data_2A1I
# 
_entry.id   2A1I 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2A1I         
RCSB  RCSB033374   
WWPDB D_1000033374 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2A1I 
_pdbx_database_status.recvd_initial_deposition_date   2005-06-20 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Tsodikov, O.V.'  1 
'Enzlin, J.H.'    2 
'Scharer, O.D.'   3 
'Ellenberger, T.' 4 
# 
_citation.id                        primary 
_citation.title                     
'Crystal structure and DNA binding functions of ERCC1, a subunit of the DNA structure-specific endonuclease XPF-ERCC1.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.Usa 
_citation.journal_volume            102 
_citation.page_first                11236 
_citation.page_last                 11241 
_citation.year                      2005 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16076955 
_citation.pdbx_database_id_DOI      10.1073/pnas.0504341102 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Tsodikov, O.V.'  1 
primary 'Enzlin, J.H.'    2 
primary 'Scharer, O.D.'   3 
primary 'Ellenberger, T.' 4 
# 
_cell.entry_id           2A1I 
_cell.length_a           40.070 
_cell.length_b           50.291 
_cell.length_c           72.216 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2A1I 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA excision repair protein ERCC-1' 16679.209 1   ? ? 'CENTRAL DOMAIN' ? 
2 non-polymer syn 'MERCURY (II) ION'                   200.590   1   ? ? ?                ? 
3 water       nat water                                18.015    130 ? ? ?                ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MGSSHHHHHHSQDPAKSNSIIVSPRQRGNPVLKFVRNVPWEFGDVIPDYVLGQSTCALFLSLRYHNLHPDYIHGRLQSLG
KNFALRVLLVQVDVKDPQQALKELAKMCILADCTLILAWSPEEAGRYLETYKAYEQKPADLLMEKL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGSSHHHHHHSQDPAKSNSIIVSPRQRGNPVLKFVRNVPWEFGDVIPDYVLGQSTCALFLSLRYHNLHPDYIHGRLQSLG
KNFALRVLLVQVDVKDPQQALKELAKMCILADCTLILAWSPEEAGRYLETYKAYEQKPADLLMEKL
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   SER n 
1 4   SER n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  SER n 
1 12  GLN n 
1 13  ASP n 
1 14  PRO n 
1 15  ALA n 
1 16  LYS n 
1 17  SER n 
1 18  ASN n 
1 19  SER n 
1 20  ILE n 
1 21  ILE n 
1 22  VAL n 
1 23  SER n 
1 24  PRO n 
1 25  ARG n 
1 26  GLN n 
1 27  ARG n 
1 28  GLY n 
1 29  ASN n 
1 30  PRO n 
1 31  VAL n 
1 32  LEU n 
1 33  LYS n 
1 34  PHE n 
1 35  VAL n 
1 36  ARG n 
1 37  ASN n 
1 38  VAL n 
1 39  PRO n 
1 40  TRP n 
1 41  GLU n 
1 42  PHE n 
1 43  GLY n 
1 44  ASP n 
1 45  VAL n 
1 46  ILE n 
1 47  PRO n 
1 48  ASP n 
1 49  TYR n 
1 50  VAL n 
1 51  LEU n 
1 52  GLY n 
1 53  GLN n 
1 54  SER n 
1 55  THR n 
1 56  CYS n 
1 57  ALA n 
1 58  LEU n 
1 59  PHE n 
1 60  LEU n 
1 61  SER n 
1 62  LEU n 
1 63  ARG n 
1 64  TYR n 
1 65  HIS n 
1 66  ASN n 
1 67  LEU n 
1 68  HIS n 
1 69  PRO n 
1 70  ASP n 
1 71  TYR n 
1 72  ILE n 
1 73  HIS n 
1 74  GLY n 
1 75  ARG n 
1 76  LEU n 
1 77  GLN n 
1 78  SER n 
1 79  LEU n 
1 80  GLY n 
1 81  LYS n 
1 82  ASN n 
1 83  PHE n 
1 84  ALA n 
1 85  LEU n 
1 86  ARG n 
1 87  VAL n 
1 88  LEU n 
1 89  LEU n 
1 90  VAL n 
1 91  GLN n 
1 92  VAL n 
1 93  ASP n 
1 94  VAL n 
1 95  LYS n 
1 96  ASP n 
1 97  PRO n 
1 98  GLN n 
1 99  GLN n 
1 100 ALA n 
1 101 LEU n 
1 102 LYS n 
1 103 GLU n 
1 104 LEU n 
1 105 ALA n 
1 106 LYS n 
1 107 MET n 
1 108 CYS n 
1 109 ILE n 
1 110 LEU n 
1 111 ALA n 
1 112 ASP n 
1 113 CYS n 
1 114 THR n 
1 115 LEU n 
1 116 ILE n 
1 117 LEU n 
1 118 ALA n 
1 119 TRP n 
1 120 SER n 
1 121 PRO n 
1 122 GLU n 
1 123 GLU n 
1 124 ALA n 
1 125 GLY n 
1 126 ARG n 
1 127 TYR n 
1 128 LEU n 
1 129 GLU n 
1 130 THR n 
1 131 TYR n 
1 132 LYS n 
1 133 ALA n 
1 134 TYR n 
1 135 GLU n 
1 136 GLN n 
1 137 LYS n 
1 138 PRO n 
1 139 ALA n 
1 140 ASP n 
1 141 LEU n 
1 142 LEU n 
1 143 MET n 
1 144 GLU n 
1 145 LYS n 
1 146 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ERCC1 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 (DE3/RIL)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pEt-DUET1 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ERCC1_HUMAN 
_struct_ref.pdbx_db_accession          P07992 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;AKSNSIIVSPRQRGNPVLKFVRNVPWEFGDVIPDYVLGQSTCALFLSLRYHNLHPDYIHGRLQSLGKNFALRVLLVQVDV
KDPQQALKELAKMCILADCTLILAWSPEEAGRYLETYKAYEQKPADLLMEKL
;
_struct_ref.pdbx_align_begin           96 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2A1I 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 15 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 146 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P07992 
_struct_ref_seq.db_align_beg                  96 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  227 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       96 
_struct_ref_seq.pdbx_auth_seq_align_end       227 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2A1I MET A 1  ? UNP P07992 ? ? 'CLONING ARTIFACT' 82 1  
1 2A1I GLY A 2  ? UNP P07992 ? ? 'CLONING ARTIFACT' 83 2  
1 2A1I SER A 3  ? UNP P07992 ? ? 'CLONING ARTIFACT' 84 3  
1 2A1I SER A 4  ? UNP P07992 ? ? 'CLONING ARTIFACT' 85 4  
1 2A1I HIS A 5  ? UNP P07992 ? ? 'EXPRESSION TAG'   86 5  
1 2A1I HIS A 6  ? UNP P07992 ? ? 'EXPRESSION TAG'   87 6  
1 2A1I HIS A 7  ? UNP P07992 ? ? 'EXPRESSION TAG'   88 7  
1 2A1I HIS A 8  ? UNP P07992 ? ? 'EXPRESSION TAG'   89 8  
1 2A1I HIS A 9  ? UNP P07992 ? ? 'EXPRESSION TAG'   90 9  
1 2A1I HIS A 10 ? UNP P07992 ? ? 'EXPRESSION TAG'   91 10 
1 2A1I SER A 11 ? UNP P07992 ? ? 'CLONING ARTIFACT' 92 11 
1 2A1I GLN A 12 ? UNP P07992 ? ? 'CLONING ARTIFACT' 93 12 
1 2A1I ASP A 13 ? UNP P07992 ? ? 'CLONING ARTIFACT' 94 13 
1 2A1I PRO A 14 ? UNP P07992 ? ? 'CLONING ARTIFACT' 95 14 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE            ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE           ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE         ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'    ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE           ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE          ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'    ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE            ? 'C2 H5 N O2'     75.067  
HG  non-polymer         . 'MERCURY (II) ION' ? 'Hg 2'           200.590 
HIS 'L-peptide linking' y HISTIDINE          ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER              ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE         ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE            ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE             ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE         ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE      ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE            ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE             ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE          ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN         ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE           ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE             ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2A1I 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.3 
_exptl_crystal.density_percent_sol   47 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    'MES, PEG 5000 MME, GLYCEROL, pH 6.5, VAPOR DIFFUSION, SITTING DROP,temperature 295K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           116 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2004-11-20 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.00636 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 19-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   19-ID 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.00636 
# 
_reflns.entry_id                     2A1I 
_reflns.observed_criterion_sigma_F   3.0 
_reflns.observed_criterion_sigma_I   3.0 
_reflns.d_resolution_high            1.9 
_reflns.d_resolution_low             50 
_reflns.number_all                   11968 
_reflns.number_obs                   11932 
_reflns.percent_possible_obs         99.7 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.90 
_reflns_shell.d_res_low              1.97 
_reflns_shell.percent_possible_all   99.7 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 2A1I 
_refine.ls_number_reflns_obs                     11309 
_refine.ls_number_reflns_all                     11343 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          3.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             30.00 
_refine.ls_d_res_high                            1.90 
_refine.ls_percent_reflns_obs                    99.57 
_refine.ls_R_factor_obs                          0.20624 
_refine.ls_R_factor_all                          0.21763 
_refine.ls_R_factor_R_work                       0.20415 
_refine.ls_R_factor_R_free                       0.24762 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.9 
_refine.ls_number_reflns_R_free                  586 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.957 
_refine.correlation_coeff_Fo_to_Fc_free          0.933 
_refine.B_iso_mean                               33.183 
_refine.aniso_B[1][1]                            3.42 
_refine.aniso_B[2][2]                            -1.94 
_refine.aniso_B[3][3]                            -1.48 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          SIRAS 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.166 
_refine.pdbx_overall_ESU_R_Free                  0.154 
_refine.overall_SU_ML                            0.130 
_refine.overall_SU_B                             4.539 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1039 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         1 
_refine_hist.number_atoms_solvent             130 
_refine_hist.number_atoms_total               1170 
_refine_hist.d_res_high                       1.90 
_refine_hist.d_res_low                        30.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.018 0.022 ? 1062 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.701 1.976 ? 1442 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   6.298 5.000 ? 128  'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.163 0.200 ? 162  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.007 0.020 ? 797  'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.258 0.200 ? 510  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.237 0.200 ? 101  'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.213 0.200 ? 53   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.189 0.200 ? 19   'X-RAY DIFFRACTION' ? 
r_mcbond_it              0.887 1.500 ? 645  'X-RAY DIFFRACTION' ? 
r_mcangle_it             1.655 2.000 ? 1044 'X-RAY DIFFRACTION' ? 
r_scbond_it              2.583 3.000 ? 417  'X-RAY DIFFRACTION' ? 
r_scangle_it             3.969 4.500 ? 398  'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.90 
_refine_ls_shell.d_res_low                        1.953 
_refine_ls_shell.number_reflns_R_work             786 
_refine_ls_shell.R_factor_R_work                  0.278 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.352 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             50 
_refine_ls_shell.number_reflns_obs                786 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  2A1I 
_struct.title                     'Crystal Structure of the Central Domain of Human ERCC1' 
_struct.pdbx_descriptor           'DNA excision repair protein ERCC-1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2A1I 
_struct_keywords.pdbx_keywords   'DNA BINDING PROTEIN' 
_struct_keywords.text            'ERCC1, XPF, NER, central domain, DNA repair, endonuclease, DNA BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 PRO A 24  ? ARG A 27  ? PRO A 105 ARG A 108 5 ? 4  
HELX_P HELX_P2 2 ASN A 29  ? VAL A 35  ? ASN A 110 VAL A 116 5 ? 7  
HELX_P HELX_P3 3 LEU A 62  ? HIS A 68  ? LEU A 143 HIS A 149 1 ? 7  
HELX_P HELX_P4 4 ASP A 70  ? GLY A 80  ? ASP A 151 GLY A 161 1 ? 11 
HELX_P HELX_P5 5 PRO A 97  ? ASP A 112 ? PRO A 178 ASP A 193 1 ? 16 
HELX_P HELX_P6 6 SER A 120 ? ALA A 133 ? SER A 201 ALA A 214 1 ? 14 
HELX_P HELX_P7 7 ASP A 140 ? LEU A 146 ? ASP A 221 LEU A 227 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? B HG . HG ? ? ? 1_555 A CYS 56 O  ? ? A HG 1 A CYS 137 1_555 ? ? ? ? ? ? ? 3.211 ? 
metalc2 metalc ? ? B HG . HG ? ? ? 1_555 A CYS 56 SG ? ? A HG 1 A CYS 137 1_555 ? ? ? ? ? ? ? 2.659 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   6 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? parallel      
A 5 6 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TRP A 40  ? PHE A 42  ? TRP A 121 PHE A 123 
A 2 ILE A 20  ? VAL A 22  ? ILE A 101 VAL A 103 
A 3 TYR A 49  ? GLY A 52  ? TYR A 130 GLY A 133 
A 4 THR A 55  ? SER A 61  ? THR A 136 SER A 142 
A 5 LEU A 85  ? GLN A 91  ? LEU A 166 GLN A 172 
A 6 THR A 114 ? ALA A 118 ? THR A 195 ALA A 199 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O GLU A 41 ? O GLU A 122 N VAL A 22  ? N VAL A 103 
A 2 3 N ILE A 21 ? N ILE A 102 O VAL A 50  ? O VAL A 131 
A 3 4 N LEU A 51 ? N LEU A 132 O THR A 55  ? O THR A 136 
A 4 5 N LEU A 58 ? N LEU A 139 O LEU A 89  ? O LEU A 170 
A 5 6 N LEU A 88 ? N LEU A 169 O THR A 114 ? O THR A 195 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    3 
_struct_site.details              'BINDING SITE FOR RESIDUE HG A 1' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 3 CYS A 56 ? CYS A 137 . ? 1_555 ? 
2 AC1 3 LEU A 79 ? LEU A 160 . ? 1_555 ? 
3 AC1 3 ARG A 86 ? ARG A 167 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2A1I 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2A1I 
_atom_sites.fract_transf_matrix[1][1]   0.024956 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.019884 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.013847 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
HG 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ASN A 1 18  ? 23.554 38.089 4.053  1.00 29.36  ? 99  ASN A N   1 
ATOM   2    C  CA  . ASN A 1 18  ? 22.124 38.231 4.476  1.00 29.67  ? 99  ASN A CA  1 
ATOM   3    C  C   . ASN A 1 18  ? 21.642 37.198 5.506  1.00 29.09  ? 99  ASN A C   1 
ATOM   4    O  O   . ASN A 1 18  ? 20.804 37.500 6.358  1.00 29.60  ? 99  ASN A O   1 
ATOM   5    C  CB  . ASN A 1 18  ? 21.225 38.161 3.245  1.00 30.16  ? 99  ASN A CB  1 
ATOM   6    C  CG  . ASN A 1 18  ? 19.974 39.034 3.367  1.00 32.41  ? 99  ASN A CG  1 
ATOM   7    O  OD1 . ASN A 1 18  ? 19.584 39.468 4.464  1.00 32.73  ? 99  ASN A OD1 1 
ATOM   8    N  ND2 . ASN A 1 18  ? 19.321 39.274 2.222  1.00 34.34  ? 99  ASN A ND2 1 
ATOM   9    N  N   . SER A 1 19  ? 22.150 35.979 5.429  1.00 27.98  ? 100 SER A N   1 
ATOM   10   C  CA  . SER A 1 19  ? 21.656 34.922 6.309  1.00 27.43  ? 100 SER A CA  1 
ATOM   11   C  C   . SER A 1 19  ? 22.414 34.817 7.623  1.00 26.01  ? 100 SER A C   1 
ATOM   12   O  O   . SER A 1 19  ? 23.602 35.102 7.680  1.00 26.35  ? 100 SER A O   1 
ATOM   13   C  CB  . SER A 1 19  ? 21.680 33.573 5.591  1.00 26.67  ? 100 SER A CB  1 
ATOM   14   O  OG  . SER A 1 19  ? 20.961 33.654 4.376  1.00 29.52  ? 100 SER A OG  1 
ATOM   15   N  N   . ILE A 1 20  ? 21.715 34.406 8.680  1.00 25.07  ? 101 ILE A N   1 
ATOM   16   C  CA  . ILE A 1 20  ? 22.384 33.971 9.921  1.00 23.73  ? 101 ILE A CA  1 
ATOM   17   C  C   . ILE A 1 20  ? 22.947 32.573 9.650  1.00 23.37  ? 101 ILE A C   1 
ATOM   18   O  O   . ILE A 1 20  ? 22.241 31.748 9.072  1.00 22.78  ? 101 ILE A O   1 
ATOM   19   C  CB  . ILE A 1 20  ? 21.386 33.934 11.075 1.00 22.91  ? 101 ILE A CB  1 
ATOM   20   C  CG1 . ILE A 1 20  ? 20.931 35.365 11.409 1.00 23.17  ? 101 ILE A CG1 1 
ATOM   21   C  CG2 . ILE A 1 20  ? 22.017 33.278 12.352 1.00 24.20  ? 101 ILE A CG2 1 
ATOM   22   C  CD1 . ILE A 1 20  ? 19.992 35.426 12.687 1.00 24.75  ? 101 ILE A CD1 1 
ATOM   23   N  N   . ILE A 1 21  ? 24.209 32.318 10.009 1.00 22.51  ? 102 ILE A N   1 
ATOM   24   C  CA  . ILE A 1 21  ? 24.780 30.989 9.781  1.00 23.09  ? 102 ILE A CA  1 
ATOM   25   C  C   . ILE A 1 21  ? 24.777 30.281 11.121 1.00 23.96  ? 102 ILE A C   1 
ATOM   26   O  O   . ILE A 1 21  ? 25.193 30.863 12.115 1.00 24.18  ? 102 ILE A O   1 
ATOM   27   C  CB  . ILE A 1 21  ? 26.199 31.060 9.182  1.00 23.41  ? 102 ILE A CB  1 
ATOM   28   C  CG1 . ILE A 1 21  ? 26.226 32.018 7.970  1.00 24.17  ? 102 ILE A CG1 1 
ATOM   29   C  CG2 . ILE A 1 21  ? 26.709 29.640 8.771  1.00 20.73  ? 102 ILE A CG2 1 
ATOM   30   C  CD1 . ILE A 1 21  ? 25.212 31.662 6.919  1.00 23.26  ? 102 ILE A CD1 1 
ATOM   31   N  N   . VAL A 1 22  ? 24.263 29.052 11.144 1.00 24.02  ? 103 VAL A N   1 
ATOM   32   C  CA  . VAL A 1 22  ? 23.925 28.350 12.393 1.00 23.69  ? 103 VAL A CA  1 
ATOM   33   C  C   . VAL A 1 22  ? 24.756 27.064 12.483 1.00 23.21  ? 103 VAL A C   1 
ATOM   34   O  O   . VAL A 1 22  ? 24.847 26.312 11.527 1.00 24.74  ? 103 VAL A O   1 
ATOM   35   C  CB  . VAL A 1 22  ? 22.403 27.970 12.441 1.00 23.98  ? 103 VAL A CB  1 
ATOM   36   C  CG1 . VAL A 1 22  ? 22.062 27.182 13.749 1.00 23.60  ? 103 VAL A CG1 1 
ATOM   37   C  CG2 . VAL A 1 22  ? 21.528 29.205 12.315 1.00 20.99  ? 103 VAL A CG2 1 
ATOM   38   N  N   . SER A 1 23  ? 25.383 26.834 13.629 1.00 23.02  ? 104 SER A N   1 
ATOM   39   C  CA  . SER A 1 23  ? 26.220 25.647 13.834 1.00 23.22  ? 104 SER A CA  1 
ATOM   40   C  C   . SER A 1 23  ? 25.275 24.459 13.853 1.00 22.83  ? 104 SER A C   1 
ATOM   41   O  O   . SER A 1 23  ? 24.221 24.588 14.463 1.00 23.38  ? 104 SER A O   1 
ATOM   42   C  CB  . SER A 1 23  ? 26.913 25.745 15.206 1.00 23.33  ? 104 SER A CB  1 
ATOM   43   O  OG  . SER A 1 23  ? 27.557 24.522 15.554 1.00 22.48  ? 104 SER A OG  1 
ATOM   44   N  N   . PRO A 1 24  ? 25.629 23.316 13.239 1.00 23.83  ? 105 PRO A N   1 
ATOM   45   C  CA  . PRO A 1 24  ? 24.799 22.102 13.323 1.00 23.99  ? 105 PRO A CA  1 
ATOM   46   C  C   . PRO A 1 24  ? 24.556 21.674 14.775 1.00 24.67  ? 105 PRO A C   1 
ATOM   47   O  O   . PRO A 1 24  ? 23.633 20.904 15.012 1.00 25.31  ? 105 PRO A O   1 
ATOM   48   C  CB  . PRO A 1 24  ? 25.652 21.038 12.597 1.00 23.55  ? 105 PRO A CB  1 
ATOM   49   C  CG  . PRO A 1 24  ? 26.489 21.796 11.722 1.00 24.73  ? 105 PRO A CG  1 
ATOM   50   C  CD  . PRO A 1 24  ? 26.826 23.068 12.418 1.00 22.89  ? 105 PRO A CD  1 
ATOM   51   N  N   . ARG A 1 25  ? 25.341 22.188 15.721 1.00 24.77  ? 106 ARG A N   1 
ATOM   52   C  CA  . ARG A 1 25  ? 25.139 21.859 17.137 1.00 26.16  ? 106 ARG A CA  1 
ATOM   53   C  C   . ARG A 1 25  ? 23.825 22.433 17.654 1.00 25.62  ? 106 ARG A C   1 
ATOM   54   O  O   . ARG A 1 25  ? 23.342 22.061 18.719 1.00 24.73  ? 106 ARG A O   1 
ATOM   55   C  CB  . ARG A 1 25  ? 26.303 22.395 17.977 1.00 27.48  ? 106 ARG A CB  1 
ATOM   56   C  CG  . ARG A 1 25  ? 27.612 21.687 17.664 1.00 31.38  ? 106 ARG A CG  1 
ATOM   57   C  CD  . ARG A 1 25  ? 28.836 22.421 18.163 1.00 39.08  ? 106 ARG A CD  1 
ATOM   58   N  NE  . ARG A 1 25  ? 29.040 22.129 19.574 1.00 43.65  ? 106 ARG A NE  1 
ATOM   59   C  CZ  . ARG A 1 25  ? 30.161 22.339 20.248 1.00 44.41  ? 106 ARG A CZ  1 
ATOM   60   N  NH1 . ARG A 1 25  ? 31.235 22.871 19.649 1.00 44.99  ? 106 ARG A NH1 1 
ATOM   61   N  NH2 . ARG A 1 25  ? 30.194 22.020 21.534 1.00 42.94  ? 106 ARG A NH2 1 
ATOM   62   N  N   . GLN A 1 26  ? 23.293 23.417 16.931 1.00 25.02  ? 107 GLN A N   1 
ATOM   63   C  CA  . GLN A 1 26  ? 22.014 24.009 17.238 1.00 24.57  ? 107 GLN A CA  1 
ATOM   64   C  C   . GLN A 1 26  ? 20.793 23.279 16.683 1.00 24.70  ? 107 GLN A C   1 
ATOM   65   O  O   . GLN A 1 26  ? 19.651 23.704 16.922 1.00 24.68  ? 107 GLN A O   1 
ATOM   66   C  CB  . GLN A 1 26  ? 22.006 25.483 16.766 1.00 24.60  ? 107 GLN A CB  1 
ATOM   67   C  CG  . GLN A 1 26  ? 22.915 26.364 17.539 1.00 24.96  ? 107 GLN A CG  1 
ATOM   68   C  CD  . GLN A 1 26  ? 22.533 26.427 19.043 1.00 27.00  ? 107 GLN A CD  1 
ATOM   69   O  OE1 . GLN A 1 26  ? 21.435 26.892 19.405 1.00 28.64  ? 107 GLN A OE1 1 
ATOM   70   N  NE2 . GLN A 1 26  ? 23.414 25.911 19.885 1.00 28.07  ? 107 GLN A NE2 1 
ATOM   71   N  N   . ARG A 1 27  ? 21.023 22.205 15.931 1.00 24.44  ? 108 ARG A N   1 
ATOM   72   C  CA  . ARG A 1 27  ? 19.955 21.434 15.308 1.00 25.87  ? 108 ARG A CA  1 
ATOM   73   C  C   . ARG A 1 27  ? 18.987 20.897 16.386 1.00 26.39  ? 108 ARG A C   1 
ATOM   74   O  O   . ARG A 1 27  ? 19.422 20.281 17.360 1.00 26.44  ? 108 ARG A O   1 
ATOM   75   C  CB  . ARG A 1 27  ? 20.527 20.264 14.485 1.00 24.88  ? 108 ARG A CB  1 
ATOM   76   C  CG  . ARG A 1 27  ? 19.511 19.640 13.489 1.00 26.73  ? 108 ARG A CG  1 
ATOM   77   C  CD  . ARG A 1 27  ? 20.090 18.393 12.654 1.00 31.74  ? 108 ARG A CD  1 
ATOM   78   N  NE  . ARG A 1 27  ? 20.061 18.638 11.178 1.00 40.16  ? 108 ARG A NE  1 
ATOM   79   C  CZ  . ARG A 1 27  ? 21.118 18.987 10.414 1.00 44.31  ? 108 ARG A CZ  1 
ATOM   80   N  NH1 . ARG A 1 27  ? 22.325 19.109 10.965 1.00 48.41  ? 108 ARG A NH1 1 
ATOM   81   N  NH2 . ARG A 1 27  ? 20.959 19.240 9.119  1.00 45.15  ? 108 ARG A NH2 1 
ATOM   82   N  N   . GLY A 1 28  ? 17.685 21.157 16.227 1.00 25.92  ? 109 GLY A N   1 
ATOM   83   C  CA  . GLY A 1 28  ? 16.736 20.740 17.248 1.00 25.37  ? 109 GLY A CA  1 
ATOM   84   C  C   . GLY A 1 28  ? 16.429 21.818 18.278 1.00 25.41  ? 109 GLY A C   1 
ATOM   85   O  O   . GLY A 1 28  ? 15.493 21.666 19.053 1.00 25.95  ? 109 GLY A O   1 
ATOM   86   N  N   . ASN A 1 29  ? 17.187 22.914 18.298 1.00 24.69  ? 110 ASN A N   1 
ATOM   87   C  CA  . ASN A 1 29  ? 16.904 24.000 19.229 1.00 25.13  ? 110 ASN A CA  1 
ATOM   88   C  C   . ASN A 1 29  ? 15.641 24.725 18.745 1.00 24.81  ? 110 ASN A C   1 
ATOM   89   O  O   . ASN A 1 29  ? 15.617 25.234 17.602 1.00 23.40  ? 110 ASN A O   1 
ATOM   90   C  CB  . ASN A 1 29  ? 18.085 24.994 19.326 1.00 25.31  ? 110 ASN A CB  1 
ATOM   91   C  CG  . ASN A 1 29  ? 17.901 26.028 20.425 1.00 25.38  ? 110 ASN A CG  1 
ATOM   92   O  OD1 . ASN A 1 29  ? 16.799 26.235 20.935 1.00 23.80  ? 110 ASN A OD1 1 
ATOM   93   N  ND2 . ASN A 1 29  ? 18.984 26.712 20.776 1.00 23.12  ? 110 ASN A ND2 1 
ATOM   94   N  N   . PRO A 1 30  ? 14.596 24.751 19.586 1.00 24.79  ? 111 PRO A N   1 
ATOM   95   C  CA  . PRO A 1 30  ? 13.318 25.373 19.204 1.00 24.24  ? 111 PRO A CA  1 
ATOM   96   C  C   . PRO A 1 30  ? 13.469 26.868 18.916 1.00 23.96  ? 111 PRO A C   1 
ATOM   97   O  O   . PRO A 1 30  ? 12.600 27.445 18.279 1.00 23.16  ? 111 PRO A O   1 
ATOM   98   C  CB  . PRO A 1 30  ? 12.420 25.129 20.427 1.00 24.47  ? 111 PRO A CB  1 
ATOM   99   C  CG  . PRO A 1 30  ? 13.398 24.989 21.584 1.00 25.58  ? 111 PRO A CG  1 
ATOM   100  C  CD  . PRO A 1 30  ? 14.558 24.233 20.973 1.00 25.63  ? 111 PRO A CD  1 
ATOM   101  N  N   . VAL A 1 31  ? 14.597 27.468 19.307 1.00 23.98  ? 112 VAL A N   1 
ATOM   102  C  CA  . VAL A 1 31  ? 14.910 28.854 18.936 1.00 24.44  ? 112 VAL A CA  1 
ATOM   103  C  C   . VAL A 1 31  ? 14.780 29.107 17.429 1.00 25.38  ? 112 VAL A C   1 
ATOM   104  O  O   . VAL A 1 31  ? 14.240 30.157 17.002 1.00 26.97  ? 112 VAL A O   1 
ATOM   105  C  CB  . VAL A 1 31  ? 16.331 29.228 19.391 1.00 25.15  ? 112 VAL A CB  1 
ATOM   106  C  CG1 . VAL A 1 31  ? 16.794 30.563 18.706 1.00 23.81  ? 112 VAL A CG1 1 
ATOM   107  C  CG2 . VAL A 1 31  ? 16.316 29.433 20.923 1.00 24.93  ? 112 VAL A CG2 1 
ATOM   108  N  N   . LEU A 1 32  ? 15.231 28.131 16.640 1.00 24.97  ? 113 LEU A N   1 
ATOM   109  C  CA  . LEU A 1 32  ? 15.264 28.233 15.179 1.00 25.58  ? 113 LEU A CA  1 
ATOM   110  C  C   . LEU A 1 32  ? 13.871 28.460 14.563 1.00 27.13  ? 113 LEU A C   1 
ATOM   111  O  O   . LEU A 1 32  ? 13.741 29.125 13.517 1.00 26.87  ? 113 LEU A O   1 
ATOM   112  C  CB  . LEU A 1 32  ? 15.928 26.972 14.572 1.00 25.85  ? 113 LEU A CB  1 
ATOM   113  C  CG  . LEU A 1 32  ? 17.404 26.776 14.985 1.00 24.58  ? 113 LEU A CG  1 
ATOM   114  C  CD1 . LEU A 1 32  ? 17.957 25.422 14.550 1.00 26.60  ? 113 LEU A CD1 1 
ATOM   115  C  CD2 . LEU A 1 32  ? 18.278 27.906 14.467 1.00 27.30  ? 113 LEU A CD2 1 
ATOM   116  N  N   . LYS A 1 33  ? 12.839 27.939 15.219 1.00 26.65  ? 114 LYS A N   1 
ATOM   117  C  CA  . LYS A 1 33  ? 11.459 28.177 14.770 1.00 28.20  ? 114 LYS A CA  1 
ATOM   118  C  C   . LYS A 1 33  ? 11.108 29.660 14.774 1.00 27.54  ? 114 LYS A C   1 
ATOM   119  O  O   . LYS A 1 33  ? 10.234 30.095 14.021 1.00 28.37  ? 114 LYS A O   1 
ATOM   120  C  CB  . LYS A 1 33  ? 10.439 27.405 15.615 1.00 26.79  ? 114 LYS A CB  1 
ATOM   121  C  CG  . LYS A 1 33  ? 10.721 25.917 15.703 1.00 30.07  ? 114 LYS A CG  1 
ATOM   122  C  CD  . LYS A 1 33  ? 9.580  25.160 16.381 1.00 33.06  ? 114 LYS A CD  1 
ATOM   123  C  CE  . LYS A 1 33  ? 9.474  25.546 17.858 1.00 34.25  ? 114 LYS A CE  1 
ATOM   124  N  NZ  . LYS A 1 33  ? 8.510  24.694 18.579 1.00 33.95  ? 114 LYS A NZ  1 
ATOM   125  N  N   . PHE A 1 34  ? 11.781 30.404 15.630 1.00 28.33  ? 115 PHE A N   1 
ATOM   126  C  CA  . PHE A 1 34  ? 11.521 31.812 15.871 1.00 28.81  ? 115 PHE A CA  1 
ATOM   127  C  C   . PHE A 1 34  ? 12.520 32.764 15.183 1.00 29.17  ? 115 PHE A C   1 
ATOM   128  O  O   . PHE A 1 34  ? 12.520 33.967 15.443 1.00 29.51  ? 115 PHE A O   1 
ATOM   129  C  CB  . PHE A 1 34  ? 11.427 32.050 17.396 1.00 28.40  ? 115 PHE A CB  1 
ATOM   130  C  CG  . PHE A 1 34  ? 10.331 31.254 18.024 1.00 28.84  ? 115 PHE A CG  1 
ATOM   131  C  CD1 . PHE A 1 34  ? 10.606 30.063 18.703 1.00 26.70  ? 115 PHE A CD1 1 
ATOM   132  C  CD2 . PHE A 1 34  ? 9.001  31.630 17.828 1.00 28.56  ? 115 PHE A CD2 1 
ATOM   133  C  CE1 . PHE A 1 34  ? 9.546  29.296 19.253 1.00 28.98  ? 115 PHE A CE1 1 
ATOM   134  C  CE2 . PHE A 1 34  ? 7.949  30.862 18.335 1.00 30.61  ? 115 PHE A CE2 1 
ATOM   135  C  CZ  . PHE A 1 34  ? 8.214  29.698 19.045 1.00 30.42  ? 115 PHE A CZ  1 
ATOM   136  N  N   . VAL A 1 35  ? 13.360 32.221 14.311 1.00 28.55  ? 116 VAL A N   1 
ATOM   137  C  CA  . VAL A 1 35  ? 14.212 33.036 13.462 1.00 28.73  ? 116 VAL A CA  1 
ATOM   138  C  C   . VAL A 1 35  ? 13.461 33.065 12.127 1.00 29.98  ? 116 VAL A C   1 
ATOM   139  O  O   . VAL A 1 35  ? 13.619 32.173 11.293 1.00 29.48  ? 116 VAL A O   1 
ATOM   140  C  CB  . VAL A 1 35  ? 15.632 32.436 13.285 1.00 28.82  ? 116 VAL A CB  1 
ATOM   141  C  CG1 . VAL A 1 35  ? 16.446 33.330 12.356 1.00 28.34  ? 116 VAL A CG1 1 
ATOM   142  C  CG2 . VAL A 1 35  ? 16.359 32.294 14.666 1.00 26.82  ? 116 VAL A CG2 1 
ATOM   143  N  N   . ARG A 1 36  ? 12.635 34.092 11.958 1.00 31.58  ? 117 ARG A N   1 
ATOM   144  C  CA  . ARG A 1 36  ? 11.595 34.041 10.946 1.00 33.45  ? 117 ARG A CA  1 
ATOM   145  C  C   . ARG A 1 36  ? 11.655 35.187 9.964  1.00 33.41  ? 117 ARG A C   1 
ATOM   146  O  O   . ARG A 1 36  ? 11.065 35.108 8.876  1.00 33.59  ? 117 ARG A O   1 
ATOM   147  C  CB  . ARG A 1 36  ? 10.242 34.043 11.636 1.00 34.29  ? 117 ARG A CB  1 
ATOM   148  C  CG  . ARG A 1 36  ? 9.701  32.661 11.984 1.00 36.83  ? 117 ARG A CG  1 
ATOM   149  C  CD  . ARG A 1 36  ? 8.552  32.731 12.981 1.00 38.51  ? 117 ARG A CD  1 
ATOM   150  N  NE  . ARG A 1 36  ? 8.923  33.602 14.098 1.00 39.04  ? 117 ARG A NE  1 
ATOM   151  C  CZ  . ARG A 1 36  ? 8.109  33.982 15.074 1.00 40.75  ? 117 ARG A CZ  1 
ATOM   152  N  NH1 . ARG A 1 36  ? 6.834  33.587 15.081 1.00 41.35  ? 117 ARG A NH1 1 
ATOM   153  N  NH2 . ARG A 1 36  ? 8.569  34.777 16.040 1.00 40.07  ? 117 ARG A NH2 1 
ATOM   154  N  N   . ASN A 1 37  ? 12.344 36.259 10.344 1.00 33.61  ? 118 ASN A N   1 
ATOM   155  C  CA  . ASN A 1 37  ? 12.338 37.476 9.532  1.00 34.38  ? 118 ASN A CA  1 
ATOM   156  C  C   . ASN A 1 37  ? 13.687 37.763 8.836  1.00 33.62  ? 118 ASN A C   1 
ATOM   157  O  O   . ASN A 1 37  ? 13.857 38.791 8.180  1.00 33.49  ? 118 ASN A O   1 
ATOM   158  C  CB  . ASN A 1 37  ? 11.811 38.665 10.347 1.00 34.81  ? 118 ASN A CB  1 
ATOM   159  C  CG  . ASN A 1 37  ? 10.488 38.345 11.080 1.00 37.69  ? 118 ASN A CG  1 
ATOM   160  O  OD1 . ASN A 1 37  ? 9.399  38.314 10.473 1.00 37.12  ? 118 ASN A OD1 1 
ATOM   161  N  ND2 . ASN A 1 37  ? 10.589 38.085 12.392 1.00 41.37  ? 118 ASN A ND2 1 
ATOM   162  N  N   . VAL A 1 38  ? 14.631 36.839 8.996  1.00 31.85  ? 119 VAL A N   1 
ATOM   163  C  CA  . VAL A 1 38  ? 15.888 36.845 8.255  1.00 30.57  ? 119 VAL A CA  1 
ATOM   164  C  C   . VAL A 1 38  ? 16.154 35.399 7.873  1.00 29.17  ? 119 VAL A C   1 
ATOM   165  O  O   . VAL A 1 38  ? 15.782 34.505 8.624  1.00 29.17  ? 119 VAL A O   1 
ATOM   166  C  CB  . VAL A 1 38  ? 17.065 37.387 9.096  1.00 29.58  ? 119 VAL A CB  1 
ATOM   167  C  CG1 . VAL A 1 38  ? 16.912 38.869 9.348  1.00 32.56  ? 119 VAL A CG1 1 
ATOM   168  C  CG2 . VAL A 1 38  ? 17.157 36.681 10.428 1.00 31.10  ? 119 VAL A CG2 1 
ATOM   169  N  N   . PRO A 1 39  ? 16.768 35.143 6.724  1.00 28.60  ? 120 PRO A N   1 
ATOM   170  C  CA  . PRO A 1 39  ? 17.131 33.763 6.388  1.00 28.42  ? 120 PRO A CA  1 
ATOM   171  C  C   . PRO A 1 39  ? 18.183 33.221 7.374  1.00 27.63  ? 120 PRO A C   1 
ATOM   172  O  O   . PRO A 1 39  ? 18.921 34.000 7.999  1.00 27.46  ? 120 PRO A O   1 
ATOM   173  C  CB  . PRO A 1 39  ? 17.661 33.851 4.946  1.00 28.53  ? 120 PRO A CB  1 
ATOM   174  C  CG  . PRO A 1 39  ? 17.935 35.308 4.698  1.00 29.82  ? 120 PRO A CG  1 
ATOM   175  C  CD  . PRO A 1 39  ? 17.100 36.103 5.652  1.00 29.24  ? 120 PRO A CD  1 
ATOM   176  N  N   . TRP A 1 40  ? 18.189 31.901 7.550  1.00 27.45  ? 121 TRP A N   1 
ATOM   177  C  CA  . TRP A 1 40  ? 19.255 31.208 8.255  1.00 26.55  ? 121 TRP A CA  1 
ATOM   178  C  C   . TRP A 1 40  ? 19.534 29.871 7.574  1.00 26.96  ? 121 TRP A C   1 
ATOM   179  O  O   . TRP A 1 40  ? 18.661 29.289 6.907  1.00 26.79  ? 121 TRP A O   1 
ATOM   180  C  CB  . TRP A 1 40  ? 18.946 31.039 9.764  1.00 26.05  ? 121 TRP A CB  1 
ATOM   181  C  CG  . TRP A 1 40  ? 17.850 30.037 10.099 1.00 27.38  ? 121 TRP A CG  1 
ATOM   182  C  CD1 . TRP A 1 40  ? 16.511 30.300 10.287 1.00 26.64  ? 121 TRP A CD1 1 
ATOM   183  C  CD2 . TRP A 1 40  ? 17.998 28.610 10.290 1.00 28.65  ? 121 TRP A CD2 1 
ATOM   184  N  NE1 . TRP A 1 40  ? 15.828 29.140 10.580 1.00 28.66  ? 121 TRP A NE1 1 
ATOM   185  C  CE2 . TRP A 1 40  ? 16.710 28.085 10.579 1.00 27.64  ? 121 TRP A CE2 1 
ATOM   186  C  CE3 . TRP A 1 40  ? 19.087 27.717 10.223 1.00 27.51  ? 121 TRP A CE3 1 
ATOM   187  C  CZ2 . TRP A 1 40  ? 16.488 26.726 10.828 1.00 26.28  ? 121 TRP A CZ2 1 
ATOM   188  C  CZ3 . TRP A 1 40  ? 18.861 26.354 10.484 1.00 27.68  ? 121 TRP A CZ3 1 
ATOM   189  C  CH2 . TRP A 1 40  ? 17.564 25.882 10.778 1.00 26.58  ? 121 TRP A CH2 1 
ATOM   190  N  N   . GLU A 1 41  ? 20.756 29.380 7.745  1.00 26.63  ? 122 GLU A N   1 
ATOM   191  C  CA  . GLU A 1 41  ? 21.138 28.083 7.221  1.00 26.34  ? 122 GLU A CA  1 
ATOM   192  C  C   . GLU A 1 41  ? 22.191 27.558 8.158  1.00 26.34  ? 122 GLU A C   1 
ATOM   193  O  O   . GLU A 1 41  ? 22.888 28.346 8.784  1.00 25.70  ? 122 GLU A O   1 
ATOM   194  C  CB  . GLU A 1 41  ? 21.703 28.185 5.791  1.00 26.89  ? 122 GLU A CB  1 
ATOM   195  C  CG  . GLU A 1 41  ? 22.852 29.177 5.642  1.00 28.67  ? 122 GLU A CG  1 
ATOM   196  C  CD  . GLU A 1 41  ? 23.288 29.333 4.208  1.00 32.86  ? 122 GLU A CD  1 
ATOM   197  O  OE1 . GLU A 1 41  ? 24.477 29.073 3.891  1.00 32.68  ? 122 GLU A OE1 1 
ATOM   198  O  OE2 . GLU A 1 41  ? 22.418 29.690 3.389  1.00 35.72  ? 122 GLU A OE2 1 
ATOM   199  N  N   . PHE A 1 42  ? 22.285 26.234 8.267  1.00 25.90  ? 123 PHE A N   1 
ATOM   200  C  CA  . PHE A 1 42  ? 23.414 25.591 8.938  1.00 26.63  ? 123 PHE A CA  1 
ATOM   201  C  C   . PHE A 1 42  ? 24.704 25.816 8.154  1.00 26.47  ? 123 PHE A C   1 
ATOM   202  O  O   . PHE A 1 42  ? 24.695 25.868 6.929  1.00 26.82  ? 123 PHE A O   1 
ATOM   203  C  CB  . PHE A 1 42  ? 23.175 24.070 9.116  1.00 25.29  ? 123 PHE A CB  1 
ATOM   204  C  CG  . PHE A 1 42  ? 22.034 23.744 10.059 1.00 27.17  ? 123 PHE A CG  1 
ATOM   205  C  CD1 . PHE A 1 42  ? 22.110 24.071 11.415 1.00 27.06  ? 123 PHE A CD1 1 
ATOM   206  C  CD2 . PHE A 1 42  ? 20.880 23.102 9.584  1.00 29.02  ? 123 PHE A CD2 1 
ATOM   207  C  CE1 . PHE A 1 42  ? 21.054 23.782 12.283 1.00 27.67  ? 123 PHE A CE1 1 
ATOM   208  C  CE2 . PHE A 1 42  ? 19.824 22.807 10.442 1.00 27.92  ? 123 PHE A CE2 1 
ATOM   209  C  CZ  . PHE A 1 42  ? 19.902 23.142 11.778 1.00 25.53  ? 123 PHE A CZ  1 
ATOM   210  N  N   . GLY A 1 43  ? 25.809 25.943 8.873  1.00 26.70  ? 124 GLY A N   1 
ATOM   211  C  CA  . GLY A 1 43  ? 27.124 26.021 8.257  1.00 26.49  ? 124 GLY A CA  1 
ATOM   212  C  C   . GLY A 1 43  ? 28.188 25.600 9.255  1.00 26.81  ? 124 GLY A C   1 
ATOM   213  O  O   . GLY A 1 43  ? 27.919 25.499 10.465 1.00 25.50  ? 124 GLY A O   1 
ATOM   214  N  N   . ASP A 1 44  ? 29.401 25.374 8.757  1.00 26.53  ? 125 ASP A N   1 
ATOM   215  C  CA  . ASP A 1 44  ? 30.507 24.908 9.593  1.00 27.26  ? 125 ASP A CA  1 
ATOM   216  C  C   . ASP A 1 44  ? 31.215 26.076 10.275 1.00 27.03  ? 125 ASP A C   1 
ATOM   217  O  O   . ASP A 1 44  ? 32.254 26.539 9.814  1.00 27.03  ? 125 ASP A O   1 
ATOM   218  C  CB  . ASP A 1 44  ? 31.503 24.076 8.769  1.00 28.11  ? 125 ASP A CB  1 
ATOM   219  C  CG  . ASP A 1 44  ? 32.656 23.552 9.616  1.00 30.13  ? 125 ASP A CG  1 
ATOM   220  O  OD1 . ASP A 1 44  ? 32.456 23.393 10.850 1.00 31.25  ? 125 ASP A OD1 1 
ATOM   221  O  OD2 . ASP A 1 44  ? 33.794 23.304 9.146  1.00 30.55  ? 125 ASP A OD2 1 
ATOM   222  N  N   . VAL A 1 45  ? 30.655 26.510 11.404 1.00 27.25  ? 126 VAL A N   1 
ATOM   223  C  CA  . VAL A 1 45  ? 31.075 27.718 12.102 1.00 26.74  ? 126 VAL A CA  1 
ATOM   224  C  C   . VAL A 1 45  ? 31.388 27.423 13.568 1.00 27.45  ? 126 VAL A C   1 
ATOM   225  O  O   . VAL A 1 45  ? 30.882 26.446 14.122 1.00 27.17  ? 126 VAL A O   1 
ATOM   226  C  CB  . VAL A 1 45  ? 30.021 28.859 11.990 1.00 25.72  ? 126 VAL A CB  1 
ATOM   227  C  CG1 . VAL A 1 45  ? 29.879 29.286 10.541 1.00 26.00  ? 126 VAL A CG1 1 
ATOM   228  C  CG2 . VAL A 1 45  ? 28.631 28.491 12.640 1.00 23.97  ? 126 VAL A CG2 1 
ATOM   229  N  N   . ILE A 1 46  ? 32.233 28.262 14.173 1.00 27.15  ? 127 ILE A N   1 
ATOM   230  C  CA  . ILE A 1 46  ? 32.696 28.022 15.538 1.00 27.81  ? 127 ILE A CA  1 
ATOM   231  C  C   . ILE A 1 46  ? 31.663 28.429 16.581 1.00 27.02  ? 127 ILE A C   1 
ATOM   232  O  O   . ILE A 1 46  ? 31.343 27.620 17.434 1.00 27.67  ? 127 ILE A O   1 
ATOM   233  C  CB  . ILE A 1 46  ? 34.135 28.590 15.798 1.00 28.47  ? 127 ILE A CB  1 
ATOM   234  C  CG1 . ILE A 1 46  ? 35.163 27.803 14.985 1.00 28.71  ? 127 ILE A CG1 1 
ATOM   235  C  CG2 . ILE A 1 46  ? 34.500 28.529 17.276 1.00 30.34  ? 127 ILE A CG2 1 
ATOM   236  C  CD1 . ILE A 1 46  ? 36.551 28.437 14.960 1.00 29.97  ? 127 ILE A CD1 1 
ATOM   237  N  N   . PRO A 1 47  ? 31.116 29.647 16.511 1.00 26.27  ? 128 PRO A N   1 
ATOM   238  C  CA  . PRO A 1 47  ? 30.009 30.028 17.403 1.00 25.87  ? 128 PRO A CA  1 
ATOM   239  C  C   . PRO A 1 47  ? 28.725 29.267 17.051 1.00 25.62  ? 128 PRO A C   1 
ATOM   240  O  O   . PRO A 1 47  ? 28.732 28.506 16.062 1.00 25.75  ? 128 PRO A O   1 
ATOM   241  C  CB  . PRO A 1 47  ? 29.823 31.532 17.167 1.00 24.40  ? 128 PRO A CB  1 
ATOM   242  C  CG  . PRO A 1 47  ? 30.711 31.899 15.997 1.00 27.29  ? 128 PRO A CG  1 
ATOM   243  C  CD  . PRO A 1 47  ? 31.556 30.753 15.632 1.00 25.61  ? 128 PRO A CD  1 
ATOM   244  N  N   . ASP A 1 48  ? 27.685 29.403 17.879 1.00 24.57  ? 129 ASP A N   1 
ATOM   245  C  CA  . ASP A 1 48  ? 26.403 28.815 17.564 1.00 24.65  ? 129 ASP A CA  1 
ATOM   246  C  C   . ASP A 1 48  ? 25.676 29.594 16.477 1.00 23.62  ? 129 ASP A C   1 
ATOM   247  O  O   . ASP A 1 48  ? 25.007 28.974 15.680 1.00 24.04  ? 129 ASP A O   1 
ATOM   248  C  CB  . ASP A 1 48  ? 25.523 28.716 18.806 1.00 24.11  ? 129 ASP A CB  1 
ATOM   249  C  CG  . ASP A 1 48  ? 26.069 27.715 19.799 1.00 26.65  ? 129 ASP A CG  1 
ATOM   250  O  OD1 . ASP A 1 48  ? 26.539 26.632 19.353 1.00 26.51  ? 129 ASP A OD1 1 
ATOM   251  O  OD2 . ASP A 1 48  ? 26.092 27.969 21.019 1.00 25.80  ? 129 ASP A OD2 1 
ATOM   252  N  N   . TYR A 1 49  ? 25.833 30.929 16.448 1.00 24.07  ? 130 TYR A N   1 
ATOM   253  C  CA  . TYR A 1 49  ? 25.233 31.786 15.403 1.00 23.92  ? 130 TYR A CA  1 
ATOM   254  C  C   . TYR A 1 49  ? 26.208 32.841 14.948 1.00 24.58  ? 130 TYR A C   1 
ATOM   255  O  O   . TYR A 1 49  ? 26.790 33.557 15.775 1.00 23.17  ? 130 TYR A O   1 
ATOM   256  C  CB  . TYR A 1 49  ? 23.946 32.476 15.897 1.00 23.09  ? 130 TYR A CB  1 
ATOM   257  C  CG  . TYR A 1 49  ? 22.928 31.484 16.413 1.00 25.01  ? 130 TYR A CG  1 
ATOM   258  C  CD1 . TYR A 1 49  ? 21.934 30.998 15.566 1.00 22.94  ? 130 TYR A CD1 1 
ATOM   259  C  CD2 . TYR A 1 49  ? 23.000 30.984 17.722 1.00 25.54  ? 130 TYR A CD2 1 
ATOM   260  C  CE1 . TYR A 1 49  ? 21.028 30.062 16.001 1.00 25.87  ? 130 TYR A CE1 1 
ATOM   261  C  CE2 . TYR A 1 49  ? 22.075 30.001 18.178 1.00 26.35  ? 130 TYR A CE2 1 
ATOM   262  C  CZ  . TYR A 1 49  ? 21.104 29.554 17.295 1.00 24.80  ? 130 TYR A CZ  1 
ATOM   263  O  OH  . TYR A 1 49  ? 20.175 28.626 17.692 1.00 26.33  ? 130 TYR A OH  1 
ATOM   264  N  N   . VAL A 1 50  ? 26.388 32.946 13.632 1.00 24.33  ? 131 VAL A N   1 
ATOM   265  C  CA  . VAL A 1 50  ? 27.180 34.035 13.100 1.00 25.21  ? 131 VAL A CA  1 
ATOM   266  C  C   . VAL A 1 50  ? 26.185 35.073 12.591 1.00 25.84  ? 131 VAL A C   1 
ATOM   267  O  O   . VAL A 1 50  ? 25.296 34.764 11.767 1.00 26.38  ? 131 VAL A O   1 
ATOM   268  C  CB  . VAL A 1 50  ? 28.111 33.568 11.986 1.00 25.22  ? 131 VAL A CB  1 
ATOM   269  C  CG1 . VAL A 1 50  ? 28.909 34.724 11.462 1.00 25.72  ? 131 VAL A CG1 1 
ATOM   270  C  CG2 . VAL A 1 50  ? 29.033 32.483 12.519 1.00 25.62  ? 131 VAL A CG2 1 
ATOM   271  N  N   . LEU A 1 51  ? 26.338 36.296 13.079 1.00 25.37  ? 132 LEU A N   1 
ATOM   272  C  CA  . LEU A 1 51  ? 25.302 37.304 12.957 1.00 26.87  ? 132 LEU A CA  1 
ATOM   273  C  C   . LEU A 1 51  ? 25.821 38.489 12.156 1.00 28.06  ? 132 LEU A C   1 
ATOM   274  O  O   . LEU A 1 51  ? 25.213 39.553 12.149 1.00 27.19  ? 132 LEU A O   1 
ATOM   275  C  CB  . LEU A 1 51  ? 24.866 37.778 14.354 1.00 27.10  ? 132 LEU A CB  1 
ATOM   276  C  CG  . LEU A 1 51  ? 23.706 37.130 15.159 1.00 29.17  ? 132 LEU A CG  1 
ATOM   277  C  CD1 . LEU A 1 51  ? 23.072 35.890 14.648 1.00 27.91  ? 132 LEU A CD1 1 
ATOM   278  C  CD2 . LEU A 1 51  ? 23.996 37.007 16.690 1.00 30.64  ? 132 LEU A CD2 1 
ATOM   279  N  N   . GLY A 1 52  ? 26.967 38.285 11.521 1.00 29.20  ? 133 GLY A N   1 
ATOM   280  C  CA  . GLY A 1 52  ? 27.654 39.293 10.743 1.00 30.24  ? 133 GLY A CA  1 
ATOM   281  C  C   . GLY A 1 52  ? 29.142 38.980 10.699 1.00 30.98  ? 133 GLY A C   1 
ATOM   282  O  O   . GLY A 1 52  ? 29.593 38.003 11.314 1.00 30.05  ? 133 GLY A O   1 
ATOM   283  N  N   . GLN A 1 53  ? 29.898 39.829 9.991  1.00 31.03  ? 134 GLN A N   1 
ATOM   284  C  CA  . GLN A 1 53  ? 31.339 39.646 9.792  1.00 32.05  ? 134 GLN A CA  1 
ATOM   285  C  C   . GLN A 1 53  ? 32.178 39.419 11.073 1.00 32.11  ? 134 GLN A C   1 
ATOM   286  O  O   . GLN A 1 53  ? 33.062 38.542 11.096 1.00 32.90  ? 134 GLN A O   1 
ATOM   287  C  CB  . GLN A 1 53  ? 31.905 40.803 8.947  1.00 32.29  ? 134 GLN A CB  1 
ATOM   288  C  CG  . GLN A 1 53  ? 33.407 40.758 8.781  1.00 34.22  ? 134 GLN A CG  1 
ATOM   289  C  CD  . GLN A 1 53  ? 33.873 41.123 7.381  1.00 37.79  ? 134 GLN A CD  1 
ATOM   290  O  OE1 . GLN A 1 53  ? 33.080 41.552 6.531  1.00 38.33  ? 134 GLN A OE1 1 
ATOM   291  N  NE2 . GLN A 1 53  ? 35.172 40.962 7.137  1.00 38.56  ? 134 GLN A NE2 1 
ATOM   292  N  N   . SER A 1 54  ? 31.893 40.192 12.125 1.00 31.74  ? 135 SER A N   1 
ATOM   293  C  CA  . SER A 1 54  ? 32.564 40.064 13.424 1.00 31.06  ? 135 SER A CA  1 
ATOM   294  C  C   . SER A 1 54  ? 31.583 40.105 14.609 1.00 30.70  ? 135 SER A C   1 
ATOM   295  O  O   . SER A 1 54  ? 31.890 40.696 15.645 1.00 30.44  ? 135 SER A O   1 
ATOM   296  C  CB  . SER A 1 54  ? 33.617 41.175 13.585 1.00 31.97  ? 135 SER A CB  1 
ATOM   297  O  OG  . SER A 1 54  ? 34.878 40.658 13.995 1.00 33.25  ? 135 SER A OG  1 
ATOM   298  N  N   . THR A 1 55  ? 30.403 39.507 14.439 1.00 29.54  ? 136 THR A N   1 
ATOM   299  C  CA  . THR A 1 55  ? 29.434 39.337 15.528 1.00 28.79  ? 136 THR A CA  1 
ATOM   300  C  C   . THR A 1 55  ? 28.976 37.916 15.550 1.00 28.35  ? 136 THR A C   1 
ATOM   301  O  O   . THR A 1 55  ? 28.682 37.341 14.497 1.00 27.42  ? 136 THR A O   1 
ATOM   302  C  CB  . THR A 1 55  ? 28.198 40.195 15.322 1.00 28.82  ? 136 THR A CB  1 
ATOM   303  O  OG1 . THR A 1 55  ? 28.603 41.552 15.197 1.00 31.18  ? 136 THR A OG1 1 
ATOM   304  C  CG2 . THR A 1 55  ? 27.330 40.207 16.584 1.00 29.26  ? 136 THR A CG2 1 
ATOM   305  N  N   . CYS A 1 56  ? 28.850 37.367 16.751 1.00 26.45  ? 137 CYS A N   1 
ATOM   306  C  CA  . CYS A 1 56  ? 28.375 36.010 16.883 1.00 26.15  ? 137 CYS A CA  1 
ATOM   307  C  C   . CYS A 1 56  ? 27.774 35.802 18.267 1.00 25.32  ? 137 CYS A C   1 
ATOM   308  O  O   . CYS A 1 56  ? 27.997 36.603 19.166 1.00 23.67  ? 137 CYS A O   1 
ATOM   309  C  CB  . CYS A 1 56  ? 29.561 35.068 16.680 1.00 26.72  ? 137 CYS A CB  1 
ATOM   310  S  SG  . CYS A 1 56  ? 30.775 35.154 18.014 1.00 29.67  ? 137 CYS A SG  1 
ATOM   311  N  N   . ALA A 1 57  ? 27.032 34.711 18.414 1.00 24.32  ? 138 ALA A N   1 
ATOM   312  C  CA  . ALA A 1 57  ? 26.369 34.377 19.658 1.00 24.21  ? 138 ALA A CA  1 
ATOM   313  C  C   . ALA A 1 57  ? 26.619 32.918 20.006 1.00 23.53  ? 138 ALA A C   1 
ATOM   314  O  O   . ALA A 1 57  ? 26.749 32.071 19.116 1.00 23.17  ? 138 ALA A O   1 
ATOM   315  C  CB  . ALA A 1 57  ? 24.846 34.616 19.561 1.00 23.66  ? 138 ALA A CB  1 
ATOM   316  N  N   . LEU A 1 58  ? 26.651 32.647 21.313 1.00 23.35  ? 139 LEU A N   1 
ATOM   317  C  CA  . LEU A 1 58  ? 26.529 31.295 21.832 1.00 24.05  ? 139 LEU A CA  1 
ATOM   318  C  C   . LEU A 1 58  ? 25.171 31.231 22.528 1.00 24.87  ? 139 LEU A C   1 
ATOM   319  O  O   . LEU A 1 58  ? 24.711 32.213 23.082 1.00 26.72  ? 139 LEU A O   1 
ATOM   320  C  CB  . LEU A 1 58  ? 27.580 31.003 22.882 1.00 24.41  ? 139 LEU A CB  1 
ATOM   321  C  CG  . LEU A 1 58  ? 28.941 30.415 22.526 1.00 28.02  ? 139 LEU A CG  1 
ATOM   322  C  CD1 . LEU A 1 58  ? 29.117 29.823 21.111 1.00 24.89  ? 139 LEU A CD1 1 
ATOM   323  C  CD2 . LEU A 1 58  ? 30.118 31.265 23.002 1.00 30.13  ? 139 LEU A CD2 1 
ATOM   324  N  N   . PHE A 1 59  ? 24.552 30.065 22.484 1.00 24.50  ? 140 PHE A N   1 
ATOM   325  C  CA  . PHE A 1 59  ? 23.274 29.861 23.157 1.00 25.73  ? 140 PHE A CA  1 
ATOM   326  C  C   . PHE A 1 59  ? 23.540 28.947 24.341 1.00 25.79  ? 140 PHE A C   1 
ATOM   327  O  O   . PHE A 1 59  ? 24.300 27.951 24.221 1.00 25.75  ? 140 PHE A O   1 
ATOM   328  C  CB  . PHE A 1 59  ? 22.300 29.151 22.234 1.00 25.62  ? 140 PHE A CB  1 
ATOM   329  C  CG  . PHE A 1 59  ? 20.982 28.794 22.914 1.00 27.44  ? 140 PHE A CG  1 
ATOM   330  C  CD1 . PHE A 1 59  ? 19.994 29.724 23.023 1.00 30.09  ? 140 PHE A CD1 1 
ATOM   331  C  CD2 . PHE A 1 59  ? 20.793 27.526 23.486 1.00 24.34  ? 140 PHE A CD2 1 
ATOM   332  C  CE1 . PHE A 1 59  ? 18.767 29.417 23.713 1.00 25.21  ? 140 PHE A CE1 1 
ATOM   333  C  CE2 . PHE A 1 59  ? 19.593 27.186 24.145 1.00 29.83  ? 140 PHE A CE2 1 
ATOM   334  C  CZ  . PHE A 1 59  ? 18.574 28.143 24.234 1.00 26.62  ? 140 PHE A CZ  1 
ATOM   335  N  N   . LEU A 1 60  ? 22.894 29.254 25.467 1.00 25.37  ? 141 LEU A N   1 
ATOM   336  C  CA  . LEU A 1 60  ? 22.994 28.350 26.595 1.00 24.84  ? 141 LEU A CA  1 
ATOM   337  C  C   . LEU A 1 60  ? 21.685 28.277 27.390 1.00 25.50  ? 141 LEU A C   1 
ATOM   338  O  O   . LEU A 1 60  ? 21.228 29.266 27.946 1.00 26.56  ? 141 LEU A O   1 
ATOM   339  C  CB  . LEU A 1 60  ? 24.170 28.787 27.508 1.00 24.98  ? 141 LEU A CB  1 
ATOM   340  C  CG  . LEU A 1 60  ? 24.432 27.890 28.728 1.00 23.31  ? 141 LEU A CG  1 
ATOM   341  C  CD1 . LEU A 1 60  ? 25.053 26.482 28.383 1.00 22.41  ? 141 LEU A CD1 1 
ATOM   342  C  CD2 . LEU A 1 60  ? 25.351 28.671 29.663 1.00 24.80  ? 141 LEU A CD2 1 
ATOM   343  N  N   . SER A 1 61  ? 21.127 27.085 27.489 1.00 24.03  ? 142 SER A N   1 
ATOM   344  C  CA  . SER A 1 61  ? 20.000 26.872 28.370 1.00 24.17  ? 142 SER A CA  1 
ATOM   345  C  C   . SER A 1 61  ? 20.515 26.656 29.798 1.00 24.03  ? 142 SER A C   1 
ATOM   346  O  O   . SER A 1 61  ? 21.436 25.904 30.013 1.00 22.20  ? 142 SER A O   1 
ATOM   347  C  CB  . SER A 1 61  ? 19.235 25.625 27.875 1.00 24.25  ? 142 SER A CB  1 
ATOM   348  O  OG  . SER A 1 61  ? 18.762 24.904 28.987 1.00 23.79  ? 142 SER A OG  1 
ATOM   349  N  N   . LEU A 1 62  ? 19.888 27.279 30.795 1.00 23.99  ? 143 LEU A N   1 
ATOM   350  C  CA  . LEU A 1 62  ? 20.331 27.050 32.174 1.00 24.13  ? 143 LEU A CA  1 
ATOM   351  C  C   . LEU A 1 62  ? 20.161 25.601 32.663 1.00 24.18  ? 143 LEU A C   1 
ATOM   352  O  O   . LEU A 1 62  ? 20.956 25.104 33.477 1.00 24.74  ? 143 LEU A O   1 
ATOM   353  C  CB  . LEU A 1 62  ? 19.624 28.016 33.144 1.00 23.21  ? 143 LEU A CB  1 
ATOM   354  C  CG  . LEU A 1 62  ? 20.055 29.474 33.087 1.00 24.64  ? 143 LEU A CG  1 
ATOM   355  C  CD1 . LEU A 1 62  ? 19.419 30.218 34.277 1.00 26.02  ? 143 LEU A CD1 1 
ATOM   356  C  CD2 . LEU A 1 62  ? 21.625 29.641 33.158 1.00 24.18  ? 143 LEU A CD2 1 
ATOM   357  N  N   . ARG A 1 63  ? 19.135 24.914 32.172 1.00 24.14  ? 144 ARG A N   1 
ATOM   358  C  CA  . ARG A 1 63  ? 18.976 23.517 32.480 1.00 24.02  ? 144 ARG A CA  1 
ATOM   359  C  C   . ARG A 1 63  ? 20.192 22.723 31.944 1.00 24.17  ? 144 ARG A C   1 
ATOM   360  O  O   . ARG A 1 63  ? 20.727 21.850 32.621 1.00 23.68  ? 144 ARG A O   1 
ATOM   361  C  CB  . ARG A 1 63  ? 17.688 23.018 31.852 1.00 24.38  ? 144 ARG A CB  1 
ATOM   362  C  CG  . ARG A 1 63  ? 17.375 21.556 32.062 1.00 26.63  ? 144 ARG A CG  1 
ATOM   363  C  CD  . ARG A 1 63  ? 16.251 21.061 31.148 1.00 30.79  ? 144 ARG A CD  1 
ATOM   364  N  NE  . ARG A 1 63  ? 16.632 21.322 29.765 1.00 33.21  ? 144 ARG A NE  1 
ATOM   365  C  CZ  . ARG A 1 63  ? 17.371 20.509 29.033 1.00 35.33  ? 144 ARG A CZ  1 
ATOM   366  N  NH1 . ARG A 1 63  ? 17.755 19.343 29.533 1.00 33.00  ? 144 ARG A NH1 1 
ATOM   367  N  NH2 . ARG A 1 63  ? 17.742 20.875 27.804 1.00 36.15  ? 144 ARG A NH2 1 
ATOM   368  N  N   . TYR A 1 64  ? 20.579 23.019 30.707 1.00 23.75  ? 145 TYR A N   1 
ATOM   369  C  CA  . TYR A 1 64  ? 21.720 22.355 30.072 1.00 24.24  ? 145 TYR A CA  1 
ATOM   370  C  C   . TYR A 1 64  ? 23.017 22.699 30.823 1.00 23.31  ? 145 TYR A C   1 
ATOM   371  O  O   . TYR A 1 64  ? 23.861 21.829 31.080 1.00 23.81  ? 145 TYR A O   1 
ATOM   372  C  CB  . TYR A 1 64  ? 21.816 22.783 28.602 1.00 23.72  ? 145 TYR A CB  1 
ATOM   373  C  CG  . TYR A 1 64  ? 22.874 22.009 27.873 1.00 25.37  ? 145 TYR A CG  1 
ATOM   374  C  CD1 . TYR A 1 64  ? 22.553 20.830 27.184 1.00 25.52  ? 145 TYR A CD1 1 
ATOM   375  C  CD2 . TYR A 1 64  ? 24.200 22.446 27.881 1.00 25.88  ? 145 TYR A CD2 1 
ATOM   376  C  CE1 . TYR A 1 64  ? 23.553 20.081 26.519 1.00 28.81  ? 145 TYR A CE1 1 
ATOM   377  C  CE2 . TYR A 1 64  ? 25.199 21.724 27.217 1.00 27.68  ? 145 TYR A CE2 1 
ATOM   378  C  CZ  . TYR A 1 64  ? 24.875 20.548 26.535 1.00 28.71  ? 145 TYR A CZ  1 
ATOM   379  O  OH  . TYR A 1 64  ? 25.878 19.847 25.910 1.00 27.97  ? 145 TYR A OH  1 
ATOM   380  N  N   . HIS A 1 65  ? 23.155 23.962 31.204 1.00 23.90  ? 146 HIS A N   1 
ATOM   381  C  CA  . HIS A 1 65  ? 24.337 24.409 31.973 1.00 25.40  ? 146 HIS A CA  1 
ATOM   382  C  C   . HIS A 1 65  ? 24.506 23.647 33.305 1.00 25.87  ? 146 HIS A C   1 
ATOM   383  O  O   . HIS A 1 65  ? 25.632 23.294 33.685 1.00 26.03  ? 146 HIS A O   1 
ATOM   384  C  CB  . HIS A 1 65  ? 24.274 25.939 32.149 1.00 24.85  ? 146 HIS A CB  1 
ATOM   385  C  CG  . HIS A 1 65  ? 25.346 26.508 33.036 1.00 26.06  ? 146 HIS A CG  1 
ATOM   386  N  ND1 . HIS A 1 65  ? 26.670 26.598 32.650 1.00 23.94  ? 146 HIS A ND1 1 
ATOM   387  C  CD2 . HIS A 1 65  ? 25.270 27.082 34.260 1.00 25.32  ? 146 HIS A CD2 1 
ATOM   388  C  CE1 . HIS A 1 65  ? 27.372 27.158 33.623 1.00 28.43  ? 146 HIS A CE1 1 
ATOM   389  N  NE2 . HIS A 1 65  ? 26.546 27.467 34.610 1.00 24.90  ? 146 HIS A NE2 1 
ATOM   390  N  N   . ASN A 1 66  ? 23.400 23.359 33.996 1.00 26.70  ? 147 ASN A N   1 
ATOM   391  C  CA  . ASN A 1 66  ? 23.422 22.569 35.257 1.00 26.70  ? 147 ASN A CA  1 
ATOM   392  C  C   . ASN A 1 66  ? 23.879 21.144 35.045 1.00 26.09  ? 147 ASN A C   1 
ATOM   393  O  O   . ASN A 1 66  ? 24.588 20.568 35.868 1.00 26.16  ? 147 ASN A O   1 
ATOM   394  C  CB  . ASN A 1 66  ? 22.018 22.540 35.893 1.00 27.63  ? 147 ASN A CB  1 
ATOM   395  C  CG  . ASN A 1 66  ? 21.906 21.574 37.107 1.00 29.97  ? 147 ASN A CG  1 
ATOM   396  O  OD1 . ASN A 1 66  ? 21.286 20.500 37.021 1.00 33.48  ? 147 ASN A OD1 1 
ATOM   397  N  ND2 . ASN A 1 66  ? 22.501 21.962 38.237 1.00 32.04  ? 147 ASN A ND2 1 
ATOM   398  N  N   . LEU A 1 67  ? 23.436 20.572 33.932 1.00 26.02  ? 148 LEU A N   1 
ATOM   399  C  CA  . LEU A 1 67  ? 23.723 19.195 33.574 1.00 25.56  ? 148 LEU A CA  1 
ATOM   400  C  C   . LEU A 1 67  ? 25.169 19.068 33.093 1.00 24.98  ? 148 LEU A C   1 
ATOM   401  O  O   . LEU A 1 67  ? 25.802 18.068 33.324 1.00 24.93  ? 148 LEU A O   1 
ATOM   402  C  CB  . LEU A 1 67  ? 22.752 18.736 32.479 1.00 26.13  ? 148 LEU A CB  1 
ATOM   403  C  CG  . LEU A 1 67  ? 21.599 17.745 32.710 1.00 28.23  ? 148 LEU A CG  1 
ATOM   404  C  CD1 . LEU A 1 67  ? 21.217 17.537 34.177 1.00 31.14  ? 148 LEU A CD1 1 
ATOM   405  C  CD2 . LEU A 1 67  ? 20.382 18.129 31.862 1.00 30.13  ? 148 LEU A CD2 1 
ATOM   406  N  N   . HIS A 1 68  ? 25.693 20.116 32.456 1.00 25.17  ? 149 HIS A N   1 
ATOM   407  C  CA  . HIS A 1 68  ? 27.035 20.088 31.879 1.00 25.38  ? 149 HIS A CA  1 
ATOM   408  C  C   . HIS A 1 68  ? 27.785 21.345 32.331 1.00 25.27  ? 149 HIS A C   1 
ATOM   409  O  O   . HIS A 1 68  ? 28.014 22.262 31.547 1.00 23.07  ? 149 HIS A O   1 
ATOM   410  C  CB  . HIS A 1 68  ? 26.954 19.990 30.336 1.00 25.32  ? 149 HIS A CB  1 
ATOM   411  C  CG  . HIS A 1 68  ? 26.149 18.817 29.844 1.00 27.47  ? 149 HIS A CG  1 
ATOM   412  N  ND1 . HIS A 1 68  ? 24.843 18.935 29.409 1.00 30.07  ? 149 HIS A ND1 1 
ATOM   413  C  CD2 . HIS A 1 68  ? 26.473 17.509 29.708 1.00 29.56  ? 149 HIS A CD2 1 
ATOM   414  C  CE1 . HIS A 1 68  ? 24.397 17.750 29.027 1.00 29.00  ? 149 HIS A CE1 1 
ATOM   415  N  NE2 . HIS A 1 68  ? 25.366 16.863 29.206 1.00 32.41  ? 149 HIS A NE2 1 
ATOM   416  N  N   . PRO A 1 69  ? 28.156 21.410 33.610 1.00 26.20  ? 150 PRO A N   1 
ATOM   417  C  CA  . PRO A 1 69  ? 28.732 22.645 34.157 1.00 27.02  ? 150 PRO A CA  1 
ATOM   418  C  C   . PRO A 1 69  ? 30.049 23.109 33.509 1.00 27.52  ? 150 PRO A C   1 
ATOM   419  O  O   . PRO A 1 69  ? 30.350 24.301 33.615 1.00 28.65  ? 150 PRO A O   1 
ATOM   420  C  CB  . PRO A 1 69  ? 28.937 22.321 35.640 1.00 26.22  ? 150 PRO A CB  1 
ATOM   421  C  CG  . PRO A 1 69  ? 28.968 20.856 35.703 1.00 27.73  ? 150 PRO A CG  1 
ATOM   422  C  CD  . PRO A 1 69  ? 28.050 20.356 34.631 1.00 26.59  ? 150 PRO A CD  1 
ATOM   423  N  N   . ASP A 1 70  ? 30.799 22.235 32.845 1.00 27.49  ? 151 ASP A N   1 
ATOM   424  C  CA  . ASP A 1 70  ? 32.033 22.709 32.215 1.00 28.06  ? 151 ASP A CA  1 
ATOM   425  C  C   . ASP A 1 70  ? 31.883 23.171 30.770 1.00 27.89  ? 151 ASP A C   1 
ATOM   426  O  O   . ASP A 1 70  ? 32.832 23.707 30.174 1.00 28.03  ? 151 ASP A O   1 
ATOM   427  C  CB  . ASP A 1 70  ? 33.126 21.684 32.345 1.00 29.24  ? 151 ASP A CB  1 
ATOM   428  C  CG  . ASP A 1 70  ? 33.663 21.621 33.742 1.00 31.52  ? 151 ASP A CG  1 
ATOM   429  O  OD1 . ASP A 1 70  ? 33.847 22.698 34.360 1.00 35.49  ? 151 ASP A OD1 1 
ATOM   430  O  OD2 . ASP A 1 70  ? 33.922 20.548 34.308 1.00 35.77  ? 151 ASP A OD2 1 
ATOM   431  N  N   . TYR A 1 71  ? 30.683 22.981 30.226 1.00 25.56  ? 152 TYR A N   1 
ATOM   432  C  CA  . TYR A 1 71  ? 30.453 23.183 28.803 1.00 24.55  ? 152 TYR A CA  1 
ATOM   433  C  C   . TYR A 1 71  ? 30.725 24.610 28.325 1.00 23.52  ? 152 TYR A C   1 
ATOM   434  O  O   . TYR A 1 71  ? 31.461 24.808 27.368 1.00 23.10  ? 152 TYR A O   1 
ATOM   435  C  CB  . TYR A 1 71  ? 29.033 22.757 28.414 1.00 24.37  ? 152 TYR A CB  1 
ATOM   436  C  CG  . TYR A 1 71  ? 28.656 23.239 27.037 1.00 26.33  ? 152 TYR A CG  1 
ATOM   437  C  CD1 . TYR A 1 71  ? 29.102 22.585 25.888 1.00 28.97  ? 152 TYR A CD1 1 
ATOM   438  C  CD2 . TYR A 1 71  ? 27.895 24.388 26.889 1.00 27.84  ? 152 TYR A CD2 1 
ATOM   439  C  CE1 . TYR A 1 71  ? 28.740 23.056 24.618 1.00 31.05  ? 152 TYR A CE1 1 
ATOM   440  C  CE2 . TYR A 1 71  ? 27.532 24.861 25.651 1.00 30.16  ? 152 TYR A CE2 1 
ATOM   441  C  CZ  . TYR A 1 71  ? 27.973 24.213 24.524 1.00 29.71  ? 152 TYR A CZ  1 
ATOM   442  O  OH  . TYR A 1 71  ? 27.552 24.731 23.324 1.00 33.27  ? 152 TYR A OH  1 
ATOM   443  N  N   . ILE A 1 72  ? 30.124 25.602 28.967 1.00 23.16  ? 153 ILE A N   1 
ATOM   444  C  CA  . ILE A 1 72  ? 30.196 26.948 28.407 1.00 24.43  ? 153 ILE A CA  1 
ATOM   445  C  C   . ILE A 1 72  ? 31.573 27.629 28.501 1.00 24.87  ? 153 ILE A C   1 
ATOM   446  O  O   . ILE A 1 72  ? 31.916 28.403 27.616 1.00 25.75  ? 153 ILE A O   1 
ATOM   447  C  CB  . ILE A 1 72  ? 29.015 27.874 28.863 1.00 23.38  ? 153 ILE A CB  1 
ATOM   448  C  CG1 . ILE A 1 72  ? 28.951 29.091 27.952 1.00 24.88  ? 153 ILE A CG1 1 
ATOM   449  C  CG2 . ILE A 1 72  ? 29.202 28.320 30.329 1.00 23.73  ? 153 ILE A CG2 1 
ATOM   450  C  CD1 . ILE A 1 72  ? 28.507 28.782 26.523 1.00 26.18  ? 153 ILE A CD1 1 
ATOM   451  N  N   . HIS A 1 73  ? 32.334 27.362 29.558 1.00 25.65  ? 154 HIS A N   1 
ATOM   452  C  CA  . HIS A 1 73  ? 33.676 27.920 29.711 1.00 27.22  ? 154 HIS A CA  1 
ATOM   453  C  C   . HIS A 1 73  ? 34.545 27.491 28.518 1.00 27.27  ? 154 HIS A C   1 
ATOM   454  O  O   . HIS A 1 73  ? 35.187 28.320 27.882 1.00 27.46  ? 154 HIS A O   1 
ATOM   455  C  CB  . HIS A 1 73  ? 34.284 27.462 31.052 1.00 28.13  ? 154 HIS A CB  1 
ATOM   456  C  CG  . HIS A 1 73  ? 35.693 27.930 31.290 1.00 30.73  ? 154 HIS A CG  1 
ATOM   457  N  ND1 . HIS A 1 73  ? 35.992 29.187 31.781 1.00 33.93  ? 154 HIS A ND1 1 
ATOM   458  C  CD2 . HIS A 1 73  ? 36.882 27.307 31.105 1.00 34.03  ? 154 HIS A CD2 1 
ATOM   459  C  CE1 . HIS A 1 73  ? 37.308 29.310 31.898 1.00 35.29  ? 154 HIS A CE1 1 
ATOM   460  N  NE2 . HIS A 1 73  ? 37.869 28.185 31.493 1.00 34.87  ? 154 HIS A NE2 1 
ATOM   461  N  N   . GLY A 1 74  ? 34.530 26.201 28.200 1.00 27.24  ? 155 GLY A N   1 
ATOM   462  C  CA  . GLY A 1 74  ? 35.270 25.671 27.057 1.00 27.70  ? 155 GLY A CA  1 
ATOM   463  C  C   . GLY A 1 74  ? 34.789 26.258 25.736 1.00 27.30  ? 155 GLY A C   1 
ATOM   464  O  O   . GLY A 1 74  ? 35.572 26.601 24.857 1.00 25.35  ? 155 GLY A O   1 
ATOM   465  N  N   . ARG A 1 75  ? 33.475 26.388 25.588 1.00 27.37  ? 156 ARG A N   1 
ATOM   466  C  CA  . ARG A 1 75  ? 32.927 27.033 24.415 1.00 29.00  ? 156 ARG A CA  1 
ATOM   467  C  C   . ARG A 1 75  ? 33.378 28.494 24.236 1.00 30.52  ? 156 ARG A C   1 
ATOM   468  O  O   . ARG A 1 75  ? 33.835 28.901 23.161 1.00 30.79  ? 156 ARG A O   1 
ATOM   469  C  CB  . ARG A 1 75  ? 31.410 26.980 24.473 1.00 29.01  ? 156 ARG A CB  1 
ATOM   470  C  CG  . ARG A 1 75  ? 30.830 27.073 23.177 1.00 29.54  ? 156 ARG A CG  1 
ATOM   471  C  CD  . ARG A 1 75  ? 31.126 25.865 22.263 1.00 31.09  ? 156 ARG A CD  1 
ATOM   472  N  NE  . ARG A 1 75  ? 30.821 26.349 20.934 1.00 31.27  ? 156 ARG A NE  1 
ATOM   473  C  CZ  . ARG A 1 75  ? 29.622 26.308 20.398 1.00 32.66  ? 156 ARG A CZ  1 
ATOM   474  N  NH1 . ARG A 1 75  ? 28.614 25.718 21.046 1.00 33.31  ? 156 ARG A NH1 1 
ATOM   475  N  NH2 . ARG A 1 75  ? 29.442 26.790 19.182 1.00 34.14  ? 156 ARG A NH2 1 
ATOM   476  N  N   . LEU A 1 76  ? 33.253 29.281 25.291 1.00 31.86  ? 157 LEU A N   1 
ATOM   477  C  CA  . LEU A 1 76  ? 33.651 30.665 25.227 1.00 34.51  ? 157 LEU A CA  1 
ATOM   478  C  C   . LEU A 1 76  ? 35.143 30.733 24.919 1.00 35.67  ? 157 LEU A C   1 
ATOM   479  O  O   . LEU A 1 76  ? 35.578 31.571 24.140 1.00 36.46  ? 157 LEU A O   1 
ATOM   480  C  CB  . LEU A 1 76  ? 33.382 31.339 26.557 1.00 34.90  ? 157 LEU A CB  1 
ATOM   481  C  CG  . LEU A 1 76  ? 32.237 32.325 26.663 1.00 38.09  ? 157 LEU A CG  1 
ATOM   482  C  CD1 . LEU A 1 76  ? 32.303 32.978 28.040 1.00 37.26  ? 157 LEU A CD1 1 
ATOM   483  C  CD2 . LEU A 1 76  ? 32.230 33.376 25.520 1.00 38.38  ? 157 LEU A CD2 1 
ATOM   484  N  N   . GLN A 1 77  ? 35.913 29.832 25.519 1.00 37.15  ? 158 GLN A N   1 
ATOM   485  C  CA  . GLN A 1 77  ? 37.369 29.806 25.321 1.00 38.91  ? 158 GLN A CA  1 
ATOM   486  C  C   . GLN A 1 77  ? 37.810 29.382 23.919 1.00 39.64  ? 158 GLN A C   1 
ATOM   487  O  O   . GLN A 1 77  ? 38.819 29.887 23.391 1.00 39.51  ? 158 GLN A O   1 
ATOM   488  C  CB  . GLN A 1 77  ? 38.041 28.909 26.363 1.00 39.27  ? 158 GLN A CB  1 
ATOM   489  C  CG  . GLN A 1 77  ? 37.909 29.404 27.804 1.00 41.55  ? 158 GLN A CG  1 
ATOM   490  C  CD  . GLN A 1 77  ? 38.352 30.844 27.980 1.00 43.80  ? 158 GLN A CD  1 
ATOM   491  O  OE1 . GLN A 1 77  ? 37.544 31.774 27.851 1.00 44.26  ? 158 GLN A OE1 1 
ATOM   492  N  NE2 . GLN A 1 77  ? 39.630 31.033 28.275 1.00 42.63  ? 158 GLN A NE2 1 
ATOM   493  N  N   . SER A 1 78  ? 37.081 28.442 23.325 1.00 40.44  ? 159 SER A N   1 
ATOM   494  C  CA  . SER A 1 78  ? 37.407 27.995 21.973 1.00 41.80  ? 159 SER A CA  1 
ATOM   495  C  C   . SER A 1 78  ? 37.029 29.080 20.970 1.00 41.80  ? 159 SER A C   1 
ATOM   496  O  O   . SER A 1 78  ? 37.610 29.178 19.889 1.00 42.25  ? 159 SER A O   1 
ATOM   497  C  CB  . SER A 1 78  ? 36.744 26.652 21.648 1.00 41.89  ? 159 SER A CB  1 
ATOM   498  O  OG  . SER A 1 78  ? 35.525 26.829 20.940 1.00 43.71  ? 159 SER A OG  1 
ATOM   499  N  N   . LEU A 1 79  ? 36.078 29.917 21.369 1.00 42.47  ? 160 LEU A N   1 
ATOM   500  C  CA  . LEU A 1 79  ? 35.648 31.052 20.573 1.00 42.54  ? 160 LEU A CA  1 
ATOM   501  C  C   . LEU A 1 79  ? 36.756 32.087 20.420 1.00 42.91  ? 160 LEU A C   1 
ATOM   502  O  O   . LEU A 1 79  ? 37.067 32.509 19.311 1.00 42.99  ? 160 LEU A O   1 
ATOM   503  C  CB  . LEU A 1 79  ? 34.419 31.686 21.215 1.00 42.63  ? 160 LEU A CB  1 
ATOM   504  C  CG  . LEU A 1 79  ? 33.721 32.759 20.404 1.00 42.58  ? 160 LEU A CG  1 
ATOM   505  C  CD1 . LEU A 1 79  ? 33.321 32.218 19.034 1.00 42.41  ? 160 LEU A CD1 1 
ATOM   506  C  CD2 . LEU A 1 79  ? 32.505 33.239 21.187 1.00 41.37  ? 160 LEU A CD2 1 
ATOM   507  N  N   . GLY A 1 80  ? 37.353 32.478 21.540 1.00 43.35  ? 161 GLY A N   1 
ATOM   508  C  CA  . GLY A 1 80  ? 38.392 33.491 21.551 1.00 43.99  ? 161 GLY A CA  1 
ATOM   509  C  C   . GLY A 1 80  ? 37.882 34.852 21.116 1.00 44.45  ? 161 GLY A C   1 
ATOM   510  O  O   . GLY A 1 80  ? 36.720 35.197 21.356 1.00 43.86  ? 161 GLY A O   1 
ATOM   511  N  N   . LYS A 1 81  ? 38.741 35.605 20.435 1.00 44.62  ? 162 LYS A N   1 
ATOM   512  C  CA  . LYS A 1 81  ? 38.485 37.014 20.143 1.00 45.59  ? 162 LYS A CA  1 
ATOM   513  C  C   . LYS A 1 81  ? 38.334 37.360 18.648 1.00 45.66  ? 162 LYS A C   1 
ATOM   514  O  O   . LYS A 1 81  ? 38.504 38.526 18.251 1.00 46.09  ? 162 LYS A O   1 
ATOM   515  C  CB  . LYS A 1 81  ? 39.597 37.868 20.772 1.00 45.86  ? 162 LYS A CB  1 
ATOM   516  C  CG  . LYS A 1 81  ? 39.094 38.884 21.782 1.00 47.19  ? 162 LYS A CG  1 
ATOM   517  C  CD  . LYS A 1 81  ? 39.330 38.419 23.209 1.00 47.64  ? 162 LYS A CD  1 
ATOM   518  C  CE  . LYS A 1 81  ? 38.856 39.481 24.199 1.00 47.72  ? 162 LYS A CE  1 
ATOM   519  N  NZ  . LYS A 1 81  ? 38.872 38.952 25.580 1.00 47.75  ? 162 LYS A NZ  1 
ATOM   520  N  N   . ASN A 1 82  ? 38.015 36.359 17.827 1.00 45.52  ? 163 ASN A N   1 
ATOM   521  C  CA  . ASN A 1 82  ? 37.935 36.540 16.365 1.00 45.10  ? 163 ASN A CA  1 
ATOM   522  C  C   . ASN A 1 82  ? 36.818 37.503 15.967 1.00 44.16  ? 163 ASN A C   1 
ATOM   523  O  O   . ASN A 1 82  ? 37.030 38.402 15.134 1.00 43.91  ? 163 ASN A O   1 
ATOM   524  C  CB  . ASN A 1 82  ? 37.764 35.193 15.647 1.00 45.31  ? 163 ASN A CB  1 
ATOM   525  C  CG  . ASN A 1 82  ? 38.788 34.168 16.091 1.00 45.90  ? 163 ASN A CG  1 
ATOM   526  O  OD1 . ASN A 1 82  ? 39.965 34.250 15.725 1.00 45.34  ? 163 ASN A OD1 1 
ATOM   527  N  ND2 . ASN A 1 82  ? 38.349 33.206 16.900 1.00 46.01  ? 163 ASN A ND2 1 
ATOM   528  N  N   . PHE A 1 83  ? 35.648 37.298 16.583 1.00 42.51  ? 164 PHE A N   1 
ATOM   529  C  CA  . PHE A 1 83  ? 34.482 38.165 16.440 1.00 41.18  ? 164 PHE A CA  1 
ATOM   530  C  C   . PHE A 1 83  ? 34.599 39.365 17.408 1.00 40.20  ? 164 PHE A C   1 
ATOM   531  O  O   . PHE A 1 83  ? 34.892 39.178 18.596 1.00 40.33  ? 164 PHE A O   1 
ATOM   532  C  CB  . PHE A 1 83  ? 33.158 37.391 16.738 1.00 41.49  ? 164 PHE A CB  1 
ATOM   533  C  CG  . PHE A 1 83  ? 32.901 36.173 15.837 1.00 40.96  ? 164 PHE A CG  1 
ATOM   534  C  CD1 . PHE A 1 83  ? 33.326 34.881 16.203 1.00 41.54  ? 164 PHE A CD1 1 
ATOM   535  C  CD2 . PHE A 1 83  ? 32.198 36.304 14.641 1.00 42.05  ? 164 PHE A CD2 1 
ATOM   536  C  CE1 . PHE A 1 83  ? 33.090 33.754 15.376 1.00 42.66  ? 164 PHE A CE1 1 
ATOM   537  C  CE2 . PHE A 1 83  ? 31.957 35.178 13.805 1.00 41.70  ? 164 PHE A CE2 1 
ATOM   538  C  CZ  . PHE A 1 83  ? 32.401 33.902 14.182 1.00 42.60  ? 164 PHE A CZ  1 
ATOM   539  N  N   . ALA A 1 84  ? 34.363 40.576 16.893 1.00 38.44  ? 165 ALA A N   1 
ATOM   540  C  CA  . ALA A 1 84  ? 34.385 41.815 17.687 1.00 36.94  ? 165 ALA A CA  1 
ATOM   541  C  C   . ALA A 1 84  ? 33.323 41.886 18.791 1.00 35.81  ? 165 ALA A C   1 
ATOM   542  O  O   . ALA A 1 84  ? 33.631 42.272 19.930 1.00 35.49  ? 165 ALA A O   1 
ATOM   543  C  CB  . ALA A 1 84  ? 34.254 43.024 16.778 1.00 37.27  ? 165 ALA A CB  1 
ATOM   544  N  N   . LEU A 1 85  ? 32.087 41.523 18.426 1.00 33.19  ? 166 LEU A N   1 
ATOM   545  C  CA  . LEU A 1 85  ? 30.930 41.500 19.323 1.00 31.35  ? 166 LEU A CA  1 
ATOM   546  C  C   . LEU A 1 85  ? 30.513 40.046 19.581 1.00 30.06  ? 166 LEU A C   1 
ATOM   547  O  O   . LEU A 1 85  ? 30.058 39.364 18.652 1.00 28.21  ? 166 LEU A O   1 
ATOM   548  C  CB  . LEU A 1 85  ? 29.773 42.251 18.653 1.00 31.09  ? 166 LEU A CB  1 
ATOM   549  C  CG  . LEU A 1 85  ? 28.677 43.018 19.408 1.00 32.97  ? 166 LEU A CG  1 
ATOM   550  C  CD1 . LEU A 1 85  ? 27.368 43.127 18.623 1.00 30.04  ? 166 LEU A CD1 1 
ATOM   551  C  CD2 . LEU A 1 85  ? 28.418 42.535 20.820 1.00 32.18  ? 166 LEU A CD2 1 
ATOM   552  N  N   . ARG A 1 86  ? 30.664 39.592 20.830 1.00 28.98  ? 167 ARG A N   1 
ATOM   553  C  CA  . ARG A 1 86  ? 30.324 38.231 21.237 1.00 29.71  ? 167 ARG A CA  1 
ATOM   554  C  C   . ARG A 1 86  ? 29.166 38.347 22.232 1.00 29.59  ? 167 ARG A C   1 
ATOM   555  O  O   . ARG A 1 86  ? 29.203 39.213 23.114 1.00 30.10  ? 167 ARG A O   1 
ATOM   556  C  CB  . ARG A 1 86  ? 31.508 37.492 21.883 1.00 29.14  ? 167 ARG A CB  1 
ATOM   557  C  CG  . ARG A 1 86  ? 32.802 37.323 21.027 1.00 31.95  ? 167 ARG A CG  1 
ATOM   558  C  CD  . ARG A 1 86  ? 34.122 37.395 21.859 1.00 33.85  ? 167 ARG A CD  1 
ATOM   559  N  NE  . ARG A 1 86  ? 34.773 38.672 21.595 1.00 42.02  ? 167 ARG A NE  1 
ATOM   560  C  CZ  . ARG A 1 86  ? 35.392 39.441 22.477 1.00 41.86  ? 167 ARG A CZ  1 
ATOM   561  N  NH1 . ARG A 1 86  ? 35.524 39.089 23.751 1.00 42.76  ? 167 ARG A NH1 1 
ATOM   562  N  NH2 . ARG A 1 86  ? 35.898 40.584 22.064 1.00 45.38  ? 167 ARG A NH2 1 
ATOM   563  N  N   . VAL A 1 87  ? 28.159 37.494 22.049 1.00 28.58  ? 168 VAL A N   1 
ATOM   564  C  CA  . VAL A 1 87  ? 26.876 37.556 22.784 1.00 28.12  ? 168 VAL A CA  1 
ATOM   565  C  C   . VAL A 1 87  ? 26.605 36.164 23.327 1.00 27.21  ? 168 VAL A C   1 
ATOM   566  O  O   . VAL A 1 87  ? 26.597 35.188 22.580 1.00 26.77  ? 168 VAL A O   1 
ATOM   567  C  CB  . VAL A 1 87  ? 25.703 37.985 21.857 1.00 27.61  ? 168 VAL A CB  1 
ATOM   568  C  CG1 . VAL A 1 87  ? 24.354 37.975 22.605 1.00 29.04  ? 168 VAL A CG1 1 
ATOM   569  C  CG2 . VAL A 1 87  ? 25.974 39.394 21.256 1.00 26.13  ? 168 VAL A CG2 1 
ATOM   570  N  N   . LEU A 1 88  ? 26.409 36.071 24.637 1.00 26.59  ? 169 LEU A N   1 
ATOM   571  C  CA  . LEU A 1 88  ? 25.946 34.825 25.247 1.00 27.00  ? 169 LEU A CA  1 
ATOM   572  C  C   . LEU A 1 88  ? 24.491 34.996 25.511 1.00 26.06  ? 169 LEU A C   1 
ATOM   573  O  O   . LEU A 1 88  ? 24.081 35.826 26.307 1.00 25.82  ? 169 LEU A O   1 
ATOM   574  C  CB  . LEU A 1 88  ? 26.602 34.585 26.613 1.00 26.67  ? 169 LEU A CB  1 
ATOM   575  C  CG  . LEU A 1 88  ? 26.821 33.173 27.163 1.00 32.54  ? 169 LEU A CG  1 
ATOM   576  C  CD1 . LEU A 1 88  ? 26.710 33.059 28.739 1.00 31.13  ? 169 LEU A CD1 1 
ATOM   577  C  CD2 . LEU A 1 88  ? 26.304 31.957 26.377 1.00 29.12  ? 169 LEU A CD2 1 
ATOM   578  N  N   . LEU A 1 89  ? 23.707 34.168 24.851 1.00 27.17  ? 170 LEU A N   1 
ATOM   579  C  CA  . LEU A 1 89  ? 22.271 34.255 24.974 1.00 27.94  ? 170 LEU A CA  1 
ATOM   580  C  C   . LEU A 1 89  ? 21.867 33.116 25.887 1.00 27.10  ? 170 LEU A C   1 
ATOM   581  O  O   . LEU A 1 89  ? 21.971 31.930 25.526 1.00 27.25  ? 170 LEU A O   1 
ATOM   582  C  CB  . LEU A 1 89  ? 21.699 34.116 23.564 1.00 28.43  ? 170 LEU A CB  1 
ATOM   583  C  CG  . LEU A 1 89  ? 20.252 34.243 23.174 1.00 34.04  ? 170 LEU A CG  1 
ATOM   584  C  CD1 . LEU A 1 89  ? 19.634 35.515 23.770 1.00 37.18  ? 170 LEU A CD1 1 
ATOM   585  C  CD2 . LEU A 1 89  ? 20.262 34.288 21.623 1.00 35.29  ? 170 LEU A CD2 1 
ATOM   586  N  N   . VAL A 1 90  ? 21.480 33.474 27.108 1.00 27.11  ? 171 VAL A N   1 
ATOM   587  C  CA  . VAL A 1 90  ? 21.087 32.501 28.124 1.00 25.98  ? 171 VAL A CA  1 
ATOM   588  C  C   . VAL A 1 90  ? 19.538 32.342 28.176 1.00 26.63  ? 171 VAL A C   1 
ATOM   589  O  O   . VAL A 1 90  ? 18.821 33.320 28.379 1.00 28.29  ? 171 VAL A O   1 
ATOM   590  C  CB  . VAL A 1 90  ? 21.556 32.961 29.477 1.00 26.90  ? 171 VAL A CB  1 
ATOM   591  C  CG1 . VAL A 1 90  ? 21.112 31.994 30.570 1.00 26.89  ? 171 VAL A CG1 1 
ATOM   592  C  CG2 . VAL A 1 90  ? 23.122 33.109 29.471 1.00 25.84  ? 171 VAL A CG2 1 
ATOM   593  N  N   . GLN A 1 91  ? 19.054 31.118 28.015 1.00 24.86  ? 172 GLN A N   1 
ATOM   594  C  CA  . GLN A 1 91  ? 17.625 30.878 28.179 1.00 25.44  ? 172 GLN A CA  1 
ATOM   595  C  C   . GLN A 1 91  ? 17.407 30.529 29.646 1.00 24.27  ? 172 GLN A C   1 
ATOM   596  O  O   . GLN A 1 91  ? 17.907 29.504 30.133 1.00 23.80  ? 172 GLN A O   1 
ATOM   597  C  CB  . GLN A 1 91  ? 17.190 29.725 27.293 1.00 24.78  ? 172 GLN A CB  1 
ATOM   598  C  CG  . GLN A 1 91  ? 15.696 29.428 27.341 1.00 24.14  ? 172 GLN A CG  1 
ATOM   599  C  CD  . GLN A 1 91  ? 15.357 28.341 26.354 1.00 25.15  ? 172 GLN A CD  1 
ATOM   600  O  OE1 . GLN A 1 91  ? 15.219 28.616 25.154 1.00 25.61  ? 172 GLN A OE1 1 
ATOM   601  N  NE2 . GLN A 1 91  ? 15.248 27.098 26.839 1.00 24.71  ? 172 GLN A NE2 1 
ATOM   602  N  N   . VAL A 1 92  ? 16.683 31.395 30.349 1.00 24.95  ? 173 VAL A N   1 
ATOM   603  C  CA  . VAL A 1 92  ? 16.473 31.233 31.776 1.00 24.98  ? 173 VAL A CA  1 
ATOM   604  C  C   . VAL A 1 92  ? 15.288 30.230 31.932 1.00 26.22  ? 173 VAL A C   1 
ATOM   605  O  O   . VAL A 1 92  ? 14.109 30.614 31.844 1.00 26.53  ? 173 VAL A O   1 
ATOM   606  C  CB  . VAL A 1 92  ? 16.158 32.580 32.442 1.00 25.63  ? 173 VAL A CB  1 
ATOM   607  C  CG1 . VAL A 1 92  ? 16.053 32.397 33.954 1.00 24.90  ? 173 VAL A CG1 1 
ATOM   608  C  CG2 . VAL A 1 92  ? 17.246 33.654 32.127 1.00 25.06  ? 173 VAL A CG2 1 
ATOM   609  N  N   . ASP A 1 93  ? 15.600 28.955 32.130 1.00 26.11  ? 174 ASP A N   1 
ATOM   610  C  CA  . ASP A 1 93  ? 14.567 27.907 32.077 1.00 27.39  ? 174 ASP A CA  1 
ATOM   611  C  C   . ASP A 1 93  ? 14.633 26.943 33.250 1.00 28.45  ? 174 ASP A C   1 
ATOM   612  O  O   . ASP A 1 93  ? 14.239 25.786 33.143 1.00 28.21  ? 174 ASP A O   1 
ATOM   613  C  CB  . ASP A 1 93  ? 14.651 27.128 30.768 1.00 27.51  ? 174 ASP A CB  1 
ATOM   614  C  CG  . ASP A 1 93  ? 16.022 26.560 30.524 1.00 25.69  ? 174 ASP A CG  1 
ATOM   615  O  OD1 . ASP A 1 93  ? 16.876 26.611 31.436 1.00 25.05  ? 174 ASP A OD1 1 
ATOM   616  O  OD2 . ASP A 1 93  ? 16.337 26.045 29.446 1.00 26.13  ? 174 ASP A OD2 1 
ATOM   617  N  N   . VAL A 1 94  ? 15.074 27.466 34.384 1.00 29.70  ? 175 VAL A N   1 
ATOM   618  C  CA  . VAL A 1 94  ? 15.401 26.662 35.550 1.00 31.35  ? 175 VAL A CA  1 
ATOM   619  C  C   . VAL A 1 94  ? 14.863 27.477 36.727 1.00 32.15  ? 175 VAL A C   1 
ATOM   620  O  O   . VAL A 1 94  ? 15.016 28.696 36.744 1.00 32.71  ? 175 VAL A O   1 
ATOM   621  C  CB  . VAL A 1 94  ? 16.970 26.490 35.523 1.00 31.81  ? 175 VAL A CB  1 
ATOM   622  C  CG1 . VAL A 1 94  ? 17.713 27.270 36.619 1.00 31.65  ? 175 VAL A CG1 1 
ATOM   623  C  CG2 . VAL A 1 94  ? 17.395 25.031 35.354 1.00 33.63  ? 175 VAL A CG2 1 
ATOM   624  N  N   . LYS A 1 95  ? 14.186 26.836 37.681 1.00 32.42  ? 176 LYS A N   1 
ATOM   625  C  CA  . LYS A 1 95  ? 13.814 27.538 38.903 1.00 33.99  ? 176 LYS A CA  1 
ATOM   626  C  C   . LYS A 1 95  ? 15.086 27.854 39.687 1.00 33.60  ? 176 LYS A C   1 
ATOM   627  O  O   . LYS A 1 95  ? 16.056 27.069 39.677 1.00 34.49  ? 176 LYS A O   1 
ATOM   628  C  CB  . LYS A 1 95  ? 12.850 26.719 39.770 1.00 33.61  ? 176 LYS A CB  1 
ATOM   629  C  CG  . LYS A 1 95  ? 12.449 27.440 41.042 1.00 36.41  ? 176 LYS A CG  1 
ATOM   630  C  CD  . LYS A 1 95  ? 10.931 27.616 41.182 1.00 38.94  ? 176 LYS A CD  1 
ATOM   631  C  CE  . LYS A 1 95  ? 10.549 29.088 41.338 1.00 38.79  ? 176 LYS A CE  1 
ATOM   632  N  NZ  . LYS A 1 95  ? 10.154 29.459 42.719 1.00 39.77  ? 176 LYS A NZ  1 
ATOM   633  N  N   . ASP A 1 96  ? 15.084 29.015 40.321 1.00 32.80  ? 177 ASP A N   1 
ATOM   634  C  CA  . ASP A 1 96  ? 16.199 29.467 41.135 1.00 32.56  ? 177 ASP A CA  1 
ATOM   635  C  C   . ASP A 1 96  ? 17.472 29.693 40.316 1.00 31.52  ? 177 ASP A C   1 
ATOM   636  O  O   . ASP A 1 96  ? 18.512 29.146 40.657 1.00 31.41  ? 177 ASP A O   1 
ATOM   637  C  CB  . ASP A 1 96  ? 16.492 28.453 42.239 1.00 32.86  ? 177 ASP A CB  1 
ATOM   638  C  CG  . ASP A 1 96  ? 15.694 28.708 43.480 1.00 35.73  ? 177 ASP A CG  1 
ATOM   639  O  OD1 . ASP A 1 96  ? 14.702 27.981 43.708 1.00 36.29  ? 177 ASP A OD1 1 
ATOM   640  O  OD2 . ASP A 1 96  ? 15.996 29.606 44.304 1.00 40.10  ? 177 ASP A OD2 1 
ATOM   641  N  N   . PRO A 1 97  ? 17.404 30.489 39.253 1.00 30.74  ? 178 PRO A N   1 
ATOM   642  C  CA  . PRO A 1 97  ? 18.559 30.660 38.353 1.00 30.27  ? 178 PRO A CA  1 
ATOM   643  C  C   . PRO A 1 97  ? 19.635 31.628 38.855 1.00 29.47  ? 178 PRO A C   1 
ATOM   644  O  O   . PRO A 1 97  ? 20.665 31.792 38.195 1.00 28.69  ? 178 PRO A O   1 
ATOM   645  C  CB  . PRO A 1 97  ? 17.913 31.238 37.081 1.00 28.99  ? 178 PRO A CB  1 
ATOM   646  C  CG  . PRO A 1 97  ? 16.791 32.083 37.608 1.00 30.68  ? 178 PRO A CG  1 
ATOM   647  C  CD  . PRO A 1 97  ? 16.245 31.281 38.795 1.00 30.88  ? 178 PRO A CD  1 
ATOM   648  N  N   . GLN A 1 98  ? 19.406 32.262 40.002 1.00 29.64  ? 179 GLN A N   1 
ATOM   649  C  CA  . GLN A 1 98  ? 20.177 33.433 40.355 1.00 29.83  ? 179 GLN A CA  1 
ATOM   650  C  C   . GLN A 1 98  ? 21.666 33.123 40.543 1.00 29.14  ? 179 GLN A C   1 
ATOM   651  O  O   . GLN A 1 98  ? 22.519 33.922 40.147 1.00 28.31  ? 179 GLN A O   1 
ATOM   652  C  CB  . GLN A 1 98  ? 19.576 34.176 41.580 1.00 30.36  ? 179 GLN A CB  1 
ATOM   653  C  CG  . GLN A 1 98  ? 19.128 33.283 42.728 1.00 33.61  ? 179 GLN A CG  1 
ATOM   654  C  CD  . GLN A 1 98  ? 17.825 32.507 42.458 1.00 37.33  ? 179 GLN A CD  1 
ATOM   655  O  OE1 . GLN A 1 98  ? 16.952 32.954 41.707 1.00 38.76  ? 179 GLN A OE1 1 
ATOM   656  N  NE2 . GLN A 1 98  ? 17.694 31.356 43.095 1.00 38.19  ? 179 GLN A NE2 1 
ATOM   657  N  N   . GLN A 1 99  ? 21.963 31.971 41.137 1.00 28.92  ? 180 GLN A N   1 
ATOM   658  C  CA  . GLN A 1 99  ? 23.348 31.615 41.446 1.00 29.55  ? 180 GLN A CA  1 
ATOM   659  C  C   . GLN A 1 99  ? 24.076 31.275 40.150 1.00 27.72  ? 180 GLN A C   1 
ATOM   660  O  O   . GLN A 1 99  ? 25.183 31.763 39.919 1.00 27.55  ? 180 GLN A O   1 
ATOM   661  C  CB  . GLN A 1 99  ? 23.437 30.459 42.435 1.00 29.70  ? 180 GLN A CB  1 
ATOM   662  C  CG  . GLN A 1 99  ? 24.148 30.829 43.721 1.00 36.01  ? 180 GLN A CG  1 
ATOM   663  C  CD  . GLN A 1 99  ? 25.508 30.142 43.865 1.00 41.21  ? 180 GLN A CD  1 
ATOM   664  O  OE1 . GLN A 1 99  ? 25.815 29.584 44.922 1.00 42.92  ? 180 GLN A OE1 1 
ATOM   665  N  NE2 . GLN A 1 99  ? 26.318 30.182 42.803 1.00 43.31  ? 180 GLN A NE2 1 
ATOM   666  N  N   . ALA A 1 100 ? 23.435 30.480 39.299 1.00 26.70  ? 181 ALA A N   1 
ATOM   667  C  CA  . ALA A 1 100 ? 23.961 30.224 37.953 1.00 25.03  ? 181 ALA A CA  1 
ATOM   668  C  C   . ALA A 1 100 ? 24.206 31.519 37.177 1.00 24.56  ? 181 ALA A C   1 
ATOM   669  O  O   . ALA A 1 100 ? 25.291 31.704 36.610 1.00 22.18  ? 181 ALA A O   1 
ATOM   670  C  CB  . ALA A 1 100 ? 23.058 29.292 37.178 1.00 25.28  ? 181 ALA A CB  1 
ATOM   671  N  N   . LEU A 1 101 ? 23.218 32.418 37.156 1.00 23.04  ? 182 LEU A N   1 
ATOM   672  C  CA  . LEU A 1 101 ? 23.363 33.705 36.459 1.00 23.62  ? 182 LEU A CA  1 
ATOM   673  C  C   . LEU A 1 101 ? 24.530 34.599 36.945 1.00 24.12  ? 182 LEU A C   1 
ATOM   674  O  O   . LEU A 1 101 ? 25.206 35.277 36.159 1.00 24.12  ? 182 LEU A O   1 
ATOM   675  C  CB  . LEU A 1 101 ? 22.041 34.481 36.476 1.00 23.59  ? 182 LEU A CB  1 
ATOM   676  C  CG  . LEU A 1 101 ? 20.940 33.785 35.646 1.00 23.63  ? 182 LEU A CG  1 
ATOM   677  C  CD1 . LEU A 1 101 ? 19.576 34.454 35.842 1.00 25.38  ? 182 LEU A CD1 1 
ATOM   678  C  CD2 . LEU A 1 101 ? 21.276 33.754 34.135 1.00 25.14  ? 182 LEU A CD2 1 
ATOM   679  N  N   . LYS A 1 102 ? 24.742 34.627 38.240 1.00 24.29  ? 183 LYS A N   1 
ATOM   680  C  CA  . LYS A 1 102 ? 25.812 35.426 38.773 1.00 25.96  ? 183 LYS A CA  1 
ATOM   681  C  C   . LYS A 1 102 ? 27.175 34.881 38.312 1.00 25.94  ? 183 LYS A C   1 
ATOM   682  O  O   . LYS A 1 102 ? 28.075 35.666 37.984 1.00 25.09  ? 183 LYS A O   1 
ATOM   683  C  CB  . LYS A 1 102 ? 25.666 35.501 40.291 1.00 25.97  ? 183 LYS A CB  1 
ATOM   684  C  CG  . LYS A 1 102 ? 26.931 35.630 41.060 1.00 29.96  ? 183 LYS A CG  1 
ATOM   685  C  CD  . LYS A 1 102 ? 26.675 35.213 42.499 1.00 34.71  ? 183 LYS A CD  1 
ATOM   686  C  CE  . LYS A 1 102 ? 27.358 36.116 43.504 1.00 35.82  ? 183 LYS A CE  1 
ATOM   687  N  NZ  . LYS A 1 102 ? 26.914 35.737 44.888 1.00 38.01  ? 183 LYS A NZ  1 
ATOM   688  N  N   . GLU A 1 103 ? 27.318 33.552 38.276 1.00 25.97  ? 184 GLU A N   1 
ATOM   689  C  CA  . GLU A 1 103 ? 28.576 32.939 37.827 1.00 26.85  ? 184 GLU A CA  1 
ATOM   690  C  C   . GLU A 1 103 ? 28.791 33.161 36.318 1.00 25.30  ? 184 GLU A C   1 
ATOM   691  O  O   . GLU A 1 103 ? 29.907 33.391 35.875 1.00 24.83  ? 184 GLU A O   1 
ATOM   692  C  CB  . GLU A 1 103 ? 28.618 31.459 38.162 1.00 27.49  ? 184 GLU A CB  1 
ATOM   693  C  CG  . GLU A 1 103 ? 27.636 30.636 37.355 1.00 34.46  ? 184 GLU A CG  1 
ATOM   694  C  CD  . GLU A 1 103 ? 27.488 29.209 37.850 1.00 40.46  ? 184 GLU A CD  1 
ATOM   695  O  OE1 . GLU A 1 103 ? 27.600 28.948 39.082 1.00 42.30  ? 184 GLU A OE1 1 
ATOM   696  O  OE2 . GLU A 1 103 ? 27.245 28.349 36.986 1.00 41.38  ? 184 GLU A OE2 1 
ATOM   697  N  N   . LEU A 1 104 ? 27.724 33.102 35.544 1.00 23.64  ? 185 LEU A N   1 
ATOM   698  C  CA  . LEU A 1 104 ? 27.805 33.354 34.105 1.00 23.32  ? 185 LEU A CA  1 
ATOM   699  C  C   . LEU A 1 104 ? 28.110 34.824 33.826 1.00 23.41  ? 185 LEU A C   1 
ATOM   700  O  O   . LEU A 1 104 ? 28.826 35.138 32.881 1.00 22.58  ? 185 LEU A O   1 
ATOM   701  C  CB  . LEU A 1 104 ? 26.506 32.970 33.423 1.00 22.18  ? 185 LEU A CB  1 
ATOM   702  C  CG  . LEU A 1 104 ? 26.287 31.462 33.328 1.00 24.33  ? 185 LEU A CG  1 
ATOM   703  C  CD1 . LEU A 1 104 ? 24.811 31.140 32.931 1.00 26.08  ? 185 LEU A CD1 1 
ATOM   704  C  CD2 . LEU A 1 104 ? 27.224 30.835 32.286 1.00 23.78  ? 185 LEU A CD2 1 
ATOM   705  N  N   . ALA A 1 105 ? 27.585 35.724 34.668 1.00 22.46  ? 186 ALA A N   1 
ATOM   706  C  CA  . ALA A 1 105 ? 27.891 37.137 34.530 1.00 21.74  ? 186 ALA A CA  1 
ATOM   707  C  C   . ALA A 1 105 ? 29.395 37.381 34.723 1.00 21.06  ? 186 ALA A C   1 
ATOM   708  O  O   . ALA A 1 105 ? 29.999 38.097 33.928 1.00 20.13  ? 186 ALA A O   1 
ATOM   709  C  CB  . ALA A 1 105 ? 27.062 38.003 35.520 1.00 21.74  ? 186 ALA A CB  1 
ATOM   710  N  N   . LYS A 1 106 ? 29.957 36.822 35.787 1.00 20.62  ? 187 LYS A N   1 
ATOM   711  C  CA  . LYS A 1 106 ? 31.394 36.909 36.048 1.00 20.85  ? 187 LYS A CA  1 
ATOM   712  C  C   . LYS A 1 106 ? 32.172 36.424 34.828 1.00 20.43  ? 187 LYS A C   1 
ATOM   713  O  O   . LYS A 1 106 ? 33.148 37.046 34.422 1.00 21.33  ? 187 LYS A O   1 
ATOM   714  C  CB  . LYS A 1 106 ? 31.793 36.050 37.246 1.00 20.24  ? 187 LYS A CB  1 
ATOM   715  C  CG  . LYS A 1 106 ? 31.289 36.556 38.592 1.00 22.09  ? 187 LYS A CG  1 
ATOM   716  C  CD  . LYS A 1 106 ? 31.838 35.695 39.710 1.00 22.09  ? 187 LYS A CD  1 
ATOM   717  C  CE  . LYS A 1 106 ? 31.169 35.963 41.055 1.00 23.91  ? 187 LYS A CE  1 
ATOM   718  N  NZ  . LYS A 1 106 ? 31.681 34.960 42.105 1.00 22.81  ? 187 LYS A NZ  1 
ATOM   719  N  N   . MET A 1 107 ? 31.788 35.263 34.321 1.00 20.26  ? 188 MET A N   1 
ATOM   720  C  CA  . MET A 1 107 ? 32.455 34.669 33.178 1.00 22.56  ? 188 MET A CA  1 
ATOM   721  C  C   . MET A 1 107 ? 32.427 35.608 31.956 1.00 21.84  ? 188 MET A C   1 
ATOM   722  O  O   . MET A 1 107 ? 33.425 35.786 31.283 1.00 20.95  ? 188 MET A O   1 
ATOM   723  C  CB  . MET A 1 107 ? 31.743 33.367 32.799 1.00 24.74  ? 188 MET A CB  1 
ATOM   724  C  CG  . MET A 1 107 ? 32.496 32.561 31.758 1.00 29.55  ? 188 MET A CG  1 
ATOM   725  S  SD  . MET A 1 107 ? 31.489 31.158 31.264 1.00 35.76  ? 188 MET A SD  1 
ATOM   726  C  CE  . MET A 1 107 ? 31.146 30.392 33.001 1.00 31.98  ? 188 MET A CE  1 
ATOM   727  N  N   . CYS A 1 108 ? 31.259 36.159 31.642 1.00 20.51  ? 189 CYS A N   1 
ATOM   728  C  CA  . CYS A 1 108 ? 31.131 37.102 30.541 1.00 21.71  ? 189 CYS A CA  1 
ATOM   729  C  C   . CYS A 1 108 ? 31.928 38.384 30.730 1.00 21.74  ? 189 CYS A C   1 
ATOM   730  O  O   . CYS A 1 108 ? 32.504 38.917 29.757 1.00 23.06  ? 189 CYS A O   1 
ATOM   731  C  CB  . CYS A 1 108 ? 29.646 37.393 30.285 1.00 21.77  ? 189 CYS A CB  1 
ATOM   732  S  SG  . CYS A 1 108 ? 28.800 35.948 29.616 1.00 26.49  ? 189 CYS A SG  1 
ATOM   733  N  N   . ILE A 1 109 ? 31.999 38.903 31.967 1.00 20.01  ? 190 ILE A N   1 
ATOM   734  C  CA  . ILE A 1 109 ? 32.754 40.118 32.189 1.00 18.76  ? 190 ILE A CA  1 
ATOM   735  C  C   . ILE A 1 109 ? 34.218 39.815 31.866 1.00 19.10  ? 190 ILE A C   1 
ATOM   736  O  O   . ILE A 1 109 ? 34.846 40.561 31.126 1.00 17.97  ? 190 ILE A O   1 
ATOM   737  C  CB  . ILE A 1 109 ? 32.606 40.646 33.664 1.00 18.43  ? 190 ILE A CB  1 
ATOM   738  C  CG1 . ILE A 1 109 ? 31.241 41.292 33.856 1.00 19.40  ? 190 ILE A CG1 1 
ATOM   739  C  CG2 . ILE A 1 109 ? 33.741 41.644 34.021 1.00 16.52  ? 190 ILE A CG2 1 
ATOM   740  C  CD1 . ILE A 1 109 ? 30.841 41.480 35.306 1.00 24.03  ? 190 ILE A CD1 1 
ATOM   741  N  N   . LEU A 1 110 ? 34.736 38.699 32.380 1.00 18.96  ? 191 LEU A N   1 
ATOM   742  C  CA  . LEU A 1 110 ? 36.175 38.374 32.215 1.00 21.06  ? 191 LEU A CA  1 
ATOM   743  C  C   . LEU A 1 110 ? 36.494 38.030 30.769 1.00 22.25  ? 191 LEU A C   1 
ATOM   744  O  O   . LEU A 1 110 ? 37.597 38.301 30.305 1.00 23.11  ? 191 LEU A O   1 
ATOM   745  C  CB  . LEU A 1 110 ? 36.588 37.212 33.116 1.00 19.79  ? 191 LEU A CB  1 
ATOM   746  C  CG  . LEU A 1 110 ? 36.472 37.532 34.613 1.00 20.49  ? 191 LEU A CG  1 
ATOM   747  C  CD1 . LEU A 1 110 ? 36.661 36.290 35.452 1.00 23.33  ? 191 LEU A CD1 1 
ATOM   748  C  CD2 . LEU A 1 110 ? 37.503 38.591 34.972 1.00 21.80  ? 191 LEU A CD2 1 
ATOM   749  N  N   . ALA A 1 111 ? 35.536 37.417 30.074 1.00 23.63  ? 192 ALA A N   1 
ATOM   750  C  CA  . ALA A 1 111 ? 35.749 37.085 28.669 1.00 25.50  ? 192 ALA A CA  1 
ATOM   751  C  C   . ALA A 1 111 ? 35.312 38.193 27.704 1.00 26.52  ? 192 ALA A C   1 
ATOM   752  O  O   . ALA A 1 111 ? 35.497 38.059 26.494 1.00 27.44  ? 192 ALA A O   1 
ATOM   753  C  CB  . ALA A 1 111 ? 35.118 35.758 28.317 1.00 24.99  ? 192 ALA A CB  1 
ATOM   754  N  N   . ASP A 1 112 ? 34.779 39.293 28.240 1.00 26.89  ? 193 ASP A N   1 
ATOM   755  C  CA  . ASP A 1 112 ? 34.367 40.428 27.425 1.00 28.27  ? 193 ASP A CA  1 
ATOM   756  C  C   . ASP A 1 112 ? 33.316 39.953 26.454 1.00 29.25  ? 193 ASP A C   1 
ATOM   757  O  O   . ASP A 1 112 ? 33.475 40.052 25.235 1.00 29.27  ? 193 ASP A O   1 
ATOM   758  C  CB  . ASP A 1 112 ? 35.559 41.028 26.671 1.00 28.69  ? 193 ASP A CB  1 
ATOM   759  C  CG  . ASP A 1 112 ? 35.222 42.328 25.968 1.00 29.85  ? 193 ASP A CG  1 
ATOM   760  O  OD1 . ASP A 1 112 ? 34.159 42.925 26.265 1.00 30.12  ? 193 ASP A OD1 1 
ATOM   761  O  OD2 . ASP A 1 112 ? 35.994 42.835 25.113 1.00 31.98  ? 193 ASP A OD2 1 
ATOM   762  N  N   . CYS A 1 113 ? 32.243 39.396 26.995 1.00 29.85  ? 194 CYS A N   1 
ATOM   763  C  CA  . CYS A 1 113 ? 31.121 39.104 26.148 1.00 31.35  ? 194 CYS A CA  1 
ATOM   764  C  C   . CYS A 1 113 ? 29.803 39.597 26.725 1.00 29.88  ? 194 CYS A C   1 
ATOM   765  O  O   . CYS A 1 113 ? 29.652 39.754 27.939 1.00 27.92  ? 194 CYS A O   1 
ATOM   766  C  CB  . CYS A 1 113 ? 31.121 37.641 25.726 1.00 32.43  ? 194 CYS A CB  1 
ATOM   767  S  SG  . CYS A 1 113 ? 31.026 36.354 26.980 1.00 45.58  ? 194 CYS A SG  1 
ATOM   768  N  N   . THR A 1 114 ? 28.877 39.924 25.837 1.00 28.35  ? 195 THR A N   1 
ATOM   769  C  CA  . THR A 1 114 ? 27.620 40.504 26.254 1.00 28.83  ? 195 THR A CA  1 
ATOM   770  C  C   . THR A 1 114 ? 26.754 39.379 26.795 1.00 29.13  ? 195 THR A C   1 
ATOM   771  O  O   . THR A 1 114 ? 26.701 38.310 26.199 1.00 29.85  ? 195 THR A O   1 
ATOM   772  C  CB  . THR A 1 114 ? 26.945 41.173 25.033 1.00 29.91  ? 195 THR A CB  1 
ATOM   773  O  OG1 . THR A 1 114 ? 27.677 42.365 24.718 1.00 28.64  ? 195 THR A OG1 1 
ATOM   774  C  CG2 . THR A 1 114 ? 25.501 41.678 25.381 1.00 29.03  ? 195 THR A CG2 1 
ATOM   775  N  N   . LEU A 1 115 ? 26.075 39.599 27.911 1.00 28.69  ? 196 LEU A N   1 
ATOM   776  C  CA  . LEU A 1 115 ? 25.191 38.568 28.435 1.00 29.68  ? 196 LEU A CA  1 
ATOM   777  C  C   . LEU A 1 115 ? 23.749 39.035 28.242 1.00 29.09  ? 196 LEU A C   1 
ATOM   778  O  O   . LEU A 1 115 ? 23.375 40.107 28.715 1.00 29.79  ? 196 LEU A O   1 
ATOM   779  C  CB  . LEU A 1 115 ? 25.458 38.314 29.925 1.00 29.98  ? 196 LEU A CB  1 
ATOM   780  C  CG  . LEU A 1 115 ? 24.836 37.058 30.575 1.00 33.87  ? 196 LEU A CG  1 
ATOM   781  C  CD1 . LEU A 1 115 ? 25.436 36.861 31.963 1.00 33.81  ? 196 LEU A CD1 1 
ATOM   782  C  CD2 . LEU A 1 115 ? 23.347 37.174 30.724 1.00 37.55  ? 196 LEU A CD2 1 
ATOM   783  N  N   . ILE A 1 116 ? 22.960 38.225 27.563 1.00 28.71  ? 197 ILE A N   1 
ATOM   784  C  CA  . ILE A 1 116 ? 21.545 38.520 27.332 1.00 27.88  ? 197 ILE A CA  1 
ATOM   785  C  C   . ILE A 1 116 ? 20.676 37.421 27.948 1.00 27.45  ? 197 ILE A C   1 
ATOM   786  O  O   . ILE A 1 116 ? 20.947 36.243 27.764 1.00 25.71  ? 197 ILE A O   1 
ATOM   787  C  CB  . ILE A 1 116 ? 21.264 38.586 25.806 1.00 28.97  ? 197 ILE A CB  1 
ATOM   788  C  CG1 . ILE A 1 116 ? 21.969 39.803 25.187 1.00 31.12  ? 197 ILE A CG1 1 
ATOM   789  C  CG2 . ILE A 1 116 ? 19.704 38.613 25.527 1.00 29.82  ? 197 ILE A CG2 1 
ATOM   790  C  CD1 . ILE A 1 116 ? 21.538 41.146 25.755 1.00 30.53  ? 197 ILE A CD1 1 
ATOM   791  N  N   . LEU A 1 117 ? 19.617 37.812 28.664 1.00 26.76  ? 198 LEU A N   1 
ATOM   792  C  CA  . LEU A 1 117 ? 18.716 36.825 29.254 1.00 26.82  ? 198 LEU A CA  1 
ATOM   793  C  C   . LEU A 1 117 ? 17.477 36.750 28.387 1.00 26.05  ? 198 LEU A C   1 
ATOM   794  O  O   . LEU A 1 117 ? 16.814 37.769 28.150 1.00 25.50  ? 198 LEU A O   1 
ATOM   795  C  CB  . LEU A 1 117 ? 18.329 37.206 30.688 1.00 27.27  ? 198 LEU A CB  1 
ATOM   796  C  CG  . LEU A 1 117 ? 19.328 37.117 31.836 1.00 30.28  ? 198 LEU A CG  1 
ATOM   797  C  CD1 . LEU A 1 117 ? 20.520 38.011 31.608 1.00 37.62  ? 198 LEU A CD1 1 
ATOM   798  C  CD2 . LEU A 1 117 ? 18.681 37.558 33.135 1.00 28.95  ? 198 LEU A CD2 1 
ATOM   799  N  N   . ALA A 1 118 ? 17.192 35.553 27.904 1.00 26.67  ? 199 ALA A N   1 
ATOM   800  C  CA  . ALA A 1 118 ? 15.954 35.293 27.188 1.00 26.30  ? 199 ALA A CA  1 
ATOM   801  C  C   . ALA A 1 118 ? 15.102 34.347 28.049 1.00 25.49  ? 199 ALA A C   1 
ATOM   802  O  O   . ALA A 1 118 ? 15.583 33.354 28.580 1.00 25.40  ? 199 ALA A O   1 
ATOM   803  C  CB  . ALA A 1 118 ? 16.242 34.660 25.812 1.00 26.62  ? 199 ALA A CB  1 
ATOM   804  N  N   . TRP A 1 119 ? 13.826 34.628 28.120 1.00 24.18  ? 200 TRP A N   1 
ATOM   805  C  CA  . TRP A 1 119 ? 12.954 33.851 28.979 1.00 24.63  ? 200 TRP A CA  1 
ATOM   806  C  C   . TRP A 1 119 ? 12.096 32.831 28.253 1.00 23.37  ? 200 TRP A C   1 
ATOM   807  O  O   . TRP A 1 119 ? 11.195 32.231 28.858 1.00 23.80  ? 200 TRP A O   1 
ATOM   808  C  CB  . TRP A 1 119 ? 12.084 34.820 29.769 1.00 23.91  ? 200 TRP A CB  1 
ATOM   809  C  CG  . TRP A 1 119 ? 12.920 35.718 30.675 1.00 25.90  ? 200 TRP A CG  1 
ATOM   810  C  CD1 . TRP A 1 119 ? 13.504 36.906 30.353 1.00 25.01  ? 200 TRP A CD1 1 
ATOM   811  C  CD2 . TRP A 1 119 ? 13.218 35.490 32.058 1.00 26.90  ? 200 TRP A CD2 1 
ATOM   812  N  NE1 . TRP A 1 119 ? 14.162 37.425 31.444 1.00 26.43  ? 200 TRP A NE1 1 
ATOM   813  C  CE2 . TRP A 1 119 ? 14.010 36.575 32.505 1.00 26.19  ? 200 TRP A CE2 1 
ATOM   814  C  CE3 . TRP A 1 119 ? 12.884 34.478 32.975 1.00 25.36  ? 200 TRP A CE3 1 
ATOM   815  C  CZ2 . TRP A 1 119 ? 14.460 36.683 33.820 1.00 25.00  ? 200 TRP A CZ2 1 
ATOM   816  C  CZ3 . TRP A 1 119 ? 13.331 34.589 34.290 1.00 24.59  ? 200 TRP A CZ3 1 
ATOM   817  C  CH2 . TRP A 1 119 ? 14.108 35.686 34.697 1.00 26.67  ? 200 TRP A CH2 1 
ATOM   818  N  N   . SER A 1 120 ? 12.326 32.679 26.952 1.00 23.09  ? 201 SER A N   1 
ATOM   819  C  CA  . SER A 1 120 ? 11.647 31.714 26.121 1.00 23.12  ? 201 SER A CA  1 
ATOM   820  C  C   . SER A 1 120 ? 12.474 31.544 24.822 1.00 24.38  ? 201 SER A C   1 
ATOM   821  O  O   . SER A 1 120 ? 13.310 32.412 24.520 1.00 24.37  ? 201 SER A O   1 
ATOM   822  C  CB  . SER A 1 120 ? 10.232 32.222 25.784 1.00 23.89  ? 201 SER A CB  1 
ATOM   823  O  OG  . SER A 1 120 ? 10.286 33.366 24.942 1.00 22.50  ? 201 SER A OG  1 
ATOM   824  N  N   . PRO A 1 121 ? 12.280 30.437 24.087 1.00 24.56  ? 202 PRO A N   1 
ATOM   825  C  CA  . PRO A 1 121 ? 12.889 30.258 22.755 1.00 24.93  ? 202 PRO A CA  1 
ATOM   826  C  C   . PRO A 1 121 ? 12.539 31.446 21.829 1.00 26.04  ? 202 PRO A C   1 
ATOM   827  O  O   . PRO A 1 121 ? 13.395 31.941 21.099 1.00 25.60  ? 202 PRO A O   1 
ATOM   828  C  CB  . PRO A 1 121 ? 12.199 28.980 22.223 1.00 26.90  ? 202 PRO A CB  1 
ATOM   829  C  CG  . PRO A 1 121 ? 11.916 28.168 23.521 1.00 26.96  ? 202 PRO A CG  1 
ATOM   830  C  CD  . PRO A 1 121 ? 11.490 29.249 24.509 1.00 24.40  ? 202 PRO A CD  1 
ATOM   831  N  N   . GLU A 1 122 ? 11.296 31.914 21.888 1.00 25.13  ? 203 GLU A N   1 
ATOM   832  C  CA  . GLU A 1 122 ? 10.850 32.988 20.999 1.00 26.07  ? 203 GLU A CA  1 
ATOM   833  C  C   . GLU A 1 122 ? 11.604 34.296 21.252 1.00 25.86  ? 203 GLU A C   1 
ATOM   834  O  O   . GLU A 1 122 ? 12.046 34.971 20.319 1.00 25.59  ? 203 GLU A O   1 
ATOM   835  C  CB  . GLU A 1 122 ? 9.355  33.240 21.159 1.00 24.96  ? 203 GLU A CB  1 
ATOM   836  C  CG  . GLU A 1 122 ? 8.903  34.442 20.354 1.00 29.95  ? 203 GLU A CG  1 
ATOM   837  C  CD  . GLU A 1 122 ? 7.400  34.510 20.168 1.00 33.89  ? 203 GLU A CD  1 
ATOM   838  O  OE1 . GLU A 1 122 ? 6.667  33.804 20.890 1.00 36.59  ? 203 GLU A OE1 1 
ATOM   839  O  OE2 . GLU A 1 122 ? 6.951  35.270 19.292 1.00 37.72  ? 203 GLU A OE2 1 
ATOM   840  N  N   . GLU A 1 123 ? 11.796 34.620 22.527 1.00 24.45  ? 204 GLU A N   1 
ATOM   841  C  CA  . GLU A 1 123 ? 12.593 35.772 22.875 1.00 24.80  ? 204 GLU A CA  1 
ATOM   842  C  C   . GLU A 1 123 ? 14.024 35.666 22.372 1.00 24.09  ? 204 GLU A C   1 
ATOM   843  O  O   . GLU A 1 123 ? 14.533 36.645 21.868 1.00 23.09  ? 204 GLU A O   1 
ATOM   844  C  CB  . GLU A 1 123 ? 12.602 36.019 24.379 1.00 24.81  ? 204 GLU A CB  1 
ATOM   845  C  CG  . GLU A 1 123 ? 12.536 37.501 24.687 1.00 30.75  ? 204 GLU A CG  1 
ATOM   846  C  CD  . GLU A 1 123 ? 12.883 37.830 26.125 1.00 33.60  ? 204 GLU A CD  1 
ATOM   847  O  OE1 . GLU A 1 123 ? 12.835 36.920 26.985 1.00 29.99  ? 204 GLU A OE1 1 
ATOM   848  O  OE2 . GLU A 1 123 ? 13.204 39.029 26.392 1.00 35.16  ? 204 GLU A OE2 1 
ATOM   849  N  N   . ALA A 1 124 ? 14.645 34.491 22.484 1.00 23.59  ? 205 ALA A N   1 
ATOM   850  C  CA  . ALA A 1 124 ? 16.011 34.259 21.976 1.00 24.06  ? 205 ALA A CA  1 
ATOM   851  C  C   . ALA A 1 124 ? 16.121 34.439 20.460 1.00 23.58  ? 205 ALA A C   1 
ATOM   852  O  O   . ALA A 1 124 ? 17.076 35.045 19.952 1.00 22.61  ? 205 ALA A O   1 
ATOM   853  C  CB  . ALA A 1 124 ? 16.520 32.860 22.386 1.00 23.80  ? 205 ALA A CB  1 
ATOM   854  N  N   . GLY A 1 125 ? 15.111 33.947 19.747 1.00 24.25  ? 206 GLY A N   1 
ATOM   855  C  CA  . GLY A 1 125 ? 15.059 34.070 18.306 1.00 25.05  ? 206 GLY A CA  1 
ATOM   856  C  C   . GLY A 1 125 ? 14.922 35.541 17.924 1.00 25.54  ? 206 GLY A C   1 
ATOM   857  O  O   . GLY A 1 125 ? 15.583 36.011 17.015 1.00 26.92  ? 206 GLY A O   1 
ATOM   858  N  N   . ARG A 1 126 ? 14.114 36.284 18.654 1.00 25.70  ? 207 ARG A N   1 
ATOM   859  C  CA  . ARG A 1 126 ? 14.022 37.721 18.425 1.00 26.99  ? 207 ARG A CA  1 
ATOM   860  C  C   . ARG A 1 126 ? 15.353 38.475 18.687 1.00 25.34  ? 207 ARG A C   1 
ATOM   861  O  O   . ARG A 1 126 ? 15.666 39.442 17.958 1.00 25.00  ? 207 ARG A O   1 
ATOM   862  C  CB  . ARG A 1 126 ? 12.886 38.337 19.252 1.00 27.53  ? 207 ARG A CB  1 
ATOM   863  C  CG  . ARG A 1 126 ? 11.517 38.025 18.687 1.00 34.99  ? 207 ARG A CG  1 
ATOM   864  C  CD  . ARG A 1 126 ? 11.117 38.871 17.439 1.00 41.65  ? 207 ARG A CD  1 
ATOM   865  N  NE  . ARG A 1 126 ? 9.922  39.702 17.614 1.00 49.57  ? 207 ARG A NE  1 
ATOM   866  C  CZ  . ARG A 1 126 ? 9.689  40.505 18.654 1.00 51.91  ? 207 ARG A CZ  1 
ATOM   867  N  NH1 . ARG A 1 126 ? 10.561 40.590 19.660 1.00 53.91  ? 207 ARG A NH1 1 
ATOM   868  N  NH2 . ARG A 1 126 ? 8.575  41.222 18.697 1.00 51.61  ? 207 ARG A NH2 1 
ATOM   869  N  N   . TYR A 1 127 ? 16.065 38.113 19.757 1.00 24.60  ? 208 TYR A N   1 
ATOM   870  C  CA  . TYR A 1 127 ? 17.393 38.698 20.006 1.00 25.07  ? 208 TYR A CA  1 
ATOM   871  C  C   . TYR A 1 127 ? 18.313 38.448 18.812 1.00 24.15  ? 208 TYR A C   1 
ATOM   872  O  O   . TYR A 1 127 ? 19.021 39.332 18.426 1.00 25.36  ? 208 TYR A O   1 
ATOM   873  C  CB  . TYR A 1 127 ? 18.046 38.177 21.306 1.00 24.89  ? 208 TYR A CB  1 
ATOM   874  C  CG  . TYR A 1 127 ? 17.526 38.845 22.554 1.00 26.05  ? 208 TYR A CG  1 
ATOM   875  C  CD1 . TYR A 1 127 ? 17.656 40.221 22.730 1.00 26.85  ? 208 TYR A CD1 1 
ATOM   876  C  CD2 . TYR A 1 127 ? 16.859 38.115 23.553 1.00 28.12  ? 208 TYR A CD2 1 
ATOM   877  C  CE1 . TYR A 1 127 ? 17.199 40.867 23.884 1.00 27.77  ? 208 TYR A CE1 1 
ATOM   878  C  CE2 . TYR A 1 127 ? 16.384 38.759 24.725 1.00 25.17  ? 208 TYR A CE2 1 
ATOM   879  C  CZ  . TYR A 1 127 ? 16.562 40.117 24.875 1.00 30.42  ? 208 TYR A CZ  1 
ATOM   880  O  OH  . TYR A 1 127 ? 16.075 40.773 25.989 1.00 31.00  ? 208 TYR A OH  1 
ATOM   881  N  N   . LEU A 1 128 ? 18.332 37.227 18.279 1.00 24.14  ? 209 LEU A N   1 
ATOM   882  C  CA  . LEU A 1 128 ? 19.192 36.884 17.147 1.00 24.71  ? 209 LEU A CA  1 
ATOM   883  C  C   . LEU A 1 128 ? 18.851 37.765 15.898 1.00 24.23  ? 209 LEU A C   1 
ATOM   884  O  O   . LEU A 1 128 ? 19.753 38.335 15.281 1.00 22.66  ? 209 LEU A O   1 
ATOM   885  C  CB  . LEU A 1 128 ? 19.016 35.428 16.794 1.00 23.48  ? 209 LEU A CB  1 
ATOM   886  C  CG  . LEU A 1 128 ? 19.946 34.314 17.315 1.00 28.13  ? 209 LEU A CG  1 
ATOM   887  C  CD1 . LEU A 1 128 ? 20.983 34.682 18.328 1.00 27.66  ? 209 LEU A CD1 1 
ATOM   888  C  CD2 . LEU A 1 128 ? 19.235 32.961 17.562 1.00 27.61  ? 209 LEU A CD2 1 
ATOM   889  N  N   . GLU A 1 129 ? 17.563 37.911 15.602 1.00 23.78  ? 210 GLU A N   1 
ATOM   890  C  CA  . GLU A 1 129 ? 17.121 38.766 14.487 1.00 24.89  ? 210 GLU A CA  1 
ATOM   891  C  C   . GLU A 1 129 ? 17.505 40.223 14.710 1.00 23.94  ? 210 GLU A C   1 
ATOM   892  O  O   . GLU A 1 129 ? 17.899 40.901 13.771 1.00 23.75  ? 210 GLU A O   1 
ATOM   893  C  CB  . GLU A 1 129 ? 15.609 38.694 14.288 1.00 26.09  ? 210 GLU A CB  1 
ATOM   894  C  CG  . GLU A 1 129 ? 15.101 37.354 13.746 1.00 27.86  ? 210 GLU A CG  1 
ATOM   895  C  CD  . GLU A 1 129 ? 13.586 37.319 13.773 1.00 33.13  ? 210 GLU A CD  1 
ATOM   896  O  OE1 . GLU A 1 129 ? 12.987 36.536 13.013 1.00 34.66  ? 210 GLU A OE1 1 
ATOM   897  O  OE2 . GLU A 1 129 ? 13.001 38.086 14.581 1.00 36.40  ? 210 GLU A OE2 1 
ATOM   898  N  N   . THR A 1 130 ? 17.368 40.693 15.947 1.00 23.23  ? 211 THR A N   1 
ATOM   899  C  CA  . THR A 1 130 ? 17.760 42.046 16.344 1.00 24.68  ? 211 THR A CA  1 
ATOM   900  C  C   . THR A 1 130 ? 19.250 42.334 16.119 1.00 23.87  ? 211 THR A C   1 
ATOM   901  O  O   . THR A 1 130 ? 19.570 43.336 15.521 1.00 24.08  ? 211 THR A O   1 
ATOM   902  C  CB  . THR A 1 130 ? 17.368 42.328 17.852 1.00 24.45  ? 211 THR A CB  1 
ATOM   903  O  OG1 . THR A 1 130 ? 15.953 42.123 18.018 1.00 27.73  ? 211 THR A OG1 1 
ATOM   904  C  CG2 . THR A 1 130 ? 17.504 43.832 18.193 1.00 26.82  ? 211 THR A CG2 1 
ATOM   905  N  N   . TYR A 1 131 ? 20.147 41.493 16.644 1.00 23.25  ? 212 TYR A N   1 
ATOM   906  C  CA  . TYR A 1 131 ? 21.587 41.669 16.374 1.00 23.41  ? 212 TYR A CA  1 
ATOM   907  C  C   . TYR A 1 131 ? 21.905 41.588 14.873 1.00 22.64  ? 212 TYR A C   1 
ATOM   908  O  O   . TYR A 1 131 ? 22.677 42.395 14.364 1.00 23.64  ? 212 TYR A O   1 
ATOM   909  C  CB  . TYR A 1 131 ? 22.430 40.668 17.154 1.00 23.37  ? 212 TYR A CB  1 
ATOM   910  C  CG  . TYR A 1 131 ? 22.621 41.123 18.582 1.00 25.12  ? 212 TYR A CG  1 
ATOM   911  C  CD1 . TYR A 1 131 ? 23.596 42.087 18.914 1.00 26.85  ? 212 TYR A CD1 1 
ATOM   912  C  CD2 . TYR A 1 131 ? 21.840 40.586 19.611 1.00 27.81  ? 212 TYR A CD2 1 
ATOM   913  C  CE1 . TYR A 1 131 ? 23.775 42.502 20.252 1.00 29.15  ? 212 TYR A CE1 1 
ATOM   914  C  CE2 . TYR A 1 131 ? 22.015 40.995 20.940 1.00 27.70  ? 212 TYR A CE2 1 
ATOM   915  C  CZ  . TYR A 1 131 ? 22.957 41.958 21.245 1.00 29.32  ? 212 TYR A CZ  1 
ATOM   916  O  OH  . TYR A 1 131 ? 23.091 42.358 22.554 1.00 33.93  ? 212 TYR A OH  1 
ATOM   917  N  N   . LYS A 1 132 ? 21.262 40.670 14.161 1.00 21.84  ? 213 LYS A N   1 
ATOM   918  C  CA  . LYS A 1 132 ? 21.439 40.583 12.709 1.00 21.28  ? 213 LYS A CA  1 
ATOM   919  C  C   . LYS A 1 132 ? 21.009 41.852 11.944 1.00 20.66  ? 213 LYS A C   1 
ATOM   920  O  O   . LYS A 1 132 ? 21.472 42.106 10.818 1.00 20.85  ? 213 LYS A O   1 
ATOM   921  C  CB  . LYS A 1 132 ? 20.736 39.309 12.157 1.00 20.61  ? 213 LYS A CB  1 
ATOM   922  C  CG  . LYS A 1 132 ? 20.853 39.130 10.616 1.00 21.41  ? 213 LYS A CG  1 
ATOM   923  C  CD  . LYS A 1 132 ? 22.299 38.841 10.252 1.00 24.07  ? 213 LYS A CD  1 
ATOM   924  C  CE  . LYS A 1 132 ? 22.526 38.854 8.742  1.00 27.44  ? 213 LYS A CE  1 
ATOM   925  N  NZ  . LYS A 1 132 ? 23.959 38.547 8.511  1.00 26.49  ? 213 LYS A NZ  1 
ATOM   926  N  N   . ALA A 1 133 ? 20.133 42.671 12.530 1.00 20.88  ? 214 ALA A N   1 
ATOM   927  C  CA  . ALA A 1 133 ? 19.658 43.884 11.838 1.00 20.74  ? 214 ALA A CA  1 
ATOM   928  C  C   . ALA A 1 133 ? 20.782 44.890 11.623 1.00 20.68  ? 214 ALA A C   1 
ATOM   929  O  O   . ALA A 1 133 ? 20.678 45.717 10.732 1.00 18.85  ? 214 ALA A O   1 
ATOM   930  C  CB  . ALA A 1 133 ? 18.494 44.563 12.605 1.00 21.47  ? 214 ALA A CB  1 
ATOM   931  N  N   . TYR A 1 134 ? 21.840 44.833 12.447 1.00 19.79  ? 215 TYR A N   1 
ATOM   932  C  CA  . TYR A 1 134 ? 22.888 45.867 12.424 1.00 21.54  ? 215 TYR A CA  1 
ATOM   933  C  C   . TYR A 1 134 ? 24.279 45.369 12.012 1.00 22.56  ? 215 TYR A C   1 
ATOM   934  O  O   . TYR A 1 134 ? 24.735 44.327 12.476 1.00 24.95  ? 215 TYR A O   1 
ATOM   935  C  CB  . TYR A 1 134 ? 22.995 46.578 13.783 1.00 21.78  ? 215 TYR A CB  1 
ATOM   936  C  CG  . TYR A 1 134 ? 21.687 47.120 14.314 1.00 22.29  ? 215 TYR A CG  1 
ATOM   937  C  CD1 . TYR A 1 134 ? 21.200 48.444 13.885 1.00 22.50  ? 215 TYR A CD1 1 
ATOM   938  C  CD2 . TYR A 1 134 ? 20.929 46.354 15.232 1.00 23.82  ? 215 TYR A CD2 1 
ATOM   939  C  CE1 . TYR A 1 134 ? 20.007 48.963 14.363 1.00 22.90  ? 215 TYR A CE1 1 
ATOM   940  C  CE2 . TYR A 1 134 ? 19.730 46.855 15.727 1.00 23.38  ? 215 TYR A CE2 1 
ATOM   941  C  CZ  . TYR A 1 134 ? 19.266 48.169 15.272 1.00 25.34  ? 215 TYR A CZ  1 
ATOM   942  O  OH  . TYR A 1 134 ? 18.074 48.714 15.687 1.00 26.61  ? 215 TYR A OH  1 
ATOM   943  N  N   . GLU A 1 135 ? 24.947 46.132 11.168 1.00 23.34  ? 216 GLU A N   1 
ATOM   944  C  CA  . GLU A 1 135 ? 26.335 45.901 10.842 1.00 23.91  ? 216 GLU A CA  1 
ATOM   945  C  C   . GLU A 1 135 ? 27.129 46.650 11.862 1.00 23.71  ? 216 GLU A C   1 
ATOM   946  O  O   . GLU A 1 135 ? 27.012 47.904 11.936 1.00 22.51  ? 216 GLU A O   1 
ATOM   947  C  CB  . GLU A 1 135 ? 26.674 46.499 9.479  1.00 24.76  ? 216 GLU A CB  1 
ATOM   948  C  CG  . GLU A 1 135 ? 26.079 45.798 8.295  1.00 26.98  ? 216 GLU A CG  1 
ATOM   949  C  CD  . GLU A 1 135 ? 26.637 46.346 6.980  1.00 29.39  ? 216 GLU A CD  1 
ATOM   950  O  OE1 . GLU A 1 135 ? 26.634 45.603 5.966  1.00 32.78  ? 216 GLU A OE1 1 
ATOM   951  O  OE2 . GLU A 1 135 ? 27.087 47.514 6.947  1.00 30.94  ? 216 GLU A OE2 1 
ATOM   952  N  N   . GLN A 1 136 ? 27.954 45.894 12.630 1.00 24.06  ? 217 GLN A N   1 
ATOM   953  C  CA  . GLN A 1 136 ? 28.871 46.523 13.588 1.00 25.91  ? 217 GLN A CA  1 
ATOM   954  C  C   . GLN A 1 136 ? 29.826 47.507 12.978 1.00 26.81  ? 217 GLN A C   1 
ATOM   955  O  O   . GLN A 1 136 ? 30.157 48.519 13.590 1.00 27.81  ? 217 GLN A O   1 
ATOM   956  C  CB  . GLN A 1 136 ? 29.685 45.459 14.336 1.00 24.42  ? 217 GLN A CB  1 
ATOM   957  C  CG  . GLN A 1 136 ? 28.843 44.672 15.306 1.00 25.72  ? 217 GLN A CG  1 
ATOM   958  C  CD  . GLN A 1 136 ? 27.848 45.559 16.041 1.00 22.15  ? 217 GLN A CD  1 
ATOM   959  O  OE1 . GLN A 1 136 ? 26.626 45.350 15.971 1.00 23.19  ? 217 GLN A OE1 1 
ATOM   960  N  NE2 . GLN A 1 136 ? 28.354 46.553 16.708 1.00 19.27  ? 217 GLN A NE2 1 
ATOM   961  N  N   . LYS A 1 137 ? 30.279 47.192 11.766 1.00 29.61  ? 218 LYS A N   1 
ATOM   962  C  CA  . LYS A 1 137 ? 31.130 48.126 11.052 1.00 32.66  ? 218 LYS A CA  1 
ATOM   963  C  C   . LYS A 1 137 ? 30.411 48.257 9.687  1.00 34.36  ? 218 LYS A C   1 
ATOM   964  O  O   . LYS A 1 137 ? 30.754 47.557 8.715  1.00 35.50  ? 218 LYS A O   1 
ATOM   965  C  CB  . LYS A 1 137 ? 32.540 47.543 10.872 1.00 32.59  ? 218 LYS A CB  1 
ATOM   966  C  CG  . LYS A 1 137 ? 33.562 48.088 11.867 1.00 34.40  ? 218 LYS A CG  1 
ATOM   967  C  CD  . LYS A 1 137 ? 34.221 46.954 12.630 1.00 36.79  ? 218 LYS A CD  1 
ATOM   968  C  CE  . LYS A 1 137 ? 33.437 46.594 13.880 1.00 38.25  ? 218 LYS A CE  1 
ATOM   969  N  NZ  . LYS A 1 137 ? 33.563 45.145 14.241 1.00 38.37  ? 218 LYS A NZ  1 
ATOM   970  N  N   . PRO A 1 138 ? 29.387 49.122 9.612  1.00 36.40  ? 219 PRO A N   1 
ATOM   971  C  CA  . PRO A 1 138 ? 28.710 49.374 8.343  1.00 37.82  ? 219 PRO A CA  1 
ATOM   972  C  C   . PRO A 1 138 ? 29.674 49.961 7.359  1.00 38.47  ? 219 PRO A C   1 
ATOM   973  O  O   . PRO A 1 138 ? 30.751 50.499 7.774  1.00 40.40  ? 219 PRO A O   1 
ATOM   974  C  CB  . PRO A 1 138 ? 27.670 50.445 8.708  1.00 37.77  ? 219 PRO A CB  1 
ATOM   975  C  CG  . PRO A 1 138 ? 28.258 51.129 9.864  1.00 37.10  ? 219 PRO A CG  1 
ATOM   976  C  CD  . PRO A 1 138 ? 28.820 49.953 10.692 1.00 36.21  ? 219 PRO A CD  1 
ATOM   977  N  N   . ALA A 1 139 ? 29.306 49.894 6.069  1.00 39.94  ? 220 ALA A N   1 
ATOM   978  C  CA  . ALA A 1 139 ? 30.024 50.688 5.059  1.00 40.06  ? 220 ALA A CA  1 
ATOM   979  C  C   . ALA A 1 139 ? 30.209 52.134 5.616  1.00 41.10  ? 220 ALA A C   1 
ATOM   980  O  O   . ALA A 1 139 ? 29.253 52.756 6.444  1.00 42.27  ? 220 ALA A O   1 
ATOM   981  C  CB  . ALA A 1 139 ? 29.255 50.681 3.710  1.00 40.15  ? 220 ALA A CB  1 
ATOM   982  N  N   . ASP A 1 140 ? 31.473 52.635 5.177  1.00 41.37  ? 221 ASP A N   1 
ATOM   983  C  CA  . ASP A 1 140 ? 31.815 54.038 5.342  1.00 41.17  ? 221 ASP A CA  1 
ATOM   984  C  C   . ASP A 1 140 ? 32.083 54.575 3.944  1.00 41.10  ? 221 ASP A C   1 
ATOM   985  O  O   . ASP A 1 140 ? 33.230 54.495 3.430  1.00 41.71  ? 221 ASP A O   1 
ATOM   986  C  CB  . ASP A 1 140 ? 33.040 54.166 6.254  1.00 40.98  ? 221 ASP A CB  1 
ATOM   987  C  CG  . ASP A 1 140 ? 33.531 55.597 6.398  1.00 40.61  ? 221 ASP A CG  1 
ATOM   988  O  OD1 . ASP A 1 140 ? 32.845 56.540 5.923  1.00 41.55  ? 221 ASP A OD1 1 
ATOM   989  O  OD2 . ASP A 1 140 ? 34.600 55.877 6.977  1.00 41.24  ? 221 ASP A OD2 1 
ATOM   990  N  N   . LEU A 1 141 ? 31.007 55.112 3.334  1.00 41.45  ? 222 LEU A N   1 
ATOM   991  C  CA  . LEU A 1 141 ? 31.039 55.595 1.953  1.00 42.01  ? 222 LEU A CA  1 
ATOM   992  C  C   . LEU A 1 141 ? 31.990 56.765 1.636  1.00 42.74  ? 222 LEU A C   1 
ATOM   993  O  O   . LEU A 1 141 ? 32.627 56.756 0.569  1.00 42.77  ? 222 LEU A O   1 
ATOM   994  C  CB  . LEU A 1 141 ? 29.632 55.958 1.477  1.00 41.65  ? 222 LEU A CB  1 
ATOM   995  C  CG  . LEU A 1 141 ? 28.495 54.949 1.582  1.00 40.21  ? 222 LEU A CG  1 
ATOM   996  C  CD1 . LEU A 1 141 ? 27.209 55.636 1.019  1.00 39.66  ? 222 LEU A CD1 1 
ATOM   997  C  CD2 . LEU A 1 141 ? 28.846 53.617 0.810  1.00 39.58  ? 222 LEU A CD2 1 
ATOM   998  N  N   . LEU A 1 142 ? 32.069 57.772 2.539  1.00 44.07  ? 223 LEU A N   1 
ATOM   999  C  CA  . LEU A 1 142 ? 32.802 59.048 2.259  1.00 45.93  ? 223 LEU A CA  1 
ATOM   1000 C  C   . LEU A 1 142 ? 34.302 58.851 2.058  1.00 47.74  ? 223 LEU A C   1 
ATOM   1001 O  O   . LEU A 1 142 ? 34.902 59.449 1.164  1.00 47.58  ? 223 LEU A O   1 
ATOM   1002 C  CB  . LEU A 1 142 ? 32.570 60.099 3.379  1.00 45.35  ? 223 LEU A CB  1 
ATOM   1003 C  CG  . LEU A 1 142 ? 31.141 60.655 3.582  1.00 44.44  ? 223 LEU A CG  1 
ATOM   1004 C  CD1 . LEU A 1 142 ? 31.148 61.765 4.607  1.00 43.59  ? 223 LEU A CD1 1 
ATOM   1005 C  CD2 . LEU A 1 142 ? 30.547 61.156 2.273  1.00 43.22  ? 223 LEU A CD2 1 
ATOM   1006 N  N   . MET A 1 143 ? 34.898 58.015 2.911  1.00 50.43  ? 224 MET A N   1 
ATOM   1007 C  CA  . MET A 1 143 ? 36.270 57.576 2.727  1.00 52.96  ? 224 MET A CA  1 
ATOM   1008 C  C   . MET A 1 143 ? 36.433 56.830 1.401  1.00 53.11  ? 224 MET A C   1 
ATOM   1009 O  O   . MET A 1 143 ? 37.361 57.105 0.638  1.00 53.91  ? 224 MET A O   1 
ATOM   1010 C  CB  . MET A 1 143 ? 36.683 56.686 3.901  1.00 54.03  ? 224 MET A CB  1 
ATOM   1011 C  CG  . MET A 1 143 ? 37.990 57.136 4.538  1.00 59.16  ? 224 MET A CG  1 
ATOM   1012 S  SD  . MET A 1 143 ? 37.918 58.853 5.139  1.00 70.67  ? 224 MET A SD  1 
ATOM   1013 C  CE  . MET A 1 143 ? 37.911 58.593 7.017  1.00 68.62  ? 224 MET A CE  1 
ATOM   1014 N  N   . GLU A 1 144 ? 35.500 55.920 1.128  1.00 53.01  ? 225 GLU A N   1 
ATOM   1015 C  CA  . GLU A 1 144 ? 35.492 55.142 -0.102 1.00 53.84  ? 225 GLU A CA  1 
ATOM   1016 C  C   . GLU A 1 144 ? 35.474 56.013 -1.380 1.00 53.23  ? 225 GLU A C   1 
ATOM   1017 O  O   . GLU A 1 144 ? 36.156 55.706 -2.365 1.00 52.95  ? 225 GLU A O   1 
ATOM   1018 C  CB  . GLU A 1 144 ? 34.254 54.264 -0.092 1.00 53.97  ? 225 GLU A CB  1 
ATOM   1019 C  CG  . GLU A 1 144 ? 34.140 53.282 -1.239 1.00 58.20  ? 225 GLU A CG  1 
ATOM   1020 C  CD  . GLU A 1 144 ? 32.826 52.523 -1.197 1.00 62.64  ? 225 GLU A CD  1 
ATOM   1021 O  OE1 . GLU A 1 144 ? 32.037 52.694 -2.162 1.00 65.78  ? 225 GLU A OE1 1 
ATOM   1022 O  OE2 . GLU A 1 144 ? 32.578 51.772 -0.206 1.00 61.99  ? 225 GLU A OE2 1 
ATOM   1023 N  N   . LYS A 1 145 ? 34.683 57.092 -1.335 1.00 51.11  ? 226 LYS A N   1 
ATOM   1024 C  CA  . LYS A 1 145 ? 34.415 57.931 -2.486 1.00 49.95  ? 226 LYS A CA  1 
ATOM   1025 C  C   . LYS A 1 145 ? 35.686 58.677 -2.893 1.00 50.71  ? 226 LYS A C   1 
ATOM   1026 O  O   . LYS A 1 145 ? 35.876 58.990 -4.070 1.00 51.57  ? 226 LYS A O   1 
ATOM   1027 C  CB  . LYS A 1 145 ? 33.269 58.908 -2.164 1.00 48.99  ? 226 LYS A CB  1 
ATOM   1028 C  CG  . LYS A 1 145 ? 32.686 59.668 -3.346 1.00 45.72  ? 226 LYS A CG  1 
ATOM   1029 C  CD  . LYS A 1 145 ? 31.965 58.756 -4.336 1.00 46.26  ? 226 LYS A CD  1 
ATOM   1030 C  CE  . LYS A 1 145 ? 31.177 59.573 -5.323 1.00 43.98  ? 226 LYS A CE  1 
ATOM   1031 N  NZ  . LYS A 1 145 ? 30.722 58.706 -6.432 1.00 43.81  ? 226 LYS A NZ  1 
ATOM   1032 N  N   . LEU A 1 146 ? 36.532 58.942 -1.899 1.00 50.41  ? 227 LEU A N   1 
ATOM   1033 C  CA  . LEU A 1 146 ? 37.779 59.674 -2.025 1.00 51.06  ? 227 LEU A CA  1 
ATOM   1034 C  C   . LEU A 1 146 ? 38.952 58.788 -2.520 1.00 50.56  ? 227 LEU A C   1 
ATOM   1035 O  O   . LEU A 1 146 ? 39.698 59.016 -3.493 1.00 50.57  ? 227 LEU A O   1 
ATOM   1036 C  CB  . LEU A 1 146 ? 38.108 60.265 -0.654 1.00 50.89  ? 227 LEU A CB  1 
ATOM   1037 C  CG  . LEU A 1 146 ? 37.896 61.769 -0.389 1.00 51.57  ? 227 LEU A CG  1 
ATOM   1038 C  CD1 . LEU A 1 146 ? 36.845 62.432 -1.271 1.00 47.99  ? 227 LEU A CD1 1 
ATOM   1039 C  CD2 . LEU A 1 146 ? 37.678 62.071 1.093  1.00 49.63  ? 227 LEU A CD2 1 
HETATM 1040 HG HG  . HG  B 2 .   ? 30.143 34.655 20.548 0.60 76.35  ? 1   HG  A HG  1 
HETATM 1041 O  O   . HOH C 3 .   ? 15.486 26.793 23.204 1.00 31.71  ? 228 HOH A O   1 
HETATM 1042 O  O   . HOH C 3 .   ? 27.918 25.102 30.685 1.00 38.51  ? 229 HOH A O   1 
HETATM 1043 O  O   . HOH C 3 .   ? 23.446 25.451 22.763 1.00 35.24  ? 230 HOH A O   1 
HETATM 1044 O  O   . HOH C 3 .   ? 19.602 40.672 29.588 1.00 47.81  ? 231 HOH A O   1 
HETATM 1045 O  O   . HOH C 3 .   ? 21.172 28.885 39.872 1.00 41.45  ? 232 HOH A O   1 
HETATM 1046 O  O   . HOH C 3 .   ? 27.828 54.106 7.364  1.00 52.92  ? 233 HOH A O   1 
HETATM 1047 O  O   . HOH C 3 .   ? 23.281 18.550 13.820 1.00 44.70  ? 234 HOH A O   1 
HETATM 1048 O  O   . HOH C 3 .   ? 17.154 23.341 26.160 1.00 38.55  ? 235 HOH A O   1 
HETATM 1049 O  O   . HOH C 3 .   ? 33.024 28.124 20.602 1.00 57.59  ? 236 HOH A O   1 
HETATM 1050 O  O   . HOH C 3 .   ? 19.294 20.526 34.804 1.00 50.36  ? 237 HOH A O   1 
HETATM 1051 O  O   . HOH C 3 .   ? 20.244 48.452 10.484 1.00 34.52  ? 238 HOH A O   1 
HETATM 1052 O  O   . HOH C 3 .   ? 16.788 19.664 10.840 1.00 48.19  ? 239 HOH A O   1 
HETATM 1053 O  O   . HOH C 3 .   ? 14.337 23.584 15.643 1.00 45.73  ? 240 HOH A O   1 
HETATM 1054 O  O   . HOH C 3 .   ? 30.830 51.331 14.456 1.00 52.01  ? 241 HOH A O   1 
HETATM 1055 O  O   . HOH C 3 .   ? 24.686 48.732 7.236  1.00 40.96  ? 242 HOH A O   1 
HETATM 1056 O  O   . HOH C 3 .   ? 8.858  30.523 22.894 1.00 39.96  ? 243 HOH A O   1 
HETATM 1057 O  O   . HOH C 3 .   ? 17.215 41.487 11.288 1.00 47.74  ? 244 HOH A O   1 
HETATM 1058 O  O   . HOH C 3 .   ? 28.401 42.983 11.398 1.00 51.95  ? 245 HOH A O   1 
HETATM 1059 O  O   . HOH C 3 .   ? 26.716 27.131 23.297 1.00 36.94  ? 246 HOH A O   1 
HETATM 1060 O  O   . HOH C 3 .   ? 31.577 26.352 32.117 1.00 49.15  ? 247 HOH A O   1 
HETATM 1061 O  O   . HOH C 3 .   ? 16.340 22.038 14.024 1.00 38.81  ? 248 HOH A O   1 
HETATM 1062 O  O   . HOH C 3 .   ? 18.066 41.883 8.640  1.00 46.99  ? 249 HOH A O   1 
HETATM 1063 O  O   . HOH C 3 .   ? 25.551 36.116 9.222  1.00 56.23  ? 250 HOH A O   1 
HETATM 1064 O  O   . HOH C 3 .   ? 26.131 42.345 29.204 1.00 49.39  ? 251 HOH A O   1 
HETATM 1065 O  O   . HOH C 3 .   ? 30.679 36.016 44.245 1.00 62.40  ? 252 HOH A O   1 
HETATM 1066 O  O   . HOH C 3 .   ? 38.756 55.625 -3.092 1.00 76.33  ? 253 HOH A O   1 
HETATM 1067 O  O   . HOH C 3 .   ? 14.098 32.293 8.584  1.00 44.06  ? 254 HOH A O   1 
HETATM 1068 O  O   . HOH C 3 .   ? 20.153 30.096 42.695 1.00 58.60  ? 255 HOH A O   1 
HETATM 1069 O  O   . HOH C 3 .   ? 25.271 49.774 11.283 1.00 40.74  ? 256 HOH A O   1 
HETATM 1070 O  O   . HOH C 3 .   ? 13.247 24.918 12.683 1.00 50.01  ? 257 HOH A O   1 
HETATM 1071 O  O   . HOH C 3 .   ? 11.768 31.260 31.638 1.00 44.23  ? 258 HOH A O   1 
HETATM 1072 O  O   . HOH C 3 .   ? 22.070 26.482 35.347 1.00 41.08  ? 259 HOH A O   1 
HETATM 1073 O  O   . HOH C 3 .   ? 18.179 42.479 29.818 1.00 57.58  ? 260 HOH A O   1 
HETATM 1074 O  O   . HOH C 3 .   ? 27.386 47.310 19.326 1.00 44.75  ? 261 HOH A O   1 
HETATM 1075 O  O   . HOH C 3 .   ? 32.448 41.070 22.791 1.00 43.83  ? 262 HOH A O   1 
HETATM 1076 O  O   . HOH C 3 .   ? 38.244 59.292 -5.342 1.00 56.11  ? 263 HOH A O   1 
HETATM 1077 O  O   . HOH C 3 .   ? 40.164 27.119 27.183 1.00 83.26  ? 264 HOH A O   1 
HETATM 1078 O  O   . HOH C 3 .   ? 35.579 33.857 31.402 1.00 43.82  ? 265 HOH A O   1 
HETATM 1079 O  O   . HOH C 3 .   ? 34.146 36.672 24.770 1.00 63.00  ? 266 HOH A O   1 
HETATM 1080 O  O   . HOH C 3 .   ? 27.395 28.148 5.201  1.00 54.20  ? 267 HOH A O   1 
HETATM 1081 O  O   . HOH C 3 .   ? 34.562 58.740 6.405  1.00 82.22  ? 268 HOH A O   1 
HETATM 1082 O  O   . HOH C 3 .   ? 20.523 24.875 6.384  1.00 48.53  ? 269 HOH A O   1 
HETATM 1083 O  O   . HOH C 3 .   ? 31.062 54.209 8.719  1.00 56.03  ? 270 HOH A O   1 
HETATM 1084 O  O   . HOH C 3 .   ? 32.599 51.115 9.012  1.00 61.47  ? 271 HOH A O   1 
HETATM 1085 O  O   . HOH C 3 .   ? 15.428 43.286 25.392 1.00 55.68  ? 272 HOH A O   1 
HETATM 1086 O  O   . HOH C 3 .   ? 24.111 26.071 2.071  1.00 63.91  ? 273 HOH A O   1 
HETATM 1087 O  O   . HOH C 3 .   ? 22.507 41.442 3.737  1.00 76.34  ? 274 HOH A O   1 
HETATM 1088 O  O   . HOH C 3 .   ? 30.635 19.807 31.461 1.00 60.34  ? 275 HOH A O   1 
HETATM 1089 O  O   . HOH C 3 .   ? 26.892 48.758 4.693  1.00 57.77  ? 276 HOH A O   1 
HETATM 1090 O  O   . HOH C 3 .   ? 33.189 43.149 30.225 1.00 55.19  ? 277 HOH A O   1 
HETATM 1091 O  O   . HOH C 3 .   ? 35.702 31.641 29.512 1.00 56.41  ? 278 HOH A O   1 
HETATM 1092 O  O   . HOH C 3 .   ? 14.809 42.047 20.939 1.00 55.13  ? 279 HOH A O   1 
HETATM 1093 O  O   . HOH C 3 .   ? 35.991 32.793 33.807 1.00 47.87  ? 280 HOH A O   1 
HETATM 1094 O  O   . HOH C 3 .   ? 31.421 58.804 6.481  1.00 54.84  ? 281 HOH A O   1 
HETATM 1095 O  O   . HOH C 3 .   ? 31.262 19.547 28.741 1.00 61.32  ? 282 HOH A O   1 
HETATM 1096 O  O   . HOH C 3 .   ? 30.436 42.707 24.147 1.00 46.11  ? 283 HOH A O   1 
HETATM 1097 O  O   . HOH C 3 .   ? 34.178 46.576 16.938 1.00 79.96  ? 284 HOH A O   1 
HETATM 1098 O  O   . HOH C 3 .   ? 25.742 20.744 21.981 1.00 65.06  ? 285 HOH A O   1 
HETATM 1099 O  O   . HOH C 3 .   ? 12.994 29.208 10.950 1.00 55.56  ? 286 HOH A O   1 
HETATM 1100 O  O   . HOH C 3 .   ? 20.343 42.759 8.493  1.00 45.18  ? 287 HOH A O   1 
HETATM 1101 O  O   . HOH C 3 .   ? 35.710 35.551 18.969 1.00 68.82  ? 288 HOH A O   1 
HETATM 1102 O  O   . HOH C 3 .   ? 34.063 34.402 42.242 1.00 59.13  ? 289 HOH A O   1 
HETATM 1103 O  O   . HOH C 3 .   ? 33.108 48.747 0.128  1.00 69.10  ? 290 HOH A O   1 
HETATM 1104 O  O   . HOH C 3 .   ? 15.526 39.987 31.804 1.00 59.85  ? 291 HOH A O   1 
HETATM 1105 O  O   . HOH C 3 .   ? 29.615 28.373 36.003 1.00 50.30  ? 292 HOH A O   1 
HETATM 1106 O  O   . HOH C 3 .   ? 28.859 58.088 -8.967 1.00 58.84  ? 293 HOH A O   1 
HETATM 1107 O  O   . HOH C 3 .   ? 6.610  31.199 22.163 1.00 49.52  ? 294 HOH A O   1 
HETATM 1108 O  O   . HOH C 3 .   ? 20.635 26.920 37.990 1.00 54.12  ? 295 HOH A O   1 
HETATM 1109 O  O   . HOH C 3 .   ? 23.875 25.527 37.074 1.00 55.40  ? 296 HOH A O   1 
HETATM 1110 O  O   . HOH C 3 .   ? 28.349 19.234 26.672 1.00 54.18  ? 297 HOH A O   1 
HETATM 1111 O  O   . HOH C 3 .   ? 29.098 25.259 5.576  1.00 57.57  ? 298 HOH A O   1 
HETATM 1112 O  O   . HOH C 3 .   ? 35.697 43.673 13.211 1.00 68.26  ? 299 HOH A O   1 
HETATM 1113 O  O   . HOH C 3 .   ? 13.941 39.710 22.267 1.00 47.30  ? 300 HOH A O   1 
HETATM 1114 O  O   . HOH C 3 .   ? 24.621 23.007 22.826 1.00 61.32  ? 301 HOH A O   1 
HETATM 1115 O  O   . HOH C 3 .   ? 36.339 43.008 21.015 1.00 66.53  ? 302 HOH A O   1 
HETATM 1116 O  O   . HOH C 3 .   ? 12.675 30.609 39.813 1.00 79.66  ? 303 HOH A O   1 
HETATM 1117 O  O   . HOH C 3 .   ? 13.104 40.839 24.531 1.00 59.00  ? 304 HOH A O   1 
HETATM 1118 O  O   . HOH C 3 .   ? 31.897 31.983 36.729 1.00 53.12  ? 305 HOH A O   1 
HETATM 1119 O  O   . HOH C 3 .   ? 23.985 44.011 27.972 1.00 64.44  ? 306 HOH A O   1 
HETATM 1120 O  O   . HOH C 3 .   ? 32.195 43.456 11.486 1.00 59.84  ? 307 HOH A O   1 
HETATM 1121 O  O   . HOH C 3 .   ? 23.886 28.323 0.648  1.00 68.44  ? 308 HOH A O   1 
HETATM 1122 O  O   . HOH C 3 .   ? 27.301 32.514 43.587 1.00 102.20 ? 309 HOH A O   1 
HETATM 1123 O  O   . HOH C 3 .   ? 30.415 41.876 12.632 1.00 47.14  ? 310 HOH A O   1 
HETATM 1124 O  O   . HOH C 3 .   ? 30.128 44.691 10.334 1.00 48.60  ? 311 HOH A O   1 
HETATM 1125 O  O   . HOH C 3 .   ? 30.051 32.202 40.725 1.00 57.13  ? 312 HOH A O   1 
HETATM 1126 O  O   . HOH C 3 .   ? 33.518 29.255 33.155 1.00 61.38  ? 313 HOH A O   1 
HETATM 1127 O  O   . HOH C 3 .   ? 30.489 24.952 16.584 1.00 53.74  ? 314 HOH A O   1 
HETATM 1128 O  O   . HOH C 3 .   ? 40.309 29.686 30.914 1.00 74.71  ? 315 HOH A O   1 
HETATM 1129 O  O   . HOH C 3 .   ? 34.717 42.870 11.012 1.00 70.51  ? 316 HOH A O   1 
HETATM 1130 O  O   . HOH C 3 .   ? 13.627 40.588 11.377 1.00 71.58  ? 317 HOH A O   1 
HETATM 1131 O  O   . HOH C 3 .   ? 9.047  37.596 20.906 1.00 65.95  ? 318 HOH A O   1 
HETATM 1132 O  O   . HOH C 3 .   ? 29.686 32.518 45.352 1.00 65.00  ? 319 HOH A O   1 
HETATM 1133 O  O   . HOH C 3 .   ? 38.932 39.046 27.932 1.00 56.75  ? 320 HOH A O   1 
HETATM 1134 O  O   . HOH C 3 .   ? 10.917 35.842 16.690 1.00 63.11  ? 321 HOH A O   1 
HETATM 1135 O  O   . HOH C 3 .   ? 26.407 24.505 36.419 1.00 58.38  ? 322 HOH A O   1 
HETATM 1136 O  O   . HOH C 3 .   ? 29.306 17.188 29.596 1.00 74.12  ? 323 HOH A O   1 
HETATM 1137 O  O   . HOH C 3 .   ? 29.510 25.656 35.760 1.00 63.33  ? 324 HOH A O   1 
HETATM 1138 O  O   . HOH C 3 .   ? 20.163 40.224 6.691  1.00 59.15  ? 325 HOH A O   1 
HETATM 1139 O  O   . HOH C 3 .   ? 32.270 21.929 23.287 1.00 55.87  ? 326 HOH A O   1 
HETATM 1140 O  O   . HOH C 3 .   ? 21.584 24.766 36.979 1.00 76.88  ? 327 HOH A O   1 
HETATM 1141 O  O   . HOH C 3 .   ? 40.410 56.023 -1.551 1.00 67.16  ? 328 HOH A O   1 
HETATM 1142 O  O   . HOH C 3 .   ? 33.562 30.358 12.462 1.00 54.33  ? 329 HOH A O   1 
HETATM 1143 O  O   . HOH C 3 .   ? 14.651 39.472 27.904 1.00 44.21  ? 330 HOH A O   1 
HETATM 1144 O  O   . HOH C 3 .   ? 31.869 60.759 8.222  1.00 58.03  ? 331 HOH A O   1 
HETATM 1145 O  O   . HOH C 3 .   ? 21.560 40.754 1.492  1.00 85.63  ? 332 HOH A O   1 
HETATM 1146 O  O   . HOH C 3 .   ? 8.077  36.621 23.169 1.00 68.04  ? 333 HOH A O   1 
HETATM 1147 O  O   . HOH C 3 .   ? 34.721 52.048 1.408  1.00 61.68  ? 334 HOH A O   1 
HETATM 1148 O  O   . HOH C 3 .   ? 12.807 43.737 20.640 1.00 61.10  ? 335 HOH A O   1 
HETATM 1149 O  O   . HOH C 3 .   ? 24.517 44.379 23.080 1.00 59.08  ? 336 HOH A O   1 
HETATM 1150 O  O   . HOH C 3 .   ? 24.056 37.502 1.539  1.00 87.24  ? 337 HOH A O   1 
HETATM 1151 O  O   . HOH C 3 .   ? 20.377 35.265 2.283  1.00 69.96  ? 338 HOH A O   1 
HETATM 1152 O  O   . HOH C 3 .   ? 33.262 50.688 4.325  1.00 69.13  ? 339 HOH A O   1 
HETATM 1153 O  O   . HOH C 3 .   ? 15.643 30.353 6.778  1.00 61.68  ? 340 HOH A O   1 
HETATM 1154 O  O   . HOH C 3 .   ? 35.185 36.296 12.045 1.00 70.49  ? 341 HOH A O   1 
HETATM 1155 O  O   . HOH C 3 .   ? 30.781 55.829 -2.221 1.00 59.87  ? 342 HOH A O   1 
HETATM 1156 O  O   . HOH C 3 .   ? 26.538 43.001 8.613  1.00 72.30  ? 343 HOH A O   1 
HETATM 1157 O  O   . HOH C 3 .   ? 16.825 25.952 7.020  1.00 64.74  ? 344 HOH A O   1 
HETATM 1158 O  O   . HOH C 3 .   ? 25.199 42.983 15.360 1.00 65.33  ? 345 HOH A O   1 
HETATM 1159 O  O   . HOH C 3 .   ? 12.877 35.307 5.890  1.00 54.79  ? 346 HOH A O   1 
HETATM 1160 O  O   . HOH C 3 .   ? 15.280 27.808 7.450  1.00 72.99  ? 347 HOH A O   1 
HETATM 1161 O  O   . HOH C 3 .   ? 24.994 38.350 5.683  1.00 55.44  ? 348 HOH A O   1 
HETATM 1162 O  O   . HOH C 3 .   ? 15.814 43.200 28.049 1.00 73.41  ? 349 HOH A O   1 
HETATM 1163 O  O   . HOH C 3 .   ? 31.111 56.783 -8.186 1.00 68.85  ? 350 HOH A O   1 
HETATM 1164 O  O   . HOH C 3 .   ? 29.493 46.406 7.436  1.00 85.22  ? 351 HOH A O   1 
HETATM 1165 O  O   . HOH C 3 .   ? 34.568 33.685 35.925 1.00 56.77  ? 352 HOH A O   1 
HETATM 1166 O  O   . HOH C 3 .   ? 23.961 24.408 24.884 1.00 74.88  ? 353 HOH A O   1 
HETATM 1167 O  O   . HOH C 3 .   ? 35.904 34.349 38.276 1.00 69.64  ? 354 HOH A O   1 
HETATM 1168 O  O   . HOH C 3 .   ? 36.009 32.155 15.458 1.00 87.55  ? 355 HOH A O   1 
HETATM 1169 O  O   . HOH C 3 .   ? 37.769 35.890 25.137 1.00 60.64  ? 356 HOH A O   1 
HETATM 1170 O  O   . HOH C 3 .   ? 21.075 35.051 31.417 1.00 111.53 ? 357 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   82  ?   ?   ?   A . n 
A 1 2   GLY 2   83  ?   ?   ?   A . n 
A 1 3   SER 3   84  ?   ?   ?   A . n 
A 1 4   SER 4   85  ?   ?   ?   A . n 
A 1 5   HIS 5   86  ?   ?   ?   A . n 
A 1 6   HIS 6   87  ?   ?   ?   A . n 
A 1 7   HIS 7   88  ?   ?   ?   A . n 
A 1 8   HIS 8   89  ?   ?   ?   A . n 
A 1 9   HIS 9   90  ?   ?   ?   A . n 
A 1 10  HIS 10  91  ?   ?   ?   A . n 
A 1 11  SER 11  92  ?   ?   ?   A . n 
A 1 12  GLN 12  93  ?   ?   ?   A . n 
A 1 13  ASP 13  94  ?   ?   ?   A . n 
A 1 14  PRO 14  95  ?   ?   ?   A . n 
A 1 15  ALA 15  96  ?   ?   ?   A . n 
A 1 16  LYS 16  97  ?   ?   ?   A . n 
A 1 17  SER 17  98  ?   ?   ?   A . n 
A 1 18  ASN 18  99  99  ASN ASN A . n 
A 1 19  SER 19  100 100 SER SER A . n 
A 1 20  ILE 20  101 101 ILE ILE A . n 
A 1 21  ILE 21  102 102 ILE ILE A . n 
A 1 22  VAL 22  103 103 VAL VAL A . n 
A 1 23  SER 23  104 104 SER SER A . n 
A 1 24  PRO 24  105 105 PRO PRO A . n 
A 1 25  ARG 25  106 106 ARG ARG A . n 
A 1 26  GLN 26  107 107 GLN GLN A . n 
A 1 27  ARG 27  108 108 ARG ARG A . n 
A 1 28  GLY 28  109 109 GLY GLY A . n 
A 1 29  ASN 29  110 110 ASN ASN A . n 
A 1 30  PRO 30  111 111 PRO PRO A . n 
A 1 31  VAL 31  112 112 VAL VAL A . n 
A 1 32  LEU 32  113 113 LEU LEU A . n 
A 1 33  LYS 33  114 114 LYS LYS A . n 
A 1 34  PHE 34  115 115 PHE PHE A . n 
A 1 35  VAL 35  116 116 VAL VAL A . n 
A 1 36  ARG 36  117 117 ARG ARG A . n 
A 1 37  ASN 37  118 118 ASN ASN A . n 
A 1 38  VAL 38  119 119 VAL VAL A . n 
A 1 39  PRO 39  120 120 PRO PRO A . n 
A 1 40  TRP 40  121 121 TRP TRP A . n 
A 1 41  GLU 41  122 122 GLU GLU A . n 
A 1 42  PHE 42  123 123 PHE PHE A . n 
A 1 43  GLY 43  124 124 GLY GLY A . n 
A 1 44  ASP 44  125 125 ASP ASP A . n 
A 1 45  VAL 45  126 126 VAL VAL A . n 
A 1 46  ILE 46  127 127 ILE ILE A . n 
A 1 47  PRO 47  128 128 PRO PRO A . n 
A 1 48  ASP 48  129 129 ASP ASP A . n 
A 1 49  TYR 49  130 130 TYR TYR A . n 
A 1 50  VAL 50  131 131 VAL VAL A . n 
A 1 51  LEU 51  132 132 LEU LEU A . n 
A 1 52  GLY 52  133 133 GLY GLY A . n 
A 1 53  GLN 53  134 134 GLN GLN A . n 
A 1 54  SER 54  135 135 SER SER A . n 
A 1 55  THR 55  136 136 THR THR A . n 
A 1 56  CYS 56  137 137 CYS CYS A . n 
A 1 57  ALA 57  138 138 ALA ALA A . n 
A 1 58  LEU 58  139 139 LEU LEU A . n 
A 1 59  PHE 59  140 140 PHE PHE A . n 
A 1 60  LEU 60  141 141 LEU LEU A . n 
A 1 61  SER 61  142 142 SER SER A . n 
A 1 62  LEU 62  143 143 LEU LEU A . n 
A 1 63  ARG 63  144 144 ARG ARG A . n 
A 1 64  TYR 64  145 145 TYR TYR A . n 
A 1 65  HIS 65  146 146 HIS HIS A . n 
A 1 66  ASN 66  147 147 ASN ASN A . n 
A 1 67  LEU 67  148 148 LEU LEU A . n 
A 1 68  HIS 68  149 149 HIS HIS A . n 
A 1 69  PRO 69  150 150 PRO PRO A . n 
A 1 70  ASP 70  151 151 ASP ASP A . n 
A 1 71  TYR 71  152 152 TYR TYR A . n 
A 1 72  ILE 72  153 153 ILE ILE A . n 
A 1 73  HIS 73  154 154 HIS HIS A . n 
A 1 74  GLY 74  155 155 GLY GLY A . n 
A 1 75  ARG 75  156 156 ARG ARG A . n 
A 1 76  LEU 76  157 157 LEU LEU A . n 
A 1 77  GLN 77  158 158 GLN GLN A . n 
A 1 78  SER 78  159 159 SER SER A . n 
A 1 79  LEU 79  160 160 LEU LEU A . n 
A 1 80  GLY 80  161 161 GLY GLY A . n 
A 1 81  LYS 81  162 162 LYS LYS A . n 
A 1 82  ASN 82  163 163 ASN ASN A . n 
A 1 83  PHE 83  164 164 PHE PHE A . n 
A 1 84  ALA 84  165 165 ALA ALA A . n 
A 1 85  LEU 85  166 166 LEU LEU A . n 
A 1 86  ARG 86  167 167 ARG ARG A . n 
A 1 87  VAL 87  168 168 VAL VAL A . n 
A 1 88  LEU 88  169 169 LEU LEU A . n 
A 1 89  LEU 89  170 170 LEU LEU A . n 
A 1 90  VAL 90  171 171 VAL VAL A . n 
A 1 91  GLN 91  172 172 GLN GLN A . n 
A 1 92  VAL 92  173 173 VAL VAL A . n 
A 1 93  ASP 93  174 174 ASP ASP A . n 
A 1 94  VAL 94  175 175 VAL VAL A . n 
A 1 95  LYS 95  176 176 LYS LYS A . n 
A 1 96  ASP 96  177 177 ASP ASP A . n 
A 1 97  PRO 97  178 178 PRO PRO A . n 
A 1 98  GLN 98  179 179 GLN GLN A . n 
A 1 99  GLN 99  180 180 GLN GLN A . n 
A 1 100 ALA 100 181 181 ALA ALA A . n 
A 1 101 LEU 101 182 182 LEU LEU A . n 
A 1 102 LYS 102 183 183 LYS LYS A . n 
A 1 103 GLU 103 184 184 GLU GLU A . n 
A 1 104 LEU 104 185 185 LEU LEU A . n 
A 1 105 ALA 105 186 186 ALA ALA A . n 
A 1 106 LYS 106 187 187 LYS LYS A . n 
A 1 107 MET 107 188 188 MET MET A . n 
A 1 108 CYS 108 189 189 CYS CYS A . n 
A 1 109 ILE 109 190 190 ILE ILE A . n 
A 1 110 LEU 110 191 191 LEU LEU A . n 
A 1 111 ALA 111 192 192 ALA ALA A . n 
A 1 112 ASP 112 193 193 ASP ASP A . n 
A 1 113 CYS 113 194 194 CYS CYS A . n 
A 1 114 THR 114 195 195 THR THR A . n 
A 1 115 LEU 115 196 196 LEU LEU A . n 
A 1 116 ILE 116 197 197 ILE ILE A . n 
A 1 117 LEU 117 198 198 LEU LEU A . n 
A 1 118 ALA 118 199 199 ALA ALA A . n 
A 1 119 TRP 119 200 200 TRP TRP A . n 
A 1 120 SER 120 201 201 SER SER A . n 
A 1 121 PRO 121 202 202 PRO PRO A . n 
A 1 122 GLU 122 203 203 GLU GLU A . n 
A 1 123 GLU 123 204 204 GLU GLU A . n 
A 1 124 ALA 124 205 205 ALA ALA A . n 
A 1 125 GLY 125 206 206 GLY GLY A . n 
A 1 126 ARG 126 207 207 ARG ARG A . n 
A 1 127 TYR 127 208 208 TYR TYR A . n 
A 1 128 LEU 128 209 209 LEU LEU A . n 
A 1 129 GLU 129 210 210 GLU GLU A . n 
A 1 130 THR 130 211 211 THR THR A . n 
A 1 131 TYR 131 212 212 TYR TYR A . n 
A 1 132 LYS 132 213 213 LYS LYS A . n 
A 1 133 ALA 133 214 214 ALA ALA A . n 
A 1 134 TYR 134 215 215 TYR TYR A . n 
A 1 135 GLU 135 216 216 GLU GLU A . n 
A 1 136 GLN 136 217 217 GLN GLN A . n 
A 1 137 LYS 137 218 218 LYS LYS A . n 
A 1 138 PRO 138 219 219 PRO PRO A . n 
A 1 139 ALA 139 220 220 ALA ALA A . n 
A 1 140 ASP 140 221 221 ASP ASP A . n 
A 1 141 LEU 141 222 222 LEU LEU A . n 
A 1 142 LEU 142 223 223 LEU LEU A . n 
A 1 143 MET 143 224 224 MET MET A . n 
A 1 144 GLU 144 225 225 GLU GLU A . n 
A 1 145 LYS 145 226 226 LYS LYS A . n 
A 1 146 LEU 146 227 227 LEU LEU A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HG  1   1   1   HG  HG  A . 
C 3 HOH 1   228 2   HOH HOH A . 
C 3 HOH 2   229 3   HOH HOH A . 
C 3 HOH 3   230 5   HOH HOH A . 
C 3 HOH 4   231 6   HOH HOH A . 
C 3 HOH 5   232 7   HOH HOH A . 
C 3 HOH 6   233 8   HOH HOH A . 
C 3 HOH 7   234 9   HOH HOH A . 
C 3 HOH 8   235 10  HOH HOH A . 
C 3 HOH 9   236 11  HOH HOH A . 
C 3 HOH 10  237 12  HOH HOH A . 
C 3 HOH 11  238 13  HOH HOH A . 
C 3 HOH 12  239 14  HOH HOH A . 
C 3 HOH 13  240 15  HOH HOH A . 
C 3 HOH 14  241 16  HOH HOH A . 
C 3 HOH 15  242 17  HOH HOH A . 
C 3 HOH 16  243 18  HOH HOH A . 
C 3 HOH 17  244 19  HOH HOH A . 
C 3 HOH 18  245 20  HOH HOH A . 
C 3 HOH 19  246 21  HOH HOH A . 
C 3 HOH 20  247 22  HOH HOH A . 
C 3 HOH 21  248 23  HOH HOH A . 
C 3 HOH 22  249 24  HOH HOH A . 
C 3 HOH 23  250 25  HOH HOH A . 
C 3 HOH 24  251 26  HOH HOH A . 
C 3 HOH 25  252 27  HOH HOH A . 
C 3 HOH 26  253 28  HOH HOH A . 
C 3 HOH 27  254 29  HOH HOH A . 
C 3 HOH 28  255 30  HOH HOH A . 
C 3 HOH 29  256 31  HOH HOH A . 
C 3 HOH 30  257 32  HOH HOH A . 
C 3 HOH 31  258 33  HOH HOH A . 
C 3 HOH 32  259 34  HOH HOH A . 
C 3 HOH 33  260 35  HOH HOH A . 
C 3 HOH 34  261 36  HOH HOH A . 
C 3 HOH 35  262 37  HOH HOH A . 
C 3 HOH 36  263 38  HOH HOH A . 
C 3 HOH 37  264 39  HOH HOH A . 
C 3 HOH 38  265 40  HOH HOH A . 
C 3 HOH 39  266 41  HOH HOH A . 
C 3 HOH 40  267 42  HOH HOH A . 
C 3 HOH 41  268 43  HOH HOH A . 
C 3 HOH 42  269 44  HOH HOH A . 
C 3 HOH 43  270 45  HOH HOH A . 
C 3 HOH 44  271 46  HOH HOH A . 
C 3 HOH 45  272 47  HOH HOH A . 
C 3 HOH 46  273 48  HOH HOH A . 
C 3 HOH 47  274 49  HOH HOH A . 
C 3 HOH 48  275 50  HOH HOH A . 
C 3 HOH 49  276 51  HOH HOH A . 
C 3 HOH 50  277 52  HOH HOH A . 
C 3 HOH 51  278 53  HOH HOH A . 
C 3 HOH 52  279 54  HOH HOH A . 
C 3 HOH 53  280 55  HOH HOH A . 
C 3 HOH 54  281 56  HOH HOH A . 
C 3 HOH 55  282 57  HOH HOH A . 
C 3 HOH 56  283 58  HOH HOH A . 
C 3 HOH 57  284 59  HOH HOH A . 
C 3 HOH 58  285 60  HOH HOH A . 
C 3 HOH 59  286 61  HOH HOH A . 
C 3 HOH 60  287 62  HOH HOH A . 
C 3 HOH 61  288 63  HOH HOH A . 
C 3 HOH 62  289 64  HOH HOH A . 
C 3 HOH 63  290 65  HOH HOH A . 
C 3 HOH 64  291 66  HOH HOH A . 
C 3 HOH 65  292 67  HOH HOH A . 
C 3 HOH 66  293 68  HOH HOH A . 
C 3 HOH 67  294 69  HOH HOH A . 
C 3 HOH 68  295 70  HOH HOH A . 
C 3 HOH 69  296 71  HOH HOH A . 
C 3 HOH 70  297 72  HOH HOH A . 
C 3 HOH 71  298 73  HOH HOH A . 
C 3 HOH 72  299 74  HOH HOH A . 
C 3 HOH 73  300 75  HOH HOH A . 
C 3 HOH 74  301 76  HOH HOH A . 
C 3 HOH 75  302 77  HOH HOH A . 
C 3 HOH 76  303 78  HOH HOH A . 
C 3 HOH 77  304 79  HOH HOH A . 
C 3 HOH 78  305 80  HOH HOH A . 
C 3 HOH 79  306 81  HOH HOH A . 
C 3 HOH 80  307 82  HOH HOH A . 
C 3 HOH 81  308 83  HOH HOH A . 
C 3 HOH 82  309 84  HOH HOH A . 
C 3 HOH 83  310 85  HOH HOH A . 
C 3 HOH 84  311 86  HOH HOH A . 
C 3 HOH 85  312 87  HOH HOH A . 
C 3 HOH 86  313 88  HOH HOH A . 
C 3 HOH 87  314 89  HOH HOH A . 
C 3 HOH 88  315 90  HOH HOH A . 
C 3 HOH 89  316 91  HOH HOH A . 
C 3 HOH 90  317 92  HOH HOH A . 
C 3 HOH 91  318 93  HOH HOH A . 
C 3 HOH 92  319 94  HOH HOH A . 
C 3 HOH 93  320 95  HOH HOH A . 
C 3 HOH 94  321 96  HOH HOH A . 
C 3 HOH 95  322 97  HOH HOH A . 
C 3 HOH 96  323 98  HOH HOH A . 
C 3 HOH 97  324 99  HOH HOH A . 
C 3 HOH 98  325 100 HOH HOH A . 
C 3 HOH 99  326 101 HOH HOH A . 
C 3 HOH 100 327 102 HOH HOH A . 
C 3 HOH 101 328 103 HOH HOH A . 
C 3 HOH 102 329 104 HOH HOH A . 
C 3 HOH 103 330 105 HOH HOH A . 
C 3 HOH 104 331 106 HOH HOH A . 
C 3 HOH 105 332 107 HOH HOH A . 
C 3 HOH 106 333 108 HOH HOH A . 
C 3 HOH 107 334 109 HOH HOH A . 
C 3 HOH 108 335 110 HOH HOH A . 
C 3 HOH 109 336 111 HOH HOH A . 
C 3 HOH 110 337 112 HOH HOH A . 
C 3 HOH 111 338 113 HOH HOH A . 
C 3 HOH 112 339 114 HOH HOH A . 
C 3 HOH 113 340 115 HOH HOH A . 
C 3 HOH 114 341 116 HOH HOH A . 
C 3 HOH 115 342 117 HOH HOH A . 
C 3 HOH 116 343 118 HOH HOH A . 
C 3 HOH 117 344 119 HOH HOH A . 
C 3 HOH 118 345 120 HOH HOH A . 
C 3 HOH 119 346 121 HOH HOH A . 
C 3 HOH 120 347 122 HOH HOH A . 
C 3 HOH 121 348 123 HOH HOH A . 
C 3 HOH 122 349 124 HOH HOH A . 
C 3 HOH 123 350 125 HOH HOH A . 
C 3 HOH 124 351 126 HOH HOH A . 
C 3 HOH 125 352 127 HOH HOH A . 
C 3 HOH 126 353 129 HOH HOH A . 
C 3 HOH 127 354 130 HOH HOH A . 
C 3 HOH 128 355 131 HOH HOH A . 
C 3 HOH 129 356 132 HOH HOH A . 
C 3 HOH 130 357 133 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_struct_conn_angle.id                    1 
_pdbx_struct_conn_angle.ptnr1_label_atom_id   O 
_pdbx_struct_conn_angle.ptnr1_label_alt_id    ? 
_pdbx_struct_conn_angle.ptnr1_label_asym_id   A 
_pdbx_struct_conn_angle.ptnr1_label_comp_id   CYS 
_pdbx_struct_conn_angle.ptnr1_label_seq_id    56 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id    ? 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id    A 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id    CYS 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id     137 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code    ? 
_pdbx_struct_conn_angle.ptnr1_symmetry        1_555 
_pdbx_struct_conn_angle.ptnr2_label_atom_id   HG 
_pdbx_struct_conn_angle.ptnr2_label_alt_id    ? 
_pdbx_struct_conn_angle.ptnr2_label_asym_id   B 
_pdbx_struct_conn_angle.ptnr2_label_comp_id   HG 
_pdbx_struct_conn_angle.ptnr2_label_seq_id    . 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id    ? 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id    A 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id    HG 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id     1 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code    ? 
_pdbx_struct_conn_angle.ptnr2_symmetry        1_555 
_pdbx_struct_conn_angle.ptnr3_label_atom_id   SG 
_pdbx_struct_conn_angle.ptnr3_label_alt_id    ? 
_pdbx_struct_conn_angle.ptnr3_label_asym_id   A 
_pdbx_struct_conn_angle.ptnr3_label_comp_id   CYS 
_pdbx_struct_conn_angle.ptnr3_label_seq_id    56 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id    ? 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id    A 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id    CYS 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id     137 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code    ? 
_pdbx_struct_conn_angle.ptnr3_symmetry        1_555 
_pdbx_struct_conn_angle.value                 68.6 
_pdbx_struct_conn_angle.value_esd             ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2005-08-02 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
_pdbx_refine_tls.id               1 
_pdbx_refine_tls.details          ? 
_pdbx_refine_tls.method           refined 
_pdbx_refine_tls.origin_x         23.9350 
_pdbx_refine_tls.origin_y         33.1600 
_pdbx_refine_tls.origin_z         21.8360 
_pdbx_refine_tls.T[1][1]          0.0213 
_pdbx_refine_tls.T[2][2]          0.0377 
_pdbx_refine_tls.T[3][3]          0.0721 
_pdbx_refine_tls.T[1][2]          0.0094 
_pdbx_refine_tls.T[1][3]          0.0007 
_pdbx_refine_tls.T[2][3]          -0.0213 
_pdbx_refine_tls.L[1][1]          2.5001 
_pdbx_refine_tls.L[2][2]          5.5136 
_pdbx_refine_tls.L[3][3]          5.2344 
_pdbx_refine_tls.L[1][2]          0.2247 
_pdbx_refine_tls.L[1][3]          0.7726 
_pdbx_refine_tls.L[2][3]          0.7488 
_pdbx_refine_tls.S[1][1]          -0.0475 
_pdbx_refine_tls.S[1][2]          0.0437 
_pdbx_refine_tls.S[1][3]          0.0020 
_pdbx_refine_tls.S[2][1]          -0.3559 
_pdbx_refine_tls.S[2][2]          -0.0847 
_pdbx_refine_tls.S[2][3]          -0.2477 
_pdbx_refine_tls.S[3][1]          -0.1053 
_pdbx_refine_tls.S[3][2]          0.2624 
_pdbx_refine_tls.S[3][3]          0.1322 
_pdbx_refine_tls.pdbx_refine_id   'X-RAY DIFFRACTION' 
# 
_pdbx_refine_tls_group.id                  1 
_pdbx_refine_tls_group.refine_tls_id       1 
_pdbx_refine_tls_group.beg_auth_asym_id    A 
_pdbx_refine_tls_group.beg_auth_seq_id     99 
_pdbx_refine_tls_group.beg_label_asym_id   A 
_pdbx_refine_tls_group.beg_label_seq_id    18 
_pdbx_refine_tls_group.end_auth_asym_id    A 
_pdbx_refine_tls_group.end_auth_seq_id     128 
_pdbx_refine_tls_group.end_label_asym_id   A 
_pdbx_refine_tls_group.end_label_seq_id    47 
_pdbx_refine_tls_group.selection           ? 
_pdbx_refine_tls_group.pdbx_refine_id      'X-RAY DIFFRACTION' 
_pdbx_refine_tls_group.selection_details   ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC    refinement       5.1.24 ? 1 
HKL-2000  'data reduction' .      ? 2 
SCALEPACK 'data scaling'   .      ? 3 
SOLVE     phasing          .      ? 4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O   A LYS 218 ? ? O A HOH 351 ? ? 2.13 
2 1 OE2 A GLU 204 ? ? O A HOH 330 ? ? 2.14 
3 1 O   A ALA 220 ? ? O A HOH 233 ? ? 2.17 
4 1 N   A ASN 99  ? ? O A HOH 348 ? ? 2.19 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CG A TYR 215 ? ? CD1 A TYR 215 ? ? 1.475 1.387 0.088 0.013 N 
2 1 CZ A TYR 215 ? ? CE2 A TYR 215 ? ? 1.466 1.381 0.085 0.013 N 
3 1 C  A ALA 220 ? ? O   A ALA 220 ? ? 1.409 1.229 0.180 0.019 N 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 82 ? A MET 1  
2  1 Y 1 A GLY 83 ? A GLY 2  
3  1 Y 1 A SER 84 ? A SER 3  
4  1 Y 1 A SER 85 ? A SER 4  
5  1 Y 1 A HIS 86 ? A HIS 5  
6  1 Y 1 A HIS 87 ? A HIS 6  
7  1 Y 1 A HIS 88 ? A HIS 7  
8  1 Y 1 A HIS 89 ? A HIS 8  
9  1 Y 1 A HIS 90 ? A HIS 9  
10 1 Y 1 A HIS 91 ? A HIS 10 
11 1 Y 1 A SER 92 ? A SER 11 
12 1 Y 1 A GLN 93 ? A GLN 12 
13 1 Y 1 A ASP 94 ? A ASP 13 
14 1 Y 1 A PRO 95 ? A PRO 14 
15 1 Y 1 A ALA 96 ? A ALA 15 
16 1 Y 1 A LYS 97 ? A LYS 16 
17 1 Y 1 A SER 98 ? A SER 17 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'MERCURY (II) ION' HG  
3 water              HOH 
#