data_1ZUC
# 
_entry.id   1ZUC 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1ZUC         
RCSB  RCSB033128   
WWPDB D_1000033128 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1ZUC 
_pdbx_database_status.recvd_initial_deposition_date   2005-05-30 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Zhang, Z.'      1  
'Olland, A.M.'   2  
'Zhu, Y.'        3  
'Cohen, J.'      4  
'Berrodin, T.'   5  
'Chippari, S.'   6  
'Appavu, C.'     7  
'Li, S.'         8  
'Wilhem, J.'     9  
'Chopra, R.'     10 
'Fensome, A.'    11 
'Zhang, P.'      12 
'Wrobel, J.'     13 
'Unwalla, R.J.'  14 
'Lyttle, C.R.'   15 
'Winneker, R.C.' 16 
# 
_citation.id                        primary 
_citation.title                     
'Molecular and pharmacological properties of a potent and selective novel nonsteroidal progesterone receptor agonist tanaproget' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            280 
_citation.page_first                28468 
_citation.page_last                 28475 
_citation.year                      2005 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15937332 
_citation.pdbx_database_id_DOI      10.1074/jbc.M504144200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Zhang, Z.'      1  
primary 'Olland, A.M.'   2  
primary 'Zhu, Y.'        3  
primary 'Cohen, J.'      4  
primary 'Berrodin, T.'   5  
primary 'Chippari, S.'   6  
primary 'Appavu, C.'     7  
primary 'Li, S.'         8  
primary 'Wilhem, J.'     9  
primary 'Chopra, R.'     10 
primary 'Fensome, A.'    11 
primary 'Zhang, P.'      12 
primary 'Wrobel, J.'     13 
primary 'Unwalla, R.J.'  14 
primary 'Lyttle, C.R.'   15 
primary 'Winneker, R.C.' 16 
# 
_cell.entry_id           1ZUC 
_cell.length_a           57.519 
_cell.length_b           64.497 
_cell.length_c           70.406 
_cell.angle_alpha        90.00 
_cell.angle_beta         95.76 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1ZUC 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Progesterone receptor'                                                                           29795.875 2   
? ? ? ? 
2 non-polymer syn '5-(4,4-DIMETHYL-2-THIOXO-1,4-DIHYDRO-2H-3,1-BENZOXAZIN-6-YL)-1-METHYL-1H-PYRROLE-2-CARBONITRILE' 297.375   2   
? ? ? ? 
3 non-polymer syn 'SULFATE ION'                                                                                     96.063    1   
? ? ? ? 
4 water       nat water                                                                                             18.015    179 
? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        PR 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSPGQDIQLIPPLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQLGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYS
WMSLMVFGLGWRSYKHVSGQMLYFAPDLILNEQRMKESSFYSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTIPLEG
LRSQTQFEEMRSSYIRELIKAIGLRQKGVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRALSVEFPEMMSEVIA
AQLPKILAGMVKPLLFHKK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSPGQDIQLIPPLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQLGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYS
WMSLMVFGLGWRSYKHVSGQMLYFAPDLILNEQRMKESSFYSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTIPLEG
LRSQTQFEEMRSSYIRELIKAIGLRQKGVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRALSVEFPEMMSEVIA
AQLPKILAGMVKPLLFHKK
;
_entity_poly.pdbx_strand_id                 B,A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   PRO n 
1 4   GLY n 
1 5   GLN n 
1 6   ASP n 
1 7   ILE n 
1 8   GLN n 
1 9   LEU n 
1 10  ILE n 
1 11  PRO n 
1 12  PRO n 
1 13  LEU n 
1 14  ILE n 
1 15  ASN n 
1 16  LEU n 
1 17  LEU n 
1 18  MET n 
1 19  SER n 
1 20  ILE n 
1 21  GLU n 
1 22  PRO n 
1 23  ASP n 
1 24  VAL n 
1 25  ILE n 
1 26  TYR n 
1 27  ALA n 
1 28  GLY n 
1 29  HIS n 
1 30  ASP n 
1 31  ASN n 
1 32  THR n 
1 33  LYS n 
1 34  PRO n 
1 35  ASP n 
1 36  THR n 
1 37  SER n 
1 38  SER n 
1 39  SER n 
1 40  LEU n 
1 41  LEU n 
1 42  THR n 
1 43  SER n 
1 44  LEU n 
1 45  ASN n 
1 46  GLN n 
1 47  LEU n 
1 48  GLY n 
1 49  GLU n 
1 50  ARG n 
1 51  GLN n 
1 52  LEU n 
1 53  LEU n 
1 54  SER n 
1 55  VAL n 
1 56  VAL n 
1 57  LYS n 
1 58  TRP n 
1 59  SER n 
1 60  LYS n 
1 61  SER n 
1 62  LEU n 
1 63  PRO n 
1 64  GLY n 
1 65  PHE n 
1 66  ARG n 
1 67  ASN n 
1 68  LEU n 
1 69  HIS n 
1 70  ILE n 
1 71  ASP n 
1 72  ASP n 
1 73  GLN n 
1 74  ILE n 
1 75  THR n 
1 76  LEU n 
1 77  ILE n 
1 78  GLN n 
1 79  TYR n 
1 80  SER n 
1 81  TRP n 
1 82  MET n 
1 83  SER n 
1 84  LEU n 
1 85  MET n 
1 86  VAL n 
1 87  PHE n 
1 88  GLY n 
1 89  LEU n 
1 90  GLY n 
1 91  TRP n 
1 92  ARG n 
1 93  SER n 
1 94  TYR n 
1 95  LYS n 
1 96  HIS n 
1 97  VAL n 
1 98  SER n 
1 99  GLY n 
1 100 GLN n 
1 101 MET n 
1 102 LEU n 
1 103 TYR n 
1 104 PHE n 
1 105 ALA n 
1 106 PRO n 
1 107 ASP n 
1 108 LEU n 
1 109 ILE n 
1 110 LEU n 
1 111 ASN n 
1 112 GLU n 
1 113 GLN n 
1 114 ARG n 
1 115 MET n 
1 116 LYS n 
1 117 GLU n 
1 118 SER n 
1 119 SER n 
1 120 PHE n 
1 121 TYR n 
1 122 SER n 
1 123 LEU n 
1 124 CYS n 
1 125 LEU n 
1 126 THR n 
1 127 MET n 
1 128 TRP n 
1 129 GLN n 
1 130 ILE n 
1 131 PRO n 
1 132 GLN n 
1 133 GLU n 
1 134 PHE n 
1 135 VAL n 
1 136 LYS n 
1 137 LEU n 
1 138 GLN n 
1 139 VAL n 
1 140 SER n 
1 141 GLN n 
1 142 GLU n 
1 143 GLU n 
1 144 PHE n 
1 145 LEU n 
1 146 CYS n 
1 147 MET n 
1 148 LYS n 
1 149 VAL n 
1 150 LEU n 
1 151 LEU n 
1 152 LEU n 
1 153 LEU n 
1 154 ASN n 
1 155 THR n 
1 156 ILE n 
1 157 PRO n 
1 158 LEU n 
1 159 GLU n 
1 160 GLY n 
1 161 LEU n 
1 162 ARG n 
1 163 SER n 
1 164 GLN n 
1 165 THR n 
1 166 GLN n 
1 167 PHE n 
1 168 GLU n 
1 169 GLU n 
1 170 MET n 
1 171 ARG n 
1 172 SER n 
1 173 SER n 
1 174 TYR n 
1 175 ILE n 
1 176 ARG n 
1 177 GLU n 
1 178 LEU n 
1 179 ILE n 
1 180 LYS n 
1 181 ALA n 
1 182 ILE n 
1 183 GLY n 
1 184 LEU n 
1 185 ARG n 
1 186 GLN n 
1 187 LYS n 
1 188 GLY n 
1 189 VAL n 
1 190 VAL n 
1 191 SER n 
1 192 SER n 
1 193 SER n 
1 194 GLN n 
1 195 ARG n 
1 196 PHE n 
1 197 TYR n 
1 198 GLN n 
1 199 LEU n 
1 200 THR n 
1 201 LYS n 
1 202 LEU n 
1 203 LEU n 
1 204 ASP n 
1 205 ASN n 
1 206 LEU n 
1 207 HIS n 
1 208 ASP n 
1 209 LEU n 
1 210 VAL n 
1 211 LYS n 
1 212 GLN n 
1 213 LEU n 
1 214 HIS n 
1 215 LEU n 
1 216 TYR n 
1 217 CYS n 
1 218 LEU n 
1 219 ASN n 
1 220 THR n 
1 221 PHE n 
1 222 ILE n 
1 223 GLN n 
1 224 SER n 
1 225 ARG n 
1 226 ALA n 
1 227 LEU n 
1 228 SER n 
1 229 VAL n 
1 230 GLU n 
1 231 PHE n 
1 232 PRO n 
1 233 GLU n 
1 234 MET n 
1 235 MET n 
1 236 SER n 
1 237 GLU n 
1 238 VAL n 
1 239 ILE n 
1 240 ALA n 
1 241 ALA n 
1 242 GLN n 
1 243 LEU n 
1 244 PRO n 
1 245 LYS n 
1 246 ILE n 
1 247 LEU n 
1 248 ALA n 
1 249 GLY n 
1 250 MET n 
1 251 VAL n 
1 252 LYS n 
1 253 PRO n 
1 254 LEU n 
1 255 LEU n 
1 256 PHE n 
1 257 HIS n 
1 258 LYS n 
1 259 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'PGR, NR3C3' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pGEX2T 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PRGR_HUMAN 
_struct_ref.pdbx_db_accession          P06401 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;FSPGQDIQLIPPLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQLGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYS
WMSLMVFGLGWRSYKHVSGQMLYFAPDLILNEQRMKESSFYSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTIPLEG
LRSQTQFEEMRSSYIRELIKAIGLRQKGVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRALSVEFPEMMSEVIA
AQLPKILAGMVKPLLFHKK
;
_struct_ref.pdbx_align_begin           675 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1ZUC A 1 ? 259 ? P06401 675 ? 933 ? 675 933 
2 1 1ZUC B 1 ? 259 ? P06401 675 ? 933 ? 675 933 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1ZUC GLY A 1 ? UNP P06401 ? ? 'cloning artifact' 675 1 
2 1ZUC GLY B 1 ? UNP P06401 ? ? 'cloning artifact' 675 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                                                           ? 
'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                                                                          ? 
'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                                        ? 
'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                                   ? 
'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                                                                                          ? 
'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                                                         ? 
'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                                   ? 
'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                                                                           ? 
'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                                         ? 
'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                                                                             ? 
'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                                                        ? 
'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                                                                           ? 
'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                                                                            ? 
'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                                                                                        ? 
'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                                                     ? 
'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                                                                           ? 
'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                                                                            ? 
'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'                                                                                     ? 
'O4 S -2'        96.063  
T98 non-polymer         . '5-(4,4-DIMETHYL-2-THIOXO-1,4-DIHYDRO-2H-3,1-BENZOXAZIN-6-YL)-1-METHYL-1H-PYRROLE-2-CARBONITRILE' 
TANAPROGET 'C16 H15 N3 O S' 297.375 
THR 'L-peptide linking' y THREONINE                                                                                         ? 
'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                                        ? 
'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                                                                          ? 
'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                                                                            ? 
'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1ZUC 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.18 
_exptl_crystal.density_percent_sol   43.59 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    'PEG 3350, MgSO4, PIPES pH 6.5, glycerol, VAPOR DIFFUSION, HANGING DROP, temperature 291K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           93 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   2002-09-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    graphite 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        RIGAKU 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.entry_id                     1ZUC 
_reflns.observed_criterion_sigma_F   2.0 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.d_resolution_high            2.0 
_reflns.d_resolution_low             30.0 
_reflns.number_all                   ? 
_reflns.number_obs                   34825 
_reflns.percent_possible_obs         100 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.0 
_reflns_shell.d_res_low              2.07 
_reflns_shell.percent_possible_all   99.9 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1ZUC 
_refine.ls_number_reflns_obs                     33082 
_refine.ls_number_reflns_all                     33178 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             30.0 
_refine.ls_d_res_high                            2.00 
_refine.ls_percent_reflns_obs                    99.71 
_refine.ls_R_factor_obs                          0.18122 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1788 
_refine.ls_R_factor_R_free                       0.22812 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  1737 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.952 
_refine.correlation_coeff_Fo_to_Fc_free          0.925 
_refine.B_iso_mean                               22.511 
_refine.aniso_B[1][1]                            1.77 
_refine.aniso_B[2][2]                            -0.55 
_refine.aniso_B[3][3]                            -1.06 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.84 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'pdb entry 1A28' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.189 
_refine.pdbx_overall_ESU_R_Free                  0.167 
_refine.overall_SU_ML                            0.107 
_refine.overall_SU_B                             3.735 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4070 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         47 
_refine_hist.number_atoms_solvent             179 
_refine_hist.number_atoms_total               4296 
_refine_hist.d_res_high                       2.00 
_refine_hist.d_res_low                        30.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.018  0.022  ? 4208 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.583  1.997  ? 5698 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   5.254  5.000  ? 500  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   36.138 24.432 ? 176  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   14.465 15.000 ? 798  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   17.500 15.000 ? 20   'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.105  0.200  ? 646  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.007  0.020  ? 3064 'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.214  0.200  ? 1968 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          0.305  0.200  ? 2927 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.134  0.200  ? 203  'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.261  0.200  ? 68   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.202  0.200  ? 16   'X-RAY DIFFRACTION' ? 
r_mcbond_it              1.233  1.500  ? 2621 'X-RAY DIFFRACTION' ? 
r_mcangle_it             1.856  2.000  ? 4084 'X-RAY DIFFRACTION' ? 
r_scbond_it              2.963  3.000  ? 1887 'X-RAY DIFFRACTION' ? 
r_scangle_it             4.244  4.500  ? 1614 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.0 
_refine_ls_shell.d_res_low                        2.050 
_refine_ls_shell.number_reflns_R_work             2360 
_refine_ls_shell.R_factor_R_work                  0.196 
_refine_ls_shell.percent_reflns_obs               96.83 
_refine_ls_shell.R_factor_R_free                  0.262 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             116 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1ZUC 
_struct.title                     'Progesterone receptor ligand binding domain in complex with the nonsteroidal agonist tanaproget' 
_struct.pdbx_descriptor           'Progesterone receptor' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1ZUC 
_struct_keywords.pdbx_keywords   'HORMONE/GROWTH FACTOR' 
_struct_keywords.text            
'progesterone receptor, nonsteroidal agonist, tanaproget, progesterone, hormone, HORMONE-GROWTH FACTOR COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 2 ? 
F N N 4 ? 
G N N 4 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               'The asymmetric unit contains one dimer of the PR LBD.' 
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PRO A 11  ? ILE A 20  ? PRO B 685 ILE B 694 1 ? 10 
HELX_P HELX_P2  2  THR A 36  ? LEU A 62  ? THR B 710 LEU B 736 1 ? 27 
HELX_P HELX_P3  3  GLY A 64  ? LEU A 68  ? GLY B 738 LEU B 742 5 ? 5  
HELX_P HELX_P4  4  HIS A 69  ? SER A 98  ? HIS B 743 SER B 772 1 ? 30 
HELX_P HELX_P5  5  ASN A 111 ? GLU A 117 ? ASN B 785 GLU B 791 1 ? 7  
HELX_P HELX_P6  6  PHE A 120 ? GLN A 138 ? PHE B 794 GLN B 812 1 ? 19 
HELX_P HELX_P7  7  SER A 140 ? LEU A 153 ? SER B 814 LEU B 827 1 ? 14 
HELX_P HELX_P8  8  SER A 163 ? LEU A 184 ? SER B 837 LEU B 858 1 ? 22 
HELX_P HELX_P9  9  GLY A 188 ? GLN A 223 ? GLY B 862 GLN B 897 1 ? 36 
HELX_P HELX_P10 10 GLN A 223 ? SER A 228 ? GLN B 897 SER B 902 1 ? 6  
HELX_P HELX_P11 11 PRO A 232 ? ALA A 248 ? PRO B 906 ALA B 922 1 ? 17 
HELX_P HELX_P12 12 PRO B 11  ? ILE B 20  ? PRO A 685 ILE A 694 1 ? 10 
HELX_P HELX_P13 13 THR B 36  ? LEU B 62  ? THR A 710 LEU A 736 1 ? 27 
HELX_P HELX_P14 14 GLY B 64  ? LEU B 68  ? GLY A 738 LEU A 742 5 ? 5  
HELX_P HELX_P15 15 HIS B 69  ? SER B 98  ? HIS A 743 SER A 772 1 ? 30 
HELX_P HELX_P16 16 ASN B 111 ? MET B 115 ? ASN A 785 MET A 789 5 ? 5  
HELX_P HELX_P17 17 GLU B 117 ? GLN B 138 ? GLU A 791 GLN A 812 1 ? 22 
HELX_P HELX_P18 18 SER B 140 ? LEU B 153 ? SER A 814 LEU A 827 1 ? 14 
HELX_P HELX_P19 19 SER B 163 ? LEU B 184 ? SER A 837 LEU A 858 1 ? 22 
HELX_P HELX_P20 20 GLY B 188 ? GLN B 223 ? GLY A 862 GLN A 897 1 ? 36 
HELX_P HELX_P21 21 GLN B 223 ? SER B 228 ? GLN A 897 SER A 902 1 ? 6  
HELX_P HELX_P22 22 PRO B 232 ? ALA B 248 ? PRO A 906 ALA A 922 1 ? 17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
C ? 2 ? 
D ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 102 ? ALA A 105 ? LEU B 776 ALA B 779 
A 2 LEU A 108 ? LEU A 110 ? LEU B 782 LEU B 784 
B 1 THR A 155 ? ILE A 156 ? THR B 829 ILE B 830 
B 2 LYS A 252 ? PRO A 253 ? LYS B 926 PRO B 927 
C 1 LEU B 102 ? ALA B 105 ? LEU A 776 ALA A 779 
C 2 LEU B 108 ? LEU B 110 ? LEU A 782 LEU A 784 
D 1 THR B 155 ? PRO B 157 ? THR A 829 PRO A 831 
D 2 VAL B 251 ? PRO B 253 ? VAL A 925 PRO A 927 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 102 ? N LEU B 776 O LEU A 110 ? O LEU B 784 
B 1 2 N ILE A 156 ? N ILE B 830 O LYS A 252 ? O LYS B 926 
C 1 2 N LEU B 102 ? N LEU A 776 O LEU B 110 ? O LEU A 784 
D 1 2 N ILE B 156 ? N ILE A 830 O LYS B 252 ? O LYS A 926 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE SO4 A 203' 
AC2 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE T98 A 201' 
AC3 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE T98 B 202' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 9  PRO B 63  ? PRO A 737 . ? 1_555 ? 
2  AC1 9  GLY B 64  ? GLY A 738 . ? 1_555 ? 
3  AC1 9  ARG B 66  ? ARG A 740 . ? 1_555 ? 
4  AC1 9  ASN B 67  ? ASN A 741 . ? 1_555 ? 
5  AC1 9  HOH F .   ? HOH B 176 . ? 1_554 ? 
6  AC1 9  PRO A 63  ? PRO B 737 . ? 1_554 ? 
7  AC1 9  GLY A 64  ? GLY B 738 . ? 1_554 ? 
8  AC1 9  ARG A 66  ? ARG B 740 . ? 1_554 ? 
9  AC1 9  ASN A 67  ? ASN B 741 . ? 1_554 ? 
10 AC2 10 LEU B 44  ? LEU A 718 . ? 1_555 ? 
11 AC2 10 ASN B 45  ? ASN A 719 . ? 1_555 ? 
12 AC2 10 GLN B 51  ? GLN A 725 . ? 1_555 ? 
13 AC2 10 MET B 85  ? MET A 759 . ? 1_555 ? 
14 AC2 10 ARG B 92  ? ARG A 766 . ? 1_555 ? 
15 AC2 10 PHE B 104 ? PHE A 778 . ? 1_555 ? 
16 AC2 10 LEU B 123 ? LEU A 797 . ? 1_555 ? 
17 AC2 10 TYR B 216 ? TYR A 890 . ? 1_555 ? 
18 AC2 10 THR B 220 ? THR A 894 . ? 1_555 ? 
19 AC2 10 PHE B 231 ? PHE A 905 . ? 1_555 ? 
20 AC3 8  LEU A 44  ? LEU B 718 . ? 1_555 ? 
21 AC3 8  ASN A 45  ? ASN B 719 . ? 1_555 ? 
22 AC3 8  GLN A 51  ? GLN B 725 . ? 1_555 ? 
23 AC3 8  MET A 85  ? MET B 759 . ? 1_555 ? 
24 AC3 8  ARG A 92  ? ARG B 766 . ? 1_555 ? 
25 AC3 8  LEU A 123 ? LEU B 797 . ? 1_555 ? 
26 AC3 8  TYR A 216 ? TYR B 890 . ? 1_555 ? 
27 AC3 8  THR A 220 ? THR B 894 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1ZUC 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1ZUC 
_atom_sites.fract_transf_matrix[1][1]   0.017386 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001753 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.015505 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.014275 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLN A 1 8   ? -5.191  12.780  56.480  1.00 50.19 ? 682 GLN B N   1 
ATOM   2    C CA  . GLN A 1 8   ? -6.272  12.262  57.399  1.00 49.55 ? 682 GLN B CA  1 
ATOM   3    C C   . GLN A 1 8   ? -7.020  11.136  56.706  1.00 47.84 ? 682 GLN B C   1 
ATOM   4    O O   . GLN A 1 8   ? -7.065  9.993   57.196  1.00 48.24 ? 682 GLN B O   1 
ATOM   5    C CB  . GLN A 1 8   ? -7.262  13.376  57.801  1.00 50.34 ? 682 GLN B CB  1 
ATOM   6    C CG  . GLN A 1 8   ? -6.644  14.550  58.588  1.00 53.45 ? 682 GLN B CG  1 
ATOM   7    C CD  . GLN A 1 8   ? -6.030  14.136  59.943  1.00 56.93 ? 682 GLN B CD  1 
ATOM   8    O OE1 . GLN A 1 8   ? -6.742  13.739  60.880  1.00 58.99 ? 682 GLN B OE1 1 
ATOM   9    N NE2 . GLN A 1 8   ? -4.709  14.251  60.048  1.00 55.93 ? 682 GLN B NE2 1 
ATOM   10   N N   . LEU A 1 9   ? -7.616  11.476  55.564  1.00 45.24 ? 683 LEU B N   1 
ATOM   11   C CA  . LEU A 1 9   ? -8.291  10.489  54.742  1.00 42.53 ? 683 LEU B CA  1 
ATOM   12   C C   . LEU A 1 9   ? -7.335  9.902   53.698  1.00 39.32 ? 683 LEU B C   1 
ATOM   13   O O   . LEU A 1 9   ? -7.677  8.915   53.060  1.00 38.54 ? 683 LEU B O   1 
ATOM   14   C CB  . LEU A 1 9   ? -9.570  11.059  54.089  1.00 43.25 ? 683 LEU B CB  1 
ATOM   15   C CG  . LEU A 1 9   ? -10.921 10.738  54.767  1.00 44.93 ? 683 LEU B CG  1 
ATOM   16   C CD1 . LEU A 1 9   ? -12.110 11.272  53.952  1.00 47.14 ? 683 LEU B CD1 1 
ATOM   17   C CD2 . LEU A 1 9   ? -11.093 9.239   55.049  1.00 45.72 ? 683 LEU B CD2 1 
ATOM   18   N N   . ILE A 1 10  ? -6.134  10.477  53.566  1.00 36.19 ? 684 ILE B N   1 
ATOM   19   C CA  . ILE A 1 10  ? -5.146  9.984   52.574  1.00 33.06 ? 684 ILE B CA  1 
ATOM   20   C C   . ILE A 1 10  ? -4.424  8.720   53.046  1.00 31.13 ? 684 ILE B C   1 
ATOM   21   O O   . ILE A 1 10  ? -3.782  8.741   54.095  1.00 31.01 ? 684 ILE B O   1 
ATOM   22   C CB  . ILE A 1 10  ? -4.067  11.031  52.133  1.00 33.30 ? 684 ILE B CB  1 
ATOM   23   C CG1 . ILE A 1 10  ? -4.629  12.449  51.973  1.00 32.72 ? 684 ILE B CG1 1 
ATOM   24   C CG2 . ILE A 1 10  ? -3.440  10.606  50.819  1.00 31.57 ? 684 ILE B CG2 1 
ATOM   25   C CD1 . ILE A 1 10  ? -5.764  12.543  51.037  1.00 30.58 ? 684 ILE B CD1 1 
ATOM   26   N N   . PRO A 1 11  ? -4.517  7.627   52.254  1.00 29.03 ? 685 PRO B N   1 
ATOM   27   C CA  . PRO A 1 11  ? -3.831  6.372   52.521  1.00 27.46 ? 685 PRO B CA  1 
ATOM   28   C C   . PRO A 1 11  ? -2.345  6.594   52.782  1.00 26.34 ? 685 PRO B C   1 
ATOM   29   O O   . PRO A 1 11  ? -1.725  7.390   52.068  1.00 25.60 ? 685 PRO B O   1 
ATOM   30   C CB  . PRO A 1 11  ? -4.029  5.586   51.215  1.00 27.05 ? 685 PRO B CB  1 
ATOM   31   C CG  . PRO A 1 11  ? -5.282  6.077   50.687  1.00 28.54 ? 685 PRO B CG  1 
ATOM   32   C CD  . PRO A 1 11  ? -5.319  7.541   51.016  1.00 28.44 ? 685 PRO B CD  1 
ATOM   33   N N   . PRO A 1 12  ? -1.787  5.926   53.825  1.00 25.45 ? 686 PRO B N   1 
ATOM   34   C CA  . PRO A 1 12  ? -0.386  6.127   54.188  1.00 24.69 ? 686 PRO B CA  1 
ATOM   35   C C   . PRO A 1 12  ? 0.627   5.962   53.046  1.00 22.90 ? 686 PRO B C   1 
ATOM   36   O O   . PRO A 1 12  ? 1.524   6.795   52.965  1.00 23.39 ? 686 PRO B O   1 
ATOM   37   C CB  . PRO A 1 12  ? -0.149  5.106   55.324  1.00 24.69 ? 686 PRO B CB  1 
ATOM   38   C CG  . PRO A 1 12  ? -1.304  4.164   55.229  1.00 24.57 ? 686 PRO B CG  1 
ATOM   39   C CD  . PRO A 1 12  ? -2.437  5.020   54.788  1.00 26.12 ? 686 PRO B CD  1 
ATOM   40   N N   . LEU A 1 13  ? 0.492   4.947   52.180  1.00 19.68 ? 687 LEU B N   1 
ATOM   41   C CA  . LEU A 1 13  ? 1.475   4.805   51.079  1.00 18.66 ? 687 LEU B CA  1 
ATOM   42   C C   . LEU A 1 13  ? 1.485   6.046   50.203  1.00 18.49 ? 687 LEU B C   1 
ATOM   43   O O   . LEU A 1 13  ? 2.540   6.481   49.737  1.00 18.38 ? 687 LEU B O   1 
ATOM   44   C CB  . LEU A 1 13  ? 1.192   3.592   50.205  1.00 17.94 ? 687 LEU B CB  1 
ATOM   45   C CG  . LEU A 1 13  ? 2.165   3.326   49.046  1.00 17.15 ? 687 LEU B CG  1 
ATOM   46   C CD1 . LEU A 1 13  ? 3.634   3.397   49.517  1.00 15.91 ? 687 LEU B CD1 1 
ATOM   47   C CD2 . LEU A 1 13  ? 1.834   1.928   48.419  1.00 16.79 ? 687 LEU B CD2 1 
ATOM   48   N N   . ILE A 1 14  ? 0.312   6.616   49.971  1.00 18.46 ? 688 ILE B N   1 
ATOM   49   C CA  . ILE A 1 14  ? 0.215   7.844   49.175  1.00 18.04 ? 688 ILE B CA  1 
ATOM   50   C C   . ILE A 1 14  ? 0.905   8.995   49.900  1.00 18.39 ? 688 ILE B C   1 
ATOM   51   O O   . ILE A 1 14  ? 1.643   9.746   49.271  1.00 18.59 ? 688 ILE B O   1 
ATOM   52   C CB  . ILE A 1 14  ? -1.272  8.192   48.767  1.00 18.21 ? 688 ILE B CB  1 
ATOM   53   C CG1 . ILE A 1 14  ? -1.845  7.116   47.813  1.00 17.61 ? 688 ILE B CG1 1 
ATOM   54   C CG2 . ILE A 1 14  ? -1.333  9.520   48.103  1.00 17.78 ? 688 ILE B CG2 1 
ATOM   55   C CD1 . ILE A 1 14  ? -3.356  7.275   47.524  1.00 17.18 ? 688 ILE B CD1 1 
ATOM   56   N N   . ASN A 1 15  ? 0.684   9.169   51.213  1.00 19.40 ? 689 ASN B N   1 
ATOM   57   C CA  . ASN A 1 15  ? 1.386   10.258  51.921  1.00 19.66 ? 689 ASN B CA  1 
ATOM   58   C C   . ASN A 1 15  ? 2.914   10.032  51.839  1.00 19.04 ? 689 ASN B C   1 
ATOM   59   O O   . ASN A 1 15  ? 3.679   10.963  51.664  1.00 18.05 ? 689 ASN B O   1 
ATOM   60   C CB  . ASN A 1 15  ? 0.995   10.336  53.403  1.00 21.85 ? 689 ASN B CB  1 
ATOM   61   C CG  . ASN A 1 15  ? -0.429  10.869  53.641  1.00 26.62 ? 689 ASN B CG  1 
ATOM   62   O OD1 . ASN A 1 15  ? -1.106  10.404  54.569  1.00 36.70 ? 689 ASN B OD1 1 
ATOM   63   N ND2 . ASN A 1 15  ? -0.879  11.842  52.843  1.00 29.94 ? 689 ASN B ND2 1 
ATOM   64   N N   . LEU A 1 16  ? 3.327   8.775   51.907  1.00 18.17 ? 690 LEU B N   1 
ATOM   65   C CA  . LEU A 1 16  ? 4.754   8.459   51.797  1.00 18.68 ? 690 LEU B CA  1 
ATOM   66   C C   . LEU A 1 16  ? 5.255   8.851   50.393  1.00 18.11 ? 690 LEU B C   1 
ATOM   67   O O   . LEU A 1 16  ? 6.262   9.572   50.267  1.00 18.78 ? 690 LEU B O   1 
ATOM   68   C CB  . LEU A 1 16  ? 4.987   6.997   52.079  1.00 18.17 ? 690 LEU B CB  1 
ATOM   69   C CG  . LEU A 1 16  ? 6.460   6.601   52.260  1.00 20.09 ? 690 LEU B CG  1 
ATOM   70   C CD1 . LEU A 1 16  ? 6.434   5.450   53.138  1.00 25.02 ? 690 LEU B CD1 1 
ATOM   71   C CD2 . LEU A 1 16  ? 7.105   6.231   50.933  1.00 21.76 ? 690 LEU B CD2 1 
ATOM   72   N N   . LEU A 1 17  ? 4.526   8.443   49.355  1.00 17.23 ? 691 LEU B N   1 
ATOM   73   C CA  . LEU A 1 17  ? 4.863   8.894   47.998  1.00 16.91 ? 691 LEU B CA  1 
ATOM   74   C C   . LEU A 1 17  ? 5.029   10.421  47.887  1.00 17.85 ? 691 LEU B C   1 
ATOM   75   O O   . LEU A 1 17  ? 5.998   10.923  47.295  1.00 16.74 ? 691 LEU B O   1 
ATOM   76   C CB  . LEU A 1 17  ? 3.854   8.357   46.983  1.00 16.08 ? 691 LEU B CB  1 
ATOM   77   C CG  . LEU A 1 17  ? 3.901   6.835   46.717  1.00 14.18 ? 691 LEU B CG  1 
ATOM   78   C CD1 . LEU A 1 17  ? 2.866   6.501   45.648  1.00 12.13 ? 691 LEU B CD1 1 
ATOM   79   C CD2 . LEU A 1 17  ? 5.313   6.318   46.302  1.00 15.07 ? 691 LEU B CD2 1 
ATOM   80   N N   . MET A 1 18  ? 4.088   11.173  48.456  1.00 18.93 ? 692 MET B N   1 
ATOM   81   C CA  . MET A 1 18  ? 4.202   12.641  48.423  1.00 20.86 ? 692 MET B CA  1 
ATOM   82   C C   . MET A 1 18  ? 5.483   13.100  49.132  1.00 20.84 ? 692 MET B C   1 
ATOM   83   O O   . MET A 1 18  ? 6.149   14.009  48.651  1.00 20.21 ? 692 MET B O   1 
ATOM   84   C CB  . MET A 1 18  ? 2.984   13.340  49.085  1.00 21.25 ? 692 MET B CB  1 
ATOM   85   C CG  . MET A 1 18  ? 3.015   14.859  48.956  1.00 25.93 ? 692 MET B CG  1 
ATOM   86   S SD  . MET A 1 18  ? 3.004   15.420  47.212  1.00 35.96 ? 692 MET B SD  1 
ATOM   87   C CE  . MET A 1 18  ? 4.599   16.247  47.048  1.00 35.76 ? 692 MET B CE  1 
ATOM   88   N N   . SER A 1 19  ? 5.806   12.471  50.268  1.00 21.47 ? 693 SER B N   1 
ATOM   89   C CA  . SER A 1 19  ? 6.982   12.886  51.070  1.00 22.40 ? 693 SER B CA  1 
ATOM   90   C C   . SER A 1 19  ? 8.336   12.703  50.364  1.00 21.17 ? 693 SER B C   1 
ATOM   91   O O   . SER A 1 19  ? 9.253   13.432  50.653  1.00 20.56 ? 693 SER B O   1 
ATOM   92   C CB  . SER A 1 19  ? 7.016   12.183  52.442  1.00 22.56 ? 693 SER B CB  1 
ATOM   93   O OG  . SER A 1 19  ? 7.501   10.850  52.310  1.00 26.04 ? 693 SER B OG  1 
ATOM   94   N N   . ILE A 1 20  ? 8.435   11.752  49.431  1.00 20.11 ? 694 ILE B N   1 
ATOM   95   C CA  . ILE A 1 20  ? 9.717   11.448  48.800  1.00 19.35 ? 694 ILE B CA  1 
ATOM   96   C C   . ILE A 1 20  ? 9.852   12.052  47.398  1.00 20.49 ? 694 ILE B C   1 
ATOM   97   O O   . ILE A 1 20  ? 10.794  11.707  46.640  1.00 20.59 ? 694 ILE B O   1 
ATOM   98   C CB  . ILE A 1 20  ? 10.020  9.910   48.788  1.00 19.16 ? 694 ILE B CB  1 
ATOM   99   C CG1 . ILE A 1 20  ? 8.986   9.168   47.944  1.00 18.14 ? 694 ILE B CG1 1 
ATOM   100  C CG2 . ILE A 1 20  ? 10.070  9.356   50.254  1.00 18.25 ? 694 ILE B CG2 1 
ATOM   101  C CD1 . ILE A 1 20  ? 9.361   7.711   47.562  1.00 18.03 ? 694 ILE B CD1 1 
ATOM   102  N N   . GLU A 1 21  ? 8.912   12.921  47.035  1.00 21.32 ? 695 GLU B N   1 
ATOM   103  C CA  . GLU A 1 21  ? 8.959   13.621  45.742  1.00 22.88 ? 695 GLU B CA  1 
ATOM   104  C C   . GLU A 1 21  ? 10.163  14.544  45.717  1.00 24.27 ? 695 GLU B C   1 
ATOM   105  O O   . GLU A 1 21  ? 10.546  15.046  46.745  1.00 23.69 ? 695 GLU B O   1 
ATOM   106  C CB  . GLU A 1 21  ? 7.705   14.488  45.527  1.00 22.15 ? 695 GLU B CB  1 
ATOM   107  C CG  . GLU A 1 21  ? 6.550   13.690  44.996  1.00 21.48 ? 695 GLU B CG  1 
ATOM   108  C CD  . GLU A 1 21  ? 6.786   13.234  43.565  1.00 21.04 ? 695 GLU B CD  1 
ATOM   109  O OE1 . GLU A 1 21  ? 6.590   14.052  42.672  1.00 24.01 ? 695 GLU B OE1 1 
ATOM   110  O OE2 . GLU A 1 21  ? 7.131   12.065  43.329  1.00 19.82 ? 695 GLU B OE2 1 
ATOM   111  N N   . PRO A 1 22  ? 10.733  14.794  44.533  1.00 26.06 ? 696 PRO B N   1 
ATOM   112  C CA  . PRO A 1 22  ? 11.956  15.583  44.452  1.00 27.18 ? 696 PRO B CA  1 
ATOM   113  C C   . PRO A 1 22  ? 11.656  17.036  44.684  1.00 27.52 ? 696 PRO B C   1 
ATOM   114  O O   . PRO A 1 22  ? 10.524  17.434  44.505  1.00 26.98 ? 696 PRO B O   1 
ATOM   115  C CB  . PRO A 1 22  ? 12.389  15.382  42.993  1.00 26.57 ? 696 PRO B CB  1 
ATOM   116  C CG  . PRO A 1 22  ? 11.695  14.085  42.587  1.00 29.18 ? 696 PRO B CG  1 
ATOM   117  C CD  . PRO A 1 22  ? 10.337  14.315  43.199  1.00 26.67 ? 696 PRO B CD  1 
ATOM   118  N N   . ASP A 1 23  ? 12.669  17.810  45.067  1.00 28.30 ? 697 ASP B N   1 
ATOM   119  C CA  . ASP A 1 23  ? 12.567  19.255  45.062  1.00 29.98 ? 697 ASP B CA  1 
ATOM   120  C C   . ASP A 1 23  ? 12.605  19.725  43.595  1.00 29.42 ? 697 ASP B C   1 
ATOM   121  O O   . ASP A 1 23  ? 12.711  18.905  42.693  1.00 28.07 ? 697 ASP B O   1 
ATOM   122  C CB  . ASP A 1 23  ? 13.747  19.863  45.831  1.00 31.66 ? 697 ASP B CB  1 
ATOM   123  C CG  . ASP A 1 23  ? 13.428  20.097  47.290  1.00 36.69 ? 697 ASP B CG  1 
ATOM   124  O OD1 . ASP A 1 23  ? 12.515  20.926  47.568  1.00 40.73 ? 697 ASP B OD1 1 
ATOM   125  O OD2 . ASP A 1 23  ? 14.083  19.455  48.146  1.00 40.28 ? 697 ASP B OD2 1 
ATOM   126  N N   . VAL A 1 24  ? 12.532  21.048  43.405  1.00 29.62 ? 698 VAL B N   1 
ATOM   127  C CA  . VAL A 1 24  ? 12.619  21.728  42.104  1.00 29.40 ? 698 VAL B CA  1 
ATOM   128  C C   . VAL A 1 24  ? 13.981  21.421  41.512  1.00 27.82 ? 698 VAL B C   1 
ATOM   129  O O   . VAL A 1 24  ? 15.010  21.536  42.205  1.00 27.53 ? 698 VAL B O   1 
ATOM   130  C CB  . VAL A 1 24  ? 12.450  23.306  42.266  1.00 30.13 ? 698 VAL B CB  1 
ATOM   131  C CG1 . VAL A 1 24  ? 12.984  24.054  41.080  1.00 31.58 ? 698 VAL B CG1 1 
ATOM   132  C CG2 . VAL A 1 24  ? 10.993  23.689  42.488  1.00 32.17 ? 698 VAL B CG2 1 
ATOM   133  N N   . ILE A 1 25  ? 13.984  20.995  40.248  1.00 25.94 ? 699 ILE B N   1 
ATOM   134  C CA  . ILE A 1 25  ? 15.227  20.789  39.509  1.00 24.28 ? 699 ILE B CA  1 
ATOM   135  C C   . ILE A 1 25  ? 15.354  21.788  38.377  1.00 24.28 ? 699 ILE B C   1 
ATOM   136  O O   . ILE A 1 25  ? 14.443  21.929  37.534  1.00 22.06 ? 699 ILE B O   1 
ATOM   137  C CB  . ILE A 1 25  ? 15.333  19.332  38.946  1.00 24.67 ? 699 ILE B CB  1 
ATOM   138  C CG1 . ILE A 1 25  ? 15.329  18.319  40.103  1.00 23.12 ? 699 ILE B CG1 1 
ATOM   139  C CG2 . ILE A 1 25  ? 16.603  19.160  38.017  1.00 22.17 ? 699 ILE B CG2 1 
ATOM   140  C CD1 . ILE A 1 25  ? 14.863  16.939  39.698  1.00 23.80 ? 699 ILE B CD1 1 
ATOM   141  N N   . TYR A 1 26  ? 16.495  22.479  38.357  1.00 24.64 ? 700 TYR B N   1 
ATOM   142  C CA  . TYR A 1 26  ? 16.763  23.461  37.319  1.00 25.33 ? 700 TYR B CA  1 
ATOM   143  C C   . TYR A 1 26  ? 17.533  22.833  36.179  1.00 24.48 ? 700 TYR B C   1 
ATOM   144  O O   . TYR A 1 26  ? 18.310  21.881  36.400  1.00 23.81 ? 700 TYR B O   1 
ATOM   145  C CB  . TYR A 1 26  ? 17.579  24.597  37.892  1.00 27.40 ? 700 TYR B CB  1 
ATOM   146  C CG  . TYR A 1 26  ? 16.835  25.457  38.877  1.00 30.54 ? 700 TYR B CG  1 
ATOM   147  C CD1 . TYR A 1 26  ? 16.777  25.105  40.234  1.00 32.60 ? 700 TYR B CD1 1 
ATOM   148  C CD2 . TYR A 1 26  ? 16.224  26.648  38.471  1.00 32.55 ? 700 TYR B CD2 1 
ATOM   149  C CE1 . TYR A 1 26  ? 16.114  25.898  41.146  1.00 33.77 ? 700 TYR B CE1 1 
ATOM   150  C CE2 . TYR A 1 26  ? 15.561  27.458  39.386  1.00 33.85 ? 700 TYR B CE2 1 
ATOM   151  C CZ  . TYR A 1 26  ? 15.517  27.072  40.714  1.00 32.92 ? 700 TYR B CZ  1 
ATOM   152  O OH  . TYR A 1 26  ? 14.863  27.860  41.629  1.00 37.15 ? 700 TYR B OH  1 
ATOM   153  N N   . ALA A 1 27  ? 17.316  23.351  34.963  1.00 23.84 ? 701 ALA B N   1 
ATOM   154  C CA  . ALA A 1 27  ? 18.061  22.917  33.771  1.00 23.17 ? 701 ALA B CA  1 
ATOM   155  C C   . ALA A 1 27  ? 19.458  23.532  33.674  1.00 23.37 ? 701 ALA B C   1 
ATOM   156  O O   . ALA A 1 27  ? 20.354  22.947  33.051  1.00 22.86 ? 701 ALA B O   1 
ATOM   157  C CB  . ALA A 1 27  ? 17.268  23.227  32.478  1.00 22.83 ? 701 ALA B CB  1 
ATOM   158  N N   . GLY A 1 28  ? 19.627  24.698  34.300  1.00 24.07 ? 702 GLY B N   1 
ATOM   159  C CA  . GLY A 1 28  ? 20.843  25.522  34.170  1.00 24.20 ? 702 GLY B CA  1 
ATOM   160  C C   . GLY A 1 28  ? 20.969  26.160  32.791  1.00 24.70 ? 702 GLY B C   1 
ATOM   161  O O   . GLY A 1 28  ? 22.086  26.352  32.294  1.00 23.72 ? 702 GLY B O   1 
ATOM   162  N N   . HIS A 1 29  ? 19.839  26.433  32.143  1.00 23.70 ? 703 HIS B N   1 
ATOM   163  C CA  . HIS A 1 29  ? 19.852  27.100  30.841  1.00 25.18 ? 703 HIS B CA  1 
ATOM   164  C C   . HIS A 1 29  ? 20.160  28.622  30.960  1.00 26.51 ? 703 HIS B C   1 
ATOM   165  O O   . HIS A 1 29  ? 19.671  29.292  31.848  1.00 25.17 ? 703 HIS B O   1 
ATOM   166  C CB  . HIS A 1 29  ? 18.531  26.883  30.106  1.00 24.31 ? 703 HIS B CB  1 
ATOM   167  C CG  . HIS A 1 29  ? 18.561  27.308  28.674  1.00 25.62 ? 703 HIS B CG  1 
ATOM   168  N ND1 . HIS A 1 29  ? 18.015  28.502  28.242  1.00 27.77 ? 703 HIS B ND1 1 
ATOM   169  C CD2 . HIS A 1 29  ? 19.082  26.716  27.578  1.00 23.72 ? 703 HIS B CD2 1 
ATOM   170  C CE1 . HIS A 1 29  ? 18.169  28.606  26.935  1.00 27.45 ? 703 HIS B CE1 1 
ATOM   171  N NE2 . HIS A 1 29  ? 18.824  27.542  26.508  1.00 26.78 ? 703 HIS B NE2 1 
ATOM   172  N N   . ASP A 1 30  ? 20.965  29.138  30.035  1.00 28.77 ? 704 ASP B N   1 
ATOM   173  C CA  . ASP A 1 30  ? 21.351  30.554  30.000  1.00 31.97 ? 704 ASP B CA  1 
ATOM   174  C C   . ASP A 1 30  ? 20.141  31.541  30.172  1.00 33.26 ? 704 ASP B C   1 
ATOM   175  O O   . ASP A 1 30  ? 20.003  32.234  31.223  1.00 36.43 ? 704 ASP B O   1 
ATOM   176  C CB  . ASP A 1 30  ? 22.126  30.781  28.687  1.00 32.92 ? 704 ASP B CB  1 
ATOM   177  C CG  . ASP A 1 30  ? 21.214  30.660  27.439  1.00 34.14 ? 704 ASP B CG  1 
ATOM   178  O OD1 . ASP A 1 30  ? 20.150  31.306  27.557  1.00 28.71 ? 704 ASP B OD1 1 
ATOM   179  O OD2 . ASP A 1 30  ? 21.537  29.947  26.393  1.00 31.36 ? 704 ASP B OD2 1 
ATOM   180  N N   . ASN A 1 31  ? 19.255  31.557  29.179  1.00 33.49 ? 705 ASN B N   1 
ATOM   181  C CA  . ASN A 1 31  ? 18.056  32.447  29.036  1.00 33.46 ? 705 ASN B CA  1 
ATOM   182  C C   . ASN A 1 31  ? 18.357  33.915  28.659  1.00 34.23 ? 705 ASN B C   1 
ATOM   183  O O   . ASN A 1 31  ? 17.461  34.648  28.220  1.00 34.21 ? 705 ASN B O   1 
ATOM   184  C CB  . ASN A 1 31  ? 17.071  32.379  30.214  1.00 33.71 ? 705 ASN B CB  1 
ATOM   185  C CG  . ASN A 1 31  ? 16.317  31.052  30.290  1.00 33.09 ? 705 ASN B CG  1 
ATOM   186  O OD1 . ASN A 1 31  ? 15.689  30.603  29.327  1.00 32.85 ? 705 ASN B OD1 1 
ATOM   187  N ND2 . ASN A 1 31  ? 16.360  30.431  31.458  1.00 30.75 ? 705 ASN B ND2 1 
ATOM   188  N N   . THR A 1 32  ? 19.601  34.349  28.827  1.00 34.03 ? 706 THR B N   1 
ATOM   189  C CA  . THR A 1 32  ? 19.976  35.677  28.343  1.00 34.83 ? 706 THR B CA  1 
ATOM   190  C C   . THR A 1 32  ? 20.417  35.627  26.865  1.00 34.87 ? 706 THR B C   1 
ATOM   191  O O   . THR A 1 32  ? 20.806  36.646  26.292  1.00 35.76 ? 706 THR B O   1 
ATOM   192  C CB  . THR A 1 32  ? 21.107  36.281  29.170  1.00 34.64 ? 706 THR B CB  1 
ATOM   193  O OG1 . THR A 1 32  ? 22.305  35.551  28.916  1.00 35.24 ? 706 THR B OG1 1 
ATOM   194  C CG2 . THR A 1 32  ? 20.785  36.233  30.671  1.00 36.06 ? 706 THR B CG2 1 
ATOM   195  N N   . LYS A 1 33  ? 20.386  34.446  26.252  1.00 33.55 ? 707 LYS B N   1 
ATOM   196  C CA  . LYS A 1 33  ? 20.895  34.301  24.891  1.00 33.30 ? 707 LYS B CA  1 
ATOM   197  C C   . LYS A 1 33  ? 19.746  33.776  24.113  1.00 31.18 ? 707 LYS B C   1 
ATOM   198  O O   . LYS A 1 33  ? 18.928  33.087  24.692  1.00 31.63 ? 707 LYS B O   1 
ATOM   199  C CB  . LYS A 1 33  ? 22.057  33.285  24.814  1.00 32.91 ? 707 LYS B CB  1 
ATOM   200  C CG  . LYS A 1 33  ? 23.335  33.720  25.517  1.00 35.76 ? 707 LYS B CG  1 
ATOM   201  C CD  . LYS A 1 33  ? 24.484  32.792  25.135  1.00 35.45 ? 707 LYS B CD  1 
ATOM   202  C CE  . LYS A 1 33  ? 25.859  33.416  25.446  1.00 41.72 ? 707 LYS B CE  1 
ATOM   203  N NZ  . LYS A 1 33  ? 26.464  32.931  26.736  1.00 44.57 ? 707 LYS B NZ  1 
ATOM   204  N N   . PRO A 1 34  ? 19.666  34.101  22.813  1.00 30.22 ? 708 PRO B N   1 
ATOM   205  C CA  . PRO A 1 34  ? 18.657  33.507  21.919  1.00 29.05 ? 708 PRO B CA  1 
ATOM   206  C C   . PRO A 1 34  ? 18.803  31.975  21.824  1.00 28.04 ? 708 PRO B C   1 
ATOM   207  O O   . PRO A 1 34  ? 19.922  31.473  21.858  1.00 26.85 ? 708 PRO B O   1 
ATOM   208  C CB  . PRO A 1 34  ? 18.952  34.171  20.565  1.00 29.22 ? 708 PRO B CB  1 
ATOM   209  C CG  . PRO A 1 34  ? 19.661  35.451  20.919  1.00 30.68 ? 708 PRO B CG  1 
ATOM   210  C CD  . PRO A 1 34  ? 20.501  35.098  22.107  1.00 30.62 ? 708 PRO B CD  1 
ATOM   211  N N   . ASP A 1 35  ? 17.677  31.260  21.730  1.00 26.46 ? 709 ASP B N   1 
ATOM   212  C CA  . ASP A 1 35  ? 17.678  29.792  21.726  1.00 24.83 ? 709 ASP B CA  1 
ATOM   213  C C   . ASP A 1 35  ? 18.351  29.340  20.481  1.00 24.61 ? 709 ASP B C   1 
ATOM   214  O O   . ASP A 1 35  ? 18.177  29.958  19.429  1.00 22.71 ? 709 ASP B O   1 
ATOM   215  C CB  . ASP A 1 35  ? 16.247  29.242  21.603  1.00 24.44 ? 709 ASP B CB  1 
ATOM   216  C CG  . ASP A 1 35  ? 15.492  29.269  22.901  1.00 23.87 ? 709 ASP B CG  1 
ATOM   217  O OD1 . ASP A 1 35  ? 16.105  29.560  23.952  1.00 23.87 ? 709 ASP B OD1 1 
ATOM   218  O OD2 . ASP A 1 35  ? 14.277  28.975  22.861  1.00 24.16 ? 709 ASP B OD2 1 
ATOM   219  N N   . THR A 1 36  ? 19.080  28.238  20.562  1.00 23.44 ? 710 THR B N   1 
ATOM   220  C CA  . THR A 1 36  ? 19.439  27.540  19.343  1.00 24.21 ? 710 THR B CA  1 
ATOM   221  C C   . THR A 1 36  ? 19.018  26.082  19.560  1.00 24.58 ? 710 THR B C   1 
ATOM   222  O O   . THR A 1 36  ? 18.810  25.634  20.706  1.00 24.30 ? 710 THR B O   1 
ATOM   223  C CB  . THR A 1 36  ? 20.966  27.645  19.031  1.00 23.94 ? 710 THR B CB  1 
ATOM   224  O OG1 . THR A 1 36  ? 21.671  26.943  20.042  1.00 22.12 ? 710 THR B OG1 1 
ATOM   225  C CG2 . THR A 1 36  ? 21.463  29.102  19.072  1.00 24.68 ? 710 THR B CG2 1 
ATOM   226  N N   . SER A 1 37  ? 18.875  25.357  18.465  1.00 24.79 ? 711 SER B N   1 
ATOM   227  C CA  . SER A 1 37  ? 18.532  23.938  18.535  1.00 26.58 ? 711 SER B CA  1 
ATOM   228  C C   . SER A 1 37  ? 19.551  23.234  19.438  1.00 25.79 ? 711 SER B C   1 
ATOM   229  O O   . SER A 1 37  ? 19.201  22.449  20.320  1.00 26.34 ? 711 SER B O   1 
ATOM   230  C CB  . SER A 1 37  ? 18.517  23.371  17.110  1.00 27.08 ? 711 SER B CB  1 
ATOM   231  O OG  . SER A 1 37  ? 18.816  21.995  17.095  1.00 32.63 ? 711 SER B OG  1 
ATOM   232  N N   . SER A 1 38  ? 20.821  23.572  19.288  1.00 24.93 ? 712 SER B N   1 
ATOM   233  C CA  . SER A 1 38  ? 21.825  22.901  20.082  1.00 24.43 ? 712 SER B CA  1 
ATOM   234  C C   . SER A 1 38  ? 21.793  23.270  21.572  1.00 23.33 ? 712 SER B C   1 
ATOM   235  O O   . SER A 1 38  ? 21.960  22.393  22.407  1.00 21.55 ? 712 SER B O   1 
ATOM   236  C CB  . SER A 1 38  ? 23.198  23.048  19.438  1.00 25.78 ? 712 SER B CB  1 
ATOM   237  O OG  . SER A 1 38  ? 24.081  23.771  20.258  1.00 27.77 ? 712 SER B OG  1 
ATOM   238  N N   . SER A 1 39  ? 21.516  24.540  21.906  1.00 21.42 ? 713 SER B N   1 
ATOM   239  C CA  . SER A 1 39  ? 21.507  24.952  23.305  1.00 21.11 ? 713 SER B CA  1 
ATOM   240  C C   . SER A 1 39  ? 20.272  24.453  24.073  1.00 19.56 ? 713 SER B C   1 
ATOM   241  O O   . SER A 1 39  ? 20.363  24.082  25.265  1.00 18.82 ? 713 SER B O   1 
ATOM   242  C CB  . SER A 1 39  ? 21.670  26.482  23.459  1.00 21.28 ? 713 SER B CB  1 
ATOM   243  O OG  . SER A 1 39  ? 20.490  27.160  23.087  1.00 23.88 ? 713 SER B OG  1 
ATOM   244  N N   . LEU A 1 40  ? 19.129  24.458  23.396  1.00 18.41 ? 714 LEU B N   1 
ATOM   245  C CA  . LEU A 1 40  ? 17.887  23.910  23.933  1.00 17.60 ? 714 LEU B CA  1 
ATOM   246  C C   . LEU A 1 40  ? 18.025  22.411  24.218  1.00 16.53 ? 714 LEU B C   1 
ATOM   247  O O   . LEU A 1 40  ? 17.683  21.940  25.328  1.00 17.11 ? 714 LEU B O   1 
ATOM   248  C CB  . LEU A 1 40  ? 16.696  24.125  22.973  1.00 16.34 ? 714 LEU B CB  1 
ATOM   249  C CG  . LEU A 1 40  ? 16.024  25.482  22.934  1.00 19.49 ? 714 LEU B CG  1 
ATOM   250  C CD1 . LEU A 1 40  ? 14.889  25.450  21.893  1.00 15.13 ? 714 LEU B CD1 1 
ATOM   251  C CD2 . LEU A 1 40  ? 15.497  25.869  24.319  1.00 20.79 ? 714 LEU B CD2 1 
ATOM   252  N N   . LEU A 1 41  ? 18.505  21.664  23.232  1.00 14.61 ? 715 LEU B N   1 
ATOM   253  C CA  . LEU A 1 41  ? 18.635  20.187  23.375  1.00 14.49 ? 715 LEU B CA  1 
ATOM   254  C C   . LEU A 1 41  ? 19.711  19.827  24.418  1.00 14.62 ? 715 LEU B C   1 
ATOM   255  O O   . LEU A 1 41  ? 19.538  18.900  25.239  1.00 12.79 ? 715 LEU B O   1 
ATOM   256  C CB  . LEU A 1 41  ? 18.878  19.525  22.002  1.00 14.69 ? 715 LEU B CB  1 
ATOM   257  C CG  . LEU A 1 41  ? 17.702  19.625  20.999  1.00 14.35 ? 715 LEU B CG  1 
ATOM   258  C CD1 . LEU A 1 41  ? 18.069  19.071  19.622  1.00 16.17 ? 715 LEU B CD1 1 
ATOM   259  C CD2 . LEU A 1 41  ? 16.438  18.890  21.553  1.00 13.96 ? 715 LEU B CD2 1 
ATOM   260  N N   . THR A 1 42  ? 20.821  20.571  24.408  1.00 13.96 ? 716 THR B N   1 
ATOM   261  C CA  . THR A 1 42  ? 21.828  20.444  25.473  1.00 14.24 ? 716 THR B CA  1 
ATOM   262  C C   . THR A 1 42  ? 21.259  20.672  26.896  1.00 14.80 ? 716 THR B C   1 
ATOM   263  O O   . THR A 1 42  ? 21.539  19.897  27.804  1.00 14.64 ? 716 THR B O   1 
ATOM   264  C CB  . THR A 1 42  ? 23.061  21.347  25.179  1.00 14.18 ? 716 THR B CB  1 
ATOM   265  O OG1 . THR A 1 42  ? 23.699  20.836  24.011  1.00 16.22 ? 716 THR B OG1 1 
ATOM   266  C CG2 . THR A 1 42  ? 24.073  21.351  26.342  1.00 15.10 ? 716 THR B CG2 1 
ATOM   267  N N   . SER A 1 43  ? 20.423  21.700  27.075  1.00 15.66 ? 717 SER B N   1 
ATOM   268  C CA  . SER A 1 43  ? 19.799  21.949  28.382  1.00 16.54 ? 717 SER B CA  1 
ATOM   269  C C   . SER A 1 43  ? 18.813  20.848  28.700  1.00 16.16 ? 717 SER B C   1 
ATOM   270  O O   . SER A 1 43  ? 18.727  20.404  29.830  1.00 16.25 ? 717 SER B O   1 
ATOM   271  C CB  . SER A 1 43  ? 19.082  23.304  28.392  1.00 15.90 ? 717 SER B CB  1 
ATOM   272  O OG  . SER A 1 43  ? 20.061  24.287  28.492  1.00 18.65 ? 717 SER B OG  1 
ATOM   273  N N   . LEU A 1 44  ? 18.051  20.402  27.708  1.00 17.04 ? 718 LEU B N   1 
ATOM   274  C CA  . LEU A 1 44  ? 17.097  19.296  27.940  1.00 16.72 ? 718 LEU B CA  1 
ATOM   275  C C   . LEU A 1 44  ? 17.822  18.029  28.419  1.00 17.36 ? 718 LEU B C   1 
ATOM   276  O O   . LEU A 1 44  ? 17.337  17.296  29.321  1.00 17.16 ? 718 LEU B O   1 
ATOM   277  C CB  . LEU A 1 44  ? 16.239  19.020  26.690  1.00 17.05 ? 718 LEU B CB  1 
ATOM   278  C CG  . LEU A 1 44  ? 15.079  20.023  26.493  1.00 17.66 ? 718 LEU B CG  1 
ATOM   279  C CD1 . LEU A 1 44  ? 14.432  19.857  25.092  1.00 16.94 ? 718 LEU B CD1 1 
ATOM   280  C CD2 . LEU A 1 44  ? 14.019  19.835  27.618  1.00 17.77 ? 718 LEU B CD2 1 
ATOM   281  N N   . ASN A 1 45  ? 18.982  17.766  27.823  1.00 16.05 ? 719 ASN B N   1 
ATOM   282  C CA  . ASN A 1 45  ? 19.841  16.647  28.260  1.00 17.14 ? 719 ASN B CA  1 
ATOM   283  C C   . ASN A 1 45  ? 20.505  16.864  29.620  1.00 17.06 ? 719 ASN B C   1 
ATOM   284  O O   . ASN A 1 45  ? 20.635  15.919  30.395  1.00 16.08 ? 719 ASN B O   1 
ATOM   285  C CB  . ASN A 1 45  ? 20.894  16.306  27.190  1.00 16.74 ? 719 ASN B CB  1 
ATOM   286  C CG  . ASN A 1 45  ? 20.282  15.659  25.956  1.00 19.32 ? 719 ASN B CG  1 
ATOM   287  O OD1 . ASN A 1 45  ? 19.209  15.043  26.006  1.00 19.77 ? 719 ASN B OD1 1 
ATOM   288  N ND2 . ASN A 1 45  ? 20.976  15.770  24.842  1.00 20.08 ? 719 ASN B ND2 1 
ATOM   289  N N   . GLN A 1 46  ? 20.907  18.107  29.925  1.00 18.18 ? 720 GLN B N   1 
ATOM   290  C CA  . GLN A 1 46  ? 21.425  18.428  31.257  1.00 19.95 ? 720 GLN B CA  1 
ATOM   291  C C   . GLN A 1 46  ? 20.342  18.268  32.338  1.00 19.05 ? 720 GLN B C   1 
ATOM   292  O O   . GLN A 1 46  ? 20.579  17.629  33.367  1.00 17.55 ? 720 GLN B O   1 
ATOM   293  C CB  . GLN A 1 46  ? 22.056  19.835  31.291  1.00 20.20 ? 720 GLN B CB  1 
ATOM   294  C CG  . GLN A 1 46  ? 22.770  20.140  32.624  1.00 23.38 ? 720 GLN B CG  1 
ATOM   295  C CD  . GLN A 1 46  ? 23.762  21.348  32.505  1.00 27.09 ? 720 GLN B CD  1 
ATOM   296  O OE1 . GLN A 1 46  ? 23.366  22.510  32.652  1.00 34.94 ? 720 GLN B OE1 1 
ATOM   297  N NE2 . GLN A 1 46  ? 25.032  21.059  32.241  1.00 32.43 ? 720 GLN B NE2 1 
ATOM   298  N N   . LEU A 1 47  ? 19.145  18.821  32.063  1.00 18.31 ? 721 LEU B N   1 
ATOM   299  C CA  . LEU A 1 47  ? 17.959  18.594  32.869  1.00 18.77 ? 721 LEU B CA  1 
ATOM   300  C C   . LEU A 1 47  ? 17.690  17.097  33.029  1.00 18.33 ? 721 LEU B C   1 
ATOM   301  O O   . LEU A 1 47  ? 17.461  16.613  34.130  1.00 18.77 ? 721 LEU B O   1 
ATOM   302  C CB  . LEU A 1 47  ? 16.715  19.303  32.246  1.00 18.94 ? 721 LEU B CB  1 
ATOM   303  C CG  . LEU A 1 47  ? 15.495  19.417  33.145  1.00 20.30 ? 721 LEU B CG  1 
ATOM   304  C CD1 . LEU A 1 47  ? 15.856  20.140  34.476  1.00 16.09 ? 721 LEU B CD1 1 
ATOM   305  C CD2 . LEU A 1 47  ? 14.307  20.033  32.399  1.00 16.72 ? 721 LEU B CD2 1 
ATOM   306  N N   . GLY A 1 48  ? 17.711  16.369  31.920  1.00 17.83 ? 722 GLY B N   1 
ATOM   307  C CA  . GLY A 1 48  ? 17.629  14.928  31.950  1.00 17.96 ? 722 GLY B CA  1 
ATOM   308  C C   . GLY A 1 48  ? 18.592  14.234  32.895  1.00 17.77 ? 722 GLY B C   1 
ATOM   309  O O   . GLY A 1 48  ? 18.172  13.394  33.707  1.00 19.29 ? 722 GLY B O   1 
ATOM   310  N N   . GLU A 1 49  ? 19.877  14.563  32.809  1.00 16.44 ? 723 GLU B N   1 
ATOM   311  C CA  . GLU A 1 49  ? 20.903  13.993  33.702  1.00 16.09 ? 723 GLU B CA  1 
ATOM   312  C C   . GLU A 1 49  ? 20.547  14.221  35.176  1.00 16.04 ? 723 GLU B C   1 
ATOM   313  O O   . GLU A 1 49  ? 20.691  13.297  36.005  1.00 14.70 ? 723 GLU B O   1 
ATOM   314  C CB  . GLU A 1 49  ? 22.300  14.622  33.423  1.00 15.89 ? 723 GLU B CB  1 
ATOM   315  C CG  . GLU A 1 49  ? 23.447  13.986  34.207  1.00 17.87 ? 723 GLU B CG  1 
ATOM   316  C CD  . GLU A 1 49  ? 23.944  12.676  33.596  1.00 21.39 ? 723 GLU B CD  1 
ATOM   317  O OE1 . GLU A 1 49  ? 23.301  12.150  32.654  1.00 21.74 ? 723 GLU B OE1 1 
ATOM   318  O OE2 . GLU A 1 49  ? 25.014  12.171  34.027  1.00 21.20 ? 723 GLU B OE2 1 
ATOM   319  N N   . ARG A 1 50  ? 20.128  15.437  35.498  1.00 15.41 ? 724 ARG B N   1 
ATOM   320  C CA  . ARG A 1 50  ? 19.695  15.789  36.844  1.00 17.03 ? 724 ARG B CA  1 
ATOM   321  C C   . ARG A 1 50  ? 18.425  15.067  37.289  1.00 17.14 ? 724 ARG B C   1 
ATOM   322  O O   . ARG A 1 50  ? 18.332  14.595  38.406  1.00 16.53 ? 724 ARG B O   1 
ATOM   323  C CB  . ARG A 1 50  ? 19.532  17.296  36.974  1.00 17.27 ? 724 ARG B CB  1 
ATOM   324  C CG  . ARG A 1 50  ? 20.811  18.059  36.771  1.00 18.05 ? 724 ARG B CG  1 
ATOM   325  C CD  . ARG A 1 50  ? 20.580  19.535  36.612  1.00 21.84 ? 724 ARG B CD  1 
ATOM   326  N NE  . ARG A 1 50  ? 21.841  20.226  36.432  1.00 21.50 ? 724 ARG B NE  1 
ATOM   327  C CZ  . ARG A 1 50  ? 22.024  21.535  36.502  1.00 26.13 ? 724 ARG B CZ  1 
ATOM   328  N NH1 . ARG A 1 50  ? 21.027  22.355  36.758  1.00 25.20 ? 724 ARG B NH1 1 
ATOM   329  N NH2 . ARG A 1 50  ? 23.233  22.023  36.327  1.00 23.76 ? 724 ARG B NH2 1 
ATOM   330  N N   . GLN A 1 51  ? 17.454  14.984  36.398  1.00 16.88 ? 725 GLN B N   1 
ATOM   331  C CA  . GLN A 1 51  ? 16.271  14.207  36.665  1.00 18.01 ? 725 GLN B CA  1 
ATOM   332  C C   . GLN A 1 51  ? 16.568  12.726  36.876  1.00 18.09 ? 725 GLN B C   1 
ATOM   333  O O   . GLN A 1 51  ? 15.974  12.094  37.717  1.00 18.38 ? 725 GLN B O   1 
ATOM   334  C CB  . GLN A 1 51  ? 15.191  14.455  35.620  1.00 18.68 ? 725 GLN B CB  1 
ATOM   335  C CG  . GLN A 1 51  ? 14.582  15.852  35.710  1.00 23.36 ? 725 GLN B CG  1 
ATOM   336  C CD  . GLN A 1 51  ? 13.502  16.099  34.695  1.00 27.87 ? 725 GLN B CD  1 
ATOM   337  O OE1 . GLN A 1 51  ? 13.010  15.182  34.081  1.00 34.33 ? 725 GLN B OE1 1 
ATOM   338  N NE2 . GLN A 1 51  ? 13.137  17.348  34.516  1.00 29.31 ? 725 GLN B NE2 1 
ATOM   339  N N   . LEU A 1 52  ? 17.519  12.199  36.121  1.00 18.31 ? 726 LEU B N   1 
ATOM   340  C CA  . LEU A 1 52  ? 17.971  10.826  36.277  1.00 18.39 ? 726 LEU B CA  1 
ATOM   341  C C   . LEU A 1 52  ? 18.550  10.591  37.676  1.00 18.61 ? 726 LEU B C   1 
ATOM   342  O O   . LEU A 1 52  ? 18.184  9.657   38.357  1.00 17.03 ? 726 LEU B O   1 
ATOM   343  C CB  . LEU A 1 52  ? 18.991  10.485  35.193  1.00 18.93 ? 726 LEU B CB  1 
ATOM   344  C CG  . LEU A 1 52  ? 19.071  9.121   34.510  1.00 19.97 ? 726 LEU B CG  1 
ATOM   345  C CD1 . LEU A 1 52  ? 17.748  8.402   34.374  1.00 18.96 ? 726 LEU B CD1 1 
ATOM   346  C CD2 . LEU A 1 52  ? 19.751  9.263   33.168  1.00 19.58 ? 726 LEU B CD2 1 
ATOM   347  N N   . LEU A 1 53  ? 19.447  11.469  38.091  1.00 17.81 ? 727 LEU B N   1 
ATOM   348  C CA  . LEU A 1 53  ? 20.002  11.404  39.442  1.00 18.10 ? 727 LEU B CA  1 
ATOM   349  C C   . LEU A 1 53  ? 18.900  11.387  40.518  1.00 17.21 ? 727 LEU B C   1 
ATOM   350  O O   . LEU A 1 53  ? 18.960  10.623  41.499  1.00 16.05 ? 727 LEU B O   1 
ATOM   351  C CB  . LEU A 1 53  ? 20.908  12.589  39.642  1.00 19.45 ? 727 LEU B CB  1 
ATOM   352  C CG  . LEU A 1 53  ? 22.298  12.389  39.041  1.00 22.35 ? 727 LEU B CG  1 
ATOM   353  C CD1 . LEU A 1 53  ? 23.112  13.650  39.219  1.00 28.29 ? 727 LEU B CD1 1 
ATOM   354  C CD2 . LEU A 1 53  ? 22.966  11.196  39.734  1.00 23.97 ? 727 LEU B CD2 1 
ATOM   355  N N   . SER A 1 54  ? 17.870  12.186  40.265  1.00 16.84 ? 728 SER B N   1 
ATOM   356  C CA  . SER A 1 54  ? 16.737  12.352  41.150  1.00 18.00 ? 728 SER B CA  1 
ATOM   357  C C   . SER A 1 54  ? 15.871  11.092  41.179  1.00 17.59 ? 728 SER B C   1 
ATOM   358  O O   . SER A 1 54  ? 15.402  10.680  42.239  1.00 16.36 ? 728 SER B O   1 
ATOM   359  C CB  . SER A 1 54  ? 15.916  13.532  40.646  1.00 19.11 ? 728 SER B CB  1 
ATOM   360  O OG  . SER A 1 54  ? 14.809  13.765  41.467  1.00 22.56 ? 728 SER B OG  1 
ATOM   361  N N   . VAL A 1 55  ? 15.665  10.479  40.002  1.00 16.87 ? 729 VAL B N   1 
ATOM   362  C CA  . VAL A 1 55  ? 14.990  9.186   39.926  1.00 16.08 ? 729 VAL B CA  1 
ATOM   363  C C   . VAL A 1 55  ? 15.722  8.110   40.721  1.00 15.24 ? 729 VAL B C   1 
ATOM   364  O O   . VAL A 1 55  ? 15.086  7.350   41.486  1.00 14.33 ? 729 VAL B O   1 
ATOM   365  C CB  . VAL A 1 55  ? 14.765  8.718   38.445  1.00 15.76 ? 729 VAL B CB  1 
ATOM   366  C CG1 . VAL A 1 55  ? 14.267  7.309   38.416  1.00 16.17 ? 729 VAL B CG1 1 
ATOM   367  C CG2 . VAL A 1 55  ? 13.789  9.694   37.777  1.00 17.72 ? 729 VAL B CG2 1 
ATOM   368  N N   . VAL A 1 56  ? 17.040  8.036   40.553  1.00 14.66 ? 730 VAL B N   1 
ATOM   369  C CA  . VAL A 1 56  ? 17.850  7.076   41.311  1.00 14.82 ? 730 VAL B CA  1 
ATOM   370  C C   . VAL A 1 56  ? 17.658  7.305   42.833  1.00 16.59 ? 730 VAL B C   1 
ATOM   371  O O   . VAL A 1 56  ? 17.320  6.357   43.592  1.00 17.83 ? 730 VAL B O   1 
ATOM   372  C CB  . VAL A 1 56  ? 19.366  7.088   40.879  1.00 15.31 ? 730 VAL B CB  1 
ATOM   373  C CG1 . VAL A 1 56  ? 20.225  6.240   41.844  1.00 17.22 ? 730 VAL B CG1 1 
ATOM   374  C CG2 . VAL A 1 56  ? 19.511  6.471   39.486  1.00 16.32 ? 730 VAL B CG2 1 
ATOM   375  N N   . LYS A 1 57  ? 17.788  8.556   43.286  1.00 17.27 ? 731 LYS B N   1 
ATOM   376  C CA  . LYS A 1 57  ? 17.556  8.868   44.715  1.00 18.24 ? 731 LYS B CA  1 
ATOM   377  C C   . LYS A 1 57  ? 16.123  8.487   45.192  1.00 18.19 ? 731 LYS B C   1 
ATOM   378  O O   . LYS A 1 57  ? 15.943  7.786   46.208  1.00 18.05 ? 731 LYS B O   1 
ATOM   379  C CB  . LYS A 1 57  ? 17.871  10.347  44.965  1.00 19.48 ? 731 LYS B CB  1 
ATOM   380  C CG  . LYS A 1 57  ? 17.505  10.902  46.362  1.00 22.53 ? 731 LYS B CG  1 
ATOM   381  C CD  . LYS A 1 57  ? 18.437  10.468  47.490  1.00 29.06 ? 731 LYS B CD  1 
ATOM   382  C CE  . LYS A 1 57  ? 17.941  11.039  48.860  1.00 27.98 ? 731 LYS B CE  1 
ATOM   383  N NZ  . LYS A 1 57  ? 19.089  11.219  49.793  1.00 32.39 ? 731 LYS B NZ  1 
ATOM   384  N N   . TRP A 1 58  ? 15.111  8.923   44.442  1.00 16.91 ? 732 TRP B N   1 
ATOM   385  C CA  . TRP A 1 58  ? 13.720  8.581   44.725  1.00 15.42 ? 732 TRP B CA  1 
ATOM   386  C C   . TRP A 1 58  ? 13.505  7.086   44.844  1.00 15.26 ? 732 TRP B C   1 
ATOM   387  O O   . TRP A 1 58  ? 12.862  6.606   45.794  1.00 15.00 ? 732 TRP B O   1 
ATOM   388  C CB  . TRP A 1 58  ? 12.838  9.196   43.655  1.00 15.39 ? 732 TRP B CB  1 
ATOM   389  C CG  . TRP A 1 58  ? 11.383  8.843   43.601  1.00 14.23 ? 732 TRP B CG  1 
ATOM   390  C CD1 . TRP A 1 58  ? 10.357  9.280   44.444  1.00 15.70 ? 732 TRP B CD1 1 
ATOM   391  C CD2 . TRP A 1 58  ? 10.757  8.057   42.579  1.00 15.60 ? 732 TRP B CD2 1 
ATOM   392  N NE1 . TRP A 1 58  ? 9.138   8.779   43.997  1.00 15.60 ? 732 TRP B NE1 1 
ATOM   393  C CE2 . TRP A 1 58  ? 9.353   8.033   42.855  1.00 16.96 ? 732 TRP B CE2 1 
ATOM   394  C CE3 . TRP A 1 58  ? 11.251  7.340   41.462  1.00 14.89 ? 732 TRP B CE3 1 
ATOM   395  C CZ2 . TRP A 1 58  ? 8.439   7.323   42.043  1.00 16.15 ? 732 TRP B CZ2 1 
ATOM   396  C CZ3 . TRP A 1 58  ? 10.348  6.654   40.647  1.00 13.94 ? 732 TRP B CZ3 1 
ATOM   397  C CH2 . TRP A 1 58  ? 8.945   6.642   40.959  1.00 15.73 ? 732 TRP B CH2 1 
ATOM   398  N N   . SER A 1 59  ? 14.063  6.342   43.903  1.00 15.07 ? 733 SER B N   1 
ATOM   399  C CA  . SER A 1 59  ? 13.829  4.917   43.815  1.00 16.48 ? 733 SER B CA  1 
ATOM   400  C C   . SER A 1 59  ? 14.336  4.164   45.078  1.00 16.78 ? 733 SER B C   1 
ATOM   401  O O   . SER A 1 59  ? 13.732  3.142   45.511  1.00 16.82 ? 733 SER B O   1 
ATOM   402  C CB  . SER A 1 59  ? 14.438  4.353   42.504  1.00 15.76 ? 733 SER B CB  1 
ATOM   403  O OG  . SER A 1 59  ? 15.848  4.211   42.628  1.00 16.53 ? 733 SER B OG  1 
ATOM   404  N N   . LYS A 1 60  ? 15.416  4.692   45.665  1.00 17.11 ? 734 LYS B N   1 
ATOM   405  C CA  . LYS A 1 60  ? 15.997  4.176   46.900  1.00 17.48 ? 734 LYS B CA  1 
ATOM   406  C C   . LYS A 1 60  ? 15.050  4.295   48.084  1.00 17.58 ? 734 LYS B C   1 
ATOM   407  O O   . LYS A 1 60  ? 15.147  3.513   49.021  1.00 16.40 ? 734 LYS B O   1 
ATOM   408  C CB  . LYS A 1 60  ? 17.314  4.900   47.242  1.00 18.66 ? 734 LYS B CB  1 
ATOM   409  C CG  . LYS A 1 60  ? 18.419  4.596   46.247  1.00 20.67 ? 734 LYS B CG  1 
ATOM   410  C CD  . LYS A 1 60  ? 19.687  5.291   46.592  1.00 27.53 ? 734 LYS B CD  1 
ATOM   411  C CE  . LYS A 1 60  ? 20.731  4.865   45.576  1.00 30.70 ? 734 LYS B CE  1 
ATOM   412  N NZ  . LYS A 1 60  ? 21.840  5.817   45.546  1.00 31.97 ? 734 LYS B NZ  1 
ATOM   413  N N   . SER A 1 61  ? 14.153  5.281   48.042  1.00 18.42 ? 735 SER B N   1 
ATOM   414  C CA  . SER A 1 61  ? 13.109  5.459   49.080  1.00 18.80 ? 735 SER B CA  1 
ATOM   415  C C   . SER A 1 61  ? 11.742  4.933   48.775  1.00 17.15 ? 735 SER B C   1 
ATOM   416  O O   . SER A 1 61  ? 10.875  4.956   49.631  1.00 16.31 ? 735 SER B O   1 
ATOM   417  C CB  . SER A 1 61  ? 12.945  6.935   49.384  1.00 19.32 ? 735 SER B CB  1 
ATOM   418  O OG  . SER A 1 61  ? 14.173  7.383   49.901  1.00 23.58 ? 735 SER B OG  1 
ATOM   419  N N   . LEU A 1 62  ? 11.538  4.505   47.543  1.00 16.53 ? 736 LEU B N   1 
ATOM   420  C CA  . LEU A 1 62  ? 10.262  4.030   47.049  1.00 14.98 ? 736 LEU B CA  1 
ATOM   421  C C   . LEU A 1 62  ? 9.903   2.657   47.632  1.00 14.69 ? 736 LEU B C   1 
ATOM   422  O O   . LEU A 1 62  ? 10.596  1.647   47.351  1.00 14.05 ? 736 LEU B O   1 
ATOM   423  C CB  . LEU A 1 62  ? 10.287  3.987   45.511  1.00 14.51 ? 736 LEU B CB  1 
ATOM   424  C CG  . LEU A 1 62  ? 9.050   3.450   44.794  1.00 16.30 ? 736 LEU B CG  1 
ATOM   425  C CD1 . LEU A 1 62  ? 7.784   4.347   45.006  1.00 14.45 ? 736 LEU B CD1 1 
ATOM   426  C CD2 . LEU A 1 62  ? 9.365   3.336   43.294  1.00 11.44 ? 736 LEU B CD2 1 
ATOM   427  N N   . PRO A 1 63  ? 8.834   2.604   48.451  1.00 15.00 ? 737 PRO B N   1 
ATOM   428  C CA  . PRO A 1 63  ? 8.552   1.306   49.117  1.00 15.92 ? 737 PRO B CA  1 
ATOM   429  C C   . PRO A 1 63  ? 8.480   0.137   48.148  1.00 17.47 ? 737 PRO B C   1 
ATOM   430  O O   . PRO A 1 63  ? 7.825   0.223   47.099  1.00 17.44 ? 737 PRO B O   1 
ATOM   431  C CB  . PRO A 1 63  ? 7.220   1.548   49.844  1.00 16.36 ? 737 PRO B CB  1 
ATOM   432  C CG  . PRO A 1 63  ? 7.296   3.015   50.212  1.00 13.97 ? 737 PRO B CG  1 
ATOM   433  C CD  . PRO A 1 63  ? 7.911   3.663   48.917  1.00 15.04 ? 737 PRO B CD  1 
ATOM   434  N N   . GLY A 1 64  ? 9.199   -0.939  48.470  1.00 18.01 ? 738 GLY B N   1 
ATOM   435  C CA  . GLY A 1 64  ? 9.205   -2.134  47.609  1.00 18.02 ? 738 GLY B CA  1 
ATOM   436  C C   . GLY A 1 64  ? 10.398  -2.214  46.658  1.00 18.84 ? 738 GLY B C   1 
ATOM   437  O O   . GLY A 1 64  ? 10.862  -3.303  46.325  1.00 19.82 ? 738 GLY B O   1 
ATOM   438  N N   . PHE A 1 65  ? 10.889  -1.075  46.182  1.00 17.75 ? 739 PHE B N   1 
ATOM   439  C CA  . PHE A 1 65  ? 11.797  -1.104  45.020  1.00 17.59 ? 739 PHE B CA  1 
ATOM   440  C C   . PHE A 1 65  ? 13.148  -1.712  45.404  1.00 18.15 ? 739 PHE B C   1 
ATOM   441  O O   . PHE A 1 65  ? 13.655  -2.552  44.692  1.00 17.36 ? 739 PHE B O   1 
ATOM   442  C CB  . PHE A 1 65  ? 12.016  0.313   44.436  1.00 16.96 ? 739 PHE B CB  1 
ATOM   443  C CG  . PHE A 1 65  ? 12.611  0.325   43.020  1.00 17.87 ? 739 PHE B CG  1 
ATOM   444  C CD1 . PHE A 1 65  ? 11.880  -0.186  41.940  1.00 19.39 ? 739 PHE B CD1 1 
ATOM   445  C CD2 . PHE A 1 65  ? 13.870  0.890   42.780  1.00 20.56 ? 739 PHE B CD2 1 
ATOM   446  C CE1 . PHE A 1 65  ? 12.404  -0.168  40.604  1.00 17.79 ? 739 PHE B CE1 1 
ATOM   447  C CE2 . PHE A 1 65  ? 14.417  0.942   41.436  1.00 18.30 ? 739 PHE B CE2 1 
ATOM   448  C CZ  . PHE A 1 65  ? 13.643  0.389   40.359  1.00 15.84 ? 739 PHE B CZ  1 
ATOM   449  N N   . ARG A 1 66  ? 13.697  -1.282  46.545  1.00 19.25 ? 740 ARG B N   1 
ATOM   450  C CA  . ARG A 1 66  ? 15.021  -1.733  47.052  1.00 19.58 ? 740 ARG B CA  1 
ATOM   451  C C   . ARG A 1 66  ? 15.133  -3.253  47.227  1.00 20.88 ? 740 ARG B C   1 
ATOM   452  O O   . ARG A 1 66  ? 16.253  -3.823  47.239  1.00 21.55 ? 740 ARG B O   1 
ATOM   453  C CB  . ARG A 1 66  ? 15.367  -1.015  48.361  1.00 19.50 ? 740 ARG B CB  1 
ATOM   454  C CG  . ARG A 1 66  ? 14.409  -1.337  49.529  1.00 18.61 ? 740 ARG B CG  1 
ATOM   455  C CD  . ARG A 1 66  ? 14.918  -0.715  50.813  1.00 16.88 ? 740 ARG B CD  1 
ATOM   456  N NE  . ARG A 1 66  ? 14.008  -0.954  51.934  1.00 17.55 ? 740 ARG B NE  1 
ATOM   457  C CZ  . ARG A 1 66  ? 14.335  -0.683  53.192  1.00 15.74 ? 740 ARG B CZ  1 
ATOM   458  N NH1 . ARG A 1 66  ? 15.515  -0.154  53.441  1.00 13.00 ? 740 ARG B NH1 1 
ATOM   459  N NH2 . ARG A 1 66  ? 13.488  -0.926  54.192  1.00 14.93 ? 740 ARG B NH2 1 
ATOM   460  N N   . ASN A 1 67  ? 13.987  -3.903  47.323  1.00 21.26 ? 741 ASN B N   1 
ATOM   461  C CA  . ASN A 1 67  ? 13.928  -5.355  47.537  1.00 22.62 ? 741 ASN B CA  1 
ATOM   462  C C   . ASN A 1 67  ? 13.985  -6.212  46.248  1.00 21.84 ? 741 ASN B C   1 
ATOM   463  O O   . ASN A 1 67  ? 14.132  -7.445  46.310  1.00 21.90 ? 741 ASN B O   1 
ATOM   464  C CB  . ASN A 1 67  ? 12.730  -5.686  48.472  1.00 23.48 ? 741 ASN B CB  1 
ATOM   465  C CG  . ASN A 1 67  ? 12.784  -4.870  49.781  1.00 23.41 ? 741 ASN B CG  1 
ATOM   466  O OD1 . ASN A 1 67  ? 13.847  -4.730  50.363  1.00 25.15 ? 741 ASN B OD1 1 
ATOM   467  N ND2 . ASN A 1 67  ? 11.659  -4.305  50.206  1.00 24.81 ? 741 ASN B ND2 1 
ATOM   468  N N   . LEU A 1 68  ? 13.915  -5.551  45.086  1.00 20.05 ? 742 LEU B N   1 
ATOM   469  C CA  . LEU A 1 68  ? 14.175  -6.190  43.801  1.00 18.96 ? 742 LEU B CA  1 
ATOM   470  C C   . LEU A 1 68  ? 15.677  -6.312  43.600  1.00 19.42 ? 742 LEU B C   1 
ATOM   471  O O   . LEU A 1 68  ? 16.442  -5.530  44.149  1.00 18.41 ? 742 LEU B O   1 
ATOM   472  C CB  . LEU A 1 68  ? 13.551  -5.386  42.641  1.00 19.33 ? 742 LEU B CB  1 
ATOM   473  C CG  . LEU A 1 68  ? 12.064  -4.980  42.766  1.00 18.82 ? 742 LEU B CG  1 
ATOM   474  C CD1 . LEU A 1 68  ? 11.636  -4.160  41.530  1.00 21.13 ? 742 LEU B CD1 1 
ATOM   475  C CD2 . LEU A 1 68  ? 11.185  -6.208  42.902  1.00 17.49 ? 742 LEU B CD2 1 
ATOM   476  N N   . HIS A 1 69  ? 16.101  -7.301  42.816  1.00 20.48 ? 743 HIS B N   1 
ATOM   477  C CA  . HIS A 1 69  ? 17.523  -7.491  42.511  1.00 21.19 ? 743 HIS B CA  1 
ATOM   478  C C   . HIS A 1 69  ? 18.018  -6.152  41.975  1.00 21.61 ? 743 HIS B C   1 
ATOM   479  O O   . HIS A 1 69  ? 17.262  -5.435  41.293  1.00 20.79 ? 743 HIS B O   1 
ATOM   480  C CB  . HIS A 1 69  ? 17.693  -8.573  41.449  1.00 21.80 ? 743 HIS B CB  1 
ATOM   481  C CG  . HIS A 1 69  ? 19.105  -9.061  41.299  1.00 26.22 ? 743 HIS B CG  1 
ATOM   482  N ND1 . HIS A 1 69  ? 20.087  -8.334  40.649  1.00 27.79 ? 743 HIS B ND1 1 
ATOM   483  C CD2 . HIS A 1 69  ? 19.709  -10.188 41.751  1.00 29.63 ? 743 HIS B CD2 1 
ATOM   484  C CE1 . HIS A 1 69  ? 21.230  -9.001  40.693  1.00 29.63 ? 743 HIS B CE1 1 
ATOM   485  N NE2 . HIS A 1 69  ? 21.026  -10.132 41.351  1.00 30.22 ? 743 HIS B NE2 1 
ATOM   486  N N   . ILE A 1 70  ? 19.253  -5.800  42.303  1.00 20.97 ? 744 ILE B N   1 
ATOM   487  C CA  . ILE A 1 70  ? 19.841  -4.558  41.796  1.00 21.57 ? 744 ILE B CA  1 
ATOM   488  C C   . ILE A 1 70  ? 19.826  -4.466  40.240  1.00 20.37 ? 744 ILE B C   1 
ATOM   489  O O   . ILE A 1 70  ? 19.637  -3.371  39.680  1.00 19.45 ? 744 ILE B O   1 
ATOM   490  C CB  . ILE A 1 70  ? 21.270  -4.296  42.374  1.00 21.71 ? 744 ILE B CB  1 
ATOM   491  C CG1 . ILE A 1 70  ? 21.838  -2.973  41.809  1.00 24.20 ? 744 ILE B CG1 1 
ATOM   492  C CG2 . ILE A 1 70  ? 22.210  -5.453  41.998  1.00 22.41 ? 744 ILE B CG2 1 
ATOM   493  C CD1 . ILE A 1 70  ? 21.269  -1.615  42.422  1.00 26.20 ? 744 ILE B CD1 1 
ATOM   494  N N   . ASP A 1 71  ? 19.998  -5.597  39.551  1.00 20.09 ? 745 ASP B N   1 
ATOM   495  C CA  . ASP A 1 71  ? 19.950  -5.599  38.094  1.00 19.69 ? 745 ASP B CA  1 
ATOM   496  C C   . ASP A 1 71  ? 18.560  -5.182  37.630  1.00 17.83 ? 745 ASP B C   1 
ATOM   497  O O   . ASP A 1 71  ? 18.419  -4.540  36.587  1.00 17.58 ? 745 ASP B O   1 
ATOM   498  C CB  . ASP A 1 71  ? 20.214  -6.990  37.527  1.00 21.56 ? 745 ASP B CB  1 
ATOM   499  C CG  . ASP A 1 71  ? 21.669  -7.462  37.706  1.00 23.94 ? 745 ASP B CG  1 
ATOM   500  O OD1 . ASP A 1 71  ? 22.533  -6.684  38.117  1.00 25.56 ? 745 ASP B OD1 1 
ATOM   501  O OD2 . ASP A 1 71  ? 21.905  -8.657  37.425  1.00 30.74 ? 745 ASP B OD2 1 
ATOM   502  N N   . ASP A 1 72  ? 17.537  -5.638  38.355  1.00 16.95 ? 746 ASP B N   1 
ATOM   503  C CA  . ASP A 1 72  ? 16.149  -5.344  38.049  1.00 16.03 ? 746 ASP B CA  1 
ATOM   504  C C   . ASP A 1 72  ? 15.889  -3.852  38.231  1.00 16.03 ? 746 ASP B C   1 
ATOM   505  O O   . ASP A 1 72  ? 15.269  -3.211  37.373  1.00 14.85 ? 746 ASP B O   1 
ATOM   506  C CB  . ASP A 1 72  ? 15.192  -6.129  38.947  1.00 16.43 ? 746 ASP B CB  1 
ATOM   507  C CG  . ASP A 1 72  ? 15.144  -7.623  38.637  1.00 17.76 ? 746 ASP B CG  1 
ATOM   508  O OD1 . ASP A 1 72  ? 15.651  -8.090  37.604  1.00 22.51 ? 746 ASP B OD1 1 
ATOM   509  O OD2 . ASP A 1 72  ? 14.551  -8.340  39.453  1.00 21.42 ? 746 ASP B OD2 1 
ATOM   510  N N   . GLN A 1 73  ? 16.371  -3.301  39.346  1.00 14.59 ? 747 GLN B N   1 
ATOM   511  C CA  . GLN A 1 73  ? 16.217  -1.903  39.635  1.00 14.65 ? 747 GLN B CA  1 
ATOM   512  C C   . GLN A 1 73  ? 16.821  -1.048  38.505  1.00 15.04 ? 747 GLN B C   1 
ATOM   513  O O   . GLN A 1 73  ? 16.187  -0.102  38.013  1.00 14.25 ? 747 GLN B O   1 
ATOM   514  C CB  . GLN A 1 73  ? 16.943  -1.551  40.946  1.00 15.28 ? 747 GLN B CB  1 
ATOM   515  C CG  . GLN A 1 73  ? 16.354  -2.244  42.192  1.00 13.73 ? 747 GLN B CG  1 
ATOM   516  C CD  . GLN A 1 73  ? 17.045  -1.823  43.488  1.00 16.29 ? 747 GLN B CD  1 
ATOM   517  O OE1 . GLN A 1 73  ? 17.369  -2.661  44.332  1.00 21.46 ? 747 GLN B OE1 1 
ATOM   518  N NE2 . GLN A 1 73  ? 17.238  -0.539  43.668  1.00 9.81  ? 747 GLN B NE2 1 
ATOM   519  N N   . ILE A 1 74  ? 18.044  -1.404  38.099  1.00 15.21 ? 748 ILE B N   1 
ATOM   520  C CA  . ILE A 1 74  ? 18.744  -0.652  37.058  1.00 16.73 ? 748 ILE B CA  1 
ATOM   521  C C   . ILE A 1 74  ? 17.985  -0.731  35.755  1.00 15.03 ? 748 ILE B C   1 
ATOM   522  O O   . ILE A 1 74  ? 17.840  0.261   35.086  1.00 16.16 ? 748 ILE B O   1 
ATOM   523  C CB  . ILE A 1 74  ? 20.188  -1.150  36.857  1.00 16.04 ? 748 ILE B CB  1 
ATOM   524  C CG1 . ILE A 1 74  ? 21.025  -0.755  38.083  1.00 17.12 ? 748 ILE B CG1 1 
ATOM   525  C CG2 . ILE A 1 74  ? 20.792  -0.577  35.522  1.00 17.58 ? 748 ILE B CG2 1 
ATOM   526  C CD1 . ILE A 1 74  ? 22.479  -1.355  38.081  1.00 20.43 ? 748 ILE B CD1 1 
ATOM   527  N N   . THR A 1 75  ? 17.492  -1.914  35.422  1.00 14.90 ? 749 THR B N   1 
ATOM   528  C CA  . THR A 1 75  ? 16.772  -2.138  34.181  1.00 15.76 ? 749 THR B CA  1 
ATOM   529  C C   . THR A 1 75  ? 15.489  -1.299  34.099  1.00 15.03 ? 749 THR B C   1 
ATOM   530  O O   . THR A 1 75  ? 15.221  -0.685  33.066  1.00 15.27 ? 749 THR B O   1 
ATOM   531  C CB  . THR A 1 75  ? 16.470  -3.648  33.949  1.00 15.10 ? 749 THR B CB  1 
ATOM   532  O OG1 . THR A 1 75  ? 17.699  -4.357  33.743  1.00 17.35 ? 749 THR B OG1 1 
ATOM   533  C CG2 . THR A 1 75  ? 15.626  -3.845  32.730  1.00 16.80 ? 749 THR B CG2 1 
ATOM   534  N N   . LEU A 1 76  ? 14.717  -1.294  35.182  1.00 14.76 ? 750 LEU B N   1 
ATOM   535  C CA  . LEU A 1 76  ? 13.430  -0.568  35.252  1.00 14.41 ? 750 LEU B CA  1 
ATOM   536  C C   . LEU A 1 76  ? 13.659  0.936   35.101  1.00 14.79 ? 750 LEU B C   1 
ATOM   537  O O   . LEU A 1 76  ? 12.915  1.647   34.374  1.00 15.01 ? 750 LEU B O   1 
ATOM   538  C CB  . LEU A 1 76  ? 12.674  -0.916  36.556  1.00 13.94 ? 750 LEU B CB  1 
ATOM   539  C CG  . LEU A 1 76  ? 12.148  -2.372  36.665  1.00 14.98 ? 750 LEU B CG  1 
ATOM   540  C CD1 . LEU A 1 76  ? 11.600  -2.634  38.078  1.00 13.00 ? 750 LEU B CD1 1 
ATOM   541  C CD2 . LEU A 1 76  ? 11.069  -2.647  35.615  1.00 12.14 ? 750 LEU B CD2 1 
ATOM   542  N N   . ILE A 1 77  ? 14.695  1.436   35.762  1.00 14.67 ? 751 ILE B N   1 
ATOM   543  C CA  . ILE A 1 77  ? 15.050  2.862   35.589  1.00 15.34 ? 751 ILE B CA  1 
ATOM   544  C C   . ILE A 1 77  ? 15.478  3.190   34.133  1.00 15.66 ? 751 ILE B C   1 
ATOM   545  O O   . ILE A 1 77  ? 15.083  4.219   33.579  1.00 15.88 ? 751 ILE B O   1 
ATOM   546  C CB  . ILE A 1 77  ? 16.117  3.336   36.595  1.00 15.79 ? 751 ILE B CB  1 
ATOM   547  C CG1 . ILE A 1 77  ? 15.557  3.296   38.054  1.00 15.82 ? 751 ILE B CG1 1 
ATOM   548  C CG2 . ILE A 1 77  ? 16.573  4.740   36.236  1.00 14.95 ? 751 ILE B CG2 1 
ATOM   549  C CD1 . ILE A 1 77  ? 16.684  3.426   39.197  1.00 15.51 ? 751 ILE B CD1 1 
ATOM   550  N N   . GLN A 1 78  ? 16.298  2.329   33.545  1.00 15.79 ? 752 GLN B N   1 
ATOM   551  C CA  . GLN A 1 78  ? 16.744  2.497   32.147  1.00 16.58 ? 752 GLN B CA  1 
ATOM   552  C C   . GLN A 1 78  ? 15.615  2.406   31.121  1.00 16.57 ? 752 GLN B C   1 
ATOM   553  O O   . GLN A 1 78  ? 15.669  3.094   30.087  1.00 17.34 ? 752 GLN B O   1 
ATOM   554  C CB  . GLN A 1 78  ? 17.859  1.515   31.834  1.00 16.20 ? 752 GLN B CB  1 
ATOM   555  C CG  . GLN A 1 78  ? 19.154  1.848   32.607  1.00 18.54 ? 752 GLN B CG  1 
ATOM   556  C CD  . GLN A 1 78  ? 20.326  0.906   32.292  1.00 19.03 ? 752 GLN B CD  1 
ATOM   557  O OE1 . GLN A 1 78  ? 20.167  -0.159  31.711  1.00 20.33 ? 752 GLN B OE1 1 
ATOM   558  N NE2 . GLN A 1 78  ? 21.500  1.313   32.707  1.00 20.04 ? 752 GLN B NE2 1 
ATOM   559  N N   . TYR A 1 79  ? 14.611  1.563   31.393  1.00 14.57 ? 753 TYR B N   1 
ATOM   560  C CA  . TYR A 1 79  ? 13.457  1.435   30.495  1.00 15.47 ? 753 TYR B CA  1 
ATOM   561  C C   . TYR A 1 79  ? 12.528  2.629   30.602  1.00 15.86 ? 753 TYR B C   1 
ATOM   562  O O   . TYR A 1 79  ? 11.899  3.026   29.603  1.00 18.26 ? 753 TYR B O   1 
ATOM   563  C CB  . TYR A 1 79  ? 12.606  0.208   30.813  1.00 14.77 ? 753 TYR B CB  1 
ATOM   564  C CG  . TYR A 1 79  ? 13.162  -1.155  30.384  1.00 16.71 ? 753 TYR B CG  1 
ATOM   565  C CD1 . TYR A 1 79  ? 14.282  -1.278  29.563  1.00 17.37 ? 753 TYR B CD1 1 
ATOM   566  C CD2 . TYR A 1 79  ? 12.554  -2.324  30.841  1.00 18.74 ? 753 TYR B CD2 1 
ATOM   567  C CE1 . TYR A 1 79  ? 14.761  -2.554  29.172  1.00 18.25 ? 753 TYR B CE1 1 
ATOM   568  C CE2 . TYR A 1 79  ? 13.020  -3.566  30.483  1.00 16.87 ? 753 TYR B CE2 1 
ATOM   569  C CZ  . TYR A 1 79  ? 14.079  -3.686  29.639  1.00 18.33 ? 753 TYR B CZ  1 
ATOM   570  O OH  . TYR A 1 79  ? 14.482  -4.961  29.320  1.00 18.41 ? 753 TYR B OH  1 
ATOM   571  N N   . SER A 1 80  ? 12.377  3.144   31.807  1.00 14.21 ? 754 SER B N   1 
ATOM   572  C CA  . SER A 1 80  ? 11.250  4.058   32.103  1.00 14.57 ? 754 SER B CA  1 
ATOM   573  C C   . SER A 1 80  ? 11.623  5.557   32.175  1.00 13.99 ? 754 SER B C   1 
ATOM   574  O O   . SER A 1 80  ? 10.761  6.407   32.322  1.00 13.72 ? 754 SER B O   1 
ATOM   575  C CB  . SER A 1 80  ? 10.588  3.648   33.437  1.00 14.26 ? 754 SER B CB  1 
ATOM   576  O OG  . SER A 1 80  ? 11.468  3.965   34.521  1.00 12.07 ? 754 SER B OG  1 
ATOM   577  N N   . TRP A 1 81  ? 12.896  5.889   32.077  1.00 14.05 ? 755 TRP B N   1 
ATOM   578  C CA  . TRP A 1 81  ? 13.285  7.275   32.331  1.00 14.06 ? 755 TRP B CA  1 
ATOM   579  C C   . TRP A 1 81  ? 12.598  8.332   31.464  1.00 13.71 ? 755 TRP B C   1 
ATOM   580  O O   . TRP A 1 81  ? 12.230  9.381   31.984  1.00 13.66 ? 755 TRP B O   1 
ATOM   581  C CB  . TRP A 1 81  ? 14.810  7.455   32.281  1.00 15.36 ? 755 TRP B CB  1 
ATOM   582  C CG  . TRP A 1 81  ? 15.367  7.252   30.961  1.00 15.29 ? 755 TRP B CG  1 
ATOM   583  C CD1 . TRP A 1 81  ? 15.822  6.081   30.455  1.00 18.86 ? 755 TRP B CD1 1 
ATOM   584  C CD2 . TRP A 1 81  ? 15.596  8.262   29.929  1.00 15.03 ? 755 TRP B CD2 1 
ATOM   585  N NE1 . TRP A 1 81  ? 16.264  6.270   29.153  1.00 20.11 ? 755 TRP B NE1 1 
ATOM   586  C CE2 . TRP A 1 81  ? 16.150  7.598   28.820  1.00 15.24 ? 755 TRP B CE2 1 
ATOM   587  C CE3 . TRP A 1 81  ? 15.370  9.642   29.849  1.00 16.95 ? 755 TRP B CE3 1 
ATOM   588  C CZ2 . TRP A 1 81  ? 16.481  8.251   27.640  1.00 16.41 ? 755 TRP B CZ2 1 
ATOM   589  C CZ3 . TRP A 1 81  ? 15.692  10.303  28.663  1.00 20.09 ? 755 TRP B CZ3 1 
ATOM   590  C CH2 . TRP A 1 81  ? 16.249  9.595   27.570  1.00 17.49 ? 755 TRP B CH2 1 
ATOM   591  N N   . MET A 1 82  ? 12.460  8.094   30.158  1.00 13.13 ? 756 MET B N   1 
ATOM   592  C CA  . MET A 1 82  ? 11.804  9.086   29.294  1.00 12.95 ? 756 MET B CA  1 
ATOM   593  C C   . MET A 1 82  ? 10.330  9.252   29.681  1.00 13.06 ? 756 MET B C   1 
ATOM   594  O O   . MET A 1 82  ? 9.824   10.394  29.772  1.00 13.24 ? 756 MET B O   1 
ATOM   595  C CB  . MET A 1 82  ? 11.935  8.736   27.793  1.00 12.66 ? 756 MET B CB  1 
ATOM   596  C CG  . MET A 1 82  ? 11.282  9.791   26.871  1.00 13.40 ? 756 MET B CG  1 
ATOM   597  S SD  . MET A 1 82  ? 12.204  11.346  26.799  1.00 18.24 ? 756 MET B SD  1 
ATOM   598  C CE  . MET A 1 82  ? 13.517  10.822  25.739  1.00 14.36 ? 756 MET B CE  1 
ATOM   599  N N   . SER A 1 83  ? 9.633   8.148   29.944  1.00 13.64 ? 757 SER B N   1 
ATOM   600  C CA  . SER A 1 83  ? 8.230   8.273   30.355  1.00 14.83 ? 757 SER B CA  1 
ATOM   601  C C   . SER A 1 83  ? 8.109   8.980   31.695  1.00 14.14 ? 757 SER B C   1 
ATOM   602  O O   . SER A 1 83  ? 7.180   9.729   31.896  1.00 13.68 ? 757 SER B O   1 
ATOM   603  C CB  . SER A 1 83  ? 7.503   6.914   30.390  1.00 15.67 ? 757 SER B CB  1 
ATOM   604  O OG  . SER A 1 83  ? 7.992   6.121   31.447  1.00 20.65 ? 757 SER B OG  1 
ATOM   605  N N   . LEU A 1 84  ? 9.034   8.746   32.636  1.00 14.45 ? 758 LEU B N   1 
ATOM   606  C CA  . LEU A 1 84  ? 8.938   9.456   33.917  1.00 13.99 ? 758 LEU B CA  1 
ATOM   607  C C   . LEU A 1 84  ? 9.184   10.938  33.736  1.00 13.44 ? 758 LEU B C   1 
ATOM   608  O O   . LEU A 1 84  ? 8.472   11.760  34.314  1.00 12.13 ? 758 LEU B O   1 
ATOM   609  C CB  . LEU A 1 84  ? 9.905   8.903   34.965  1.00 14.81 ? 758 LEU B CB  1 
ATOM   610  C CG  . LEU A 1 84  ? 9.750   7.449   35.427  1.00 15.88 ? 758 LEU B CG  1 
ATOM   611  C CD1 . LEU A 1 84  ? 10.879  7.101   36.427  1.00 16.95 ? 758 LEU B CD1 1 
ATOM   612  C CD2 . LEU A 1 84  ? 8.421   7.262   36.068  1.00 16.17 ? 758 LEU B CD2 1 
ATOM   613  N N   . MET A 1 85  ? 10.188  11.294  32.924  1.00 14.58 ? 759 MET B N   1 
ATOM   614  C CA  . MET A 1 85  ? 10.454  12.711  32.620  1.00 15.61 ? 759 MET B CA  1 
ATOM   615  C C   . MET A 1 85  ? 9.276   13.426  31.984  1.00 15.41 ? 759 MET B C   1 
ATOM   616  O O   . MET A 1 85  ? 8.904   14.555  32.388  1.00 15.75 ? 759 MET B O   1 
ATOM   617  C CB  . MET A 1 85  ? 11.688  12.872  31.725  1.00 15.15 ? 759 MET B CB  1 
ATOM   618  C CG  . MET A 1 85  ? 12.960  12.585  32.491  1.00 17.94 ? 759 MET B CG  1 
ATOM   619  S SD  . MET A 1 85  ? 14.355  12.813  31.388  1.00 22.11 ? 759 MET B SD  1 
ATOM   620  C CE  . MET A 1 85  ? 15.490  12.034  32.530  1.00 20.76 ? 759 MET B CE  1 
ATOM   621  N N   . VAL A 1 86  ? 8.694   12.800  30.973  1.00 15.36 ? 760 VAL B N   1 
ATOM   622  C CA  . VAL A 1 86  ? 7.576   13.434  30.257  1.00 15.59 ? 760 VAL B CA  1 
ATOM   623  C C   . VAL A 1 86  ? 6.283   13.511  31.124  1.00 16.13 ? 760 VAL B C   1 
ATOM   624  O O   . VAL A 1 86  ? 5.507   14.478  31.033  1.00 15.92 ? 760 VAL B O   1 
ATOM   625  C CB  . VAL A 1 86  ? 7.330   12.778  28.873  1.00 15.67 ? 760 VAL B CB  1 
ATOM   626  C CG1 . VAL A 1 86  ? 6.529   11.504  28.997  1.00 17.49 ? 760 VAL B CG1 1 
ATOM   627  C CG2 . VAL A 1 86  ? 6.678   13.764  27.925  1.00 18.22 ? 760 VAL B CG2 1 
ATOM   628  N N   . PHE A 1 87  ? 6.065   12.505  31.958  1.00 15.37 ? 761 PHE B N   1 
ATOM   629  C CA  . PHE A 1 87  ? 4.958   12.544  32.929  1.00 14.70 ? 761 PHE B CA  1 
ATOM   630  C C   . PHE A 1 87  ? 5.137   13.662  33.940  1.00 14.75 ? 761 PHE B C   1 
ATOM   631  O O   . PHE A 1 87  ? 4.179   14.388  34.216  1.00 15.04 ? 761 PHE B O   1 
ATOM   632  C CB  . PHE A 1 87  ? 4.854   11.203  33.632  1.00 14.63 ? 761 PHE B CB  1 
ATOM   633  C CG  . PHE A 1 87  ? 3.456   10.860  34.152  1.00 14.01 ? 761 PHE B CG  1 
ATOM   634  C CD1 . PHE A 1 87  ? 2.380   10.768  33.288  1.00 10.34 ? 761 PHE B CD1 1 
ATOM   635  C CD2 . PHE A 1 87  ? 3.260   10.574  35.508  1.00 14.62 ? 761 PHE B CD2 1 
ATOM   636  C CE1 . PHE A 1 87  ? 1.126   10.422  33.766  1.00 12.75 ? 761 PHE B CE1 1 
ATOM   637  C CE2 . PHE A 1 87  ? 1.986   10.189  35.985  1.00 13.10 ? 761 PHE B CE2 1 
ATOM   638  C CZ  . PHE A 1 87  ? 0.936   10.150  35.113  1.00 13.45 ? 761 PHE B CZ  1 
ATOM   639  N N   . GLY A 1 88  ? 6.350   13.803  34.497  1.00 13.70 ? 762 GLY B N   1 
ATOM   640  C CA  . GLY A 1 88  ? 6.656   14.894  35.447  1.00 13.72 ? 762 GLY B CA  1 
ATOM   641  C C   . GLY A 1 88  ? 6.498   16.254  34.757  1.00 14.43 ? 762 GLY B C   1 
ATOM   642  O O   . GLY A 1 88  ? 5.952   17.197  35.338  1.00 13.64 ? 762 GLY B O   1 
ATOM   643  N N   . LEU A 1 89  ? 6.958   16.358  33.508  1.00 13.91 ? 763 LEU B N   1 
ATOM   644  C CA  . LEU A 1 89  ? 6.765   17.600  32.736  1.00 15.24 ? 763 LEU B CA  1 
ATOM   645  C C   . LEU A 1 89  ? 5.280   17.960  32.632  1.00 15.65 ? 763 LEU B C   1 
ATOM   646  O O   . LEU A 1 89  ? 4.889   19.143  32.797  1.00 15.38 ? 763 LEU B O   1 
ATOM   647  C CB  . LEU A 1 89  ? 7.344   17.433  31.333  1.00 15.68 ? 763 LEU B CB  1 
ATOM   648  C CG  . LEU A 1 89  ? 6.979   18.432  30.240  1.00 15.56 ? 763 LEU B CG  1 
ATOM   649  C CD1 . LEU A 1 89  ? 7.565   19.837  30.569  1.00 14.12 ? 763 LEU B CD1 1 
ATOM   650  C CD2 . LEU A 1 89  ? 7.478   17.890  28.887  1.00 14.94 ? 763 LEU B CD2 1 
ATOM   651  N N   . GLY A 1 90  ? 4.484   16.935  32.335  1.00 16.29 ? 764 GLY B N   1 
ATOM   652  C CA  . GLY A 1 90  ? 3.028   17.031  32.246  1.00 16.67 ? 764 GLY B CA  1 
ATOM   653  C C   . GLY A 1 90  ? 2.475   17.636  33.519  1.00 17.13 ? 764 GLY B C   1 
ATOM   654  O O   . GLY A 1 90  ? 1.698   18.596  33.463  1.00 16.83 ? 764 GLY B O   1 
ATOM   655  N N   . TRP A 1 91  ? 2.923   17.105  34.662  1.00 16.99 ? 765 TRP B N   1 
ATOM   656  C CA  . TRP A 1 91  ? 2.445   17.548  35.978  1.00 17.92 ? 765 TRP B CA  1 
ATOM   657  C C   . TRP A 1 91  ? 2.816   18.985  36.313  1.00 16.77 ? 765 TRP B C   1 
ATOM   658  O O   . TRP A 1 91  ? 1.941   19.795  36.593  1.00 16.31 ? 765 TRP B O   1 
ATOM   659  C CB  . TRP A 1 91  ? 2.936   16.598  37.103  1.00 18.96 ? 765 TRP B CB  1 
ATOM   660  C CG  . TRP A 1 91  ? 2.384   17.007  38.458  1.00 20.56 ? 765 TRP B CG  1 
ATOM   661  C CD1 . TRP A 1 91  ? 3.039   17.648  39.462  1.00 22.48 ? 765 TRP B CD1 1 
ATOM   662  C CD2 . TRP A 1 91  ? 1.033   16.808  38.912  1.00 20.75 ? 765 TRP B CD2 1 
ATOM   663  N NE1 . TRP A 1 91  ? 2.176   17.850  40.526  1.00 23.70 ? 765 TRP B NE1 1 
ATOM   664  C CE2 . TRP A 1 91  ? 0.943   17.346  40.200  1.00 22.82 ? 765 TRP B CE2 1 
ATOM   665  C CE3 . TRP A 1 91  ? -0.120  16.240  38.321  1.00 23.27 ? 765 TRP B CE3 1 
ATOM   666  C CZ2 . TRP A 1 91  ? -0.254  17.328  40.935  1.00 23.97 ? 765 TRP B CZ2 1 
ATOM   667  C CZ3 . TRP A 1 91  ? -1.296  16.217  39.047  1.00 22.27 ? 765 TRP B CZ3 1 
ATOM   668  C CH2 . TRP A 1 91  ? -1.354  16.769  40.327  1.00 21.12 ? 765 TRP B CH2 1 
ATOM   669  N N   . ARG A 1 92  ? 4.111   19.302  36.290  1.00 17.09 ? 766 ARG B N   1 
ATOM   670  C CA  . ARG A 1 92  ? 4.598   20.708  36.423  1.00 16.53 ? 766 ARG B CA  1 
ATOM   671  C C   . ARG A 1 92  ? 3.906   21.709  35.502  1.00 16.83 ? 766 ARG B C   1 
ATOM   672  O O   . ARG A 1 92  ? 3.511   22.818  35.916  1.00 15.82 ? 766 ARG B O   1 
ATOM   673  C CB  . ARG A 1 92  ? 6.121   20.786  36.189  1.00 16.27 ? 766 ARG B CB  1 
ATOM   674  C CG  . ARG A 1 92  ? 6.892   20.127  37.305  1.00 16.70 ? 766 ARG B CG  1 
ATOM   675  C CD  . ARG A 1 92  ? 8.390   20.432  37.227  1.00 14.45 ? 766 ARG B CD  1 
ATOM   676  N NE  . ARG A 1 92  ? 8.969   20.011  35.956  1.00 16.82 ? 766 ARG B NE  1 
ATOM   677  C CZ  . ARG A 1 92  ? 9.312   18.759  35.647  1.00 18.86 ? 766 ARG B CZ  1 
ATOM   678  N NH1 . ARG A 1 92  ? 9.112   17.751  36.507  1.00 18.39 ? 766 ARG B NH1 1 
ATOM   679  N NH2 . ARG A 1 92  ? 9.826   18.508  34.456  1.00 13.79 ? 766 ARG B NH2 1 
ATOM   680  N N   . SER A 1 93  ? 3.743   21.340  34.240  1.00 16.81 ? 767 SER B N   1 
ATOM   681  C CA  . SER A 1 93  ? 3.104   22.272  33.291  1.00 16.89 ? 767 SER B CA  1 
ATOM   682  C C   . SER A 1 93  ? 1.633   22.521  33.688  1.00 18.20 ? 767 SER B C   1 
ATOM   683  O O   . SER A 1 93  ? 1.159   23.679  33.708  1.00 17.03 ? 767 SER B O   1 
ATOM   684  C CB  . SER A 1 93  ? 3.143   21.693  31.896  1.00 17.43 ? 767 SER B CB  1 
ATOM   685  O OG  . SER A 1 93  ? 4.458   21.449  31.472  1.00 17.09 ? 767 SER B OG  1 
ATOM   686  N N   . TYR A 1 94  ? 0.941   21.428  34.039  1.00 18.81 ? 768 TYR B N   1 
ATOM   687  C CA  . TYR A 1 94  ? -0.434  21.466  34.580  1.00 20.38 ? 768 TYR B CA  1 
ATOM   688  C C   . TYR A 1 94  ? -0.539  22.365  35.831  1.00 21.01 ? 768 TYR B C   1 
ATOM   689  O O   . TYR A 1 94  ? -1.379  23.264  35.913  1.00 20.97 ? 768 TYR B O   1 
ATOM   690  C CB  . TYR A 1 94  ? -0.884  20.022  34.899  1.00 21.82 ? 768 TYR B CB  1 
ATOM   691  C CG  . TYR A 1 94  ? -2.246  19.826  35.549  1.00 22.98 ? 768 TYR B CG  1 
ATOM   692  C CD1 . TYR A 1 94  ? -3.371  20.482  35.068  1.00 24.17 ? 768 TYR B CD1 1 
ATOM   693  C CD2 . TYR A 1 94  ? -2.426  18.897  36.602  1.00 24.25 ? 768 TYR B CD2 1 
ATOM   694  C CE1 . TYR A 1 94  ? -4.630  20.281  35.627  1.00 24.58 ? 768 TYR B CE1 1 
ATOM   695  C CE2 . TYR A 1 94  ? -3.708  18.689  37.164  1.00 24.95 ? 768 TYR B CE2 1 
ATOM   696  C CZ  . TYR A 1 94  ? -4.792  19.393  36.665  1.00 26.37 ? 768 TYR B CZ  1 
ATOM   697  O OH  . TYR A 1 94  ? -6.071  19.225  37.188  1.00 27.86 ? 768 TYR B OH  1 
ATOM   698  N N   . LYS A 1 95  ? 0.315   22.117  36.810  1.00 22.16 ? 769 LYS B N   1 
ATOM   699  C CA  . LYS A 1 95  ? 0.220   22.818  38.106  1.00 23.34 ? 769 LYS B CA  1 
ATOM   700  C C   . LYS A 1 95  ? 0.753   24.249  38.138  1.00 23.30 ? 769 LYS B C   1 
ATOM   701  O O   . LYS A 1 95  ? 0.231   25.067  38.913  1.00 23.87 ? 769 LYS B O   1 
ATOM   702  C CB  . LYS A 1 95  ? 0.885   21.997  39.235  1.00 24.23 ? 769 LYS B CB  1 
ATOM   703  C CG  . LYS A 1 95  ? 0.217   20.651  39.588  1.00 29.76 ? 769 LYS B CG  1 
ATOM   704  C CD  . LYS A 1 95  ? -1.351  20.639  39.579  1.00 35.98 ? 769 LYS B CD  1 
ATOM   705  C CE  . LYS A 1 95  ? -1.959  21.107  40.894  1.00 38.53 ? 769 LYS B CE  1 
ATOM   706  N NZ  . LYS A 1 95  ? -3.455  21.132  40.790  1.00 40.18 ? 769 LYS B NZ  1 
ATOM   707  N N   . HIS A 1 96  ? 1.792   24.574  37.358  1.00 22.23 ? 770 HIS B N   1 
ATOM   708  C CA  . HIS A 1 96  ? 2.379   25.929  37.434  1.00 22.83 ? 770 HIS B CA  1 
ATOM   709  C C   . HIS A 1 96  ? 1.845   26.892  36.376  1.00 22.20 ? 770 HIS B C   1 
ATOM   710  O O   . HIS A 1 96  ? 1.785   28.109  36.604  1.00 22.50 ? 770 HIS B O   1 
ATOM   711  C CB  . HIS A 1 96  ? 3.910   25.905  37.329  1.00 23.33 ? 770 HIS B CB  1 
ATOM   712  C CG  . HIS A 1 96  ? 4.571   25.070  38.371  1.00 26.61 ? 770 HIS B CG  1 
ATOM   713  N ND1 . HIS A 1 96  ? 4.903   25.565  39.611  1.00 32.37 ? 770 HIS B ND1 1 
ATOM   714  C CD2 . HIS A 1 96  ? 4.932   23.766  38.378  1.00 28.72 ? 770 HIS B CD2 1 
ATOM   715  C CE1 . HIS A 1 96  ? 5.446   24.601  40.337  1.00 31.18 ? 770 HIS B CE1 1 
ATOM   716  N NE2 . HIS A 1 96  ? 5.483   23.503  39.609  1.00 30.75 ? 770 HIS B NE2 1 
ATOM   717  N N   . VAL A 1 97  ? 1.539   26.370  35.194  1.00 20.65 ? 771 VAL B N   1 
ATOM   718  C CA  . VAL A 1 97  ? 1.179   27.258  34.052  1.00 20.59 ? 771 VAL B CA  1 
ATOM   719  C C   . VAL A 1 97  ? -0.153  26.874  33.422  1.00 19.65 ? 771 VAL B C   1 
ATOM   720  O O   . VAL A 1 97  ? -0.409  27.157  32.255  1.00 20.09 ? 771 VAL B O   1 
ATOM   721  C CB  . VAL A 1 97  ? 2.321   27.471  33.006  1.00 20.75 ? 771 VAL B CB  1 
ATOM   722  C CG1 . VAL A 1 97  ? 3.377   28.476  33.563  1.00 22.00 ? 771 VAL B CG1 1 
ATOM   723  C CG2 . VAL A 1 97  ? 2.962   26.133  32.572  1.00 19.78 ? 771 VAL B CG2 1 
ATOM   724  N N   . SER A 1 98  ? -1.004  26.259  34.242  1.00 18.88 ? 772 SER B N   1 
ATOM   725  C CA  . SER A 1 98  ? -2.346  25.830  33.842  1.00 19.51 ? 772 SER B CA  1 
ATOM   726  C C   . SER A 1 98  ? -2.292  24.933  32.611  1.00 19.03 ? 772 SER B C   1 
ATOM   727  O O   . SER A 1 98  ? -3.267  24.845  31.828  1.00 18.71 ? 772 SER B O   1 
ATOM   728  C CB  . SER A 1 98  ? -3.255  27.060  33.588  1.00 20.53 ? 772 SER B CB  1 
ATOM   729  O OG  . SER A 1 98  ? -3.266  27.964  34.703  1.00 21.01 ? 772 SER B OG  1 
ATOM   730  N N   . GLY A 1 99  ? -1.138  24.285  32.401  1.00 18.54 ? 773 GLY B N   1 
ATOM   731  C CA  . GLY A 1 99  ? -0.988  23.362  31.253  1.00 16.87 ? 773 GLY B CA  1 
ATOM   732  C C   . GLY A 1 99  ? -0.617  24.048  29.930  1.00 17.59 ? 773 GLY B C   1 
ATOM   733  O O   . GLY A 1 99  ? -0.448  23.371  28.889  1.00 18.24 ? 773 GLY B O   1 
ATOM   734  N N   . GLN A 1 100 ? -0.447  25.366  29.945  1.00 16.66 ? 774 GLN B N   1 
ATOM   735  C CA  . GLN A 1 100 ? -0.404  26.128  28.677  1.00 17.12 ? 774 GLN B CA  1 
ATOM   736  C C   . GLN A 1 100 ? 1.012   26.543  28.226  1.00 17.11 ? 774 GLN B C   1 
ATOM   737  O O   . GLN A 1 100 ? 1.182   27.326  27.297  1.00 17.10 ? 774 GLN B O   1 
ATOM   738  C CB  . GLN A 1 100 ? -1.359  27.351  28.760  1.00 17.31 ? 774 GLN B CB  1 
ATOM   739  C CG  . GLN A 1 100 ? -2.851  26.950  28.935  1.00 16.52 ? 774 GLN B CG  1 
ATOM   740  C CD  . GLN A 1 100 ? -3.210  25.710  28.130  1.00 16.27 ? 774 GLN B CD  1 
ATOM   741  O OE1 . GLN A 1 100 ? -3.131  25.701  26.895  1.00 17.57 ? 774 GLN B OE1 1 
ATOM   742  N NE2 . GLN A 1 100 ? -3.616  24.658  28.826  1.00 16.37 ? 774 GLN B NE2 1 
ATOM   743  N N   . MET A 1 101 ? 2.019   26.046  28.934  1.00 17.21 ? 775 MET B N   1 
ATOM   744  C CA  . MET A 1 101 ? 3.403   26.122  28.491  1.00 18.56 ? 775 MET B CA  1 
ATOM   745  C C   . MET A 1 101 ? 4.034   24.785  28.859  1.00 17.37 ? 775 MET B C   1 
ATOM   746  O O   . MET A 1 101 ? 3.474   24.050  29.667  1.00 18.18 ? 775 MET B O   1 
ATOM   747  C CB  . MET A 1 101 ? 4.155   27.275  29.192  1.00 18.27 ? 775 MET B CB  1 
ATOM   748  C CG  . MET A 1 101 ? 3.478   28.683  29.080  1.00 17.74 ? 775 MET B CG  1 
ATOM   749  S SD  . MET A 1 101 ? 4.511   29.881  29.872  1.00 22.76 ? 775 MET B SD  1 
ATOM   750  C CE  . MET A 1 101 ? 3.335   31.114  30.472  1.00 21.64 ? 775 MET B CE  1 
ATOM   751  N N   . LEU A 1 102 ? 5.201   24.492  28.301  1.00 16.88 ? 776 LEU B N   1 
ATOM   752  C CA  . LEU A 1 102 ? 5.998   23.322  28.744  1.00 16.72 ? 776 LEU B CA  1 
ATOM   753  C C   . LEU A 1 102 ? 6.947   23.791  29.831  1.00 16.90 ? 776 LEU B C   1 
ATOM   754  O O   . LEU A 1 102 ? 7.912   24.519  29.533  1.00 16.89 ? 776 LEU B O   1 
ATOM   755  C CB  . LEU A 1 102 ? 6.769   22.683  27.563  1.00 16.99 ? 776 LEU B CB  1 
ATOM   756  C CG  . LEU A 1 102 ? 5.889   21.911  26.546  1.00 17.04 ? 776 LEU B CG  1 
ATOM   757  C CD1 . LEU A 1 102 ? 6.660   21.393  25.339  1.00 15.11 ? 776 LEU B CD1 1 
ATOM   758  C CD2 . LEU A 1 102 ? 5.051   20.778  27.166  1.00 15.74 ? 776 LEU B CD2 1 
ATOM   759  N N   . TYR A 1 103 ? 6.664   23.378  31.077  1.00 15.36 ? 777 TYR B N   1 
ATOM   760  C CA  . TYR A 1 103 ? 7.416   23.752  32.249  1.00 15.56 ? 777 TYR B CA  1 
ATOM   761  C C   . TYR A 1 103 ? 8.435   22.631  32.513  1.00 14.89 ? 777 TYR B C   1 
ATOM   762  O O   . TYR A 1 103 ? 8.259   21.784  33.396  1.00 14.22 ? 777 TYR B O   1 
ATOM   763  C CB  . TYR A 1 103 ? 6.448   23.914  33.449  1.00 15.79 ? 777 TYR B CB  1 
ATOM   764  C CG  . TYR A 1 103 ? 7.025   24.681  34.627  1.00 18.86 ? 777 TYR B CG  1 
ATOM   765  C CD1 . TYR A 1 103 ? 7.926   24.069  35.504  1.00 20.58 ? 777 TYR B CD1 1 
ATOM   766  C CD2 . TYR A 1 103 ? 6.659   26.021  34.870  1.00 18.42 ? 777 TYR B CD2 1 
ATOM   767  C CE1 . TYR A 1 103 ? 8.442   24.738  36.604  1.00 21.76 ? 777 TYR B CE1 1 
ATOM   768  C CE2 . TYR A 1 103 ? 7.198   26.719  35.971  1.00 20.06 ? 777 TYR B CE2 1 
ATOM   769  C CZ  . TYR A 1 103 ? 8.079   26.067  36.831  1.00 21.87 ? 777 TYR B CZ  1 
ATOM   770  O OH  . TYR A 1 103 ? 8.633   26.697  37.927  1.00 21.09 ? 777 TYR B OH  1 
ATOM   771  N N   . PHE A 1 104 ? 9.461   22.567  31.666  1.00 15.74 ? 778 PHE B N   1 
ATOM   772  C CA  . PHE A 1 104 ? 10.541  21.604  31.871  1.00 15.36 ? 778 PHE B CA  1 
ATOM   773  C C   . PHE A 1 104 ? 11.182  21.872  33.237  1.00 15.21 ? 778 PHE B C   1 
ATOM   774  O O   . PHE A 1 104 ? 11.393  20.949  34.047  1.00 13.20 ? 778 PHE B O   1 
ATOM   775  C CB  . PHE A 1 104 ? 11.586  21.704  30.734  1.00 14.87 ? 778 PHE B CB  1 
ATOM   776  C CG  . PHE A 1 104 ? 11.070  21.285  29.377  1.00 17.34 ? 778 PHE B CG  1 
ATOM   777  C CD1 . PHE A 1 104 ? 10.676  22.244  28.437  1.00 15.59 ? 778 PHE B CD1 1 
ATOM   778  C CD2 . PHE A 1 104 ? 10.987  19.938  29.033  1.00 14.23 ? 778 PHE B CD2 1 
ATOM   779  C CE1 . PHE A 1 104 ? 10.232  21.845  27.158  1.00 17.65 ? 778 PHE B CE1 1 
ATOM   780  C CE2 . PHE A 1 104 ? 10.534  19.545  27.784  1.00 18.11 ? 778 PHE B CE2 1 
ATOM   781  C CZ  . PHE A 1 104 ? 10.156  20.486  26.839  1.00 16.43 ? 778 PHE B CZ  1 
ATOM   782  N N   . ALA A 1 105 ? 11.507  23.152  33.480  1.00 15.63 ? 779 ALA B N   1 
ATOM   783  C CA  . ALA A 1 105 ? 12.141  23.583  34.720  1.00 17.09 ? 779 ALA B CA  1 
ATOM   784  C C   . ALA A 1 105 ? 11.831  25.088  34.982  1.00 18.46 ? 779 ALA B C   1 
ATOM   785  O O   . ALA A 1 105 ? 11.355  25.779  34.092  1.00 17.42 ? 779 ALA B O   1 
ATOM   786  C CB  . ALA A 1 105 ? 13.665  23.324  34.673  1.00 15.34 ? 779 ALA B CB  1 
ATOM   787  N N   . PRO A 1 106 ? 12.062  25.585  36.218  1.00 20.16 ? 780 PRO B N   1 
ATOM   788  C CA  . PRO A 1 106 ? 11.761  27.024  36.358  1.00 21.43 ? 780 PRO B CA  1 
ATOM   789  C C   . PRO A 1 106 ? 12.598  27.935  35.423  1.00 21.50 ? 780 PRO B C   1 
ATOM   790  O O   . PRO A 1 106 ? 12.118  28.990  35.047  1.00 21.54 ? 780 PRO B O   1 
ATOM   791  C CB  . PRO A 1 106 ? 12.058  27.320  37.822  1.00 21.91 ? 780 PRO B CB  1 
ATOM   792  C CG  . PRO A 1 106 ? 12.034  25.964  38.516  1.00 21.36 ? 780 PRO B CG  1 
ATOM   793  C CD  . PRO A 1 106 ? 12.508  24.980  37.477  1.00 20.00 ? 780 PRO B CD  1 
ATOM   794  N N   . ASP A 1 107 ? 13.822  27.514  35.080  1.00 20.67 ? 781 ASP B N   1 
ATOM   795  C CA  . ASP A 1 107 ? 14.689  28.201  34.101  1.00 19.94 ? 781 ASP B CA  1 
ATOM   796  C C   . ASP A 1 107 ? 14.568  27.649  32.642  1.00 19.14 ? 781 ASP B C   1 
ATOM   797  O O   . ASP A 1 107 ? 15.345  28.012  31.739  1.00 18.58 ? 781 ASP B O   1 
ATOM   798  C CB  . ASP A 1 107 ? 16.150  28.156  34.580  1.00 20.33 ? 781 ASP B CB  1 
ATOM   799  C CG  . ASP A 1 107 ? 16.679  26.717  34.759  1.00 21.33 ? 781 ASP B CG  1 
ATOM   800  O OD1 . ASP A 1 107 ? 15.884  25.747  34.860  1.00 21.43 ? 781 ASP B OD1 1 
ATOM   801  O OD2 . ASP A 1 107 ? 17.914  26.556  34.813  1.00 20.77 ? 781 ASP B OD2 1 
ATOM   802  N N   . LEU A 1 108 ? 13.577  26.799  32.391  1.00 17.54 ? 782 LEU B N   1 
ATOM   803  C CA  . LEU A 1 108 ? 13.374  26.325  31.036  1.00 17.55 ? 782 LEU B CA  1 
ATOM   804  C C   . LEU A 1 108 ? 11.879  26.126  30.789  1.00 16.75 ? 782 LEU B C   1 
ATOM   805  O O   . LEU A 1 108 ? 11.333  25.031  30.909  1.00 15.50 ? 782 LEU B O   1 
ATOM   806  C CB  . LEU A 1 108 ? 14.215  25.054  30.741  1.00 16.83 ? 782 LEU B CB  1 
ATOM   807  C CG  . LEU A 1 108 ? 14.205  24.494  29.291  1.00 17.78 ? 782 LEU B CG  1 
ATOM   808  C CD1 . LEU A 1 108 ? 14.791  25.493  28.298  1.00 21.15 ? 782 LEU B CD1 1 
ATOM   809  C CD2 . LEU A 1 108 ? 14.968  23.182  29.237  1.00 16.43 ? 782 LEU B CD2 1 
ATOM   810  N N   . ILE A 1 109 ? 11.227  27.225  30.477  1.00 16.94 ? 783 ILE B N   1 
ATOM   811  C CA  . ILE A 1 109 ? 9.780   27.216  30.241  1.00 17.50 ? 783 ILE B CA  1 
ATOM   812  C C   . ILE A 1 109 ? 9.538   27.603  28.770  1.00 17.42 ? 783 ILE B C   1 
ATOM   813  O O   . ILE A 1 109 ? 9.973   28.678  28.313  1.00 17.44 ? 783 ILE B O   1 
ATOM   814  C CB  . ILE A 1 109 ? 9.023   28.183  31.202  1.00 16.92 ? 783 ILE B CB  1 
ATOM   815  C CG1 . ILE A 1 109 ? 9.221   27.784  32.672  1.00 17.94 ? 783 ILE B CG1 1 
ATOM   816  C CG2 . ILE A 1 109 ? 7.496   28.167  30.870  1.00 20.06 ? 783 ILE B CG2 1 
ATOM   817  C CD1 . ILE A 1 109 ? 8.957   28.948  33.735  1.00 17.98 ? 783 ILE B CD1 1 
ATOM   818  N N   . LEU A 1 110 ? 8.925   26.714  28.014  1.00 16.44 ? 784 LEU B N   1 
ATOM   819  C CA  . LEU A 1 110 ? 8.594   27.080  26.630  1.00 16.30 ? 784 LEU B CA  1 
ATOM   820  C C   . LEU A 1 110 ? 7.099   27.293  26.458  1.00 16.05 ? 784 LEU B C   1 
ATOM   821  O O   . LEU A 1 110 ? 6.321   26.331  26.531  1.00 15.71 ? 784 LEU B O   1 
ATOM   822  C CB  . LEU A 1 110 ? 9.016   25.988  25.630  1.00 16.45 ? 784 LEU B CB  1 
ATOM   823  C CG  . LEU A 1 110 ? 10.374  25.283  25.640  1.00 18.76 ? 784 LEU B CG  1 
ATOM   824  C CD1 . LEU A 1 110 ? 10.702  24.741  24.219  1.00 17.00 ? 784 LEU B CD1 1 
ATOM   825  C CD2 . LEU A 1 110 ? 11.530  26.063  26.184  1.00 20.46 ? 784 LEU B CD2 1 
ATOM   826  N N   . ASN A 1 111 ? 6.707   28.536  26.195  1.00 15.90 ? 785 ASN B N   1 
ATOM   827  C CA  . ASN A 1 111 ? 5.358   28.835  25.688  1.00 16.77 ? 785 ASN B CA  1 
ATOM   828  C C   . ASN A 1 111 ? 5.273   28.409  24.210  1.00 17.66 ? 785 ASN B C   1 
ATOM   829  O O   . ASN A 1 111 ? 6.281   28.036  23.621  1.00 17.74 ? 785 ASN B O   1 
ATOM   830  C CB  . ASN A 1 111 ? 4.992   30.342  25.936  1.00 17.49 ? 785 ASN B CB  1 
ATOM   831  C CG  . ASN A 1 111 ? 5.878   31.308  25.156  1.00 18.76 ? 785 ASN B CG  1 
ATOM   832  O OD1 . ASN A 1 111 ? 6.471   30.936  24.159  1.00 19.29 ? 785 ASN B OD1 1 
ATOM   833  N ND2 . ASN A 1 111 ? 5.984   32.550  25.632  1.00 17.50 ? 785 ASN B ND2 1 
ATOM   834  N N   . GLU A 1 112 ? 4.102   28.448  23.596  1.00 18.64 ? 786 GLU B N   1 
ATOM   835  C CA  . GLU A 1 112 ? 3.977   27.933  22.238  1.00 19.14 ? 786 GLU B CA  1 
ATOM   836  C C   . GLU A 1 112 ? 4.835   28.673  21.228  1.00 20.21 ? 786 GLU B C   1 
ATOM   837  O O   . GLU A 1 112 ? 5.336   28.060  20.312  1.00 20.14 ? 786 GLU B O   1 
ATOM   838  C CB  . GLU A 1 112 ? 2.521   27.879  21.767  1.00 20.75 ? 786 GLU B CB  1 
ATOM   839  C CG  . GLU A 1 112 ? 2.377   27.064  20.514  1.00 21.19 ? 786 GLU B CG  1 
ATOM   840  C CD  . GLU A 1 112 ? 0.949   26.878  20.064  1.00 25.48 ? 786 GLU B CD  1 
ATOM   841  O OE1 . GLU A 1 112 ? 0.046   27.529  20.645  1.00 19.93 ? 786 GLU B OE1 1 
ATOM   842  O OE2 . GLU A 1 112 ? 0.756   26.061  19.133  1.00 21.79 ? 786 GLU B OE2 1 
ATOM   843  N N   . GLN A 1 113 ? 4.981   29.984  21.361  1.00 21.12 ? 787 GLN B N   1 
ATOM   844  C CA  . GLN A 1 113 ? 5.839   30.739  20.425  1.00 21.79 ? 787 GLN B CA  1 
ATOM   845  C C   . GLN A 1 113 ? 7.307   30.223  20.475  1.00 22.06 ? 787 GLN B C   1 
ATOM   846  O O   . GLN A 1 113 ? 7.951   30.061  19.427  1.00 21.67 ? 787 GLN B O   1 
ATOM   847  C CB  . GLN A 1 113 ? 5.790   32.261  20.690  1.00 21.60 ? 787 GLN B CB  1 
ATOM   848  C CG  . GLN A 1 113 ? 6.520   33.120  19.595  1.00 22.92 ? 787 GLN B CG  1 
ATOM   849  C CD  . GLN A 1 113 ? 6.008   32.854  18.166  1.00 30.52 ? 787 GLN B CD  1 
ATOM   850  O OE1 . GLN A 1 113 ? 4.799   32.615  17.931  1.00 31.95 ? 787 GLN B OE1 1 
ATOM   851  N NE2 . GLN A 1 113 ? 6.928   32.906  17.197  1.00 33.15 ? 787 GLN B NE2 1 
ATOM   852  N N   . ARG A 1 114 ? 7.812   29.979  21.683  1.00 21.43 ? 788 ARG B N   1 
ATOM   853  C CA  . ARG A 1 114 ? 9.169   29.446  21.870  1.00 20.75 ? 788 ARG B CA  1 
ATOM   854  C C   . ARG A 1 114 ? 9.295   28.002  21.321  1.00 20.45 ? 788 ARG B C   1 
ATOM   855  O O   . ARG A 1 114 ? 10.362  27.626  20.803  1.00 20.13 ? 788 ARG B O   1 
ATOM   856  C CB  . ARG A 1 114 ? 9.562   29.521  23.338  1.00 20.23 ? 788 ARG B CB  1 
ATOM   857  C CG  . ARG A 1 114 ? 11.031  29.336  23.587  1.00 20.80 ? 788 ARG B CG  1 
ATOM   858  C CD  . ARG A 1 114 ? 11.366  29.429  25.058  1.00 19.42 ? 788 ARG B CD  1 
ATOM   859  N NE  . ARG A 1 114 ? 12.807  29.429  25.286  1.00 18.71 ? 788 ARG B NE  1 
ATOM   860  C CZ  . ARG A 1 114 ? 13.394  29.465  26.491  1.00 24.98 ? 788 ARG B CZ  1 
ATOM   861  N NH1 . ARG A 1 114 ? 14.732  29.444  26.595  1.00 24.55 ? 788 ARG B NH1 1 
ATOM   862  N NH2 . ARG A 1 114 ? 12.660  29.521  27.602  1.00 26.65 ? 788 ARG B NH2 1 
ATOM   863  N N   . MET A 1 115 ? 8.213   27.217  21.449  1.00 19.82 ? 789 MET B N   1 
ATOM   864  C CA  . MET A 1 115 ? 8.075   25.926  20.788  1.00 19.92 ? 789 MET B CA  1 
ATOM   865  C C   . MET A 1 115 ? 8.169   26.068  19.270  1.00 21.85 ? 789 MET B C   1 
ATOM   866  O O   . MET A 1 115 ? 8.888   25.306  18.632  1.00 21.15 ? 789 MET B O   1 
ATOM   867  C CB  . MET A 1 115 ? 6.763   25.191  21.132  1.00 20.02 ? 789 MET B CB  1 
ATOM   868  C CG  . MET A 1 115 ? 6.487   24.894  22.647  1.00 16.32 ? 789 MET B CG  1 
ATOM   869  S SD  . MET A 1 115 ? 4.883   24.069  22.795  1.00 18.46 ? 789 MET B SD  1 
ATOM   870  C CE  . MET A 1 115 ? 4.343   24.717  24.376  1.00 17.83 ? 789 MET B CE  1 
ATOM   871  N N   . LYS A 1 116 ? 7.420   27.006  18.695  1.00 23.40 ? 790 LYS B N   1 
ATOM   872  C CA  . LYS A 1 116 ? 7.406   27.212  17.237  1.00 25.90 ? 790 LYS B CA  1 
ATOM   873  C C   . LYS A 1 116 ? 8.765   27.577  16.681  1.00 26.17 ? 790 LYS B C   1 
ATOM   874  O O   . LYS A 1 116 ? 9.096   27.183  15.556  1.00 25.66 ? 790 LYS B O   1 
ATOM   875  C CB  . LYS A 1 116 ? 6.442   28.343  16.849  1.00 26.03 ? 790 LYS B CB  1 
ATOM   876  C CG  . LYS A 1 116 ? 5.046   27.913  16.580  1.00 29.81 ? 790 LYS B CG  1 
ATOM   877  C CD  . LYS A 1 116 ? 4.119   29.119  16.298  1.00 29.16 ? 790 LYS B CD  1 
ATOM   878  C CE  . LYS A 1 116 ? 2.782   28.911  17.031  1.00 32.82 ? 790 LYS B CE  1 
ATOM   879  N NZ  . LYS A 1 116 ? 1.634   29.839  16.614  1.00 34.34 ? 790 LYS B NZ  1 
ATOM   880  N N   . GLU A 1 117 ? 9.516   28.388  17.419  1.00 26.43 ? 791 GLU B N   1 
ATOM   881  C CA  . GLU A 1 117 ? 10.853  28.774  16.962  1.00 28.86 ? 791 GLU B CA  1 
ATOM   882  C C   . GLU A 1 117 ? 11.975  27.790  17.339  1.00 28.84 ? 791 GLU B C   1 
ATOM   883  O O   . GLU A 1 117 ? 13.142  28.064  17.046  1.00 30.54 ? 791 GLU B O   1 
ATOM   884  C CB  . GLU A 1 117 ? 11.222  30.225  17.327  1.00 28.70 ? 791 GLU B CB  1 
ATOM   885  C CG  . GLU A 1 117 ? 10.216  30.957  18.153  1.00 31.67 ? 791 GLU B CG  1 
ATOM   886  C CD  . GLU A 1 117 ? 10.413  32.452  18.205  1.00 31.31 ? 791 GLU B CD  1 
ATOM   887  O OE1 . GLU A 1 117 ? 9.544   33.201  17.681  1.00 34.45 ? 791 GLU B OE1 1 
ATOM   888  O OE2 . GLU A 1 117 ? 11.403  32.879  18.821  1.00 33.60 ? 791 GLU B OE2 1 
ATOM   889  N N   . SER A 1 118 ? 11.633  26.645  17.940  1.00 28.43 ? 792 SER B N   1 
ATOM   890  C CA  . SER A 1 118 ? 12.640  25.718  18.534  1.00 27.88 ? 792 SER B CA  1 
ATOM   891  C C   . SER A 1 118 ? 13.536  24.869  17.601  1.00 29.09 ? 792 SER B C   1 
ATOM   892  O O   . SER A 1 118 ? 14.694  24.532  17.996  1.00 29.79 ? 792 SER B O   1 
ATOM   893  C CB  . SER A 1 118 ? 11.980  24.783  19.566  1.00 27.17 ? 792 SER B CB  1 
ATOM   894  O OG  . SER A 1 118 ? 11.210  23.788  18.910  1.00 22.42 ? 792 SER B OG  1 
ATOM   895  N N   . SER A 1 119 ? 13.020  24.535  16.406  1.00 28.55 ? 793 SER B N   1 
ATOM   896  C CA  . SER A 1 119 ? 13.524  23.435  15.503  1.00 27.89 ? 793 SER B CA  1 
ATOM   897  C C   . SER A 1 119 ? 12.822  22.080  15.738  1.00 27.60 ? 793 SER B C   1 
ATOM   898  O O   . SER A 1 119 ? 12.898  21.163  14.899  1.00 28.37 ? 793 SER B O   1 
ATOM   899  C CB  . SER A 1 119 ? 15.082  23.266  15.472  1.00 29.24 ? 793 SER B CB  1 
ATOM   900  O OG  . SER A 1 119 ? 15.569  22.385  16.498  1.00 28.00 ? 793 SER B OG  1 
ATOM   901  N N   . PHE A 1 120 ? 12.114  21.937  16.854  1.00 25.70 ? 794 PHE B N   1 
ATOM   902  C CA  . PHE A 1 120 ? 11.386  20.684  17.099  1.00 24.52 ? 794 PHE B CA  1 
ATOM   903  C C   . PHE A 1 120 ? 9.943   20.939  17.596  1.00 24.54 ? 794 PHE B C   1 
ATOM   904  O O   . PHE A 1 120 ? 9.486   20.354  18.586  1.00 23.71 ? 794 PHE B O   1 
ATOM   905  C CB  . PHE A 1 120 ? 12.175  19.738  18.028  1.00 23.89 ? 794 PHE B CB  1 
ATOM   906  C CG  . PHE A 1 120 ? 12.707  20.396  19.288  1.00 19.35 ? 794 PHE B CG  1 
ATOM   907  C CD1 . PHE A 1 120 ? 12.067  20.223  20.498  1.00 20.65 ? 794 PHE B CD1 1 
ATOM   908  C CD2 . PHE A 1 120 ? 13.852  21.177  19.251  1.00 18.25 ? 794 PHE B CD2 1 
ATOM   909  C CE1 . PHE A 1 120 ? 12.560  20.837  21.679  1.00 22.74 ? 794 PHE B CE1 1 
ATOM   910  C CE2 . PHE A 1 120 ? 14.373  21.785  20.412  1.00 17.84 ? 794 PHE B CE2 1 
ATOM   911  C CZ  . PHE A 1 120 ? 13.738  21.623  21.614  1.00 22.14 ? 794 PHE B CZ  1 
ATOM   912  N N   . TYR A 1 121 ? 9.250   21.821  16.868  1.00 23.95 ? 795 TYR B N   1 
ATOM   913  C CA  . TYR A 1 121 ? 7.857   22.216  17.172  1.00 23.22 ? 795 TYR B CA  1 
ATOM   914  C C   . TYR A 1 121 ? 6.973   20.998  17.341  1.00 22.52 ? 795 TYR B C   1 
ATOM   915  O O   . TYR A 1 121 ? 6.271   20.890  18.342  1.00 21.07 ? 795 TYR B O   1 
ATOM   916  C CB  . TYR A 1 121 ? 7.312   23.146  16.069  1.00 23.52 ? 795 TYR B CB  1 
ATOM   917  C CG  . TYR A 1 121 ? 5.916   23.720  16.323  1.00 25.23 ? 795 TYR B CG  1 
ATOM   918  C CD1 . TYR A 1 121 ? 5.522   24.165  17.616  1.00 24.52 ? 795 TYR B CD1 1 
ATOM   919  C CD2 . TYR A 1 121 ? 4.994   23.828  15.275  1.00 25.94 ? 795 TYR B CD2 1 
ATOM   920  C CE1 . TYR A 1 121 ? 4.247   24.700  17.839  1.00 24.35 ? 795 TYR B CE1 1 
ATOM   921  C CE2 . TYR A 1 121 ? 3.718   24.356  15.487  1.00 28.02 ? 795 TYR B CE2 1 
ATOM   922  C CZ  . TYR A 1 121 ? 3.346   24.791  16.770  1.00 27.05 ? 795 TYR B CZ  1 
ATOM   923  O OH  . TYR A 1 121 ? 2.077   25.313  16.960  1.00 27.73 ? 795 TYR B OH  1 
ATOM   924  N N   . SER A 1 122 ? 7.025   20.055  16.389  1.00 21.92 ? 796 SER B N   1 
ATOM   925  C CA  . SER A 1 122 ? 6.106   18.915  16.409  1.00 22.07 ? 796 SER B CA  1 
ATOM   926  C C   . SER A 1 122 ? 6.306   18.000  17.617  1.00 21.92 ? 796 SER B C   1 
ATOM   927  O O   . SER A 1 122 ? 5.338   17.454  18.159  1.00 21.22 ? 796 SER B O   1 
ATOM   928  C CB  . SER A 1 122 ? 6.194   18.109  15.106  1.00 23.87 ? 796 SER B CB  1 
ATOM   929  O OG  . SER A 1 122 ? 7.566   17.796  14.804  1.00 27.05 ? 796 SER B OG  1 
ATOM   930  N N   . LEU A 1 123 ? 7.565   17.828  18.019  1.00 20.75 ? 797 LEU B N   1 
ATOM   931  C CA  . LEU A 1 123 ? 7.905   17.100  19.211  1.00 21.07 ? 797 LEU B CA  1 
ATOM   932  C C   . LEU A 1 123 ? 7.386   17.828  20.438  1.00 19.41 ? 797 LEU B C   1 
ATOM   933  O O   . LEU A 1 123 ? 6.882   17.184  21.332  1.00 19.69 ? 797 LEU B O   1 
ATOM   934  C CB  . LEU A 1 123 ? 9.423   16.960  19.342  1.00 22.39 ? 797 LEU B CB  1 
ATOM   935  C CG  . LEU A 1 123 ? 9.928   15.757  20.142  1.00 24.52 ? 797 LEU B CG  1 
ATOM   936  C CD1 . LEU A 1 123 ? 9.836   14.526  19.268  1.00 25.95 ? 797 LEU B CD1 1 
ATOM   937  C CD2 . LEU A 1 123 ? 11.374  16.038  20.570  1.00 25.23 ? 797 LEU B CD2 1 
ATOM   938  N N   . CYS A 1 124 ? 7.545   19.153  20.480  1.00 19.32 ? 798 CYS B N   1 
ATOM   939  C CA  . CYS A 1 124 ? 6.974   19.970  21.575  1.00 19.09 ? 798 CYS B CA  1 
ATOM   940  C C   . CYS A 1 124 ? 5.486   19.725  21.675  1.00 19.00 ? 798 CYS B C   1 
ATOM   941  O O   . CYS A 1 124 ? 4.948   19.509  22.788  1.00 18.50 ? 798 CYS B O   1 
ATOM   942  C CB  . CYS A 1 124 ? 7.251   21.473  21.379  1.00 18.66 ? 798 CYS B CB  1 
ATOM   943  S SG  . CYS A 1 124 ? 8.987   21.858  21.711  1.00 19.14 ? 798 CYS B SG  1 
ATOM   944  N N   . LEU A 1 125 ? 4.816   19.761  20.520  1.00 18.95 ? 799 LEU B N   1 
ATOM   945  C CA  . LEU A 1 125 ? 3.369   19.530  20.482  1.00 19.42 ? 799 LEU B CA  1 
ATOM   946  C C   . LEU A 1 125 ? 3.016   18.164  21.019  1.00 19.75 ? 799 LEU B C   1 
ATOM   947  O O   . LEU A 1 125 ? 2.061   18.034  21.768  1.00 20.35 ? 799 LEU B O   1 
ATOM   948  C CB  . LEU A 1 125 ? 2.796   19.711  19.072  1.00 19.85 ? 799 LEU B CB  1 
ATOM   949  C CG  . LEU A 1 125 ? 2.856   21.159  18.559  1.00 18.92 ? 799 LEU B CG  1 
ATOM   950  C CD1 . LEU A 1 125 ? 2.315   21.215  17.141  1.00 23.57 ? 799 LEU B CD1 1 
ATOM   951  C CD2 . LEU A 1 125 ? 2.114   22.193  19.474  1.00 18.23 ? 799 LEU B CD2 1 
ATOM   952  N N   . THR A 1 126 ? 3.766   17.133  20.621  1.00 19.57 ? 800 THR B N   1 
ATOM   953  C CA  . THR A 1 126 ? 3.604   15.780  21.191  1.00 20.23 ? 800 THR B CA  1 
ATOM   954  C C   . THR A 1 126 ? 3.718   15.725  22.713  1.00 19.49 ? 800 THR B C   1 
ATOM   955  O O   . THR A 1 126 ? 2.878   15.167  23.391  1.00 20.47 ? 800 THR B O   1 
ATOM   956  C CB  . THR A 1 126 ? 4.627   14.786  20.522  1.00 20.43 ? 800 THR B CB  1 
ATOM   957  O OG1 . THR A 1 126 ? 4.363   14.773  19.126  1.00 19.25 ? 800 THR B OG1 1 
ATOM   958  C CG2 . THR A 1 126 ? 4.490   13.369  21.078  1.00 21.82 ? 800 THR B CG2 1 
ATOM   959  N N   . MET A 1 127 ? 4.768   16.313  23.253  1.00 19.83 ? 801 MET B N   1 
ATOM   960  C CA  . MET A 1 127 ? 4.942   16.385  24.689  1.00 19.55 ? 801 MET B CA  1 
ATOM   961  C C   . MET A 1 127 ? 3.771   17.161  25.360  1.00 19.85 ? 801 MET B C   1 
ATOM   962  O O   . MET A 1 127 ? 3.252   16.730  26.401  1.00 19.18 ? 801 MET B O   1 
ATOM   963  C CB  . MET A 1 127 ? 6.298   17.018  25.000  1.00 19.17 ? 801 MET B CB  1 
ATOM   964  C CG  . MET A 1 127 ? 7.495   16.077  24.643  1.00 19.78 ? 801 MET B CG  1 
ATOM   965  S SD  . MET A 1 127 ? 9.095   16.733  25.192  1.00 22.00 ? 801 MET B SD  1 
ATOM   966  C CE  . MET A 1 127 ? 9.514   17.964  23.986  1.00 20.98 ? 801 MET B CE  1 
ATOM   967  N N   . TRP A 1 128 ? 3.340   18.257  24.720  1.00 18.93 ? 802 TRP B N   1 
ATOM   968  C CA  . TRP A 1 128 ? 2.286   19.158  25.233  1.00 19.24 ? 802 TRP B CA  1 
ATOM   969  C C   . TRP A 1 128 ? 0.902   18.481  25.405  1.00 20.01 ? 802 TRP B C   1 
ATOM   970  O O   . TRP A 1 128 ? 0.051   18.967  26.191  1.00 19.92 ? 802 TRP B O   1 
ATOM   971  C CB  . TRP A 1 128 ? 2.206   20.383  24.330  1.00 18.85 ? 802 TRP B CB  1 
ATOM   972  C CG  . TRP A 1 128 ? 1.633   21.653  24.949  1.00 18.36 ? 802 TRP B CG  1 
ATOM   973  C CD1 . TRP A 1 128 ? 1.417   21.926  26.281  1.00 17.64 ? 802 TRP B CD1 1 
ATOM   974  C CD2 . TRP A 1 128 ? 1.272   22.839  24.233  1.00 20.17 ? 802 TRP B CD2 1 
ATOM   975  N NE1 . TRP A 1 128 ? 0.896   23.212  26.426  1.00 18.38 ? 802 TRP B NE1 1 
ATOM   976  C CE2 . TRP A 1 128 ? 0.796   23.790  25.188  1.00 18.90 ? 802 TRP B CE2 1 
ATOM   977  C CE3 . TRP A 1 128 ? 1.258   23.179  22.871  1.00 20.18 ? 802 TRP B CE3 1 
ATOM   978  C CZ2 . TRP A 1 128 ? 0.327   25.068  24.817  1.00 20.14 ? 802 TRP B CZ2 1 
ATOM   979  C CZ3 . TRP A 1 128 ? 0.813   24.472  22.501  1.00 19.89 ? 802 TRP B CZ3 1 
ATOM   980  C CH2 . TRP A 1 128 ? 0.366   25.396  23.470  1.00 19.68 ? 802 TRP B CH2 1 
ATOM   981  N N   . GLN A 1 129 ? 0.695   17.361  24.701  1.00 19.96 ? 803 GLN B N   1 
ATOM   982  C CA  . GLN A 1 129 ? -0.529  16.555  24.823  1.00 21.15 ? 803 GLN B CA  1 
ATOM   983  C C   . GLN A 1 129 ? -0.770  16.163  26.285  1.00 21.04 ? 803 GLN B C   1 
ATOM   984  O O   . GLN A 1 129 ? -1.918  16.146  26.753  1.00 20.35 ? 803 GLN B O   1 
ATOM   985  C CB  . GLN A 1 129 ? -0.431  15.294  23.947  1.00 20.62 ? 803 GLN B CB  1 
ATOM   986  C CG  . GLN A 1 129 ? -0.434  15.610  22.400  1.00 22.36 ? 803 GLN B CG  1 
ATOM   987  C CD  . GLN A 1 129 ? -0.147  14.397  21.494  1.00 25.99 ? 803 GLN B CD  1 
ATOM   988  O OE1 . GLN A 1 129 ? 0.281   14.545  20.325  1.00 33.01 ? 803 GLN B OE1 1 
ATOM   989  N NE2 . GLN A 1 129 ? -0.349  13.210  22.025  1.00 30.22 ? 803 GLN B NE2 1 
ATOM   990  N N   . ILE A 1 130 ? 0.319   15.818  26.984  1.00 19.30 ? 804 ILE B N   1 
ATOM   991  C CA  . ILE A 1 130 ? 0.210   15.292  28.336  1.00 20.07 ? 804 ILE B CA  1 
ATOM   992  C C   . ILE A 1 130 ? -0.404  16.303  29.312  1.00 19.14 ? 804 ILE B C   1 
ATOM   993  O O   . ILE A 1 130 ? -1.390  15.971  29.953  1.00 19.61 ? 804 ILE B O   1 
ATOM   994  C CB  . ILE A 1 130 ? 1.552   14.731  28.885  1.00 19.50 ? 804 ILE B CB  1 
ATOM   995  C CG1 . ILE A 1 130 ? 2.006   13.564  27.994  1.00 23.94 ? 804 ILE B CG1 1 
ATOM   996  C CG2 . ILE A 1 130 ? 1.391   14.246  30.355  1.00 19.96 ? 804 ILE B CG2 1 
ATOM   997  C CD1 . ILE A 1 130 ? 3.399   13.093  28.250  1.00 27.68 ? 804 ILE B CD1 1 
ATOM   998  N N   . PRO A 1 131 ? 0.191   17.511  29.444  1.00 19.56 ? 805 PRO B N   1 
ATOM   999  C CA  . PRO A 1 131 ? -0.465  18.467  30.358  1.00 19.81 ? 805 PRO B CA  1 
ATOM   1000 C C   . PRO A 1 131 ? -1.898  18.725  29.934  1.00 20.59 ? 805 PRO B C   1 
ATOM   1001 O O   . PRO A 1 131 ? -2.781  18.893  30.794  1.00 20.47 ? 805 PRO B O   1 
ATOM   1002 C CB  . PRO A 1 131 ? 0.348   19.757  30.208  1.00 19.86 ? 805 PRO B CB  1 
ATOM   1003 C CG  . PRO A 1 131 ? 1.401   19.517  29.234  1.00 19.54 ? 805 PRO B CG  1 
ATOM   1004 C CD  . PRO A 1 131 ? 1.459   18.030  28.904  1.00 17.96 ? 805 PRO B CD  1 
ATOM   1005 N N   . GLN A 1 132 ? -2.137  18.770  28.617  1.00 20.16 ? 806 GLN B N   1 
ATOM   1006 C CA  . GLN A 1 132 ? -3.512  18.967  28.144  1.00 21.62 ? 806 GLN B CA  1 
ATOM   1007 C C   . GLN A 1 132 ? -4.457  17.859  28.652  1.00 21.74 ? 806 GLN B C   1 
ATOM   1008 O O   . GLN A 1 132 ? -5.588  18.165  29.049  1.00 21.39 ? 806 GLN B O   1 
ATOM   1009 C CB  . GLN A 1 132 ? -3.595  19.196  26.602  1.00 21.83 ? 806 GLN B CB  1 
ATOM   1010 C CG  . GLN A 1 132 ? -2.755  20.408  26.059  1.00 22.30 ? 806 GLN B CG  1 
ATOM   1011 C CD  . GLN A 1 132 ? -3.249  21.805  26.517  1.00 26.41 ? 806 GLN B CD  1 
ATOM   1012 O OE1 . GLN A 1 132 ? -3.962  21.937  27.521  1.00 23.10 ? 806 GLN B OE1 1 
ATOM   1013 N NE2 . GLN A 1 132 ? -2.848  22.872  25.760  1.00 27.08 ? 806 GLN B NE2 1 
ATOM   1014 N N   . GLU A 1 133 ? -4.004  16.592  28.681  1.00 21.57 ? 807 GLU B N   1 
ATOM   1015 C CA  . GLU A 1 133 ? -4.819  15.504  29.244  1.00 22.38 ? 807 GLU B CA  1 
ATOM   1016 C C   . GLU A 1 133 ? -5.022  15.611  30.755  1.00 21.43 ? 807 GLU B C   1 
ATOM   1017 O O   . GLU A 1 133 ? -6.050  15.187  31.270  1.00 20.85 ? 807 GLU B O   1 
ATOM   1018 C CB  . GLU A 1 133 ? -4.208  14.123  28.978  1.00 23.50 ? 807 GLU B CB  1 
ATOM   1019 C CG  . GLU A 1 133 ? -4.467  13.566  27.619  1.00 28.02 ? 807 GLU B CG  1 
ATOM   1020 C CD  . GLU A 1 133 ? -5.961  13.527  27.264  1.00 32.37 ? 807 GLU B CD  1 
ATOM   1021 O OE1 . GLU A 1 133 ? -6.725  12.760  27.892  1.00 32.72 ? 807 GLU B OE1 1 
ATOM   1022 O OE2 . GLU A 1 133 ? -6.343  14.263  26.328  1.00 33.87 ? 807 GLU B OE2 1 
ATOM   1023 N N   . PHE A 1 134 ? -4.018  16.128  31.463  1.00 20.87 ? 808 PHE B N   1 
ATOM   1024 C CA  . PHE A 1 134 ? -4.118  16.343  32.907  1.00 20.37 ? 808 PHE B CA  1 
ATOM   1025 C C   . PHE A 1 134 ? -5.228  17.354  33.189  1.00 20.38 ? 808 PHE B C   1 
ATOM   1026 O O   . PHE A 1 134 ? -6.088  17.098  34.039  1.00 21.12 ? 808 PHE B O   1 
ATOM   1027 C CB  . PHE A 1 134 ? -2.778  16.801  33.474  1.00 20.72 ? 808 PHE B CB  1 
ATOM   1028 C CG  . PHE A 1 134 ? -1.787  15.683  33.652  1.00 20.97 ? 808 PHE B CG  1 
ATOM   1029 C CD1 . PHE A 1 134 ? -2.139  14.367  33.366  1.00 22.56 ? 808 PHE B CD1 1 
ATOM   1030 C CD2 . PHE A 1 134 ? -0.524  15.936  34.127  1.00 22.87 ? 808 PHE B CD2 1 
ATOM   1031 C CE1 . PHE A 1 134 ? -1.198  13.310  33.544  1.00 24.95 ? 808 PHE B CE1 1 
ATOM   1032 C CE2 . PHE A 1 134 ? 0.422   14.886  34.310  1.00 24.17 ? 808 PHE B CE2 1 
ATOM   1033 C CZ  . PHE A 1 134 ? 0.083   13.594  34.027  1.00 21.55 ? 808 PHE B CZ  1 
ATOM   1034 N N   . VAL A 1 135 ? -5.255  18.452  32.423  1.00 20.54 ? 809 VAL B N   1 
ATOM   1035 C CA  . VAL A 1 135 ? -6.352  19.454  32.522  1.00 20.37 ? 809 VAL B CA  1 
ATOM   1036 C C   . VAL A 1 135 ? -7.739  18.809  32.301  1.00 21.61 ? 809 VAL B C   1 
ATOM   1037 O O   . VAL A 1 135 ? -8.703  19.027  33.062  1.00 20.81 ? 809 VAL B O   1 
ATOM   1038 C CB  . VAL A 1 135 ? -6.131  20.594  31.500  1.00 20.26 ? 809 VAL B CB  1 
ATOM   1039 C CG1 . VAL A 1 135 ? -7.360  21.535  31.429  1.00 20.75 ? 809 VAL B CG1 1 
ATOM   1040 C CG2 . VAL A 1 135 ? -4.866  21.382  31.820  1.00 18.59 ? 809 VAL B CG2 1 
ATOM   1041 N N   . LYS A 1 136 ? -7.847  18.007  31.256  1.00 22.83 ? 810 LYS B N   1 
ATOM   1042 C CA  . LYS A 1 136 ? -9.137  17.460  30.868  1.00 25.21 ? 810 LYS B CA  1 
ATOM   1043 C C   . LYS A 1 136 ? -9.646  16.458  31.904  1.00 25.14 ? 810 LYS B C   1 
ATOM   1044 O O   . LYS A 1 136 ? -10.847 16.417  32.193  1.00 24.30 ? 810 LYS B O   1 
ATOM   1045 C CB  . LYS A 1 136 ? -9.068  16.783  29.492  1.00 25.89 ? 810 LYS B CB  1 
ATOM   1046 C CG  . LYS A 1 136 ? -9.029  17.741  28.332  1.00 28.04 ? 810 LYS B CG  1 
ATOM   1047 C CD  . LYS A 1 136 ? -8.508  17.077  27.022  1.00 29.37 ? 810 LYS B CD  1 
ATOM   1048 C CE  . LYS A 1 136 ? -8.696  18.039  25.800  1.00 33.31 ? 810 LYS B CE  1 
ATOM   1049 N NZ  . LYS A 1 136 ? -7.924  17.612  24.566  1.00 36.86 ? 810 LYS B NZ  1 
ATOM   1050 N N   . LEU A 1 137 ? -8.728  15.629  32.422  1.00 23.87 ? 811 LEU B N   1 
ATOM   1051 C CA  . LEU A 1 137 ? -9.080  14.654  33.428  1.00 23.61 ? 811 LEU B CA  1 
ATOM   1052 C C   . LEU A 1 137 ? -9.068  15.201  34.866  1.00 22.93 ? 811 LEU B C   1 
ATOM   1053 O O   . LEU A 1 137 ? -9.532  14.540  35.767  1.00 23.13 ? 811 LEU B O   1 
ATOM   1054 C CB  . LEU A 1 137 ? -8.179  13.430  33.305  1.00 23.55 ? 811 LEU B CB  1 
ATOM   1055 C CG  . LEU A 1 137 ? -8.467  12.548  32.105  1.00 24.26 ? 811 LEU B CG  1 
ATOM   1056 C CD1 . LEU A 1 137 ? -7.331  11.572  31.911  1.00 25.74 ? 811 LEU B CD1 1 
ATOM   1057 C CD2 . LEU A 1 137 ? -9.748  11.783  32.364  1.00 25.55 ? 811 LEU B CD2 1 
ATOM   1058 N N   . GLN A 1 138 ? -8.589  16.423  35.051  1.00 22.79 ? 812 GLN B N   1 
ATOM   1059 C CA  . GLN A 1 138 ? -8.352  16.978  36.395  1.00 24.60 ? 812 GLN B CA  1 
ATOM   1060 C C   . GLN A 1 138 ? -7.666  15.940  37.322  1.00 22.98 ? 812 GLN B C   1 
ATOM   1061 O O   . GLN A 1 138 ? -8.193  15.569  38.391  1.00 21.75 ? 812 GLN B O   1 
ATOM   1062 C CB  . GLN A 1 138 ? -9.655  17.547  36.999  1.00 24.66 ? 812 GLN B CB  1 
ATOM   1063 C CG  . GLN A 1 138 ? -10.203 18.750  36.211  1.00 27.45 ? 812 GLN B CG  1 
ATOM   1064 C CD  . GLN A 1 138 ? -11.415 19.399  36.872  1.00 30.48 ? 812 GLN B CD  1 
ATOM   1065 O OE1 . GLN A 1 138 ? -11.514 20.648  36.954  1.00 41.60 ? 812 GLN B OE1 1 
ATOM   1066 N NE2 . GLN A 1 138 ? -12.348 18.566  37.372  1.00 36.14 ? 812 GLN B NE2 1 
ATOM   1067 N N   . VAL A 1 139 ? -6.502  15.457  36.873  1.00 21.59 ? 813 VAL B N   1 
ATOM   1068 C CA  . VAL A 1 139 ? -5.740  14.424  37.591  1.00 19.11 ? 813 VAL B CA  1 
ATOM   1069 C C   . VAL A 1 139 ? -5.368  14.989  38.951  1.00 19.05 ? 813 VAL B C   1 
ATOM   1070 O O   . VAL A 1 139 ? -4.913  16.152  39.028  1.00 17.00 ? 813 VAL B O   1 
ATOM   1071 C CB  . VAL A 1 139 ? -4.489  14.004  36.782  1.00 19.87 ? 813 VAL B CB  1 
ATOM   1072 C CG1 . VAL A 1 139 ? -3.531  13.074  37.643  1.00 18.99 ? 813 VAL B CG1 1 
ATOM   1073 C CG2 . VAL A 1 139 ? -4.936  13.300  35.507  1.00 17.58 ? 813 VAL B CG2 1 
ATOM   1074 N N   . SER A 1 140 ? -5.559  14.200  40.022  1.00 17.49 ? 814 SER B N   1 
ATOM   1075 C CA  . SER A 1 140 ? -5.205  14.709  41.361  1.00 18.52 ? 814 SER B CA  1 
ATOM   1076 C C   . SER A 1 140 ? -3.767  14.385  41.666  1.00 19.12 ? 814 SER B C   1 
ATOM   1077 O O   . SER A 1 140 ? -3.153  13.520  41.029  1.00 19.22 ? 814 SER B O   1 
ATOM   1078 C CB  . SER A 1 140 ? -6.062  14.109  42.469  1.00 17.59 ? 814 SER B CB  1 
ATOM   1079 O OG  . SER A 1 140 ? -5.842  12.700  42.525  1.00 16.77 ? 814 SER B OG  1 
ATOM   1080 N N   . GLN A 1 141 ? -3.249  15.051  42.675  1.00 19.84 ? 815 GLN B N   1 
ATOM   1081 C CA  . GLN A 1 141 ? -1.897  14.795  43.152  1.00 22.47 ? 815 GLN B CA  1 
ATOM   1082 C C   . GLN A 1 141 ? -1.741  13.339  43.575  1.00 20.14 ? 815 GLN B C   1 
ATOM   1083 O O   . GLN A 1 141 ? -0.712  12.724  43.282  1.00 20.14 ? 815 GLN B O   1 
ATOM   1084 C CB  . GLN A 1 141 ? -1.570  15.768  44.301  1.00 23.13 ? 815 GLN B CB  1 
ATOM   1085 C CG  . GLN A 1 141 ? -0.242  15.549  44.993  1.00 27.62 ? 815 GLN B CG  1 
ATOM   1086 C CD  . GLN A 1 141 ? 0.117   16.733  45.878  1.00 29.44 ? 815 GLN B CD  1 
ATOM   1087 O OE1 . GLN A 1 141 ? 1.225   17.286  45.778  1.00 41.46 ? 815 GLN B OE1 1 
ATOM   1088 N NE2 . GLN A 1 141 ? -0.833  17.172  46.711  1.00 37.72 ? 815 GLN B NE2 1 
ATOM   1089 N N   . GLU A 1 142 ? -2.780  12.757  44.179  1.00 18.24 ? 816 GLU B N   1 
ATOM   1090 C CA  . GLU A 1 142 ? -2.706  11.373  44.680  1.00 17.55 ? 816 GLU B CA  1 
ATOM   1091 C C   . GLU A 1 142 ? -2.707  10.357  43.549  1.00 16.53 ? 816 GLU B C   1 
ATOM   1092 O O   . GLU A 1 142 ? -2.002  9.366   43.604  1.00 14.64 ? 816 GLU B O   1 
ATOM   1093 C CB  . GLU A 1 142 ? -3.892  11.083  45.600  1.00 18.10 ? 816 GLU B CB  1 
ATOM   1094 C CG  . GLU A 1 142 ? -3.855  11.890  46.902  1.00 19.42 ? 816 GLU B CG  1 
ATOM   1095 C CD  . GLU A 1 142 ? -4.348  13.329  46.748  1.00 22.83 ? 816 GLU B CD  1 
ATOM   1096 O OE1 . GLU A 1 142 ? -4.911  13.701  45.706  1.00 21.01 ? 816 GLU B OE1 1 
ATOM   1097 O OE2 . GLU A 1 142 ? -4.127  14.119  47.684  1.00 27.48 ? 816 GLU B OE2 1 
ATOM   1098 N N   . GLU A 1 143 ? -3.523  10.612  42.527  1.00 15.50 ? 817 GLU B N   1 
ATOM   1099 C CA  . GLU A 1 143 ? -3.590  9.741   41.359  1.00 16.18 ? 817 GLU B CA  1 
ATOM   1100 C C   . GLU A 1 143 ? -2.227  9.867   40.628  1.00 15.67 ? 817 GLU B C   1 
ATOM   1101 O O   . GLU A 1 143 ? -1.688  8.874   40.230  1.00 15.75 ? 817 GLU B O   1 
ATOM   1102 C CB  . GLU A 1 143 ? -4.715  10.189  40.423  1.00 16.36 ? 817 GLU B CB  1 
ATOM   1103 C CG  . GLU A 1 143 ? -6.139  9.789   40.871  1.00 14.85 ? 817 GLU B CG  1 
ATOM   1104 C CD  . GLU A 1 143 ? -7.213  10.580  40.146  1.00 17.42 ? 817 GLU B CD  1 
ATOM   1105 O OE1 . GLU A 1 143 ? -6.910  11.587  39.470  1.00 18.65 ? 817 GLU B OE1 1 
ATOM   1106 O OE2 . GLU A 1 143 ? -8.390  10.193  40.226  1.00 17.99 ? 817 GLU B OE2 1 
ATOM   1107 N N   . PHE A 1 144 ? -1.706  11.085  40.474  1.00 15.56 ? 818 PHE B N   1 
ATOM   1108 C CA  . PHE A 1 144 ? -0.441  11.351  39.764  1.00 15.72 ? 818 PHE B CA  1 
ATOM   1109 C C   . PHE A 1 144 ? 0.702   10.571  40.405  1.00 15.74 ? 818 PHE B C   1 
ATOM   1110 O O   . PHE A 1 144 ? 1.426   9.850   39.720  1.00 15.34 ? 818 PHE B O   1 
ATOM   1111 C CB  . PHE A 1 144 ? -0.098  12.866  39.804  1.00 16.19 ? 818 PHE B CB  1 
ATOM   1112 C CG  . PHE A 1 144 ? 1.362   13.174  39.397  1.00 17.21 ? 818 PHE B CG  1 
ATOM   1113 C CD1 . PHE A 1 144 ? 1.756   13.108  38.059  1.00 18.35 ? 818 PHE B CD1 1 
ATOM   1114 C CD2 . PHE A 1 144 ? 2.328   13.493  40.358  1.00 20.13 ? 818 PHE B CD2 1 
ATOM   1115 C CE1 . PHE A 1 144 ? 3.101   13.368  37.658  1.00 16.59 ? 818 PHE B CE1 1 
ATOM   1116 C CE2 . PHE A 1 144 ? 3.667   13.759  39.989  1.00 19.04 ? 818 PHE B CE2 1 
ATOM   1117 C CZ  . PHE A 1 144 ? 4.056   13.678  38.624  1.00 18.84 ? 818 PHE B CZ  1 
ATOM   1118 N N   . LEU A 1 145 ? 0.833   10.686  41.733  1.00 14.83 ? 819 LEU B N   1 
ATOM   1119 C CA  . LEU A 1 145 ? 1.845   9.971   42.489  1.00 14.63 ? 819 LEU B CA  1 
ATOM   1120 C C   . LEU A 1 145 ? 1.838   8.443   42.258  1.00 15.19 ? 819 LEU B C   1 
ATOM   1121 O O   . LEU A 1 145 ? 2.888   7.859   41.977  1.00 14.91 ? 819 LEU B O   1 
ATOM   1122 C CB  . LEU A 1 145 ? 1.749   10.321  43.973  1.00 14.95 ? 819 LEU B CB  1 
ATOM   1123 C CG  . LEU A 1 145 ? 2.128   11.763  44.328  1.00 15.05 ? 819 LEU B CG  1 
ATOM   1124 C CD1 . LEU A 1 145 ? 1.704   12.062  45.782  1.00 16.67 ? 819 LEU B CD1 1 
ATOM   1125 C CD2 . LEU A 1 145 ? 3.634   11.951  44.153  1.00 16.62 ? 819 LEU B CD2 1 
ATOM   1126 N N   . CYS A 1 146 ? 0.657   7.821   42.309  1.00 14.36 ? 820 CYS B N   1 
ATOM   1127 C CA  . CYS A 1 146 ? 0.510   6.371   42.030  1.00 14.20 ? 820 CYS B CA  1 
ATOM   1128 C C   . CYS A 1 146 ? 0.810   5.995   40.570  1.00 14.87 ? 820 CYS B C   1 
ATOM   1129 O O   . CYS A 1 146 ? 1.518   4.980   40.304  1.00 14.27 ? 820 CYS B O   1 
ATOM   1130 C CB  . CYS A 1 146 ? -0.907  5.926   42.400  1.00 12.58 ? 820 CYS B CB  1 
ATOM   1131 S SG  . CYS A 1 146 ? -1.213  6.004   44.186  1.00 16.86 ? 820 CYS B SG  1 
ATOM   1132 N N   . MET A 1 147 ? 0.298   6.816   39.642  1.00 13.39 ? 821 MET B N   1 
ATOM   1133 C CA  . MET A 1 147 ? 0.525   6.581   38.219  1.00 14.84 ? 821 MET B CA  1 
ATOM   1134 C C   . MET A 1 147 ? 2.012   6.708   37.882  1.00 13.81 ? 821 MET B C   1 
ATOM   1135 O O   . MET A 1 147 ? 2.526   5.927   37.110  1.00 12.40 ? 821 MET B O   1 
ATOM   1136 C CB  . MET A 1 147 ? -0.281  7.565   37.384  1.00 14.99 ? 821 MET B CB  1 
ATOM   1137 C CG  . MET A 1 147 ? -1.800  7.285   37.364  1.00 13.98 ? 821 MET B CG  1 
ATOM   1138 S SD  . MET A 1 147 ? -2.651  8.807   36.766  1.00 18.31 ? 821 MET B SD  1 
ATOM   1139 C CE  . MET A 1 147 ? -2.594  8.457   35.018  1.00 11.35 ? 821 MET B CE  1 
ATOM   1140 N N   . LYS A 1 148 ? 2.695   7.669   38.490  1.00 13.08 ? 822 LYS B N   1 
ATOM   1141 C CA  . LYS A 1 148 ? 4.133   7.789   38.247  1.00 14.17 ? 822 LYS B CA  1 
ATOM   1142 C C   . LYS A 1 148 ? 4.922   6.525   38.699  1.00 14.02 ? 822 LYS B C   1 
ATOM   1143 O O   . LYS A 1 148 ? 5.844   6.090   38.023  1.00 13.40 ? 822 LYS B O   1 
ATOM   1144 C CB  . LYS A 1 148 ? 4.677   9.082   38.862  1.00 14.08 ? 822 LYS B CB  1 
ATOM   1145 C CG  . LYS A 1 148 ? 6.127   9.282   38.545  1.00 13.51 ? 822 LYS B CG  1 
ATOM   1146 C CD  . LYS A 1 148 ? 6.551   10.758  38.518  1.00 15.65 ? 822 LYS B CD  1 
ATOM   1147 C CE  . LYS A 1 148 ? 6.500   11.401  39.912  1.00 14.56 ? 822 LYS B CE  1 
ATOM   1148 N NZ  . LYS A 1 148 ? 7.200   10.635  40.951  1.00 17.21 ? 822 LYS B NZ  1 
ATOM   1149 N N   . VAL A 1 149 ? 4.544   5.917   39.840  1.00 13.83 ? 823 VAL B N   1 
ATOM   1150 C CA  . VAL A 1 149 ? 5.145   4.627   40.207  1.00 12.49 ? 823 VAL B CA  1 
ATOM   1151 C C   . VAL A 1 149 ? 4.882   3.549   39.191  1.00 12.36 ? 823 VAL B C   1 
ATOM   1152 O O   . VAL A 1 149 ? 5.780   2.763   38.885  1.00 11.78 ? 823 VAL B O   1 
ATOM   1153 C CB  . VAL A 1 149 ? 4.783   4.097   41.661  1.00 12.88 ? 823 VAL B CB  1 
ATOM   1154 C CG1 . VAL A 1 149 ? 5.485   2.727   41.942  1.00 12.13 ? 823 VAL B CG1 1 
ATOM   1155 C CG2 . VAL A 1 149 ? 5.203   5.167   42.732  1.00 11.92 ? 823 VAL B CG2 1 
ATOM   1156 N N   . LEU A 1 150 ? 3.663   3.485   38.667  1.00 11.57 ? 824 LEU B N   1 
ATOM   1157 C CA  . LEU A 1 150 ? 3.351   2.431   37.713  1.00 12.46 ? 824 LEU B CA  1 
ATOM   1158 C C   . LEU A 1 150 ? 4.150   2.559   36.433  1.00 11.41 ? 824 LEU B C   1 
ATOM   1159 O O   . LEU A 1 150 ? 4.434   1.555   35.803  1.00 12.06 ? 824 LEU B O   1 
ATOM   1160 C CB  . LEU A 1 150 ? 1.833   2.361   37.427  1.00 12.53 ? 824 LEU B CB  1 
ATOM   1161 C CG  . LEU A 1 150 ? 0.995   1.992   38.665  1.00 14.11 ? 824 LEU B CG  1 
ATOM   1162 C CD1 . LEU A 1 150 ? -0.501  2.124   38.426  1.00 13.86 ? 824 LEU B CD1 1 
ATOM   1163 C CD2 . LEU A 1 150 ? 1.374   0.554   39.163  1.00 14.06 ? 824 LEU B CD2 1 
ATOM   1164 N N   . LEU A 1 151 ? 4.476   3.789   36.040  1.00 11.53 ? 825 LEU B N   1 
ATOM   1165 C CA  . LEU A 1 151 ? 5.321   4.012   34.868  1.00 12.20 ? 825 LEU B CA  1 
ATOM   1166 C C   . LEU A 1 151 ? 6.734   3.429   35.060  1.00 12.61 ? 825 LEU B C   1 
ATOM   1167 O O   . LEU A 1 151 ? 7.260   2.800   34.150  1.00 12.47 ? 825 LEU B O   1 
ATOM   1168 C CB  . LEU A 1 151 ? 5.421   5.518   34.533  1.00 10.91 ? 825 LEU B CB  1 
ATOM   1169 C CG  . LEU A 1 151 ? 4.241   6.128   33.764  1.00 12.53 ? 825 LEU B CG  1 
ATOM   1170 C CD1 . LEU A 1 151 ? 4.560   7.619   33.481  1.00 13.99 ? 825 LEU B CD1 1 
ATOM   1171 C CD2 . LEU A 1 151 ? 4.034   5.352   32.457  1.00 11.58 ? 825 LEU B CD2 1 
ATOM   1172 N N   . LEU A 1 152 ? 7.329   3.634   36.246  1.00 12.16 ? 826 LEU B N   1 
ATOM   1173 C CA  . LEU A 1 152 ? 8.608   3.019   36.590  1.00 13.16 ? 826 LEU B CA  1 
ATOM   1174 C C   . LEU A 1 152 ? 8.532   1.467   36.434  1.00 13.48 ? 826 LEU B C   1 
ATOM   1175 O O   . LEU A 1 152 ? 9.486   0.829   36.001  1.00 13.72 ? 826 LEU B O   1 
ATOM   1176 C CB  . LEU A 1 152 ? 9.024   3.417   38.039  1.00 12.37 ? 826 LEU B CB  1 
ATOM   1177 C CG  . LEU A 1 152 ? 10.242  2.626   38.578  1.00 15.25 ? 826 LEU B CG  1 
ATOM   1178 C CD1 . LEU A 1 152 ? 11.542  3.094   37.847  1.00 12.10 ? 826 LEU B CD1 1 
ATOM   1179 C CD2 . LEU A 1 152 ? 10.404  2.808   40.096  1.00 14.82 ? 826 LEU B CD2 1 
ATOM   1180 N N   . LEU A 1 153 ? 7.357   0.891   36.705  1.00 13.89 ? 827 LEU B N   1 
ATOM   1181 C CA  . LEU A 1 153 ? 7.126   -0.547  36.633  1.00 14.13 ? 827 LEU B CA  1 
ATOM   1182 C C   . LEU A 1 153 ? 6.403   -1.019  35.347  1.00 15.08 ? 827 LEU B C   1 
ATOM   1183 O O   . LEU A 1 153 ? 5.794   -2.087  35.333  1.00 14.10 ? 827 LEU B O   1 
ATOM   1184 C CB  . LEU A 1 153 ? 6.303   -0.957  37.885  1.00 13.78 ? 827 LEU B CB  1 
ATOM   1185 C CG  . LEU A 1 153 ? 6.857   -0.518  39.260  1.00 13.83 ? 827 LEU B CG  1 
ATOM   1186 C CD1 . LEU A 1 153 ? 5.923   -0.858  40.413  1.00 12.20 ? 827 LEU B CD1 1 
ATOM   1187 C CD2 . LEU A 1 153 ? 8.286   -1.142  39.527  1.00 15.75 ? 827 LEU B CD2 1 
ATOM   1188 N N   . ASN A 1 154 ? 6.463   -0.226  34.272  1.00 16.31 ? 828 ASN B N   1 
ATOM   1189 C CA  . ASN A 1 154 ? 5.542   -0.425  33.129  1.00 15.48 ? 828 ASN B CA  1 
ATOM   1190 C C   . ASN A 1 154 ? 6.099   -1.191  31.919  1.00 15.10 ? 828 ASN B C   1 
ATOM   1191 O O   . ASN A 1 154 ? 5.394   -1.413  30.951  1.00 15.07 ? 828 ASN B O   1 
ATOM   1192 C CB  . ASN A 1 154 ? 4.890   0.895   32.699  1.00 15.52 ? 828 ASN B CB  1 
ATOM   1193 C CG  . ASN A 1 154 ? 3.430   0.704   32.367  1.00 18.86 ? 828 ASN B CG  1 
ATOM   1194 O OD1 . ASN A 1 154 ? 2.793   -0.241  32.896  1.00 17.19 ? 828 ASN B OD1 1 
ATOM   1195 N ND2 . ASN A 1 154 ? 2.891   1.530   31.473  1.00 15.86 ? 828 ASN B ND2 1 
ATOM   1196 N N   . THR A 1 155 ? 7.363   -1.586  31.999  1.00 14.40 ? 829 THR B N   1 
ATOM   1197 C CA  . THR A 1 155 ? 8.041   -2.353  30.970  1.00 15.46 ? 829 THR B CA  1 
ATOM   1198 C C   . THR A 1 155 ? 8.967   -3.327  31.671  1.00 15.91 ? 829 THR B C   1 
ATOM   1199 O O   . THR A 1 155 ? 9.680   -2.938  32.607  1.00 16.21 ? 829 THR B O   1 
ATOM   1200 C CB  . THR A 1 155 ? 8.900   -1.448  30.008  1.00 15.71 ? 829 THR B CB  1 
ATOM   1201 O OG1 . THR A 1 155 ? 8.093   -0.393  29.479  1.00 14.37 ? 829 THR B OG1 1 
ATOM   1202 C CG2 . THR A 1 155 ? 9.536   -2.293  28.853  1.00 17.57 ? 829 THR B CG2 1 
ATOM   1203 N N   . ILE A 1 156 ? 8.961   -4.589  31.242  1.00 15.82 ? 830 ILE B N   1 
ATOM   1204 C CA  . ILE A 1 156 ? 9.942   -5.568  31.729  1.00 16.84 ? 830 ILE B CA  1 
ATOM   1205 C C   . ILE A 1 156 ? 10.652  -6.306  30.573  1.00 17.11 ? 830 ILE B C   1 
ATOM   1206 O O   . ILE A 1 156 ? 10.221  -6.220  29.434  1.00 16.93 ? 830 ILE B O   1 
ATOM   1207 C CB  . ILE A 1 156 ? 9.328   -6.555  32.741  1.00 16.81 ? 830 ILE B CB  1 
ATOM   1208 C CG1 . ILE A 1 156 ? 8.369   -7.547  32.043  1.00 15.40 ? 830 ILE B CG1 1 
ATOM   1209 C CG2 . ILE A 1 156 ? 8.602   -5.769  33.890  1.00 18.34 ? 830 ILE B CG2 1 
ATOM   1210 C CD1 . ILE A 1 156 ? 7.759   -8.681  32.994  1.00 16.94 ? 830 ILE B CD1 1 
ATOM   1211 N N   . PRO A 1 157 ? 11.774  -7.003  30.864  1.00 18.09 ? 831 PRO B N   1 
ATOM   1212 C CA  . PRO A 1 157 ? 12.410  -7.681  29.764  1.00 18.87 ? 831 PRO B CA  1 
ATOM   1213 C C   . PRO A 1 157 ? 11.514  -8.795  29.238  1.00 20.62 ? 831 PRO B C   1 
ATOM   1214 O O   . PRO A 1 157 ? 10.602  -9.274  29.940  1.00 20.31 ? 831 PRO B O   1 
ATOM   1215 C CB  . PRO A 1 157 ? 13.694  -8.277  30.393  1.00 19.25 ? 831 PRO B CB  1 
ATOM   1216 C CG  . PRO A 1 157 ? 13.927  -7.477  31.659  1.00 17.53 ? 831 PRO B CG  1 
ATOM   1217 C CD  . PRO A 1 157 ? 12.537  -7.134  32.124  1.00 16.43 ? 831 PRO B CD  1 
ATOM   1218 N N   . LEU A 1 158 ? 11.808  -9.223  28.020  1.00 21.71 ? 832 LEU B N   1 
ATOM   1219 C CA  . LEU A 1 158 ? 11.124  -10.357 27.420  1.00 23.45 ? 832 LEU B CA  1 
ATOM   1220 C C   . LEU A 1 158 ? 11.194  -11.601 28.302  1.00 23.94 ? 832 LEU B C   1 
ATOM   1221 O O   . LEU A 1 158 ? 10.214  -12.343 28.410  1.00 23.77 ? 832 LEU B O   1 
ATOM   1222 C CB  . LEU A 1 158 ? 11.744  -10.646 26.043  1.00 24.17 ? 832 LEU B CB  1 
ATOM   1223 C CG  . LEU A 1 158 ? 11.354  -9.593  25.004  1.00 25.09 ? 832 LEU B CG  1 
ATOM   1224 C CD1 . LEU A 1 158 ? 12.105  -9.850  23.702  1.00 28.97 ? 832 LEU B CD1 1 
ATOM   1225 C CD2 . LEU A 1 158 ? 9.835   -9.564  24.795  1.00 27.16 ? 832 LEU B CD2 1 
ATOM   1226 N N   . GLU A 1 159 ? 12.348  -11.803 28.933  1.00 23.66 ? 833 GLU B N   1 
ATOM   1227 C CA  . GLU A 1 159 ? 12.602  -12.967 29.793  1.00 24.50 ? 833 GLU B CA  1 
ATOM   1228 C C   . GLU A 1 159 ? 12.151  -12.741 31.260  1.00 23.97 ? 833 GLU B C   1 
ATOM   1229 O O   . GLU A 1 159 ? 12.365  -13.584 32.137  1.00 24.50 ? 833 GLU B O   1 
ATOM   1230 C CB  . GLU A 1 159 ? 14.083  -13.385 29.705  1.00 25.34 ? 833 GLU B CB  1 
ATOM   1231 C CG  . GLU A 1 159 ? 15.113  -12.392 30.305  1.00 28.27 ? 833 GLU B CG  1 
ATOM   1232 C CD  . GLU A 1 159 ? 15.497  -11.196 29.398  1.00 30.36 ? 833 GLU B CD  1 
ATOM   1233 O OE1 . GLU A 1 159 ? 14.850  -10.931 28.371  1.00 26.94 ? 833 GLU B OE1 1 
ATOM   1234 O OE2 . GLU A 1 159 ? 16.455  -10.486 29.750  1.00 34.24 ? 833 GLU B OE2 1 
ATOM   1235 N N   . GLY A 1 160 ? 11.501  -11.609 31.498  1.00 22.54 ? 834 GLY B N   1 
ATOM   1236 C CA  . GLY A 1 160 ? 11.143  -11.180 32.838  1.00 21.88 ? 834 GLY B CA  1 
ATOM   1237 C C   . GLY A 1 160 ? 12.303  -10.710 33.695  1.00 20.88 ? 834 GLY B C   1 
ATOM   1238 O O   . GLY A 1 160 ? 13.440  -10.650 33.256  1.00 21.40 ? 834 GLY B O   1 
ATOM   1239 N N   . LEU A 1 161 ? 12.003  -10.404 34.944  1.00 20.53 ? 835 LEU B N   1 
ATOM   1240 C CA  . LEU A 1 161 ? 12.985  -9.907  35.869  1.00 21.16 ? 835 LEU B CA  1 
ATOM   1241 C C   . LEU A 1 161 ? 13.542  -11.038 36.766  1.00 21.59 ? 835 LEU B C   1 
ATOM   1242 O O   . LEU A 1 161 ? 12.957  -12.116 36.856  1.00 20.96 ? 835 LEU B O   1 
ATOM   1243 C CB  . LEU A 1 161 ? 12.379  -8.774  36.688  1.00 20.55 ? 835 LEU B CB  1 
ATOM   1244 C CG  . LEU A 1 161 ? 11.954  -7.483  35.944  1.00 21.29 ? 835 LEU B CG  1 
ATOM   1245 C CD1 . LEU A 1 161 ? 10.968  -6.691  36.851  1.00 18.35 ? 835 LEU B CD1 1 
ATOM   1246 C CD2 . LEU A 1 161 ? 13.128  -6.551  35.509  1.00 19.63 ? 835 LEU B CD2 1 
ATOM   1247 N N   . ARG A 1 162 ? 14.694  -10.799 37.382  1.00 23.16 ? 836 ARG B N   1 
ATOM   1248 C CA  . ARG A 1 162 ? 15.300  -11.754 38.332  1.00 24.47 ? 836 ARG B CA  1 
ATOM   1249 C C   . ARG A 1 162 ? 14.352  -11.937 39.531  1.00 23.82 ? 836 ARG B C   1 
ATOM   1250 O O   . ARG A 1 162 ? 14.158  -13.076 40.022  1.00 23.50 ? 836 ARG B O   1 
ATOM   1251 C CB  . ARG A 1 162 ? 16.641  -11.225 38.880  1.00 25.15 ? 836 ARG B CB  1 
ATOM   1252 C CG  . ARG A 1 162 ? 17.866  -11.283 37.959  1.00 30.64 ? 836 ARG B CG  1 
ATOM   1253 C CD  . ARG A 1 162 ? 19.140  -11.626 38.778  1.00 38.81 ? 836 ARG B CD  1 
ATOM   1254 N NE  . ARG A 1 162 ? 19.687  -12.973 38.509  1.00 46.53 ? 836 ARG B NE  1 
ATOM   1255 C CZ  . ARG A 1 162 ? 19.175  -14.146 38.927  1.00 49.93 ? 836 ARG B CZ  1 
ATOM   1256 N NH1 . ARG A 1 162 ? 18.076  -14.213 39.677  1.00 51.95 ? 836 ARG B NH1 1 
ATOM   1257 N NH2 . ARG A 1 162 ? 19.771  -15.286 38.582  1.00 51.38 ? 836 ARG B NH2 1 
ATOM   1258 N N   . SER A 1 163 ? 13.776  -10.821 39.995  1.00 21.59 ? 837 SER B N   1 
ATOM   1259 C CA  . SER A 1 163 ? 12.888  -10.813 41.157  1.00 21.38 ? 837 SER B CA  1 
ATOM   1260 C C   . SER A 1 163 ? 11.455  -10.659 40.682  1.00 20.72 ? 837 SER B C   1 
ATOM   1261 O O   . SER A 1 163 ? 10.721  -9.808  41.190  1.00 19.12 ? 837 SER B O   1 
ATOM   1262 C CB  . SER A 1 163 ? 13.231  -9.649  42.111  1.00 21.21 ? 837 SER B CB  1 
ATOM   1263 O OG  . SER A 1 163 ? 14.560  -9.681  42.582  1.00 21.21 ? 837 SER B OG  1 
ATOM   1264 N N   . GLN A 1 164 ? 11.056  -11.484 39.710  1.00 20.81 ? 838 GLN B N   1 
ATOM   1265 C CA  . GLN A 1 164 ? 9.720   -11.378 39.092  1.00 21.54 ? 838 GLN B CA  1 
ATOM   1266 C C   . GLN A 1 164 ? 8.571   -11.445 40.085  1.00 22.15 ? 838 GLN B C   1 
ATOM   1267 O O   . GLN A 1 164 ? 7.579   -10.722 39.934  1.00 21.73 ? 838 GLN B O   1 
ATOM   1268 C CB  . GLN A 1 164 ? 9.510   -12.443 37.986  1.00 22.30 ? 838 GLN B CB  1 
ATOM   1269 C CG  . GLN A 1 164 ? 8.257   -12.243 37.120  1.00 19.94 ? 838 GLN B CG  1 
ATOM   1270 C CD  . GLN A 1 164 ? 8.296   -10.955 36.245  1.00 22.52 ? 838 GLN B CD  1 
ATOM   1271 O OE1 . GLN A 1 164 ? 9.342   -10.525 35.769  1.00 23.21 ? 838 GLN B OE1 1 
ATOM   1272 N NE2 . GLN A 1 164 ? 7.138   -10.385 36.010  1.00 19.15 ? 838 GLN B NE2 1 
ATOM   1273 N N   . THR A 1 165 ? 8.668   -12.350 41.061  1.00 23.61 ? 839 THR B N   1 
ATOM   1274 C CA  . THR A 1 165 ? 7.634   -12.489 42.115  1.00 23.77 ? 839 THR B CA  1 
ATOM   1275 C C   . THR A 1 165 ? 7.456   -11.193 42.907  1.00 22.46 ? 839 THR B C   1 
ATOM   1276 O O   . THR A 1 165 ? 6.338   -10.704 43.056  1.00 22.43 ? 839 THR B O   1 
ATOM   1277 C CB  . THR A 1 165 ? 7.979   -13.623 43.106  1.00 24.86 ? 839 THR B CB  1 
ATOM   1278 O OG1 . THR A 1 165 ? 8.223   -14.834 42.370  1.00 28.38 ? 839 THR B OG1 1 
ATOM   1279 C CG2 . THR A 1 165 ? 6.840   -13.854 44.073  1.00 24.52 ? 839 THR B CG2 1 
ATOM   1280 N N   . GLN A 1 166 ? 8.566   -10.646 43.402  1.00 21.95 ? 840 GLN B N   1 
ATOM   1281 C CA  . GLN A 1 166 ? 8.551   -9.408  44.173  1.00 22.10 ? 840 GLN B CA  1 
ATOM   1282 C C   . GLN A 1 166 ? 8.056   -8.229  43.306  1.00 20.87 ? 840 GLN B C   1 
ATOM   1283 O O   . GLN A 1 166 ? 7.301   -7.404  43.779  1.00 21.38 ? 840 GLN B O   1 
ATOM   1284 C CB  . GLN A 1 166 ? 9.935   -9.090  44.793  1.00 22.38 ? 840 GLN B CB  1 
ATOM   1285 C CG  . GLN A 1 166 ? 10.586  -10.182 45.745  1.00 26.46 ? 840 GLN B CG  1 
ATOM   1286 C CD  . GLN A 1 166 ? 11.442  -11.243 45.003  1.00 31.31 ? 840 GLN B CD  1 
ATOM   1287 O OE1 . GLN A 1 166 ? 11.036  -11.823 43.966  1.00 27.98 ? 840 GLN B OE1 1 
ATOM   1288 N NE2 . GLN A 1 166 ? 12.625  -11.521 45.564  1.00 32.95 ? 840 GLN B NE2 1 
ATOM   1289 N N   . PHE A 1 167 ? 8.477   -8.164  42.038  1.00 20.28 ? 841 PHE B N   1 
ATOM   1290 C CA  . PHE A 1 167 ? 7.976   -7.121  41.129  1.00 18.94 ? 841 PHE B CA  1 
ATOM   1291 C C   . PHE A 1 167 ? 6.452   -7.212  40.978  1.00 19.04 ? 841 PHE B C   1 
ATOM   1292 O O   . PHE A 1 167 ? 5.749   -6.207  41.009  1.00 15.71 ? 841 PHE B O   1 
ATOM   1293 C CB  . PHE A 1 167 ? 8.651   -7.250  39.745  1.00 18.61 ? 841 PHE B CB  1 
ATOM   1294 C CG  . PHE A 1 167 ? 7.990   -6.408  38.662  1.00 17.60 ? 841 PHE B CG  1 
ATOM   1295 C CD1 . PHE A 1 167 ? 8.357   -5.080  38.482  1.00 16.54 ? 841 PHE B CD1 1 
ATOM   1296 C CD2 . PHE A 1 167 ? 6.987   -6.935  37.861  1.00 19.15 ? 841 PHE B CD2 1 
ATOM   1297 C CE1 . PHE A 1 167 ? 7.768   -4.332  37.510  1.00 16.04 ? 841 PHE B CE1 1 
ATOM   1298 C CE2 . PHE A 1 167 ? 6.361   -6.165  36.896  1.00 15.45 ? 841 PHE B CE2 1 
ATOM   1299 C CZ  . PHE A 1 167 ? 6.770   -4.861  36.729  1.00 17.04 ? 841 PHE B CZ  1 
ATOM   1300 N N   . GLU A 1 168 ? 5.957   -8.431  40.760  1.00 19.15 ? 842 GLU B N   1 
ATOM   1301 C CA  . GLU A 1 168 ? 4.532   -8.645  40.592  1.00 21.69 ? 842 GLU B CA  1 
ATOM   1302 C C   . GLU A 1 168 ? 3.768   -8.121  41.849  1.00 21.37 ? 842 GLU B C   1 
ATOM   1303 O O   . GLU A 1 168 ? 2.812   -7.384  41.729  1.00 21.49 ? 842 GLU B O   1 
ATOM   1304 C CB  . GLU A 1 168 ? 4.313   -10.145 40.342  1.00 23.30 ? 842 GLU B CB  1 
ATOM   1305 C CG  . GLU A 1 168 ? 3.439   -10.541 39.196  1.00 27.24 ? 842 GLU B CG  1 
ATOM   1306 C CD  . GLU A 1 168 ? 3.676   -9.811  37.876  1.00 27.57 ? 842 GLU B CD  1 
ATOM   1307 O OE1 . GLU A 1 168 ? 4.267   -10.385 36.952  1.00 33.98 ? 842 GLU B OE1 1 
ATOM   1308 O OE2 . GLU A 1 168 ? 3.187   -8.699  37.726  1.00 28.54 ? 842 GLU B OE2 1 
ATOM   1309 N N   . GLU A 1 169 ? 4.242   -8.461  43.041  1.00 21.99 ? 843 GLU B N   1 
ATOM   1310 C CA  . GLU A 1 169 ? 3.638   -7.990  44.302  1.00 22.82 ? 843 GLU B CA  1 
ATOM   1311 C C   . GLU A 1 169 ? 3.678   -6.452  44.435  1.00 19.86 ? 843 GLU B C   1 
ATOM   1312 O O   . GLU A 1 169 ? 2.723   -5.808  44.858  1.00 18.73 ? 843 GLU B O   1 
ATOM   1313 C CB  . GLU A 1 169 ? 4.373   -8.650  45.477  1.00 22.71 ? 843 GLU B CB  1 
ATOM   1314 C CG  . GLU A 1 169 ? 4.027   -10.175 45.603  1.00 27.66 ? 843 GLU B CG  1 
ATOM   1315 C CD  . GLU A 1 169 ? 4.600   -10.831 46.863  1.00 29.15 ? 843 GLU B CD  1 
ATOM   1316 O OE1 . GLU A 1 169 ? 5.181   -10.105 47.709  1.00 37.89 ? 843 GLU B OE1 1 
ATOM   1317 O OE2 . GLU A 1 169 ? 4.468   -12.071 47.017  1.00 36.76 ? 843 GLU B OE2 1 
ATOM   1318 N N   . MET A 1 170 ? 4.793   -5.876  44.036  1.00 17.76 ? 844 MET B N   1 
ATOM   1319 C CA  . MET A 1 170 ? 4.970   -4.426  44.157  1.00 17.71 ? 844 MET B CA  1 
ATOM   1320 C C   . MET A 1 170 ? 4.069   -3.728  43.151  1.00 16.32 ? 844 MET B C   1 
ATOM   1321 O O   . MET A 1 170 ? 3.345   -2.812  43.503  1.00 15.13 ? 844 MET B O   1 
ATOM   1322 C CB  . MET A 1 170 ? 6.433   -4.056  43.890  1.00 17.44 ? 844 MET B CB  1 
ATOM   1323 C CG  . MET A 1 170 ? 6.747   -2.543  44.054  1.00 17.64 ? 844 MET B CG  1 
ATOM   1324 S SD  . MET A 1 170 ? 8.440   -2.119  43.490  1.00 19.02 ? 844 MET B SD  1 
ATOM   1325 C CE  . MET A 1 170 ? 8.361   -0.357  43.788  1.00 14.77 ? 844 MET B CE  1 
ATOM   1326 N N   . ARG A 1 171 ? 4.127   -4.154  41.885  1.00 16.61 ? 845 ARG B N   1 
ATOM   1327 C CA  . ARG A 1 171 ? 3.257   -3.538  40.862  1.00 17.29 ? 845 ARG B CA  1 
ATOM   1328 C C   . ARG A 1 171 ? 1.768   -3.684  41.249  1.00 17.10 ? 845 ARG B C   1 
ATOM   1329 O O   . ARG A 1 171 ? 1.015   -2.725  41.203  1.00 16.77 ? 845 ARG B O   1 
ATOM   1330 C CB  . ARG A 1 171 ? 3.529   -4.139  39.489  1.00 17.40 ? 845 ARG B CB  1 
ATOM   1331 C CG  . ARG A 1 171 ? 2.633   -3.565  38.370  1.00 17.46 ? 845 ARG B CG  1 
ATOM   1332 C CD  . ARG A 1 171 ? 3.118   -4.096  37.054  1.00 21.04 ? 845 ARG B CD  1 
ATOM   1333 N NE  . ARG A 1 171 ? 2.383   -3.516  35.924  1.00 25.39 ? 845 ARG B NE  1 
ATOM   1334 C CZ  . ARG A 1 171 ? 1.287   -4.024  35.392  1.00 29.76 ? 845 ARG B CZ  1 
ATOM   1335 N NH1 . ARG A 1 171 ? 0.747   -5.150  35.885  1.00 33.06 ? 845 ARG B NH1 1 
ATOM   1336 N NH2 . ARG A 1 171 ? 0.717   -3.397  34.358  1.00 32.18 ? 845 ARG B NH2 1 
ATOM   1337 N N   . SER A 1 172 ? 1.367   -4.878  41.687  1.00 16.51 ? 846 SER B N   1 
ATOM   1338 C CA  . SER A 1 172 ? -0.022  -5.060  42.103  1.00 17.38 ? 846 SER B CA  1 
ATOM   1339 C C   . SER A 1 172 ? -0.402  -4.114  43.282  1.00 16.99 ? 846 SER B C   1 
ATOM   1340 O O   . SER A 1 172 ? -1.484  -3.542  43.325  1.00 17.10 ? 846 SER B O   1 
ATOM   1341 C CB  . SER A 1 172 ? -0.262  -6.524  42.435  1.00 18.51 ? 846 SER B CB  1 
ATOM   1342 O OG  . SER A 1 172 ? -0.128  -7.320  41.234  1.00 19.27 ? 846 SER B OG  1 
ATOM   1343 N N   . SER A 1 173 ? 0.515   -3.926  44.226  1.00 16.74 ? 847 SER B N   1 
ATOM   1344 C CA  . SER A 1 173 ? 0.256   -3.047  45.337  1.00 16.62 ? 847 SER B CA  1 
ATOM   1345 C C   . SER A 1 173 ? 0.058   -1.603  44.918  1.00 15.48 ? 847 SER B C   1 
ATOM   1346 O O   . SER A 1 173 ? -0.808  -0.933  45.454  1.00 14.56 ? 847 SER B O   1 
ATOM   1347 C CB  . SER A 1 173 ? 1.370   -3.163  46.385  1.00 17.51 ? 847 SER B CB  1 
ATOM   1348 O OG  . SER A 1 173 ? 1.193   -2.153  47.344  1.00 23.17 ? 847 SER B OG  1 
ATOM   1349 N N   . TYR A 1 174 ? 0.858   -1.109  43.972  1.00 14.38 ? 848 TYR B N   1 
ATOM   1350 C CA  . TYR A 1 174 ? 0.644   0.268   43.489  1.00 14.33 ? 848 TYR B CA  1 
ATOM   1351 C C   . TYR A 1 174 ? -0.628  0.435   42.633  1.00 13.93 ? 848 TYR B C   1 
ATOM   1352 O O   . TYR A 1 174 ? -1.238  1.512   42.617  1.00 14.31 ? 848 TYR B O   1 
ATOM   1353 C CB  . TYR A 1 174 ? 1.899   0.784   42.781  1.00 14.13 ? 848 TYR B CB  1 
ATOM   1354 C CG  . TYR A 1 174 ? 2.964   1.121   43.798  1.00 12.94 ? 848 TYR B CG  1 
ATOM   1355 C CD1 . TYR A 1 174 ? 2.882   2.304   44.555  1.00 13.24 ? 848 TYR B CD1 1 
ATOM   1356 C CD2 . TYR A 1 174 ? 3.998   0.247   44.062  1.00 13.24 ? 848 TYR B CD2 1 
ATOM   1357 C CE1 . TYR A 1 174 ? 3.855   2.622   45.518  1.00 13.90 ? 848 TYR B CE1 1 
ATOM   1358 C CE2 . TYR A 1 174 ? 4.978   0.557   45.019  1.00 12.45 ? 848 TYR B CE2 1 
ATOM   1359 C CZ  . TYR A 1 174 ? 4.887   1.750   45.739  1.00 13.92 ? 848 TYR B CZ  1 
ATOM   1360 O OH  . TYR A 1 174 ? 5.840   2.059   46.666  1.00 13.37 ? 848 TYR B OH  1 
ATOM   1361 N N   . ILE A 1 175 ? -1.018  -0.622  41.924  1.00 13.75 ? 849 ILE B N   1 
ATOM   1362 C CA  . ILE A 1 175 ? -2.322  -0.597  41.212  1.00 15.18 ? 849 ILE B CA  1 
ATOM   1363 C C   . ILE A 1 175 ? -3.459  -0.477  42.255  1.00 15.04 ? 849 ILE B C   1 
ATOM   1364 O O   . ILE A 1 175 ? -4.390  0.334   42.126  1.00 15.99 ? 849 ILE B O   1 
ATOM   1365 C CB  . ILE A 1 175 ? -2.534  -1.875  40.326  1.00 14.75 ? 849 ILE B CB  1 
ATOM   1366 C CG1 . ILE A 1 175 ? -1.494  -1.923  39.194  1.00 15.18 ? 849 ILE B CG1 1 
ATOM   1367 C CG2 . ILE A 1 175 ? -4.002  -1.917  39.795  1.00 10.74 ? 849 ILE B CG2 1 
ATOM   1368 C CD1 . ILE A 1 175 ? -1.418  -3.251  38.463  1.00 16.40 ? 849 ILE B CD1 1 
ATOM   1369 N N   . ARG A 1 176 ? -3.385  -1.303  43.295  1.00 15.84 ? 850 ARG B N   1 
ATOM   1370 C CA  . ARG A 1 176 ? -4.359  -1.214  44.407  1.00 15.85 ? 850 ARG B CA  1 
ATOM   1371 C C   . ARG A 1 176 ? -4.322  0.174   45.029  1.00 15.73 ? 850 ARG B C   1 
ATOM   1372 O O   . ARG A 1 176 ? -5.376  0.730   45.421  1.00 14.93 ? 850 ARG B O   1 
ATOM   1373 C CB  . ARG A 1 176 ? -4.103  -2.285  45.469  1.00 15.19 ? 850 ARG B CB  1 
ATOM   1374 C CG  . ARG A 1 176 ? -4.434  -3.675  44.977  1.00 15.86 ? 850 ARG B CG  1 
ATOM   1375 C CD  . ARG A 1 176 ? -4.524  -4.715  46.110  1.00 15.42 ? 850 ARG B CD  1 
ATOM   1376 N NE  . ARG A 1 176 ? -3.297  -4.867  46.887  1.00 18.02 ? 850 ARG B NE  1 
ATOM   1377 C CZ  . ARG A 1 176 ? -2.257  -5.644  46.553  1.00 21.42 ? 850 ARG B CZ  1 
ATOM   1378 N NH1 . ARG A 1 176 ? -2.255  -6.357  45.425  1.00 17.02 ? 850 ARG B NH1 1 
ATOM   1379 N NH2 . ARG A 1 176 ? -1.180  -5.685  47.354  1.00 20.29 ? 850 ARG B NH2 1 
ATOM   1380 N N   . GLU A 1 177 ? -3.130  0.764   45.092  1.00 14.91 ? 851 GLU B N   1 
ATOM   1381 C CA  . GLU A 1 177 ? -3.030  2.142   45.652  1.00 15.01 ? 851 GLU B CA  1 
ATOM   1382 C C   . GLU A 1 177 ? -3.664  3.247   44.755  1.00 14.96 ? 851 GLU B C   1 
ATOM   1383 O O   . GLU A 1 177 ? -4.320  4.221   45.242  1.00 16.99 ? 851 GLU B O   1 
ATOM   1384 C CB  . GLU A 1 177 ? -1.570  2.460   46.023  1.00 14.75 ? 851 GLU B CB  1 
ATOM   1385 C CG  . GLU A 1 177 ? -1.482  3.544   47.096  1.00 15.99 ? 851 GLU B CG  1 
ATOM   1386 C CD  . GLU A 1 177 ? -1.977  3.011   48.447  1.00 14.95 ? 851 GLU B CD  1 
ATOM   1387 O OE1 . GLU A 1 177 ? -2.126  1.767   48.586  1.00 14.79 ? 851 GLU B OE1 1 
ATOM   1388 O OE2 . GLU A 1 177 ? -2.153  3.824   49.378  1.00 15.79 ? 851 GLU B OE2 1 
ATOM   1389 N N   . LEU A 1 178 ? -3.475  3.113   43.448  1.00 14.07 ? 852 LEU B N   1 
ATOM   1390 C CA  . LEU A 1 178 ? -4.078  4.014   42.482  1.00 14.77 ? 852 LEU B CA  1 
ATOM   1391 C C   . LEU A 1 178 ? -5.594  3.930   42.650  1.00 15.22 ? 852 LEU B C   1 
ATOM   1392 O O   . LEU A 1 178 ? -6.293  4.932   42.558  1.00 15.29 ? 852 LEU B O   1 
ATOM   1393 C CB  . LEU A 1 178 ? -3.726  3.543   41.070  1.00 14.22 ? 852 LEU B CB  1 
ATOM   1394 C CG  . LEU A 1 178 ? -4.394  4.330   39.933  1.00 14.97 ? 852 LEU B CG  1 
ATOM   1395 C CD1 . LEU A 1 178 ? -4.235  5.886   40.096  1.00 11.65 ? 852 LEU B CD1 1 
ATOM   1396 C CD2 . LEU A 1 178 ? -3.995  3.821   38.529  1.00 15.04 ? 852 LEU B CD2 1 
ATOM   1397 N N   . ILE A 1 179 ? -6.097  2.705   42.827  1.00 16.14 ? 853 ILE B N   1 
ATOM   1398 C CA  . ILE A 1 179 ? -7.530  2.500   43.091  1.00 16.57 ? 853 ILE B CA  1 
ATOM   1399 C C   . ILE A 1 179 ? -7.997  3.280   44.311  1.00 17.08 ? 853 ILE B C   1 
ATOM   1400 O O   . ILE A 1 179 ? -9.047  3.945   44.241  1.00 18.23 ? 853 ILE B O   1 
ATOM   1401 C CB  . ILE A 1 179 ? -7.884  1.002   43.168  1.00 15.98 ? 853 ILE B CB  1 
ATOM   1402 C CG1 . ILE A 1 179 ? -7.767  0.401   41.765  1.00 14.83 ? 853 ILE B CG1 1 
ATOM   1403 C CG2 . ILE A 1 179 ? -9.328  0.775   43.736  1.00 17.17 ? 853 ILE B CG2 1 
ATOM   1404 C CD1 . ILE A 1 179 ? -7.697  -1.186  41.755  1.00 15.41 ? 853 ILE B CD1 1 
ATOM   1405 N N   . LYS A 1 180 ? -7.211  3.251   45.398  1.00 17.07 ? 854 LYS B N   1 
ATOM   1406 C CA  . LYS A 1 180 ? -7.556  4.008   46.608  1.00 17.20 ? 854 LYS B CA  1 
ATOM   1407 C C   . LYS A 1 180 ? -7.521  5.538   46.380  1.00 16.88 ? 854 LYS B C   1 
ATOM   1408 O O   . LYS A 1 180 ? -8.359  6.292   46.900  1.00 16.14 ? 854 LYS B O   1 
ATOM   1409 C CB  . LYS A 1 180 ? -6.629  3.642   47.787  1.00 15.94 ? 854 LYS B CB  1 
ATOM   1410 C CG  . LYS A 1 180 ? -6.656  2.221   48.297  1.00 19.36 ? 854 LYS B CG  1 
ATOM   1411 C CD  . LYS A 1 180 ? -5.601  2.163   49.425  1.00 22.89 ? 854 LYS B CD  1 
ATOM   1412 C CE  . LYS A 1 180 ? -5.236  0.791   49.796  1.00 26.55 ? 854 LYS B CE  1 
ATOM   1413 N NZ  . LYS A 1 180 ? -3.943  0.899   50.522  1.00 24.67 ? 854 LYS B NZ  1 
ATOM   1414 N N   . ALA A 1 181 ? -6.527  5.995   45.609  1.00 17.34 ? 855 ALA B N   1 
ATOM   1415 C CA  . ALA A 1 181 ? -6.365  7.415   45.249  1.00 17.74 ? 855 ALA B CA  1 
ATOM   1416 C C   . ALA A 1 181 ? -7.604  7.904   44.466  1.00 18.11 ? 855 ALA B C   1 
ATOM   1417 O O   . ALA A 1 181 ? -8.147  8.969   44.727  1.00 18.40 ? 855 ALA B O   1 
ATOM   1418 C CB  . ALA A 1 181 ? -5.098  7.579   44.367  1.00 17.09 ? 855 ALA B CB  1 
ATOM   1419 N N   . ILE A 1 182 ? -8.038  7.117   43.490  1.00 19.47 ? 856 ILE B N   1 
ATOM   1420 C CA  . ILE A 1 182 ? -9.293  7.388   42.775  1.00 19.51 ? 856 ILE B CA  1 
ATOM   1421 C C   . ILE A 1 182 ? -10.480 7.473   43.745  1.00 21.23 ? 856 ILE B C   1 
ATOM   1422 O O   . ILE A 1 182 ? -11.317 8.357   43.616  1.00 21.51 ? 856 ILE B O   1 
ATOM   1423 C CB  . ILE A 1 182 ? -9.593  6.309   41.697  1.00 19.67 ? 856 ILE B CB  1 
ATOM   1424 C CG1 . ILE A 1 182 ? -8.597  6.418   40.537  1.00 18.39 ? 856 ILE B CG1 1 
ATOM   1425 C CG2 . ILE A 1 182 ? -11.014 6.507   41.115  1.00 20.25 ? 856 ILE B CG2 1 
ATOM   1426 C CD1 . ILE A 1 182 ? -8.635  5.167   39.628  1.00 17.48 ? 856 ILE B CD1 1 
ATOM   1427 N N   . GLY A 1 183 ? -10.578 6.527   44.677  1.00 22.21 ? 857 GLY B N   1 
ATOM   1428 C CA  . GLY A 1 183 ? -11.710 6.503   45.610  1.00 24.09 ? 857 GLY B CA  1 
ATOM   1429 C C   . GLY A 1 183 ? -11.802 7.729   46.523  1.00 25.52 ? 857 GLY B C   1 
ATOM   1430 O O   . GLY A 1 183 ? -12.848 7.976   47.141  1.00 24.83 ? 857 GLY B O   1 
ATOM   1431 N N   . LEU A 1 184 ? -10.722 8.516   46.599  1.00 26.62 ? 858 LEU B N   1 
ATOM   1432 C CA  . LEU A 1 184 ? -10.701 9.751   47.412  1.00 27.62 ? 858 LEU B CA  1 
ATOM   1433 C C   . LEU A 1 184 ? -11.682 10.819  46.891  1.00 29.95 ? 858 LEU B C   1 
ATOM   1434 O O   . LEU A 1 184 ? -12.120 11.693  47.642  1.00 29.10 ? 858 LEU B O   1 
ATOM   1435 C CB  . LEU A 1 184 ? -9.278  10.357  47.480  1.00 27.23 ? 858 LEU B CB  1 
ATOM   1436 C CG  . LEU A 1 184 ? -8.180  9.557   48.172  1.00 24.96 ? 858 LEU B CG  1 
ATOM   1437 C CD1 . LEU A 1 184 ? -6.817  10.297  48.048  1.00 25.44 ? 858 LEU B CD1 1 
ATOM   1438 C CD2 . LEU A 1 184 ? -8.593  9.314   49.627  1.00 25.17 ? 858 LEU B CD2 1 
ATOM   1439 N N   . ARG A 1 185 ? -12.006 10.759  45.601  1.00 32.13 ? 859 ARG B N   1 
ATOM   1440 C CA  . ARG A 1 185 ? -12.842 11.785  44.992  1.00 35.51 ? 859 ARG B CA  1 
ATOM   1441 C C   . ARG A 1 185 ? -14.006 11.179  44.240  1.00 37.60 ? 859 ARG B C   1 
ATOM   1442 O O   . ARG A 1 185 ? -15.157 11.645  44.340  1.00 38.18 ? 859 ARG B O   1 
ATOM   1443 C CB  . ARG A 1 185 ? -12.005 12.642  44.049  1.00 36.05 ? 859 ARG B CB  1 
ATOM   1444 C CG  . ARG A 1 185 ? -11.239 13.700  44.806  1.00 38.90 ? 859 ARG B CG  1 
ATOM   1445 C CD  . ARG A 1 185 ? -10.231 14.487  43.982  1.00 42.11 ? 859 ARG B CD  1 
ATOM   1446 N NE  . ARG A 1 185 ? -9.129  14.820  44.874  1.00 44.58 ? 859 ARG B NE  1 
ATOM   1447 C CZ  . ARG A 1 185 ? -8.342  15.880  44.771  1.00 46.68 ? 859 ARG B CZ  1 
ATOM   1448 N NH1 . ARG A 1 185 ? -8.507  16.760  43.778  1.00 48.69 ? 859 ARG B NH1 1 
ATOM   1449 N NH2 . ARG A 1 185 ? -7.376  16.050  45.668  1.00 44.39 ? 859 ARG B NH2 1 
ATOM   1450 N N   . GLN A 1 186 ? -13.696 10.140  43.473  1.00 39.27 ? 860 GLN B N   1 
ATOM   1451 C CA  . GLN A 1 186 ? -14.675 9.483   42.627  1.00 41.02 ? 860 GLN B CA  1 
ATOM   1452 C C   . GLN A 1 186 ? -15.450 8.535   43.506  1.00 41.91 ? 860 GLN B C   1 
ATOM   1453 O O   . GLN A 1 186 ? -15.013 7.417   43.816  1.00 42.22 ? 860 GLN B O   1 
ATOM   1454 C CB  . GLN A 1 186 ? -14.023 8.785   41.436  1.00 41.22 ? 860 GLN B CB  1 
ATOM   1455 C CG  . GLN A 1 186 ? -12.930 9.623   40.743  1.00 42.61 ? 860 GLN B CG  1 
ATOM   1456 C CD  . GLN A 1 186 ? -13.454 10.875  40.059  1.00 44.58 ? 860 GLN B CD  1 
ATOM   1457 O OE1 . GLN A 1 186 ? -12.763 11.894  39.995  1.00 44.29 ? 860 GLN B OE1 1 
ATOM   1458 N NE2 . GLN A 1 186 ? -14.680 10.802  39.541  1.00 45.45 ? 860 GLN B NE2 1 
ATOM   1459 N N   . LYS A 1 187 ? -16.591 9.052   43.949  1.00 42.47 ? 861 LYS B N   1 
ATOM   1460 C CA  . LYS A 1 187 ? -17.479 8.358   44.832  1.00 43.06 ? 861 LYS B CA  1 
ATOM   1461 C C   . LYS A 1 187 ? -18.504 7.707   43.909  1.00 42.32 ? 861 LYS B C   1 
ATOM   1462 O O   . LYS A 1 187 ? -19.024 8.334   42.971  1.00 42.78 ? 861 LYS B O   1 
ATOM   1463 C CB  . LYS A 1 187 ? -18.103 9.363   45.810  1.00 42.84 ? 861 LYS B CB  1 
ATOM   1464 C CG  . LYS A 1 187 ? -17.059 10.195  46.550  1.00 43.35 ? 861 LYS B CG  1 
ATOM   1465 C CD  . LYS A 1 187 ? -17.666 11.276  47.435  1.00 45.49 ? 861 LYS B CD  1 
ATOM   1466 C CE  . LYS A 1 187 ? -18.374 12.390  46.613  1.00 49.88 ? 861 LYS B CE  1 
ATOM   1467 N NZ  . LYS A 1 187 ? -19.272 13.237  47.472  1.00 50.64 ? 861 LYS B NZ  1 
ATOM   1468 N N   . GLY A 1 188 ? -18.752 6.432   44.142  1.00 41.07 ? 862 GLY B N   1 
ATOM   1469 C CA  . GLY A 1 188 ? -19.662 5.693   43.291  1.00 39.29 ? 862 GLY B CA  1 
ATOM   1470 C C   . GLY A 1 188 ? -18.904 4.695   42.447  1.00 38.02 ? 862 GLY B C   1 
ATOM   1471 O O   . GLY A 1 188 ? -17.881 5.011   41.818  1.00 36.31 ? 862 GLY B O   1 
ATOM   1472 N N   . VAL A 1 189 ? -19.427 3.485   42.420  1.00 36.99 ? 863 VAL B N   1 
ATOM   1473 C CA  . VAL A 1 189 ? -18.790 2.388   41.696  1.00 37.11 ? 863 VAL B CA  1 
ATOM   1474 C C   . VAL A 1 189 ? -18.603 2.673   40.169  1.00 36.29 ? 863 VAL B C   1 
ATOM   1475 O O   . VAL A 1 189 ? -17.556 2.361   39.590  1.00 36.22 ? 863 VAL B O   1 
ATOM   1476 C CB  . VAL A 1 189 ? -19.550 1.060   41.975  1.00 37.19 ? 863 VAL B CB  1 
ATOM   1477 C CG1 . VAL A 1 189 ? -19.897 0.956   43.485  1.00 38.68 ? 863 VAL B CG1 1 
ATOM   1478 C CG2 . VAL A 1 189 ? -20.817 1.006   41.189  1.00 38.25 ? 863 VAL B CG2 1 
ATOM   1479 N N   . VAL A 1 190 ? -19.601 3.281   39.532  1.00 35.19 ? 864 VAL B N   1 
ATOM   1480 C CA  . VAL A 1 190 ? -19.546 3.507   38.080  1.00 34.62 ? 864 VAL B CA  1 
ATOM   1481 C C   . VAL A 1 190 ? -18.516 4.592   37.711  1.00 33.11 ? 864 VAL B C   1 
ATOM   1482 O O   . VAL A 1 190 ? -17.708 4.372   36.838  1.00 32.59 ? 864 VAL B O   1 
ATOM   1483 C CB  . VAL A 1 190 ? -20.970 3.736   37.417  1.00 34.77 ? 864 VAL B CB  1 
ATOM   1484 C CG1 . VAL A 1 190 ? -21.600 5.010   37.888  1.00 36.62 ? 864 VAL B CG1 1 
ATOM   1485 C CG2 . VAL A 1 190 ? -20.866 3.745   35.895  1.00 36.97 ? 864 VAL B CG2 1 
ATOM   1486 N N   . SER A 1 191 ? -18.552 5.736   38.394  1.00 31.65 ? 865 SER B N   1 
ATOM   1487 C CA  . SER A 1 191 ? -17.545 6.787   38.222  1.00 31.69 ? 865 SER B CA  1 
ATOM   1488 C C   . SER A 1 191 ? -16.125 6.292   38.544  1.00 30.31 ? 865 SER B C   1 
ATOM   1489 O O   . SER A 1 191 ? -15.198 6.522   37.765  1.00 29.05 ? 865 SER B O   1 
ATOM   1490 C CB  . SER A 1 191 ? -17.855 8.002   39.115  1.00 32.61 ? 865 SER B CB  1 
ATOM   1491 O OG  . SER A 1 191 ? -17.037 9.101   38.726  1.00 36.91 ? 865 SER B OG  1 
ATOM   1492 N N   . SER A 1 192 ? -15.956 5.609   39.675  1.00 28.29 ? 866 SER B N   1 
ATOM   1493 C CA  . SER A 1 192 ? -14.617 5.218   40.085  1.00 28.37 ? 866 SER B CA  1 
ATOM   1494 C C   . SER A 1 192 ? -14.060 4.108   39.171  1.00 27.45 ? 866 SER B C   1 
ATOM   1495 O O   . SER A 1 192 ? -12.858 4.059   38.884  1.00 25.73 ? 866 SER B O   1 
ATOM   1496 C CB  . SER A 1 192 ? -14.559 4.892   41.592  1.00 28.78 ? 866 SER B CB  1 
ATOM   1497 O OG  . SER A 1 192 ? -15.139 3.634   41.885  1.00 32.85 ? 866 SER B OG  1 
ATOM   1498 N N   . SER A 1 193 ? -14.956 3.263   38.672  1.00 27.29 ? 867 SER B N   1 
ATOM   1499 C CA  . SER A 1 193 ? -14.640 2.227   37.656  1.00 29.02 ? 867 SER B CA  1 
ATOM   1500 C C   . SER A 1 193 ? -14.213 2.806   36.292  1.00 28.10 ? 867 SER B C   1 
ATOM   1501 O O   . SER A 1 193 ? -13.210 2.368   35.692  1.00 27.83 ? 867 SER B O   1 
ATOM   1502 C CB  . SER A 1 193 ? -15.838 1.296   37.459  1.00 29.38 ? 867 SER B CB  1 
ATOM   1503 O OG  . SER A 1 193 ? -15.373 -0.042  37.441  1.00 36.54 ? 867 SER B OG  1 
ATOM   1504 N N   . GLN A 1 194 ? -14.989 3.763   35.808  1.00 27.12 ? 868 GLN B N   1 
ATOM   1505 C CA  . GLN A 1 194 ? -14.658 4.534   34.614  1.00 28.51 ? 868 GLN B CA  1 
ATOM   1506 C C   . GLN A 1 194 ? -13.319 5.295   34.753  1.00 26.18 ? 868 GLN B C   1 
ATOM   1507 O O   . GLN A 1 194 ? -12.518 5.327   33.807  1.00 25.75 ? 868 GLN B O   1 
ATOM   1508 C CB  . GLN A 1 194 ? -15.765 5.548   34.313  1.00 28.06 ? 868 GLN B CB  1 
ATOM   1509 C CG  . GLN A 1 194 ? -17.091 4.919   33.815  1.00 33.43 ? 868 GLN B CG  1 
ATOM   1510 C CD  . GLN A 1 194 ? -17.986 5.903   33.030  1.00 34.93 ? 868 GLN B CD  1 
ATOM   1511 O OE1 . GLN A 1 194 ? -17.560 6.493   32.012  1.00 44.57 ? 868 GLN B OE1 1 
ATOM   1512 N NE2 . GLN A 1 194 ? -19.228 6.068   33.486  1.00 41.31 ? 868 GLN B NE2 1 
ATOM   1513 N N   . ARG A 1 195 ? -13.109 5.919   35.919  1.00 23.48 ? 869 ARG B N   1 
ATOM   1514 C CA  . ARG A 1 195 ? -11.889 6.660   36.212  1.00 21.65 ? 869 ARG B CA  1 
ATOM   1515 C C   . ARG A 1 195 ? -10.646 5.764   36.159  1.00 20.42 ? 869 ARG B C   1 
ATOM   1516 O O   . ARG A 1 195 ? -9.599  6.163   35.625  1.00 19.37 ? 869 ARG B O   1 
ATOM   1517 C CB  . ARG A 1 195 ? -11.992 7.355   37.578  1.00 21.49 ? 869 ARG B CB  1 
ATOM   1518 C CG  . ARG A 1 195 ? -10.779 8.212   37.939  1.00 21.09 ? 869 ARG B CG  1 
ATOM   1519 C CD  . ARG A 1 195 ? -10.885 9.530   37.305  1.00 24.66 ? 869 ARG B CD  1 
ATOM   1520 N NE  . ARG A 1 195 ? -9.885  10.480  37.778  1.00 24.99 ? 869 ARG B NE  1 
ATOM   1521 C CZ  . ARG A 1 195 ? -9.718  11.676  37.240  1.00 25.43 ? 869 ARG B CZ  1 
ATOM   1522 N NH1 . ARG A 1 195 ? -10.475 12.036  36.209  1.00 25.79 ? 869 ARG B NH1 1 
ATOM   1523 N NH2 . ARG A 1 195 ? -8.800  12.498  37.717  1.00 24.20 ? 869 ARG B NH2 1 
ATOM   1524 N N   . PHE A 1 196 ? -10.739 4.575   36.733  1.00 19.05 ? 870 PHE B N   1 
ATOM   1525 C CA  . PHE A 1 196 ? -9.642  3.602   36.654  1.00 20.33 ? 870 PHE B CA  1 
ATOM   1526 C C   . PHE A 1 196 ? -9.334  3.257   35.178  1.00 20.39 ? 870 PHE B C   1 
ATOM   1527 O O   . PHE A 1 196 ? -8.173  3.196   34.774  1.00 18.11 ? 870 PHE B O   1 
ATOM   1528 C CB  . PHE A 1 196 ? -9.956  2.335   37.474  1.00 20.45 ? 870 PHE B CB  1 
ATOM   1529 C CG  . PHE A 1 196 ? -8.886  1.270   37.389  1.00 21.05 ? 870 PHE B CG  1 
ATOM   1530 C CD1 . PHE A 1 196 ? -7.807  1.280   38.265  1.00 22.23 ? 870 PHE B CD1 1 
ATOM   1531 C CD2 . PHE A 1 196 ? -8.958  0.260   36.429  1.00 21.90 ? 870 PHE B CD2 1 
ATOM   1532 C CE1 . PHE A 1 196 ? -6.828  0.302   38.179  1.00 20.16 ? 870 PHE B CE1 1 
ATOM   1533 C CE2 . PHE A 1 196 ? -7.981  -0.725  36.340  1.00 19.94 ? 870 PHE B CE2 1 
ATOM   1534 C CZ  . PHE A 1 196 ? -6.919  -0.697  37.212  1.00 21.11 ? 870 PHE B CZ  1 
ATOM   1535 N N   . TYR A 1 197 ? -10.374 3.026   34.381  1.00 20.29 ? 871 TYR B N   1 
ATOM   1536 C CA  . TYR A 1 197 ? -10.186 2.823   32.943  1.00 21.64 ? 871 TYR B CA  1 
ATOM   1537 C C   . TYR A 1 197 ? -9.417  4.008   32.324  1.00 20.00 ? 871 TYR B C   1 
ATOM   1538 O O   . TYR A 1 197 ? -8.427  3.814   31.625  1.00 19.15 ? 871 TYR B O   1 
ATOM   1539 C CB  . TYR A 1 197 ? -11.529 2.612   32.211  1.00 23.76 ? 871 TYR B CB  1 
ATOM   1540 C CG  . TYR A 1 197 ? -11.321 2.442   30.713  1.00 27.91 ? 871 TYR B CG  1 
ATOM   1541 C CD1 . TYR A 1 197 ? -11.046 1.189   30.163  1.00 29.92 ? 871 TYR B CD1 1 
ATOM   1542 C CD2 . TYR A 1 197 ? -11.345 3.556   29.852  1.00 29.63 ? 871 TYR B CD2 1 
ATOM   1543 C CE1 . TYR A 1 197 ? -10.816 1.038   28.755  1.00 31.86 ? 871 TYR B CE1 1 
ATOM   1544 C CE2 . TYR A 1 197 ? -11.117 3.416   28.476  1.00 31.42 ? 871 TYR B CE2 1 
ATOM   1545 C CZ  . TYR A 1 197 ? -10.851 2.153   27.939  1.00 31.45 ? 871 TYR B CZ  1 
ATOM   1546 O OH  . TYR A 1 197 ? -10.626 2.028   26.559  1.00 34.13 ? 871 TYR B OH  1 
ATOM   1547 N N   . GLN A 1 198 ? -9.895  5.227   32.558  1.00 18.81 ? 872 GLN B N   1 
ATOM   1548 C CA  . GLN A 1 198 ? -9.346  6.399   31.871  1.00 19.35 ? 872 GLN B CA  1 
ATOM   1549 C C   . GLN A 1 198 ? -7.865  6.621   32.243  1.00 18.74 ? 872 GLN B C   1 
ATOM   1550 O O   . GLN A 1 198 ? -7.033  6.960   31.386  1.00 16.90 ? 872 GLN B O   1 
ATOM   1551 C CB  . GLN A 1 198 ? -10.081 7.639   32.303  1.00 20.02 ? 872 GLN B CB  1 
ATOM   1552 C CG  . GLN A 1 198 ? -11.570 7.664   31.923  1.00 24.74 ? 872 GLN B CG  1 
ATOM   1553 C CD  . GLN A 1 198 ? -12.216 8.925   32.425  1.00 31.03 ? 872 GLN B CD  1 
ATOM   1554 O OE1 . GLN A 1 198 ? -12.271 9.193   33.637  1.00 32.94 ? 872 GLN B OE1 1 
ATOM   1555 N NE2 . GLN A 1 198 ? -12.665 9.746   31.494  1.00 34.37 ? 872 GLN B NE2 1 
ATOM   1556 N N   . LEU A 1 199 ? -7.551  6.444   33.522  1.00 16.56 ? 873 LEU B N   1 
ATOM   1557 C CA  . LEU A 1 199 ? -6.201  6.748   33.986  1.00 17.63 ? 873 LEU B CA  1 
ATOM   1558 C C   . LEU A 1 199 ? -5.222  5.711   33.490  1.00 17.90 ? 873 LEU B C   1 
ATOM   1559 O O   . LEU A 1 199 ? -4.097  6.052   33.084  1.00 16.82 ? 873 LEU B O   1 
ATOM   1560 C CB  . LEU A 1 199 ? -6.156  6.922   35.513  1.00 17.87 ? 873 LEU B CB  1 
ATOM   1561 C CG  . LEU A 1 199 ? -6.980  8.096   36.077  1.00 18.30 ? 873 LEU B CG  1 
ATOM   1562 C CD1 . LEU A 1 199 ? -6.812  8.189   37.585  1.00 17.02 ? 873 LEU B CD1 1 
ATOM   1563 C CD2 . LEU A 1 199 ? -6.659  9.468   35.402  1.00 20.89 ? 873 LEU B CD2 1 
ATOM   1564 N N   . THR A 1 200 ? -5.652  4.449   33.515  1.00 17.72 ? 874 THR B N   1 
ATOM   1565 C CA  . THR A 1 200 ? -4.818  3.354   33.066  1.00 18.39 ? 874 THR B CA  1 
ATOM   1566 C C   . THR A 1 200 ? -4.692  3.345   31.514  1.00 19.66 ? 874 THR B C   1 
ATOM   1567 O O   . THR A 1 200 ? -3.585  3.109   30.946  1.00 20.25 ? 874 THR B O   1 
ATOM   1568 C CB  . THR A 1 200 ? -5.322  2.000   33.614  1.00 18.00 ? 874 THR B CB  1 
ATOM   1569 O OG1 . THR A 1 200 ? -6.668  1.791   33.194  1.00 18.27 ? 874 THR B OG1 1 
ATOM   1570 C CG2 . THR A 1 200 ? -5.223  1.932   35.176  1.00 16.90 ? 874 THR B CG2 1 
ATOM   1571 N N   . LYS A 1 201 ? -5.788  3.659   30.835  1.00 20.23 ? 875 LYS B N   1 
ATOM   1572 C CA  . LYS A 1 201 ? -5.743  3.952   29.383  1.00 20.95 ? 875 LYS B CA  1 
ATOM   1573 C C   . LYS A 1 201 ? -4.722  5.036   29.039  1.00 20.92 ? 875 LYS B C   1 
ATOM   1574 O O   . LYS A 1 201 ? -3.974  4.842   28.105  1.00 21.29 ? 875 LYS B O   1 
ATOM   1575 C CB  . LYS A 1 201 ? -7.116  4.321   28.801  1.00 20.80 ? 875 LYS B CB  1 
ATOM   1576 C CG  . LYS A 1 201 ? -7.194  4.263   27.270  1.00 24.47 ? 875 LYS B CG  1 
ATOM   1577 C CD  . LYS A 1 201 ? -6.831  2.875   26.734  1.00 27.88 ? 875 LYS B CD  1 
ATOM   1578 C CE  . LYS A 1 201 ? -6.769  2.865   25.213  1.00 30.88 ? 875 LYS B CE  1 
ATOM   1579 N NZ  . LYS A 1 201 ? -6.797  1.444   24.757  1.00 35.44 ? 875 LYS B NZ  1 
ATOM   1580 N N   . LEU A 1 202 ? -4.706  6.163   29.770  1.00 20.85 ? 876 LEU B N   1 
ATOM   1581 C CA  . LEU A 1 202 ? -3.696  7.214   29.592  1.00 20.80 ? 876 LEU B CA  1 
ATOM   1582 C C   . LEU A 1 202 ? -2.275  6.625   29.669  1.00 20.34 ? 876 LEU B C   1 
ATOM   1583 O O   . LEU A 1 202 ? -1.422  6.901   28.784  1.00 19.35 ? 876 LEU B O   1 
ATOM   1584 C CB  . LEU A 1 202 ? -3.878  8.339   30.633  1.00 20.31 ? 876 LEU B CB  1 
ATOM   1585 C CG  . LEU A 1 202 ? -3.081  9.657   30.622  1.00 21.71 ? 876 LEU B CG  1 
ATOM   1586 C CD1 . LEU A 1 202 ? -3.676  10.646  31.603  1.00 23.01 ? 876 LEU B CD1 1 
ATOM   1587 C CD2 . LEU A 1 202 ? -1.595  9.506   30.951  1.00 21.69 ? 876 LEU B CD2 1 
ATOM   1588 N N   . LEU A 1 203 ? -2.016  5.817   30.711  1.00 18.76 ? 877 LEU B N   1 
ATOM   1589 C CA  . LEU A 1 203 ? -0.706  5.176   30.835  1.00 18.37 ? 877 LEU B CA  1 
ATOM   1590 C C   . LEU A 1 203 ? -0.375  4.270   29.636  1.00 18.59 ? 877 LEU B C   1 
ATOM   1591 O O   . LEU A 1 203 ? 0.769   4.304   29.119  1.00 16.69 ? 877 LEU B O   1 
ATOM   1592 C CB  . LEU A 1 203 ? -0.546  4.435   32.168  1.00 17.43 ? 877 LEU B CB  1 
ATOM   1593 C CG  . LEU A 1 203 ? -0.645  5.343   33.410  1.00 16.91 ? 877 LEU B CG  1 
ATOM   1594 C CD1 . LEU A 1 203 ? -0.570  4.442   34.655  1.00 19.47 ? 877 LEU B CD1 1 
ATOM   1595 C CD2 . LEU A 1 203 ? 0.438   6.461   33.478  1.00 16.45 ? 877 LEU B CD2 1 
ATOM   1596 N N   . ASP A 1 204 ? -1.340  3.452   29.210  1.00 18.71 ? 878 ASP B N   1 
ATOM   1597 C CA  . ASP A 1 204 ? -1.177  2.633   27.982  1.00 19.90 ? 878 ASP B CA  1 
ATOM   1598 C C   . ASP A 1 204 ? -0.804  3.515   26.796  1.00 19.97 ? 878 ASP B C   1 
ATOM   1599 O O   . ASP A 1 204 ? 0.115   3.186   26.058  1.00 20.87 ? 878 ASP B O   1 
ATOM   1600 C CB  . ASP A 1 204 ? -2.457  1.860   27.612  1.00 19.05 ? 878 ASP B CB  1 
ATOM   1601 C CG  . ASP A 1 204 ? -2.714  0.622   28.475  1.00 20.93 ? 878 ASP B CG  1 
ATOM   1602 O OD1 . ASP A 1 204 ? -1.942  0.277   29.398  1.00 16.27 ? 878 ASP B OD1 1 
ATOM   1603 O OD2 . ASP A 1 204 ? -3.764  -0.028  28.222  1.00 23.77 ? 878 ASP B OD2 1 
ATOM   1604 N N   . ASN A 1 205 ? -1.507  4.633   26.641  1.00 20.32 ? 879 ASN B N   1 
ATOM   1605 C CA  . ASN A 1 205 ? -1.307  5.570   25.535  1.00 22.25 ? 879 ASN B CA  1 
ATOM   1606 C C   . ASN A 1 205 ? 0.078   6.236   25.551  1.00 22.91 ? 879 ASN B C   1 
ATOM   1607 O O   . ASN A 1 205 ? 0.596   6.617   24.488  1.00 23.88 ? 879 ASN B O   1 
ATOM   1608 C CB  . ASN A 1 205 ? -2.406  6.650   25.501  1.00 21.07 ? 879 ASN B CB  1 
ATOM   1609 C CG  . ASN A 1 205 ? -3.767  6.106   25.061  1.00 23.78 ? 879 ASN B CG  1 
ATOM   1610 O OD1 . ASN A 1 205 ? -3.874  5.012   24.511  1.00 22.88 ? 879 ASN B OD1 1 
ATOM   1611 N ND2 . ASN A 1 205 ? -4.820  6.890   25.313  1.00 22.20 ? 879 ASN B ND2 1 
ATOM   1612 N N   . LEU A 1 206 ? 0.677   6.372   26.736  1.00 22.26 ? 880 LEU B N   1 
ATOM   1613 C CA  . LEU A 1 206 ? 2.038   6.914   26.836  1.00 23.33 ? 880 LEU B CA  1 
ATOM   1614 C C   . LEU A 1 206 ? 3.114   6.118   26.103  1.00 23.37 ? 880 LEU B C   1 
ATOM   1615 O O   . LEU A 1 206 ? 4.052   6.724   25.625  1.00 23.27 ? 880 LEU B O   1 
ATOM   1616 C CB  . LEU A 1 206 ? 2.488   7.066   28.271  1.00 22.88 ? 880 LEU B CB  1 
ATOM   1617 C CG  . LEU A 1 206 ? 1.969   8.226   29.111  1.00 27.37 ? 880 LEU B CG  1 
ATOM   1618 C CD1 . LEU A 1 206 ? 2.797   8.243   30.412  1.00 24.66 ? 880 LEU B CD1 1 
ATOM   1619 C CD2 . LEU A 1 206 ? 2.034   9.586   28.356  1.00 28.29 ? 880 LEU B CD2 1 
ATOM   1620 N N   . HIS A 1 207 ? 3.003   4.771   26.059  1.00 23.78 ? 881 HIS B N   1 
ATOM   1621 C CA  . HIS A 1 207 ? 3.964   3.915   25.324  1.00 23.37 ? 881 HIS B CA  1 
ATOM   1622 C C   . HIS A 1 207 ? 4.220   4.474   23.913  1.00 23.78 ? 881 HIS B C   1 
ATOM   1623 O O   . HIS A 1 207 ? 5.362   4.643   23.483  1.00 23.74 ? 881 HIS B O   1 
ATOM   1624 C CB  . HIS A 1 207 ? 3.519   2.431   25.293  1.00 23.85 ? 881 HIS B CB  1 
ATOM   1625 C CG  . HIS A 1 207 ? 3.821   1.665   26.557  1.00 24.88 ? 881 HIS B CG  1 
ATOM   1626 N ND1 . HIS A 1 207 ? 2.863   0.947   27.255  1.00 27.25 ? 881 HIS B ND1 1 
ATOM   1627 C CD2 . HIS A 1 207 ? 4.978   1.504   27.249  1.00 25.67 ? 881 HIS B CD2 1 
ATOM   1628 C CE1 . HIS A 1 207 ? 3.419   0.358   28.301  1.00 26.18 ? 881 HIS B CE1 1 
ATOM   1629 N NE2 . HIS A 1 207 ? 4.707   0.675   28.319  1.00 28.17 ? 881 HIS B NE2 1 
ATOM   1630 N N   . ASP A 1 208 ? 3.154   4.846   23.223  1.00 23.38 ? 882 ASP B N   1 
ATOM   1631 C CA  . ASP A 1 208 ? 3.260   5.333   21.863  1.00 23.31 ? 882 ASP B CA  1 
ATOM   1632 C C   . ASP A 1 208 ? 3.825   6.730   21.743  1.00 21.52 ? 882 ASP B C   1 
ATOM   1633 O O   . ASP A 1 208 ? 4.658   6.991   20.877  1.00 21.94 ? 882 ASP B O   1 
ATOM   1634 C CB  . ASP A 1 208 ? 1.872   5.280   21.232  1.00 25.83 ? 882 ASP B CB  1 
ATOM   1635 C CG  . ASP A 1 208 ? 1.231   3.927   21.421  1.00 31.01 ? 882 ASP B CG  1 
ATOM   1636 O OD1 . ASP A 1 208 ? 1.467   3.096   20.496  1.00 33.98 ? 882 ASP B OD1 1 
ATOM   1637 O OD2 . ASP A 1 208 ? 0.625   3.668   22.537  1.00 33.32 ? 882 ASP B OD2 1 
ATOM   1638 N N   . LEU A 1 209 ? 3.395   7.620   22.626  1.00 19.78 ? 883 LEU B N   1 
ATOM   1639 C CA  . LEU A 1 209 ? 3.922   8.969   22.690  1.00 18.61 ? 883 LEU B CA  1 
ATOM   1640 C C   . LEU A 1 209 ? 5.427   8.933   22.995  1.00 17.22 ? 883 LEU B C   1 
ATOM   1641 O O   . LEU A 1 209 ? 6.219   9.608   22.355  1.00 15.49 ? 883 LEU B O   1 
ATOM   1642 C CB  . LEU A 1 209 ? 3.157   9.770   23.750  1.00 18.40 ? 883 LEU B CB  1 
ATOM   1643 C CG  . LEU A 1 209 ? 3.415   11.266  23.867  1.00 20.93 ? 883 LEU B CG  1 
ATOM   1644 C CD1 . LEU A 1 209 ? 2.134   11.915  24.437  1.00 23.02 ? 883 LEU B CD1 1 
ATOM   1645 C CD2 . LEU A 1 209 ? 4.666   11.675  24.709  1.00 21.04 ? 883 LEU B CD2 1 
ATOM   1646 N N   . VAL A 1 210 ? 5.812   8.158   24.000  1.00 16.33 ? 884 VAL B N   1 
ATOM   1647 C CA  . VAL A 1 210 ? 7.227   7.976   24.358  1.00 14.72 ? 884 VAL B CA  1 
ATOM   1648 C C   . VAL A 1 210 ? 8.100   7.340   23.252  1.00 14.63 ? 884 VAL B C   1 
ATOM   1649 O O   . VAL A 1 210 ? 9.298   7.634   23.123  1.00 14.00 ? 884 VAL B O   1 
ATOM   1650 C CB  . VAL A 1 210 ? 7.324   7.192   25.687  1.00 15.38 ? 884 VAL B CB  1 
ATOM   1651 C CG1 . VAL A 1 210 ? 8.776   6.780   26.011  1.00 13.25 ? 884 VAL B CG1 1 
ATOM   1652 C CG2 . VAL A 1 210 ? 6.732   8.080   26.833  1.00 14.13 ? 884 VAL B CG2 1 
ATOM   1653 N N   . LYS A 1 211 ? 7.507   6.488   22.440  1.00 15.53 ? 885 LYS B N   1 
ATOM   1654 C CA  . LYS A 1 211 ? 8.229   5.981   21.271  1.00 16.48 ? 885 LYS B CA  1 
ATOM   1655 C C   . LYS A 1 211 ? 8.709   7.080   20.297  1.00 16.35 ? 885 LYS B C   1 
ATOM   1656 O O   . LYS A 1 211 ? 9.854   7.017   19.814  1.00 15.06 ? 885 LYS B O   1 
ATOM   1657 C CB  . LYS A 1 211 ? 7.424   4.925   20.560  1.00 17.15 ? 885 LYS B CB  1 
ATOM   1658 C CG  . LYS A 1 211 ? 8.218   4.253   19.427  1.00 19.44 ? 885 LYS B CG  1 
ATOM   1659 C CD  . LYS A 1 211 ? 7.296   3.245   18.728  1.00 26.15 ? 885 LYS B CD  1 
ATOM   1660 C CE  . LYS A 1 211 ? 7.941   2.716   17.442  1.00 31.30 ? 885 LYS B CE  1 
ATOM   1661 N NZ  . LYS A 1 211 ? 7.080   1.601   16.906  1.00 34.31 ? 885 LYS B NZ  1 
ATOM   1662 N N   . GLN A 1 212 ? 7.886   8.095   20.031  1.00 17.62 ? 886 GLN B N   1 
ATOM   1663 C CA  . GLN A 1 212 ? 8.352   9.248   19.222  1.00 18.78 ? 886 GLN B CA  1 
ATOM   1664 C C   . GLN A 1 212 ? 9.540   9.998   19.845  1.00 17.78 ? 886 GLN B C   1 
ATOM   1665 O O   . GLN A 1 212 ? 10.491  10.364  19.154  1.00 15.26 ? 886 GLN B O   1 
ATOM   1666 C CB  . GLN A 1 212 ? 7.222   10.191  18.913  1.00 19.18 ? 886 GLN B CB  1 
ATOM   1667 C CG  . GLN A 1 212 ? 6.141   9.525   18.019  1.00 24.27 ? 886 GLN B CG  1 
ATOM   1668 C CD  . GLN A 1 212 ? 4.819   10.339  17.926  1.00 26.16 ? 886 GLN B CD  1 
ATOM   1669 O OE1 . GLN A 1 212 ? 3.763   9.765   17.655  1.00 38.46 ? 886 GLN B OE1 1 
ATOM   1670 N NE2 . GLN A 1 212 ? 4.881   11.658  18.162  1.00 34.52 ? 886 GLN B NE2 1 
ATOM   1671 N N   . LEU A 1 213 ? 9.484   10.200  21.168  1.00 15.91 ? 887 LEU B N   1 
ATOM   1672 C CA  . LEU A 1 213 ? 10.571  10.832  21.919  1.00 14.59 ? 887 LEU B CA  1 
ATOM   1673 C C   . LEU A 1 213 ? 11.822  9.980   21.878  1.00 13.93 ? 887 LEU B C   1 
ATOM   1674 O O   . LEU A 1 213 ? 12.899  10.492  21.606  1.00 15.64 ? 887 LEU B O   1 
ATOM   1675 C CB  . LEU A 1 213 ? 10.160  11.114  23.370  1.00 14.45 ? 887 LEU B CB  1 
ATOM   1676 C CG  . LEU A 1 213 ? 8.848   11.906  23.538  1.00 16.75 ? 887 LEU B CG  1 
ATOM   1677 C CD1 . LEU A 1 213 ? 8.622   12.280  25.059  1.00 14.77 ? 887 LEU B CD1 1 
ATOM   1678 C CD2 . LEU A 1 213 ? 8.779   13.110  22.635  1.00 14.51 ? 887 LEU B CD2 1 
ATOM   1679 N N   . HIS A 1 214 ? 11.680  8.685   22.138  1.00 12.66 ? 888 HIS B N   1 
ATOM   1680 C CA  . HIS A 1 214 ? 12.789  7.741   22.030  1.00 12.44 ? 888 HIS B CA  1 
ATOM   1681 C C   . HIS A 1 214 ? 13.529  7.787   20.693  1.00 12.16 ? 888 HIS B C   1 
ATOM   1682 O O   . HIS A 1 214 ? 14.773  7.799   20.662  1.00 12.74 ? 888 HIS B O   1 
ATOM   1683 C CB  . HIS A 1 214 ? 12.318  6.301   22.299  1.00 10.89 ? 888 HIS B CB  1 
ATOM   1684 C CG  . HIS A 1 214 ? 12.178  5.973   23.759  1.00 14.44 ? 888 HIS B CG  1 
ATOM   1685 N ND1 . HIS A 1 214 ? 11.511  4.859   24.207  1.00 17.32 ? 888 HIS B ND1 1 
ATOM   1686 C CD2 . HIS A 1 214 ? 12.649  6.595   24.865  1.00 13.87 ? 888 HIS B CD2 1 
ATOM   1687 C CE1 . HIS A 1 214 ? 11.582  4.792   25.526  1.00 17.38 ? 888 HIS B CE1 1 
ATOM   1688 N NE2 . HIS A 1 214 ? 12.268  5.833   25.951  1.00 18.30 ? 888 HIS B NE2 1 
ATOM   1689 N N   . LEU A 1 215 ? 12.774  7.764   19.596  1.00 12.87 ? 889 LEU B N   1 
ATOM   1690 C CA  . LEU A 1 215 ? 13.389  7.765   18.246  1.00 13.51 ? 889 LEU B CA  1 
ATOM   1691 C C   . LEU A 1 215 ? 14.161  9.070   17.989  1.00 13.62 ? 889 LEU B C   1 
ATOM   1692 O O   . LEU A 1 215 ? 15.287  9.046   17.487  1.00 12.88 ? 889 LEU B O   1 
ATOM   1693 C CB  . LEU A 1 215 ? 12.342  7.518   17.156  1.00 12.82 ? 889 LEU B CB  1 
ATOM   1694 C CG  . LEU A 1 215 ? 12.867  7.461   15.681  1.00 13.66 ? 889 LEU B CG  1 
ATOM   1695 C CD1 . LEU A 1 215 ? 14.026  6.484   15.468  1.00 12.59 ? 889 LEU B CD1 1 
ATOM   1696 C CD2 . LEU A 1 215 ? 11.775  7.218   14.639  1.00 14.23 ? 889 LEU B CD2 1 
ATOM   1697 N N   . TYR A 1 216 ? 13.544  10.200  18.347  1.00 13.84 ? 890 TYR B N   1 
ATOM   1698 C CA  . TYR A 1 216 ? 14.165  11.524  18.177  1.00 14.14 ? 890 TYR B CA  1 
ATOM   1699 C C   . TYR A 1 216 ? 15.455  11.616  19.024  1.00 13.40 ? 890 TYR B C   1 
ATOM   1700 O O   . TYR A 1 216 ? 16.495  12.154  18.581  1.00 13.85 ? 890 TYR B O   1 
ATOM   1701 C CB  . TYR A 1 216 ? 13.181  12.646  18.633  1.00 15.14 ? 890 TYR B CB  1 
ATOM   1702 C CG  . TYR A 1 216 ? 13.729  14.061  18.382  1.00 17.39 ? 890 TYR B CG  1 
ATOM   1703 C CD1 . TYR A 1 216 ? 14.640  14.652  19.269  1.00 15.13 ? 890 TYR B CD1 1 
ATOM   1704 C CD2 . TYR A 1 216 ? 13.354  14.785  17.242  1.00 17.99 ? 890 TYR B CD2 1 
ATOM   1705 C CE1 . TYR A 1 216 ? 15.131  15.955  19.032  1.00 18.78 ? 890 TYR B CE1 1 
ATOM   1706 C CE2 . TYR A 1 216 ? 13.862  16.080  16.998  1.00 19.77 ? 890 TYR B CE2 1 
ATOM   1707 C CZ  . TYR A 1 216 ? 14.751  16.639  17.881  1.00 19.09 ? 890 TYR B CZ  1 
ATOM   1708 O OH  . TYR A 1 216 ? 15.268  17.881  17.637  1.00 18.85 ? 890 TYR B OH  1 
ATOM   1709 N N   . CYS A 1 217 ? 15.366  11.138  20.260  1.00 12.88 ? 891 CYS B N   1 
ATOM   1710 C CA  . CYS A 1 217 ? 16.489  11.142  21.190  1.00 12.30 ? 891 CYS B CA  1 
ATOM   1711 C C   . CYS A 1 217 ? 17.622  10.261  20.652  1.00 11.51 ? 891 CYS B C   1 
ATOM   1712 O O   . CYS A 1 217 ? 18.785  10.668  20.577  1.00 12.46 ? 891 CYS B O   1 
ATOM   1713 C CB  . CYS A 1 217 ? 16.030  10.664  22.590  1.00 13.25 ? 891 CYS B CB  1 
ATOM   1714 S SG  . CYS A 1 217 ? 17.417  10.544  23.777  1.00 15.69 ? 891 CYS B SG  1 
ATOM   1715 N N   . LEU A 1 218 ? 17.294  9.055   20.236  1.00 12.44 ? 892 LEU B N   1 
ATOM   1716 C CA  . LEU A 1 218 ? 18.338  8.192   19.637  1.00 11.96 ? 892 LEU B CA  1 
ATOM   1717 C C   . LEU A 1 218 ? 19.008  8.807   18.407  1.00 11.60 ? 892 LEU B C   1 
ATOM   1718 O O   . LEU A 1 218 ? 20.227  8.740   18.296  1.00 11.76 ? 892 LEU B O   1 
ATOM   1719 C CB  . LEU A 1 218 ? 17.812  6.767   19.359  1.00 11.75 ? 892 LEU B CB  1 
ATOM   1720 C CG  . LEU A 1 218 ? 18.836  5.727   18.821  1.00 13.48 ? 892 LEU B CG  1 
ATOM   1721 C CD1 . LEU A 1 218 ? 20.030  5.581   19.762  1.00 14.73 ? 892 LEU B CD1 1 
ATOM   1722 C CD2 . LEU A 1 218 ? 18.145  4.384   18.609  1.00 12.14 ? 892 LEU B CD2 1 
ATOM   1723 N N   . ASN A 1 219 ? 18.220  9.334   17.464  1.00 12.35 ? 893 ASN B N   1 
ATOM   1724 C CA  . ASN A 1 219 ? 18.782  9.948   16.273  1.00 13.49 ? 893 ASN B CA  1 
ATOM   1725 C C   . ASN A 1 219 ? 19.704  11.087  16.660  1.00 14.61 ? 893 ASN B C   1 
ATOM   1726 O O   . ASN A 1 219 ? 20.830  11.219  16.125  1.00 13.06 ? 893 ASN B O   1 
ATOM   1727 C CB  . ASN A 1 219 ? 17.691  10.444  15.313  1.00 14.65 ? 893 ASN B CB  1 
ATOM   1728 C CG  . ASN A 1 219 ? 17.041  9.324   14.549  1.00 16.72 ? 893 ASN B CG  1 
ATOM   1729 O OD1 . ASN A 1 219 ? 17.718  8.390   14.136  1.00 20.05 ? 893 ASN B OD1 1 
ATOM   1730 N ND2 . ASN A 1 219 ? 15.732  9.428   14.312  1.00 17.74 ? 893 ASN B ND2 1 
ATOM   1731 N N   . THR A 1 220 ? 19.243  11.903  17.618  1.00 13.54 ? 894 THR B N   1 
ATOM   1732 C CA  . THR A 1 220 ? 20.021  13.035  18.059  1.00 14.40 ? 894 THR B CA  1 
ATOM   1733 C C   . THR A 1 220 ? 21.336  12.567  18.750  1.00 14.11 ? 894 THR B C   1 
ATOM   1734 O O   . THR A 1 220 ? 22.397  13.156  18.491  1.00 13.48 ? 894 THR B O   1 
ATOM   1735 C CB  . THR A 1 220 ? 19.206  13.969  18.991  1.00 15.28 ? 894 THR B CB  1 
ATOM   1736 O OG1 . THR A 1 220 ? 17.992  14.374  18.309  1.00 15.77 ? 894 THR B OG1 1 
ATOM   1737 C CG2 . THR A 1 220 ? 20.064  15.175  19.434  1.00 15.72 ? 894 THR B CG2 1 
ATOM   1738 N N   . PHE A 1 221 ? 21.277  11.501  19.563  1.00 12.45 ? 895 PHE B N   1 
ATOM   1739 C CA  . PHE A 1 221 ? 22.474  10.943  20.210  1.00 13.42 ? 895 PHE B CA  1 
ATOM   1740 C C   . PHE A 1 221 ? 23.512  10.462  19.162  1.00 14.15 ? 895 PHE B C   1 
ATOM   1741 O O   . PHE A 1 221 ? 24.706  10.737  19.291  1.00 14.36 ? 895 PHE B O   1 
ATOM   1742 C CB  . PHE A 1 221 ? 22.035  9.766   21.100  1.00 14.50 ? 895 PHE B CB  1 
ATOM   1743 C CG  . PHE A 1 221 ? 23.145  9.127   21.879  1.00 14.78 ? 895 PHE B CG  1 
ATOM   1744 C CD1 . PHE A 1 221 ? 23.648  9.728   23.046  1.00 17.27 ? 895 PHE B CD1 1 
ATOM   1745 C CD2 . PHE A 1 221 ? 23.643  7.883   21.488  1.00 17.08 ? 895 PHE B CD2 1 
ATOM   1746 C CE1 . PHE A 1 221 ? 24.656  9.101   23.802  1.00 18.98 ? 895 PHE B CE1 1 
ATOM   1747 C CE2 . PHE A 1 221 ? 24.668  7.252   22.212  1.00 19.06 ? 895 PHE B CE2 1 
ATOM   1748 C CZ  . PHE A 1 221 ? 25.168  7.853   23.392  1.00 17.90 ? 895 PHE B CZ  1 
ATOM   1749 N N   . ILE A 1 222 ? 23.032  9.710   18.168  1.00 14.27 ? 896 ILE B N   1 
ATOM   1750 C CA  . ILE A 1 222 ? 23.870  9.198   17.054  1.00 15.91 ? 896 ILE B CA  1 
ATOM   1751 C C   . ILE A 1 222 ? 24.531  10.377  16.340  1.00 16.26 ? 896 ILE B C   1 
ATOM   1752 O O   . ILE A 1 222 ? 25.727  10.352  16.012  1.00 17.16 ? 896 ILE B O   1 
ATOM   1753 C CB  . ILE A 1 222 ? 22.977  8.412   16.040  1.00 15.55 ? 896 ILE B CB  1 
ATOM   1754 C CG1 . ILE A 1 222 ? 22.600  7.049   16.599  1.00 15.26 ? 896 ILE B CG1 1 
ATOM   1755 C CG2 . ILE A 1 222 ? 23.669  8.210   14.651  1.00 17.93 ? 896 ILE B CG2 1 
ATOM   1756 C CD1 . ILE A 1 222 ? 21.460  6.467   15.796  1.00 16.89 ? 896 ILE B CD1 1 
ATOM   1757 N N   . GLN A 1 223 ? 23.769  11.444  16.153  1.00 15.60 ? 897 GLN B N   1 
ATOM   1758 C CA  . GLN A 1 223 ? 24.265  12.639  15.446  1.00 16.93 ? 897 GLN B CA  1 
ATOM   1759 C C   . GLN A 1 223 ? 24.768  13.775  16.346  1.00 16.59 ? 897 GLN B C   1 
ATOM   1760 O O   . GLN A 1 223 ? 24.938  14.930  15.894  1.00 15.68 ? 897 GLN B O   1 
ATOM   1761 C CB  . GLN A 1 223 ? 23.155  13.177  14.566  1.00 17.05 ? 897 GLN B CB  1 
ATOM   1762 C CG  . GLN A 1 223 ? 22.767  12.198  13.435  1.00 18.85 ? 897 GLN B CG  1 
ATOM   1763 C CD  . GLN A 1 223 ? 21.468  12.567  12.756  1.00 20.86 ? 897 GLN B CD  1 
ATOM   1764 O OE1 . GLN A 1 223 ? 20.556  11.725  12.576  1.00 23.27 ? 897 GLN B OE1 1 
ATOM   1765 N NE2 . GLN A 1 223 ? 21.370  13.802  12.367  1.00 20.11 ? 897 GLN B NE2 1 
ATOM   1766 N N   . SER A 1 224 ? 25.000  13.473  17.611  1.00 17.84 ? 898 SER B N   1 
ATOM   1767 C CA  . SER A 1 224 ? 25.243  14.526  18.612  1.00 17.77 ? 898 SER B CA  1 
ATOM   1768 C C   . SER A 1 224 ? 26.444  15.429  18.297  1.00 18.60 ? 898 SER B C   1 
ATOM   1769 O O   . SER A 1 224 ? 26.350  16.616  18.555  1.00 17.88 ? 898 SER B O   1 
ATOM   1770 C CB  . SER A 1 224 ? 25.393  13.947  20.010  1.00 18.00 ? 898 SER B CB  1 
ATOM   1771 O OG  . SER A 1 224 ? 26.511  13.124  20.102  1.00 20.13 ? 898 SER B OG  1 
ATOM   1772 N N   . ARG A 1 225 ? 27.554  14.890  17.770  1.00 18.44 ? 899 ARG B N   1 
ATOM   1773 C CA  . ARG A 1 225 ? 28.720  15.745  17.426  1.00 22.02 ? 899 ARG B CA  1 
ATOM   1774 C C   . ARG A 1 225 ? 28.398  16.772  16.308  1.00 21.57 ? 899 ARG B C   1 
ATOM   1775 O O   . ARG A 1 225 ? 28.654  17.974  16.456  1.00 21.39 ? 899 ARG B O   1 
ATOM   1776 C CB  . ARG A 1 225 ? 29.958  14.891  17.062  1.00 21.79 ? 899 ARG B CB  1 
ATOM   1777 C CG  . ARG A 1 225 ? 30.486  14.066  18.254  1.00 25.70 ? 899 ARG B CG  1 
ATOM   1778 C CD  . ARG A 1 225 ? 31.622  13.066  17.886  1.00 28.46 ? 899 ARG B CD  1 
ATOM   1779 N NE  . ARG A 1 225 ? 32.351  12.638  19.091  1.00 39.73 ? 899 ARG B NE  1 
ATOM   1780 C CZ  . ARG A 1 225 ? 33.600  12.160  19.093  1.00 45.39 ? 899 ARG B CZ  1 
ATOM   1781 N NH1 . ARG A 1 225 ? 34.173  11.794  20.243  1.00 48.32 ? 899 ARG B NH1 1 
ATOM   1782 N NH2 . ARG A 1 225 ? 34.279  12.028  17.950  1.00 46.66 ? 899 ARG B NH2 1 
ATOM   1783 N N   . ALA A 1 226 ? 27.824  16.275  15.209  1.00 21.65 ? 900 ALA B N   1 
ATOM   1784 C CA  . ALA A 1 226 ? 27.382  17.102  14.083  1.00 22.71 ? 900 ALA B CA  1 
ATOM   1785 C C   . ALA A 1 226 ? 26.417  18.194  14.540  1.00 23.45 ? 900 ALA B C   1 
ATOM   1786 O O   . ALA A 1 226 ? 26.536  19.329  14.130  1.00 22.62 ? 900 ALA B O   1 
ATOM   1787 C CB  . ALA A 1 226 ? 26.717  16.237  13.035  1.00 22.67 ? 900 ALA B CB  1 
ATOM   1788 N N   . LEU A 1 227 ? 25.489  17.844  15.435  1.00 23.45 ? 901 LEU B N   1 
ATOM   1789 C CA  . LEU A 1 227 ? 24.447  18.753  15.883  1.00 23.92 ? 901 LEU B CA  1 
ATOM   1790 C C   . LEU A 1 227 ? 24.839  19.623  17.089  1.00 24.37 ? 901 LEU B C   1 
ATOM   1791 O O   . LEU A 1 227 ? 24.032  20.441  17.537  1.00 23.96 ? 901 LEU B O   1 
ATOM   1792 C CB  . LEU A 1 227 ? 23.177  17.942  16.200  1.00 24.29 ? 901 LEU B CB  1 
ATOM   1793 C CG  . LEU A 1 227 ? 22.613  17.051  15.089  1.00 24.06 ? 901 LEU B CG  1 
ATOM   1794 C CD1 . LEU A 1 227 ? 21.416  16.252  15.596  1.00 24.21 ? 901 LEU B CD1 1 
ATOM   1795 C CD2 . LEU A 1 227 ? 22.224  17.859  13.876  1.00 26.88 ? 901 LEU B CD2 1 
ATOM   1796 N N   . SER A 1 228 ? 26.057  19.433  17.624  1.00 23.43 ? 902 SER B N   1 
ATOM   1797 C CA  . SER A 1 228 ? 26.517  20.070  18.878  1.00 22.99 ? 902 SER B CA  1 
ATOM   1798 C C   . SER A 1 228 ? 25.571  19.896  20.063  1.00 22.90 ? 902 SER B C   1 
ATOM   1799 O O   . SER A 1 228 ? 25.292  20.850  20.806  1.00 21.00 ? 902 SER B O   1 
ATOM   1800 C CB  . SER A 1 228 ? 26.743  21.579  18.714  1.00 23.56 ? 902 SER B CB  1 
ATOM   1801 O OG  . SER A 1 228 ? 27.707  21.818  17.743  1.00 27.92 ? 902 SER B OG  1 
ATOM   1802 N N   . VAL A 1 229 ? 25.056  18.688  20.240  1.00 22.10 ? 903 VAL B N   1 
ATOM   1803 C CA  . VAL A 1 229 ? 24.207  18.429  21.401  1.00 21.02 ? 903 VAL B CA  1 
ATOM   1804 C C   . VAL A 1 229 ? 25.014  17.577  22.379  1.00 20.89 ? 903 VAL B C   1 
ATOM   1805 O O   . VAL A 1 229 ? 25.454  16.498  22.026  1.00 21.02 ? 903 VAL B O   1 
ATOM   1806 C CB  . VAL A 1 229 ? 22.916  17.736  20.938  1.00 20.35 ? 903 VAL B CB  1 
ATOM   1807 C CG1 . VAL A 1 229 ? 22.058  17.280  22.128  1.00 19.48 ? 903 VAL B CG1 1 
ATOM   1808 C CG2 . VAL A 1 229 ? 22.120  18.670  19.980  1.00 20.99 ? 903 VAL B CG2 1 
ATOM   1809 N N   . GLU A 1 230 ? 25.218  18.036  23.605  1.00 21.05 ? 904 GLU B N   1 
ATOM   1810 C CA  . GLU A 1 230 ? 25.931  17.218  24.580  1.00 20.74 ? 904 GLU B CA  1 
ATOM   1811 C C   . GLU A 1 230 ? 24.985  16.267  25.297  1.00 20.11 ? 904 GLU B C   1 
ATOM   1812 O O   . GLU A 1 230 ? 23.847  16.642  25.661  1.00 19.57 ? 904 GLU B O   1 
ATOM   1813 C CB  . GLU A 1 230 ? 26.609  18.077  25.655  1.00 22.40 ? 904 GLU B CB  1 
ATOM   1814 C CG  . GLU A 1 230 ? 27.551  19.138  25.104  1.00 28.76 ? 904 GLU B CG  1 
ATOM   1815 C CD  . GLU A 1 230 ? 27.912  20.141  26.182  1.00 35.02 ? 904 GLU B CD  1 
ATOM   1816 O OE1 . GLU A 1 230 ? 28.138  19.686  27.336  1.00 38.17 ? 904 GLU B OE1 1 
ATOM   1817 O OE2 . GLU A 1 230 ? 27.922  21.360  25.880  1.00 36.30 ? 904 GLU B OE2 1 
ATOM   1818 N N   . PHE A 1 231 ? 25.481  15.062  25.559  1.00 18.34 ? 905 PHE B N   1 
ATOM   1819 C CA  . PHE A 1 231 ? 24.751  14.076  26.344  1.00 18.32 ? 905 PHE B CA  1 
ATOM   1820 C C   . PHE A 1 231 ? 25.624  13.729  27.539  1.00 18.11 ? 905 PHE B C   1 
ATOM   1821 O O   . PHE A 1 231 ? 26.673  13.127  27.342  1.00 17.98 ? 905 PHE B O   1 
ATOM   1822 C CB  . PHE A 1 231 ? 24.471  12.809  25.509  1.00 16.41 ? 905 PHE B CB  1 
ATOM   1823 C CG  . PHE A 1 231 ? 23.351  12.979  24.498  1.00 18.47 ? 905 PHE B CG  1 
ATOM   1824 C CD1 . PHE A 1 231 ? 23.594  13.606  23.276  1.00 14.76 ? 905 PHE B CD1 1 
ATOM   1825 C CD2 . PHE A 1 231 ? 22.060  12.505  24.770  1.00 13.65 ? 905 PHE B CD2 1 
ATOM   1826 C CE1 . PHE A 1 231 ? 22.610  13.767  22.352  1.00 15.08 ? 905 PHE B CE1 1 
ATOM   1827 C CE2 . PHE A 1 231 ? 21.045  12.677  23.845  1.00 17.46 ? 905 PHE B CE2 1 
ATOM   1828 C CZ  . PHE A 1 231 ? 21.327  13.293  22.604  1.00 15.90 ? 905 PHE B CZ  1 
ATOM   1829 N N   . PRO A 1 232 ? 25.231  14.135  28.772  1.00 17.83 ? 906 PRO B N   1 
ATOM   1830 C CA  . PRO A 1 232 ? 26.056  13.767  29.921  1.00 18.04 ? 906 PRO B CA  1 
ATOM   1831 C C   . PRO A 1 232 ? 26.153  12.262  30.148  1.00 18.90 ? 906 PRO B C   1 
ATOM   1832 O O   . PRO A 1 232 ? 25.516  11.486  29.452  1.00 17.57 ? 906 PRO B O   1 
ATOM   1833 C CB  . PRO A 1 232 ? 25.337  14.448  31.102  1.00 17.72 ? 906 PRO B CB  1 
ATOM   1834 C CG  . PRO A 1 232 ? 24.611  15.588  30.498  1.00 18.51 ? 906 PRO B CG  1 
ATOM   1835 C CD  . PRO A 1 232 ? 24.109  14.996  29.193  1.00 18.64 ? 906 PRO B CD  1 
ATOM   1836 N N   . GLU A 1 233 ? 26.937  11.880  31.149  1.00 20.36 ? 907 GLU B N   1 
ATOM   1837 C CA  . GLU A 1 233 ? 27.327  10.505  31.394  1.00 22.30 ? 907 GLU B CA  1 
ATOM   1838 C C   . GLU A 1 233 ? 26.172  9.517   31.640  1.00 20.45 ? 907 GLU B C   1 
ATOM   1839 O O   . GLU A 1 233 ? 26.096  8.496   30.976  1.00 19.21 ? 907 GLU B O   1 
ATOM   1840 C CB  . GLU A 1 233 ? 28.267  10.493  32.603  1.00 23.41 ? 907 GLU B CB  1 
ATOM   1841 C CG  . GLU A 1 233 ? 28.980  9.139   32.808  1.00 28.75 ? 907 GLU B CG  1 
ATOM   1842 C CD  . GLU A 1 233 ? 29.865  9.128   34.054  1.00 29.24 ? 907 GLU B CD  1 
ATOM   1843 O OE1 . GLU A 1 233 ? 30.165  10.252  34.571  1.00 37.46 ? 907 GLU B OE1 1 
ATOM   1844 O OE2 . GLU A 1 233 ? 30.252  8.004   34.485  1.00 34.02 ? 907 GLU B OE2 1 
ATOM   1845 N N   . MET A 1 234 ? 25.311  9.776   32.614  1.00 20.87 ? 908 MET B N   1 
ATOM   1846 C CA  . MET A 1 234 ? 24.253  8.785   32.927  1.00 23.56 ? 908 MET B CA  1 
ATOM   1847 C C   . MET A 1 234 ? 23.205  8.708   31.827  1.00 19.80 ? 908 MET B C   1 
ATOM   1848 O O   . MET A 1 234 ? 22.702  7.609   31.563  1.00 18.88 ? 908 MET B O   1 
ATOM   1849 C CB  . MET A 1 234 ? 23.554  9.024   34.265  1.00 22.75 ? 908 MET B CB  1 
ATOM   1850 C CG  . MET A 1 234 ? 24.404  8.814   35.509  1.00 28.86 ? 908 MET B CG  1 
ATOM   1851 S SD  . MET A 1 234 ? 23.382  9.070   37.022  1.00 35.82 ? 908 MET B SD  1 
ATOM   1852 C CE  . MET A 1 234 ? 22.006  7.942   36.742  1.00 31.04 ? 908 MET B CE  1 
ATOM   1853 N N   . MET A 1 235 ? 22.910  9.860   31.198  1.00 17.75 ? 909 MET B N   1 
ATOM   1854 C CA  . MET A 1 235 ? 22.015  9.966   30.025  1.00 17.98 ? 909 MET B CA  1 
ATOM   1855 C C   . MET A 1 235 ? 22.587  9.108   28.888  1.00 17.21 ? 909 MET B C   1 
ATOM   1856 O O   . MET A 1 235 ? 21.907  8.255   28.344  1.00 16.97 ? 909 MET B O   1 
ATOM   1857 C CB  . MET A 1 235 ? 21.850  11.436  29.546  1.00 18.55 ? 909 MET B CB  1 
ATOM   1858 C CG  . MET A 1 235 ? 20.898  12.272  30.343  1.00 18.24 ? 909 MET B CG  1 
ATOM   1859 S SD  . MET A 1 235 ? 19.136  11.799  30.119  1.00 25.66 ? 909 MET B SD  1 
ATOM   1860 C CE  . MET A 1 235 ? 19.009  12.204  28.348  1.00 18.23 ? 909 MET B CE  1 
ATOM   1861 N N   . SER A 1 236 ? 23.864  9.294   28.579  1.00 17.48 ? 910 SER B N   1 
ATOM   1862 C CA  . SER A 1 236 ? 24.542  8.466   27.564  1.00 18.16 ? 910 SER B CA  1 
ATOM   1863 C C   . SER A 1 236 ? 24.462  6.957   27.874  1.00 19.25 ? 910 SER B C   1 
ATOM   1864 O O   . SER A 1 236 ? 24.209  6.162   26.992  1.00 17.98 ? 910 SER B O   1 
ATOM   1865 C CB  . SER A 1 236 ? 25.993  8.915   27.440  1.00 17.97 ? 910 SER B CB  1 
ATOM   1866 O OG  . SER A 1 236 ? 26.011  10.218  26.852  1.00 17.86 ? 910 SER B OG  1 
ATOM   1867 N N   . GLU A 1 237 ? 24.658  6.594   29.137  1.00 20.43 ? 911 GLU B N   1 
ATOM   1868 C CA  . GLU A 1 237 ? 24.636  5.188   29.557  1.00 23.43 ? 911 GLU B CA  1 
ATOM   1869 C C   . GLU A 1 237 ? 23.247  4.554   29.357  1.00 21.72 ? 911 GLU B C   1 
ATOM   1870 O O   . GLU A 1 237 ? 23.142  3.463   28.750  1.00 21.94 ? 911 GLU B O   1 
ATOM   1871 C CB  . GLU A 1 237 ? 25.162  5.047   30.998  1.00 23.41 ? 911 GLU B CB  1 
ATOM   1872 C CG  . GLU A 1 237 ? 24.837  3.725   31.679  1.00 27.99 ? 911 GLU B CG  1 
ATOM   1873 C CD  . GLU A 1 237 ? 25.000  3.763   33.234  1.00 30.38 ? 911 GLU B CD  1 
ATOM   1874 O OE1 . GLU A 1 237 ? 26.080  4.163   33.738  1.00 40.35 ? 911 GLU B OE1 1 
ATOM   1875 O OE2 . GLU A 1 237 ? 24.038  3.368   33.959  1.00 41.85 ? 911 GLU B OE2 1 
ATOM   1876 N N   . VAL A 1 238 ? 22.187  5.226   29.820  1.00 19.41 ? 912 VAL B N   1 
ATOM   1877 C CA  . VAL A 1 238 ? 20.835  4.682   29.628  1.00 19.89 ? 912 VAL B CA  1 
ATOM   1878 C C   . VAL A 1 238 ? 20.465  4.558   28.158  1.00 18.84 ? 912 VAL B C   1 
ATOM   1879 O O   . VAL A 1 238 ? 19.880  3.550   27.745  1.00 19.32 ? 912 VAL B O   1 
ATOM   1880 C CB  . VAL A 1 238 ? 19.699  5.447   30.427  1.00 19.08 ? 912 VAL B CB  1 
ATOM   1881 C CG1 . VAL A 1 238 ? 20.018  5.460   31.940  1.00 20.36 ? 912 VAL B CG1 1 
ATOM   1882 C CG2 . VAL A 1 238 ? 19.549  6.839   29.935  1.00 20.14 ? 912 VAL B CG2 1 
ATOM   1883 N N   . ILE A 1 239 ? 20.827  5.562   27.371  1.00 18.33 ? 913 ILE B N   1 
ATOM   1884 C CA  . ILE A 1 239 ? 20.481  5.579   25.954  1.00 19.61 ? 913 ILE B CA  1 
ATOM   1885 C C   . ILE A 1 239 ? 21.203  4.421   25.273  1.00 20.65 ? 913 ILE B C   1 
ATOM   1886 O O   . ILE A 1 239 ? 20.586  3.669   24.554  1.00 21.61 ? 913 ILE B O   1 
ATOM   1887 C CB  . ILE A 1 239 ? 20.841  6.951   25.277  1.00 19.85 ? 913 ILE B CB  1 
ATOM   1888 C CG1 . ILE A 1 239 ? 19.858  8.029   25.731  1.00 18.28 ? 913 ILE B CG1 1 
ATOM   1889 C CG2 . ILE A 1 239 ? 20.819  6.843   23.737  1.00 19.52 ? 913 ILE B CG2 1 
ATOM   1890 C CD1 . ILE A 1 239 ? 20.373  9.447   25.553  1.00 21.47 ? 913 ILE B CD1 1 
ATOM   1891 N N   . ALA A 1 240 ? 22.506  4.280   25.520  1.00 21.57 ? 914 ALA B N   1 
ATOM   1892 C CA  . ALA A 1 240 ? 23.300  3.228   24.911  1.00 22.48 ? 914 ALA B CA  1 
ATOM   1893 C C   . ALA A 1 240 ? 22.827  1.852   25.325  1.00 23.23 ? 914 ALA B C   1 
ATOM   1894 O O   . ALA A 1 240 ? 22.734  0.974   24.470  1.00 23.12 ? 914 ALA B O   1 
ATOM   1895 C CB  . ALA A 1 240 ? 24.816  3.392   25.249  1.00 22.16 ? 914 ALA B CB  1 
ATOM   1896 N N   . ALA A 1 241 ? 22.560  1.666   26.629  1.00 24.42 ? 915 ALA B N   1 
ATOM   1897 C CA  . ALA A 1 241 ? 22.118  0.372   27.175  1.00 24.84 ? 915 ALA B CA  1 
ATOM   1898 C C   . ALA A 1 241 ? 20.815  -0.091  26.526  1.00 25.18 ? 915 ALA B C   1 
ATOM   1899 O O   . ALA A 1 241 ? 20.711  -1.225  26.053  1.00 26.37 ? 915 ALA B O   1 
ATOM   1900 C CB  . ALA A 1 241 ? 21.924  0.464   28.689  1.00 24.91 ? 915 ALA B CB  1 
ATOM   1901 N N   . GLN A 1 242 ? 19.813  0.785   26.471  1.00 23.24 ? 916 GLN B N   1 
ATOM   1902 C CA  . GLN A 1 242 ? 18.488  0.271   26.168  1.00 21.68 ? 916 GLN B CA  1 
ATOM   1903 C C   . GLN A 1 242 ? 17.726  0.810   24.998  1.00 19.78 ? 916 GLN B C   1 
ATOM   1904 O O   . GLN A 1 242 ? 16.808  0.126   24.594  1.00 18.77 ? 916 GLN B O   1 
ATOM   1905 C CB  . GLN A 1 242 ? 17.565  0.318   27.407  1.00 21.40 ? 916 GLN B CB  1 
ATOM   1906 C CG  . GLN A 1 242 ? 18.184  -0.184  28.678  1.00 23.60 ? 916 GLN B CG  1 
ATOM   1907 C CD  . GLN A 1 242 ? 18.283  -1.686  28.751  1.00 27.70 ? 916 GLN B CD  1 
ATOM   1908 O OE1 . GLN A 1 242 ? 17.866  -2.408  27.841  1.00 28.20 ? 916 GLN B OE1 1 
ATOM   1909 N NE2 . GLN A 1 242 ? 18.875  -2.175  29.837  1.00 29.78 ? 916 GLN B NE2 1 
ATOM   1910 N N   . LEU A 1 243 ? 18.012  2.017   24.468  1.00 18.43 ? 917 LEU B N   1 
ATOM   1911 C CA  . LEU A 1 243 ? 17.038  2.611   23.533  1.00 18.57 ? 917 LEU B CA  1 
ATOM   1912 C C   . LEU A 1 243 ? 16.833  1.839   22.238  1.00 18.38 ? 917 LEU B C   1 
ATOM   1913 O O   . LEU A 1 243 ? 15.676  1.684   21.766  1.00 18.35 ? 917 LEU B O   1 
ATOM   1914 C CB  . LEU A 1 243 ? 17.328  4.106   23.179  1.00 19.45 ? 917 LEU B CB  1 
ATOM   1915 C CG  . LEU A 1 243 ? 16.665  5.162   24.021  1.00 22.60 ? 917 LEU B CG  1 
ATOM   1916 C CD1 . LEU A 1 243 ? 16.848  6.599   23.399  1.00 18.96 ? 917 LEU B CD1 1 
ATOM   1917 C CD2 . LEU A 1 243 ? 15.209  4.776   24.225  1.00 24.00 ? 917 LEU B CD2 1 
ATOM   1918 N N   . PRO A 1 244 ? 17.937  1.364   21.619  1.00 17.94 ? 918 PRO B N   1 
ATOM   1919 C CA  . PRO A 1 244 ? 17.712  0.583   20.409  1.00 17.67 ? 918 PRO B CA  1 
ATOM   1920 C C   . PRO A 1 244 ? 16.843  -0.654  20.664  1.00 16.99 ? 918 PRO B C   1 
ATOM   1921 O O   . PRO A 1 244 ? 15.924  -0.917  19.898  1.00 16.20 ? 918 PRO B O   1 
ATOM   1922 C CB  . PRO A 1 244 ? 19.132  0.144   19.996  1.00 17.02 ? 918 PRO B CB  1 
ATOM   1923 C CG  . PRO A 1 244 ? 20.026  1.207   20.567  1.00 18.63 ? 918 PRO B CG  1 
ATOM   1924 C CD  . PRO A 1 244 ? 19.378  1.521   21.909  1.00 19.11 ? 918 PRO B CD  1 
ATOM   1925 N N   . LYS A 1 245 ? 17.136  -1.394  21.730  1.00 16.58 ? 919 LYS B N   1 
ATOM   1926 C CA  . LYS A 1 245 ? 16.344  -2.573  22.130  1.00 16.60 ? 919 LYS B CA  1 
ATOM   1927 C C   . LYS A 1 245 ? 14.875  -2.228  22.411  1.00 16.93 ? 919 LYS B C   1 
ATOM   1928 O O   . LYS A 1 245 ? 13.946  -2.945  21.996  1.00 15.62 ? 919 LYS B O   1 
ATOM   1929 C CB  . LYS A 1 245 ? 17.011  -3.179  23.374  1.00 17.60 ? 919 LYS B CB  1 
ATOM   1930 C CG  . LYS A 1 245 ? 16.385  -4.457  23.895  1.00 23.28 ? 919 LYS B CG  1 
ATOM   1931 C CD  . LYS A 1 245 ? 16.785  -4.707  25.358  1.00 26.05 ? 919 LYS B CD  1 
ATOM   1932 C CE  . LYS A 1 245 ? 18.269  -4.940  25.501  1.00 28.43 ? 919 LYS B CE  1 
ATOM   1933 N NZ  . LYS A 1 245 ? 18.789  -4.679  26.910  1.00 32.26 ? 919 LYS B NZ  1 
ATOM   1934 N N   . ILE A 1 246 ? 14.637  -1.114  23.120  1.00 17.44 ? 920 ILE B N   1 
ATOM   1935 C CA  . ILE A 1 246 ? 13.249  -0.635  23.333  1.00 16.46 ? 920 ILE B CA  1 
ATOM   1936 C C   . ILE A 1 246 ? 12.539  -0.306  22.046  1.00 16.91 ? 920 ILE B C   1 
ATOM   1937 O O   . ILE A 1 246 ? 11.441  -0.806  21.792  1.00 16.23 ? 920 ILE B O   1 
ATOM   1938 C CB  . ILE A 1 246 ? 13.213  0.574   24.301  1.00 17.35 ? 920 ILE B CB  1 
ATOM   1939 C CG1 . ILE A 1 246 ? 13.628  0.109   25.709  1.00 13.91 ? 920 ILE B CG1 1 
ATOM   1940 C CG2 . ILE A 1 246 ? 11.804  1.172   24.334  1.00 19.39 ? 920 ILE B CG2 1 
ATOM   1941 C CD1 . ILE A 1 246 ? 13.955  1.298   26.659  1.00 18.89 ? 920 ILE B CD1 1 
ATOM   1942 N N   . LEU A 1 247 ? 13.168  0.513   21.202  1.00 17.80 ? 921 LEU B N   1 
ATOM   1943 C CA  . LEU A 1 247 ? 12.604  0.857   19.888  1.00 18.76 ? 921 LEU B CA  1 
ATOM   1944 C C   . LEU A 1 247 ? 12.316  -0.364  19.021  1.00 19.44 ? 921 LEU B C   1 
ATOM   1945 O O   . LEU A 1 247 ? 11.319  -0.400  18.303  1.00 21.40 ? 921 LEU B O   1 
ATOM   1946 C CB  . LEU A 1 247 ? 13.545  1.830   19.165  1.00 19.15 ? 921 LEU B CB  1 
ATOM   1947 C CG  . LEU A 1 247 ? 13.396  3.289   19.608  1.00 21.06 ? 921 LEU B CG  1 
ATOM   1948 C CD1 . LEU A 1 247 ? 14.520  4.160   18.997  1.00 17.48 ? 921 LEU B CD1 1 
ATOM   1949 C CD2 . LEU A 1 247 ? 11.987  3.842   19.242  1.00 18.38 ? 921 LEU B CD2 1 
ATOM   1950 N N   . ALA A 1 248 ? 13.177  -1.374  19.087  1.00 18.98 ? 922 ALA B N   1 
ATOM   1951 C CA  . ALA A 1 248 ? 12.991  -2.597  18.295  1.00 19.61 ? 922 ALA B CA  1 
ATOM   1952 C C   . ALA A 1 248 ? 11.899  -3.495  18.856  1.00 20.59 ? 922 ALA B C   1 
ATOM   1953 O O   . ALA A 1 248 ? 11.611  -4.552  18.285  1.00 20.05 ? 922 ALA B O   1 
ATOM   1954 C CB  . ALA A 1 248 ? 14.282  -3.384  18.230  1.00 18.41 ? 922 ALA B CB  1 
ATOM   1955 N N   . GLY A 1 249 ? 11.315  -3.088  19.991  1.00 20.31 ? 923 GLY B N   1 
ATOM   1956 C CA  . GLY A 1 249 ? 10.259  -3.881  20.638  1.00 20.04 ? 923 GLY B CA  1 
ATOM   1957 C C   . GLY A 1 249 ? 10.781  -5.175  21.250  1.00 18.94 ? 923 GLY B C   1 
ATOM   1958 O O   . GLY A 1 249 ? 10.029  -6.139  21.391  1.00 20.12 ? 923 GLY B O   1 
ATOM   1959 N N   . MET A 1 250 ? 12.062  -5.211  21.611  1.00 17.25 ? 924 MET B N   1 
ATOM   1960 C CA  . MET A 1 250 ? 12.670  -6.382  22.223  1.00 17.74 ? 924 MET B CA  1 
ATOM   1961 C C   . MET A 1 250 ? 12.671  -6.287  23.755  1.00 17.19 ? 924 MET B C   1 
ATOM   1962 O O   . MET A 1 250 ? 13.650  -6.637  24.396  1.00 16.64 ? 924 MET B O   1 
ATOM   1963 C CB  . MET A 1 250 ? 14.097  -6.600  21.689  1.00 17.89 ? 924 MET B CB  1 
ATOM   1964 C CG  . MET A 1 250 ? 14.111  -6.919  20.188  1.00 21.19 ? 924 MET B CG  1 
ATOM   1965 S SD  . MET A 1 250 ? 13.135  -8.365  19.783  1.00 26.31 ? 924 MET B SD  1 
ATOM   1966 C CE  . MET A 1 250 ? 14.174  -9.667  20.395  1.00 24.77 ? 924 MET B CE  1 
ATOM   1967 N N   . VAL A 1 251 ? 11.534  -5.821  24.289  1.00 17.61 ? 925 VAL B N   1 
ATOM   1968 C CA  . VAL A 1 251 ? 11.205  -5.717  25.701  1.00 17.15 ? 925 VAL B CA  1 
ATOM   1969 C C   . VAL A 1 251 ? 9.686   -5.953  25.760  1.00 18.23 ? 925 VAL B C   1 
ATOM   1970 O O   . VAL A 1 251 ? 9.016   -6.031  24.716  1.00 15.43 ? 925 VAL B O   1 
ATOM   1971 C CB  . VAL A 1 251 ? 11.531  -4.308  26.287  1.00 16.89 ? 925 VAL B CB  1 
ATOM   1972 C CG1 . VAL A 1 251 ? 13.072  -4.001  26.255  1.00 15.59 ? 925 VAL B CG1 1 
ATOM   1973 C CG2 . VAL A 1 251 ? 10.710  -3.210  25.598  1.00 13.80 ? 925 VAL B CG2 1 
ATOM   1974 N N   . LYS A 1 252 ? 9.150   -6.073  26.971  1.00 18.34 ? 926 LYS B N   1 
ATOM   1975 C CA  . LYS A 1 252 ? 7.716   -6.294  27.160  1.00 21.36 ? 926 LYS B CA  1 
ATOM   1976 C C   . LYS A 1 252 ? 7.034   -5.068  27.844  1.00 20.88 ? 926 LYS B C   1 
ATOM   1977 O O   . LYS A 1 252 ? 7.111   -4.906  29.095  1.00 20.74 ? 926 LYS B O   1 
ATOM   1978 C CB  . LYS A 1 252 ? 7.489   -7.602  27.955  1.00 21.05 ? 926 LYS B CB  1 
ATOM   1979 C CG  . LYS A 1 252 ? 6.040   -7.980  28.105  1.00 23.46 ? 926 LYS B CG  1 
ATOM   1980 C CD  . LYS A 1 252 ? 5.918   -9.364  28.782  1.00 26.44 ? 926 LYS B CD  1 
ATOM   1981 C CE  . LYS A 1 252 ? 4.429   -9.681  29.028  1.00 31.06 ? 926 LYS B CE  1 
ATOM   1982 N NZ  . LYS A 1 252 ? 4.284   -11.018 29.652  1.00 36.14 ? 926 LYS B NZ  1 
ATOM   1983 N N   . PRO A 1 253 ? 6.401   -4.193  27.040  1.00 21.93 ? 927 PRO B N   1 
ATOM   1984 C CA  . PRO A 1 253 ? 5.618   -3.114  27.639  1.00 22.26 ? 927 PRO B CA  1 
ATOM   1985 C C   . PRO A 1 253 ? 4.397   -3.749  28.291  1.00 22.54 ? 927 PRO B C   1 
ATOM   1986 O O   . PRO A 1 253 ? 3.845   -4.742  27.773  1.00 22.40 ? 927 PRO B O   1 
ATOM   1987 C CB  . PRO A 1 253 ? 5.207   -2.213  26.453  1.00 22.43 ? 927 PRO B CB  1 
ATOM   1988 C CG  . PRO A 1 253 ? 5.676   -2.905  25.216  1.00 23.38 ? 927 PRO B CG  1 
ATOM   1989 C CD  . PRO A 1 253 ? 6.366   -4.185  25.567  1.00 21.90 ? 927 PRO B CD  1 
ATOM   1990 N N   . LEU A 1 254 ? 4.014   -3.234  29.444  1.00 21.13 ? 928 LEU B N   1 
ATOM   1991 C CA  . LEU A 1 254 ? 2.887   -3.812  30.139  1.00 21.70 ? 928 LEU B CA  1 
ATOM   1992 C C   . LEU A 1 254 ? 1.710   -2.922  29.827  1.00 21.88 ? 928 LEU B C   1 
ATOM   1993 O O   . LEU A 1 254 ? 1.848   -1.676  29.763  1.00 23.90 ? 928 LEU B O   1 
ATOM   1994 C CB  . LEU A 1 254 ? 3.175   -3.967  31.649  1.00 20.43 ? 928 LEU B CB  1 
ATOM   1995 C CG  . LEU A 1 254 ? 4.437   -4.745  32.057  1.00 20.89 ? 928 LEU B CG  1 
ATOM   1996 C CD1 . LEU A 1 254 ? 4.564   -4.895  33.583  1.00 19.13 ? 928 LEU B CD1 1 
ATOM   1997 C CD2 . LEU A 1 254 ? 4.487   -6.131  31.398  1.00 22.92 ? 928 LEU B CD2 1 
ATOM   1998 N N   . LEU A 1 255 ? 0.570   -3.531  29.561  1.00 21.76 ? 929 LEU B N   1 
ATOM   1999 C CA  . LEU A 1 255 ? -0.635  -2.780  29.259  1.00 21.88 ? 929 LEU B CA  1 
ATOM   2000 C C   . LEU A 1 255 ? -1.705  -3.166  30.260  1.00 23.15 ? 929 LEU B C   1 
ATOM   2001 O O   . LEU A 1 255 ? -1.767  -4.319  30.724  1.00 21.47 ? 929 LEU B O   1 
ATOM   2002 C CB  . LEU A 1 255 ? -1.139  -3.092  27.843  1.00 22.79 ? 929 LEU B CB  1 
ATOM   2003 C CG  . LEU A 1 255 ? -0.336  -2.622  26.626  1.00 21.23 ? 929 LEU B CG  1 
ATOM   2004 C CD1 . LEU A 1 255 ? -0.806  -3.347  25.348  1.00 23.53 ? 929 LEU B CD1 1 
ATOM   2005 C CD2 . LEU A 1 255 ? -0.402  -1.094  26.464  1.00 20.37 ? 929 LEU B CD2 1 
ATOM   2006 N N   . PHE A 1 256 ? -2.520  -2.174  30.596  1.00 24.42 ? 930 PHE B N   1 
ATOM   2007 C CA  . PHE A 1 256 ? -3.673  -2.336  31.452  1.00 25.85 ? 930 PHE B CA  1 
ATOM   2008 C C   . PHE A 1 256 ? -4.897  -2.821  30.685  1.00 28.29 ? 930 PHE B C   1 
ATOM   2009 O O   . PHE A 1 256 ? -5.754  -3.498  31.271  1.00 26.97 ? 930 PHE B O   1 
ATOM   2010 C CB  . PHE A 1 256 ? -3.964  -1.014  32.152  1.00 24.83 ? 930 PHE B CB  1 
ATOM   2011 C CG  . PHE A 1 256 ? -2.856  -0.580  33.115  1.00 23.69 ? 930 PHE B CG  1 
ATOM   2012 C CD1 . PHE A 1 256 ? -2.727  -1.180  34.370  1.00 24.00 ? 930 PHE B CD1 1 
ATOM   2013 C CD2 . PHE A 1 256 ? -1.973  0.440   32.771  1.00 19.80 ? 930 PHE B CD2 1 
ATOM   2014 C CE1 . PHE A 1 256 ? -1.692  -0.784  35.258  1.00 21.55 ? 930 PHE B CE1 1 
ATOM   2015 C CE2 . PHE A 1 256 ? -0.950  0.851   33.652  1.00 20.56 ? 930 PHE B CE2 1 
ATOM   2016 C CZ  . PHE A 1 256 ? -0.808  0.225   34.897  1.00 22.39 ? 930 PHE B CZ  1 
ATOM   2017 N N   . HIS A 1 257 ? -4.956  -2.478  29.387  1.00 30.77 ? 931 HIS B N   1 
ATOM   2018 C CA  . HIS A 1 257 ? -6.041  -2.889  28.485  1.00 35.05 ? 931 HIS B CA  1 
ATOM   2019 C C   . HIS A 1 257 ? -5.512  -3.389  27.152  1.00 37.11 ? 931 HIS B C   1 
ATOM   2020 O O   . HIS A 1 257 ? -4.413  -3.043  26.735  1.00 37.34 ? 931 HIS B O   1 
ATOM   2021 C CB  . HIS A 1 257 ? -7.034  -1.742  28.250  1.00 35.29 ? 931 HIS B CB  1 
ATOM   2022 C CG  . HIS A 1 257 ? -7.394  -1.010  29.503  1.00 36.33 ? 931 HIS B CG  1 
ATOM   2023 N ND1 . HIS A 1 257 ? -8.056  -1.615  30.553  1.00 37.19 ? 931 HIS B ND1 1 
ATOM   2024 C CD2 . HIS A 1 257 ? -7.140  0.259   29.894  1.00 36.17 ? 931 HIS B CD2 1 
ATOM   2025 C CE1 . HIS A 1 257 ? -8.195  -0.746  31.539  1.00 36.50 ? 931 HIS B CE1 1 
ATOM   2026 N NE2 . HIS A 1 257 ? -7.657  0.400   31.160  1.00 37.96 ? 931 HIS B NE2 1 
ATOM   2027 N N   . LYS A 1 258 ? -6.299  -4.229  26.492  1.00 40.25 ? 932 LYS B N   1 
ATOM   2028 C CA  . LYS A 1 258 ? -5.875  -4.792  25.220  1.00 43.32 ? 932 LYS B CA  1 
ATOM   2029 C C   . LYS A 1 258 ? -5.915  -3.745  24.112  1.00 44.13 ? 932 LYS B C   1 
ATOM   2030 O O   . LYS A 1 258 ? -6.550  -2.681  24.236  1.00 44.80 ? 932 LYS B O   1 
ATOM   2031 C CB  . LYS A 1 258 ? -6.666  -6.061  24.845  1.00 43.63 ? 932 LYS B CB  1 
ATOM   2032 C CG  . LYS A 1 258 ? -8.186  -5.950  24.881  1.00 44.22 ? 932 LYS B CG  1 
ATOM   2033 C CD  . LYS A 1 258 ? -8.803  -7.345  24.673  1.00 45.72 ? 932 LYS B CD  1 
ATOM   2034 C CE  . LYS A 1 258 ? -9.845  -7.722  25.775  1.00 50.12 ? 932 LYS B CE  1 
ATOM   2035 N NZ  . LYS A 1 258 ? -11.119 -6.892  25.789  1.00 51.46 ? 932 LYS B NZ  1 
ATOM   2036 N N   . GLN B 1 8   ? 19.917  -20.330 -24.400 1.00 53.28 ? 682 GLN A N   1 
ATOM   2037 C CA  . GLN B 1 8   ? 18.628  -20.743 -25.034 1.00 53.12 ? 682 GLN A CA  1 
ATOM   2038 C C   . GLN B 1 8   ? 17.607  -21.252 -24.006 1.00 51.79 ? 682 GLN A C   1 
ATOM   2039 O O   . GLN B 1 8   ? 16.457  -20.828 -24.027 1.00 52.24 ? 682 GLN A O   1 
ATOM   2040 C CB  . GLN B 1 8   ? 18.856  -21.781 -26.154 1.00 53.96 ? 682 GLN A CB  1 
ATOM   2041 C CG  . GLN B 1 8   ? 19.930  -21.384 -27.197 1.00 56.87 ? 682 GLN A CG  1 
ATOM   2042 C CD  . GLN B 1 8   ? 19.521  -21.701 -28.652 1.00 60.42 ? 682 GLN A CD  1 
ATOM   2043 O OE1 . GLN B 1 8   ? 18.772  -22.656 -28.925 1.00 61.73 ? 682 GLN A OE1 1 
ATOM   2044 N NE2 . GLN B 1 8   ? 20.018  -20.886 -29.590 1.00 60.44 ? 682 GLN A NE2 1 
ATOM   2045 N N   . LEU B 1 9   ? 18.019  -22.154 -23.115 1.00 49.94 ? 683 LEU A N   1 
ATOM   2046 C CA  . LEU B 1 9   ? 17.136  -22.633 -22.048 1.00 47.81 ? 683 LEU A CA  1 
ATOM   2047 C C   . LEU B 1 9   ? 17.081  -21.644 -20.869 1.00 45.43 ? 683 LEU A C   1 
ATOM   2048 O O   . LEU B 1 9   ? 16.000  -21.448 -20.295 1.00 45.52 ? 683 LEU A O   1 
ATOM   2049 C CB  . LEU B 1 9   ? 17.539  -24.031 -21.546 1.00 48.68 ? 683 LEU A CB  1 
ATOM   2050 C CG  . LEU B 1 9   ? 17.516  -25.286 -22.434 1.00 50.64 ? 683 LEU A CG  1 
ATOM   2051 C CD1 . LEU B 1 9   ? 18.024  -26.479 -21.629 1.00 52.08 ? 683 LEU A CD1 1 
ATOM   2052 C CD2 . LEU B 1 9   ? 16.139  -25.595 -23.048 1.00 52.44 ? 683 LEU A CD2 1 
ATOM   2053 N N   . ILE B 1 10  ? 18.225  -21.028 -20.523 1.00 41.74 ? 684 ILE A N   1 
ATOM   2054 C CA  . ILE B 1 10  ? 18.286  -20.033 -19.440 1.00 38.24 ? 684 ILE A CA  1 
ATOM   2055 C C   . ILE B 1 10  ? 17.747  -18.669 -19.898 1.00 35.10 ? 684 ILE A C   1 
ATOM   2056 O O   . ILE B 1 10  ? 18.329  -18.064 -20.796 1.00 34.08 ? 684 ILE A O   1 
ATOM   2057 C CB  . ILE B 1 10  ? 19.715  -19.834 -18.878 1.00 38.22 ? 684 ILE A CB  1 
ATOM   2058 C CG1 . ILE B 1 10  ? 20.349  -21.169 -18.469 1.00 40.68 ? 684 ILE A CG1 1 
ATOM   2059 C CG2 . ILE B 1 10  ? 19.695  -18.837 -17.685 1.00 37.88 ? 684 ILE A CG2 1 
ATOM   2060 C CD1 . ILE B 1 10  ? 19.945  -21.683 -17.094 1.00 41.61 ? 684 ILE A CD1 1 
ATOM   2061 N N   . PRO B 1 11  ? 16.652  -18.183 -19.271 1.00 32.21 ? 685 PRO A N   1 
ATOM   2062 C CA  . PRO B 1 11  ? 16.067  -16.888 -19.648 1.00 30.31 ? 685 PRO A CA  1 
ATOM   2063 C C   . PRO B 1 11  ? 17.138  -15.776 -19.660 1.00 28.24 ? 685 PRO A C   1 
ATOM   2064 O O   . PRO B 1 11  ? 18.009  -15.766 -18.792 1.00 26.92 ? 685 PRO A O   1 
ATOM   2065 C CB  . PRO B 1 11  ? 15.008  -16.637 -18.564 1.00 30.79 ? 685 PRO A CB  1 
ATOM   2066 C CG  . PRO B 1 11  ? 14.676  -17.956 -18.003 1.00 31.15 ? 685 PRO A CG  1 
ATOM   2067 C CD  . PRO B 1 11  ? 15.908  -18.827 -18.176 1.00 32.28 ? 685 PRO A CD  1 
ATOM   2068 N N   . PRO B 1 12  ? 17.101  -14.886 -20.668 1.00 26.70 ? 686 PRO A N   1 
ATOM   2069 C CA  . PRO B 1 12  ? 18.141  -13.873 -20.815 1.00 25.56 ? 686 PRO A CA  1 
ATOM   2070 C C   . PRO B 1 12  ? 18.310  -12.972 -19.577 1.00 23.30 ? 686 PRO A C   1 
ATOM   2071 O O   . PRO B 1 12  ? 19.423  -12.579 -19.274 1.00 23.14 ? 686 PRO A O   1 
ATOM   2072 C CB  . PRO B 1 12  ? 17.670  -13.055 -22.023 1.00 25.63 ? 686 PRO A CB  1 
ATOM   2073 C CG  . PRO B 1 12  ? 16.850  -14.014 -22.810 1.00 28.05 ? 686 PRO A CG  1 
ATOM   2074 C CD  . PRO B 1 12  ? 16.096  -14.788 -21.745 1.00 27.51 ? 686 PRO A CD  1 
ATOM   2075 N N   . LEU B 1 13  ? 17.232  -12.649 -18.869 1.00 21.86 ? 687 LEU A N   1 
ATOM   2076 C CA  . LEU B 1 13  ? 17.375  -11.786 -17.677 1.00 21.05 ? 687 LEU A CA  1 
ATOM   2077 C C   . LEU B 1 13  ? 18.222  -12.471 -16.579 1.00 19.89 ? 687 LEU A C   1 
ATOM   2078 O O   . LEU B 1 13  ? 19.042  -11.842 -15.930 1.00 21.04 ? 687 LEU A O   1 
ATOM   2079 C CB  . LEU B 1 13  ? 16.025  -11.344 -17.120 1.00 19.90 ? 687 LEU A CB  1 
ATOM   2080 C CG  . LEU B 1 13  ? 16.011  -10.463 -15.855 1.00 20.79 ? 687 LEU A CG  1 
ATOM   2081 C CD1 . LEU B 1 13  ? 16.952  -9.258  -15.988 1.00 20.07 ? 687 LEU A CD1 1 
ATOM   2082 C CD2 . LEU B 1 13  ? 14.583  -10.007 -15.539 1.00 21.69 ? 687 LEU A CD2 1 
ATOM   2083 N N   . ILE B 1 14  ? 18.015  -13.764 -16.393 1.00 20.03 ? 688 ILE A N   1 
ATOM   2084 C CA  . ILE B 1 14  ? 18.770  -14.523 -15.398 1.00 18.97 ? 688 ILE A CA  1 
ATOM   2085 C C   . ILE B 1 14  ? 20.214  -14.602 -15.814 1.00 19.37 ? 688 ILE A C   1 
ATOM   2086 O O   . ILE B 1 14  ? 21.109  -14.518 -14.980 1.00 17.71 ? 688 ILE A O   1 
ATOM   2087 C CB  . ILE B 1 14  ? 18.147  -15.898 -15.208 1.00 19.44 ? 688 ILE A CB  1 
ATOM   2088 C CG1 . ILE B 1 14  ? 16.767  -15.728 -14.572 1.00 18.40 ? 688 ILE A CG1 1 
ATOM   2089 C CG2 . ILE B 1 14  ? 19.084  -16.837 -14.406 1.00 19.56 ? 688 ILE A CG2 1 
ATOM   2090 C CD1 . ILE B 1 14  ? 15.910  -17.006 -14.566 1.00 19.96 ? 688 ILE A CD1 1 
ATOM   2091 N N   . ASN B 1 15  ? 20.458  -14.747 -17.118 1.00 19.64 ? 689 ASN A N   1 
ATOM   2092 C CA  . ASN B 1 15  ? 21.828  -14.731 -17.624 1.00 21.38 ? 689 ASN A CA  1 
ATOM   2093 C C   . ASN B 1 15  ? 22.491  -13.406 -17.304 1.00 19.95 ? 689 ASN A C   1 
ATOM   2094 O O   . ASN B 1 15  ? 23.665  -13.342 -16.894 1.00 20.59 ? 689 ASN A O   1 
ATOM   2095 C CB  . ASN B 1 15  ? 21.846  -14.963 -19.172 1.00 22.23 ? 689 ASN A CB  1 
ATOM   2096 C CG  . ASN B 1 15  ? 23.265  -15.137 -19.720 1.00 30.11 ? 689 ASN A CG  1 
ATOM   2097 O OD1 . ASN B 1 15  ? 23.978  -16.096 -19.366 1.00 37.34 ? 689 ASN A OD1 1 
ATOM   2098 N ND2 . ASN B 1 15  ? 23.689  -14.210 -20.607 1.00 36.30 ? 689 ASN A ND2 1 
ATOM   2099 N N   . LEU B 1 16  ? 21.744  -12.339 -17.527 1.00 20.18 ? 690 LEU A N   1 
ATOM   2100 C CA  . LEU B 1 16  ? 22.221  -10.971 -17.201 1.00 19.38 ? 690 LEU A CA  1 
ATOM   2101 C C   . LEU B 1 16  ? 22.547  -10.883 -15.710 1.00 18.61 ? 690 LEU A C   1 
ATOM   2102 O O   . LEU B 1 16  ? 23.631  -10.416 -15.320 1.00 18.55 ? 690 LEU A O   1 
ATOM   2103 C CB  . LEU B 1 16  ? 21.169  -9.945  -17.574 1.00 18.83 ? 690 LEU A CB  1 
ATOM   2104 C CG  . LEU B 1 16  ? 21.676  -8.508  -17.438 1.00 22.73 ? 690 LEU A CG  1 
ATOM   2105 C CD1 . LEU B 1 16  ? 20.888  -7.662  -18.434 1.00 26.06 ? 690 LEU A CD1 1 
ATOM   2106 C CD2 . LEU B 1 16  ? 21.538  -7.945  -15.989 1.00 20.86 ? 690 LEU A CD2 1 
ATOM   2107 N N   . LEU B 1 17  ? 21.632  -11.379 -14.880 1.00 17.87 ? 691 LEU A N   1 
ATOM   2108 C CA  . LEU B 1 17  ? 21.853  -11.371 -13.411 1.00 16.77 ? 691 LEU A CA  1 
ATOM   2109 C C   . LEU B 1 17  ? 23.148  -12.122 -13.032 1.00 17.11 ? 691 LEU A C   1 
ATOM   2110 O O   . LEU B 1 17  ? 23.843  -11.715 -12.140 1.00 15.98 ? 691 LEU A O   1 
ATOM   2111 C CB  . LEU B 1 17  ? 20.628  -11.962 -12.683 1.00 14.58 ? 691 LEU A CB  1 
ATOM   2112 C CG  . LEU B 1 17  ? 19.366  -11.070 -12.666 1.00 15.79 ? 691 LEU A CG  1 
ATOM   2113 C CD1 . LEU B 1 17  ? 18.219  -11.763 -11.923 1.00 13.13 ? 691 LEU A CD1 1 
ATOM   2114 C CD2 . LEU B 1 17  ? 19.610  -9.610  -12.087 1.00 15.06 ? 691 LEU A CD2 1 
ATOM   2115 N N   . MET B 1 18  ? 23.441  -13.239 -13.703 1.00 18.31 ? 692 MET A N   1 
ATOM   2116 C CA  . MET B 1 18  ? 24.692  -14.002 -13.439 1.00 21.00 ? 692 MET A CA  1 
ATOM   2117 C C   . MET B 1 18  ? 25.910  -13.147 -13.765 1.00 18.92 ? 692 MET A C   1 
ATOM   2118 O O   . MET B 1 18  ? 26.860  -13.078 -12.995 1.00 18.79 ? 692 MET A O   1 
ATOM   2119 C CB  . MET B 1 18  ? 24.730  -15.272 -14.304 1.00 20.33 ? 692 MET A CB  1 
ATOM   2120 C CG  . MET B 1 18  ? 23.704  -16.340 -13.949 1.00 24.71 ? 692 MET A CG  1 
ATOM   2121 S SD  . MET B 1 18  ? 23.869  -17.890 -14.963 1.00 29.06 ? 692 MET A SD  1 
ATOM   2122 C CE  . MET B 1 18  ? 22.875  -17.515 -16.389 1.00 32.36 ? 692 MET A CE  1 
ATOM   2123 N N   . SER B 1 19  ? 25.852  -12.455 -14.909 1.00 19.45 ? 693 SER A N   1 
ATOM   2124 C CA  . SER B 1 19  ? 26.963  -11.659 -15.418 1.00 20.09 ? 693 SER A CA  1 
ATOM   2125 C C   . SER B 1 19  ? 27.279  -10.405 -14.594 1.00 19.27 ? 693 SER A C   1 
ATOM   2126 O O   . SER B 1 19  ? 28.423  -9.919  -14.605 1.00 19.73 ? 693 SER A O   1 
ATOM   2127 C CB  . SER B 1 19  ? 26.740  -11.288 -16.914 1.00 21.21 ? 693 SER A CB  1 
ATOM   2128 O OG  . SER B 1 19  ? 25.971  -10.100 -17.080 1.00 26.65 ? 693 SER A OG  1 
ATOM   2129 N N   . ILE B 1 20  ? 26.295  -9.874  -13.881 1.00 18.42 ? 694 ILE A N   1 
ATOM   2130 C CA  . ILE B 1 20  ? 26.527  -8.623  -13.111 1.00 18.19 ? 694 ILE A CA  1 
ATOM   2131 C C   . ILE B 1 20  ? 26.833  -8.883  -11.635 1.00 19.08 ? 694 ILE A C   1 
ATOM   2132 O O   . ILE B 1 20  ? 27.026  -7.967  -10.851 1.00 18.81 ? 694 ILE A O   1 
ATOM   2133 C CB  . ILE B 1 20  ? 25.377  -7.619  -13.263 1.00 18.00 ? 694 ILE A CB  1 
ATOM   2134 C CG1 . ILE B 1 20  ? 24.062  -8.211  -12.746 1.00 15.89 ? 694 ILE A CG1 1 
ATOM   2135 C CG2 . ILE B 1 20  ? 25.217  -7.210  -14.768 1.00 18.01 ? 694 ILE A CG2 1 
ATOM   2136 C CD1 . ILE B 1 20  ? 22.915  -7.161  -12.508 1.00 17.07 ? 694 ILE A CD1 1 
ATOM   2137 N N   . GLU B 1 21  ? 26.853  -10.153 -11.271 1.00 20.61 ? 695 GLU A N   1 
ATOM   2138 C CA  . GLU B 1 21  ? 27.141  -10.550 -9.924  1.00 23.29 ? 695 GLU A CA  1 
ATOM   2139 C C   . GLU B 1 21  ? 28.578  -10.103 -9.591  1.00 24.87 ? 695 GLU A C   1 
ATOM   2140 O O   . GLU B 1 21  ? 29.460  -10.117 -10.457 1.00 24.54 ? 695 GLU A O   1 
ATOM   2141 C CB  . GLU B 1 21  ? 26.898  -12.055 -9.801  1.00 22.88 ? 695 GLU A CB  1 
ATOM   2142 C CG  . GLU B 1 21  ? 26.991  -12.564 -8.433  1.00 26.99 ? 695 GLU A CG  1 
ATOM   2143 C CD  . GLU B 1 21  ? 25.739  -12.353 -7.638  1.00 25.94 ? 695 GLU A CD  1 
ATOM   2144 O OE1 . GLU B 1 21  ? 24.917  -11.450 -7.959  1.00 22.69 ? 695 GLU A OE1 1 
ATOM   2145 O OE2 . GLU B 1 21  ? 25.574  -13.165 -6.701  1.00 30.23 ? 695 GLU A OE2 1 
ATOM   2146 N N   . PRO B 1 22  ? 28.790  -9.589  -8.375  1.00 27.24 ? 696 PRO A N   1 
ATOM   2147 C CA  . PRO B 1 22  ? 30.106  -9.088  -7.956  1.00 28.00 ? 696 PRO A CA  1 
ATOM   2148 C C   . PRO B 1 22  ? 31.226  -10.128 -8.034  1.00 27.94 ? 696 PRO A C   1 
ATOM   2149 O O   . PRO B 1 22  ? 30.989  -11.321 -7.903  1.00 26.87 ? 696 PRO A O   1 
ATOM   2150 C CB  . PRO B 1 22  ? 29.892  -8.733  -6.469  1.00 27.96 ? 696 PRO A CB  1 
ATOM   2151 C CG  . PRO B 1 22  ? 28.427  -8.468  -6.339  1.00 29.26 ? 696 PRO A CG  1 
ATOM   2152 C CD  . PRO B 1 22  ? 27.762  -9.394  -7.323  1.00 28.27 ? 696 PRO A CD  1 
ATOM   2153 N N   . ASP B 1 23  ? 32.443  -9.640  -8.233  1.00 28.28 ? 697 ASP A N   1 
ATOM   2154 C CA  . ASP B 1 23  ? 33.637  -10.432 -8.058  1.00 29.43 ? 697 ASP A CA  1 
ATOM   2155 C C   . ASP B 1 23  ? 33.804  -10.742 -6.565  1.00 27.27 ? 697 ASP A C   1 
ATOM   2156 O O   . ASP B 1 23  ? 33.177  -10.109 -5.732  1.00 26.04 ? 697 ASP A O   1 
ATOM   2157 C CB  . ASP B 1 23  ? 34.828  -9.617  -8.522  1.00 31.50 ? 697 ASP A CB  1 
ATOM   2158 C CG  . ASP B 1 23  ? 35.589  -10.282 -9.639  1.00 36.89 ? 697 ASP A CG  1 
ATOM   2159 O OD1 . ASP B 1 23  ? 34.931  -10.809 -10.597 1.00 40.45 ? 697 ASP A OD1 1 
ATOM   2160 O OD2 . ASP B 1 23  ? 36.848  -10.237 -9.545  1.00 40.81 ? 697 ASP A OD2 1 
ATOM   2161 N N   . VAL B 1 24  ? 34.636  -11.733 -6.264  1.00 26.25 ? 698 VAL A N   1 
ATOM   2162 C CA  . VAL B 1 24  ? 35.048  -12.094 -4.898  1.00 24.95 ? 698 VAL A CA  1 
ATOM   2163 C C   . VAL B 1 24  ? 35.508  -10.878 -4.110  1.00 23.39 ? 698 VAL A C   1 
ATOM   2164 O O   . VAL B 1 24  ? 36.336  -10.110 -4.569  1.00 23.19 ? 698 VAL A O   1 
ATOM   2165 C CB  . VAL B 1 24  ? 36.225  -13.138 -4.909  1.00 25.79 ? 698 VAL A CB  1 
ATOM   2166 C CG1 . VAL B 1 24  ? 36.841  -13.307 -3.513  1.00 26.29 ? 698 VAL A CG1 1 
ATOM   2167 C CG2 . VAL B 1 24  ? 35.736  -14.506 -5.420  1.00 26.50 ? 698 VAL A CG2 1 
ATOM   2168 N N   . ILE B 1 25  ? 34.952  -10.716 -2.917  1.00 22.22 ? 699 ILE A N   1 
ATOM   2169 C CA  . ILE B 1 25  ? 35.344  -9.624  -2.016  1.00 19.99 ? 699 ILE A CA  1 
ATOM   2170 C C   . ILE B 1 25  ? 36.055  -10.164 -0.760  1.00 20.01 ? 699 ILE A C   1 
ATOM   2171 O O   . ILE B 1 25  ? 35.504  -10.992 0.007   1.00 16.49 ? 699 ILE A O   1 
ATOM   2172 C CB  . ILE B 1 25  ? 34.125  -8.739  -1.643  1.00 18.80 ? 699 ILE A CB  1 
ATOM   2173 C CG1 . ILE B 1 25  ? 33.547  -8.076  -2.900  1.00 19.88 ? 699 ILE A CG1 1 
ATOM   2174 C CG2 . ILE B 1 25  ? 34.533  -7.629  -0.678  1.00 17.65 ? 699 ILE A CG2 1 
ATOM   2175 C CD1 . ILE B 1 25  ? 32.292  -7.404  -2.637  1.00 19.17 ? 699 ILE A CD1 1 
ATOM   2176 N N   . TYR B 1 26  ? 37.275  -9.679  -0.578  1.00 19.63 ? 700 TYR A N   1 
ATOM   2177 C CA  . TYR B 1 26  ? 38.070  -9.981  0.594   1.00 22.52 ? 700 TYR A CA  1 
ATOM   2178 C C   . TYR B 1 26  ? 37.778  -9.005  1.726   1.00 21.90 ? 700 TYR A C   1 
ATOM   2179 O O   . TYR B 1 26  ? 37.494  -7.835  1.498   1.00 22.00 ? 700 TYR A O   1 
ATOM   2180 C CB  . TYR B 1 26  ? 39.567  -9.946  0.256   1.00 24.12 ? 700 TYR A CB  1 
ATOM   2181 C CG  . TYR B 1 26  ? 39.969  -11.042 -0.705  1.00 28.87 ? 700 TYR A CG  1 
ATOM   2182 C CD1 . TYR B 1 26  ? 39.754  -10.904 -2.071  1.00 31.97 ? 700 TYR A CD1 1 
ATOM   2183 C CD2 . TYR B 1 26  ? 40.547  -12.218 -0.254  1.00 30.40 ? 700 TYR A CD2 1 
ATOM   2184 C CE1 . TYR B 1 26  ? 40.113  -11.890 -2.954  1.00 34.09 ? 700 TYR A CE1 1 
ATOM   2185 C CE2 . TYR B 1 26  ? 40.909  -13.223 -1.151  1.00 33.12 ? 700 TYR A CE2 1 
ATOM   2186 C CZ  . TYR B 1 26  ? 40.684  -13.043 -2.494  1.00 32.04 ? 700 TYR A CZ  1 
ATOM   2187 O OH  . TYR B 1 26  ? 41.025  -14.042 -3.407  1.00 36.01 ? 700 TYR A OH  1 
ATOM   2188 N N   . ALA B 1 27  ? 37.816  -9.490  2.951   1.00 21.75 ? 701 ALA A N   1 
ATOM   2189 C CA  . ALA B 1 27  ? 37.674  -8.598  4.109   1.00 22.63 ? 701 ALA A CA  1 
ATOM   2190 C C   . ALA B 1 27  ? 38.937  -7.762  4.396   1.00 23.61 ? 701 ALA A C   1 
ATOM   2191 O O   . ALA B 1 27  ? 38.865  -6.711  5.085   1.00 22.67 ? 701 ALA A O   1 
ATOM   2192 C CB  . ALA B 1 27  ? 37.262  -9.401  5.343   1.00 21.07 ? 701 ALA A CB  1 
ATOM   2193 N N   . GLY B 1 28  ? 40.075  -8.224  3.875   1.00 24.98 ? 702 GLY A N   1 
ATOM   2194 C CA  . GLY B 1 28  ? 41.391  -7.657  4.241   1.00 28.81 ? 702 GLY A CA  1 
ATOM   2195 C C   . GLY B 1 28  ? 41.766  -8.013  5.679   1.00 31.89 ? 702 GLY A C   1 
ATOM   2196 O O   . GLY B 1 28  ? 42.405  -7.211  6.395   1.00 31.20 ? 702 GLY A O   1 
ATOM   2197 N N   . HIS B 1 29  ? 41.358  -9.214  6.108   1.00 33.98 ? 703 HIS A N   1 
ATOM   2198 C CA  . HIS B 1 29  ? 41.477  -9.607  7.505   1.00 37.60 ? 703 HIS A CA  1 
ATOM   2199 C C   . HIS B 1 29  ? 42.860  -10.181 7.811   1.00 40.47 ? 703 HIS A C   1 
ATOM   2200 O O   . HIS B 1 29  ? 43.443  -10.885 6.996   1.00 40.82 ? 703 HIS A O   1 
ATOM   2201 C CB  . HIS B 1 29  ? 40.359  -10.580 7.910   1.00 37.16 ? 703 HIS A CB  1 
ATOM   2202 C CG  . HIS B 1 29  ? 40.426  -11.006 9.341   1.00 38.14 ? 703 HIS A CG  1 
ATOM   2203 N ND1 . HIS B 1 29  ? 41.047  -12.171 9.740   1.00 41.12 ? 703 HIS A ND1 1 
ATOM   2204 C CD2 . HIS B 1 29  ? 39.986  -10.410 10.474  1.00 39.63 ? 703 HIS A CD2 1 
ATOM   2205 C CE1 . HIS B 1 29  ? 40.968  -12.284 11.055  1.00 41.51 ? 703 HIS A CE1 1 
ATOM   2206 N NE2 . HIS B 1 29  ? 40.333  -11.225 11.526  1.00 42.17 ? 703 HIS A NE2 1 
ATOM   2207 N N   . ASP B 1 30  ? 43.366  -9.861  8.998   1.00 44.53 ? 704 ASP A N   1 
ATOM   2208 C CA  . ASP B 1 30  ? 44.687  -10.291 9.469   1.00 48.33 ? 704 ASP A CA  1 
ATOM   2209 C C   . ASP B 1 30  ? 44.571  -11.642 10.204  1.00 50.09 ? 704 ASP A C   1 
ATOM   2210 O O   . ASP B 1 30  ? 44.471  -11.672 11.437  1.00 50.44 ? 704 ASP A O   1 
ATOM   2211 C CB  . ASP B 1 30  ? 45.269  -9.226  10.416  1.00 48.83 ? 704 ASP A CB  1 
ATOM   2212 C CG  . ASP B 1 30  ? 44.451  -7.919  10.423  1.00 52.31 ? 704 ASP A CG  1 
ATOM   2213 O OD1 . ASP B 1 30  ? 43.196  -7.975  10.604  1.00 53.66 ? 704 ASP A OD1 1 
ATOM   2214 O OD2 . ASP B 1 30  ? 45.066  -6.829  10.255  1.00 56.89 ? 704 ASP A OD2 1 
ATOM   2215 N N   . ASN B 1 31  ? 44.558  -12.746 9.449   1.00 52.35 ? 705 ASN A N   1 
ATOM   2216 C CA  . ASN B 1 31  ? 44.481  -14.089 10.043  1.00 54.85 ? 705 ASN A CA  1 
ATOM   2217 C C   . ASN B 1 31  ? 45.747  -14.368 10.873  1.00 56.39 ? 705 ASN A C   1 
ATOM   2218 O O   . ASN B 1 31  ? 45.705  -15.094 11.873  1.00 57.19 ? 705 ASN A O   1 
ATOM   2219 C CB  . ASN B 1 31  ? 44.237  -15.176 8.966   1.00 54.76 ? 705 ASN A CB  1 
ATOM   2220 C CG  . ASN B 1 31  ? 42.872  -15.032 8.282   1.00 54.82 ? 705 ASN A CG  1 
ATOM   2221 O OD1 . ASN B 1 31  ? 42.785  -14.535 7.159   1.00 55.36 ? 705 ASN A OD1 1 
ATOM   2222 N ND2 . ASN B 1 31  ? 41.804  -15.434 8.972   1.00 54.22 ? 705 ASN A ND2 1 
ATOM   2223 N N   . THR B 1 32  ? 46.856  -13.758 10.444  1.00 57.92 ? 706 THR A N   1 
ATOM   2224 C CA  . THR B 1 32  ? 48.143  -13.752 11.163  1.00 59.07 ? 706 THR A CA  1 
ATOM   2225 C C   . THR B 1 32  ? 47.994  -13.725 12.693  1.00 59.40 ? 706 THR A C   1 
ATOM   2226 O O   . THR B 1 32  ? 48.210  -14.742 13.357  1.00 59.70 ? 706 THR A O   1 
ATOM   2227 C CB  . THR B 1 32  ? 49.049  -12.580 10.665  1.00 58.94 ? 706 THR A CB  1 
ATOM   2228 O OG1 . THR B 1 32  ? 49.800  -12.051 11.760  1.00 59.71 ? 706 THR A OG1 1 
ATOM   2229 C CG2 . THR B 1 32  ? 48.205  -11.448 10.048  1.00 59.83 ? 706 THR A CG2 1 
ATOM   2230 N N   . LYS B 1 33  ? 47.602  -12.566 13.228  1.00 59.86 ? 707 LYS A N   1 
ATOM   2231 C CA  . LYS B 1 33  ? 47.368  -12.363 14.663  1.00 60.09 ? 707 LYS A CA  1 
ATOM   2232 C C   . LYS B 1 33  ? 46.126  -13.131 15.133  1.00 59.91 ? 707 LYS A C   1 
ATOM   2233 O O   . LYS B 1 33  ? 45.151  -13.252 14.377  1.00 60.07 ? 707 LYS A O   1 
ATOM   2234 C CB  . LYS B 1 33  ? 47.167  -10.871 14.955  1.00 60.10 ? 707 LYS A CB  1 
ATOM   2235 C CG  . LYS B 1 33  ? 48.300  -9.944  14.491  1.00 60.79 ? 707 LYS A CG  1 
ATOM   2236 C CD  . LYS B 1 33  ? 47.807  -8.488  14.426  1.00 60.62 ? 707 LYS A CD  1 
ATOM   2237 C CE  . LYS B 1 33  ? 48.895  -7.520  13.956  1.00 60.74 ? 707 LYS A CE  1 
ATOM   2238 N NZ  . LYS B 1 33  ? 48.484  -6.095  14.198  1.00 59.43 ? 707 LYS A NZ  1 
ATOM   2239 N N   . PRO B 1 34  ? 46.153  -13.664 16.377  1.00 59.55 ? 708 PRO A N   1 
ATOM   2240 C CA  . PRO B 1 34  ? 44.923  -14.229 16.979  1.00 58.98 ? 708 PRO A CA  1 
ATOM   2241 C C   . PRO B 1 34  ? 43.744  -13.222 16.967  1.00 57.97 ? 708 PRO A C   1 
ATOM   2242 O O   . PRO B 1 34  ? 43.953  -12.021 17.167  1.00 57.80 ? 708 PRO A O   1 
ATOM   2243 C CB  . PRO B 1 34  ? 45.354  -14.559 18.423  1.00 59.23 ? 708 PRO A CB  1 
ATOM   2244 C CG  . PRO B 1 34  ? 46.838  -14.736 18.354  1.00 59.31 ? 708 PRO A CG  1 
ATOM   2245 C CD  . PRO B 1 34  ? 47.322  -13.794 17.273  1.00 59.62 ? 708 PRO A CD  1 
ATOM   2246 N N   . ASP B 1 35  ? 42.527  -13.704 16.724  1.00 56.74 ? 709 ASP A N   1 
ATOM   2247 C CA  . ASP B 1 35  ? 41.377  -12.806 16.613  1.00 55.46 ? 709 ASP A CA  1 
ATOM   2248 C C   . ASP B 1 35  ? 40.723  -12.502 17.966  1.00 53.67 ? 709 ASP A C   1 
ATOM   2249 O O   . ASP B 1 35  ? 40.593  -13.391 18.807  1.00 53.60 ? 709 ASP A O   1 
ATOM   2250 C CB  . ASP B 1 35  ? 40.353  -13.262 15.516  1.00 56.39 ? 709 ASP A CB  1 
ATOM   2251 C CG  . ASP B 1 35  ? 39.625  -14.604 15.839  1.00 58.06 ? 709 ASP A CG  1 
ATOM   2252 O OD1 . ASP B 1 35  ? 39.736  -15.558 15.011  1.00 58.81 ? 709 ASP A OD1 1 
ATOM   2253 O OD2 . ASP B 1 35  ? 38.905  -14.694 16.875  1.00 58.63 ? 709 ASP A OD2 1 
ATOM   2254 N N   . THR B 1 36  ? 40.357  -11.230 18.173  1.00 51.05 ? 710 THR A N   1 
ATOM   2255 C CA  . THR B 1 36  ? 39.504  -10.813 19.292  1.00 48.08 ? 710 THR A CA  1 
ATOM   2256 C C   . THR B 1 36  ? 38.086  -10.517 18.788  1.00 46.35 ? 710 THR A C   1 
ATOM   2257 O O   . THR B 1 36  ? 37.843  -10.417 17.591  1.00 44.83 ? 710 THR A O   1 
ATOM   2258 C CB  . THR B 1 36  ? 40.062  -9.564  20.022  1.00 48.44 ? 710 THR A CB  1 
ATOM   2259 O OG1 . THR B 1 36  ? 40.327  -8.524  19.070  1.00 47.53 ? 710 THR A OG1 1 
ATOM   2260 C CG2 . THR B 1 36  ? 41.345  -9.890  20.769  1.00 48.06 ? 710 THR A CG2 1 
ATOM   2261 N N   . SER B 1 37  ? 37.153  -10.376 19.714  1.00 44.47 ? 711 SER A N   1 
ATOM   2262 C CA  . SER B 1 37  ? 35.786  -10.034 19.366  1.00 43.04 ? 711 SER A CA  1 
ATOM   2263 C C   . SER B 1 37  ? 35.732  -8.668  18.679  1.00 40.85 ? 711 SER A C   1 
ATOM   2264 O O   . SER B 1 37  ? 34.985  -8.478  17.735  1.00 40.34 ? 711 SER A O   1 
ATOM   2265 C CB  . SER B 1 37  ? 34.887  -10.036 20.607  1.00 43.25 ? 711 SER A CB  1 
ATOM   2266 O OG  . SER B 1 37  ? 33.523  -10.180 20.234  1.00 46.46 ? 711 SER A OG  1 
ATOM   2267 N N   . SER B 1 38  ? 36.538  -7.725  19.145  1.00 38.31 ? 712 SER A N   1 
ATOM   2268 C CA  . SER B 1 38  ? 36.526  -6.399  18.570  1.00 36.12 ? 712 SER A CA  1 
ATOM   2269 C C   . SER B 1 38  ? 37.184  -6.390  17.166  1.00 33.85 ? 712 SER A C   1 
ATOM   2270 O O   . SER B 1 38  ? 36.715  -5.702  16.244  1.00 32.68 ? 712 SER A O   1 
ATOM   2271 C CB  . SER B 1 38  ? 37.169  -5.394  19.546  1.00 36.29 ? 712 SER A CB  1 
ATOM   2272 O OG  . SER B 1 38  ? 38.584  -5.352  19.401  1.00 39.05 ? 712 SER A OG  1 
ATOM   2273 N N   . SER B 1 39  ? 38.235  -7.193  17.001  1.00 30.45 ? 713 SER A N   1 
ATOM   2274 C CA  . SER B 1 39  ? 38.988  -7.206  15.760  1.00 28.47 ? 713 SER A CA  1 
ATOM   2275 C C   . SER B 1 39  ? 38.191  -7.923  14.659  1.00 26.74 ? 713 SER A C   1 
ATOM   2276 O O   . SER B 1 39  ? 38.264  -7.569  13.495  1.00 24.13 ? 713 SER A O   1 
ATOM   2277 C CB  . SER B 1 39  ? 40.386  -7.819  15.961  1.00 29.13 ? 713 SER A CB  1 
ATOM   2278 O OG  . SER B 1 39  ? 40.358  -9.230  15.797  1.00 29.41 ? 713 SER A OG  1 
ATOM   2279 N N   . LEU B 1 40  ? 37.434  -8.932  15.070  1.00 24.83 ? 714 LEU A N   1 
ATOM   2280 C CA  . LEU B 1 40  ? 36.518  -9.651  14.214  1.00 24.87 ? 714 LEU A CA  1 
ATOM   2281 C C   . LEU B 1 40  ? 35.336  -8.772  13.763  1.00 23.49 ? 714 LEU A C   1 
ATOM   2282 O O   . LEU B 1 40  ? 34.974  -8.765  12.573  1.00 21.80 ? 714 LEU A O   1 
ATOM   2283 C CB  . LEU B 1 40  ? 36.018  -10.889 14.976  1.00 25.90 ? 714 LEU A CB  1 
ATOM   2284 C CG  . LEU B 1 40  ? 35.205  -12.013 14.359  1.00 28.12 ? 714 LEU A CG  1 
ATOM   2285 C CD1 . LEU B 1 40  ? 35.645  -12.291 12.923  1.00 32.06 ? 714 LEU A CD1 1 
ATOM   2286 C CD2 . LEU B 1 40  ? 35.327  -13.285 15.216  1.00 27.10 ? 714 LEU A CD2 1 
ATOM   2287 N N   . LEU B 1 41  ? 34.756  -7.999  14.690  1.00 21.50 ? 715 LEU A N   1 
ATOM   2288 C CA  . LEU B 1 41  ? 33.693  -7.076  14.318  1.00 20.51 ? 715 LEU A CA  1 
ATOM   2289 C C   . LEU B 1 41  ? 34.201  -5.965  13.369  1.00 19.51 ? 715 LEU A C   1 
ATOM   2290 O O   . LEU B 1 41  ? 33.549  -5.651  12.364  1.00 18.75 ? 715 LEU A O   1 
ATOM   2291 C CB  . LEU B 1 41  ? 33.013  -6.525  15.551  1.00 21.13 ? 715 LEU A CB  1 
ATOM   2292 C CG  . LEU B 1 41  ? 32.225  -7.605  16.328  1.00 22.89 ? 715 LEU A CG  1 
ATOM   2293 C CD1 . LEU B 1 41  ? 31.844  -7.101  17.704  1.00 22.99 ? 715 LEU A CD1 1 
ATOM   2294 C CD2 . LEU B 1 41  ? 30.985  -8.029  15.537  1.00 21.38 ? 715 LEU A CD2 1 
ATOM   2295 N N   . THR B 1 42  ? 35.389  -5.432  13.663  1.00 18.34 ? 716 THR A N   1 
ATOM   2296 C CA  . THR B 1 42  ? 36.079  -4.505  12.761  1.00 17.89 ? 716 THR A CA  1 
ATOM   2297 C C   . THR B 1 42  ? 36.241  -5.092  11.349  1.00 17.96 ? 716 THR A C   1 
ATOM   2298 O O   . THR B 1 42  ? 35.986  -4.412  10.364  1.00 16.87 ? 716 THR A O   1 
ATOM   2299 C CB  . THR B 1 42  ? 37.429  -4.052  13.381  1.00 17.55 ? 716 THR A CB  1 
ATOM   2300 O OG1 . THR B 1 42  ? 37.146  -3.268  14.551  1.00 18.90 ? 716 THR A OG1 1 
ATOM   2301 C CG2 . THR B 1 42  ? 38.257  -3.220  12.418  1.00 19.23 ? 716 THR A CG2 1 
ATOM   2302 N N   . SER B 1 43  ? 36.666  -6.350  11.252  1.00 18.19 ? 717 SER A N   1 
ATOM   2303 C CA  . SER B 1 43  ? 36.865  -6.969  9.937   1.00 19.26 ? 717 SER A CA  1 
ATOM   2304 C C   . SER B 1 43  ? 35.559  -7.126  9.193   1.00 17.72 ? 717 SER A C   1 
ATOM   2305 O O   . SER B 1 43  ? 35.531  -6.897  7.983   1.00 18.62 ? 717 SER A O   1 
ATOM   2306 C CB  . SER B 1 43  ? 37.605  -8.300  10.030  1.00 19.42 ? 717 SER A CB  1 
ATOM   2307 O OG  . SER B 1 43  ? 38.979  -8.004  10.184  1.00 25.42 ? 717 SER A OG  1 
ATOM   2308 N N   . LEU B 1 44  ? 34.479  -7.478  9.904   1.00 16.88 ? 718 LEU A N   1 
ATOM   2309 C CA  . LEU B 1 44  ? 33.151  -7.623  9.292   1.00 16.49 ? 718 LEU A CA  1 
ATOM   2310 C C   . LEU B 1 44  ? 32.607  -6.263  8.825   1.00 16.35 ? 718 LEU A C   1 
ATOM   2311 O O   . LEU B 1 44  ? 31.872  -6.168  7.817   1.00 14.45 ? 718 LEU A O   1 
ATOM   2312 C CB  . LEU B 1 44  ? 32.164  -8.233  10.270  1.00 16.91 ? 718 LEU A CB  1 
ATOM   2313 C CG  . LEU B 1 44  ? 32.283  -9.744  10.589  1.00 19.02 ? 718 LEU A CG  1 
ATOM   2314 C CD1 . LEU B 1 44  ? 31.439  -10.016 11.811  1.00 18.08 ? 718 LEU A CD1 1 
ATOM   2315 C CD2 . LEU B 1 44  ? 31.781  -10.553 9.377   1.00 16.72 ? 718 LEU A CD2 1 
ATOM   2316 N N   . ASN B 1 45  ? 32.953  -5.211  9.569   1.00 16.48 ? 719 ASN A N   1 
ATOM   2317 C CA  . ASN B 1 45  ? 32.527  -3.864  9.161   1.00 16.54 ? 719 ASN A CA  1 
ATOM   2318 C C   . ASN B 1 45  ? 33.300  -3.401  7.915   1.00 16.58 ? 719 ASN A C   1 
ATOM   2319 O O   . ASN B 1 45  ? 32.734  -2.725  7.061   1.00 15.75 ? 719 ASN A O   1 
ATOM   2320 C CB  . ASN B 1 45  ? 32.698  -2.882  10.317  1.00 16.54 ? 719 ASN A CB  1 
ATOM   2321 C CG  . ASN B 1 45  ? 31.652  -3.084  11.394  1.00 17.05 ? 719 ASN A CG  1 
ATOM   2322 O OD1 . ASN B 1 45  ? 30.595  -3.651  11.141  1.00 19.21 ? 719 ASN A OD1 1 
ATOM   2323 N ND2 . ASN B 1 45  ? 31.937  -2.609  12.600  1.00 17.24 ? 719 ASN A ND2 1 
ATOM   2324 N N   . GLN B 1 46  ? 34.575  -3.827  7.809   1.00 16.49 ? 720 GLN A N   1 
ATOM   2325 C CA  . GLN B 1 46  ? 35.405  -3.494  6.642   1.00 17.75 ? 720 GLN A CA  1 
ATOM   2326 C C   . GLN B 1 46  ? 34.893  -4.250  5.425   1.00 17.80 ? 720 GLN A C   1 
ATOM   2327 O O   . GLN B 1 46  ? 34.720  -3.697  4.329   1.00 15.62 ? 720 GLN A O   1 
ATOM   2328 C CB  . GLN B 1 46  ? 36.878  -3.817  6.925   1.00 18.01 ? 720 GLN A CB  1 
ATOM   2329 C CG  . GLN B 1 46  ? 37.835  -3.659  5.741   1.00 21.63 ? 720 GLN A CG  1 
ATOM   2330 C CD  . GLN B 1 46  ? 37.837  -2.248  5.179   1.00 23.73 ? 720 GLN A CD  1 
ATOM   2331 O OE1 . GLN B 1 46  ? 37.820  -2.072  3.963   1.00 21.77 ? 720 GLN A OE1 1 
ATOM   2332 N NE2 . GLN B 1 46  ? 37.797  -1.246  6.055   1.00 21.42 ? 720 GLN A NE2 1 
ATOM   2333 N N   . LEU B 1 47  ? 34.616  -5.532  5.637   1.00 16.87 ? 721 LEU A N   1 
ATOM   2334 C CA  . LEU B 1 47  ? 33.964  -6.319  4.609   1.00 16.40 ? 721 LEU A CA  1 
ATOM   2335 C C   . LEU B 1 47  ? 32.624  -5.687  4.221   1.00 16.27 ? 721 LEU A C   1 
ATOM   2336 O O   . LEU B 1 47  ? 32.308  -5.592  3.036   1.00 16.50 ? 721 LEU A O   1 
ATOM   2337 C CB  . LEU B 1 47  ? 33.794  -7.774  5.107   1.00 16.00 ? 721 LEU A CB  1 
ATOM   2338 C CG  . LEU B 1 47  ? 33.205  -8.744  4.095   1.00 16.93 ? 721 LEU A CG  1 
ATOM   2339 C CD1 . LEU B 1 47  ? 34.151  -8.868  2.890   1.00 12.70 ? 721 LEU A CD1 1 
ATOM   2340 C CD2 . LEU B 1 47  ? 33.001  -10.080 4.835   1.00 15.45 ? 721 LEU A CD2 1 
ATOM   2341 N N   . GLY B 1 48  ? 31.844  -5.241  5.210   1.00 15.12 ? 722 GLY A N   1 
ATOM   2342 C CA  . GLY B 1 48  ? 30.578  -4.559  4.964   1.00 15.21 ? 722 GLY A CA  1 
ATOM   2343 C C   . GLY B 1 48  ? 30.758  -3.266  4.152   1.00 16.77 ? 722 GLY A C   1 
ATOM   2344 O O   . GLY B 1 48  ? 29.912  -2.942  3.275   1.00 16.67 ? 722 GLY A O   1 
ATOM   2345 N N   . GLU B 1 49  ? 31.849  -2.524  4.404   1.00 15.31 ? 723 GLU A N   1 
ATOM   2346 C CA  . GLU B 1 49  ? 32.113  -1.302  3.584   1.00 15.20 ? 723 GLU A CA  1 
ATOM   2347 C C   . GLU B 1 49  ? 32.332  -1.638  2.093   1.00 15.66 ? 723 GLU A C   1 
ATOM   2348 O O   . GLU B 1 49  ? 31.846  -0.935  1.185   1.00 15.73 ? 723 GLU A O   1 
ATOM   2349 C CB  . GLU B 1 49  ? 33.339  -0.565  4.135   1.00 14.39 ? 723 GLU A CB  1 
ATOM   2350 C CG  . GLU B 1 49  ? 33.615  0.798   3.496   1.00 14.25 ? 723 GLU A CG  1 
ATOM   2351 C CD  . GLU B 1 49  ? 32.736  1.926   4.029   1.00 15.08 ? 723 GLU A CD  1 
ATOM   2352 O OE1 . GLU B 1 49  ? 31.693  1.611   4.624   1.00 15.80 ? 723 GLU A OE1 1 
ATOM   2353 O OE2 . GLU B 1 49  ? 33.100  3.142   3.838   1.00 13.26 ? 723 GLU A OE2 1 
ATOM   2354 N N   . ARG B 1 50  ? 33.078  -2.705  1.873   1.00 15.92 ? 724 ARG A N   1 
ATOM   2355 C CA  . ARG B 1 50  ? 33.469  -3.124  0.545   1.00 15.93 ? 724 ARG A CA  1 
ATOM   2356 C C   . ARG B 1 50  ? 32.260  -3.705  -0.188  1.00 16.09 ? 724 ARG A C   1 
ATOM   2357 O O   . ARG B 1 50  ? 32.039  -3.435  -1.346  1.00 15.05 ? 724 ARG A O   1 
ATOM   2358 C CB  . ARG B 1 50  ? 34.623  -4.126  0.626   1.00 15.08 ? 724 ARG A CB  1 
ATOM   2359 C CG  . ARG B 1 50  ? 35.890  -3.570  1.260   1.00 16.27 ? 724 ARG A CG  1 
ATOM   2360 C CD  . ARG B 1 50  ? 36.989  -4.594  1.307   1.00 17.27 ? 724 ARG A CD  1 
ATOM   2361 N NE  . ARG B 1 50  ? 38.178  -4.106  1.973   1.00 19.45 ? 724 ARG A NE  1 
ATOM   2362 C CZ  . ARG B 1 50  ? 39.378  -4.652  1.869   1.00 23.06 ? 724 ARG A CZ  1 
ATOM   2363 N NH1 . ARG B 1 50  ? 39.566  -5.713  1.120   1.00 21.01 ? 724 ARG A NH1 1 
ATOM   2364 N NH2 . ARG B 1 50  ? 40.399  -4.123  2.515   1.00 25.99 ? 724 ARG A NH2 1 
ATOM   2365 N N   . GLN B 1 51  ? 31.460  -4.466  0.537   1.00 15.63 ? 725 GLN A N   1 
ATOM   2366 C CA  . GLN B 1 51  ? 30.217  -4.985  0.013   1.00 15.90 ? 725 GLN A CA  1 
ATOM   2367 C C   . GLN B 1 51  ? 29.169  -3.920  -0.309  1.00 15.60 ? 725 GLN A C   1 
ATOM   2368 O O   . GLN B 1 51  ? 28.426  -4.044  -1.259  1.00 15.76 ? 725 GLN A O   1 
ATOM   2369 C CB  . GLN B 1 51  ? 29.660  -6.070  0.921   1.00 14.59 ? 725 GLN A CB  1 
ATOM   2370 C CG  . GLN B 1 51  ? 30.529  -7.317  0.984   1.00 20.22 ? 725 GLN A CG  1 
ATOM   2371 C CD  . GLN B 1 51  ? 29.837  -8.463  1.657   1.00 24.44 ? 725 GLN A CD  1 
ATOM   2372 O OE1 . GLN B 1 51  ? 28.695  -8.343  2.040   1.00 29.50 ? 725 GLN A OE1 1 
ATOM   2373 N NE2 . GLN B 1 51  ? 30.520  -9.576  1.799   1.00 25.20 ? 725 GLN A NE2 1 
ATOM   2374 N N   . LEU B 1 52  ? 29.138  -2.862  0.478   1.00 16.56 ? 726 LEU A N   1 
ATOM   2375 C CA  . LEU B 1 52  ? 28.272  -1.741  0.179   1.00 16.16 ? 726 LEU A CA  1 
ATOM   2376 C C   . LEU B 1 52  ? 28.591  -1.131  -1.193  1.00 15.81 ? 726 LEU A C   1 
ATOM   2377 O O   . LEU B 1 52  ? 27.710  -0.934  -2.005  1.00 15.07 ? 726 LEU A O   1 
ATOM   2378 C CB  . LEU B 1 52  ? 28.330  -0.708  1.297   1.00 17.47 ? 726 LEU A CB  1 
ATOM   2379 C CG  . LEU B 1 52  ? 27.254  0.363   1.418   1.00 18.15 ? 726 LEU A CG  1 
ATOM   2380 C CD1 . LEU B 1 52  ? 25.864  -0.174  1.240   1.00 19.17 ? 726 LEU A CD1 1 
ATOM   2381 C CD2 . LEU B 1 52  ? 27.429  1.131   2.723   1.00 16.48 ? 726 LEU A CD2 1 
ATOM   2382 N N   . LEU B 1 53  ? 29.866  -0.880  -1.444  1.00 14.54 ? 727 LEU A N   1 
ATOM   2383 C CA  . LEU B 1 53  ? 30.276  -0.377  -2.745  1.00 16.30 ? 727 LEU A CA  1 
ATOM   2384 C C   . LEU B 1 53  ? 29.858  -1.346  -3.889  1.00 16.15 ? 727 LEU A C   1 
ATOM   2385 O O   . LEU B 1 53  ? 29.387  -0.906  -4.973  1.00 15.99 ? 727 LEU A O   1 
ATOM   2386 C CB  . LEU B 1 53  ? 31.789  -0.135  -2.762  1.00 16.18 ? 727 LEU A CB  1 
ATOM   2387 C CG  . LEU B 1 53  ? 32.394  0.334   -4.097  1.00 18.07 ? 727 LEU A CG  1 
ATOM   2388 C CD1 . LEU B 1 53  ? 31.887  1.713   -4.535  1.00 20.47 ? 727 LEU A CD1 1 
ATOM   2389 C CD2 . LEU B 1 53  ? 33.913  0.363   -3.983  1.00 19.43 ? 727 LEU A CD2 1 
ATOM   2390 N N   . SER B 1 54  ? 29.987  -2.653  -3.643  1.00 15.49 ? 728 SER A N   1 
ATOM   2391 C CA  . SER B 1 54  ? 29.642  -3.605  -4.692  1.00 16.98 ? 728 SER A CA  1 
ATOM   2392 C C   . SER B 1 54  ? 28.137  -3.640  -4.929  1.00 15.47 ? 728 SER A C   1 
ATOM   2393 O O   . SER B 1 54  ? 27.717  -3.782  -6.055  1.00 15.42 ? 728 SER A O   1 
ATOM   2394 C CB  . SER B 1 54  ? 30.195  -5.024  -4.422  1.00 17.52 ? 728 SER A CB  1 
ATOM   2395 O OG  . SER B 1 54  ? 29.336  -5.712  -3.557  1.00 24.49 ? 728 SER A OG  1 
ATOM   2396 N N   . VAL B 1 55  ? 27.339  -3.548  -3.873  1.00 15.58 ? 729 VAL A N   1 
ATOM   2397 C CA  . VAL B 1 55  ? 25.851  -3.411  -4.017  1.00 15.88 ? 729 VAL A CA  1 
ATOM   2398 C C   . VAL B 1 55  ? 25.455  -2.215  -4.882  1.00 15.36 ? 729 VAL A C   1 
ATOM   2399 O O   . VAL B 1 55  ? 24.635  -2.354  -5.793  1.00 15.18 ? 729 VAL A O   1 
ATOM   2400 C CB  . VAL B 1 55  ? 25.146  -3.308  -2.630  1.00 16.09 ? 729 VAL A CB  1 
ATOM   2401 C CG1 . VAL B 1 55  ? 23.659  -2.928  -2.763  1.00 17.15 ? 729 VAL A CG1 1 
ATOM   2402 C CG2 . VAL B 1 55  ? 25.251  -4.695  -1.926  1.00 19.62 ? 729 VAL A CG2 1 
ATOM   2403 N N   . VAL B 1 56  ? 26.033  -1.055  -4.598  1.00 14.69 ? 730 VAL A N   1 
ATOM   2404 C CA  . VAL B 1 56  ? 25.723  0.141   -5.393  1.00 16.76 ? 730 VAL A CA  1 
ATOM   2405 C C   . VAL B 1 56  ? 26.171  -0.091  -6.847  1.00 16.20 ? 730 VAL A C   1 
ATOM   2406 O O   . VAL B 1 56  ? 25.395  0.137   -7.762  1.00 18.43 ? 730 VAL A O   1 
ATOM   2407 C CB  . VAL B 1 56  ? 26.313  1.438   -4.775  1.00 15.50 ? 730 VAL A CB  1 
ATOM   2408 C CG1 . VAL B 1 56  ? 25.889  2.679   -5.606  1.00 18.58 ? 730 VAL A CG1 1 
ATOM   2409 C CG2 . VAL B 1 56  ? 25.838  1.621   -3.265  1.00 17.71 ? 730 VAL A CG2 1 
ATOM   2410 N N   . LYS B 1 57  ? 27.370  -0.603  -7.072  1.00 16.18 ? 731 LYS A N   1 
ATOM   2411 C CA  . LYS B 1 57  ? 27.776  -0.884  -8.450  1.00 16.41 ? 731 LYS A CA  1 
ATOM   2412 C C   . LYS B 1 57  ? 26.850  -1.858  -9.182  1.00 16.87 ? 731 LYS A C   1 
ATOM   2413 O O   . LYS B 1 57  ? 26.439  -1.604  -10.332 1.00 15.91 ? 731 LYS A O   1 
ATOM   2414 C CB  . LYS B 1 57  ? 29.233  -1.329  -8.533  1.00 18.30 ? 731 LYS A CB  1 
ATOM   2415 C CG  . LYS B 1 57  ? 30.239  -0.176  -8.212  1.00 20.37 ? 731 LYS A CG  1 
ATOM   2416 C CD  . LYS B 1 57  ? 31.645  -0.710  -8.439  1.00 26.98 ? 731 LYS A CD  1 
ATOM   2417 C CE  . LYS B 1 57  ? 32.656  0.437   -8.462  1.00 29.49 ? 731 LYS A CE  1 
ATOM   2418 N NZ  . LYS B 1 57  ? 34.014  -0.062  -8.101  1.00 35.32 ? 731 LYS A NZ  1 
ATOM   2419 N N   . TRP B 1 58  ? 26.550  -2.973  -8.512  1.00 15.37 ? 732 TRP A N   1 
ATOM   2420 C CA  . TRP B 1 58  ? 25.584  -3.969  -8.999  1.00 15.02 ? 732 TRP A CA  1 
ATOM   2421 C C   . TRP B 1 58  ? 24.257  -3.348  -9.383  1.00 14.31 ? 732 TRP A C   1 
ATOM   2422 O O   . TRP B 1 58  ? 23.749  -3.630  -10.461 1.00 14.32 ? 732 TRP A O   1 
ATOM   2423 C CB  . TRP B 1 58  ? 25.398  -5.058  -7.937  1.00 14.49 ? 732 TRP A CB  1 
ATOM   2424 C CG  . TRP B 1 58  ? 24.252  -6.040  -8.134  1.00 13.85 ? 732 TRP A CG  1 
ATOM   2425 C CD1 . TRP B 1 58  ? 24.204  -7.116  -9.006  1.00 13.54 ? 732 TRP A CD1 1 
ATOM   2426 C CD2 . TRP B 1 58  ? 23.055  -6.090  -7.373  1.00 13.58 ? 732 TRP A CD2 1 
ATOM   2427 N NE1 . TRP B 1 58  ? 23.034  -7.809  -8.828  1.00 13.26 ? 732 TRP A NE1 1 
ATOM   2428 C CE2 . TRP B 1 58  ? 22.307  -7.201  -7.830  1.00 15.25 ? 732 TRP A CE2 1 
ATOM   2429 C CE3 . TRP B 1 58  ? 22.533  -5.306  -6.325  1.00 13.09 ? 732 TRP A CE3 1 
ATOM   2430 C CZ2 . TRP B 1 58  ? 21.047  -7.535  -7.287  1.00 14.52 ? 732 TRP A CZ2 1 
ATOM   2431 C CZ3 . TRP B 1 58  ? 21.279  -5.646  -5.777  1.00 12.14 ? 732 TRP A CZ3 1 
ATOM   2432 C CH2 . TRP B 1 58  ? 20.559  -6.750  -6.257  1.00 14.49 ? 732 TRP A CH2 1 
ATOM   2433 N N   . SER B 1 59  ? 23.711  -2.501  -8.516  1.00 14.35 ? 733 SER A N   1 
ATOM   2434 C CA  . SER B 1 59  ? 22.368  -1.924  -8.737  1.00 14.48 ? 733 SER A CA  1 
ATOM   2435 C C   . SER B 1 59  ? 22.340  -1.028  -10.030 1.00 15.53 ? 733 SER A C   1 
ATOM   2436 O O   . SER B 1 59  ? 21.311  -0.894  -10.664 1.00 15.34 ? 733 SER A O   1 
ATOM   2437 C CB  . SER B 1 59  ? 21.921  -1.138  -7.496  1.00 14.08 ? 733 SER A CB  1 
ATOM   2438 O OG  . SER B 1 59  ? 22.641  0.085   -7.400  1.00 14.63 ? 733 SER A OG  1 
ATOM   2439 N N   . LYS B 1 60  ? 23.494  -0.493  -10.436 1.00 15.85 ? 734 LYS A N   1 
ATOM   2440 C CA  . LYS B 1 60  ? 23.596  0.391   -11.611 1.00 17.87 ? 734 LYS A CA  1 
ATOM   2441 C C   . LYS B 1 60  ? 23.461  -0.387  -12.915 1.00 18.03 ? 734 LYS A C   1 
ATOM   2442 O O   . LYS B 1 60  ? 23.131  0.192   -13.977 1.00 17.15 ? 734 LYS A O   1 
ATOM   2443 C CB  . LYS B 1 60  ? 24.952  1.154   -11.601 1.00 19.71 ? 734 LYS A CB  1 
ATOM   2444 C CG  . LYS B 1 60  ? 25.069  2.007   -10.359 1.00 22.45 ? 734 LYS A CG  1 
ATOM   2445 C CD  . LYS B 1 60  ? 26.141  3.068   -10.387 1.00 28.53 ? 734 LYS A CD  1 
ATOM   2446 C CE  . LYS B 1 60  ? 25.545  4.356   -9.792  1.00 30.08 ? 734 LYS A CE  1 
ATOM   2447 N NZ  . LYS B 1 60  ? 25.032  5.303   -10.897 1.00 33.31 ? 734 LYS A NZ  1 
ATOM   2448 N N   . SER B 1 61  ? 23.728  -1.692  -12.838 1.00 16.66 ? 735 SER A N   1 
ATOM   2449 C CA  . SER B 1 61  ? 23.556  -2.606  -13.977 1.00 17.20 ? 735 SER A CA  1 
ATOM   2450 C C   . SER B 1 61  ? 22.304  -3.479  -13.883 1.00 16.13 ? 735 SER A C   1 
ATOM   2451 O O   . SER B 1 61  ? 22.017  -4.222  -14.839 1.00 14.95 ? 735 SER A O   1 
ATOM   2452 C CB  . SER B 1 61  ? 24.777  -3.533  -14.143 1.00 16.62 ? 735 SER A CB  1 
ATOM   2453 O OG  . SER B 1 61  ? 25.951  -2.758  -14.342 1.00 20.86 ? 735 SER A OG  1 
ATOM   2454 N N   . LEU B 1 62  ? 21.589  -3.415  -12.746 1.00 15.60 ? 736 LEU A N   1 
ATOM   2455 C CA  . LEU B 1 62  ? 20.382  -4.247  -12.499 1.00 15.03 ? 736 LEU A CA  1 
ATOM   2456 C C   . LEU B 1 62  ? 19.225  -3.695  -13.336 1.00 15.18 ? 736 LEU A C   1 
ATOM   2457 O O   . LEU B 1 62  ? 18.798  -2.567  -13.092 1.00 14.81 ? 736 LEU A O   1 
ATOM   2458 C CB  . LEU B 1 62  ? 19.965  -4.175  -11.002 1.00 14.68 ? 736 LEU A CB  1 
ATOM   2459 C CG  . LEU B 1 62  ? 18.731  -4.960  -10.524 1.00 16.55 ? 736 LEU A CG  1 
ATOM   2460 C CD1 . LEU B 1 62  ? 18.905  -6.480  -10.759 1.00 15.21 ? 736 LEU A CD1 1 
ATOM   2461 C CD2 . LEU B 1 62  ? 18.484  -4.730  -9.020  1.00 15.13 ? 736 LEU A CD2 1 
ATOM   2462 N N   . PRO B 1 63  ? 18.692  -4.472  -14.306 1.00 15.81 ? 737 PRO A N   1 
ATOM   2463 C CA  . PRO B 1 63  ? 17.619  -3.937  -15.183 1.00 15.99 ? 737 PRO A CA  1 
ATOM   2464 C C   . PRO B 1 63  ? 16.443  -3.386  -14.413 1.00 16.52 ? 737 PRO A C   1 
ATOM   2465 O O   . PRO B 1 63  ? 15.904  -4.031  -13.506 1.00 17.14 ? 737 PRO A O   1 
ATOM   2466 C CB  . PRO B 1 63  ? 17.218  -5.154  -16.047 1.00 16.33 ? 737 PRO A CB  1 
ATOM   2467 C CG  . PRO B 1 63  ? 18.508  -5.996  -16.056 1.00 14.95 ? 737 PRO A CG  1 
ATOM   2468 C CD  . PRO B 1 63  ? 19.042  -5.862  -14.674 1.00 15.04 ? 737 PRO A CD  1 
ATOM   2469 N N   . GLY B 1 64  ? 16.095  -2.144  -14.730 1.00 16.09 ? 738 GLY A N   1 
ATOM   2470 C CA  . GLY B 1 64  ? 14.955  -1.501  -14.097 1.00 16.23 ? 738 GLY A CA  1 
ATOM   2471 C C   . GLY B 1 64  ? 15.349  -0.562  -12.979 1.00 14.94 ? 738 GLY A C   1 
ATOM   2472 O O   . GLY B 1 64  ? 14.693  0.459   -12.784 1.00 14.85 ? 738 GLY A O   1 
ATOM   2473 N N   . PHE B 1 65  ? 16.438  -0.865  -12.258 1.00 13.73 ? 739 PHE A N   1 
ATOM   2474 C CA  . PHE B 1 65  ? 16.688  -0.169  -11.013 1.00 13.22 ? 739 PHE A CA  1 
ATOM   2475 C C   . PHE B 1 65  ? 17.028  1.293   -11.227 1.00 14.33 ? 739 PHE A C   1 
ATOM   2476 O O   . PHE B 1 65  ? 16.544  2.160   -10.478 1.00 14.31 ? 739 PHE A O   1 
ATOM   2477 C CB  . PHE B 1 65  ? 17.824  -0.836  -10.195 1.00 13.20 ? 739 PHE A CB  1 
ATOM   2478 C CG  . PHE B 1 65  ? 17.922  -0.315  -8.793  1.00 13.64 ? 739 PHE A CG  1 
ATOM   2479 C CD1 . PHE B 1 65  ? 16.996  -0.727  -7.821  1.00 16.41 ? 739 PHE A CD1 1 
ATOM   2480 C CD2 . PHE B 1 65  ? 18.906  0.605   -8.434  1.00 15.24 ? 739 PHE A CD2 1 
ATOM   2481 C CE1 . PHE B 1 65  ? 17.070  -0.231  -6.492  1.00 18.13 ? 739 PHE A CE1 1 
ATOM   2482 C CE2 . PHE B 1 65  ? 19.010  1.075   -7.127  1.00 16.95 ? 739 PHE A CE2 1 
ATOM   2483 C CZ  . PHE B 1 65  ? 18.080  0.645   -6.148  1.00 13.49 ? 739 PHE A CZ  1 
ATOM   2484 N N   . ARG B 1 66  ? 17.882  1.560   -12.233 1.00 14.43 ? 740 ARG A N   1 
ATOM   2485 C CA  . ARG B 1 66  ? 18.333  2.932   -12.552 1.00 15.80 ? 740 ARG A CA  1 
ATOM   2486 C C   . ARG B 1 66  ? 17.178  3.821   -13.008 1.00 15.79 ? 740 ARG A C   1 
ATOM   2487 O O   . ARG B 1 66  ? 17.309  5.043   -13.034 1.00 16.36 ? 740 ARG A O   1 
ATOM   2488 C CB  . ARG B 1 66  ? 19.405  2.917   -13.633 1.00 16.46 ? 740 ARG A CB  1 
ATOM   2489 C CG  . ARG B 1 66  ? 18.950  2.231   -14.957 1.00 15.14 ? 740 ARG A CG  1 
ATOM   2490 C CD  . ARG B 1 66  ? 20.001  2.494   -16.072 1.00 16.77 ? 740 ARG A CD  1 
ATOM   2491 N NE  . ARG B 1 66  ? 19.468  2.000   -17.329 1.00 17.08 ? 740 ARG A NE  1 
ATOM   2492 C CZ  . ARG B 1 66  ? 19.999  2.229   -18.521 1.00 18.09 ? 740 ARG A CZ  1 
ATOM   2493 N NH1 . ARG B 1 66  ? 21.144  2.905   -18.626 1.00 16.42 ? 740 ARG A NH1 1 
ATOM   2494 N NH2 . ARG B 1 66  ? 19.402  1.696   -19.593 1.00 17.16 ? 740 ARG A NH2 1 
ATOM   2495 N N   . ASN B 1 67  ? 16.052  3.206   -13.351 1.00 15.94 ? 741 ASN A N   1 
ATOM   2496 C CA  . ASN B 1 67  ? 14.850  3.931   -13.774 1.00 16.82 ? 741 ASN A CA  1 
ATOM   2497 C C   . ASN B 1 67  ? 13.932  4.441   -12.662 1.00 16.64 ? 741 ASN A C   1 
ATOM   2498 O O   . ASN B 1 67  ? 13.028  5.255   -12.914 1.00 16.43 ? 741 ASN A O   1 
ATOM   2499 C CB  . ASN B 1 67  ? 14.073  3.100   -14.817 1.00 18.69 ? 741 ASN A CB  1 
ATOM   2500 C CG  . ASN B 1 67  ? 14.962  2.706   -15.992 1.00 19.65 ? 741 ASN A CG  1 
ATOM   2501 O OD1 . ASN B 1 67  ? 14.892  1.582   -16.511 1.00 23.38 ? 741 ASN A OD1 1 
ATOM   2502 N ND2 . ASN B 1 67  ? 15.884  3.603   -16.343 1.00 18.34 ? 741 ASN A ND2 1 
ATOM   2503 N N   . LEU B 1 68  ? 14.213  4.035   -11.426 1.00 15.06 ? 742 LEU A N   1 
ATOM   2504 C CA  . LEU B 1 68  ? 13.515  4.574   -10.250 1.00 15.86 ? 742 LEU A CA  1 
ATOM   2505 C C   . LEU B 1 68  ? 14.115  5.932   -9.927  1.00 15.30 ? 742 LEU A C   1 
ATOM   2506 O O   . LEU B 1 68  ? 15.294  6.191   -10.200 1.00 15.66 ? 742 LEU A O   1 
ATOM   2507 C CB  . LEU B 1 68  ? 13.647  3.632   -9.015  1.00 15.59 ? 742 LEU A CB  1 
ATOM   2508 C CG  . LEU B 1 68  ? 13.247  2.150   -9.210  1.00 16.26 ? 742 LEU A CG  1 
ATOM   2509 C CD1 . LEU B 1 68  ? 13.724  1.354   -8.002  1.00 17.93 ? 742 LEU A CD1 1 
ATOM   2510 C CD2 . LEU B 1 68  ? 11.704  1.997   -9.407  1.00 17.75 ? 742 LEU A CD2 1 
ATOM   2511 N N   . HIS B 1 69  ? 13.310  6.805   -9.364  1.00 15.56 ? 743 HIS A N   1 
ATOM   2512 C CA  . HIS B 1 69  ? 13.797  8.088   -8.828  1.00 17.54 ? 743 HIS A CA  1 
ATOM   2513 C C   . HIS B 1 69  ? 15.059  7.792   -7.994  1.00 17.97 ? 743 HIS A C   1 
ATOM   2514 O O   . HIS B 1 69  ? 15.116  6.770   -7.302  1.00 17.19 ? 743 HIS A O   1 
ATOM   2515 C CB  . HIS B 1 69  ? 12.686  8.665   -7.950  1.00 18.20 ? 743 HIS A CB  1 
ATOM   2516 C CG  . HIS B 1 69  ? 12.882  10.088  -7.558  1.00 22.80 ? 743 HIS A CG  1 
ATOM   2517 N ND1 . HIS B 1 69  ? 13.757  10.476  -6.567  1.00 24.60 ? 743 HIS A ND1 1 
ATOM   2518 C CD2 . HIS B 1 69  ? 12.276  11.221  -7.987  1.00 26.85 ? 743 HIS A CD2 1 
ATOM   2519 C CE1 . HIS B 1 69  ? 13.714  11.790  -6.429  1.00 25.87 ? 743 HIS A CE1 1 
ATOM   2520 N NE2 . HIS B 1 69  ? 12.807  12.263  -7.262  1.00 24.86 ? 743 HIS A NE2 1 
ATOM   2521 N N   . ILE B 1 70  ? 16.073  8.651   -8.102  1.00 18.45 ? 744 ILE A N   1 
ATOM   2522 C CA  . ILE B 1 70  ? 17.334  8.509   -7.350  1.00 18.68 ? 744 ILE A CA  1 
ATOM   2523 C C   . ILE B 1 70  ? 17.120  8.373   -5.837  1.00 18.94 ? 744 ILE A C   1 
ATOM   2524 O O   . ILE B 1 70  ? 17.818  7.581   -5.185  1.00 18.27 ? 744 ILE A O   1 
ATOM   2525 C CB  . ILE B 1 70  ? 18.358  9.644   -7.694  1.00 19.02 ? 744 ILE A CB  1 
ATOM   2526 C CG1 . ILE B 1 70  ? 18.794  9.526   -9.169  1.00 17.92 ? 744 ILE A CG1 1 
ATOM   2527 C CG2 . ILE B 1 70  ? 19.593  9.602   -6.741  1.00 18.94 ? 744 ILE A CG2 1 
ATOM   2528 C CD1 . ILE B 1 70  ? 19.806  10.648  -9.683  1.00 21.08 ? 744 ILE A CD1 1 
ATOM   2529 N N   . ASP B 1 71  ? 16.153  9.115   -5.270  1.00 18.12 ? 745 ASP A N   1 
ATOM   2530 C CA  . ASP B 1 71  ? 15.893  9.005   -3.824  1.00 18.66 ? 745 ASP A CA  1 
ATOM   2531 C C   . ASP B 1 71  ? 15.446  7.598   -3.462  1.00 17.33 ? 745 ASP A C   1 
ATOM   2532 O O   . ASP B 1 71  ? 15.792  7.100   -2.390  1.00 17.43 ? 745 ASP A O   1 
ATOM   2533 C CB  . ASP B 1 71  ? 14.769  9.950   -3.386  1.00 20.00 ? 745 ASP A CB  1 
ATOM   2534 C CG  . ASP B 1 71  ? 15.197  11.400  -3.374  1.00 23.89 ? 745 ASP A CG  1 
ATOM   2535 O OD1 . ASP B 1 71  ? 16.401  11.680  -3.479  1.00 28.67 ? 745 ASP A OD1 1 
ATOM   2536 O OD2 . ASP B 1 71  ? 14.305  12.252  -3.212  1.00 29.02 ? 745 ASP A OD2 1 
ATOM   2537 N N   . ASP B 1 72  ? 14.607  7.019   -4.320  1.00 16.19 ? 746 ASP A N   1 
ATOM   2538 C CA  . ASP B 1 72  ? 14.084  5.662   -4.118  1.00 15.83 ? 746 ASP A CA  1 
ATOM   2539 C C   . ASP B 1 72  ? 15.252  4.668   -4.229  1.00 14.60 ? 746 ASP A C   1 
ATOM   2540 O O   . ASP B 1 72  ? 15.315  3.723   -3.446  1.00 14.62 ? 746 ASP A O   1 
ATOM   2541 C CB  . ASP B 1 72  ? 13.055  5.249   -5.163  1.00 15.11 ? 746 ASP A CB  1 
ATOM   2542 C CG  . ASP B 1 72  ? 11.802  6.093   -5.159  1.00 18.77 ? 746 ASP A CG  1 
ATOM   2543 O OD1 . ASP B 1 72  ? 11.526  6.874   -4.201  1.00 18.30 ? 746 ASP A OD1 1 
ATOM   2544 O OD2 . ASP B 1 72  ? 11.071  5.909   -6.162  1.00 21.75 ? 746 ASP A OD2 1 
ATOM   2545 N N   . GLN B 1 73  ? 16.157  4.876   -5.184  1.00 13.87 ? 747 GLN A N   1 
ATOM   2546 C CA  . GLN B 1 73  ? 17.326  3.989   -5.304  1.00 13.49 ? 747 GLN A CA  1 
ATOM   2547 C C   . GLN B 1 73  ? 18.118  3.952   -3.994  1.00 13.54 ? 747 GLN A C   1 
ATOM   2548 O O   . GLN B 1 73  ? 18.434  2.872   -3.475  1.00 12.13 ? 747 GLN A O   1 
ATOM   2549 C CB  . GLN B 1 73  ? 18.232  4.371   -6.462  1.00 13.82 ? 747 GLN A CB  1 
ATOM   2550 C CG  . GLN B 1 73  ? 17.612  4.211   -7.879  1.00 10.99 ? 747 GLN A CG  1 
ATOM   2551 C CD  . GLN B 1 73  ? 18.506  4.771   -8.929  1.00 13.75 ? 747 GLN A CD  1 
ATOM   2552 O OE1 . GLN B 1 73  ? 18.062  5.488   -9.837  1.00 16.79 ? 747 GLN A OE1 1 
ATOM   2553 N NE2 . GLN B 1 73  ? 19.788  4.501   -8.802  1.00 9.54  ? 747 GLN A NE2 1 
ATOM   2554 N N   . ILE B 1 74  ? 18.433  5.139   -3.479  1.00 13.53 ? 748 ILE A N   1 
ATOM   2555 C CA  . ILE B 1 74  ? 19.187  5.277   -2.251  1.00 13.54 ? 748 ILE A CA  1 
ATOM   2556 C C   . ILE B 1 74  ? 18.458  4.611   -1.097  1.00 13.83 ? 748 ILE A C   1 
ATOM   2557 O O   . ILE B 1 74  ? 19.077  3.854   -0.332  1.00 14.34 ? 748 ILE A O   1 
ATOM   2558 C CB  . ILE B 1 74  ? 19.483  6.738   -1.911  1.00 14.41 ? 748 ILE A CB  1 
ATOM   2559 C CG1 . ILE B 1 74  ? 20.428  7.363   -2.947  1.00 14.70 ? 748 ILE A CG1 1 
ATOM   2560 C CG2 . ILE B 1 74  ? 20.185  6.815   -0.558  1.00 15.54 ? 748 ILE A CG2 1 
ATOM   2561 C CD1 . ILE B 1 74  ? 20.561  8.966   -2.843  1.00 16.04 ? 748 ILE A CD1 1 
ATOM   2562 N N   . THR B 1 75  ? 17.157  4.905   -0.963  1.00 13.13 ? 749 THR A N   1 
ATOM   2563 C CA  . THR B 1 75  ? 16.302  4.318   0.075   1.00 13.99 ? 749 THR A CA  1 
ATOM   2564 C C   . THR B 1 75  ? 16.308  2.780   0.065   1.00 13.25 ? 749 THR A C   1 
ATOM   2565 O O   . THR B 1 75  ? 16.514  2.144   1.122   1.00 13.76 ? 749 THR A O   1 
ATOM   2566 C CB  . THR B 1 75  ? 14.863  4.890   -0.029  1.00 14.24 ? 749 THR A CB  1 
ATOM   2567 O OG1 . THR B 1 75  ? 14.902  6.275   0.316   1.00 16.76 ? 749 THR A OG1 1 
ATOM   2568 C CG2 . THR B 1 75  ? 13.902  4.209   0.919   1.00 15.59 ? 749 THR A CG2 1 
ATOM   2569 N N   . LEU B 1 76  ? 16.126  2.179   -1.117  1.00 12.55 ? 750 LEU A N   1 
ATOM   2570 C CA  . LEU B 1 76  ? 16.074  0.704   -1.238  1.00 12.66 ? 750 LEU A CA  1 
ATOM   2571 C C   . LEU B 1 76  ? 17.415  0.089   -0.867  1.00 12.73 ? 750 LEU A C   1 
ATOM   2572 O O   . LEU B 1 76  ? 17.459  -0.936  -0.185  1.00 13.81 ? 750 LEU A O   1 
ATOM   2573 C CB  . LEU B 1 76  ? 15.678  0.260   -2.670  1.00 12.12 ? 750 LEU A CB  1 
ATOM   2574 C CG  . LEU B 1 76  ? 14.211  0.655   -2.966  1.00 14.42 ? 750 LEU A CG  1 
ATOM   2575 C CD1 . LEU B 1 76  ? 13.923  0.512   -4.511  1.00 13.96 ? 750 LEU A CD1 1 
ATOM   2576 C CD2 . LEU B 1 76  ? 13.187  -0.133  -2.090  1.00 12.03 ? 750 LEU A CD2 1 
ATOM   2577 N N   . ILE B 1 77  ? 18.503  0.718   -1.294  1.00 12.48 ? 751 ILE A N   1 
ATOM   2578 C CA  . ILE B 1 77  ? 19.846  0.166   -0.947  1.00 14.06 ? 751 ILE A CA  1 
ATOM   2579 C C   . ILE B 1 77  ? 20.058  0.276   0.575   1.00 14.49 ? 751 ILE A C   1 
ATOM   2580 O O   . ILE B 1 77  ? 20.529  -0.659  1.236   1.00 14.32 ? 751 ILE A O   1 
ATOM   2581 C CB  . ILE B 1 77  ? 21.017  0.851   -1.743  1.00 12.59 ? 751 ILE A CB  1 
ATOM   2582 C CG1 . ILE B 1 77  ? 20.941  0.471   -3.235  1.00 13.10 ? 751 ILE A CG1 1 
ATOM   2583 C CG2 . ILE B 1 77  ? 22.440  0.499   -1.099  1.00 12.94 ? 751 ILE A CG2 1 
ATOM   2584 C CD1 . ILE B 1 77  ? 21.802  1.288   -4.147  1.00 16.16 ? 751 ILE A CD1 1 
ATOM   2585 N N   . GLN B 1 78  ? 19.743  1.441   1.114   1.00 15.42 ? 752 GLN A N   1 
ATOM   2586 C CA  . GLN B 1 78  ? 19.897  1.679   2.560   1.00 16.76 ? 752 GLN A CA  1 
ATOM   2587 C C   . GLN B 1 78  ? 18.999  0.775   3.409   1.00 17.15 ? 752 GLN A C   1 
ATOM   2588 O O   . GLN B 1 78  ? 19.453  0.327   4.450   1.00 17.71 ? 752 GLN A O   1 
ATOM   2589 C CB  . GLN B 1 78  ? 19.741  3.172   2.916   1.00 15.62 ? 752 GLN A CB  1 
ATOM   2590 C CG  . GLN B 1 78  ? 20.885  4.018   2.328   1.00 16.93 ? 752 GLN A CG  1 
ATOM   2591 C CD  . GLN B 1 78  ? 20.925  5.459   2.826   1.00 17.92 ? 752 GLN A CD  1 
ATOM   2592 O OE1 . GLN B 1 78  ? 19.937  5.982   3.356   1.00 19.65 ? 752 GLN A OE1 1 
ATOM   2593 N NE2 . GLN B 1 78  ? 22.079  6.114   2.647   1.00 17.24 ? 752 GLN A NE2 1 
ATOM   2594 N N   . TYR B 1 79  ? 17.760  0.504   2.969   1.00 16.47 ? 753 TYR A N   1 
ATOM   2595 C CA  . TYR B 1 79  ? 16.857  -0.428  3.628   1.00 15.59 ? 753 TYR A CA  1 
ATOM   2596 C C   . TYR B 1 79  ? 17.344  -1.881  3.585   1.00 16.64 ? 753 TYR A C   1 
ATOM   2597 O O   . TYR B 1 79  ? 17.185  -2.612  4.569   1.00 15.88 ? 753 TYR A O   1 
ATOM   2598 C CB  . TYR B 1 79  ? 15.448  -0.390  3.018   1.00 17.04 ? 753 TYR A CB  1 
ATOM   2599 C CG  . TYR B 1 79  ? 14.579  0.796   3.428   1.00 16.97 ? 753 TYR A CG  1 
ATOM   2600 C CD1 . TYR B 1 79  ? 15.078  1.845   4.225   1.00 17.42 ? 753 TYR A CD1 1 
ATOM   2601 C CD2 . TYR B 1 79  ? 13.269  0.874   2.984   1.00 18.45 ? 753 TYR A CD2 1 
ATOM   2602 C CE1 . TYR B 1 79  ? 14.215  2.969   4.579   1.00 18.95 ? 753 TYR A CE1 1 
ATOM   2603 C CE2 . TYR B 1 79  ? 12.439  1.966   3.313   1.00 19.05 ? 753 TYR A CE2 1 
ATOM   2604 C CZ  . TYR B 1 79  ? 12.904  2.979   4.090   1.00 17.93 ? 753 TYR A CZ  1 
ATOM   2605 O OH  . TYR B 1 79  ? 12.054  4.004   4.379   1.00 20.41 ? 753 TYR A OH  1 
ATOM   2606 N N   . SER B 1 80  ? 17.936  -2.291  2.462   1.00 15.95 ? 754 SER A N   1 
ATOM   2607 C CA  . SER B 1 80  ? 18.197  -3.734  2.192   1.00 15.29 ? 754 SER A CA  1 
ATOM   2608 C C   . SER B 1 80  ? 19.647  -4.159  2.381   1.00 15.39 ? 754 SER A C   1 
ATOM   2609 O O   . SER B 1 80  ? 19.957  -5.353  2.242   1.00 15.53 ? 754 SER A O   1 
ATOM   2610 C CB  . SER B 1 80  ? 17.779  -4.085  0.761   1.00 14.51 ? 754 SER A CB  1 
ATOM   2611 O OG  . SER B 1 80  ? 18.664  -3.441  -0.135  1.00 14.29 ? 754 SER A OG  1 
ATOM   2612 N N   . TRP B 1 81  ? 20.526  -3.203  2.681   1.00 15.34 ? 755 TRP A N   1 
ATOM   2613 C CA  . TRP B 1 81  ? 21.986  -3.473  2.790   1.00 16.70 ? 755 TRP A CA  1 
ATOM   2614 C C   . TRP B 1 81  ? 22.302  -4.760  3.634   1.00 15.90 ? 755 TRP A C   1 
ATOM   2615 O O   . TRP B 1 81  ? 22.933  -5.694  3.164   1.00 15.30 ? 755 TRP A O   1 
ATOM   2616 C CB  . TRP B 1 81  ? 22.634  -2.192  3.357   1.00 19.72 ? 755 TRP A CB  1 
ATOM   2617 C CG  . TRP B 1 81  ? 23.827  -2.400  4.146   1.00 24.63 ? 755 TRP A CG  1 
ATOM   2618 C CD1 . TRP B 1 81  ? 25.051  -2.777  3.675   1.00 28.87 ? 755 TRP A CD1 1 
ATOM   2619 C CD2 . TRP B 1 81  ? 23.963  -2.251  5.557   1.00 26.50 ? 755 TRP A CD2 1 
ATOM   2620 N NE1 . TRP B 1 81  ? 25.951  -2.887  4.724   1.00 32.24 ? 755 TRP A NE1 1 
ATOM   2621 C CE2 . TRP B 1 81  ? 25.298  -2.589  5.888   1.00 29.72 ? 755 TRP A CE2 1 
ATOM   2622 C CE3 . TRP B 1 81  ? 23.104  -1.830  6.574   1.00 25.54 ? 755 TRP A CE3 1 
ATOM   2623 C CZ2 . TRP B 1 81  ? 25.777  -2.536  7.189   1.00 29.13 ? 755 TRP A CZ2 1 
ATOM   2624 C CZ3 . TRP B 1 81  ? 23.575  -1.811  7.857   1.00 25.58 ? 755 TRP A CZ3 1 
ATOM   2625 C CH2 . TRP B 1 81  ? 24.891  -2.157  8.159   1.00 25.78 ? 755 TRP A CH2 1 
ATOM   2626 N N   . MET B 1 82  ? 21.826  -4.794  4.870   1.00 14.12 ? 756 MET A N   1 
ATOM   2627 C CA  . MET B 1 82  ? 22.043  -5.949  5.784   1.00 13.67 ? 756 MET A CA  1 
ATOM   2628 C C   . MET B 1 82  ? 21.466  -7.237  5.205   1.00 13.29 ? 756 MET A C   1 
ATOM   2629 O O   . MET B 1 82  ? 22.126  -8.271  5.242   1.00 13.04 ? 756 MET A O   1 
ATOM   2630 C CB  . MET B 1 82  ? 21.459  -5.682  7.188   1.00 11.07 ? 756 MET A CB  1 
ATOM   2631 C CG  . MET B 1 82  ? 21.866  -6.763  8.262   1.00 14.19 ? 756 MET A CG  1 
ATOM   2632 S SD  . MET B 1 82  ? 23.658  -6.838  8.593   1.00 18.35 ? 756 MET A SD  1 
ATOM   2633 C CE  . MET B 1 82  ? 23.970  -5.498  9.739   1.00 19.75 ? 756 MET A CE  1 
ATOM   2634 N N   . SER B 1 83  ? 20.236  -7.183  4.679   1.00 13.18 ? 757 SER A N   1 
ATOM   2635 C CA  . SER B 1 83  ? 19.606  -8.377  4.143   1.00 14.93 ? 757 SER A CA  1 
ATOM   2636 C C   . SER B 1 83  ? 20.368  -8.904  2.942   1.00 14.54 ? 757 SER A C   1 
ATOM   2637 O O   . SER B 1 83  ? 20.505  -10.085 2.807   1.00 15.09 ? 757 SER A O   1 
ATOM   2638 C CB  . SER B 1 83  ? 18.128  -8.146  3.764   1.00 16.12 ? 757 SER A CB  1 
ATOM   2639 O OG  . SER B 1 83  ? 18.097  -7.239  2.685   1.00 24.83 ? 757 SER A OG  1 
ATOM   2640 N N   . LEU B 1 84  ? 20.866  -8.037  2.065   1.00 15.14 ? 758 LEU A N   1 
ATOM   2641 C CA  . LEU B 1 84  ? 21.638  -8.492  0.893   1.00 15.39 ? 758 LEU A CA  1 
ATOM   2642 C C   . LEU B 1 84  ? 22.936  -9.119  1.366   1.00 14.79 ? 758 LEU A C   1 
ATOM   2643 O O   . LEU B 1 84  ? 23.352  -10.128 0.823   1.00 14.73 ? 758 LEU A O   1 
ATOM   2644 C CB  . LEU B 1 84  ? 21.943  -7.328  -0.066  1.00 14.29 ? 758 LEU A CB  1 
ATOM   2645 C CG  . LEU B 1 84  ? 20.704  -6.704  -0.746  1.00 18.47 ? 758 LEU A CG  1 
ATOM   2646 C CD1 . LEU B 1 84  ? 21.064  -5.489  -1.665  1.00 18.90 ? 758 LEU A CD1 1 
ATOM   2647 C CD2 . LEU B 1 84  ? 19.947  -7.733  -1.535  1.00 18.79 ? 758 LEU A CD2 1 
ATOM   2648 N N   . MET B 1 85  ? 23.573  -8.526  2.379   1.00 13.87 ? 759 MET A N   1 
ATOM   2649 C CA  . MET B 1 85  ? 24.819  -9.060  2.873   1.00 16.73 ? 759 MET A CA  1 
ATOM   2650 C C   . MET B 1 85  ? 24.673  -10.439 3.495   1.00 15.51 ? 759 MET A C   1 
ATOM   2651 O O   . MET B 1 85  ? 25.507  -11.321 3.245   1.00 14.88 ? 759 MET A O   1 
ATOM   2652 C CB  . MET B 1 85  ? 25.481  -8.115  3.863   1.00 15.98 ? 759 MET A CB  1 
ATOM   2653 C CG  . MET B 1 85  ? 26.110  -6.913  3.136   1.00 20.36 ? 759 MET A CG  1 
ATOM   2654 S SD  . MET B 1 85  ? 27.020  -6.027  4.377   1.00 24.90 ? 759 MET A SD  1 
ATOM   2655 C CE  . MET B 1 85  ? 27.234  -4.635  3.278   1.00 23.38 ? 759 MET A CE  1 
ATOM   2656 N N   . VAL B 1 86  ? 23.656  -10.601 4.336   1.00 14.60 ? 760 VAL A N   1 
ATOM   2657 C CA  . VAL B 1 86  ? 23.412  -11.895 4.965   1.00 14.81 ? 760 VAL A CA  1 
ATOM   2658 C C   . VAL B 1 86  ? 22.915  -12.978 3.950   1.00 14.74 ? 760 VAL A C   1 
ATOM   2659 O O   . VAL B 1 86  ? 23.251  -14.150 4.072   1.00 13.62 ? 760 VAL A O   1 
ATOM   2660 C CB  . VAL B 1 86  ? 22.505  -11.743 6.228   1.00 15.65 ? 760 VAL A CB  1 
ATOM   2661 C CG1 . VAL B 1 86  ? 21.025  -11.557 5.861   1.00 16.03 ? 760 VAL A CG1 1 
ATOM   2662 C CG2 . VAL B 1 86  ? 22.701  -12.904 7.187   1.00 15.57 ? 760 VAL A CG2 1 
ATOM   2663 N N   . PHE B 1 87  ? 22.140  -12.570 2.954   1.00 13.02 ? 761 PHE A N   1 
ATOM   2664 C CA  . PHE B 1 87  ? 21.687  -13.485 1.899   1.00 13.70 ? 761 PHE A CA  1 
ATOM   2665 C C   . PHE B 1 87  ? 22.891  -13.944 1.061   1.00 13.36 ? 761 PHE A C   1 
ATOM   2666 O O   . PHE B 1 87  ? 23.008  -15.150 0.775   1.00 13.65 ? 761 PHE A O   1 
ATOM   2667 C CB  . PHE B 1 87  ? 20.639  -12.777 1.051   1.00 11.66 ? 761 PHE A CB  1 
ATOM   2668 C CG  . PHE B 1 87  ? 19.733  -13.683 0.270   1.00 14.41 ? 761 PHE A CG  1 
ATOM   2669 C CD1 . PHE B 1 87  ? 18.830  -14.550 0.923   1.00 14.63 ? 761 PHE A CD1 1 
ATOM   2670 C CD2 . PHE B 1 87  ? 19.705  -13.613 -1.123  1.00 14.02 ? 761 PHE A CD2 1 
ATOM   2671 C CE1 . PHE B 1 87  ? 17.966  -15.355 0.206   1.00 15.24 ? 761 PHE A CE1 1 
ATOM   2672 C CE2 . PHE B 1 87  ? 18.809  -14.428 -1.848  1.00 13.12 ? 761 PHE A CE2 1 
ATOM   2673 C CZ  . PHE B 1 87  ? 17.965  -15.315 -1.159  1.00 12.78 ? 761 PHE A CZ  1 
ATOM   2674 N N   . GLY B 1 88  ? 23.762  -13.003 0.670   1.00 12.74 ? 762 GLY A N   1 
ATOM   2675 C CA  . GLY B 1 88  ? 25.021  -13.326 -0.063  1.00 13.03 ? 762 GLY A CA  1 
ATOM   2676 C C   . GLY B 1 88  ? 25.911  -14.259 0.793   1.00 12.89 ? 762 GLY A C   1 
ATOM   2677 O O   . GLY B 1 88  ? 26.496  -15.217 0.289   1.00 12.26 ? 762 GLY A O   1 
ATOM   2678 N N   . LEU B 1 89  ? 26.020  -13.970 2.088   1.00 11.63 ? 763 LEU A N   1 
ATOM   2679 C CA  . LEU B 1 89  ? 26.736  -14.846 3.015   1.00 11.69 ? 763 LEU A CA  1 
ATOM   2680 C C   . LEU B 1 89  ? 26.156  -16.290 3.008   1.00 11.20 ? 763 LEU A C   1 
ATOM   2681 O O   . LEU B 1 89  ? 26.902  -17.289 2.952   1.00 11.11 ? 763 LEU A O   1 
ATOM   2682 C CB  . LEU B 1 89  ? 26.692  -14.239 4.422   1.00 12.16 ? 763 LEU A CB  1 
ATOM   2683 C CG  . LEU B 1 89  ? 26.949  -15.219 5.575   1.00 11.19 ? 763 LEU A CG  1 
ATOM   2684 C CD1 . LEU B 1 89  ? 28.409  -15.639 5.539   1.00 12.10 ? 763 LEU A CD1 1 
ATOM   2685 C CD2 . LEU B 1 89  ? 26.583  -14.557 6.966   1.00 12.41 ? 763 LEU A CD2 1 
ATOM   2686 N N   . GLY B 1 90  ? 24.833  -16.407 3.005   1.00 11.85 ? 764 GLY A N   1 
ATOM   2687 C CA  . GLY B 1 90  ? 24.199  -17.729 2.980   1.00 12.61 ? 764 GLY A CA  1 
ATOM   2688 C C   . GLY B 1 90  ? 24.599  -18.470 1.695   1.00 13.81 ? 764 GLY A C   1 
ATOM   2689 O O   . GLY B 1 90  ? 24.930  -19.656 1.742   1.00 12.71 ? 764 GLY A O   1 
ATOM   2690 N N   . TRP B 1 91  ? 24.575  -17.764 0.560   1.00 13.44 ? 765 TRP A N   1 
ATOM   2691 C CA  . TRP B 1 91  ? 24.981  -18.352 -0.754  1.00 13.56 ? 765 TRP A CA  1 
ATOM   2692 C C   . TRP B 1 91  ? 26.415  -18.850 -0.757  1.00 12.86 ? 765 TRP A C   1 
ATOM   2693 O O   . TRP B 1 91  ? 26.685  -20.004 -1.090  1.00 12.21 ? 765 TRP A O   1 
ATOM   2694 C CB  . TRP B 1 91  ? 24.779  -17.355 -1.899  1.00 14.95 ? 765 TRP A CB  1 
ATOM   2695 C CG  . TRP B 1 91  ? 25.083  -17.991 -3.268  1.00 15.92 ? 765 TRP A CG  1 
ATOM   2696 C CD1 . TRP B 1 91  ? 26.160  -17.763 -4.071  1.00 19.48 ? 765 TRP A CD1 1 
ATOM   2697 C CD2 . TRP B 1 91  ? 24.296  -18.982 -3.926  1.00 18.59 ? 765 TRP A CD2 1 
ATOM   2698 N NE1 . TRP B 1 91  ? 26.089  -18.552 -5.208  1.00 18.58 ? 765 TRP A NE1 1 
ATOM   2699 C CE2 . TRP B 1 91  ? 24.957  -19.317 -5.130  1.00 19.63 ? 765 TRP A CE2 1 
ATOM   2700 C CE3 . TRP B 1 91  ? 23.101  -19.644 -3.600  1.00 17.41 ? 765 TRP A CE3 1 
ATOM   2701 C CZ2 . TRP B 1 91  ? 24.467  -20.276 -6.003  1.00 17.40 ? 765 TRP A CZ2 1 
ATOM   2702 C CZ3 . TRP B 1 91  ? 22.604  -20.580 -4.503  1.00 18.81 ? 765 TRP A CZ3 1 
ATOM   2703 C CH2 . TRP B 1 91  ? 23.292  -20.877 -5.680  1.00 17.30 ? 765 TRP A CH2 1 
ATOM   2704 N N   . ARG B 1 92  ? 27.360  -17.992 -0.388  1.00 12.84 ? 766 ARG A N   1 
ATOM   2705 C CA  . ARG B 1 92  ? 28.771  -18.417 -0.296  1.00 12.68 ? 766 ARG A CA  1 
ATOM   2706 C C   . ARG B 1 92  ? 29.021  -19.579 0.691   1.00 13.15 ? 766 ARG A C   1 
ATOM   2707 O O   . ARG B 1 92  ? 29.842  -20.458 0.414   1.00 12.55 ? 766 ARG A O   1 
ATOM   2708 C CB  . ARG B 1 92  ? 29.659  -17.244 0.079   1.00 12.37 ? 766 ARG A CB  1 
ATOM   2709 C CG  . ARG B 1 92  ? 29.685  -16.152 -1.042  1.00 13.70 ? 766 ARG A CG  1 
ATOM   2710 C CD  . ARG B 1 92  ? 30.756  -15.118 -0.685  1.00 14.76 ? 766 ARG A CD  1 
ATOM   2711 N NE  . ARG B 1 92  ? 30.452  -14.452 0.579   1.00 13.95 ? 766 ARG A NE  1 
ATOM   2712 C CZ  . ARG B 1 92  ? 29.625  -13.415 0.711   1.00 14.69 ? 766 ARG A CZ  1 
ATOM   2713 N NH1 . ARG B 1 92  ? 29.015  -12.888 -0.356  1.00 12.55 ? 766 ARG A NH1 1 
ATOM   2714 N NH2 . ARG B 1 92  ? 29.456  -12.842 1.899   1.00 13.31 ? 766 ARG A NH2 1 
ATOM   2715 N N   . SER B 1 93  ? 28.390  -19.550 1.860   1.00 13.11 ? 767 SER A N   1 
ATOM   2716 C CA  . SER B 1 93  ? 28.587  -20.625 2.842   1.00 14.43 ? 767 SER A CA  1 
ATOM   2717 C C   . SER B 1 93  ? 28.055  -21.986 2.279   1.00 14.15 ? 767 SER A C   1 
ATOM   2718 O O   . SER B 1 93  ? 28.706  -23.040 2.388   1.00 15.27 ? 767 SER A O   1 
ATOM   2719 C CB  . SER B 1 93  ? 27.846  -20.260 4.142   1.00 13.76 ? 767 SER A CB  1 
ATOM   2720 O OG  . SER B 1 93  ? 28.260  -18.988 4.604   1.00 15.26 ? 767 SER A OG  1 
ATOM   2721 N N   . TYR B 1 94  ? 26.868  -21.929 1.682   1.00 14.21 ? 768 TYR A N   1 
ATOM   2722 C CA  . TYR B 1 94  ? 26.235  -23.013 0.947   1.00 14.14 ? 768 TYR A CA  1 
ATOM   2723 C C   . TYR B 1 94  ? 27.162  -23.549 -0.154  1.00 15.19 ? 768 TYR A C   1 
ATOM   2724 O O   . TYR B 1 94  ? 27.499  -24.741 -0.168  1.00 15.22 ? 768 TYR A O   1 
ATOM   2725 C CB  . TYR B 1 94  ? 24.943  -22.473 0.341   1.00 14.74 ? 768 TYR A CB  1 
ATOM   2726 C CG  . TYR B 1 94  ? 24.197  -23.364 -0.641  1.00 14.12 ? 768 TYR A CG  1 
ATOM   2727 C CD1 . TYR B 1 94  ? 23.997  -24.738 -0.402  1.00 12.49 ? 768 TYR A CD1 1 
ATOM   2728 C CD2 . TYR B 1 94  ? 23.660  -22.821 -1.807  1.00 14.96 ? 768 TYR A CD2 1 
ATOM   2729 C CE1 . TYR B 1 94  ? 23.249  -25.520 -1.308  1.00 13.11 ? 768 TYR A CE1 1 
ATOM   2730 C CE2 . TYR B 1 94  ? 22.930  -23.591 -2.690  1.00 14.55 ? 768 TYR A CE2 1 
ATOM   2731 C CZ  . TYR B 1 94  ? 22.737  -24.920 -2.455  1.00 13.21 ? 768 TYR A CZ  1 
ATOM   2732 O OH  . TYR B 1 94  ? 21.964  -25.608 -3.342  1.00 15.55 ? 768 TYR A OH  1 
ATOM   2733 N N   . LYS B 1 95  ? 27.621  -22.668 -1.029  1.00 13.95 ? 769 LYS A N   1 
ATOM   2734 C CA  . LYS B 1 95  ? 28.477  -23.060 -2.152  1.00 15.08 ? 769 LYS A CA  1 
ATOM   2735 C C   . LYS B 1 95  ? 29.860  -23.594 -1.764  1.00 16.18 ? 769 LYS A C   1 
ATOM   2736 O O   . LYS B 1 95  ? 30.301  -24.604 -2.318  1.00 16.92 ? 769 LYS A O   1 
ATOM   2737 C CB  . LYS B 1 95  ? 28.618  -21.901 -3.160  1.00 14.78 ? 769 LYS A CB  1 
ATOM   2738 C CG  . LYS B 1 95  ? 27.326  -21.610 -3.862  1.00 15.09 ? 769 LYS A CG  1 
ATOM   2739 C CD  . LYS B 1 95  ? 26.971  -22.635 -4.996  1.00 17.47 ? 769 LYS A CD  1 
ATOM   2740 C CE  . LYS B 1 95  ? 27.855  -22.521 -6.266  1.00 16.75 ? 769 LYS A CE  1 
ATOM   2741 N NZ  . LYS B 1 95  ? 27.397  -23.497 -7.334  1.00 12.91 ? 769 LYS A NZ  1 
ATOM   2742 N N   . HIS B 1 96  ? 30.546  -22.927 -0.832  1.00 15.68 ? 770 HIS A N   1 
ATOM   2743 C CA  . HIS B 1 96  ? 31.959  -23.229 -0.558  1.00 16.23 ? 770 HIS A CA  1 
ATOM   2744 C C   . HIS B 1 96  ? 32.231  -24.226 0.565   1.00 17.05 ? 770 HIS A C   1 
ATOM   2745 O O   . HIS B 1 96  ? 33.281  -24.890 0.560   1.00 16.87 ? 770 HIS A O   1 
ATOM   2746 C CB  . HIS B 1 96  ? 32.753  -21.950 -0.245  1.00 17.16 ? 770 HIS A CB  1 
ATOM   2747 C CG  . HIS B 1 96  ? 32.805  -20.985 -1.387  1.00 18.46 ? 770 HIS A CG  1 
ATOM   2748 N ND1 . HIS B 1 96  ? 33.724  -21.106 -2.410  1.00 20.32 ? 770 HIS A ND1 1 
ATOM   2749 C CD2 . HIS B 1 96  ? 32.032  -19.914 -1.694  1.00 19.39 ? 770 HIS A CD2 1 
ATOM   2750 C CE1 . HIS B 1 96  ? 33.515  -20.145 -3.296  1.00 22.24 ? 770 HIS A CE1 1 
ATOM   2751 N NE2 . HIS B 1 96  ? 32.491  -19.411 -2.889  1.00 20.42 ? 770 HIS A NE2 1 
ATOM   2752 N N   . VAL B 1 97  ? 31.319  -24.302 1.537   1.00 16.90 ? 771 VAL A N   1 
ATOM   2753 C CA  . VAL B 1 97  ? 31.536  -25.051 2.786   1.00 17.24 ? 771 VAL A CA  1 
ATOM   2754 C C   . VAL B 1 97  ? 30.297  -25.876 3.153   1.00 16.83 ? 771 VAL A C   1 
ATOM   2755 O O   . VAL B 1 97  ? 30.060  -26.204 4.343   1.00 17.42 ? 771 VAL A O   1 
ATOM   2756 C CB  . VAL B 1 97  ? 32.009  -24.099 3.978   1.00 18.31 ? 771 VAL A CB  1 
ATOM   2757 C CG1 . VAL B 1 97  ? 33.404  -23.560 3.716   1.00 19.78 ? 771 VAL A CG1 1 
ATOM   2758 C CG2 . VAL B 1 97  ? 31.088  -22.885 4.118   1.00 18.84 ? 771 VAL A CG2 1 
ATOM   2759 N N   . SER B 1 98  ? 29.513  -26.230 2.135   1.00 14.90 ? 772 SER A N   1 
ATOM   2760 C CA  . SER B 1 98  ? 28.253  -26.977 2.355   1.00 16.22 ? 772 SER A CA  1 
ATOM   2761 C C   . SER B 1 98  ? 27.355  -26.432 3.449   1.00 16.25 ? 772 SER A C   1 
ATOM   2762 O O   . SER B 1 98  ? 26.597  -27.201 4.083   1.00 16.18 ? 772 SER A O   1 
ATOM   2763 C CB  . SER B 1 98  ? 28.546  -28.483 2.533   1.00 16.17 ? 772 SER A CB  1 
ATOM   2764 O OG  . SER B 1 98  ? 29.246  -28.900 1.359   1.00 18.24 ? 772 SER A OG  1 
ATOM   2765 N N   . GLY B 1 99  ? 27.376  -25.096 3.636   1.00 16.02 ? 773 GLY A N   1 
ATOM   2766 C CA  . GLY B 1 99  ? 26.524  -24.460 4.677   1.00 16.30 ? 773 GLY A CA  1 
ATOM   2767 C C   . GLY B 1 99  ? 27.016  -24.669 6.118   1.00 17.19 ? 773 GLY A C   1 
ATOM   2768 O O   . GLY B 1 99  ? 26.348  -24.243 7.091   1.00 17.61 ? 773 GLY A O   1 
ATOM   2769 N N   . GLN B 1 100 ? 28.165  -25.344 6.276   1.00 16.41 ? 774 GLN A N   1 
ATOM   2770 C CA  . GLN B 1 100 ? 28.633  -25.799 7.601   1.00 16.69 ? 774 GLN A CA  1 
ATOM   2771 C C   . GLN B 1 100 ? 29.618  -24.843 8.304   1.00 16.93 ? 774 GLN A C   1 
ATOM   2772 O O   . GLN B 1 100 ? 30.001  -25.077 9.452   1.00 15.99 ? 774 GLN A O   1 
ATOM   2773 C CB  . GLN B 1 100 ? 29.224  -27.230 7.545   1.00 16.39 ? 774 GLN A CB  1 
ATOM   2774 C CG  . GLN B 1 100 ? 28.263  -28.244 6.958   1.00 18.54 ? 774 GLN A CG  1 
ATOM   2775 C CD  . GLN B 1 100 ? 26.910  -28.221 7.642   1.00 23.42 ? 774 GLN A CD  1 
ATOM   2776 O OE1 . GLN B 1 100 ? 26.803  -28.510 8.848   1.00 26.10 ? 774 GLN A OE1 1 
ATOM   2777 N NE2 . GLN B 1 100 ? 25.855  -27.857 6.878   1.00 26.28 ? 774 GLN A NE2 1 
ATOM   2778 N N   . MET B 1 101 ? 30.008  -23.780 7.608   1.00 16.30 ? 775 MET A N   1 
ATOM   2779 C CA  . MET B 1 101 ? 30.743  -22.645 8.200   1.00 17.57 ? 775 MET A CA  1 
ATOM   2780 C C   . MET B 1 101 ? 30.177  -21.364 7.578   1.00 15.60 ? 775 MET A C   1 
ATOM   2781 O O   . MET B 1 101 ? 29.460  -21.411 6.590   1.00 14.28 ? 775 MET A O   1 
ATOM   2782 C CB  . MET B 1 101 ? 32.257  -22.703 7.947   1.00 17.22 ? 775 MET A CB  1 
ATOM   2783 C CG  . MET B 1 101 ? 32.955  -24.009 8.351   1.00 18.60 ? 775 MET A CG  1 
ATOM   2784 S SD  . MET B 1 101 ? 34.731  -23.862 8.248   1.00 24.56 ? 775 MET A SD  1 
ATOM   2785 C CE  . MET B 1 101 ? 35.195  -25.549 8.720   1.00 24.44 ? 775 MET A CE  1 
ATOM   2786 N N   . LEU B 1 102 ? 30.471  -20.225 8.190   1.00 15.28 ? 776 LEU A N   1 
ATOM   2787 C CA  . LEU B 1 102 ? 29.995  -18.951 7.638   1.00 14.27 ? 776 LEU A CA  1 
ATOM   2788 C C   . LEU B 1 102 ? 31.112  -18.336 6.809   1.00 13.61 ? 776 LEU A C   1 
ATOM   2789 O O   . LEU B 1 102 ? 32.128  -17.875 7.358   1.00 13.20 ? 776 LEU A O   1 
ATOM   2790 C CB  . LEU B 1 102 ? 29.506  -18.012 8.774   1.00 14.38 ? 776 LEU A CB  1 
ATOM   2791 C CG  . LEU B 1 102 ? 28.235  -18.452 9.526   1.00 13.23 ? 776 LEU A CG  1 
ATOM   2792 C CD1 . LEU B 1 102 ? 27.791  -17.397 10.528  1.00 15.44 ? 776 LEU A CD1 1 
ATOM   2793 C CD2 . LEU B 1 102 ? 27.075  -18.777 8.578   1.00 13.70 ? 776 LEU A CD2 1 
ATOM   2794 N N   . TYR B 1 103 ? 30.930  -18.385 5.490   1.00 12.89 ? 777 TYR A N   1 
ATOM   2795 C CA  . TYR B 1 103 ? 31.926  -17.939 4.529   1.00 12.29 ? 777 TYR A CA  1 
ATOM   2796 C C   . TYR B 1 103 ? 31.696  -16.428 4.219   1.00 12.98 ? 777 TYR A C   1 
ATOM   2797 O O   . TYR B 1 103 ? 31.076  -16.062 3.210   1.00 11.86 ? 777 TYR A O   1 
ATOM   2798 C CB  . TYR B 1 103 ? 31.817  -18.802 3.257   1.00 13.29 ? 777 TYR A CB  1 
ATOM   2799 C CG  . TYR B 1 103 ? 32.989  -18.694 2.284   1.00 14.73 ? 777 TYR A CG  1 
ATOM   2800 C CD1 . TYR B 1 103 ? 33.108  -17.592 1.409   1.00 16.13 ? 777 TYR A CD1 1 
ATOM   2801 C CD2 . TYR B 1 103 ? 33.949  -19.695 2.203   1.00 17.81 ? 777 TYR A CD2 1 
ATOM   2802 C CE1 . TYR B 1 103 ? 34.190  -17.498 0.487   1.00 15.13 ? 777 TYR A CE1 1 
ATOM   2803 C CE2 . TYR B 1 103 ? 35.025  -19.612 1.253   1.00 14.81 ? 777 TYR A CE2 1 
ATOM   2804 C CZ  . TYR B 1 103 ? 35.117  -18.519 0.422   1.00 15.49 ? 777 TYR A CZ  1 
ATOM   2805 O OH  . TYR B 1 103 ? 36.151  -18.475 -0.487  1.00 16.15 ? 777 TYR A OH  1 
ATOM   2806 N N   . PHE B 1 104 ? 32.145  -15.572 5.130   1.00 13.14 ? 778 PHE A N   1 
ATOM   2807 C CA  . PHE B 1 104 ? 31.996  -14.114 4.973   1.00 14.42 ? 778 PHE A CA  1 
ATOM   2808 C C   . PHE B 1 104 ? 32.824  -13.692 3.765   1.00 14.96 ? 778 PHE A C   1 
ATOM   2809 O O   . PHE B 1 104 ? 32.343  -12.980 2.864   1.00 16.14 ? 778 PHE A O   1 
ATOM   2810 C CB  . PHE B 1 104 ? 32.402  -13.345 6.259   1.00 13.08 ? 778 PHE A CB  1 
ATOM   2811 C CG  . PHE B 1 104 ? 31.428  -13.540 7.423   1.00 14.74 ? 778 PHE A CG  1 
ATOM   2812 C CD1 . PHE B 1 104 ? 31.648  -14.531 8.394   1.00 16.27 ? 778 PHE A CD1 1 
ATOM   2813 C CD2 . PHE B 1 104 ? 30.250  -12.776 7.506   1.00 15.22 ? 778 PHE A CD2 1 
ATOM   2814 C CE1 . PHE B 1 104 ? 30.713  -14.746 9.450   1.00 16.38 ? 778 PHE A CE1 1 
ATOM   2815 C CE2 . PHE B 1 104 ? 29.327  -12.972 8.574   1.00 15.34 ? 778 PHE A CE2 1 
ATOM   2816 C CZ  . PHE B 1 104 ? 29.570  -13.953 9.542   1.00 14.13 ? 778 PHE A CZ  1 
ATOM   2817 N N   . ALA B 1 105 ? 34.053  -14.183 3.721   1.00 15.92 ? 779 ALA A N   1 
ATOM   2818 C CA  . ALA B 1 105 ? 34.955  -13.908 2.636   1.00 17.54 ? 779 ALA A CA  1 
ATOM   2819 C C   . ALA B 1 105 ? 35.987  -15.034 2.535   1.00 18.60 ? 779 ALA A C   1 
ATOM   2820 O O   . ALA B 1 105 ? 36.102  -15.870 3.446   1.00 17.91 ? 779 ALA A O   1 
ATOM   2821 C CB  . ALA B 1 105 ? 35.643  -12.572 2.871   1.00 16.12 ? 779 ALA A CB  1 
ATOM   2822 N N   . PRO B 1 106 ? 36.745  -15.074 1.432   1.00 19.96 ? 780 PRO A N   1 
ATOM   2823 C CA  . PRO B 1 106 ? 37.834  -16.079 1.374   1.00 20.12 ? 780 PRO A CA  1 
ATOM   2824 C C   . PRO B 1 106 ? 38.844  -15.948 2.512   1.00 20.11 ? 780 PRO A C   1 
ATOM   2825 O O   . PRO B 1 106 ? 39.398  -16.960 2.967   1.00 20.10 ? 780 PRO A O   1 
ATOM   2826 C CB  . PRO B 1 106 ? 38.496  -15.811 0.008   1.00 20.91 ? 780 PRO A CB  1 
ATOM   2827 C CG  . PRO B 1 106 ? 37.416  -15.171 -0.795  1.00 23.71 ? 780 PRO A CG  1 
ATOM   2828 C CD  . PRO B 1 106 ? 36.651  -14.297 0.178   1.00 20.28 ? 780 PRO A CD  1 
ATOM   2829 N N   . ASP B 1 107 ? 39.029  -14.732 3.029   1.00 19.67 ? 781 ASP A N   1 
ATOM   2830 C CA  . ASP B 1 107 ? 39.935  -14.516 4.173   1.00 19.84 ? 781 ASP A CA  1 
ATOM   2831 C C   . ASP B 1 107 ? 39.266  -14.345 5.540   1.00 19.45 ? 781 ASP A C   1 
ATOM   2832 O O   . ASP B 1 107 ? 39.914  -13.939 6.499   1.00 20.91 ? 781 ASP A O   1 
ATOM   2833 C CB  . ASP B 1 107 ? 40.832  -13.291 3.874   1.00 20.90 ? 781 ASP A CB  1 
ATOM   2834 C CG  . ASP B 1 107 ? 40.024  -12.015 3.600   1.00 21.01 ? 781 ASP A CG  1 
ATOM   2835 O OD1 . ASP B 1 107 ? 38.781  -12.067 3.405   1.00 20.14 ? 781 ASP A OD1 1 
ATOM   2836 O OD2 . ASP B 1 107 ? 40.647  -10.943 3.629   1.00 22.28 ? 781 ASP A OD2 1 
ATOM   2837 N N   . LEU B 1 108 ? 37.967  -14.625 5.608   1.00 18.03 ? 782 LEU A N   1 
ATOM   2838 C CA  . LEU B 1 108 ? 37.161  -14.527 6.805   1.00 17.43 ? 782 LEU A CA  1 
ATOM   2839 C C   . LEU B 1 108 ? 36.046  -15.599 6.763   1.00 16.89 ? 782 LEU A C   1 
ATOM   2840 O O   . LEU B 1 108 ? 34.919  -15.335 6.340   1.00 14.40 ? 782 LEU A O   1 
ATOM   2841 C CB  . LEU B 1 108 ? 36.530  -13.139 6.930   1.00 17.47 ? 782 LEU A CB  1 
ATOM   2842 C CG  . LEU B 1 108 ? 35.964  -12.762 8.295   1.00 18.97 ? 782 LEU A CG  1 
ATOM   2843 C CD1 . LEU B 1 108 ? 36.993  -13.019 9.406   1.00 23.69 ? 782 LEU A CD1 1 
ATOM   2844 C CD2 . LEU B 1 108 ? 35.532  -11.254 8.305   1.00 17.60 ? 782 LEU A CD2 1 
ATOM   2845 N N   . ILE B 1 109 ? 36.395  -16.814 7.191   1.00 16.50 ? 783 ILE A N   1 
ATOM   2846 C CA  . ILE B 1 109 ? 35.462  -17.927 7.272   1.00 16.55 ? 783 ILE A CA  1 
ATOM   2847 C C   . ILE B 1 109 ? 35.350  -18.349 8.736   1.00 17.25 ? 783 ILE A C   1 
ATOM   2848 O O   . ILE B 1 109 ? 36.366  -18.703 9.361   1.00 18.11 ? 783 ILE A O   1 
ATOM   2849 C CB  . ILE B 1 109 ? 35.991  -19.137 6.458   1.00 16.28 ? 783 ILE A CB  1 
ATOM   2850 C CG1 . ILE B 1 109 ? 36.160  -18.744 4.969   1.00 16.39 ? 783 ILE A CG1 1 
ATOM   2851 C CG2 . ILE B 1 109 ? 35.056  -20.324 6.677   1.00 18.54 ? 783 ILE A CG2 1 
ATOM   2852 C CD1 . ILE B 1 109 ? 37.199  -19.608 4.162   1.00 17.37 ? 783 ILE A CD1 1 
ATOM   2853 N N   . LEU B 1 110 ? 34.155  -18.326 9.299   1.00 17.56 ? 784 LEU A N   1 
ATOM   2854 C CA  . LEU B 1 110 ? 34.031  -18.629 10.729  1.00 19.77 ? 784 LEU A CA  1 
ATOM   2855 C C   . LEU B 1 110 ? 33.299  -19.940 10.960  1.00 21.03 ? 784 LEU A C   1 
ATOM   2856 O O   . LEU B 1 110 ? 32.276  -20.240 10.337  1.00 19.79 ? 784 LEU A O   1 
ATOM   2857 C CB  . LEU B 1 110 ? 33.317  -17.506 11.514  1.00 18.59 ? 784 LEU A CB  1 
ATOM   2858 C CG  . LEU B 1 110 ? 33.860  -16.077 11.394  1.00 21.96 ? 784 LEU A CG  1 
ATOM   2859 C CD1 . LEU B 1 110 ? 32.936  -15.121 12.174  1.00 22.71 ? 784 LEU A CD1 1 
ATOM   2860 C CD2 . LEU B 1 110 ? 35.303  -15.939 11.839  1.00 21.97 ? 784 LEU A CD2 1 
ATOM   2861 N N   . ASN B 1 111 ? 33.856  -20.722 11.873  1.00 22.76 ? 785 ASN A N   1 
ATOM   2862 C CA  . ASN B 1 111 ? 33.157  -21.888 12.382  1.00 25.00 ? 785 ASN A CA  1 
ATOM   2863 C C   . ASN B 1 111 ? 32.844  -21.598 13.869  1.00 25.90 ? 785 ASN A C   1 
ATOM   2864 O O   . ASN B 1 111 ? 33.225  -20.549 14.434  1.00 24.59 ? 785 ASN A O   1 
ATOM   2865 C CB  . ASN B 1 111 ? 34.026  -23.133 12.197  1.00 25.26 ? 785 ASN A CB  1 
ATOM   2866 C CG  . ASN B 1 111 ? 35.446  -22.920 12.694  1.00 28.29 ? 785 ASN A CG  1 
ATOM   2867 O OD1 . ASN B 1 111 ? 35.681  -22.115 13.591  1.00 29.53 ? 785 ASN A OD1 1 
ATOM   2868 N ND2 . ASN B 1 111 ? 36.399  -23.643 12.119  1.00 32.90 ? 785 ASN A ND2 1 
ATOM   2869 N N   . GLU B 1 112 ? 32.131  -22.520 14.485  1.00 26.84 ? 786 GLU A N   1 
ATOM   2870 C CA  . GLU B 1 112 ? 31.746  -22.423 15.873  1.00 28.30 ? 786 GLU A CA  1 
ATOM   2871 C C   . GLU B 1 112 ? 32.862  -22.021 16.827  1.00 27.91 ? 786 GLU A C   1 
ATOM   2872 O O   . GLU B 1 112 ? 32.662  -21.175 17.711  1.00 27.32 ? 786 GLU A O   1 
ATOM   2873 C CB  . GLU B 1 112 ? 31.208  -23.777 16.289  1.00 30.40 ? 786 GLU A CB  1 
ATOM   2874 C CG  . GLU B 1 112 ? 30.311  -23.722 17.482  1.00 34.26 ? 786 GLU A CG  1 
ATOM   2875 C CD  . GLU B 1 112 ? 29.664  -25.064 17.744  1.00 42.29 ? 786 GLU A CD  1 
ATOM   2876 O OE1 . GLU B 1 112 ? 29.181  -25.690 16.751  1.00 43.16 ? 786 GLU A OE1 1 
ATOM   2877 O OE2 . GLU B 1 112 ? 29.652  -25.482 18.935  1.00 44.30 ? 786 GLU A OE2 1 
ATOM   2878 N N   . GLN B 1 113 ? 34.040  -22.601 16.640  1.00 27.60 ? 787 GLN A N   1 
ATOM   2879 C CA  . GLN B 1 113 ? 35.139  -22.364 17.544  1.00 29.47 ? 787 GLN A CA  1 
ATOM   2880 C C   . GLN B 1 113 ? 35.612  -20.897 17.546  1.00 29.66 ? 787 GLN A C   1 
ATOM   2881 O O   . GLN B 1 113 ? 36.291  -20.450 18.488  1.00 29.74 ? 787 GLN A O   1 
ATOM   2882 C CB  . GLN B 1 113 ? 36.290  -23.298 17.182  1.00 30.16 ? 787 GLN A CB  1 
ATOM   2883 C CG  . GLN B 1 113 ? 37.274  -22.721 16.210  1.00 34.06 ? 787 GLN A CG  1 
ATOM   2884 C CD  . GLN B 1 113 ? 38.538  -23.535 16.111  1.00 41.12 ? 787 GLN A CD  1 
ATOM   2885 O OE1 . GLN B 1 113 ? 39.641  -22.969 16.063  1.00 44.42 ? 787 GLN A OE1 1 
ATOM   2886 N NE2 . GLN B 1 113 ? 38.395  -24.890 16.081  1.00 45.39 ? 787 GLN A NE2 1 
ATOM   2887 N N   . ARG B 1 114 ? 35.267  -20.161 16.485  1.00 28.77 ? 788 ARG A N   1 
ATOM   2888 C CA  . ARG B 1 114 ? 35.739  -18.789 16.302  1.00 29.13 ? 788 ARG A CA  1 
ATOM   2889 C C   . ARG B 1 114 ? 34.663  -17.800 16.727  1.00 28.73 ? 788 ARG A C   1 
ATOM   2890 O O   . ARG B 1 114 ? 34.809  -16.581 16.554  1.00 29.59 ? 788 ARG A O   1 
ATOM   2891 C CB  . ARG B 1 114 ? 36.169  -18.545 14.840  1.00 28.53 ? 788 ARG A CB  1 
ATOM   2892 C CG  . ARG B 1 114 ? 37.428  -19.320 14.411  1.00 30.32 ? 788 ARG A CG  1 
ATOM   2893 C CD  . ARG B 1 114 ? 37.848  -19.005 12.947  1.00 30.25 ? 788 ARG A CD  1 
ATOM   2894 N NE  . ARG B 1 114 ? 38.454  -17.670 12.873  1.00 32.43 ? 788 ARG A NE  1 
ATOM   2895 C CZ  . ARG B 1 114 ? 38.894  -17.053 11.761  1.00 34.46 ? 788 ARG A CZ  1 
ATOM   2896 N NH1 . ARG B 1 114 ? 38.805  -17.627 10.545  1.00 30.60 ? 788 ARG A NH1 1 
ATOM   2897 N NH2 . ARG B 1 114 ? 39.431  -15.837 11.875  1.00 32.05 ? 788 ARG A NH2 1 
ATOM   2898 N N   . MET B 1 115 ? 33.574  -18.335 17.258  1.00 28.41 ? 789 MET A N   1 
ATOM   2899 C CA  . MET B 1 115 ? 32.452  -17.532 17.787  1.00 28.73 ? 789 MET A CA  1 
ATOM   2900 C C   . MET B 1 115 ? 32.393  -17.686 19.301  1.00 29.25 ? 789 MET A C   1 
ATOM   2901 O O   . MET B 1 115 ? 31.522  -18.372 19.830  1.00 29.89 ? 789 MET A O   1 
ATOM   2902 C CB  . MET B 1 115 ? 31.132  -17.962 17.147  1.00 27.99 ? 789 MET A CB  1 
ATOM   2903 C CG  . MET B 1 115 ? 31.235  -18.097 15.638  1.00 28.26 ? 789 MET A CG  1 
ATOM   2904 S SD  . MET B 1 115 ? 29.883  -19.024 14.910  1.00 26.49 ? 789 MET A SD  1 
ATOM   2905 C CE  . MET B 1 115 ? 30.357  -18.842 13.182  1.00 27.90 ? 789 MET A CE  1 
ATOM   2906 N N   . LYS B 1 116 ? 33.333  -17.037 19.989  1.00 30.09 ? 790 LYS A N   1 
ATOM   2907 C CA  . LYS B 1 116 ? 33.512  -17.277 21.423  1.00 31.03 ? 790 LYS A CA  1 
ATOM   2908 C C   . LYS B 1 116 ? 32.415  -16.651 22.301  1.00 32.28 ? 790 LYS A C   1 
ATOM   2909 O O   . LYS B 1 116 ? 31.821  -17.341 23.110  1.00 32.06 ? 790 LYS A O   1 
ATOM   2910 C CB  . LYS B 1 116 ? 34.897  -16.829 21.846  1.00 30.84 ? 790 LYS A CB  1 
ATOM   2911 C CG  . LYS B 1 116 ? 35.997  -17.513 21.038  1.00 30.22 ? 790 LYS A CG  1 
ATOM   2912 C CD  . LYS B 1 116 ? 37.330  -16.943 21.405  1.00 31.92 ? 790 LYS A CD  1 
ATOM   2913 C CE  . LYS B 1 116 ? 38.428  -17.536 20.534  1.00 33.76 ? 790 LYS A CE  1 
ATOM   2914 N NZ  . LYS B 1 116 ? 39.666  -16.720 20.652  1.00 35.16 ? 790 LYS A NZ  1 
ATOM   2915 N N   . GLU B 1 117 ? 32.172  -15.344 22.131  1.00 33.36 ? 791 GLU A N   1 
ATOM   2916 C CA  . GLU B 1 117 ? 31.166  -14.586 22.883  1.00 34.58 ? 791 GLU A CA  1 
ATOM   2917 C C   . GLU B 1 117 ? 29.774  -15.100 22.554  1.00 34.39 ? 791 GLU A C   1 
ATOM   2918 O O   . GLU B 1 117 ? 29.417  -15.240 21.368  1.00 34.29 ? 791 GLU A O   1 
ATOM   2919 C CB  . GLU B 1 117 ? 31.273  -13.106 22.513  1.00 35.13 ? 791 GLU A CB  1 
ATOM   2920 C CG  . GLU B 1 117 ? 31.611  -12.180 23.666  1.00 41.86 ? 791 GLU A CG  1 
ATOM   2921 C CD  . GLU B 1 117 ? 30.364  -11.712 24.473  1.00 47.56 ? 791 GLU A CD  1 
ATOM   2922 O OE1 . GLU B 1 117 ? 29.265  -11.510 23.883  1.00 48.51 ? 791 GLU A OE1 1 
ATOM   2923 O OE2 . GLU B 1 117 ? 30.493  -11.531 25.713  1.00 49.36 ? 791 GLU A OE2 1 
ATOM   2924 N N   . SER B 1 118 ? 28.977  -15.368 23.584  1.00 33.75 ? 792 SER A N   1 
ATOM   2925 C CA  . SER B 1 118 ? 27.694  -16.046 23.386  1.00 33.93 ? 792 SER A CA  1 
ATOM   2926 C C   . SER B 1 118 ? 26.708  -15.215 22.555  1.00 32.74 ? 792 SER A C   1 
ATOM   2927 O O   . SER B 1 118 ? 25.854  -15.764 21.849  1.00 32.15 ? 792 SER A O   1 
ATOM   2928 C CB  . SER B 1 118 ? 27.082  -16.436 24.740  1.00 35.07 ? 792 SER A CB  1 
ATOM   2929 O OG  . SER B 1 118 ? 27.040  -15.313 25.599  1.00 37.83 ? 792 SER A OG  1 
ATOM   2930 N N   . SER B 1 119 ? 26.836  -13.892 22.684  1.00 31.92 ? 793 SER A N   1 
ATOM   2931 C CA  . SER B 1 119 ? 26.042  -12.894 21.976  1.00 31.30 ? 793 SER A CA  1 
ATOM   2932 C C   . SER B 1 119 ? 26.269  -12.990 20.459  1.00 29.78 ? 793 SER A C   1 
ATOM   2933 O O   . SER B 1 119 ? 25.324  -13.051 19.670  1.00 28.37 ? 793 SER A O   1 
ATOM   2934 C CB  . SER B 1 119 ? 26.510  -11.519 22.445  1.00 31.39 ? 793 SER A CB  1 
ATOM   2935 O OG  . SER B 1 119 ? 25.490  -10.571 22.245  1.00 36.72 ? 793 SER A OG  1 
ATOM   2936 N N   . PHE B 1 120 ? 27.551  -12.966 20.095  1.00 29.52 ? 794 PHE A N   1 
ATOM   2937 C CA  . PHE B 1 120 ? 28.018  -13.101 18.721  1.00 30.06 ? 794 PHE A CA  1 
ATOM   2938 C C   . PHE B 1 120 ? 27.688  -14.488 18.152  1.00 28.71 ? 794 PHE A C   1 
ATOM   2939 O O   . PHE B 1 120 ? 27.209  -14.596 17.026  1.00 28.61 ? 794 PHE A O   1 
ATOM   2940 C CB  . PHE B 1 120 ? 29.512  -12.781 18.625  1.00 30.68 ? 794 PHE A CB  1 
ATOM   2941 C CG  . PHE B 1 120 ? 30.046  -12.808 17.214  1.00 34.44 ? 794 PHE A CG  1 
ATOM   2942 C CD1 . PHE B 1 120 ? 29.582  -11.893 16.250  1.00 36.10 ? 794 PHE A CD1 1 
ATOM   2943 C CD2 . PHE B 1 120 ? 31.007  -13.757 16.837  1.00 36.21 ? 794 PHE A CD2 1 
ATOM   2944 C CE1 . PHE B 1 120 ? 30.073  -11.915 14.926  1.00 36.59 ? 794 PHE A CE1 1 
ATOM   2945 C CE2 . PHE B 1 120 ? 31.511  -13.791 15.524  1.00 37.77 ? 794 PHE A CE2 1 
ATOM   2946 C CZ  . PHE B 1 120 ? 31.043  -12.852 14.562  1.00 37.27 ? 794 PHE A CZ  1 
ATOM   2947 N N   . TYR B 1 121 ? 27.908  -15.537 18.947  1.00 27.85 ? 795 TYR A N   1 
ATOM   2948 C CA  . TYR B 1 121 ? 27.536  -16.893 18.576  1.00 26.38 ? 795 TYR A CA  1 
ATOM   2949 C C   . TYR B 1 121 ? 26.033  -16.992 18.290  1.00 25.41 ? 795 TYR A C   1 
ATOM   2950 O O   . TYR B 1 121 ? 25.635  -17.615 17.316  1.00 23.29 ? 795 TYR A O   1 
ATOM   2951 C CB  . TYR B 1 121 ? 27.962  -17.910 19.663  1.00 28.54 ? 795 TYR A CB  1 
ATOM   2952 C CG  . TYR B 1 121 ? 27.600  -19.358 19.331  1.00 29.54 ? 795 TYR A CG  1 
ATOM   2953 C CD1 . TYR B 1 121 ? 27.967  -19.937 18.093  1.00 30.65 ? 795 TYR A CD1 1 
ATOM   2954 C CD2 . TYR B 1 121 ? 26.902  -20.149 20.246  1.00 32.79 ? 795 TYR A CD2 1 
ATOM   2955 C CE1 . TYR B 1 121 ? 27.646  -21.241 17.774  1.00 30.42 ? 795 TYR A CE1 1 
ATOM   2956 C CE2 . TYR B 1 121 ? 26.572  -21.479 19.936  1.00 33.71 ? 795 TYR A CE2 1 
ATOM   2957 C CZ  . TYR B 1 121 ? 26.949  -22.003 18.704  1.00 32.02 ? 795 TYR A CZ  1 
ATOM   2958 O OH  . TYR B 1 121 ? 26.618  -23.291 18.399  1.00 35.18 ? 795 TYR A OH  1 
ATOM   2959 N N   . SER B 1 122 ? 25.190  -16.377 19.123  1.00 24.05 ? 796 SER A N   1 
ATOM   2960 C CA  . SER B 1 122 ? 23.749  -16.439 18.862  1.00 24.75 ? 796 SER A CA  1 
ATOM   2961 C C   . SER B 1 122 ? 23.364  -15.733 17.560  1.00 23.35 ? 796 SER A C   1 
ATOM   2962 O O   . SER B 1 122 ? 22.422  -16.129 16.877  1.00 23.33 ? 796 SER A O   1 
ATOM   2963 C CB  . SER B 1 122 ? 22.911  -15.851 19.998  1.00 25.41 ? 796 SER A CB  1 
ATOM   2964 O OG  . SER B 1 122 ? 23.116  -16.598 21.168  1.00 28.22 ? 796 SER A OG  1 
ATOM   2965 N N   . LEU B 1 123 ? 24.072  -14.661 17.284  1.00 22.16 ? 797 LEU A N   1 
ATOM   2966 C CA  . LEU B 1 123 ? 23.863  -13.878 16.074  1.00 22.18 ? 797 LEU A CA  1 
ATOM   2967 C C   . LEU B 1 123 ? 24.219  -14.722 14.837  1.00 20.28 ? 797 LEU A C   1 
ATOM   2968 O O   . LEU B 1 123 ? 23.427  -14.826 13.896  1.00 20.49 ? 797 LEU A O   1 
ATOM   2969 C CB  . LEU B 1 123 ? 24.690  -12.604 16.137  1.00 21.10 ? 797 LEU A CB  1 
ATOM   2970 C CG  . LEU B 1 123 ? 24.405  -11.621 14.984  1.00 24.49 ? 797 LEU A CG  1 
ATOM   2971 C CD1 . LEU B 1 123 ? 23.062  -10.938 15.121  1.00 24.53 ? 797 LEU A CD1 1 
ATOM   2972 C CD2 . LEU B 1 123 ? 25.522  -10.645 14.899  1.00 26.96 ? 797 LEU A CD2 1 
ATOM   2973 N N   . CYS B 1 124 ? 25.400  -15.336 14.865  1.00 19.58 ? 798 CYS A N   1 
ATOM   2974 C CA  . CYS B 1 124 ? 25.810  -16.282 13.822  1.00 19.53 ? 798 CYS A CA  1 
ATOM   2975 C C   . CYS B 1 124 ? 24.838  -17.462 13.612  1.00 19.28 ? 798 CYS A C   1 
ATOM   2976 O O   . CYS B 1 124 ? 24.546  -17.832 12.466  1.00 19.33 ? 798 CYS A O   1 
ATOM   2977 C CB  . CYS B 1 124 ? 27.229  -16.776 14.110  1.00 19.18 ? 798 CYS A CB  1 
ATOM   2978 S SG  . CYS B 1 124 ? 28.475  -15.484 14.012  1.00 20.54 ? 798 CYS A SG  1 
ATOM   2979 N N   . LEU B 1 125 ? 24.357  -18.080 14.695  1.00 18.16 ? 799 LEU A N   1 
ATOM   2980 C CA  . LEU B 1 125 ? 23.291  -19.086 14.586  1.00 18.26 ? 799 LEU A CA  1 
ATOM   2981 C C   . LEU B 1 125 ? 22.085  -18.539 13.853  1.00 18.29 ? 799 LEU A C   1 
ATOM   2982 O O   . LEU B 1 125 ? 21.531  -19.198 12.988  1.00 17.75 ? 799 LEU A O   1 
ATOM   2983 C CB  . LEU B 1 125 ? 22.857  -19.593 15.967  1.00 20.17 ? 799 LEU A CB  1 
ATOM   2984 C CG  . LEU B 1 125 ? 23.812  -20.526 16.733  1.00 21.48 ? 799 LEU A CG  1 
ATOM   2985 C CD1 . LEU B 1 125 ? 23.163  -20.951 18.083  1.00 25.81 ? 799 LEU A CD1 1 
ATOM   2986 C CD2 . LEU B 1 125 ? 24.188  -21.764 15.874  1.00 25.04 ? 799 LEU A CD2 1 
ATOM   2987 N N   . THR B 1 126 ? 21.691  -17.309 14.153  1.00 18.14 ? 800 THR A N   1 
ATOM   2988 C CA  . THR B 1 126 ? 20.632  -16.668 13.367  1.00 18.15 ? 800 THR A CA  1 
ATOM   2989 C C   . THR B 1 126 ? 20.978  -16.549 11.867  1.00 17.42 ? 800 THR A C   1 
ATOM   2990 O O   . THR B 1 126 ? 20.154  -16.843 10.998  1.00 17.78 ? 800 THR A O   1 
ATOM   2991 C CB  . THR B 1 126 ? 20.234  -15.300 13.988  1.00 18.63 ? 800 THR A CB  1 
ATOM   2992 O OG1 . THR B 1 126 ? 19.807  -15.511 15.344  1.00 19.02 ? 800 THR A OG1 1 
ATOM   2993 C CG2 . THR B 1 126 ? 19.119  -14.618 13.216  1.00 18.82 ? 800 THR A CG2 1 
ATOM   2994 N N   . MET B 1 127 ? 22.171  -16.087 11.561  1.00 17.40 ? 801 MET A N   1 
ATOM   2995 C CA  . MET B 1 127 ? 22.559  -15.941 10.148  1.00 18.55 ? 801 MET A CA  1 
ATOM   2996 C C   . MET B 1 127 ? 22.653  -17.311 9.462   1.00 17.92 ? 801 MET A C   1 
ATOM   2997 O O   . MET B 1 127 ? 22.296  -17.454 8.299   1.00 16.88 ? 801 MET A O   1 
ATOM   2998 C CB  . MET B 1 127 ? 23.903  -15.234 10.044  1.00 17.89 ? 801 MET A CB  1 
ATOM   2999 C CG  . MET B 1 127 ? 23.862  -13.787 10.525  1.00 17.32 ? 801 MET A CG  1 
ATOM   3000 S SD  . MET B 1 127 ? 25.378  -12.919 10.181  1.00 21.65 ? 801 MET A SD  1 
ATOM   3001 C CE  . MET B 1 127 ? 26.420  -13.317 11.535  1.00 23.89 ? 801 MET A CE  1 
ATOM   3002 N N   . TRP B 1 128 ? 23.086  -18.312 10.221  1.00 18.85 ? 802 TRP A N   1 
ATOM   3003 C CA  . TRP B 1 128 ? 23.277  -19.697 9.753   1.00 19.42 ? 802 TRP A CA  1 
ATOM   3004 C C   . TRP B 1 128 ? 22.008  -20.345 9.219   1.00 19.29 ? 802 TRP A C   1 
ATOM   3005 O O   . TRP B 1 128 ? 22.077  -21.315 8.481   1.00 19.28 ? 802 TRP A O   1 
ATOM   3006 C CB  . TRP B 1 128 ? 23.798  -20.541 10.901  1.00 20.26 ? 802 TRP A CB  1 
ATOM   3007 C CG  . TRP B 1 128 ? 25.004  -21.323 10.555  1.00 21.21 ? 802 TRP A CG  1 
ATOM   3008 C CD1 . TRP B 1 128 ? 25.198  -22.123 9.436   1.00 22.10 ? 802 TRP A CD1 1 
ATOM   3009 C CD2 . TRP B 1 128 ? 26.198  -21.416 11.329  1.00 22.63 ? 802 TRP A CD2 1 
ATOM   3010 N NE1 . TRP B 1 128 ? 26.446  -22.696 9.495   1.00 22.31 ? 802 TRP A NE1 1 
ATOM   3011 C CE2 . TRP B 1 128 ? 27.092  -22.260 10.625  1.00 21.96 ? 802 TRP A CE2 1 
ATOM   3012 C CE3 . TRP B 1 128 ? 26.615  -20.848 12.553  1.00 24.62 ? 802 TRP A CE3 1 
ATOM   3013 C CZ2 . TRP B 1 128 ? 28.382  -22.559 11.106  1.00 24.12 ? 802 TRP A CZ2 1 
ATOM   3014 C CZ3 . TRP B 1 128 ? 27.913  -21.141 13.030  1.00 22.42 ? 802 TRP A CZ3 1 
ATOM   3015 C CH2 . TRP B 1 128 ? 28.770  -21.995 12.311  1.00 23.24 ? 802 TRP A CH2 1 
ATOM   3016 N N   . GLN B 1 129 ? 20.839  -19.825 9.601   1.00 19.23 ? 803 GLN A N   1 
ATOM   3017 C CA  . GLN B 1 129 ? 19.575  -20.403 9.169   1.00 18.77 ? 803 GLN A CA  1 
ATOM   3018 C C   . GLN B 1 129 ? 19.444  -20.347 7.654   1.00 19.03 ? 803 GLN A C   1 
ATOM   3019 O O   . GLN B 1 129 ? 18.808  -21.212 7.027   1.00 18.41 ? 803 GLN A O   1 
ATOM   3020 C CB  . GLN B 1 129 ? 18.419  -19.649 9.811   1.00 19.06 ? 803 GLN A CB  1 
ATOM   3021 C CG  . GLN B 1 129 ? 18.437  -19.694 11.335  1.00 19.73 ? 803 GLN A CG  1 
ATOM   3022 C CD  . GLN B 1 129 ? 17.335  -18.859 11.908  1.00 26.01 ? 803 GLN A CD  1 
ATOM   3023 O OE1 . GLN B 1 129 ? 16.276  -19.368 12.272  1.00 28.61 ? 803 GLN A OE1 1 
ATOM   3024 N NE2 . GLN B 1 129 ? 17.554  -17.572 11.955  1.00 27.76 ? 803 GLN A NE2 1 
ATOM   3025 N N   . ILE B 1 130 ? 20.005  -19.289 7.064   1.00 18.25 ? 804 ILE A N   1 
ATOM   3026 C CA  . ILE B 1 130 ? 19.872  -19.090 5.635   1.00 17.19 ? 804 ILE A CA  1 
ATOM   3027 C C   . ILE B 1 130 ? 20.622  -20.210 4.846   1.00 17.85 ? 804 ILE A C   1 
ATOM   3028 O O   . ILE B 1 130 ? 19.997  -20.873 4.027   1.00 18.69 ? 804 ILE A O   1 
ATOM   3029 C CB  . ILE B 1 130 ? 20.294  -17.665 5.207   1.00 16.66 ? 804 ILE A CB  1 
ATOM   3030 C CG1 . ILE B 1 130 ? 19.376  -16.600 5.868   1.00 17.46 ? 804 ILE A CG1 1 
ATOM   3031 C CG2 . ILE B 1 130 ? 20.200  -17.524 3.680   1.00 15.98 ? 804 ILE A CG2 1 
ATOM   3032 C CD1 . ILE B 1 130 ? 19.791  -15.125 5.568   1.00 17.42 ? 804 ILE A CD1 1 
ATOM   3033 N N   . PRO B 1 131 ? 21.937  -20.403 5.062   1.00 18.10 ? 805 PRO A N   1 
ATOM   3034 C CA  . PRO B 1 131 ? 22.575  -21.522 4.285   1.00 18.87 ? 805 PRO A CA  1 
ATOM   3035 C C   . PRO B 1 131 ? 22.014  -22.911 4.615   1.00 20.00 ? 805 PRO A C   1 
ATOM   3036 O O   . PRO B 1 131 ? 21.992  -23.798 3.748   1.00 19.64 ? 805 PRO A O   1 
ATOM   3037 C CB  . PRO B 1 131 ? 24.061  -21.457 4.670   1.00 17.76 ? 805 PRO A CB  1 
ATOM   3038 C CG  . PRO B 1 131 ? 24.152  -20.576 5.863   1.00 17.44 ? 805 PRO A CG  1 
ATOM   3039 C CD  . PRO B 1 131 ? 22.929  -19.674 5.882   1.00 18.17 ? 805 PRO A CD  1 
ATOM   3040 N N   . GLN B 1 132 ? 21.574  -23.101 5.863   1.00 20.44 ? 806 GLN A N   1 
ATOM   3041 C CA  . GLN B 1 132 ? 20.891  -24.335 6.258   1.00 20.61 ? 806 GLN A CA  1 
ATOM   3042 C C   . GLN B 1 132 ? 19.670  -24.544 5.379   1.00 20.49 ? 806 GLN A C   1 
ATOM   3043 O O   . GLN B 1 132 ? 19.465  -25.653 4.874   1.00 20.58 ? 806 GLN A O   1 
ATOM   3044 C CB  . GLN B 1 132 ? 20.500  -24.296 7.738   1.00 20.22 ? 806 GLN A CB  1 
ATOM   3045 C CG  . GLN B 1 132 ? 21.736  -24.404 8.650   1.00 23.33 ? 806 GLN A CG  1 
ATOM   3046 C CD  . GLN B 1 132 ? 21.458  -24.166 10.145  1.00 25.89 ? 806 GLN A CD  1 
ATOM   3047 O OE1 . GLN B 1 132 ? 22.243  -24.622 10.991  1.00 34.12 ? 806 GLN A OE1 1 
ATOM   3048 N NE2 . GLN B 1 132 ? 20.348  -23.484 10.483  1.00 30.37 ? 806 GLN A NE2 1 
ATOM   3049 N N   . GLU B 1 133 ? 18.874  -23.494 5.158   1.00 18.80 ? 807 GLU A N   1 
ATOM   3050 C CA  . GLU B 1 133 ? 17.661  -23.614 4.296   1.00 19.10 ? 807 GLU A CA  1 
ATOM   3051 C C   . GLU B 1 133 ? 18.002  -23.809 2.832   1.00 17.62 ? 807 GLU A C   1 
ATOM   3052 O O   . GLU B 1 133 ? 17.283  -24.528 2.116   1.00 16.46 ? 807 GLU A O   1 
ATOM   3053 C CB  . GLU B 1 133 ? 16.750  -22.379 4.397   1.00 21.25 ? 807 GLU A CB  1 
ATOM   3054 C CG  . GLU B 1 133 ? 15.841  -22.309 5.602   1.00 25.30 ? 807 GLU A CG  1 
ATOM   3055 C CD  . GLU B 1 133 ? 14.899  -23.508 5.671   1.00 30.91 ? 807 GLU A CD  1 
ATOM   3056 O OE1 . GLU B 1 133 ? 14.050  -23.654 4.780   1.00 31.38 ? 807 GLU A OE1 1 
ATOM   3057 O OE2 . GLU B 1 133 ? 15.043  -24.312 6.609   1.00 31.69 ? 807 GLU A OE2 1 
ATOM   3058 N N   . PHE B 1 134 ? 19.061  -23.116 2.377   1.00 16.65 ? 808 PHE A N   1 
ATOM   3059 C CA  . PHE B 1 134 ? 19.606  -23.270 1.026   1.00 16.21 ? 808 PHE A CA  1 
ATOM   3060 C C   . PHE B 1 134 ? 20.008  -24.713 0.816   1.00 15.09 ? 808 PHE A C   1 
ATOM   3061 O O   . PHE B 1 134 ? 19.668  -25.282 -0.181  1.00 15.18 ? 808 PHE A O   1 
ATOM   3062 C CB  . PHE B 1 134 ? 20.848  -22.375 0.763   1.00 14.03 ? 808 PHE A CB  1 
ATOM   3063 C CG  . PHE B 1 134 ? 20.519  -20.924 0.561   1.00 16.64 ? 808 PHE A CG  1 
ATOM   3064 C CD1 . PHE B 1 134 ? 19.207  -20.471 0.593   1.00 13.05 ? 808 PHE A CD1 1 
ATOM   3065 C CD2 . PHE B 1 134 ? 21.529  -20.011 0.301   1.00 14.69 ? 808 PHE A CD2 1 
ATOM   3066 C CE1 . PHE B 1 134 ? 18.908  -19.085 0.413   1.00 15.61 ? 808 PHE A CE1 1 
ATOM   3067 C CE2 . PHE B 1 134 ? 21.240  -18.634 0.146   1.00 17.06 ? 808 PHE A CE2 1 
ATOM   3068 C CZ  . PHE B 1 134 ? 19.899  -18.193 0.185   1.00 14.19 ? 808 PHE A CZ  1 
ATOM   3069 N N   . VAL B 1 135 ? 20.744  -25.285 1.756   1.00 16.60 ? 809 VAL A N   1 
ATOM   3070 C CA  . VAL B 1 135 ? 21.091  -26.741 1.687   1.00 18.00 ? 809 VAL A CA  1 
ATOM   3071 C C   . VAL B 1 135 ? 19.817  -27.631 1.670   1.00 19.44 ? 809 VAL A C   1 
ATOM   3072 O O   . VAL B 1 135 ? 19.708  -28.571 0.852   1.00 19.73 ? 809 VAL A O   1 
ATOM   3073 C CB  . VAL B 1 135 ? 22.056  -27.171 2.860   1.00 18.61 ? 809 VAL A CB  1 
ATOM   3074 C CG1 . VAL B 1 135 ? 22.265  -28.675 2.894   1.00 21.03 ? 809 VAL A CG1 1 
ATOM   3075 C CG2 . VAL B 1 135 ? 23.437  -26.473 2.804   1.00 18.20 ? 809 VAL A CG2 1 
ATOM   3076 N N   . LYS B 1 136 ? 18.862  -27.363 2.570   1.00 19.61 ? 810 LYS A N   1 
ATOM   3077 C CA  . LYS B 1 136 ? 17.666  -28.187 2.649   1.00 22.21 ? 810 LYS A CA  1 
ATOM   3078 C C   . LYS B 1 136 ? 16.845  -28.130 1.385   1.00 21.06 ? 810 LYS A C   1 
ATOM   3079 O O   . LYS B 1 136 ? 16.384  -29.170 0.890   1.00 19.28 ? 810 LYS A O   1 
ATOM   3080 C CB  . LYS B 1 136 ? 16.739  -27.771 3.816   1.00 22.63 ? 810 LYS A CB  1 
ATOM   3081 C CG  . LYS B 1 136 ? 17.169  -28.205 5.213   1.00 25.33 ? 810 LYS A CG  1 
ATOM   3082 C CD  . LYS B 1 136 ? 15.975  -27.934 6.157   1.00 27.72 ? 810 LYS A CD  1 
ATOM   3083 C CE  . LYS B 1 136 ? 16.437  -27.499 7.533   1.00 36.39 ? 810 LYS A CE  1 
ATOM   3084 N NZ  . LYS B 1 136 ? 15.258  -27.078 8.341   1.00 37.88 ? 810 LYS A NZ  1 
ATOM   3085 N N   . LEU B 1 137 ? 16.621  -26.907 0.883   1.00 20.62 ? 811 LEU A N   1 
ATOM   3086 C CA  . LEU B 1 137 ? 15.743  -26.716 -0.277  1.00 19.58 ? 811 LEU A CA  1 
ATOM   3087 C C   . LEU B 1 137 ? 16.476  -26.945 -1.611  1.00 19.52 ? 811 LEU A C   1 
ATOM   3088 O O   . LEU B 1 137 ? 15.851  -26.979 -2.695  1.00 19.06 ? 811 LEU A O   1 
ATOM   3089 C CB  . LEU B 1 137 ? 15.087  -25.329 -0.254  1.00 19.37 ? 811 LEU A CB  1 
ATOM   3090 C CG  . LEU B 1 137 ? 14.054  -25.027 0.842   1.00 19.21 ? 811 LEU A CG  1 
ATOM   3091 C CD1 . LEU B 1 137 ? 13.677  -23.539 0.889   1.00 19.13 ? 811 LEU A CD1 1 
ATOM   3092 C CD2 . LEU B 1 137 ? 12.788  -25.882 0.709   1.00 23.33 ? 811 LEU A CD2 1 
ATOM   3093 N N   . GLN B 1 138 ? 17.792  -27.089 -1.520  1.00 18.75 ? 812 GLN A N   1 
ATOM   3094 C CA  . GLN B 1 138 ? 18.662  -27.148 -2.694  1.00 18.92 ? 812 GLN A CA  1 
ATOM   3095 C C   . GLN B 1 138 ? 18.396  -25.968 -3.631  1.00 18.18 ? 812 GLN A C   1 
ATOM   3096 O O   . GLN B 1 138 ? 18.195  -26.145 -4.817  1.00 19.61 ? 812 GLN A O   1 
ATOM   3097 C CB  . GLN B 1 138 ? 18.600  -28.528 -3.394  1.00 17.54 ? 812 GLN A CB  1 
ATOM   3098 C CG  . GLN B 1 138 ? 18.937  -29.668 -2.421  1.00 19.38 ? 812 GLN A CG  1 
ATOM   3099 C CD  . GLN B 1 138 ? 19.093  -31.065 -3.101  1.00 21.95 ? 812 GLN A CD  1 
ATOM   3100 O OE1 . GLN B 1 138 ? 19.764  -31.963 -2.576  1.00 24.46 ? 812 GLN A OE1 1 
ATOM   3101 N NE2 . GLN B 1 138 ? 18.462  -31.237 -4.230  1.00 20.94 ? 812 GLN A NE2 1 
ATOM   3102 N N   . VAL B 1 139 ? 18.408  -24.755 -3.085  1.00 16.94 ? 813 VAL A N   1 
ATOM   3103 C CA  . VAL B 1 139 ? 18.259  -23.542 -3.906  1.00 17.21 ? 813 VAL A CA  1 
ATOM   3104 C C   . VAL B 1 139 ? 19.263  -23.468 -5.094  1.00 16.34 ? 813 VAL A C   1 
ATOM   3105 O O   . VAL B 1 139 ? 20.463  -23.639 -4.903  1.00 17.27 ? 813 VAL A O   1 
ATOM   3106 C CB  . VAL B 1 139 ? 18.387  -22.293 -2.985  1.00 16.21 ? 813 VAL A CB  1 
ATOM   3107 C CG1 . VAL B 1 139 ? 18.383  -20.947 -3.789  1.00 18.30 ? 813 VAL A CG1 1 
ATOM   3108 C CG2 . VAL B 1 139 ? 17.313  -22.347 -1.900  1.00 16.35 ? 813 VAL A CG2 1 
ATOM   3109 N N   . SER B 1 140 ? 18.774  -23.180 -6.304  1.00 17.13 ? 814 SER A N   1 
ATOM   3110 C CA  . SER B 1 140 ? 19.627  -23.074 -7.477  1.00 16.53 ? 814 SER A CA  1 
ATOM   3111 C C   . SER B 1 140 ? 20.212  -21.648 -7.609  1.00 17.83 ? 814 SER A C   1 
ATOM   3112 O O   . SER B 1 140 ? 19.648  -20.690 -7.060  1.00 17.02 ? 814 SER A O   1 
ATOM   3113 C CB  . SER B 1 140 ? 18.825  -23.421 -8.756  1.00 17.35 ? 814 SER A CB  1 
ATOM   3114 O OG  . SER B 1 140 ? 17.827  -22.452 -8.967  1.00 15.38 ? 814 SER A OG  1 
ATOM   3115 N N   . GLN B 1 141 ? 21.317  -21.491 -8.342  1.00 18.25 ? 815 GLN A N   1 
ATOM   3116 C CA  . GLN B 1 141 ? 21.805  -20.134 -8.619  1.00 19.87 ? 815 GLN A CA  1 
ATOM   3117 C C   . GLN B 1 141 ? 20.746  -19.259 -9.237  1.00 18.80 ? 815 GLN A C   1 
ATOM   3118 O O   . GLN B 1 141 ? 20.643  -18.081 -8.889  1.00 18.66 ? 815 GLN A O   1 
ATOM   3119 C CB  . GLN B 1 141 ? 23.006  -20.115 -9.556  1.00 20.19 ? 815 GLN A CB  1 
ATOM   3120 C CG  . GLN B 1 141 ? 23.859  -18.799 -9.452  1.00 23.67 ? 815 GLN A CG  1 
ATOM   3121 C CD  . GLN B 1 141 ? 24.789  -18.613 -10.647 1.00 23.60 ? 815 GLN A CD  1 
ATOM   3122 O OE1 . GLN B 1 141 ? 25.370  -17.536 -10.841 1.00 33.54 ? 815 GLN A OE1 1 
ATOM   3123 N NE2 . GLN B 1 141 ? 24.908  -19.641 -11.472 1.00 27.85 ? 815 GLN A NE2 1 
ATOM   3124 N N   . GLU B 1 142 ? 19.966  -19.815 -10.156 1.00 17.61 ? 816 GLU A N   1 
ATOM   3125 C CA  . GLU B 1 142 ? 18.926  -19.025 -10.851 1.00 18.57 ? 816 GLU A CA  1 
ATOM   3126 C C   . GLU B 1 142 ? 17.826  -18.531 -9.910  1.00 17.94 ? 816 GLU A C   1 
ATOM   3127 O O   . GLU B 1 142 ? 17.411  -17.368 -10.003 1.00 17.36 ? 816 GLU A O   1 
ATOM   3128 C CB  . GLU B 1 142 ? 18.357  -19.783 -12.053 1.00 18.96 ? 816 GLU A CB  1 
ATOM   3129 C CG  . GLU B 1 142 ? 19.433  -20.156 -13.087 1.00 20.52 ? 816 GLU A CG  1 
ATOM   3130 C CD  . GLU B 1 142 ? 20.102  -21.515 -12.849 1.00 25.76 ? 816 GLU A CD  1 
ATOM   3131 O OE1 . GLU B 1 142 ? 20.036  -22.078 -11.732 1.00 21.49 ? 816 GLU A OE1 1 
ATOM   3132 O OE2 . GLU B 1 142 ? 20.731  -22.005 -13.801 1.00 28.33 ? 816 GLU A OE2 1 
ATOM   3133 N N   . GLU B 1 143 ? 17.393  -19.385 -8.975  1.00 16.65 ? 817 GLU A N   1 
ATOM   3134 C CA  . GLU B 1 143 ? 16.448  -18.969 -7.931  1.00 16.38 ? 817 GLU A CA  1 
ATOM   3135 C C   . GLU B 1 143 ? 17.084  -17.898 -7.042  1.00 15.31 ? 817 GLU A C   1 
ATOM   3136 O O   . GLU B 1 143 ? 16.445  -16.901 -6.751  1.00 14.55 ? 817 GLU A O   1 
ATOM   3137 C CB  . GLU B 1 143 ? 15.974  -20.165 -7.067  1.00 15.35 ? 817 GLU A CB  1 
ATOM   3138 C CG  . GLU B 1 143 ? 15.162  -21.235 -7.901  1.00 17.87 ? 817 GLU A CG  1 
ATOM   3139 C CD  . GLU B 1 143 ? 14.983  -22.551 -7.159  1.00 18.43 ? 817 GLU A CD  1 
ATOM   3140 O OE1 . GLU B 1 143 ? 15.830  -22.898 -6.283  1.00 19.42 ? 817 GLU A OE1 1 
ATOM   3141 O OE2 . GLU B 1 143 ? 13.966  -23.219 -7.447  1.00 23.39 ? 817 GLU A OE2 1 
ATOM   3142 N N   . PHE B 1 144 ? 18.321  -18.148 -6.602  1.00 14.92 ? 818 PHE A N   1 
ATOM   3143 C CA  . PHE B 1 144 ? 19.021  -17.276 -5.671  1.00 14.74 ? 818 PHE A CA  1 
ATOM   3144 C C   . PHE B 1 144 ? 19.107  -15.840 -6.251  1.00 14.41 ? 818 PHE A C   1 
ATOM   3145 O O   . PHE B 1 144 ? 18.860  -14.847 -5.527  1.00 12.67 ? 818 PHE A O   1 
ATOM   3146 C CB  . PHE B 1 144 ? 20.445  -17.808 -5.398  1.00 15.04 ? 818 PHE A CB  1 
ATOM   3147 C CG  . PHE B 1 144 ? 21.382  -16.760 -4.775  1.00 16.43 ? 818 PHE A CG  1 
ATOM   3148 C CD1 . PHE B 1 144 ? 21.252  -16.412 -3.417  1.00 13.37 ? 818 PHE A CD1 1 
ATOM   3149 C CD2 . PHE B 1 144 ? 22.380  -16.134 -5.559  1.00 15.58 ? 818 PHE A CD2 1 
ATOM   3150 C CE1 . PHE B 1 144 ? 22.096  -15.451 -2.831  1.00 15.28 ? 818 PHE A CE1 1 
ATOM   3151 C CE2 . PHE B 1 144 ? 23.218  -15.136 -5.004  1.00 15.14 ? 818 PHE A CE2 1 
ATOM   3152 C CZ  . PHE B 1 144 ? 23.086  -14.794 -3.632  1.00 14.18 ? 818 PHE A CZ  1 
ATOM   3153 N N   . LEU B 1 145 ? 19.455  -15.754 -7.543  1.00 13.02 ? 819 LEU A N   1 
ATOM   3154 C CA  . LEU B 1 145 ? 19.708  -14.448 -8.195  1.00 14.22 ? 819 LEU A CA  1 
ATOM   3155 C C   . LEU B 1 145 ? 18.428  -13.616 -8.285  1.00 13.62 ? 819 LEU A C   1 
ATOM   3156 O O   . LEU B 1 145 ? 18.476  -12.397 -8.063  1.00 14.97 ? 819 LEU A O   1 
ATOM   3157 C CB  . LEU B 1 145 ? 20.369  -14.579 -9.581  1.00 13.28 ? 819 LEU A CB  1 
ATOM   3158 C CG  . LEU B 1 145 ? 21.788  -15.173 -9.588  1.00 14.64 ? 819 LEU A CG  1 
ATOM   3159 C CD1 . LEU B 1 145 ? 22.132  -15.647 -10.952 1.00 17.40 ? 819 LEU A CD1 1 
ATOM   3160 C CD2 . LEU B 1 145 ? 22.858  -14.197 -9.081  1.00 13.88 ? 819 LEU A CD2 1 
ATOM   3161 N N   . CYS B 1 146 ? 17.308  -14.266 -8.595  1.00 13.95 ? 820 CYS A N   1 
ATOM   3162 C CA  . CYS B 1 146 ? 15.984  -13.623 -8.603  1.00 14.22 ? 820 CYS A CA  1 
ATOM   3163 C C   . CYS B 1 146 ? 15.516  -13.231 -7.221  1.00 13.95 ? 820 CYS A C   1 
ATOM   3164 O O   . CYS B 1 146 ? 15.029  -12.109 -7.035  1.00 12.77 ? 820 CYS A O   1 
ATOM   3165 C CB  . CYS B 1 146 ? 14.930  -14.510 -9.277  1.00 14.46 ? 820 CYS A CB  1 
ATOM   3166 S SG  . CYS B 1 146 ? 15.295  -14.848 -11.043 1.00 16.96 ? 820 CYS A SG  1 
ATOM   3167 N N   . MET B 1 147 ? 15.665  -14.154 -6.255  1.00 14.44 ? 821 MET A N   1 
ATOM   3168 C CA  . MET B 1 147 ? 15.353  -13.866 -4.830  1.00 14.40 ? 821 MET A CA  1 
ATOM   3169 C C   . MET B 1 147 ? 16.116  -12.658 -4.296  1.00 14.35 ? 821 MET A C   1 
ATOM   3170 O O   . MET B 1 147 ? 15.580  -11.853 -3.559  1.00 14.03 ? 821 MET A O   1 
ATOM   3171 C CB  . MET B 1 147 ? 15.636  -15.084 -3.958  1.00 14.34 ? 821 MET A CB  1 
ATOM   3172 C CG  . MET B 1 147 ? 14.629  -16.232 -4.198  1.00 15.41 ? 821 MET A CG  1 
ATOM   3173 S SD  . MET B 1 147 ? 15.251  -17.728 -3.404  1.00 18.06 ? 821 MET A SD  1 
ATOM   3174 C CE  . MET B 1 147 ? 14.828  -17.369 -1.753  1.00 12.66 ? 821 MET A CE  1 
ATOM   3175 N N   . LYS B 1 148 ? 17.372  -12.536 -4.681  1.00 14.63 ? 822 LYS A N   1 
ATOM   3176 C CA  . LYS B 1 148 ? 18.216  -11.473 -4.151  1.00 14.77 ? 822 LYS A CA  1 
ATOM   3177 C C   . LYS B 1 148 ? 17.777  -10.113 -4.673  1.00 15.54 ? 822 LYS A C   1 
ATOM   3178 O O   . LYS B 1 148 ? 17.854  -9.139  -3.941  1.00 15.67 ? 822 LYS A O   1 
ATOM   3179 C CB  . LYS B 1 148 ? 19.676  -11.765 -4.473  1.00 14.65 ? 822 LYS A CB  1 
ATOM   3180 C CG  . LYS B 1 148 ? 20.653  -10.711 -3.877  1.00 17.40 ? 822 LYS A CG  1 
ATOM   3181 C CD  . LYS B 1 148 ? 22.064  -11.304 -3.740  1.00 16.51 ? 822 LYS A CD  1 
ATOM   3182 C CE  . LYS B 1 148 ? 22.733  -11.546 -5.116  1.00 22.07 ? 822 LYS A CE  1 
ATOM   3183 N NZ  . LYS B 1 148 ? 22.954  -10.279 -5.893  1.00 21.90 ? 822 LYS A NZ  1 
ATOM   3184 N N   . VAL B 1 149 ? 17.315  -10.032 -5.929  1.00 14.92 ? 823 VAL A N   1 
ATOM   3185 C CA  . VAL B 1 149 ? 16.664  -8.807  -6.412  1.00 14.04 ? 823 VAL A CA  1 
ATOM   3186 C C   . VAL B 1 149 ? 15.365  -8.476  -5.662  1.00 13.62 ? 823 VAL A C   1 
ATOM   3187 O O   . VAL B 1 149 ? 15.098  -7.333  -5.336  1.00 11.56 ? 823 VAL A O   1 
ATOM   3188 C CB  . VAL B 1 149 ? 16.363  -8.857  -7.914  1.00 14.49 ? 823 VAL A CB  1 
ATOM   3189 C CG1 . VAL B 1 149 ? 15.728  -7.489  -8.376  1.00 12.70 ? 823 VAL A CG1 1 
ATOM   3190 C CG2 . VAL B 1 149 ? 17.623  -9.168  -8.706  1.00 13.13 ? 823 VAL A CG2 1 
ATOM   3191 N N   . LEU B 1 150 ? 14.562  -9.479  -5.360  1.00 13.19 ? 824 LEU A N   1 
ATOM   3192 C CA  . LEU B 1 150 ? 13.333  -9.245  -4.608  1.00 13.75 ? 824 LEU A CA  1 
ATOM   3193 C C   . LEU B 1 150 ? 13.619  -8.770  -3.204  1.00 13.88 ? 824 LEU A C   1 
ATOM   3194 O O   . LEU B 1 150 ? 12.853  -7.964  -2.622  1.00 14.17 ? 824 LEU A O   1 
ATOM   3195 C CB  . LEU B 1 150 ? 12.481  -10.537 -4.591  1.00 14.27 ? 824 LEU A CB  1 
ATOM   3196 C CG  . LEU B 1 150 ? 11.880  -10.866 -5.963  1.00 14.65 ? 824 LEU A CG  1 
ATOM   3197 C CD1 . LEU B 1 150 ? 11.208  -12.196 -5.867  1.00 14.82 ? 824 LEU A CD1 1 
ATOM   3198 C CD2 . LEU B 1 150 ? 10.872  -9.780  -6.394  1.00 13.78 ? 824 LEU A CD2 1 
ATOM   3199 N N   . LEU B 1 151 ? 14.731  -9.237  -2.650  1.00 13.99 ? 825 LEU A N   1 
ATOM   3200 C CA  . LEU B 1 151 ? 15.205  -8.681  -1.341  1.00 15.27 ? 825 LEU A CA  1 
ATOM   3201 C C   . LEU B 1 151 ? 15.520  -7.218  -1.365  1.00 14.29 ? 825 LEU A C   1 
ATOM   3202 O O   . LEU B 1 151 ? 15.162  -6.497  -0.424  1.00 13.81 ? 825 LEU A O   1 
ATOM   3203 C CB  . LEU B 1 151 ? 16.463  -9.367  -0.829  1.00 14.49 ? 825 LEU A CB  1 
ATOM   3204 C CG  . LEU B 1 151 ? 16.372  -10.480 0.178   1.00 20.14 ? 825 LEU A CG  1 
ATOM   3205 C CD1 . LEU B 1 151 ? 17.802  -10.647 0.728   1.00 15.87 ? 825 LEU A CD1 1 
ATOM   3206 C CD2 . LEU B 1 151 ? 15.305  -10.273 1.313   1.00 18.13 ? 825 LEU A CD2 1 
ATOM   3207 N N   . LEU B 1 152 ? 16.236  -6.791  -2.412  1.00 13.92 ? 826 LEU A N   1 
ATOM   3208 C CA  . LEU B 1 152 ? 16.514  -5.359  -2.624  1.00 13.65 ? 826 LEU A CA  1 
ATOM   3209 C C   . LEU B 1 152 ? 15.198  -4.567  -2.613  1.00 13.04 ? 826 LEU A C   1 
ATOM   3210 O O   . LEU B 1 152 ? 15.127  -3.425  -2.114  1.00 13.26 ? 826 LEU A O   1 
ATOM   3211 C CB  . LEU B 1 152 ? 17.235  -5.168  -3.964  1.00 12.02 ? 826 LEU A CB  1 
ATOM   3212 C CG  . LEU B 1 152 ? 17.428  -3.756  -4.459  1.00 16.00 ? 826 LEU A CG  1 
ATOM   3213 C CD1 . LEU B 1 152 ? 18.330  -2.832  -3.551  1.00 12.81 ? 826 LEU A CD1 1 
ATOM   3214 C CD2 . LEU B 1 152 ? 17.866  -3.792  -5.984  1.00 13.26 ? 826 LEU A CD2 1 
ATOM   3215 N N   . LEU B 1 153 ? 14.158  -5.200  -3.153  1.00 13.18 ? 827 LEU A N   1 
ATOM   3216 C CA  . LEU B 1 153 ? 12.862  -4.568  -3.327  1.00 14.21 ? 827 LEU A CA  1 
ATOM   3217 C C   . LEU B 1 153 ? 11.863  -4.918  -2.262  1.00 14.08 ? 827 LEU A C   1 
ATOM   3218 O O   . LEU B 1 153 ? 10.682  -4.791  -2.523  1.00 15.90 ? 827 LEU A O   1 
ATOM   3219 C CB  . LEU B 1 153 ? 12.247  -4.942  -4.717  1.00 13.02 ? 827 LEU A CB  1 
ATOM   3220 C CG  . LEU B 1 153 ? 13.172  -4.664  -5.914  1.00 15.53 ? 827 LEU A CG  1 
ATOM   3221 C CD1 . LEU B 1 153 ? 12.586  -5.223  -7.247  1.00 13.75 ? 827 LEU A CD1 1 
ATOM   3222 C CD2 . LEU B 1 153 ? 13.556  -3.147  -6.034  1.00 11.67 ? 827 LEU A CD2 1 
ATOM   3223 N N   . ASN B 1 154 ? 12.306  -5.343  -1.077  1.00 13.38 ? 828 ASN A N   1 
ATOM   3224 C CA  . ASN B 1 154 ? 11.359  -6.000  -0.174  1.00 15.04 ? 828 ASN A CA  1 
ATOM   3225 C C   . ASN B 1 154 ? 10.882  -5.143  1.039   1.00 14.33 ? 828 ASN A C   1 
ATOM   3226 O O   . ASN B 1 154 ? 10.176  -5.642  1.898   1.00 14.40 ? 828 ASN A O   1 
ATOM   3227 C CB  . ASN B 1 154 ? 12.000  -7.315  0.314   1.00 15.42 ? 828 ASN A CB  1 
ATOM   3228 C CG  . ASN B 1 154 ? 11.005  -8.451  0.427   1.00 19.66 ? 828 ASN A CG  1 
ATOM   3229 O OD1 . ASN B 1 154 ? 10.013  -8.488  -0.308  1.00 23.24 ? 828 ASN A OD1 1 
ATOM   3230 N ND2 . ASN B 1 154 ? 11.273  -9.399  1.352   1.00 22.76 ? 828 ASN A ND2 1 
ATOM   3231 N N   . THR B 1 155 ? 11.315  -3.891  1.104   1.00 13.23 ? 829 THR A N   1 
ATOM   3232 C CA  . THR B 1 155 ? 10.861  -2.920  2.106   1.00 15.55 ? 829 THR A CA  1 
ATOM   3233 C C   . THR B 1 155 ? 10.736  -1.552  1.438   1.00 16.41 ? 829 THR A C   1 
ATOM   3234 O O   . THR B 1 155 ? 11.604  -1.177  0.614   1.00 15.66 ? 829 THR A O   1 
ATOM   3235 C CB  . THR B 1 155 ? 11.879  -2.776  3.303   1.00 15.34 ? 829 THR A CB  1 
ATOM   3236 O OG1 . THR B 1 155 ? 12.174  -4.066  3.830   1.00 14.96 ? 829 THR A OG1 1 
ATOM   3237 C CG2 . THR B 1 155 ? 11.289  -1.928  4.405   1.00 16.54 ? 829 THR A CG2 1 
ATOM   3238 N N   . ILE B 1 156 ? 9.672   -0.817  1.761   1.00 16.24 ? 830 ILE A N   1 
ATOM   3239 C CA  . ILE B 1 156 ? 9.487   0.545   1.242   1.00 18.04 ? 830 ILE A CA  1 
ATOM   3240 C C   . ILE B 1 156 ? 9.083   1.530   2.375   1.00 17.98 ? 830 ILE A C   1 
ATOM   3241 O O   . ILE B 1 156 ? 8.724   1.081   3.458   1.00 19.51 ? 830 ILE A O   1 
ATOM   3242 C CB  . ILE B 1 156 ? 8.492   0.603   0.014   1.00 18.00 ? 830 ILE A CB  1 
ATOM   3243 C CG1 . ILE B 1 156 ? 7.038   0.366   0.460   1.00 18.36 ? 830 ILE A CG1 1 
ATOM   3244 C CG2 . ILE B 1 156 ? 8.971   -0.342  -1.128  1.00 16.64 ? 830 ILE A CG2 1 
ATOM   3245 C CD1 . ILE B 1 156 ? 6.048   0.169   -0.651  1.00 18.87 ? 830 ILE A CD1 1 
ATOM   3246 N N   . PRO B 1 157 ? 9.185   2.856   2.150   1.00 18.45 ? 831 PRO A N   1 
ATOM   3247 C CA  . PRO B 1 157 ? 8.800   3.792   3.215   1.00 19.51 ? 831 PRO A CA  1 
ATOM   3248 C C   . PRO B 1 157 ? 7.329   3.670   3.487   1.00 20.71 ? 831 PRO A C   1 
ATOM   3249 O O   . PRO B 1 157 ? 6.574   3.200   2.642   1.00 20.60 ? 831 PRO A O   1 
ATOM   3250 C CB  . PRO B 1 157 ? 9.064   5.173   2.609   1.00 19.17 ? 831 PRO A CB  1 
ATOM   3251 C CG  . PRO B 1 157 ? 10.140  4.906   1.540   1.00 20.10 ? 831 PRO A CG  1 
ATOM   3252 C CD  . PRO B 1 157 ? 9.696   3.563   0.969   1.00 17.85 ? 831 PRO A CD  1 
ATOM   3253 N N   . LEU B 1 158 ? 6.909   4.118   4.657   1.00 22.27 ? 832 LEU A N   1 
ATOM   3254 C CA  . LEU B 1 158 ? 5.466   4.098   4.984   1.00 23.69 ? 832 LEU A CA  1 
ATOM   3255 C C   . LEU B 1 158 ? 4.574   4.821   3.936   1.00 24.75 ? 832 LEU A C   1 
ATOM   3256 O O   . LEU B 1 158 ? 3.496   4.341   3.595   1.00 24.98 ? 832 LEU A O   1 
ATOM   3257 C CB  . LEU B 1 158 ? 5.265   4.639   6.404   1.00 24.52 ? 832 LEU A CB  1 
ATOM   3258 C CG  . LEU B 1 158 ? 5.722   3.758   7.587   1.00 22.76 ? 832 LEU A CG  1 
ATOM   3259 C CD1 . LEU B 1 158 ? 5.639   4.597   8.875   1.00 26.43 ? 832 LEU A CD1 1 
ATOM   3260 C CD2 . LEU B 1 158 ? 4.857   2.520   7.718   1.00 24.57 ? 832 LEU A CD2 1 
ATOM   3261 N N   . GLU B 1 159 ? 5.064   5.945   3.404   1.00 25.34 ? 833 GLU A N   1 
ATOM   3262 C CA  . GLU B 1 159 ? 4.371   6.726   2.387   1.00 26.01 ? 833 GLU A CA  1 
ATOM   3263 C C   . GLU B 1 159 ? 4.597   6.152   0.956   1.00 25.72 ? 833 GLU A C   1 
ATOM   3264 O O   . GLU B 1 159 ? 4.052   6.679   -0.043  1.00 26.56 ? 833 GLU A O   1 
ATOM   3265 C CB  . GLU B 1 159 ? 4.802   8.207   2.487   1.00 26.90 ? 833 GLU A CB  1 
ATOM   3266 C CG  . GLU B 1 159 ? 6.302   8.454   2.187   1.00 29.46 ? 833 GLU A CG  1 
ATOM   3267 C CD  . GLU B 1 159 ? 7.236   8.211   3.398   1.00 32.73 ? 833 GLU A CD  1 
ATOM   3268 O OE1 . GLU B 1 159 ? 6.882   7.467   4.320   1.00 32.00 ? 833 GLU A OE1 1 
ATOM   3269 O OE2 . GLU B 1 159 ? 8.367   8.746   3.408   1.00 36.49 ? 833 GLU A OE2 1 
ATOM   3270 N N   . GLY B 1 160 ? 5.356   5.061   0.865   1.00 22.78 ? 834 GLY A N   1 
ATOM   3271 C CA  . GLY B 1 160 ? 5.658   4.452   -0.407  1.00 21.83 ? 834 GLY A CA  1 
ATOM   3272 C C   . GLY B 1 160 ? 6.782   5.229   -1.099  1.00 21.49 ? 834 GLY A C   1 
ATOM   3273 O O   . GLY B 1 160 ? 7.334   6.184   -0.550  1.00 20.22 ? 834 GLY A O   1 
ATOM   3274 N N   . LEU B 1 161 ? 7.104   4.811   -2.315  1.00 21.20 ? 835 LEU A N   1 
ATOM   3275 C CA  . LEU B 1 161 ? 8.220   5.359   -3.038  1.00 21.29 ? 835 LEU A CA  1 
ATOM   3276 C C   . LEU B 1 161 ? 7.742   6.492   -3.962  1.00 22.08 ? 835 LEU A C   1 
ATOM   3277 O O   . LEU B 1 161 ? 6.533   6.605   -4.255  1.00 21.01 ? 835 LEU A O   1 
ATOM   3278 C CB  . LEU B 1 161 ? 8.822   4.230   -3.858  1.00 21.20 ? 835 LEU A CB  1 
ATOM   3279 C CG  . LEU B 1 161 ? 9.587   3.126   -3.092  1.00 20.66 ? 835 LEU A CG  1 
ATOM   3280 C CD1 . LEU B 1 161 ? 9.921   2.025   -4.041  1.00 19.26 ? 835 LEU A CD1 1 
ATOM   3281 C CD2 . LEU B 1 161 ? 10.863  3.692   -2.456  1.00 19.93 ? 835 LEU A CD2 1 
ATOM   3282 N N   . ARG B 1 162 ? 8.692   7.294   -4.440  1.00 22.35 ? 836 ARG A N   1 
ATOM   3283 C CA  . ARG B 1 162 ? 8.384   8.334   -5.441  1.00 23.69 ? 836 ARG A CA  1 
ATOM   3284 C C   . ARG B 1 162 ? 7.968   7.686   -6.772  1.00 22.70 ? 836 ARG A C   1 
ATOM   3285 O O   . ARG B 1 162 ? 6.926   8.021   -7.338  1.00 22.18 ? 836 ARG A O   1 
ATOM   3286 C CB  . ARG B 1 162 ? 9.559   9.309   -5.570  1.00 23.90 ? 836 ARG A CB  1 
ATOM   3287 C CG  . ARG B 1 162 ? 9.736   10.113  -4.290  1.00 28.25 ? 836 ARG A CG  1 
ATOM   3288 C CD  . ARG B 1 162 ? 10.853  11.122  -4.365  1.00 36.84 ? 836 ARG A CD  1 
ATOM   3289 N NE  . ARG B 1 162 ? 11.279  11.462  -3.001  1.00 44.55 ? 836 ARG A NE  1 
ATOM   3290 C CZ  . ARG B 1 162 ? 11.569  12.693  -2.579  1.00 48.78 ? 836 ARG A CZ  1 
ATOM   3291 N NH1 . ARG B 1 162 ? 11.939  12.897  -1.307  1.00 48.19 ? 836 ARG A NH1 1 
ATOM   3292 N NH2 . ARG B 1 162 ? 11.496  13.718  -3.432  1.00 50.78 ? 836 ARG A NH2 1 
ATOM   3293 N N   . SER B 1 163 ? 8.744   6.694   -7.216  1.00 21.29 ? 837 SER A N   1 
ATOM   3294 C CA  . SER B 1 163 ? 8.434   5.919   -8.418  1.00 19.86 ? 837 SER A CA  1 
ATOM   3295 C C   . SER B 1 163 ? 7.721   4.628   -8.044  1.00 19.58 ? 837 SER A C   1 
ATOM   3296 O O   . SER B 1 163 ? 8.201   3.538   -8.370  1.00 17.93 ? 837 SER A O   1 
ATOM   3297 C CB  . SER B 1 163 ? 9.724   5.589   -9.178  1.00 20.26 ? 837 SER A CB  1 
ATOM   3298 O OG  . SER B 1 163 ? 10.475  6.783   -9.436  1.00 22.36 ? 837 SER A OG  1 
ATOM   3299 N N   . GLN B 1 164 ? 6.588   4.745   -7.346  1.00 19.63 ? 838 GLN A N   1 
ATOM   3300 C CA  . GLN B 1 164 ? 5.842   3.578   -6.883  1.00 19.91 ? 838 GLN A CA  1 
ATOM   3301 C C   . GLN B 1 164 ? 5.359   2.658   -8.018  1.00 19.93 ? 838 GLN A C   1 
ATOM   3302 O O   . GLN B 1 164 ? 5.500   1.446   -7.921  1.00 18.46 ? 838 GLN A O   1 
ATOM   3303 C CB  . GLN B 1 164 ? 4.649   3.991   -5.984  1.00 20.58 ? 838 GLN A CB  1 
ATOM   3304 C CG  . GLN B 1 164 ? 3.968   2.792   -5.258  1.00 23.05 ? 838 GLN A CG  1 
ATOM   3305 C CD  . GLN B 1 164 ? 4.857   2.142   -4.171  1.00 22.73 ? 838 GLN A CD  1 
ATOM   3306 O OE1 . GLN B 1 164 ? 5.671   2.800   -3.550  1.00 23.84 ? 838 GLN A OE1 1 
ATOM   3307 N NE2 . GLN B 1 164 ? 4.675   0.852   -3.943  1.00 23.88 ? 838 GLN A NE2 1 
ATOM   3308 N N   . THR B 1 165 ? 4.809   3.243   -9.092  1.00 19.81 ? 839 THR A N   1 
ATOM   3309 C CA  . THR B 1 165 ? 4.347   2.472   -10.243 1.00 20.10 ? 839 THR A CA  1 
ATOM   3310 C C   . THR B 1 165 ? 5.458   1.695   -10.895 1.00 18.49 ? 839 THR A C   1 
ATOM   3311 O O   . THR B 1 165 ? 5.299   0.510   -11.155 1.00 18.72 ? 839 THR A O   1 
ATOM   3312 C CB  . THR B 1 165 ? 3.629   3.335   -11.309 1.00 21.01 ? 839 THR A CB  1 
ATOM   3313 O OG1 . THR B 1 165 ? 2.525   3.995   -10.696 1.00 25.21 ? 839 THR A OG1 1 
ATOM   3314 C CG2 . THR B 1 165 ? 3.077   2.466   -12.445 1.00 21.76 ? 839 THR A CG2 1 
ATOM   3315 N N   . GLN B 1 166 ? 6.565   2.356   -11.170 1.00 17.03 ? 840 GLN A N   1 
ATOM   3316 C CA  . GLN B 1 166 ? 7.719   1.686   -11.744 1.00 18.74 ? 840 GLN A CA  1 
ATOM   3317 C C   . GLN B 1 166 ? 8.263   0.597   -10.792 1.00 18.27 ? 840 GLN A C   1 
ATOM   3318 O O   . GLN B 1 166 ? 8.631   -0.471  -11.239 1.00 18.96 ? 840 GLN A O   1 
ATOM   3319 C CB  . GLN B 1 166 ? 8.810   2.695   -12.010 1.00 19.90 ? 840 GLN A CB  1 
ATOM   3320 C CG  . GLN B 1 166 ? 10.053  2.103   -12.749 1.00 27.36 ? 840 GLN A CG  1 
ATOM   3321 C CD  . GLN B 1 166 ? 9.667   1.352   -14.021 1.00 35.97 ? 840 GLN A CD  1 
ATOM   3322 O OE1 . GLN B 1 166 ? 9.431   1.967   -15.075 1.00 40.57 ? 840 GLN A OE1 1 
ATOM   3323 N NE2 . GLN B 1 166 ? 9.593   0.001   -13.929 1.00 41.13 ? 840 GLN A NE2 1 
ATOM   3324 N N   . PHE B 1 167 ? 8.303   0.892   -9.494  1.00 15.83 ? 841 PHE A N   1 
ATOM   3325 C CA  . PHE B 1 167 ? 8.772   -0.080  -8.484  1.00 16.36 ? 841 PHE A CA  1 
ATOM   3326 C C   . PHE B 1 167 ? 7.925   -1.326  -8.527  1.00 16.22 ? 841 PHE A C   1 
ATOM   3327 O O   . PHE B 1 167 ? 8.433   -2.436  -8.568  1.00 15.54 ? 841 PHE A O   1 
ATOM   3328 C CB  . PHE B 1 167 ? 8.714   0.531   -7.085  1.00 14.96 ? 841 PHE A CB  1 
ATOM   3329 C CG  . PHE B 1 167 ? 8.869   -0.491  -5.959  1.00 16.07 ? 841 PHE A CG  1 
ATOM   3330 C CD1 . PHE B 1 167 ? 10.130  -0.927  -5.562  1.00 18.42 ? 841 PHE A CD1 1 
ATOM   3331 C CD2 . PHE B 1 167 ? 7.755   -0.992  -5.292  1.00 13.60 ? 841 PHE A CD2 1 
ATOM   3332 C CE1 . PHE B 1 167 ? 10.262  -1.832  -4.491  1.00 13.61 ? 841 PHE A CE1 1 
ATOM   3333 C CE2 . PHE B 1 167 ? 7.889   -1.939  -4.242  1.00 14.76 ? 841 PHE A CE2 1 
ATOM   3334 C CZ  . PHE B 1 167 ? 9.151   -2.339  -3.862  1.00 13.44 ? 841 PHE A CZ  1 
ATOM   3335 N N   . GLU B 1 168 ? 6.621   -1.137  -8.567  1.00 16.89 ? 842 GLU A N   1 
ATOM   3336 C CA  . GLU B 1 168 ? 5.717   -2.289  -8.592  1.00 19.25 ? 842 GLU A CA  1 
ATOM   3337 C C   . GLU B 1 168 ? 5.861   -3.144  -9.856  1.00 17.94 ? 842 GLU A C   1 
ATOM   3338 O O   . GLU B 1 168 ? 5.865   -4.364  -9.758  1.00 16.60 ? 842 GLU A O   1 
ATOM   3339 C CB  . GLU B 1 168 ? 4.267   -1.829  -8.304  1.00 18.96 ? 842 GLU A CB  1 
ATOM   3340 C CG  . GLU B 1 168 ? 4.070   -1.559  -6.780  1.00 22.51 ? 842 GLU A CG  1 
ATOM   3341 C CD  . GLU B 1 168 ? 2.788   -0.809  -6.426  1.00 25.56 ? 842 GLU A CD  1 
ATOM   3342 O OE1 . GLU B 1 168 ? 1.904   -0.692  -7.308  1.00 34.34 ? 842 GLU A OE1 1 
ATOM   3343 O OE2 . GLU B 1 168 ? 2.671   -0.312  -5.269  1.00 30.39 ? 842 GLU A OE2 1 
ATOM   3344 N N   . GLU B 1 169 ? 5.991   -2.504  -11.024 1.00 17.72 ? 843 GLU A N   1 
ATOM   3345 C CA  . GLU B 1 169 ? 6.246   -3.210  -12.278 1.00 19.07 ? 843 GLU A CA  1 
ATOM   3346 C C   . GLU B 1 169 ? 7.566   -4.004  -12.219 1.00 18.49 ? 843 GLU A C   1 
ATOM   3347 O O   . GLU B 1 169 ? 7.643   -5.171  -12.622 1.00 17.71 ? 843 GLU A O   1 
ATOM   3348 C CB  . GLU B 1 169 ? 6.317   -2.195  -13.438 1.00 18.56 ? 843 GLU A CB  1 
ATOM   3349 C CG  . GLU B 1 169 ? 4.954   -1.614  -13.835 1.00 21.35 ? 843 GLU A CG  1 
ATOM   3350 C CD  . GLU B 1 169 ? 5.043   -0.548  -14.950 1.00 22.48 ? 843 GLU A CD  1 
ATOM   3351 O OE1 . GLU B 1 169 ? 6.056   -0.500  -15.688 1.00 29.56 ? 843 GLU A OE1 1 
ATOM   3352 O OE2 . GLU B 1 169 ? 4.099   0.236   -15.089 1.00 27.74 ? 843 GLU A OE2 1 
ATOM   3353 N N   . MET B 1 170 ? 8.598   -3.351  -11.694 1.00 18.38 ? 844 MET A N   1 
ATOM   3354 C CA  . MET B 1 170 ? 9.903   -3.969  -11.532 1.00 18.90 ? 844 MET A CA  1 
ATOM   3355 C C   . MET B 1 170 ? 9.808   -5.190  -10.594 1.00 19.11 ? 844 MET A C   1 
ATOM   3356 O O   . MET B 1 170 ? 10.262  -6.282  -10.941 1.00 18.89 ? 844 MET A O   1 
ATOM   3357 C CB  . MET B 1 170 ? 10.919  -2.939  -11.042 1.00 19.05 ? 844 MET A CB  1 
ATOM   3358 C CG  . MET B 1 170 ? 12.324  -3.546  -10.897 1.00 20.55 ? 844 MET A CG  1 
ATOM   3359 S SD  . MET B 1 170 ? 13.572  -2.429  -10.240 1.00 17.95 ? 844 MET A SD  1 
ATOM   3360 C CE  . MET B 1 170 ? 14.935  -3.580  -10.197 1.00 16.28 ? 844 MET A CE  1 
ATOM   3361 N N   . ARG B 1 171 ? 9.187   -5.020  -9.429  1.00 19.53 ? 845 ARG A N   1 
ATOM   3362 C CA  . ARG B 1 171 ? 8.948   -6.162  -8.546  1.00 20.48 ? 845 ARG A CA  1 
ATOM   3363 C C   . ARG B 1 171 ? 8.166   -7.336  -9.216  1.00 20.68 ? 845 ARG A C   1 
ATOM   3364 O O   . ARG B 1 171 ? 8.631   -8.473  -9.143  1.00 20.36 ? 845 ARG A O   1 
ATOM   3365 C CB  . ARG B 1 171 ? 8.272   -5.678  -7.277  1.00 21.13 ? 845 ARG A CB  1 
ATOM   3366 C CG  . ARG B 1 171 ? 8.399   -6.592  -6.122  1.00 24.43 ? 845 ARG A CG  1 
ATOM   3367 C CD  . ARG B 1 171 ? 7.823   -5.921  -4.871  1.00 21.96 ? 845 ARG A CD  1 
ATOM   3368 N NE  . ARG B 1 171 ? 7.370   -6.967  -3.978  1.00 24.65 ? 845 ARG A NE  1 
ATOM   3369 C CZ  . ARG B 1 171 ? 8.157   -7.682  -3.189  1.00 29.12 ? 845 ARG A CZ  1 
ATOM   3370 N NH1 . ARG B 1 171 ? 7.610   -8.627  -2.421  1.00 33.70 ? 845 ARG A NH1 1 
ATOM   3371 N NH2 . ARG B 1 171 ? 9.486   -7.475  -3.159  1.00 26.66 ? 845 ARG A NH2 1 
ATOM   3372 N N   . SER B 1 172 ? 7.042   -7.066  -9.902  1.00 19.60 ? 846 SER A N   1 
ATOM   3373 C CA  . SER B 1 172 ? 6.304   -8.126  -10.620 1.00 21.04 ? 846 SER A CA  1 
ATOM   3374 C C   . SER B 1 172 ? 7.168   -8.824  -11.659 1.00 19.93 ? 846 SER A C   1 
ATOM   3375 O O   . SER B 1 172 ? 7.045   -10.027 -11.851 1.00 21.55 ? 846 SER A O   1 
ATOM   3376 C CB  . SER B 1 172 ? 5.022   -7.576  -11.315 1.00 21.76 ? 846 SER A CB  1 
ATOM   3377 O OG  . SER B 1 172 ? 4.195   -6.968  -10.350 1.00 24.24 ? 846 SER A OG  1 
ATOM   3378 N N   . SER B 1 173 ? 8.008   -8.068  -12.357 1.00 19.91 ? 847 SER A N   1 
ATOM   3379 C CA  . SER B 1 173 ? 8.924   -8.614  -13.342 1.00 19.60 ? 847 SER A CA  1 
ATOM   3380 C C   . SER B 1 173 ? 9.854   -9.651  -12.738 1.00 17.97 ? 847 SER A C   1 
ATOM   3381 O O   . SER B 1 173 ? 10.035  -10.710 -13.292 1.00 17.70 ? 847 SER A O   1 
ATOM   3382 C CB  . SER B 1 173 ? 9.816   -7.529  -13.959 1.00 20.72 ? 847 SER A CB  1 
ATOM   3383 O OG  . SER B 1 173 ? 9.067   -6.665  -14.801 1.00 27.65 ? 847 SER A OG  1 
ATOM   3384 N N   . TYR B 1 174 ? 10.472  -9.331  -11.607 1.00 17.59 ? 848 TYR A N   1 
ATOM   3385 C CA  . TYR B 1 174 ? 11.368  -10.268 -10.960 1.00 16.30 ? 848 TYR A CA  1 
ATOM   3386 C C   . TYR B 1 174 ? 10.629  -11.420 -10.265 1.00 16.24 ? 848 TYR A C   1 
ATOM   3387 O O   . TYR B 1 174 ? 11.157  -12.518 -10.173 1.00 15.61 ? 848 TYR A O   1 
ATOM   3388 C CB  . TYR B 1 174 ? 12.286  -9.506  -10.016 1.00 16.67 ? 848 TYR A CB  1 
ATOM   3389 C CG  . TYR B 1 174 ? 13.364  -8.764  -10.828 1.00 17.34 ? 848 TYR A CG  1 
ATOM   3390 C CD1 . TYR B 1 174 ? 14.507  -9.443  -11.285 1.00 15.08 ? 848 TYR A CD1 1 
ATOM   3391 C CD2 . TYR B 1 174 ? 13.219  -7.415  -11.146 1.00 15.54 ? 848 TYR A CD2 1 
ATOM   3392 C CE1 . TYR B 1 174 ? 15.495  -8.781  -12.053 1.00 12.57 ? 848 TYR A CE1 1 
ATOM   3393 C CE2 . TYR B 1 174 ? 14.199  -6.746  -11.896 1.00 15.17 ? 848 TYR A CE2 1 
ATOM   3394 C CZ  . TYR B 1 174 ? 15.329  -7.428  -12.329 1.00 16.39 ? 848 TYR A CZ  1 
ATOM   3395 O OH  . TYR B 1 174 ? 16.299  -6.756  -13.041 1.00 15.91 ? 848 TYR A OH  1 
ATOM   3396 N N   . ILE B 1 175 ? 9.432   -11.173 -9.755  1.00 16.53 ? 849 ILE A N   1 
ATOM   3397 C CA  . ILE B 1 175 ? 8.579   -12.301 -9.303  1.00 17.56 ? 849 ILE A CA  1 
ATOM   3398 C C   . ILE B 1 175 ? 8.326   -13.246 -10.527 1.00 18.64 ? 849 ILE A C   1 
ATOM   3399 O O   . ILE B 1 175 ? 8.448   -14.468 -10.407 1.00 18.98 ? 849 ILE A O   1 
ATOM   3400 C CB  . ILE B 1 175 ? 7.237   -11.803 -8.609  1.00 17.86 ? 849 ILE A CB  1 
ATOM   3401 C CG1 . ILE B 1 175 ? 7.523   -11.116 -7.277  1.00 18.75 ? 849 ILE A CG1 1 
ATOM   3402 C CG2 . ILE B 1 175 ? 6.271   -12.974 -8.293  1.00 17.12 ? 849 ILE A CG2 1 
ATOM   3403 C CD1 . ILE B 1 175 ? 6.370   -10.237 -6.769  1.00 18.14 ? 849 ILE A CD1 1 
ATOM   3404 N N   . ARG B 1 176 ? 8.019   -12.704 -11.708 1.00 19.36 ? 850 ARG A N   1 
ATOM   3405 C CA  . ARG B 1 176 ? 7.852   -13.596 -12.880 1.00 21.68 ? 850 ARG A CA  1 
ATOM   3406 C C   . ARG B 1 176 ? 9.129   -14.337 -13.224 1.00 21.59 ? 850 ARG A C   1 
ATOM   3407 O O   . ARG B 1 176 ? 9.087   -15.496 -13.690 1.00 22.47 ? 850 ARG A O   1 
ATOM   3408 C CB  . ARG B 1 176 ? 7.366   -12.847 -14.129 1.00 21.30 ? 850 ARG A CB  1 
ATOM   3409 C CG  . ARG B 1 176 ? 5.881   -12.425 -14.027 1.00 24.25 ? 850 ARG A CG  1 
ATOM   3410 C CD  . ARG B 1 176 ? 5.341   -11.879 -15.368 1.00 24.96 ? 850 ARG A CD  1 
ATOM   3411 N NE  . ARG B 1 176 ? 5.911   -10.574 -15.706 1.00 28.12 ? 850 ARG A NE  1 
ATOM   3412 C CZ  . ARG B 1 176 ? 5.491   -9.411  -15.206 1.00 29.99 ? 850 ARG A CZ  1 
ATOM   3413 N NH1 . ARG B 1 176 ? 4.458   -9.369  -14.366 1.00 31.22 ? 850 ARG A NH1 1 
ATOM   3414 N NH2 . ARG B 1 176 ? 6.085   -8.283  -15.570 1.00 28.00 ? 850 ARG A NH2 1 
ATOM   3415 N N   . GLU B 1 177 ? 10.265  -13.680 -13.008 1.00 19.90 ? 851 GLU A N   1 
ATOM   3416 C CA  . GLU B 1 177 ? 11.551  -14.264 -13.386 1.00 19.60 ? 851 GLU A CA  1 
ATOM   3417 C C   . GLU B 1 177 ? 11.880  -15.383 -12.420 1.00 19.72 ? 851 GLU A C   1 
ATOM   3418 O O   . GLU B 1 177 ? 12.398  -16.426 -12.831 1.00 20.04 ? 851 GLU A O   1 
ATOM   3419 C CB  . GLU B 1 177 ? 12.650  -13.182 -13.426 1.00 19.58 ? 851 GLU A CB  1 
ATOM   3420 C CG  . GLU B 1 177 ? 13.840  -13.552 -14.285 1.00 19.15 ? 851 GLU A CG  1 
ATOM   3421 C CD  . GLU B 1 177 ? 13.478  -13.714 -15.784 1.00 22.16 ? 851 GLU A CD  1 
ATOM   3422 O OE1 . GLU B 1 177 ? 12.444  -13.167 -16.249 1.00 24.09 ? 851 GLU A OE1 1 
ATOM   3423 O OE2 . GLU B 1 177 ? 14.240  -14.400 -16.508 1.00 25.60 ? 851 GLU A OE2 1 
ATOM   3424 N N   . LEU B 1 178 ? 11.528  -15.192 -11.141 1.00 19.47 ? 852 LEU A N   1 
ATOM   3425 C CA  . LEU B 1 178 ? 11.679  -16.264 -10.140 1.00 19.26 ? 852 LEU A CA  1 
ATOM   3426 C C   . LEU B 1 178 ? 10.852  -17.503 -10.511 1.00 19.65 ? 852 LEU A C   1 
ATOM   3427 O O   . LEU B 1 178 ? 11.304  -18.640 -10.343 1.00 18.73 ? 852 LEU A O   1 
ATOM   3428 C CB  . LEU B 1 178 ? 11.283  -15.769 -8.738  1.00 18.29 ? 852 LEU A CB  1 
ATOM   3429 C CG  . LEU B 1 178 ? 11.251  -16.740 -7.544  1.00 18.34 ? 852 LEU A CG  1 
ATOM   3430 C CD1 . LEU B 1 178 ? 12.600  -17.393 -7.323  1.00 17.65 ? 852 LEU A CD1 1 
ATOM   3431 C CD2 . LEU B 1 178 ? 10.776  -16.054 -6.234  1.00 19.43 ? 852 LEU A CD2 1 
ATOM   3432 N N   . ILE B 1 179 ? 9.630   -17.273 -10.977 1.00 20.20 ? 853 ILE A N   1 
ATOM   3433 C CA  . ILE B 1 179 ? 8.799   -18.368 -11.455 1.00 21.03 ? 853 ILE A CA  1 
ATOM   3434 C C   . ILE B 1 179 ? 9.508   -19.124 -12.587 1.00 21.11 ? 853 ILE A C   1 
ATOM   3435 O O   . ILE B 1 179 ? 9.644   -20.357 -12.509 1.00 20.89 ? 853 ILE A O   1 
ATOM   3436 C CB  . ILE B 1 179 ? 7.403   -17.870 -11.844 1.00 21.76 ? 853 ILE A CB  1 
ATOM   3437 C CG1 . ILE B 1 179 ? 6.689   -17.295 -10.599 1.00 21.21 ? 853 ILE A CG1 1 
ATOM   3438 C CG2 . ILE B 1 179 ? 6.586   -18.963 -12.565 1.00 20.80 ? 853 ILE A CG2 1 
ATOM   3439 C CD1 . ILE B 1 179 ? 5.319   -16.713 -10.902 1.00 25.07 ? 853 ILE A CD1 1 
ATOM   3440 N N   . LYS B 1 180 ? 10.024  -18.398 -13.579 1.00 21.25 ? 854 LYS A N   1 
ATOM   3441 C CA  . LYS B 1 180 ? 10.856  -19.013 -14.631 1.00 22.11 ? 854 LYS A CA  1 
ATOM   3442 C C   . LYS B 1 180 ? 12.039  -19.822 -14.053 1.00 22.04 ? 854 LYS A C   1 
ATOM   3443 O O   . LYS B 1 180 ? 12.291  -20.982 -14.478 1.00 21.85 ? 854 LYS A O   1 
ATOM   3444 C CB  . LYS B 1 180 ? 11.395  -17.971 -15.628 1.00 21.66 ? 854 LYS A CB  1 
ATOM   3445 C CG  . LYS B 1 180 ? 10.360  -17.061 -16.309 1.00 23.54 ? 854 LYS A CG  1 
ATOM   3446 C CD  . LYS B 1 180 ? 11.112  -16.147 -17.295 1.00 23.60 ? 854 LYS A CD  1 
ATOM   3447 C CE  . LYS B 1 180 ? 10.263  -14.985 -17.792 1.00 27.21 ? 854 LYS A CE  1 
ATOM   3448 N NZ  . LYS B 1 180 ? 11.172  -14.065 -18.575 1.00 26.60 ? 854 LYS A NZ  1 
ATOM   3449 N N   . ALA B 1 181 ? 12.763  -19.215 -13.092 1.00 21.11 ? 855 ALA A N   1 
ATOM   3450 C CA  . ALA B 1 181 ? 13.880  -19.875 -12.399 1.00 20.54 ? 855 ALA A CA  1 
ATOM   3451 C C   . ALA B 1 181 ? 13.449  -21.199 -11.791 1.00 21.06 ? 855 ALA A C   1 
ATOM   3452 O O   . ALA B 1 181 ? 14.148  -22.201 -11.942 1.00 20.57 ? 855 ALA A O   1 
ATOM   3453 C CB  . ALA B 1 181 ? 14.499  -18.941 -11.312 1.00 19.33 ? 855 ALA A CB  1 
ATOM   3454 N N   . ILE B 1 182 ? 12.296  -21.200 -11.115 1.00 22.20 ? 856 ILE A N   1 
ATOM   3455 C CA  . ILE B 1 182 ? 11.747  -22.408 -10.465 1.00 23.70 ? 856 ILE A CA  1 
ATOM   3456 C C   . ILE B 1 182 ? 11.401  -23.497 -11.535 1.00 25.59 ? 856 ILE A C   1 
ATOM   3457 O O   . ILE B 1 182 ? 11.641  -24.695 -11.313 1.00 26.18 ? 856 ILE A O   1 
ATOM   3458 C CB  . ILE B 1 182 ? 10.510  -22.045 -9.606  1.00 23.75 ? 856 ILE A CB  1 
ATOM   3459 C CG1 . ILE B 1 182 ? 10.907  -21.229 -8.356  1.00 22.17 ? 856 ILE A CG1 1 
ATOM   3460 C CG2 . ILE B 1 182 ? 9.679   -23.287 -9.239  1.00 24.23 ? 856 ILE A CG2 1 
ATOM   3461 C CD1 . ILE B 1 182 ? 9.738   -20.574 -7.614  1.00 21.88 ? 856 ILE A CD1 1 
ATOM   3462 N N   . GLY B 1 183 ? 10.894  -23.045 -12.695 1.00 26.21 ? 857 GLY A N   1 
ATOM   3463 C CA  . GLY B 1 183 ? 10.456  -23.900 -13.827 1.00 27.53 ? 857 GLY A CA  1 
ATOM   3464 C C   . GLY B 1 183 ? 11.589  -24.578 -14.573 1.00 28.34 ? 857 GLY A C   1 
ATOM   3465 O O   . GLY B 1 183 ? 11.384  -25.558 -15.302 1.00 28.01 ? 857 GLY A O   1 
ATOM   3466 N N   . LEU B 1 184 ? 12.797  -24.091 -14.363 1.00 28.13 ? 858 LEU A N   1 
ATOM   3467 C CA  . LEU B 1 184 ? 13.949  -24.711 -14.948 1.00 30.12 ? 858 LEU A CA  1 
ATOM   3468 C C   . LEU B 1 184 ? 14.166  -26.140 -14.422 1.00 32.33 ? 858 LEU A C   1 
ATOM   3469 O O   . LEU B 1 184 ? 14.737  -26.968 -15.132 1.00 31.49 ? 858 LEU A O   1 
ATOM   3470 C CB  . LEU B 1 184 ? 15.199  -23.845 -14.756 1.00 29.23 ? 858 LEU A CB  1 
ATOM   3471 C CG  . LEU B 1 184 ? 15.272  -22.490 -15.463 1.00 27.00 ? 858 LEU A CG  1 
ATOM   3472 C CD1 . LEU B 1 184 ? 16.532  -21.745 -14.988 1.00 26.39 ? 858 LEU A CD1 1 
ATOM   3473 C CD2 . LEU B 1 184 ? 15.268  -22.642 -17.020 1.00 26.61 ? 858 LEU A CD2 1 
ATOM   3474 N N   . ARG B 1 185 ? 13.679  -26.397 -13.203 1.00 34.99 ? 859 ARG A N   1 
ATOM   3475 C CA  . ARG B 1 185 ? 13.897  -27.637 -12.465 1.00 38.82 ? 859 ARG A CA  1 
ATOM   3476 C C   . ARG B 1 185 ? 12.580  -28.223 -11.955 1.00 41.03 ? 859 ARG A C   1 
ATOM   3477 O O   . ARG B 1 185 ? 12.311  -29.415 -12.178 1.00 42.61 ? 859 ARG A O   1 
ATOM   3478 C CB  . ARG B 1 185 ? 14.909  -27.421 -11.325 1.00 39.24 ? 859 ARG A CB  1 
ATOM   3479 C CG  . ARG B 1 185 ? 16.345  -27.313 -11.848 1.00 40.64 ? 859 ARG A CG  1 
ATOM   3480 C CD  . ARG B 1 185 ? 17.323  -26.635 -10.904 1.00 44.33 ? 859 ARG A CD  1 
ATOM   3481 N NE  . ARG B 1 185 ? 18.369  -25.932 -11.669 1.00 47.33 ? 859 ARG A NE  1 
ATOM   3482 C CZ  . ARG B 1 185 ? 19.668  -25.882 -11.346 1.00 50.33 ? 859 ARG A CZ  1 
ATOM   3483 N NH1 . ARG B 1 185 ? 20.147  -26.491 -10.250 1.00 53.50 ? 859 ARG A NH1 1 
ATOM   3484 N NH2 . ARG B 1 185 ? 20.508  -25.206 -12.114 1.00 48.51 ? 859 ARG A NH2 1 
ATOM   3485 N N   . GLN B 1 186 ? 11.742  -27.404 -11.311 1.00 43.03 ? 860 GLN A N   1 
ATOM   3486 C CA  . GLN B 1 186 ? 10.422  -27.871 -10.826 1.00 44.76 ? 860 GLN A CA  1 
ATOM   3487 C C   . GLN B 1 186 ? 9.422   -27.958 -11.952 1.00 45.77 ? 860 GLN A C   1 
ATOM   3488 O O   . GLN B 1 186 ? 8.792   -26.962 -12.358 1.00 46.32 ? 860 GLN A O   1 
ATOM   3489 C CB  . GLN B 1 186 ? 9.850   -27.039 -9.675  1.00 44.77 ? 860 GLN A CB  1 
ATOM   3490 C CG  . GLN B 1 186 ? 10.847  -26.703 -8.553  1.00 46.92 ? 860 GLN A CG  1 
ATOM   3491 C CD  . GLN B 1 186 ? 11.469  -27.910 -7.868  1.00 50.40 ? 860 GLN A CD  1 
ATOM   3492 O OE1 . GLN B 1 186 ? 12.699  -27.957 -7.647  1.00 50.47 ? 860 GLN A OE1 1 
ATOM   3493 N NE2 . GLN B 1 186 ? 10.628  -28.884 -7.501  1.00 51.79 ? 860 GLN A NE2 1 
ATOM   3494 N N   . LYS B 1 187 ? 9.261   -29.194 -12.411 1.00 46.60 ? 861 LYS A N   1 
ATOM   3495 C CA  . LYS B 1 187 ? 8.570   -29.521 -13.647 1.00 47.44 ? 861 LYS A CA  1 
ATOM   3496 C C   . LYS B 1 187 ? 7.034   -29.451 -13.577 1.00 47.60 ? 861 LYS A C   1 
ATOM   3497 O O   . LYS B 1 187 ? 6.393   -28.960 -14.512 1.00 48.51 ? 861 LYS A O   1 
ATOM   3498 C CB  . LYS B 1 187 ? 9.055   -30.894 -14.132 1.00 47.45 ? 861 LYS A CB  1 
ATOM   3499 C CG  . LYS B 1 187 ? 10.509  -30.885 -14.609 1.00 47.79 ? 861 LYS A CG  1 
ATOM   3500 C CD  . LYS B 1 187 ? 10.700  -29.789 -15.668 1.00 50.32 ? 861 LYS A CD  1 
ATOM   3501 C CE  . LYS B 1 187 ? 12.134  -29.681 -16.149 1.00 50.93 ? 861 LYS A CE  1 
ATOM   3502 N NZ  . LYS B 1 187 ? 12.231  -28.671 -17.252 1.00 50.80 ? 861 LYS A NZ  1 
ATOM   3503 N N   . GLY B 1 188 ? 6.447   -29.937 -12.488 1.00 47.60 ? 862 GLY A N   1 
ATOM   3504 C CA  . GLY B 1 188 ? 4.987   -29.980 -12.379 1.00 47.25 ? 862 GLY A CA  1 
ATOM   3505 C C   . GLY B 1 188 ? 4.401   -28.696 -11.833 1.00 46.83 ? 862 GLY A C   1 
ATOM   3506 O O   . GLY B 1 188 ? 5.059   -27.974 -11.096 1.00 46.29 ? 862 GLY A O   1 
ATOM   3507 N N   . VAL B 1 189 ? 3.150   -28.425 -12.187 1.00 46.79 ? 863 VAL A N   1 
ATOM   3508 C CA  . VAL B 1 189 ? 2.412   -27.254 -11.691 1.00 46.77 ? 863 VAL A CA  1 
ATOM   3509 C C   . VAL B 1 189 ? 2.279   -27.208 -10.155 1.00 46.14 ? 863 VAL A C   1 
ATOM   3510 O O   . VAL B 1 189 ? 2.341   -26.133 -9.541  1.00 45.73 ? 863 VAL A O   1 
ATOM   3511 C CB  . VAL B 1 189 ? 1.020   -27.156 -12.345 1.00 47.14 ? 863 VAL A CB  1 
ATOM   3512 C CG1 . VAL B 1 189 ? 1.167   -26.986 -13.854 1.00 47.69 ? 863 VAL A CG1 1 
ATOM   3513 C CG2 . VAL B 1 189 ? 0.164   -28.399 -12.004 1.00 48.39 ? 863 VAL A CG2 1 
ATOM   3514 N N   . VAL B 1 190 ? 2.121   -28.384 -9.548  1.00 45.25 ? 864 VAL A N   1 
ATOM   3515 C CA  . VAL B 1 190 ? 1.912   -28.501 -8.101  1.00 44.24 ? 864 VAL A CA  1 
ATOM   3516 C C   . VAL B 1 190 ? 3.249   -28.306 -7.359  1.00 42.86 ? 864 VAL A C   1 
ATOM   3517 O O   . VAL B 1 190 ? 3.344   -27.470 -6.460  1.00 42.48 ? 864 VAL A O   1 
ATOM   3518 C CB  . VAL B 1 190 ? 1.227   -29.854 -7.728  1.00 44.34 ? 864 VAL A CB  1 
ATOM   3519 C CG1 . VAL B 1 190 ? 1.138   -30.018 -6.219  1.00 46.03 ? 864 VAL A CG1 1 
ATOM   3520 C CG2 . VAL B 1 190 ? -0.168  -29.931 -8.339  1.00 44.30 ? 864 VAL A CG2 1 
ATOM   3521 N N   . SER B 1 191 ? 4.250   -29.098 -7.747  1.00 41.12 ? 865 SER A N   1 
ATOM   3522 C CA  . SER B 1 191 ? 5.643   -28.932 -7.353  1.00 40.03 ? 865 SER A CA  1 
ATOM   3523 C C   . SER B 1 191 ? 6.152   -27.452 -7.507  1.00 38.69 ? 865 SER A C   1 
ATOM   3524 O O   . SER B 1 191 ? 6.703   -26.881 -6.565  1.00 37.50 ? 865 SER A O   1 
ATOM   3525 C CB  . SER B 1 191 ? 6.495   -29.916 -8.176  1.00 40.47 ? 865 SER A CB  1 
ATOM   3526 O OG  . SER B 1 191 ? 7.877   -29.878 -7.850  1.00 43.26 ? 865 SER A OG  1 
ATOM   3527 N N   . SER B 1 192 ? 5.960   -26.870 -8.690  1.00 37.13 ? 866 SER A N   1 
ATOM   3528 C CA  . SER B 1 192 ? 6.240   -25.466 -8.968  1.00 36.15 ? 866 SER A CA  1 
ATOM   3529 C C   . SER B 1 192 ? 5.599   -24.472 -8.010  1.00 35.18 ? 866 SER A C   1 
ATOM   3530 O O   . SER B 1 192 ? 6.268   -23.525 -7.569  1.00 34.88 ? 866 SER A O   1 
ATOM   3531 C CB  . SER B 1 192 ? 5.811   -25.108 -10.389 1.00 36.42 ? 866 SER A CB  1 
ATOM   3532 O OG  . SER B 1 192 ? 6.797   -25.536 -11.311 1.00 38.98 ? 866 SER A OG  1 
ATOM   3533 N N   . SER B 1 193 ? 4.316   -24.669 -7.697  1.00 33.88 ? 867 SER A N   1 
ATOM   3534 C CA  . SER B 1 193 ? 3.597   -23.754 -6.806  1.00 33.03 ? 867 SER A CA  1 
ATOM   3535 C C   . SER B 1 193 ? 4.063   -23.913 -5.381  1.00 31.94 ? 867 SER A C   1 
ATOM   3536 O O   . SER B 1 193 ? 4.203   -22.928 -4.661  1.00 31.18 ? 867 SER A O   1 
ATOM   3537 C CB  . SER B 1 193 ? 2.077   -23.928 -6.887  1.00 33.05 ? 867 SER A CB  1 
ATOM   3538 O OG  . SER B 1 193 ? 1.653   -23.768 -8.231  1.00 36.05 ? 867 SER A OG  1 
ATOM   3539 N N   . GLN B 1 194 ? 4.312   -25.148 -4.970  1.00 29.79 ? 868 GLN A N   1 
ATOM   3540 C CA  . GLN B 1 194 ? 4.769   -25.348 -3.615  1.00 29.73 ? 868 GLN A CA  1 
ATOM   3541 C C   . GLN B 1 194 ? 6.181   -24.803 -3.425  1.00 27.58 ? 868 GLN A C   1 
ATOM   3542 O O   . GLN B 1 194 ? 6.510   -24.343 -2.346  1.00 27.19 ? 868 GLN A O   1 
ATOM   3543 C CB  . GLN B 1 194 ? 4.720   -26.807 -3.220  1.00 30.45 ? 868 GLN A CB  1 
ATOM   3544 C CG  . GLN B 1 194 ? 3.308   -27.334 -3.085  1.00 35.85 ? 868 GLN A CG  1 
ATOM   3545 C CD  . GLN B 1 194 ? 3.282   -28.843 -3.115  1.00 40.87 ? 868 GLN A CD  1 
ATOM   3546 O OE1 . GLN B 1 194 ? 4.276   -29.492 -2.776  1.00 45.40 ? 868 GLN A OE1 1 
ATOM   3547 N NE2 . GLN B 1 194 ? 2.154   -29.413 -3.532  1.00 40.63 ? 868 GLN A NE2 1 
ATOM   3548 N N   . ARG B 1 195 ? 6.992   -24.891 -4.469  1.00 26.12 ? 869 ARG A N   1 
ATOM   3549 C CA  . ARG B 1 195 ? 8.370   -24.371 -4.455  1.00 26.39 ? 869 ARG A CA  1 
ATOM   3550 C C   . ARG B 1 195 ? 8.376   -22.831 -4.346  1.00 25.53 ? 869 ARG A C   1 
ATOM   3551 O O   . ARG B 1 195 ? 9.168   -22.249 -3.602  1.00 25.84 ? 869 ARG A O   1 
ATOM   3552 C CB  . ARG B 1 195 ? 9.096   -24.794 -5.721  1.00 25.65 ? 869 ARG A CB  1 
ATOM   3553 C CG  . ARG B 1 195 ? 10.541  -24.265 -5.807  1.00 27.80 ? 869 ARG A CG  1 
ATOM   3554 C CD  . ARG B 1 195 ? 11.413  -25.042 -4.886  1.00 26.11 ? 869 ARG A CD  1 
ATOM   3555 N NE  . ARG B 1 195 ? 12.831  -24.773 -5.088  1.00 28.87 ? 869 ARG A NE  1 
ATOM   3556 C CZ  . ARG B 1 195 ? 13.792  -25.419 -4.434  1.00 26.87 ? 869 ARG A CZ  1 
ATOM   3557 N NH1 . ARG B 1 195 ? 13.441  -26.369 -3.577  1.00 24.03 ? 869 ARG A NH1 1 
ATOM   3558 N NH2 . ARG B 1 195 ? 15.081  -25.121 -4.645  1.00 21.17 ? 869 ARG A NH2 1 
ATOM   3559 N N   . PHE B 1 196 ? 7.458   -22.205 -5.068  1.00 24.76 ? 870 PHE A N   1 
ATOM   3560 C CA  . PHE B 1 196 ? 7.283   -20.766 -5.034  1.00 25.16 ? 870 PHE A CA  1 
ATOM   3561 C C   . PHE B 1 196 ? 6.832   -20.339 -3.640  1.00 25.52 ? 870 PHE A C   1 
ATOM   3562 O O   . PHE B 1 196 ? 7.341   -19.349 -3.091  1.00 24.95 ? 870 PHE A O   1 
ATOM   3563 C CB  . PHE B 1 196 ? 6.317   -20.304 -6.125  1.00 24.92 ? 870 PHE A CB  1 
ATOM   3564 C CG  . PHE B 1 196 ? 6.081   -18.812 -6.137  1.00 24.97 ? 870 PHE A CG  1 
ATOM   3565 C CD1 . PHE B 1 196 ? 6.929   -17.962 -6.862  1.00 25.76 ? 870 PHE A CD1 1 
ATOM   3566 C CD2 . PHE B 1 196 ? 4.995   -18.255 -5.442  1.00 26.60 ? 870 PHE A CD2 1 
ATOM   3567 C CE1 . PHE B 1 196 ? 6.709   -16.561 -6.880  1.00 24.70 ? 870 PHE A CE1 1 
ATOM   3568 C CE2 . PHE B 1 196 ? 4.770   -16.851 -5.452  1.00 27.30 ? 870 PHE A CE2 1 
ATOM   3569 C CZ  . PHE B 1 196 ? 5.635   -16.017 -6.197  1.00 23.72 ? 870 PHE A CZ  1 
ATOM   3570 N N   . TYR B 1 197 ? 5.906   -21.100 -3.052  1.00 25.41 ? 871 TYR A N   1 
ATOM   3571 C CA  . TYR B 1 197 ? 5.517   -20.829 -1.688  1.00 26.36 ? 871 TYR A CA  1 
ATOM   3572 C C   . TYR B 1 197 ? 6.750   -20.848 -0.780  1.00 25.12 ? 871 TYR A C   1 
ATOM   3573 O O   . TYR B 1 197 ? 6.949   -19.938 0.026   1.00 24.53 ? 871 TYR A O   1 
ATOM   3574 C CB  . TYR B 1 197 ? 4.431   -21.815 -1.172  1.00 28.40 ? 871 TYR A CB  1 
ATOM   3575 C CG  . TYR B 1 197 ? 4.068   -21.515 0.254   1.00 30.95 ? 871 TYR A CG  1 
ATOM   3576 C CD1 . TYR B 1 197 ? 2.978   -20.702 0.557   1.00 34.80 ? 871 TYR A CD1 1 
ATOM   3577 C CD2 . TYR B 1 197 ? 4.861   -21.964 1.295   1.00 32.93 ? 871 TYR A CD2 1 
ATOM   3578 C CE1 . TYR B 1 197 ? 2.665   -20.389 1.883   1.00 35.24 ? 871 TYR A CE1 1 
ATOM   3579 C CE2 . TYR B 1 197 ? 4.570   -21.643 2.607   1.00 34.18 ? 871 TYR A CE2 1 
ATOM   3580 C CZ  . TYR B 1 197 ? 3.485   -20.860 2.896   1.00 34.29 ? 871 TYR A CZ  1 
ATOM   3581 O OH  . TYR B 1 197 ? 3.206   -20.553 4.221   1.00 35.85 ? 871 TYR A OH  1 
ATOM   3582 N N   . GLN B 1 198 ? 7.571   -21.893 -0.910  1.00 23.85 ? 872 GLN A N   1 
ATOM   3583 C CA  . GLN B 1 198 ? 8.704   -22.096 0.001   1.00 22.91 ? 872 GLN A CA  1 
ATOM   3584 C C   . GLN B 1 198 ? 9.720   -20.974 -0.144  1.00 21.36 ? 872 GLN A C   1 
ATOM   3585 O O   . GLN B 1 198 ? 10.207  -20.461 0.843   1.00 19.91 ? 872 GLN A O   1 
ATOM   3586 C CB  . GLN B 1 198 ? 9.395   -23.425 -0.283  1.00 23.25 ? 872 GLN A CB  1 
ATOM   3587 C CG  . GLN B 1 198 ? 8.614   -24.631 0.170   1.00 26.82 ? 872 GLN A CG  1 
ATOM   3588 C CD  . GLN B 1 198 ? 9.200   -25.926 -0.367  1.00 30.28 ? 872 GLN A CD  1 
ATOM   3589 O OE1 . GLN B 1 198 ? 9.607   -26.022 -1.533  1.00 33.22 ? 872 GLN A OE1 1 
ATOM   3590 N NE2 . GLN B 1 198 ? 9.242   -26.931 0.482   1.00 34.21 ? 872 GLN A NE2 1 
ATOM   3591 N N   . LEU B 1 199 ? 10.016  -20.601 -1.380  1.00 19.94 ? 873 LEU A N   1 
ATOM   3592 C CA  . LEU B 1 199 ? 11.042  -19.578 -1.618  1.00 19.57 ? 873 LEU A CA  1 
ATOM   3593 C C   . LEU B 1 199 ? 10.587  -18.188 -1.156  1.00 19.71 ? 873 LEU A C   1 
ATOM   3594 O O   . LEU B 1 199 ? 11.393  -17.431 -0.590  1.00 19.95 ? 873 LEU A O   1 
ATOM   3595 C CB  . LEU B 1 199 ? 11.534  -19.602 -3.065  1.00 17.99 ? 873 LEU A CB  1 
ATOM   3596 C CG  . LEU B 1 199 ? 12.233  -20.937 -3.476  1.00 18.08 ? 873 LEU A CG  1 
ATOM   3597 C CD1 . LEU B 1 199 ? 12.655  -20.919 -4.900  1.00 14.91 ? 873 LEU A CD1 1 
ATOM   3598 C CD2 . LEU B 1 199 ? 13.456  -21.328 -2.592  1.00 15.51 ? 873 LEU A CD2 1 
ATOM   3599 N N   . THR B 1 200 ? 9.308   -17.874 -1.378  1.00 20.16 ? 874 THR A N   1 
ATOM   3600 C CA  . THR B 1 200 ? 8.729   -16.593 -0.967  1.00 20.76 ? 874 THR A CA  1 
ATOM   3601 C C   . THR B 1 200 ? 8.479   -16.540 0.552   1.00 21.58 ? 874 THR A C   1 
ATOM   3602 O O   . THR B 1 200 ? 8.540   -15.460 1.144   1.00 22.71 ? 874 THR A O   1 
ATOM   3603 C CB  . THR B 1 200 ? 7.458   -16.226 -1.738  1.00 20.36 ? 874 THR A CB  1 
ATOM   3604 O OG1 . THR B 1 200 ? 6.421   -17.194 -1.490  1.00 20.57 ? 874 THR A OG1 1 
ATOM   3605 C CG2 . THR B 1 200 ? 7.747   -16.131 -3.246  1.00 22.90 ? 874 THR A CG2 1 
ATOM   3606 N N   . LYS B 1 201 ? 8.235   -17.688 1.190   1.00 21.22 ? 875 LYS A N   1 
ATOM   3607 C CA  . LYS B 1 201 ? 8.189   -17.761 2.658   1.00 20.96 ? 875 LYS A CA  1 
ATOM   3608 C C   . LYS B 1 201 ? 9.577   -17.522 3.261   1.00 20.48 ? 875 LYS A C   1 
ATOM   3609 O O   . LYS B 1 201 ? 9.715   -16.881 4.296   1.00 18.97 ? 875 LYS A O   1 
ATOM   3610 C CB  . LYS B 1 201 ? 7.647   -19.117 3.158   1.00 21.95 ? 875 LYS A CB  1 
ATOM   3611 C CG  . LYS B 1 201 ? 7.276   -19.119 4.651   1.00 23.97 ? 875 LYS A CG  1 
ATOM   3612 C CD  . LYS B 1 201 ? 6.099   -18.143 4.933   1.00 28.47 ? 875 LYS A CD  1 
ATOM   3613 C CE  . LYS B 1 201 ? 5.925   -17.879 6.448   1.00 29.68 ? 875 LYS A CE  1 
ATOM   3614 N NZ  . LYS B 1 201 ? 4.558   -17.317 6.635   1.00 34.15 ? 875 LYS A NZ  1 
ATOM   3615 N N   . LEU B 1 202 ? 10.607  -18.027 2.607   1.00 19.87 ? 876 LEU A N   1 
ATOM   3616 C CA  . LEU B 1 202 ? 11.981  -17.815 3.103   1.00 20.35 ? 876 LEU A CA  1 
ATOM   3617 C C   . LEU B 1 202 ? 12.278  -16.302 3.101   1.00 19.91 ? 876 LEU A C   1 
ATOM   3618 O O   . LEU B 1 202 ? 12.809  -15.768 4.058   1.00 20.30 ? 876 LEU A O   1 
ATOM   3619 C CB  . LEU B 1 202 ? 13.000  -18.569 2.217   1.00 19.99 ? 876 LEU A CB  1 
ATOM   3620 C CG  . LEU B 1 202 ? 14.491  -18.545 2.632   1.00 20.65 ? 876 LEU A CG  1 
ATOM   3621 C CD1 . LEU B 1 202 ? 15.252  -19.681 1.956   1.00 22.26 ? 876 LEU A CD1 1 
ATOM   3622 C CD2 . LEU B 1 202 ? 15.116  -17.212 2.242   1.00 21.75 ? 876 LEU A CD2 1 
ATOM   3623 N N   . LEU B 1 203 ? 11.921  -15.641 2.010   1.00 19.51 ? 877 LEU A N   1 
ATOM   3624 C CA  . LEU B 1 203 ? 12.033  -14.179 1.907   1.00 19.35 ? 877 LEU A CA  1 
ATOM   3625 C C   . LEU B 1 203 ? 11.236  -13.446 2.983   1.00 18.30 ? 877 LEU A C   1 
ATOM   3626 O O   . LEU B 1 203 ? 11.794  -12.563 3.634   1.00 17.24 ? 877 LEU A O   1 
ATOM   3627 C CB  . LEU B 1 203 ? 11.651  -13.677 0.515   1.00 18.02 ? 877 LEU A CB  1 
ATOM   3628 C CG  . LEU B 1 203 ? 12.559  -14.028 -0.661  1.00 19.48 ? 877 LEU A CG  1 
ATOM   3629 C CD1 . LEU B 1 203 ? 11.946  -13.500 -1.947  1.00 19.75 ? 877 LEU A CD1 1 
ATOM   3630 C CD2 . LEU B 1 203 ? 14.045  -13.556 -0.507  1.00 16.99 ? 877 LEU A CD2 1 
ATOM   3631 N N   . ASP B 1 204 ? 9.954   -13.807 3.180   1.00 17.58 ? 878 ASP A N   1 
ATOM   3632 C CA  . ASP B 1 204 ? 9.176   -13.273 4.319   1.00 18.27 ? 878 ASP A CA  1 
ATOM   3633 C C   . ASP B 1 204 ? 9.894   -13.403 5.646   1.00 18.03 ? 878 ASP A C   1 
ATOM   3634 O O   . ASP B 1 204 ? 10.003  -12.438 6.419   1.00 16.39 ? 878 ASP A O   1 
ATOM   3635 C CB  . ASP B 1 204 ? 7.838   -13.997 4.483   1.00 18.05 ? 878 ASP A CB  1 
ATOM   3636 C CG  . ASP B 1 204 ? 6.813   -13.550 3.500   1.00 19.64 ? 878 ASP A CG  1 
ATOM   3637 O OD1 . ASP B 1 204 ? 7.143   -12.724 2.620   1.00 21.72 ? 878 ASP A OD1 1 
ATOM   3638 O OD2 . ASP B 1 204 ? 5.664   -14.047 3.614   1.00 20.73 ? 878 ASP A OD2 1 
ATOM   3639 N N   . ASN B 1 205 ? 10.397  -14.612 5.913   1.00 18.19 ? 879 ASN A N   1 
ATOM   3640 C CA  . ASN B 1 205 ? 11.090  -14.894 7.161   1.00 19.05 ? 879 ASN A CA  1 
ATOM   3641 C C   . ASN B 1 205 ? 12.382  -14.104 7.340   1.00 19.29 ? 879 ASN A C   1 
ATOM   3642 O O   . ASN B 1 205 ? 12.886  -13.963 8.461   1.00 18.53 ? 879 ASN A O   1 
ATOM   3643 C CB  . ASN B 1 205 ? 11.395  -16.395 7.280   1.00 20.41 ? 879 ASN A CB  1 
ATOM   3644 C CG  . ASN B 1 205 ? 10.149  -17.229 7.389   1.00 24.80 ? 879 ASN A CG  1 
ATOM   3645 O OD1 . ASN B 1 205 ? 9.074   -16.726 7.717   1.00 28.40 ? 879 ASN A OD1 1 
ATOM   3646 N ND2 . ASN B 1 205 ? 10.285  -18.526 7.128   1.00 27.40 ? 879 ASN A ND2 1 
ATOM   3647 N N   . LEU B 1 206 ? 12.934  -13.576 6.255   1.00 18.85 ? 880 LEU A N   1 
ATOM   3648 C CA  . LEU B 1 206 ? 14.156  -12.769 6.428   1.00 18.90 ? 880 LEU A CA  1 
ATOM   3649 C C   . LEU B 1 206 ? 13.938  -11.460 7.159   1.00 17.72 ? 880 LEU A C   1 
ATOM   3650 O O   . LEU B 1 206 ? 14.862  -10.979 7.764   1.00 17.89 ? 880 LEU A O   1 
ATOM   3651 C CB  . LEU B 1 206 ? 14.877  -12.505 5.111   1.00 18.07 ? 880 LEU A CB  1 
ATOM   3652 C CG  . LEU B 1 206 ? 15.426  -13.798 4.477   1.00 22.13 ? 880 LEU A CG  1 
ATOM   3653 C CD1 . LEU B 1 206 ? 16.053  -13.435 3.181   1.00 22.92 ? 880 LEU A CD1 1 
ATOM   3654 C CD2 . LEU B 1 206 ? 16.449  -14.405 5.357   1.00 24.01 ? 880 LEU A CD2 1 
ATOM   3655 N N   . HIS B 1 207 ? 12.739  -10.875 7.120   1.00 17.82 ? 881 HIS A N   1 
ATOM   3656 C CA  . HIS B 1 207 ? 12.512  -9.635  7.864   1.00 17.61 ? 881 HIS A CA  1 
ATOM   3657 C C   . HIS B 1 207 ? 12.846  -9.819  9.368   1.00 19.12 ? 881 HIS A C   1 
ATOM   3658 O O   . HIS B 1 207 ? 13.587  -9.037  9.972   1.00 17.86 ? 881 HIS A O   1 
ATOM   3659 C CB  . HIS B 1 207 ? 11.076  -9.118  7.668   1.00 18.53 ? 881 HIS A CB  1 
ATOM   3660 C CG  . HIS B 1 207 ? 10.811  -8.542  6.293   1.00 17.74 ? 881 HIS A CG  1 
ATOM   3661 N ND1 . HIS B 1 207 ? 9.895   -9.090  5.417   1.00 20.54 ? 881 HIS A ND1 1 
ATOM   3662 C CD2 . HIS B 1 207 ? 11.343  -7.471  5.656   1.00 13.52 ? 881 HIS A CD2 1 
ATOM   3663 C CE1 . HIS B 1 207 ? 9.861   -8.374  4.303   1.00 16.07 ? 881 HIS A CE1 1 
ATOM   3664 N NE2 . HIS B 1 207 ? 10.717  -7.373  4.433   1.00 20.71 ? 881 HIS A NE2 1 
ATOM   3665 N N   . ASP B 1 208 ? 12.306  -10.861 9.974   1.00 19.53 ? 882 ASP A N   1 
ATOM   3666 C CA  . ASP B 1 208 ? 12.545  -11.133 11.400  1.00 20.41 ? 882 ASP A CA  1 
ATOM   3667 C C   . ASP B 1 208 ? 13.974  -11.433 11.687  1.00 19.63 ? 882 ASP A C   1 
ATOM   3668 O O   . ASP B 1 208 ? 14.513  -11.010 12.707  1.00 19.29 ? 882 ASP A O   1 
ATOM   3669 C CB  . ASP B 1 208 ? 11.734  -12.352 11.822  1.00 22.59 ? 882 ASP A CB  1 
ATOM   3670 C CG  . ASP B 1 208 ? 10.275  -12.049 11.944  1.00 29.78 ? 882 ASP A CG  1 
ATOM   3671 O OD1 . ASP B 1 208 ? 9.928   -10.947 12.435  1.00 33.69 ? 882 ASP A OD1 1 
ATOM   3672 O OD2 . ASP B 1 208 ? 9.471   -12.925 11.545  1.00 39.73 ? 882 ASP A OD2 1 
ATOM   3673 N N   . LEU B 1 209 ? 14.609  -12.185 10.784  1.00 18.54 ? 883 LEU A N   1 
ATOM   3674 C CA  . LEU B 1 209 ? 16.007  -12.550 10.955  1.00 17.00 ? 883 LEU A CA  1 
ATOM   3675 C C   . LEU B 1 209 ? 16.921  -11.313 10.939  1.00 16.25 ? 883 LEU A C   1 
ATOM   3676 O O   . LEU B 1 209 ? 17.773  -11.112 11.818  1.00 15.38 ? 883 LEU A O   1 
ATOM   3677 C CB  . LEU B 1 209 ? 16.380  -13.565 9.834   1.00 17.63 ? 883 LEU A CB  1 
ATOM   3678 C CG  . LEU B 1 209 ? 17.748  -14.254 9.831   1.00 20.68 ? 883 LEU A CG  1 
ATOM   3679 C CD1 . LEU B 1 209 ? 17.698  -15.485 8.870   1.00 21.01 ? 883 LEU A CD1 1 
ATOM   3680 C CD2 . LEU B 1 209 ? 18.911  -13.288 9.482   1.00 21.10 ? 883 LEU A CD2 1 
ATOM   3681 N N   . VAL B 1 210 ? 16.729  -10.484 9.919   1.00 15.38 ? 884 VAL A N   1 
ATOM   3682 C CA  . VAL B 1 210 ? 17.518  -9.262  9.724   1.00 15.79 ? 884 VAL A CA  1 
ATOM   3683 C C   . VAL B 1 210 ? 17.291  -8.249  10.835  1.00 15.31 ? 884 VAL A C   1 
ATOM   3684 O O   . VAL B 1 210 ? 18.195  -7.499  11.185  1.00 15.93 ? 884 VAL A O   1 
ATOM   3685 C CB  . VAL B 1 210 ? 17.226  -8.671  8.365   1.00 15.80 ? 884 VAL A CB  1 
ATOM   3686 C CG1 . VAL B 1 210 ? 17.827  -7.301  8.242   1.00 18.25 ? 884 VAL A CG1 1 
ATOM   3687 C CG2 . VAL B 1 210 ? 17.740  -9.662  7.294   1.00 15.77 ? 884 VAL A CG2 1 
ATOM   3688 N N   . LYS B 1 211 ? 16.111  -8.259  11.423  1.00 15.52 ? 885 LYS A N   1 
ATOM   3689 C CA  . LYS B 1 211 ? 15.858  -7.371  12.517  1.00 16.89 ? 885 LYS A CA  1 
ATOM   3690 C C   . LYS B 1 211 ? 16.860  -7.594  13.687  1.00 16.90 ? 885 LYS A C   1 
ATOM   3691 O O   . LYS B 1 211 ? 17.382  -6.632  14.263  1.00 15.39 ? 885 LYS A O   1 
ATOM   3692 C CB  . LYS B 1 211 ? 14.427  -7.562  12.995  1.00 18.48 ? 885 LYS A CB  1 
ATOM   3693 C CG  . LYS B 1 211 ? 14.131  -6.657  14.224  1.00 21.65 ? 885 LYS A CG  1 
ATOM   3694 C CD  . LYS B 1 211 ? 12.673  -6.736  14.549  1.00 27.33 ? 885 LYS A CD  1 
ATOM   3695 C CE  . LYS B 1 211 ? 12.436  -6.175  15.955  1.00 28.98 ? 885 LYS A CE  1 
ATOM   3696 N NZ  . LYS B 1 211 ? 11.193  -6.884  16.444  1.00 37.30 ? 885 LYS A NZ  1 
ATOM   3697 N N   . GLN B 1 212 ? 17.160  -8.864  14.003  1.00 17.14 ? 886 GLN A N   1 
ATOM   3698 C CA  . GLN B 1 212 ? 18.182  -9.187  15.014  1.00 17.40 ? 886 GLN A CA  1 
ATOM   3699 C C   . GLN B 1 212 ? 19.591  -8.674  14.640  1.00 15.66 ? 886 GLN A C   1 
ATOM   3700 O O   . GLN B 1 212 ? 20.343  -8.183  15.503  1.00 14.17 ? 886 GLN A O   1 
ATOM   3701 C CB  . GLN B 1 212 ? 18.237  -10.707 15.270  1.00 19.32 ? 886 GLN A CB  1 
ATOM   3702 C CG  . GLN B 1 212 ? 17.041  -11.304 16.017  1.00 26.45 ? 886 GLN A CG  1 
ATOM   3703 C CD  . GLN B 1 212 ? 16.496  -10.398 17.164  1.00 34.45 ? 886 GLN A CD  1 
ATOM   3704 O OE1 . GLN B 1 212 ? 15.304  -10.093 17.176  1.00 39.74 ? 886 GLN A OE1 1 
ATOM   3705 N NE2 . GLN B 1 212 ? 17.369  -9.960  18.107  1.00 36.02 ? 886 GLN A NE2 1 
ATOM   3706 N N   . LEU B 1 213 ? 19.949  -8.787  13.361  1.00 14.78 ? 887 LEU A N   1 
ATOM   3707 C CA  . LEU B 1 213 ? 21.227  -8.253  12.870  1.00 14.30 ? 887 LEU A CA  1 
ATOM   3708 C C   . LEU B 1 213 ? 21.247  -6.717  12.970  1.00 12.89 ? 887 LEU A C   1 
ATOM   3709 O O   . LEU B 1 213 ? 22.251  -6.151  13.365  1.00 13.57 ? 887 LEU A O   1 
ATOM   3710 C CB  . LEU B 1 213 ? 21.481  -8.679  11.415  1.00 14.06 ? 887 LEU A CB  1 
ATOM   3711 C CG  . LEU B 1 213 ? 21.509  -10.180 11.031  1.00 19.98 ? 887 LEU A CG  1 
ATOM   3712 C CD1 . LEU B 1 213 ? 22.299  -10.362 9.732   1.00 20.25 ? 887 LEU A CD1 1 
ATOM   3713 C CD2 . LEU B 1 213 ? 22.028  -11.064 12.071  1.00 22.27 ? 887 LEU A CD2 1 
ATOM   3714 N N   . HIS B 1 214 ? 20.141  -6.063  12.611  1.00 13.03 ? 888 HIS A N   1 
ATOM   3715 C CA  . HIS B 1 214 ? 20.044  -4.604  12.651  1.00 13.17 ? 888 HIS A CA  1 
ATOM   3716 C C   . HIS B 1 214 ? 20.224  -4.140  14.097  1.00 13.69 ? 888 HIS A C   1 
ATOM   3717 O O   . HIS B 1 214 ? 20.983  -3.206  14.381  1.00 15.11 ? 888 HIS A O   1 
ATOM   3718 C CB  . HIS B 1 214 ? 18.674  -4.121  12.112  1.00 13.64 ? 888 HIS A CB  1 
ATOM   3719 C CG  . HIS B 1 214 ? 18.585  -4.042  10.613  1.00 13.63 ? 888 HIS A CG  1 
ATOM   3720 N ND1 . HIS B 1 214 ? 17.380  -4.055  9.940   1.00 14.80 ? 888 HIS A ND1 1 
ATOM   3721 C CD2 . HIS B 1 214 ? 19.545  -3.943  9.659   1.00 14.90 ? 888 HIS A CD2 1 
ATOM   3722 C CE1 . HIS B 1 214 ? 17.595  -3.948  8.641   1.00 12.59 ? 888 HIS A CE1 1 
ATOM   3723 N NE2 . HIS B 1 214 ? 18.901  -3.874  8.443   1.00 16.48 ? 888 HIS A NE2 1 
ATOM   3724 N N   . LEU B 1 215 ? 19.537  -4.794  15.030  1.00 14.91 ? 889 LEU A N   1 
ATOM   3725 C CA  . LEU B 1 215 ? 19.642  -4.386  16.449  1.00 15.37 ? 889 LEU A CA  1 
ATOM   3726 C C   . LEU B 1 215 ? 21.075  -4.572  16.977  1.00 15.20 ? 889 LEU A C   1 
ATOM   3727 O O   . LEU B 1 215 ? 21.633  -3.659  17.576  1.00 15.30 ? 889 LEU A O   1 
ATOM   3728 C CB  . LEU B 1 215 ? 18.616  -5.145  17.304  1.00 14.14 ? 889 LEU A CB  1 
ATOM   3729 C CG  . LEU B 1 215 ? 18.634  -4.861  18.815  1.00 15.89 ? 889 LEU A CG  1 
ATOM   3730 C CD1 . LEU B 1 215 ? 18.444  -3.364  19.101  1.00 16.10 ? 889 LEU A CD1 1 
ATOM   3731 C CD2 . LEU B 1 215 ? 17.545  -5.725  19.474  1.00 17.29 ? 889 LEU A CD2 1 
ATOM   3732 N N   . TYR B 1 216 ? 21.673  -5.757  16.747  1.00 15.87 ? 890 TYR A N   1 
ATOM   3733 C CA  . TYR B 1 216 ? 23.060  -6.025  17.161  1.00 17.04 ? 890 TYR A CA  1 
ATOM   3734 C C   . TYR B 1 216 ? 23.985  -4.940  16.569  1.00 15.72 ? 890 TYR A C   1 
ATOM   3735 O O   . TYR B 1 216 ? 24.821  -4.347  17.265  1.00 15.81 ? 890 TYR A O   1 
ATOM   3736 C CB  . TYR B 1 216 ? 23.500  -7.426  16.693  1.00 17.99 ? 890 TYR A CB  1 
ATOM   3737 C CG  . TYR B 1 216 ? 24.854  -7.833  17.251  1.00 20.30 ? 890 TYR A CG  1 
ATOM   3738 C CD1 . TYR B 1 216 ? 26.023  -7.369  16.672  1.00 18.08 ? 890 TYR A CD1 1 
ATOM   3739 C CD2 . TYR B 1 216 ? 24.950  -8.662  18.366  1.00 21.58 ? 890 TYR A CD2 1 
ATOM   3740 C CE1 . TYR B 1 216 ? 27.249  -7.694  17.177  1.00 22.87 ? 890 TYR A CE1 1 
ATOM   3741 C CE2 . TYR B 1 216 ? 26.201  -9.017  18.884  1.00 25.09 ? 890 TYR A CE2 1 
ATOM   3742 C CZ  . TYR B 1 216 ? 27.341  -8.535  18.265  1.00 23.74 ? 890 TYR A CZ  1 
ATOM   3743 O OH  . TYR B 1 216 ? 28.602  -8.842  18.734  1.00 25.50 ? 890 TYR A OH  1 
ATOM   3744 N N   . CYS B 1 217 ? 23.842  -4.696  15.267  1.00 15.25 ? 891 CYS A N   1 
ATOM   3745 C CA  . CYS B 1 217 ? 24.668  -3.691  14.579  1.00 14.22 ? 891 CYS A CA  1 
ATOM   3746 C C   . CYS B 1 217 ? 24.486  -2.268  15.195  1.00 13.70 ? 891 CYS A C   1 
ATOM   3747 O O   . CYS B 1 217 ? 25.458  -1.594  15.493  1.00 14.31 ? 891 CYS A O   1 
ATOM   3748 C CB  . CYS B 1 217 ? 24.338  -3.667  13.071  1.00 13.90 ? 891 CYS A CB  1 
ATOM   3749 S SG  . CYS B 1 217 ? 25.379  -2.459  12.135  1.00 17.02 ? 891 CYS A SG  1 
ATOM   3750 N N   . LEU B 1 218 ? 23.263  -1.803  15.352  1.00 13.61 ? 892 LEU A N   1 
ATOM   3751 C CA  . LEU B 1 218 ? 23.077  -0.480  15.978  1.00 14.30 ? 892 LEU A CA  1 
ATOM   3752 C C   . LEU B 1 218 ? 23.664  -0.338  17.402  1.00 15.06 ? 892 LEU A C   1 
ATOM   3753 O O   . LEU B 1 218 ? 24.318  0.672   17.691  1.00 16.70 ? 892 LEU A O   1 
ATOM   3754 C CB  . LEU B 1 218 ? 21.618  -0.013  15.920  1.00 14.03 ? 892 LEU A CB  1 
ATOM   3755 C CG  . LEU B 1 218 ? 21.280  1.421   16.354  1.00 13.12 ? 892 LEU A CG  1 
ATOM   3756 C CD1 . LEU B 1 218 ? 22.070  2.479   15.494  1.00 12.34 ? 892 LEU A CD1 1 
ATOM   3757 C CD2 . LEU B 1 218 ? 19.763  1.569   16.199  1.00 13.02 ? 892 LEU A CD2 1 
ATOM   3758 N N   . ASN B 1 219 ? 23.458  -1.336  18.267  1.00 15.51 ? 893 ASN A N   1 
ATOM   3759 C CA  . ASN B 1 219 ? 24.041  -1.347  19.606  1.00 16.53 ? 893 ASN A CA  1 
ATOM   3760 C C   . ASN B 1 219 ? 25.528  -1.235  19.550  1.00 17.88 ? 893 ASN A C   1 
ATOM   3761 O O   . ASN B 1 219 ? 26.126  -0.482  20.299  1.00 19.52 ? 893 ASN A O   1 
ATOM   3762 C CB  . ASN B 1 219 ? 23.718  -2.658  20.353  1.00 16.46 ? 893 ASN A CB  1 
ATOM   3763 C CG  . ASN B 1 219 ? 22.342  -2.669  20.901  1.00 19.90 ? 893 ASN A CG  1 
ATOM   3764 O OD1 . ASN B 1 219 ? 21.795  -1.609  21.221  1.00 23.26 ? 893 ASN A OD1 1 
ATOM   3765 N ND2 . ASN B 1 219 ? 21.747  -3.870  21.034  1.00 22.01 ? 893 ASN A ND2 1 
ATOM   3766 N N   . THR B 1 220 ? 26.148  -2.032  18.689  1.00 17.50 ? 894 THR A N   1 
ATOM   3767 C CA  . THR B 1 220 ? 27.577  -1.995  18.535  1.00 17.88 ? 894 THR A CA  1 
ATOM   3768 C C   . THR B 1 220 ? 28.070  -0.628  18.010  1.00 19.39 ? 894 THR A C   1 
ATOM   3769 O O   . THR B 1 220 ? 29.102  -0.131  18.458  1.00 18.50 ? 894 THR A O   1 
ATOM   3770 C CB  . THR B 1 220 ? 28.055  -3.162  17.595  1.00 18.45 ? 894 THR A CB  1 
ATOM   3771 O OG1 . THR B 1 220 ? 27.470  -4.397  18.053  1.00 15.87 ? 894 THR A OG1 1 
ATOM   3772 C CG2 . THR B 1 220 ? 29.582  -3.261  17.595  1.00 18.00 ? 894 THR A CG2 1 
ATOM   3773 N N   . PHE B 1 221 ? 27.344  -0.053  17.039  1.00 18.80 ? 895 PHE A N   1 
ATOM   3774 C CA  . PHE B 1 221 ? 27.679  1.245   16.469  1.00 20.27 ? 895 PHE A CA  1 
ATOM   3775 C C   . PHE B 1 221 ? 27.630  2.325   17.552  1.00 21.61 ? 895 PHE A C   1 
ATOM   3776 O O   . PHE B 1 221 ? 28.557  3.108   17.685  1.00 21.00 ? 895 PHE A O   1 
ATOM   3777 C CB  . PHE B 1 221 ? 26.688  1.566   15.346  1.00 20.09 ? 895 PHE A CB  1 
ATOM   3778 C CG  . PHE B 1 221 ? 26.939  2.858   14.650  1.00 19.39 ? 895 PHE A CG  1 
ATOM   3779 C CD1 . PHE B 1 221 ? 28.047  3.017   13.817  1.00 20.74 ? 895 PHE A CD1 1 
ATOM   3780 C CD2 . PHE B 1 221 ? 26.025  3.896   14.765  1.00 20.82 ? 895 PHE A CD2 1 
ATOM   3781 C CE1 . PHE B 1 221 ? 28.276  4.212   13.155  1.00 21.11 ? 895 PHE A CE1 1 
ATOM   3782 C CE2 . PHE B 1 221 ? 26.217  5.096   14.080  1.00 20.88 ? 895 PHE A CE2 1 
ATOM   3783 C CZ  . PHE B 1 221 ? 27.357  5.263   13.286  1.00 21.36 ? 895 PHE A CZ  1 
ATOM   3784 N N   . ILE B 1 222 ? 26.537  2.347   18.309  1.00 24.34 ? 896 ILE A N   1 
ATOM   3785 C CA  . ILE B 1 222 ? 26.372  3.226   19.485  1.00 28.22 ? 896 ILE A CA  1 
ATOM   3786 C C   . ILE B 1 222 ? 27.552  3.090   20.488  1.00 30.31 ? 896 ILE A C   1 
ATOM   3787 O O   . ILE B 1 222 ? 27.998  4.081   21.059  1.00 32.45 ? 896 ILE A O   1 
ATOM   3788 C CB  . ILE B 1 222 ? 25.029  2.880   20.216  1.00 28.17 ? 896 ILE A CB  1 
ATOM   3789 C CG1 . ILE B 1 222 ? 23.811  3.434   19.487  1.00 29.72 ? 896 ILE A CG1 1 
ATOM   3790 C CG2 . ILE B 1 222 ? 25.039  3.257   21.684  1.00 30.35 ? 896 ILE A CG2 1 
ATOM   3791 C CD1 . ILE B 1 222 ? 24.101  4.549   18.620  1.00 24.68 ? 896 ILE A CD1 1 
ATOM   3792 N N   . GLN B 1 223 ? 28.052  1.872   20.704  1.00 31.85 ? 897 GLN A N   1 
ATOM   3793 C CA  . GLN B 1 223 ? 29.104  1.632   21.704  1.00 33.14 ? 897 GLN A CA  1 
ATOM   3794 C C   . GLN B 1 223 ? 30.480  1.421   21.073  1.00 33.73 ? 897 GLN A C   1 
ATOM   3795 O O   . GLN B 1 223 ? 31.399  0.910   21.740  1.00 34.04 ? 897 GLN A O   1 
ATOM   3796 C CB  . GLN B 1 223 ? 28.742  0.422   22.577  1.00 32.95 ? 897 GLN A CB  1 
ATOM   3797 C CG  . GLN B 1 223 ? 27.275  0.334   23.015  1.00 32.98 ? 897 GLN A CG  1 
ATOM   3798 C CD  . GLN B 1 223 ? 26.935  -1.012  23.640  1.00 35.13 ? 897 GLN A CD  1 
ATOM   3799 O OE1 . GLN B 1 223 ? 25.780  -1.474  23.608  1.00 36.34 ? 897 GLN A OE1 1 
ATOM   3800 N NE2 . GLN B 1 223 ? 27.954  -1.665  24.219  1.00 39.62 ? 897 GLN A NE2 1 
ATOM   3801 N N   . SER B 1 224 ? 30.631  1.825   19.800  1.00 34.14 ? 898 SER A N   1 
ATOM   3802 C CA  . SER B 1 224 ? 31.794  1.481   18.971  1.00 34.00 ? 898 SER A CA  1 
ATOM   3803 C C   . SER B 1 224 ? 33.137  1.874   19.609  1.00 34.88 ? 898 SER A C   1 
ATOM   3804 O O   . SER B 1 224 ? 34.069  1.070   19.680  1.00 32.92 ? 898 SER A O   1 
ATOM   3805 C CB  . SER B 1 224 ? 31.668  2.111   17.578  1.00 34.17 ? 898 SER A CB  1 
ATOM   3806 O OG  . SER B 1 224 ? 31.933  3.508   17.579  1.00 33.69 ? 898 SER A OG  1 
ATOM   3807 N N   . ARG B 1 225 ? 33.221  3.127   20.051  1.00 36.39 ? 899 ARG A N   1 
ATOM   3808 C CA  . ARG B 1 225 ? 34.412  3.643   20.734  1.00 38.37 ? 899 ARG A CA  1 
ATOM   3809 C C   . ARG B 1 225 ? 34.801  2.806   21.949  1.00 37.74 ? 899 ARG A C   1 
ATOM   3810 O O   . ARG B 1 225 ? 35.976  2.454   22.119  1.00 38.03 ? 899 ARG A O   1 
ATOM   3811 C CB  . ARG B 1 225 ? 34.177  5.088   21.154  1.00 39.55 ? 899 ARG A CB  1 
ATOM   3812 C CG  . ARG B 1 225 ? 35.379  5.754   21.752  1.00 45.02 ? 899 ARG A CG  1 
ATOM   3813 C CD  . ARG B 1 225 ? 35.303  7.288   21.595  1.00 52.48 ? 899 ARG A CD  1 
ATOM   3814 N NE  . ARG B 1 225 ? 36.188  7.877   22.590  1.00 57.83 ? 899 ARG A NE  1 
ATOM   3815 C CZ  . ARG B 1 225 ? 36.189  9.146   22.976  1.00 60.36 ? 899 ARG A CZ  1 
ATOM   3816 N NH1 . ARG B 1 225 ? 37.046  9.504   23.907  1.00 61.80 ? 899 ARG A NH1 1 
ATOM   3817 N NH2 . ARG B 1 225 ? 35.355  10.044  22.457  1.00 62.30 ? 899 ARG A NH2 1 
ATOM   3818 N N   . ALA B 1 226 ? 33.802  2.487   22.764  1.00 37.22 ? 900 ALA A N   1 
ATOM   3819 C CA  . ALA B 1 226 ? 33.971  1.707   23.985  1.00 36.92 ? 900 ALA A CA  1 
ATOM   3820 C C   . ALA B 1 226 ? 34.264  0.219   23.735  1.00 36.74 ? 900 ALA A C   1 
ATOM   3821 O O   . ALA B 1 226 ? 34.871  -0.440  24.589  1.00 36.69 ? 900 ALA A O   1 
ATOM   3822 C CB  . ALA B 1 226 ? 32.730  1.841   24.857  1.00 37.14 ? 900 ALA A CB  1 
ATOM   3823 N N   . LEU B 1 227 ? 33.824  -0.301  22.583  1.00 34.71 ? 901 LEU A N   1 
ATOM   3824 C CA  . LEU B 1 227 ? 34.015  -1.714  22.234  1.00 34.01 ? 901 LEU A CA  1 
ATOM   3825 C C   . LEU B 1 227 ? 35.274  -1.942  21.395  1.00 32.94 ? 901 LEU A C   1 
ATOM   3826 O O   . LEU B 1 227 ? 35.585  -3.077  21.048  1.00 33.19 ? 901 LEU A O   1 
ATOM   3827 C CB  . LEU B 1 227 ? 32.768  -2.279  21.516  1.00 33.43 ? 901 LEU A CB  1 
ATOM   3828 C CG  . LEU B 1 227 ? 31.504  -2.376  22.367  1.00 34.20 ? 901 LEU A CG  1 
ATOM   3829 C CD1 . LEU B 1 227 ? 30.298  -2.913  21.595  1.00 32.49 ? 901 LEU A CD1 1 
ATOM   3830 C CD2 . LEU B 1 227 ? 31.772  -3.225  23.642  1.00 35.63 ? 901 LEU A CD2 1 
ATOM   3831 N N   . SER B 1 228 ? 35.990  -0.850  21.125  1.00 31.20 ? 902 SER A N   1 
ATOM   3832 C CA  . SER B 1 228 ? 37.081  -0.751  20.147  1.00 30.19 ? 902 SER A CA  1 
ATOM   3833 C C   . SER B 1 228 ? 36.771  -1.307  18.732  1.00 27.91 ? 902 SER A C   1 
ATOM   3834 O O   . SER B 1 228 ? 37.647  -1.918  18.102  1.00 26.10 ? 902 SER A O   1 
ATOM   3835 C CB  . SER B 1 228 ? 38.377  -1.367  20.688  1.00 31.30 ? 902 SER A CB  1 
ATOM   3836 O OG  . SER B 1 228 ? 38.765  -0.739  21.875  1.00 35.09 ? 902 SER A OG  1 
ATOM   3837 N N   . VAL B 1 229 ? 35.550  -1.060  18.251  1.00 25.78 ? 903 VAL A N   1 
ATOM   3838 C CA  . VAL B 1 229 ? 35.082  -1.545  16.930  1.00 24.75 ? 903 VAL A CA  1 
ATOM   3839 C C   . VAL B 1 229 ? 35.047  -0.377  15.930  1.00 24.48 ? 903 VAL A C   1 
ATOM   3840 O O   . VAL B 1 229 ? 34.381  0.624   16.175  1.00 24.77 ? 903 VAL A O   1 
ATOM   3841 C CB  . VAL B 1 229 ? 33.688  -2.229  17.034  1.00 23.92 ? 903 VAL A CB  1 
ATOM   3842 C CG1 . VAL B 1 229 ? 33.222  -2.771  15.652  1.00 23.64 ? 903 VAL A CG1 1 
ATOM   3843 C CG2 . VAL B 1 229 ? 33.735  -3.378  18.058  1.00 25.54 ? 903 VAL A CG2 1 
ATOM   3844 N N   . GLU B 1 230 ? 35.779  -0.506  14.828  1.00 23.20 ? 904 GLU A N   1 
ATOM   3845 C CA  . GLU B 1 230 ? 35.797  0.503   13.788  1.00 24.00 ? 904 GLU A CA  1 
ATOM   3846 C C   . GLU B 1 230 ? 34.663  0.268   12.808  1.00 21.43 ? 904 GLU A C   1 
ATOM   3847 O O   . GLU B 1 230 ? 34.464  -0.868  12.349  1.00 18.94 ? 904 GLU A O   1 
ATOM   3848 C CB  . GLU B 1 230 ? 37.127  0.502   13.044  1.00 23.32 ? 904 GLU A CB  1 
ATOM   3849 C CG  . GLU B 1 230 ? 38.299  0.920   13.960  1.00 30.89 ? 904 GLU A CG  1 
ATOM   3850 C CD  . GLU B 1 230 ? 39.634  1.002   13.247  1.00 31.80 ? 904 GLU A CD  1 
ATOM   3851 O OE1 . GLU B 1 230 ? 40.115  -0.035  12.708  1.00 41.62 ? 904 GLU A OE1 1 
ATOM   3852 O OE2 . GLU B 1 230 ? 40.223  2.110   13.251  1.00 42.89 ? 904 GLU A OE2 1 
ATOM   3853 N N   . PHE B 1 231 ? 33.959  1.364   12.487  1.00 19.27 ? 905 PHE A N   1 
ATOM   3854 C CA  . PHE B 1 231 ? 32.923  1.387   11.465  1.00 19.62 ? 905 PHE A CA  1 
ATOM   3855 C C   . PHE B 1 231 ? 33.372  2.356   10.365  1.00 18.49 ? 905 PHE A C   1 
ATOM   3856 O O   . PHE B 1 231 ? 33.519  3.563   10.628  1.00 18.62 ? 905 PHE A O   1 
ATOM   3857 C CB  . PHE B 1 231 ? 31.600  1.892   12.048  1.00 19.48 ? 905 PHE A CB  1 
ATOM   3858 C CG  . PHE B 1 231 ? 30.863  0.880   12.874  1.00 20.60 ? 905 PHE A CG  1 
ATOM   3859 C CD1 . PHE B 1 231 ? 31.247  0.630   14.193  1.00 17.69 ? 905 PHE A CD1 1 
ATOM   3860 C CD2 . PHE B 1 231 ? 29.786  0.187   12.340  1.00 18.86 ? 905 PHE A CD2 1 
ATOM   3861 C CE1 . PHE B 1 231 ? 30.574  -0.316  14.963  1.00 19.07 ? 905 PHE A CE1 1 
ATOM   3862 C CE2 . PHE B 1 231 ? 29.119  -0.761  13.096  1.00 21.20 ? 905 PHE A CE2 1 
ATOM   3863 C CZ  . PHE B 1 231 ? 29.524  -1.006  14.439  1.00 19.13 ? 905 PHE A CZ  1 
ATOM   3864 N N   . PRO B 1 232 ? 33.594  1.844   9.145   1.00 17.27 ? 906 PRO A N   1 
ATOM   3865 C CA  . PRO B 1 232 ? 33.957  2.766   8.039   1.00 16.48 ? 906 PRO A CA  1 
ATOM   3866 C C   . PRO B 1 232 ? 32.856  3.739   7.646   1.00 15.33 ? 906 PRO A C   1 
ATOM   3867 O O   . PRO B 1 232 ? 31.671  3.552   8.011   1.00 14.59 ? 906 PRO A O   1 
ATOM   3868 C CB  . PRO B 1 232 ? 34.309  1.814   6.873   1.00 15.57 ? 906 PRO A CB  1 
ATOM   3869 C CG  . PRO B 1 232 ? 34.726  0.510   7.578   1.00 18.08 ? 906 PRO A CG  1 
ATOM   3870 C CD  . PRO B 1 232 ? 33.663  0.436   8.704   1.00 17.79 ? 906 PRO A CD  1 
ATOM   3871 N N   . GLU B 1 233 ? 33.241  4.740   6.858   1.00 15.13 ? 907 GLU A N   1 
ATOM   3872 C CA  . GLU B 1 233 ? 32.369  5.906   6.575   1.00 14.93 ? 907 GLU A CA  1 
ATOM   3873 C C   . GLU B 1 233 ? 31.051  5.638   5.876   1.00 15.18 ? 907 GLU A C   1 
ATOM   3874 O O   . GLU B 1 233 ? 30.010  6.229   6.234   1.00 14.59 ? 907 GLU A O   1 
ATOM   3875 C CB  . GLU B 1 233 ? 33.159  6.995   5.839   1.00 13.51 ? 907 GLU A CB  1 
ATOM   3876 C CG  . GLU B 1 233 ? 34.280  7.551   6.722   1.00 14.04 ? 907 GLU A CG  1 
ATOM   3877 C CD  . GLU B 1 233 ? 33.822  8.339   7.952   1.00 15.62 ? 907 GLU A CD  1 
ATOM   3878 O OE1 . GLU B 1 233 ? 32.680  8.828   8.024   1.00 14.04 ? 907 GLU A OE1 1 
ATOM   3879 O OE2 . GLU B 1 233 ? 34.662  8.499   8.847   1.00 16.80 ? 907 GLU A OE2 1 
ATOM   3880 N N   . MET B 1 234 ? 31.071  4.790   4.856   1.00 14.47 ? 908 MET A N   1 
ATOM   3881 C CA  . MET B 1 234 ? 29.836  4.560   4.126   1.00 15.62 ? 908 MET A CA  1 
ATOM   3882 C C   . MET B 1 234 ? 28.810  3.752   4.922   1.00 16.73 ? 908 MET A C   1 
ATOM   3883 O O   . MET B 1 234 ? 27.617  4.101   4.962   1.00 16.50 ? 908 MET A O   1 
ATOM   3884 C CB  . MET B 1 234 ? 30.114  3.931   2.752   1.00 16.22 ? 908 MET A CB  1 
ATOM   3885 C CG  . MET B 1 234 ? 31.029  4.790   1.831   1.00 15.23 ? 908 MET A CG  1 
ATOM   3886 S SD  . MET B 1 234 ? 31.341  4.048   0.188   1.00 17.78 ? 908 MET A SD  1 
ATOM   3887 C CE  . MET B 1 234 ? 32.312  2.596   0.586   1.00 17.87 ? 908 MET A CE  1 
ATOM   3888 N N   . MET B 1 235 ? 29.277  2.654   5.532   1.00 17.94 ? 909 MET A N   1 
ATOM   3889 C CA  . MET B 1 235 ? 28.526  1.824   6.495   1.00 18.66 ? 909 MET A CA  1 
ATOM   3890 C C   . MET B 1 235 ? 27.932  2.697   7.583   1.00 17.01 ? 909 MET A C   1 
ATOM   3891 O O   . MET B 1 235 ? 26.745  2.602   7.889   1.00 15.34 ? 909 MET A O   1 
ATOM   3892 C CB  . MET B 1 235 ? 29.520  0.858   7.188   1.00 20.56 ? 909 MET A CB  1 
ATOM   3893 C CG  . MET B 1 235 ? 29.966  -0.214  6.316   1.00 25.48 ? 909 MET A CG  1 
ATOM   3894 S SD  . MET B 1 235 ? 28.757  -1.580  6.482   1.00 40.01 ? 909 MET A SD  1 
ATOM   3895 C CE  . MET B 1 235 ? 29.103  -2.000  8.246   1.00 25.35 ? 909 MET A CE  1 
ATOM   3896 N N   . SER B 1 236 ? 28.770  3.564   8.154   1.00 17.07 ? 910 SER A N   1 
ATOM   3897 C CA  . SER B 1 236 ? 28.333  4.460   9.226   1.00 16.92 ? 910 SER A CA  1 
ATOM   3898 C C   . SER B 1 236 ? 27.111  5.309   8.842   1.00 16.65 ? 910 SER A C   1 
ATOM   3899 O O   . SER B 1 236 ? 26.185  5.468   9.630   1.00 16.23 ? 910 SER A O   1 
ATOM   3900 C CB  . SER B 1 236 ? 29.483  5.343   9.734   1.00 17.50 ? 910 SER A CB  1 
ATOM   3901 O OG  . SER B 1 236 ? 30.399  4.593   10.515  1.00 19.41 ? 910 SER A OG  1 
ATOM   3902 N N   . GLU B 1 237 ? 27.111  5.836   7.619   1.00 16.78 ? 911 GLU A N   1 
ATOM   3903 C CA  . GLU B 1 237 ? 26.042  6.703   7.130   1.00 16.30 ? 911 GLU A CA  1 
ATOM   3904 C C   . GLU B 1 237 ? 24.760  5.880   6.977   1.00 16.45 ? 911 GLU A C   1 
ATOM   3905 O O   . GLU B 1 237 ? 23.654  6.320   7.332   1.00 15.46 ? 911 GLU A O   1 
ATOM   3906 C CB  . GLU B 1 237 ? 26.459  7.347   5.791   1.00 16.63 ? 911 GLU A CB  1 
ATOM   3907 C CG  . GLU B 1 237 ? 25.345  8.090   5.094   1.00 20.53 ? 911 GLU A CG  1 
ATOM   3908 C CD  . GLU B 1 237 ? 24.870  9.275   5.893   1.00 25.12 ? 911 GLU A CD  1 
ATOM   3909 O OE1 . GLU B 1 237 ? 25.691  9.849   6.660   1.00 28.55 ? 911 GLU A OE1 1 
ATOM   3910 O OE2 . GLU B 1 237 ? 23.673  9.594   5.776   1.00 27.04 ? 911 GLU A OE2 1 
ATOM   3911 N N   . VAL B 1 238 ? 24.899  4.671   6.459   1.00 15.52 ? 912 VAL A N   1 
ATOM   3912 C CA  . VAL B 1 238 ? 23.724  3.819   6.274   1.00 16.02 ? 912 VAL A CA  1 
ATOM   3913 C C   . VAL B 1 238 ? 23.052  3.494   7.620   1.00 15.65 ? 912 VAL A C   1 
ATOM   3914 O O   . VAL B 1 238 ? 21.805  3.510   7.744   1.00 14.82 ? 912 VAL A O   1 
ATOM   3915 C CB  . VAL B 1 238 ? 24.101  2.530   5.443   1.00 16.84 ? 912 VAL A CB  1 
ATOM   3916 C CG1 . VAL B 1 238 ? 23.104  1.472   5.643   1.00 19.61 ? 912 VAL A CG1 1 
ATOM   3917 C CG2 . VAL B 1 238 ? 24.184  2.904   3.927   1.00 15.48 ? 912 VAL A CG2 1 
ATOM   3918 N N   . ILE B 1 239 ? 23.896  3.181   8.609   1.00 14.34 ? 913 ILE A N   1 
ATOM   3919 C CA  . ILE B 1 239 ? 23.436  2.809   9.934   1.00 15.63 ? 913 ILE A CA  1 
ATOM   3920 C C   . ILE B 1 239 ? 22.759  4.046   10.562  1.00 17.21 ? 913 ILE A C   1 
ATOM   3921 O O   . ILE B 1 239 ? 21.598  3.987   10.972  1.00 17.73 ? 913 ILE A O   1 
ATOM   3922 C CB  . ILE B 1 239 ? 24.582  2.262   10.805  1.00 15.63 ? 913 ILE A CB  1 
ATOM   3923 C CG1 . ILE B 1 239 ? 25.086  0.901   10.259  1.00 13.08 ? 913 ILE A CG1 1 
ATOM   3924 C CG2 . ILE B 1 239 ? 24.136  2.123   12.304  1.00 14.51 ? 913 ILE A CG2 1 
ATOM   3925 C CD1 . ILE B 1 239 ? 26.552  0.561   10.682  1.00 16.66 ? 913 ILE A CD1 1 
ATOM   3926 N N   . ALA B 1 240 ? 23.449  5.184   10.550  1.00 18.26 ? 914 ALA A N   1 
ATOM   3927 C CA  . ALA B 1 240 ? 22.887  6.408   11.142  1.00 19.00 ? 914 ALA A CA  1 
ATOM   3928 C C   . ALA B 1 240 ? 21.624  6.860   10.424  1.00 20.62 ? 914 ALA A C   1 
ATOM   3929 O O   . ALA B 1 240 ? 20.666  7.293   11.071  1.00 22.01 ? 914 ALA A O   1 
ATOM   3930 C CB  . ALA B 1 240 ? 23.936  7.520   11.192  1.00 18.37 ? 914 ALA A CB  1 
ATOM   3931 N N   . ALA B 1 241 ? 21.570  6.735   9.096   1.00 21.15 ? 915 ALA A N   1 
ATOM   3932 C CA  . ALA B 1 241 ? 20.409  7.256   8.366   1.00 20.10 ? 915 ALA A CA  1 
ATOM   3933 C C   . ALA B 1 241 ? 19.112  6.462   8.535   1.00 20.06 ? 915 ALA A C   1 
ATOM   3934 O O   . ALA B 1 241 ? 18.028  7.048   8.558   1.00 20.44 ? 915 ALA A O   1 
ATOM   3935 C CB  . ALA B 1 241 ? 20.718  7.454   6.883   1.00 21.08 ? 915 ALA A CB  1 
ATOM   3936 N N   . GLN B 1 242 ? 19.204  5.144   8.623   1.00 18.51 ? 916 GLN A N   1 
ATOM   3937 C CA  . GLN B 1 242 ? 18.034  4.336   8.538   1.00 19.24 ? 916 GLN A CA  1 
ATOM   3938 C C   . GLN B 1 242 ? 17.823  3.394   9.705   1.00 18.46 ? 916 GLN A C   1 
ATOM   3939 O O   . GLN B 1 242 ? 16.671  2.985   9.896   1.00 19.18 ? 916 GLN A O   1 
ATOM   3940 C CB  . GLN B 1 242 ? 18.050  3.421   7.263   1.00 20.42 ? 916 GLN A CB  1 
ATOM   3941 C CG  . GLN B 1 242 ? 18.076  4.127   5.867   1.00 22.15 ? 916 GLN A CG  1 
ATOM   3942 C CD  . GLN B 1 242 ? 17.023  5.180   5.634   1.00 25.44 ? 916 GLN A CD  1 
ATOM   3943 O OE1 . GLN B 1 242 ? 15.985  5.241   6.291   1.00 26.69 ? 916 GLN A OE1 1 
ATOM   3944 N NE2 . GLN B 1 242 ? 17.294  6.033   4.656   1.00 30.66 ? 916 GLN A NE2 1 
ATOM   3945 N N   . LEU B 1 243 ? 18.879  2.899   10.373  1.00 16.57 ? 917 LEU A N   1 
ATOM   3946 C CA  . LEU B 1 243 ? 18.618  1.775   11.333  1.00 16.35 ? 917 LEU A CA  1 
ATOM   3947 C C   . LEU B 1 243 ? 17.650  2.090   12.475  1.00 16.17 ? 917 LEU A C   1 
ATOM   3948 O O   . LEU B 1 243 ? 16.762  1.265   12.772  1.00 16.97 ? 917 LEU A O   1 
ATOM   3949 C CB  . LEU B 1 243 ? 19.874  1.040   11.870  1.00 15.10 ? 917 LEU A CB  1 
ATOM   3950 C CG  . LEU B 1 243 ? 20.691  0.156   10.922  1.00 17.47 ? 917 LEU A CG  1 
ATOM   3951 C CD1 . LEU B 1 243 ? 21.627  -0.843  11.625  1.00 12.36 ? 917 LEU A CD1 1 
ATOM   3952 C CD2 . LEU B 1 243 ? 19.808  -0.539  9.962   1.00 17.70 ? 917 LEU A CD2 1 
ATOM   3953 N N   . PRO B 1 244 ? 17.805  3.262   13.134  1.00 16.31 ? 918 PRO A N   1 
ATOM   3954 C CA  . PRO B 1 244 ? 16.820  3.565   14.187  1.00 16.45 ? 918 PRO A CA  1 
ATOM   3955 C C   . PRO B 1 244 ? 15.361  3.541   13.662  1.00 16.63 ? 918 PRO A C   1 
ATOM   3956 O O   . PRO B 1 244 ? 14.506  2.902   14.246  1.00 14.87 ? 918 PRO A O   1 
ATOM   3957 C CB  . PRO B 1 244 ? 17.253  4.958   14.661  1.00 17.03 ? 918 PRO A CB  1 
ATOM   3958 C CG  . PRO B 1 244 ? 18.770  4.922   14.464  1.00 15.50 ? 918 PRO A CG  1 
ATOM   3959 C CD  . PRO B 1 244 ? 18.832  4.317   13.052  1.00 16.58 ? 918 PRO A CD  1 
ATOM   3960 N N   . LYS B 1 245 ? 15.113  4.207   12.539  1.00 16.20 ? 919 LYS A N   1 
ATOM   3961 C CA  . LYS B 1 245 ? 13.798  4.232   11.877  1.00 16.99 ? 919 LYS A CA  1 
ATOM   3962 C C   . LYS B 1 245 ? 13.278  2.840   11.477  1.00 16.00 ? 919 LYS A C   1 
ATOM   3963 O O   . LYS B 1 245 ? 12.103  2.522   11.698  1.00 16.39 ? 919 LYS A O   1 
ATOM   3964 C CB  . LYS B 1 245 ? 13.925  5.120   10.634  1.00 18.49 ? 919 LYS A CB  1 
ATOM   3965 C CG  . LYS B 1 245 ? 12.734  5.109   9.685   1.00 23.05 ? 919 LYS A CG  1 
ATOM   3966 C CD  . LYS B 1 245 ? 13.140  5.565   8.316   1.00 29.77 ? 919 LYS A CD  1 
ATOM   3967 C CE  . LYS B 1 245 ? 13.510  7.044   8.356   1.00 35.37 ? 919 LYS A CE  1 
ATOM   3968 N NZ  . LYS B 1 245 ? 14.598  7.324   7.358   1.00 39.57 ? 919 LYS A NZ  1 
ATOM   3969 N N   . ILE B 1 246 ? 14.145  2.019   10.868  1.00 14.95 ? 920 ILE A N   1 
ATOM   3970 C CA  . ILE B 1 246 ? 13.789  0.626   10.562  1.00 15.19 ? 920 ILE A CA  1 
ATOM   3971 C C   . ILE B 1 246 ? 13.413  -0.182  11.832  1.00 15.49 ? 920 ILE A C   1 
ATOM   3972 O O   . ILE B 1 246 ? 12.343  -0.771  11.926  1.00 17.45 ? 920 ILE A O   1 
ATOM   3973 C CB  . ILE B 1 246 ? 14.932  -0.084  9.776   1.00 14.86 ? 920 ILE A CB  1 
ATOM   3974 C CG1 . ILE B 1 246 ? 15.133  0.612   8.409   1.00 14.33 ? 920 ILE A CG1 1 
ATOM   3975 C CG2 . ILE B 1 246 ? 14.532  -1.557  9.515   1.00 15.21 ? 920 ILE A CG2 1 
ATOM   3976 C CD1 . ILE B 1 246 ? 16.386  0.187   7.641   1.00 14.59 ? 920 ILE A CD1 1 
ATOM   3977 N N   . LEU B 1 247 ? 14.290  -0.177  12.827  1.00 16.13 ? 921 LEU A N   1 
ATOM   3978 C CA  . LEU B 1 247 ? 14.028  -0.890  14.093  1.00 15.48 ? 921 LEU A CA  1 
ATOM   3979 C C   . LEU B 1 247 ? 12.761  -0.412  14.798  1.00 16.52 ? 921 LEU A C   1 
ATOM   3980 O O   . LEU B 1 247 ? 12.011  -1.230  15.380  1.00 16.18 ? 921 LEU A O   1 
ATOM   3981 C CB  . LEU B 1 247 ? 15.231  -0.738  15.013  1.00 14.80 ? 921 LEU A CB  1 
ATOM   3982 C CG  . LEU B 1 247 ? 16.468  -1.573  14.583  1.00 18.01 ? 921 LEU A CG  1 
ATOM   3983 C CD1 . LEU B 1 247 ? 17.694  -1.191  15.398  1.00 17.65 ? 921 LEU A CD1 1 
ATOM   3984 C CD2 . LEU B 1 247 ? 16.210  -3.104  14.651  1.00 18.09 ? 921 LEU A CD2 1 
ATOM   3985 N N   . ALA B 1 248 ? 12.532  0.899   14.765  1.00 16.38 ? 922 ALA A N   1 
ATOM   3986 C CA  . ALA B 1 248 ? 11.272  1.484   15.267  1.00 18.41 ? 922 ALA A CA  1 
ATOM   3987 C C   . ALA B 1 248 ? 10.019  1.117   14.455  1.00 19.40 ? 922 ALA A C   1 
ATOM   3988 O O   . ALA B 1 248 ? 8.928   1.582   14.755  1.00 19.35 ? 922 ALA A O   1 
ATOM   3989 C CB  . ALA B 1 248 ? 11.414  3.022   15.372  1.00 17.27 ? 922 ALA A CB  1 
ATOM   3990 N N   . GLY B 1 249 ? 10.161  0.302   13.404  1.00 19.47 ? 923 GLY A N   1 
ATOM   3991 C CA  . GLY B 1 249 ? 8.999   -0.084  12.601  1.00 19.86 ? 923 GLY A CA  1 
ATOM   3992 C C   . GLY B 1 249 ? 8.447   1.029   11.726  1.00 20.22 ? 923 GLY A C   1 
ATOM   3993 O O   . GLY B 1 249 ? 7.294   0.999   11.327  1.00 21.80 ? 923 GLY A O   1 
ATOM   3994 N N   . MET B 1 250 ? 9.254   2.027   11.419  1.00 20.50 ? 924 MET A N   1 
ATOM   3995 C CA  . MET B 1 250 ? 8.755   3.163   10.657  1.00 20.56 ? 924 MET A CA  1 
ATOM   3996 C C   . MET B 1 250 ? 8.977   3.026   9.139   1.00 19.42 ? 924 MET A C   1 
ATOM   3997 O O   . MET B 1 250 ? 9.307   3.988   8.480   1.00 20.47 ? 924 MET A O   1 
ATOM   3998 C CB  . MET B 1 250 ? 9.367   4.434   11.219  1.00 21.26 ? 924 MET A CB  1 
ATOM   3999 C CG  . MET B 1 250 ? 9.199   4.502   12.749  1.00 24.77 ? 924 MET A CG  1 
ATOM   4000 S SD  . MET B 1 250 ? 7.447   4.596   13.214  1.00 34.31 ? 924 MET A SD  1 
ATOM   4001 C CE  . MET B 1 250 ? 7.106   6.188   12.439  1.00 29.06 ? 924 MET A CE  1 
ATOM   4002 N N   . VAL B 1 251 ? 8.813   1.805   8.635   1.00 19.53 ? 925 VAL A N   1 
ATOM   4003 C CA  . VAL B 1 251 ? 8.912   1.405   7.227   1.00 18.46 ? 925 VAL A CA  1 
ATOM   4004 C C   . VAL B 1 251 ? 7.921   0.269   7.025   1.00 19.27 ? 925 VAL A C   1 
ATOM   4005 O O   . VAL B 1 251 ? 7.418   -0.315  8.007   1.00 17.90 ? 925 VAL A O   1 
ATOM   4006 C CB  . VAL B 1 251 ? 10.348  0.866   6.839   1.00 19.33 ? 925 VAL A CB  1 
ATOM   4007 C CG1 . VAL B 1 251 ? 11.434  1.953   7.021   1.00 17.70 ? 925 VAL A CG1 1 
ATOM   4008 C CG2 . VAL B 1 251 ? 10.734  -0.454  7.594   1.00 18.05 ? 925 VAL A CG2 1 
ATOM   4009 N N   . LYS B 1 252 ? 7.653   -0.059  5.757   1.00 19.12 ? 926 LYS A N   1 
ATOM   4010 C CA  . LYS B 1 252 ? 6.724   -1.122  5.410   1.00 20.26 ? 926 LYS A CA  1 
ATOM   4011 C C   . LYS B 1 252 ? 7.452   -2.315  4.784   1.00 20.64 ? 926 LYS A C   1 
ATOM   4012 O O   . LYS B 1 252 ? 7.820   -2.259  3.599   1.00 19.80 ? 926 LYS A O   1 
ATOM   4013 C CB  . LYS B 1 252 ? 5.700   -0.605  4.402   1.00 20.52 ? 926 LYS A CB  1 
ATOM   4014 C CG  . LYS B 1 252 ? 4.674   -1.665  4.032   1.00 24.16 ? 926 LYS A CG  1 
ATOM   4015 C CD  . LYS B 1 252 ? 3.776   -1.250  2.868   1.00 27.83 ? 926 LYS A CD  1 
ATOM   4016 C CE  . LYS B 1 252 ? 2.751   -2.370  2.644   1.00 32.24 ? 926 LYS A CE  1 
ATOM   4017 N NZ  . LYS B 1 252 ? 1.851   -2.046  1.524   1.00 34.55 ? 926 LYS A NZ  1 
ATOM   4018 N N   . PRO B 1 253 ? 7.636   -3.411  5.557   1.00 21.84 ? 927 PRO A N   1 
ATOM   4019 C CA  . PRO B 1 253 ? 8.233   -4.608  4.979   1.00 21.83 ? 927 PRO A CA  1 
ATOM   4020 C C   . PRO B 1 253 ? 7.185   -5.259  4.092   1.00 21.97 ? 927 PRO A C   1 
ATOM   4021 O O   . PRO B 1 253 ? 6.001   -5.283  4.446   1.00 21.92 ? 927 PRO A O   1 
ATOM   4022 C CB  . PRO B 1 253 ? 8.525   -5.498  6.194   1.00 22.10 ? 927 PRO A CB  1 
ATOM   4023 C CG  . PRO B 1 253 ? 8.273   -4.606  7.421   1.00 24.50 ? 927 PRO A CG  1 
ATOM   4024 C CD  . PRO B 1 253 ? 7.297   -3.594  6.979   1.00 21.37 ? 927 PRO A CD  1 
ATOM   4025 N N   . LEU B 1 254 ? 7.603   -5.763  2.939   1.00 20.46 ? 928 LEU A N   1 
ATOM   4026 C CA  . LEU B 1 254 ? 6.670   -6.366  2.025   1.00 20.56 ? 928 LEU A CA  1 
ATOM   4027 C C   . LEU B 1 254 ? 6.647   -7.874  2.283   1.00 20.75 ? 928 LEU A C   1 
ATOM   4028 O O   . LEU B 1 254 ? 7.675   -8.502  2.525   1.00 20.16 ? 928 LEU A O   1 
ATOM   4029 C CB  . LEU B 1 254 ? 7.046   -6.024  0.553   1.00 20.22 ? 928 LEU A CB  1 
ATOM   4030 C CG  . LEU B 1 254 ? 7.046   -4.534  0.183   1.00 18.73 ? 928 LEU A CG  1 
ATOM   4031 C CD1 . LEU B 1 254 ? 7.402   -4.317  -1.327  1.00 19.33 ? 928 LEU A CD1 1 
ATOM   4032 C CD2 . LEU B 1 254 ? 5.703   -3.834  0.459   1.00 18.81 ? 928 LEU A CD2 1 
ATOM   4033 N N   . LEU B 1 255 ? 5.456   -8.446  2.238   1.00 21.10 ? 929 LEU A N   1 
ATOM   4034 C CA  . LEU B 1 255 ? 5.266   -9.860  2.498   1.00 20.92 ? 929 LEU A CA  1 
ATOM   4035 C C   . LEU B 1 255 ? 4.512   -10.518 1.350   1.00 22.45 ? 929 LEU A C   1 
ATOM   4036 O O   . LEU B 1 255 ? 3.519   -9.974  0.820   1.00 21.66 ? 929 LEU A O   1 
ATOM   4037 C CB  . LEU B 1 255 ? 4.478   -10.054 3.802   1.00 20.63 ? 929 LEU A CB  1 
ATOM   4038 C CG  . LEU B 1 255 ? 5.018   -9.508  5.115   1.00 20.05 ? 929 LEU A CG  1 
ATOM   4039 C CD1 . LEU B 1 255 ? 3.976   -9.691  6.239   1.00 22.36 ? 929 LEU A CD1 1 
ATOM   4040 C CD2 . LEU B 1 255 ? 6.312   -10.238 5.444   1.00 16.60 ? 929 LEU A CD2 1 
ATOM   4041 N N   . PHE B 1 256 ? 4.990   -11.700 0.978   1.00 22.71 ? 930 PHE A N   1 
ATOM   4042 C CA  . PHE B 1 256 ? 4.265   -12.551 0.054   1.00 25.50 ? 930 PHE A CA  1 
ATOM   4043 C C   . PHE B 1 256 ? 3.093   -13.314 0.679   1.00 27.03 ? 930 PHE A C   1 
ATOM   4044 O O   . PHE B 1 256 ? 2.149   -13.652 -0.033  1.00 28.49 ? 930 PHE A O   1 
ATOM   4045 C CB  . PHE B 1 256 ? 5.212   -13.544 -0.573  1.00 24.72 ? 930 PHE A CB  1 
ATOM   4046 C CG  . PHE B 1 256 ? 6.213   -12.913 -1.474  1.00 25.07 ? 930 PHE A CG  1 
ATOM   4047 C CD1 . PHE B 1 256 ? 5.943   -12.771 -2.822  1.00 24.51 ? 930 PHE A CD1 1 
ATOM   4048 C CD2 . PHE B 1 256 ? 7.421   -12.467 -0.972  1.00 23.23 ? 930 PHE A CD2 1 
ATOM   4049 C CE1 . PHE B 1 256 ? 6.883   -12.198 -3.666  1.00 26.44 ? 930 PHE A CE1 1 
ATOM   4050 C CE2 . PHE B 1 256 ? 8.355   -11.867 -1.799  1.00 25.65 ? 930 PHE A CE2 1 
ATOM   4051 C CZ  . PHE B 1 256 ? 8.093   -11.746 -3.152  1.00 24.42 ? 930 PHE A CZ  1 
ATOM   4052 N N   . HIS B 1 257 ? 3.174   -13.609 1.972   1.00 28.12 ? 931 HIS A N   1 
ATOM   4053 C CA  . HIS B 1 257 ? 2.145   -14.379 2.665   1.00 30.91 ? 931 HIS A CA  1 
ATOM   4054 C C   . HIS B 1 257 ? 1.651   -13.652 3.899   1.00 33.11 ? 931 HIS A C   1 
ATOM   4055 O O   . HIS B 1 257 ? 2.379   -12.883 4.509   1.00 33.08 ? 931 HIS A O   1 
ATOM   4056 C CB  . HIS B 1 257 ? 2.689   -15.757 3.045   1.00 29.94 ? 931 HIS A CB  1 
ATOM   4057 C CG  . HIS B 1 257 ? 3.370   -16.451 1.913   1.00 30.11 ? 931 HIS A CG  1 
ATOM   4058 N ND1 . HIS B 1 257 ? 2.690   -16.913 0.803   1.00 28.47 ? 931 HIS A ND1 1 
ATOM   4059 C CD2 . HIS B 1 257 ? 4.682   -16.682 1.678   1.00 27.57 ? 931 HIS A CD2 1 
ATOM   4060 C CE1 . HIS B 1 257 ? 3.555   -17.431 -0.048  1.00 29.28 ? 931 HIS A CE1 1 
ATOM   4061 N NE2 . HIS B 1 257 ? 4.770   -17.310 0.463   1.00 28.72 ? 931 HIS A NE2 1 
ATOM   4062 N N   . LYS B 1 258 ? 0.408   -13.902 4.284   1.00 36.82 ? 932 LYS A N   1 
ATOM   4063 C CA  . LYS B 1 258 ? -0.181  -13.193 5.443   1.00 40.05 ? 932 LYS A CA  1 
ATOM   4064 C C   . LYS B 1 258 ? 0.380   -13.630 6.806   1.00 40.86 ? 932 LYS A C   1 
ATOM   4065 O O   . LYS B 1 258 ? 0.882   -14.749 6.971   1.00 41.35 ? 932 LYS A O   1 
ATOM   4066 C CB  . LYS B 1 258 ? -1.720  -13.257 5.412   1.00 40.70 ? 932 LYS A CB  1 
ATOM   4067 C CG  . LYS B 1 258 ? -2.250  -14.526 4.826   1.00 42.29 ? 932 LYS A CG  1 
ATOM   4068 C CD  . LYS B 1 258 ? -3.441  -14.261 3.906   1.00 46.96 ? 932 LYS A CD  1 
ATOM   4069 C CE  . LYS B 1 258 ? -3.717  -15.473 2.986   1.00 48.70 ? 932 LYS A CE  1 
ATOM   4070 N NZ  . LYS B 1 258 ? -3.637  -16.800 3.710   1.00 49.95 ? 932 LYS A NZ  1 
HETATM 4071 C C1  . T98 C 2 .   ? 13.917  16.387  23.117  1.00 21.90 ? 202 T98 B C1  1 
HETATM 4072 C C2  . T98 C 2 .   ? 14.157  14.914  23.541  1.00 24.79 ? 202 T98 B C2  1 
HETATM 4073 C C3  . T98 C 2 .   ? 14.432  14.891  25.027  1.00 22.57 ? 202 T98 B C3  1 
HETATM 4074 C C4  . T98 C 2 .   ? 13.422  15.041  26.009  1.00 23.53 ? 202 T98 B C4  1 
HETATM 4075 C C5  . T98 C 2 .   ? 13.722  15.026  27.376  1.00 22.85 ? 202 T98 B C5  1 
HETATM 4076 C C6  . T98 C 2 .   ? 15.053  14.941  27.795  1.00 23.69 ? 202 T98 B C6  1 
HETATM 4077 C C7  . T98 C 2 .   ? 16.076  14.805  26.857  1.00 24.60 ? 202 T98 B C7  1 
HETATM 4078 C C8  . T98 C 2 .   ? 15.754  14.777  25.495  1.00 24.79 ? 202 T98 B C8  1 
HETATM 4079 N N1  . T98 C 2 .   ? 16.800  14.639  24.600  1.00 25.96 ? 202 T98 B N1  1 
HETATM 4080 C C9  . T98 C 2 .   ? 16.579  14.608  23.248  1.00 25.50 ? 202 T98 B C9  1 
HETATM 4081 S S1  . T98 C 2 .   ? 17.771  14.499  22.145  1.00 23.79 ? 202 T98 B S1  1 
HETATM 4082 O O1  . T98 C 2 .   ? 15.349  14.666  22.725  1.00 25.60 ? 202 T98 B O1  1 
HETATM 4083 C C10 . T98 C 2 .   ? 12.612  15.264  28.298  1.00 24.03 ? 202 T98 B C10 1 
HETATM 4084 C C11 . T98 C 2 .   ? 11.238  14.977  28.164  1.00 20.97 ? 202 T98 B C11 1 
HETATM 4085 C C12 . T98 C 2 .   ? 10.596  15.569  29.283  1.00 21.81 ? 202 T98 B C12 1 
HETATM 4086 C C13 . T98 C 2 .   ? 11.550  16.199  30.047  1.00 19.24 ? 202 T98 B C13 1 
HETATM 4087 N N2  . T98 C 2 .   ? 12.778  16.051  29.444  1.00 21.24 ? 202 T98 B N2  1 
HETATM 4088 C C14 . T98 C 2 .   ? 14.021  16.625  30.004  1.00 16.79 ? 202 T98 B C14 1 
HETATM 4089 C C15 . T98 C 2 .   ? 11.396  16.905  31.261  1.00 21.76 ? 202 T98 B C15 1 
HETATM 4090 N N3  . T98 C 2 .   ? 11.332  17.504  32.239  1.00 23.21 ? 202 T98 B N3  1 
HETATM 4091 C C16 . T98 C 2 .   ? 13.061  13.970  23.037  1.00 22.83 ? 202 T98 B C16 1 
HETATM 4092 S S   . SO4 D 3 .   ? 17.378  -1.292  -18.005 1.00 28.71 ? 203 SO4 A S   1 
HETATM 4093 O O1  . SO4 D 3 .   ? 18.493  -2.263  -18.082 1.00 31.99 ? 203 SO4 A O1  1 
HETATM 4094 O O2  . SO4 D 3 .   ? 17.445  -0.568  -16.759 1.00 28.93 ? 203 SO4 A O2  1 
HETATM 4095 O O3  . SO4 D 3 .   ? 17.649  -0.506  -19.162 1.00 29.01 ? 203 SO4 A O3  1 
HETATM 4096 O O4  . SO4 D 3 .   ? 16.125  -2.002  -18.106 1.00 32.13 ? 203 SO4 A O4  1 
HETATM 4097 C C1  . T98 E 2 .   ? 27.910  -8.707  13.244  1.00 28.58 ? 201 T98 A C1  1 
HETATM 4098 C C2  . T98 E 2 .   ? 27.042  -7.601  12.615  1.00 25.83 ? 201 T98 A C2  1 
HETATM 4099 C C3  . T98 E 2 .   ? 27.507  -7.303  11.213  1.00 25.27 ? 201 T98 A C3  1 
HETATM 4100 C C4  . T98 E 2 .   ? 27.266  -8.182  10.147  1.00 25.47 ? 201 T98 A C4  1 
HETATM 4101 C C5  . T98 E 2 .   ? 27.717  -7.883  8.851   1.00 25.39 ? 201 T98 A C5  1 
HETATM 4102 C C6  . T98 E 2 .   ? 28.462  -6.716  8.606   1.00 25.49 ? 201 T98 A C6  1 
HETATM 4103 C C7  . T98 E 2 .   ? 28.708  -5.839  9.662   1.00 26.92 ? 201 T98 A C7  1 
HETATM 4104 C C8  . T98 E 2 .   ? 28.211  -6.131  10.945  1.00 25.38 ? 201 T98 A C8  1 
HETATM 4105 N N1  . T98 E 2 .   ? 28.459  -5.227  11.978  1.00 27.42 ? 201 T98 A N1  1 
HETATM 4106 C C9  . T98 E 2 .   ? 28.047  -5.456  13.267  1.00 27.13 ? 201 T98 A C9  1 
HETATM 4107 S S1  . T98 E 2 .   ? 28.371  -4.444  14.511  1.00 27.66 ? 201 T98 A S1  1 
HETATM 4108 O O1  . T98 E 2 .   ? 27.336  -6.559  13.575  1.00 27.00 ? 201 T98 A O1  1 
HETATM 4109 C C10 . T98 E 2 .   ? 27.452  -8.903  7.837   1.00 24.91 ? 201 T98 A C10 1 
HETATM 4110 C C11 . T98 E 2 .   ? 26.397  -9.809  7.755   1.00 20.67 ? 201 T98 A C11 1 
HETATM 4111 C C12 . T98 E 2 .   ? 26.674  -10.627 6.638   1.00 23.67 ? 201 T98 A C12 1 
HETATM 4112 C C13 . T98 E 2 .   ? 27.881  -10.238 6.108   1.00 20.15 ? 201 T98 A C13 1 
HETATM 4113 N N2  . T98 E 2 .   ? 28.341  -9.182  6.832   1.00 21.84 ? 201 T98 A N2  1 
HETATM 4114 C C14 . T98 E 2 .   ? 29.638  -8.545  6.551   1.00 18.91 ? 201 T98 A C14 1 
HETATM 4115 C C15 . T98 E 2 .   ? 28.595  -10.745 4.986   1.00 23.55 ? 201 T98 A C15 1 
HETATM 4116 N N3  . T98 E 2 .   ? 29.216  -11.142 4.084   1.00 24.16 ? 201 T98 A N3  1 
HETATM 4117 C C16 . T98 E 2 .   ? 25.547  -7.914  12.653  1.00 25.66 ? 201 T98 A C16 1 
HETATM 4118 O O   . HOH F 4 .   ? 9.843   -0.160  33.311  1.00 13.81 ? 1   HOH B O   1 
HETATM 4119 O O   . HOH F 4 .   ? 2.048   29.117  25.393  1.00 18.63 ? 3   HOH B O   1 
HETATM 4120 O O   . HOH F 4 .   ? 13.285  5.633   28.621  1.00 19.65 ? 6   HOH B O   1 
HETATM 4121 O O   . HOH F 4 .   ? 13.202  1.428   47.657  1.00 12.95 ? 7   HOH B O   1 
HETATM 4122 O O   . HOH F 4 .   ? 12.917  -0.359  56.870  1.00 17.27 ? 10  HOH B O   1 
HETATM 4123 O O   . HOH F 4 .   ? 10.300  23.250  14.406  1.00 23.70 ? 13  HOH B O   1 
HETATM 4124 O O   . HOH F 4 .   ? -7.537  -1.136  46.157  1.00 17.73 ? 15  HOH B O   1 
HETATM 4125 O O   . HOH F 4 .   ? 10.482  5.422   28.982  1.00 14.56 ? 16  HOH B O   1 
HETATM 4126 O O   . HOH F 4 .   ? 8.927   1.446   31.384  1.00 19.25 ? 17  HOH B O   1 
HETATM 4127 O O   . HOH F 4 .   ? 0.484   -1.766  32.107  1.00 25.53 ? 18  HOH B O   1 
HETATM 4128 O O   . HOH F 4 .   ? 3.101   31.697  22.888  1.00 21.59 ? 21  HOH B O   1 
HETATM 4129 O O   . HOH F 4 .   ? 10.075  15.496  34.694  1.00 16.08 ? 22  HOH B O   1 
HETATM 4130 O O   . HOH F 4 .   ? 5.336   8.907   42.529  1.00 14.63 ? 24  HOH B O   1 
HETATM 4131 O O   . HOH F 4 .   ? 12.960  28.615  20.658  1.00 21.72 ? 25  HOH B O   1 
HETATM 4132 O O   . HOH F 4 .   ? -4.580  17.286  43.692  1.00 25.57 ? 26  HOH B O   1 
HETATM 4133 O O   . HOH F 4 .   ? 9.680   3.335   22.854  1.00 13.24 ? 27  HOH B O   1 
HETATM 4134 O O   . HOH F 4 .   ? 7.509   21.306  40.907  1.00 36.53 ? 30  HOH B O   1 
HETATM 4135 O O   . HOH F 4 .   ? -1.539  -0.731  48.086  1.00 17.04 ? 33  HOH B O   1 
HETATM 4136 O O   . HOH F 4 .   ? 3.415   -1.453  48.987  1.00 33.10 ? 34  HOH B O   1 
HETATM 4137 O O   . HOH F 4 .   ? 11.526  20.765  38.915  1.00 35.97 ? 36  HOH B O   1 
HETATM 4138 O O   . HOH F 4 .   ? 9.181   1.221   21.451  1.00 23.95 ? 37  HOH B O   1 
HETATM 4139 O O   . HOH F 4 .   ? -1.704  3.189   51.955  1.00 19.46 ? 38  HOH B O   1 
HETATM 4140 O O   . HOH F 4 .   ? -11.137 22.889  35.695  1.00 30.82 ? 39  HOH B O   1 
HETATM 4141 O O   . HOH F 4 .   ? 18.297  30.334  24.990  1.00 40.80 ? 42  HOH B O   1 
HETATM 4142 O O   . HOH F 4 .   ? 14.012  -7.878  26.739  1.00 20.74 ? 43  HOH B O   1 
HETATM 4143 O O   . HOH F 4 .   ? 2.751   -1.188  35.504  1.00 28.58 ? 44  HOH B O   1 
HETATM 4144 O O   . HOH F 4 .   ? 17.955  16.707  16.984  1.00 22.67 ? 47  HOH B O   1 
HETATM 4145 O O   . HOH F 4 .   ? 12.727  29.643  30.400  1.00 30.83 ? 48  HOH B O   1 
HETATM 4146 O O   . HOH F 4 .   ? -0.711  -9.768  42.165  1.00 27.72 ? 50  HOH B O   1 
HETATM 4147 O O   . HOH F 4 .   ? -0.486  29.865  21.587  1.00 18.17 ? 51  HOH B O   1 
HETATM 4148 O O   . HOH F 4 .   ? 18.410  -2.513  46.954  1.00 27.43 ? 52  HOH B O   1 
HETATM 4149 O O   . HOH F 4 .   ? 8.690   0.752   27.117  1.00 29.77 ? 53  HOH B O   1 
HETATM 4150 O O   . HOH F 4 .   ? 12.618  20.271  36.375  1.00 14.13 ? 55  HOH B O   1 
HETATM 4151 O O   . HOH F 4 .   ? -8.033  11.410  43.613  1.00 22.02 ? 56  HOH B O   1 
HETATM 4152 O O   . HOH F 4 .   ? -11.530 3.615   43.231  1.00 25.77 ? 57  HOH B O   1 
HETATM 4153 O O   . HOH F 4 .   ? 28.031  11.969  16.956  1.00 23.21 ? 60  HOH B O   1 
HETATM 4154 O O   . HOH F 4 .   ? -22.267 4.183   40.763  1.00 30.89 ? 61  HOH B O   1 
HETATM 4155 O O   . HOH F 4 .   ? 22.469  24.843  26.579  1.00 17.21 ? 62  HOH B O   1 
HETATM 4156 O O   . HOH F 4 .   ? 28.485  13.860  32.634  1.00 27.49 ? 63  HOH B O   1 
HETATM 4157 O O   . HOH F 4 .   ? 1.601   -7.029  38.705  1.00 23.71 ? 64  HOH B O   1 
HETATM 4158 O O   . HOH F 4 .   ? 6.134   32.989  28.847  1.00 45.15 ? 65  HOH B O   1 
HETATM 4159 O O   . HOH F 4 .   ? 7.473   3.487   24.497  1.00 23.10 ? 66  HOH B O   1 
HETATM 4160 O O   . HOH F 4 .   ? 27.962  10.582  25.089  1.00 33.39 ? 67  HOH B O   1 
HETATM 4161 O O   . HOH F 4 .   ? 1.986   13.149  18.226  1.00 30.95 ? 72  HOH B O   1 
HETATM 4162 O O   . HOH F 4 .   ? 24.293  27.522  20.766  1.00 26.98 ? 73  HOH B O   1 
HETATM 4163 O O   . HOH F 4 .   ? 13.522  11.584  46.712  1.00 22.39 ? 74  HOH B O   1 
HETATM 4164 O O   . HOH F 4 .   ? -3.783  1.886   53.153  1.00 20.51 ? 75  HOH B O   1 
HETATM 4165 O O   . HOH F 4 .   ? 8.361   20.438  13.678  1.00 28.59 ? 77  HOH B O   1 
HETATM 4166 O O   . HOH F 4 .   ? 23.713  15.402  11.525  1.00 33.59 ? 80  HOH B O   1 
HETATM 4167 O O   . HOH F 4 .   ? -5.110  -2.178  21.305  1.00 46.28 ? 82  HOH B O   1 
HETATM 4168 O O   . HOH F 4 .   ? 7.417   3.524   31.615  1.00 20.03 ? 88  HOH B O   1 
HETATM 4169 O O   . HOH F 4 .   ? 7.859   -6.316  46.278  1.00 30.53 ? 89  HOH B O   1 
HETATM 4170 O O   . HOH F 4 .   ? 23.689  18.277  28.125  1.00 29.92 ? 91  HOH B O   1 
HETATM 4171 O O   . HOH F 4 .   ? 8.736   30.788  26.777  1.00 22.00 ? 92  HOH B O   1 
HETATM 4172 O O   . HOH F 4 .   ? 21.083  9.838   42.801  1.00 22.67 ? 93  HOH B O   1 
HETATM 4173 O O   . HOH F 4 .   ? 4.300   -12.655 42.760  1.00 32.81 ? 95  HOH B O   1 
HETATM 4174 O O   . HOH F 4 .   ? 17.807  0.705   51.861  1.00 24.41 ? 97  HOH B O   1 
HETATM 4175 O O   . HOH F 4 .   ? 21.677  3.637   34.534  1.00 26.91 ? 99  HOH B O   1 
HETATM 4176 O O   . HOH F 4 .   ? -12.571 -0.676  35.297  1.00 37.02 ? 101 HOH B O   1 
HETATM 4177 O O   . HOH F 4 .   ? 9.910   18.276  15.674  1.00 26.82 ? 102 HOH B O   1 
HETATM 4178 O O   . HOH F 4 .   ? -20.711 6.706   40.201  1.00 29.07 ? 103 HOH B O   1 
HETATM 4179 O O   . HOH F 4 .   ? 17.234  3.798   27.760  1.00 22.90 ? 104 HOH B O   1 
HETATM 4180 O O   . HOH F 4 .   ? 12.213  31.190  32.899  1.00 41.01 ? 105 HOH B O   1 
HETATM 4181 O O   . HOH F 4 .   ? 0.622   0.631   30.218  1.00 16.77 ? 108 HOH B O   1 
HETATM 4182 O O   . HOH F 4 .   ? 9.883   10.289  39.689  1.00 37.51 ? 109 HOH B O   1 
HETATM 4183 O O   . HOH F 4 .   ? 4.987   -13.381 36.824  1.00 24.30 ? 110 HOH B O   1 
HETATM 4184 O O   . HOH F 4 .   ? 24.175  -0.008  32.315  1.00 36.53 ? 111 HOH B O   1 
HETATM 4185 O O   . HOH F 4 .   ? 7.644   3.223   27.378  1.00 27.59 ? 112 HOH B O   1 
HETATM 4186 O O   . HOH F 4 .   ? -13.147 10.862  35.217  1.00 34.09 ? 113 HOH B O   1 
HETATM 4187 O O   . HOH F 4 .   ? 14.363  10.764  48.975  1.00 24.00 ? 114 HOH B O   1 
HETATM 4188 O O   . HOH F 4 .   ? 9.652   12.676  37.119  1.00 33.77 ? 115 HOH B O   1 
HETATM 4189 O O   . HOH F 4 .   ? -4.390  0.060   25.622  1.00 27.04 ? 116 HOH B O   1 
HETATM 4190 O O   . HOH F 4 .   ? 9.850   22.787  39.524  1.00 29.42 ? 118 HOH B O   1 
HETATM 4191 O O   . HOH F 4 .   ? 15.529  -4.097  52.593  1.00 28.15 ? 119 HOH B O   1 
HETATM 4192 O O   . HOH F 4 .   ? 3.071   16.574  16.802  1.00 23.93 ? 121 HOH B O   1 
HETATM 4193 O O   . HOH F 4 .   ? 14.566  12.601  44.557  1.00 25.31 ? 124 HOH B O   1 
HETATM 4194 O O   . HOH F 4 .   ? 4.171   16.162  43.463  1.00 39.00 ? 125 HOH B O   1 
HETATM 4195 O O   . HOH F 4 .   ? 7.363   25.859  12.996  1.00 36.16 ? 126 HOH B O   1 
HETATM 4196 O O   . HOH F 4 .   ? 6.739   10.018  44.797  1.00 16.44 ? 129 HOH B O   1 
HETATM 4197 O O   . HOH F 4 .   ? 22.024  24.751  16.930  1.00 25.51 ? 131 HOH B O   1 
HETATM 4198 O O   . HOH F 4 .   ? 27.693  13.280  14.352  1.00 24.04 ? 134 HOH B O   1 
HETATM 4199 O O   . HOH F 4 .   ? 17.335  1.960   49.527  1.00 21.09 ? 137 HOH B O   1 
HETATM 4200 O O   . HOH F 4 .   ? 16.992  6.836   11.697  1.00 28.77 ? 145 HOH B O   1 
HETATM 4201 O O   . HOH F 4 .   ? 3.303   3.888   29.604  1.00 31.91 ? 146 HOH B O   1 
HETATM 4202 O O   . HOH F 4 .   ? 13.445  6.017   35.108  1.00 30.00 ? 147 HOH B O   1 
HETATM 4203 O O   . HOH F 4 .   ? 11.114  18.489  40.391  1.00 35.08 ? 148 HOH B O   1 
HETATM 4204 O O   . HOH F 4 .   ? 28.687  16.963  21.320  1.00 38.94 ? 153 HOH B O   1 
HETATM 4205 O O   . HOH F 4 .   ? 21.337  29.702  23.565  1.00 39.56 ? 154 HOH B O   1 
HETATM 4206 O O   . HOH F 4 .   ? 16.872  -7.615  35.179  1.00 37.64 ? 156 HOH B O   1 
HETATM 4207 O O   . HOH F 4 .   ? 10.546  10.723  16.465  1.00 28.41 ? 157 HOH B O   1 
HETATM 4208 O O   . HOH F 4 .   ? -0.985  29.364  35.880  1.00 31.16 ? 160 HOH B O   1 
HETATM 4209 O O   . HOH F 4 .   ? 0.638   -6.460  29.641  1.00 27.56 ? 161 HOH B O   1 
HETATM 4210 O O   . HOH F 4 .   ? 26.417  21.690  15.149  1.00 38.33 ? 162 HOH B O   1 
HETATM 4211 O O   . HOH F 4 .   ? 15.194  32.437  21.996  1.00 31.25 ? 163 HOH B O   1 
HETATM 4212 O O   . HOH F 4 .   ? -3.352  -2.468  48.893  1.00 28.22 ? 164 HOH B O   1 
HETATM 4213 O O   . HOH F 4 .   ? -1.702  26.396  37.028  1.00 27.08 ? 165 HOH B O   1 
HETATM 4214 O O   . HOH F 4 .   ? 27.934  14.281  24.226  1.00 25.51 ? 166 HOH B O   1 
HETATM 4215 O O   . HOH F 4 .   ? 7.568   17.229  39.011  1.00 39.34 ? 167 HOH B O   1 
HETATM 4216 O O   . HOH F 4 .   ? 10.872  4.903   52.264  1.00 27.64 ? 168 HOH B O   1 
HETATM 4217 O O   . HOH F 4 .   ? 25.272  1.897   28.461  1.00 37.58 ? 170 HOH B O   1 
HETATM 4218 O O   . HOH F 4 .   ? 8.043   -3.926  50.610  1.00 31.87 ? 176 HOH B O   1 
HETATM 4219 O O   . HOH F 4 .   ? -2.466  26.891  20.251  1.00 35.06 ? 177 HOH B O   1 
HETATM 4220 O O   . HOH F 4 .   ? 20.730  -7.611  44.097  1.00 29.00 ? 178 HOH B O   1 
HETATM 4221 O O   . HOH G 4 .   ? 22.931  -10.548 -10.009 1.00 14.23 ? 2   HOH A O   1 
HETATM 4222 O O   . HOH G 4 .   ? 14.111  -2.551  0.264   1.00 14.12 ? 4   HOH A O   1 
HETATM 4223 O O   . HOH G 4 .   ? 27.339  -10.873 1.284   1.00 14.76 ? 5   HOH A O   1 
HETATM 4224 O O   . HOH G 4 .   ? 32.985  -11.704 0.508   1.00 13.08 ? 8   HOH A O   1 
HETATM 4225 O O   . HOH G 4 .   ? 18.288  -4.844  5.438   1.00 16.73 ? 9   HOH A O   1 
HETATM 4226 O O   . HOH G 4 .   ? 39.322  -17.277 7.819   1.00 25.20 ? 11  HOH A O   1 
HETATM 4227 O O   . HOH G 4 .   ? 26.046  -12.840 -4.010  1.00 32.08 ? 12  HOH A O   1 
HETATM 4228 O O   . HOH G 4 .   ? 33.745  -3.512  -3.277  1.00 22.27 ? 14  HOH A O   1 
HETATM 4229 O O   . HOH G 4 .   ? 20.113  -2.788  6.224   1.00 20.01 ? 19  HOH A O   1 
HETATM 4230 O O   . HOH G 4 .   ? 6.819   5.228   -11.154 1.00 17.46 ? 20  HOH A O   1 
HETATM 4231 O O   . HOH G 4 .   ? 28.414  -13.700 -2.975  1.00 24.97 ? 23  HOH A O   1 
HETATM 4232 O O   . HOH G 4 .   ? 13.855  -6.360  9.092   1.00 21.23 ? 28  HOH A O   1 
HETATM 4233 O O   . HOH G 4 .   ? 19.782  -1.629  23.223  1.00 19.33 ? 29  HOH A O   1 
HETATM 4234 O O   . HOH G 4 .   ? 20.231  -8.808  18.167  1.00 19.43 ? 31  HOH A O   1 
HETATM 4235 O O   . HOH G 4 .   ? 20.783  -10.932 -8.107  1.00 18.44 ? 32  HOH A O   1 
HETATM 4236 O O   . HOH G 4 .   ? 40.518  -6.372  12.430  1.00 25.83 ? 35  HOH A O   1 
HETATM 4237 O O   . HOH G 4 .   ? 11.877  7.522   -1.630  1.00 25.50 ? 40  HOH A O   1 
HETATM 4238 O O   . HOH G 4 .   ? 14.493  -13.464 -19.023 1.00 25.66 ? 41  HOH A O   1 
HETATM 4239 O O   . HOH G 4 .   ? 19.791  -5.906  22.118  1.00 22.44 ? 45  HOH A O   1 
HETATM 4240 O O   . HOH G 4 .   ? 36.580  -7.145  -5.243  1.00 26.49 ? 46  HOH A O   1 
HETATM 4241 O O   . HOH G 4 .   ? 35.618  2.712   0.743   1.00 24.36 ? 49  HOH A O   1 
HETATM 4242 O O   . HOH G 4 .   ? 20.554  8.822   13.316  1.00 19.72 ? 54  HOH A O   1 
HETATM 4243 O O   . HOH G 4 .   ? 7.077   -16.465 -15.083 1.00 21.24 ? 58  HOH A O   1 
HETATM 4244 O O   . HOH G 4 .   ? 21.271  -22.168 13.147  1.00 27.41 ? 59  HOH A O   1 
HETATM 4245 O O   . HOH G 4 .   ? 14.814  -4.656  10.938  1.00 19.04 ? 68  HOH A O   1 
HETATM 4246 O O   . HOH G 4 .   ? 12.526  -3.847  11.940  1.00 28.69 ? 69  HOH A O   1 
HETATM 4247 O O   . HOH G 4 .   ? 23.599  -16.339 5.801   1.00 21.27 ? 70  HOH A O   1 
HETATM 4248 O O   . HOH G 4 .   ? 10.580  -11.209 -15.985 1.00 21.98 ? 71  HOH A O   1 
HETATM 4249 O O   . HOH G 4 .   ? 14.283  -6.256  6.428   1.00 31.47 ? 76  HOH A O   1 
HETATM 4250 O O   . HOH G 4 .   ? 10.661  -27.736 -3.083  1.00 22.33 ? 78  HOH A O   1 
HETATM 4251 O O   . HOH G 4 .   ? 29.292  -5.206  -7.987  1.00 26.24 ? 79  HOH A O   1 
HETATM 4252 O O   . HOH G 4 .   ? 26.335  -4.142  -17.010 1.00 36.91 ? 81  HOH A O   1 
HETATM 4253 O O   . HOH G 4 .   ? 8.972   -10.719 1.683   1.00 21.97 ? 83  HOH A O   1 
HETATM 4254 O O   . HOH G 4 .   ? 22.379  8.861   3.586   1.00 29.25 ? 84  HOH A O   1 
HETATM 4255 O O   . HOH G 4 .   ? 15.513  -6.450  2.300   1.00 19.36 ? 85  HOH A O   1 
HETATM 4256 O O   . HOH G 4 .   ? 22.895  -28.477 6.922   1.00 39.45 ? 86  HOH A O   1 
HETATM 4257 O O   . HOH G 4 .   ? 35.906  -1.746  10.298  1.00 23.46 ? 87  HOH A O   1 
HETATM 4258 O O   . HOH G 4 .   ? 43.110  -4.815  5.793   1.00 31.99 ? 90  HOH A O   1 
HETATM 4259 O O   . HOH G 4 .   ? 34.237  3.854   13.878  1.00 25.41 ? 94  HOH A O   1 
HETATM 4260 O O   . HOH G 4 .   ? 4.923   -14.696 5.741   1.00 31.24 ? 96  HOH A O   1 
HETATM 4261 O O   . HOH G 4 .   ? 29.851  -26.777 -0.597  1.00 27.13 ? 98  HOH A O   1 
HETATM 4262 O O   . HOH G 4 .   ? 8.815   5.185   6.115   1.00 27.09 ? 100 HOH A O   1 
HETATM 4263 O O   . HOH G 4 .   ? 30.896  -13.444 -10.041 1.00 39.17 ? 106 HOH A O   1 
HETATM 4264 O O   . HOH G 4 .   ? 31.280  -11.441 -3.637  1.00 28.90 ? 107 HOH A O   1 
HETATM 4265 O O   . HOH G 4 .   ? 31.086  5.134   20.691  1.00 28.87 ? 117 HOH A O   1 
HETATM 4266 O O   . HOH G 4 .   ? 14.510  -3.568  6.288   1.00 31.30 ? 120 HOH A O   1 
HETATM 4267 O O   . HOH G 4 .   ? 39.775  -19.163 1.590   1.00 24.31 ? 122 HOH A O   1 
HETATM 4268 O O   . HOH G 4 .   ? 37.248  -1.429  24.100  1.00 37.95 ? 123 HOH A O   1 
HETATM 4269 O O   . HOH G 4 .   ? 9.801   -12.152 9.029   1.00 25.07 ? 127 HOH A O   1 
HETATM 4270 O O   . HOH G 4 .   ? 15.713  11.102  -9.958  1.00 21.95 ? 128 HOH A O   1 
HETATM 4271 O O   . HOH G 4 .   ? 14.767  -8.480  4.702   1.00 17.89 ? 130 HOH A O   1 
HETATM 4272 O O   . HOH G 4 .   ? 33.144  -12.595 -1.910  1.00 21.57 ? 132 HOH A O   1 
HETATM 4273 O O   . HOH G 4 .   ? 23.297  3.924   -16.518 1.00 32.66 ? 133 HOH A O   1 
HETATM 4274 O O   . HOH G 4 .   ? 23.514  -8.163  -4.472  1.00 30.52 ? 135 HOH A O   1 
HETATM 4275 O O   . HOH G 4 .   ? 3.275   -6.668  1.898   1.00 24.32 ? 136 HOH A O   1 
HETATM 4276 O O   . HOH G 4 .   ? 38.376  -7.518  -2.159  1.00 26.42 ? 138 HOH A O   1 
HETATM 4277 O O   . HOH G 4 .   ? 14.891  -4.227  2.433   1.00 26.78 ? 139 HOH A O   1 
HETATM 4278 O O   . HOH G 4 .   ? 37.986  -0.897  8.712   1.00 25.70 ? 140 HOH A O   1 
HETATM 4279 O O   . HOH G 4 .   ? 26.395  5.355   2.407   1.00 27.58 ? 141 HOH A O   1 
HETATM 4280 O O   . HOH G 4 .   ? 35.355  3.818   3.237   1.00 28.43 ? 142 HOH A O   1 
HETATM 4281 O O   . HOH G 4 .   ? 11.342  -21.830 -16.723 1.00 26.90 ? 143 HOH A O   1 
HETATM 4282 O O   . HOH G 4 .   ? 39.654  -6.556  7.712   1.00 31.17 ? 144 HOH A O   1 
HETATM 4283 O O   . HOH G 4 .   ? 35.682  -17.096 -3.043  1.00 30.30 ? 149 HOH A O   1 
HETATM 4284 O O   . HOH G 4 .   ? 27.547  -15.292 -11.457 1.00 24.14 ? 150 HOH A O   1 
HETATM 4285 O O   . HOH G 4 .   ? 24.964  -10.007 -1.771  1.00 30.45 ? 151 HOH A O   1 
HETATM 4286 O O   . HOH G 4 .   ? 15.839  8.153   -12.318 1.00 33.43 ? 152 HOH A O   1 
HETATM 4287 O O   . HOH G 4 .   ? 12.787  -9.873  3.630   1.00 30.18 ? 155 HOH A O   1 
HETATM 4288 O O   . HOH G 4 .   ? 28.257  -5.421  -10.816 1.00 37.20 ? 158 HOH A O   1 
HETATM 4289 O O   . HOH G 4 .   ? 36.147  4.451   6.046   1.00 22.99 ? 159 HOH A O   1 
HETATM 4290 O O   . HOH G 4 .   ? 10.643  -22.119 3.461   1.00 33.99 ? 169 HOH A O   1 
HETATM 4291 O O   . HOH G 4 .   ? 4.201   6.557   -2.938  1.00 28.90 ? 171 HOH A O   1 
HETATM 4292 O O   . HOH G 4 .   ? 4.023   6.273   -9.311  1.00 30.63 ? 172 HOH A O   1 
HETATM 4293 O O   . HOH G 4 .   ? 7.775   -22.077 -12.019 1.00 30.64 ? 173 HOH A O   1 
HETATM 4294 O O   . HOH G 4 .   ? 13.134  -15.812 10.757  1.00 34.98 ? 174 HOH A O   1 
HETATM 4295 O O   . HOH G 4 .   ? 15.398  -15.478 12.617  1.00 32.46 ? 175 HOH A O   1 
HETATM 4296 O O   . HOH G 4 .   ? 7.485   -14.378 8.263   1.00 40.87 ? 179 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   675 ?   ?   ?   B . n 
A 1 2   SER 2   676 ?   ?   ?   B . n 
A 1 3   PRO 3   677 ?   ?   ?   B . n 
A 1 4   GLY 4   678 ?   ?   ?   B . n 
A 1 5   GLN 5   679 ?   ?   ?   B . n 
A 1 6   ASP 6   680 ?   ?   ?   B . n 
A 1 7   ILE 7   681 ?   ?   ?   B . n 
A 1 8   GLN 8   682 682 GLN GLN B . n 
A 1 9   LEU 9   683 683 LEU LEU B . n 
A 1 10  ILE 10  684 684 ILE ILE B . n 
A 1 11  PRO 11  685 685 PRO PRO B . n 
A 1 12  PRO 12  686 686 PRO PRO B . n 
A 1 13  LEU 13  687 687 LEU LEU B . n 
A 1 14  ILE 14  688 688 ILE ILE B . n 
A 1 15  ASN 15  689 689 ASN ASN B . n 
A 1 16  LEU 16  690 690 LEU LEU B . n 
A 1 17  LEU 17  691 691 LEU LEU B . n 
A 1 18  MET 18  692 692 MET MET B . n 
A 1 19  SER 19  693 693 SER SER B . n 
A 1 20  ILE 20  694 694 ILE ILE B . n 
A 1 21  GLU 21  695 695 GLU GLU B . n 
A 1 22  PRO 22  696 696 PRO PRO B . n 
A 1 23  ASP 23  697 697 ASP ASP B . n 
A 1 24  VAL 24  698 698 VAL VAL B . n 
A 1 25  ILE 25  699 699 ILE ILE B . n 
A 1 26  TYR 26  700 700 TYR TYR B . n 
A 1 27  ALA 27  701 701 ALA ALA B . n 
A 1 28  GLY 28  702 702 GLY GLY B . n 
A 1 29  HIS 29  703 703 HIS HIS B . n 
A 1 30  ASP 30  704 704 ASP ASP B . n 
A 1 31  ASN 31  705 705 ASN ASN B . n 
A 1 32  THR 32  706 706 THR THR B . n 
A 1 33  LYS 33  707 707 LYS LYS B . n 
A 1 34  PRO 34  708 708 PRO PRO B . n 
A 1 35  ASP 35  709 709 ASP ASP B . n 
A 1 36  THR 36  710 710 THR THR B . n 
A 1 37  SER 37  711 711 SER SER B . n 
A 1 38  SER 38  712 712 SER SER B . n 
A 1 39  SER 39  713 713 SER SER B . n 
A 1 40  LEU 40  714 714 LEU LEU B . n 
A 1 41  LEU 41  715 715 LEU LEU B . n 
A 1 42  THR 42  716 716 THR THR B . n 
A 1 43  SER 43  717 717 SER SER B . n 
A 1 44  LEU 44  718 718 LEU LEU B . n 
A 1 45  ASN 45  719 719 ASN ASN B . n 
A 1 46  GLN 46  720 720 GLN GLN B . n 
A 1 47  LEU 47  721 721 LEU LEU B . n 
A 1 48  GLY 48  722 722 GLY GLY B . n 
A 1 49  GLU 49  723 723 GLU GLU B . n 
A 1 50  ARG 50  724 724 ARG ARG B . n 
A 1 51  GLN 51  725 725 GLN GLN B . n 
A 1 52  LEU 52  726 726 LEU LEU B . n 
A 1 53  LEU 53  727 727 LEU LEU B . n 
A 1 54  SER 54  728 728 SER SER B . n 
A 1 55  VAL 55  729 729 VAL VAL B . n 
A 1 56  VAL 56  730 730 VAL VAL B . n 
A 1 57  LYS 57  731 731 LYS LYS B . n 
A 1 58  TRP 58  732 732 TRP TRP B . n 
A 1 59  SER 59  733 733 SER SER B . n 
A 1 60  LYS 60  734 734 LYS LYS B . n 
A 1 61  SER 61  735 735 SER SER B . n 
A 1 62  LEU 62  736 736 LEU LEU B . n 
A 1 63  PRO 63  737 737 PRO PRO B . n 
A 1 64  GLY 64  738 738 GLY GLY B . n 
A 1 65  PHE 65  739 739 PHE PHE B . n 
A 1 66  ARG 66  740 740 ARG ARG B . n 
A 1 67  ASN 67  741 741 ASN ASN B . n 
A 1 68  LEU 68  742 742 LEU LEU B . n 
A 1 69  HIS 69  743 743 HIS HIS B . n 
A 1 70  ILE 70  744 744 ILE ILE B . n 
A 1 71  ASP 71  745 745 ASP ASP B . n 
A 1 72  ASP 72  746 746 ASP ASP B . n 
A 1 73  GLN 73  747 747 GLN GLN B . n 
A 1 74  ILE 74  748 748 ILE ILE B . n 
A 1 75  THR 75  749 749 THR THR B . n 
A 1 76  LEU 76  750 750 LEU LEU B . n 
A 1 77  ILE 77  751 751 ILE ILE B . n 
A 1 78  GLN 78  752 752 GLN GLN B . n 
A 1 79  TYR 79  753 753 TYR TYR B . n 
A 1 80  SER 80  754 754 SER SER B . n 
A 1 81  TRP 81  755 755 TRP TRP B . n 
A 1 82  MET 82  756 756 MET MET B . n 
A 1 83  SER 83  757 757 SER SER B . n 
A 1 84  LEU 84  758 758 LEU LEU B . n 
A 1 85  MET 85  759 759 MET MET B . n 
A 1 86  VAL 86  760 760 VAL VAL B . n 
A 1 87  PHE 87  761 761 PHE PHE B . n 
A 1 88  GLY 88  762 762 GLY GLY B . n 
A 1 89  LEU 89  763 763 LEU LEU B . n 
A 1 90  GLY 90  764 764 GLY GLY B . n 
A 1 91  TRP 91  765 765 TRP TRP B . n 
A 1 92  ARG 92  766 766 ARG ARG B . n 
A 1 93  SER 93  767 767 SER SER B . n 
A 1 94  TYR 94  768 768 TYR TYR B . n 
A 1 95  LYS 95  769 769 LYS LYS B . n 
A 1 96  HIS 96  770 770 HIS HIS B . n 
A 1 97  VAL 97  771 771 VAL VAL B . n 
A 1 98  SER 98  772 772 SER SER B . n 
A 1 99  GLY 99  773 773 GLY GLY B . n 
A 1 100 GLN 100 774 774 GLN GLN B . n 
A 1 101 MET 101 775 775 MET MET B . n 
A 1 102 LEU 102 776 776 LEU LEU B . n 
A 1 103 TYR 103 777 777 TYR TYR B . n 
A 1 104 PHE 104 778 778 PHE PHE B . n 
A 1 105 ALA 105 779 779 ALA ALA B . n 
A 1 106 PRO 106 780 780 PRO PRO B . n 
A 1 107 ASP 107 781 781 ASP ASP B . n 
A 1 108 LEU 108 782 782 LEU LEU B . n 
A 1 109 ILE 109 783 783 ILE ILE B . n 
A 1 110 LEU 110 784 784 LEU LEU B . n 
A 1 111 ASN 111 785 785 ASN ASN B . n 
A 1 112 GLU 112 786 786 GLU GLU B . n 
A 1 113 GLN 113 787 787 GLN GLN B . n 
A 1 114 ARG 114 788 788 ARG ARG B . n 
A 1 115 MET 115 789 789 MET MET B . n 
A 1 116 LYS 116 790 790 LYS LYS B . n 
A 1 117 GLU 117 791 791 GLU GLU B . n 
A 1 118 SER 118 792 792 SER SER B . n 
A 1 119 SER 119 793 793 SER SER B . n 
A 1 120 PHE 120 794 794 PHE PHE B . n 
A 1 121 TYR 121 795 795 TYR TYR B . n 
A 1 122 SER 122 796 796 SER SER B . n 
A 1 123 LEU 123 797 797 LEU LEU B . n 
A 1 124 CYS 124 798 798 CYS CYS B . n 
A 1 125 LEU 125 799 799 LEU LEU B . n 
A 1 126 THR 126 800 800 THR THR B . n 
A 1 127 MET 127 801 801 MET MET B . n 
A 1 128 TRP 128 802 802 TRP TRP B . n 
A 1 129 GLN 129 803 803 GLN GLN B . n 
A 1 130 ILE 130 804 804 ILE ILE B . n 
A 1 131 PRO 131 805 805 PRO PRO B . n 
A 1 132 GLN 132 806 806 GLN GLN B . n 
A 1 133 GLU 133 807 807 GLU GLU B . n 
A 1 134 PHE 134 808 808 PHE PHE B . n 
A 1 135 VAL 135 809 809 VAL VAL B . n 
A 1 136 LYS 136 810 810 LYS LYS B . n 
A 1 137 LEU 137 811 811 LEU LEU B . n 
A 1 138 GLN 138 812 812 GLN GLN B . n 
A 1 139 VAL 139 813 813 VAL VAL B . n 
A 1 140 SER 140 814 814 SER SER B . n 
A 1 141 GLN 141 815 815 GLN GLN B . n 
A 1 142 GLU 142 816 816 GLU GLU B . n 
A 1 143 GLU 143 817 817 GLU GLU B . n 
A 1 144 PHE 144 818 818 PHE PHE B . n 
A 1 145 LEU 145 819 819 LEU LEU B . n 
A 1 146 CYS 146 820 820 CYS CYS B . n 
A 1 147 MET 147 821 821 MET MET B . n 
A 1 148 LYS 148 822 822 LYS LYS B . n 
A 1 149 VAL 149 823 823 VAL VAL B . n 
A 1 150 LEU 150 824 824 LEU LEU B . n 
A 1 151 LEU 151 825 825 LEU LEU B . n 
A 1 152 LEU 152 826 826 LEU LEU B . n 
A 1 153 LEU 153 827 827 LEU LEU B . n 
A 1 154 ASN 154 828 828 ASN ASN B . n 
A 1 155 THR 155 829 829 THR THR B . n 
A 1 156 ILE 156 830 830 ILE ILE B . n 
A 1 157 PRO 157 831 831 PRO PRO B . n 
A 1 158 LEU 158 832 832 LEU LEU B . n 
A 1 159 GLU 159 833 833 GLU GLU B . n 
A 1 160 GLY 160 834 834 GLY GLY B . n 
A 1 161 LEU 161 835 835 LEU LEU B . n 
A 1 162 ARG 162 836 836 ARG ARG B . n 
A 1 163 SER 163 837 837 SER SER B . n 
A 1 164 GLN 164 838 838 GLN GLN B . n 
A 1 165 THR 165 839 839 THR THR B . n 
A 1 166 GLN 166 840 840 GLN GLN B . n 
A 1 167 PHE 167 841 841 PHE PHE B . n 
A 1 168 GLU 168 842 842 GLU GLU B . n 
A 1 169 GLU 169 843 843 GLU GLU B . n 
A 1 170 MET 170 844 844 MET MET B . n 
A 1 171 ARG 171 845 845 ARG ARG B . n 
A 1 172 SER 172 846 846 SER SER B . n 
A 1 173 SER 173 847 847 SER SER B . n 
A 1 174 TYR 174 848 848 TYR TYR B . n 
A 1 175 ILE 175 849 849 ILE ILE B . n 
A 1 176 ARG 176 850 850 ARG ARG B . n 
A 1 177 GLU 177 851 851 GLU GLU B . n 
A 1 178 LEU 178 852 852 LEU LEU B . n 
A 1 179 ILE 179 853 853 ILE ILE B . n 
A 1 180 LYS 180 854 854 LYS LYS B . n 
A 1 181 ALA 181 855 855 ALA ALA B . n 
A 1 182 ILE 182 856 856 ILE ILE B . n 
A 1 183 GLY 183 857 857 GLY GLY B . n 
A 1 184 LEU 184 858 858 LEU LEU B . n 
A 1 185 ARG 185 859 859 ARG ARG B . n 
A 1 186 GLN 186 860 860 GLN GLN B . n 
A 1 187 LYS 187 861 861 LYS LYS B . n 
A 1 188 GLY 188 862 862 GLY GLY B . n 
A 1 189 VAL 189 863 863 VAL VAL B . n 
A 1 190 VAL 190 864 864 VAL VAL B . n 
A 1 191 SER 191 865 865 SER SER B . n 
A 1 192 SER 192 866 866 SER SER B . n 
A 1 193 SER 193 867 867 SER SER B . n 
A 1 194 GLN 194 868 868 GLN GLN B . n 
A 1 195 ARG 195 869 869 ARG ARG B . n 
A 1 196 PHE 196 870 870 PHE PHE B . n 
A 1 197 TYR 197 871 871 TYR TYR B . n 
A 1 198 GLN 198 872 872 GLN GLN B . n 
A 1 199 LEU 199 873 873 LEU LEU B . n 
A 1 200 THR 200 874 874 THR THR B . n 
A 1 201 LYS 201 875 875 LYS LYS B . n 
A 1 202 LEU 202 876 876 LEU LEU B . n 
A 1 203 LEU 203 877 877 LEU LEU B . n 
A 1 204 ASP 204 878 878 ASP ASP B . n 
A 1 205 ASN 205 879 879 ASN ASN B . n 
A 1 206 LEU 206 880 880 LEU LEU B . n 
A 1 207 HIS 207 881 881 HIS HIS B . n 
A 1 208 ASP 208 882 882 ASP ASP B . n 
A 1 209 LEU 209 883 883 LEU LEU B . n 
A 1 210 VAL 210 884 884 VAL VAL B . n 
A 1 211 LYS 211 885 885 LYS LYS B . n 
A 1 212 GLN 212 886 886 GLN GLN B . n 
A 1 213 LEU 213 887 887 LEU LEU B . n 
A 1 214 HIS 214 888 888 HIS HIS B . n 
A 1 215 LEU 215 889 889 LEU LEU B . n 
A 1 216 TYR 216 890 890 TYR TYR B . n 
A 1 217 CYS 217 891 891 CYS CYS B . n 
A 1 218 LEU 218 892 892 LEU LEU B . n 
A 1 219 ASN 219 893 893 ASN ASN B . n 
A 1 220 THR 220 894 894 THR THR B . n 
A 1 221 PHE 221 895 895 PHE PHE B . n 
A 1 222 ILE 222 896 896 ILE ILE B . n 
A 1 223 GLN 223 897 897 GLN GLN B . n 
A 1 224 SER 224 898 898 SER SER B . n 
A 1 225 ARG 225 899 899 ARG ARG B . n 
A 1 226 ALA 226 900 900 ALA ALA B . n 
A 1 227 LEU 227 901 901 LEU LEU B . n 
A 1 228 SER 228 902 902 SER SER B . n 
A 1 229 VAL 229 903 903 VAL VAL B . n 
A 1 230 GLU 230 904 904 GLU GLU B . n 
A 1 231 PHE 231 905 905 PHE PHE B . n 
A 1 232 PRO 232 906 906 PRO PRO B . n 
A 1 233 GLU 233 907 907 GLU GLU B . n 
A 1 234 MET 234 908 908 MET MET B . n 
A 1 235 MET 235 909 909 MET MET B . n 
A 1 236 SER 236 910 910 SER SER B . n 
A 1 237 GLU 237 911 911 GLU GLU B . n 
A 1 238 VAL 238 912 912 VAL VAL B . n 
A 1 239 ILE 239 913 913 ILE ILE B . n 
A 1 240 ALA 240 914 914 ALA ALA B . n 
A 1 241 ALA 241 915 915 ALA ALA B . n 
A 1 242 GLN 242 916 916 GLN GLN B . n 
A 1 243 LEU 243 917 917 LEU LEU B . n 
A 1 244 PRO 244 918 918 PRO PRO B . n 
A 1 245 LYS 245 919 919 LYS LYS B . n 
A 1 246 ILE 246 920 920 ILE ILE B . n 
A 1 247 LEU 247 921 921 LEU LEU B . n 
A 1 248 ALA 248 922 922 ALA ALA B . n 
A 1 249 GLY 249 923 923 GLY GLY B . n 
A 1 250 MET 250 924 924 MET MET B . n 
A 1 251 VAL 251 925 925 VAL VAL B . n 
A 1 252 LYS 252 926 926 LYS LYS B . n 
A 1 253 PRO 253 927 927 PRO PRO B . n 
A 1 254 LEU 254 928 928 LEU LEU B . n 
A 1 255 LEU 255 929 929 LEU LEU B . n 
A 1 256 PHE 256 930 930 PHE PHE B . n 
A 1 257 HIS 257 931 931 HIS HIS B . n 
A 1 258 LYS 258 932 932 LYS LYS B . n 
A 1 259 LYS 259 933 ?   ?   ?   B . n 
B 1 1   GLY 1   675 ?   ?   ?   A . n 
B 1 2   SER 2   676 ?   ?   ?   A . n 
B 1 3   PRO 3   677 ?   ?   ?   A . n 
B 1 4   GLY 4   678 ?   ?   ?   A . n 
B 1 5   GLN 5   679 ?   ?   ?   A . n 
B 1 6   ASP 6   680 ?   ?   ?   A . n 
B 1 7   ILE 7   681 ?   ?   ?   A . n 
B 1 8   GLN 8   682 682 GLN GLN A . n 
B 1 9   LEU 9   683 683 LEU LEU A . n 
B 1 10  ILE 10  684 684 ILE ILE A . n 
B 1 11  PRO 11  685 685 PRO PRO A . n 
B 1 12  PRO 12  686 686 PRO PRO A . n 
B 1 13  LEU 13  687 687 LEU LEU A . n 
B 1 14  ILE 14  688 688 ILE ILE A . n 
B 1 15  ASN 15  689 689 ASN ASN A . n 
B 1 16  LEU 16  690 690 LEU LEU A . n 
B 1 17  LEU 17  691 691 LEU LEU A . n 
B 1 18  MET 18  692 692 MET MET A . n 
B 1 19  SER 19  693 693 SER SER A . n 
B 1 20  ILE 20  694 694 ILE ILE A . n 
B 1 21  GLU 21  695 695 GLU GLU A . n 
B 1 22  PRO 22  696 696 PRO PRO A . n 
B 1 23  ASP 23  697 697 ASP ASP A . n 
B 1 24  VAL 24  698 698 VAL VAL A . n 
B 1 25  ILE 25  699 699 ILE ILE A . n 
B 1 26  TYR 26  700 700 TYR TYR A . n 
B 1 27  ALA 27  701 701 ALA ALA A . n 
B 1 28  GLY 28  702 702 GLY GLY A . n 
B 1 29  HIS 29  703 703 HIS HIS A . n 
B 1 30  ASP 30  704 704 ASP ASP A . n 
B 1 31  ASN 31  705 705 ASN ASN A . n 
B 1 32  THR 32  706 706 THR THR A . n 
B 1 33  LYS 33  707 707 LYS LYS A . n 
B 1 34  PRO 34  708 708 PRO PRO A . n 
B 1 35  ASP 35  709 709 ASP ASP A . n 
B 1 36  THR 36  710 710 THR THR A . n 
B 1 37  SER 37  711 711 SER SER A . n 
B 1 38  SER 38  712 712 SER SER A . n 
B 1 39  SER 39  713 713 SER SER A . n 
B 1 40  LEU 40  714 714 LEU LEU A . n 
B 1 41  LEU 41  715 715 LEU LEU A . n 
B 1 42  THR 42  716 716 THR THR A . n 
B 1 43  SER 43  717 717 SER SER A . n 
B 1 44  LEU 44  718 718 LEU LEU A . n 
B 1 45  ASN 45  719 719 ASN ASN A . n 
B 1 46  GLN 46  720 720 GLN GLN A . n 
B 1 47  LEU 47  721 721 LEU LEU A . n 
B 1 48  GLY 48  722 722 GLY GLY A . n 
B 1 49  GLU 49  723 723 GLU GLU A . n 
B 1 50  ARG 50  724 724 ARG ARG A . n 
B 1 51  GLN 51  725 725 GLN GLN A . n 
B 1 52  LEU 52  726 726 LEU LEU A . n 
B 1 53  LEU 53  727 727 LEU LEU A . n 
B 1 54  SER 54  728 728 SER SER A . n 
B 1 55  VAL 55  729 729 VAL VAL A . n 
B 1 56  VAL 56  730 730 VAL VAL A . n 
B 1 57  LYS 57  731 731 LYS LYS A . n 
B 1 58  TRP 58  732 732 TRP TRP A . n 
B 1 59  SER 59  733 733 SER SER A . n 
B 1 60  LYS 60  734 734 LYS LYS A . n 
B 1 61  SER 61  735 735 SER SER A . n 
B 1 62  LEU 62  736 736 LEU LEU A . n 
B 1 63  PRO 63  737 737 PRO PRO A . n 
B 1 64  GLY 64  738 738 GLY GLY A . n 
B 1 65  PHE 65  739 739 PHE PHE A . n 
B 1 66  ARG 66  740 740 ARG ARG A . n 
B 1 67  ASN 67  741 741 ASN ASN A . n 
B 1 68  LEU 68  742 742 LEU LEU A . n 
B 1 69  HIS 69  743 743 HIS HIS A . n 
B 1 70  ILE 70  744 744 ILE ILE A . n 
B 1 71  ASP 71  745 745 ASP ASP A . n 
B 1 72  ASP 72  746 746 ASP ASP A . n 
B 1 73  GLN 73  747 747 GLN GLN A . n 
B 1 74  ILE 74  748 748 ILE ILE A . n 
B 1 75  THR 75  749 749 THR THR A . n 
B 1 76  LEU 76  750 750 LEU LEU A . n 
B 1 77  ILE 77  751 751 ILE ILE A . n 
B 1 78  GLN 78  752 752 GLN GLN A . n 
B 1 79  TYR 79  753 753 TYR TYR A . n 
B 1 80  SER 80  754 754 SER SER A . n 
B 1 81  TRP 81  755 755 TRP TRP A . n 
B 1 82  MET 82  756 756 MET MET A . n 
B 1 83  SER 83  757 757 SER SER A . n 
B 1 84  LEU 84  758 758 LEU LEU A . n 
B 1 85  MET 85  759 759 MET MET A . n 
B 1 86  VAL 86  760 760 VAL VAL A . n 
B 1 87  PHE 87  761 761 PHE PHE A . n 
B 1 88  GLY 88  762 762 GLY GLY A . n 
B 1 89  LEU 89  763 763 LEU LEU A . n 
B 1 90  GLY 90  764 764 GLY GLY A . n 
B 1 91  TRP 91  765 765 TRP TRP A . n 
B 1 92  ARG 92  766 766 ARG ARG A . n 
B 1 93  SER 93  767 767 SER SER A . n 
B 1 94  TYR 94  768 768 TYR TYR A . n 
B 1 95  LYS 95  769 769 LYS LYS A . n 
B 1 96  HIS 96  770 770 HIS HIS A . n 
B 1 97  VAL 97  771 771 VAL VAL A . n 
B 1 98  SER 98  772 772 SER SER A . n 
B 1 99  GLY 99  773 773 GLY GLY A . n 
B 1 100 GLN 100 774 774 GLN GLN A . n 
B 1 101 MET 101 775 775 MET MET A . n 
B 1 102 LEU 102 776 776 LEU LEU A . n 
B 1 103 TYR 103 777 777 TYR TYR A . n 
B 1 104 PHE 104 778 778 PHE PHE A . n 
B 1 105 ALA 105 779 779 ALA ALA A . n 
B 1 106 PRO 106 780 780 PRO PRO A . n 
B 1 107 ASP 107 781 781 ASP ASP A . n 
B 1 108 LEU 108 782 782 LEU LEU A . n 
B 1 109 ILE 109 783 783 ILE ILE A . n 
B 1 110 LEU 110 784 784 LEU LEU A . n 
B 1 111 ASN 111 785 785 ASN ASN A . n 
B 1 112 GLU 112 786 786 GLU GLU A . n 
B 1 113 GLN 113 787 787 GLN GLN A . n 
B 1 114 ARG 114 788 788 ARG ARG A . n 
B 1 115 MET 115 789 789 MET MET A . n 
B 1 116 LYS 116 790 790 LYS LYS A . n 
B 1 117 GLU 117 791 791 GLU GLU A . n 
B 1 118 SER 118 792 792 SER SER A . n 
B 1 119 SER 119 793 793 SER SER A . n 
B 1 120 PHE 120 794 794 PHE PHE A . n 
B 1 121 TYR 121 795 795 TYR TYR A . n 
B 1 122 SER 122 796 796 SER SER A . n 
B 1 123 LEU 123 797 797 LEU LEU A . n 
B 1 124 CYS 124 798 798 CYS CYS A . n 
B 1 125 LEU 125 799 799 LEU LEU A . n 
B 1 126 THR 126 800 800 THR THR A . n 
B 1 127 MET 127 801 801 MET MET A . n 
B 1 128 TRP 128 802 802 TRP TRP A . n 
B 1 129 GLN 129 803 803 GLN GLN A . n 
B 1 130 ILE 130 804 804 ILE ILE A . n 
B 1 131 PRO 131 805 805 PRO PRO A . n 
B 1 132 GLN 132 806 806 GLN GLN A . n 
B 1 133 GLU 133 807 807 GLU GLU A . n 
B 1 134 PHE 134 808 808 PHE PHE A . n 
B 1 135 VAL 135 809 809 VAL VAL A . n 
B 1 136 LYS 136 810 810 LYS LYS A . n 
B 1 137 LEU 137 811 811 LEU LEU A . n 
B 1 138 GLN 138 812 812 GLN GLN A . n 
B 1 139 VAL 139 813 813 VAL VAL A . n 
B 1 140 SER 140 814 814 SER SER A . n 
B 1 141 GLN 141 815 815 GLN GLN A . n 
B 1 142 GLU 142 816 816 GLU GLU A . n 
B 1 143 GLU 143 817 817 GLU GLU A . n 
B 1 144 PHE 144 818 818 PHE PHE A . n 
B 1 145 LEU 145 819 819 LEU LEU A . n 
B 1 146 CYS 146 820 820 CYS CYS A . n 
B 1 147 MET 147 821 821 MET MET A . n 
B 1 148 LYS 148 822 822 LYS LYS A . n 
B 1 149 VAL 149 823 823 VAL VAL A . n 
B 1 150 LEU 150 824 824 LEU LEU A . n 
B 1 151 LEU 151 825 825 LEU LEU A . n 
B 1 152 LEU 152 826 826 LEU LEU A . n 
B 1 153 LEU 153 827 827 LEU LEU A . n 
B 1 154 ASN 154 828 828 ASN ASN A . n 
B 1 155 THR 155 829 829 THR THR A . n 
B 1 156 ILE 156 830 830 ILE ILE A . n 
B 1 157 PRO 157 831 831 PRO PRO A . n 
B 1 158 LEU 158 832 832 LEU LEU A . n 
B 1 159 GLU 159 833 833 GLU GLU A . n 
B 1 160 GLY 160 834 834 GLY GLY A . n 
B 1 161 LEU 161 835 835 LEU LEU A . n 
B 1 162 ARG 162 836 836 ARG ARG A . n 
B 1 163 SER 163 837 837 SER SER A . n 
B 1 164 GLN 164 838 838 GLN GLN A . n 
B 1 165 THR 165 839 839 THR THR A . n 
B 1 166 GLN 166 840 840 GLN GLN A . n 
B 1 167 PHE 167 841 841 PHE PHE A . n 
B 1 168 GLU 168 842 842 GLU GLU A . n 
B 1 169 GLU 169 843 843 GLU GLU A . n 
B 1 170 MET 170 844 844 MET MET A . n 
B 1 171 ARG 171 845 845 ARG ARG A . n 
B 1 172 SER 172 846 846 SER SER A . n 
B 1 173 SER 173 847 847 SER SER A . n 
B 1 174 TYR 174 848 848 TYR TYR A . n 
B 1 175 ILE 175 849 849 ILE ILE A . n 
B 1 176 ARG 176 850 850 ARG ARG A . n 
B 1 177 GLU 177 851 851 GLU GLU A . n 
B 1 178 LEU 178 852 852 LEU LEU A . n 
B 1 179 ILE 179 853 853 ILE ILE A . n 
B 1 180 LYS 180 854 854 LYS LYS A . n 
B 1 181 ALA 181 855 855 ALA ALA A . n 
B 1 182 ILE 182 856 856 ILE ILE A . n 
B 1 183 GLY 183 857 857 GLY GLY A . n 
B 1 184 LEU 184 858 858 LEU LEU A . n 
B 1 185 ARG 185 859 859 ARG ARG A . n 
B 1 186 GLN 186 860 860 GLN GLN A . n 
B 1 187 LYS 187 861 861 LYS LYS A . n 
B 1 188 GLY 188 862 862 GLY GLY A . n 
B 1 189 VAL 189 863 863 VAL VAL A . n 
B 1 190 VAL 190 864 864 VAL VAL A . n 
B 1 191 SER 191 865 865 SER SER A . n 
B 1 192 SER 192 866 866 SER SER A . n 
B 1 193 SER 193 867 867 SER SER A . n 
B 1 194 GLN 194 868 868 GLN GLN A . n 
B 1 195 ARG 195 869 869 ARG ARG A . n 
B 1 196 PHE 196 870 870 PHE PHE A . n 
B 1 197 TYR 197 871 871 TYR TYR A . n 
B 1 198 GLN 198 872 872 GLN GLN A . n 
B 1 199 LEU 199 873 873 LEU LEU A . n 
B 1 200 THR 200 874 874 THR THR A . n 
B 1 201 LYS 201 875 875 LYS LYS A . n 
B 1 202 LEU 202 876 876 LEU LEU A . n 
B 1 203 LEU 203 877 877 LEU LEU A . n 
B 1 204 ASP 204 878 878 ASP ASP A . n 
B 1 205 ASN 205 879 879 ASN ASN A . n 
B 1 206 LEU 206 880 880 LEU LEU A . n 
B 1 207 HIS 207 881 881 HIS HIS A . n 
B 1 208 ASP 208 882 882 ASP ASP A . n 
B 1 209 LEU 209 883 883 LEU LEU A . n 
B 1 210 VAL 210 884 884 VAL VAL A . n 
B 1 211 LYS 211 885 885 LYS LYS A . n 
B 1 212 GLN 212 886 886 GLN GLN A . n 
B 1 213 LEU 213 887 887 LEU LEU A . n 
B 1 214 HIS 214 888 888 HIS HIS A . n 
B 1 215 LEU 215 889 889 LEU LEU A . n 
B 1 216 TYR 216 890 890 TYR TYR A . n 
B 1 217 CYS 217 891 891 CYS CYS A . n 
B 1 218 LEU 218 892 892 LEU LEU A . n 
B 1 219 ASN 219 893 893 ASN ASN A . n 
B 1 220 THR 220 894 894 THR THR A . n 
B 1 221 PHE 221 895 895 PHE PHE A . n 
B 1 222 ILE 222 896 896 ILE ILE A . n 
B 1 223 GLN 223 897 897 GLN GLN A . n 
B 1 224 SER 224 898 898 SER SER A . n 
B 1 225 ARG 225 899 899 ARG ARG A . n 
B 1 226 ALA 226 900 900 ALA ALA A . n 
B 1 227 LEU 227 901 901 LEU LEU A . n 
B 1 228 SER 228 902 902 SER SER A . n 
B 1 229 VAL 229 903 903 VAL VAL A . n 
B 1 230 GLU 230 904 904 GLU GLU A . n 
B 1 231 PHE 231 905 905 PHE PHE A . n 
B 1 232 PRO 232 906 906 PRO PRO A . n 
B 1 233 GLU 233 907 907 GLU GLU A . n 
B 1 234 MET 234 908 908 MET MET A . n 
B 1 235 MET 235 909 909 MET MET A . n 
B 1 236 SER 236 910 910 SER SER A . n 
B 1 237 GLU 237 911 911 GLU GLU A . n 
B 1 238 VAL 238 912 912 VAL VAL A . n 
B 1 239 ILE 239 913 913 ILE ILE A . n 
B 1 240 ALA 240 914 914 ALA ALA A . n 
B 1 241 ALA 241 915 915 ALA ALA A . n 
B 1 242 GLN 242 916 916 GLN GLN A . n 
B 1 243 LEU 243 917 917 LEU LEU A . n 
B 1 244 PRO 244 918 918 PRO PRO A . n 
B 1 245 LYS 245 919 919 LYS LYS A . n 
B 1 246 ILE 246 920 920 ILE ILE A . n 
B 1 247 LEU 247 921 921 LEU LEU A . n 
B 1 248 ALA 248 922 922 ALA ALA A . n 
B 1 249 GLY 249 923 923 GLY GLY A . n 
B 1 250 MET 250 924 924 MET MET A . n 
B 1 251 VAL 251 925 925 VAL VAL A . n 
B 1 252 LYS 252 926 926 LYS LYS A . n 
B 1 253 PRO 253 927 927 PRO PRO A . n 
B 1 254 LEU 254 928 928 LEU LEU A . n 
B 1 255 LEU 255 929 929 LEU LEU A . n 
B 1 256 PHE 256 930 930 PHE PHE A . n 
B 1 257 HIS 257 931 931 HIS HIS A . n 
B 1 258 LYS 258 932 932 LYS LYS A . n 
B 1 259 LYS 259 933 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 T98 1   202 1   T98 989 B . 
D 3 SO4 1   203 1   SO4 SO4 A . 
E 2 T98 1   201 1   T98 989 A . 
F 4 HOH 1   1   1   HOH HOH B . 
F 4 HOH 2   3   3   HOH HOH B . 
F 4 HOH 3   6   6   HOH HOH B . 
F 4 HOH 4   7   7   HOH HOH B . 
F 4 HOH 5   10  10  HOH HOH B . 
F 4 HOH 6   13  13  HOH HOH B . 
F 4 HOH 7   15  15  HOH HOH B . 
F 4 HOH 8   16  16  HOH HOH B . 
F 4 HOH 9   17  17  HOH HOH B . 
F 4 HOH 10  18  18  HOH HOH B . 
F 4 HOH 11  21  21  HOH HOH B . 
F 4 HOH 12  22  22  HOH HOH B . 
F 4 HOH 13  24  24  HOH HOH B . 
F 4 HOH 14  25  25  HOH HOH B . 
F 4 HOH 15  26  26  HOH HOH B . 
F 4 HOH 16  27  27  HOH HOH B . 
F 4 HOH 17  30  30  HOH HOH B . 
F 4 HOH 18  33  33  HOH HOH B . 
F 4 HOH 19  34  34  HOH HOH B . 
F 4 HOH 20  36  36  HOH HOH B . 
F 4 HOH 21  37  37  HOH HOH B . 
F 4 HOH 22  38  38  HOH HOH B . 
F 4 HOH 23  39  39  HOH HOH B . 
F 4 HOH 24  42  42  HOH HOH B . 
F 4 HOH 25  43  43  HOH HOH B . 
F 4 HOH 26  44  44  HOH HOH B . 
F 4 HOH 27  47  47  HOH HOH B . 
F 4 HOH 28  48  48  HOH HOH B . 
F 4 HOH 29  50  50  HOH HOH B . 
F 4 HOH 30  51  51  HOH HOH B . 
F 4 HOH 31  52  52  HOH HOH B . 
F 4 HOH 32  53  53  HOH HOH B . 
F 4 HOH 33  55  55  HOH HOH B . 
F 4 HOH 34  56  56  HOH HOH B . 
F 4 HOH 35  57  57  HOH HOH B . 
F 4 HOH 36  60  60  HOH HOH B . 
F 4 HOH 37  61  61  HOH HOH B . 
F 4 HOH 38  62  62  HOH HOH B . 
F 4 HOH 39  63  63  HOH HOH B . 
F 4 HOH 40  64  64  HOH HOH B . 
F 4 HOH 41  65  65  HOH HOH B . 
F 4 HOH 42  66  66  HOH HOH B . 
F 4 HOH 43  67  67  HOH HOH B . 
F 4 HOH 44  72  72  HOH HOH B . 
F 4 HOH 45  73  73  HOH HOH B . 
F 4 HOH 46  74  74  HOH HOH B . 
F 4 HOH 47  75  75  HOH HOH B . 
F 4 HOH 48  77  77  HOH HOH B . 
F 4 HOH 49  80  80  HOH HOH B . 
F 4 HOH 50  82  82  HOH HOH B . 
F 4 HOH 51  88  88  HOH HOH B . 
F 4 HOH 52  89  89  HOH HOH B . 
F 4 HOH 53  91  91  HOH HOH B . 
F 4 HOH 54  92  92  HOH HOH B . 
F 4 HOH 55  93  93  HOH HOH B . 
F 4 HOH 56  95  95  HOH HOH B . 
F 4 HOH 57  97  97  HOH HOH B . 
F 4 HOH 58  99  99  HOH HOH B . 
F 4 HOH 59  101 101 HOH HOH B . 
F 4 HOH 60  102 102 HOH HOH B . 
F 4 HOH 61  103 103 HOH HOH B . 
F 4 HOH 62  104 104 HOH HOH B . 
F 4 HOH 63  105 105 HOH HOH B . 
F 4 HOH 64  108 108 HOH HOH B . 
F 4 HOH 65  109 109 HOH HOH B . 
F 4 HOH 66  110 110 HOH HOH B . 
F 4 HOH 67  111 111 HOH HOH B . 
F 4 HOH 68  112 112 HOH HOH B . 
F 4 HOH 69  113 113 HOH HOH B . 
F 4 HOH 70  114 114 HOH HOH B . 
F 4 HOH 71  115 115 HOH HOH B . 
F 4 HOH 72  116 116 HOH HOH B . 
F 4 HOH 73  118 118 HOH HOH B . 
F 4 HOH 74  119 119 HOH HOH B . 
F 4 HOH 75  121 121 HOH HOH B . 
F 4 HOH 76  124 124 HOH HOH B . 
F 4 HOH 77  125 125 HOH HOH B . 
F 4 HOH 78  126 126 HOH HOH B . 
F 4 HOH 79  129 129 HOH HOH B . 
F 4 HOH 80  131 131 HOH HOH B . 
F 4 HOH 81  134 134 HOH HOH B . 
F 4 HOH 82  137 137 HOH HOH B . 
F 4 HOH 83  145 145 HOH HOH B . 
F 4 HOH 84  146 146 HOH HOH B . 
F 4 HOH 85  147 147 HOH HOH B . 
F 4 HOH 86  148 148 HOH HOH B . 
F 4 HOH 87  153 153 HOH HOH B . 
F 4 HOH 88  154 154 HOH HOH B . 
F 4 HOH 89  156 156 HOH HOH B . 
F 4 HOH 90  157 157 HOH HOH B . 
F 4 HOH 91  160 160 HOH HOH B . 
F 4 HOH 92  161 161 HOH HOH B . 
F 4 HOH 93  162 162 HOH HOH B . 
F 4 HOH 94  163 163 HOH HOH B . 
F 4 HOH 95  164 164 HOH HOH B . 
F 4 HOH 96  165 165 HOH HOH B . 
F 4 HOH 97  166 166 HOH HOH B . 
F 4 HOH 98  167 167 HOH HOH B . 
F 4 HOH 99  168 168 HOH HOH B . 
F 4 HOH 100 170 170 HOH HOH B . 
F 4 HOH 101 176 176 HOH HOH B . 
F 4 HOH 102 177 177 HOH HOH B . 
F 4 HOH 103 178 178 HOH HOH B . 
G 4 HOH 1   2   2   HOH HOH A . 
G 4 HOH 2   4   4   HOH HOH A . 
G 4 HOH 3   5   5   HOH HOH A . 
G 4 HOH 4   8   8   HOH HOH A . 
G 4 HOH 5   9   9   HOH HOH A . 
G 4 HOH 6   11  11  HOH HOH A . 
G 4 HOH 7   12  12  HOH HOH A . 
G 4 HOH 8   14  14  HOH HOH A . 
G 4 HOH 9   19  19  HOH HOH A . 
G 4 HOH 10  20  20  HOH HOH A . 
G 4 HOH 11  23  23  HOH HOH A . 
G 4 HOH 12  28  28  HOH HOH A . 
G 4 HOH 13  29  29  HOH HOH A . 
G 4 HOH 14  31  31  HOH HOH A . 
G 4 HOH 15  32  32  HOH HOH A . 
G 4 HOH 16  35  35  HOH HOH A . 
G 4 HOH 17  40  40  HOH HOH A . 
G 4 HOH 18  41  41  HOH HOH A . 
G 4 HOH 19  45  45  HOH HOH A . 
G 4 HOH 20  46  46  HOH HOH A . 
G 4 HOH 21  49  49  HOH HOH A . 
G 4 HOH 22  54  54  HOH HOH A . 
G 4 HOH 23  58  58  HOH HOH A . 
G 4 HOH 24  59  59  HOH HOH A . 
G 4 HOH 25  68  68  HOH HOH A . 
G 4 HOH 26  69  69  HOH HOH A . 
G 4 HOH 27  70  70  HOH HOH A . 
G 4 HOH 28  71  71  HOH HOH A . 
G 4 HOH 29  76  76  HOH HOH A . 
G 4 HOH 30  78  78  HOH HOH A . 
G 4 HOH 31  79  79  HOH HOH A . 
G 4 HOH 32  81  81  HOH HOH A . 
G 4 HOH 33  83  83  HOH HOH A . 
G 4 HOH 34  84  84  HOH HOH A . 
G 4 HOH 35  85  85  HOH HOH A . 
G 4 HOH 36  86  86  HOH HOH A . 
G 4 HOH 37  87  87  HOH HOH A . 
G 4 HOH 38  90  90  HOH HOH A . 
G 4 HOH 39  94  94  HOH HOH A . 
G 4 HOH 40  96  96  HOH HOH A . 
G 4 HOH 41  98  98  HOH HOH A . 
G 4 HOH 42  100 100 HOH HOH A . 
G 4 HOH 43  106 106 HOH HOH A . 
G 4 HOH 44  107 107 HOH HOH A . 
G 4 HOH 45  117 117 HOH HOH A . 
G 4 HOH 46  120 120 HOH HOH A . 
G 4 HOH 47  122 122 HOH HOH A . 
G 4 HOH 48  123 123 HOH HOH A . 
G 4 HOH 49  127 127 HOH HOH A . 
G 4 HOH 50  128 128 HOH HOH A . 
G 4 HOH 51  130 130 HOH HOH A . 
G 4 HOH 52  132 132 HOH HOH A . 
G 4 HOH 53  133 133 HOH HOH A . 
G 4 HOH 54  135 135 HOH HOH A . 
G 4 HOH 55  136 136 HOH HOH A . 
G 4 HOH 56  138 138 HOH HOH A . 
G 4 HOH 57  139 139 HOH HOH A . 
G 4 HOH 58  140 140 HOH HOH A . 
G 4 HOH 59  141 141 HOH HOH A . 
G 4 HOH 60  142 142 HOH HOH A . 
G 4 HOH 61  143 143 HOH HOH A . 
G 4 HOH 62  144 144 HOH HOH A . 
G 4 HOH 63  149 149 HOH HOH A . 
G 4 HOH 64  150 150 HOH HOH A . 
G 4 HOH 65  151 151 HOH HOH A . 
G 4 HOH 66  152 152 HOH HOH A . 
G 4 HOH 67  155 155 HOH HOH A . 
G 4 HOH 68  158 158 HOH HOH A . 
G 4 HOH 69  159 159 HOH HOH A . 
G 4 HOH 70  169 169 HOH HOH A . 
G 4 HOH 71  171 171 HOH HOH A . 
G 4 HOH 72  172 172 HOH HOH A . 
G 4 HOH 73  173 173 HOH HOH A . 
G 4 HOH 74  174 174 HOH HOH A . 
G 4 HOH 75  175 175 HOH HOH A . 
G 4 HOH 76  179 179 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2005-07-05 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC    refinement       5.2.0005 ? 1 
DENZO     'data reduction' .        ? 2 
SCALEPACK 'data scaling'   .        ? 3 
AMoRE     phasing          .        ? 4 
# 
_pdbx_database_remark.id     300 
_pdbx_database_remark.text   
;BIOMOLECULE: 1                                                       
THIS ENTRY CONTAINS THE CRYSTALLOGRAPHIC ASYMMETRIC UNIT             
WHICH CONSISTS OF 2 CHAIN(S). IT IS NOT KNOWN WHETHER 
THE DIMER IN THE SAYMMETRIC UNIT IS ACTUALLY THE 
BIOLOGICAL UNIT.
;
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             CB 
_pdbx_validate_rmsd_angle.auth_asym_id_1             B 
_pdbx_validate_rmsd_angle.auth_comp_id_1             ASP 
_pdbx_validate_rmsd_angle.auth_seq_id_1              704 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CG 
_pdbx_validate_rmsd_angle.auth_asym_id_2             B 
_pdbx_validate_rmsd_angle.auth_comp_id_2             ASP 
_pdbx_validate_rmsd_angle.auth_seq_id_2              704 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             OD1 
_pdbx_validate_rmsd_angle.auth_asym_id_3             B 
_pdbx_validate_rmsd_angle.auth_comp_id_3             ASP 
_pdbx_validate_rmsd_angle.auth_seq_id_3              704 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                112.60 
_pdbx_validate_rmsd_angle.angle_target_value         118.30 
_pdbx_validate_rmsd_angle.angle_deviation            -5.70 
_pdbx_validate_rmsd_angle.angle_standard_deviation   0.90 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASN B 705 ? ? 73.80   -16.79 
2 1 SER B 793 ? ? 91.96   -14.91 
3 1 SER B 837 ? ? -105.04 49.84  
4 1 MET B 924 ? ? -95.15  42.47  
5 1 THR A 706 ? ? -34.54  -73.41 
6 1 MET A 789 ? ? -111.57 74.27  
7 1 SER A 837 ? ? -96.41  57.27  
8 1 ALA A 922 ? ? -66.73  1.15   
9 1 MET A 924 ? ? -93.67  38.20  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 B GLY 675 ? A GLY 1   
2  1 Y 1 B SER 676 ? A SER 2   
3  1 Y 1 B PRO 677 ? A PRO 3   
4  1 Y 1 B GLY 678 ? A GLY 4   
5  1 Y 1 B GLN 679 ? A GLN 5   
6  1 Y 1 B ASP 680 ? A ASP 6   
7  1 Y 1 B ILE 681 ? A ILE 7   
8  1 Y 1 B LYS 933 ? A LYS 259 
9  1 Y 1 A GLY 675 ? B GLY 1   
10 1 Y 1 A SER 676 ? B SER 2   
11 1 Y 1 A PRO 677 ? B PRO 3   
12 1 Y 1 A GLY 678 ? B GLY 4   
13 1 Y 1 A GLN 679 ? B GLN 5   
14 1 Y 1 A ASP 680 ? B ASP 6   
15 1 Y 1 A ILE 681 ? B ILE 7   
16 1 Y 1 A LYS 933 ? B LYS 259 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 '5-(4,4-DIMETHYL-2-THIOXO-1,4-DIHYDRO-2H-3,1-BENZOXAZIN-6-YL)-1-METHYL-1H-PYRROLE-2-CARBONITRILE' T98 
3 'SULFATE ION'                                                                                     SO4 
4 water                                                                                             HOH 
#