU 163 143 143 GLU GLU D . n 
D 1 164 THR 164 144 144 THR THR D . n 
D 1 165 VAL 165 145 145 VAL VAL D . n 
D 1 166 MET 166 146 146 MET MET D . n 
D 1 167 VAL 167 147 147 VAL VAL D . n 
D 1 168 ASN 168 148 148 ASN ASN D . n 
D 1 169 ALA 169 149 149 ALA ALA D . n 
D 1 170 ALA 170 150 150 ALA ALA D . n 
D 1 171 ALA 171 151 151 ALA ALA D . n 
D 1 172 GLY 172 152 152 GLY GLY D . n 
D 1 173 ALA 173 153 153 ALA ALA D . n 
D 1 174 VAL 174 154 154 VAL VAL D . n 
D 1 175 GLY 175 155 155 GLY GLY D . n 
D 1 176 SER 176 156 156 SER SER D . n 
D 1 177 VAL 177 157 157 VAL VAL D . n 
D 1 178 VAL 178 158 158 VAL VAL D . n 
D 1 179 GLY 179 159 159 GLY GLY D . n 
D 1 180 GLN 180 160 160 GLN GLN D . n 
D 1 181 ILE 181 161 161 ILE ILE D . n 
D 1 182 ALA 182 162 162 ALA ALA D . n 
D 1 183 LYS 183 163 163 LYS LYS D . n 
D 1 184 LEU 184 164 164 LEU LEU D . n 
D 1 185 LYS 185 165 165 LYS LYS D . n 
D 1 186 GLY 186 166 166 GLY GLY D . n 
D 1 187 CYS 187 167 167 CYS CYS D . n 
D 1 188 LYS 188 168 168 LYS LYS D . n 
D 1 189 VAL 189 169 169 VAL VAL D . n 
D 1 190 VAL 190 170 170 VAL VAL D . n 
D 1 191 GLY 191 171 171 GLY GLY D . n 
D 1 192 ALA 192 172 172 ALA ALA D . n 
D 1 193 VAL 193 173 173 VAL VAL D . n 
D 1 194 GLY 194 174 174 GLY GLY D . n 
D 1 195 SER 195 175 175 SER SER D . n 
D 1 196 ASP 196 176 176 ASP ASP D . n 
D 1 197 GLU 197 177 177 GLU GLU D . n 
D 1 198 LYS 198 178 178 LYS LYS D . n 
D 1 199 VAL 199 179 179 VAL VAL D . n 
D 1 200 ALA 200 180 180 ALA ALA D . n 
D 1 201 TYR 201 181 181 TYR TYR D . n 
D 1 202 LEU 202 182 182 LEU LEU D . n 
D 1 203 GLN 203 183 183 GLN GLN D . n 
D 1 204 LYS 204 184 184 LYS LYS D . n 
D 1 205 LEU 205 185 185 LEU LEU D . n 
D 1 206 GLY 206 186 186 GLY GLY D . n 
D 1 207 PHE 207 187 187 PHE PHE D . n 
D 1 208 ASP 208 188 188 ASP ASP D . n 
D 1 209 VAL 209 189 189 VAL VAL D . n 
D 1 210 VAL 210 190 190 VAL VAL D . n 
D 1 211 PHE 211 191 191 PHE PHE D . n 
D 1 212 ASN 212 192 192 ASN ASN D . n 
D 1 213 TYR 213 193 193 TYR TYR D . n 
D 1 214 LYS 214 194 194 LYS LYS D . n 
D 1 215 THR 215 195 195 THR THR D . n 
D 1 216 VAL 216 196 196 VAL VAL D . n 
D 1 217 GLU 217 197 197 GLU GLU D . n 
D 1 218 SER 218 198 198 SER SER D . n 
D 1 219 LEU 219 199 199 LEU LEU D . n 
D 1 220 GLU 220 200 200 GLU GLU D . n 
D 1 221 GLU 221 201 201 GLU GLU D . n 
D 1 222 THR 222 202 202 THR THR D . n 
D 1 223 LEU 223 203 203 LEU LEU D . n 
D 1 224 LYS 224 204 204 LYS LYS D . n 
D 1 225 LYS 225 205 205 LYS LYS D . n 
D 1 226 ALA 226 206 206 ALA ALA D . n 
D 1 227 SER 227 207 207 SER SER D . n 
D 1 228 PRO 228 208 208 PRO PRO D . n 
D 1 229 ASP 229 209 209 ASP ASP D . n 
D 1 230 GLY 230 210 210 GLY GLY D . n 
D 1 231 TYR 231 211 211 TYR TYR D . n 
D 1 232 ASP 232 212 212 ASP ASP D . n 
D 1 233 CYS 233 213 213 CYS CYS D . n 
D 1 234 TYR 234 214 214 TYR TYR D . n 
D 1 235 PHE 235 215 215 PHE PHE D . n 
D 1 236 ASP 236 216 216 ASP ASP D . n 
D 1 237 ASN 237 217 217 ASN ASN D . n 
D 1 238 VAL 238 218 218 VAL VAL D . n 
D 1 239 GLY 239 219 219 GLY GLY D . n 
D 1 240 GLY 240 220 220 GLY GLY D . n 
D 1 241 GLU 241 221 221 GLU GLU D . n 
D 1 242 PHE 242 222 222 PHE PHE D . n 
D 1 243 SER 243 223 223 SER SER D . n 
D 1 244 ASN 244 224 224 ASN ASN D . n 
D 1 245 THR 245 225 225 THR THR D . n 
D 1 246 VAL 246 226 226 VAL VAL D . n 
D 1 247 ILE 247 227 227 ILE ILE D . n 
D 1 248 GLY 248 228 228 GLY GLY D . n 
D 1 249 GLN 249 229 229 GLN GLN D . n 
D 1 250 MET 250 230 230 MET MET D . n 
D 1 251 LYS 251 231 231 LYS LYS D . n 
D 1 252 LYS 252 232 232 LYS LYS D . n 
D 1 253 PHE 253 233 233 PHE PHE D . n 
D 1 254 GLY 254 234 234 GLY GLY D . n 
D 1 255 ARG 255 235 235 ARG ARG D . n 
D 1 256 ILE 256 236 236 ILE ILE D . n 
D 1 257 ALA 257 237 237 ALA ALA D . n 
D 1 258 ILE 258 238 238 ILE ILE D . n 
D 1 259 CYS 259 239 239 CYS CYS D . n 
D 1 260 GLY 260 240 240 GLY GLY D . n 
D 1 261 ALA 261 241 241 ALA ALA D . n 
D 1 262 ILE 262 242 242 ILE ILE D . n 
D 1 263 SER 263 243 243 SER SER D . n 
D 1 264 THR 264 244 244 THR THR D . n 
D 1 265 TYR 265 245 245 TYR TYR D . n 
D 1 266 ASN 266 246 246 ASN ASN D . n 
D 1 267 ARG 267 247 247 ARG ARG D . n 
D 1 268 THR 268 248 248 THR THR D . n 
D 1 269 GLY 269 249 249 GLY GLY D . n 
D 1 270 PRO 270 250 250 PRO PRO D . n 
D 1 271 LEU 271 251 251 LEU LEU D . n 
D 1 272 PRO 272 252 252 PRO PRO D . n 
D 1 273 PRO 273 253 253 PRO PRO D . n 
D 1 274 GLY 274 254 254 GLY GLY D . n 
D 1 275 PRO 275 255 255 PRO PRO D . n 
D 1 276 PRO 276 256 256 PRO PRO D . n 
D 1 277 PRO 277 257 257 PRO PRO D . n 
D 1 278 GLU 278 258 258 GLU GLU D . n 
D 1 279 ILE 279 259 259 ILE ILE D . n 
D 1 280 VAL 280 260 260 VAL VAL D . n 
D 1 281 ILE 281 261 261 ILE ILE D . n 
D 1 282 TYR 282 262 262 TYR TYR D . n 
D 1 283 GLN 283 263 263 GLN GLN D . n 
D 1 284 GLU 284 264 264 GLU GLU D . n 
D 1 285 LEU 285 265 265 LEU LEU D . n 
D 1 286 ARG 286 266 266 ARG ARG D . n 
D 1 287 MET 287 267 267 MET MET D . n 
D 1 288 GLU 288 268 268 GLU GLU D . n 
D 1 289 ALA 289 269 269 ALA ALA D . n 
D 1 290 PHE 290 270 270 PHE PHE D . n 
D 1 291 VAL 291 271 271 VAL VAL D . n 
D 1 292 VAL 292 272 272 VAL VAL D . n 
D 1 293 TYR 293 273 273 TYR TYR D . n 
D 1 294 ARG 294 274 274 ARG ARG D . n 
D 1 295 TRP 295 275 275 TRP TRP D . n 
D 1 296 GLN 296 276 276 GLN GLN D . n 
D 1 297 GLY 297 277 277 GLY GLY D . n 
D 1 298 ASP 298 278 278 ASP ASP D . n 
D 1 299 ALA 299 279 279 ALA ALA D . n 
D 1 300 ARG 300 280 280 ARG ARG D . n 
D 1 301 GLN 301 281 281 GLN GLN D . n 
D 1 302 LYS 302 282 282 LYS LYS D . n 
D 1 303 ALA 303 283 283 ALA ALA D . n 
D 1 304 LEU 304 284 284 LEU LEU D . n 
D 1 305 LYS 305 285 285 LYS LYS D . n 
D 1 306 ASP 306 286 286 ASP ASP D . n 
D 1 307 LEU 307 287 287 LEU LEU D . n 
D 1 308 LEU 308 288 288 LEU LEU D . n 
D 1 309 LYS 309 289 289 LYS LYS D . n 
D 1 310 TRP 310 290 290 TRP TRP D . n 
D 1 311 VAL 311 291 291 VAL VAL D . n 
D 1 312 LEU 312 292 292 LEU LEU D . n 
D 1 313 GLU 313 293 293 GLU GLU D . n 
D 1 314 GLY 314 294 294 GLY GLY D . n 
D 1 315 LYS 315 295 295 LYS LYS D . n 
D 1 316 ILE 316 296 296 ILE ILE D . n 
D 1 317 GLN 317 297 297 GLN GLN D . n 
D 1 318 TYR 318 298 298 TYR TYR D . n 
D 1 319 LYS 319 299 299 LYS LYS D . n 
D 1 320 GLU 320 300 300 GLU GLU D . n 
D 1 321 TYR 321 301 301 TYR TYR D . n 
D 1 322 ILE 322 302 302 ILE ILE D . n 
D 1 323 ILE 323 303 303 ILE ILE D . n 
D 1 324 GLU 324 304 304 GLU GLU D . n 
D 1 325 GLY 325 305 305 GLY GLY D . n 
D 1 326 PHE 326 306 306 PHE PHE D . n 
D 1 327 GLU 327 307 307 GLU GLU D . n 
D 1 328 ASN 328 308 308 ASN ASN D . n 
D 1 329 MET 329 309 309 MET MET D . n 
D 1 330 PRO 330 310 310 PRO PRO D . n 
D 1 331 ALA 331 311 311 ALA ALA D . n 
D 1 332 ALA 332 312 312 ALA ALA D . n 
D 1 333 PHE 333 313 313 PHE PHE D . n 
D 1 334 MET 334 314 314 MET MET D . n 
D 1 335 GLY 335 315 315 GLY GLY D . n 
D 1 336 MET 336 316 316 MET MET D . n 
D 1 337 LEU 337 317 317 LEU LEU D . n 
D 1 338 LYS 338 318 318 LYS LYS D . n 
D 1 339 GLY 339 319 319 GLY GLY D . n 
D 1 340 ASP 340 320 320 ASP ASP D . n 
D 1 341 ASN 341 321 321 ASN ASN D . n 
D 1 342 LEU 342 322 322 LEU LEU D . n 
D 1 343 GLY 343 323 323 GLY GLY D . n 
D 1 344 LYS 344 324 324 LYS LYS D . n 
D 1 345 THR 345 325 325 THR THR D . n 
D 1 346 ILE 346 326 326 ILE ILE D . n 
D 1 347 VAL 347 327 327 VAL VAL D . n 
D 1 348 LYS 348 328 328 LYS LYS D . n 
D 1 349 ALA 349 329 329 ALA ALA D . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Structural Genomics Consortium' 
_pdbx_SG_project.initial_of_center     SGC 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E  2 CL  1  407 7   CL  CL  A . 
F  2 CL  1  408 8   CL  CL  A . 
G  2 CL  1  411 11  CL  CL  A . 
H  2 CL  1  413 13  CL  CL  A . 
I  2 CL  1  422 22  CL  CL  A . 
J  2 CL  1  402 2   CL  CL  B . 
K  2 CL  1  409 9   CL  CL  B . 
L  2 CL  1  412 12  CL  CL  B . 
M  2 CL  1  418 18  CL  CL  B . 
N  2 CL  1  420 20  CL  CL  B . 
O  2 CL  1  404 4   CL  CL  C . 
P  2 CL  1  405 5   CL  CL  C . 
Q  2 CL  1  406 6   CL  CL  C . 
R  2 CL  1  410 10  CL  CL  C . 
S  2 CL  1  415 15  CL  CL  C . 
T  2 CL  1  419 19  CL  CL  C . 
U  2 CL  1  401 1   CL  CL  D . 
V  2 CL  1  403 3   CL  CL  D . 
W  2 CL  1  414 14  CL  CL  D . 
X  2 CL  1  416 16  CL  CL  D . 
Y  2 CL  1  417 17  CL  CL  D . 
Z  2 CL  1  421 21  CL  CL  D . 
AA 3 HOH 1  423 2   HOH HOH A . 
AA 3 HOH 2  424 6   HOH HOH A . 
AA 3 HOH 3  425 8   HOH HOH A . 
AA 3 HOH 4  426 9   HOH HOH A . 
AA 3 HOH 5  427 10  HOH HOH A . 
AA 3 HOH 6  428 16  HOH HOH A . 
AA 3 HOH 7  429 22  HOH HOH A . 
AA 3 HOH 8  430 26  HOH HOH A . 
AA 3 HOH 9  431 31  HOH HOH A . 
AA 3 HOH 10 432 35  HOH HOH A . 
AA 3 HOH 11 433 41  HOH HOH A . 
AA 3 HOH 12 434 46  HOH HOH A . 
AA 3 HOH 13 435 47  HOH HOH A . 
AA 3 HOH 14 436 48  HOH HOH A . 
AA 3 HOH 15 437 54  HOH HOH A . 
AA 3 HOH 16 438 56  HOH HOH A . 
AA 3 HOH 17 439 57  HOH HOH A . 
AA 3 HOH 18 440 65  HOH HOH A . 
AA 3 HOH 19 441 68  HOH HOH A . 
AA 3 HOH 20 442 79  HOH HOH A . 
AA 3 HOH 21 443 87  HOH HOH A . 
AA 3 HOH 22 444 94  HOH HOH A . 
AA 3 HOH 23 445 95  HOH HOH A . 
AA 3 HOH 24 446 102 HOH HOH A . 
AA 3 HOH 25 447 104 HOH HOH A . 
AA 3 HOH 26 448 105 HOH HOH A . 
AA 3 HOH 27 449 109 HOH HOH A . 
AA 3 HOH 28 450 115 HOH HOH A . 
AA 3 HOH 29 451 116 HOH HOH A . 
AA 3 HOH 30 452 119 HOH HOH A . 
AA 3 HOH 31 453 124 HOH HOH A . 
AA 3 HOH 32 454 125 HOH HOH A . 
AA 3 HOH 33 455 127 HOH HOH A . 
AA 3 HOH 34 456 132 HOH HOH A . 
AA 3 HOH 35 457 158 HOH HOH A . 
AA 3 HOH 36 458 159 HOH HOH A . 
AA 3 HOH 37 459 160 HOH HOH A . 
AA 3 HOH 38 460 168 HOH HOH A . 
AA 3 HOH 39 461 170 HOH HOH A . 
AA 3 HOH 40 462 172 HOH HOH A . 
AA 3 HOH 41 463 173 HOH HOH A . 
AA 3 HOH 42 464 176 HOH HOH A . 
AA 3 HOH 43 465 177 HOH HOH A . 
AA 3 HOH 44 466 181 HOH HOH A . 
AA 3 HOH 45 467 184 HOH HOH A . 
AA 3 HOH 46 468 189 HOH HOH A . 
AA 3 HOH 47 469 194 HOH HOH A . 
AA 3 HOH 48 470 213 HOH HOH A . 
AA 3 HOH 49 471 215 HOH HOH A . 
AA 3 HOH 50 472 220 HOH HOH A . 
AA 3 HOH 51 473 224 HOH HOH A . 
AA 3 HOH 52 474 225 HOH HOH A . 
AA 3 HOH 53 475 227 HOH HOH A . 
AA 3 HOH 54 476 229 HOH HOH A . 
AA 3 HOH 55 477 230 HOH HOH A . 
AA 3 HOH 56 478 231 HOH HOH A . 
AA 3 HOH 57 479 235 HOH HOH A . 
AA 3 HOH 58 480 243 HOH HOH A . 
AA 3 HOH 59 481 245 HOH HOH A . 
AA 3 HOH 60 482 246 HOH HOH A . 
AA 3 HOH 61 483 253 HOH HOH A . 
AA 3 HOH 62 484 259 HOH HOH A . 
AA 3 HOH 63 485 260 HOH HOH A . 
AA 3 HOH 64 486 262 HOH HOH A . 
AA 3 HOH 65 487 263 HOH HOH A . 
AA 3 HOH 66 488 264 HOH HOH A . 
AA 3 HOH 67 489 268 HOH HOH A . 
AA 3 HOH 68 490 271 HOH HOH A . 
AA 3 HOH 69 491 274 HOH HOH A . 
AA 3 HOH 70 492 275 HOH HOH A . 
AA 3 HOH 71 493 281 HOH HOH A . 
AA 3 HOH 72 494 287 HOH HOH A . 
AA 3 HOH 73 495 289 HOH HOH A . 
AA 3 HOH 74 496 293 HOH HOH A . 
AA 3 HOH 75 497 297 HOH HOH A . 
AA 3 HOH 76 498 298 HOH HOH A . 
AA 3 HOH 77 499 300 HOH HOH A . 
AA 3 HOH 78 500 301 HOH HOH A . 
AA 3 HOH 79 501 309 HOH HOH A . 
AA 3 HOH 80 502 310 HOH HOH A . 
AA 3 HOH 81 503 312 HOH HOH A . 
AA 3 HOH 82 504 314 HOH HOH A . 
AA 3 HOH 83 505 315 HOH HOH A . 
AA 3 HOH 84 506 316 HOH HOH A . 
BA 3 HOH 1  421 4   HOH HOH B . 
BA 3 HOH 2  422 12  HOH HOH B . 
BA 3 HOH 3  423 15  HOH HOH B . 
BA 3 HOH 4  424 19  HOH HOH B . 
BA 3 HOH 5  425 24  HOH HOH B . 
BA 3 HOH 6  426 25  HOH HOH B . 
BA 3 HOH 7  427 29  HOH HOH B . 
BA 3 HOH 8  428 30  HOH HOH B . 
BA 3 HOH 9  429 32  HOH HOH B . 
BA 3 HOH 10 430 42  HOH HOH B . 
BA 3 HOH 11 431 43  HOH HOH B . 
BA 3 HOH 12 432 51  HOH HOH B . 
BA 3 HOH 13 433 59  HOH HOH B . 
BA 3 HOH 14 434 60  HOH HOH B . 
BA 3 HOH 15 435 61  HOH HOH B . 
BA 3 HOH 16 436 64  HOH HOH B . 
BA 3 HOH 17 437 67  HOH HOH B . 
BA 3 HOH 18 438 71  HOH HOH B . 
BA 3 HOH 19 439 77  HOH HOH B . 
BA 3 HOH 20 440 81  HOH HOH B . 
BA 3 HOH 21 441 85  HOH HOH B . 
BA 3 HOH 22 442 91  HOH HOH B . 
BA 3 HOH 23 443 98  HOH HOH B . 
BA 3 HOH 24 444 99  HOH HOH B . 
BA 3 HOH 25 445 103 HOH HOH B . 
BA 3 HOH 26 446 107 HOH HOH B . 
BA 3 HOH 27 447 110 HOH HOH B . 
BA 3 HOH 28 448 118 HOH HOH B . 
BA 3 HOH 29 449 120 HOH HOH B . 
BA 3 HOH 30 450 126 HOH HOH B . 
BA 3 HOH 31 451 128 HOH HOH B . 
BA 3 HOH 32 452 131 HOH HOH B . 
BA 3 HOH 33 453 135 HOH HOH B . 
BA 3 HOH 34 454 136 HOH HOH B . 
BA 3 HOH 35 455 139 HOH HOH B . 
BA 3 HOH 36 456 143 HOH HOH B . 
BA 3 HOH 37 457 151 HOH HOH B . 
BA 3 HOH 38 458 156 HOH HOH B . 
BA 3 HOH 39 459 162 HOH HOH B . 
BA 3 HOH 40 460 165 HOH HOH B . 
BA 3 HOH 41 461 175 HOH HOH B . 
BA 3 HOH 42 462 185 HOH HOH B . 
BA 3 HOH 43 463 187 HOH HOH B . 
BA 3 HOH 44 464 190 HOH HOH B . 
BA 3 HOH 45 465 192 HOH HOH B . 
BA 3 HOH 46 466 193 HOH HOH B . 
BA 3 HOH 47 467 195 HOH HOH B . 
BA 3 HOH 48 468 196 HOH HOH B . 
BA 3 HOH 49 469 201 HOH HOH B . 
BA 3 HOH 50 470 203 HOH HOH B . 
BA 3 HOH 51 471 204 HOH HOH B . 
BA 3 HOH 52 472 217 HOH HOH B . 
BA 3 HOH 53 473 218 HOH HOH B . 
BA 3 HOH 54 474 232 HOH HOH B . 
BA 3 HOH 55 475 254 HOH HOH B . 
BA 3 HOH 56 476 256 HOH HOH B . 
BA 3 HOH 57 477 257 HOH HOH B . 
BA 3 HOH 58 478 261 HOH HOH B . 
BA 3 HOH 59 479 270 HOH HOH B . 
BA 3 HOH 60 480 282 HOH HOH B . 
BA 3 HOH 61 481 283 HOH HOH B . 
BA 3 HOH 62 482 284 HOH HOH B . 
BA 3 HOH 63 483 286 HOH HOH B . 
BA 3 HOH 64 484 290 HOH HOH B . 
BA 3 HOH 65 485 292 HOH HOH B . 
BA 3 HOH 66 486 294 HOH HOH B . 
BA 3 HOH 67 487 295 HOH HOH B . 
BA 3 HOH 68 488 299 HOH HOH B . 
BA 3 HOH 69 489 302 HOH HOH B . 
BA 3 HOH 70 490 308 HOH HOH B . 
BA 3 HOH 71 491 313 HOH HOH B . 
CA 3 HOH 1  420 1   HOH HOH C . 
CA 3 HOH 2  421 7   HOH HOH C . 
CA 3 HOH 3  422 14  HOH HOH C . 
CA 3 HOH 4  423 17  HOH HOH C . 
CA 3 HOH 5  424 20  HOH HOH C . 
CA 3 HOH 6  425 28  HOH HOH C . 
CA 3 HOH 7  426 33  HOH HOH C . 
CA 3 HOH 8  427 34  HOH HOH C . 
CA 3 HOH 9  428 38  HOH HOH C . 
CA 3 HOH 10 429 39  HOH HOH C . 
CA 3 HOH 11 430 44  HOH HOH C . 
CA 3 HOH 12 431 45  HOH HOH C . 
CA 3 HOH 13 432 52  HOH HOH C . 
CA 3 HOH 14 433 53  HOH HOH C . 
CA 3 HOH 15 434 63  HOH HOH C . 
CA 3 HOH 16 435 66  HOH HOH C . 
CA 3 HOH 17 436 70  HOH HOH C . 
CA 3 HOH 18 437 72  HOH HOH C . 
CA 3 HOH 19 438 73  HOH HOH C . 
CA 3 HOH 20 439 74  HOH HOH C . 
CA 3 HOH 21 440 75  HOH HOH C . 
CA 3 HOH 22 441 76  HOH HOH C . 
CA 3 HOH 23 442 78  HOH HOH C . 
CA 3 HOH 24 443 84  HOH HOH C . 
CA 3 HOH 25 444 88  HOH HOH C . 
CA 3 HOH 26 445 96  HOH HOH C . 
CA 3 HOH 27 446 97  HOH HOH C . 
CA 3 HOH 28 447 100 HOH HOH C . 
CA 3 HOH 29 448 101 HOH HOH C . 
CA 3 HOH 30 449 111 HOH HOH C . 
CA 3 HOH 31 450 112 HOH HOH C . 
CA 3 HOH 32 451 113 HOH HOH C . 
CA 3 HOH 33 452 130 HOH HOH C . 
CA 3 HOH 34 453 133 HOH HOH C . 
CA 3 HOH 35 454 138 HOH HOH C . 
CA 3 HOH 36 455 140 HOH HOH C . 
CA 3 HOH 37 456 146 HOH HOH C . 
CA 3 HOH 38 457 148 HOH HOH C . 
CA 3 HOH 39 458 149 HOH HOH C . 
CA 3 HOH 40 459 150 HOH HOH C . 
CA 3 HOH 41 460 152 HOH HOH C . 
CA 3 HOH 42 461 153 HOH HOH C . 
CA 3 HOH 43 462 161 HOH HOH C . 
CA 3 HOH 44 463 164 HOH HOH C . 
CA 3 HOH 45 464 167 HOH HOH C . 
CA 3 HOH 46 465 169 HOH HOH C . 
CA 3 HOH 47 466 182 HOH HOH C . 
CA 3 HOH 48 467 183 HOH HOH C . 
CA 3 HOH 49 468 186 HOH HOH C . 
CA 3 HOH 50 469 188 HOH HOH C . 
CA 3 HOH 51 470 197 HOH HOH C . 
CA 3 HOH 52 471 198 HOH HOH C . 
CA 3 HOH 53 472 199 HOH HOH C . 
CA 3 HOH 54 473 206 HOH HOH C . 
CA 3 HOH 55 474 208 HOH HOH C . 
CA 3 HOH 56 475 209 HOH HOH C . 
CA 3 HOH 57 476 212 HOH HOH C . 
CA 3 HOH 58 477 216 HOH HOH C . 
CA 3 HOH 59 478 223 HOH HOH C . 
CA 3 HOH 60 479 226 HOH HOH C . 
CA 3 HOH 61 480 236 HOH HOH C . 
CA 3 HOH 62 481 237 HOH HOH C . 
CA 3 HOH 63 482 238 HOH HOH C . 
CA 3 HOH 64 483 239 HOH HOH C . 
CA 3 HOH 65 484 240 HOH HOH C . 
CA 3 HOH 66 485 241 HOH HOH C . 
CA 3 HOH 67 486 247 HOH HOH C . 
CA 3 HOH 68 487 248 HOH HOH C . 
CA 3 HOH 69 488 249 HOH HOH C . 
CA 3 HOH 70 489 251 HOH HOH C . 
CA 3 HOH 71 490 265 HOH HOH C . 
CA 3 HOH 72 491 266 HOH HOH C . 
CA 3 HOH 73 492 267 HOH HOH C . 
CA 3 HOH 74 493 269 HOH HOH C . 
CA 3 HOH 75 494 273 HOH HOH C . 
CA 3 HOH 76 495 277 HOH HOH C . 
CA 3 HOH 77 496 278 HOH HOH C . 
CA 3 HOH 78 497 280 HOH HOH C . 
CA 3 HOH 79 498 288 HOH HOH C . 
CA 3 HOH 80 499 291 HOH HOH C . 
CA 3 HOH 81 500 296 HOH HOH C . 
CA 3 HOH 82 501 305 HOH HOH C . 
CA 3 HOH 83 502 306 HOH HOH C . 
CA 3 HOH 84 503 307 HOH HOH C . 
DA 3 HOH 1  422 3   HOH HOH D . 
DA 3 HOH 2  423 5   HOH HOH D . 
DA 3 HOH 3  424 11  HOH HOH D . 
DA 3 HOH 4  425 13  HOH HOH D . 
DA 3 HOH 5  426 18  HOH HOH D . 
DA 3 HOH 6  427 21  HOH HOH D . 
DA 3 HOH 7  428 23  HOH HOH D . 
DA 3 HOH 8  429 27  HOH HOH D . 
DA 3 HOH 9  430 36  HOH HOH D . 
DA 3 HOH 10 431 37  HOH HOH D . 
DA 3 HOH 11 432 40  HOH HOH D . 
DA 3 HOH 12 433 49  HOH HOH D . 
DA 3 HOH 13 434 50  HOH HOH D . 
DA 3 HOH 14 435 55  HOH HOH D . 
DA 3 HOH 15 436 58  HOH HOH D . 
DA 3 HOH 16 437 62  HOH HOH D . 
DA 3 HOH 17 438 69  HOH HOH D . 
DA 3 HOH 18 439 80  HOH HOH D . 
DA 3 HOH 19 440 82  HOH HOH D . 
DA 3 HOH 20 441 83  HOH HOH D . 
DA 3 HOH 21 442 86  HOH HOH D . 
DA 3 HOH 22 443 89  HOH HOH D . 
DA 3 HOH 23 444 90  HOH HOH D . 
DA 3 HOH 24 445 92  HOH HOH D . 
DA 3 HOH 25 446 93  HOH HOH D . 
DA 3 HOH 26 447 106 HOH HOH D . 
DA 3 HOH 27 448 108 HOH HOH D . 
DA 3 HOH 28 449 114 HOH HOH D . 
DA 3 HOH 29 450 117 HOH HOH D . 
DA 3 HOH 30 451 121 HOH HOH D . 
DA 3 HOH 31 452 122 HOH HOH D . 
DA 3 HOH 32 453 123 HOH HOH D . 
DA 3 HOH 33 454 129 HOH HOH D . 
DA 3 HOH 34 455 134 HOH HOH D . 
DA 3 HOH 35 456 137 HOH HOH D . 
DA 3 HOH 36 457 141 HOH HOH D . 
DA 3 HOH 37 458 142 HOH HOH D . 
DA 3 HOH 38 459 144 HOH HOH D . 
DA 3 HOH 39 460 145 HOH HOH D . 
DA 3 HOH 40 461 147 HOH HOH D . 
DA 3 HOH 41 462 154 HOH HOH D . 
DA 3 HOH 42 463 155 HOH HOH D . 
DA 3 HOH 43 464 157 HOH HOH D . 
DA 3 HOH 44 465 163 HOH HOH D . 
DA 3 HOH 45 466 166 HOH HOH D . 
DA 3 HOH 46 467 171 HOH HOH D . 
DA 3 HOH 47 468 178 HOH HOH D . 
DA 3 HOH 48 469 179 HOH HOH D . 
DA 3 HOH 49 470 180 HOH HOH D . 
DA 3 HOH 50 471 191 HOH HOH D . 
DA 3 HOH 51 472 200 HOH HOH D . 
DA 3 HOH 52 473 202 HOH HOH D . 
DA 3 HOH 53 474 205 HOH HOH D . 
DA 3 HOH 54 475 207 HOH HOH D . 
DA 3 HOH 55 476 211 HOH HOH D . 
DA 3 HOH 56 477 214 HOH HOH D . 
DA 3 HOH 57 478 219 HOH HOH D . 
DA 3 HOH 58 479 221 HOH HOH D . 
DA 3 HOH 59 480 222 HOH HOH D . 
DA 3 HOH 60 481 228 HOH HOH D . 
DA 3 HOH 61 482 233 HOH HOH D . 
DA 3 HOH 62 483 234 HOH HOH D . 
DA 3 HOH 63 484 242 HOH HOH D . 
DA 3 HOH 64 485 244 HOH HOH D . 
DA 3 HOH 65 486 250 HOH HOH D . 
DA 3 HOH 66 487 252 HOH HOH D . 
DA 3 HOH 67 488 255 HOH HOH D . 
DA 3 HOH 68 489 258 HOH HOH D . 
DA 3 HOH 69 490 272 HOH HOH D . 
DA 3 HOH 70 491 276 HOH HOH D . 
DA 3 HOH 71 492 279 HOH HOH D . 
DA 3 HOH 72 493 285 HOH HOH D . 
DA 3 HOH 73 494 303 HOH HOH D . 
DA 3 HOH 74 495 304 HOH HOH D . 
DA 3 HOH 75 496 311 HOH HOH D . 
DA 3 HOH 76 497 317 HOH HOH D . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric    2 
2 author_and_software_defined_assembly PISA dimeric    2 
3 software_defined_assembly            PISA tetrameric 4 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,E,F,G,H,I,J,K,L,M,N,AA,BA                                   
2 1 C,D,O,P,Q,R,S,T,U,V,W,X,Y,Z,CA,DA                               
3 1 A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,Y,Z,AA,BA,CA,DA 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3820  ? 
1 MORE         -131  ? 
1 'SSA (A^2)'  26890 ? 
2 'ABSA (A^2)' 3820  ? 
2 MORE         -131  ? 
2 'SSA (A^2)'  26690 ? 
3 'ABSA (A^2)' 10010 ? 
3 MORE         -278  ? 
3 'SSA (A^2)'  51220 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2005-06-21 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC refinement       5.2.0005  ? 1 
MOSFLM 'data reduction' .         ? 2 
CCP4   'data scaling'   '(SCALA)' ? 3 
PHASER phasing          .         ? 4 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   C 
_pdbx_validate_close_contact.auth_comp_id_1   GLY 
_pdbx_validate_close_contact.auth_seq_id_1    90 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   C 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    485 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.16 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CB B CYS 239 ? ? SG B CYS 239 ? ? 1.700 1.812 -0.112 0.016 N 
2 1 CB D CYS 239 ? ? SG D CYS 239 ? ? 1.699 1.812 -0.113 0.016 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE A ARG 56  ? ? CZ A ARG 56  ? ? NH1 A ARG 56  ? ? 123.93 120.30 3.63   0.50 N 
2 1 NE A ARG 235 ? ? CZ A ARG 235 ? ? NH2 A ARG 235 ? ? 123.74 120.30 3.44   0.50 N 
3 1 NE B ARG 235 ? ? CZ B ARG 235 ? ? NH1 B ARG 235 ? ? 123.64 120.30 3.34   0.50 N 
4 1 NE C ARG 56  ? ? CZ C ARG 56  ? ? NH1 C ARG 56  ? ? 123.44 120.30 3.14   0.50 N 
5 1 CB C VAL 272 ? ? CA C VAL 272 ? ? C   C VAL 272 ? ? 98.82  111.40 -12.58 1.90 N 
6 1 NE D ARG 56  ? ? CZ D ARG 56  ? ? NH1 D ARG 56  ? ? 123.52 120.30 3.22   0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ALA A 149 ? ? 38.67   54.12  
2  1 SER A 207 ? ? -151.38 88.69  
3  1 PRO A 253 ? ? -41.30  151.86 
4  1 VAL B 122 ? ? -105.96 55.97  
5  1 ALA B 149 ? ? 39.52   50.83  
6  1 SER C 88  ? ? -119.98 56.80  
7  1 VAL C 122 ? ? -110.05 54.69  
8  1 ALA C 241 ? ? -144.75 55.74  
9  1 GLU D 108 ? ? -78.05  20.46  
10 1 VAL D 122 ? ? -109.69 50.76  
11 1 ALA D 149 ? ? 38.31   47.79  
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   GLY 
_pdbx_validate_peptide_omega.auth_asym_id_1   D 
_pdbx_validate_peptide_omega.auth_seq_id_1    249 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   PRO 
_pdbx_validate_peptide_omega.auth_asym_id_2   D 
_pdbx_validate_peptide_omega.auth_seq_id_2    250 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            146.57 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A LYS 5   ? CE  ? A LYS 25  CE  
2   1 Y 1 A LYS 5   ? NZ  ? A LYS 25  NZ  
3   1 Y 1 A GLU 28  ? CG  ? A GLU 48  CG  
4   1 Y 1 A GLU 28  ? CD  ? A GLU 48  CD  
5   1 Y 1 A GLU 28  ? OE1 ? A GLU 48  OE1 
6   1 Y 1 A GLU 28  ? OE2 ? A GLU 48  OE2 
7   1 Y 1 A LYS 70  ? CE  ? A LYS 90  CE  
8   1 Y 1 A LYS 70  ? NZ  ? A LYS 90  NZ  
9   1 Y 1 A GLU 73  ? CD  ? A GLU 93  CD  
10  1 Y 1 A GLU 73  ? OE1 ? A GLU 93  OE1 
11  1 Y 1 A GLU 73  ? OE2 ? A GLU 93  OE2 
12  1 Y 1 A LYS 81  ? CE  ? A LYS 101 CE  
13  1 Y 1 A LYS 81  ? NZ  ? A LYS 101 NZ  
14  1 Y 1 A ASP 111 ? CG  ? A ASP 131 CG  
15  1 Y 1 A ASP 111 ? OD1 ? A ASP 131 OD1 
16  1 Y 1 A ASP 111 ? OD2 ? A ASP 131 OD2 
17  1 Y 1 A GLU 177 ? CD  ? A GLU 197 CD  
18  1 Y 1 A GLU 177 ? OE1 ? A GLU 197 OE1 
19  1 Y 1 A GLU 177 ? OE2 ? A GLU 197 OE2 
20  1 Y 1 A LYS 184 ? CG  ? A LYS 204 CG  
21  1 Y 1 A LYS 184 ? CD  ? A LYS 204 CD  
22  1 Y 1 A LYS 184 ? CE  ? A LYS 204 CE  
23  1 Y 1 A LYS 184 ? NZ  ? A LYS 204 NZ  
24  1 Y 1 A LYS 205 ? CD  ? A LYS 225 CD  
25  1 Y 1 A LYS 205 ? CE  ? A LYS 225 CE  
26  1 Y 1 A LYS 205 ? NZ  ? A LYS 225 NZ  
27  1 Y 1 A GLU 258 ? CG  ? A GLU 278 CG  
28  1 Y 1 A GLU 258 ? CD  ? A GLU 278 CD  
29  1 Y 1 A GLU 258 ? OE1 ? A GLU 278 OE1 
30  1 Y 1 A GLU 258 ? OE2 ? A GLU 278 OE2 
31  1 Y 1 A TYR 262 ? CD1 ? A TYR 282 CD1 
32  1 Y 1 A TYR 262 ? CD2 ? A TYR 282 CD2 
33  1 Y 1 A TYR 262 ? CE1 ? A TYR 282 CE1 
34  1 Y 1 A TYR 262 ? CE2 ? A TYR 282 CE2 
35  1 Y 1 A TYR 262 ? CZ  ? A TYR 282 CZ  
36  1 Y 1 A TYR 262 ? OH  ? A TYR 282 OH  
37  1 Y 1 A ARG 266 ? NE  ? A ARG 286 NE  
38  1 Y 1 A ARG 266 ? CZ  ? A ARG 286 CZ  
39  1 Y 1 A ARG 266 ? NH1 ? A ARG 286 NH1 
40  1 Y 1 A ARG 266 ? NH2 ? A ARG 286 NH2 
41  1 Y 1 A LYS 289 ? CE  ? A LYS 309 CE  
42  1 Y 1 A LYS 289 ? NZ  ? A LYS 309 NZ  
43  1 Y 1 A ALA 329 ? C   ? A ALA 349 C   
44  1 Y 1 A ALA 329 ? O   ? A ALA 349 O   
45  1 Y 1 B LYS 5   ? CE  ? B LYS 25  CE  
46  1 Y 1 B LYS 5   ? NZ  ? B LYS 25  NZ  
47  1 Y 1 B LYS 11  ? CD  ? B LYS 31  CD  
48  1 Y 1 B LYS 11  ? CE  ? B LYS 31  CE  
49  1 Y 1 B LYS 11  ? NZ  ? B LYS 31  NZ  
50  1 Y 1 B GLU 28  ? CG  ? B GLU 48  CG  
51  1 Y 1 B GLU 28  ? CD  ? B GLU 48  CD  
52  1 Y 1 B GLU 28  ? OE1 ? B GLU 48  OE1 
53  1 Y 1 B GLU 28  ? OE2 ? B GLU 48  OE2 
54  1 Y 1 B LYS 33  ? CE  ? B LYS 53  CE  
55  1 Y 1 B LYS 33  ? NZ  ? B LYS 53  NZ  
56  1 Y 1 B LYS 58  ? CD  ? B LYS 78  CD  
57  1 Y 1 B LYS 58  ? CE  ? B LYS 78  CE  
58  1 Y 1 B LYS 58  ? NZ  ? B LYS 78  NZ  
59  1 Y 1 B LYS 70  ? CE  ? B LYS 90  CE  
60  1 Y 1 B LYS 70  ? NZ  ? B LYS 90  NZ  
61  1 Y 1 B GLU 73  ? CD  ? B GLU 93  CD  
62  1 Y 1 B GLU 73  ? OE1 ? B GLU 93  OE1 
63  1 Y 1 B GLU 73  ? OE2 ? B GLU 93  OE2 
64  1 Y 1 B LYS 81  ? CE  ? B LYS 101 CE  
65  1 Y 1 B LYS 81  ? NZ  ? B LYS 101 NZ  
66  1 Y 1 B LYS 100 ? CG  ? B LYS 120 CG  
67  1 Y 1 B LYS 100 ? CD  ? B LYS 120 CD  
68  1 Y 1 B LYS 100 ? CE  ? B LYS 120 CE  
69  1 Y 1 B LYS 100 ? NZ  ? B LYS 120 NZ  
70  1 Y 1 B LYS 104 ? CE  ? B LYS 124 CE  
71  1 Y 1 B LYS 104 ? NZ  ? B LYS 124 NZ  
72  1 Y 1 B ASP 111 ? CG  ? B ASP 131 CG  
73  1 Y 1 B ASP 111 ? OD1 ? B ASP 131 OD1 
74  1 Y 1 B ASP 111 ? OD2 ? B ASP 131 OD2 
75  1 Y 1 B LYS 140 ? CE  ? B LYS 160 CE  
76  1 Y 1 B LYS 140 ? NZ  ? B LYS 160 NZ  
77  1 Y 1 B GLU 177 ? CD  ? B GLU 197 CD  
78  1 Y 1 B GLU 177 ? OE1 ? B GLU 197 OE1 
79  1 Y 1 B GLU 177 ? OE2 ? B GLU 197 OE2 
80  1 Y 1 B LYS 184 ? CG  ? B LYS 204 CG  
81  1 Y 1 B LYS 184 ? CD  ? B LYS 204 CD  
82  1 Y 1 B LYS 184 ? CE  ? B LYS 204 CE  
83  1 Y 1 B LYS 184 ? NZ  ? B LYS 204 NZ  
84  1 Y 1 B GLU 197 ? CG  ? B GLU 217 CG  
85  1 Y 1 B GLU 197 ? CD  ? B GLU 217 CD  
86  1 Y 1 B GLU 197 ? OE1 ? B GLU 217 OE1 
87  1 Y 1 B GLU 197 ? OE2 ? B GLU 217 OE2 
88  1 Y 1 B LYS 205 ? CG  ? B LYS 225 CG  
89  1 Y 1 B LYS 205 ? CD  ? B LYS 225 CD  
90  1 Y 1 B LYS 205 ? CE  ? B LYS 225 CE  
91  1 Y 1 B LYS 205 ? NZ  ? B LYS 225 NZ  
92  1 Y 1 B ARG 266 ? NE  ? B ARG 286 NE  
93  1 Y 1 B ARG 266 ? CZ  ? B ARG 286 CZ  
94  1 Y 1 B ARG 266 ? NH1 ? B ARG 286 NH1 
95  1 Y 1 B