data_2A1X
# 
_entry.id   2A1X 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.289 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2A1X         
RCSB  RCSB033389   
WWPDB D_1000033389 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2A1X 
_pdbx_database_status.recvd_initial_deposition_date   2005-06-21 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kavanagh, K.L.'                       1  
'McDonough, M.A.'                      2  
'Searles, T.'                          3  
'Butler, D.'                           4  
'Bunkoczi, G.'                         5  
'von Delft, F.'                        6  
'Edwards, A.'                          7  
'Arrowsmith, C.'                       8  
'Sundstrom, M.'                        9  
'Schofield, C.J.'                      10 
'Oppermann, U.'                        11 
'Structural Genomics Consortium (SGC)' 12 
# 
_citation.id                        primary 
_citation.title                     
'Structure of Human Phytanoyl-CoA 2-Hydroxylase Identifies Molecular Mechanisms of Refsum Disease' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            280 
_citation.page_first                41101 
_citation.page_last                 41110 
_citation.year                      2005 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16186124 
_citation.pdbx_database_id_DOI      10.1074/jbc.M507528200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'McDonough, M.A.' 1 
primary 'Kavanagh, K.L.'  2 
primary 'Butler, D.'      3 
primary 'Searles, T.'     4 
primary 'Oppermann, U.'   5 
primary 'Schofield, C.J.' 6 
# 
_cell.entry_id           2A1X 
_cell.length_a           67.929 
_cell.length_b           86.677 
_cell.length_c           97.541 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2A1X 
_symmetry.space_group_name_H-M             'I 2 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                23 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Phytanoyl-CoA dioxygenase' 35490.664 1  1.14.11.18 ? ? ? 
2 non-polymer syn 'FE (II) ION'               55.845    1  ?          ? ? ? 
3 non-polymer syn '2-OXOGLUTARIC ACID'        146.098   1  ?          ? ? ? 
4 water       nat water                       18.015    15 ?          ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Phytanoyl-CoA alpha-hydroxylase, PhyH, Phytanic acid oxidase, phytanoyl-CoA 2-hydroxylase' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SGTISSASFHPQQFQYTLDNNVLTLEQRKFYEENGFLVIKNLVPDADIQRFRNEFEKICRKEVKPLGLTVMRDVTISKSE
YAPSEKMITKVQDFQEDKELFRYCTLPEILKYVECFTGPNIMAMHTMLINKPPDSGKKTSRHPLHQDLHYFPFRPSDLIV
CAWTAMEHISRNNGCLVVLPGTHKGSLKPHDYPKWEGGVNKMFHGIQDYEENKARVHLVMEKGDTVFFHPLLIHGSGQNK
TQGFRKAISCHFASADCHYIDVKGTSQENIEKEVVGIAHKFFGAENSVNLKDIWMFRARLVKGERTNL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SGTISSASFHPQQFQYTLDNNVLTLEQRKFYEENGFLVIKNLVPDADIQRFRNEFEKICRKEVKPLGLTVMRDVTISKSE
YAPSEKMITKVQDFQEDKELFRYCTLPEILKYVECFTGPNIMAMHTMLINKPPDSGKKTSRHPLHQDLHYFPFRPSDLIV
CAWTAMEHISRNNGCLVVLPGTHKGSLKPHDYPKWEGGVNKMFHGIQDYEENKARVHLVMEKGDTVFFHPLLIHGSGQNK
TQGFRKAISCHFASADCHYIDVKGTSQENIEKEVVGIAHKFFGAENSVNLKDIWMFRARLVKGERTNL
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   GLY n 
1 3   THR n 
1 4   ILE n 
1 5   SER n 
1 6   SER n 
1 7   ALA n 
1 8   SER n 
1 9   PHE n 
1 10  HIS n 
1 11  PRO n 
1 12  GLN n 
1 13  GLN n 
1 14  PHE n 
1 15  GLN n 
1 16  TYR n 
1 17  THR n 
1 18  LEU n 
1 19  ASP n 
1 20  ASN n 
1 21  ASN n 
1 22  VAL n 
1 23  LEU n 
1 24  THR n 
1 25  LEU n 
1 26  GLU n 
1 27  GLN n 
1 28  ARG n 
1 29  LYS n 
1 30  PHE n 
1 31  TYR n 
1 32  GLU n 
1 33  GLU n 
1 34  ASN n 
1 35  GLY n 
1 36  PHE n 
1 37  LEU n 
1 38  VAL n 
1 39  ILE n 
1 40  LYS n 
1 41  ASN n 
1 42  LEU n 
1 43  VAL n 
1 44  PRO n 
1 45  ASP n 
1 46  ALA n 
1 47  ASP n 
1 48  ILE n 
1 49  GLN n 
1 50  ARG n 
1 51  PHE n 
1 52  ARG n 
1 53  ASN n 
1 54  GLU n 
1 55  PHE n 
1 56  GLU n 
1 57  LYS n 
1 58  ILE n 
1 59  CYS n 
1 60  ARG n 
1 61  LYS n 
1 62  GLU n 
1 63  VAL n 
1 64  LYS n 
1 65  PRO n 
1 66  LEU n 
1 67  GLY n 
1 68  LEU n 
1 69  THR n 
1 70  VAL n 
1 71  MET n 
1 72  ARG n 
1 73  ASP n 
1 74  VAL n 
1 75  THR n 
1 76  ILE n 
1 77  SER n 
1 78  LYS n 
1 79  SER n 
1 80  GLU n 
1 81  TYR n 
1 82  ALA n 
1 83  PRO n 
1 84  SER n 
1 85  GLU n 
1 86  LYS n 
1 87  MET n 
1 88  ILE n 
1 89  THR n 
1 90  LYS n 
1 91  VAL n 
1 92  GLN n 
1 93  ASP n 
1 94  PHE n 
1 95  GLN n 
1 96  GLU n 
1 97  ASP n 
1 98  LYS n 
1 99  GLU n 
1 100 LEU n 
1 101 PHE n 
1 102 ARG n 
1 103 TYR n 
1 104 CYS n 
1 105 THR n 
1 106 LEU n 
1 107 PRO n 
1 108 GLU n 
1 109 ILE n 
1 110 LEU n 
1 111 LYS n 
1 112 TYR n 
1 113 VAL n 
1 114 GLU n 
1 115 CYS n 
1 116 PHE n 
1 117 THR n 
1 118 GLY n 
1 119 PRO n 
1 120 ASN n 
1 121 ILE n 
1 122 MET n 
1 123 ALA n 
1 124 MET n 
1 125 HIS n 
1 126 THR n 
1 127 MET n 
1 128 LEU n 
1 129 ILE n 
1 130 ASN n 
1 131 LYS n 
1 132 PRO n 
1 133 PRO n 
1 134 ASP n 
1 135 SER n 
1 136 GLY n 
1 137 LYS n 
1 138 LYS n 
1 139 THR n 
1 140 SER n 
1 141 ARG n 
1 142 HIS n 
1 143 PRO n 
1 144 LEU n 
1 145 HIS n 
1 146 GLN n 
1 147 ASP n 
1 148 LEU n 
1 149 HIS n 
1 150 TYR n 
1 151 PHE n 
1 152 PRO n 
1 153 PHE n 
1 154 ARG n 
1 155 PRO n 
1 156 SER n 
1 157 ASP n 
1 158 LEU n 
1 159 ILE n 
1 160 VAL n 
1 161 CYS n 
1 162 ALA n 
1 163 TRP n 
1 164 THR n 
1 165 ALA n 
1 166 MET n 
1 167 GLU n 
1 168 HIS n 
1 169 ILE n 
1 170 SER n 
1 171 ARG n 
1 172 ASN n 
1 173 ASN n 
1 174 GLY n 
1 175 CYS n 
1 176 LEU n 
1 177 VAL n 
1 178 VAL n 
1 179 LEU n 
1 180 PRO n 
1 181 GLY n 
1 182 THR n 
1 183 HIS n 
1 184 LYS n 
1 185 GLY n 
1 186 SER n 
1 187 LEU n 
1 188 LYS n 
1 189 PRO n 
1 190 HIS n 
1 191 ASP n 
1 192 TYR n 
1 193 PRO n 
1 194 LYS n 
1 195 TRP n 
1 196 GLU n 
1 197 GLY n 
1 198 GLY n 
1 199 VAL n 
1 200 ASN n 
1 201 LYS n 
1 202 MET n 
1 203 PHE n 
1 204 HIS n 
1 205 GLY n 
1 206 ILE n 
1 207 GLN n 
1 208 ASP n 
1 209 TYR n 
1 210 GLU n 
1 211 GLU n 
1 212 ASN n 
1 213 LYS n 
1 214 ALA n 
1 215 ARG n 
1 216 VAL n 
1 217 HIS n 
1 218 LEU n 
1 219 VAL n 
1 220 MET n 
1 221 GLU n 
1 222 LYS n 
1 223 GLY n 
1 224 ASP n 
1 225 THR n 
1 226 VAL n 
1 227 PHE n 
1 228 PHE n 
1 229 HIS n 
1 230 PRO n 
1 231 LEU n 
1 232 LEU n 
1 233 ILE n 
1 234 HIS n 
1 235 GLY n 
1 236 SER n 
1 237 GLY n 
1 238 GLN n 
1 239 ASN n 
1 240 LYS n 
1 241 THR n 
1 242 GLN n 
1 243 GLY n 
1 244 PHE n 
1 245 ARG n 
1 246 LYS n 
1 247 ALA n 
1 248 ILE n 
1 249 SER n 
1 250 CYS n 
1 251 HIS n 
1 252 PHE n 
1 253 ALA n 
1 254 SER n 
1 255 ALA n 
1 256 ASP n 
1 257 CYS n 
1 258 HIS n 
1 259 TYR n 
1 260 ILE n 
1 261 ASP n 
1 262 VAL n 
1 263 LYS n 
1 264 GLY n 
1 265 THR n 
1 266 SER n 
1 267 GLN n 
1 268 GLU n 
1 269 ASN n 
1 270 ILE n 
1 271 GLU n 
1 272 LYS n 
1 273 GLU n 
1 274 VAL n 
1 275 VAL n 
1 276 GLY n 
1 277 ILE n 
1 278 ALA n 
1 279 HIS n 
1 280 LYS n 
1 281 PHE n 
1 282 PHE n 
1 283 GLY n 
1 284 ALA n 
1 285 GLU n 
1 286 ASN n 
1 287 SER n 
1 288 VAL n 
1 289 ASN n 
1 290 LEU n 
1 291 LYS n 
1 292 ASP n 
1 293 ILE n 
1 294 TRP n 
1 295 MET n 
1 296 PHE n 
1 297 ARG n 
1 298 ALA n 
1 299 ARG n 
1 300 LEU n 
1 301 VAL n 
1 302 LYS n 
1 303 GLY n 
1 304 GLU n 
1 305 ARG n 
1 306 THR n 
1 307 ASN n 
1 308 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'PHYH, PAHX' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET24a 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PAHX_HUMAN 
_struct_ref.pdbx_db_accession          O14832 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;SGTISSASFHPQQFQYTLDNNVLTLEQRKFYEENGFLVIKNLVPDADIQRFRNEFEKICRKEVKPLGLTVMRDVTISKSE
YAPSEKMITKVQDFQEDKELFRYCTLPEILKYVECFTGPNIMAMHTMLINKPPDSGKKTSRHPLHQDLHYFPFRPSDLIV
CAWTAMEHISRNNGCLVVLPGTHKGSLKPHDYPKWEGGVNKMFHGIQDYEENKARVHLVMEKGDTVFFHPLLIHGSGQNK
TQGFRKAISCHFASADCHYIDVKGTSQENIEKEVVGIAHKFFGAENSVNLKDIWMFRARLVKGERTNL
;
_struct_ref.pdbx_align_begin           31 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2A1X 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 308 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             O14832 
_struct_ref_seq.db_align_beg                  31 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  338 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       31 
_struct_ref_seq.pdbx_auth_seq_align_end       338 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
AKG non-polymer         . '2-OXOGLUTARIC ACID' ? 'C5 H6 O5'       146.098 
ALA 'L-peptide linking' y ALANINE              ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE             ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE           ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'      ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE             ? 'C3 H7 N O2 S'   121.158 
FE2 non-polymer         . 'FE (II) ION'        ? 'Fe 2'           55.845  
GLN 'L-peptide linking' y GLUTAMINE            ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'      ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE              ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE            ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE           ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE              ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE               ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE           ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE        ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE              ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE               ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE            ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN           ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE             ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE               ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2A1X 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.1 
_exptl_crystal.density_percent_sol   40 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.1 
_exptl_crystal_grow.pdbx_details    
'20% PEG 3350, 0.3 M tri-ammonium citrate, pH 7.1, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2005-02-06 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SAGITALLY FOCUSED Si(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9800 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SRS BEAMLINE PX10.1' 
_diffrn_source.pdbx_synchrotron_site       SRS 
_diffrn_source.pdbx_synchrotron_beamline   PX10.1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9800 
# 
_reflns.entry_id                     2A1X 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.d_resolution_high            2.5 
_reflns.d_resolution_low             30.44 
_reflns.number_all                   9583 
_reflns.number_obs                   9583 
_reflns.percent_possible_obs         94.2 
_reflns.pdbx_Rmerge_I_obs            0.119 
_reflns.pdbx_Rsym_value              0.13 
_reflns.pdbx_netI_over_sigmaI        13.5 
_reflns.B_iso_Wilson_estimate        51 
_reflns.pdbx_redundancy              5.3 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.50 
_reflns_shell.d_res_low              2.64 
_reflns_shell.percent_possible_all   97.2 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.0 
_reflns_shell.pdbx_redundancy        5.2 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      1448 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2A1X 
_refine.ls_number_reflns_obs                     9110 
_refine.ls_number_reflns_all                     9110 
_refine.pdbx_ls_sigma_I                          0 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             30.44 
_refine.ls_d_res_high                            2.50 
_refine.ls_percent_reflns_obs                    93.05 
_refine.ls_R_factor_obs                          0.20772 
_refine.ls_R_factor_all                          0.20772 
_refine.ls_R_factor_R_work                       0.20425 
_refine.ls_R_factor_R_free                       0.27428 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.9 
_refine.ls_number_reflns_R_free                  472 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.938 
_refine.correlation_coeff_Fo_to_Fc_free          0.891 
_refine.B_iso_mean                               35.234 
_refine.aniso_B[1][1]                            -1.69 
_refine.aniso_B[2][2]                            3.40 
_refine.aniso_B[3][3]                            -1.71 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          SAD 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.696 
_refine.pdbx_overall_ESU_R_Free                  0.334 
_refine.overall_SU_ML                            0.246 
_refine.overall_SU_B                             22.175 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1961 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         11 
_refine_hist.number_atoms_solvent             15 
_refine_hist.number_atoms_total               1987 
_refine_hist.d_res_high                       2.50 
_refine_hist.d_res_low                        30.44 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.012  0.021  ? 2012 'X-RAY DIFFRACTION' ? 
r_bond_other_d           0.001  0.020  ? 1795 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.360  1.949  ? 2722 'X-RAY DIFFRACTION' ? 
r_angle_other_deg        0.811  3.000  ? 4133 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   7.634  5.000  ? 246  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   35.286 23.804 ? 92   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   16.544 15.000 ? 318  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   20.882 15.000 ? 11   'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.079  0.200  ? 306  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.005  0.020  ? 2231 'X-RAY DIFFRACTION' ? 
r_gen_planes_other       0.001  0.020  ? 414  'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.208  0.200  ? 369  'X-RAY DIFFRACTION' ? 
r_nbd_other              0.179  0.200  ? 1819 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          0.177  0.200  ? 928  'X-RAY DIFFRACTION' ? 
r_nbtor_other            0.083  0.200  ? 1182 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.132  0.200  ? 45   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.099  0.200  ? 6    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other     0.152  0.200  ? 19   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.021  0.200  ? 1    'X-RAY DIFFRACTION' ? 
r_mcbond_it              1.446  3.000  ? 1295 'X-RAY DIFFRACTION' ? 
r_mcbond_other           0.307  3.000  ? 506  'X-RAY DIFFRACTION' ? 
r_mcangle_it             2.389  5.000  ? 2006 'X-RAY DIFFRACTION' ? 
r_scbond_it              4.263  8.000  ? 810  'X-RAY DIFFRACTION' ? 
r_scangle_it             5.662  11.000 ? 716  'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.500 
_refine_ls_shell.d_res_low                        2.565 
_refine_ls_shell.number_reflns_R_work             685 
_refine_ls_shell.R_factor_R_work                  0.25 
_refine_ls_shell.percent_reflns_obs               97.21 
_refine_ls_shell.R_factor_R_free                  0.311 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             48 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  2A1X 
_struct.title                     'Human phytanoyl-coa 2-hydroxylase in complex with iron and 2-oxoglutarate' 
_struct.pdbx_descriptor           'Phytanoyl-CoA dioxygenase (E.C.1.14.11.18)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2A1X 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            
'beta jelly roll, DOUBLE-STRANDED BETA-HELIX, Structural Genomics, Structural Genomics Consortium, SGC, OXIDOREDUCTASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLU A 26  ? GLY A 35  ? GLU A 56  GLY A 65  1 ? 10 
HELX_P HELX_P2 2 PRO A 44  ? ARG A 60  ? PRO A 74  ARG A 90  1 ? 17 
HELX_P HELX_P3 3 ASP A 97  ? LEU A 106 ? ASP A 127 LEU A 136 1 ? 10 
HELX_P HELX_P4 4 LEU A 106 ? GLY A 118 ? LEU A 136 GLY A 148 1 ? 13 
HELX_P HELX_P5 5 GLN A 146 ? PHE A 151 ? GLN A 176 PHE A 181 5 ? 6  
HELX_P HELX_P6 6 PRO A 155 ? ASP A 157 ? PRO A 185 ASP A 187 5 ? 3  
HELX_P HELX_P7 7 GLY A 181 ? GLY A 185 ? GLY A 211 GLY A 215 5 ? 5  
HELX_P HELX_P8 8 THR A 265 ? LYS A 272 ? THR A 295 LYS A 302 5 ? 8  
HELX_P HELX_P9 9 ASN A 289 ? ALA A 298 ? ASN A 319 ALA A 328 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? B FE2 . FE ? ? ? 1_555 C AKG .   O5  ? ? A FE2 450 A AKG 451 1_555 ? ? ? ? ? ? ? 2.290 ? 
metalc2 metalc ? ? B FE2 . FE ? ? ? 1_555 A ASP 147 OD1 ? ? A FE2 450 A ASP 177 1_555 ? ? ? ? ? ? ? 2.291 ? 
metalc3 metalc ? ? B FE2 . FE ? ? ? 1_555 A HIS 234 NE2 ? ? A FE2 450 A HIS 264 1_555 ? ? ? ? ? ? ? 2.229 ? 
metalc4 metalc ? ? B FE2 . FE ? ? ? 1_555 D HOH .   O   ? ? A FE2 450 A HOH 463 1_555 ? ? ? ? ? ? ? 2.189 ? 
metalc5 metalc ? ? B FE2 . FE ? ? ? 1_555 A HIS 145 NE2 ? ? A FE2 450 A HIS 175 1_555 ? ? ? ? ? ? ? 2.215 ? 
metalc6 metalc ? ? B FE2 . FE ? ? ? 1_555 C AKG .   O2  ? ? A FE2 450 A AKG 451 1_555 ? ? ? ? ? ? ? 2.028 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          ARG 
_struct_mon_prot_cis.label_seq_id           154 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           ARG 
_struct_mon_prot_cis.auth_seq_id            184 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    155 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     185 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -10.29 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 7 ? 
B ? 6 ? 
C ? 2 ? 
D ? 2 ? 
E ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
A 6 7 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 36  ? ILE A 39  ? PHE A 66  ILE A 69  
A 2 THR A 225 ? PHE A 228 ? THR A 255 PHE A 258 
A 3 ILE A 159 ? ALA A 165 ? ILE A 189 ALA A 195 
A 4 ARG A 245 ? SER A 254 ? ARG A 275 SER A 284 
A 5 ILE A 121 ? LYS A 131 ? ILE A 151 LYS A 161 
A 6 LYS A 90  ? GLN A 92  ? LYS A 120 GLN A 122 
A 7 THR A 69  ? MET A 71  ? THR A 99  MET A 101 
B 1 PHE A 36  ? ILE A 39  ? PHE A 66  ILE A 69  
B 2 THR A 225 ? PHE A 228 ? THR A 255 PHE A 258 
B 3 ILE A 159 ? ALA A 165 ? ILE A 189 ALA A 195 
B 4 ARG A 245 ? SER A 254 ? ARG A 275 SER A 284 
B 5 ILE A 121 ? LYS A 131 ? ILE A 151 LYS A 161 
B 6 ARG A 299 ? LYS A 302 ? ARG A 329 LYS A 332 
C 1 VAL A 74  ? ILE A 76  ? VAL A 104 ILE A 106 
C 2 GLU A 85  ? MET A 87  ? GLU A 115 MET A 117 
D 1 PHE A 153 ? ARG A 154 ? PHE A 183 ARG A 184 
D 2 HIS A 258 ? TYR A 259 ? HIS A 288 TYR A 289 
E 1 VAL A 216 ? LEU A 218 ? VAL A 246 LEU A 248 
E 2 LEU A 176 ? VAL A 178 ? LEU A 206 VAL A 208 
E 3 HIS A 234 ? SER A 236 ? HIS A 264 SER A 266 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 37  ? N LEU A 67  O PHE A 227 ? O PHE A 257 
A 2 3 O VAL A 226 ? O VAL A 256 N TRP A 163 ? N TRP A 193 
A 3 4 N ALA A 162 ? N ALA A 192 O CYS A 250 ? O CYS A 280 
A 4 5 O ALA A 247 ? O ALA A 277 N ILE A 129 ? N ILE A 159 
A 5 6 O LEU A 128 ? O LEU A 158 N VAL A 91  ? N VAL A 121 
A 6 7 O GLN A 92  ? O GLN A 122 N THR A 69  ? N THR A 99  
B 1 2 N LEU A 37  ? N LEU A 67  O PHE A 227 ? O PHE A 257 
B 2 3 O VAL A 226 ? O VAL A 256 N TRP A 163 ? N TRP A 193 
B 3 4 N ALA A 162 ? N ALA A 192 O CYS A 250 ? O CYS A 280 
B 4 5 O ALA A 247 ? O ALA A 277 N ILE A 129 ? N ILE A 159 
B 5 6 N ILE A 121 ? N ILE A 151 O LYS A 302 ? O LYS A 332 
C 1 2 N VAL A 74  ? N VAL A 104 O MET A 87  ? O MET A 117 
D 1 2 N ARG A 154 ? N ARG A 184 O HIS A 258 ? O HIS A 288 
E 1 2 O LEU A 218 ? O LEU A 248 N LEU A 176 ? N LEU A 206 
E 2 3 N VAL A 177 ? N VAL A 207 O GLY A 235 ? O GLY A 265 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE FE2 A 450' 
AC2 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE AKG A 451' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5  HIS A 145 ? HIS A 175 . ? 1_555 ? 
2  AC1 5  ASP A 147 ? ASP A 177 . ? 1_555 ? 
3  AC1 5  HIS A 234 ? HIS A 264 . ? 1_555 ? 
4  AC1 5  AKG C .   ? AKG A 451 . ? 1_555 ? 
5  AC1 5  HOH D .   ? HOH A 463 . ? 1_555 ? 
6  AC2 11 LYS A 90  ? LYS A 120 . ? 1_555 ? 
7  AC2 11 MET A 127 ? MET A 157 . ? 1_555 ? 
8  AC2 11 ILE A 129 ? ILE A 159 . ? 1_555 ? 
9  AC2 11 HIS A 145 ? HIS A 175 . ? 1_555 ? 
10 AC2 11 ASP A 147 ? ASP A 177 . ? 1_555 ? 
11 AC2 11 TRP A 163 ? TRP A 193 . ? 1_555 ? 
12 AC2 11 HIS A 234 ? HIS A 264 . ? 1_555 ? 
13 AC2 11 SER A 236 ? SER A 266 . ? 1_555 ? 
14 AC2 11 ARG A 245 ? ARG A 275 . ? 1_555 ? 
15 AC2 11 FE2 B .   ? FE2 A 450 . ? 1_555 ? 
16 AC2 11 HOH D .   ? HOH A 463 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2A1X 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2A1X 
_atom_sites.fract_transf_matrix[1][1]   0.014721 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011537 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010252 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
FE 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    C  CA  . GLN A 1 13  ? 26.138 3.531  15.219 1.00 33.20 ? 43  GLN A CA  1 
ATOM   2    C  C   . GLN A 1 13  ? 25.422 4.592  16.066 1.00 34.99 ? 43  GLN A C   1 
ATOM   3    O  O   . GLN A 1 13  ? 25.009 5.638  15.547 1.00 36.28 ? 43  GLN A O   1 
ATOM   4    N  N   . PHE A 1 14  ? 25.290 4.341  17.370 1.00 34.31 ? 44  PHE A N   1 
ATOM   5    C  CA  . PHE A 1 14  ? 24.602 5.284  18.263 1.00 35.22 ? 44  PHE A CA  1 
ATOM   6    C  C   . PHE A 1 14  ? 25.563 6.406  18.732 1.00 36.66 ? 44  PHE A C   1 
ATOM   7    O  O   . PHE A 1 14  ? 26.756 6.184  18.879 1.00 37.74 ? 44  PHE A O   1 
ATOM   8    C  CB  . PHE A 1 14  ? 23.960 4.518  19.437 1.00 32.98 ? 44  PHE A CB  1 
ATOM   9    C  CG  . PHE A 1 14  ? 22.993 3.416  18.997 1.00 32.79 ? 44  PHE A CG  1 
ATOM   10   C  CD1 . PHE A 1 14  ? 21.678 3.717  18.640 1.00 23.48 ? 44  PHE A CD1 1 
ATOM   11   C  CD2 . PHE A 1 14  ? 23.410 2.080  18.927 1.00 23.08 ? 44  PHE A CD2 1 
ATOM   12   C  CE1 . PHE A 1 14  ? 20.786 2.717  18.220 1.00 28.44 ? 44  PHE A CE1 1 
ATOM   13   C  CE2 . PHE A 1 14  ? 22.525 1.068  18.508 1.00 22.28 ? 44  PHE A CE2 1 
ATOM   14   C  CZ  . PHE A 1 14  ? 21.210 1.387  18.157 1.00 25.84 ? 44  PHE A CZ  1 
ATOM   15   N  N   . GLN A 1 15  ? 25.049 7.615  18.925 1.00 38.15 ? 45  GLN A N   1 
ATOM   16   C  CA  . GLN A 1 15  ? 25.860 8.728  19.436 1.00 38.99 ? 45  GLN A CA  1 
ATOM   17   C  C   . GLN A 1 15  ? 25.532 9.090  20.859 1.00 38.16 ? 45  GLN A C   1 
ATOM   18   O  O   . GLN A 1 15  ? 26.345 9.720  21.536 1.00 38.97 ? 45  GLN A O   1 
ATOM   19   C  CB  . GLN A 1 15  ? 25.672 9.978  18.578 1.00 38.66 ? 45  GLN A CB  1 
ATOM   20   C  CG  . GLN A 1 15  ? 26.560 9.997  17.342 1.00 45.99 ? 45  GLN A CG  1 
ATOM   21   C  CD  . GLN A 1 15  ? 25.927 10.740 16.171 1.00 50.05 ? 45  GLN A CD  1 
ATOM   22   O  OE1 . GLN A 1 15  ? 25.593 11.936 16.272 1.00 51.48 ? 45  GLN A OE1 1 
ATOM   23   N  NE2 . GLN A 1 15  ? 25.753 10.031 15.049 1.00 36.05 ? 45  GLN A NE2 1 
ATOM   24   N  N   . TYR A 1 16  ? 24.346 8.709  21.315 1.00 36.80 ? 46  TYR A N   1 
ATOM   25   C  CA  . TYR A 1 16  ? 23.810 9.227  22.567 1.00 36.29 ? 46  TYR A CA  1 
ATOM   26   C  C   . TYR A 1 16  ? 23.779 8.217  23.709 1.00 35.89 ? 46  TYR A C   1 
ATOM   27   O  O   . TYR A 1 16  ? 23.465 8.562  24.847 1.00 34.45 ? 46  TYR A O   1 
ATOM   28   C  CB  . TYR A 1 16  ? 22.428 9.802  22.286 1.00 35.93 ? 46  TYR A CB  1 
ATOM   29   C  CG  . TYR A 1 16  ? 22.487 10.938 21.273 1.00 37.24 ? 46  TYR A CG  1 
ATOM   30   C  CD1 . TYR A 1 16  ? 21.900 10.819 20.025 1.00 39.31 ? 46  TYR A CD1 1 
ATOM   31   C  CD2 . TYR A 1 16  ? 23.150 12.122 21.564 1.00 36.57 ? 46  TYR A CD2 1 
ATOM   32   C  CE1 . TYR A 1 16  ? 21.955 11.859 19.096 1.00 33.85 ? 46  TYR A CE1 1 
ATOM   33   C  CE2 . TYR A 1 16  ? 23.207 13.158 20.645 1.00 36.71 ? 46  TYR A CE2 1 
ATOM   34   C  CZ  . TYR A 1 16  ? 22.606 13.022 19.410 1.00 33.63 ? 46  TYR A CZ  1 
ATOM   35   O  OH  . TYR A 1 16  ? 22.649 14.048 18.480 1.00 28.26 ? 46  TYR A OH  1 
ATOM   36   N  N   . THR A 1 17  ? 24.142 6.977  23.402 1.00 38.59 ? 47  THR A N   1 
ATOM   37   C  CA  . THR A 1 17  ? 24.161 5.884  24.368 1.00 40.75 ? 47  THR A CA  1 
ATOM   38   C  C   . THR A 1 17  ? 25.358 4.997  24.086 1.00 42.24 ? 47  THR A C   1 
ATOM   39   O  O   . THR A 1 17  ? 25.859 4.983  22.969 1.00 43.23 ? 47  THR A O   1 
ATOM   40   C  CB  . THR A 1 17  ? 22.885 5.043  24.247 1.00 40.56 ? 47  THR A CB  1 
ATOM   41   O  OG1 . THR A 1 17  ? 22.563 4.887  22.860 1.00 44.36 ? 47  THR A OG1 1 
ATOM   42   C  CG2 . THR A 1 17  ? 21.723 5.732  24.947 1.00 38.42 ? 47  THR A CG2 1 
ATOM   43   N  N   . LEU A 1 18  ? 25.804 4.261  25.100 1.00 44.23 ? 48  LEU A N   1 
ATOM   44   C  CA  . LEU A 1 18  ? 26.879 3.274  24.961 1.00 45.35 ? 48  LEU A CA  1 
ATOM   45   C  C   . LEU A 1 18  ? 26.295 1.846  24.975 1.00 45.57 ? 48  LEU A C   1 
ATOM   46   O  O   . LEU A 1 18  ? 25.074 1.682  25.059 1.00 45.71 ? 48  LEU A O   1 
ATOM   47   C  CB  . LEU A 1 18  ? 27.907 3.465  26.082 1.00 45.88 ? 48  LEU A CB  1 
ATOM   48   C  CG  . LEU A 1 18  ? 28.336 4.921  26.343 1.00 50.79 ? 48  LEU A CG  1 
ATOM   49   C  CD1 . LEU A 1 18  ? 29.111 5.024  27.650 1.00 56.93 ? 48  LEU A CD1 1 
ATOM   50   C  CD2 . LEU A 1 18  ? 29.156 5.477  25.197 1.00 46.97 ? 48  LEU A CD2 1 
ATOM   51   N  N   . ASP A 1 19  ? 27.158 0.827  24.886 1.00 45.66 ? 49  ASP A N   1 
ATOM   52   C  CA  . ASP A 1 19  ? 26.721 -0.575 24.783 1.00 46.62 ? 49  ASP A CA  1 
ATOM   53   C  C   . ASP A 1 19  ? 26.095 -1.092 26.080 1.00 47.81 ? 49  ASP A C   1 
ATOM   54   O  O   . ASP A 1 19  ? 26.605 -0.827 27.170 1.00 48.36 ? 49  ASP A O   1 
ATOM   55   C  CB  . ASP A 1 19  ? 27.887 -1.491 24.373 1.00 46.49 ? 49  ASP A CB  1 
ATOM   56   N  N   . ASN A 1 20  ? 25.007 -1.857 25.937 1.00 49.01 ? 50  ASN A N   1 
ATOM   57   C  CA  . ASN A 1 20  ? 24.154 -2.310 27.054 1.00 47.91 ? 50  ASN A CA  1 
ATOM   58   C  C   . ASN A 1 20  ? 23.360 -1.146 27.652 1.00 48.05 ? 50  ASN A C   1 
ATOM   59   O  O   . ASN A 1 20  ? 23.508 0.010  27.223 1.00 48.13 ? 50  ASN A O   1 
ATOM   60   C  CB  . ASN A 1 20  ? 24.971 -3.022 28.139 1.00 47.35 ? 50  ASN A CB  1 
ATOM   61   N  N   . LEU A 1 23  ? 20.993 -3.510 29.974 1.00 47.73 ? 53  LEU A N   1 
ATOM   62   C  CA  . LEU A 1 23  ? 19.983 -2.580 30.489 1.00 47.54 ? 53  LEU A CA  1 
ATOM   63   C  C   . LEU A 1 23  ? 18.885 -2.362 29.487 1.00 46.60 ? 53  LEU A C   1 
ATOM   64   O  O   . LEU A 1 23  ? 17.698 -2.348 29.816 1.00 45.38 ? 53  LEU A O   1 
ATOM   65   C  CB  . LEU A 1 23  ? 20.601 -1.212 30.766 1.00 46.76 ? 53  LEU A CB  1 
ATOM   66   C  CG  . LEU A 1 23  ? 21.503 -1.110 31.989 1.00 50.64 ? 53  LEU A CG  1 
ATOM   67   C  CD1 . LEU A 1 23  ? 20.676 -1.185 33.265 1.00 56.68 ? 53  LEU A CD1 1 
ATOM   68   C  CD2 . LEU A 1 23  ? 22.587 -2.178 31.983 1.00 44.90 ? 53  LEU A CD2 1 
ATOM   69   N  N   . THR A 1 24  ? 19.309 -2.216 28.246 1.00 46.73 ? 54  THR A N   1 
ATOM   70   C  CA  . THR A 1 24  ? 18.550 -1.475 27.296 1.00 48.07 ? 54  THR A CA  1 
ATOM   71   C  C   . THR A 1 24  ? 18.489 -2.192 25.934 1.00 47.37 ? 54  THR A C   1 
ATOM   72   O  O   . THR A 1 24  ? 19.390 -2.932 25.547 1.00 45.82 ? 54  THR A O   1 
ATOM   73   C  CB  . THR A 1 24  ? 19.134 -0.033 27.268 1.00 49.64 ? 54  THR A CB  1 
ATOM   74   O  OG1 . THR A 1 24  ? 18.495 0.780  28.270 1.00 51.42 ? 54  THR A OG1 1 
ATOM   75   C  CG2 . THR A 1 24  ? 18.971 0.618  25.949 1.00 54.45 ? 54  THR A CG2 1 
ATOM   76   N  N   . LEU A 1 25  ? 17.384 -1.944 25.241 1.00 47.98 ? 55  LEU A N   1 
ATOM   77   C  CA  . LEU A 1 25  ? 16.953 -2.641 24.041 1.00 47.09 ? 55  LEU A CA  1 
ATOM   78   C  C   . LEU A 1 25  ? 16.994 -1.632 22.873 1.00 47.14 ? 55  LEU A C   1 
ATOM   79   O  O   . LEU A 1 25  ? 17.929 -0.848 22.778 1.00 45.56 ? 55  LEU A O   1 
ATOM   80   C  CB  . LEU A 1 25  ? 15.521 -3.124 24.291 1.00 46.87 ? 55  LEU A CB  1 
ATOM   81   C  CG  . LEU A 1 25  ? 15.238 -4.144 25.413 1.00 48.83 ? 55  LEU A CG  1 
ATOM   82   C  CD1 . LEU A 1 25  ? 15.713 -3.723 26.802 1.00 45.63 ? 55  LEU A CD1 1 
ATOM   83   C  CD2 . LEU A 1 25  ? 13.741 -4.473 25.448 1.00 47.86 ? 55  LEU A CD2 1 
ATOM   84   N  N   . GLU A 1 26  ? 15.982 -1.649 21.998 1.00 47.43 ? 56  GLU A N   1 
ATOM   85   C  CA  . GLU A 1 26  ? 15.720 -0.541 21.056 1.00 47.59 ? 56  GLU A CA  1 
ATOM   86   C  C   . GLU A 1 26  ? 14.964 0.634  21.727 1.00 47.35 ? 56  GLU A C   1 
ATOM   87   O  O   . GLU A 1 26  ? 14.365 1.508  21.069 1.00 47.53 ? 56  GLU A O   1 
ATOM   88   C  CB  . GLU A 1 26  ? 14.964 -1.043 19.831 1.00 47.57 ? 56  GLU A CB  1 
ATOM   89   C  CG  . GLU A 1 26  ? 13.595 -1.632 20.129 1.00 52.45 ? 56  GLU A CG  1 
ATOM   90   C  CD  . GLU A 1 26  ? 12.467 -0.675 19.875 1.00 53.94 ? 56  GLU A CD  1 
ATOM   91   O  OE1 . GLU A 1 26  ? 12.228 -0.346 18.689 1.00 57.15 ? 56  GLU A OE1 1 
ATOM   92   O  OE2 . GLU A 1 26  ? 11.816 -0.273 20.861 1.00 53.70 ? 56  GLU A OE2 1 
ATOM   93   N  N   . GLN A 1 27  ? 14.993 0.647  23.051 1.00 44.18 ? 57  GLN A N   1 
ATOM   94   C  CA  . GLN A 1 27  ? 14.759 1.862  23.768 1.00 42.12 ? 57  GLN A CA  1 
ATOM   95   C  C   . GLN A 1 27  ? 16.017 2.766  23.659 1.00 42.44 ? 57  GLN A C   1 
ATOM   96   O  O   . GLN A 1 27  ? 15.982 3.938  24.061 1.00 43.48 ? 57  GLN A O   1 
ATOM   97   C  CB  . GLN A 1 27  ? 14.339 1.550  25.208 1.00 42.11 ? 57  GLN A CB  1 
ATOM   98   C  CG  . GLN A 1 27  ? 15.422 0.978  26.072 1.00 39.48 ? 57  GLN A CG  1 
ATOM   99   C  CD  . GLN A 1 27  ? 14.898 0.189  27.263 1.00 38.91 ? 57  GLN A CD  1 
ATOM   100  O  OE1 . GLN A 1 27  ? 15.405 -0.876 27.548 1.00 41.08 ? 57  GLN A OE1 1 
ATOM   101  N  NE2 . GLN A 1 27  ? 13.891 0.706  27.955 1.00 25.59 ? 57  GLN A NE2 1 
ATOM   102  N  N   . ARG A 1 28  ? 17.109 2.234  23.098 1.00 41.08 ? 58  ARG A N   1 
ATOM   103  C  CA  . ARG A 1 28  ? 18.227 3.062  22.636 1.00 40.23 ? 58  ARG A CA  1 
ATOM   104  C  C   . ARG A 1 28  ? 17.790 3.822  21.418 1.00 40.98 ? 58  ARG A C   1 
ATOM   105  O  O   . ARG A 1 28  ? 17.983 5.038  21.340 1.00 43.52 ? 58  ARG A O   1 
ATOM   106  C  CB  . ARG A 1 28  ? 19.436 2.233  22.215 1.00 41.26 ? 58  ARG A CB  1 
ATOM   107  C  CG  . ARG A 1 28  ? 20.075 1.444  23.314 1.00 42.73 ? 58  ARG A CG  1 
ATOM   108  C  CD  . ARG A 1 28  ? 21.342 0.727  22.882 1.00 38.38 ? 58  ARG A CD  1 
ATOM   109  N  NE  . ARG A 1 28  ? 22.400 1.681  22.565 1.00 39.91 ? 58  ARG A NE  1 
ATOM   110  C  CZ  . ARG A 1 28  ? 23.652 1.352  22.253 1.00 32.91 ? 58  ARG A CZ  1 
ATOM   111  N  NH1 . ARG A 1 28  ? 24.047 0.074  22.228 1.00 24.56 ? 58  ARG A NH1 1 
ATOM   112  N  NH2 . ARG A 1 28  ? 24.518 2.314  21.975 1.00 28.50 ? 58  ARG A NH2 1 
ATOM   113  N  N   . LYS A 1 29  ? 17.216 3.095  20.457 1.00 40.30 ? 59  LYS A N   1 
ATOM   114  C  CA  . LYS A 1 29  ? 16.684 3.699  19.230 1.00 40.70 ? 59  LYS A CA  1 
ATOM   115  C  C   . LYS A 1 29  ? 15.702 4.837  19.562 1.00 40.90 ? 59  LYS A C   1 
ATOM   116  O  O   . LYS A 1 29  ? 15.673 5.870  18.890 1.00 40.08 ? 59  LYS A O   1 
ATOM   117  C  CB  . LYS A 1 29  ? 16.018 2.640  18.340 1.00 40.29 ? 59  LYS A CB  1 
ATOM   118  N  N   . PHE A 1 30  ? 14.927 4.645  20.623 1.00 41.30 ? 60  PHE A N   1 
ATOM   119  C  CA  . PHE A 1 30  ? 14.028 5.674  21.116 1.00 41.57 ? 60  PHE A CA  1 
ATOM   120  C  C   . PHE A 1 30  ? 14.816 6.896  21.616 1.00 41.80 ? 60  PHE A C   1 
ATOM   121  O  O   . PHE A 1 30  ? 14.600 8.026  21.146 1.00 39.64 ? 60  PHE A O   1 
ATOM   122  C  CB  . PHE A 1 30  ? 13.139 5.097  22.222 1.00 42.06 ? 60  PHE A CB  1 
ATOM   123  C  CG  . PHE A 1 30  ? 12.016 6.000  22.623 1.00 43.87 ? 60  PHE A CG  1 
ATOM   124  C  CD1 . PHE A 1 30  ? 10.789 5.925  21.986 1.00 42.59 ? 60  PHE A CD1 1 
ATOM   125  C  CD2 . PHE A 1 30  ? 12.193 6.941  23.626 1.00 40.80 ? 60  PHE A CD2 1 
ATOM   126  C  CE1 . PHE A 1 30  ? 9.754  6.779  22.347 1.00 42.62 ? 60  PHE A CE1 1 
ATOM   127  C  CE2 . PHE A 1 30  ? 11.166 7.774  23.995 1.00 42.76 ? 60  PHE A CE2 1 
ATOM   128  C  CZ  . PHE A 1 30  ? 9.946  7.696  23.354 1.00 42.09 ? 60  PHE A CZ  1 
ATOM   129  N  N   . TYR A 1 31  ? 15.749 6.668  22.544 1.00 41.31 ? 61  TYR A N   1 
ATOM   130  C  CA  . TYR A 1 31  ? 16.595 7.757  23.052 1.00 40.01 ? 61  TYR A CA  1 
ATOM   131  C  C   . TYR A 1 31  ? 17.247 8.526  21.908 1.00 39.34 ? 61  TYR A C   1 
ATOM   132  O  O   . TYR A 1 31  ? 17.252 9.745  21.889 1.00 40.45 ? 61  TYR A O   1 
ATOM   133  C  CB  . TYR A 1 31  ? 17.687 7.232  23.976 1.00 39.62 ? 61  TYR A CB  1 
ATOM   134  C  CG  . TYR A 1 31  ? 18.263 8.311  24.847 1.00 39.17 ? 61  TYR A CG  1 
ATOM   135  C  CD1 . TYR A 1 31  ? 17.631 8.676  26.031 1.00 45.39 ? 61  TYR A CD1 1 
ATOM   136  C  CD2 . TYR A 1 31  ? 19.416 8.996  24.481 1.00 41.56 ? 61  TYR A CD2 1 
ATOM   137  C  CE1 . TYR A 1 31  ? 18.134 9.694  26.840 1.00 47.00 ? 61  TYR A CE1 1 
ATOM   138  C  CE2 . TYR A 1 31  ? 19.940 10.016 25.293 1.00 41.38 ? 61  TYR A CE2 1 
ATOM   139  C  CZ  . TYR A 1 31  ? 19.283 10.367 26.467 1.00 40.53 ? 61  TYR A CZ  1 
ATOM   140  O  OH  . TYR A 1 31  ? 19.777 11.358 27.286 1.00 35.39 ? 61  TYR A OH  1 
ATOM   141  N  N   . GLU A 1 32  ? 17.777 7.797  20.942 1.00 38.82 ? 62  GLU A N   1 
ATOM   142  C  CA  . GLU A 1 32  ? 18.522 8.394  19.840 1.00 38.44 ? 62  GLU A CA  1 
ATOM   143  C  C   . GLU A 1 32  ? 17.680 9.271  18.916 1.00 37.16 ? 62  GLU A C   1 
ATOM   144  O  O   . GLU A 1 32  ? 18.122 10.328 18.508 1.00 36.45 ? 62  GLU A O   1 
ATOM   145  C  CB  . GLU A 1 32  ? 19.180 7.282  19.050 1.00 39.51 ? 62  GLU A CB  1 
ATOM   146  C  CG  . GLU A 1 32  ? 20.255 6.591  19.868 1.00 41.47 ? 62  GLU A CG  1 
ATOM   147  C  CD  . GLU A 1 32  ? 21.646 7.162  19.608 1.00 48.23 ? 62  GLU A CD  1 
ATOM   148  O  OE1 . GLU A 1 32  ? 21.956 7.587  18.454 1.00 35.43 ? 62  GLU A OE1 1 
ATOM   149  O  OE2 . GLU A 1 32  ? 22.429 7.185  20.582 1.00 53.86 ? 62  GLU A OE2 1 
ATOM   150  N  N   . GLU A 1 33  ? 16.471 8.827  18.593 1.00 36.75 ? 63  GLU A N   1 
ATOM   151  C  CA  . GLU A 1 33  ? 15.532 9.630  17.808 1.00 36.07 ? 63  GLU A CA  1 
ATOM   152  C  C   . GLU A 1 33  ? 14.864 10.765 18.618 1.00 35.67 ? 63  GLU A C   1 
ATOM   153  O  O   . GLU A 1 33  ? 14.492 11.786 18.035 1.00 36.33 ? 63  GLU A O   1 
ATOM   154  C  CB  . GLU A 1 33  ? 14.457 8.728  17.176 1.00 33.61 ? 63  GLU A CB  1 
ATOM   155  N  N   . ASN A 1 34  ? 14.717 10.580 19.941 1.00 35.42 ? 64  ASN A N   1 
ATOM   156  C  CA  . ASN A 1 34  ? 13.888 11.455 20.801 1.00 33.74 ? 64  ASN A CA  1 
ATOM   157  C  C   . ASN A 1 34  ? 14.631 12.295 21.822 1.00 31.86 ? 64  ASN A C   1 
ATOM   158  O  O   . ASN A 1 34  ? 14.228 13.419 22.115 1.00 30.56 ? 64  ASN A O   1 
ATOM   159  C  CB  . ASN A 1 34  ? 12.844 10.628 21.551 1.00 34.53 ? 64  ASN A CB  1 
ATOM   160  C  CG  . ASN A 1 34  ? 11.871 9.963  20.622 1.00 36.16 ? 64  ASN A CG  1 
ATOM   161  O  OD1 . ASN A 1 34  ? 10.948 10.616 20.110 1.00 34.31 ? 64  ASN A OD1 1 
ATOM   162  N  ND2 . ASN A 1 34  ? 12.070 8.653  20.375 1.00 28.70 ? 64  ASN A ND2 1 
ATOM   163  N  N   . GLY A 1 35  ? 15.698 11.746 22.379 1.00 31.91 ? 65  GLY A N   1 
ATOM   164  C  CA  . GLY A 1 35  ? 16.531 12.472 23.332 1.00 31.43 ? 65  GLY A CA  1 
ATOM   165  C  C   . GLY A 1 35  ? 16.080 12.345 24.770 1.00 30.23 ? 65  GLY A C   1 
ATOM   166  O  O   . GLY A 1 35  ? 16.642 13.002 25.660 1.00 28.48 ? 65  GLY A O   1 
ATOM   167  N  N   . PHE A 1 36  ? 15.051 11.522 24.993 1.00 30.35 ? 66  PHE A N   1 
ATOM   168  C  CA  . PHE A 1 36  ? 14.601 11.181 26.342 1.00 27.94 ? 66  PHE A CA  1 
ATOM   169  C  C   . PHE A 1 36  ? 14.198 9.717  26.426 1.00 28.56 ? 66  PHE A C   1 
ATOM   170  O  O   . PHE A 1 36  ? 13.846 9.096  25.425 1.00 24.22 ? 66  PHE A O   1 
ATOM   171  C  CB  . PHE A 1 36  ? 13.428 12.051 26.767 1.00 26.10 ? 66  PHE A CB  1 
ATOM   172  C  CG  . PHE A 1 36  ? 12.147 11.755 26.044 1.00 24.01 ? 66  PHE A CG  1 
ATOM   173  C  CD1 . PHE A 1 36  ? 11.179 10.948 26.615 1.00 29.27 ? 66  PHE A CD1 1 
ATOM   174  C  CD2 . PHE A 1 36  ? 11.887 12.314 24.815 1.00 29.67 ? 66  PHE A CD2 1 
ATOM   175  C  CE1 . PHE A 1 36  ? 10.006 10.689 25.957 1.00 26.40 ? 66  PHE A CE1 1 
ATOM   176  C  CE2 . PHE A 1 36  ? 10.706 12.067 24.165 1.00 25.60 ? 66  PHE A CE2 1 
ATOM   177  C  CZ  . PHE A 1 36  ? 9.771  11.236 24.736 1.00 24.13 ? 66  PHE A CZ  1 
ATOM   178  N  N   . LEU A 1 37  ? 14.227 9.197  27.647 1.00 30.21 ? 67  LEU A N   1 
ATOM   179  C  CA  . LEU A 1 37  ? 13.715 7.874  27.923 1.00 30.69 ? 67  LEU A CA  1 
ATOM   180  C  C   . LEU A 1 37  ? 13.140 7.775  29.329 1.00 29.99 ? 67  LEU A C   1 
ATOM   181  O  O   . LEU A 1 37  ? 13.783 8.175  30.297 1.00 29.71 ? 67  LEU A O   1 
ATOM   182  C  CB  . LEU A 1 37  ? 14.829 6.866  27.759 1.00 31.23 ? 67  LEU A CB  1 
ATOM   183  C  CG  . LEU A 1 37  ? 14.423 5.435  28.038 1.00 36.82 ? 67  LEU A CG  1 
ATOM   184  C  CD1 . LEU A 1 37  ? 13.345 5.007  27.058 1.00 39.00 ? 67  LEU A CD1 1 
ATOM   185  C  CD2 . LEU A 1 37  ? 15.650 4.540  27.963 1.00 37.50 ? 67  LEU A CD2 1 
ATOM   186  N  N   . VAL A 1 38  ? 11.929 7.227  29.421 1.00 31.17 ? 68  VAL A N   1 
ATOM   187  C  CA  . VAL A 1 38  ? 11.241 7.029  30.687 1.00 31.85 ? 68  VAL A CA  1 
ATOM   188  C  C   . VAL A 1 38  ? 11.251 5.560  31.117 1.00 33.63 ? 68  VAL A C   1 
ATOM   189  O  O   . VAL A 1 38  ? 10.745 4.669  30.412 1.00 31.02 ? 68  VAL A O   1 
ATOM   190  C  CB  . VAL A 1 38  ? 9.780  7.482  30.605 1.00 33.02 ? 68  VAL A CB  1 
ATOM   191  C  CG1 . VAL A 1 38  ? 9.078  7.338  31.992 1.00 34.70 ? 68  VAL A CG1 1 
ATOM   192  C  CG2 . VAL A 1 38  ? 9.713  8.903  30.097 1.00 29.75 ? 68  VAL A CG2 1 
ATOM   193  N  N   . ILE A 1 39  ? 11.837 5.337  32.289 1.00 34.71 ? 69  ILE A N   1 
ATOM   194  C  CA  . ILE A 1 39  ? 11.902 4.040  32.917 1.00 33.91 ? 69  ILE A CA  1 
ATOM   195  C  C   . ILE A 1 39  ? 10.867 4.032  34.025 1.00 35.94 ? 69  ILE A C   1 
ATOM   196  O  O   . ILE A 1 39  ? 10.952 4.850  34.950 1.00 35.90 ? 69  ILE A O   1 
ATOM   197  C  CB  . ILE A 1 39  ? 13.292 3.799  33.501 1.00 33.11 ? 69  ILE A CB  1 
ATOM   198  C  CG1 . ILE A 1 39  ? 14.347 4.006  32.414 1.00 38.47 ? 69  ILE A CG1 1 
ATOM   199  C  CG2 . ILE A 1 39  ? 13.402 2.376  34.062 1.00 32.57 ? 69  ILE A CG2 1 
ATOM   200  C  CD1 . ILE A 1 39  ? 14.217 3.023  31.208 1.00 39.34 ? 69  ILE A CD1 1 
ATOM   201  N  N   . LYS A 1 40  ? 9.907  3.107  33.927 1.00 36.54 ? 70  LYS A N   1 
ATOM   202  C  CA  . LYS A 1 40  ? 8.755  3.058  34.823 1.00 37.61 ? 70  LYS A CA  1 
ATOM   203  C  C   . LYS A 1 40  ? 9.184  2.570  36.202 1.00 39.60 ? 70  LYS A C   1 
ATOM   204  O  O   . LYS A 1 40  ? 10.126 1.782  36.315 1.00 40.08 ? 70  LYS A O   1 
ATOM   205  C  CB  . LYS A 1 40  ? 7.669  2.137  34.243 1.00 35.97 ? 70  LYS A CB  1 
ATOM   206  N  N   . ASN A 1 41  ? 8.502  3.057  37.244 1.00 40.10 ? 71  ASN A N   1 
ATOM   207  C  CA  . ASN A 1 41  ? 8.722  2.608  38.632 1.00 38.62 ? 71  ASN A CA  1 
ATOM   208  C  C   . ASN A 1 41  ? 10.181 2.269  38.915 1.00 37.74 ? 71  ASN A C   1 
ATOM   209  O  O   . ASN A 1 41  ? 10.517 1.132  39.216 1.00 37.47 ? 71  ASN A O   1 
ATOM   210  C  CB  . ASN A 1 41  ? 7.812  1.407  38.962 1.00 37.27 ? 71  ASN A CB  1 
ATOM   211  N  N   . LEU A 1 42  ? 11.046 3.267  38.819 1.00 38.19 ? 72  LEU A N   1 
ATOM   212  C  CA  . LEU A 1 42  ? 12.485 3.029  38.913 1.00 39.29 ? 72  LEU A CA  1 
ATOM   213  C  C   . LEU A 1 42  ? 12.995 3.193  40.342 1.00 38.94 ? 72  LEU A C   1 
ATOM   214  O  O   . LEU A 1 42  ? 13.891 2.464  40.773 1.00 38.76 ? 72  LEU A O   1 
ATOM   215  C  CB  . LEU A 1 42  ? 13.255 3.978  37.981 1.00 39.27 ? 72  LEU A CB  1 
ATOM   216  C  CG  . LEU A 1 42  ? 14.554 3.457  37.339 1.00 41.74 ? 72  LEU A CG  1 
ATOM   217  C  CD1 . LEU A 1 42  ? 15.364 4.602  36.733 1.00 39.83 ? 72  LEU A CD1 1 
ATOM   218  C  CD2 . LEU A 1 42  ? 15.431 2.660  38.298 1.00 45.35 ? 72  LEU A CD2 1 
ATOM   219  N  N   . VAL A 1 43  ? 12.443 4.165  41.060 1.00 37.77 ? 73  VAL A N   1 
ATOM   220  C  CA  . VAL A 1 43  ? 12.867 4.453  42.425 1.00 36.91 ? 73  VAL A CA  1 
ATOM   221  C  C   . VAL A 1 43  ? 11.778 3.945  43.392 1.00 35.96 ? 73  VAL A C   1 
ATOM   222  O  O   . VAL A 1 43  ? 10.605 4.280  43.242 1.00 33.35 ? 73  VAL A O   1 
ATOM   223  C  CB  . VAL A 1 43  ? 13.171 5.972  42.583 1.00 36.57 ? 73  VAL A CB  1 
ATOM   224  C  CG1 . VAL A 1 43  ? 13.480 6.353  44.029 1.00 37.05 ? 73  VAL A CG1 1 
ATOM   225  C  CG2 . VAL A 1 43  ? 14.335 6.357  41.685 1.00 37.23 ? 73  VAL A CG2 1 
ATOM   226  N  N   . PRO A 1 44  ? 12.155 3.077  44.348 1.00 37.24 ? 74  PRO A N   1 
ATOM   227  C  CA  . PRO A 1 44  ? 11.212 2.582  45.364 1.00 37.12 ? 74  PRO A CA  1 
ATOM   228  C  C   . PRO A 1 44  ? 10.406 3.679  46.074 1.00 38.95 ? 74  PRO A C   1 
ATOM   229  O  O   . PRO A 1 44  ? 10.942 4.756  46.366 1.00 40.81 ? 74  PRO A O   1 
ATOM   230  C  CB  . PRO A 1 44  ? 12.125 1.877  46.368 1.00 36.62 ? 74  PRO A CB  1 
ATOM   231  C  CG  . PRO A 1 44  ? 13.279 1.413  45.567 1.00 36.41 ? 74  PRO A CG  1 
ATOM   232  C  CD  . PRO A 1 44  ? 13.486 2.457  44.492 1.00 37.82 ? 74  PRO A CD  1 
ATOM   233  N  N   . ASP A 1 45  ? 9.125  3.402  46.329 1.00 39.28 ? 75  ASP A N   1 
ATOM   234  C  CA  . ASP A 1 45  ? 8.282  4.254  47.180 1.00 39.47 ? 75  ASP A CA  1 
ATOM   235  C  C   . ASP A 1 45  ? 9.017  4.630  48.469 1.00 39.13 ? 75  ASP A C   1 
ATOM   236  O  O   . ASP A 1 45  ? 8.885  5.746  48.963 1.00 36.95 ? 75  ASP A O   1 
ATOM   237  C  CB  . ASP A 1 45  ? 6.984  3.524  47.572 1.00 38.67 ? 75  ASP A CB  1 
ATOM   238  C  CG  . ASP A 1 45  ? 6.023  3.318  46.402 1.00 39.98 ? 75  ASP A CG  1 
ATOM   239  O  OD1 . ASP A 1 45  ? 6.090  4.065  45.396 1.00 31.55 ? 75  ASP A OD1 1 
ATOM   240  O  OD2 . ASP A 1 45  ? 5.177  2.396  46.508 1.00 38.99 ? 75  ASP A OD2 1 
ATOM   241  N  N   . ALA A 1 46  ? 9.763  3.670  49.019 1.00 39.81 ? 76  ALA A N   1 
ATOM   242  C  CA  . ALA A 1 46  ? 10.505 3.870  50.261 1.00 40.37 ? 76  ALA A CA  1 
ATOM   243  C  C   . ALA A 1 46  ? 11.483 5.038  50.143 1.00 40.65 ? 76  ALA A C   1 
ATOM   244  O  O   . ALA A 1 46  ? 11.556 5.880  51.036 1.00 42.12 ? 76  ALA A O   1 
ATOM   245  C  CB  . ALA A 1 46  ? 11.247 2.579  50.664 1.00 39.64 ? 76  ALA A CB  1 
ATOM   246  N  N   . ASP A 1 47  ? 12.216 5.091  49.034 1.00 40.08 ? 77  ASP A N   1 
ATOM   247  C  CA  . ASP A 1 47  ? 13.215 6.147  48.814 1.00 40.08 ? 77  ASP A CA  1 
ATOM   248  C  C   . ASP A 1 47  ? 12.582 7.510  48.513 1.00 37.42 ? 77  ASP A C   1 
ATOM   249  O  O   . ASP A 1 47  ? 13.103 8.548  48.933 1.00 37.25 ? 77  ASP A O   1 
ATOM   250  C  CB  . ASP A 1 47  ? 14.180 5.739  47.691 1.00 40.56 ? 77  ASP A CB  1 
ATOM   251  C  CG  . ASP A 1 47  ? 14.967 4.483  48.034 1.00 41.14 ? 77  ASP A CG  1 
ATOM   252  O  OD1 . ASP A 1 47  ? 15.300 4.314  49.218 1.00 44.57 ? 77  ASP A OD1 1 
ATOM   253  O  OD2 . ASP A 1 47  ? 15.256 3.665  47.135 1.00 43.74 ? 77  ASP A OD2 1 
ATOM   254  N  N   . ILE A 1 48  ? 11.458 7.502  47.804 1.00 35.32 ? 78  ILE A N   1 
ATOM   255  C  CA  . ILE A 1 48  ? 10.753 8.747  47.474 1.00 34.64 ? 78  ILE A CA  1 
ATOM   256  C  C   . ILE A 1 48  ? 10.272 9.438  48.748 1.00 34.61 ? 78  ILE A C   1 
ATOM   257  O  O   . ILE A 1 48  ? 10.391 10.658 48.885 1.00 33.41 ? 78  ILE A O   1 
ATOM   258  C  CB  . ILE A 1 48  ? 9.541  8.521  46.532 1.00 33.13 ? 78  ILE A CB  1 
ATOM   259  C  CG1 . ILE A 1 48  ? 9.960  7.841  45.218 1.00 33.13 ? 78  ILE A CG1 1 
ATOM   260  C  CG2 . ILE A 1 48  ? 8.866  9.848  46.219 1.00 31.35 ? 78  ILE A CG2 1 
ATOM   261  C  CD1 . ILE A 1 48  ? 11.031 8.605  44.399 1.00 35.83 ? 78  ILE A CD1 1 
ATOM   262  N  N   . GLN A 1 49  ? 9.736  8.638  49.669 1.00 35.78 ? 79  GLN A N   1 
ATOM   263  C  CA  . GLN A 1 49  ? 9.231  9.125  50.948 1.00 36.07 ? 79  GLN A CA  1 
ATOM   264  C  C   . GLN A 1 49  ? 10.362 9.703  51.795 1.00 36.85 ? 79  GLN A C   1 
ATOM   265  O  O   . GLN A 1 49  ? 10.193 10.754 52.411 1.00 38.07 ? 79  GLN A O   1 
ATOM   266  C  CB  . GLN A 1 49  ? 8.501  8.005  51.695 1.00 35.32 ? 79  GLN A CB  1 
ATOM   267  C  CG  . GLN A 1 49  ? 7.817  8.435  52.995 1.00 35.31 ? 79  GLN A CG  1 
ATOM   268  C  CD  . GLN A 1 49  ? 6.844  9.578  52.805 1.00 33.14 ? 79  GLN A CD  1 
ATOM   269  O  OE1 . GLN A 1 49  ? 5.761  9.390  52.269 1.00 41.23 ? 79  GLN A OE1 1 
ATOM   270  N  NE2 . GLN A 1 49  ? 7.223  10.769 53.250 1.00 32.96 ? 79  GLN A NE2 1 
ATOM   271  N  N   . ARG A 1 50  ? 11.514 9.035  51.807 1.00 36.78 ? 80  ARG A N   1 
ATOM   272  C  CA  . ARG A 1 50  ? 12.708 9.596  52.442 1.00 37.30 ? 80  ARG A CA  1 
ATOM   273  C  C   . ARG A 1 50  ? 13.085 10.988 51.860 1.00 36.77 ? 80  ARG A C   1 
ATOM   274  O  O   . ARG A 1 50  ? 13.418 11.901 52.620 1.00 38.40 ? 80  ARG A O   1 
ATOM   275  C  CB  . ARG A 1 50  ? 13.897 8.623  52.340 1.00 37.83 ? 80  ARG A CB  1 
ATOM   276  C  CG  . ARG A 1 50  ? 13.767 7.361  53.187 1.00 37.66 ? 80  ARG A CG  1 
ATOM   277  C  CD  . ARG A 1 50  ? 14.931 6.369  52.965 1.00 37.32 ? 80  ARG A CD  1 
ATOM   278  N  NE  . ARG A 1 50  ? 16.141 6.712  53.718 1.00 36.14 ? 80  ARG A NE  1 
ATOM   279  C  CZ  . ARG A 1 50  ? 17.218 5.929  53.825 1.00 36.81 ? 80  ARG A CZ  1 
ATOM   280  N  NH1 . ARG A 1 50  ? 17.267 4.740  53.233 1.00 37.25 ? 80  ARG A NH1 1 
ATOM   281  N  NH2 . ARG A 1 50  ? 18.259 6.334  54.540 1.00 37.20 ? 80  ARG A NH2 1 
ATOM   282  N  N   . PHE A 1 51  ? 13.029 11.160 50.538 1.00 34.34 ? 81  PHE A N   1 
ATOM   283  C  CA  . PHE A 1 51  ? 13.307 12.490 49.936 1.00 33.90 ? 81  PHE A CA  1 
ATOM   284  C  C   . PHE A 1 51  ? 12.269 13.528 50.388 1.00 33.31 ? 81  PHE A C   1 
ATOM   285  O  O   . PHE A 1 51  ? 12.624 14.653 50.762 1.00 31.83 ? 81  PHE A O   1 
ATOM   286  C  CB  . PHE A 1 51  ? 13.341 12.441 48.395 1.00 32.52 ? 81  PHE A CB  1 
ATOM   287  C  CG  . PHE A 1 51  ? 14.308 11.421 47.822 1.00 34.31 ? 81  PHE A CG  1 
ATOM   288  C  CD1 . PHE A 1 51  ? 15.554 11.179 48.423 1.00 35.76 ? 81  PHE A CD1 1 
ATOM   289  C  CD2 . PHE A 1 51  ? 13.969 10.701 46.674 1.00 29.41 ? 81  PHE A CD2 1 
ATOM   290  C  CE1 . PHE A 1 51  ? 16.431 10.220 47.894 1.00 34.03 ? 81  PHE A CE1 1 
ATOM   291  C  CE2 . PHE A 1 51  ? 14.842 9.749  46.132 1.00 29.05 ? 81  PHE A CE2 1 
ATOM   292  C  CZ  . PHE A 1 51  ? 16.074 9.513  46.735 1.00 32.70 ? 81  PHE A CZ  1 
ATOM   293  N  N   . ARG A 1 52  ? 10.993 13.129 50.355 1.00 32.78 ? 82  ARG A N   1 
ATOM   294  C  CA  . ARG A 1 52  ? 9.883  13.966 50.834 1.00 32.13 ? 82  ARG A CA  1 
ATOM   295  C  C   . ARG A 1 52  ? 10.149 14.461 52.264 1.00 32.09 ? 82  ARG A C   1 
ATOM   296  O  O   . ARG A 1 52  ? 10.133 15.673 52.534 1.00 31.76 ? 82  ARG A O   1 
ATOM   297  C  CB  . ARG A 1 52  ? 8.535  13.200 50.753 1.00 31.80 ? 82  ARG A CB  1 
ATOM   298  C  CG  . ARG A 1 52  ? 7.499  13.807 49.766 1.00 34.50 ? 82  ARG A CG  1 
ATOM   299  C  CD  . ARG A 1 52  ? 6.636  12.749 49.048 1.00 32.06 ? 82  ARG A CD  1 
ATOM   300  N  N   . ASN A 1 53  ? 10.406 13.505 53.156 1.00 30.25 ? 83  ASN A N   1 
ATOM   301  C  CA  . ASN A 1 53  ? 10.682 13.767 54.557 1.00 30.53 ? 83  ASN A CA  1 
ATOM   302  C  C   . ASN A 1 53  ? 11.795 14.787 54.785 1.00 30.70 ? 83  ASN A C   1 
ATOM   303  O  O   . ASN A 1 53  ? 11.630 15.722 55.571 1.00 30.00 ? 83  ASN A O   1 
ATOM   304  C  CB  . ASN A 1 53  ? 11.055 12.453 55.273 1.00 31.77 ? 83  ASN A CB  1 
ATOM   305  C  CG  . ASN A 1 53  ? 9.887  11.479 55.379 1.00 31.69 ? 83  ASN A CG  1 
ATOM   306  O  OD1 . ASN A 1 53  ? 8.775  11.777 54.936 1.00 38.24 ? 83  ASN A OD1 1 
ATOM   307  N  ND2 . ASN A 1 53  ? 10.141 10.300 55.962 1.00 27.13 ? 83  ASN A ND2 1 
ATOM   308  N  N   . GLU A 1 54  ? 12.924 14.604 54.101 1.00 31.90 ? 84  GLU A N   1 
ATOM   309  C  CA  . GLU A 1 54  ? 14.080 15.506 54.248 1.00 33.05 ? 84  GLU A CA  1 
ATOM   310  C  C   . GLU A 1 54  ? 13.809 16.924 53.725 1.00 32.74 ? 84  GLU A C   1 
ATOM   311  O  O   . GLU A 1 54  ? 14.218 17.908 54.363 1.00 30.53 ? 84  GLU A O   1 
ATOM   312  C  CB  . GLU A 1 54  ? 15.310 14.915 53.548 1.00 33.53 ? 84  GLU A CB  1 
ATOM   313  C  CG  . GLU A 1 54  ? 16.623 15.680 53.785 1.00 34.74 ? 84  GLU A CG  1 
ATOM   314  C  CD  . GLU A 1 54  ? 17.179 15.521 55.183 1.00 32.75 ? 84  GLU A CD  1 
ATOM   315  O  OE1 . GLU A 1 54  ? 16.639 14.710 55.967 1.00 33.16 ? 84  GLU A OE1 1 
ATOM   316  O  OE2 . GLU A 1 54  ? 18.173 16.211 55.496 1.00 38.68 ? 84  GLU A OE2 1 
ATOM   317  N  N   . PHE A 1 55  ? 13.135 17.010 52.570 1.00 32.88 ? 85  PHE A N   1 
ATOM   318  C  CA  . PHE A 1 55  ? 12.680 18.291 52.009 1.00 34.16 ? 85  PHE A CA  1 
ATOM   319  C  C   . PHE A 1 55  ? 11.866 19.081 53.016 1.00 33.53 ? 85  PHE A C   1 
ATOM   320  O  O   . PHE A 1 55  ? 12.152 20.253 53.259 1.00 33.70 ? 85  PHE A O   1 
ATOM   321  C  CB  . PHE A 1 55  ? 11.825 18.084 50.751 1.00 35.20 ? 85  PHE A CB  1 
ATOM   322  C  CG  . PHE A 1 55  ? 11.252 19.367 50.180 1.00 39.27 ? 85  PHE A CG  1 
ATOM   323  C  CD1 . PHE A 1 55  ? 12.019 20.185 49.347 1.00 43.95 ? 85  PHE A CD1 1 
ATOM   324  C  CD2 . PHE A 1 55  ? 9.948  19.752 50.461 1.00 44.17 ? 85  PHE A CD2 1 
ATOM   325  C  CE1 . PHE A 1 55  ? 11.490 21.365 48.814 1.00 40.90 ? 85  PHE A CE1 1 
ATOM   326  C  CE2 . PHE A 1 55  ? 9.414  20.929 49.924 1.00 43.63 ? 85  PHE A CE2 1 
ATOM   327  C  CZ  . PHE A 1 55  ? 10.186 21.733 49.107 1.00 39.73 ? 85  PHE A CZ  1 
ATOM   328  N  N   . GLU A 1 56  ? 10.858 18.436 53.596 1.00 31.97 ? 86  GLU A N   1 
ATOM   329  C  CA  . GLU A 1 56  ? 9.998  19.102 54.580 1.00 33.16 ? 86  GLU A CA  1 
ATOM   330  C  C   . GLU A 1 56  ? 10.759 19.578 55.832 1.00 32.38 ? 86  GLU A C   1 
ATOM   331  O  O   . GLU A 1 56  ? 10.479 20.660 56.354 1.00 32.10 ? 86  GLU A O   1 
ATOM   332  C  CB  . GLU A 1 56  ? 8.790  18.217 54.957 1.00 34.20 ? 86  GLU A CB  1 
ATOM   333  C  CG  . GLU A 1 56  ? 7.514  18.548 54.159 1.00 35.81 ? 86  GLU A CG  1 
ATOM   334  C  CD  . GLU A 1 56  ? 6.972  19.951 54.466 1.00 39.44 ? 86  GLU A CD  1 
ATOM   335  O  OE1 . GLU A 1 56  ? 7.000  20.354 55.655 1.00 41.09 ? 86  GLU A OE1 1 
ATOM   336  O  OE2 . GLU A 1 56  ? 6.527  20.649 53.524 1.00 33.98 ? 86  GLU A OE2 1 
ATOM   337  N  N   . LYS A 1 57  ? 11.725 18.790 56.302 1.00 31.86 ? 87  LYS A N   1 
ATOM   338  C  CA  . LYS A 1 57  ? 12.621 19.252 57.375 1.00 31.97 ? 87  LYS A CA  1 
ATOM   339  C  C   . LYS A 1 57  ? 13.351 20.531 56.959 1.00 32.06 ? 87  LYS A C   1 
ATOM   340  O  O   . LYS A 1 57  ? 13.439 21.488 57.726 1.00 32.51 ? 87  LYS A O   1 
ATOM   341  C  CB  . LYS A 1 57  ? 13.635 18.169 57.771 1.00 31.48 ? 87  LYS A CB  1 
ATOM   342  C  CG  . LYS A 1 57  ? 13.084 17.150 58.733 1.00 31.46 ? 87  LYS A CG  1 
ATOM   343  C  CD  . LYS A 1 57  ? 13.792 15.808 58.631 1.00 32.91 ? 87  LYS A CD  1 
ATOM   344  C  CE  . LYS A 1 57  ? 13.318 14.858 59.741 1.00 31.99 ? 87  LYS A CE  1 
ATOM   345  N  NZ  . LYS A 1 57  ? 11.827 14.757 59.772 1.00 33.86 ? 87  LYS A NZ  1 
ATOM   346  N  N   . ILE A 1 58  ? 13.872 20.552 55.741 1.00 32.48 ? 88  ILE A N   1 
ATOM   347  C  CA  . ILE A 1 58  ? 14.493 21.765 55.240 1.00 33.59 ? 88  ILE A CA  1 
ATOM   348  C  C   . ILE A 1 58  ? 13.439 22.872 55.247 1.00 33.14 ? 88  ILE A C   1 
ATOM   349  O  O   . ILE A 1 58  ? 13.696 23.969 55.755 1.00 31.59 ? 88  ILE A O   1 
ATOM   350  C  CB  . ILE A 1 58  ? 15.103 21.555 53.839 1.00 34.55 ? 88  ILE A CB  1 
ATOM   351  C  CG1 . ILE A 1 58  ? 16.293 20.598 53.938 1.00 32.86 ? 88  ILE A CG1 1 
ATOM   352  C  CG2 . ILE A 1 58  ? 15.549 22.895 53.232 1.00 35.55 ? 88  ILE A CG2 1 
ATOM   353  C  CD1 . ILE A 1 58  ? 16.654 19.948 52.648 1.00 30.55 ? 88  ILE A CD1 1 
ATOM   354  N  N   . CYS A 1 59  ? 12.247 22.551 54.733 1.00 34.08 ? 89  CYS A N   1 
ATOM   355  C  CA  . CYS A 1 59  ? 11.099 23.487 54.719 1.00 35.02 ? 89  CYS A CA  1 
ATOM   356  C  C   . CYS A 1 59  ? 10.750 24.057 56.106 1.00 35.24 ? 89  CYS A C   1 
ATOM   357  O  O   . CYS A 1 59  ? 10.353 25.213 56.197 1.00 35.25 ? 89  CYS A O   1 
ATOM   358  C  CB  . CYS A 1 59  ? 9.850  22.861 54.064 1.00 34.09 ? 89  CYS A CB  1 
ATOM   359  S  SG  . CYS A 1 59  ? 9.934  22.670 52.236 1.00 35.54 ? 89  CYS A SG  1 
ATOM   360  N  N   . ARG A 1 60  ? 10.913 23.273 57.171 1.00 36.20 ? 90  ARG A N   1 
ATOM   361  C  CA  . ARG A 1 60  ? 10.734 23.790 58.549 1.00 38.41 ? 90  ARG A CA  1 
ATOM   362  C  C   . ARG A 1 60  ? 12.005 24.386 59.188 1.00 39.18 ? 90  ARG A C   1 
ATOM   363  O  O   . ARG A 1 60  ? 12.016 24.678 60.386 1.00 38.55 ? 90  ARG A O   1 
ATOM   364  C  CB  . ARG A 1 60  ? 10.194 22.695 59.471 1.00 38.69 ? 90  ARG A CB  1 
ATOM   365  C  CG  . ARG A 1 60  ? 8.797  22.217 59.119 1.00 41.81 ? 90  ARG A CG  1 
ATOM   366  C  CD  . ARG A 1 60  ? 8.478  20.918 59.833 1.00 42.99 ? 90  ARG A CD  1 
ATOM   367  N  NE  . ARG A 1 60  ? 7.785  19.973 58.956 1.00 45.47 ? 90  ARG A NE  1 
ATOM   368  C  CZ  . ARG A 1 60  ? 7.900  18.644 59.022 1.00 44.93 ? 90  ARG A CZ  1 
ATOM   369  N  NH1 . ARG A 1 60  ? 7.209  17.882 58.175 1.00 43.25 ? 90  ARG A NH1 1 
ATOM   370  N  NH2 . ARG A 1 60  ? 8.701  18.065 59.918 1.00 41.88 ? 90  ARG A NH2 1 
ATOM   371  N  N   . LYS A 1 61  ? 13.067 24.566 58.401 1.00 41.02 ? 91  LYS A N   1 
ATOM   372  C  CA  . LYS A 1 61  ? 14.333 25.099 58.913 1.00 41.39 ? 91  LYS A CA  1 
ATOM   373  C  C   . LYS A 1 61  ? 14.828 24.301 60.132 1.00 43.20 ? 91  LYS A C   1 
ATOM   374  O  O   . LYS A 1 61  ? 15.409 24.864 61.072 1.00 44.22 ? 91  LYS A O   1 
ATOM   375  C  CB  . LYS A 1 61  ? 14.185 26.587 59.252 1.00 40.28 ? 91  LYS A CB  1 
ATOM   376  N  N   . GLU A 1 62  ? 14.582 22.988 60.106 1.00 44.10 ? 92  GLU A N   1 
ATOM   377  C  CA  . GLU A 1 62  ? 15.055 22.070 61.148 1.00 44.06 ? 92  GLU A CA  1 
ATOM   378  C  C   . GLU A 1 62  ? 16.406 21.485 60.735 1.00 43.95 ? 92  GLU A C   1 
ATOM   379  O  O   . GLU A 1 62  ? 17.285 21.288 61.574 1.00 45.04 ? 92  GLU A O   1 
ATOM   380  C  CB  . GLU A 1 62  ? 14.030 20.955 61.400 1.00 44.26 ? 92  GLU A CB  1 
ATOM   381  N  N   . VAL A 1 63  ? 16.559 21.217 59.439 1.00 43.03 ? 93  VAL A N   1 
ATOM   382  C  CA  . VAL A 1 63  ? 17.824 20.805 58.851 1.00 42.86 ? 93  VAL A CA  1 
ATOM   383  C  C   . VAL A 1 63  ? 18.348 21.925 57.950 1.00 43.03 ? 93  VAL A C   1 
ATOM   384  O  O   . VAL A 1 63  ? 17.613 22.404 57.087 1.00 44.33 ? 93  VAL A O   1 
ATOM   385  C  CB  . VAL A 1 63  ? 17.636 19.542 57.985 1.00 43.25 ? 93  VAL A CB  1 
ATOM   386  N  N   . LYS A 1 64  ? 19.608 22.331 58.141 1.00 42.22 ? 94  LYS A N   1 
ATOM   387  C  CA  . LYS A 1 64  ? 20.243 23.386 57.333 1.00 41.12 ? 94  LYS A CA  1 
ATOM   388  C  C   . LYS A 1 64  ? 21.528 22.882 56.664 1.00 40.70 ? 94  LYS A C   1 
ATOM   389  O  O   . LYS A 1 64  ? 22.621 23.138 57.155 1.00 40.83 ? 94  LYS A O   1 
ATOM   390  C  CB  . LYS A 1 64  ? 20.550 24.617 58.199 1.00 40.16 ? 94  LYS A CB  1 
ATOM   391  N  N   . PRO A 1 65  ? 21.402 22.180 55.523 1.00 41.59 ? 95  PRO A N   1 
ATOM   392  C  CA  . PRO A 1 65  ? 22.572 21.651 54.803 1.00 42.57 ? 95  PRO A CA  1 
ATOM   393  C  C   . PRO A 1 65  ? 23.571 22.737 54.401 1.00 43.14 ? 95  PRO A C   1 
ATOM   394  O  O   . PRO A 1 65  ? 23.199 23.916 54.319 1.00 43.96 ? 95  PRO A O   1 
ATOM   395  C  CB  . PRO A 1 65  ? 21.959 20.996 53.555 1.00 41.26 ? 95  PRO A CB  1 
ATOM   396  C  CG  . PRO A 1 65  ? 20.560 20.736 53.919 1.00 40.77 ? 95  PRO A CG  1 
ATOM   397  C  CD  . PRO A 1 65  ? 20.152 21.850 54.818 1.00 41.12 ? 95  PRO A CD  1 
ATOM   398  N  N   . LEU A 1 66  ? 24.810 22.327 54.120 1.00 42.88 ? 96  LEU A N   1 
ATOM   399  C  CA  . LEU A 1 66  ? 25.945 23.256 54.112 1.00 43.31 ? 96  LEU A CA  1 
ATOM   400  C  C   . LEU A 1 66  ? 25.850 24.326 53.025 1.00 41.79 ? 96  LEU A C   1 
ATOM   401  O  O   . LEU A 1 66  ? 25.638 25.506 53.331 1.00 42.32 ? 96  LEU A O   1 
ATOM   402  C  CB  . LEU A 1 66  ? 27.279 22.494 54.017 1.00 44.08 ? 96  LEU A CB  1 
ATOM   403  C  CG  . LEU A 1 66  ? 28.575 23.310 53.890 1.00 42.28 ? 96  LEU A CG  1 
ATOM   404  C  CD1 . LEU A 1 66  ? 28.853 24.172 55.126 1.00 38.01 ? 96  LEU A CD1 1 
ATOM   405  C  CD2 . LEU A 1 66  ? 29.737 22.370 53.619 1.00 43.52 ? 96  LEU A CD2 1 
ATOM   406  N  N   . GLY A 1 67  ? 26.008 23.923 51.772 1.00 39.77 ? 97  GLY A N   1 
ATOM   407  C  CA  . GLY A 1 67  ? 26.032 24.880 50.665 1.00 38.51 ? 97  GLY A CA  1 
ATOM   408  C  C   . GLY A 1 67  ? 24.725 24.985 49.897 1.00 37.24 ? 97  GLY A C   1 
ATOM   409  O  O   . GLY A 1 67  ? 24.718 25.396 48.739 1.00 36.80 ? 97  GLY A O   1 
ATOM   410  N  N   . LEU A 1 68  ? 23.616 24.648 50.547 1.00 36.65 ? 98  LEU A N   1 
ATOM   411  C  CA  . LEU A 1 68  ? 22.321 24.557 49.870 1.00 36.27 ? 98  LEU A CA  1 
ATOM   412  C  C   . LEU A 1 68  ? 21.731 25.909 49.485 1.00 34.74 ? 98  LEU A C   1 
ATOM   413  O  O   . LEU A 1 68  ? 21.761 26.852 50.270 1.00 32.85 ? 98  LEU A O   1 
ATOM   414  C  CB  . LEU A 1 68  ? 21.313 23.808 50.744 1.00 35.96 ? 98  LEU A CB  1 
ATOM   415  C  CG  . LEU A 1 68  ? 19.972 23.498 50.069 1.00 38.09 ? 98  LEU A CG  1 
ATOM   416  C  CD1 . LEU A 1 68  ? 20.126 22.364 49.041 1.00 40.91 ? 98  LEU A CD1 1 
ATOM   417  C  CD2 . LEU A 1 68  ? 18.932 23.151 51.122 1.00 37.48 ? 98  LEU A CD2 1 
ATOM   418  N  N   . THR A 1 69  ? 21.173 25.962 48.275 1.00 34.47 ? 99  THR A N   1 
ATOM   419  C  CA  . THR A 1 69  ? 20.494 27.143 47.748 1.00 35.21 ? 99  THR A CA  1 
ATOM   420  C  C   . THR A 1 69  ? 18.961 26.934 47.827 1.00 34.00 ? 99  THR A C   1 
ATOM   421  O  O   . THR A 1 69  ? 18.451 25.867 47.500 1.00 32.80 ? 99  THR A O   1 
ATOM   422  C  CB  . THR A 1 69  ? 20.922 27.423 46.277 1.00 35.46 ? 99  THR A CB  1 
ATOM   423  O  OG1 . THR A 1 69  ? 22.287 27.029 46.081 1.00 38.26 ? 99  THR A OG1 1 
ATOM   424  C  CG2 . THR A 1 69  ? 20.785 28.904 45.939 1.00 35.96 ? 99  THR A CG2 1 
ATOM   425  N  N   . VAL A 1 70  ? 18.239 27.951 48.279 1.00 33.44 ? 100 VAL A N   1 
ATOM   426  C  CA  . VAL A 1 70  ? 16.799 27.854 48.442 1.00 34.45 ? 100 VAL A CA  1 
ATOM   427  C  C   . VAL A 1 70  ? 16.142 28.968 47.644 1.00 36.83 ? 100 VAL A C   1 
ATOM   428  O  O   . VAL A 1 70  ? 16.539 30.139 47.747 1.00 38.06 ? 100 VAL A O   1 
ATOM   429  C  CB  . VAL A 1 70  ? 16.381 27.966 49.929 1.00 34.45 ? 100 VAL A CB  1 
ATOM   430  C  CG1 . VAL A 1 70  ? 14.864 28.006 50.058 1.00 36.50 ? 100 VAL A CG1 1 
ATOM   431  C  CG2 . VAL A 1 70  ? 16.960 26.806 50.752 1.00 30.04 ? 100 VAL A CG2 1 
ATOM   432  N  N   . MET A 1 71  ? 15.159 28.587 46.831 1.00 38.47 ? 101 MET A N   1 
ATOM   433  C  CA  . MET A 1 71  ? 14.328 29.532 46.095 1.00 39.63 ? 101 MET A CA  1 
ATOM   434  C  C   . MET A 1 71  ? 13.004 29.586 46.814 1.00 37.88 ? 101 MET A C   1 
ATOM   435  O  O   . MET A 1 71  ? 12.398 28.546 47.061 1.00 38.22 ? 101 MET A O   1 
ATOM   436  C  CB  . MET A 1 71  ? 14.080 29.061 44.658 1.00 41.45 ? 101 MET A CB  1 
ATOM   437  C  CG  . MET A 1 71  ? 15.214 29.306 43.681 1.00 46.37 ? 101 MET A CG  1 
ATOM   438  S  SD  . MET A 1 71  ? 16.733 28.437 44.104 1.00 60.13 ? 101 MET A SD  1 
ATOM   439  C  CE  . MET A 1 71  ? 17.547 28.512 42.512 1.00 51.81 ? 101 MET A CE  1 
ATOM   440  N  N   . ARG A 1 72  ? 12.563 30.792 47.152 1.00 37.41 ? 102 ARG A N   1 
ATOM   441  C  CA  . ARG A 1 72  ? 11.228 31.013 47.686 1.00 36.63 ? 102 ARG A CA  1 
ATOM   442  C  C   . ARG A 1 72  ? 10.470 31.973 46.777 1.00 35.59 ? 102 ARG A C   1 
ATOM   443  O  O   . ARG A 1 72  ? 10.239 33.120 47.136 1.00 34.79 ? 102 ARG A O   1 
ATOM   444  C  CB  . ARG A 1 72  ? 11.313 31.575 49.100 1.00 37.77 ? 102 ARG A CB  1 
ATOM   445  C  CG  . ARG A 1 72  ? 12.018 30.666 50.089 1.00 39.45 ? 102 ARG A CG  1 
ATOM   446  C  CD  . ARG A 1 72  ? 12.172 31.348 51.424 1.00 44.23 ? 102 ARG A CD  1 
ATOM   447  N  NE  . ARG A 1 72  ? 12.138 30.382 52.521 1.00 49.02 ? 102 ARG A NE  1 
ATOM   448  C  CZ  . ARG A 1 72  ? 13.181 30.000 53.261 1.00 53.19 ? 102 ARG A CZ  1 
ATOM   449  N  NH1 . ARG A 1 72  ? 14.408 30.496 53.063 1.00 50.83 ? 102 ARG A NH1 1 
ATOM   450  N  NH2 . ARG A 1 72  ? 12.987 29.106 54.227 1.00 53.91 ? 102 ARG A NH2 1 
ATOM   451  N  N   . ASP A 1 73  ? 10.066 31.491 45.605 1.00 35.24 ? 103 ASP A N   1 
ATOM   452  C  CA  . ASP A 1 73  ? 9.477  32.357 44.585 1.00 36.82 ? 103 ASP A CA  1 
ATOM   453  C  C   . ASP A 1 73  ? 7.954  32.601 44.702 1.00 37.27 ? 103 ASP A C   1 
ATOM   454  O  O   . ASP A 1 73  ? 7.341  33.176 43.790 1.00 37.81 ? 103 ASP A O   1 
ATOM   455  C  CB  . ASP A 1 73  ? 9.820  31.811 43.197 1.00 37.81 ? 103 ASP A CB  1 
ATOM   456  C  CG  . ASP A 1 73  ? 11.319 31.810 42.926 1.00 41.24 ? 103 ASP A CG  1 
ATOM   457  O  OD1 . ASP A 1 73  ? 11.773 30.939 42.165 1.00 46.51 ? 103 ASP A OD1 1 
ATOM   458  O  OD2 . ASP A 1 73  ? 12.051 32.666 43.477 1.00 44.37 ? 103 ASP A OD2 1 
ATOM   459  N  N   . VAL A 1 74  ? 7.349  32.182 45.812 1.00 36.92 ? 104 VAL A N   1 
ATOM   460  C  CA  . VAL A 1 74  ? 5.910  32.354 46.026 1.00 37.87 ? 104 VAL A CA  1 
ATOM   461  C  C   . VAL A 1 74  ? 5.634  32.650 47.491 1.00 37.70 ? 104 VAL A C   1 
ATOM   462  O  O   . VAL A 1 74  ? 6.233  32.026 48.375 1.00 37.52 ? 104 VAL A O   1 
ATOM   463  C  CB  . VAL A 1 74  ? 5.100  31.095 45.604 1.00 39.78 ? 104 VAL A CB  1 
ATOM   464  C  CG1 . VAL A 1 74  ? 5.121  30.905 44.072 1.00 41.30 ? 104 VAL A CG1 1 
ATOM   465  C  CG2 . VAL A 1 74  ? 5.612  29.827 46.305 1.00 41.15 ? 104 VAL A CG2 1 
ATOM   466  N  N   . THR A 1 75  ? 4.753  33.617 47.742 1.00 36.67 ? 105 THR A N   1 
ATOM   467  C  CA  . THR A 1 75  ? 4.318  33.930 49.098 1.00 37.05 ? 105 THR A CA  1 
ATOM   468  C  C   . THR A 1 75  ? 2.801  33.829 49.227 1.00 35.91 ? 105 THR A C   1 
ATOM   469  O  O   . THR A 1 75  ? 2.057  33.901 48.241 1.00 35.26 ? 105 THR A O   1 
ATOM   470  C  CB  . THR A 1 75  ? 4.790  35.333 49.569 1.00 38.60 ? 105 THR A CB  1 
ATOM   471  O  OG1 . THR A 1 75  ? 4.387  36.335 48.624 1.00 41.32 ? 105 THR A OG1 1 
ATOM   472  C  CG2 . THR A 1 75  ? 6.312  35.363 49.748 1.00 39.39 ? 105 THR A CG2 1 
ATOM   473  N  N   . ILE A 1 76  ? 2.363  33.675 50.470 1.00 34.65 ? 106 ILE A N   1 
ATOM   474  C  CA  . ILE A 1 76  ? 0.994  33.288 50.783 1.00 33.67 ? 106 ILE A CA  1 
ATOM   475  C  C   . ILE A 1 76  ? 0.560  34.074 52.025 1.00 31.50 ? 106 ILE A C   1 
ATOM   476  O  O   . ILE A 1 76  ? 1.376  34.318 52.919 1.00 31.96 ? 106 ILE A O   1 
ATOM   477  C  CB  . ILE A 1 76  ? 0.911  31.731 50.943 1.00 33.21 ? 106 ILE A CB  1 
ATOM   478  C  CG1 . ILE A 1 76  ? -0.526 31.252 51.180 1.00 35.81 ? 106 ILE A CG1 1 
ATOM   479  C  CG2 . ILE A 1 76  ? 1.882  31.245 52.010 1.00 37.41 ? 106 ILE A CG2 1 
ATOM   480  C  CD1 . ILE A 1 76  ? -0.849 30.828 52.603 1.00 38.39 ? 106 ILE A CD1 1 
ATOM   481  N  N   . SER A 1 77  ? -0.700 34.512 52.047 1.00 28.98 ? 107 SER A N   1 
ATOM   482  C  CA  . SER A 1 77  ? -1.205 35.408 53.095 1.00 28.62 ? 107 SER A CA  1 
ATOM   483  C  C   . SER A 1 77  ? -2.655 35.115 53.477 1.00 27.02 ? 107 SER A C   1 
ATOM   484  O  O   . SER A 1 77  ? -3.419 34.591 52.672 1.00 25.93 ? 107 SER A O   1 
ATOM   485  C  CB  . SER A 1 77  ? -1.086 36.863 52.640 1.00 29.05 ? 107 SER A CB  1 
ATOM   486  O  OG  . SER A 1 77  ? -1.425 36.987 51.272 1.00 32.03 ? 107 SER A OG  1 
ATOM   487  N  N   . LYS A 1 78  ? -3.024 35.481 54.703 1.00 26.58 ? 108 LYS A N   1 
ATOM   488  C  CA  . LYS A 1 78  ? -4.329 35.133 55.267 1.00 26.33 ? 108 LYS A CA  1 
ATOM   489  C  C   . LYS A 1 78  ? -4.872 36.219 56.185 1.00 25.50 ? 108 LYS A C   1 
ATOM   490  O  O   . LYS A 1 78  ? -4.867 37.396 55.842 1.00 25.42 ? 108 LYS A O   1 
ATOM   491  C  CB  . LYS A 1 78  ? -4.209 33.834 56.056 1.00 26.59 ? 108 LYS A CB  1 
ATOM   492  N  N   . SER A 1 84  ? 3.127  38.501 54.989 1.00 39.58 ? 114 SER A N   1 
ATOM   493  C  CA  . SER A 1 84  ? 2.963  37.201 54.347 1.00 40.16 ? 114 SER A CA  1 
ATOM   494  C  C   . SER A 1 84  ? 4.048  36.231 54.831 1.00 40.94 ? 114 SER A C   1 
ATOM   495  O  O   . SER A 1 84  ? 4.731  36.509 55.819 1.00 40.99 ? 114 SER A O   1 
ATOM   496  C  CB  . SER A 1 84  ? 2.996  37.356 52.826 1.00 39.86 ? 114 SER A CB  1 
ATOM   497  N  N   . GLU A 1 85  ? 4.188  35.092 54.152 1.00 41.19 ? 115 GLU A N   1 
ATOM   498  C  CA  . GLU A 1 85  ? 5.166  34.068 54.540 1.00 41.07 ? 115 GLU A CA  1 
ATOM   499  C  C   . GLU A 1 85  ? 5.585  33.289 53.296 1.00 40.10 ? 115 GLU A C   1 
ATOM   500  O  O   . GLU A 1 85  ? 4.734  32.785 52.571 1.00 41.84 ? 115 GLU A O   1 
ATOM   501  C  CB  . GLU A 1 85  ? 4.570  33.124 55.595 1.00 40.93 ? 115 GLU A CB  1 
ATOM   502  C  CG  . GLU A 1 85  ? 5.600  32.496 56.523 1.00 42.26 ? 115 GLU A CG  1 
ATOM   503  C  CD  . GLU A 1 85  ? 6.098  33.465 57.594 1.00 48.91 ? 115 GLU A CD  1 
ATOM   504  O  OE1 . GLU A 1 85  ? 5.265  33.956 58.397 1.00 47.80 ? 115 GLU A OE1 1 
ATOM   505  O  OE2 . GLU A 1 85  ? 7.323  33.729 57.642 1.00 47.37 ? 115 GLU A OE2 1 
ATOM   506  N  N   . LYS A 1 86  ? 6.889  33.199 53.052 1.00 38.57 ? 116 LYS A N   1 
ATOM   507  C  CA  . LYS A 1 86  ? 7.412  32.679 51.784 1.00 38.17 ? 116 LYS A CA  1 
ATOM   508  C  C   . LYS A 1 86  ? 7.597  31.162 51.794 1.00 36.88 ? 116 LYS A C   1 
ATOM   509  O  O   . LYS A 1 86  ? 8.027  30.593 52.794 1.00 37.53 ? 116 LYS A O   1 
ATOM   510  C  CB  . LYS A 1 86  ? 8.749  33.355 51.455 1.00 38.53 ? 116 LYS A CB  1 
ATOM   511  N  N   . MET A 1 87  ? 7.298  30.524 50.663 1.00 35.42 ? 117 MET A N   1 
ATOM   512  C  CA  . MET A 1 87  ? 7.334  29.065 50.545 1.00 33.92 ? 117 MET A CA  1 
ATOM   513  C  C   . MET A 1 87  ? 8.462  28.612 49.624 1.00 31.95 ? 117 MET A C   1 
ATOM   514  O  O   . MET A 1 87  ? 8.710  29.221 48.586 1.00 31.85 ? 117 MET A O   1 
ATOM   515  C  CB  . MET A 1 87  ? 6.012  28.538 49.977 1.00 32.69 ? 117 MET A CB  1 
ATOM   516  C  CG  . MET A 1 87  ? 4.772  29.287 50.408 1.00 35.46 ? 117 MET A CG  1 
ATOM   517  S  SD  . MET A 1 87  ? 3.399  28.188 50.829 1.00 38.01 ? 117 MET A SD  1 
ATOM   518  C  CE  . MET A 1 87  ? 3.867  27.716 52.491 1.00 39.65 ? 117 MET A CE  1 
ATOM   519  N  N   . ILE A 1 88  ? 9.106  27.506 49.978 1.00 31.48 ? 118 ILE A N   1 
ATOM   520  C  CA  . ILE A 1 88  ? 10.183 26.942 49.161 1.00 32.34 ? 118 ILE A CA  1 
ATOM   521  C  C   . ILE A 1 88  ? 9.631  26.313 47.875 1.00 30.86 ? 118 ILE A C   1 
ATOM   522  O  O   . ILE A 1 88  ? 8.716  25.514 47.928 1.00 32.24 ? 118 ILE A O   1 
ATOM   523  C  CB  . ILE A 1 88  ? 11.007 25.889 49.949 1.00 33.09 ? 118 ILE A CB  1 
ATOM   524  C  CG1 . ILE A 1 88  ? 11.604 26.522 51.210 1.00 32.92 ? 118 ILE A CG1 1 
ATOM   525  C  CG2 . ILE A 1 88  ? 12.116 25.286 49.058 1.00 35.72 ? 118 ILE A CG2 1 
ATOM   526  C  CD1 . ILE A 1 88  ? 12.512 25.608 52.019 1.00 31.87 ? 118 ILE A CD1 1 
ATOM   527  N  N   . THR A 1 89  ? 10.189 26.696 46.730 1.00 30.89 ? 119 THR A N   1 
ATOM   528  C  CA  . THR A 1 89  ? 9.734  26.210 45.412 1.00 29.52 ? 119 THR A CA  1 
ATOM   529  C  C   . THR A 1 89  ? 10.788 25.390 44.670 1.00 30.59 ? 119 THR A C   1 
ATOM   530  O  O   . THR A 1 89  ? 10.472 24.683 43.686 1.00 26.94 ? 119 THR A O   1 
ATOM   531  C  CB  . THR A 1 89  ? 9.300  27.379 44.482 1.00 28.41 ? 119 THR A CB  1 
ATOM   532  O  OG1 . THR A 1 89  ? 10.180 28.502 44.638 1.00 27.66 ? 119 THR A OG1 1 
ATOM   533  C  CG2 . THR A 1 89  ? 7.884  27.796 44.791 1.00 26.98 ? 119 THR A CG2 1 
ATOM   534  N  N   . LYS A 1 90  ? 12.032 25.513 45.133 1.00 32.91 ? 120 LYS A N   1 
ATOM   535  C  CA  . LYS A 1 90  ? 13.148 24.716 44.665 1.00 34.14 ? 120 LYS A CA  1 
ATOM   536  C  C   . LYS A 1 90  ? 14.283 24.797 45.689 1.00 34.89 ? 120 LYS A C   1 
ATOM   537  O  O   . LYS A 1 90  ? 14.455 25.815 46.381 1.00 33.59 ? 120 LYS A O   1 
ATOM   538  C  CB  . LYS A 1 90  ? 13.621 25.235 43.300 1.00 34.29 ? 120 LYS A CB  1 
ATOM   539  C  CG  . LYS A 1 90  ? 14.841 24.527 42.707 1.00 40.16 ? 120 LYS A CG  1 
ATOM   540  C  CD  . LYS A 1 90  ? 15.267 25.080 41.333 1.00 38.24 ? 120 LYS A CD  1 
ATOM   541  C  CE  . LYS A 1 90  ? 14.109 25.044 40.297 1.00 46.41 ? 120 LYS A CE  1 
ATOM   542  N  NZ  . LYS A 1 90  ? 14.544 25.284 38.880 1.00 47.68 ? 120 LYS A NZ  1 
ATOM   543  N  N   . VAL A 1 91  ? 15.041 23.706 45.781 1.00 37.02 ? 121 VAL A N   1 
ATOM   544  C  CA  . VAL A 1 91  ? 16.344 23.686 46.449 1.00 37.02 ? 121 VAL A CA  1 
ATOM   545  C  C   . VAL A 1 91  ? 17.379 23.116 45.489 1.00 38.13 ? 121 VAL A C   1 
ATOM   546  O  O   . VAL A 1 91  ? 17.110 22.119 44.829 1.00 40.12 ? 121 VAL A O   1 
ATOM   547  C  CB  . VAL A 1 91  ? 16.348 22.841 47.732 1.00 36.91 ? 121 VAL A CB  1 
ATOM   548  C  CG1 . VAL A 1 91  ? 15.420 23.453 48.803 1.00 37.88 ? 121 VAL A CG1 1 
ATOM   549  C  CG2 . VAL A 1 91  ? 16.007 21.385 47.442 1.00 35.40 ? 121 VAL A CG2 1 
ATOM   550  N  N   . GLN A 1 92  ? 18.541 23.766 45.403 1.00 38.30 ? 122 GLN A N   1 
ATOM   551  C  CA  . GLN A 1 92  ? 19.653 23.313 44.574 1.00 39.64 ? 122 GLN A CA  1 
ATOM   552  C  C   . GLN A 1 92  ? 20.947 23.138 45.382 1.00 39.52 ? 122 GLN A C   1 
ATOM   553  O  O   . GLN A 1 92  ? 21.142 23.807 46.400 1.00 41.24 ? 122 GLN A O   1 
ATOM   554  C  CB  . GLN A 1 92  ? 19.936 24.328 43.459 1.00 40.80 ? 122 GLN A CB  1 
ATOM   555  C  CG  . GLN A 1 92  ? 18.755 24.652 42.583 1.00 43.48 ? 122 GLN A CG  1 
ATOM   556  C  CD  . GLN A 1 92  ? 19.146 25.318 41.272 1.00 41.24 ? 122 GLN A CD  1 
ATOM   557  O  OE1 . GLN A 1 92  ? 18.316 25.463 40.365 1.00 46.30 ? 122 GLN A OE1 1 
ATOM   558  N  NE2 . GLN A 1 92  ? 20.406 25.712 41.156 1.00 45.88 ? 122 GLN A NE2 1 
ATOM   559  N  N   . ASP A 1 93  ? 21.840 22.279 44.886 1.00 36.76 ? 123 ASP A N   1 
ATOM   560  C  CA  . ASP A 1 93  ? 23.127 22.005 45.519 1.00 38.49 ? 123 ASP A CA  1 
ATOM   561  C  C   . ASP A 1 93  ? 22.972 21.365 46.892 1.00 37.28 ? 123 ASP A C   1 
ATOM   562  O  O   . ASP A 1 93  ? 23.471 21.887 47.879 1.00 34.51 ? 123 ASP A O   1 
ATOM   563  C  CB  . ASP A 1 93  ? 24.005 23.263 45.620 1.00 39.40 ? 123 ASP A CB  1 
ATOM   564  C  CG  . ASP A 1 93  ? 24.247 23.906 44.283 1.00 43.45 ? 123 ASP A CG  1 
ATOM   565  O  OD1 . ASP A 1 93  ? 24.520 23.159 43.302 1.00 42.80 ? 123 ASP A OD1 1 
ATOM   566  O  OD2 . ASP A 1 93  ? 24.163 25.155 44.226 1.00 42.92 ? 123 ASP A OD2 1 
ATOM   567  N  N   . PHE A 1 94  ? 22.292 20.215 46.912 1.00 37.85 ? 124 PHE A N   1 
ATOM   568  C  CA  . PHE A 1 94  ? 22.013 19.458 48.132 1.00 36.21 ? 124 PHE A CA  1 
ATOM   569  C  C   . PHE A 1 94  ? 22.967 18.279 48.290 1.00 36.30 ? 124 PHE A C   1 
ATOM   570  O  O   . PHE A 1 94  ? 22.698 17.337 49.059 1.00 37.40 ? 124 PHE A O   1 
ATOM   571  C  CB  . PHE A 1 94  ? 20.543 18.995 48.171 1.00 36.19 ? 124 PHE A CB  1 
ATOM   572  C  CG  . PHE A 1 94  ? 20.120 18.057 47.034 1.00 35.16 ? 124 PHE A CG  1 
ATOM   573  C  CD1 . PHE A 1 94  ? 20.781 16.856 46.777 1.00 31.46 ? 124 PHE A CD1 1 
ATOM   574  C  CD2 . PHE A 1 94  ? 18.999 18.356 46.273 1.00 32.31 ? 124 PHE A CD2 1 
ATOM   575  C  CE1 . PHE A 1 94  ? 20.355 16.012 45.758 1.00 31.36 ? 124 PHE A CE1 1 
ATOM   576  C  CE2 . PHE A 1 94  ? 18.569 17.507 45.266 1.00 30.03 ? 124 PHE A CE2 1 
ATOM   577  C  CZ  . PHE A 1 94  ? 19.249 16.337 45.006 1.00 27.74 ? 124 PHE A CZ  1 
ATOM   578  N  N   . GLN A 1 95  ? 24.098 18.351 47.585 1.00 35.38 ? 125 GLN A N   1 
ATOM   579  C  CA  . GLN A 1 95  ? 25.136 17.315 47.637 1.00 33.44 ? 125 GLN A CA  1 
ATOM   580  C  C   . GLN A 1 95  ? 25.740 17.094 49.033 1.00 32.94 ? 125 GLN A C   1 
ATOM   581  O  O   . GLN A 1 95  ? 26.281 16.018 49.300 1.00 32.56 ? 125 GLN A O   1 
ATOM   582  C  CB  . GLN A 1 95  ? 26.245 17.605 46.608 1.00 32.47 ? 125 GLN A CB  1 
ATOM   583  C  CG  . GLN A 1 95  ? 27.108 18.871 46.865 1.00 36.00 ? 125 GLN A CG  1 
ATOM   584  C  CD  . GLN A 1 95  ? 26.539 20.158 46.281 1.00 28.97 ? 125 GLN A CD  1 
ATOM   585  O  OE1 . GLN A 1 95  ? 25.595 20.130 45.515 1.00 38.91 ? 125 GLN A OE1 1 
ATOM   586  N  NE2 . GLN A 1 95  ? 27.126 21.293 46.648 1.00 34.19 ? 125 GLN A NE2 1 
ATOM   587  N  N   . GLU A 1 96  ? 25.650 18.097 49.908 1.00 32.52 ? 126 GLU A N   1 
ATOM   588  C  CA  . GLU A 1 96  ? 26.104 17.948 51.304 1.00 34.45 ? 126 GLU A CA  1 
ATOM   589  C  C   . GLU A 1 96  ? 24.960 17.603 52.293 1.00 34.18 ? 126 GLU A C   1 
ATOM   590  O  O   . GLU A 1 96  ? 25.169 17.598 53.502 1.00 32.16 ? 126 GLU A O   1 
ATOM   591  C  CB  . GLU A 1 96  ? 26.868 19.211 51.749 1.00 34.38 ? 126 GLU A CB  1 
ATOM   592  C  CG  . GLU A 1 96  ? 28.157 18.935 52.510 1.00 33.38 ? 126 GLU A CG  1 
ATOM   593  C  CD  . GLU A 1 96  ? 29.099 17.991 51.785 1.00 28.09 ? 126 GLU A CD  1 
ATOM   594  O  OE1 . GLU A 1 96  ? 29.341 18.198 50.585 1.00 30.02 ? 126 GLU A OE1 1 
ATOM   595  O  OE2 . GLU A 1 96  ? 29.598 17.038 52.419 1.00 26.78 ? 126 GLU A OE2 1 
ATOM   596  N  N   . ASP A 1 97  ? 23.767 17.330 51.753 1.00 34.92 ? 127 ASP A N   1 
ATOM   597  C  CA  . ASP A 1 97  ? 22.639 16.749 52.489 1.00 35.22 ? 127 ASP A CA  1 
ATOM   598  C  C   . ASP A 1 97  ? 22.525 15.256 52.162 1.00 35.00 ? 127 ASP A C   1 
ATOM   599  O  O   . ASP A 1 97  ? 22.325 14.884 51.003 1.00 36.93 ? 127 ASP A O   1 
ATOM   600  C  CB  . ASP A 1 97  ? 21.336 17.449 52.081 1.00 36.14 ? 127 ASP A CB  1 
ATOM   601  C  CG  . ASP A 1 97  ? 20.135 16.996 52.900 1.00 36.60 ? 127 ASP A CG  1 
ATOM   602  O  OD1 . ASP A 1 97  ? 19.576 17.838 53.635 1.00 33.23 ? 127 ASP A OD1 1 
ATOM   603  O  OD2 . ASP A 1 97  ? 19.752 15.803 52.815 1.00 38.47 ? 127 ASP A OD2 1 
ATOM   604  N  N   . LYS A 1 98  ? 22.579 14.426 53.194 1.00 34.38 ? 128 LYS A N   1 
ATOM   605  C  CA  . LYS A 1 98  ? 22.754 12.966 53.075 1.00 35.11 ? 128 LYS A CA  1 
ATOM   606  C  C   . LYS A 1 98  ? 21.604 12.163 52.437 1.00 34.96 ? 128 LYS A C   1 
ATOM   607  O  O   . LYS A 1 98  ? 21.844 11.225 51.668 1.00 33.17 ? 128 LYS A O   1 
ATOM   608  C  CB  . LYS A 1 98  ? 23.039 12.378 54.479 1.00 34.43 ? 128 LYS A CB  1 
ATOM   609  N  N   . GLU A 1 99  ? 20.367 12.491 52.796 1.00 35.88 ? 129 GLU A N   1 
ATOM   610  C  CA  . GLU A 1 99  ? 19.214 11.718 52.331 1.00 35.95 ? 129 GLU A CA  1 
ATOM   611  C  C   . GLU A 1 99  ? 18.904 12.090 50.892 1.00 35.55 ? 129 GLU A C   1 
ATOM   612  O  O   . GLU A 1 99  ? 18.564 11.236 50.077 1.00 36.67 ? 129 GLU A O   1 
ATOM   613  C  CB  . GLU A 1 99  ? 17.995 11.960 53.227 1.00 34.73 ? 129 GLU A CB  1 
ATOM   614  C  CG  . GLU A 1 99  ? 18.205 11.543 54.678 1.00 33.14 ? 129 GLU A CG  1 
ATOM   615  C  CD  . GLU A 1 99  ? 18.239 10.037 54.875 1.00 30.78 ? 129 GLU A CD  1 
ATOM   616  O  OE1 . GLU A 1 99  ? 17.366 9.340  54.330 1.00 31.61 ? 129 GLU A OE1 1 
ATOM   617  O  OE2 . GLU A 1 99  ? 19.123 9.546  55.604 1.00 33.09 ? 129 GLU A OE2 1 
ATOM   618  N  N   . LEU A 1 100 ? 19.022 13.378 50.597 1.00 36.04 ? 130 LEU A N   1 
ATOM   619  C  CA  . LEU A 1 100 ? 18.847 13.901 49.240 1.00 34.88 ? 130 LEU A CA  1 
ATOM   620  C  C   . LEU A 1 100 ? 19.950 13.392 48.315 1.00 34.43 ? 130 LEU A C   1 
ATOM   621  O  O   . LEU A 1 100 ? 19.683 12.973 47.196 1.00 31.29 ? 130 LEU A O   1 
ATOM   622  C  CB  . LEU A 1 100 ? 18.805 15.432 49.265 1.00 33.97 ? 130 LEU A CB  1 
ATOM   623  C  CG  . LEU A 1 100 ? 17.409 16.068 49.295 1.00 37.21 ? 130 LEU A CG  1 
ATOM   624  C  CD1 . LEU A 1 100 ? 16.494 15.359 50.266 1.00 37.71 ? 130 LEU A CD1 1 
ATOM   625  C  CD2 . LEU A 1 100 ? 17.483 17.568 49.609 1.00 36.91 ? 130 LEU A CD2 1 
ATOM   626  N  N   . PHE A 1 101 ? 21.183 13.380 48.810 1.00 37.25 ? 131 PHE A N   1 
ATOM   627  C  CA  . PHE A 1 101 ? 22.316 12.926 48.006 1.00 38.85 ? 131 PHE A CA  1 
ATOM   628  C  C   . PHE A 1 101 ? 22.322 11.414 47.706 1.00 40.66 ? 131 PHE A C   1 
ATOM   629  O  O   . PHE A 1 101 ? 23.037 10.964 46.811 1.00 42.51 ? 131 PHE A O   1 
ATOM   630  C  CB  . PHE A 1 101 ? 23.654 13.335 48.642 1.00 36.29 ? 131 PHE A CB  1 
ATOM   631  C  CG  . PHE A 1 101 ? 24.818 13.178 47.705 1.00 37.95 ? 131 PHE A CG  1 
ATOM   632  C  CD1 . PHE A 1 101 ? 24.807 13.828 46.458 1.00 28.50 ? 131 PHE A CD1 1 
ATOM   633  C  CD2 . PHE A 1 101 ? 25.884 12.341 48.019 1.00 27.31 ? 131 PHE A CD2 1 
ATOM   634  C  CE1 . PHE A 1 101 ? 25.862 13.686 45.557 1.00 28.39 ? 131 PHE A CE1 1 
ATOM   635  C  CE2 . PHE A 1 101 ? 26.942 12.190 47.120 1.00 31.50 ? 131 PHE A CE2 1 
ATOM   636  C  CZ  . PHE A 1 101 ? 26.928 12.870 45.882 1.00 29.66 ? 131 PHE A CZ  1 
ATOM   637  N  N   . ARG A 1 102 ? 21.531 10.628 48.431 1.00 41.32 ? 132 ARG A N   1 
ATOM   638  C  CA  . ARG A 1 102 ? 21.398 9.204  48.106 1.00 42.24 ? 132 ARG A CA  1 
ATOM   639  C  C   . ARG A 1 102 ? 20.800 9.020  46.708 1.00 41.16 ? 132 ARG A C   1 
ATOM   640  O  O   . ARG A 1 102 ? 20.998 7.984  46.072 1.00 40.36 ? 132 ARG A O   1 
ATOM   641  C  CB  . ARG A 1 102 ? 20.548 8.463  49.147 1.00 41.57 ? 132 ARG A CB  1 
ATOM   642  C  CG  . ARG A 1 102 ? 21.325 7.957  50.346 1.00 41.79 ? 132 ARG A CG  1 
ATOM   643  C  CD  . ARG A 1 102 ? 20.391 7.474  51.497 1.00 45.12 ? 132 ARG A CD  1 
ATOM   644  N  NE  . ARG A 1 102 ? 19.067 7.061  51.016 1.00 45.72 ? 132 ARG A NE  1 
ATOM   645  C  CZ  . ARG A 1 102 ? 18.776 5.868  50.497 1.00 42.09 ? 132 ARG A CZ  1 
ATOM   646  N  NH1 . ARG A 1 102 ? 19.702 4.918  50.385 1.00 35.87 ? 132 ARG A NH1 1 
ATOM   647  N  NH2 . ARG A 1 102 ? 17.543 5.623  50.082 1.00 42.47 ? 132 ARG A NH2 1 
ATOM   648  N  N   . TYR A 1 103 ? 20.071 10.033 46.236 1.00 41.01 ? 133 TYR A N   1 
ATOM   649  C  CA  . TYR A 1 103 ? 19.505 10.008 44.898 1.00 39.59 ? 133 TYR A CA  1 
ATOM   650  C  C   . TYR A 1 103 ? 20.626 9.824  43.887 1.00 39.62 ? 133 TYR A C   1 
ATOM   651  O  O   . TYR A 1 103 ? 20.503 9.021  42.965 1.00 41.52 ? 133 TYR A O   1 
ATOM   652  C  CB  . TYR A 1 103 ? 18.702 11.285 44.608 1.00 39.68 ? 133 TYR A CB  1 
ATOM   653  C  CG  . TYR A 1 103 ? 18.117 11.300 43.207 1.00 40.22 ? 133 TYR A CG  1 
ATOM   654  C  CD1 . TYR A 1 103 ? 18.664 12.108 42.203 1.00 36.16 ? 133 TYR A CD1 1 
ATOM   655  C  CD2 . TYR A 1 103 ? 17.048 10.472 42.876 1.00 39.23 ? 133 TYR A CD2 1 
ATOM   656  C  CE1 . TYR A 1 103 ? 18.146 12.106 40.924 1.00 38.14 ? 133 TYR A CE1 1 
ATOM   657  C  CE2 . TYR A 1 103 ? 16.521 10.463 41.595 1.00 41.29 ? 133 TYR A CE2 1 
ATOM   658  C  CZ  . TYR A 1 103 ? 17.073 11.280 40.628 1.00 39.39 ? 133 TYR A CZ  1 
ATOM   659  O  OH  . TYR A 1 103 ? 16.559 11.248 39.363 1.00 42.20 ? 133 TYR A OH  1 
ATOM   660  N  N   . CYS A 1 104 ? 21.725 10.546 44.098 1.00 38.44 ? 134 CYS A N   1 
ATOM   661  C  CA  . CYS A 1 104 ? 22.890 10.516 43.214 1.00 38.40 ? 134 CYS A CA  1 
ATOM   662  C  C   . CYS A 1 104 ? 23.660 9.207  43.257 1.00 38.84 ? 134 CYS A C   1 
ATOM   663  O  O   . CYS A 1 104 ? 24.272 8.817  42.268 1.00 39.50 ? 134 CYS A O   1 
ATOM   664  C  CB  . CYS A 1 104 ? 23.851 11.644 43.589 1.00 37.64 ? 134 CYS A CB  1 
ATOM   665  S  SG  . CYS A 1 104 ? 23.071 13.258 43.668 1.00 42.21 ? 134 CYS A SG  1 
ATOM   666  N  N   . THR A 1 105 ? 23.626 8.546  44.411 1.00 39.08 ? 135 THR A N   1 
ATOM   667  C  CA  . THR A 1 105 ? 24.419 7.361  44.675 1.00 38.03 ? 135 THR A CA  1 
ATOM   668  C  C   . THR A 1 105 ? 23.600 6.087  44.465 1.00 38.77 ? 135 THR A C   1 
ATOM   669  O  O   . THR A 1 105 ? 24.103 4.970  44.656 1.00 40.09 ? 135 THR A O   1 
ATOM   670  C  CB  . THR A 1 105 ? 24.896 7.375  46.139 1.00 37.00 ? 135 THR A CB  1 
ATOM   671  O  OG1 . THR A 1 105 ? 23.803 7.034  47.003 1.00 39.22 ? 135 THR A OG1 1 
ATOM   672  C  CG2 . THR A 1 105 ? 25.407 8.739  46.522 1.00 35.73 ? 135 THR A CG2 1 
ATOM   673  N  N   . LEU A 1 106 ? 22.333 6.251  44.099 1.00 38.60 ? 136 LEU A N   1 
ATOM   674  C  CA  . LEU A 1 106 ? 21.383 5.142  44.121 1.00 38.45 ? 136 LEU A CA  1 
ATOM   675  C  C   . LEU A 1 106 ? 21.694 4.212  42.963 1.00 38.21 ? 136 LEU A C   1 
ATOM   676  O  O   . LEU A 1 106 ? 21.727 4.664  41.812 1.00 39.32 ? 136 LEU A O   1 
ATOM   677  C  CB  . LEU A 1 106 ? 19.959 5.674  43.994 1.00 38.10 ? 136 LEU A CB  1 
ATOM   678  C  CG  . LEU A 1 106 ? 18.851 4.715  44.377 1.00 37.64 ? 136 LEU A CG  1 
ATOM   679  C  CD1 . LEU A 1 106 ? 18.878 4.409  45.869 1.00 38.70 ? 136 LEU A CD1 1 
ATOM   680  C  CD2 . LEU A 1 106 ? 17.521 5.310  43.983 1.00 36.99 ? 136 LEU A CD2 1 
ATOM   681  N  N   . PRO A 1 107 ? 21.949 2.925  43.252 1.00 36.65 ? 137 PRO A N   1 
ATOM   682  C  CA  . PRO A 1 107 ? 22.372 2.014  42.185 1.00 36.80 ? 137 PRO A CA  1 
ATOM   683  C  C   . PRO A 1 107 ? 21.340 1.820  41.069 1.00 36.54 ? 137 PRO A C   1 
ATOM   684  O  O   . PRO A 1 107 ? 21.708 1.517  39.932 1.00 37.13 ? 137 PRO A O   1 
ATOM   685  C  CB  . PRO A 1 107 ? 22.658 0.690  42.926 1.00 37.18 ? 137 PRO A CB  1 
ATOM   686  C  CG  . PRO A 1 107 ? 21.935 0.787  44.233 1.00 35.47 ? 137 PRO A CG  1 
ATOM   687  C  CD  . PRO A 1 107 ? 21.889 2.254  44.566 1.00 38.98 ? 137 PRO A CD  1 
ATOM   688  N  N   . GLU A 1 108 ? 20.064 1.995  41.379 1.00 36.78 ? 138 GLU A N   1 
ATOM   689  C  CA  . GLU A 1 108 ? 19.033 1.903  40.352 1.00 37.51 ? 138 GLU A CA  1 
ATOM   690  C  C   . GLU A 1 108 ? 19.170 3.041  39.338 1.00 36.87 ? 138 GLU A C   1 
ATOM   691  O  O   . GLU A 1 108 ? 19.000 2.842  38.133 1.00 35.83 ? 138 GLU A O   1 
ATOM   692  C  CB  . GLU A 1 108 ? 17.635 1.873  40.985 1.00 38.07 ? 138 GLU A CB  1 
ATOM   693  C  CG  . GLU A 1 108 ? 17.331 0.549  41.752 1.00 43.41 ? 138 GLU A CG  1 
ATOM   694  C  CD  . GLU A 1 108 ? 17.631 0.608  43.246 1.00 45.62 ? 138 GLU A CD  1 
ATOM   695  O  OE1 . GLU A 1 108 ? 18.111 1.662  43.730 1.00 42.16 ? 138 GLU A OE1 1 
ATOM   696  O  OE2 . GLU A 1 108 ? 17.373 -0.407 43.936 1.00 42.23 ? 138 GLU A OE2 1 
ATOM   697  N  N   . ILE A 1 109 ? 19.505 4.227  39.833 1.00 37.27 ? 139 ILE A N   1 
ATOM   698  C  CA  . ILE A 1 109 ? 19.758 5.373  38.971 1.00 37.62 ? 139 ILE A CA  1 
ATOM   699  C  C   . ILE A 1 109 ? 21.038 5.192  38.121 1.00 37.15 ? 139 ILE A C   1 
ATOM   700  O  O   . ILE A 1 109 ? 21.061 5.582  36.943 1.00 37.19 ? 139 ILE A O   1 
ATOM   701  C  CB  . ILE A 1 109 ? 19.826 6.700  39.809 1.00 39.17 ? 139 ILE A CB  1 
ATOM   702  C  CG1 . ILE A 1 109 ? 18.444 7.064  40.374 1.00 36.77 ? 139 ILE A CG1 1 
ATOM   703  C  CG2 . ILE A 1 109 ? 20.388 7.886  38.982 1.00 40.86 ? 139 ILE A CG2 1 
ATOM   704  C  CD1 . ILE A 1 109 ? 17.410 7.459  39.320 1.00 37.38 ? 139 ILE A CD1 1 
ATOM   705  N  N   . LEU A 1 110 ? 22.078 4.594  38.706 1.00 34.99 ? 140 LEU A N   1 
ATOM   706  C  CA  . LEU A 1 110 ? 23.401 4.570  38.077 1.00 33.75 ? 140 LEU A CA  1 
ATOM   707  C  C   . LEU A 1 110 ? 23.554 3.507  36.998 1.00 35.19 ? 140 LEU A C   1 
ATOM   708  O  O   . LEU A 1 110 ? 24.234 3.750  36.000 1.00 36.07 ? 140 LEU A O   1 
ATOM   709  C  CB  . LEU A 1 110 ? 24.513 4.433  39.124 1.00 33.11 ? 140 LEU A CB  1 
ATOM   710  C  CG  . LEU A 1 110 ? 24.651 5.592  40.130 1.00 29.02 ? 140 LEU A CG  1 
ATOM   711  C  CD1 . LEU A 1 110 ? 25.662 5.252  41.219 1.00 28.23 ? 140 LEU A CD1 1 
ATOM   712  C  CD2 . LEU A 1 110 ? 25.041 6.870  39.447 1.00 25.47 ? 140 LEU A CD2 1 
ATOM   713  N  N   . LYS A 1 111 ? 22.936 2.337  37.185 1.00 36.54 ? 141 LYS A N   1 
ATOM   714  C  CA  . LYS A 1 111 ? 22.910 1.299  36.146 1.00 36.46 ? 141 LYS A CA  1 
ATOM   715  C  C   . LYS A 1 111 ? 22.451 1.868  34.798 1.00 38.05 ? 141 LYS A C   1 
ATOM   716  O  O   . LYS A 1 111 ? 22.840 1.358  33.744 1.00 39.05 ? 141 LYS A O   1 
ATOM   717  C  CB  . LYS A 1 111 ? 21.986 0.148  36.547 1.00 37.62 ? 141 LYS A CB  1 
ATOM   718  N  N   . TYR A 1 112 ? 21.621 2.918  34.844 1.00 36.64 ? 142 TYR A N   1 
ATOM   719  C  CA  . TYR A 1 112 ? 21.123 3.576  33.649 1.00 35.06 ? 142 TYR A CA  1 
ATOM   720  C  C   . TYR A 1 112 ? 21.998 4.780  33.275 1.00 37.01 ? 142 TYR A C   1 
ATOM   721  O  O   . TYR A 1 112 ? 22.315 4.962  32.096 1.00 36.98 ? 142 TYR A O   1 
ATOM   722  C  CB  . TYR A 1 112 ? 19.662 4.000  33.831 1.00 33.87 ? 142 TYR A CB  1 
ATOM   723  C  CG  . TYR A 1 112 ? 18.652 2.868  33.697 1.00 34.50 ? 142 TYR A CG  1 
ATOM   724  C  CD1 . TYR A 1 112 ? 18.222 2.153  34.814 1.00 32.12 ? 142 TYR A CD1 1 
ATOM   725  C  CD2 . TYR A 1 112 ? 18.114 2.525  32.455 1.00 29.03 ? 142 TYR A CD2 1 
ATOM   726  C  CE1 . TYR A 1 112 ? 17.291 1.124  34.705 1.00 35.69 ? 142 TYR A CE1 1 
ATOM   727  C  CE2 . TYR A 1 112 ? 17.173 1.513  32.337 1.00 34.32 ? 142 TYR A CE2 1 
ATOM   728  C  CZ  . TYR A 1 112 ? 16.769 0.791  33.465 1.00 38.16 ? 142 TYR A CZ  1 
ATOM   729  O  OH  . TYR A 1 112 ? 15.842 -0.260 33.351 1.00 25.10 ? 142 TYR A OH  1 
ATOM   730  N  N   . VAL A 1 113 ? 22.406 5.587  34.259 1.00 37.80 ? 143 VAL A N   1 
ATOM   731  C  CA  . VAL A 1 113 ? 23.266 6.754  33.975 1.00 39.12 ? 143 VAL A CA  1 
ATOM   732  C  C   . VAL A 1 113 ? 24.529 6.351  33.201 1.00 38.16 ? 143 VAL A C   1 
ATOM   733  O  O   . VAL A 1 113 ? 24.950 7.041  32.256 1.00 39.59 ? 143 VAL A O   1 
ATOM   734  C  CB  . VAL A 1 113 ? 23.709 7.532  35.244 1.00 39.14 ? 143 VAL A CB  1 
ATOM   735  C  CG1 . VAL A 1 113 ? 24.661 8.675  34.849 1.00 38.87 ? 143 VAL A CG1 1 
ATOM   736  C  CG2 . VAL A 1 113 ? 22.515 8.114  35.976 1.00 40.71 ? 143 VAL A CG2 1 
ATOM   737  N  N   . GLU A 1 114 ? 25.125 5.242  33.605 1.00 36.10 ? 144 GLU A N   1 
ATOM   738  C  CA  . GLU A 1 114 ? 26.329 4.753  32.952 1.00 37.05 ? 144 GLU A CA  1 
ATOM   739  C  C   . GLU A 1 114 ? 26.143 4.527  31.442 1.00 37.32 ? 144 GLU A C   1 
ATOM   740  O  O   . GLU A 1 114 ? 27.089 4.716  30.660 1.00 37.53 ? 144 GLU A O   1 
ATOM   741  C  CB  . GLU A 1 114 ? 26.790 3.472  33.627 1.00 35.72 ? 144 GLU A CB  1 
ATOM   742  C  CG  . GLU A 1 114 ? 28.108 2.957  33.122 1.00 37.82 ? 144 GLU A CG  1 
ATOM   743  C  CD  . GLU A 1 114 ? 28.657 1.848  33.989 1.00 36.93 ? 144 GLU A CD  1 
ATOM   744  O  OE1 . GLU A 1 114 ? 27.882 1.325  34.814 1.00 36.15 ? 144 GLU A OE1 1 
ATOM   745  O  OE2 . GLU A 1 114 ? 29.854 1.501  33.841 1.00 36.44 ? 144 GLU A OE2 1 
ATOM   746  N  N   . CYS A 1 115 ? 24.932 4.146  31.030 1.00 36.98 ? 145 CYS A N   1 
ATOM   747  C  CA  . CYS A 1 115 ? 24.627 3.946  29.604 1.00 36.60 ? 145 CYS A CA  1 
ATOM   748  C  C   . CYS A 1 115 ? 24.904 5.200  28.771 1.00 36.43 ? 145 CYS A C   1 
ATOM   749  O  O   . CYS A 1 115 ? 25.218 5.090  27.581 1.00 36.55 ? 145 CYS A O   1 
ATOM   750  C  CB  . CYS A 1 115 ? 23.167 3.499  29.396 1.00 37.35 ? 145 CYS A CB  1 
ATOM   751  S  SG  . CYS A 1 115 ? 22.711 1.835  30.049 1.00 40.60 ? 145 CYS A SG  1 
ATOM   752  N  N   . PHE A 1 116 ? 24.788 6.384  29.389 1.00 35.79 ? 146 PHE A N   1 
ATOM   753  C  CA  . PHE A 1 116 ? 25.072 7.653  28.696 1.00 36.54 ? 146 PHE A CA  1 
ATOM   754  C  C   . PHE A 1 116 ? 26.471 8.188  29.002 1.00 36.56 ? 146 PHE A C   1 
ATOM   755  O  O   . PHE A 1 116 ? 27.130 8.714  28.098 1.00 37.36 ? 146 PHE A O   1 
ATOM   756  C  CB  . PHE A 1 116 ? 24.024 8.737  29.032 1.00 37.11 ? 146 PHE A CB  1 
ATOM   757  C  CG  . PHE A 1 116 ? 22.615 8.217  29.103 1.00 40.19 ? 146 PHE A CG  1 
ATOM   758  C  CD1 . PHE A 1 116 ? 22.105 7.726  30.302 1.00 41.36 ? 146 PHE A CD1 1 
ATOM   759  C  CD2 . PHE A 1 116 ? 21.809 8.190  27.969 1.00 37.00 ? 146 PHE A CD2 1 
ATOM   760  C  CE1 . PHE A 1 116 ? 20.818 7.218  30.371 1.00 39.09 ? 146 PHE A CE1 1 
ATOM   761  C  CE2 . PHE A 1 116 ? 20.523 7.698  28.033 1.00 38.56 ? 146 PHE A CE2 1 
ATOM   762  C  CZ  . PHE A 1 116 ? 20.026 7.204  29.238 1.00 41.16 ? 146 PHE A CZ  1 
ATOM   763  N  N   . THR A 1 117 ? 26.910 8.079  30.261 1.00 35.83 ? 147 THR A N   1 
ATOM   764  C  CA  . THR A 1 117 ? 28.160 8.713  30.705 1.00 36.19 ? 147 THR A CA  1 
ATOM   765  C  C   . THR A 1 117 ? 29.417 7.822  30.585 1.00 36.81 ? 147 THR A C   1 
ATOM   766  O  O   . THR A 1 117 ? 30.522 8.322  30.343 1.00 38.67 ? 147 THR A O   1 
ATOM   767  C  CB  . THR A 1 117 ? 28.038 9.224  32.165 1.00 35.21 ? 147 THR A CB  1 
ATOM   768  O  OG1 . THR A 1 117 ? 27.700 8.148  33.029 1.00 36.93 ? 147 THR A OG1 1 
ATOM   769  C  CG2 . THR A 1 117 ? 26.936 10.262 32.293 1.00 39.72 ? 147 THR A CG2 1 
ATOM   770  N  N   . GLY A 1 118 ? 29.258 6.512  30.743 1.00 36.05 ? 148 GLY A N   1 
ATOM   771  C  CA  . GLY A 1 118 ? 30.400 5.611  30.877 1.00 35.95 ? 148 GLY A CA  1 
ATOM   772  C  C   . GLY A 1 118 ? 30.660 5.356  32.353 1.00 36.36 ? 148 GLY A C   1 
ATOM   773  O  O   . GLY A 1 118 ? 29.963 5.898  33.203 1.00 36.82 ? 148 GLY A O   1 
ATOM   774  N  N   . PRO A 1 119 ? 31.668 4.532  32.670 1.00 37.06 ? 149 PRO A N   1 
ATOM   775  C  CA  . PRO A 1 119 ? 31.886 4.069  34.051 1.00 38.14 ? 149 PRO A CA  1 
ATOM   776  C  C   . PRO A 1 119 ? 32.482 5.067  35.049 1.00 39.13 ? 149 PRO A C   1 
ATOM   777  O  O   . PRO A 1 119 ? 32.505 4.774  36.244 1.00 42.89 ? 149 PRO A O   1 
ATOM   778  C  CB  . PRO A 1 119 ? 32.857 2.895  33.869 1.00 35.70 ? 149 PRO A CB  1 
ATOM   779  C  CG  . PRO A 1 119 ? 33.634 3.254  32.658 1.00 33.23 ? 149 PRO A CG  1 
ATOM   780  C  CD  . PRO A 1 119 ? 32.661 3.954  31.738 1.00 36.45 ? 149 PRO A CD  1 
ATOM   781  N  N   . ASN A 1 120 ? 32.991 6.198  34.581 1.00 38.18 ? 150 ASN A N   1 
ATOM   782  C  CA  . ASN A 1 120 ? 33.477 7.235  35.486 1.00 38.96 ? 150 ASN A CA  1 
ATOM   783  C  C   . ASN A 1 120 ? 32.403 8.276  35.554 1.00 38.87 ? 150 ASN A C   1 
ATOM   784  O  O   . ASN A 1 120 ? 32.217 8.972  34.572 1.00 38.50 ? 150 ASN A O   1 
ATOM   785  C  CB  . ASN A 1 120 ? 34.737 7.927  34.939 1.00 40.29 ? 150 ASN A CB  1 
ATOM   786  C  CG  . ASN A 1 120 ? 35.767 6.962  34.425 1.00 34.94 ? 150 ASN A CG  1 
ATOM   787  O  OD1 . ASN A 1 120 ? 36.067 5.947  35.053 1.00 34.23 ? 150 ASN A OD1 1 
ATOM   788  N  ND2 . ASN A 1 120 ? 36.329 7.286  33.268 1.00 35.82 ? 150 ASN A ND2 1 
ATOM   789  N  N   . ILE A 1 121 ? 31.718 8.404  36.689 1.00 39.73 ? 151 ILE A N   1 
ATOM   790  C  CA  . ILE A 1 121 ? 30.516 9.266  36.774 1.00 39.66 ? 151 ILE A CA  1 
ATOM   791  C  C   . ILE A 1 121 ? 30.603 10.365 37.856 1.00 39.20 ? 151 ILE A C   1 
ATOM   792  O  O   . ILE A 1 121 ? 30.887 10.081 39.022 1.00 38.77 ? 151 ILE A O   1 
ATOM   793  C  CB  . ILE A 1 121 ? 29.230 8.432  37.025 1.00 38.83 ? 151 ILE A CB  1 
ATOM   794  C  CG1 . ILE A 1 121 ? 29.218 7.142  36.198 1.00 42.07 ? 151 ILE A CG1 1 
ATOM   795  C  CG2 . ILE A 1 121 ? 28.009 9.234  36.672 1.00 38.62 ? 151 ILE A CG2 1 
ATOM   796  C  CD1 . ILE A 1 121 ? 27.966 6.237  36.439 1.00 38.61 ? 151 ILE A CD1 1 
ATOM   797  N  N   . MET A 1 122 ? 30.312 11.601 37.448 1.00 39.03 ? 152 MET A N   1 
ATOM   798  C  CA  . MET A 1 122 ? 30.256 12.777 38.331 1.00 39.54 ? 152 MET A CA  1 
ATOM   799  C  C   . MET A 1 122 ? 28.815 13.255 38.458 1.00 39.47 ? 152 MET A C   1 
ATOM   800  O  O   . MET A 1 122 ? 28.135 13.457 37.450 1.00 41.38 ? 152 MET A O   1 
ATOM   801  C  CB  . MET A 1 122 ? 31.070 13.950 37.750 1.00 39.76 ? 152 MET A CB  1 
ATOM   802  C  CG  . MET A 1 122 ? 32.578 13.673 37.508 1.00 39.79 ? 152 MET A CG  1 
ATOM   803  S  SD  . MET A 1 122 ? 33.532 13.286 38.996 1.00 38.92 ? 152 MET A SD  1 
ATOM   804  C  CE  . MET A 1 122 ? 33.275 14.799 39.950 1.00 41.19 ? 152 MET A CE  1 
ATOM   805  N  N   . ALA A 1 123 ? 28.352 13.457 39.686 1.00 38.53 ? 153 ALA A N   1 
ATOM   806  C  CA  . ALA A 1 123 ? 27.064 14.085 39.905 1.00 38.00 ? 153 ALA A CA  1 
ATOM   807  C  C   . ALA A 1 123 ? 27.294 15.589 39.918 1.00 36.98 ? 153 ALA A C   1 
ATOM   808  O  O   . ALA A 1 123 ? 27.881 16.108 40.870 1.00 37.74 ? 153 ALA A O   1 
ATOM   809  C  CB  . ALA A 1 123 ? 26.452 13.619 41.211 1.00 37.40 ? 153 ALA A CB  1 
ATOM   810  N  N   . MET A 1 124 ? 26.817 16.281 38.883 1.00 34.78 ? 154 MET A N   1 
ATOM   811  C  CA  . MET A 1 124 ? 27.222 17.670 38.619 1.00 36.17 ? 154 MET A CA  1 
ATOM   812  C  C   . MET A 1 124 ? 26.249 18.758 39.099 1.00 37.73 ? 154 MET A C   1 
ATOM   813  O  O   . MET A 1 124 ? 26.687 19.770 39.628 1.00 38.57 ? 154 MET A O   1 
ATOM   814  C  CB  . MET A 1 124 ? 27.498 17.868 37.115 1.00 37.48 ? 154 MET A CB  1 
ATOM   815  C  CG  . MET A 1 124 ? 28.719 17.120 36.556 1.00 37.42 ? 154 MET A CG  1 
ATOM   816  S  SD  . MET A 1 124 ? 30.298 17.624 37.311 1.00 35.00 ? 154 MET A SD  1 
ATOM   817  C  CE  . MET A 1 124 ? 30.353 19.339 36.819 1.00 28.12 ? 154 MET A CE  1 
ATOM   818  N  N   . HIS A 1 125 ? 24.943 18.583 38.888 1.00 39.94 ? 155 HIS A N   1 
ATOM   819  C  CA  . HIS A 1 125 ? 23.944 19.571 39.346 1.00 39.25 ? 155 HIS A CA  1 
ATOM   820  C  C   . HIS A 1 125 ? 22.797 18.843 40.021 1.00 38.51 ? 155 HIS A C   1 
ATOM   821  O  O   . HIS A 1 125 ? 22.242 17.908 39.448 1.00 40.24 ? 155 HIS A O   1 
ATOM   822  C  CB  . HIS A 1 125 ? 23.427 20.392 38.162 1.00 39.92 ? 155 HIS A CB  1 
ATOM   823  C  CG  . HIS A 1 125 ? 22.575 21.564 38.543 1.00 39.53 ? 155 HIS A CG  1 
ATOM   824  N  ND1 . HIS A 1 125 ? 23.102 22.765 38.970 1.00 43.14 ? 155 HIS A ND1 1 
ATOM   825  C  CD2 . HIS A 1 125 ? 21.229 21.732 38.521 1.00 38.35 ? 155 HIS A CD2 1 
ATOM   826  C  CE1 . HIS A 1 125 ? 22.118 23.616 39.211 1.00 37.30 ? 155 HIS A CE1 1 
ATOM   827  N  NE2 . HIS A 1 125 ? 20.971 23.012 38.947 1.00 38.10 ? 155 HIS A NE2 1 
ATOM   828  N  N   . THR A 1 126 ? 22.447 19.281 41.234 1.00 36.67 ? 156 THR A N   1 
ATOM   829  C  CA  . THR A 1 126 ? 21.386 18.669 42.021 1.00 34.48 ? 156 THR A CA  1 
ATOM   830  C  C   . THR A 1 126 ? 20.217 19.633 42.246 1.00 35.19 ? 156 THR A C   1 
ATOM   831  O  O   . THR A 1 126 ? 20.443 20.781 42.635 1.00 34.09 ? 156 THR A O   1 
ATOM   832  C  CB  . THR A 1 126 ? 21.927 18.196 43.369 1.00 34.98 ? 156 THR A CB  1 
ATOM   833  O  OG1 . THR A 1 126 ? 22.676 19.246 44.000 1.00 27.53 ? 156 THR A OG1 1 
ATOM   834  C  CG2 . THR A 1 126 ? 22.815 16.947 43.185 1.00 35.53 ? 156 THR A CG2 1 
ATOM   835  N  N   . MET A 1 127 ? 18.982 19.170 41.992 1.00 35.35 ? 157 MET A N   1 
ATOM   836  C  CA  . MET A 1 127 ? 17.762 19.969 42.261 1.00 39.36 ? 157 MET A CA  1 
ATOM   837  C  C   . MET A 1 127 ? 16.641 19.146 42.889 1.00 36.76 ? 157 MET A C   1 
ATOM   838  O  O   . MET A 1 127 ? 16.441 18.010 42.500 1.00 36.27 ? 157 MET A O   1 
ATOM   839  C  CB  . MET A 1 127 ? 17.128 20.497 40.971 1.00 40.67 ? 157 MET A CB  1 
ATOM   840  C  CG  . MET A 1 127 ? 17.935 21.362 40.050 1.00 45.84 ? 157 MET A CG  1 
ATOM   841  S  SD  . MET A 1 127 ? 16.809 21.957 38.752 1.00 46.97 ? 157 MET A SD  1 
ATOM   842  C  CE  . MET A 1 127 ? 16.441 20.474 37.798 1.00 42.15 ? 157 MET A CE  1 
ATOM   843  N  N   . LEU A 1 128 ? 15.887 19.743 43.812 1.00 36.74 ? 158 LEU A N   1 
ATOM   844  C  CA  . LEU A 1 128 ? 14.531 19.262 44.160 1.00 35.83 ? 158 LEU A CA  1 
ATOM   845  C  C   . LEU A 1 128 ? 13.526 20.370 43.838 1.00 35.19 ? 158 LEU A C   1 
ATOM   846  O  O   . LEU A 1 128 ? 13.661 21.489 44.326 1.00 31.41 ? 158 LEU A O   1 
ATOM   847  C  CB  . LEU A 1 128 ? 14.422 18.841 45.633 1.00 34.56 ? 158 LEU A CB  1 
ATOM   848  C  CG  . LEU A 1 128 ? 13.283 17.847 45.913 1.00 39.06 ? 158 LEU A CG  1 
ATOM   849  C  CD1 . LEU A 1 128 ? 13.529 17.032 47.193 1.00 34.84 ? 158 LEU A CD1 1 
ATOM   850  C  CD2 . LEU A 1 128 ? 11.895 18.544 45.965 1.00 38.63 ? 158 LEU A CD2 1 
ATOM   851  N  N   . ILE A 1 129 ? 12.528 20.057 43.011 1.00 35.41 ? 159 ILE A N   1 
ATOM   852  C  CA  . ILE A 1 129 ? 11.645 21.083 42.457 1.00 37.19 ? 159 ILE A CA  1 
ATOM   853  C  C   . ILE A 1 129 ? 10.250 20.986 43.058 1.00 37.09 ? 159 ILE A C   1 
ATOM   854  O  O   . ILE A 1 129 ? 9.632  19.927 43.034 1.00 41.02 ? 159 ILE A O   1 
ATOM   855  C  CB  . ILE A 1 129 ? 11.557 20.983 40.921 1.00 38.21 ? 159 ILE A CB  1 
ATOM   856  C  CG1 . ILE A 1 129 ? 12.954 20.816 40.288 1.00 42.04 ? 159 ILE A CG1 1 
ATOM   857  C  CG2 . ILE A 1 129 ? 10.946 22.264 40.357 1.00 41.07 ? 159 ILE A CG2 1 
ATOM   858  C  CD1 . ILE A 1 129 ? 13.032 19.738 39.218 1.00 43.68 ? 159 ILE A CD1 1 
ATOM   859  N  N   . ASN A 1 130 ? 9.765  22.091 43.607 1.00 35.83 ? 160 ASN A N   1 
ATOM   860  C  CA  . ASN A 1 130 ? 8.499  22.117 44.334 1.00 36.34 ? 160 ASN A CA  1 
ATOM   861  C  C   . ASN A 1 130 ? 7.545  23.099 43.649 1.00 36.29 ? 160 ASN A C   1 
ATOM   862  O  O   . ASN A 1 130 ? 7.302  24.198 44.148 1.00 34.83 ? 160 ASN A O   1 
ATOM   863  C  CB  . ASN A 1 130 ? 8.772  22.510 45.795 1.00 35.99 ? 160 ASN A CB  1 
ATOM   864  C  CG  . ASN A 1 130 ? 7.577  22.286 46.704 1.00 39.05 ? 160 ASN A CG  1 
ATOM   865  O  OD1 . ASN A 1 130 ? 6.924  21.224 46.664 1.00 34.74 ? 160 ASN A OD1 1 
ATOM   866  N  ND2 . ASN A 1 130 ? 7.292  23.281 47.548 1.00 29.87 ? 160 ASN A ND2 1 
ATOM   867  N  N   . LYS A 1 131 ? 7.014  22.690 42.494 1.00 36.92 ? 161 LYS A N   1 
ATOM   868  C  CA  . LYS A 1 131 ? 6.341  23.620 41.576 1.00 37.40 ? 161 LYS A CA  1 
ATOM   869  C  C   . LYS A 1 131 ? 4.994  24.099 42.124 1.00 36.58 ? 161 LYS A C   1 
ATOM   870  O  O   . LYS A 1 131 ? 4.116  23.288 42.391 1.00 36.66 ? 161 LYS A O   1 
ATOM   871  C  CB  . LYS A 1 131 ? 6.145  22.972 40.200 1.00 38.51 ? 161 LYS A CB  1 
ATOM   872  C  CG  . LYS A 1 131 ? 5.693  23.924 39.083 1.00 35.98 ? 161 LYS A CG  1 
ATOM   873  C  CD  . LYS A 1 131 ? 5.415  23.132 37.802 1.00 38.48 ? 161 LYS A CD  1 
ATOM   874  C  CE  . LYS A 1 131 ? 5.443  24.006 36.542 1.00 40.22 ? 161 LYS A CE  1 
ATOM   875  N  NZ  . LYS A 1 131 ? 4.627  25.248 36.661 1.00 49.72 ? 161 LYS A NZ  1 
ATOM   876  N  N   . PRO A 1 132 ? 4.835  25.422 42.289 1.00 34.67 ? 162 PRO A N   1 
ATOM   877  C  CA  . PRO A 1 132 ? 3.651  25.937 42.940 1.00 35.35 ? 162 PRO A CA  1 
ATOM   878  C  C   . PRO A 1 132 ? 2.437  25.972 42.005 1.00 36.89 ? 162 PRO A C   1 
ATOM   879  O  O   . PRO A 1 132 ? 2.593  25.760 40.810 1.00 35.75 ? 162 PRO A O   1 
ATOM   880  C  CB  . PRO A 1 132 ? 4.072  27.346 43.343 1.00 35.05 ? 162 PRO A CB  1 
ATOM   881  C  CG  . PRO A 1 132 ? 5.064  27.740 42.303 1.00 34.86 ? 162 PRO A CG  1 
ATOM   882  C  CD  . PRO A 1 132 ? 5.759  26.498 41.890 1.00 33.73 ? 162 PRO A CD  1 
ATOM   883  N  N   . PRO A 1 133 ? 1.224  26.201 42.556 1.00 38.40 ? 163 PRO A N   1 
ATOM   884  C  CA  . PRO A 1 133 ? 0.027  26.420 41.734 1.00 40.27 ? 163 PRO A CA  1 
ATOM   885  C  C   . PRO A 1 133 ? 0.135  27.680 40.874 1.00 42.82 ? 163 PRO A C   1 
ATOM   886  O  O   . PRO A 1 133 ? 0.292  28.772 41.424 1.00 45.07 ? 163 PRO A O   1 
ATOM   887  C  CB  . PRO A 1 133 ? -1.080 26.590 42.783 1.00 40.29 ? 163 PRO A CB  1 
ATOM   888  C  CG  . PRO A 1 133 ? -0.563 25.889 43.995 1.00 38.75 ? 163 PRO A CG  1 
ATOM   889  C  CD  . PRO A 1 133 ? 0.895  26.196 43.992 1.00 36.86 ? 163 PRO A CD  1 
ATOM   890  N  N   . ASP A 1 134 ? 0.069  27.542 39.550 1.00 43.83 ? 164 ASP A N   1 
ATOM   891  C  CA  . ASP A 1 134 ? 0.129  28.711 38.658 1.00 44.85 ? 164 ASP A CA  1 
ATOM   892  C  C   . ASP A 1 134 ? -1.170 29.502 38.779 1.00 44.36 ? 164 ASP A C   1 
ATOM   893  O  O   . ASP A 1 134 ? -2.166 29.176 38.134 1.00 44.96 ? 164 ASP A O   1 
ATOM   894  C  CB  . ASP A 1 134 ? 0.346  28.311 37.182 1.00 46.41 ? 164 ASP A CB  1 
ATOM   895  C  CG  . ASP A 1 134 ? 1.754  27.794 36.892 1.00 47.84 ? 164 ASP A CG  1 
ATOM   896  O  OD1 . ASP A 1 134 ? 2.740  28.505 37.172 1.00 55.85 ? 164 ASP A OD1 1 
ATOM   897  O  OD2 . ASP A 1 134 ? 1.875  26.671 36.365 1.00 45.47 ? 164 ASP A OD2 1 
ATOM   898  N  N   . PRO A 1 143 ? 7.799  28.321 29.679 1.00 54.57 ? 173 PRO A N   1 
ATOM   899  C  CA  . PRO A 1 143 ? 8.954  28.746 28.897 1.00 52.20 ? 173 PRO A CA  1 
ATOM   900  C  C   . PRO A 1 143 ? 9.987  27.670 28.673 1.00 45.51 ? 173 PRO A C   1 
ATOM   901  O  O   . PRO A 1 143 ? 10.411 27.015 29.616 1.00 45.99 ? 173 PRO A O   1 
ATOM   902  C  CB  . PRO A 1 143 ? 9.502  29.915 29.728 1.00 52.47 ? 173 PRO A CB  1 
ATOM   903  C  CG  . PRO A 1 143 ? 8.206  30.620 30.163 1.00 56.95 ? 173 PRO A CG  1 
ATOM   904  C  CD  . PRO A 1 143 ? 7.103  29.500 30.228 1.00 56.10 ? 173 PRO A CD  1 
ATOM   905  N  N   . LEU A 1 144 ? 10.412 27.526 27.419 1.00 41.06 ? 174 LEU A N   1 
ATOM   906  C  CA  . LEU A 1 144 ? 11.220 26.366 27.017 1.00 39.99 ? 174 LEU A CA  1 
ATOM   907  C  C   . LEU A 1 144 ? 12.727 26.623 26.985 1.00 36.06 ? 174 LEU A C   1 
ATOM   908  O  O   . LEU A 1 144 ? 13.162 27.730 26.744 1.00 35.90 ? 174 LEU A O   1 
ATOM   909  C  CB  . LEU A 1 144 ? 10.749 25.851 25.662 1.00 38.73 ? 174 LEU A CB  1 
ATOM   910  C  CG  . LEU A 1 144 ? 9.243  25.659 25.500 1.00 33.94 ? 174 LEU A CG  1 
ATOM   911  C  CD1 . LEU A 1 144 ? 8.851  25.766 24.016 1.00 39.03 ? 174 LEU A CD1 1 
ATOM   912  C  CD2 . LEU A 1 144 ? 8.803  24.340 26.076 1.00 27.91 ? 174 LEU A CD2 1 
ATOM   913  N  N   . HIS A 1 145 ? 13.513 25.576 27.223 1.00 34.50 ? 175 HIS A N   1 
ATOM   914  C  CA  . HIS A 1 145 ? 14.954 25.716 27.308 1.00 30.24 ? 175 HIS A CA  1 
ATOM   915  C  C   . HIS A 1 145 ? 15.744 24.427 27.172 1.00 28.55 ? 175 HIS A C   1 
ATOM   916  O  O   . HIS A 1 145 ? 15.201 23.328 27.053 1.00 28.91 ? 175 HIS A O   1 
ATOM   917  C  CB  . HIS A 1 145 ? 15.302 26.353 28.649 1.00 30.57 ? 175 HIS A CB  1 
ATOM   918  C  CG  . HIS A 1 145 ? 15.093 25.450 29.816 1.00 24.78 ? 175 HIS A CG  1 
ATOM   919  N  ND1 . HIS A 1 145 ? 13.877 25.320 30.441 1.00 28.34 ? 175 HIS A ND1 1 
ATOM   920  C  CD2 . HIS A 1 145 ? 15.950 24.653 30.494 1.00 37.14 ? 175 HIS A CD2 1 
ATOM   921  C  CE1 . HIS A 1 145 ? 13.986 24.478 31.448 1.00 30.58 ? 175 HIS A CE1 1 
ATOM   922  N  NE2 . HIS A 1 145 ? 15.237 24.058 31.505 1.00 40.40 ? 175 HIS A NE2 1 
ATOM   923  N  N   . GLN A 1 146 ? 17.056 24.598 27.234 1.00 30.07 ? 176 GLN A N   1 
ATOM   924  C  CA  . GLN A 1 146 ? 18.036 23.523 27.137 1.00 30.51 ? 176 GLN A CA  1 
ATOM   925  C  C   . GLN A 1 146 ? 18.882 23.621 28.376 1.00 28.87 ? 176 GLN A C   1 
ATOM   926  O  O   . GLN A 1 146 ? 19.481 24.647 28.614 1.00 29.50 ? 176 GLN A O   1 
ATOM   927  C  CB  . GLN A 1 146 ? 18.886 23.724 25.876 1.00 30.05 ? 176 GLN A CB  1 
ATOM   928  C  CG  . GLN A 1 146 ? 18.048 23.622 24.637 1.00 26.45 ? 176 GLN A CG  1 
ATOM   929  C  CD  . GLN A 1 146 ? 18.802 23.847 23.381 1.00 33.26 ? 176 GLN A CD  1 
ATOM   930  O  OE1 . GLN A 1 146 ? 19.167 24.977 23.070 1.00 28.02 ? 176 GLN A OE1 1 
ATOM   931  N  NE2 . GLN A 1 146 ? 19.014 22.772 22.608 1.00 25.91 ? 176 GLN A NE2 1 
ATOM   932  N  N   . ASP A 1 147 ? 18.898 22.587 29.194 1.00 28.85 ? 177 ASP A N   1 
ATOM   933  C  CA  . ASP A 1 147 ? 19.725 22.618 30.412 1.00 30.78 ? 177 ASP A CA  1 
ATOM   934  C  C   . ASP A 1 147 ? 21.185 22.998 30.167 1.00 30.07 ? 177 ASP A C   1 
ATOM   935  O  O   . ASP A 1 147 ? 21.795 23.611 31.029 1.00 33.39 ? 177 ASP A O   1 
ATOM   936  C  CB  . ASP A 1 147 ? 19.667 21.264 31.143 1.00 28.73 ? 177 ASP A CB  1 
ATOM   937  C  CG  . ASP A 1 147 ? 18.285 20.952 31.661 1.00 26.54 ? 177 ASP A CG  1 
ATOM   938  O  OD1 . ASP A 1 147 ? 17.469 21.898 31.766 1.00 24.55 ? 177 ASP A OD1 1 
ATOM   939  O  OD2 . ASP A 1 147 ? 18.004 19.765 31.951 1.00 39.61 ? 177 ASP A OD2 1 
ATOM   940  N  N   . LEU A 1 148 ? 21.730 22.649 29.000 1.00 29.96 ? 178 LEU A N   1 
ATOM   941  C  CA  . LEU A 1 148 ? 23.149 22.900 28.680 1.00 30.10 ? 178 LEU A CA  1 
ATOM   942  C  C   . LEU A 1 148 ? 23.505 24.370 28.642 1.00 30.45 ? 178 LEU A C   1 
ATOM   943  O  O   . LEU A 1 148 ? 24.671 24.751 28.754 1.00 33.32 ? 178 LEU A O   1 
ATOM   944  C  CB  . LEU A 1 148 ? 23.518 22.306 27.319 1.00 28.29 ? 178 LEU A CB  1 
ATOM   945  C  CG  . LEU A 1 148 ? 25.020 22.140 27.063 1.00 31.87 ? 178 LEU A CG  1 
ATOM   946  C  CD1 . LEU A 1 148 ? 25.573 21.039 27.938 1.00 36.14 ? 178 LEU A CD1 1 
ATOM   947  C  CD2 . LEU A 1 148 ? 25.324 21.819 25.588 1.00 33.42 ? 178 LEU A CD2 1 
ATOM   948  N  N   . HIS A 1 149 ? 22.522 25.224 28.465 1.00 29.73 ? 179 HIS A N   1 
ATOM   949  C  CA  . HIS A 1 149 ? 22.849 26.616 28.466 1.00 32.15 ? 179 HIS A CA  1 
ATOM   950  C  C   . HIS A 1 149 ? 23.627 26.956 29.727 1.00 33.39 ? 179 HIS A C   1 
ATOM   951  O  O   . HIS A 1 149 ? 24.491 27.826 29.705 1.00 35.57 ? 179 HIS A O   1 
ATOM   952  C  CB  . HIS A 1 149 ? 21.604 27.462 28.382 1.00 28.97 ? 179 HIS A CB  1 
ATOM   953  C  CG  . HIS A 1 149 ? 21.894 28.914 28.427 1.00 28.33 ? 179 HIS A CG  1 
ATOM   954  N  ND1 . HIS A 1 149 ? 22.550 29.562 27.409 1.00 23.94 ? 179 HIS A ND1 1 
ATOM   955  C  CD2 . HIS A 1 149 ? 21.615 29.851 29.364 1.00 28.20 ? 179 HIS A CD2 1 
ATOM   956  C  CE1 . HIS A 1 149 ? 22.633 30.847 27.704 1.00 29.31 ? 179 HIS A CE1 1 
ATOM   957  N  NE2 . HIS A 1 149 ? 22.086 31.043 28.892 1.00 22.65 ? 179 HIS A NE2 1 
ATOM   958  N  N   . TYR A 1 150 ? 23.300 26.270 30.817 1.00 34.71 ? 180 TYR A N   1 
ATOM   959  C  CA  . TYR A 1 150 ? 23.888 26.546 32.112 1.00 37.30 ? 180 TYR A CA  1 
ATOM   960  C  C   . TYR A 1 150 ? 25.156 25.753 32.425 1.00 35.25 ? 180 TYR A C   1 
ATOM   961  O  O   . TYR A 1 150 ? 25.785 25.990 33.446 1.00 36.26 ? 180 TYR A O   1 
ATOM   962  C  CB  . TYR A 1 150 ? 22.817 26.360 33.201 1.00 42.36 ? 180 TYR A CB  1 
ATOM   963  C  CG  . TYR A 1 150 ? 22.075 27.647 33.396 1.00 51.31 ? 180 TYR A CG  1 
ATOM   964  C  CD1 . TYR A 1 150 ? 20.861 27.887 32.759 1.00 55.04 ? 180 TYR A CD1 1 
ATOM   965  C  CD2 . TYR A 1 150 ? 22.654 28.687 34.145 1.00 55.81 ? 180 TYR A CD2 1 
ATOM   966  C  CE1 . TYR A 1 150 ? 20.214 29.120 32.910 1.00 58.06 ? 180 TYR A CE1 1 
ATOM   967  C  CE2 . TYR A 1 150 ? 22.020 29.896 34.305 1.00 53.02 ? 180 TYR A CE2 1 
ATOM   968  C  CZ  . TYR A 1 150 ? 20.801 30.116 33.689 1.00 54.70 ? 180 TYR A CZ  1 
ATOM   969  O  OH  . TYR A 1 150 ? 20.183 31.339 33.861 1.00 55.05 ? 180 TYR A OH  1 
ATOM   970  N  N   . PHE A 1 151 ? 25.564 24.859 31.531 1.00 32.18 ? 181 PHE A N   1 
ATOM   971  C  CA  . PHE A 1 151 ? 26.666 23.934 31.824 1.00 32.95 ? 181 PHE A CA  1 
ATOM   972  C  C   . PHE A 1 151 ? 27.901 24.273 30.997 1.00 32.02 ? 181 PHE A C   1 
ATOM   973  O  O   . PHE A 1 151 ? 27.906 24.085 29.789 1.00 29.84 ? 181 PHE A O   1 
ATOM   974  C  CB  . PHE A 1 151 ? 26.245 22.477 31.545 1.00 33.15 ? 181 PHE A CB  1 
ATOM   975  C  CG  . PHE A 1 151 ? 25.069 21.994 32.356 1.00 26.78 ? 181 PHE A CG  1 
ATOM   976  C  CD1 . PHE A 1 151 ? 24.790 22.492 33.616 1.00 35.92 ? 181 PHE A CD1 1 
ATOM   977  C  CD2 . PHE A 1 151 ? 24.277 20.970 31.875 1.00 42.81 ? 181 PHE A CD2 1 
ATOM   978  C  CE1 . PHE A 1 151 ? 23.698 22.018 34.350 1.00 33.27 ? 181 PHE A CE1 1 
ATOM   979  C  CE2 . PHE A 1 151 ? 23.202 20.487 32.605 1.00 39.39 ? 181 PHE A CE2 1 
ATOM   980  C  CZ  . PHE A 1 151 ? 22.916 21.022 33.846 1.00 38.37 ? 181 PHE A CZ  1 
ATOM   981  N  N   . PRO A 1 152 ? 28.957 24.782 31.643 1.00 32.55 ? 182 PRO A N   1 
ATOM   982  C  CA  . PRO A 1 152 ? 30.150 25.091 30.870 1.00 31.88 ? 182 PRO A CA  1 
ATOM   983  C  C   . PRO A 1 152 ? 31.095 23.914 30.880 1.00 31.28 ? 182 PRO A C   1 
ATOM   984  O  O   . PRO A 1 152 ? 32.210 24.046 31.349 1.00 31.49 ? 182 PRO A O   1 
ATOM   985  C  CB  . PRO A 1 152 ? 30.750 26.277 31.630 1.00 31.03 ? 182 PRO A CB  1 
ATOM   986  C  CG  . PRO A 1 152 ? 30.390 26.004 33.060 1.00 29.27 ? 182 PRO A CG  1 
ATOM   987  C  CD  . PRO A 1 152 ? 29.141 25.120 33.068 1.00 32.62 ? 182 PRO A CD  1 
ATOM   988  N  N   . PHE A 1 153 ? 30.630 22.763 30.401 1.00 30.76 ? 183 PHE A N   1 
ATOM   989  C  CA  . PHE A 1 153 ? 31.468 21.581 30.273 1.00 30.38 ? 183 PHE A CA  1 
ATOM   990  C  C   . PHE A 1 153 ? 30.976 20.706 29.105 1.00 30.56 ? 183 PHE A C   1 
ATOM   991  O  O   . PHE A 1 153 ? 29.809 20.747 28.743 1.00 32.00 ? 183 PHE A O   1 
ATOM   992  C  CB  . PHE A 1 153 ? 31.609 20.803 31.616 1.00 32.83 ? 183 PHE A CB  1 
ATOM   993  C  CG  . PHE A 1 153 ? 30.324 20.614 32.369 1.00 31.58 ? 183 PHE A CG  1 
ATOM   994  C  CD1 . PHE A 1 153 ? 29.519 19.521 32.132 1.00 37.34 ? 183 PHE A CD1 1 
ATOM   995  C  CD2 . PHE A 1 153 ? 29.926 21.532 33.322 1.00 33.20 ? 183 PHE A CD2 1 
ATOM   996  C  CE1 . PHE A 1 153 ? 28.319 19.351 32.820 1.00 33.19 ? 183 PHE A CE1 1 
ATOM   997  C  CE2 . PHE A 1 153 ? 28.740 21.370 34.012 1.00 33.70 ? 183 PHE A CE2 1 
ATOM   998  C  CZ  . PHE A 1 153 ? 27.929 20.273 33.751 1.00 31.74 ? 183 PHE A CZ  1 
ATOM   999  N  N   . ARG A 1 154 ? 31.883 19.968 28.472 1.00 30.80 ? 184 ARG A N   1 
ATOM   1000 C  CA  . ARG A 1 154 ? 31.558 19.208 27.257 1.00 33.03 ? 184 ARG A CA  1 
ATOM   1001 C  C   . ARG A 1 154 ? 32.293 17.858 27.233 1.00 35.04 ? 184 ARG A C   1 
ATOM   1002 O  O   . ARG A 1 154 ? 33.156 17.630 28.069 1.00 38.52 ? 184 ARG A O   1 
ATOM   1003 C  CB  . ARG A 1 154 ? 31.963 20.028 26.048 1.00 32.36 ? 184 ARG A CB  1 
ATOM   1004 C  CG  . ARG A 1 154 ? 31.164 21.352 25.912 1.00 31.04 ? 184 ARG A CG  1 
ATOM   1005 C  CD  . ARG A 1 154 ? 29.716 21.089 25.468 1.00 29.62 ? 184 ARG A CD  1 
ATOM   1006 N  NE  . ARG A 1 154 ? 29.148 22.351 25.040 1.00 21.41 ? 184 ARG A NE  1 
ATOM   1007 C  CZ  . ARG A 1 154 ? 28.719 23.310 25.860 1.00 32.24 ? 184 ARG A CZ  1 
ATOM   1008 N  NH1 . ARG A 1 154 ? 28.736 23.134 27.180 1.00 34.75 ? 184 ARG A NH1 1 
ATOM   1009 N  NH2 . ARG A 1 154 ? 28.294 24.476 25.358 1.00 26.28 ? 184 ARG A NH2 1 
ATOM   1010 N  N   . PRO A 1 155 ? 31.945 16.944 26.304 1.00 33.81 ? 185 PRO A N   1 
ATOM   1011 C  CA  . PRO A 1 155 ? 30.814 16.882 25.358 1.00 34.27 ? 185 PRO A CA  1 
ATOM   1012 C  C   . PRO A 1 155 ? 29.424 16.739 26.015 1.00 33.33 ? 185 PRO A C   1 
ATOM   1013 O  O   . PRO A 1 155 ? 29.249 15.989 26.971 1.00 32.00 ? 185 PRO A O   1 
ATOM   1014 C  CB  . PRO A 1 155 ? 31.120 15.631 24.509 1.00 34.18 ? 185 PRO A CB  1 
ATOM   1015 C  CG  . PRO A 1 155 ? 32.532 15.285 24.770 1.00 36.49 ? 185 PRO A CG  1 
ATOM   1016 C  CD  . PRO A 1 155 ? 32.853 15.797 26.140 1.00 35.38 ? 185 PRO A CD  1 
ATOM   1017 N  N   . SER A 1 156 ? 28.435 17.451 25.490 1.00 34.67 ? 186 SER A N   1 
ATOM   1018 C  CA  . SER A 1 156 ? 27.046 17.271 25.952 1.00 35.59 ? 186 SER A CA  1 
ATOM   1019 C  C   . SER A 1 156 ? 26.511 15.823 25.861 1.00 35.46 ? 186 SER A C   1 
ATOM   1020 O  O   . SER A 1 156 ? 25.580 15.469 26.581 1.00 35.59 ? 186 SER A O   1 
ATOM   1021 C  CB  . SER A 1 156 ? 26.142 18.172 25.153 1.00 35.57 ? 186 SER A CB  1 
ATOM   1022 O  OG  . SER A 1 156 ? 26.596 18.197 23.817 1.00 39.64 ? 186 SER A OG  1 
ATOM   1023 N  N   . ASP A 1 157 ? 27.077 14.995 24.984 1.00 34.68 ? 187 ASP A N   1 
ATOM   1024 C  CA  . ASP A 1 157 ? 26.535 13.636 24.777 1.00 37.05 ? 187 ASP A CA  1 
ATOM   1025 C  C   . ASP A 1 157 ? 26.838 12.721 25.969 1.00 34.29 ? 187 ASP A C   1 
ATOM   1026 O  O   . ASP A 1 157 ? 26.142 11.744 26.179 1.00 33.58 ? 187 ASP A O   1 
ATOM   1027 C  CB  . ASP A 1 157 ? 27.019 13.016 23.444 1.00 35.69 ? 187 ASP A CB  1 
ATOM   1028 C  CG  . ASP A 1 157 ? 26.454 13.751 22.203 1.00 46.21 ? 187 ASP A CG  1 
ATOM   1029 O  OD1 . ASP A 1 157 ? 26.617 13.225 21.083 1.00 53.54 ? 187 ASP A OD1 1 
ATOM   1030 O  OD2 . ASP A 1 157 ? 25.858 14.859 22.331 1.00 51.74 ? 187 ASP A OD2 1 
ATOM   1031 N  N   . LEU A 1 158 ? 27.846 13.088 26.762 1.00 34.24 ? 188 LEU A N   1 
ATOM   1032 C  CA  . LEU A 1 158 ? 28.263 12.332 27.944 1.00 32.59 ? 188 LEU A CA  1 
ATOM   1033 C  C   . LEU A 1 158 ? 27.673 12.924 29.247 1.00 32.37 ? 188 LEU A C   1 
ATOM   1034 O  O   . LEU A 1 158 ? 28.189 12.687 30.344 1.00 31.21 ? 188 LEU A O   1 
ATOM   1035 C  CB  . LEU A 1 158 ? 29.802 12.271 28.002 1.00 31.64 ? 188 LEU A CB  1 
ATOM   1036 C  CG  . LEU A 1 158 ? 30.524 11.483 26.902 1.00 27.84 ? 188 LEU A CG  1 
ATOM   1037 C  CD1 . LEU A 1 158 ? 32.034 11.599 27.092 1.00 26.32 ? 188 LEU A CD1 1 
ATOM   1038 C  CD2 . LEU A 1 158 ? 30.133 9.999  26.869 1.00 26.84 ? 188 LEU A CD2 1 
ATOM   1039 N  N   . ILE A 1 159 ? 26.579 13.674 29.100 1.00 33.49 ? 189 ILE A N   1 
ATOM   1040 C  CA  . ILE A 1 159 ? 25.888 14.355 30.194 1.00 32.74 ? 189 ILE A CA  1 
ATOM   1041 C  C   . ILE A 1 159 ? 24.433 13.935 30.153 1.00 32.54 ? 189 ILE A C   1 
ATOM   1042 O  O   . ILE A 1 159 ? 23.818 13.945 29.085 1.00 31.71 ? 189 ILE A O   1 
ATOM   1043 C  CB  . ILE A 1 159 ? 25.859 15.902 30.002 1.00 32.93 ? 189 ILE A CB  1 
ATOM   1044 C  CG1 . ILE A 1 159 ? 27.268 16.504 29.999 1.00 32.85 ? 189 ILE A CG1 1 
ATOM   1045 C  CG2 . ILE A 1 159 ? 25.002 16.542 31.097 1.00 30.60 ? 189 ILE A CG2 1 
ATOM   1046 C  CD1 . ILE A 1 159 ? 27.286 18.028 29.711 1.00 34.86 ? 189 ILE A CD1 1 
ATOM   1047 N  N   . VAL A 1 160 ? 23.848 13.653 31.309 1.00 33.62 ? 190 VAL A N   1 
ATOM   1048 C  CA  . VAL A 1 160 ? 22.449 13.236 31.362 1.00 33.27 ? 190 VAL A CA  1 
ATOM   1049 C  C   . VAL A 1 160 ? 21.716 13.753 32.609 1.00 33.83 ? 190 VAL A C   1 
ATOM   1050 O  O   . VAL A 1 160 ? 22.225 13.715 33.738 1.00 33.78 ? 190 VAL A O   1 
ATOM   1051 C  CB  . VAL A 1 160 ? 22.345 11.694 31.266 1.00 31.41 ? 190 VAL A CB  1 
ATOM   1052 C  CG1 . VAL A 1 160 ? 22.785 11.035 32.563 1.00 29.12 ? 190 VAL A CG1 1 
ATOM   1053 C  CG2 . VAL A 1 160 ? 20.936 11.275 30.903 1.00 35.71 ? 190 VAL A CG2 1 
ATOM   1054 N  N   . CYS A 1 161 ? 20.508 14.236 32.400 1.00 35.20 ? 191 CYS A N   1 
ATOM   1055 C  CA  . CYS A 1 161 ? 19.637 14.575 33.520 1.00 34.90 ? 191 CYS A CA  1 
ATOM   1056 C  C   . CYS A 1 161 ? 18.830 13.360 33.945 1.00 33.26 ? 191 CYS A C   1 
ATOM   1057 O  O   . CYS A 1 161 ? 18.233 12.711 33.106 1.00 31.31 ? 191 CYS A O   1 
ATOM   1058 C  CB  . CYS A 1 161 ? 18.669 15.658 33.094 1.00 33.88 ? 191 CYS A CB  1 
ATOM   1059 S  SG  . CYS A 1 161 ? 17.543 16.094 34.369 1.00 37.06 ? 191 CYS A SG  1 
ATOM   1060 N  N   . ALA A 1 162 ? 18.795 13.077 35.242 1.00 33.93 ? 192 ALA A N   1 
ATOM   1061 C  CA  . ALA A 1 162 ? 17.898 12.057 35.795 1.00 34.60 ? 192 ALA A CA  1 
ATOM   1062 C  C   . ALA A 1 162 ? 16.850 12.731 36.670 1.00 34.77 ? 192 ALA A C   1 
ATOM   1063 O  O   . ALA A 1 162 ? 17.169 13.298 37.725 1.00 36.13 ? 192 ALA A O   1 
ATOM   1064 C  CB  . ALA A 1 162 ? 18.678 11.027 36.597 1.00 36.06 ? 192 ALA A CB  1 
ATOM   1065 N  N   . TRP A 1 163 ? 15.598 12.659 36.237 1.00 32.74 ? 193 TRP A N   1 
ATOM   1066 C  CA  . TRP A 1 163 ? 14.539 13.470 36.818 1.00 32.65 ? 193 TRP A CA  1 
ATOM   1067 C  C   . TRP A 1 163 ? 13.446 12.525 37.272 1.00 30.30 ? 193 TRP A C   1 
ATOM   1068 O  O   . TRP A 1 163 ? 12.860 11.822 36.454 1.00 30.11 ? 193 TRP A O   1 
ATOM   1069 C  CB  . TRP A 1 163 ? 14.037 14.410 35.736 1.00 32.40 ? 193 TRP A CB  1 
ATOM   1070 C  CG  . TRP A 1 163 ? 13.107 15.507 36.101 1.00 32.02 ? 193 TRP A CG  1 
ATOM   1071 C  CD1 . TRP A 1 163 ? 13.415 16.843 36.203 1.00 33.10 ? 193 TRP A CD1 1 
ATOM   1072 C  CD2 . TRP A 1 163 ? 11.695 15.412 36.256 1.00 29.40 ? 193 TRP A CD2 1 
ATOM   1073 N  NE1 . TRP A 1 163 ? 12.281 17.573 36.448 1.00 33.96 ? 193 TRP A NE1 1 
ATOM   1074 C  CE2 . TRP A 1 163 ? 11.210 16.721 36.498 1.00 29.74 ? 193 TRP A CE2 1 
ATOM   1075 C  CE3 . TRP A 1 163 ? 10.787 14.345 36.250 1.00 33.83 ? 193 TRP A CE3 1 
ATOM   1076 C  CZ2 . TRP A 1 163 ? 9.865  16.986 36.753 1.00 30.31 ? 193 TRP A CZ2 1 
ATOM   1077 C  CZ3 . TRP A 1 163 ? 9.434  14.613 36.495 1.00 33.91 ? 193 TRP A CZ3 1 
ATOM   1078 C  CH2 . TRP A 1 163 ? 8.994  15.919 36.755 1.00 34.24 ? 193 TRP A CH2 1 
ATOM   1079 N  N   . THR A 1 164 ? 13.171 12.497 38.568 1.00 29.81 ? 194 THR A N   1 
ATOM   1080 C  CA  . THR A 1 164 ? 12.220 11.507 39.105 1.00 31.46 ? 194 THR A CA  1 
ATOM   1081 C  C   . THR A 1 164 ? 10.989 12.130 39.742 1.00 30.84 ? 194 THR A C   1 
ATOM   1082 O  O   . THR A 1 164 ? 11.075 13.078 40.520 1.00 32.01 ? 194 THR A O   1 
ATOM   1083 C  CB  . THR A 1 164 ? 12.900 10.581 40.106 1.00 31.08 ? 194 THR A CB  1 
ATOM   1084 O  OG1 . THR A 1 164 ? 13.890 9.806  39.419 1.00 29.67 ? 194 THR A OG1 1 
ATOM   1085 C  CG2 . THR A 1 164 ? 11.903 9.618  40.744 1.00 34.76 ? 194 THR A CG2 1 
ATOM   1086 N  N   . ALA A 1 165 ? 9.832  11.587 39.398 1.00 32.30 ? 195 ALA A N   1 
ATOM   1087 C  CA  . ALA A 1 165 ? 8.580  12.019 40.011 1.00 32.02 ? 195 ALA A CA  1 
ATOM   1088 C  C   . ALA A 1 165 ? 8.520  11.549 41.464 1.00 32.50 ? 195 ALA A C   1 
ATOM   1089 O  O   . ALA A 1 165 ? 8.665  10.346 41.753 1.00 30.71 ? 195 ALA A O   1 
ATOM   1090 C  CB  . ALA A 1 165 ? 7.416  11.489 39.232 1.00 32.46 ? 195 ALA A CB  1 
ATOM   1091 N  N   . MET A 1 166 ? 8.336  12.515 42.368 1.00 33.18 ? 196 MET A N   1 
ATOM   1092 C  CA  . MET A 1 166 ? 8.070  12.245 43.789 1.00 32.75 ? 196 MET A CA  1 
ATOM   1093 C  C   . MET A 1 166 ? 6.583  12.168 44.134 1.00 31.91 ? 196 MET A C   1 
ATOM   1094 O  O   . MET A 1 166 ? 6.219  12.164 45.313 1.00 32.36 ? 196 MET A O   1 
ATOM   1095 C  CB  . MET A 1 166 ? 8.715  13.324 44.650 1.00 32.85 ? 196 MET A CB  1 
ATOM   1096 C  CG  . MET A 1 166 ? 10.216 13.206 44.719 1.00 35.52 ? 196 MET A CG  1 
ATOM   1097 S  SD  . MET A 1 166 ? 10.885 14.566 45.656 1.00 35.27 ? 196 MET A SD  1 
ATOM   1098 C  CE  . MET A 1 166 ? 10.298 14.183 47.301 1.00 33.52 ? 196 MET A CE  1 
ATOM   1099 N  N   . GLU A 1 167 ? 5.726  12.140 43.116 1.00 31.73 ? 197 GLU A N   1 
ATOM   1100 C  CA  . GLU A 1 167 ? 4.287  11.884 43.281 1.00 30.49 ? 197 GLU A CA  1 
ATOM   1101 C  C   . GLU A 1 167 ? 3.716  11.702 41.878 1.00 29.76 ? 197 GLU A C   1 
ATOM   1102 O  O   . GLU A 1 167 ? 4.466  11.719 40.888 1.00 21.23 ? 197 GLU A O   1 
ATOM   1103 C  CB  . GLU A 1 167 ? 3.576  13.040 44.005 1.00 28.58 ? 197 GLU A CB  1 
ATOM   1104 C  CG  . GLU A 1 167 ? 3.477  14.319 43.153 1.00 37.00 ? 197 GLU A CG  1 
ATOM   1105 C  CD  . GLU A 1 167 ? 3.171  15.562 43.964 1.00 30.51 ? 197 GLU A CD  1 
ATOM   1106 O  OE1 . GLU A 1 167 ? 1.987  15.825 44.239 1.00 35.92 ? 197 GLU A OE1 1 
ATOM   1107 O  OE2 . GLU A 1 167 ? 4.119  16.278 44.310 1.00 29.59 ? 197 GLU A OE2 1 
ATOM   1108 N  N   . HIS A 1 168 ? 2.396  11.526 41.786 1.00 33.55 ? 198 HIS A N   1 
ATOM   1109 C  CA  . HIS A 1 168 ? 1.749  11.409 40.478 1.00 36.57 ? 198 HIS A CA  1 
ATOM   1110 C  C   . HIS A 1 168 ? 1.820  12.753 39.763 1.00 37.08 ? 198 HIS A C   1 
ATOM   1111 O  O   . HIS A 1 168 ? 1.281  13.753 40.249 1.00 36.62 ? 198 HIS A O   1 
ATOM   1112 C  CB  . HIS A 1 168 ? 0.295  10.964 40.587 1.00 36.33 ? 198 HIS A CB  1 
ATOM   1113 C  CG  . HIS A 1 168 ? -0.340 10.678 39.259 1.00 44.89 ? 198 HIS A CG  1 
ATOM   1114 N  ND1 . HIS A 1 168 ? -0.151 9.487  38.582 1.00 52.35 ? 198 HIS A ND1 1 
ATOM   1115 C  CD2 . HIS A 1 168 ? -1.156 11.428 38.477 1.00 47.27 ? 198 HIS A CD2 1 
ATOM   1116 C  CE1 . HIS A 1 168 ? -0.823 9.518  37.443 1.00 47.54 ? 198 HIS A CE1 1 
ATOM   1117 N  NE2 . HIS A 1 168 ? -1.445 10.682 37.357 1.00 45.88 ? 198 HIS A NE2 1 
ATOM   1118 N  N   . ILE A 1 169 ? 2.496  12.760 38.619 1.00 38.79 ? 199 ILE A N   1 
ATOM   1119 C  CA  . ILE A 1 169 ? 2.634  13.953 37.791 1.00 40.40 ? 199 ILE A CA  1 
ATOM   1120 C  C   . ILE A 1 169 ? 1.963  13.735 36.447 1.00 41.88 ? 199 ILE A C   1 
ATOM   1121 O  O   . ILE A 1 169 ? 2.346  12.841 35.684 1.00 41.02 ? 199 ILE A O   1 
ATOM   1122 C  CB  . ILE A 1 169 ? 4.092  14.284 37.579 1.00 40.84 ? 199 ILE A CB  1 
ATOM   1123 C  CG1 . ILE A 1 169 ? 4.724  14.586 38.943 1.00 36.13 ? 199 ILE A CG1 1 
ATOM   1124 C  CG2 . ILE A 1 169 ? 4.238  15.437 36.591 1.00 41.46 ? 199 ILE A CG2 1 
ATOM   1125 C  CD1 . ILE A 1 169 ? 6.212  14.715 38.913 1.00 36.38 ? 199 ILE A CD1 1 
ATOM   1126 N  N   . SER A 1 170 ? 0.946  14.559 36.189 1.00 42.99 ? 200 SER A N   1 
ATOM   1127 C  CA  . SER A 1 170 ? 0.143  14.491 34.975 1.00 42.26 ? 200 SER A CA  1 
ATOM   1128 C  C   . SER A 1 170 ? 0.139  15.855 34.312 1.00 41.82 ? 200 SER A C   1 
ATOM   1129 O  O   . SER A 1 170 ? 0.940  16.728 34.660 1.00 41.33 ? 200 SER A O   1 
ATOM   1130 C  CB  . SER A 1 170 ? -1.293 14.068 35.317 1.00 43.73 ? 200 SER A CB  1 
ATOM   1131 O  OG  . SER A 1 170 ? -2.102 15.190 35.662 1.00 44.36 ? 200 SER A OG  1 
ATOM   1132 N  N   . ARG A 1 171 ? -0.795 16.050 33.386 1.00 42.44 ? 201 ARG A N   1 
ATOM   1133 C  CA  . ARG A 1 171 ? -0.866 17.282 32.609 1.00 43.14 ? 201 ARG A CA  1 
ATOM   1134 C  C   . ARG A 1 171 ? -1.427 18.416 33.466 1.00 42.62 ? 201 ARG A C   1 
ATOM   1135 O  O   . ARG A 1 171 ? -1.017 19.556 33.308 1.00 44.39 ? 201 ARG A O   1 
ATOM   1136 C  CB  . ARG A 1 171 ? -1.720 17.091 31.340 1.00 45.00 ? 201 ARG A CB  1 
ATOM   1137 C  CG  . ARG A 1 171 ? -1.528 15.738 30.624 1.00 46.77 ? 201 ARG A CG  1 
ATOM   1138 C  CD  . ARG A 1 171 ? -2.349 14.588 31.272 1.00 41.64 ? 201 ARG A CD  1 
ATOM   1139 N  N   . ASN A 1 172 ? -2.348 18.084 34.375 1.00 41.62 ? 202 ASN A N   1 
ATOM   1140 C  CA  . ASN A 1 172 ? -2.951 19.035 35.324 1.00 41.26 ? 202 ASN A CA  1 
ATOM   1141 C  C   . ASN A 1 172 ? -2.007 19.746 36.285 1.00 39.12 ? 202 ASN A C   1 
ATOM   1142 O  O   . ASN A 1 172 ? -2.205 20.931 36.561 1.00 39.44 ? 202 ASN A O   1 
ATOM   1143 C  CB  . ASN A 1 172 ? -3.997 18.328 36.205 1.00 43.01 ? 202 ASN A CB  1 
ATOM   1144 C  CG  . ASN A 1 172 ? -5.335 18.192 35.537 1.00 43.18 ? 202 ASN A CG  1 
ATOM   1145 O  OD1 . ASN A 1 172 ? -5.706 18.998 34.674 1.00 38.93 ? 202 ASN A OD1 1 
ATOM   1146 N  ND2 . ASN A 1 172 ? -6.091 17.181 35.956 1.00 41.66 ? 202 ASN A ND2 1 
ATOM   1147 N  N   . ASN A 1 173 ? -1.036 19.027 36.845 1.00 36.71 ? 203 ASN A N   1 
ATOM   1148 C  CA  . ASN A 1 173 ? -0.087 19.655 37.782 1.00 35.43 ? 203 ASN A CA  1 
ATOM   1149 C  C   . ASN A 1 173 ? 1.272  19.977 37.211 1.00 35.67 ? 203 ASN A C   1 
ATOM   1150 O  O   . ASN A 1 173 ? 2.226  20.137 37.952 1.00 38.71 ? 203 ASN A O   1 
ATOM   1151 C  CB  . ASN A 1 173 ? 0.058  18.855 39.084 1.00 34.44 ? 203 ASN A CB  1 
ATOM   1152 C  CG  . ASN A 1 173 ? 0.491  17.416 38.868 1.00 31.94 ? 203 ASN A CG  1 
ATOM   1153 O  OD1 . ASN A 1 173 ? 0.760  16.971 37.751 1.00 25.92 ? 203 ASN A OD1 1 
ATOM   1154 N  ND2 . ASN A 1 173 ? 0.570  16.681 39.964 1.00 15.08 ? 203 ASN A ND2 1 
ATOM   1155 N  N   . GLY A 1 174 ? 1.367  20.106 35.897 1.00 36.04 ? 204 GLY A N   1 
ATOM   1156 C  CA  . GLY A 1 174 ? 2.554  20.681 35.280 1.00 33.71 ? 204 GLY A CA  1 
ATOM   1157 C  C   . GLY A 1 174 ? 3.664  19.684 35.132 1.00 34.07 ? 204 GLY A C   1 
ATOM   1158 O  O   . GLY A 1 174 ? 4.732  19.858 35.687 1.00 36.27 ? 204 GLY A O   1 
ATOM   1159 N  N   . CYS A 1 175 ? 3.421  18.626 34.369 1.00 35.41 ? 205 CYS A N   1 
ATOM   1160 C  CA  . CYS A 1 175 ? 4.480  17.687 34.006 1.00 35.54 ? 205 CYS A CA  1 
ATOM   1161 C  C   . CYS A 1 175 ? 5.430  18.309 32.975 1.00 35.29 ? 205 CYS A C   1 
ATOM   1162 O  O   . CYS A 1 175 ? 5.200  19.410 32.472 1.00 35.46 ? 205 CYS A O   1 
ATOM   1163 C  CB  . CYS A 1 175 ? 3.878  16.403 33.444 1.00 37.32 ? 205 CYS A CB  1 
ATOM   1164 S  SG  . CYS A 1 175 ? 2.996  16.614 31.902 1.00 35.35 ? 205 CYS A SG  1 
ATOM   1165 N  N   . LEU A 1 176 ? 6.513  17.606 32.684 1.00 35.41 ? 206 LEU A N   1 
ATOM   1166 C  CA  . LEU A 1 176 ? 7.498  18.088 31.738 1.00 36.16 ? 206 LEU A CA  1 
ATOM   1167 C  C   . LEU A 1 176 ? 6.928  17.968 30.329 1.00 35.94 ? 206 LEU A C   1 
ATOM   1168 O  O   . LEU A 1 176 ? 6.240  16.981 30.005 1.00 37.06 ? 206 LEU A O   1 
ATOM   1169 C  CB  . LEU A 1 176 ? 8.803  17.277 31.837 1.00 36.07 ? 206 LEU A CB  1 
ATOM   1170 C  CG  . LEU A 1 176 ? 9.782  17.600 32.970 1.00 38.07 ? 206 LEU A CG  1 
ATOM   1171 C  CD1 . LEU A 1 176 ? 10.925 16.615 32.943 1.00 40.58 ? 206 LEU A CD1 1 
ATOM   1172 C  CD2 . LEU A 1 176 ? 10.327 19.026 32.909 1.00 34.26 ? 206 LEU A CD2 1 
ATOM   1173 N  N   . VAL A 1 177 ? 7.186  18.988 29.514 1.00 32.53 ? 207 VAL A N   1 
ATOM   1174 C  CA  . VAL A 1 177 ? 6.933  18.919 28.068 1.00 32.89 ? 207 VAL A CA  1 
ATOM   1175 C  C   . VAL A 1 177 ? 8.266  18.785 27.360 1.00 32.60 ? 207 VAL A C   1 
ATOM   1176 O  O   . VAL A 1 177 ? 9.261  19.388 27.776 1.00 30.64 ? 207 VAL A O   1 
ATOM   1177 C  CB  . VAL A 1 177 ? 6.240  20.182 27.500 1.00 31.30 ? 207 VAL A CB  1 
ATOM   1178 C  CG1 . VAL A 1 177 ? 5.578  19.851 26.164 1.00 28.87 ? 207 VAL A CG1 1 
ATOM   1179 C  CG2 . VAL A 1 177 ? 5.215  20.676 28.467 1.00 37.24 ? 207 VAL A CG2 1 
ATOM   1180 N  N   . VAL A 1 178 ? 8.294  17.981 26.304 1.00 31.56 ? 208 VAL A N   1 
ATOM   1181 C  CA  . VAL A 1 178 ? 9.508  17.816 25.521 1.00 29.49 ? 208 VAL A CA  1 
ATOM   1182 C  C   . VAL A 1 178 ? 9.218  17.905 24.028 1.00 31.03 ? 208 VAL A C   1 
ATOM   1183 O  O   . VAL A 1 178 ? 8.133  17.500 23.538 1.00 27.35 ? 208 VAL A O   1 
ATOM   1184 C  CB  . VAL A 1 178 ? 10.233 16.512 25.841 1.00 27.85 ? 208 VAL A CB  1 
ATOM   1185 C  CG1 . VAL A 1 178 ? 10.765 16.539 27.265 1.00 33.04 ? 208 VAL A CG1 1 
ATOM   1186 C  CG2 . VAL A 1 178 ? 9.355  15.336 25.637 1.00 24.88 ? 208 VAL A CG2 1 
ATOM   1187 N  N   . LEU A 1 179 ? 10.199 18.468 23.325 1.00 31.50 ? 209 LEU A N   1 
ATOM   1188 C  CA  . LEU A 1 179 ? 10.195 18.546 21.874 1.00 31.10 ? 209 LEU A CA  1 
ATOM   1189 C  C   . LEU A 1 179 ? 11.131 17.443 21.399 1.00 31.46 ? 209 LEU A C   1 
ATOM   1190 O  O   . LEU A 1 179 ? 12.339 17.636 21.365 1.00 33.28 ? 209 LEU A O   1 
ATOM   1191 C  CB  . LEU A 1 179 ? 10.697 19.918 21.424 1.00 31.19 ? 209 LEU A CB  1 
ATOM   1192 C  CG  . LEU A 1 179 ? 9.737  21.122 21.574 1.00 34.43 ? 209 LEU A CG  1 
ATOM   1193 C  CD1 . LEU A 1 179 ? 9.508  21.489 23.029 1.00 40.75 ? 209 LEU A CD1 1 
ATOM   1194 C  CD2 . LEU A 1 179 ? 10.249 22.341 20.838 1.00 28.86 ? 209 LEU A CD2 1 
ATOM   1195 N  N   . PRO A 1 180 ? 10.582 16.275 21.052 1.00 31.21 ? 210 PRO A N   1 
ATOM   1196 C  CA  . PRO A 1 180 ? 11.404 15.118 20.704 1.00 31.98 ? 210 PRO A CA  1 
ATOM   1197 C  C   . PRO A 1 180 ? 12.345 15.400 19.553 1.00 33.77 ? 210 PRO A C   1 
ATOM   1198 O  O   . PRO A 1 180 ? 11.969 16.099 18.619 1.00 34.11 ? 210 PRO A O   1 
ATOM   1199 C  CB  . PRO A 1 180 ? 10.378 14.077 20.269 1.00 32.86 ? 210 PRO A CB  1 
ATOM   1200 C  CG  . PRO A 1 180 ? 9.080  14.500 20.943 1.00 29.34 ? 210 PRO A CG  1 
ATOM   1201 C  CD  . PRO A 1 180 ? 9.140  15.978 20.954 1.00 32.87 ? 210 PRO A CD  1 
ATOM   1202 N  N   . GLY A 1 181 ? 13.566 14.869 19.635 1.00 35.40 ? 211 GLY A N   1 
ATOM   1203 C  CA  . GLY A 1 181 ? 14.560 15.034 18.581 1.00 34.69 ? 211 GLY A CA  1 
ATOM   1204 C  C   . GLY A 1 181 ? 15.316 16.364 18.536 1.00 35.10 ? 211 GLY A C   1 
ATOM   1205 O  O   . GLY A 1 181 ? 16.213 16.527 17.694 1.00 35.71 ? 211 GLY A O   1 
ATOM   1206 N  N   . THR A 1 182 ? 14.984 17.325 19.399 1.00 35.14 ? 212 THR A N   1 
ATOM   1207 C  CA  . THR A 1 182 ? 15.730 18.602 19.404 1.00 34.59 ? 212 THR A CA  1 
ATOM   1208 C  C   . THR A 1 182 ? 17.109 18.470 20.077 1.00 35.54 ? 212 THR A C   1 
ATOM   1209 O  O   . THR A 1 182 ? 17.925 19.360 19.960 1.00 35.79 ? 212 THR A O   1 
ATOM   1210 C  CB  . THR A 1 182 ? 14.931 19.773 20.009 1.00 31.97 ? 212 THR A CB  1 
ATOM   1211 O  OG1 . THR A 1 182 ? 14.423 19.420 21.302 1.00 33.85 ? 212 THR A OG1 1 
ATOM   1212 C  CG2 . THR A 1 182 ? 13.795 20.102 19.136 1.00 30.56 ? 212 THR A CG2 1 
ATOM   1213 N  N   . HIS A 1 183 ? 17.378 17.351 20.744 1.00 36.72 ? 213 HIS A N   1 
ATOM   1214 C  CA  . HIS A 1 183 ? 18.734 17.055 21.217 1.00 37.82 ? 213 HIS A CA  1 
ATOM   1215 C  C   . HIS A 1 183 ? 19.806 16.936 20.108 1.00 39.88 ? 213 HIS A C   1 
ATOM   1216 O  O   . HIS A 1 183 ? 21.014 16.930 20.392 1.00 38.59 ? 213 HIS A O   1 
ATOM   1217 C  CB  . HIS A 1 183 ? 18.727 15.764 22.034 1.00 39.36 ? 213 HIS A CB  1 
ATOM   1218 C  CG  . HIS A 1 183 ? 18.356 14.540 21.250 1.00 37.35 ? 213 HIS A CG  1 
ATOM   1219 N  ND1 . HIS A 1 183 ? 19.237 13.505 21.038 1.00 35.59 ? 213 HIS A ND1 1 
ATOM   1220 C  CD2 . HIS A 1 183 ? 17.194 14.166 20.665 1.00 39.19 ? 213 HIS A CD2 1 
ATOM   1221 C  CE1 . HIS A 1 183 ? 18.643 12.557 20.339 1.00 31.98 ? 213 HIS A CE1 1 
ATOM   1222 N  NE2 . HIS A 1 183 ? 17.399 12.929 20.105 1.00 32.30 ? 213 HIS A NE2 1 
ATOM   1223 N  N   . LYS A 1 184 ? 19.348 16.840 18.858 1.00 41.64 ? 214 LYS A N   1 
ATOM   1224 C  CA  . LYS A 1 184 ? 20.206 16.697 17.678 1.00 39.75 ? 214 LYS A CA  1 
ATOM   1225 C  C   . LYS A 1 184 ? 20.625 18.026 17.150 1.00 40.54 ? 214 LYS A C   1 
ATOM   1226 O  O   . LYS A 1 184 ? 21.511 18.082 16.292 1.00 39.82 ? 214 LYS A O   1 
ATOM   1227 C  CB  . LYS A 1 184 ? 19.455 15.968 16.546 1.00 38.60 ? 214 LYS A CB  1 
ATOM   1228 C  CG  . LYS A 1 184 ? 19.411 14.467 16.712 1.00 36.78 ? 214 LYS A CG  1 
ATOM   1229 C  CD  . LYS A 1 184 ? 18.351 13.805 15.846 1.00 38.52 ? 214 LYS A CD  1 
ATOM   1230 C  CE  . LYS A 1 184 ? 18.484 12.276 15.957 1.00 39.37 ? 214 LYS A CE  1 
ATOM   1231 N  NZ  . LYS A 1 184 ? 17.390 11.481 15.309 1.00 45.95 ? 214 LYS A NZ  1 
ATOM   1232 N  N   . GLY A 1 185 ? 19.955 19.084 17.622 1.00 40.26 ? 215 GLY A N   1 
ATOM   1233 C  CA  . GLY A 1 185 ? 20.154 20.433 17.104 1.00 40.03 ? 215 GLY A CA  1 
ATOM   1234 C  C   . GLY A 1 185 ? 21.186 21.187 17.919 1.00 41.46 ? 215 GLY A C   1 
ATOM   1235 O  O   . GLY A 1 185 ? 21.819 20.621 18.826 1.00 42.42 ? 215 GLY A O   1 
ATOM   1236 N  N   . SER A 1 186 ? 21.341 22.477 17.614 1.00 39.64 ? 216 SER A N   1 
ATOM   1237 C  CA  . SER A 1 186 ? 22.405 23.263 18.206 1.00 37.38 ? 216 SER A CA  1 
ATOM   1238 C  C   . SER A 1 186 ? 21.982 23.778 19.578 1.00 35.99 ? 216 SER A C   1 
ATOM   1239 O  O   . SER A 1 186 ? 20.816 23.697 19.941 1.00 36.87 ? 216 SER A O   1 
ATOM   1240 C  CB  . SER A 1 186 ? 22.798 24.419 17.270 1.00 36.74 ? 216 SER A CB  1 
ATOM   1241 O  OG  . SER A 1 186 ? 21.712 25.314 17.054 1.00 38.19 ? 216 SER A OG  1 
ATOM   1242 N  N   . LEU A 1 187 ? 22.947 24.277 20.349 1.00 32.76 ? 217 LEU A N   1 
ATOM   1243 C  CA  . LEU A 1 187 ? 22.637 25.054 21.530 1.00 30.44 ? 217 LEU A CA  1 
ATOM   1244 C  C   . LEU A 1 187 ? 22.072 26.393 21.055 1.00 30.03 ? 217 LEU A C   1 
ATOM   1245 O  O   . LEU A 1 187 ? 22.751 27.158 20.375 1.00 30.65 ? 217 LEU A O   1 
ATOM   1246 C  CB  . LEU A 1 187 ? 23.894 25.278 22.400 1.00 30.27 ? 217 LEU A CB  1 
ATOM   1247 C  CG  . LEU A 1 187 ? 23.697 26.129 23.677 1.00 30.62 ? 217 LEU A CG  1 
ATOM   1248 C  CD1 . LEU A 1 187 ? 22.714 25.426 24.631 1.00 27.00 ? 217 LEU A CD1 1 
ATOM   1249 C  CD2 . LEU A 1 187 ? 25.011 26.409 24.360 1.00 27.56 ? 217 LEU A CD2 1 
ATOM   1250 N  N   . LYS A 1 188 ? 20.837 26.670 21.439 1.00 31.42 ? 218 LYS A N   1 
ATOM   1251 C  CA  . LYS A 1 188 ? 20.158 27.911 21.099 1.00 33.72 ? 218 LYS A CA  1 
ATOM   1252 C  C   . LYS A 1 188 ? 20.458 28.989 22.121 1.00 34.54 ? 218 LYS A C   1 
ATOM   1253 O  O   . LYS A 1 188 ? 20.745 28.666 23.266 1.00 35.70 ? 218 LYS A O   1 
ATOM   1254 C  CB  . LYS A 1 188 ? 18.645 27.689 21.098 1.00 34.68 ? 218 LYS A CB  1 
ATOM   1255 C  CG  . LYS A 1 188 ? 18.149 26.600 20.144 1.00 39.77 ? 218 LYS A CG  1 
ATOM   1256 C  CD  . LYS A 1 188 ? 18.433 26.918 18.696 1.00 43.21 ? 218 LYS A CD  1 
ATOM   1257 C  CE  . LYS A 1 188 ? 18.456 25.644 17.864 1.00 50.60 ? 218 LYS A CE  1 
ATOM   1258 N  NZ  . LYS A 1 188 ? 17.285 24.771 18.124 1.00 45.33 ? 218 LYS A NZ  1 
ATOM   1259 N  N   . PRO A 1 189 ? 20.319 30.274 21.731 1.00 35.96 ? 219 PRO A N   1 
ATOM   1260 C  CA  . PRO A 1 189 ? 20.449 31.383 22.681 1.00 37.21 ? 219 PRO A CA  1 
ATOM   1261 C  C   . PRO A 1 189 ? 19.269 31.441 23.649 1.00 37.82 ? 219 PRO A C   1 
ATOM   1262 O  O   . PRO A 1 189 ? 18.156 31.116 23.245 1.00 40.30 ? 219 PRO A O   1 
ATOM   1263 C  CB  . PRO A 1 189 ? 20.475 32.636 21.782 1.00 36.86 ? 219 PRO A CB  1 
ATOM   1264 C  CG  . PRO A 1 189 ? 19.837 32.255 20.524 1.00 35.09 ? 219 PRO A CG  1 
ATOM   1265 C  CD  . PRO A 1 189 ? 19.983 30.747 20.374 1.00 38.39 ? 219 PRO A CD  1 
ATOM   1266 N  N   . HIS A 1 190 ? 19.521 31.848 24.900 1.00 39.53 ? 220 HIS A N   1 
ATOM   1267 C  CA  . HIS A 1 190 ? 18.490 31.980 25.954 1.00 40.88 ? 220 HIS A CA  1 
ATOM   1268 C  C   . HIS A 1 190 ? 18.537 33.355 26.613 1.00 45.30 ? 220 HIS A C   1 
ATOM   1269 O  O   . HIS A 1 190 ? 19.619 33.871 26.836 1.00 45.01 ? 220 HIS A O   1 
ATOM   1270 C  CB  . HIS A 1 190 ? 18.732 30.982 27.090 1.00 38.57 ? 220 HIS A CB  1 
ATOM   1271 C  CG  . HIS A 1 190 ? 18.602 29.547 26.699 1.00 33.93 ? 220 HIS A CG  1 
ATOM   1272 N  ND1 . HIS A 1 190 ? 19.119 29.036 25.525 1.00 35.25 ? 220 HIS A ND1 1 
ATOM   1273 C  CD2 . HIS A 1 190 ? 18.053 28.497 27.359 1.00 31.47 ? 220 HIS A CD2 1 
ATOM   1274 C  CE1 . HIS A 1 190 ? 18.876 27.737 25.472 1.00 35.46 ? 220 HIS A CE1 1 
ATOM   1275 N  NE2 . HIS A 1 190 ? 18.232 27.385 26.572 1.00 30.14 ? 220 HIS A NE2 1 
ATOM   1276 N  N   . ASP A 1 191 ? 17.363 33.900 26.970 1.00 51.84 ? 221 ASP A N   1 
ATOM   1277 C  CA  . ASP A 1 191 ? 17.210 35.113 27.815 1.00 55.61 ? 221 ASP A CA  1 
ATOM   1278 C  C   . ASP A 1 191 ? 16.669 34.754 29.217 1.00 58.26 ? 221 ASP A C   1 
ATOM   1279 O  O   . ASP A 1 191 ? 15.534 34.278 29.332 1.00 57.26 ? 221 ASP A O   1 
ATOM   1280 C  CB  . ASP A 1 191 ? 16.237 36.108 27.162 1.00 54.68 ? 221 ASP A CB  1 
ATOM   1281 C  CG  . ASP A 1 191 ? 16.902 36.994 26.142 1.00 55.40 ? 221 ASP A CG  1 
ATOM   1282 O  OD1 . ASP A 1 191 ? 17.709 37.862 26.546 1.00 50.82 ? 221 ASP A OD1 1 
ATOM   1283 O  OD2 . ASP A 1 191 ? 16.603 36.844 24.937 1.00 61.51 ? 221 ASP A OD2 1 
ATOM   1284 N  N   . TYR A 1 192 ? 17.467 35.001 30.269 1.00 62.60 ? 222 TYR A N   1 
ATOM   1285 C  CA  . TYR A 1 192 ? 17.092 34.698 31.686 1.00 61.87 ? 222 TYR A CA  1 
ATOM   1286 C  C   . TYR A 1 192 ? 18.298 34.805 32.630 1.00 62.01 ? 222 TYR A C   1 
ATOM   1287 O  O   . TYR A 1 192 ? 18.153 35.138 33.811 1.00 61.65 ? 222 TYR A O   1 
ATOM   1288 C  CB  . TYR A 1 192 ? 16.446 33.301 31.803 1.00 64.06 ? 222 TYR A CB  1 
ATOM   1289 C  CG  . TYR A 1 192 ? 16.473 32.624 33.180 1.00 65.53 ? 222 TYR A CG  1 
ATOM   1290 C  CD1 . TYR A 1 192 ? 17.296 31.522 33.409 1.00 70.99 ? 222 TYR A CD1 1 
ATOM   1291 C  CD2 . TYR A 1 192 ? 15.642 33.046 34.224 1.00 62.73 ? 222 TYR A CD2 1 
ATOM   1292 C  CE1 . TYR A 1 192 ? 17.321 30.873 34.640 1.00 68.45 ? 222 TYR A CE1 1 
ATOM   1293 C  CE2 . TYR A 1 192 ? 15.663 32.397 35.462 1.00 67.07 ? 222 TYR A CE2 1 
ATOM   1294 C  CZ  . TYR A 1 192 ? 16.512 31.307 35.658 1.00 66.99 ? 222 TYR A CZ  1 
ATOM   1295 O  OH  . TYR A 1 192 ? 16.568 30.635 36.859 1.00 63.48 ? 222 TYR A OH  1 
ATOM   1296 N  N   . HIS A 1 204 ? 15.982 29.923 31.016 1.00 58.79 ? 234 HIS A N   1 
ATOM   1297 C  CA  . HIS A 1 204 ? 14.507 29.983 30.948 1.00 59.14 ? 234 HIS A CA  1 
ATOM   1298 C  C   . HIS A 1 204 ? 14.056 30.813 29.743 1.00 56.92 ? 234 HIS A C   1 
ATOM   1299 O  O   . HIS A 1 204 ? 13.309 31.786 29.894 1.00 59.62 ? 234 HIS A O   1 
ATOM   1300 C  CB  . HIS A 1 204 ? 13.949 30.599 32.234 1.00 59.32 ? 234 HIS A CB  1 
ATOM   1301 N  N   . GLY A 1 205 ? 14.482 30.410 28.550 1.00 52.83 ? 235 GLY A N   1 
ATOM   1302 C  CA  . GLY A 1 205 ? 14.866 31.409 27.567 1.00 52.34 ? 235 GLY A CA  1 
ATOM   1303 C  C   . GLY A 1 205 ? 14.594 31.318 26.083 1.00 50.72 ? 235 GLY A C   1 
ATOM   1304 O  O   . GLY A 1 205 ? 14.468 32.356 25.471 1.00 51.34 ? 235 GLY A O   1 
ATOM   1305 N  N   . ILE A 1 206 ? 14.498 30.141 25.470 1.00 50.14 ? 236 ILE A N   1 
ATOM   1306 C  CA  . ILE A 1 206 ? 14.531 30.133 23.987 1.00 51.49 ? 236 ILE A CA  1 
ATOM   1307 C  C   . ILE A 1 206 ? 13.356 30.888 23.324 1.00 51.81 ? 236 ILE A C   1 
ATOM   1308 O  O   . ILE A 1 206 ? 12.205 30.474 23.442 1.00 53.18 ? 236 ILE A O   1 
ATOM   1309 C  CB  . ILE A 1 206 ? 14.611 28.732 23.365 1.00 49.94 ? 236 ILE A CB  1 
ATOM   1310 C  CG1 . ILE A 1 206 ? 15.758 27.945 23.956 1.00 42.20 ? 236 ILE A CG1 1 
ATOM   1311 C  CG2 . ILE A 1 206 ? 14.831 28.869 21.835 1.00 52.01 ? 236 ILE A CG2 1 
ATOM   1312 C  CD1 . ILE A 1 206 ? 15.832 26.579 23.402 1.00 40.50 ? 236 ILE A CD1 1 
ATOM   1313 N  N   . GLN A 1 207 ? 13.660 31.965 22.603 1.00 54.26 ? 237 GLN A N   1 
ATOM   1314 C  CA  . GLN A 1 207 ? 12.625 32.803 21.979 1.00 56.15 ? 237 GLN A CA  1 
ATOM   1315 C  C   . GLN A 1 207 ? 12.546 32.616 20.458 1.00 58.18 ? 237 GLN A C   1 
ATOM   1316 O  O   . GLN A 1 207 ? 12.544 33.592 19.723 1.00 61.75 ? 237 GLN A O   1 
ATOM   1317 C  CB  . GLN A 1 207 ? 12.878 34.270 22.322 1.00 55.48 ? 237 GLN A CB  1 
ATOM   1318 N  N   . ASP A 1 208 ? 12.482 31.366 19.998 1.00 60.67 ? 238 ASP A N   1 
ATOM   1319 C  CA  . ASP A 1 208 ? 12.319 31.044 18.572 1.00 62.39 ? 238 ASP A CA  1 
ATOM   1320 C  C   . ASP A 1 208 ? 10.838 30.867 18.263 1.00 64.03 ? 238 ASP A C   1 
ATOM   1321 O  O   . ASP A 1 208 ? 10.301 29.766 18.400 1.00 66.36 ? 238 ASP A O   1 
ATOM   1322 C  CB  . ASP A 1 208 ? 13.048 29.740 18.204 1.00 63.13 ? 238 ASP A CB  1 
ATOM   1323 C  CG  . ASP A 1 208 ? 14.407 29.967 17.565 1.00 64.88 ? 238 ASP A CG  1 
ATOM   1324 O  OD1 . ASP A 1 208 ? 14.475 30.766 16.606 1.00 59.45 ? 238 ASP A OD1 1 
ATOM   1325 O  OD2 . ASP A 1 208 ? 15.392 29.314 18.006 1.00 61.16 ? 238 ASP A OD2 1 
ATOM   1326 N  N   . GLU A 1 210 ? 11.653 26.596 15.691 1.00 60.37 ? 240 GLU A N   1 
ATOM   1327 C  CA  . GLU A 1 210 ? 12.669 25.564 15.475 1.00 60.55 ? 240 GLU A CA  1 
ATOM   1328 C  C   . GLU A 1 210 ? 12.162 24.155 15.849 1.00 61.05 ? 240 GLU A C   1 
ATOM   1329 O  O   . GLU A 1 210 ? 12.941 23.291 16.283 1.00 61.76 ? 240 GLU A O   1 
ATOM   1330 C  CB  . GLU A 1 210 ? 13.963 25.931 16.240 1.00 60.16 ? 240 GLU A CB  1 
ATOM   1331 C  CG  . GLU A 1 210 ? 14.111 25.436 17.689 1.00 58.24 ? 240 GLU A CG  1 
ATOM   1332 C  CD  . GLU A 1 210 ? 12.994 25.883 18.625 1.00 61.47 ? 240 GLU A CD  1 
ATOM   1333 O  OE1 . GLU A 1 210 ? 12.088 25.074 18.940 1.00 55.95 ? 240 GLU A OE1 1 
ATOM   1334 O  OE2 . GLU A 1 210 ? 13.028 27.050 19.065 1.00 60.30 ? 240 GLU A OE2 1 
ATOM   1335 N  N   . GLU A 1 211 ? 10.862 23.917 15.659 1.00 61.12 ? 241 GLU A N   1 
ATOM   1336 C  CA  . GLU A 1 211 ? 10.195 22.757 16.292 1.00 60.54 ? 241 GLU A CA  1 
ATOM   1337 C  C   . GLU A 1 211 ? 10.166 21.531 15.381 1.00 59.02 ? 241 GLU A C   1 
ATOM   1338 O  O   . GLU A 1 211 ? 11.118 20.758 15.367 1.00 60.69 ? 241 GLU A O   1 
ATOM   1339 C  CB  . GLU A 1 211 ? 8.797  23.156 16.795 1.00 60.92 ? 241 GLU A CB  1 
ATOM   1340 C  CG  . GLU A 1 211 ? 8.183  22.163 17.758 1.00 61.79 ? 241 GLU A CG  1 
ATOM   1341 C  CD  . GLU A 1 211 ? 7.056  22.762 18.562 1.00 66.12 ? 241 GLU A CD  1 
ATOM   1342 O  OE1 . GLU A 1 211 ? 5.931  22.206 18.535 1.00 71.31 ? 241 GLU A OE1 1 
ATOM   1343 O  OE2 . GLU A 1 211 ? 7.292  23.798 19.218 1.00 69.42 ? 241 GLU A OE2 1 
ATOM   1344 N  N   . ASN A 1 212 ? 9.103  21.368 14.606 1.00 57.19 ? 242 ASN A N   1 
ATOM   1345 C  CA  . ASN A 1 212 ? 8.969  20.238 13.683 1.00 55.91 ? 242 ASN A CA  1 
ATOM   1346 C  C   . ASN A 1 212 ? 9.186  18.840 14.306 1.00 52.67 ? 242 ASN A C   1 
ATOM   1347 O  O   . ASN A 1 212 ? 9.979  18.035 13.827 1.00 52.41 ? 242 ASN A O   1 
ATOM   1348 C  CB  . ASN A 1 212 ? 9.804  20.481 12.409 1.00 56.16 ? 242 ASN A CB  1 
ATOM   1349 C  CG  . ASN A 1 212 ? 9.055  21.334 11.375 1.00 59.24 ? 242 ASN A CG  1 
ATOM   1350 O  OD1 . ASN A 1 212 ? 8.081  22.020 11.707 1.00 58.55 ? 242 ASN A OD1 1 
ATOM   1351 N  ND2 . ASN A 1 212 ? 9.505  21.286 10.115 1.00 59.28 ? 242 ASN A ND2 1 
ATOM   1352 N  N   . LYS A 1 213 ? 8.475  18.618 15.411 1.00 50.44 ? 243 LYS A N   1 
ATOM   1353 C  CA  . LYS A 1 213 ? 8.059  17.293 15.915 1.00 47.51 ? 243 LYS A CA  1 
ATOM   1354 C  C   . LYS A 1 213 ? 7.125  17.564 17.105 1.00 43.33 ? 243 LYS A C   1 
ATOM   1355 O  O   . LYS A 1 213 ? 7.475  18.347 17.994 1.00 44.43 ? 243 LYS A O   1 
ATOM   1356 C  CB  . LYS A 1 213 ? 9.239  16.420 16.341 1.00 49.25 ? 243 LYS A CB  1 
ATOM   1357 C  CG  . LYS A 1 213 ? 8.952  14.930 16.281 1.00 47.09 ? 243 LYS A CG  1 
ATOM   1358 C  CD  . LYS A 1 213 ? 10.254 14.134 16.263 1.00 50.10 ? 243 LYS A CD  1 
ATOM   1359 N  N   . ALA A 1 214 ? 5.941  16.943 17.101 1.00 39.58 ? 244 ALA A N   1 
ATOM   1360 C  CA  . ALA A 1 214 ? 4.848  17.273 18.054 1.00 36.00 ? 244 ALA A CA  1 
ATOM   1361 C  C   . ALA A 1 214 ? 5.229  17.051 19.521 1.00 34.45 ? 244 ALA A C   1 
ATOM   1362 O  O   . ALA A 1 214 ? 5.775  16.004 19.874 1.00 32.93 ? 244 ALA A O   1 
ATOM   1363 C  CB  . ALA A 1 214 ? 3.587  16.481 17.717 1.00 33.88 ? 244 ALA A CB  1 
ATOM   1364 N  N   . ARG A 1 215 ? 4.922  18.025 20.377 1.00 32.90 ? 245 ARG A N   1 
ATOM   1365 C  CA  . ARG A 1 215 ? 5.337  17.950 21.782 1.00 30.77 ? 245 ARG A CA  1 
ATOM   1366 C  C   . ARG A 1 215 ? 4.796  16.722 22.507 1.00 29.57 ? 245 ARG A C   1 
ATOM   1367 O  O   . ARG A 1 215 ? 3.716  16.201 22.198 1.00 28.97 ? 245 ARG A O   1 
ATOM   1368 C  CB  . ARG A 1 215 ? 4.903  19.185 22.561 1.00 30.87 ? 245 ARG A CB  1 
ATOM   1369 C  CG  . ARG A 1 215 ? 5.444  20.455 21.998 1.00 28.97 ? 245 ARG A CG  1 
ATOM   1370 C  CD  . ARG A 1 215 ? 5.420  21.566 23.011 1.00 30.88 ? 245 ARG A CD  1 
ATOM   1371 N  NE  . ARG A 1 215 ? 5.867  22.786 22.348 1.00 39.68 ? 245 ARG A NE  1 
ATOM   1372 C  CZ  . ARG A 1 215 ? 5.723  24.021 22.811 1.00 33.14 ? 245 ARG A CZ  1 
ATOM   1373 N  NH1 . ARG A 1 215 ? 5.140  24.253 23.981 1.00 31.08 ? 245 ARG A NH1 1 
ATOM   1374 N  NH2 . ARG A 1 215 ? 6.174  25.028 22.078 1.00 38.68 ? 245 ARG A NH2 1 
ATOM   1375 N  N   . VAL A 1 216 ? 5.556  16.277 23.490 1.00 28.58 ? 246 VAL A N   1 
ATOM   1376 C  CA  . VAL A 1 216 ? 5.113  15.204 24.343 1.00 28.17 ? 246 VAL A CA  1 
ATOM   1377 C  C   . VAL A 1 216 ? 5.061  15.716 25.773 1.00 26.89 ? 246 VAL A C   1 
ATOM   1378 O  O   . VAL A 1 216 ? 5.985  16.358 26.227 1.00 25.80 ? 246 VAL A O   1 
ATOM   1379 C  CB  . VAL A 1 216 ? 6.050  13.991 24.206 1.00 30.11 ? 246 VAL A CB  1 
ATOM   1380 C  CG1 . VAL A 1 216 ? 5.717  12.924 25.249 1.00 26.16 ? 246 VAL A CG1 1 
ATOM   1381 C  CG2 . VAL A 1 216 ? 5.961  13.422 22.745 1.00 22.68 ? 246 VAL A CG2 1 
ATOM   1382 N  N   . HIS A 1 217 ? 3.933  15.482 26.429 1.00 26.11 ? 247 HIS A N   1 
ATOM   1383 C  CA  . HIS A 1 217 ? 3.765  15.700 27.846 1.00 28.48 ? 247 HIS A CA  1 
ATOM   1384 C  C   . HIS A 1 217 ? 4.065  14.399 28.612 1.00 28.38 ? 247 HIS A C   1 
ATOM   1385 O  O   . HIS A 1 217 ? 3.345  13.411 28.475 1.00 26.91 ? 247 HIS A O   1 
ATOM   1386 C  CB  . HIS A 1 217 ? 2.319  16.133 28.126 1.00 28.85 ? 247 HIS A CB  1 
ATOM   1387 C  CG  . HIS A 1 217 ? 1.950  17.422 27.460 1.00 35.73 ? 247 HIS A CG  1 
ATOM   1388 N  ND1 . HIS A 1 217 ? 1.379  17.476 26.202 1.00 37.91 ? 247 HIS A ND1 1 
ATOM   1389 C  CD2 . HIS A 1 217 ? 2.093  18.705 27.865 1.00 25.87 ? 247 HIS A CD2 1 
ATOM   1390 C  CE1 . HIS A 1 217 ? 1.182  18.738 25.868 1.00 36.15 ? 247 HIS A CE1 1 
ATOM   1391 N  NE2 . HIS A 1 217 ? 1.611  19.503 26.858 1.00 33.09 ? 247 HIS A NE2 1 
ATOM   1392 N  N   . LEU A 1 218 ? 5.095  14.434 29.452 1.00 28.09 ? 248 LEU A N   1 
ATOM   1393 C  CA  . LEU A 1 218 ? 5.521  13.270 30.202 1.00 28.28 ? 248 LEU A CA  1 
ATOM   1394 C  C   . LEU A 1 218 ? 4.708  13.079 31.458 1.00 30.15 ? 248 LEU A C   1 
ATOM   1395 O  O   . LEU A 1 218 ? 5.117  13.529 32.542 1.00 32.47 ? 248 LEU A O   1 
ATOM   1396 C  CB  . LEU A 1 218 ? 6.983  13.421 30.593 1.00 28.18 ? 248 LEU A CB  1 
ATOM   1397 C  CG  . LEU A 1 218 ? 7.941  13.572 29.415 1.00 25.28 ? 248 LEU A CG  1 
ATOM   1398 C  CD1 . LEU A 1 218 ? 9.327  13.704 29.983 1.00 22.57 ? 248 LEU A CD1 1 
ATOM   1399 C  CD2 . LEU A 1 218 ? 7.857  12.382 28.483 1.00 30.64 ? 248 LEU A CD2 1 
ATOM   1400 N  N   . VAL A 1 219 ? 3.572  12.400 31.333 1.00 29.96 ? 249 VAL A N   1 
ATOM   1401 C  CA  . VAL A 1 219 ? 2.818  12.027 32.511 1.00 31.48 ? 249 VAL A CA  1 
ATOM   1402 C  C   . VAL A 1 219 ? 3.598  10.869 33.123 1.00 33.02 ? 249 VAL A C   1 
ATOM   1403 O  O   . VAL A 1 219 ? 3.953  9.907  32.433 1.00 35.37 ? 249 VAL A O   1 
ATOM   1404 C  CB  . VAL A 1 219 ? 1.290  11.700 32.225 1.00 31.88 ? 249 VAL A CB  1 
ATOM   1405 C  CG1 . VAL A 1 219 ? 1.113  10.771 31.053 1.00 33.50 ? 249 VAL A CG1 1 
ATOM   1406 C  CG2 . VAL A 1 219 ? 0.586  11.091 33.476 1.00 30.41 ? 249 VAL A CG2 1 
ATOM   1407 N  N   . MET A 1 220 ? 3.912  10.999 34.408 1.00 34.06 ? 250 MET A N   1 
ATOM   1408 C  CA  . MET A 1 220 ? 4.687  9.999  35.131 1.00 34.34 ? 250 MET A CA  1 
ATOM   1409 C  C   . MET A 1 220 ? 3.984  9.684  36.430 1.00 36.08 ? 250 MET A C   1 
ATOM   1410 O  O   . MET A 1 220 ? 3.285  10.530 36.986 1.00 37.28 ? 250 MET A O   1 
ATOM   1411 C  CB  . MET A 1 220 ? 6.098  10.516 35.422 1.00 34.12 ? 250 MET A CB  1 
ATOM   1412 C  CG  . MET A 1 220 ? 7.003  10.573 34.194 1.00 32.15 ? 250 MET A CG  1 
ATOM   1413 S  SD  . MET A 1 220 ? 8.404  11.720 34.350 1.00 34.10 ? 250 MET A SD  1 
ATOM   1414 C  CE  . MET A 1 220 ? 9.171  11.098 35.831 1.00 41.61 ? 250 MET A CE  1 
ATOM   1415 N  N   . GLU A 1 221 ? 4.151  8.444  36.888 1.00 36.34 ? 251 GLU A N   1 
ATOM   1416 C  CA  . GLU A 1 221 ? 3.740  8.031  38.216 1.00 33.58 ? 251 GLU A CA  1 
ATOM   1417 C  C   . GLU A 1 221 ? 4.913  8.210  39.178 1.00 32.79 ? 251 GLU A C   1 
ATOM   1418 O  O   . GLU A 1 221 ? 6.065  8.275  38.759 1.00 32.13 ? 251 GLU A O   1 
ATOM   1419 C  CB  . GLU A 1 221 ? 3.291  6.563  38.196 1.00 33.78 ? 251 GLU A CB  1 
ATOM   1420 N  N   . LYS A 1 222 ? 4.593  8.294  40.466 1.00 33.60 ? 252 LYS A N   1 
ATOM   1421 C  CA  . LYS A 1 222 ? 5.562  8.298  41.574 1.00 34.05 ? 252 LYS A CA  1 
ATOM   1422 C  C   . LYS A 1 222 ? 6.652  7.229  41.410 1.00 33.62 ? 252 LYS A C   1 
ATOM   1423 O  O   . LYS A 1 222 ? 6.358  6.066  41.166 1.00 35.39 ? 252 LYS A O   1 
ATOM   1424 C  CB  . LYS A 1 222 ? 4.793  8.108  42.894 1.00 32.69 ? 252 LYS A CB  1 
ATOM   1425 C  CG  . LYS A 1 222 ? 5.612  7.737  44.146 1.00 35.69 ? 252 LYS A CG  1 
ATOM   1426 C  CD  . LYS A 1 222 ? 4.670  7.436  45.331 1.00 35.91 ? 252 LYS A CD  1 
ATOM   1427 C  CE  . LYS A 1 222 ? 5.394  6.819  46.521 1.00 38.45 ? 252 LYS A CE  1 
ATOM   1428 N  N   . GLY A 1 223 ? 7.912  7.634  41.519 1.00 34.31 ? 253 GLY A N   1 
ATOM   1429 C  CA  . GLY A 1 223 ? 9.043  6.721  41.336 1.00 33.44 ? 253 GLY A CA  1 
ATOM   1430 C  C   . GLY A 1 223 ? 9.534  6.603  39.907 1.00 34.07 ? 253 GLY A C   1 
ATOM   1431 O  O   . GLY A 1 223 ? 10.690 6.243  39.689 1.00 34.30 ? 253 GLY A O   1 
ATOM   1432 N  N   . ASP A 1 224 ? 8.671  6.886  38.923 1.00 34.33 ? 254 ASP A N   1 
ATOM   1433 C  CA  . ASP A 1 224 ? 9.092  6.873  37.521 1.00 34.30 ? 254 ASP A CA  1 
ATOM   1434 C  C   . ASP A 1 224 ? 10.216 7.886  37.338 1.00 33.07 ? 254 ASP A C   1 
ATOM   1435 O  O   . ASP A 1 224 ? 10.200 8.933  37.973 1.00 30.77 ? 254 ASP A O   1 
ATOM   1436 C  CB  . ASP A 1 224 ? 7.961  7.291  36.572 1.00 35.09 ? 254 ASP A CB  1 
ATOM   1437 C  CG  . ASP A 1 224 ? 6.848  6.283  36.464 1.00 37.17 ? 254 ASP A CG  1 
ATOM   1438 O  OD1 . ASP A 1 224 ? 6.939  5.150  37.003 1.00 48.36 ? 254 ASP A OD1 1 
ATOM   1439 O  OD2 . ASP A 1 224 ? 5.858  6.649  35.799 1.00 37.93 ? 254 ASP A OD2 1 
ATOM   1440 N  N   . THR A 1 225 ? 11.163 7.572  36.454 1.00 33.44 ? 255 THR A N   1 
ATOM   1441 C  CA  . THR A 1 225 ? 12.295 8.455  36.148 1.00 33.98 ? 255 THR A CA  1 
ATOM   1442 C  C   . THR A 1 225 ? 12.401 8.703  34.650 1.00 34.14 ? 255 THR A C   1 
ATOM   1443 O  O   . THR A 1 225 ? 12.254 7.769  33.837 1.00 34.32 ? 255 THR A O   1 
ATOM   1444 C  CB  . THR A 1 225 ? 13.651 7.834  36.555 1.00 33.64 ? 255 THR A CB  1 
ATOM   1445 O  OG1 . THR A 1 225 ? 13.565 7.246  37.860 1.00 34.86 ? 255 THR A OG1 1 
ATOM   1446 C  CG2 . THR A 1 225 ? 14.744 8.895  36.537 1.00 34.90 ? 255 THR A CG2 1 
ATOM   1447 N  N   . VAL A 1 226 ? 12.673 9.949  34.288 1.00 31.53 ? 256 VAL A N   1 
ATOM   1448 C  CA  . VAL A 1 226 ? 13.009 10.268 32.906 1.00 33.16 ? 256 VAL A CA  1 
ATOM   1449 C  C   . VAL A 1 226 ? 14.524 10.612 32.812 1.00 34.43 ? 256 VAL A C   1 
ATOM   1450 O  O   . VAL A 1 226 ? 15.096 11.256 33.709 1.00 34.42 ? 256 VAL A O   1 
ATOM   1451 C  CB  . VAL A 1 226 ? 12.063 11.377 32.339 1.00 32.46 ? 256 VAL A CB  1 
ATOM   1452 C  CG1 . VAL A 1 226 ? 12.153 12.642 33.148 1.00 31.03 ? 256 VAL A CG1 1 
ATOM   1453 C  CG2 . VAL A 1 226 ? 12.333 11.640 30.869 1.00 30.32 ? 256 VAL A CG2 1 
ATOM   1454 N  N   . PHE A 1 227 ? 15.161 10.095 31.762 1.00 34.37 ? 257 PHE A N   1 
ATOM   1455 C  CA  . PHE A 1 227 ? 16.556 10.386 31.416 1.00 33.27 ? 257 PHE A CA  1 
ATOM   1456 C  C   . PHE A 1 227 ? 16.517 11.209 30.150 1.00 33.91 ? 257 PHE A C   1 
ATOM   1457 O  O   . PHE A 1 227 ? 15.787 10.867 29.206 1.00 34.00 ? 257 PHE A O   1 
ATOM   1458 C  CB  . PHE A 1 227 ? 17.325 9.085  31.180 1.00 35.99 ? 257 PHE A CB  1 
ATOM   1459 C  CG  . PHE A 1 227 ? 17.390 8.211  32.406 1.00 34.78 ? 257 PHE A CG  1 
ATOM   1460 C  CD1 . PHE A 1 227 ? 16.404 7.299  32.664 1.00 31.23 ? 257 PHE A CD1 1 
ATOM   1461 C  CD2 . PHE A 1 227 ? 18.390 8.390  33.346 1.00 36.87 ? 257 PHE A CD2 1 
ATOM   1462 C  CE1 . PHE A 1 227 ? 16.438 6.551  33.807 1.00 40.21 ? 257 PHE A CE1 1 
ATOM   1463 C  CE2 . PHE A 1 227 ? 18.416 7.661  34.491 1.00 33.37 ? 257 PHE A CE2 1 
ATOM   1464 C  CZ  . PHE A 1 227 ? 17.453 6.736  34.725 1.00 38.69 ? 257 PHE A CZ  1 
ATOM   1465 N  N   . PHE A 1 228 ? 17.245 12.325 30.131 1.00 34.40 ? 258 PHE A N   1 
ATOM   1466 C  CA  . PHE A 1 228 ? 17.230 13.172 28.947 1.00 33.13 ? 258 PHE A CA  1 
ATOM   1467 C  C   . PHE A 1 228 ? 18.468 14.042 28.759 1.00 32.05 ? 258 PHE A C   1 
ATOM   1468 O  O   . PHE A 1 228 ? 19.194 14.337 29.711 1.00 34.31 ? 258 PHE A O   1 
ATOM   1469 C  CB  . PHE A 1 228 ? 15.910 13.941 28.844 1.00 32.79 ? 258 PHE A CB  1 
ATOM   1470 C  CG  . PHE A 1 228 ? 15.731 15.055 29.841 1.00 31.45 ? 258 PHE A CG  1 
ATOM   1471 C  CD1 . PHE A 1 228 ? 16.071 16.361 29.508 1.00 35.75 ? 258 PHE A CD1 1 
ATOM   1472 C  CD2 . PHE A 1 228 ? 15.114 14.831 31.047 1.00 35.54 ? 258 PHE A CD2 1 
ATOM   1473 C  CE1 . PHE A 1 228 ? 15.849 17.397 30.390 1.00 39.01 ? 258 PHE A CE1 1 
ATOM   1474 C  CE2 . PHE A 1 228 ? 14.886 15.871 31.940 1.00 34.67 ? 258 PHE A CE2 1 
ATOM   1475 C  CZ  . PHE A 1 228 ? 15.243 17.151 31.604 1.00 36.64 ? 258 PHE A CZ  1 
ATOM   1476 N  N   . HIS A 1 229 ? 18.687 14.400 27.496 1.00 32.20 ? 259 HIS A N   1 
ATOM   1477 C  CA  . HIS A 1 229 ? 19.893 15.074 26.969 1.00 32.58 ? 259 HIS A CA  1 
ATOM   1478 C  C   . HIS A 1 229 ? 19.842 16.577 27.242 1.00 31.30 ? 259 HIS A C   1 
ATOM   1479 O  O   . HIS A 1 229 ? 18.752 17.137 27.246 1.00 30.12 ? 259 HIS A O   1 
ATOM   1480 C  CB  . HIS A 1 229 ? 19.898 14.869 25.460 1.00 35.42 ? 259 HIS A CB  1 
ATOM   1481 C  CG  . HIS A 1 229 ? 21.163 15.267 24.777 1.00 34.49 ? 259 HIS A CG  1 
ATOM   1482 N  ND1 . HIS A 1 229 ? 21.456 16.573 24.451 1.00 36.81 ? 259 HIS A ND1 1 
ATOM   1483 C  CD2 . HIS A 1 229 ? 22.190 14.519 24.311 1.00 31.74 ? 259 HIS A CD2 1 
ATOM   1484 C  CE1 . HIS A 1 229 ? 22.636 16.616 23.856 1.00 43.29 ? 259 HIS A CE1 1 
ATOM   1485 N  NE2 . HIS A 1 229 ? 23.098 15.381 23.750 1.00 33.63 ? 259 HIS A NE2 1 
ATOM   1486 N  N   . PRO A 1 230 ? 21.005 17.230 27.487 1.00 31.08 ? 260 PRO A N   1 
ATOM   1487 C  CA  . PRO A 1 230 ? 21.108 18.663 27.823 1.00 31.39 ? 260 PRO A CA  1 
ATOM   1488 C  C   . PRO A 1 230 ? 20.714 19.637 26.757 1.00 30.55 ? 260 PRO A C   1 
ATOM   1489 O  O   . PRO A 1 230 ? 20.594 20.833 27.052 1.00 34.46 ? 260 PRO A O   1 
ATOM   1490 C  CB  . PRO A 1 230 ? 22.620 18.851 28.053 1.00 32.24 ? 260 PRO A CB  1 
ATOM   1491 C  CG  . PRO A 1 230 ? 23.125 17.491 28.317 1.00 30.71 ? 260 PRO A CG  1 
ATOM   1492 C  CD  . PRO A 1 230 ? 22.339 16.604 27.499 1.00 30.52 ? 260 PRO A CD  1 
ATOM   1493 N  N   . LEU A 1 231 ? 20.644 19.158 25.512 1.00 30.28 ? 261 LEU A N   1 
ATOM   1494 C  CA  . LEU A 1 231 ? 20.144 19.929 24.384 1.00 29.12 ? 261 LEU A CA  1 
ATOM   1495 C  C   . LEU A 1 231 ? 18.678 19.623 24.023 1.00 27.03 ? 261 LEU A C   1 
ATOM   1496 O  O   . LEU A 1 231 ? 18.114 20.234 23.094 1.00 25.84 ? 261 LEU A O   1 
ATOM   1497 C  CB  . LEU A 1 231 ? 21.058 19.716 23.168 1.00 30.79 ? 261 LEU A CB  1 
ATOM   1498 C  CG  . LEU A 1 231 ? 22.467 20.331 23.206 1.00 27.53 ? 261 LEU A CG  1 
ATOM   1499 C  CD1 . LEU A 1 231 ? 23.253 19.957 21.931 1.00 25.07 ? 261 LEU A CD1 1 
ATOM   1500 C  CD2 . LEU A 1 231 ? 22.409 21.832 23.372 1.00 26.81 ? 261 LEU A CD2 1 
ATOM   1501 N  N   . LEU A 1 232 ? 18.047 18.703 24.740 1.00 27.06 ? 262 LEU A N   1 
ATOM   1502 C  CA  . LEU A 1 232 ? 16.595 18.501 24.571 1.00 30.67 ? 262 LEU A CA  1 
ATOM   1503 C  C   . LEU A 1 232 ? 15.801 19.732 25.037 1.00 32.77 ? 262 LEU A C   1 
ATOM   1504 O  O   . LEU A 1 232 ? 15.929 20.174 26.180 1.00 30.62 ? 262 LEU A O   1 
ATOM   1505 C  CB  . LEU A 1 232 ? 16.096 17.282 25.340 1.00 29.80 ? 262 LEU A CB  1 
ATOM   1506 C  CG  . LEU A 1 232 ? 14.636 16.921 25.086 1.00 28.36 ? 262 LEU A CG  1 
ATOM   1507 C  CD1 . LEU A 1 232 ? 14.423 16.380 23.687 1.00 30.92 ? 262 LEU A CD1 1 
ATOM   1508 C  CD2 . LEU A 1 232 ? 14.155 15.933 26.126 1.00 36.35 ? 262 LEU A CD2 1 
ATOM   1509 N  N   . ILE A 1 233 ? 14.975 20.259 24.139 1.00 34.70 ? 263 ILE A N   1 
ATOM   1510 C  CA  . ILE A 1 233 ? 14.147 21.417 24.438 1.00 36.22 ? 263 ILE A CA  1 
ATOM   1511 C  C   . ILE A 1 233 ? 12.915 20.944 25.225 1.00 38.44 ? 263 ILE A C   1 
ATOM   1512 O  O   . ILE A 1 233 ? 12.164 20.058 24.785 1.00 39.36 ? 263 ILE A O   1 
ATOM   1513 C  CB  . ILE A 1 233 ? 13.777 22.219 23.155 1.00 34.87 ? 263 ILE A CB  1 
ATOM   1514 C  CG1 . ILE A 1 233 ? 15.057 22.625 22.413 1.00 32.72 ? 263 ILE A CG1 1 
ATOM   1515 C  CG2 . ILE A 1 233 ? 13.009 23.500 23.502 1.00 31.64 ? 263 ILE A CG2 1 
ATOM   1516 C  CD1 . ILE A 1 233 ? 14.841 23.169 21.007 1.00 34.55 ? 263 ILE A CD1 1 
ATOM   1517 N  N   . HIS A 1 234 ? 12.734 21.541 26.401 1.00 37.20 ? 264 HIS A N   1 
ATOM   1518 C  CA  . HIS A 1 234 ? 11.697 21.117 27.328 1.00 34.96 ? 264 HIS A CA  1 
ATOM   1519 C  C   . HIS A 1 234 ? 11.292 22.292 28.237 1.00 36.08 ? 264 HIS A C   1 
ATOM   1520 O  O   . HIS A 1 234 ? 11.918 23.390 28.204 1.00 35.89 ? 264 HIS A O   1 
ATOM   1521 C  CB  . HIS A 1 234 ? 12.197 19.930 28.171 1.00 32.68 ? 264 HIS A CB  1 
ATOM   1522 C  CG  . HIS A 1 234 ? 13.333 20.279 29.072 1.00 31.60 ? 264 HIS A CG  1 
ATOM   1523 N  ND1 . HIS A 1 234 ? 14.605 20.524 28.598 1.00 34.64 ? 264 HIS A ND1 1 
ATOM   1524 C  CD2 . HIS A 1 234 ? 13.380 20.498 30.406 1.00 32.17 ? 264 HIS A CD2 1 
ATOM   1525 C  CE1 . HIS A 1 234 ? 15.390 20.853 29.607 1.00 38.03 ? 264 HIS A CE1 1 
ATOM   1526 N  NE2 . HIS A 1 234 ? 14.672 20.849 30.714 1.00 31.46 ? 264 HIS A NE2 1 
ATOM   1527 N  N   . GLY A 1 235 ? 10.242 22.041 29.021 1.00 35.17 ? 265 GLY A N   1 
ATOM   1528 C  CA  . GLY A 1 235 ? 9.655  22.993 29.953 1.00 36.60 ? 265 GLY A CA  1 
ATOM   1529 C  C   . GLY A 1 235 ? 8.603  22.293 30.801 1.00 38.66 ? 265 GLY A C   1 
ATOM   1530 O  O   . GLY A 1 235 ? 8.264  21.153 30.555 1.00 41.95 ? 265 GLY A O   1 
ATOM   1531 N  N   . SER A 1 236 ? 8.095  22.964 31.822 1.00 41.36 ? 266 SER A N   1 
ATOM   1532 C  CA  . SER A 1 236 ? 7.022  22.429 32.649 1.00 41.20 ? 266 SER A CA  1 
ATOM   1533 C  C   . SER A 1 236 ? 5.740  23.147 32.316 1.00 41.37 ? 266 SER A C   1 
ATOM   1534 O  O   . SER A 1 236 ? 5.727  24.366 32.154 1.00 42.97 ? 266 SER A O   1 
ATOM   1535 C  CB  . SER A 1 236 ? 7.326  22.633 34.119 1.00 40.78 ? 266 SER A CB  1 
ATOM   1536 O  OG  . SER A 1 236 ? 8.374  21.791 34.507 1.00 45.77 ? 266 SER A OG  1 
ATOM   1537 N  N   . GLY A 1 237 ? 4.657  22.393 32.231 1.00 41.34 ? 267 GLY A N   1 
ATOM   1538 C  CA  . GLY A 1 237 ? 3.361  22.967 31.915 1.00 41.47 ? 267 GLY A CA  1 
ATOM   1539 C  C   . GLY A 1 237 ? 2.792  23.645 33.128 1.00 41.74 ? 267 GLY A C   1 
ATOM   1540 O  O   . GLY A 1 237 ? 3.414  23.667 34.187 1.00 42.40 ? 267 GLY A O   1 
ATOM   1541 N  N   . GLN A 1 238 ? 1.594  24.185 32.973 1.00 43.18 ? 268 GLN A N   1 
ATOM   1542 C  CA  . GLN A 1 238 ? 0.927  24.879 34.063 1.00 43.11 ? 268 GLN A CA  1 
ATOM   1543 C  C   . GLN A 1 238 ? 0.521  23.908 35.174 1.00 41.53 ? 268 GLN A C   1 
ATOM   1544 O  O   . GLN A 1 238 ? 0.043  22.820 34.903 1.00 40.75 ? 268 GLN A O   1 
ATOM   1545 C  CB  . GLN A 1 238 ? -0.298 25.641 33.538 1.00 43.36 ? 268 GLN A CB  1 
ATOM   1546 N  N   . ASN A 1 239 ? 0.750  24.304 36.421 1.00 41.44 ? 269 ASN A N   1 
ATOM   1547 C  CA  . ASN A 1 239 ? 0.225  23.593 37.574 1.00 40.67 ? 269 ASN A CA  1 
ATOM   1548 C  C   . ASN A 1 239 ? -1.122 24.232 37.949 1.00 41.61 ? 269 ASN A C   1 
ATOM   1549 O  O   . ASN A 1 239 ? -1.188 25.159 38.768 1.00 42.60 ? 269 ASN A O   1 
ATOM   1550 C  CB  . ASN A 1 239 ? 1.235  23.645 38.730 1.00 40.68 ? 269 ASN A CB  1 
ATOM   1551 C  CG  . ASN A 1 239 ? 0.741  22.939 39.989 1.00 38.55 ? 269 ASN A CG  1 
ATOM   1552 O  OD1 . ASN A 1 239 ? -0.369 22.416 40.022 1.00 34.38 ? 269 ASN A OD1 1 
ATOM   1553 N  ND2 . ASN A 1 239 ? 1.563  22.947 41.040 1.00 29.11 ? 269 ASN A ND2 1 
ATOM   1554 N  N   . LYS A 1 240 ? -2.192 23.721 37.331 1.00 41.02 ? 270 LYS A N   1 
ATOM   1555 C  CA  . LYS A 1 240 ? -3.571 24.216 37.548 1.00 40.19 ? 270 LYS A CA  1 
ATOM   1556 C  C   . LYS A 1 240 ? -4.286 23.532 38.721 1.00 38.65 ? 270 LYS A C   1 
ATOM   1557 O  O   . LYS A 1 240 ? -5.505 23.573 38.809 1.00 37.41 ? 270 LYS A O   1 
ATOM   1558 C  CB  . LYS A 1 240 ? -4.406 24.033 36.269 1.00 39.53 ? 270 LYS A CB  1 
ATOM   1559 N  N   . THR A 1 241 ? -3.521 22.880 39.594 1.00 38.05 ? 271 THR A N   1 
ATOM   1560 C  CA  . THR A 1 241 ? -4.043 22.293 40.813 1.00 36.73 ? 271 THR A CA  1 
ATOM   1561 C  C   . THR A 1 241 ? -3.669 23.225 41.962 1.00 37.68 ? 271 THR A C   1 
ATOM   1562 O  O   . THR A 1 241 ? -3.032 24.249 41.746 1.00 39.42 ? 271 THR A O   1 
ATOM   1563 C  CB  . THR A 1 241 ? -3.482 20.873 41.066 1.00 35.54 ? 271 THR A CB  1 
ATOM   1564 O  OG1 . THR A 1 241 ? -2.117 20.936 41.509 1.00 37.03 ? 271 THR A OG1 1 
ATOM   1565 C  CG2 . THR A 1 241 ? -3.555 20.042 39.807 1.00 38.91 ? 271 THR A CG2 1 
ATOM   1566 N  N   . GLN A 1 242 ? -4.076 22.868 43.176 1.00 38.57 ? 272 GLN A N   1 
ATOM   1567 C  CA  . GLN A 1 242 ? -3.789 23.658 44.365 1.00 37.28 ? 272 GLN A CA  1 
ATOM   1568 C  C   . GLN A 1 242 ? -2.605 23.105 45.135 1.00 37.91 ? 272 GLN A C   1 
ATOM   1569 O  O   . GLN A 1 242 ? -2.251 23.643 46.177 1.00 38.25 ? 272 GLN A O   1 
ATOM   1570 C  CB  . GLN A 1 242 ? -5.014 23.691 45.261 1.00 36.77 ? 272 GLN A CB  1 
ATOM   1571 C  CG  . GLN A 1 242 ? -6.246 24.190 44.544 1.00 34.51 ? 272 GLN A CG  1 
ATOM   1572 C  CD  . GLN A 1 242 ? -7.049 25.153 45.387 1.00 34.49 ? 272 GLN A CD  1 
ATOM   1573 O  OE1 . GLN A 1 242 ? -7.249 24.938 46.589 1.00 28.70 ? 272 GLN A OE1 1 
ATOM   1574 N  NE2 . GLN A 1 242 ? -7.506 26.238 44.763 1.00 31.21 ? 272 GLN A NE2 1 
ATOM   1575 N  N   . GLY A 1 243 ? -1.984 22.047 44.611 1.00 38.62 ? 273 GLY A N   1 
ATOM   1576 C  CA  . GLY A 1 243 ? -0.853 21.396 45.273 1.00 39.74 ? 273 GLY A CA  1 
ATOM   1577 C  C   . GLY A 1 243 ? 0.502  21.782 44.713 1.00 40.62 ? 273 GLY A C   1 
ATOM   1578 O  O   . GLY A 1 243 ? 0.615  22.221 43.560 1.00 43.85 ? 273 GLY A O   1 
ATOM   1579 N  N   . PHE A 1 244 ? 1.538  21.602 45.527 1.00 40.37 ? 274 PHE A N   1 
ATOM   1580 C  CA  . PHE A 1 244 ? 2.911  21.829 45.096 1.00 40.39 ? 274 PHE A CA  1 
ATOM   1581 C  C   . PHE A 1 244 ? 3.475  20.532 44.562 1.00 41.21 ? 274 PHE A C   1 
ATOM   1582 O  O   . PHE A 1 244 ? 3.426  19.503 45.229 1.00 45.04 ? 274 PHE A O   1 
ATOM   1583 C  CB  . PHE A 1 244 ? 3.764  22.338 46.246 1.00 40.02 ? 274 PHE A CB  1 
ATOM   1584 C  CG  . PHE A 1 244 ? 3.505  23.767 46.590 1.00 38.96 ? 274 PHE A CG  1 
ATOM   1585 C  CD1 . PHE A 1 244 ? 2.307  24.146 47.153 1.00 36.23 ? 274 PHE A CD1 1 
ATOM   1586 C  CD2 . PHE A 1 244 ? 4.463  24.735 46.358 1.00 40.28 ? 274 PHE A CD2 1 
ATOM   1587 C  CE1 . PHE A 1 244 ? 2.062  25.465 47.479 1.00 39.53 ? 274 PHE A CE1 1 
ATOM   1588 C  CE2 . PHE A 1 244 ? 4.221  26.063 46.683 1.00 39.01 ? 274 PHE A CE2 1 
ATOM   1589 C  CZ  . PHE A 1 244 ? 3.019  26.423 47.245 1.00 38.60 ? 274 PHE A CZ  1 
ATOM   1590 N  N   . ARG A 1 245 ? 4.022  20.586 43.362 1.00 40.80 ? 275 ARG A N   1 
ATOM   1591 C  CA  . ARG A 1 245 ? 4.344  19.386 42.601 1.00 40.88 ? 275 ARG A CA  1 
ATOM   1592 C  C   . ARG A 1 245 ? 5.862  19.111 42.663 1.00 39.81 ? 275 ARG A C   1 
ATOM   1593 O  O   . ARG A 1 245 ? 6.678  19.889 42.146 1.00 38.16 ? 275 ARG A O   1 
ATOM   1594 C  CB  . ARG A 1 245 ? 3.849  19.585 41.158 1.00 41.65 ? 275 ARG A CB  1 
ATOM   1595 C  CG  . ARG A 1 245 ? 3.824  18.354 40.300 1.00 43.54 ? 275 ARG A CG  1 
ATOM   1596 C  CD  . ARG A 1 245 ? 5.187  18.065 39.735 1.00 49.73 ? 275 ARG A CD  1 
ATOM   1597 N  NE  . ARG A 1 245 ? 5.558  18.940 38.628 1.00 52.59 ? 275 ARG A NE  1 
ATOM   1598 C  CZ  . ARG A 1 245 ? 6.787  19.417 38.417 1.00 51.73 ? 275 ARG A CZ  1 
ATOM   1599 N  NH1 . ARG A 1 245 ? 7.779  19.154 39.264 1.00 49.25 ? 275 ARG A NH1 1 
ATOM   1600 N  NH2 . ARG A 1 245 ? 7.030  20.187 37.359 1.00 52.02 ? 275 ARG A NH2 1 
ATOM   1601 N  N   . LYS A 1 246 ? 6.223  17.985 43.276 1.00 37.52 ? 276 LYS A N   1 
ATOM   1602 C  CA  . LYS A 1 246 ? 7.604  17.680 43.607 1.00 35.26 ? 276 LYS A CA  1 
ATOM   1603 C  C   . LYS A 1 246 ? 8.269  16.719 42.622 1.00 36.15 ? 276 LYS A C   1 
ATOM   1604 O  O   . LYS A 1 246 ? 7.708  15.674 42.241 1.00 36.24 ? 276 LYS A O   1 
ATOM   1605 C  CB  . LYS A 1 246 ? 7.672  17.081 45.024 1.00 35.04 ? 276 LYS A CB  1 
ATOM   1606 C  CG  . LYS A 1 246 ? 7.418  18.079 46.137 1.00 29.05 ? 276 LYS A CG  1 
ATOM   1607 C  CD  . LYS A 1 246 ? 6.943  17.365 47.398 1.00 34.21 ? 276 LYS A CD  1 
ATOM   1608 C  CE  . LYS A 1 246 ? 6.854  18.293 48.613 1.00 32.11 ? 276 LYS A CE  1 
ATOM   1609 N  NZ  . LYS A 1 246 ? 5.934  19.431 48.384 1.00 33.97 ? 276 LYS A NZ  1 
ATOM   1610 N  N   . ALA A 1 247 ? 9.478  17.075 42.217 1.00 34.44 ? 277 ALA A N   1 
ATOM   1611 C  CA  . ALA A 1 247 ? 10.346 16.153 41.508 1.00 34.14 ? 277 ALA A CA  1 
ATOM   1612 C  C   . ALA A 1 247 ? 11.750 16.375 42.034 1.00 34.32 ? 277 ALA A C   1 
ATOM   1613 O  O   . ALA A 1 247 ? 12.060 17.458 42.533 1.00 36.76 ? 277 ALA A O   1 
ATOM   1614 C  CB  . ALA A 1 247 ? 10.281 16.399 40.035 1.00 34.62 ? 277 ALA A CB  1 
ATOM   1615 N  N   . ILE A 1 248 ? 12.579 15.340 41.986 1.00 33.16 ? 278 ILE A N   1 
ATOM   1616 C  CA  . ILE A 1 248 ? 13.981 15.463 42.389 1.00 33.32 ? 278 ILE A CA  1 
ATOM   1617 C  C   . ILE A 1 248 ? 14.796 15.148 41.157 1.00 33.23 ? 278 ILE A C   1 
ATOM   1618 O  O   . ILE A 1 248 ? 14.370 14.351 40.318 1.00 33.24 ? 278 ILE A O   1 
ATOM   1619 C  CB  . ILE A 1 248 ? 14.353 14.558 43.643 1.00 34.39 ? 278 ILE A CB  1 
ATOM   1620 C  CG1 . ILE A 1 248 ? 15.763 14.876 44.148 1.00 33.99 ? 278 ILE A CG1 1 
ATOM   1621 C  CG2 . ILE A 1 248 ? 14.232 13.072 43.352 1.00 30.09 ? 278 ILE A CG2 1 
ATOM   1622 C  CD1 . ILE A 1 248 ? 16.055 14.353 45.564 1.00 31.85 ? 278 ILE A CD1 1 
ATOM   1623 N  N   . SER A 1 249 ? 15.932 15.816 40.996 1.00 35.53 ? 279 SER A N   1 
ATOM   1624 C  CA  . SER A 1 249 ? 16.748 15.571 39.818 1.00 36.56 ? 279 SER A CA  1 
ATOM   1625 C  C   . SER A 1 249 ? 18.217 15.877 39.981 1.00 35.85 ? 279 SER A C   1 
ATOM   1626 O  O   . SER A 1 249 ? 18.619 16.690 40.824 1.00 32.62 ? 279 SER A O   1 
ATOM   1627 C  CB  . SER A 1 249 ? 16.230 16.368 38.633 1.00 37.50 ? 279 SER A CB  1 
ATOM   1628 O  OG  . SER A 1 249 ? 16.756 17.673 38.679 1.00 38.88 ? 279 SER A OG  1 
ATOM   1629 N  N   . CYS A 1 250 ? 18.990 15.227 39.109 1.00 37.52 ? 280 CYS A N   1 
ATOM   1630 C  CA  . CYS A 1 250 ? 20.429 15.364 39.048 1.00 38.16 ? 280 CYS A CA  1 
ATOM   1631 C  C   . CYS A 1 250 ? 20.903 15.281 37.595 1.00 37.28 ? 280 CYS A C   1 
ATOM   1632 O  O   . CYS A 1 250 ? 20.396 14.476 36.828 1.00 36.46 ? 280 CYS A O   1 
ATOM   1633 C  CB  . CYS A 1 250 ? 21.087 14.245 39.856 1.00 39.43 ? 280 CYS A CB  1 
ATOM   1634 S  SG  . CYS A 1 250 ? 22.869 14.243 39.788 1.00 40.94 ? 280 CYS A SG  1 
ATOM   1635 N  N   . HIS A 1 251 ? 21.859 16.131 37.229 1.00 35.93 ? 281 HIS A N   1 
ATOM   1636 C  CA  . HIS A 1 251 ? 22.565 16.011 35.971 1.00 34.75 ? 281 HIS A CA  1 
ATOM   1637 C  C   . HIS A 1 251 ? 23.898 15.395 36.232 1.00 31.76 ? 281 HIS A C   1 
ATOM   1638 O  O   . HIS A 1 251 ? 24.671 15.906 37.040 1.00 26.07 ? 281 HIS A O   1 
ATOM   1639 C  CB  . HIS A 1 251 ? 22.815 17.378 35.349 1.00 38.14 ? 281 HIS A CB  1 
ATOM   1640 C  CG  . HIS A 1 251 ? 21.577 18.074 34.910 1.00 38.79 ? 281 HIS A CG  1 
ATOM   1641 N  ND1 . HIS A 1 251 ? 20.806 18.825 35.769 1.00 43.97 ? 281 HIS A ND1 1 
ATOM   1642 C  CD2 . HIS A 1 251 ? 20.978 18.141 33.701 1.00 35.72 ? 281 HIS A CD2 1 
ATOM   1643 C  CE1 . HIS A 1 251 ? 19.788 19.335 35.105 1.00 41.34 ? 281 HIS A CE1 1 
ATOM   1644 N  NE2 . HIS A 1 251 ? 19.865 18.928 33.848 1.00 44.61 ? 281 HIS A NE2 1 
ATOM   1645 N  N   . PHE A 1 252 ? 24.171 14.301 35.533 1.00 32.70 ? 282 PHE A N   1 
ATOM   1646 C  CA  . PHE A 1 252 ? 25.420 13.569 35.688 1.00 32.70 ? 282 PHE A CA  1 
ATOM   1647 C  C   . PHE A 1 252 ? 26.273 13.842 34.459 1.00 32.95 ? 282 PHE A C   1 
ATOM   1648 O  O   . PHE A 1 252 ? 25.741 14.137 33.391 1.00 31.05 ? 282 PHE A O   1 
ATOM   1649 C  CB  . PHE A 1 252 ? 25.135 12.080 35.771 1.00 32.96 ? 282 PHE A CB  1 
ATOM   1650 C  CG  . PHE A 1 252 ? 24.280 11.674 36.947 1.00 34.90 ? 282 PHE A CG  1 
ATOM   1651 C  CD1 . PHE A 1 252 ? 22.915 11.464 36.795 1.00 37.51 ? 282 PHE A CD1 1 
ATOM   1652 C  CD2 . PHE A 1 252 ? 24.856 11.436 38.197 1.00 38.37 ? 282 PHE A CD2 1 
ATOM   1653 C  CE1 . PHE A 1 252 ? 22.122 11.047 37.875 1.00 35.65 ? 282 PHE A CE1 1 
ATOM   1654 C  CE2 . PHE A 1 252 ? 24.074 11.026 39.276 1.00 37.56 ? 282 PHE A CE2 1 
ATOM   1655 C  CZ  . PHE A 1 252 ? 22.701 10.834 39.109 1.00 37.45 ? 282 PHE A CZ  1 
ATOM   1656 N  N   . ALA A 1 253 ? 27.586 13.734 34.592 1.00 32.89 ? 283 ALA A N   1 
ATOM   1657 C  CA  . ALA A 1 253 ? 28.477 13.874 33.443 1.00 33.08 ? 283 ALA A CA  1 
ATOM   1658 C  C   . ALA A 1 253 ? 29.677 12.952 33.598 1.00 35.75 ? 283 ALA A C   1 
ATOM   1659 O  O   . ALA A 1 253 ? 30.126 12.696 34.725 1.00 37.16 ? 283 ALA A O   1 
ATOM   1660 C  CB  . ALA A 1 253 ? 28.949 15.292 33.328 1.00 33.44 ? 283 ALA A CB  1 
ATOM   1661 N  N   . SER A 1 254 ? 30.201 12.459 32.474 1.00 35.44 ? 284 SER A N   1 
ATOM   1662 C  CA  . SER A 1 254 ? 31.415 11.649 32.494 1.00 33.78 ? 284 SER A CA  1 
ATOM   1663 C  C   . SER A 1 254 ? 32.542 12.488 33.064 1.00 32.24 ? 284 SER A C   1 
ATOM   1664 O  O   . SER A 1 254 ? 32.700 13.673 32.716 1.00 30.93 ? 284 SER A O   1 
ATOM   1665 C  CB  . SER A 1 254 ? 31.809 11.204 31.082 1.00 35.69 ? 284 SER A CB  1 
ATOM   1666 O  OG  . SER A 1 254 ? 33.002 10.416 31.117 1.00 35.47 ? 284 SER A OG  1 
ATOM   1667 N  N   . ALA A 1 255 ? 33.335 11.865 33.921 1.00 30.09 ? 285 ALA A N   1 
ATOM   1668 C  CA  . ALA A 1 255 ? 34.472 12.523 34.542 1.00 29.53 ? 285 ALA A CA  1 
ATOM   1669 C  C   . ALA A 1 255 ? 35.483 12.946 33.515 1.00 30.45 ? 285 ALA A C   1 
ATOM   1670 O  O   . ALA A 1 255 ? 36.294 13.828 33.784 1.00 31.79 ? 285 ALA A O   1 
ATOM   1671 C  CB  . ALA A 1 255 ? 35.125 11.615 35.551 1.00 29.34 ? 285 ALA A CB  1 
ATOM   1672 N  N   . ASP A 1 256 ? 35.440 12.309 32.343 1.00 31.38 ? 286 ASP A N   1 
ATOM   1673 C  CA  . ASP A 1 256 ? 36.353 12.627 31.246 1.00 30.86 ? 286 ASP A CA  1 
ATOM   1674 C  C   . ASP A 1 256 ? 36.010 13.925 30.541 1.00 29.40 ? 286 ASP A C   1 
ATOM   1675 O  O   . ASP A 1 256 ? 36.788 14.376 29.715 1.00 31.49 ? 286 ASP A O   1 
ATOM   1676 C  CB  . ASP A 1 256 ? 36.364 11.490 30.219 1.00 31.33 ? 286 ASP A CB  1 
ATOM   1677 C  CG  . ASP A 1 256 ? 36.845 10.191 30.806 1.00 35.95 ? 286 ASP A CG  1 
ATOM   1678 O  OD1 . ASP A 1 256 ? 37.357 10.205 31.950 1.00 46.79 ? 286 ASP A OD1 1 
ATOM   1679 O  OD2 . ASP A 1 256 ? 36.697 9.151  30.142 1.00 40.09 ? 286 ASP A OD2 1 
ATOM   1680 N  N   . CYS A 1 257 ? 34.849 14.506 30.845 1.00 29.60 ? 287 CYS A N   1 
ATOM   1681 C  CA  . CYS A 1 257 ? 34.395 15.765 30.237 1.00 29.17 ? 287 CYS A CA  1 
ATOM   1682 C  C   . CYS A 1 257 ? 35.394 16.865 30.577 1.00 28.24 ? 287 CYS A C   1 
ATOM   1683 O  O   . CYS A 1 257 ? 36.313 16.628 31.358 1.00 28.05 ? 287 CYS A O   1 
ATOM   1684 C  CB  . CYS A 1 257 ? 33.006 16.157 30.772 1.00 29.32 ? 287 CYS A CB  1 
ATOM   1685 S  SG  . CYS A 1 257 ? 31.576 15.207 30.127 1.00 33.16 ? 287 CYS A SG  1 
ATOM   1686 N  N   . HIS A 1 258 ? 35.209 18.054 30.001 1.00 27.16 ? 288 HIS A N   1 
ATOM   1687 C  CA  . HIS A 1 258 ? 36.073 19.199 30.271 1.00 27.00 ? 288 HIS A CA  1 
ATOM   1688 C  C   . HIS A 1 258 ? 35.293 20.493 30.363 1.00 27.35 ? 288 HIS A C   1 
ATOM   1689 O  O   . HIS A 1 258 ? 34.164 20.548 29.962 1.00 26.85 ? 288 HIS A O   1 
ATOM   1690 C  CB  . HIS A 1 258 ? 37.148 19.340 29.200 1.00 27.32 ? 288 HIS A CB  1 
ATOM   1691 C  CG  . HIS A 1 258 ? 36.618 19.381 27.807 1.00 27.68 ? 288 HIS A CG  1 
ATOM   1692 N  ND1 . HIS A 1 258 ? 36.552 18.264 27.007 1.00 33.23 ? 288 HIS A ND1 1 
ATOM   1693 C  CD2 . HIS A 1 258 ? 36.151 20.407 27.060 1.00 36.21 ? 288 HIS A CD2 1 
ATOM   1694 C  CE1 . HIS A 1 258 ? 36.059 18.597 25.828 1.00 28.03 ? 288 HIS A CE1 1 
ATOM   1695 N  NE2 . HIS A 1 258 ? 35.809 19.892 25.833 1.00 31.51 ? 288 HIS A NE2 1 
ATOM   1696 N  N   . TYR A 1 259 ? 35.928 21.531 30.895 1.00 29.49 ? 289 TYR A N   1 
ATOM   1697 C  CA  . TYR A 1 259 ? 35.294 22.812 31.098 1.00 30.13 ? 289 TYR A CA  1 
ATOM   1698 C  C   . TYR A 1 259 ? 35.633 23.765 29.978 1.00 29.99 ? 289 TYR A C   1 
ATOM   1699 O  O   . TYR A 1 259 ? 36.790 23.882 29.590 1.00 30.18 ? 289 TYR A O   1 
ATOM   1700 C  CB  . TYR A 1 259 ? 35.732 23.427 32.415 1.00 31.90 ? 289 TYR A CB  1 
ATOM   1701 C  CG  . TYR A 1 259 ? 35.293 22.648 33.636 1.00 37.19 ? 289 TYR A CG  1 
ATOM   1702 C  CD1 . TYR A 1 259 ? 36.191 21.835 34.305 1.00 29.97 ? 289 TYR A CD1 1 
ATOM   1703 C  CD2 . TYR A 1 259 ? 33.984 22.742 34.134 1.00 28.59 ? 289 TYR A CD2 1 
ATOM   1704 C  CE1 . TYR A 1 259 ? 35.816 21.128 35.419 1.00 36.23 ? 289 TYR A CE1 1 
ATOM   1705 C  CE2 . TYR A 1 259 ? 33.607 22.025 35.258 1.00 32.66 ? 289 TYR A CE2 1 
ATOM   1706 C  CZ  . TYR A 1 259 ? 34.531 21.219 35.901 1.00 34.06 ? 289 TYR A CZ  1 
ATOM   1707 O  OH  . TYR A 1 259 ? 34.209 20.463 37.031 1.00 40.11 ? 289 TYR A OH  1 
ATOM   1708 N  N   . ILE A 1 260 ? 34.621 24.465 29.468 1.00 30.48 ? 290 ILE A N   1 
ATOM   1709 C  CA  . ILE A 1 260 ? 34.831 25.396 28.359 1.00 30.67 ? 290 ILE A CA  1 
ATOM   1710 C  C   . ILE A 1 260 ? 34.760 26.844 28.847 1.00 29.57 ? 290 ILE A C   1 
ATOM   1711 O  O   . ILE A 1 260 ? 34.129 27.121 29.855 1.00 27.30 ? 290 ILE A O   1 
ATOM   1712 C  CB  . ILE A 1 260 ? 33.843 25.136 27.196 1.00 29.39 ? 290 ILE A CB  1 
ATOM   1713 C  CG1 . ILE A 1 260 ? 32.391 25.320 27.636 1.00 31.41 ? 290 ILE A CG1 1 
ATOM   1714 C  CG2 . ILE A 1 260 ? 34.040 23.701 26.621 1.00 31.85 ? 290 ILE A CG2 1 
ATOM   1715 C  CD1 . ILE A 1 260 ? 31.451 25.570 26.424 1.00 30.96 ? 290 ILE A CD1 1 
ATOM   1716 N  N   . ASP A 1 261 ? 35.476 27.738 28.164 1.00 30.93 ? 291 ASP A N   1 
ATOM   1717 C  CA  . ASP A 1 261 ? 35.334 29.173 28.364 1.00 31.87 ? 291 ASP A CA  1 
ATOM   1718 C  C   . ASP A 1 261 ? 34.066 29.605 27.610 1.00 32.26 ? 291 ASP A C   1 
ATOM   1719 O  O   . ASP A 1 261 ? 33.936 29.324 26.421 1.00 33.38 ? 291 ASP A O   1 
ATOM   1720 C  CB  . ASP A 1 261 ? 36.575 29.892 27.820 1.00 31.46 ? 291 ASP A CB  1 
ATOM   1721 C  CG  . ASP A 1 261 ? 36.596 31.388 28.130 1.00 33.28 ? 291 ASP A CG  1 
ATOM   1722 O  OD1 . ASP A 1 261 ? 36.615 31.769 29.313 1.00 36.94 ? 291 ASP A OD1 1 
ATOM   1723 O  OD2 . ASP A 1 261 ? 36.643 32.189 27.174 1.00 47.93 ? 291 ASP A OD2 1 
ATOM   1724 N  N   . VAL A 1 262 ? 33.132 30.247 28.310 1.00 32.31 ? 292 VAL A N   1 
ATOM   1725 C  CA  . VAL A 1 262 ? 31.894 30.796 27.703 1.00 31.87 ? 292 VAL A CA  1 
ATOM   1726 C  C   . VAL A 1 262 ? 31.971 32.292 27.252 1.00 31.56 ? 292 VAL A C   1 
ATOM   1727 O  O   . VAL A 1 262 ? 30.969 32.848 26.791 1.00 32.16 ? 292 VAL A O   1 
ATOM   1728 C  CB  . VAL A 1 262 ? 30.703 30.673 28.668 1.00 30.88 ? 292 VAL A CB  1 
ATOM   1729 C  CG1 . VAL A 1 262 ? 30.575 29.255 29.226 1.00 30.80 ? 292 VAL A CG1 1 
ATOM   1730 C  CG2 . VAL A 1 262 ? 30.841 31.676 29.816 1.00 33.51 ? 292 VAL A CG2 1 
ATOM   1731 N  N   . LYS A 1 263 ? 33.122 32.947 27.384 1.00 29.91 ? 293 LYS A N   1 
ATOM   1732 C  CA  . LYS A 1 263 ? 33.242 34.348 26.909 1.00 31.27 ? 293 LYS A CA  1 
ATOM   1733 C  C   . LYS A 1 263 ? 33.103 34.366 25.401 1.00 30.90 ? 293 LYS A C   1 
ATOM   1734 O  O   . LYS A 1 263 ? 33.701 33.521 24.714 1.00 31.71 ? 293 LYS A O   1 
ATOM   1735 C  CB  . LYS A 1 263 ? 34.593 34.991 27.284 1.00 29.87 ? 293 LYS A CB  1 
ATOM   1736 N  N   . GLY A 1 264 ? 32.305 35.307 24.897 1.00 30.02 ? 294 GLY A N   1 
ATOM   1737 C  CA  . GLY A 1 264 ? 32.055 35.443 23.464 1.00 28.18 ? 294 GLY A CA  1 
ATOM   1738 C  C   . GLY A 1 264 ? 31.097 34.407 22.892 1.00 30.85 ? 294 GLY A C   1 
ATOM   1739 O  O   . GLY A 1 264 ? 30.976 34.307 21.674 1.00 32.72 ? 294 GLY A O   1 
ATOM   1740 N  N   . THR A 1 265 ? 30.420 33.626 23.739 1.00 29.05 ? 295 THR A N   1 
ATOM   1741 C  CA  . THR A 1 265 ? 29.444 32.646 23.246 1.00 31.43 ? 295 THR A CA  1 
ATOM   1742 C  C   . THR A 1 265 ? 28.029 32.970 23.708 1.00 32.13 ? 295 THR A C   1 
ATOM   1743 O  O   . THR A 1 265 ? 27.819 33.928 24.468 1.00 31.98 ? 295 THR A O   1 
ATOM   1744 C  CB  . THR A 1 265 ? 29.795 31.199 23.675 1.00 30.52 ? 295 THR A CB  1 
ATOM   1745 O  OG1 . THR A 1 265 ? 29.572 31.029 25.094 1.00 27.71 ? 295 THR A OG1 1 
ATOM   1746 C  CG2 . THR A 1 265 ? 31.252 30.905 23.348 1.00 29.02 ? 295 THR A CG2 1 
ATOM   1747 N  N   . SER A 1 266 ? 27.061 32.156 23.271 1.00 31.08 ? 296 SER A N   1 
ATOM   1748 C  CA  . SER A 1 266 ? 25.678 32.335 23.721 1.00 30.23 ? 296 SER A CA  1 
ATOM   1749 C  C   . SER A 1 266 ? 25.633 32.242 25.244 1.00 30.97 ? 296 SER A C   1 
ATOM   1750 O  O   . SER A 1 266 ? 24.841 32.920 25.874 1.00 30.21 ? 296 SER A O   1 
ATOM   1751 C  CB  . SER A 1 266 ? 24.721 31.313 23.083 1.00 30.15 ? 296 SER A CB  1 
ATOM   1752 O  OG  . SER A 1 266 ? 25.060 29.978 23.399 1.00 25.56 ? 296 SER A OG  1 
ATOM   1753 N  N   . GLN A 1 267 ? 26.534 31.434 25.821 1.00 30.68 ? 297 GLN A N   1 
ATOM   1754 C  CA  . GLN A 1 267 ? 26.580 31.190 27.266 1.00 27.53 ? 297 GLN A CA  1 
ATOM   1755 C  C   . GLN A 1 267 ? 27.242 32.275 28.105 1.00 28.65 ? 297 GLN A C   1 
ATOM   1756 O  O   . GLN A 1 267 ? 27.281 32.144 29.338 1.00 24.42 ? 297 GLN A O   1 
ATOM   1757 C  CB  . GLN A 1 267 ? 27.287 29.868 27.542 1.00 25.93 ? 297 GLN A CB  1 
ATOM   1758 C  CG  . GLN A 1 267 ? 26.439 28.652 27.243 1.00 26.90 ? 297 GLN A CG  1 
ATOM   1759 C  CD  . GLN A 1 267 ? 27.150 27.379 27.560 1.00 25.58 ? 297 GLN A CD  1 
ATOM   1760 O  OE1 . GLN A 1 267 ? 27.988 26.934 26.783 1.00 32.39 ? 297 GLN A OE1 1 
ATOM   1761 N  NE2 . GLN A 1 267 ? 26.865 26.798 28.728 1.00 23.25 ? 297 GLN A NE2 1 
ATOM   1762 N  N   . GLU A 1 268 ? 27.749 33.348 27.478 1.00 31.19 ? 298 GLU A N   1 
ATOM   1763 C  CA  . GLU A 1 268 ? 28.460 34.380 28.247 1.00 32.40 ? 298 GLU A CA  1 
ATOM   1764 C  C   . GLU A 1 268 ? 27.696 34.728 29.521 1.00 35.93 ? 298 GLU A C   1 
ATOM   1765 O  O   . GLU A 1 268 ? 28.293 34.821 30.601 1.00 39.17 ? 298 GLU A O   1 
ATOM   1766 C  CB  . GLU A 1 268 ? 28.705 35.655 27.437 1.00 33.11 ? 298 GLU A CB  1 
ATOM   1767 C  CG  . GLU A 1 268 ? 29.694 36.613 28.124 1.00 32.79 ? 298 GLU A CG  1 
ATOM   1768 C  CD  . GLU A 1 268 ? 30.233 37.711 27.216 1.00 29.76 ? 298 GLU A CD  1 
ATOM   1769 O  OE1 . GLU A 1 268 ? 29.439 38.372 26.522 1.00 34.21 ? 298 GLU A OE1 1 
ATOM   1770 O  OE2 . GLU A 1 268 ? 31.454 37.933 27.203 1.00 24.56 ? 298 GLU A OE2 1 
ATOM   1771 N  N   . ASN A 1 269 ? 26.379 34.893 29.399 1.00 36.57 ? 299 ASN A N   1 
ATOM   1772 C  CA  . ASN A 1 269 ? 25.569 35.472 30.477 1.00 39.01 ? 299 ASN A CA  1 
ATOM   1773 C  C   . ASN A 1 269 ? 25.614 34.727 31.814 1.00 40.25 ? 299 ASN A C   1 
ATOM   1774 O  O   . ASN A 1 269 ? 25.569 35.357 32.875 1.00 38.53 ? 299 ASN A O   1 
ATOM   1775 C  CB  . ASN A 1 269 ? 24.106 35.641 30.018 1.00 40.41 ? 299 ASN A CB  1 
ATOM   1776 C  CG  . ASN A 1 269 ? 23.799 37.047 29.496 1.00 43.62 ? 299 ASN A CG  1 
ATOM   1777 O  OD1 . ASN A 1 269 ? 24.698 37.853 29.233 1.00 50.10 ? 299 ASN A OD1 1 
ATOM   1778 N  ND2 . ASN A 1 269 ? 22.509 37.340 29.344 1.00 51.47 ? 299 ASN A ND2 1 
ATOM   1779 N  N   . ILE A 1 270 ? 25.696 33.393 31.759 1.00 43.52 ? 300 ILE A N   1 
ATOM   1780 C  CA  . ILE A 1 270 ? 25.673 32.561 32.970 1.00 43.74 ? 300 ILE A CA  1 
ATOM   1781 C  C   . ILE A 1 270 ? 26.726 32.997 34.012 1.00 46.60 ? 300 ILE A C   1 
ATOM   1782 O  O   . ILE A 1 270 ? 26.411 33.061 35.195 1.00 48.77 ? 300 ILE A O   1 
ATOM   1783 C  CB  . ILE A 1 270 ? 25.785 31.044 32.661 1.00 41.81 ? 300 ILE A CB  1 
ATOM   1784 C  CG1 . ILE A 1 270 ? 27.214 30.647 32.298 1.00 44.20 ? 300 ILE A CG1 1 
ATOM   1785 C  CG2 . ILE A 1 270 ? 24.808 30.641 31.562 1.00 41.46 ? 300 ILE A CG2 1 
ATOM   1786 C  CD1 . ILE A 1 270 ? 27.381 29.195 31.966 1.00 43.33 ? 300 ILE A CD1 1 
ATOM   1787 N  N   . GLU A 1 271 ? 27.941 33.352 33.587 1.00 47.82 ? 301 GLU A N   1 
ATOM   1788 C  CA  . GLU A 1 271 ? 28.951 33.883 34.530 1.00 49.57 ? 301 GLU A CA  1 
ATOM   1789 C  C   . GLU A 1 271 ? 28.376 34.915 35.528 1.00 50.67 ? 301 GLU A C   1 
ATOM   1790 O  O   . GLU A 1 271 ? 28.768 34.943 36.696 1.00 51.23 ? 301 GLU A O   1 
ATOM   1791 C  CB  . GLU A 1 271 ? 30.137 34.482 33.775 1.00 49.13 ? 301 GLU A CB  1 
ATOM   1792 N  N   . LYS A 1 272 ? 27.450 35.750 35.055 1.00 52.57 ? 302 LYS A N   1 
ATOM   1793 C  CA  . LYS A 1 272 ? 26.673 36.666 35.897 1.00 52.69 ? 302 LYS A CA  1 
ATOM   1794 C  C   . LYS A 1 272 ? 27.555 37.724 36.528 1.00 52.94 ? 302 LYS A C   1 
ATOM   1795 O  O   . LYS A 1 272 ? 27.488 38.890 36.151 1.00 54.52 ? 302 LYS A O   1 
ATOM   1796 C  CB  . LYS A 1 272 ? 25.895 35.895 36.975 1.00 52.73 ? 302 LYS A CB  1 
ATOM   1797 N  N   . ASN A 1 289 ? 36.654 31.778 39.540 1.00 39.21 ? 319 ASN A N   1 
ATOM   1798 C  CA  . ASN A 1 289 ? 36.133 31.621 38.185 1.00 40.09 ? 319 ASN A CA  1 
ATOM   1799 C  C   . ASN A 1 289 ? 35.176 30.414 38.044 1.00 40.16 ? 319 ASN A C   1 
ATOM   1800 O  O   . ASN A 1 289 ? 35.080 29.571 38.937 1.00 39.93 ? 319 ASN A O   1 
ATOM   1801 C  CB  . ASN A 1 289 ? 37.285 31.583 37.153 1.00 39.50 ? 319 ASN A CB  1 
ATOM   1802 C  CG  . ASN A 1 289 ? 38.064 30.262 37.157 1.00 38.51 ? 319 ASN A CG  1 
ATOM   1803 O  OD1 . ASN A 1 289 ? 37.506 29.185 37.386 1.00 42.49 ? 319 ASN A OD1 1 
ATOM   1804 N  ND2 . ASN A 1 289 ? 39.355 30.344 36.864 1.00 26.63 ? 319 ASN A ND2 1 
ATOM   1805 N  N   . LEU A 1 290 ? 34.478 30.347 36.916 1.00 40.24 ? 320 LEU A N   1 
ATOM   1806 C  CA  . LEU A 1 290 ? 33.333 29.459 36.766 1.00 41.89 ? 320 LEU A CA  1 
ATOM   1807 C  C   . LEU A 1 290 ? 33.745 27.988 36.849 1.00 43.48 ? 320 LEU A C   1 
ATOM   1808 O  O   . LEU A 1 290 ? 33.054 27.170 37.454 1.00 45.94 ? 320 LEU A O   1 
ATOM   1809 C  CB  . LEU A 1 290 ? 32.613 29.761 35.447 1.00 41.45 ? 320 LEU A CB  1 
ATOM   1810 C  CG  . LEU A 1 290 ? 31.179 29.256 35.234 1.00 44.53 ? 320 LEU A CG  1 
ATOM   1811 C  CD1 . LEU A 1 290 ? 30.271 29.585 36.394 1.00 41.91 ? 320 LEU A CD1 1 
ATOM   1812 C  CD2 . LEU A 1 290 ? 30.610 29.843 33.957 1.00 44.31 ? 320 LEU A CD2 1 
ATOM   1813 N  N   . LYS A 1 291 ? 34.893 27.664 36.264 1.00 45.44 ? 321 LYS A N   1 
ATOM   1814 C  CA  . LYS A 1 291 ? 35.466 26.317 36.336 1.00 45.59 ? 321 LYS A CA  1 
ATOM   1815 C  C   . LYS A 1 291 ? 35.527 25.833 37.783 1.00 42.98 ? 321 LYS A C   1 
ATOM   1816 O  O   . LYS A 1 291 ? 35.230 24.681 38.070 1.00 43.46 ? 321 LYS A O   1 
ATOM   1817 C  CB  . LYS A 1 291 ? 36.863 26.321 35.692 1.00 45.42 ? 321 LYS A CB  1 
ATOM   1818 C  CG  . LYS A 1 291 ? 37.643 24.992 35.746 1.00 49.97 ? 321 LYS A CG  1 
ATOM   1819 C  CD  . LYS A 1 291 ? 39.088 25.167 35.215 1.00 47.92 ? 321 LYS A CD  1 
ATOM   1820 C  CE  . LYS A 1 291 ? 40.007 25.936 36.186 1.00 53.76 ? 321 LYS A CE  1 
ATOM   1821 N  NZ  . LYS A 1 291 ? 41.024 25.058 36.864 1.00 56.33 ? 321 LYS A NZ  1 
ATOM   1822 N  N   . ASP A 1 292 ? 35.869 26.733 38.693 1.00 41.45 ? 322 ASP A N   1 
ATOM   1823 C  CA  . ASP A 1 292 ? 36.109 26.360 40.087 1.00 41.11 ? 322 ASP A CA  1 
ATOM   1824 C  C   . ASP A 1 292 ? 34.828 26.123 40.901 1.00 39.78 ? 322 ASP A C   1 
ATOM   1825 O  O   . ASP A 1 292 ? 34.771 25.217 41.730 1.00 39.58 ? 322 ASP A O   1 
ATOM   1826 C  CB  . ASP A 1 292 ? 36.975 27.432 40.756 1.00 41.51 ? 322 ASP A CB  1 
ATOM   1827 C  CG  . ASP A 1 292 ? 38.350 27.576 40.098 1.00 40.84 ? 322 ASP A CG  1 
ATOM   1828 O  OD1 . ASP A 1 292 ? 38.954 26.551 39.711 1.00 41.95 ? 322 ASP A OD1 1 
ATOM   1829 O  OD2 . ASP A 1 292 ? 38.821 28.722 39.969 1.00 40.19 ? 322 ASP A OD2 1 
ATOM   1830 N  N   . ILE A 1 293 ? 33.813 26.943 40.664 1.00 37.77 ? 323 ILE A N   1 
ATOM   1831 C  CA  . ILE A 1 293 ? 32.521 26.785 41.311 1.00 36.75 ? 323 ILE A CA  1 
ATOM   1832 C  C   . ILE A 1 293 ? 31.897 25.455 40.926 1.00 36.25 ? 323 ILE A C   1 
ATOM   1833 O  O   . ILE A 1 293 ? 31.283 24.768 41.746 1.00 37.26 ? 323 ILE A O   1 
ATOM   1834 C  CB  . ILE A 1 293 ? 31.595 27.949 40.904 1.00 37.98 ? 323 ILE A CB  1 
ATOM   1835 C  CG1 . ILE A 1 293 ? 32.119 29.241 41.551 1.00 35.17 ? 323 ILE A CG1 1 
ATOM   1836 C  CG2 . ILE A 1 293 ? 30.124 27.689 41.287 1.00 33.67 ? 323 ILE A CG2 1 
ATOM   1837 C  CD1 . ILE A 1 293 ? 32.262 30.389 40.582 1.00 32.61 ? 323 ILE A CD1 1 
ATOM   1838 N  N   . TRP A 1 294 ? 32.051 25.092 39.668 1.00 34.64 ? 324 TRP A N   1 
ATOM   1839 C  CA  . TRP A 1 294 ? 31.560 23.811 39.203 1.00 35.41 ? 324 TRP A CA  1 
ATOM   1840 C  C   . TRP A 1 294 ? 32.462 22.662 39.684 1.00 35.64 ? 324 TRP A C   1 
ATOM   1841 O  O   . TRP A 1 294 ? 31.989 21.559 39.974 1.00 34.54 ? 324 TRP A O   1 
ATOM   1842 C  CB  . TRP A 1 294 ? 31.447 23.831 37.681 1.00 34.82 ? 324 TRP A CB  1 
ATOM   1843 C  CG  . TRP A 1 294 ? 30.198 24.508 37.214 1.00 36.84 ? 324 TRP A CG  1 
ATOM   1844 C  CD1 . TRP A 1 294 ? 30.073 25.788 36.752 1.00 35.71 ? 324 TRP A CD1 1 
ATOM   1845 C  CD2 . TRP A 1 294 ? 28.887 23.927 37.156 1.00 29.68 ? 324 TRP A CD2 1 
ATOM   1846 N  NE1 . TRP A 1 294 ? 28.766 26.030 36.404 1.00 38.30 ? 324 TRP A NE1 1 
ATOM   1847 C  CE2 . TRP A 1 294 ? 28.023 24.900 36.643 1.00 33.80 ? 324 TRP A CE2 1 
ATOM   1848 C  CE3 . TRP A 1 294 ? 28.372 22.667 37.472 1.00 34.38 ? 324 TRP A CE3 1 
ATOM   1849 C  CZ2 . TRP A 1 294 ? 26.664 24.665 36.464 1.00 31.07 ? 324 TRP A CZ2 1 
ATOM   1850 C  CZ3 . TRP A 1 294 ? 27.040 22.432 37.292 1.00 33.61 ? 324 TRP A CZ3 1 
ATOM   1851 C  CH2 . TRP A 1 294 ? 26.194 23.431 36.791 1.00 34.19 ? 324 TRP A CH2 1 
ATOM   1852 N  N   . MET A 1 295 ? 33.766 22.919 39.762 1.00 35.85 ? 325 MET A N   1 
ATOM   1853 C  CA  . MET A 1 295 ? 34.679 21.949 40.345 1.00 36.32 ? 325 MET A CA  1 
ATOM   1854 C  C   . MET A 1 295 ? 34.409 21.743 41.841 1.00 36.16 ? 325 MET A C   1 
ATOM   1855 O  O   . MET A 1 295 ? 34.368 20.607 42.296 1.00 37.34 ? 325 MET A O   1 
ATOM   1856 C  CB  . MET A 1 295 ? 36.117 22.370 40.114 1.00 36.95 ? 325 MET A CB  1 
ATOM   1857 C  CG  . MET A 1 295 ? 36.645 21.990 38.741 1.00 36.76 ? 325 MET A CG  1 
ATOM   1858 S  SD  . MET A 1 295 ? 38.416 22.298 38.690 1.00 38.70 ? 325 MET A SD  1 
ATOM   1859 C  CE  . MET A 1 295 ? 39.074 20.759 39.371 1.00 32.20 ? 325 MET A CE  1 
ATOM   1860 N  N   . PHE A 1 296 ? 34.195 22.822 42.593 1.00 35.74 ? 326 PHE A N   1 
ATOM   1861 C  CA  . PHE A 1 296 ? 33.869 22.697 44.012 1.00 38.48 ? 326 PHE A CA  1 
ATOM   1862 C  C   . PHE A 1 296 ? 32.546 21.980 44.255 1.00 39.55 ? 326 PHE A C   1 
ATOM   1863 O  O   . PHE A 1 296 ? 32.367 21.350 45.294 1.00 40.76 ? 326 PHE A O   1 
ATOM   1864 C  CB  . PHE A 1 296 ? 33.853 24.067 44.703 1.00 39.85 ? 326 PHE A CB  1 
ATOM   1865 C  CG  . PHE A 1 296 ? 35.224 24.543 45.155 1.00 43.58 ? 326 PHE A CG  1 
ATOM   1866 C  CD1 . PHE A 1 296 ? 35.796 25.700 44.620 1.00 47.00 ? 326 PHE A CD1 1 
ATOM   1867 C  CD2 . PHE A 1 296 ? 35.940 23.838 46.126 1.00 43.07 ? 326 PHE A CD2 1 
ATOM   1868 C  CE1 . PHE A 1 296 ? 37.059 26.142 45.047 1.00 46.18 ? 326 PHE A CE1 1 
ATOM   1869 C  CE2 . PHE A 1 296 ? 37.196 24.275 46.552 1.00 41.98 ? 326 PHE A CE2 1 
ATOM   1870 C  CZ  . PHE A 1 296 ? 37.753 25.429 46.016 1.00 42.35 ? 326 PHE A CZ  1 
ATOM   1871 N  N   . ARG A 1 297 ? 31.630 22.083 43.295 1.00 40.31 ? 327 ARG A N   1 
ATOM   1872 C  CA  . ARG A 1 297 ? 30.298 21.498 43.393 1.00 40.60 ? 327 ARG A CA  1 
ATOM   1873 C  C   . ARG A 1 297 ? 30.289 20.011 42.993 1.00 40.70 ? 327 ARG A C   1 
ATOM   1874 O  O   . ARG A 1 297 ? 29.514 19.215 43.548 1.00 40.05 ? 327 ARG A O   1 
ATOM   1875 C  CB  . ARG A 1 297 ? 29.336 22.318 42.523 1.00 41.20 ? 327 ARG A CB  1 
ATOM   1876 C  CG  . ARG A 1 297 ? 27.966 21.680 42.188 1.00 44.07 ? 327 ARG A CG  1 
ATOM   1877 C  CD  . ARG A 1 297 ? 27.150 22.580 41.198 1.00 42.14 ? 327 ARG A CD  1 
ATOM   1878 N  NE  . ARG A 1 297 ? 26.888 23.901 41.793 1.00 51.97 ? 327 ARG A NE  1 
ATOM   1879 C  CZ  . ARG A 1 297 ? 26.730 25.039 41.114 1.00 48.29 ? 327 ARG A CZ  1 
ATOM   1880 N  NH1 . ARG A 1 297 ? 26.798 25.055 39.793 1.00 51.88 ? 327 ARG A NH1 1 
ATOM   1881 N  NH2 . ARG A 1 297 ? 26.513 26.175 41.766 1.00 46.46 ? 327 ARG A NH2 1 
ATOM   1882 N  N   . ALA A 1 298 ? 31.149 19.637 42.044 1.00 38.77 ? 328 ALA A N   1 
ATOM   1883 C  CA  . ALA A 1 298 ? 31.156 18.273 41.500 1.00 38.23 ? 328 ALA A CA  1 
ATOM   1884 C  C   . ALA A 1 298 ? 31.573 17.207 42.532 1.00 37.24 ? 328 ALA A C   1 
ATOM   1885 O  O   . ALA A 1 298 ? 32.483 17.431 43.314 1.00 37.27 ? 328 ALA A O   1 
ATOM   1886 C  CB  . ALA A 1 298 ? 32.070 18.215 40.292 1.00 38.99 ? 328 ALA A CB  1 
ATOM   1887 N  N   . ARG A 1 299 ? 30.899 16.056 42.502 1.00 36.98 ? 329 ARG A N   1 
ATOM   1888 C  CA  . ARG A 1 299 ? 31.141 14.942 43.410 1.00 37.41 ? 329 ARG A CA  1 
ATOM   1889 C  C   . ARG A 1 299 ? 31.299 13.637 42.631 1.00 38.56 ? 329 ARG A C   1 
ATOM   1890 O  O   . ARG A 1 299 ? 30.473 13.322 41.771 1.00 39.31 ? 329 ARG A O   1 
ATOM   1891 C  CB  . ARG A 1 299 ? 29.963 14.763 44.370 1.00 37.99 ? 329 ARG A CB  1 
ATOM   1892 C  CG  . ARG A 1 299 ? 29.763 15.865 45.399 1.00 37.96 ? 329 ARG A CG  1 
ATOM   1893 C  CD  . ARG A 1 299 ? 30.923 15.950 46.366 1.00 35.03 ? 329 ARG A CD  1 
ATOM   1894 N  NE  . ARG A 1 299 ? 30.750 17.004 47.361 1.00 35.52 ? 329 ARG A NE  1 
ATOM   1895 C  CZ  . ARG A 1 299 ? 30.847 18.310 47.122 1.00 36.69 ? 329 ARG A CZ  1 
ATOM   1896 N  NH1 . ARG A 1 299 ? 31.097 18.764 45.902 1.00 38.95 ? 329 ARG A NH1 1 
ATOM   1897 N  NH2 . ARG A 1 299 ? 30.681 19.179 48.116 1.00 41.23 ? 329 ARG A NH2 1 
ATOM   1898 N  N   . LEU A 1 300 ? 32.334 12.865 42.945 1.00 37.88 ? 330 LEU A N   1 
ATOM   1899 C  CA  . LEU A 1 300 ? 32.523 11.582 42.272 1.00 38.85 ? 330 LEU A CA  1 
ATOM   1900 C  C   . LEU A 1 300 ? 31.557 10.553 42.829 1.00 39.10 ? 330 LEU A C   1 
ATOM   1901 O  O   . LEU A 1 300 ? 31.569 10.260 44.019 1.00 40.67 ? 330 LEU A O   1 
ATOM   1902 C  CB  . LEU A 1 300 ? 33.955 11.058 42.404 1.00 38.09 ? 330 LEU A CB  1 
ATOM   1903 C  CG  . LEU A 1 300 ? 34.189 9.699  41.724 1.00 39.56 ? 330 LEU A CG  1 
ATOM   1904 C  CD1 . LEU A 1 300 ? 34.136 9.856  40.217 1.00 33.93 ? 330 LEU A CD1 1 
ATOM   1905 C  CD2 . LEU A 1 300 ? 35.522 9.019  42.171 1.00 36.72 ? 330 LEU A CD2 1 
ATOM   1906 N  N   . VAL A 1 301 ? 30.749 9.984  41.947 1.00 39.23 ? 331 VAL A N   1 
ATOM   1907 C  CA  . VAL A 1 301 ? 29.674 9.087  42.344 1.00 39.65 ? 331 VAL A CA  1 
ATOM   1908 C  C   . VAL A 1 301 ? 29.945 7.626  41.896 1.00 38.95 ? 331 VAL A C   1 
ATOM   1909 O  O   . VAL A 1 301 ? 29.435 6.698  42.499 1.00 39.15 ? 331 VAL A O   1 
ATOM   1910 C  CB  . VAL A 1 301 ? 28.310 9.683  41.852 1.00 41.14 ? 331 VAL A CB  1 
ATOM   1911 C  CG1 . VAL A 1 301 ? 27.236 8.632  41.709 1.00 46.00 ? 331 VAL A CG1 1 
ATOM   1912 C  CG2 . VAL A 1 301 ? 27.844 10.792 42.798 1.00 39.29 ? 331 VAL A CG2 1 
ATOM   1913 N  N   . LYS A 1 302 ? 30.766 7.421  40.867 1.00 39.89 ? 332 LYS A N   1 
ATOM   1914 C  CA  . LYS A 1 302 ? 31.262 6.074  40.527 1.00 38.93 ? 332 LYS A CA  1 
ATOM   1915 C  C   . LYS A 1 302 ? 32.495 6.140  39.618 1.00 37.98 ? 332 LYS A C   1 
ATOM   1916 O  O   . LYS A 1 302 ? 32.644 7.078  38.831 1.00 39.38 ? 332 LYS A O   1 
ATOM   1917 C  CB  . LYS A 1 302 ? 30.167 5.224  39.861 1.00 39.13 ? 332 LYS A CB  1 
ATOM   1918 C  CG  . LYS A 1 302 ? 29.688 4.034  40.680 1.00 40.44 ? 332 LYS A CG  1 
ATOM   1919 N  N   . GLY A 1 303 ? 33.355 5.131  39.718 1.00 36.76 ? 333 GLY A N   1 
ATOM   1920 C  CA  . GLY A 1 303 ? 34.583 5.082  38.941 1.00 37.17 ? 333 GLY A CA  1 
ATOM   1921 C  C   . GLY A 1 303 ? 35.664 5.951  39.558 1.00 37.39 ? 333 GLY A C   1 
ATOM   1922 O  O   . GLY A 1 303 ? 35.929 5.855  40.754 1.00 38.67 ? 333 GLY A O   1 
ATOM   1923 N  N   . GLU A 1 304 ? 36.288 6.797  38.742 1.00 37.33 ? 334 GLU A N   1 
ATOM   1924 C  CA  . GLU A 1 304 ? 37.335 7.705  39.214 1.00 37.66 ? 334 GLU A CA  1 
ATOM   1925 C  C   . GLU A 1 304 ? 37.117 9.117  38.677 1.00 37.44 ? 334 GLU A C   1 
ATOM   1926 O  O   . GLU A 1 304 ? 36.568 9.297  37.587 1.00 37.28 ? 334 GLU A O   1 
ATOM   1927 C  CB  . GLU A 1 304 ? 38.722 7.191  38.800 1.00 37.63 ? 334 GLU A CB  1 
ATOM   1928 N  N   . ARG A 1 305 ? 37.529 10.107 39.469 1.00 37.57 ? 335 ARG A N   1 
ATOM   1929 C  CA  . ARG A 1 305 ? 37.521 11.515 39.061 1.00 37.58 ? 335 ARG A CA  1 
ATOM   1930 C  C   . ARG A 1 305 ? 38.724 11.745 38.128 1.00 38.44 ? 335 ARG A C   1 
ATOM   1931 O  O   . ARG A 1 305 ? 39.835 12.083 38.560 1.00 34.14 ? 335 ARG A O   1 
ATOM   1932 C  CB  . ARG A 1 305 ? 37.558 12.433 40.302 1.00 38.05 ? 335 ARG A CB  1 
ATOM   1933 C  CG  . ARG A 1 305 ? 38.094 13.861 40.098 1.00 39.32 ? 335 ARG A CG  1 
ATOM   1934 C  CD  . ARG A 1 305 ? 37.032 14.942 40.163 1.00 45.70 ? 335 ARG A CD  1 
ATOM   1935 N  NE  . ARG A 1 305 ? 36.930 15.557 41.487 1.00 45.05 ? 335 ARG A NE  1 
ATOM   1936 C  CZ  . ARG A 1 305 ? 36.367 16.742 41.743 1.00 50.66 ? 335 ARG A CZ  1 
ATOM   1937 N  NH1 . ARG A 1 305 ? 35.841 17.487 40.769 1.00 47.72 ? 335 ARG A NH1 1 
ATOM   1938 N  NH2 . ARG A 1 305 ? 36.329 17.188 42.996 1.00 53.27 ? 335 ARG A NH2 1 
ATOM   1939 N  N   . THR A 1 306 ? 38.484 11.534 36.838 1.00 40.40 ? 336 THR A N   1 
ATOM   1940 C  CA  . THR A 1 306 ? 39.508 11.709 35.821 1.00 41.78 ? 336 THR A CA  1 
ATOM   1941 C  C   . THR A 1 306 ? 39.784 13.192 35.589 1.00 42.38 ? 336 THR A C   1 
ATOM   1942 O  O   . THR A 1 306 ? 40.824 13.692 35.996 1.00 43.75 ? 336 THR A O   1 
ATOM   1943 C  CB  . THR A 1 306 ? 39.111 10.992 34.500 1.00 42.51 ? 336 THR A CB  1 
ATOM   1944 O  OG1 . THR A 1 306 ? 39.323 9.581  34.653 1.00 38.88 ? 336 THR A OG1 1 
ATOM   1945 C  CG2 . THR A 1 306 ? 39.940 11.484 33.309 1.00 45.78 ? 336 THR A CG2 1 
ATOM   1946 N  N   . ASN A 1 307 ? 38.859 13.896 34.950 1.00 42.14 ? 337 ASN A N   1 
ATOM   1947 C  CA  . ASN A 1 307 ? 39.163 15.237 34.465 1.00 43.09 ? 337 ASN A CA  1 
ATOM   1948 C  C   . ASN A 1 307 ? 38.284 16.365 35.002 1.00 44.00 ? 337 ASN A C   1 
ATOM   1949 O  O   . ASN A 1 307 ? 38.783 17.479 35.201 1.00 45.40 ? 337 ASN A O   1 
ATOM   1950 C  CB  . ASN A 1 307 ? 39.147 15.263 32.936 1.00 43.08 ? 337 ASN A CB  1 
ATOM   1951 C  CG  . ASN A 1 307 ? 39.757 16.520 32.383 1.00 42.64 ? 337 ASN A CG  1 
ATOM   1952 O  OD1 . ASN A 1 307 ? 40.914 16.838 32.665 1.00 40.37 ? 337 ASN A OD1 1 
ATOM   1953 N  ND2 . ASN A 1 307 ? 38.980 17.257 31.600 1.00 41.13 ? 337 ASN A ND2 1 
ATOM   1954 N  N   . LEU A 1 308 ? 36.991 16.101 35.210 1.00 43.74 ? 338 LEU A N   1 
ATOM   1955 C  CA  . LEU A 1 308 ? 36.116 17.095 35.823 1.00 43.43 ? 338 LEU A CA  1 
ATOM   1956 C  C   . LEU A 1 308 ? 36.480 17.266 37.295 1.00 43.85 ? 338 LEU A C   1 
ATOM   1957 O  O   . LEU A 1 308 ? 36.324 18.357 37.839 1.00 45.51 ? 338 LEU A O   1 
ATOM   1958 C  CB  . LEU A 1 308 ? 34.634 16.718 35.681 1.00 42.46 ? 338 LEU A CB  1 
ATOM   1959 C  CG  . LEU A 1 308 ? 33.920 16.941 34.337 1.00 43.38 ? 338 LEU A CG  1 
ATOM   1960 C  CD1 . LEU A 1 308 ? 32.453 16.651 34.492 1.00 40.65 ? 338 LEU A CD1 1 
ATOM   1961 C  CD2 . LEU A 1 308 ? 34.079 18.361 33.810 1.00 42.96 ? 338 LEU A CD2 1 
HETATM 1962 FE FE  . FE2 B 2 .   ? 15.296 22.067 32.473 1.00 40.12 ? 450 FE2 A FE  1 
HETATM 1963 C  C1  . AKG C 3 .   ? 15.021 23.120 35.100 1.00 51.24 ? 451 AKG A C1  1 
HETATM 1964 O  O1  . AKG C 3 .   ? 15.359 23.571 36.238 1.00 38.83 ? 451 AKG A O1  1 
HETATM 1965 O  O2  . AKG C 3 .   ? 15.852 23.013 34.178 1.00 38.53 ? 451 AKG A O2  1 
HETATM 1966 C  C2  . AKG C 3 .   ? 13.645 22.674 34.794 1.00 55.47 ? 451 AKG A C2  1 
HETATM 1967 O  O5  . AKG C 3 .   ? 13.347 22.310 33.651 1.00 34.96 ? 451 AKG A O5  1 
HETATM 1968 C  C3  . AKG C 3 .   ? 12.587 22.637 35.883 1.00 55.14 ? 451 AKG A C3  1 
HETATM 1969 C  C4  . AKG C 3 .   ? 12.099 21.198 36.044 1.00 61.32 ? 451 AKG A C4  1 
HETATM 1970 C  C5  . AKG C 3 .   ? 10.722 21.109 36.683 1.00 68.17 ? 451 AKG A C5  1 
HETATM 1971 O  O3  . AKG C 3 .   ? 9.938  22.090 36.659 1.00 77.20 ? 451 AKG A O3  1 
HETATM 1972 O  O4  . AKG C 3 .   ? 10.396 20.033 37.228 1.00 68.51 ? 451 AKG A O4  1 
HETATM 1973 O  O   . HOH D 4 .   ? 17.826 19.779 27.822 1.00 25.44 ? 452 HOH A O   1 
HETATM 1974 O  O   . HOH D 4 .   ? 22.983 29.237 24.703 1.00 33.00 ? 453 HOH A O   1 
HETATM 1975 O  O   . HOH D 4 .   ? 23.822 11.389 25.005 1.00 26.11 ? 454 HOH A O   1 
HETATM 1976 O  O   . HOH D 4 .   ? 19.353 17.655 30.690 1.00 33.22 ? 455 HOH A O   1 
HETATM 1977 O  O   . HOH D 4 .   ? 23.403 16.724 19.100 1.00 40.40 ? 456 HOH A O   1 
HETATM 1978 O  O   . HOH D 4 .   ? 6.839  15.230 33.912 1.00 32.15 ? 457 HOH A O   1 
HETATM 1979 O  O   . HOH D 4 .   ? 27.019 22.814 22.007 1.00 37.00 ? 458 HOH A O   1 
HETATM 1980 O  O   . HOH D 4 .   ? 26.896 20.110 21.753 1.00 35.11 ? 459 HOH A O   1 
HETATM 1981 O  O   . HOH D 4 .   ? 28.919 18.994 22.626 1.00 44.30 ? 460 HOH A O   1 
HETATM 1982 O  O   . HOH D 4 .   ? 20.316 23.709 33.581 1.00 31.15 ? 461 HOH A O   1 
HETATM 1983 O  O   . HOH D 4 .   ? 24.968 35.221 26.658 1.00 39.54 ? 462 HOH A O   1 
HETATM 1984 O  O   . HOH D 4 .   ? 15.799 20.222 33.539 1.00 44.46 ? 463 HOH A O   1 
HETATM 1985 O  O   . HOH D 4 .   ? 27.424 17.959 42.341 1.00 37.72 ? 464 HOH A O   1 
HETATM 1986 O  O   . HOH D 4 .   ? 19.579 39.004 27.648 1.00 51.37 ? 465 HOH A O   1 
HETATM 1987 O  O   . HOH D 4 .   ? 19.416 36.986 29.397 1.00 63.21 ? 466 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   31  ?   ?   ?   A . n 
A 1 2   GLY 2   32  ?   ?   ?   A . n 
A 1 3   THR 3   33  ?   ?   ?   A . n 
A 1 4   ILE 4   34  ?   ?   ?   A . n 
A 1 5   SER 5   35  ?   ?   ?   A . n 
A 1 6   SER 6   36  ?   ?   ?   A . n 
A 1 7   ALA 7   37  ?   ?   ?   A . n 
A 1 8   SER 8   38  ?   ?   ?   A . n 
A 1 9   PHE 9   39  ?   ?   ?   A . n 
A 1 10  HIS 10  40  ?   ?   ?   A . n 
A 1 11  PRO 11  41  ?   ?   ?   A . n 
A 1 12  GLN 12  42  ?   ?   ?   A . n 
A 1 13  GLN 13  43  43  GLN GLN A . n 
A 1 14  PHE 14  44  44  PHE PHE A . n 
A 1 15  GLN 15  45  45  GLN GLN A . n 
A 1 16  TYR 16  46  46  TYR TYR A . n 
A 1 17  THR 17  47  47  THR THR A . n 
A 1 18  LEU 18  48  48  LEU LEU A . n 
A 1 19  ASP 19  49  49  ASP ASP A . n 
A 1 20  ASN 20  50  50  ASN ASN A . n 
A 1 21  ASN 21  51  ?   ?   ?   A . n 
A 1 22  VAL 22  52  ?   ?   ?   A . n 
A 1 23  LEU 23  53  53  LEU LEU A . n 
A 1 24  THR 24  54  54  THR THR A . n 
A 1 25  LEU 25  55  55  LEU LEU A . n 
A 1 26  GLU 26  56  56  GLU GLU A . n 
A 1 27  GLN 27  57  57  GLN GLN A . n 
A 1 28  ARG 28  58  58  ARG ARG A . n 
A 1 29  LYS 29  59  59  LYS LYS A . n 
A 1 30  PHE 30  60  60  PHE PHE A . n 
A 1 31  TYR 31  61  61  TYR TYR A . n 
A 1 32  GLU 32  62  62  GLU GLU A . n 
A 1 33  GLU 33  63  63  GLU GLU A . n 
A 1 34  ASN 34  64  64  ASN ASN A . n 
A 1 35  GLY 35  65  65  GLY GLY A . n 
A 1 36  PHE 36  66  66  PHE PHE A . n 
A 1 37  LEU 37  67  67  LEU LEU A . n 
A 1 38  VAL 38  68  68  VAL VAL A . n 
A 1 39  ILE 39  69  69  ILE ILE A . n 
A 1 40  LYS 40  70  70  LYS LYS A . n 
A 1 41  ASN 41  71  71  ASN ASN A . n 
A 1 42  LEU 42  72  72  LEU LEU A . n 
A 1 43  VAL 43  73  73  VAL VAL A . n 
A 1 44  PRO 44  74  74  PRO PRO A . n 
A 1 45  ASP 45  75  75  ASP ASP A . n 
A 1 46  ALA 46  76  76  ALA ALA A . n 
A 1 47  ASP 47  77  77  ASP ASP A . n 
A 1 48  ILE 48  78  78  ILE ILE A . n 
A 1 49  GLN 49  79  79  GLN GLN A . n 
A 1 50  ARG 50  80  80  ARG ARG A . n 
A 1 51  PHE 51  81  81  PHE PHE A . n 
A 1 52  ARG 52  82  82  ARG ARG A . n 
A 1 53  ASN 53  83  83  ASN ASN A . n 
A 1 54  GLU 54  84  84  GLU GLU A . n 
A 1 55  PHE 55  85  85  PHE PHE A . n 
A 1 56  GLU 56  86  86  GLU GLU A . n 
A 1 57  LYS 57  87  87  LYS LYS A . n 
A 1 58  ILE 58  88  88  ILE ILE A . n 
A 1 59  CYS 59  89  89  CYS CYS A . n 
A 1 60  ARG 60  90  90  ARG ARG A . n 
A 1 61  LYS 61  91  91  LYS LYS A . n 
A 1 62  GLU 62  92  92  GLU GLU A . n 
A 1 63  VAL 63  93  93  VAL VAL A . n 
A 1 64  LYS 64  94  94  LYS LYS A . n 
A 1 65  PRO 65  95  95  PRO PRO A . n 
A 1 66  LEU 66  96  96  LEU LEU A . n 
A 1 67  GLY 67  97  97  GLY GLY A . n 
A 1 68  LEU 68  98  98  LEU LEU A . n 
A 1 69  THR 69  99  99  THR THR A . n 
A 1 70  VAL 70  100 100 VAL VAL A . n 
A 1 71  MET 71  101 101 MET MET A . n 
A 1 72  ARG 72  102 102 ARG ARG A . n 
A 1 73  ASP 73  103 103 ASP ASP A . n 
A 1 74  VAL 74  104 104 VAL VAL A . n 
A 1 75  THR 75  105 105 THR THR A . n 
A 1 76  ILE 76  106 106 ILE ILE A . n 
A 1 77  SER 77  107 107 SER SER A . n 
A 1 78  LYS 78  108 108 LYS LYS A . n 
A 1 79  SER 79  109 ?   ?   ?   A . n 
A 1 80  GLU 80  110 ?   ?   ?   A . n 
A 1 81  TYR 81  111 ?   ?   ?   A . n 
A 1 82  ALA 82  112 ?   ?   ?   A . n 
A 1 83  PRO 83  113 ?   ?   ?   A . n 
A 1 84  SER 84  114 114 SER SER A . n 
A 1 85  GLU 85  115 115 GLU GLU A . n 
A 1 86  LYS 86  116 116 LYS LYS A . n 
A 1 87  MET 87  117 117 MET MET A . n 
A 1 88  ILE 88  118 118 ILE ILE A . n 
A 1 89  THR 89  119 119 THR THR A . n 
A 1 90  LYS 90  120 120 LYS LYS A . n 
A 1 91  VAL 91  121 121 VAL VAL A . n 
A 1 92  GLN 92  122 122 GLN GLN A . n 
A 1 93  ASP 93  123 123 ASP ASP A . n 
A 1 94  PHE 94  124 124 PHE PHE A . n 
A 1 95  GLN 95  125 125 GLN GLN A . n 
A 1 96  GLU 96  126 126 GLU GLU A . n 
A 1 97  ASP 97  127 127 ASP ASP A . n 
A 1 98  LYS 98  128 128 LYS LYS A . n 
A 1 99  GLU 99  129 129 GLU GLU A . n 
A 1 100 LEU 100 130 130 LEU LEU A . n 
A 1 101 PHE 101 131 131 PHE PHE A . n 
A 1 102 ARG 102 132 132 ARG ARG A . n 
A 1 103 TYR 103 133 133 TYR TYR A . n 
A 1 104 CYS 104 134 134 CYS CYS A . n 
A 1 105 THR 105 135 135 THR THR A . n 
A 1 106 LEU 106 136 136 LEU LEU A . n 
A 1 107 PRO 107 137 137 PRO PRO A . n 
A 1 108 GLU 108 138 138 GLU GLU A . n 
A 1 109 ILE 109 139 139 ILE ILE A . n 
A 1 110 LEU 110 140 140 LEU LEU A . n 
A 1 111 LYS 111 141 141 LYS LYS A . n 
A 1 112 TYR 112 142 142 TYR TYR A . n 
A 1 113 VAL 113 143 143 VAL VAL A . n 
A 1 114 GLU 114 144 144 GLU GLU A . n 
A 1 115 CYS 115 145 145 CYS CYS A . n 
A 1 116 PHE 116 146 146 PHE PHE A . n 
A 1 117 THR 117 147 147 THR THR A . n 
A 1 118 GLY 118 148 148 GLY GLY A . n 
A 1 119 PRO 119 149 149 PRO PRO A . n 
A 1 120 ASN 120 150 150 ASN ASN A . n 
A 1 121 ILE 121 151 151 ILE ILE A . n 
A 1 122 MET 122 152 152 MET MET A . n 
A 1 123 ALA 123 153 153 ALA ALA A . n 
A 1 124 MET 124 154 154 MET MET A . n 
A 1 125 HIS 125 155 155 HIS HIS A . n 
A 1 126 THR 126 156 156 THR THR A . n 
A 1 127 MET 127 157 157 MET MET A . n 
A 1 128 LEU 128 158 158 LEU LEU A . n 
A 1 129 ILE 129 159 159 ILE ILE A . n 
A 1 130 ASN 130 160 160 ASN ASN A . n 
A 1 131 LYS 131 161 161 LYS LYS A . n 
A 1 132 PRO 132 162 162 PRO PRO A . n 
A 1 133 PRO 133 163 163 PRO PRO A . n 
A 1 134 ASP 134 164 164 ASP ASP A . n 
A 1 135 SER 135 165 ?   ?   ?   A . n 
A 1 136 GLY 136 166 ?   ?   ?   A . n 
A 1 137 LYS 137 167 ?   ?   ?   A . n 
A 1 138 LYS 138 168 ?   ?   ?   A . n 
A 1 139 THR 139 169 ?   ?   ?   A . n 
A 1 140 SER 140 170 ?   ?   ?   A . n 
A 1 141 ARG 141 171 ?   ?   ?   A . n 
A 1 142 HIS 142 172 ?   ?   ?   A . n 
A 1 143 PRO 143 173 173 PRO PRO A . n 
A 1 144 LEU 144 174 174 LEU LEU A . n 
A 1 145 HIS 145 175 175 HIS HIS A . n 
A 1 146 GLN 146 176 176 GLN GLN A . n 
A 1 147 ASP 147 177 177 ASP ASP A . n 
A 1 148 LEU 148 178 178 LEU LEU A . n 
A 1 149 HIS 149 179 179 HIS HIS A . n 
A 1 150 TYR 150 180 180 TYR TYR A . n 
A 1 151 PHE 151 181 181 PHE PHE A . n 
A 1 152 PRO 152 182 182 PRO PRO A . n 
A 1 153 PHE 153 183 183 PHE PHE A . n 
A 1 154 ARG 154 184 184 ARG ARG A . n 
A 1 155 PRO 155 185 185 PRO PRO A . n 
A 1 156 SER 156 186 186 SER SER A . n 
A 1 157 ASP 157 187 187 ASP ASP A . n 
A 1 158 LEU 158 188 188 LEU LEU A . n 
A 1 159 ILE 159 189 189 ILE ILE A . n 
A 1 160 VAL 160 190 190 VAL VAL A . n 
A 1 161 CYS 161 191 191 CYS CYS A . n 
A 1 162 ALA 162 192 192 ALA ALA A . n 
A 1 163 TRP 163 193 193 TRP TRP A . n 
A 1 164 THR 164 194 194 THR THR A . n 
A 1 165 ALA 165 195 195 ALA ALA A . n 
A 1 166 MET 166 196 196 MET MET A . n 
A 1 167 GLU 167 197 197 GLU GLU A . n 
A 1 168 HIS 168 198 198 HIS HIS A . n 
A 1 169 ILE 169 199 199 ILE ILE A . n 
A 1 170 SER 170 200 200 SER SER A . n 
A 1 171 ARG 171 201 201 ARG ARG A . n 
A 1 172 ASN 172 202 202 ASN ASN A . n 
A 1 173 ASN 173 203 203 ASN ASN A . n 
A 1 174 GLY 174 204 204 GLY GLY A . n 
A 1 175 CYS 175 205 205 CYS CYS A . n 
A 1 176 LEU 176 206 206 LEU LEU A . n 
A 1 177 VAL 177 207 207 VAL VAL A . n 
A 1 178 VAL 178 208 208 VAL VAL A . n 
A 1 179 LEU 179 209 209 LEU LEU A . n 
A 1 180 PRO 180 210 210 PRO PRO A . n 
A 1 181 GLY 181 211 211 GLY GLY A . n 
A 1 182 THR 182 212 212 THR THR A . n 
A 1 183 HIS 183 213 213 HIS HIS A . n 
A 1 184 LYS 184 214 214 LYS LYS A . n 
A 1 185 GLY 185 215 215 GLY GLY A . n 
A 1 186 SER 186 216 216 SER SER A . n 
A 1 187 LEU 187 217 217 LEU LEU A . n 
A 1 188 LYS 188 218 218 LYS LYS A . n 
A 1 189 PRO 189 219 219 PRO PRO A . n 
A 1 190 HIS 190 220 220 HIS HIS A . n 
A 1 191 ASP 191 221 221 ASP ASP A . n 
A 1 192 TYR 192 222 222 TYR TYR A . n 
A 1 193 PRO 193 223 ?   ?   ?   A . n 
A 1 194 LYS 194 224 ?   ?   ?   A . n 
A 1 195 TRP 195 225 ?   ?   ?   A . n 
A 1 196 GLU 196 226 ?   ?   ?   A . n 
A 1 197 GLY 197 227 ?   ?   ?   A . n 
A 1 198 GLY 198 228 ?   ?   ?   A . n 
A 1 199 VAL 199 229 ?   ?   ?   A . n 
A 1 200 ASN 200 230 ?   ?   ?   A . n 
A 1 201 LYS 201 231 ?   ?   ?   A . n 
A 1 202 MET 202 232 ?   ?   ?   A . n 
A 1 203 PHE 203 233 ?   ?   ?   A . n 
A 1 204 HIS 204 234 234 HIS HIS A . n 
A 1 205 GLY 205 235 235 GLY GLY A . n 
A 1 206 ILE 206 236 236 ILE ILE A . n 
A 1 207 GLN 207 237 237 GLN GLN A . n 
A 1 208 ASP 208 238 238 ASP ASP A . n 
A 1 209 TYR 209 239 ?   ?   ?   A . n 
A 1 210 GLU 210 240 240 GLU GLU A . n 
A 1 211 GLU 211 241 241 GLU GLU A . n 
A 1 212 ASN 212 242 242 ASN ASN A . n 
A 1 213 LYS 213 243 243 LYS LYS A . n 
A 1 214 ALA 214 244 244 ALA ALA A . n 
A 1 215 ARG 215 245 245 ARG ARG A . n 
A 1 216 VAL 216 246 246 VAL VAL A . n 
A 1 217 HIS 217 247 247 HIS HIS A . n 
A 1 218 LEU 218 248 248 LEU LEU A . n 
A 1 219 VAL 219 249 249 VAL VAL A . n 
A 1 220 MET 220 250 250 MET MET A . n 
A 1 221 GLU 221 251 251 GLU GLU A . n 
A 1 222 LYS 222 252 252 LYS LYS A . n 
A 1 223 GLY 223 253 253 GLY GLY A . n 
A 1 224 ASP 224 254 254 ASP ASP A . n 
A 1 225 THR 225 255 255 THR THR A . n 
A 1 226 VAL 226 256 256 VAL VAL A . n 
A 1 227 PHE 227 257 257 PHE PHE A . n 
A 1 228 PHE 228 258 258 PHE PHE A . n 
A 1 229 HIS 229 259 259 HIS HIS A . n 
A 1 230 PRO 230 260 260 PRO PRO A . n 
A 1 231 LEU 231 261 261 LEU LEU A . n 
A 1 232 LEU 232 262 262 LEU LEU A . n 
A 1 233 ILE 233 263 263 ILE ILE A . n 
A 1 234 HIS 234 264 264 HIS HIS A . n 
A 1 235 GLY 235 265 265 GLY GLY A . n 
A 1 236 SER 236 266 266 SER SER A . n 
A 1 237 GLY 237 267 267 GLY GLY A . n 
A 1 238 GLN 238 268 268 GLN GLN A . n 
A 1 239 ASN 239 269 269 ASN ASN A . n 
A 1 240 LYS 240 270 270 LYS LYS A . n 
A 1 241 THR 241 271 271 THR THR A . n 
A 1 242 GLN 242 272 272 GLN GLN A . n 
A 1 243 GLY 243 273 273 GLY GLY A . n 
A 1 244 PHE 244 274 274 PHE PHE A . n 
A 1 245 ARG 245 275 275 ARG ARG A . n 
A 1 246 LYS 246 276 276 LYS LYS A . n 
A 1 247 ALA 247 277 277 ALA ALA A . n 
A 1 248 ILE 248 278 278 ILE ILE A . n 
A 1 249 SER 249 279 279 SER SER A . n 
A 1 250 CYS 250 280 280 CYS CYS A . n 
A 1 251 HIS 251 281 281 HIS HIS A . n 
A 1 252 PHE 252 282 282 PHE PHE A . n 
A 1 253 ALA 253 283 283 ALA ALA A . n 
A 1 254 SER 254 284 284 SER SER A . n 
A 1 255 ALA 255 285 285 ALA ALA A . n 
A 1 256 ASP 256 286 286 ASP ASP A . n 
A 1 257 CYS 257 287 287 CYS CYS A . n 
A 1 258 HIS 258 288 288 HIS HIS A . n 
A 1 259 TYR 259 289 289 TYR TYR A . n 
A 1 260 ILE 260 290 290 ILE ILE A . n 
A 1 261 ASP 261 291 291 ASP ASP A . n 
A 1 262 VAL 262 292 292 VAL VAL A . n 
A 1 263 LYS 263 293 293 LYS LYS A . n 
A 1 264 GLY 264 294 294 GLY GLY A . n 
A 1 265 THR 265 295 295 THR THR A . n 
A 1 266 SER 266 296 296 SER SER A . n 
A 1 267 GLN 267 297 297 GLN GLN A . n 
A 1 268 GLU 268 298 298 GLU GLU A . n 
A 1 269 ASN 269 299 299 ASN ASN A . n 
A 1 270 ILE 270 300 300 ILE ILE A . n 
A 1 271 GLU 271 301 301 GLU GLU A . n 
A 1 272 LYS 272 302 302 LYS LYS A . n 
A 1 273 GLU 273 303 ?   ?   ?   A . n 
A 1 274 VAL 274 304 ?   ?   ?   A . n 
A 1 275 VAL 275 305 ?   ?   ?   A . n 
A 1 276 GLY 276 306 ?   ?   ?   A . n 
A 1 277 ILE 277 307 ?   ?   ?   A . n 
A 1 278 ALA 278 308 ?   ?   ?   A . n 
A 1 279 HIS 279 309 ?   ?   ?   A . n 
A 1 280 LYS 280 310 ?   ?   ?   A . n 
A 1 281 PHE 281 311 ?   ?   ?   A . n 
A 1 282 PHE 282 312 ?   ?   ?   A . n 
A 1 283 GLY 283 313 ?   ?   ?   A . n 
A 1 284 ALA 284 314 ?   ?   ?   A . n 
A 1 285 GLU 285 315 ?   ?   ?   A . n 
A 1 286 ASN 286 316 ?   ?   ?   A . n 
A 1 287 SER 287 317 ?   ?   ?   A . n 
A 1 288 VAL 288 318 ?   ?   ?   A . n 
A 1 289 ASN 289 319 319 ASN ASN A . n 
A 1 290 LEU 290 320 320 LEU LEU A . n 
A 1 291 LYS 291 321 321 LYS LYS A . n 
A 1 292 ASP 292 322 322 ASP ASP A . n 
A 1 293 ILE 293 323 323 ILE ILE A . n 
A 1 294 TRP 294 324 324 TRP TRP A . n 
A 1 295 MET 295 325 325 MET MET A . n 
A 1 296 PHE 296 326 326 PHE PHE A . n 
A 1 297 ARG 297 327 327 ARG ARG A . n 
A 1 298 ALA 298 328 328 ALA ALA A . n 
A 1 299 ARG 299 329 329 ARG ARG A . n 
A 1 300 LEU 300 330 330 LEU LEU A . n 
A 1 301 VAL 301 331 331 VAL VAL A . n 
A 1 302 LYS 302 332 332 LYS LYS A . n 
A 1 303 GLY 303 333 333 GLY GLY A . n 
A 1 304 GLU 304 334 334 GLU GLU A . n 
A 1 305 ARG 305 335 335 ARG ARG A . n 
A 1 306 THR 306 336 336 THR THR A . n 
A 1 307 ASN 307 337 337 ASN ASN A . n 
A 1 308 LEU 308 338 338 LEU LEU A . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Structural Genomics Consortium' 
_pdbx_SG_project.initial_of_center     SGC 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 FE2 1  450 450 FE2 FE2 A . 
C 3 AKG 1  451 451 AKG AKG A . 
D 4 HOH 1  452 2   HOH HOH A . 
D 4 HOH 2  453 4   HOH HOH A . 
D 4 HOH 3  454 12  HOH HOH A . 
D 4 HOH 4  455 13  HOH HOH A . 
D 4 HOH 5  456 14  HOH HOH A . 
D 4 HOH 6  457 15  HOH HOH A . 
D 4 HOH 7  458 18  HOH HOH A . 
D 4 HOH 8  459 20  HOH HOH A . 
D 4 HOH 9  460 21  HOH HOH A . 
D 4 HOH 10 461 29  HOH HOH A . 
D 4 HOH 11 462 30  HOH HOH A . 
D 4 HOH 12 463 32  HOH HOH A . 
D 4 HOH 13 464 33  HOH HOH A . 
D 4 HOH 14 465 38  HOH HOH A . 
D 4 HOH 15 466 39  HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O5  ? C AKG .   ? A AKG 451 ? 1_555 FE ? B FE2 . ? A FE2 450 ? 1_555 OD1 ? A ASP 147 ? A ASP 177 ? 1_555 166.8 ? 
2  O5  ? C AKG .   ? A AKG 451 ? 1_555 FE ? B FE2 . ? A FE2 450 ? 1_555 NE2 ? A HIS 234 ? A HIS 264 ? 1_555 103.0 ? 
3  OD1 ? A ASP 147 ? A ASP 177 ? 1_555 FE ? B FE2 . ? A FE2 450 ? 1_555 NE2 ? A HIS 234 ? A HIS 264 ? 1_555 89.0  ? 
4  O5  ? C AKG .   ? A AKG 451 ? 1_555 FE ? B FE2 . ? A FE2 450 ? 1_555 O   ? D HOH .   ? A HOH 463 ? 1_555 92.0  ? 
5  OD1 ? A ASP 147 ? A ASP 177 ? 1_555 FE ? B FE2 . ? A FE2 450 ? 1_555 O   ? D HOH .   ? A HOH 463 ? 1_555 82.5  ? 
6  NE2 ? A HIS 234 ? A HIS 264 ? 1_555 FE ? B FE2 . ? A FE2 450 ? 1_555 O   ? D HOH .   ? A HOH 463 ? 1_555 89.3  ? 
7  O5  ? C AKG .   ? A AKG 451 ? 1_555 FE ? B FE2 . ? A FE2 450 ? 1_555 NE2 ? A HIS 145 ? A HIS 175 ? 1_555 96.1  ? 
8  OD1 ? A ASP 147 ? A ASP 177 ? 1_555 FE ? B FE2 . ? A FE2 450 ? 1_555 NE2 ? A HIS 145 ? A HIS 175 ? 1_555 87.5  ? 
9  NE2 ? A HIS 234 ? A HIS 264 ? 1_555 FE ? B FE2 . ? A FE2 450 ? 1_555 NE2 ? A HIS 145 ? A HIS 175 ? 1_555 98.0  ? 
10 O   ? D HOH .   ? A HOH 463 ? 1_555 FE ? B FE2 . ? A FE2 450 ? 1_555 NE2 ? A HIS 145 ? A HIS 175 ? 1_555 167.6 ? 
11 O5  ? C AKG .   ? A AKG 451 ? 1_555 FE ? B FE2 . ? A FE2 450 ? 1_555 O2  ? C AKG .   ? A AKG 451 ? 1_555 75.6  ? 
12 OD1 ? A ASP 147 ? A ASP 177 ? 1_555 FE ? B FE2 . ? A FE2 450 ? 1_555 O2  ? C AKG .   ? A AKG 451 ? 1_555 91.9  ? 
13 NE2 ? A HIS 234 ? A HIS 264 ? 1_555 FE ? B FE2 . ? A FE2 450 ? 1_555 O2  ? C AKG .   ? A AKG 451 ? 1_555 174.5 ? 
14 O   ? D HOH .   ? A HOH 463 ? 1_555 FE ? B FE2 . ? A FE2 450 ? 1_555 O2  ? C AKG .   ? A AKG 451 ? 1_555 85.5  ? 
15 NE2 ? A HIS 145 ? A HIS 175 ? 1_555 FE ? B FE2 . ? A FE2 450 ? 1_555 O2  ? C AKG .   ? A AKG 451 ? 1_555 87.4  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2005-08-16 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2018-01-31 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' Advisory                    
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Structure summary'         
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            audit_author 
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    4 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_audit_author.name' 
# 
_pdbx_refine_tls.id               1 
_pdbx_refine_tls.details          ? 
_pdbx_refine_tls.method           refined 
_pdbx_refine_tls.origin_x         17.9091 
_pdbx_refine_tls.origin_y         17.2925 
_pdbx_refine_tls.origin_z         36.1656 
_pdbx_refine_tls.T[1][1]          0.0297 
_pdbx_refine_tls.T[2][2]          -0.0560 
_pdbx_refine_tls.T[3][3]          0.0113 
_pdbx_refine_tls.T[1][2]          0.0047 
_pdbx_refine_tls.T[1][3]          -0.0164 
_pdbx_refine_tls.T[2][3]          0.1451 
_pdbx_refine_tls.L[1][1]          5.3131 
_pdbx_refine_tls.L[2][2]          1.5005 
_pdbx_refine_tls.L[3][3]          3.1446 
_pdbx_refine_tls.L[1][2]          0.6034 
_pdbx_refine_tls.L[1][3]          -1.2940 
_pdbx_refine_tls.L[2][3]          0.2177 
_pdbx_refine_tls.S[1][1]          0.0409 
_pdbx_refine_tls.S[1][2]          -0.6886 
_pdbx_refine_tls.S[1][3]          -0.3403 
_pdbx_refine_tls.S[2][1]          0.1370 
_pdbx_refine_tls.S[2][2]          -0.1012 
_pdbx_refine_tls.S[2][3]          -0.0371 
_pdbx_refine_tls.S[3][1]          0.2566 
_pdbx_refine_tls.S[3][2]          0.0113 
_pdbx_refine_tls.S[3][3]          0.0604 
_pdbx_refine_tls.pdbx_refine_id   'X-RAY DIFFRACTION' 
# 
_pdbx_refine_tls_group.id                  1 
_pdbx_refine_tls_group.refine_tls_id       1 
_pdbx_refine_tls_group.beg_auth_asym_id    A 
_pdbx_refine_tls_group.beg_auth_seq_id     43 
_pdbx_refine_tls_group.beg_label_asym_id   A 
_pdbx_refine_tls_group.beg_label_seq_id    13 
_pdbx_refine_tls_group.end_auth_asym_id    A 
_pdbx_refine_tls_group.end_auth_seq_id     338 
_pdbx_refine_tls_group.end_label_asym_id   A 
_pdbx_refine_tls_group.end_label_seq_id    308 
_pdbx_refine_tls_group.selection           ? 
_pdbx_refine_tls_group.pdbx_refine_id      'X-RAY DIFFRACTION' 
_pdbx_refine_tls_group.selection_details   ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC refinement       5.2.0005  ? 1 
MOSFLM 'data reduction' .         ? 2 
CCP4   'data scaling'   '(SCALA)' ? 3 
SHELXS phasing          .         ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 LEU A 55  ? ? -114.24 -138.27 
2  1 ASN A 71  ? ? 34.79   63.32   
3  1 LEU A 96  ? ? -64.78  -70.30  
4  1 PRO A 182 ? ? -92.65  58.67   
5  1 GLU A 197 ? ? -170.58 -176.59 
6  1 SER A 200 ? ? -125.97 -164.28 
7  1 GLN A 237 ? ? -106.43 49.54   
8  1 GLU A 241 ? ? -93.51  -92.15  
9  1 LYS A 243 ? ? -173.21 129.03  
10 1 THR A 336 ? ? -73.42  -72.28  
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   HIS 
_pdbx_validate_peptide_omega.auth_asym_id_1   A 
_pdbx_validate_peptide_omega.auth_seq_id_1    234 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   GLY 
_pdbx_validate_peptide_omega.auth_asym_id_2   A 
_pdbx_validate_peptide_omega.auth_seq_id_2    235 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            -141.29 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A GLN 43  ? N   ? A GLN 13  N   
2   1 Y 1 A GLN 43  ? CB  ? A GLN 13  CB  
3   1 Y 1 A GLN 43  ? CG  ? A GLN 13  CG  
4   1 Y 1 A GLN 43  ? CD  ? A GLN 13  CD  
5   1 Y 1 A GLN 43  ? OE1 ? A GLN 13  OE1 
6   1 Y 1 A GLN 43  ? NE2 ? A GLN 13  NE2 
7   1 Y 1 A ASP 49  ? CG  ? A ASP 19  CG  
8   1 Y 1 A ASP 49  ? OD1 ? A ASP 19  OD1 
9   1 Y 1 A ASP 49  ? OD2 ? A ASP 19  OD2 
10  1 Y 1 A ASN 50  ? CG  ? A ASN 20  CG  
11  1 Y 1 A ASN 50  ? OD1 ? A ASN 20  OD1 
12  1 Y 1 A ASN 50  ? ND2 ? A ASN 20  ND2 
13  1 Y 1 A LYS 59  ? CG  ? A LYS 29  CG  
14  1 Y 1 A LYS 59  ? CD  ? A LYS 29  CD  
15  1 Y 1 A LYS 59  ? CE  ? A LYS 29  CE  
16  1 Y 1 A LYS 59  ? NZ  ? A LYS 29  NZ  
17  1 Y 1 A GLU 63  ? CG  ? A GLU 33  CG  
18  1 Y 1 A GLU 63  ? CD  ? A GLU 33  CD  
19  1 Y 1 A GLU 63  ? OE1 ? A GLU 33  OE1 
20  1 Y 1 A GLU 63  ? OE2 ? A GLU 33  OE2 
21  1 Y 1 A LYS 70  ? CG  ? A LYS 40  CG  
22  1 Y 1 A LYS 70  ? CD  ? A LYS 40  CD  
23  1 Y 1 A LYS 70  ? CE  ? A LYS 40  CE  
24  1 Y 1 A LYS 70  ? NZ  ? A LYS 40  NZ  
25  1 Y 1 A ASN 71  ? CG  ? A ASN 41  CG  
26  1 Y 1 A ASN 71  ? OD1 ? A ASN 41  OD1 
27  1 Y 1 A ASN 71  ? ND2 ? A ASN 41  ND2 
28  1 Y 1 A ARG 82  ? NE  ? A ARG 52  NE  
29  1 Y 1 A ARG 82  ? CZ  ? A ARG 52  CZ  
30  1 Y 1 A ARG 82  ? NH1 ? A ARG 52  NH1 
31  1 Y 1 A ARG 82  ? NH2 ? A ARG 52  NH2 
32  1 Y 1 A LYS 91  ? CG  ? A LYS 61  CG  
33  1 Y 1 A LYS 91  ? CD  ? A LYS 61  CD  
34  1 Y 1 A LYS 91  ? CE  ? A LYS 61  CE  
35  1 Y 1 A LYS 91  ? NZ  ? A LYS 61  NZ  
36  1 Y 1 A GLU 92  ? CG  ? A GLU 62  CG  
37  1 Y 1 A GLU 92  ? CD  ? A GLU 62  CD  
38  1 Y 1 A GLU 92  ? OE1 ? A GLU 62  OE1 
39  1 Y 1 A GLU 92  ? OE2 ? A GLU 62  OE2 
40  1 Y 1 A VAL 93  ? CG1 ? A VAL 63  CG1 
41  1 Y 1 A VAL 93  ? CG2 ? A VAL 63  CG2 
42  1 Y 1 A LYS 94  ? CG  ? A LYS 64  CG  
43  1 Y 1 A LYS 94  ? CD  ? A LYS 64  CD  
44  1 Y 1 A LYS 94  ? CE  ? A LYS 64  CE  
45  1 Y 1 A LYS 94  ? NZ  ? A LYS 64  NZ  
46  1 Y 1 A LYS 108 ? CG  ? A LYS 78  CG  
47  1 Y 1 A LYS 108 ? CD  ? A LYS 78  CD  
48  1 Y 1 A LYS 108 ? CE  ? A LYS 78  CE  
49  1 Y 1 A LYS 108 ? NZ  ? A LYS 78  NZ  
50  1 Y 1 A SER 114 ? OG  ? A SER 84  OG  
51  1 Y 1 A LYS 116 ? CG  ? A LYS 86  CG  
52  1 Y 1 A LYS 116 ? CD  ? A LYS 86  CD  
53  1 Y 1 A LYS 116 ? CE  ? A LYS 86  CE  
54  1 Y 1 A LYS 116 ? NZ  ? A LYS 86  NZ  
55  1 Y 1 A LYS 128 ? CG  ? A LYS 98  CG  
56  1 Y 1 A LYS 128 ? CD  ? A LYS 98  CD  
57  1 Y 1 A LYS 128 ? CE  ? A LYS 98  CE  
58  1 Y 1 A LYS 128 ? NZ  ? A LYS 98  NZ  
59  1 Y 1 A LYS 141 ? CG  ? A LYS 111 CG  
60  1 Y 1 A LYS 141 ? CD  ? A LYS 111 CD  
61  1 Y 1 A LYS 141 ? CE  ? A LYS 111 CE  
62  1 Y 1 A LYS 141 ? NZ  ? A LYS 111 NZ  
63  1 Y 1 A ARG 201 ? NE  ? A ARG 171 NE  
64  1 Y 1 A ARG 201 ? CZ  ? A ARG 171 CZ  
65  1 Y 1 A ARG 201 ? NH1 ? A ARG 171 NH1 
66  1 Y 1 A ARG 201 ? NH2 ? A ARG 171 NH2 
67  1 Y 1 A HIS 234 ? CG  ? A HIS 204 CG  
68  1 Y 1 A HIS 234 ? ND1 ? A HIS 204 ND1 
69  1 Y 1 A HIS 234 ? CD2 ? A HIS 204 CD2 
70  1 Y 1 A HIS 234 ? CE1 ? A HIS 204 CE1 
71  1 Y 1 A HIS 234 ? NE2 ? A HIS 204 NE2 
72  1 Y 1 A GLN 237 ? CG  ? A GLN 207 CG  
73  1 Y 1 A GLN 237 ? CD  ? A GLN 207 CD  
74  1 Y 1 A GLN 237 ? OE1 ? A GLN 207 OE1 
75  1 Y 1 A GLN 237 ? NE2 ? A GLN 207 NE2 
76  1 Y 1 A LYS 243 ? CE  ? A LYS 213 CE  
77  1 Y 1 A LYS 243 ? NZ  ? A LYS 213 NZ  
78  1 Y 1 A GLU 251 ? CG  ? A GLU 221 CG  
79  1 Y 1 A GLU 251 ? CD  ? A GLU 221 CD  
80  1 Y 1 A GLU 251 ? OE1 ? A GLU 221 OE1 
81  1 Y 1 A GLU 251 ? OE2 ? A GLU 221 OE2 
82  1 Y 1 A LYS 252 ? NZ  ? A LYS 222 NZ  
83  1 Y 1 A GLN 268 ? CG  ? A GLN 238 CG  
84  1 Y 1 A GLN 268 ? CD  ? A GLN 238 CD  
85  1 Y 1 A GLN 268 ? OE1 ? A GLN 238 OE1 
86  1 Y 1 A GLN 268 ? NE2 ? A GLN 238 NE2 
87  1 Y 1 A LYS 270 ? CG  ? A LYS 240 CG  
88  1 Y 1 A LYS 270 ? CD  ? A LYS 240 CD  
89  1 Y 1 A LYS 270 ? CE  ? A LYS 240 CE  
90  1 Y 1 A LYS 270 ? NZ  ? A LYS 240 NZ  
91  1 Y 1 A LYS 293 ? CG  ? A LYS 263 CG  
92  1 Y 1 A LYS 293 ? CD  ? A LYS 263 CD  
93  1 Y 1 A LYS 293 ? CE  ? A LYS 263 CE  
94  1 Y 1 A LYS 293 ? NZ  ? A LYS 263 NZ  
95  1 Y 1 A GLU 301 ? CG  ? A GLU 271 CG  
96  1 Y 1 A GLU 301 ? CD  ? A GLU 271 CD  
97  1 Y 1 A GLU 301 ? OE1 ? A GLU 271 OE1 
98  1 Y 1 A GLU 301 ? OE2 ? A GLU 271 OE2 
99  1 Y 1 A LYS 302 ? CG  ? A LYS 272 CG  
100 1 Y 1 A LYS 302 ? CD  ? A LYS 272 CD  
101 1 Y 1 A LYS 302 ? CE  ? A LYS 272 CE  
102 1 Y 1 A LYS 302 ? NZ  ? A LYS 272 NZ  
103 1 Y 1 A LYS 332 ? CD  ? A LYS 302 CD  
104 1 Y 1 A LYS 332 ? CE  ? A LYS 302 CE  
105 1 Y 1 A LYS 332 ? NZ  ? A LYS 302 NZ  
106 1 Y 1 A GLU 334 ? CG  ? A GLU 304 CG  
107 1 Y 1 A GLU 334 ? CD  ? A GLU 304 CD  
108 1 Y 1 A GLU 334 ? OE1 ? A GLU 304 OE1 
109 1 Y 1 A GLU 334 ? OE2 ? A GLU 304 OE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A SER 31  ? A SER 1   
2  1 Y 1 A GLY 32  ? A GLY 2   
3  1 Y 1 A THR 33  ? A THR 3   
4  1 Y 1 A ILE 34  ? A ILE 4   
5  1 Y 1 A SER 35  ? A SER 5   
6  1 Y 1 A SER 36  ? A SER 6   
7  1 Y 1 A ALA 37  ? A ALA 7   
8  1 Y 1 A SER 38  ? A SER 8   
9  1 Y 1 A PHE 39  ? A PHE 9   
10 1 Y 1 A HIS 40  ? A HIS 10  
11 1 Y 1 A PRO 41  ? A PRO 11  
12 1 Y 1 A GLN 42  ? A GLN 12  
13 1 Y 1 A ASN 51  ? A ASN 21  
14 1 Y 1 A VAL 52  ? A VAL 22  
15 1 Y 1 A SER 109 ? A SER 79  
16 1 Y 1 A GLU 110 ? A GLU 80  
17 1 Y 1 A TYR 111 ? A TYR 81  
18 1 Y 1 A ALA 112 ? A ALA 82  
19 1 Y 1 A PRO 113 ? A PRO 83  
20 1 Y 1 A SER 165 ? A SER 135 
21 1 Y 1 A GLY 166 ? A GLY 136 
22 1 Y 1 A LYS 167 ? A LYS 137 
23 1 Y 1 A LYS 168 ? A LYS 138 
24 1 Y 1 A THR 169 ? A THR 139 
25 1 Y 1 A SER 170 ? A SER 140 
26 1 Y 1 A ARG 171 ? A ARG 141 
27 1 Y 1 A HIS 172 ? A HIS 142 
28 1 Y 1 A PRO 223 ? A PRO 193 
29 1 Y 1 A LYS 224 ? A LYS 194 
30 1 Y 1 A TRP 225 ? A TRP 195 
31 1 Y 1 A GLU 226 ? A GLU 196 
32 1 Y 1 A GLY 227 ? A GLY 197 
33 1 Y 1 A GLY 228 ? A GLY 198 
34 1 Y 1 A VAL 229 ? A VAL 199 
35 1 Y 1 A ASN 230 ? A ASN 200 
36 1 Y 1 A LYS 231 ? A LYS 201 
37 1 Y 1 A MET 232 ? A MET 202 
38 1 Y 1 A PHE 233 ? A PHE 203 
39 1 Y 1 A TYR 239 ? A TYR 209 
40 1 Y 1 A GLU 303 ? A GLU 273 
41 1 Y 1 A VAL 304 ? A VAL 274 
42 1 Y 1 A VAL 305 ? A VAL 275 
43 1 Y 1 A GLY 306 ? A GLY 276 
44 1 Y 1 A ILE 307 ? A ILE 277 
45 1 Y 1 A ALA 308 ? A ALA 278 
46 1 Y 1 A HIS 309 ? A HIS 279 
47 1 Y 1 A LYS 310 ? A LYS 280 
48 1 Y 1 A PHE 311 ? A PHE 281 
49 1 Y 1 A PHE 312 ? A PHE 282 
50 1 Y 1 A GLY 313 ? A GLY 283 
51 1 Y 1 A ALA 314 ? A ALA 284 
52 1 Y 1 A GLU 315 ? A GLU 285 
53 1 Y 1 A ASN 316 ? A ASN 286 
54 1 Y 1 A SER 317 ? A SER 287 
55 1 Y 1 A VAL 318 ? A VAL 288 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'FE (II) ION'        FE2 
3 '2-OXOGLUTARIC ACID' AKG 
4 water                HOH 
#