data_1ZV4
# 
_entry.id   1ZV4 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1ZV4         
RCSB  RCSB033155   
WWPDB D_1000033155 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1ZV4 
_pdbx_database_status.recvd_initial_deposition_date   2005-06-01 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Schoch, G.A.'                         1  
'Jansson, A.'                          2  
'Elkins, J.M.'                         3  
'Haroniti, A.'                         4  
'Niesen, F.H.'                         5  
'Bunkoczi, G.'                         6  
'Lee, W.H.'                            7  
'Turnbull, A.P.'                       8  
'Yang, X.'                             9  
'Sundstrom, M.'                        10 
'Arrowsmith, C.'                       11 
'Edwards, A.'                          12 
'Marsden, B.'                          13 
'Gileadi, O.'                          14 
'Ball, L.'                             15 
'von Delft, F.'                        16 
'Doyle, D.A.'                          17 
'Structural Genomics Consortium (SGC)' 18 
# 
_citation.id                        primary 
_citation.title                     
'Structural diversity in the RGS domain and its interaction with heterotrimeric G protein alpha-subunits.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.Usa 
_citation.journal_volume            105 
_citation.page_first                6457 
_citation.page_last                 6462 
_citation.year                      2008 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18434541 
_citation.pdbx_database_id_DOI      10.1073/pnas.0801508105 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Soundararajan, M.' 1  
primary 'Willard, F.S.'     2  
primary 'Kimple, A.J.'      3  
primary 'Turnbull, A.P.'    4  
primary 'Ball, L.J.'        5  
primary 'Schoch, G.A.'      6  
primary 'Gileadi, C.'       7  
primary 'Fedorov, O.Y.'     8  
primary 'Dowler, E.F.'      9  
primary 'Higman, V.A.'      10 
primary 'Hutsell, S.Q.'     11 
primary 'Sundstrom, M.'     12 
primary 'Doyle, D.A.'       13 
primary 'Siderovski, D.P.'  14 
# 
_cell.entry_id           1ZV4 
_cell.length_a           105.153 
_cell.length_b           105.153 
_cell.length_c           57.515 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         1ZV4 
_symmetry.space_group_name_H-M             'P 63 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                182 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Regulator of G-protein signaling 17' 18727.100 1 ? ? ? ? 
2 water   nat water                                 18.015    8 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        RGS17 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MHHHHHHSSGVDLGTENLYFQSMNPTAEEVLSWSQNFDKMMKAPAGRNLFREFLRTEYSEENLLFWLACEDLKKEQNKKV
IEEKARMIYEDYISILSPKEVSLDSRVREVINRNLLDPNPHMYEDAQLQIYTLMHRDSFPRFLNSQIYKSFVESTAGS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MHHHHHHSSGVDLGTENLYFQSMNPTAEEVLSWSQNFDKMMKAPAGRNLFREFLRTEYSEENLLFWLACEDLKKEQNKKV
IEEKARMIYEDYISILSPKEVSLDSRVREVINRNLLDPNPHMYEDAQLQIYTLMHRDSFPRFLNSQIYKSFVESTAGS
;
_entity_poly.pdbx_strand_id                 X 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   HIS n 
1 3   HIS n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   SER n 
1 9   SER n 
1 10  GLY n 
1 11  VAL n 
1 12  ASP n 
1 13  LEU n 
1 14  GLY n 
1 15  THR n 
1 16  GLU n 
1 17  ASN n 
1 18  LEU n 
1 19  TYR n 
1 20  PHE n 
1 21  GLN n 
1 22  SER n 
1 23  MET n 
1 24  ASN n 
1 25  PRO n 
1 26  THR n 
1 27  ALA n 
1 28  GLU n 
1 29  GLU n 
1 30  VAL n 
1 31  LEU n 
1 32  SER n 
1 33  TRP n 
1 34  SER n 
1 35  GLN n 
1 36  ASN n 
1 37  PHE n 
1 38  ASP n 
1 39  LYS n 
1 40  MET n 
1 41  MET n 
1 42  LYS n 
1 43  ALA n 
1 44  PRO n 
1 45  ALA n 
1 46  GLY n 
1 47  ARG n 
1 48  ASN n 
1 49  LEU n 
1 50  PHE n 
1 51  ARG n 
1 52  GLU n 
1 53  PHE n 
1 54  LEU n 
1 55  ARG n 
1 56  THR n 
1 57  GLU n 
1 58  TYR n 
1 59  SER n 
1 60  GLU n 
1 61  GLU n 
1 62  ASN n 
1 63  LEU n 
1 64  LEU n 
1 65  PHE n 
1 66  TRP n 
1 67  LEU n 
1 68  ALA n 
1 69  CYS n 
1 70  GLU n 
1 71  ASP n 
1 72  LEU n 
1 73  LYS n 
1 74  LYS n 
1 75  GLU n 
1 76  GLN n 
1 77  ASN n 
1 78  LYS n 
1 79  LYS n 
1 80  VAL n 
1 81  ILE n 
1 82  GLU n 
1 83  GLU n 
1 84  LYS n 
1 85  ALA n 
1 86  ARG n 
1 87  MET n 
1 88  ILE n 
1 89  TYR n 
1 90  GLU n 
1 91  ASP n 
1 92  TYR n 
1 93  ILE n 
1 94  SER n 
1 95  ILE n 
1 96  LEU n 
1 97  SER n 
1 98  PRO n 
1 99  LYS n 
1 100 GLU n 
1 101 VAL n 
1 102 SER n 
1 103 LEU n 
1 104 ASP n 
1 105 SER n 
1 106 ARG n 
1 107 VAL n 
1 108 ARG n 
1 109 GLU n 
1 110 VAL n 
1 111 ILE n 
1 112 ASN n 
1 113 ARG n 
1 114 ASN n 
1 115 LEU n 
1 116 LEU n 
1 117 ASP n 
1 118 PRO n 
1 119 ASN n 
1 120 PRO n 
1 121 HIS n 
1 122 MET n 
1 123 TYR n 
1 124 GLU n 
1 125 ASP n 
1 126 ALA n 
1 127 GLN n 
1 128 LEU n 
1 129 GLN n 
1 130 ILE n 
1 131 TYR n 
1 132 THR n 
1 133 LEU n 
1 134 MET n 
1 135 HIS n 
1 136 ARG n 
1 137 ASP n 
1 138 SER n 
1 139 PHE n 
1 140 PRO n 
1 141 ARG n 
1 142 PHE n 
1 143 LEU n 
1 144 ASN n 
1 145 SER n 
1 146 GLN n 
1 147 ILE n 
1 148 TYR n 
1 149 LYS n 
1 150 SER n 
1 151 PHE n 
1 152 VAL n 
1 153 GLU n 
1 154 SER n 
1 155 THR n 
1 156 ALA n 
1 157 GLY n 
1 158 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 RGS17 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)-R3' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pLIC-SGC 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    RGS17_HUMAN 
_struct_ref.pdbx_db_accession          Q9UGC6 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;NPTAEEVLSWSQNFDKMMKAPAGRNLFREFLRTEYSEENLLFWLACEDLKKEQNKKVIEEKARMIYEDYISILSPKEVSL
DSRVREVINRNLLDPNPHMYEDAQLQIYTLMHRDSFPRFLNSQIYKSFVESTAGS
;
_struct_ref.pdbx_align_begin           72 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1ZV4 
_struct_ref_seq.pdbx_strand_id                X 
_struct_ref_seq.seq_align_beg                 24 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 158 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q9UGC6 
_struct_ref_seq.db_align_beg                  72 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  206 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       72 
_struct_ref_seq.pdbx_auth_seq_align_end       206 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1ZV4 MET X 1  ? UNP Q9UGC6 ? ? 'CLONING ARTIFACT' 49 1  
1 1ZV4 HIS X 2  ? UNP Q9UGC6 ? ? 'EXPRESSION TAG'   50 2  
1 1ZV4 HIS X 3  ? UNP Q9UGC6 ? ? 'EXPRESSION TAG'   51 3  
1 1ZV4 HIS X 4  ? UNP Q9UGC6 ? ? 'EXPRESSION TAG'   52 4  
1 1ZV4 HIS X 5  ? UNP Q9UGC6 ? ? 'EXPRESSION TAG'   53 5  
1 1ZV4 HIS X 6  ? UNP Q9UGC6 ? ? 'EXPRESSION TAG'   54 6  
1 1ZV4 HIS X 7  ? UNP Q9UGC6 ? ? 'EXPRESSION TAG'   55 7  
1 1ZV4 SER X 8  ? UNP Q9UGC6 ? ? 'CLONING ARTIFACT' 56 8  
1 1ZV4 SER X 9  ? UNP Q9UGC6 ? ? 'CLONING ARTIFACT' 57 9  
1 1ZV4 GLY X 10 ? UNP Q9UGC6 ? ? 'CLONING ARTIFACT' 58 10 
1 1ZV4 VAL X 11 ? UNP Q9UGC6 ? ? 'CLONING ARTIFACT' 59 11 
1 1ZV4 ASP X 12 ? UNP Q9UGC6 ? ? 'CLONING ARTIFACT' 60 12 
1 1ZV4 LEU X 13 ? UNP Q9UGC6 ? ? 'CLONING ARTIFACT' 61 13 
1 1ZV4 GLY X 14 ? UNP Q9UGC6 ? ? 'CLONING ARTIFACT' 62 14 
1 1ZV4 THR X 15 ? UNP Q9UGC6 ? ? 'CLONING ARTIFACT' 63 15 
1 1ZV4 GLU X 16 ? UNP Q9UGC6 ? ? 'CLONING ARTIFACT' 64 16 
1 1ZV4 ASN X 17 ? UNP Q9UGC6 ? ? 'CLONING ARTIFACT' 65 17 
1 1ZV4 LEU X 18 ? UNP Q9UGC6 ? ? 'CLONING ARTIFACT' 66 18 
1 1ZV4 TYR X 19 ? UNP Q9UGC6 ? ? 'CLONING ARTIFACT' 67 19 
1 1ZV4 PHE X 20 ? UNP Q9UGC6 ? ? 'CLONING ARTIFACT' 68 20 
1 1ZV4 GLN X 21 ? UNP Q9UGC6 ? ? 'CLONING ARTIFACT' 69 21 
1 1ZV4 SER X 22 ? UNP Q9UGC6 ? ? 'CLONING ARTIFACT' 70 22 
1 1ZV4 MET X 23 ? UNP Q9UGC6 ? ? 'CLONING ARTIFACT' 71 23 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1ZV4 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.5 
_exptl_crystal.density_percent_sol   49.5 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pdbx_details    'mPEG2K, Na succinate, Hepes, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2005-05-23 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.987 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X10SA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X10SA 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.987 
# 
_reflns.entry_id                     1ZV4 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.d_resolution_high            2.4 
_reflns.d_resolution_low             52.56 
_reflns.number_all                   7748 
_reflns.number_obs                   7589 
_reflns.percent_possible_obs         98.4 
_reflns.pdbx_Rmerge_I_obs            0.072 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        23 
_reflns.B_iso_Wilson_estimate        71.3 
_reflns.pdbx_redundancy              9.9 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.4 
_reflns_shell.d_res_low              2.53 
_reflns_shell.percent_possible_all   100 
_reflns_shell.Rmerge_I_obs           0.421 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    4.2 
_reflns_shell.pdbx_redundancy        9.0 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      1082 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1ZV4 
_refine.ls_number_reflns_obs                     7229 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          0 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             35.7 
_refine.ls_d_res_high                            2.40 
_refine.ls_percent_reflns_obs                    97.94 
_refine.ls_R_factor_obs                          0.22935 
_refine.ls_R_factor_all                          0.22935 
_refine.ls_R_factor_R_work                       0.22777 
_refine.ls_R_factor_R_free                       0.26204 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.6 
_refine.ls_number_reflns_R_free                  349 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.938 
_refine.correlation_coeff_Fo_to_Fc_free          0.925 
_refine.B_iso_mean                               68.449 
_refine.aniso_B[1][1]                            -2.85 
_refine.aniso_B[2][2]                            -2.85 
_refine.aniso_B[3][3]                            4.28 
_refine.aniso_B[1][2]                            -1.43 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      1CMZ 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.338 
_refine.pdbx_overall_ESU_R_Free                  0.248 
_refine.overall_SU_ML                            0.195 
_refine.overall_SU_B                             17.958 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1064 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             8 
_refine_hist.number_atoms_total               1072 
_refine_hist.d_res_high                       2.40 
_refine_hist.d_res_low                        35.7 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.010  0.022  ? 1088 'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.001  0.020  ? 953  'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.187  1.944  ? 1478 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            0.848  3.000  ? 2184 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.441  5.000  ? 136  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       38.229 24.118 ? 51   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       13.510 15.000 ? 164  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       15.797 15.000 ? 6    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.066  0.200  ? 164  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.004  0.020  ? 1231 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.001  0.020  ? 233  'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.191  0.200  ? 248  'X-RAY DIFFRACTION' ? 
r_nbd_other                  0.159  0.200  ? 874  'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.174  0.200  ? 554  'X-RAY DIFFRACTION' ? 
r_nbtor_other                0.085  0.200  ? 566  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.115  0.200  ? 20   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.176  0.200  ? 5    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         0.131  0.200  ? 21   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.215  0.200  ? 1    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.434  1.500  ? 712  'X-RAY DIFFRACTION' ? 
r_mcbond_other               0.072  1.500  ? 273  'X-RAY DIFFRACTION' ? 
r_mcangle_it                 0.692  2.000  ? 1095 'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.029  3.000  ? 437  'X-RAY DIFFRACTION' ? 
r_scangle_it                 1.640  4.500  ? 383  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.400 
_refine_ls_shell.d_res_low                        2.462 
_refine_ls_shell.number_reflns_R_work             515 
_refine_ls_shell.R_factor_R_work                  0.277 
_refine_ls_shell.percent_reflns_obs               100.00 
_refine_ls_shell.R_factor_R_free                  0.429 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             28 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1ZV4 
_struct.title                     'Structure of the Regulator of G-Protein Signaling 17 (RGSZ2)' 
_struct.pdbx_descriptor           'Regulator of G-protein signaling 17' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1ZV4 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            
;Human RGSZ2, Human RGS17(Z2); regulator of G-protein signaling; mu-opioid receptor interacting protein, GTPase-activating proteins (GAP), Regulator of Gz-selective protein signaling 2, Structural Genomics, Structural Genomics Consortium, SGC, SIGNALING PROTEIN
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 THR A 26  ? TRP A 33  ? THR X 74  TRP X 81  1 ? 8  
HELX_P HELX_P2 2 ASN A 36  ? LYS A 42  ? ASN X 84  LYS X 90  1 ? 7  
HELX_P HELX_P3 3 ALA A 43  ? GLU A 57  ? ALA X 91  GLU X 105 1 ? 15 
HELX_P HELX_P4 4 SER A 59  ? GLU A 75  ? SER X 107 GLU X 123 1 ? 17 
HELX_P HELX_P5 5 ASN A 77  ? ILE A 93  ? ASN X 125 ILE X 141 1 ? 17 
HELX_P HELX_P6 6 ASP A 104 ? ASN A 114 ? ASP X 152 ASN X 162 1 ? 11 
HELX_P HELX_P7 7 TYR A 123 ? ASP A 137 ? TYR X 171 ASP X 185 1 ? 15 
HELX_P HELX_P8 8 SER A 138 ? LEU A 143 ? SER X 186 LEU X 191 1 ? 6  
HELX_P HELX_P9 9 SER A 145 ? ALA A 156 ? SER X 193 ALA X 204 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          PRO 
_struct_mon_prot_cis.label_seq_id           98 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           PRO 
_struct_mon_prot_cis.auth_seq_id            146 
_struct_mon_prot_cis.auth_asym_id           X 
_struct_mon_prot_cis.pdbx_label_comp_id_2   LYS 
_struct_mon_prot_cis.pdbx_label_seq_id_2    99 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    LYS 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     147 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    X 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -13.63 
# 
_database_PDB_matrix.entry_id          1ZV4 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1ZV4 
_atom_sites.fract_transf_matrix[1][1]   0.009510 
_atom_sites.fract_transf_matrix[1][2]   0.005491 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010981 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.017387 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . LEU A 1 18  ? 33.137 -4.310 -3.916  1.00 73.56 ? 66  LEU X N   1 
ATOM   2    C CA  . LEU A 1 18  ? 34.190 -4.482 -4.959  1.00 73.56 ? 66  LEU X CA  1 
ATOM   3    C C   . LEU A 1 18  ? 35.059 -3.227 -5.135  1.00 73.59 ? 66  LEU X C   1 
ATOM   4    O O   . LEU A 1 18  ? 35.273 -2.759 -6.255  1.00 73.58 ? 66  LEU X O   1 
ATOM   5    C CB  . LEU A 1 18  ? 33.558 -4.882 -6.297  1.00 73.56 ? 66  LEU X CB  1 
ATOM   6    N N   . TYR A 1 19  ? 35.525 -2.675 -4.014  1.00 73.61 ? 67  TYR X N   1 
ATOM   7    C CA  . TYR A 1 19  ? 36.666 -1.751 -3.997  1.00 73.45 ? 67  TYR X CA  1 
ATOM   8    C C   . TYR A 1 19  ? 37.952 -2.568 -3.856  1.00 73.37 ? 67  TYR X C   1 
ATOM   9    O O   . TYR A 1 19  ? 39.046 -2.089 -4.167  1.00 73.44 ? 67  TYR X O   1 
ATOM   10   C CB  . TYR A 1 19  ? 36.546 -0.763 -2.836  1.00 73.54 ? 67  TYR X CB  1 
ATOM   11   N N   . PHE A 1 20  ? 37.799 -3.800 -3.366  1.00 73.17 ? 68  PHE X N   1 
ATOM   12   C CA  . PHE A 1 20  ? 38.852 -4.821 -3.334  1.00 73.07 ? 68  PHE X CA  1 
ATOM   13   C C   . PHE A 1 20  ? 39.736 -4.785 -4.580  1.00 73.37 ? 68  PHE X C   1 
ATOM   14   O O   . PHE A 1 20  ? 40.958 -4.708 -4.468  1.00 73.20 ? 68  PHE X O   1 
ATOM   15   C CB  . PHE A 1 20  ? 38.192 -6.202 -3.152  1.00 72.69 ? 68  PHE X CB  1 
ATOM   16   C CG  . PHE A 1 20  ? 39.074 -7.374 -3.496  1.00 72.15 ? 68  PHE X CG  1 
ATOM   17   C CD1 . PHE A 1 20  ? 40.107 -7.759 -2.657  1.00 71.63 ? 68  PHE X CD1 1 
ATOM   18   C CD2 . PHE A 1 20  ? 38.835 -8.122 -4.641  1.00 71.64 ? 68  PHE X CD2 1 
ATOM   19   C CE1 . PHE A 1 20  ? 40.904 -8.850 -2.968  1.00 71.51 ? 68  PHE X CE1 1 
ATOM   20   C CE2 . PHE A 1 20  ? 39.625 -9.211 -4.955  1.00 71.56 ? 68  PHE X CE2 1 
ATOM   21   C CZ  . PHE A 1 20  ? 40.661 -9.577 -4.118  1.00 71.69 ? 68  PHE X CZ  1 
ATOM   22   N N   . GLN A 1 21  ? 39.108 -4.815 -5.755  1.00 73.90 ? 69  GLN X N   1 
ATOM   23   C CA  . GLN A 1 21  ? 39.834 -4.765 -7.031  1.00 74.40 ? 69  GLN X CA  1 
ATOM   24   C C   . GLN A 1 21  ? 40.413 -3.387 -7.352  1.00 74.70 ? 69  GLN X C   1 
ATOM   25   O O   . GLN A 1 21  ? 41.313 -3.280 -8.184  1.00 74.82 ? 69  GLN X O   1 
ATOM   26   C CB  . GLN A 1 21  ? 38.950 -5.249 -8.190  1.00 74.46 ? 69  GLN X CB  1 
ATOM   27   C CG  . GLN A 1 21  ? 38.915 -6.766 -8.331  1.00 74.57 ? 69  GLN X CG  1 
ATOM   28   C CD  . GLN A 1 21  ? 37.994 -7.235 -9.438  1.00 74.60 ? 69  GLN X CD  1 
ATOM   29   O OE1 . GLN A 1 21  ? 38.446 -7.728 -10.471 1.00 74.89 ? 69  GLN X OE1 1 
ATOM   30   N NE2 . GLN A 1 21  ? 36.692 -7.082 -9.228  1.00 74.87 ? 69  GLN X NE2 1 
ATOM   31   N N   . SER A 1 22  ? 39.905 -2.343 -6.697  1.00 75.19 ? 70  SER X N   1 
ATOM   32   C CA  . SER A 1 22  ? 40.450 -0.983 -6.837  1.00 75.48 ? 70  SER X CA  1 
ATOM   33   C C   . SER A 1 22  ? 41.492 -0.624 -5.767  1.00 75.72 ? 70  SER X C   1 
ATOM   34   O O   . SER A 1 22  ? 42.186 0.389  -5.896  1.00 76.00 ? 70  SER X O   1 
ATOM   35   C CB  . SER A 1 22  ? 39.312 0.042  -6.790  1.00 75.52 ? 70  SER X CB  1 
ATOM   36   N N   . MET A 1 23  ? 41.605 -1.462 -4.733  1.00 75.96 ? 71  MET X N   1 
ATOM   37   C CA  . MET A 1 23  ? 42.420 -1.185 -3.538  1.00 76.05 ? 71  MET X CA  1 
ATOM   38   C C   . MET A 1 23  ? 43.835 -0.687 -3.829  1.00 76.21 ? 71  MET X C   1 
ATOM   39   O O   . MET A 1 23  ? 44.171 0.453  -3.475  1.00 76.56 ? 71  MET X O   1 
ATOM   40   C CB  . MET A 1 23  ? 42.494 -2.434 -2.650  1.00 76.11 ? 71  MET X CB  1 
ATOM   41   N N   . ASN A 1 24  ? 44.654 -1.533 -4.465  1.00 75.97 ? 72  ASN X N   1 
ATOM   42   C CA  . ASN A 1 24  ? 46.052 -1.198 -4.791  1.00 75.67 ? 72  ASN X CA  1 
ATOM   43   C C   . ASN A 1 24  ? 46.236 -0.881 -6.281  1.00 75.12 ? 72  ASN X C   1 
ATOM   44   O O   . ASN A 1 24  ? 46.401 -1.794 -7.096  1.00 75.13 ? 72  ASN X O   1 
ATOM   45   C CB  . ASN A 1 24  ? 46.986 -2.346 -4.386  1.00 75.77 ? 72  ASN X CB  1 
ATOM   46   C CG  . ASN A 1 24  ? 47.082 -2.520 -2.879  1.00 76.44 ? 72  ASN X CG  1 
ATOM   47   O OD1 . ASN A 1 24  ? 46.163 -2.161 -2.134  1.00 77.26 ? 72  ASN X OD1 1 
ATOM   48   N ND2 . ASN A 1 24  ? 48.198 -3.080 -2.422  1.00 77.17 ? 72  ASN X ND2 1 
ATOM   49   N N   . PRO A 1 25  ? 46.242 0.415  -6.642  1.00 74.34 ? 73  PRO X N   1 
ATOM   50   C CA  . PRO A 1 25  ? 46.206 0.767  -8.059  1.00 73.94 ? 73  PRO X CA  1 
ATOM   51   C C   . PRO A 1 25  ? 47.529 0.501  -8.802  1.00 73.72 ? 73  PRO X C   1 
ATOM   52   O O   . PRO A 1 25  ? 48.622 0.714  -8.257  1.00 73.33 ? 73  PRO X O   1 
ATOM   53   C CB  . PRO A 1 25  ? 45.874 2.261  -8.036  1.00 73.93 ? 73  PRO X CB  1 
ATOM   54   C CG  . PRO A 1 25  ? 46.400 2.741  -6.737  1.00 73.98 ? 73  PRO X CG  1 
ATOM   55   C CD  . PRO A 1 25  ? 46.312 1.606  -5.774  1.00 74.14 ? 73  PRO X CD  1 
ATOM   56   N N   . THR A 1 26  ? 47.408 0.039  -10.043 1.00 73.34 ? 74  THR X N   1 
ATOM   57   C CA  . THR A 1 26  ? 48.558 -0.201 -10.892 1.00 73.25 ? 74  THR X CA  1 
ATOM   58   C C   . THR A 1 26  ? 49.185 1.128  -11.268 1.00 73.17 ? 74  THR X C   1 
ATOM   59   O O   . THR A 1 26  ? 48.553 2.178  -11.130 1.00 73.25 ? 74  THR X O   1 
ATOM   60   C CB  . THR A 1 26  ? 48.160 -0.911 -12.196 1.00 73.20 ? 74  THR X CB  1 
ATOM   61   O OG1 . THR A 1 26  ? 47.123 -0.163 -12.839 1.00 73.08 ? 74  THR X OG1 1 
ATOM   62   C CG2 . THR A 1 26  ? 47.673 -2.324 -11.922 1.00 73.23 ? 74  THR X CG2 1 
ATOM   63   N N   . ALA A 1 27  ? 50.425 1.075  -11.753 1.00 72.80 ? 75  ALA X N   1 
ATOM   64   C CA  . ALA A 1 27  ? 51.099 2.265  -12.261 1.00 72.42 ? 75  ALA X CA  1 
ATOM   65   C C   . ALA A 1 27  ? 50.358 2.859  -13.461 1.00 72.09 ? 75  ALA X C   1 
ATOM   66   O O   . ALA A 1 27  ? 50.324 4.068  -13.619 1.00 71.78 ? 75  ALA X O   1 
ATOM   67   C CB  . ALA A 1 27  ? 52.537 1.945  -12.627 1.00 72.21 ? 75  ALA X CB  1 
ATOM   68   N N   . GLU A 1 28  ? 49.753 2.010  -14.290 1.00 72.16 ? 76  GLU X N   1 
ATOM   69   C CA  . GLU A 1 28  ? 49.051 2.490  -15.492 1.00 72.46 ? 76  GLU X CA  1 
ATOM   70   C C   . GLU A 1 28  ? 47.766 3.247  -15.131 1.00 72.82 ? 76  GLU X C   1 
ATOM   71   O O   . GLU A 1 28  ? 47.433 4.265  -15.761 1.00 72.82 ? 76  GLU X O   1 
ATOM   72   C CB  . GLU A 1 28  ? 48.797 1.378  -16.541 1.00 72.52 ? 76  GLU X CB  1 
ATOM   73   C CG  . GLU A 1 28  ? 48.742 -0.068 -16.042 1.00 72.39 ? 76  GLU X CG  1 
ATOM   74   C CD  . GLU A 1 28  ? 50.110 -0.737 -15.983 1.00 72.11 ? 76  GLU X CD  1 
ATOM   75   O OE1 . GLU A 1 28  ? 50.589 -1.028 -14.864 1.00 72.08 ? 76  GLU X OE1 1 
ATOM   76   O OE2 . GLU A 1 28  ? 50.708 -0.975 -17.054 1.00 71.84 ? 76  GLU X OE2 1 
ATOM   77   N N   . GLU A 1 29  ? 47.061 2.765  -14.107 1.00 73.03 ? 77  GLU X N   1 
ATOM   78   C CA  . GLU A 1 29  ? 45.958 3.516  -13.520 1.00 73.09 ? 77  GLU X CA  1 
ATOM   79   C C   . GLU A 1 29  ? 46.422 4.869  -12.989 1.00 72.42 ? 77  GLU X C   1 
ATOM   80   O O   . GLU A 1 29  ? 45.882 5.898  -13.369 1.00 72.16 ? 77  GLU X O   1 
ATOM   81   C CB  . GLU A 1 29  ? 45.282 2.725  -12.392 1.00 73.48 ? 77  GLU X CB  1 
ATOM   82   C CG  . GLU A 1 29  ? 43.962 2.114  -12.784 1.00 75.43 ? 77  GLU X CG  1 
ATOM   83   C CD  . GLU A 1 29  ? 42.926 3.160  -13.154 1.00 78.58 ? 77  GLU X CD  1 
ATOM   84   O OE1 . GLU A 1 29  ? 42.764 4.149  -12.399 1.00 80.65 ? 77  GLU X OE1 1 
ATOM   85   O OE2 . GLU A 1 29  ? 42.273 2.994  -14.208 1.00 80.75 ? 77  GLU X OE2 1 
ATOM   86   N N   . VAL A 1 30  ? 47.422 4.856  -12.115 1.00 72.07 ? 78  VAL X N   1 
ATOM   87   C CA  . VAL A 1 30  ? 47.950 6.087  -11.515 1.00 72.13 ? 78  VAL X CA  1 
ATOM   88   C C   . VAL A 1 30  ? 48.477 7.077  -12.565 1.00 72.38 ? 78  VAL X C   1 
ATOM   89   O O   . VAL A 1 30  ? 48.324 8.289  -12.411 1.00 73.02 ? 78  VAL X O   1 
ATOM   90   C CB  . VAL A 1 30  ? 49.085 5.786  -10.503 1.00 71.97 ? 78  VAL X CB  1 
ATOM   91   C CG1 . VAL A 1 30  ? 49.748 7.074  -10.008 1.00 71.29 ? 78  VAL X CG1 1 
ATOM   92   C CG2 . VAL A 1 30  ? 48.545 4.985  -9.336  1.00 72.03 ? 78  VAL X CG2 1 
ATOM   93   N N   . LEU A 1 31  ? 49.088 6.563  -13.629 1.00 72.31 ? 79  LEU X N   1 
ATOM   94   C CA  . LEU A 1 31  ? 49.616 7.409  -14.693 1.00 72.29 ? 79  LEU X CA  1 
ATOM   95   C C   . LEU A 1 31  ? 48.555 8.328  -15.330 1.00 72.58 ? 79  LEU X C   1 
ATOM   96   O O   . LEU A 1 31  ? 48.861 9.452  -15.714 1.00 72.65 ? 79  LEU X O   1 
ATOM   97   C CB  . LEU A 1 31  ? 50.278 6.535  -15.765 1.00 72.35 ? 79  LEU X CB  1 
ATOM   98   C CG  . LEU A 1 31  ? 51.113 7.194  -16.864 1.00 71.88 ? 79  LEU X CG  1 
ATOM   99   C CD1 . LEU A 1 31  ? 52.231 8.049  -16.290 1.00 71.58 ? 79  LEU X CD1 1 
ATOM   100  C CD2 . LEU A 1 31  ? 51.673 6.119  -17.752 1.00 71.94 ? 79  LEU X CD2 1 
ATOM   101  N N   . SER A 1 32  ? 47.309 7.865  -15.416 1.00 73.11 ? 80  SER X N   1 
ATOM   102  C CA  . SER A 1 32  ? 46.256 8.598  -16.144 1.00 73.23 ? 80  SER X CA  1 
ATOM   103  C C   . SER A 1 32  ? 45.670 9.804  -15.390 1.00 73.33 ? 80  SER X C   1 
ATOM   104  O O   . SER A 1 32  ? 45.064 10.686 -16.011 1.00 72.63 ? 80  SER X O   1 
ATOM   105  C CB  . SER A 1 32  ? 45.134 7.642  -16.534 1.00 73.12 ? 80  SER X CB  1 
ATOM   106  O OG  . SER A 1 32  ? 44.563 7.073  -15.374 1.00 74.22 ? 80  SER X OG  1 
ATOM   107  N N   . TRP A 1 33  ? 45.893 9.854  -14.074 1.00 73.70 ? 81  TRP X N   1 
ATOM   108  C CA  . TRP A 1 33  ? 45.246 10.833 -13.194 1.00 74.01 ? 81  TRP X CA  1 
ATOM   109  C C   . TRP A 1 33  ? 45.655 12.307 -13.359 1.00 74.48 ? 81  TRP X C   1 
ATOM   110  O O   . TRP A 1 33  ? 44.777 13.186 -13.388 1.00 74.58 ? 81  TRP X O   1 
ATOM   111  C CB  . TRP A 1 33  ? 45.421 10.436 -11.721 1.00 73.91 ? 81  TRP X CB  1 
ATOM   112  C CG  . TRP A 1 33  ? 44.794 9.114  -11.339 1.00 73.54 ? 81  TRP X CG  1 
ATOM   113  C CD1 . TRP A 1 33  ? 43.908 8.366  -12.071 1.00 73.18 ? 81  TRP X CD1 1 
ATOM   114  C CD2 . TRP A 1 33  ? 45.005 8.401  -10.120 1.00 73.56 ? 81  TRP X CD2 1 
ATOM   115  N NE1 . TRP A 1 33  ? 43.575 7.222  -11.389 1.00 73.00 ? 81  TRP X NE1 1 
ATOM   116  C CE2 . TRP A 1 33  ? 44.229 7.221  -10.185 1.00 73.20 ? 81  TRP X CE2 1 
ATOM   117  C CE3 . TRP A 1 33  ? 45.783 8.639  -8.979  1.00 73.36 ? 81  TRP X CE3 1 
ATOM   118  C CZ2 . TRP A 1 33  ? 44.205 6.284  -9.148  1.00 73.21 ? 81  TRP X CZ2 1 
ATOM   119  C CZ3 . TRP A 1 33  ? 45.757 7.704  -7.946  1.00 73.40 ? 81  TRP X CZ3 1 
ATOM   120  C CH2 . TRP A 1 33  ? 44.974 6.543  -8.042  1.00 73.31 ? 81  TRP X CH2 1 
ATOM   121  N N   . SER A 1 34  ? 46.950 12.604 -13.456 1.00 74.93 ? 82  SER X N   1 
ATOM   122  C CA  . SER A 1 34  ? 47.371 14.014 -13.495 1.00 75.46 ? 82  SER X CA  1 
ATOM   123  C C   . SER A 1 34  ? 46.754 14.751 -14.696 1.00 75.48 ? 82  SER X C   1 
ATOM   124  O O   . SER A 1 34  ? 46.231 15.870 -14.551 1.00 75.62 ? 82  SER X O   1 
ATOM   125  C CB  . SER A 1 34  ? 48.889 14.170 -13.432 1.00 75.29 ? 82  SER X CB  1 
ATOM   126  O OG  . SER A 1 34  ? 49.511 13.905 -14.669 1.00 78.05 ? 82  SER X OG  1 
ATOM   127  N N   . GLN A 1 35  ? 46.742 14.095 -15.855 1.00 75.14 ? 83  GLN X N   1 
ATOM   128  C CA  . GLN A 1 35  ? 46.099 14.669 -17.040 1.00 74.92 ? 83  GLN X CA  1 
ATOM   129  C C   . GLN A 1 35  ? 44.556 14.506 -17.082 1.00 74.67 ? 83  GLN X C   1 
ATOM   130  O O   . GLN A 1 35  ? 43.920 14.980 -18.022 1.00 74.43 ? 83  GLN X O   1 
ATOM   131  C CB  . GLN A 1 35  ? 46.741 14.097 -18.312 1.00 75.17 ? 83  GLN X CB  1 
ATOM   132  N N   . ASN A 1 36  ? 43.957 13.866 -16.069 1.00 74.14 ? 84  ASN X N   1 
ATOM   133  C CA  . ASN A 1 36  ? 42.530 13.531 -16.088 1.00 73.57 ? 84  ASN X CA  1 
ATOM   134  C C   . ASN A 1 36  ? 41.888 13.507 -14.671 1.00 73.57 ? 84  ASN X C   1 
ATOM   135  O O   . ASN A 1 36  ? 41.765 12.439 -14.045 1.00 73.77 ? 84  ASN X O   1 
ATOM   136  C CB  . ASN A 1 36  ? 42.309 12.170 -16.770 1.00 73.25 ? 84  ASN X CB  1 
ATOM   137  C CG  . ASN A 1 36  ? 42.880 12.094 -18.208 1.00 73.94 ? 84  ASN X CG  1 
ATOM   138  O OD1 . ASN A 1 36  ? 42.234 12.516 -19.173 1.00 73.59 ? 84  ASN X OD1 1 
ATOM   139  N ND2 . ASN A 1 36  ? 44.083 11.514 -18.346 1.00 71.36 ? 84  ASN X ND2 1 
ATOM   140  N N   . PHE A 1 37  ? 41.474 14.677 -14.180 1.00 72.99 ? 85  PHE X N   1 
ATOM   141  C CA  . PHE A 1 37  ? 40.790 14.793 -12.879 1.00 72.66 ? 85  PHE X CA  1 
ATOM   142  C C   . PHE A 1 37  ? 39.569 13.873 -12.783 1.00 72.65 ? 85  PHE X C   1 
ATOM   143  O O   . PHE A 1 37  ? 39.329 13.253 -11.740 1.00 71.81 ? 85  PHE X O   1 
ATOM   144  C CB  . PHE A 1 37  ? 40.354 16.240 -12.639 1.00 72.47 ? 85  PHE X CB  1 
ATOM   145  C CG  . PHE A 1 37  ? 39.756 16.490 -11.278 1.00 72.20 ? 85  PHE X CG  1 
ATOM   146  C CD1 . PHE A 1 37  ? 40.446 16.156 -10.127 1.00 71.60 ? 85  PHE X CD1 1 
ATOM   147  C CD2 . PHE A 1 37  ? 38.503 17.080 -11.152 1.00 72.87 ? 85  PHE X CD2 1 
ATOM   148  C CE1 . PHE A 1 37  ? 39.905 16.387 -8.876  1.00 72.01 ? 85  PHE X CE1 1 
ATOM   149  C CE2 . PHE A 1 37  ? 37.950 17.319 -9.892  1.00 72.87 ? 85  PHE X CE2 1 
ATOM   150  C CZ  . PHE A 1 37  ? 38.658 16.974 -8.756  1.00 72.61 ? 85  PHE X CZ  1 
ATOM   151  N N   . ASP A 1 38  ? 38.811 13.808 -13.879 1.00 72.89 ? 86  ASP X N   1 
ATOM   152  C CA  . ASP A 1 38  ? 37.642 12.931 -14.004 1.00 73.42 ? 86  ASP X CA  1 
ATOM   153  C C   . ASP A 1 38  ? 37.985 11.449 -13.844 1.00 73.56 ? 86  ASP X C   1 
ATOM   154  O O   . ASP A 1 38  ? 37.275 10.733 -13.169 1.00 73.57 ? 86  ASP X O   1 
ATOM   155  C CB  . ASP A 1 38  ? 36.891 13.169 -15.336 1.00 73.58 ? 86  ASP X CB  1 
ATOM   156  C CG  . ASP A 1 38  ? 37.749 12.928 -16.562 1.00 74.10 ? 86  ASP X CG  1 
ATOM   157  O OD1 . ASP A 1 38  ? 37.319 12.179 -17.464 1.00 77.80 ? 86  ASP X OD1 1 
ATOM   158  O OD2 . ASP A 1 38  ? 38.856 13.484 -16.638 1.00 76.45 ? 86  ASP X OD2 1 
ATOM   159  N N   . LYS A 1 39  ? 39.081 10.999 -14.447 1.00 74.48 ? 87  LYS X N   1 
ATOM   160  C CA  . LYS A 1 39  ? 39.563 9.629  -14.231 1.00 74.75 ? 87  LYS X CA  1 
ATOM   161  C C   . LYS A 1 39  ? 39.924 9.378  -12.770 1.00 74.62 ? 87  LYS X C   1 
ATOM   162  O O   . LYS A 1 39  ? 39.603 8.328  -12.223 1.00 74.59 ? 87  LYS X O   1 
ATOM   163  C CB  . LYS A 1 39  ? 40.767 9.336  -15.110 1.00 74.77 ? 87  LYS X CB  1 
ATOM   164  C CG  . LYS A 1 39  ? 40.427 9.265  -16.584 1.00 75.92 ? 87  LYS X CG  1 
ATOM   165  C CD  . LYS A 1 39  ? 41.593 8.730  -17.373 1.00 77.16 ? 87  LYS X CD  1 
ATOM   166  C CE  . LYS A 1 39  ? 41.337 8.770  -18.870 1.00 78.70 ? 87  LYS X CE  1 
ATOM   167  N N   . MET A 1 40  ? 40.591 10.339 -12.145 1.00 74.62 ? 88  MET X N   1 
ATOM   168  C CA  . MET A 1 40  ? 40.979 10.193 -10.746 1.00 75.19 ? 88  MET X CA  1 
ATOM   169  C C   . MET A 1 40  ? 39.772 10.157 -9.811  1.00 74.69 ? 88  MET X C   1 
ATOM   170  O O   . MET A 1 40  ? 39.714 9.350  -8.888  1.00 73.72 ? 88  MET X O   1 
ATOM   171  C CB  . MET A 1 40  ? 41.900 11.326 -10.312 1.00 74.67 ? 88  MET X CB  1 
ATOM   172  C CG  . MET A 1 40  ? 42.495 11.078 -8.934  1.00 75.32 ? 88  MET X CG  1 
ATOM   173  S SD  . MET A 1 40  ? 43.524 12.432 -8.378  1.00 78.30 ? 88  MET X SD  1 
ATOM   174  C CE  . MET A 1 40  ? 42.225 13.636 -8.029  1.00 78.13 ? 88  MET X CE  1 
ATOM   175  N N   . MET A 1 41  ? 38.836 11.072 -10.048 1.00 75.29 ? 89  MET X N   1 
ATOM   176  C CA  . MET A 1 41  ? 37.598 11.164 -9.278  1.00 75.71 ? 89  MET X CA  1 
ATOM   177  C C   . MET A 1 41  ? 36.721 9.930  -9.395  1.00 75.70 ? 89  MET X C   1 
ATOM   178  O O   . MET A 1 41  ? 35.852 9.737  -8.570  1.00 76.47 ? 89  MET X O   1 
ATOM   179  C CB  . MET A 1 41  ? 36.802 12.408 -9.690  1.00 75.63 ? 89  MET X CB  1 
ATOM   180  C CG  . MET A 1 41  ? 37.418 13.702 -9.192  1.00 76.47 ? 89  MET X CG  1 
ATOM   181  S SD  . MET A 1 41  ? 37.466 13.825 -7.386  1.00 77.59 ? 89  MET X SD  1 
ATOM   182  C CE  . MET A 1 41  ? 35.788 14.333 -7.039  1.00 79.65 ? 89  MET X CE  1 
ATOM   183  N N   . LYS A 1 42  ? 36.949 9.109  -10.411 1.00 76.12 ? 90  LYS X N   1 
ATOM   184  C CA  . LYS A 1 42  ? 36.204 7.861  -10.624 1.00 76.45 ? 90  LYS X CA  1 
ATOM   185  C C   . LYS A 1 42  ? 36.876 6.629  -10.021 1.00 76.15 ? 90  LYS X C   1 
ATOM   186  O O   . LYS A 1 42  ? 36.267 5.566  -9.966  1.00 76.09 ? 90  LYS X O   1 
ATOM   187  C CB  . LYS A 1 42  ? 36.020 7.612  -12.123 1.00 76.79 ? 90  LYS X CB  1 
ATOM   188  C CG  . LYS A 1 42  ? 34.884 8.415  -12.755 1.00 78.45 ? 90  LYS X CG  1 
ATOM   189  C CD  . LYS A 1 42  ? 34.638 7.921  -14.188 1.00 80.28 ? 90  LYS X CD  1 
ATOM   190  N N   . ALA A 1 43  ? 38.132 6.761  -9.607  1.00 75.80 ? 91  ALA X N   1 
ATOM   191  C CA  . ALA A 1 43  ? 38.887 5.656  -9.021  1.00 75.69 ? 91  ALA X CA  1 
ATOM   192  C C   . ALA A 1 43  ? 38.840 5.787  -7.498  1.00 75.92 ? 91  ALA X C   1 
ATOM   193  O O   . ALA A 1 43  ? 39.236 6.812  -6.963  1.00 76.18 ? 91  ALA X O   1 
ATOM   194  C CB  . ALA A 1 43  ? 40.325 5.679  -9.515  1.00 75.46 ? 91  ALA X CB  1 
ATOM   195  N N   . PRO A 1 44  ? 38.309 4.771  -6.795  1.00 76.37 ? 92  PRO X N   1 
ATOM   196  C CA  . PRO A 1 44  ? 38.312 4.800  -5.322  1.00 76.48 ? 92  PRO X CA  1 
ATOM   197  C C   . PRO A 1 44  ? 39.658 5.213  -4.692  1.00 76.39 ? 92  PRO X C   1 
ATOM   198  O O   . PRO A 1 44  ? 39.675 6.029  -3.773  1.00 76.48 ? 92  PRO X O   1 
ATOM   199  C CB  . PRO A 1 44  ? 37.965 3.356  -4.951  1.00 76.45 ? 92  PRO X CB  1 
ATOM   200  C CG  . PRO A 1 44  ? 37.120 2.882  -6.092  1.00 76.58 ? 92  PRO X CG  1 
ATOM   201  C CD  . PRO A 1 44  ? 37.642 3.561  -7.321  1.00 76.18 ? 92  PRO X CD  1 
ATOM   202  N N   . ALA A 1 45  ? 40.760 4.651  -5.184  1.00 76.27 ? 93  ALA X N   1 
ATOM   203  C CA  . ALA A 1 45  ? 42.099 5.007  -4.702  1.00 76.27 ? 93  ALA X CA  1 
ATOM   204  C C   . ALA A 1 45  ? 42.504 6.444  -5.080  1.00 76.10 ? 93  ALA X C   1 
ATOM   205  O O   . ALA A 1 45  ? 43.263 7.088  -4.356  1.00 76.33 ? 93  ALA X O   1 
ATOM   206  C CB  . ALA A 1 45  ? 43.136 4.011  -5.222  1.00 76.15 ? 93  ALA X CB  1 
ATOM   207  N N   . GLY A 1 46  ? 42.012 6.934  -6.215  1.00 75.61 ? 94  GLY X N   1 
ATOM   208  C CA  . GLY A 1 46  ? 42.228 8.316  -6.608  1.00 75.42 ? 94  GLY X CA  1 
ATOM   209  C C   . GLY A 1 46  ? 41.549 9.286  -5.660  1.00 75.29 ? 94  GLY X C   1 
ATOM   210  O O   . GLY A 1 46  ? 42.182 10.216 -5.146  1.00 75.46 ? 94  GLY X O   1 
ATOM   211  N N   . ARG A 1 47  ? 40.255 9.066  -5.436  1.00 74.88 ? 95  ARG X N   1 
ATOM   212  C CA  . ARG A 1 47  ? 39.468 9.884  -4.516  1.00 74.56 ? 95  ARG X CA  1 
ATOM   213  C C   . ARG A 1 47  ? 40.013 9.858  -3.090  1.00 73.61 ? 95  ARG X C   1 
ATOM   214  O O   . ARG A 1 47  ? 39.998 10.877 -2.412  1.00 73.29 ? 95  ARG X O   1 
ATOM   215  C CB  . ARG A 1 47  ? 38.016 9.404  -4.476  1.00 74.94 ? 95  ARG X CB  1 
ATOM   216  C CG  . ARG A 1 47  ? 37.230 9.618  -5.757  1.00 76.00 ? 95  ARG X CG  1 
ATOM   217  C CD  . ARG A 1 47  ? 35.765 9.322  -5.514  1.00 77.45 ? 95  ARG X CD  1 
ATOM   218  N NE  . ARG A 1 47  ? 35.529 7.924  -5.135  1.00 77.42 ? 95  ARG X NE  1 
ATOM   219  C CZ  . ARG A 1 47  ? 34.945 7.001  -5.899  1.00 77.76 ? 95  ARG X CZ  1 
ATOM   220  N NH1 . ARG A 1 47  ? 34.526 7.278  -7.130  1.00 78.20 ? 95  ARG X NH1 1 
ATOM   221  N NH2 . ARG A 1 47  ? 34.777 5.775  -5.421  1.00 78.86 ? 95  ARG X NH2 1 
ATOM   222  N N   . ASN A 1 48  ? 40.458 8.687  -2.643  1.00 72.64 ? 96  ASN X N   1 
ATOM   223  C CA  . ASN A 1 48  ? 40.981 8.508  -1.288  1.00 72.15 ? 96  ASN X CA  1 
ATOM   224  C C   . ASN A 1 48  ? 42.274 9.279  -1.049  1.00 71.86 ? 96  ASN X C   1 
ATOM   225  O O   . ASN A 1 48  ? 42.502 9.806  0.037   1.00 71.58 ? 96  ASN X O   1 
ATOM   226  C CB  . ASN A 1 48  ? 41.203 7.014  -0.988  1.00 71.99 ? 96  ASN X CB  1 
ATOM   227  C CG  . ASN A 1 48  ? 39.890 6.253  -0.711  1.00 71.59 ? 96  ASN X CG  1 
ATOM   228  O OD1 . ASN A 1 48  ? 39.909 5.046  -0.464  1.00 71.94 ? 96  ASN X OD1 1 
ATOM   229  N ND2 . ASN A 1 48  ? 38.770 6.951  -0.741  1.00 67.68 ? 96  ASN X ND2 1 
ATOM   230  N N   . LEU A 1 49  ? 43.117 9.334  -2.072  1.00 71.64 ? 97  LEU X N   1 
ATOM   231  C CA  . LEU A 1 49  ? 44.356 10.096 -2.014  1.00 71.72 ? 97  LEU X CA  1 
ATOM   232  C C   . LEU A 1 49  ? 44.049 11.597 -1.979  1.00 71.44 ? 97  LEU X C   1 
ATOM   233  O O   . LEU A 1 49  ? 44.582 12.351 -1.161  1.00 71.20 ? 97  LEU X O   1 
ATOM   234  C CB  . LEU A 1 49  ? 45.215 9.767  -3.239  1.00 71.70 ? 97  LEU X CB  1 
ATOM   235  C CG  . LEU A 1 49  ? 46.661 10.233 -3.226  1.00 71.80 ? 97  LEU X CG  1 
ATOM   236  C CD1 . LEU A 1 49  ? 47.417 9.586  -2.073  1.00 72.29 ? 97  LEU X CD1 1 
ATOM   237  C CD2 . LEU A 1 49  ? 47.305 9.900  -4.563  1.00 72.17 ? 97  LEU X CD2 1 
ATOM   238  N N   . PHE A 1 50  ? 43.174 12.009 -2.884  1.00 71.11 ? 98  PHE X N   1 
ATOM   239  C CA  . PHE A 1 50  ? 42.750 13.390 -2.983  1.00 71.18 ? 98  PHE X CA  1 
ATOM   240  C C   . PHE A 1 50  ? 42.037 13.836 -1.703  1.00 71.57 ? 98  PHE X C   1 
ATOM   241  O O   . PHE A 1 50  ? 42.177 14.980 -1.281  1.00 71.40 ? 98  PHE X O   1 
ATOM   242  C CB  . PHE A 1 50  ? 41.858 13.545 -4.219  1.00 70.89 ? 98  PHE X CB  1 
ATOM   243  C CG  . PHE A 1 50  ? 41.485 14.953 -4.533  1.00 70.29 ? 98  PHE X CG  1 
ATOM   244  C CD1 . PHE A 1 50  ? 42.454 15.927 -4.669  1.00 70.56 ? 98  PHE X CD1 1 
ATOM   245  C CD2 . PHE A 1 50  ? 40.160 15.299 -4.741  1.00 70.92 ? 98  PHE X CD2 1 
ATOM   246  C CE1 . PHE A 1 50  ? 42.114 17.235 -4.970  1.00 71.00 ? 98  PHE X CE1 1 
ATOM   247  C CE2 . PHE A 1 50  ? 39.809 16.594 -5.047  1.00 71.69 ? 98  PHE X CE2 1 
ATOM   248  C CZ  . PHE A 1 50  ? 40.791 17.573 -5.154  1.00 71.06 ? 98  PHE X CZ  1 
ATOM   249  N N   . ARG A 1 51  ? 41.307 12.910 -1.081  1.00 72.04 ? 99  ARG X N   1 
ATOM   250  C CA  . ARG A 1 51  ? 40.564 13.167 0.150   1.00 72.54 ? 99  ARG X CA  1 
ATOM   251  C C   . ARG A 1 51  ? 41.484 13.394 1.352   1.00 72.84 ? 99  ARG X C   1 
ATOM   252  O O   . ARG A 1 51  ? 41.140 14.152 2.249   1.00 73.08 ? 99  ARG X O   1 
ATOM   253  C CB  . ARG A 1 51  ? 39.609 12.003 0.431   1.00 72.70 ? 99  ARG X CB  1 
ATOM   254  C CG  . ARG A 1 51  ? 38.682 12.209 1.602   1.00 73.56 ? 99  ARG X CG  1 
ATOM   255  C CD  . ARG A 1 51  ? 37.724 11.042 1.755   1.00 74.27 ? 99  ARG X CD  1 
ATOM   256  N NE  . ARG A 1 51  ? 37.198 10.954 3.115   1.00 74.61 ? 99  ARG X NE  1 
ATOM   257  C CZ  . ARG A 1 51  ? 36.224 10.129 3.500   1.00 75.04 ? 99  ARG X CZ  1 
ATOM   258  N NH1 . ARG A 1 51  ? 35.649 9.295  2.637   1.00 75.46 ? 99  ARG X NH1 1 
ATOM   259  N NH2 . ARG A 1 51  ? 35.830 10.135 4.768   1.00 74.61 ? 99  ARG X NH2 1 
ATOM   260  N N   . GLU A 1 52  ? 42.640 12.728 1.377   1.00 73.15 ? 100 GLU X N   1 
ATOM   261  C CA  . GLU A 1 52  ? 43.669 13.004 2.381   1.00 73.28 ? 100 GLU X CA  1 
ATOM   262  C C   . GLU A 1 52  ? 44.204 14.434 2.242   1.00 73.16 ? 100 GLU X C   1 
ATOM   263  O O   . GLU A 1 52  ? 44.290 15.174 3.225   1.00 73.34 ? 100 GLU X O   1 
ATOM   264  C CB  . GLU A 1 52  ? 44.833 12.007 2.267   1.00 73.47 ? 100 GLU X CB  1 
ATOM   265  N N   . PHE A 1 53  ? 44.562 14.806 1.018   1.00 72.94 ? 101 PHE X N   1 
ATOM   266  C CA  . PHE A 1 53  ? 45.024 16.156 0.726   1.00 73.15 ? 101 PHE X CA  1 
ATOM   267  C C   . PHE A 1 53  ? 43.998 17.238 1.077   1.00 73.55 ? 101 PHE X C   1 
ATOM   268  O O   . PHE A 1 53  ? 44.371 18.289 1.600   1.00 73.81 ? 101 PHE X O   1 
ATOM   269  C CB  . PHE A 1 53  ? 45.419 16.293 -0.748  1.00 72.89 ? 101 PHE X CB  1 
ATOM   270  C CG  . PHE A 1 53  ? 45.761 17.701 -1.143  1.00 72.79 ? 101 PHE X CG  1 
ATOM   271  C CD1 . PHE A 1 53  ? 46.950 18.279 -0.719  1.00 72.78 ? 101 PHE X CD1 1 
ATOM   272  C CD2 . PHE A 1 53  ? 44.877 18.465 -1.894  1.00 72.40 ? 101 PHE X CD2 1 
ATOM   273  C CE1 . PHE A 1 53  ? 47.265 19.584 -1.059  1.00 72.85 ? 101 PHE X CE1 1 
ATOM   274  C CE2 . PHE A 1 53  ? 45.182 19.767 -2.239  1.00 71.95 ? 101 PHE X CE2 1 
ATOM   275  C CZ  . PHE A 1 53  ? 46.382 20.327 -1.824  1.00 72.87 ? 101 PHE X CZ  1 
ATOM   276  N N   . LEU A 1 54  ? 42.719 16.992 0.779   1.00 73.92 ? 102 LEU X N   1 
ATOM   277  C CA  . LEU A 1 54  ? 41.661 17.948 1.098   1.00 74.00 ? 102 LEU X CA  1 
ATOM   278  C C   . LEU A 1 54  ? 41.524 18.111 2.612   1.00 74.20 ? 102 LEU X C   1 
ATOM   279  O O   . LEU A 1 54  ? 41.225 19.199 3.085   1.00 74.09 ? 102 LEU X O   1 
ATOM   280  C CB  . LEU A 1 54  ? 40.319 17.521 0.498   1.00 73.94 ? 102 LEU X CB  1 
ATOM   281  C CG  . LEU A 1 54  ? 40.165 17.449 -1.027  1.00 74.29 ? 102 LEU X CG  1 
ATOM   282  C CD1 . LEU A 1 54  ? 38.740 17.069 -1.354  1.00 74.13 ? 102 LEU X CD1 1 
ATOM   283  C CD2 . LEU A 1 54  ? 40.546 18.744 -1.733  1.00 74.21 ? 102 LEU X CD2 1 
ATOM   284  N N   . ARG A 1 55  ? 41.746 17.036 3.364   1.00 74.58 ? 103 ARG X N   1 
ATOM   285  C CA  . ARG A 1 55  ? 41.700 17.102 4.833   1.00 75.24 ? 103 ARG X CA  1 
ATOM   286  C C   . ARG A 1 55  ? 42.693 18.127 5.389   1.00 75.12 ? 103 ARG X C   1 
ATOM   287  O O   . ARG A 1 55  ? 42.381 18.834 6.345   1.00 75.14 ? 103 ARG X O   1 
ATOM   288  C CB  . ARG A 1 55  ? 41.950 15.722 5.466   1.00 75.28 ? 103 ARG X CB  1 
ATOM   289  C CG  . ARG A 1 55  ? 40.732 14.788 5.485   1.00 75.91 ? 103 ARG X CG  1 
ATOM   290  C CD  . ARG A 1 55  ? 41.064 13.426 6.123   1.00 76.32 ? 103 ARG X CD  1 
ATOM   291  N NE  . ARG A 1 55  ? 39.899 12.826 6.778   1.00 77.91 ? 103 ARG X NE  1 
ATOM   292  C CZ  . ARG A 1 55  ? 39.927 11.761 7.584   1.00 78.80 ? 103 ARG X CZ  1 
ATOM   293  N NH1 . ARG A 1 55  ? 41.069 11.135 7.867   1.00 79.45 ? 103 ARG X NH1 1 
ATOM   294  N NH2 . ARG A 1 55  ? 38.791 11.315 8.121   1.00 78.84 ? 103 ARG X NH2 1 
ATOM   295  N N   . THR A 1 56  ? 43.873 18.218 4.770   1.00 75.27 ? 104 THR X N   1 
ATOM   296  C CA  . THR A 1 56  ? 44.914 19.160 5.199   1.00 75.35 ? 104 THR X CA  1 
ATOM   297  C C   . THR A 1 56  ? 44.552 20.623 4.909   1.00 75.57 ? 104 THR X C   1 
ATOM   298  O O   . THR A 1 56  ? 45.055 21.529 5.570   1.00 75.86 ? 104 THR X O   1 
ATOM   299  C CB  . THR A 1 56  ? 46.270 18.846 4.537   1.00 75.24 ? 104 THR X CB  1 
ATOM   300  O OG1 . THR A 1 56  ? 46.175 19.053 3.125   1.00 75.42 ? 104 THR X OG1 1 
ATOM   301  C CG2 . THR A 1 56  ? 46.686 17.406 4.807   1.00 75.18 ? 104 THR X CG2 1 
ATOM   302  N N   . GLU A 1 57  ? 43.691 20.843 3.917   1.00 75.84 ? 105 GLU X N   1 
ATOM   303  C CA  . GLU A 1 57  ? 43.154 22.174 3.602   1.00 75.96 ? 105 GLU X CA  1 
ATOM   304  C C   . GLU A 1 57  ? 41.749 22.399 4.173   1.00 75.72 ? 105 GLU X C   1 
ATOM   305  O O   . GLU A 1 57  ? 41.102 23.402 3.865   1.00 75.55 ? 105 GLU X O   1 
ATOM   306  C CB  . GLU A 1 57  ? 43.098 22.359 2.087   1.00 76.05 ? 105 GLU X CB  1 
ATOM   307  C CG  . GLU A 1 57  ? 44.441 22.257 1.422   1.00 77.04 ? 105 GLU X CG  1 
ATOM   308  C CD  . GLU A 1 57  ? 44.387 22.600 -0.048  1.00 78.27 ? 105 GLU X CD  1 
ATOM   309  O OE1 . GLU A 1 57  ? 43.274 22.640 -0.609  1.00 78.15 ? 105 GLU X OE1 1 
ATOM   310  O OE2 . GLU A 1 57  ? 45.466 22.827 -0.636  1.00 79.67 ? 105 GLU X OE2 1 
ATOM   311  N N   . TYR A 1 58  ? 41.274 21.445 4.973   1.00 75.63 ? 106 TYR X N   1 
ATOM   312  C CA  . TYR A 1 58  ? 39.965 21.525 5.627   1.00 75.65 ? 106 TYR X CA  1 
ATOM   313  C C   . TYR A 1 58  ? 38.797 21.717 4.654   1.00 75.52 ? 106 TYR X C   1 
ATOM   314  O O   . TYR A 1 58  ? 37.782 22.319 5.002   1.00 75.57 ? 106 TYR X O   1 
ATOM   315  C CB  . TYR A 1 58  ? 39.988 22.626 6.696   1.00 75.89 ? 106 TYR X CB  1 
ATOM   316  C CG  . TYR A 1 58  ? 41.135 22.472 7.662   1.00 75.72 ? 106 TYR X CG  1 
ATOM   317  C CD1 . TYR A 1 58  ? 42.358 23.091 7.426   1.00 76.20 ? 106 TYR X CD1 1 
ATOM   318  C CD2 . TYR A 1 58  ? 41.003 21.691 8.802   1.00 76.27 ? 106 TYR X CD2 1 
ATOM   319  C CE1 . TYR A 1 58  ? 43.420 22.947 8.312   1.00 76.23 ? 106 TYR X CE1 1 
ATOM   320  C CE2 . TYR A 1 58  ? 42.055 21.542 9.697   1.00 76.42 ? 106 TYR X CE2 1 
ATOM   321  C CZ  . TYR A 1 58  ? 43.260 22.169 9.442   1.00 76.13 ? 106 TYR X CZ  1 
ATOM   322  O OH  . TYR A 1 58  ? 44.301 22.019 10.324  1.00 76.78 ? 106 TYR X OH  1 
ATOM   323  N N   . SER A 1 59  ? 38.945 21.169 3.446   1.00 75.37 ? 107 SER X N   1 
ATOM   324  C CA  . SER A 1 59  ? 37.931 21.261 2.396   1.00 75.07 ? 107 SER X CA  1 
ATOM   325  C C   . SER A 1 59  ? 37.388 19.880 2.004   1.00 75.02 ? 107 SER X C   1 
ATOM   326  O O   . SER A 1 59  ? 36.791 19.734 0.945   1.00 74.63 ? 107 SER X O   1 
ATOM   327  C CB  . SER A 1 59  ? 38.526 21.938 1.165   1.00 74.90 ? 107 SER X CB  1 
ATOM   328  O OG  . SER A 1 59  ? 39.496 21.095 0.567   1.00 75.16 ? 107 SER X OG  1 
ATOM   329  N N   . GLU A 1 60  ? 37.575 18.883 2.871   1.00 75.25 ? 108 GLU X N   1 
ATOM   330  C CA  . GLU A 1 60  ? 37.135 17.504 2.605   1.00 75.48 ? 108 GLU X CA  1 
ATOM   331  C C   . GLU A 1 60  ? 35.660 17.447 2.228   1.00 75.20 ? 108 GLU X C   1 
ATOM   332  O O   . GLU A 1 60  ? 35.285 16.704 1.321   1.00 75.12 ? 108 GLU X O   1 
ATOM   333  C CB  . GLU A 1 60  ? 37.385 16.623 3.837   1.00 75.57 ? 108 GLU X CB  1 
ATOM   334  C CG  . GLU A 1 60  ? 37.114 15.122 3.661   1.00 76.18 ? 108 GLU X CG  1 
ATOM   335  C CD  . GLU A 1 60  ? 37.202 14.331 4.984   1.00 76.67 ? 108 GLU X CD  1 
ATOM   336  O OE1 . GLU A 1 60  ? 37.020 14.918 6.077   1.00 78.26 ? 108 GLU X OE1 1 
ATOM   337  O OE2 . GLU A 1 60  ? 37.453 13.109 4.931   1.00 78.36 ? 108 GLU X OE2 1 
ATOM   338  N N   . GLU A 1 61  ? 34.841 18.248 2.915   1.00 74.92 ? 109 GLU X N   1 
ATOM   339  C CA  . GLU A 1 61  ? 33.386 18.249 2.726   1.00 75.00 ? 109 GLU X CA  1 
ATOM   340  C C   . GLU A 1 61  ? 32.950 18.405 1.263   1.00 74.19 ? 109 GLU X C   1 
ATOM   341  O O   . GLU A 1 61  ? 31.949 17.814 0.855   1.00 74.26 ? 109 GLU X O   1 
ATOM   342  C CB  . GLU A 1 61  ? 32.699 19.296 3.642   1.00 75.55 ? 109 GLU X CB  1 
ATOM   343  C CG  . GLU A 1 61  ? 32.804 20.790 3.223   1.00 77.69 ? 109 GLU X CG  1 
ATOM   344  C CD  . GLU A 1 61  ? 34.145 21.467 3.553   1.00 80.48 ? 109 GLU X CD  1 
ATOM   345  O OE1 . GLU A 1 61  ? 35.109 20.784 3.981   1.00 81.82 ? 109 GLU X OE1 1 
ATOM   346  O OE2 . GLU A 1 61  ? 34.235 22.704 3.368   1.00 82.52 ? 109 GLU X OE2 1 
ATOM   347  N N   . ASN A 1 62  ? 33.702 19.171 0.472   1.00 73.33 ? 110 ASN X N   1 
ATOM   348  C CA  . ASN A 1 62  ? 33.431 19.290 -0.965  1.00 72.64 ? 110 ASN X CA  1 
ATOM   349  C C   . ASN A 1 62  ? 33.436 17.941 -1.677  1.00 72.69 ? 110 ASN X C   1 
ATOM   350  O O   . ASN A 1 62  ? 32.594 17.676 -2.538  1.00 72.34 ? 110 ASN X O   1 
ATOM   351  C CB  . ASN A 1 62  ? 34.469 20.181 -1.645  1.00 72.67 ? 110 ASN X CB  1 
ATOM   352  C CG  . ASN A 1 62  ? 34.283 21.651 -1.352  1.00 71.94 ? 110 ASN X CG  1 
ATOM   353  O OD1 . ASN A 1 62  ? 33.271 22.076 -0.793  1.00 73.68 ? 110 ASN X OD1 1 
ATOM   354  N ND2 . ASN A 1 62  ? 35.273 22.441 -1.726  1.00 70.32 ? 110 ASN X ND2 1 
ATOM   355  N N   . LEU A 1 63  ? 34.399 17.091 -1.330  1.00 72.81 ? 111 LEU X N   1 
ATOM   356  C CA  . LEU A 1 63  ? 34.518 15.779 -1.967  1.00 72.87 ? 111 LEU X CA  1 
ATOM   357  C C   . LEU A 1 63  ? 33.432 14.850 -1.431  1.00 72.58 ? 111 LEU X C   1 
ATOM   358  O O   . LEU A 1 63  ? 32.781 14.124 -2.193  1.00 72.94 ? 111 LEU X O   1 
ATOM   359  C CB  . LEU A 1 63  ? 35.918 15.189 -1.762  1.00 72.66 ? 111 LEU X CB  1 
ATOM   360  C CG  . LEU A 1 63  ? 36.207 13.807 -2.348  1.00 72.96 ? 111 LEU X CG  1 
ATOM   361  C CD1 . LEU A 1 63  ? 35.963 13.770 -3.842  1.00 74.53 ? 111 LEU X CD1 1 
ATOM   362  C CD2 . LEU A 1 63  ? 37.627 13.428 -2.074  1.00 73.49 ? 111 LEU X CD2 1 
ATOM   363  N N   . LEU A 1 64  ? 33.225 14.894 -0.120  1.00 71.99 ? 112 LEU X N   1 
ATOM   364  C CA  . LEU A 1 64  ? 32.177 14.101 0.506   1.00 71.53 ? 112 LEU X CA  1 
ATOM   365  C C   . LEU A 1 64  ? 30.793 14.409 -0.079  1.00 71.33 ? 112 LEU X C   1 
ATOM   366  O O   . LEU A 1 64  ? 29.999 13.499 -0.326  1.00 71.30 ? 112 LEU X O   1 
ATOM   367  C CB  . LEU A 1 64  ? 32.199 14.299 2.030   1.00 71.58 ? 112 LEU X CB  1 
ATOM   368  C CG  . LEU A 1 64  ? 33.020 13.283 2.837   1.00 71.39 ? 112 LEU X CG  1 
ATOM   369  C CD1 . LEU A 1 64  ? 34.335 12.974 2.190   1.00 71.95 ? 112 LEU X CD1 1 
ATOM   370  C CD2 . LEU A 1 64  ? 33.234 13.774 4.255   1.00 71.48 ? 112 LEU X CD2 1 
ATOM   371  N N   . PHE A 1 65  ? 30.506 15.689 -0.297  1.00 71.04 ? 113 PHE X N   1 
ATOM   372  C CA  . PHE A 1 65  ? 29.272 16.090 -0.965  1.00 70.87 ? 113 PHE X CA  1 
ATOM   373  C C   . PHE A 1 65  ? 29.192 15.502 -2.366  1.00 70.61 ? 113 PHE X C   1 
ATOM   374  O O   . PHE A 1 65  ? 28.178 14.927 -2.754  1.00 70.74 ? 113 PHE X O   1 
ATOM   375  C CB  . PHE A 1 65  ? 29.167 17.617 -1.034  1.00 71.01 ? 113 PHE X CB  1 
ATOM   376  C CG  . PHE A 1 65  ? 28.071 18.103 -1.933  1.00 70.97 ? 113 PHE X CG  1 
ATOM   377  C CD1 . PHE A 1 65  ? 26.748 17.863 -1.620  1.00 71.45 ? 113 PHE X CD1 1 
ATOM   378  C CD2 . PHE A 1 65  ? 28.365 18.783 -3.109  1.00 71.60 ? 113 PHE X CD2 1 
ATOM   379  C CE1 . PHE A 1 65  ? 25.729 18.302 -2.455  1.00 71.92 ? 113 PHE X CE1 1 
ATOM   380  C CE2 . PHE A 1 65  ? 27.357 19.215 -3.944  1.00 71.43 ? 113 PHE X CE2 1 
ATOM   381  C CZ  . PHE A 1 65  ? 26.034 18.971 -3.620  1.00 71.13 ? 113 PHE X CZ  1 
ATOM   382  N N   . TRP A 1 66  ? 30.274 15.657 -3.122  1.00 71.05 ? 114 TRP X N   1 
ATOM   383  C CA  . TRP A 1 66  ? 30.364 15.151 -4.491  1.00 70.73 ? 114 TRP X CA  1 
ATOM   384  C C   . TRP A 1 66  ? 30.108 13.644 -4.530  1.00 70.48 ? 114 TRP X C   1 
ATOM   385  O O   . TRP A 1 66  ? 29.346 13.166 -5.365  1.00 70.31 ? 114 TRP X O   1 
ATOM   386  C CB  . TRP A 1 66  ? 31.722 15.512 -5.116  1.00 70.70 ? 114 TRP X CB  1 
ATOM   387  C CG  . TRP A 1 66  ? 31.789 15.157 -6.570  1.00 70.49 ? 114 TRP X CG  1 
ATOM   388  C CD1 . TRP A 1 66  ? 31.450 15.947 -7.624  1.00 70.46 ? 114 TRP X CD1 1 
ATOM   389  C CD2 . TRP A 1 66  ? 32.180 13.891 -7.121  1.00 70.06 ? 114 TRP X CD2 1 
ATOM   390  N NE1 . TRP A 1 66  ? 31.596 15.245 -8.804  1.00 70.68 ? 114 TRP X NE1 1 
ATOM   391  C CE2 . TRP A 1 66  ? 32.054 13.986 -8.517  1.00 69.50 ? 114 TRP X CE2 1 
ATOM   392  C CE3 . TRP A 1 66  ? 32.609 12.682 -6.562  1.00 70.07 ? 114 TRP X CE3 1 
ATOM   393  C CZ2 . TRP A 1 66  ? 32.359 12.929 -9.363  1.00 70.15 ? 114 TRP X CZ2 1 
ATOM   394  C CZ3 . TRP A 1 66  ? 32.912 11.640 -7.399  1.00 70.83 ? 114 TRP X CZ3 1 
ATOM   395  C CH2 . TRP A 1 66  ? 32.795 11.770 -8.790  1.00 70.34 ? 114 TRP X CH2 1 
ATOM   396  N N   . LEU A 1 67  ? 30.713 12.922 -3.594  1.00 70.92 ? 115 LEU X N   1 
ATOM   397  C CA  . LEU A 1 67  ? 30.536 11.463 -3.454  1.00 71.69 ? 115 LEU X CA  1 
ATOM   398  C C   . LEU A 1 67  ? 29.123 11.061 -3.133  1.00 71.43 ? 115 LEU X C   1 
ATOM   399  O O   . LEU A 1 67  ? 28.607 10.082 -3.679  1.00 71.57 ? 115 LEU X O   1 
ATOM   400  C CB  . LEU A 1 67  ? 31.415 10.915 -2.330  1.00 71.89 ? 115 LEU X CB  1 
ATOM   401  C CG  . LEU A 1 67  ? 32.788 10.410 -2.722  1.00 74.74 ? 115 LEU X CG  1 
ATOM   402  C CD1 . LEU A 1 67  ? 33.597 10.133 -1.442  1.00 75.99 ? 115 LEU X CD1 1 
ATOM   403  C CD2 . LEU A 1 67  ? 32.656 9.138  -3.601  1.00 75.94 ? 115 LEU X CD2 1 
ATOM   404  N N   . ALA A 1 68  ? 28.513 11.777 -2.195  1.00 71.54 ? 116 ALA X N   1 
ATOM   405  C CA  . ALA A 1 68  ? 27.104 11.531 -1.846  1.00 71.27 ? 116 ALA X CA  1 
ATOM   406  C C   . ALA A 1 68  ? 26.163 11.769 -3.041  1.00 71.13 ? 116 ALA X C   1 
ATOM   407  O O   . ALA A 1 68  ? 25.232 11.002 -3.248  1.00 71.15 ? 116 ALA X O   1 
ATOM   408  C CB  . ALA A 1 68  ? 26.701 12.368 -0.664  1.00 71.31 ? 116 ALA X CB  1 
ATOM   409  N N   . CYS A 1 69  ? 26.415 12.795 -3.847  1.00 71.25 ? 117 CYS X N   1 
ATOM   410  C CA  . CYS A 1 69  ? 25.617 12.991 -5.068  1.00 71.86 ? 117 CYS X CA  1 
ATOM   411  C C   . CYS A 1 69  ? 25.809 11.873 -6.082  1.00 72.25 ? 117 CYS X C   1 
ATOM   412  O O   . CYS A 1 69  ? 24.845 11.491 -6.744  1.00 72.59 ? 117 CYS X O   1 
ATOM   413  C CB  . CYS A 1 69  ? 25.916 14.329 -5.737  1.00 71.99 ? 117 CYS X CB  1 
ATOM   414  S SG  . CYS A 1 69  ? 25.563 15.707 -4.711  1.00 72.63 ? 117 CYS X SG  1 
ATOM   415  N N   . GLU A 1 70  ? 27.036 11.352 -6.200  1.00 72.86 ? 118 GLU X N   1 
ATOM   416  C CA  . GLU A 1 70  ? 27.304 10.143 -7.012  1.00 73.59 ? 118 GLU X CA  1 
ATOM   417  C C   . GLU A 1 70  ? 26.545 8.916  -6.532  1.00 73.93 ? 118 GLU X C   1 
ATOM   418  O O   . GLU A 1 70  ? 26.016 8.167  -7.349  1.00 73.96 ? 118 GLU X O   1 
ATOM   419  C CB  . GLU A 1 70  ? 28.802 9.795  -7.044  1.00 73.84 ? 118 GLU X CB  1 
ATOM   420  C CG  . GLU A 1 70  ? 29.628 10.669 -7.948  1.00 74.72 ? 118 GLU X CG  1 
ATOM   421  C CD  . GLU A 1 70  ? 29.174 10.620 -9.403  1.00 75.73 ? 118 GLU X CD  1 
ATOM   422  O OE1 . GLU A 1 70  ? 29.409 9.592  -10.087 1.00 74.80 ? 118 GLU X OE1 1 
ATOM   423  O OE2 . GLU A 1 70  ? 28.595 11.628 -9.857  1.00 76.47 ? 118 GLU X OE2 1 
ATOM   424  N N   . ASP A 1 71  ? 26.508 8.715  -5.212  1.00 74.71 ? 119 ASP X N   1 
ATOM   425  C CA  . ASP A 1 71  ? 25.786 7.599  -4.584  1.00 75.16 ? 119 ASP X CA  1 
ATOM   426  C C   . ASP A 1 71  ? 24.264 7.682  -4.785  1.00 75.61 ? 119 ASP X C   1 
ATOM   427  O O   . ASP A 1 71  ? 23.600 6.654  -4.967  1.00 75.32 ? 119 ASP X O   1 
ATOM   428  C CB  . ASP A 1 71  ? 26.106 7.559  -3.085  1.00 75.27 ? 119 ASP X CB  1 
ATOM   429  C CG  . ASP A 1 71  ? 25.520 6.339  -2.387  1.00 76.47 ? 119 ASP X CG  1 
ATOM   430  O OD1 . ASP A 1 71  ? 26.093 5.237  -2.521  1.00 78.79 ? 119 ASP X OD1 1 
ATOM   431  O OD2 . ASP A 1 71  ? 24.490 6.476  -1.689  1.00 77.89 ? 119 ASP X OD2 1 
ATOM   432  N N   . LEU A 1 72  ? 23.717 8.897  -4.738  1.00 76.20 ? 120 LEU X N   1 
ATOM   433  C CA  . LEU A 1 72  ? 22.283 9.118  -4.969  1.00 76.75 ? 120 LEU X CA  1 
ATOM   434  C C   . LEU A 1 72  ? 21.873 8.825  -6.420  1.00 77.56 ? 120 LEU X C   1 
ATOM   435  O O   . LEU A 1 72  ? 20.813 8.247  -6.654  1.00 77.85 ? 120 LEU X O   1 
ATOM   436  C CB  . LEU A 1 72  ? 21.872 10.549 -4.572  1.00 76.59 ? 120 LEU X CB  1 
ATOM   437  C CG  . LEU A 1 72  ? 20.415 10.965 -4.838  1.00 76.78 ? 120 LEU X CG  1 
ATOM   438  C CD1 . LEU A 1 72  ? 19.451 10.058 -4.096  1.00 77.01 ? 120 LEU X CD1 1 
ATOM   439  C CD2 . LEU A 1 72  ? 20.155 12.417 -4.467  1.00 76.66 ? 120 LEU X CD2 1 
ATOM   440  N N   . LYS A 1 73  ? 22.699 9.218  -7.386  1.00 78.76 ? 121 LYS X N   1 
ATOM   441  C CA  . LYS A 1 73  ? 22.426 8.915  -8.808  1.00 79.97 ? 121 LYS X CA  1 
ATOM   442  C C   . LYS A 1 73  ? 22.248 7.431  -9.139  1.00 80.32 ? 121 LYS X C   1 
ATOM   443  O O   . LYS A 1 73  ? 21.425 7.085  -9.979  1.00 80.42 ? 121 LYS X O   1 
ATOM   444  C CB  . LYS A 1 73  ? 23.538 9.460  -9.703  1.00 80.45 ? 121 LYS X CB  1 
ATOM   445  C CG  . LYS A 1 73  ? 23.436 10.937 -9.967  1.00 81.81 ? 121 LYS X CG  1 
ATOM   446  C CD  . LYS A 1 73  ? 24.253 11.321 -11.202 1.00 83.95 ? 121 LYS X CD  1 
ATOM   447  C CE  . LYS A 1 73  ? 25.711 11.583 -10.887 1.00 84.18 ? 121 LYS X CE  1 
ATOM   448  N NZ  . LYS A 1 73  ? 26.321 12.446 -11.948 1.00 84.72 ? 121 LYS X NZ  1 
ATOM   449  N N   . LYS A 1 74  ? 23.033 6.566  -8.499  1.00 81.04 ? 122 LYS X N   1 
ATOM   450  C CA  . LYS A 1 74  ? 22.961 5.113  -8.746  1.00 81.37 ? 122 LYS X CA  1 
ATOM   451  C C   . LYS A 1 74  ? 21.714 4.476  -8.162  1.00 81.97 ? 122 LYS X C   1 
ATOM   452  O O   . LYS A 1 74  ? 21.249 3.446  -8.664  1.00 82.22 ? 122 LYS X O   1 
ATOM   453  C CB  . LYS A 1 74  ? 24.186 4.401  -8.168  1.00 81.34 ? 122 LYS X CB  1 
ATOM   454  N N   . GLU A 1 75  ? 21.170 5.067  -7.099  1.00 82.43 ? 123 GLU X N   1 
ATOM   455  C CA  . GLU A 1 75  ? 20.032 4.459  -6.411  1.00 82.76 ? 123 GLU X CA  1 
ATOM   456  C C   . GLU A 1 75  ? 18.797 4.432  -7.304  1.00 82.65 ? 123 GLU X C   1 
ATOM   457  O O   . GLU A 1 75  ? 18.629 5.304  -8.167  1.00 82.69 ? 123 GLU X O   1 
ATOM   458  C CB  . GLU A 1 75  ? 19.742 5.160  -5.078  1.00 83.01 ? 123 GLU X CB  1 
ATOM   459  C CG  . GLU A 1 75  ? 20.514 4.562  -3.903  1.00 83.98 ? 123 GLU X CG  1 
ATOM   460  C CD  . GLU A 1 75  ? 20.053 3.147  -3.534  1.00 85.03 ? 123 GLU X CD  1 
ATOM   461  O OE1 . GLU A 1 75  ? 18.834 2.940  -3.352  1.00 85.11 ? 123 GLU X OE1 1 
ATOM   462  O OE2 . GLU A 1 75  ? 20.908 2.240  -3.418  1.00 86.35 ? 123 GLU X OE2 1 
ATOM   463  N N   . GLN A 1 76  ? 17.962 3.410  -7.095  1.00 82.38 ? 124 GLN X N   1 
ATOM   464  C CA  . GLN A 1 76  ? 16.802 3.138  -7.946  1.00 82.17 ? 124 GLN X CA  1 
ATOM   465  C C   . GLN A 1 76  ? 15.485 3.012  -7.166  1.00 82.04 ? 124 GLN X C   1 
ATOM   466  O O   . GLN A 1 76  ? 14.434 3.432  -7.661  1.00 82.21 ? 124 GLN X O   1 
ATOM   467  C CB  . GLN A 1 76  ? 17.045 1.863  -8.762  1.00 82.14 ? 124 GLN X CB  1 
ATOM   468  N N   . ASN A 1 77  ? 15.528 2.418  -5.971  1.00 81.71 ? 125 ASN X N   1 
ATOM   469  C CA  . ASN A 1 77  ? 14.330 2.300  -5.125  1.00 81.34 ? 125 ASN X CA  1 
ATOM   470  C C   . ASN A 1 77  ? 13.936 3.675  -4.586  1.00 81.06 ? 125 ASN X C   1 
ATOM   471  O O   . ASN A 1 77  ? 14.787 4.423  -4.095  1.00 81.04 ? 125 ASN X O   1 
ATOM   472  C CB  . ASN A 1 77  ? 14.558 1.320  -3.967  1.00 81.20 ? 125 ASN X CB  1 
ATOM   473  N N   . LYS A 1 78  ? 12.650 3.999  -4.695  1.00 80.58 ? 126 LYS X N   1 
ATOM   474  C CA  . LYS A 1 78  ? 12.136 5.331  -4.371  1.00 80.36 ? 126 LYS X CA  1 
ATOM   475  C C   . LYS A 1 78  ? 12.409 5.744  -2.926  1.00 80.14 ? 126 LYS X C   1 
ATOM   476  O O   . LYS A 1 78  ? 12.867 6.859  -2.674  1.00 80.22 ? 126 LYS X O   1 
ATOM   477  C CB  . LYS A 1 78  ? 10.625 5.393  -4.639  1.00 80.38 ? 126 LYS X CB  1 
ATOM   478  N N   . LYS A 1 79  ? 12.119 4.845  -1.986  1.00 79.76 ? 127 LYS X N   1 
ATOM   479  C CA  . LYS A 1 79  ? 12.251 5.131  -0.555  1.00 79.33 ? 127 LYS X CA  1 
ATOM   480  C C   . LYS A 1 79  ? 13.670 5.525  -0.137  1.00 78.86 ? 127 LYS X C   1 
ATOM   481  O O   . LYS A 1 79  ? 13.858 6.462  0.642   1.00 78.76 ? 127 LYS X O   1 
ATOM   482  N N   . VAL A 1 80  ? 14.661 4.811  -0.670  1.00 78.40 ? 128 VAL X N   1 
ATOM   483  C CA  . VAL A 1 80  ? 16.062 5.036  -0.310  1.00 78.05 ? 128 VAL X CA  1 
ATOM   484  C C   . VAL A 1 80  ? 16.608 6.291  -1.001  1.00 77.54 ? 128 VAL X C   1 
ATOM   485  O O   . VAL A 1 80  ? 17.514 6.936  -0.475  1.00 77.68 ? 128 VAL X O   1 
ATOM   486  C CB  . VAL A 1 80  ? 16.946 3.803  -0.631  1.00 78.05 ? 128 VAL X CB  1 
ATOM   487  C CG1 . VAL A 1 80  ? 18.344 3.972  -0.042  1.00 78.26 ? 128 VAL X CG1 1 
ATOM   488  C CG2 . VAL A 1 80  ? 16.304 2.525  -0.091  1.00 78.55 ? 128 VAL X CG2 1 
ATOM   489  N N   . ILE A 1 81  ? 16.056 6.628  -2.170  1.00 76.99 ? 129 ILE X N   1 
ATOM   490  C CA  . ILE A 1 81  ? 16.316 7.918  -2.833  1.00 76.47 ? 129 ILE X CA  1 
ATOM   491  C C   . ILE A 1 81  ? 15.906 9.088  -1.940  1.00 76.11 ? 129 ILE X C   1 
ATOM   492  O O   . ILE A 1 81  ? 16.612 10.086 -1.853  1.00 76.11 ? 129 ILE X O   1 
ATOM   493  C CB  . ILE A 1 81  ? 15.550 8.040  -4.184  1.00 76.40 ? 129 ILE X CB  1 
ATOM   494  C CG1 . ILE A 1 81  ? 16.192 7.149  -5.243  1.00 76.17 ? 129 ILE X CG1 1 
ATOM   495  C CG2 . ILE A 1 81  ? 15.503 9.501  -4.688  1.00 76.23 ? 129 ILE X CG2 1 
ATOM   496  C CD1 . ILE A 1 81  ? 15.289 6.872  -6.430  1.00 76.35 ? 129 ILE X CD1 1 
ATOM   497  N N   . GLU A 1 82  ? 14.753 8.962  -1.294  1.00 75.83 ? 130 GLU X N   1 
ATOM   498  C CA  . GLU A 1 82  ? 14.222 10.027 -0.435  1.00 75.58 ? 130 GLU X CA  1 
ATOM   499  C C   . GLU A 1 82  ? 15.067 10.170 0.824   1.00 75.23 ? 130 GLU X C   1 
ATOM   500  O O   . GLU A 1 82  ? 15.386 11.286 1.245   1.00 74.90 ? 130 GLU X O   1 
ATOM   501  C CB  . GLU A 1 82  ? 12.760 9.746  -0.067  1.00 75.27 ? 130 GLU X CB  1 
ATOM   502  N N   . GLU A 1 83  ? 15.423 9.028  1.413   1.00 75.09 ? 131 GLU X N   1 
ATOM   503  C CA  . GLU A 1 83  ? 16.287 8.981  2.590   1.00 74.76 ? 131 GLU X CA  1 
ATOM   504  C C   . GLU A 1 83  ? 17.650 9.588  2.280   1.00 74.41 ? 131 GLU X C   1 
ATOM   505  O O   . GLU A 1 83  ? 18.150 10.406 3.051   1.00 74.49 ? 131 GLU X O   1 
ATOM   506  C CB  . GLU A 1 83  ? 16.443 7.540  3.089   1.00 74.76 ? 131 GLU X CB  1 
ATOM   507  N N   . LYS A 1 84  ? 18.235 9.205  1.145   1.00 73.99 ? 132 LYS X N   1 
ATOM   508  C CA  . LYS A 1 84  ? 19.548 9.730  0.737   1.00 73.84 ? 132 LYS X CA  1 
ATOM   509  C C   . LYS A 1 84  ? 19.526 11.221 0.388   1.00 73.34 ? 132 LYS X C   1 
ATOM   510  O O   . LYS A 1 84  ? 20.440 11.950 0.766   1.00 73.48 ? 132 LYS X O   1 
ATOM   511  C CB  . LYS A 1 84  ? 20.136 8.935  -0.438  1.00 73.99 ? 132 LYS X CB  1 
ATOM   512  C CG  . LYS A 1 84  ? 20.814 7.648  -0.028  1.00 74.42 ? 132 LYS X CG  1 
ATOM   513  C CD  . LYS A 1 84  ? 21.269 6.872  -1.237  1.00 75.54 ? 132 LYS X CD  1 
ATOM   514  C CE  . LYS A 1 84  ? 21.843 5.510  -0.845  1.00 76.42 ? 132 LYS X CE  1 
ATOM   515  N NZ  . LYS A 1 84  ? 22.972 5.626  0.124   1.00 77.05 ? 132 LYS X NZ  1 
ATOM   516  N N   . ALA A 1 85  ? 18.503 11.664 -0.342  1.00 72.77 ? 133 ALA X N   1 
ATOM   517  C CA  . ALA A 1 85  ? 18.334 13.090 -0.656  1.00 72.31 ? 133 ALA X CA  1 
ATOM   518  C C   . ALA A 1 85  ? 18.169 13.948 0.610   1.00 72.28 ? 133 ALA X C   1 
ATOM   519  O O   . ALA A 1 85  ? 18.682 15.072 0.683   1.00 72.33 ? 133 ALA X O   1 
ATOM   520  C CB  . ALA A 1 85  ? 17.159 13.285 -1.567  1.00 72.31 ? 133 ALA X CB  1 
ATOM   521  N N   . ARG A 1 86  ? 17.455 13.419 1.602   1.00 71.96 ? 134 ARG X N   1 
ATOM   522  C CA  . ARG A 1 86  ? 17.318 14.097 2.894   1.00 71.74 ? 134 ARG X CA  1 
ATOM   523  C C   . ARG A 1 86  ? 18.685 14.240 3.570   1.00 71.44 ? 134 ARG X C   1 
ATOM   524  O O   . ARG A 1 86  ? 19.082 15.344 3.963   1.00 71.33 ? 134 ARG X O   1 
ATOM   525  C CB  . ARG A 1 86  ? 16.349 13.338 3.806   1.00 71.64 ? 134 ARG X CB  1 
ATOM   526  N N   . MET A 1 87  ? 19.400 13.120 3.675   1.00 71.05 ? 135 MET X N   1 
ATOM   527  C CA  . MET A 1 87  ? 20.730 13.083 4.284   1.00 70.97 ? 135 MET X CA  1 
ATOM   528  C C   . MET A 1 87  ? 21.713 14.066 3.640   1.00 70.89 ? 135 MET X C   1 
ATOM   529  O O   . MET A 1 87  ? 22.429 14.766 4.345   1.00 70.69 ? 135 MET X O   1 
ATOM   530  C CB  . MET A 1 87  ? 21.304 11.661 4.215   1.00 70.98 ? 135 MET X CB  1 
ATOM   531  N N   . ILE A 1 88  ? 21.742 14.123 2.311   1.00 70.95 ? 136 ILE X N   1 
ATOM   532  C CA  . ILE A 1 88  ? 22.582 15.097 1.612   1.00 71.37 ? 136 ILE X CA  1 
ATOM   533  C C   . ILE A 1 88  ? 22.196 16.530 2.021   1.00 71.30 ? 136 ILE X C   1 
ATOM   534  O O   . ILE A 1 88  ? 23.062 17.341 2.317   1.00 71.59 ? 136 ILE X O   1 
ATOM   535  C CB  . ILE A 1 88  ? 22.514 14.938 0.061   1.00 71.22 ? 136 ILE X CB  1 
ATOM   536  C CG1 . ILE A 1 88  ? 23.109 13.597 -0.373  1.00 71.97 ? 136 ILE X CG1 1 
ATOM   537  C CG2 . ILE A 1 88  ? 23.243 16.088 -0.645  1.00 70.74 ? 136 ILE X CG2 1 
ATOM   538  C CD1 . ILE A 1 88  ? 22.761 13.192 -1.820  1.00 72.07 ? 136 ILE X CD1 1 
ATOM   539  N N   . TYR A 1 89  ? 20.902 16.832 2.054   1.00 71.70 ? 137 TYR X N   1 
ATOM   540  C CA  . TYR A 1 89  ? 20.443 18.188 2.396   1.00 71.54 ? 137 TYR X CA  1 
ATOM   541  C C   . TYR A 1 89  ? 20.860 18.620 3.805   1.00 71.61 ? 137 TYR X C   1 
ATOM   542  O O   . TYR A 1 89  ? 21.467 19.676 3.972   1.00 71.25 ? 137 TYR X O   1 
ATOM   543  C CB  . TYR A 1 89  ? 18.928 18.337 2.248   1.00 71.18 ? 137 TYR X CB  1 
ATOM   544  C CG  . TYR A 1 89  ? 18.489 19.779 2.434   1.00 71.09 ? 137 TYR X CG  1 
ATOM   545  C CD1 . TYR A 1 89  ? 18.580 20.683 1.390   1.00 70.20 ? 137 TYR X CD1 1 
ATOM   546  C CD2 . TYR A 1 89  ? 18.022 20.239 3.661   1.00 70.68 ? 137 TYR X CD2 1 
ATOM   547  C CE1 . TYR A 1 89  ? 18.217 21.989 1.546   1.00 69.85 ? 137 TYR X CE1 1 
ATOM   548  C CE2 . TYR A 1 89  ? 17.655 21.559 3.830   1.00 70.75 ? 137 TYR X CE2 1 
ATOM   549  C CZ  . TYR A 1 89  ? 17.756 22.430 2.764   1.00 70.72 ? 137 TYR X CZ  1 
ATOM   550  O OH  . TYR A 1 89  ? 17.395 23.745 2.899   1.00 70.43 ? 137 TYR X OH  1 
ATOM   551  N N   . GLU A 1 90  ? 20.537 17.803 4.807   1.00 71.91 ? 138 GLU X N   1 
ATOM   552  C CA  . GLU A 1 90  ? 20.872 18.122 6.202   1.00 72.24 ? 138 GLU X CA  1 
ATOM   553  C C   . GLU A 1 90  ? 22.386 18.161 6.463   1.00 72.58 ? 138 GLU X C   1 
ATOM   554  O O   . GLU A 1 90  ? 22.836 18.896 7.340   1.00 72.87 ? 138 GLU X O   1 
ATOM   555  C CB  . GLU A 1 90  ? 20.210 17.130 7.170   1.00 72.25 ? 138 GLU X CB  1 
ATOM   556  N N   . ASP A 1 91  ? 23.163 17.383 5.706   1.00 72.73 ? 139 ASP X N   1 
ATOM   557  C CA  . ASP A 1 91  ? 24.614 17.323 5.890   1.00 72.88 ? 139 ASP X CA  1 
ATOM   558  C C   . ASP A 1 91  ? 25.375 18.393 5.097   1.00 72.89 ? 139 ASP X C   1 
ATOM   559  O O   . ASP A 1 91  ? 26.288 19.010 5.632   1.00 72.69 ? 139 ASP X O   1 
ATOM   560  C CB  . ASP A 1 91  ? 25.155 15.932 5.513   1.00 73.25 ? 139 ASP X CB  1 
ATOM   561  C CG  . ASP A 1 91  ? 24.779 14.843 6.525   1.00 74.18 ? 139 ASP X CG  1 
ATOM   562  O OD1 . ASP A 1 91  ? 24.005 15.108 7.467   1.00 75.12 ? 139 ASP X OD1 1 
ATOM   563  O OD2 . ASP A 1 91  ? 25.270 13.704 6.373   1.00 76.86 ? 139 ASP X OD2 1 
ATOM   564  N N   . TYR A 1 92  ? 25.022 18.605 3.828   1.00 72.88 ? 140 TYR X N   1 
ATOM   565  C CA  . TYR A 1 92  ? 25.810 19.497 2.958   1.00 73.11 ? 140 TYR X CA  1 
ATOM   566  C C   . TYR A 1 92  ? 25.121 20.795 2.539   1.00 73.23 ? 140 TYR X C   1 
ATOM   567  O O   . TYR A 1 92  ? 25.798 21.748 2.160   1.00 73.20 ? 140 TYR X O   1 
ATOM   568  C CB  . TYR A 1 92  ? 26.301 18.731 1.711   1.00 73.06 ? 140 TYR X CB  1 
ATOM   569  C CG  . TYR A 1 92  ? 26.985 17.448 2.094   1.00 72.85 ? 140 TYR X CG  1 
ATOM   570  C CD1 . TYR A 1 92  ? 28.252 17.464 2.681   1.00 73.34 ? 140 TYR X CD1 1 
ATOM   571  C CD2 . TYR A 1 92  ? 26.352 16.229 1.936   1.00 72.08 ? 140 TYR X CD2 1 
ATOM   572  C CE1 . TYR A 1 92  ? 28.878 16.293 3.067   1.00 73.12 ? 140 TYR X CE1 1 
ATOM   573  C CE2 . TYR A 1 92  ? 26.969 15.050 2.322   1.00 72.85 ? 140 TYR X CE2 1 
ATOM   574  C CZ  . TYR A 1 92  ? 28.231 15.086 2.884   1.00 73.14 ? 140 TYR X CZ  1 
ATOM   575  O OH  . TYR A 1 92  ? 28.844 13.913 3.267   1.00 73.36 ? 140 TYR X OH  1 
ATOM   576  N N   . ILE A 1 93  ? 23.793 20.842 2.614   1.00 73.71 ? 141 ILE X N   1 
ATOM   577  C CA  . ILE A 1 93  ? 23.027 21.960 2.048   1.00 73.75 ? 141 ILE X CA  1 
ATOM   578  C C   . ILE A 1 93  ? 22.309 22.808 3.080   1.00 74.19 ? 141 ILE X C   1 
ATOM   579  O O   . ILE A 1 93  ? 22.036 23.973 2.826   1.00 74.77 ? 141 ILE X O   1 
ATOM   580  C CB  . ILE A 1 93  ? 21.981 21.461 1.007   1.00 73.65 ? 141 ILE X CB  1 
ATOM   581  C CG1 . ILE A 1 93  ? 22.591 20.425 0.040   1.00 72.90 ? 141 ILE X CG1 1 
ATOM   582  C CG2 . ILE A 1 93  ? 21.398 22.628 0.227   1.00 73.58 ? 141 ILE X CG2 1 
ATOM   583  C CD1 . ILE A 1 93  ? 23.653 20.961 -0.845  1.00 72.06 ? 141 ILE X CD1 1 
ATOM   584  N N   . SER A 1 94  ? 21.969 22.243 4.231   1.00 74.67 ? 142 SER X N   1 
ATOM   585  C CA  . SER A 1 94  ? 21.262 23.009 5.259   1.00 74.78 ? 142 SER X CA  1 
ATOM   586  C C   . SER A 1 94  ? 22.185 24.049 5.892   1.00 75.22 ? 142 SER X C   1 
ATOM   587  O O   . SER A 1 94  ? 23.397 23.847 5.975   1.00 75.09 ? 142 SER X O   1 
ATOM   588  C CB  . SER A 1 94  ? 20.689 22.075 6.337   1.00 74.74 ? 142 SER X CB  1 
ATOM   589  O OG  . SER A 1 94  ? 19.946 22.793 7.317   1.00 74.52 ? 142 SER X OG  1 
ATOM   590  N N   . ILE A 1 95  ? 21.594 25.156 6.337   1.00 75.97 ? 143 ILE X N   1 
ATOM   591  C CA  . ILE A 1 95  ? 22.314 26.204 7.072   1.00 76.46 ? 143 ILE X CA  1 
ATOM   592  C C   . ILE A 1 95  ? 22.692 25.737 8.488   1.00 76.81 ? 143 ILE X C   1 
ATOM   593  O O   . ILE A 1 95  ? 23.762 26.086 8.993   1.00 77.23 ? 143 ILE X O   1 
ATOM   594  C CB  . ILE A 1 95  ? 21.463 27.508 7.163   1.00 76.64 ? 143 ILE X CB  1 
ATOM   595  C CG1 . ILE A 1 95  ? 21.149 28.049 5.761   1.00 77.06 ? 143 ILE X CG1 1 
ATOM   596  C CG2 . ILE A 1 95  ? 22.158 28.579 8.018   1.00 76.61 ? 143 ILE X CG2 1 
ATOM   597  C CD1 . ILE A 1 95  ? 22.361 28.318 4.902   1.00 77.68 ? 143 ILE X CD1 1 
ATOM   598  N N   . LEU A 1 96  ? 21.812 24.960 9.125   1.00 76.94 ? 144 LEU X N   1 
ATOM   599  C CA  . LEU A 1 96  ? 22.056 24.450 10.479  1.00 76.94 ? 144 LEU X CA  1 
ATOM   600  C C   . LEU A 1 96  ? 22.995 23.236 10.495  1.00 77.12 ? 144 LEU X C   1 
ATOM   601  O O   . LEU A 1 96  ? 23.539 22.826 9.462   1.00 76.85 ? 144 LEU X O   1 
ATOM   602  N N   . PRO A 1 98  ? 26.590 21.881 7.665   1.00 87.59 ? 146 PRO X N   1 
ATOM   603  C CA  . PRO A 1 98  ? 26.975 22.400 8.968   1.00 87.31 ? 146 PRO X CA  1 
ATOM   604  C C   . PRO A 1 98  ? 28.462 22.760 9.230   1.00 87.20 ? 146 PRO X C   1 
ATOM   605  O O   . PRO A 1 98  ? 28.687 23.489 10.199  1.00 87.22 ? 146 PRO X O   1 
ATOM   606  C CB  . PRO A 1 98  ? 26.502 21.299 9.934   1.00 87.37 ? 146 PRO X CB  1 
ATOM   607  C CG  . PRO A 1 98  ? 25.530 20.425 9.128   1.00 87.44 ? 146 PRO X CG  1 
ATOM   608  C CD  . PRO A 1 98  ? 25.385 21.044 7.771   1.00 87.48 ? 146 PRO X CD  1 
ATOM   609  N N   . LYS A 1 99  ? 29.486 22.292 8.491   1.00 86.75 ? 147 LYS X N   1 
ATOM   610  C CA  . LYS A 1 99  ? 29.520 21.183 7.501   1.00 86.60 ? 147 LYS X CA  1 
ATOM   611  C C   . LYS A 1 99  ? 29.067 21.493 6.055   1.00 86.21 ? 147 LYS X C   1 
ATOM   612  O O   . LYS A 1 99  ? 29.080 20.603 5.203   1.00 86.23 ? 147 LYS X O   1 
ATOM   613  C CB  . LYS A 1 99  ? 28.840 19.915 8.038   1.00 86.73 ? 147 LYS X CB  1 
ATOM   614  N N   . GLU A 1 100 ? 28.740 22.756 5.779   1.00 85.64 ? 148 GLU X N   1 
ATOM   615  C CA  . GLU A 1 100 ? 28.100 23.171 4.518   1.00 85.13 ? 148 GLU X CA  1 
ATOM   616  C C   . GLU A 1 100 ? 29.108 23.419 3.390   1.00 83.90 ? 148 GLU X C   1 
ATOM   617  O O   . GLU A 1 100 ? 30.257 23.766 3.631   1.00 84.06 ? 148 GLU X O   1 
ATOM   618  C CB  . GLU A 1 100 ? 27.261 24.440 4.782   1.00 85.32 ? 148 GLU X CB  1 
ATOM   619  C CG  . GLU A 1 100 ? 26.541 25.067 3.573   1.00 85.92 ? 148 GLU X CG  1 
ATOM   620  C CD  . GLU A 1 100 ? 26.123 26.519 3.834   1.00 86.25 ? 148 GLU X CD  1 
ATOM   621  O OE1 . GLU A 1 100 ? 26.751 27.429 3.239   1.00 88.05 ? 148 GLU X OE1 1 
ATOM   622  O OE2 . GLU A 1 100 ? 25.186 26.752 4.637   1.00 86.05 ? 148 GLU X OE2 1 
ATOM   623  N N   . VAL A 1 101 ? 28.661 23.223 2.154   1.00 82.77 ? 149 VAL X N   1 
ATOM   624  C CA  . VAL A 1 101 ? 29.451 23.542 0.961   1.00 81.52 ? 149 VAL X CA  1 
ATOM   625  C C   . VAL A 1 101 ? 28.935 24.845 0.359   1.00 80.55 ? 149 VAL X C   1 
ATOM   626  O O   . VAL A 1 101 ? 27.748 25.144 0.439   1.00 80.42 ? 149 VAL X O   1 
ATOM   627  C CB  . VAL A 1 101 ? 29.416 22.395 -0.103  1.00 81.35 ? 149 VAL X CB  1 
ATOM   628  C CG1 . VAL A 1 101 ? 29.909 21.097 0.498   1.00 81.37 ? 149 VAL X CG1 1 
ATOM   629  C CG2 . VAL A 1 101 ? 28.017 22.204 -0.705  1.00 81.10 ? 149 VAL X CG2 1 
ATOM   630  N N   . SER A 1 102 ? 29.825 25.611 -0.254  1.00 79.71 ? 150 SER X N   1 
ATOM   631  C CA  . SER A 1 102 ? 29.460 26.926 -0.774  1.00 79.31 ? 150 SER X CA  1 
ATOM   632  C C   . SER A 1 102 ? 28.832 26.826 -2.151  1.00 78.50 ? 150 SER X C   1 
ATOM   633  O O   . SER A 1 102 ? 29.504 26.458 -3.118  1.00 78.02 ? 150 SER X O   1 
ATOM   634  C CB  . SER A 1 102 ? 30.678 27.847 -0.828  1.00 79.27 ? 150 SER X CB  1 
ATOM   635  O OG  . SER A 1 102 ? 31.066 28.215 0.481   1.00 80.59 ? 150 SER X OG  1 
ATOM   636  N N   . LEU A 1 103 ? 27.550 27.185 -2.227  1.00 77.85 ? 151 LEU X N   1 
ATOM   637  C CA  . LEU A 1 103 ? 26.791 27.133 -3.474  1.00 77.40 ? 151 LEU X CA  1 
ATOM   638  C C   . LEU A 1 103 ? 26.150 28.479 -3.773  1.00 77.18 ? 151 LEU X C   1 
ATOM   639  O O   . LEU A 1 103 ? 25.735 29.195 -2.864  1.00 77.18 ? 151 LEU X O   1 
ATOM   640  C CB  . LEU A 1 103 ? 25.691 26.070 -3.400  1.00 77.19 ? 151 LEU X CB  1 
ATOM   641  C CG  . LEU A 1 103 ? 26.083 24.668 -2.954  1.00 76.74 ? 151 LEU X CG  1 
ATOM   642  C CD1 . LEU A 1 103 ? 24.836 23.824 -2.742  1.00 76.38 ? 151 LEU X CD1 1 
ATOM   643  C CD2 . LEU A 1 103 ? 27.015 24.023 -3.977  1.00 76.23 ? 151 LEU X CD2 1 
ATOM   644  N N   . ASP A 1 104 ? 26.044 28.799 -5.058  1.00 77.03 ? 152 ASP X N   1 
ATOM   645  C CA  . ASP A 1 104 ? 25.356 30.008 -5.505  1.00 76.88 ? 152 ASP X CA  1 
ATOM   646  C C   . ASP A 1 104 ? 23.863 29.913 -5.192  1.00 76.64 ? 152 ASP X C   1 
ATOM   647  O O   . ASP A 1 104 ? 23.323 28.812 -5.057  1.00 76.37 ? 152 ASP X O   1 
ATOM   648  C CB  . ASP A 1 104 ? 25.537 30.204 -7.013  1.00 76.98 ? 152 ASP X CB  1 
ATOM   649  C CG  . ASP A 1 104 ? 26.961 29.966 -7.465  1.00 77.78 ? 152 ASP X CG  1 
ATOM   650  N N   . SER A 1 105 ? 23.212 31.071 -5.095  1.00 76.29 ? 153 SER X N   1 
ATOM   651  C CA  . SER A 1 105 ? 21.774 31.165 -4.837  1.00 76.22 ? 153 SER X CA  1 
ATOM   652  C C   . SER A 1 105 ? 20.975 30.508 -5.951  1.00 76.14 ? 153 SER X C   1 
ATOM   653  O O   . SER A 1 105 ? 20.026 29.766 -5.690  1.00 76.20 ? 153 SER X O   1 
ATOM   654  C CB  . SER A 1 105 ? 21.353 32.632 -4.715  1.00 76.17 ? 153 SER X CB  1 
ATOM   655  O OG  . SER A 1 105 ? 22.379 33.403 -4.113  1.00 76.58 ? 153 SER X OG  1 
ATOM   656  N N   . ARG A 1 106 ? 21.360 30.809 -7.192  1.00 76.00 ? 154 ARG X N   1 
ATOM   657  C CA  . ARG A 1 106 ? 20.810 30.157 -8.384  1.00 75.77 ? 154 ARG X CA  1 
ATOM   658  C C   . ARG A 1 106 ? 20.715 28.645 -8.182  1.00 75.11 ? 154 ARG X C   1 
ATOM   659  O O   . ARG A 1 106 ? 19.664 28.036 -8.369  1.00 75.20 ? 154 ARG X O   1 
ATOM   660  C CB  . ARG A 1 106 ? 21.712 30.444 -9.597  1.00 75.99 ? 154 ARG X CB  1 
ATOM   661  N N   . VAL A 1 107 ? 21.835 28.059 -7.787  1.00 74.38 ? 155 VAL X N   1 
ATOM   662  C CA  . VAL A 1 107 ? 21.938 26.621 -7.553  1.00 73.79 ? 155 VAL X CA  1 
ATOM   663  C C   . VAL A 1 107 ? 21.185 26.160 -6.290  1.00 73.16 ? 155 VAL X C   1 
ATOM   664  O O   . VAL A 1 107 ? 20.694 25.035 -6.232  1.00 73.44 ? 155 VAL X O   1 
ATOM   665  C CB  . VAL A 1 107 ? 23.433 26.214 -7.502  1.00 73.58 ? 155 VAL X CB  1 
ATOM   666  C CG1 . VAL A 1 107 ? 23.632 24.842 -6.901  1.00 73.82 ? 155 VAL X CG1 1 
ATOM   667  C CG2 . VAL A 1 107 ? 24.023 26.290 -8.894  1.00 73.63 ? 155 VAL X CG2 1 
ATOM   668  N N   . ARG A 1 108 ? 21.098 27.016 -5.282  1.00 72.44 ? 156 ARG X N   1 
ATOM   669  C CA  . ARG A 1 108 ? 20.362 26.669 -4.070  1.00 72.13 ? 156 ARG X CA  1 
ATOM   670  C C   . ARG A 1 108 ? 18.865 26.614 -4.298  1.00 71.74 ? 156 ARG X C   1 
ATOM   671  O O   . ARG A 1 108 ? 18.208 25.705 -3.827  1.00 71.40 ? 156 ARG X O   1 
ATOM   672  C CB  . ARG A 1 108 ? 20.676 27.646 -2.949  1.00 71.92 ? 156 ARG X CB  1 
ATOM   673  C CG  . ARG A 1 108 ? 22.010 27.401 -2.349  1.00 72.62 ? 156 ARG X CG  1 
ATOM   674  C CD  . ARG A 1 108 ? 22.186 28.133 -1.061  1.00 74.65 ? 156 ARG X CD  1 
ATOM   675  N NE  . ARG A 1 108 ? 22.985 27.310 -0.165  1.00 76.42 ? 156 ARG X NE  1 
ATOM   676  C CZ  . ARG A 1 108 ? 22.513 26.583 0.847   1.00 76.22 ? 156 ARG X CZ  1 
ATOM   677  N NH1 . ARG A 1 108 ? 21.213 26.568 1.162   1.00 74.11 ? 156 ARG X NH1 1 
ATOM   678  N NH2 . ARG A 1 108 ? 23.378 25.868 1.559   1.00 76.92 ? 156 ARG X NH2 1 
ATOM   679  N N   . GLU A 1 109 ? 18.329 27.583 -5.027  1.00 71.92 ? 157 GLU X N   1 
ATOM   680  C CA  . GLU A 1 109 ? 16.897 27.627 -5.280  1.00 72.23 ? 157 GLU X CA  1 
ATOM   681  C C   . GLU A 1 109 ? 16.402 26.502 -6.189  1.00 72.21 ? 157 GLU X C   1 
ATOM   682  O O   . GLU A 1 109 ? 15.259 26.083 -6.059  1.00 71.95 ? 157 GLU X O   1 
ATOM   683  C CB  . GLU A 1 109 ? 16.492 28.995 -5.823  1.00 72.49 ? 157 GLU X CB  1 
ATOM   684  C CG  . GLU A 1 109 ? 16.778 30.149 -4.851  1.00 73.65 ? 157 GLU X CG  1 
ATOM   685  C CD  . GLU A 1 109 ? 16.359 29.843 -3.407  1.00 75.17 ? 157 GLU X CD  1 
ATOM   686  O OE1 . GLU A 1 109 ? 15.186 29.472 -3.191  1.00 74.91 ? 157 GLU X OE1 1 
ATOM   687  O OE2 . GLU A 1 109 ? 17.213 29.971 -2.494  1.00 76.69 ? 157 GLU X OE2 1 
ATOM   688  N N   . VAL A 1 110 ? 17.253 25.993 -7.083  1.00 72.58 ? 158 VAL X N   1 
ATOM   689  C CA  . VAL A 1 110 ? 16.888 24.826 -7.888  1.00 72.60 ? 158 VAL X CA  1 
ATOM   690  C C   . VAL A 1 110 ? 16.791 23.590 -6.984  1.00 72.50 ? 158 VAL X C   1 
ATOM   691  O O   . VAL A 1 110 ? 15.834 22.829 -7.099  1.00 72.44 ? 158 VAL X O   1 
ATOM   692  C CB  . VAL A 1 110 ? 17.828 24.610 -9.132  1.00 73.11 ? 158 VAL X CB  1 
ATOM   693  C CG1 . VAL A 1 110 ? 19.266 24.388 -8.734  1.00 74.10 ? 158 VAL X CG1 1 
ATOM   694  C CG2 . VAL A 1 110 ? 17.359 23.430 -9.979  1.00 73.62 ? 158 VAL X CG2 1 
ATOM   695  N N   . ILE A 1 111 ? 17.745 23.412 -6.066  1.00 72.42 ? 159 ILE X N   1 
ATOM   696  C CA  . ILE A 1 111 ? 17.669 22.337 -5.058  1.00 72.67 ? 159 ILE X CA  1 
ATOM   697  C C   . ILE A 1 111 ? 16.389 22.404 -4.211  1.00 72.68 ? 159 ILE X C   1 
ATOM   698  O O   . ILE A 1 111 ? 15.782 21.374 -3.885  1.00 72.95 ? 159 ILE X O   1 
ATOM   699  C CB  . ILE A 1 111 ? 18.869 22.382 -4.082  1.00 72.75 ? 159 ILE X CB  1 
ATOM   700  C CG1 . ILE A 1 111 ? 20.157 21.969 -4.788  1.00 73.64 ? 159 ILE X CG1 1 
ATOM   701  C CG2 . ILE A 1 111 ? 18.648 21.461 -2.868  1.00 72.55 ? 159 ILE X CG2 1 
ATOM   702  C CD1 . ILE A 1 111 ? 21.397 22.222 -3.949  1.00 74.88 ? 159 ILE X CD1 1 
ATOM   703  N N   . ASN A 1 112 ? 15.995 23.613 -3.828  1.00 72.69 ? 160 ASN X N   1 
ATOM   704  C CA  . ASN A 1 112 ? 14.820 23.801 -2.981  1.00 72.58 ? 160 ASN X CA  1 
ATOM   705  C C   . ASN A 1 112 ? 13.523 23.414 -3.684  1.00 73.23 ? 160 ASN X C   1 
ATOM   706  O O   . ASN A 1 112 ? 12.626 22.853 -3.067  1.00 72.99 ? 160 ASN X O   1 
ATOM   707  C CB  . ASN A 1 112 ? 14.751 25.245 -2.503  1.00 72.33 ? 160 ASN X CB  1 
ATOM   708  C CG  . ASN A 1 112 ? 15.916 25.614 -1.610  1.00 71.17 ? 160 ASN X CG  1 
ATOM   709  O OD1 . ASN A 1 112 ? 16.369 24.809 -0.791  1.00 69.06 ? 160 ASN X OD1 1 
ATOM   710  N ND2 . ASN A 1 112 ? 16.411 26.837 -1.764  1.00 69.86 ? 160 ASN X ND2 1 
ATOM   711  N N   . ARG A 1 113 ? 13.432 23.711 -4.977  1.00 74.34 ? 161 ARG X N   1 
ATOM   712  C CA  . ARG A 1 113 ? 12.260 23.335 -5.777  1.00 75.26 ? 161 ARG X CA  1 
ATOM   713  C C   . ARG A 1 113 ? 12.185 21.822 -5.989  1.00 75.89 ? 161 ARG X C   1 
ATOM   714  O O   . ARG A 1 113 ? 11.096 21.242 -5.997  1.00 76.02 ? 161 ARG X O   1 
ATOM   715  C CB  . ARG A 1 113 ? 12.267 24.067 -7.120  1.00 75.28 ? 161 ARG X CB  1 
ATOM   716  C CG  . ARG A 1 113 ? 11.999 25.547 -6.960  1.00 75.82 ? 161 ARG X CG  1 
ATOM   717  C CD  . ARG A 1 113 ? 12.023 26.296 -8.267  1.00 77.22 ? 161 ARG X CD  1 
ATOM   718  N NE  . ARG A 1 113 ? 13.371 26.437 -8.812  1.00 77.90 ? 161 ARG X NE  1 
ATOM   719  C CZ  . ARG A 1 113 ? 13.770 27.433 -9.602  1.00 79.01 ? 161 ARG X CZ  1 
ATOM   720  N NH1 . ARG A 1 113 ? 15.024 27.454 -10.044 1.00 79.23 ? 161 ARG X NH1 1 
ATOM   721  N NH2 . ARG A 1 113 ? 12.931 28.411 -9.959  1.00 80.35 ? 161 ARG X NH2 1 
ATOM   722  N N   . ASN A 1 114 ? 13.345 21.190 -6.133  1.00 76.64 ? 162 ASN X N   1 
ATOM   723  C CA  . ASN A 1 114 ? 13.425 19.737 -6.261  1.00 77.38 ? 162 ASN X CA  1 
ATOM   724  C C   . ASN A 1 114 ? 13.213 19.012 -4.928  1.00 77.72 ? 162 ASN X C   1 
ATOM   725  O O   . ASN A 1 114 ? 13.144 17.788 -4.893  1.00 78.36 ? 162 ASN X O   1 
ATOM   726  C CB  . ASN A 1 114 ? 14.778 19.331 -6.855  1.00 77.49 ? 162 ASN X CB  1 
ATOM   727  C CG  . ASN A 1 114 ? 15.048 19.980 -8.210  1.00 78.44 ? 162 ASN X CG  1 
ATOM   728  O OD1 . ASN A 1 114 ? 14.127 20.470 -8.869  1.00 80.66 ? 162 ASN X OD1 1 
ATOM   729  N ND2 . ASN A 1 114 ? 16.316 19.984 -8.632  1.00 78.42 ? 162 ASN X ND2 1 
ATOM   730  N N   . LEU A 1 115 ? 13.071 19.764 -3.844  1.00 78.00 ? 163 LEU X N   1 
ATOM   731  C CA  . LEU A 1 115 ? 13.125 19.201 -2.496  1.00 78.28 ? 163 LEU X CA  1 
ATOM   732  C C   . LEU A 1 115 ? 11.846 18.509 -2.050  1.00 78.34 ? 163 LEU X C   1 
ATOM   733  O O   . LEU A 1 115 ? 11.907 17.593 -1.230  1.00 78.83 ? 163 LEU X O   1 
ATOM   734  C CB  . LEU A 1 115 ? 13.466 20.309 -1.490  1.00 78.54 ? 163 LEU X CB  1 
ATOM   735  C CG  . LEU A 1 115 ? 14.398 20.009 -0.320  1.00 78.37 ? 163 LEU X CG  1 
ATOM   736  C CD1 . LEU A 1 115 ? 15.649 19.255 -0.771  1.00 77.39 ? 163 LEU X CD1 1 
ATOM   737  C CD2 . LEU A 1 115 ? 14.768 21.333 0.350   1.00 78.19 ? 163 LEU X CD2 1 
ATOM   738  N N   . LEU A 1 116 ? 10.691 18.954 -2.550  1.00 78.20 ? 164 LEU X N   1 
ATOM   739  C CA  . LEU A 1 116 ? 9.403  18.363 -2.151  1.00 77.83 ? 164 LEU X CA  1 
ATOM   740  C C   . LEU A 1 116 ? 9.102  17.072 -2.930  1.00 77.45 ? 164 LEU X C   1 
ATOM   741  O O   . LEU A 1 116 ? 8.396  16.190 -2.425  1.00 77.51 ? 164 LEU X O   1 
ATOM   742  C CB  . LEU A 1 116 ? 8.257  19.371 -2.314  1.00 77.98 ? 164 LEU X CB  1 
ATOM   743  N N   . ASP A 1 117 ? 9.627  16.980 -4.157  1.00 76.79 ? 165 ASP X N   1 
ATOM   744  C CA  . ASP A 1 117 ? 9.584  15.748 -4.959  1.00 76.10 ? 165 ASP X CA  1 
ATOM   745  C C   . ASP A 1 117 ? 10.997 15.358 -5.404  1.00 75.30 ? 165 ASP X C   1 
ATOM   746  O O   . ASP A 1 117 ? 11.399 15.675 -6.527  1.00 75.54 ? 165 ASP X O   1 
ATOM   747  C CB  . ASP A 1 117 ? 8.688  15.934 -6.184  1.00 76.27 ? 165 ASP X CB  1 
ATOM   748  N N   . PRO A 1 118 ? 11.755 14.666 -4.527  1.00 74.11 ? 166 PRO X N   1 
ATOM   749  C CA  . PRO A 1 118 ? 13.143 14.288 -4.819  1.00 73.36 ? 166 PRO X CA  1 
ATOM   750  C C   . PRO A 1 118 ? 13.314 13.273 -5.954  1.00 72.65 ? 166 PRO X C   1 
ATOM   751  O O   . PRO A 1 118 ? 12.460 12.424 -6.170  1.00 72.65 ? 166 PRO X O   1 
ATOM   752  C CB  . PRO A 1 118 ? 13.625 13.666 -3.500  1.00 73.30 ? 166 PRO X CB  1 
ATOM   753  C CG  . PRO A 1 118 ? 12.626 14.066 -2.477  1.00 73.45 ? 166 PRO X CG  1 
ATOM   754  C CD  . PRO A 1 118 ? 11.342 14.193 -3.195  1.00 73.96 ? 166 PRO X CD  1 
ATOM   755  N N   . ASN A 1 119 ? 14.431 13.379 -6.663  1.00 72.08 ? 167 ASN X N   1 
ATOM   756  C CA  . ASN A 1 119 ? 14.850 12.383 -7.653  1.00 71.30 ? 167 ASN X CA  1 
ATOM   757  C C   . ASN A 1 119 ? 16.379 12.157 -7.562  1.00 70.52 ? 167 ASN X C   1 
ATOM   758  O O   . ASN A 1 119 ? 17.075 12.920 -6.902  1.00 69.61 ? 167 ASN X O   1 
ATOM   759  C CB  . ASN A 1 119 ? 14.404 12.825 -9.058  1.00 71.32 ? 167 ASN X CB  1 
ATOM   760  C CG  . ASN A 1 119 ? 15.060 14.126 -9.510  1.00 71.20 ? 167 ASN X CG  1 
ATOM   761  O OD1 . ASN A 1 119 ? 16.203 14.136 -9.947  1.00 71.05 ? 167 ASN X OD1 1 
ATOM   762  N ND2 . ASN A 1 119 ? 14.320 15.216 -9.439  1.00 72.04 ? 167 ASN X ND2 1 
ATOM   763  N N   . PRO A 1 120 ? 16.900 11.091 -8.199  1.00 69.93 ? 168 PRO X N   1 
ATOM   764  C CA  . PRO A 1 120 ? 18.350 10.829 -8.139  1.00 69.67 ? 168 PRO X CA  1 
ATOM   765  C C   . PRO A 1 120 ? 19.271 11.980 -8.629  1.00 69.37 ? 168 PRO X C   1 
ATOM   766  O O   . PRO A 1 120 ? 20.400 12.107 -8.156  1.00 67.85 ? 168 PRO X O   1 
ATOM   767  C CB  . PRO A 1 120 ? 18.517 9.582  -9.021  1.00 69.70 ? 168 PRO X CB  1 
ATOM   768  C CG  . PRO A 1 120 ? 17.183 8.944  -9.042  1.00 69.72 ? 168 PRO X CG  1 
ATOM   769  C CD  . PRO A 1 120 ? 16.192 10.059 -8.975  1.00 69.73 ? 168 PRO X CD  1 
ATOM   770  N N   . HIS A 1 121 ? 18.773 12.820 -9.533  1.00 69.60 ? 169 HIS X N   1 
ATOM   771  C CA  . HIS A 1 121 ? 19.587 13.863 -10.165 1.00 70.03 ? 169 HIS X CA  1 
ATOM   772  C C   . HIS A 1 121 ? 19.307 15.311 -9.667  1.00 70.51 ? 169 HIS X C   1 
ATOM   773  O O   . HIS A 1 121 ? 19.730 16.269 -10.318 1.00 70.78 ? 169 HIS X O   1 
ATOM   774  C CB  . HIS A 1 121 ? 19.420 13.751 -11.682 1.00 69.60 ? 169 HIS X CB  1 
ATOM   775  C CG  . HIS A 1 121 ? 19.876 12.436 -12.237 1.00 69.64 ? 169 HIS X CG  1 
ATOM   776  N ND1 . HIS A 1 121 ? 19.060 11.327 -12.297 1.00 70.56 ? 169 HIS X ND1 1 
ATOM   777  C CD2 . HIS A 1 121 ? 21.072 12.047 -12.742 1.00 70.63 ? 169 HIS X CD2 1 
ATOM   778  C CE1 . HIS A 1 121 ? 19.727 10.315 -12.820 0.50 70.07 ? 169 HIS X CE1 1 
ATOM   779  N NE2 . HIS A 1 121 ? 20.950 10.726 -13.102 1.00 70.84 ? 169 HIS X NE2 1 
ATOM   780  N N   . MET A 1 122 ? 18.618 15.442 -8.519  1.00 70.70 ? 170 MET X N   1 
ATOM   781  C CA  . MET A 1 122 ? 18.344 16.729 -7.817  1.00 70.98 ? 170 MET X CA  1 
ATOM   782  C C   . MET A 1 122 ? 19.533 17.650 -7.641  1.00 70.39 ? 170 MET X C   1 
ATOM   783  O O   . MET A 1 122 ? 19.397 18.862 -7.697  1.00 70.04 ? 170 MET X O   1 
ATOM   784  C CB  . MET A 1 122 ? 17.977 16.479 -6.358  1.00 70.71 ? 170 MET X CB  1 
ATOM   785  C CG  . MET A 1 122 ? 16.715 15.863 -6.064  1.00 72.01 ? 170 MET X CG  1 
ATOM   786  S SD  . MET A 1 122 ? 16.740 15.449 -4.306  1.00 73.98 ? 170 MET X SD  1 
ATOM   787  C CE  . MET A 1 122 ? 16.438 17.066 -3.577  1.00 72.87 ? 170 MET X CE  1 
ATOM   788  N N   . TYR A 1 123 ? 20.673 17.061 -7.299  1.00 70.28 ? 171 TYR X N   1 
ATOM   789  C CA  . TYR A 1 123 ? 21.823 17.836 -6.848  1.00 70.35 ? 171 TYR X CA  1 
ATOM   790  C C   . TYR A 1 123 ? 22.865 18.043 -7.927  1.00 70.47 ? 171 TYR X C   1 
ATOM   791  O O   . TYR A 1 123 ? 23.935 18.519 -7.624  1.00 70.68 ? 171 TYR X O   1 
ATOM   792  C CB  . TYR A 1 123 ? 22.460 17.164 -5.627  1.00 70.11 ? 171 TYR X CB  1 
ATOM   793  C CG  . TYR A 1 123 ? 21.554 17.109 -4.422  1.00 69.22 ? 171 TYR X CG  1 
ATOM   794  C CD1 . TYR A 1 123 ? 21.240 18.259 -3.715  1.00 69.94 ? 171 TYR X CD1 1 
ATOM   795  C CD2 . TYR A 1 123 ? 21.011 15.905 -3.987  1.00 68.83 ? 171 TYR X CD2 1 
ATOM   796  C CE1 . TYR A 1 123 ? 20.391 18.214 -2.597  1.00 70.05 ? 171 TYR X CE1 1 
ATOM   797  C CE2 . TYR A 1 123 ? 20.180 15.840 -2.871  1.00 69.00 ? 171 TYR X CE2 1 
ATOM   798  C CZ  . TYR A 1 123 ? 19.862 17.000 -2.184  1.00 69.80 ? 171 TYR X CZ  1 
ATOM   799  O OH  . TYR A 1 123 ? 19.030 16.949 -1.084  1.00 69.26 ? 171 TYR X OH  1 
ATOM   800  N N   . GLU A 1 124 ? 22.541 17.736 -9.183  1.00 71.41 ? 172 GLU X N   1 
ATOM   801  C CA  . GLU A 1 124 ? 23.551 17.650 -10.252 1.00 72.54 ? 172 GLU X CA  1 
ATOM   802  C C   . GLU A 1 124 ? 24.242 18.976 -10.572 1.00 71.89 ? 172 GLU X C   1 
ATOM   803  O O   . GLU A 1 124 ? 25.452 18.992 -10.841 1.00 72.46 ? 172 GLU X O   1 
ATOM   804  C CB  . GLU A 1 124 ? 22.965 17.031 -11.538 1.00 72.74 ? 172 GLU X CB  1 
ATOM   805  C CG  . GLU A 1 124 ? 21.899 17.887 -12.252 1.00 74.72 ? 172 GLU X CG  1 
ATOM   806  C CD  . GLU A 1 124 ? 21.272 17.189 -13.481 1.00 75.76 ? 172 GLU X CD  1 
ATOM   807  O OE1 . GLU A 1 124 ? 21.983 16.404 -14.164 1.00 80.66 ? 172 GLU X OE1 1 
ATOM   808  O OE2 . GLU A 1 124 ? 20.068 17.441 -13.762 1.00 78.08 ? 172 GLU X OE2 1 
ATOM   809  N N   . ASP A 1 125 ? 23.494 20.073 -10.556 1.00 71.30 ? 173 ASP X N   1 
ATOM   810  C CA  . ASP A 1 125 ? 24.068 21.403 -10.783 1.00 71.32 ? 173 ASP X CA  1 
ATOM   811  C C   . ASP A 1 125 ? 24.988 21.798 -9.629  1.00 71.00 ? 173 ASP X C   1 
ATOM   812  O O   . ASP A 1 125 ? 26.062 22.354 -9.841  1.00 70.74 ? 173 ASP X O   1 
ATOM   813  C CB  . ASP A 1 125 ? 22.969 22.456 -11.003 1.00 71.38 ? 173 ASP X CB  1 
ATOM   814  C CG  . ASP A 1 125 ? 22.359 22.405 -12.423 1.00 73.95 ? 173 ASP X CG  1 
ATOM   815  O OD1 . ASP A 1 125 ? 23.056 22.010 -13.385 1.00 76.98 ? 173 ASP X OD1 1 
ATOM   816  O OD2 . ASP A 1 125 ? 21.176 22.785 -12.590 1.00 78.15 ? 173 ASP X OD2 1 
ATOM   817  N N   . ALA A 1 126 ? 24.564 21.501 -8.404  1.00 70.61 ? 174 ALA X N   1 
ATOM   818  C CA  . ALA A 1 126 ? 25.405 21.703 -7.228  1.00 70.05 ? 174 ALA X CA  1 
ATOM   819  C C   . ALA A 1 126 ? 26.649 20.813 -7.268  1.00 69.69 ? 174 ALA X C   1 
ATOM   820  O O   . ALA A 1 126 ? 27.730 21.273 -6.962  1.00 69.55 ? 174 ALA X O   1 
ATOM   821  C CB  . ALA A 1 126 ? 24.619 21.438 -5.969  1.00 69.98 ? 174 ALA X CB  1 
ATOM   822  N N   . GLN A 1 127 ? 26.480 19.544 -7.628  1.00 69.64 ? 175 GLN X N   1 
ATOM   823  C CA  . GLN A 1 127 ? 27.600 18.623 -7.793  1.00 69.53 ? 175 GLN X CA  1 
ATOM   824  C C   . GLN A 1 127 ? 28.595 19.152 -8.825  1.00 69.31 ? 175 GLN X C   1 
ATOM   825  O O   . GLN A 1 127 ? 29.794 19.193 -8.554  1.00 70.10 ? 175 GLN X O   1 
ATOM   826  C CB  . GLN A 1 127 ? 27.116 17.246 -8.234  1.00 69.72 ? 175 GLN X CB  1 
ATOM   827  C CG  . GLN A 1 127 ? 28.224 16.208 -8.255  1.00 70.32 ? 175 GLN X CG  1 
ATOM   828  C CD  . GLN A 1 127 ? 27.789 14.866 -8.781  1.00 70.43 ? 175 GLN X CD  1 
ATOM   829  O OE1 . GLN A 1 127 ? 26.912 14.782 -9.616  1.00 72.51 ? 175 GLN X OE1 1 
ATOM   830  N NE2 . GLN A 1 127 ? 28.427 13.804 -8.310  1.00 71.63 ? 175 GLN X NE2 1 
ATOM   831  N N   . LEU A 1 128 ? 28.103 19.573 -9.988  1.00 68.69 ? 176 LEU X N   1 
ATOM   832  C CA  . LEU A 1 128 ? 28.972 20.152 -11.018 1.00 68.97 ? 176 LEU X CA  1 
ATOM   833  C C   . LEU A 1 128 ? 29.707 21.420 -10.562 1.00 69.29 ? 176 LEU X C   1 
ATOM   834  O O   . LEU A 1 128 ? 30.859 21.636 -10.946 1.00 69.71 ? 176 LEU X O   1 
ATOM   835  C CB  . LEU A 1 128 ? 28.181 20.471 -12.289 1.00 68.98 ? 176 LEU X CB  1 
ATOM   836  C CG  . LEU A 1 128 ? 29.038 20.813 -13.510 1.00 69.11 ? 176 LEU X CG  1 
ATOM   837  C CD1 . LEU A 1 128 ? 29.996 19.698 -13.838 1.00 68.60 ? 176 LEU X CD1 1 
ATOM   838  C CD2 . LEU A 1 128 ? 28.170 21.163 -14.716 1.00 69.02 ? 176 LEU X CD2 1 
ATOM   839  N N   . GLN A 1 129 ? 29.049 22.260 -9.765  1.00 69.26 ? 177 GLN X N   1 
ATOM   840  C CA  . GLN A 1 129 ? 29.678 23.484 -9.260  1.00 69.68 ? 177 GLN X CA  1 
ATOM   841  C C   . GLN A 1 129 ? 30.846 23.180 -8.315  1.00 69.69 ? 177 GLN X C   1 
ATOM   842  O O   . GLN A 1 129 ? 31.894 23.788 -8.414  1.00 70.32 ? 177 GLN X O   1 
ATOM   843  C CB  . GLN A 1 129 ? 28.647 24.364 -8.556  1.00 69.84 ? 177 GLN X CB  1 
ATOM   844  C CG  . GLN A 1 129 ? 29.207 25.670 -8.010  1.00 69.85 ? 177 GLN X CG  1 
ATOM   845  C CD  . GLN A 1 129 ? 28.119 26.655 -7.644  1.00 71.27 ? 177 GLN X CD  1 
ATOM   846  O OE1 . GLN A 1 129 ? 28.028 27.089 -6.504  1.00 71.69 ? 177 GLN X OE1 1 
ATOM   847  N NE2 . GLN A 1 129 ? 27.269 26.998 -8.613  1.00 72.84 ? 177 GLN X NE2 1 
ATOM   848  N N   . ILE A 1 130 ? 30.662 22.216 -7.427  1.00 70.07 ? 178 ILE X N   1 
ATOM   849  C CA  . ILE A 1 130 ? 31.691 21.821 -6.469  1.00 70.51 ? 178 ILE X CA  1 
ATOM   850  C C   . ILE A 1 130 ? 32.816 21.042 -7.153  1.00 70.87 ? 178 ILE X C   1 
ATOM   851  O O   . ILE A 1 130 ? 33.970 21.140 -6.745  1.00 71.29 ? 178 ILE X O   1 
ATOM   852  C CB  . ILE A 1 130 ? 31.065 20.990 -5.308  1.00 70.59 ? 178 ILE X CB  1 
ATOM   853  C CG1 . ILE A 1 130 ? 30.054 21.836 -4.518  1.00 70.41 ? 178 ILE X CG1 1 
ATOM   854  C CG2 . ILE A 1 130 ? 32.125 20.441 -4.375  1.00 71.42 ? 178 ILE X CG2 1 
ATOM   855  C CD1 . ILE A 1 130 ? 30.649 23.047 -3.806  1.00 70.04 ? 178 ILE X CD1 1 
ATOM   856  N N   . TYR A 1 131 ? 32.474 20.266 -8.185  1.00 71.24 ? 179 TYR X N   1 
ATOM   857  C CA  . TYR A 1 131 ? 33.468 19.569 -9.021  1.00 71.23 ? 179 TYR X CA  1 
ATOM   858  C C   . TYR A 1 131 ? 34.401 20.544 -9.721  1.00 70.92 ? 179 TYR X C   1 
ATOM   859  O O   . TYR A 1 131 ? 35.595 20.332 -9.762  1.00 71.66 ? 179 TYR X O   1 
ATOM   860  C CB  . TYR A 1 131 ? 32.768 18.713 -10.086 1.00 71.31 ? 179 TYR X CB  1 
ATOM   861  C CG  . TYR A 1 131 ? 33.699 17.998 -11.058 1.00 71.70 ? 179 TYR X CG  1 
ATOM   862  C CD1 . TYR A 1 131 ? 34.216 16.733 -10.769 1.00 71.03 ? 179 TYR X CD1 1 
ATOM   863  C CD2 . TYR A 1 131 ? 34.047 18.584 -12.277 1.00 72.29 ? 179 TYR X CD2 1 
ATOM   864  C CE1 . TYR A 1 131 ? 35.040 16.077 -11.669 1.00 71.27 ? 179 TYR X CE1 1 
ATOM   865  C CE2 . TYR A 1 131 ? 34.879 17.950 -13.169 1.00 70.76 ? 179 TYR X CE2 1 
ATOM   866  C CZ  . TYR A 1 131 ? 35.378 16.691 -12.871 1.00 71.90 ? 179 TYR X CZ  1 
ATOM   867  O OH  . TYR A 1 131 ? 36.223 16.057 -13.783 1.00 70.64 ? 179 TYR X OH  1 
ATOM   868  N N   . THR A 1 132 ? 33.827 21.598 -10.286 1.00 70.69 ? 180 THR X N   1 
ATOM   869  C CA  . THR A 1 132 ? 34.559 22.606 -11.031 1.00 70.24 ? 180 THR X CA  1 
ATOM   870  C C   . THR A 1 132 ? 35.502 23.418 -10.106 1.00 70.69 ? 180 THR X C   1 
ATOM   871  O O   . THR A 1 132 ? 36.622 23.755 -10.498 1.00 70.54 ? 180 THR X O   1 
ATOM   872  C CB  . THR A 1 132 ? 33.558 23.520 -11.769 1.00 69.96 ? 180 THR X CB  1 
ATOM   873  O OG1 . THR A 1 132 ? 32.726 22.724 -12.631 1.00 68.93 ? 180 THR X OG1 1 
ATOM   874  C CG2 . THR A 1 132 ? 34.254 24.567 -12.593 1.00 69.23 ? 180 THR X CG2 1 
ATOM   875  N N   . LEU A 1 133 ? 35.038 23.712 -8.889  1.00 71.05 ? 181 LEU X N   1 
ATOM   876  C CA  . LEU A 1 133 ? 35.848 24.352 -7.833  1.00 71.05 ? 181 LEU X CA  1 
ATOM   877  C C   . LEU A 1 133 ? 37.045 23.482 -7.448  1.00 71.02 ? 181 LEU X C   1 
ATOM   878  O O   . LEU A 1 133 ? 38.182 23.952 -7.437  1.00 71.07 ? 181 LEU X O   1 
ATOM   879  C CB  . LEU A 1 133 ? 34.986 24.633 -6.583  1.00 71.05 ? 181 LEU X CB  1 
ATOM   880  C CG  . LEU A 1 133 ? 35.677 25.035 -5.266  1.00 71.51 ? 181 LEU X CG  1 
ATOM   881  C CD1 . LEU A 1 133 ? 36.164 26.483 -5.323  1.00 71.92 ? 181 LEU X CD1 1 
ATOM   882  C CD2 . LEU A 1 133 ? 34.746 24.834 -4.069  1.00 71.61 ? 181 LEU X CD2 1 
ATOM   883  N N   . MET A 1 134 ? 36.795 22.219 -7.124  1.00 70.96 ? 182 MET X N   1 
ATOM   884  C CA  . MET A 1 134 ? 37.891 21.290 -6.803  1.00 71.11 ? 182 MET X CA  1 
ATOM   885  C C   . MET A 1 134 ? 38.922 21.182 -7.933  1.00 70.73 ? 182 MET X C   1 
ATOM   886  O O   . MET A 1 134 ? 40.131 21.201 -7.688  1.00 70.39 ? 182 MET X O   1 
ATOM   887  C CB  . MET A 1 134 ? 37.336 19.901 -6.465  1.00 71.25 ? 182 MET X CB  1 
ATOM   888  C CG  . MET A 1 134 ? 36.686 19.818 -5.086  1.00 71.83 ? 182 MET X CG  1 
ATOM   889  S SD  . MET A 1 134 ? 36.116 18.163 -4.655  1.00 72.51 ? 182 MET X SD  1 
ATOM   890  C CE  . MET A 1 134 ? 34.904 17.821 -5.915  1.00 71.58 ? 182 MET X CE  1 
ATOM   891  N N   . HIS A 1 135 ? 38.441 21.062 -9.167  1.00 70.71 ? 183 HIS X N   1 
ATOM   892  C CA  . HIS A 1 135 ? 39.323 21.009 -10.340 1.00 70.85 ? 183 HIS X CA  1 
ATOM   893  C C   . HIS A 1 135 ? 40.167 22.299 -10.484 1.00 71.20 ? 183 HIS X C   1 
ATOM   894  O O   . HIS A 1 135 ? 41.379 22.246 -10.722 1.00 71.10 ? 183 HIS X O   1 
ATOM   895  C CB  . HIS A 1 135 ? 38.476 20.745 -11.595 1.00 70.54 ? 183 HIS X CB  1 
ATOM   896  C CG  . HIS A 1 135 ? 39.269 20.361 -12.807 1.00 69.27 ? 183 HIS X CG  1 
ATOM   897  N ND1 . HIS A 1 135 ? 38.938 20.790 -14.072 1.00 68.17 ? 183 HIS X ND1 1 
ATOM   898  C CD2 . HIS A 1 135 ? 40.361 19.572 -12.951 1.00 67.40 ? 183 HIS X CD2 1 
ATOM   899  C CE1 . HIS A 1 135 ? 39.791 20.284 -14.944 1.00 68.69 ? 183 HIS X CE1 1 
ATOM   900  N NE2 . HIS A 1 135 ? 40.664 19.539 -14.289 1.00 67.44 ? 183 HIS X NE2 1 
ATOM   901  N N   . ARG A 1 136 ? 39.514 23.445 -10.310 1.00 71.99 ? 184 ARG X N   1 
ATOM   902  C CA  . ARG A 1 136 ? 40.140 24.776 -10.440 1.00 72.50 ? 184 ARG X CA  1 
ATOM   903  C C   . ARG A 1 136 ? 41.100 25.136 -9.292  1.00 73.10 ? 184 ARG X C   1 
ATOM   904  O O   . ARG A 1 136 ? 42.194 25.616 -9.533  1.00 73.27 ? 184 ARG X O   1 
ATOM   905  C CB  . ARG A 1 136 ? 39.031 25.835 -10.504 1.00 72.36 ? 184 ARG X CB  1 
ATOM   906  C CG  . ARG A 1 136 ? 39.486 27.285 -10.615 1.00 73.20 ? 184 ARG X CG  1 
ATOM   907  C CD  . ARG A 1 136 ? 38.388 28.241 -10.116 1.00 73.49 ? 184 ARG X CD  1 
ATOM   908  N N   . ASP A 1 137 ? 40.668 24.943 -8.047  1.00 73.77 ? 185 ASP X N   1 
ATOM   909  C CA  . ASP A 1 137 ? 41.416 25.425 -6.892  1.00 74.22 ? 185 ASP X CA  1 
ATOM   910  C C   . ASP A 1 137 ? 42.245 24.346 -6.208  1.00 73.78 ? 185 ASP X C   1 
ATOM   911  O O   . ASP A 1 137 ? 43.423 24.551 -5.942  1.00 74.58 ? 185 ASP X O   1 
ATOM   912  C CB  . ASP A 1 137 ? 40.467 26.068 -5.872  1.00 74.77 ? 185 ASP X CB  1 
ATOM   913  C CG  . ASP A 1 137 ? 40.011 27.476 -6.283  1.00 77.47 ? 185 ASP X CG  1 
ATOM   914  O OD1 . ASP A 1 137 ? 40.751 28.193 -7.011  1.00 79.09 ? 185 ASP X OD1 1 
ATOM   915  O OD2 . ASP A 1 137 ? 38.902 27.878 -5.852  1.00 81.80 ? 185 ASP X OD2 1 
ATOM   916  N N   . SER A 1 138 ? 41.630 23.210 -5.927  1.00 73.29 ? 186 SER X N   1 
ATOM   917  C CA  . SER A 1 138 ? 42.236 22.154 -5.112  1.00 73.10 ? 186 SER X CA  1 
ATOM   918  C C   . SER A 1 138 ? 43.179 21.227 -5.872  1.00 72.11 ? 186 SER X C   1 
ATOM   919  O O   . SER A 1 138 ? 44.271 20.915 -5.392  1.00 72.02 ? 186 SER X O   1 
ATOM   920  C CB  . SER A 1 138 ? 41.136 21.299 -4.466  1.00 73.18 ? 186 SER X CB  1 
ATOM   921  O OG  . SER A 1 138 ? 40.555 21.984 -3.373  1.00 75.41 ? 186 SER X OG  1 
ATOM   922  N N   . PHE A 1 139 ? 42.734 20.766 -7.037  1.00 71.14 ? 187 PHE X N   1 
ATOM   923  C CA  . PHE A 1 139 ? 43.455 19.747 -7.806  1.00 70.45 ? 187 PHE X CA  1 
ATOM   924  C C   . PHE A 1 139 ? 44.871 20.138 -8.195  1.00 70.35 ? 187 PHE X C   1 
ATOM   925  O O   . PHE A 1 139 ? 45.767 19.333 -8.017  1.00 70.37 ? 187 PHE X O   1 
ATOM   926  C CB  . PHE A 1 139 ? 42.664 19.347 -9.057  1.00 69.89 ? 187 PHE X CB  1 
ATOM   927  C CG  . PHE A 1 139 ? 43.267 18.206 -9.839  1.00 68.69 ? 187 PHE X CG  1 
ATOM   928  C CD1 . PHE A 1 139 ? 43.521 16.987 -9.238  1.00 68.65 ? 187 PHE X CD1 1 
ATOM   929  C CD2 . PHE A 1 139 ? 43.539 18.344 -11.192 1.00 68.11 ? 187 PHE X CD2 1 
ATOM   930  C CE1 . PHE A 1 139 ? 44.040 15.932 -9.963  1.00 67.71 ? 187 PHE X CE1 1 
ATOM   931  C CE2 . PHE A 1 139 ? 44.052 17.291 -11.916 1.00 67.64 ? 187 PHE X CE2 1 
ATOM   932  C CZ  . PHE A 1 139 ? 44.301 16.083 -11.299 1.00 67.55 ? 187 PHE X CZ  1 
ATOM   933  N N   . PRO A 1 140 ? 45.079 21.369 -8.721  1.00 70.52 ? 188 PRO X N   1 
ATOM   934  C CA  . PRO A 1 140 ? 46.432 21.743 -9.101  1.00 70.70 ? 188 PRO X CA  1 
ATOM   935  C C   . PRO A 1 140 ? 47.401 21.891 -7.925  1.00 70.98 ? 188 PRO X C   1 
ATOM   936  O O   . PRO A 1 140 ? 48.609 21.731 -8.117  1.00 71.30 ? 188 PRO X O   1 
ATOM   937  C CB  . PRO A 1 140 ? 46.231 23.089 -9.816  1.00 70.89 ? 188 PRO X CB  1 
ATOM   938  C CG  . PRO A 1 140 ? 44.792 23.119 -10.180 1.00 70.18 ? 188 PRO X CG  1 
ATOM   939  C CD  . PRO A 1 140 ? 44.147 22.470 -9.013  1.00 70.21 ? 188 PRO X CD  1 
ATOM   940  N N   . ARG A 1 141 ? 46.892 22.199 -6.732  1.00 71.12 ? 189 ARG X N   1 
ATOM   941  C CA  . ARG A 1 141 ? 47.734 22.205 -5.520  1.00 71.35 ? 189 ARG X CA  1 
ATOM   942  C C   . ARG A 1 141 ? 47.956 20.780 -5.030  1.00 70.73 ? 189 ARG X C   1 
ATOM   943  O O   . ARG A 1 141 ? 48.978 20.493 -4.433  1.00 70.69 ? 189 ARG X O   1 
ATOM   944  C CB  . ARG A 1 141 ? 47.119 23.051 -4.396  1.00 71.29 ? 189 ARG X CB  1 
ATOM   945  C CG  . ARG A 1 141 ? 47.331 24.562 -4.553  1.00 72.47 ? 189 ARG X CG  1 
ATOM   946  C CD  . ARG A 1 141 ? 46.955 25.326 -3.272  1.00 73.13 ? 189 ARG X CD  1 
ATOM   947  N NE  . ARG A 1 141 ? 45.580 25.041 -2.839  1.00 75.25 ? 189 ARG X NE  1 
ATOM   948  C CZ  . ARG A 1 141 ? 44.485 25.651 -3.296  1.00 75.73 ? 189 ARG X CZ  1 
ATOM   949  N NH1 . ARG A 1 141 ? 44.554 26.617 -4.211  1.00 76.81 ? 189 ARG X NH1 1 
ATOM   950  N NH2 . ARG A 1 141 ? 43.299 25.295 -2.824  1.00 76.12 ? 189 ARG X NH2 1 
ATOM   951  N N   . PHE A 1 142 ? 46.994 19.892 -5.280  1.00 70.39 ? 190 PHE X N   1 
ATOM   952  C CA  . PHE A 1 142 ? 47.171 18.466 -5.002  1.00 70.19 ? 190 PHE X CA  1 
ATOM   953  C C   . PHE A 1 142 ? 48.331 17.887 -5.826  1.00 70.29 ? 190 PHE X C   1 
ATOM   954  O O   . PHE A 1 142 ? 49.160 17.149 -5.291  1.00 70.18 ? 190 PHE X O   1 
ATOM   955  C CB  . PHE A 1 142 ? 45.854 17.693 -5.246  1.00 70.02 ? 190 PHE X CB  1 
ATOM   956  C CG  . PHE A 1 142 ? 45.980 16.191 -5.125  1.00 69.66 ? 190 PHE X CG  1 
ATOM   957  C CD1 . PHE A 1 142 ? 46.216 15.594 -3.896  1.00 68.85 ? 190 PHE X CD1 1 
ATOM   958  C CD2 . PHE A 1 142 ? 45.851 15.374 -6.245  1.00 69.84 ? 190 PHE X CD2 1 
ATOM   959  C CE1 . PHE A 1 142 ? 46.338 14.212 -3.777  1.00 67.97 ? 190 PHE X CE1 1 
ATOM   960  C CE2 . PHE A 1 142 ? 45.954 13.993 -6.132  1.00 69.34 ? 190 PHE X CE2 1 
ATOM   961  C CZ  . PHE A 1 142 ? 46.200 13.413 -4.894  1.00 68.63 ? 190 PHE X CZ  1 
ATOM   962  N N   . LEU A 1 143 ? 48.422 18.251 -7.105  1.00 70.42 ? 191 LEU X N   1 
ATOM   963  C CA  . LEU A 1 143 ? 49.463 17.693 -7.974  1.00 70.87 ? 191 LEU X CA  1 
ATOM   964  C C   . LEU A 1 143 ? 50.892 18.128 -7.585  1.00 71.12 ? 191 LEU X C   1 
ATOM   965  O O   . LEU A 1 143 ? 51.875 17.480 -7.969  1.00 70.87 ? 191 LEU X O   1 
ATOM   966  C CB  . LEU A 1 143 ? 49.181 18.024 -9.447  1.00 70.95 ? 191 LEU X CB  1 
ATOM   967  C CG  . LEU A 1 143 ? 47.910 17.459 -10.090 1.00 71.17 ? 191 LEU X CG  1 
ATOM   968  C CD1 . LEU A 1 143 ? 47.835 17.923 -11.546 1.00 71.84 ? 191 LEU X CD1 1 
ATOM   969  C CD2 . LEU A 1 143 ? 47.834 15.936 -10.005 1.00 70.75 ? 191 LEU X CD2 1 
ATOM   970  N N   . ASN A 1 144 ? 50.999 19.223 -6.832  1.00 71.54 ? 192 ASN X N   1 
ATOM   971  C CA  . ASN A 1 144 ? 52.278 19.673 -6.260  1.00 71.56 ? 192 ASN X CA  1 
ATOM   972  C C   . ASN A 1 144 ? 52.439 19.337 -4.774  1.00 71.27 ? 192 ASN X C   1 
ATOM   973  O O   . ASN A 1 144 ? 53.417 19.724 -4.165  1.00 71.85 ? 192 ASN X O   1 
ATOM   974  C CB  . ASN A 1 144 ? 52.436 21.188 -6.457  1.00 71.66 ? 192 ASN X CB  1 
ATOM   975  C CG  . ASN A 1 144 ? 52.474 21.594 -7.927  1.00 72.59 ? 192 ASN X CG  1 
ATOM   976  O OD1 . ASN A 1 144 ? 52.145 22.727 -8.269  1.00 74.60 ? 192 ASN X OD1 1 
ATOM   977  N ND2 . ASN A 1 144 ? 52.882 20.674 -8.799  1.00 73.06 ? 192 ASN X ND2 1 
ATOM   978  N N   . SER A 1 145 ? 51.483 18.623 -4.189  1.00 71.32 ? 193 SER X N   1 
ATOM   979  C CA  . SER A 1 145 ? 51.556 18.242 -2.783  1.00 71.05 ? 193 SER X CA  1 
ATOM   980  C C   . SER A 1 145 ? 52.574 17.115 -2.562  1.00 71.35 ? 193 SER X C   1 
ATOM   981  O O   . SER A 1 145 ? 52.939 16.396 -3.494  1.00 71.11 ? 193 SER X O   1 
ATOM   982  C CB  . SER A 1 145 ? 50.170 17.838 -2.251  1.00 71.03 ? 193 SER X CB  1 
ATOM   983  O OG  . SER A 1 145 ? 49.696 16.619 -2.809  1.00 70.13 ? 193 SER X OG  1 
ATOM   984  N N   . GLN A 1 146 ? 53.055 16.998 -1.325  1.00 71.63 ? 194 GLN X N   1 
ATOM   985  C CA  . GLN A 1 146 ? 53.882 15.866 -0.919  1.00 71.76 ? 194 GLN X CA  1 
ATOM   986  C C   . GLN A 1 146 ? 53.060 14.585 -0.943  1.00 71.94 ? 194 GLN X C   1 
ATOM   987  O O   . GLN A 1 146 ? 53.544 13.548 -1.381  1.00 71.72 ? 194 GLN X O   1 
ATOM   988  C CB  . GLN A 1 146 ? 54.452 16.078 0.488   1.00 71.97 ? 194 GLN X CB  1 
ATOM   989  N N   . ILE A 1 147 ? 51.811 14.670 -0.482  1.00 72.21 ? 195 ILE X N   1 
ATOM   990  C CA  . ILE A 1 147 ? 50.913 13.507 -0.424  1.00 72.20 ? 195 ILE X CA  1 
ATOM   991  C C   . ILE A 1 147 ? 50.870 12.793 -1.782  1.00 72.35 ? 195 ILE X C   1 
ATOM   992  O O   . ILE A 1 147 ? 51.112 11.584 -1.845  1.00 72.09 ? 195 ILE X O   1 
ATOM   993  C CB  . ILE A 1 147 ? 49.497 13.910 0.084   1.00 72.16 ? 195 ILE X CB  1 
ATOM   994  C CG1 . ILE A 1 147 ? 49.550 14.229 1.586   1.00 72.29 ? 195 ILE X CG1 1 
ATOM   995  C CG2 . ILE A 1 147 ? 48.474 12.798 -0.159  1.00 72.18 ? 195 ILE X CG2 1 
ATOM   996  C CD1 . ILE A 1 147 ? 48.325 14.995 2.117   1.00 71.97 ? 195 ILE X CD1 1 
ATOM   997  N N   . TYR A 1 148 ? 50.604 13.556 -2.851  1.00 72.61 ? 196 TYR X N   1 
ATOM   998  C CA  . TYR A 1 148 ? 50.585 13.037 -4.234  1.00 72.83 ? 196 TYR X CA  1 
ATOM   999  C C   . TYR A 1 148 ? 51.951 12.533 -4.708  1.00 72.90 ? 196 TYR X C   1 
ATOM   1000 O O   . TYR A 1 148 ? 52.102 11.355 -5.055  1.00 72.82 ? 196 TYR X O   1 
ATOM   1001 C CB  . TYR A 1 148 ? 50.102 14.113 -5.213  1.00 73.02 ? 196 TYR X CB  1 
ATOM   1002 C CG  . TYR A 1 148 ? 50.202 13.696 -6.672  1.00 73.77 ? 196 TYR X CG  1 
ATOM   1003 C CD1 . TYR A 1 148 ? 49.312 12.776 -7.206  1.00 74.66 ? 196 TYR X CD1 1 
ATOM   1004 C CD2 . TYR A 1 148 ? 51.188 14.216 -7.514  1.00 73.95 ? 196 TYR X CD2 1 
ATOM   1005 C CE1 . TYR A 1 148 ? 49.389 12.376 -8.524  1.00 74.52 ? 196 TYR X CE1 1 
ATOM   1006 C CE2 . TYR A 1 148 ? 51.272 13.824 -8.844  1.00 73.53 ? 196 TYR X CE2 1 
ATOM   1007 C CZ  . TYR A 1 148 ? 50.363 12.902 -9.342  1.00 74.25 ? 196 TYR X CZ  1 
ATOM   1008 O OH  . TYR A 1 148 ? 50.405 12.481 -10.657 1.00 74.27 ? 196 TYR X OH  1 
ATOM   1009 N N   . LYS A 1 149 ? 52.932 13.437 -4.731  1.00 72.95 ? 197 LYS X N   1 
ATOM   1010 C CA  . LYS A 1 149 ? 54.285 13.138 -5.211  1.00 72.88 ? 197 LYS X CA  1 
ATOM   1011 C C   . LYS A 1 149 ? 54.920 11.971 -4.466  1.00 72.91 ? 197 LYS X C   1 
ATOM   1012 O O   . LYS A 1 149 ? 55.673 11.192 -5.053  1.00 73.35 ? 197 LYS X O   1 
ATOM   1013 C CB  . LYS A 1 149 ? 55.187 14.378 -5.098  1.00 72.84 ? 197 LYS X CB  1 
ATOM   1014 N N   . SER A 1 150 ? 54.632 11.871 -3.171  1.00 72.96 ? 198 SER X N   1 
ATOM   1015 C CA  . SER A 1 150 ? 55.032 10.722 -2.360  1.00 72.94 ? 198 SER X CA  1 
ATOM   1016 C C   . SER A 1 150 ? 54.291 9.454  -2.812  1.00 72.98 ? 198 SER X C   1 
ATOM   1017 O O   . SER A 1 150 ? 54.875 8.372  -2.865  1.00 72.57 ? 198 SER X O   1 
ATOM   1018 C CB  . SER A 1 150 ? 54.757 11.011 -0.880  1.00 72.86 ? 198 SER X CB  1 
ATOM   1019 O OG  . SER A 1 150 ? 55.220 9.975  -0.045  1.00 73.10 ? 198 SER X OG  1 
ATOM   1020 N N   . PHE A 1 151 ? 53.006 9.600  -3.142  1.00 73.40 ? 199 PHE X N   1 
ATOM   1021 C CA  . PHE A 1 151 ? 52.206 8.481  -3.646  1.00 73.50 ? 199 PHE X CA  1 
ATOM   1022 C C   . PHE A 1 151 ? 52.707 7.967  -5.006  1.00 73.82 ? 199 PHE X C   1 
ATOM   1023 O O   . PHE A 1 151 ? 52.846 6.757  -5.185  1.00 73.77 ? 199 PHE X O   1 
ATOM   1024 C CB  . PHE A 1 151 ? 50.716 8.843  -3.735  1.00 73.32 ? 199 PHE X CB  1 
ATOM   1025 C CG  . PHE A 1 151 ? 49.855 7.712  -4.242  1.00 73.21 ? 199 PHE X CG  1 
ATOM   1026 C CD1 . PHE A 1 151 ? 49.290 6.799  -3.360  1.00 72.94 ? 199 PHE X CD1 1 
ATOM   1027 C CD2 . PHE A 1 151 ? 49.640 7.543  -5.605  1.00 72.26 ? 199 PHE X CD2 1 
ATOM   1028 C CE1 . PHE A 1 151 ? 48.522 5.748  -3.828  1.00 72.90 ? 199 PHE X CE1 1 
ATOM   1029 C CE2 . PHE A 1 151 ? 48.885 6.495  -6.077  1.00 72.21 ? 199 PHE X CE2 1 
ATOM   1030 C CZ  . PHE A 1 151 ? 48.322 5.597  -5.193  1.00 72.88 ? 199 PHE X CZ  1 
ATOM   1031 N N   . VAL A 1 152 ? 52.972 8.861  -5.961  1.00 74.31 ? 200 VAL X N   1 
ATOM   1032 C CA  . VAL A 1 152 ? 53.461 8.402  -7.280  1.00 74.77 ? 200 VAL X CA  1 
ATOM   1033 C C   . VAL A 1 152 ? 54.849 7.779  -7.154  1.00 74.64 ? 200 VAL X C   1 
ATOM   1034 O O   . VAL A 1 152 ? 55.155 6.814  -7.843  1.00 74.62 ? 200 VAL X O   1 
ATOM   1035 C CB  . VAL A 1 152 ? 53.455 9.494  -8.414  1.00 74.87 ? 200 VAL X CB  1 
ATOM   1036 C CG1 . VAL A 1 152 ? 52.211 10.374 -8.330  1.00 74.85 ? 200 VAL X CG1 1 
ATOM   1037 C CG2 . VAL A 1 152 ? 54.739 10.324 -8.439  1.00 75.02 ? 200 VAL X CG2 1 
ATOM   1038 N N   . GLU A 1 153 ? 55.660 8.339  -6.260  1.00 74.87 ? 201 GLU X N   1 
ATOM   1039 C CA  . GLU A 1 153 ? 56.999 7.830  -5.953  1.00 75.29 ? 201 GLU X CA  1 
ATOM   1040 C C   . GLU A 1 153 ? 56.967 6.379  -5.444  1.00 75.41 ? 201 GLU X C   1 
ATOM   1041 O O   . GLU A 1 153 ? 57.816 5.567  -5.813  1.00 75.22 ? 201 GLU X O   1 
ATOM   1042 C CB  . GLU A 1 153 ? 57.644 8.742  -4.907  1.00 75.29 ? 201 GLU X CB  1 
ATOM   1043 C CG  . GLU A 1 153 ? 59.115 8.523  -4.646  1.00 75.55 ? 201 GLU X CG  1 
ATOM   1044 C CD  . GLU A 1 153 ? 59.653 9.450  -3.563  1.00 75.78 ? 201 GLU X CD  1 
ATOM   1045 O OE1 . GLU A 1 153 ? 58.855 10.182 -2.937  1.00 76.48 ? 201 GLU X OE1 1 
ATOM   1046 O OE2 . GLU A 1 153 ? 60.882 9.447  -3.329  1.00 77.25 ? 201 GLU X OE2 1 
ATOM   1047 N N   . SER A 1 154 ? 55.980 6.063  -4.609  1.00 75.73 ? 202 SER X N   1 
ATOM   1048 C CA  . SER A 1 154 ? 55.798 4.699  -4.096  1.00 75.89 ? 202 SER X CA  1 
ATOM   1049 C C   . SER A 1 154 ? 55.311 3.716  -5.155  1.00 75.91 ? 202 SER X C   1 
ATOM   1050 O O   . SER A 1 154 ? 55.796 2.593  -5.210  1.00 75.78 ? 202 SER X O   1 
ATOM   1051 C CB  . SER A 1 154 ? 54.835 4.686  -2.906  1.00 75.89 ? 202 SER X CB  1 
ATOM   1052 O OG  . SER A 1 154 ? 55.540 4.949  -1.707  1.00 76.84 ? 202 SER X OG  1 
ATOM   1053 N N   . THR A 1 155 ? 54.358 4.127  -5.994  1.00 76.21 ? 203 THR X N   1 
ATOM   1054 C CA  . THR A 1 155 ? 53.816 3.221  -7.016  1.00 76.42 ? 203 THR X CA  1 
ATOM   1055 C C   . THR A 1 155 ? 54.802 2.985  -8.171  1.00 76.27 ? 203 THR X C   1 
ATOM   1056 O O   . THR A 1 155 ? 54.643 2.037  -8.936  1.00 75.99 ? 203 THR X O   1 
ATOM   1057 C CB  . THR A 1 155 ? 52.433 3.682  -7.564  1.00 76.58 ? 203 THR X CB  1 
ATOM   1058 O OG1 . THR A 1 155 ? 52.573 4.909  -8.277  1.00 77.49 ? 203 THR X OG1 1 
ATOM   1059 C CG2 . THR A 1 155 ? 51.415 3.856  -6.425  1.00 76.42 ? 203 THR X CG2 1 
ATOM   1060 N N   . ALA A 1 156 ? 55.819 3.842  -8.275  1.00 76.40 ? 204 ALA X N   1 
ATOM   1061 C CA  . ALA A 1 156 ? 56.923 3.659  -9.228  1.00 76.57 ? 204 ALA X CA  1 
ATOM   1062 C C   . ALA A 1 156 ? 58.139 3.016  -8.561  1.00 76.55 ? 204 ALA X C   1 
ATOM   1063 O O   . ALA A 1 156 ? 58.023 1.995  -7.881  1.00 76.79 ? 204 ALA X O   1 
ATOM   1064 C CB  . ALA A 1 156 ? 57.312 4.997  -9.843  1.00 76.49 ? 204 ALA X CB  1 
HETATM 1065 O O   . HOH B 2 .   ? 26.567 24.117 -11.987 1.00 55.73 ? 1   HOH X O   1 
HETATM 1066 O O   . HOH B 2 .   ? 27.676 7.609  0.665   1.00 85.44 ? 2   HOH X O   1 
HETATM 1067 O O   . HOH B 2 .   ? 41.951 17.247 -15.580 1.00 53.59 ? 3   HOH X O   1 
HETATM 1068 O O   . HOH B 2 .   ? 30.614 16.238 -11.479 1.00 64.77 ? 4   HOH X O   1 
HETATM 1069 O O   . HOH B 2 .   ? 21.657 14.430 -7.604  1.00 61.61 ? 5   HOH X O   1 
HETATM 1070 O O   . HOH B 2 .   ? 37.906 18.862 5.874   1.00 74.79 ? 6   HOH X O   1 
HETATM 1071 O O   . HOH B 2 .   ? 50.863 17.164 1.403   1.00 76.98 ? 11  HOH X O   1 
HETATM 1072 O O   . HOH B 2 .   ? 26.378 17.374 -12.756 1.00 67.67 ? 12  HOH X O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   49  ?   ?   ?   X . n 
A 1 2   HIS 2   50  ?   ?   ?   X . n 
A 1 3   HIS 3   51  ?   ?   ?   X . n 
A 1 4   HIS 4   52  ?   ?   ?   X . n 
A 1 5   HIS 5   53  ?   ?   ?   X . n 
A 1 6   HIS 6   54  ?   ?   ?   X . n 
A 1 7   HIS 7   55  ?   ?   ?   X . n 
A 1 8   SER 8   56  ?   ?   ?   X . n 
A 1 9   SER 9   57  ?   ?   ?   X . n 
A 1 10  GLY 10  58  ?   ?   ?   X . n 
A 1 11  VAL 11  59  ?   ?   ?   X . n 
A 1 12  ASP 12  60  ?   ?   ?   X . n 
A 1 13  LEU 13  61  ?   ?   ?   X . n 
A 1 14  GLY 14  62  ?   ?   ?   X . n 
A 1 15  THR 15  63  ?   ?   ?   X . n 
A 1 16  GLU 16  64  ?   ?   ?   X . n 
A 1 17  ASN 17  65  ?   ?   ?   X . n 
A 1 18  LEU 18  66  66  LEU LEU X . n 
A 1 19  TYR 19  67  67  TYR TYR X . n 
A 1 20  PHE 20  68  68  PHE PHE X . n 
A 1 21  GLN 21  69  69  GLN GLN X . n 
A 1 22  SER 22  70  70  SER SER X . n 
A 1 23  MET 23  71  71  MET MET X . n 
A 1 24  ASN 24  72  72  ASN ASN X . n 
A 1 25  PRO 25  73  73  PRO PRO X . n 
A 1 26  THR 26  74  74  THR THR X . n 
A 1 27  ALA 27  75  75  ALA ALA X . n 
A 1 28  GLU 28  76  76  GLU GLU X . n 
A 1 29  GLU 29  77  77  GLU GLU X . n 
A 1 30  VAL 30  78  78  VAL VAL X . n 
A 1 31  LEU 31  79  79  LEU LEU X . n 
A 1 32  SER 32  80  80  SER SER X . n 
A 1 33  TRP 33  81  81  TRP TRP X . n 
A 1 34  SER 34  82  82  SER SER X . n 
A 1 35  GLN 35  83  83  GLN GLN X . n 
A 1 36  ASN 36  84  84  ASN ASN X . n 
A 1 37  PHE 37  85  85  PHE PHE X . n 
A 1 38  ASP 38  86  86  ASP ASP X . n 
A 1 39  LYS 39  87  87  LYS LYS X . n 
A 1 40  MET 40  88  88  MET MET X . n 
A 1 41  MET 41  89  89  MET MET X . n 
A 1 42  LYS 42  90  90  LYS LYS X . n 
A 1 43  ALA 43  91  91  ALA ALA X . n 
A 1 44  PRO 44  92  92  PRO PRO X . n 
A 1 45  ALA 45  93  93  ALA ALA X . n 
A 1 46  GLY 46  94  94  GLY GLY X . n 
A 1 47  ARG 47  95  95  ARG ARG X . n 
A 1 48  ASN 48  96  96  ASN ASN X . n 
A 1 49  LEU 49  97  97  LEU LEU X . n 
A 1 50  PHE 50  98  98  PHE PHE X . n 
A 1 51  ARG 51  99  99  ARG ARG X . n 
A 1 52  GLU 52  100 100 GLU GLU X . n 
A 1 53  PHE 53  101 101 PHE PHE X . n 
A 1 54  LEU 54  102 102 LEU LEU X . n 
A 1 55  ARG 55  103 103 ARG ARG X . n 
A 1 56  THR 56  104 104 THR THR X . n 
A 1 57  GLU 57  105 105 GLU GLU X . n 
A 1 58  TYR 58  106 106 TYR TYR X . n 
A 1 59  SER 59  107 107 SER SER X . n 
A 1 60  GLU 60  108 108 GLU GLU X . n 
A 1 61  GLU 61  109 109 GLU GLU X . n 
A 1 62  ASN 62  110 110 ASN ASN X . n 
A 1 63  LEU 63  111 111 LEU LEU X . n 
A 1 64  LEU 64  112 112 LEU LEU X . n 
A 1 65  PHE 65  113 113 PHE PHE X . n 
A 1 66  TRP 66  114 114 TRP TRP X . n 
A 1 67  LEU 67  115 115 LEU LEU X . n 
A 1 68  ALA 68  116 116 ALA ALA X . n 
A 1 69  CYS 69  117 117 CYS CYS X . n 
A 1 70  GLU 70  118 118 GLU GLU X . n 
A 1 71  ASP 71  119 119 ASP ASP X . n 
A 1 72  LEU 72  120 120 LEU LEU X . n 
A 1 73  LYS 73  121 121 LYS LYS X . n 
A 1 74  LYS 74  122 122 LYS LYS X . n 
A 1 75  GLU 75  123 123 GLU GLU X . n 
A 1 76  GLN 76  124 124 GLN GLN X . n 
A 1 77  ASN 77  125 125 ASN ASN X . n 
A 1 78  LYS 78  126 126 LYS LYS X . n 
A 1 79  LYS 79  127 127 LYS LYS X . n 
A 1 80  VAL 80  128 128 VAL VAL X . n 
A 1 81  ILE 81  129 129 ILE ILE X . n 
A 1 82  GLU 82  130 130 GLU GLU X . n 
A 1 83  GLU 83  131 131 GLU GLU X . n 
A 1 84  LYS 84  132 132 LYS LYS X . n 
A 1 85  ALA 85  133 133 ALA ALA X . n 
A 1 86  ARG 86  134 134 ARG ARG X . n 
A 1 87  MET 87  135 135 MET MET X . n 
A 1 88  ILE 88  136 136 ILE ILE X . n 
A 1 89  TYR 89  137 137 TYR TYR X . n 
A 1 90  GLU 90  138 138 GLU GLU X . n 
A 1 91  ASP 91  139 139 ASP ASP X . n 
A 1 92  TYR 92  140 140 TYR TYR X . n 
A 1 93  ILE 93  141 141 ILE ILE X . n 
A 1 94  SER 94  142 142 SER SER X . n 
A 1 95  ILE 95  143 143 ILE ILE X . n 
A 1 96  LEU 96  144 144 LEU LEU X . n 
A 1 97  SER 97  145 ?   ?   ?   X . n 
A 1 98  PRO 98  146 146 PRO PRO X . n 
A 1 99  LYS 99  147 147 LYS LYS X . n 
A 1 100 GLU 100 148 148 GLU GLU X . n 
A 1 101 VAL 101 149 149 VAL VAL X . n 
A 1 102 SER 102 150 150 SER SER X . n 
A 1 103 LEU 103 151 151 LEU LEU X . n 
A 1 104 ASP 104 152 152 ASP ASP X . n 
A 1 105 SER 105 153 153 SER SER X . n 
A 1 106 ARG 106 154 154 ARG ARG X . n 
A 1 107 VAL 107 155 155 VAL VAL X . n 
A 1 108 ARG 108 156 156 ARG ARG X . n 
A 1 109 GLU 109 157 157 GLU GLU X . n 
A 1 110 VAL 110 158 158 VAL VAL X . n 
A 1 111 ILE 111 159 159 ILE ILE X . n 
A 1 112 ASN 112 160 160 ASN ASN X . n 
A 1 113 ARG 113 161 161 ARG ARG X . n 
A 1 114 ASN 114 162 162 ASN ASN X . n 
A 1 115 LEU 115 163 163 LEU LEU X . n 
A 1 116 LEU 116 164 164 LEU LEU X . n 
A 1 117 ASP 117 165 165 ASP ASP X . n 
A 1 118 PRO 118 166 166 PRO PRO X . n 
A 1 119 ASN 119 167 167 ASN ASN X . n 
A 1 120 PRO 120 168 168 PRO PRO X . n 
A 1 121 HIS 121 169 169 HIS HIS X . n 
A 1 122 MET 122 170 170 MET MET X . n 
A 1 123 TYR 123 171 171 TYR TYR X . n 
A 1 124 GLU 124 172 172 GLU GLU X . n 
A 1 125 ASP 125 173 173 ASP ASP X . n 
A 1 126 ALA 126 174 174 ALA ALA X . n 
A 1 127 GLN 127 175 175 GLN GLN X . n 
A 1 128 LEU 128 176 176 LEU LEU X . n 
A 1 129 GLN 129 177 177 GLN GLN X . n 
A 1 130 ILE 130 178 178 ILE ILE X . n 
A 1 131 TYR 131 179 179 TYR TYR X . n 
A 1 132 THR 132 180 180 THR THR X . n 
A 1 133 LEU 133 181 181 LEU LEU X . n 
A 1 134 MET 134 182 182 MET MET X . n 
A 1 135 HIS 135 183 183 HIS HIS X . n 
A 1 136 ARG 136 184 184 ARG ARG X . n 
A 1 137 ASP 137 185 185 ASP ASP X . n 
A 1 138 SER 138 186 186 SER SER X . n 
A 1 139 PHE 139 187 187 PHE PHE X . n 
A 1 140 PRO 140 188 188 PRO PRO X . n 
A 1 141 ARG 141 189 189 ARG ARG X . n 
A 1 142 PHE 142 190 190 PHE PHE X . n 
A 1 143 LEU 143 191 191 LEU LEU X . n 
A 1 144 ASN 144 192 192 ASN ASN X . n 
A 1 145 SER 145 193 193 SER SER X . n 
A 1 146 GLN 146 194 194 GLN GLN X . n 
A 1 147 ILE 147 195 195 ILE ILE X . n 
A 1 148 TYR 148 196 196 TYR TYR X . n 
A 1 149 LYS 149 197 197 LYS LYS X . n 
A 1 150 SER 150 198 198 SER SER X . n 
A 1 151 PHE 151 199 199 PHE PHE X . n 
A 1 152 VAL 152 200 200 VAL VAL X . n 
A 1 153 GLU 153 201 201 GLU GLU X . n 
A 1 154 SER 154 202 202 SER SER X . n 
A 1 155 THR 155 203 203 THR THR X . n 
A 1 156 ALA 156 204 204 ALA ALA X . n 
A 1 157 GLY 157 205 ?   ?   ?   X . n 
A 1 158 SER 158 206 ?   ?   ?   X . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Structural Genomics Consortium' 
_pdbx_SG_project.initial_of_center     SGC 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1 1  1  HOH HOH X . 
B 2 HOH 2 2  2  HOH HOH X . 
B 2 HOH 3 3  3  HOH HOH X . 
B 2 HOH 4 4  4  HOH HOH X . 
B 2 HOH 5 5  5  HOH HOH X . 
B 2 HOH 6 6  6  HOH HOH X . 
B 2 HOH 7 11 11 HOH HOH X . 
B 2 HOH 8 12 12 HOH HOH X . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2005-06-28 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' Advisory                    
3 3 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined 48.4658 5.3007  -7.2187 -0.1725 0.3462  0.0897  0.0698  0.1618 0.0453  6.1685  6.2426 10.2500 -2.0276 -2.1138 0.7036  
-0.6971 -0.5222 -0.9415 0.4139 0.4455 -0.2212 1.4424  0.3256  0.2516 'X-RAY DIFFRACTION' 
2 ? refined 30.0316 16.7308 -4.1054 -0.2684 -0.1387 -0.2233 -0.0108 0.0712 -0.1004 11.9112 3.3895 5.9635  -1.7568 -2.3381 -0.7215 
-0.3030 -0.7832 -0.3680 0.4076 0.1197 0.2486  -0.1497 -0.0503 0.1833 'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1 1 X 66  A 18  X 80  A 32  ? 'X-RAY DIFFRACTION' ? 
2 1 X 192 A 144 X 204 A 156 ? 'X-RAY DIFFRACTION' ? 
3 2 X 81  A 33  X 191 A 143 ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC refinement       5.2.0005  ? 1 
MOSFLM 'data reduction' .         ? 2 
CCP4   'data scaling'   '(SCALA)' ? 3 
PHASER phasing          .         ? 4 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    LYS 
_pdbx_validate_torsion.auth_asym_id    X 
_pdbx_validate_torsion.auth_seq_id     147 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             83.34 
_pdbx_validate_torsion.psi             3.31 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 X LEU 66  ? CG  ? A LEU 18  CG  
2   1 Y 1 X LEU 66  ? CD1 ? A LEU 18  CD1 
3   1 Y 1 X LEU 66  ? CD2 ? A LEU 18  CD2 
4   1 Y 1 X TYR 67  ? CG  ? A TYR 19  CG  
5   1 Y 1 X TYR 67  ? CD1 ? A TYR 19  CD1 
6   1 Y 1 X TYR 67  ? CD2 ? A TYR 19  CD2 
7   1 Y 1 X TYR 67  ? CE1 ? A TYR 19  CE1 
8   1 Y 1 X TYR 67  ? CE2 ? A TYR 19  CE2 
9   1 Y 1 X TYR 67  ? CZ  ? A TYR 19  CZ  
10  1 Y 1 X TYR 67  ? OH  ? A TYR 19  OH  
11  1 Y 1 X SER 70  ? OG  ? A SER 22  OG  
12  1 Y 1 X MET 71  ? CG  ? A MET 23  CG  
13  1 Y 1 X MET 71  ? SD  ? A MET 23  SD  
14  1 Y 1 X MET 71  ? CE  ? A MET 23  CE  
15  1 Y 1 X GLN 83  ? CG  ? A GLN 35  CG  
16  1 Y 1 X GLN 83  ? CD  ? A GLN 35  CD  
17  1 Y 1 X GLN 83  ? OE1 ? A GLN 35  OE1 
18  1 Y 1 X GLN 83  ? NE2 ? A GLN 35  NE2 
19  1 Y 1 X LYS 87  ? NZ  ? A LYS 39  NZ  
20  1 Y 1 X LYS 90  ? CE  ? A LYS 42  CE  
21  1 Y 1 X LYS 90  ? NZ  ? A LYS 42  NZ  
22  1 Y 1 X GLU 100 ? CG  ? A GLU 52  CG  
23  1 Y 1 X GLU 100 ? CD  ? A GLU 52  CD  
24  1 Y 1 X GLU 100 ? OE1 ? A GLU 52  OE1 
25  1 Y 1 X GLU 100 ? OE2 ? A GLU 52  OE2 
26  1 Y 1 X LYS 122 ? CG  ? A LYS 74  CG  
27  1 Y 1 X LYS 122 ? CD  ? A LYS 74  CD  
28  1 Y 1 X LYS 122 ? CE  ? A LYS 74  CE  
29  1 Y 1 X LYS 122 ? NZ  ? A LYS 74  NZ  
30  1 Y 1 X GLN 124 ? CG  ? A GLN 76  CG  
31  1 Y 1 X GLN 124 ? CD  ? A GLN 76  CD  
32  1 Y 1 X GLN 124 ? OE1 ? A GLN 76  OE1 
33  1 Y 1 X GLN 124 ? NE2 ? A GLN 76  NE2 
34  1 Y 1 X ASN 125 ? CG  ? A ASN 77  CG  
35  1 Y 1 X ASN 125 ? OD1 ? A ASN 77  OD1 
36  1 Y 1 X ASN 125 ? ND2 ? A ASN 77  ND2 
37  1 Y 1 X LYS 126 ? CG  ? A LYS 78  CG  
38  1 Y 1 X LYS 126 ? CD  ? A LYS 78  CD  
39  1 Y 1 X LYS 126 ? CE  ? A LYS 78  CE  
40  1 Y 1 X LYS 126 ? NZ  ? A LYS 78  NZ  
41  1 Y 1 X LYS 127 ? CB  ? A LYS 79  CB  
42  1 Y 1 X LYS 127 ? CG  ? A LYS 79  CG  
43  1 Y 1 X LYS 127 ? CD  ? A LYS 79  CD  
44  1 Y 1 X LYS 127 ? CE  ? A LYS 79  CE  
45  1 Y 1 X LYS 127 ? NZ  ? A LYS 79  NZ  
46  1 Y 1 X GLU 130 ? CG  ? A GLU 82  CG  
47  1 Y 1 X GLU 130 ? CD  ? A GLU 82  CD  
48  1 Y 1 X GLU 130 ? OE1 ? A GLU 82  OE1 
49  1 Y 1 X GLU 130 ? OE2 ? A GLU 82  OE2 
50  1 Y 1 X GLU 131 ? CG  ? A GLU 83  CG  
51  1 Y 1 X GLU 131 ? CD  ? A GLU 83  CD  
52  1 Y 1 X GLU 131 ? OE1 ? A GLU 83  OE1 
53  1 Y 1 X GLU 131 ? OE2 ? A GLU 83  OE2 
54  1 Y 1 X ARG 134 ? CG  ? A ARG 86  CG  
55  1 Y 1 X ARG 134 ? CD  ? A ARG 86  CD  
56  1 Y 1 X ARG 134 ? NE  ? A ARG 86  NE  
57  1 Y 1 X ARG 134 ? CZ  ? A ARG 86  CZ  
58  1 Y 1 X ARG 134 ? NH1 ? A ARG 86  NH1 
59  1 Y 1 X ARG 134 ? NH2 ? A ARG 86  NH2 
60  1 Y 1 X MET 135 ? CG  ? A MET 87  CG  
61  1 Y 1 X MET 135 ? SD  ? A MET 87  SD  
62  1 Y 1 X MET 135 ? CE  ? A MET 87  CE  
63  1 Y 1 X GLU 138 ? CG  ? A GLU 90  CG  
64  1 Y 1 X GLU 138 ? CD  ? A GLU 90  CD  
65  1 Y 1 X GLU 138 ? OE1 ? A GLU 90  OE1 
66  1 Y 1 X GLU 138 ? OE2 ? A GLU 90  OE2 
67  1 Y 1 X LEU 144 ? CB  ? A LEU 96  CB  
68  1 Y 1 X LEU 144 ? CG  ? A LEU 96  CG  
69  1 Y 1 X LEU 144 ? CD1 ? A LEU 96  CD1 
70  1 Y 1 X LEU 144 ? CD2 ? A LEU 96  CD2 
71  1 Y 1 X LYS 147 ? CG  ? A LYS 99  CG  
72  1 Y 1 X LYS 147 ? CD  ? A LYS 99  CD  
73  1 Y 1 X LYS 147 ? CE  ? A LYS 99  CE  
74  1 Y 1 X LYS 147 ? NZ  ? A LYS 99  NZ  
75  1 Y 1 X ASP 152 ? OD1 ? A ASP 104 OD1 
76  1 Y 1 X ASP 152 ? OD2 ? A ASP 104 OD2 
77  1 Y 1 X ARG 154 ? CG  ? A ARG 106 CG  
78  1 Y 1 X ARG 154 ? CD  ? A ARG 106 CD  
79  1 Y 1 X ARG 154 ? NE  ? A ARG 106 NE  
80  1 Y 1 X ARG 154 ? CZ  ? A ARG 106 CZ  
81  1 Y 1 X ARG 154 ? NH1 ? A ARG 106 NH1 
82  1 Y 1 X ARG 154 ? NH2 ? A ARG 106 NH2 
83  1 Y 1 X LEU 164 ? CG  ? A LEU 116 CG  
84  1 Y 1 X LEU 164 ? CD1 ? A LEU 116 CD1 
85  1 Y 1 X LEU 164 ? CD2 ? A LEU 116 CD2 
86  1 Y 1 X ASP 165 ? CG  ? A ASP 117 CG  
87  1 Y 1 X ASP 165 ? OD1 ? A ASP 117 OD1 
88  1 Y 1 X ASP 165 ? OD2 ? A ASP 117 OD2 
89  1 Y 1 X ARG 184 ? NE  ? A ARG 136 NE  
90  1 Y 1 X ARG 184 ? CZ  ? A ARG 136 CZ  
91  1 Y 1 X ARG 184 ? NH1 ? A ARG 136 NH1 
92  1 Y 1 X ARG 184 ? NH2 ? A ARG 136 NH2 
93  1 Y 1 X GLN 194 ? CG  ? A GLN 146 CG  
94  1 Y 1 X GLN 194 ? CD  ? A GLN 146 CD  
95  1 Y 1 X GLN 194 ? OE1 ? A GLN 146 OE1 
96  1 Y 1 X GLN 194 ? NE2 ? A GLN 146 NE2 
97  1 Y 1 X LYS 197 ? CG  ? A LYS 149 CG  
98  1 Y 1 X LYS 197 ? CD  ? A LYS 149 CD  
99  1 Y 1 X LYS 197 ? CE  ? A LYS 149 CE  
100 1 Y 1 X LYS 197 ? NZ  ? A LYS 149 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 X MET 49  ? A MET 1   
2  1 Y 1 X HIS 50  ? A HIS 2   
3  1 Y 1 X HIS 51  ? A HIS 3   
4  1 Y 1 X HIS 52  ? A HIS 4   
5  1 Y 1 X HIS 53  ? A HIS 5   
6  1 Y 1 X HIS 54  ? A HIS 6   
7  1 Y 1 X HIS 55  ? A HIS 7   
8  1 Y 1 X SER 56  ? A SER 8   
9  1 Y 1 X SER 57  ? A SER 9   
10 1 Y 1 X GLY 58  ? A GLY 10  
11 1 Y 1 X VAL 59  ? A VAL 11  
12 1 Y 1 X ASP 60  ? A ASP 12  
13 1 Y 1 X LEU 61  ? A LEU 13  
14 1 Y 1 X GLY 62  ? A GLY 14  
15 1 Y 1 X THR 63  ? A THR 15  
16 1 Y 1 X GLU 64  ? A GLU 16  
17 1 Y 1 X ASN 65  ? A ASN 17  
18 1 Y 1 X SER 145 ? A SER 97  
19 1 Y 1 X GLY 205 ? A GLY 157 
20 1 Y 1 X SER 206 ? A SER 158 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#