data_2A72
# 
_entry.id   2A72 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.290 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2A72         
RCSB  RCSB033568   
WWPDB D_1000033568 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2A72 
_pdbx_database_status.recvd_initial_deposition_date   2005-07-04 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Schoch, G.A.'                         1  
'Johansson, C.'                        2  
'Phillips, C.'                         3  
'Debreczeni, J.'                       4  
'Smee, C.'                             5  
'Elkins, J.M.'                         6  
'Sundstrom, M.'                        7  
'Edwards, A.'                          8  
'Arrowsmith, C.'                       9  
'von Delft, F.'                        10 
'Gileadi, O.'                          11 
'Doyle, D.A.'                          12 
'Structural Genomics Consortium (SGC)' 13 
# 
_citation.id                        primary 
_citation.title                     
'Structural diversity in the RGS domain and its interaction with heterotrimeric G protein alpha-subunits.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.Usa 
_citation.journal_volume            105 
_citation.page_first                6457 
_citation.page_last                 6462 
_citation.year                      2008 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18434541 
_citation.pdbx_database_id_DOI      10.1073/pnas.0801508105 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Soundararajan, M.' 1  
primary 'Willard, F.S.'     2  
primary 'Kimple, A.J.'      3  
primary 'Turnbull, A.P.'    4  
primary 'Ball, L.J.'        5  
primary 'Schoch, G.A.'      6  
primary 'Gileadi, C.'       7  
primary 'Fedorov, O.Y.'     8  
primary 'Dowler, E.F.'      9  
primary 'Higman, V.A.'      10 
primary 'Hutsell, S.Q.'     11 
primary 'Sundstrom, M.'     12 
primary 'Doyle, D.A.'       13 
primary 'Siderovski, D.P.'  14 
# 
_cell.entry_id           2A72 
_cell.length_a           28.915 
_cell.length_b           106.033 
_cell.length_c           52.490 
_cell.angle_alpha        90.00 
_cell.angle_beta         103.71 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2A72 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Regulator of G-protein signalling 7' 17138.375 2   ? ? 'RESIDUES 320-463' ? 
2 non-polymer syn 'CHLORIDE ION'                        35.453    1   ? ? ?                  ? 
3 water       nat water                                 18.015    231 ? ? ?                  ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SMKEPSQQRVKRWGFGMDEALKDPVGREQFLKFLESEFSSENLRFWLAVEDLKKRPIKEVPSRVQEIWQEFLAPGAPSAI
NLDSKSYDKTTHNVKEPGRYTFEDAQEHIYKLMKSDSYPRFIRSSAYQELLQAKKKSGNSMDRRTS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SMKEPSQQRVKRWGFGMDEALKDPVGREQFLKFLESEFSSENLRFWLAVEDLKKRPIKEVPSRVQEIWQEFLAPGAPSAI
NLDSKSYDKTTHNVKEPGRYTFEDAQEHIYKLMKSDSYPRFIRSSAYQELLQAKKKSGNSMDRRTS
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   MET n 
1 3   LYS n 
1 4   GLU n 
1 5   PRO n 
1 6   SER n 
1 7   GLN n 
1 8   GLN n 
1 9   ARG n 
1 10  VAL n 
1 11  LYS n 
1 12  ARG n 
1 13  TRP n 
1 14  GLY n 
1 15  PHE n 
1 16  GLY n 
1 17  MET n 
1 18  ASP n 
1 19  GLU n 
1 20  ALA n 
1 21  LEU n 
1 22  LYS n 
1 23  ASP n 
1 24  PRO n 
1 25  VAL n 
1 26  GLY n 
1 27  ARG n 
1 28  GLU n 
1 29  GLN n 
1 30  PHE n 
1 31  LEU n 
1 32  LYS n 
1 33  PHE n 
1 34  LEU n 
1 35  GLU n 
1 36  SER n 
1 37  GLU n 
1 38  PHE n 
1 39  SER n 
1 40  SER n 
1 41  GLU n 
1 42  ASN n 
1 43  LEU n 
1 44  ARG n 
1 45  PHE n 
1 46  TRP n 
1 47  LEU n 
1 48  ALA n 
1 49  VAL n 
1 50  GLU n 
1 51  ASP n 
1 52  LEU n 
1 53  LYS n 
1 54  LYS n 
1 55  ARG n 
1 56  PRO n 
1 57  ILE n 
1 58  LYS n 
1 59  GLU n 
1 60  VAL n 
1 61  PRO n 
1 62  SER n 
1 63  ARG n 
1 64  VAL n 
1 65  GLN n 
1 66  GLU n 
1 67  ILE n 
1 68  TRP n 
1 69  GLN n 
1 70  GLU n 
1 71  PHE n 
1 72  LEU n 
1 73  ALA n 
1 74  PRO n 
1 75  GLY n 
1 76  ALA n 
1 77  PRO n 
1 78  SER n 
1 79  ALA n 
1 80  ILE n 
1 81  ASN n 
1 82  LEU n 
1 83  ASP n 
1 84  SER n 
1 85  LYS n 
1 86  SER n 
1 87  TYR n 
1 88  ASP n 
1 89  LYS n 
1 90  THR n 
1 91  THR n 
1 92  HIS n 
1 93  ASN n 
1 94  VAL n 
1 95  LYS n 
1 96  GLU n 
1 97  PRO n 
1 98  GLY n 
1 99  ARG n 
1 100 TYR n 
1 101 THR n 
1 102 PHE n 
1 103 GLU n 
1 104 ASP n 
1 105 ALA n 
1 106 GLN n 
1 107 GLU n 
1 108 HIS n 
1 109 ILE n 
1 110 TYR n 
1 111 LYS n 
1 112 LEU n 
1 113 MET n 
1 114 LYS n 
1 115 SER n 
1 116 ASP n 
1 117 SER n 
1 118 TYR n 
1 119 PRO n 
1 120 ARG n 
1 121 PHE n 
1 122 ILE n 
1 123 ARG n 
1 124 SER n 
1 125 SER n 
1 126 ALA n 
1 127 TYR n 
1 128 GLN n 
1 129 GLU n 
1 130 LEU n 
1 131 LEU n 
1 132 GLN n 
1 133 ALA n 
1 134 LYS n 
1 135 LYS n 
1 136 LYS n 
1 137 SER n 
1 138 GLY n 
1 139 ASN n 
1 140 SER n 
1 141 MET n 
1 142 ASP n 
1 143 ARG n 
1 144 ARG n 
1 145 THR n 
1 146 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pLIC-SGC 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    RGS7_HUMAN 
_struct_ref.pdbx_db_accession          P49802 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;KEPSQQRVKRWGFGMDEALKDPVGREQFLKFLESEFSSENLRFWLAVEDLKKRPIKEVPSRVQEIWQEFLAPGAPSAINL
DSKSYDKTTHNVKEPGRYTFEDAQEHIYKLMKSDSYPRFIRSSAYQELLQAKKKSGNSMDRRTS
;
_struct_ref.pdbx_align_begin           320 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2A72 A 3 ? 146 ? P49802 320 ? 463 ? 320 463 
2 1 2A72 B 3 ? 146 ? P49802 320 ? 463 ? 320 463 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2A72 SER A 1 ? UNP P49802 ? ? 'CLONING ARTIFACT' 318 1 
1 2A72 MET A 2 ? UNP P49802 ? ? 'CLONING ARTIFACT' 319 2 
2 2A72 SER B 1 ? UNP P49802 ? ? 'CLONING ARTIFACT' 318 3 
2 2A72 MET B 2 ? UNP P49802 ? ? 'CLONING ARTIFACT' 319 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CL  non-polymer         . 'CHLORIDE ION'  ? 'Cl -1'          35.453  
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2A72 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.1 
_exptl_crystal.density_percent_sol   41.1 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.5 
_exptl_crystal_grow.pdbx_details    'PEG 3350, (NH4)2SO4, BIS-TRIS, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS HTC' 
_diffrn_detector.pdbx_collection_date   2005-06-13 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU FR-E DW' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     2A72 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.d_resolution_high            2.0 
_reflns.d_resolution_low             45.93 
_reflns.number_all                   19896 
_reflns.number_obs                   19896 
_reflns.percent_possible_obs         95.9 
_reflns.pdbx_Rmerge_I_obs            0.068 
_reflns.pdbx_Rsym_value              0.079 
_reflns.pdbx_netI_over_sigmaI        14.9 
_reflns.B_iso_Wilson_estimate        28.3 
_reflns.pdbx_redundancy              3.6 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.0 
_reflns_shell.d_res_low              2.11 
_reflns_shell.percent_possible_all   81.2 
_reflns_shell.Rmerge_I_obs           0.434 
_reflns_shell.pdbx_Rsym_value        0.536 
_reflns_shell.meanI_over_sigI_obs    2.2 
_reflns_shell.pdbx_redundancy        2.8 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      2457 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2A72 
_refine.ls_number_reflns_obs                     18842 
_refine.ls_number_reflns_all                     18842 
_refine.pdbx_ls_sigma_I                          0 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             53.00 
_refine.ls_d_res_high                            2.00 
_refine.ls_percent_reflns_obs                    95.64 
_refine.ls_R_factor_obs                          0.18756 
_refine.ls_R_factor_all                          0.18756 
_refine.ls_R_factor_R_work                       0.18425 
_refine.ls_R_factor_R_free                       0.2489 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.2 
_refine.ls_number_reflns_R_free                  1028 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.954 
_refine.correlation_coeff_Fo_to_Fc_free          0.911 
_refine.B_iso_mean                               28.800 
_refine.aniso_B[1][1]                            0.43 
_refine.aniso_B[2][2]                            -1.70 
_refine.aniso_B[3][3]                            1.51 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.50 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      1FQJ_B.pdb 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.195 
_refine.pdbx_overall_ESU_R_Free                  0.184 
_refine.overall_SU_ML                            0.136 
_refine.overall_SU_B                             9.269 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2167 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         1 
_refine_hist.number_atoms_solvent             231 
_refine_hist.number_atoms_total               2399 
_refine_hist.d_res_high                       2.00 
_refine_hist.d_res_low                        53.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.012  0.022  ? 2239 'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.001  0.020  ? 1983 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.237  1.957  ? 3023 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            0.857  3.000  ? 4627 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       4.952  5.000  ? 268  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       37.217 23.739 ? 115  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       13.973 15.000 ? 398  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       17.800 15.000 ? 18   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.073  0.200  ? 307  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.004  0.020  ? 2488 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.001  0.020  ? 480  'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.214  0.200  ? 513  'X-RAY DIFFRACTION' ? 
r_nbd_other                  0.173  0.200  ? 1879 'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.182  0.200  ? 1099 'X-RAY DIFFRACTION' ? 
r_nbtor_other                0.085  0.200  ? 1113 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.177  0.200  ? 169  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.164  0.200  ? 12   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         0.241  0.200  ? 65   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.151  0.200  ? 14   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.679  1.500  ? 1395 'X-RAY DIFFRACTION' ? 
r_mcbond_other               0.159  1.500  ? 532  'X-RAY DIFFRACTION' ? 
r_mcangle_it                 0.951  2.000  ? 2156 'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.761  3.000  ? 996  'X-RAY DIFFRACTION' ? 
r_scangle_it                 2.799  4.500  ? 865  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1 A 692  0.18 0.50  'medium positional' 1 'X-RAY DIFFRACTION' 1 ? ? ? 
1 A 1134 0.62 5.00  'loose positional'  1 'X-RAY DIFFRACTION' 2 ? ? ? 
1 A 692  0.44 2.00  'medium thermal'    1 'X-RAY DIFFRACTION' 3 ? ? ? 
1 A 1134 0.96 10.00 'loose thermal'     1 'X-RAY DIFFRACTION' 4 ? ? ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.000 
_refine_ls_shell.d_res_low                        2.052 
_refine_ls_shell.number_reflns_R_work             1084 
_refine_ls_shell.R_factor_R_work                  0.291 
_refine_ls_shell.percent_reflns_obs               73.02 
_refine_ls_shell.R_factor_R_free                  0.404 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             58 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.id 
_struct_ncs_dom.details 
1 1 A 
1 2 B 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1 A 326 A 443 1 5 A ARG 9 ? A ALA 126 ? 1 ? 
2 B 326 B 443 1 5 B ARG 9 ? B ALA 126 ? 1 ? 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                  2A72 
_struct.title                     'Structure of the regulator of G-protein signaling domain of RGS7' 
_struct.pdbx_descriptor           'Regulator of G-protein signalling 7' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2A72 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            
;Human RGS7, regulator of G-protein signaling 7, GTPase-activating proteins (GAP), Structural Genomics, Structural Genomics Consortium, SGC, SIGNALING PROTEIN
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 6   ? TRP A 13  ? SER A 323 TRP A 330 1 ? 8  
HELX_P HELX_P2  2  GLY A 16  ? ASP A 23  ? GLY A 333 ASP A 340 1 ? 8  
HELX_P HELX_P3  3  ASP A 23  ? GLU A 37  ? ASP A 340 GLU A 354 1 ? 15 
HELX_P HELX_P4  4  SER A 40  ? LYS A 53  ? SER A 357 LYS A 370 1 ? 14 
HELX_P HELX_P5  5  LYS A 54  ? ARG A 55  ? LYS A 371 ARG A 372 5 ? 2  
HELX_P HELX_P6  6  PRO A 56  ? LYS A 58  ? PRO A 373 LYS A 375 5 ? 3  
HELX_P HELX_P7  7  GLU A 59  ? LEU A 72  ? GLU A 376 LEU A 389 1 ? 14 
HELX_P HELX_P8  8  ASP A 83  ? GLU A 96  ? ASP A 400 GLU A 413 1 ? 14 
HELX_P HELX_P9  9  PHE A 102 ? ASP A 116 ? PHE A 419 ASP A 433 1 ? 15 
HELX_P HELX_P10 10 ASP A 116 ? SER A 124 ? ASP A 433 SER A 441 1 ? 9  
HELX_P HELX_P11 11 SER A 124 ? ALA A 133 ? SER A 441 ALA A 450 1 ? 10 
HELX_P HELX_P12 12 SER B 6   ? TRP B 13  ? SER B 323 TRP B 330 1 ? 8  
HELX_P HELX_P13 13 GLY B 16  ? ASP B 23  ? GLY B 333 ASP B 340 1 ? 8  
HELX_P HELX_P14 14 ASP B 23  ? GLU B 37  ? ASP B 340 GLU B 354 1 ? 15 
HELX_P HELX_P15 15 SER B 40  ? ARG B 55  ? SER B 357 ARG B 372 1 ? 16 
HELX_P HELX_P16 16 PRO B 56  ? LYS B 58  ? PRO B 373 LYS B 375 5 ? 3  
HELX_P HELX_P17 17 GLU B 59  ? LEU B 72  ? GLU B 376 LEU B 389 1 ? 14 
HELX_P HELX_P18 18 ASP B 83  ? GLU B 96  ? ASP B 400 GLU B 413 1 ? 14 
HELX_P HELX_P19 19 PHE B 102 ? ASP B 116 ? PHE B 419 ASP B 433 1 ? 15 
HELX_P HELX_P20 20 ASP B 116 ? SER B 124 ? ASP B 433 SER B 441 1 ? 9  
HELX_P HELX_P21 21 SER B 124 ? ALA B 133 ? SER B 441 ALA B 450 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    2 
_struct_site.details              'BINDING SITE FOR RESIDUE CL A 301' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 2 ARG A 120 ? ARG A 437 . ? 1_555 ? 
2 AC1 2 ARG A 123 ? ARG A 440 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2A72 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2A72 
_atom_sites.fract_transf_matrix[1][1]   0.034584 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.008438 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009431 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.019610 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . SER A 1 1   ? -3.325  25.604  26.348 1.00 31.45 ? 318 SER A N   1 
ATOM   2    C  CA  . SER A 1 1   ? -2.134  25.251  27.193 1.00 31.43 ? 318 SER A CA  1 
ATOM   3    C  C   . SER A 1 1   ? -2.568  24.711  28.564 1.00 32.42 ? 318 SER A C   1 
ATOM   4    O  O   . SER A 1 1   ? -3.599  25.128  29.100 1.00 32.45 ? 318 SER A O   1 
ATOM   5    C  CB  . SER A 1 1   ? -1.246  26.486  27.406 1.00 31.02 ? 318 SER A CB  1 
ATOM   6    O  OG  . SER A 1 1   ? -0.573  26.893  26.230 1.00 31.27 ? 318 SER A OG  1 
ATOM   7    N  N   . MET A 1 2   ? -1.758  23.822  29.139 1.00 33.66 ? 319 MET A N   1 
ATOM   8    C  CA  . MET A 1 2   ? -2.012  23.241  30.469 1.00 34.65 ? 319 MET A CA  1 
ATOM   9    C  C   . MET A 1 2   ? -2.020  24.315  31.556 1.00 34.79 ? 319 MET A C   1 
ATOM   10   O  O   . MET A 1 2   ? -1.299  25.290  31.464 1.00 35.10 ? 319 MET A O   1 
ATOM   11   C  CB  . MET A 1 2   ? -0.912  22.249  30.821 1.00 34.57 ? 319 MET A CB  1 
ATOM   12   C  CG  . MET A 1 2   ? -0.873  21.002  29.975 1.00 35.55 ? 319 MET A CG  1 
ATOM   13   S  SD  . MET A 1 2   ? 0.777   20.271  29.998 1.00 36.61 ? 319 MET A SD  1 
ATOM   14   C  CE  . MET A 1 2   ? 1.007   19.943  31.765 1.00 36.03 ? 319 MET A CE  1 
ATOM   15   N  N   . LYS A 1 3   ? -2.839  24.133  32.582 1.00 35.43 ? 320 LYS A N   1 
ATOM   16   C  CA  . LYS A 1 3   ? -2.828  25.031  33.732 1.00 35.71 ? 320 LYS A CA  1 
ATOM   17   C  C   . LYS A 1 3   ? -1.850  24.445  34.740 1.00 35.98 ? 320 LYS A C   1 
ATOM   18   O  O   . LYS A 1 3   ? -1.442  23.292  34.607 1.00 35.79 ? 320 LYS A O   1 
ATOM   19   C  CB  . LYS A 1 3   ? -4.227  25.160  34.344 1.00 35.82 ? 320 LYS A CB  1 
ATOM   20   N  N   . GLU A 1 4   ? -1.466  25.237  35.737 1.00 36.34 ? 321 GLU A N   1 
ATOM   21   C  CA  . GLU A 1 4   ? -0.620  24.722  36.798 1.00 37.20 ? 321 GLU A CA  1 
ATOM   22   C  C   . GLU A 1 4   ? -1.450  23.703  37.578 1.00 37.14 ? 321 GLU A C   1 
ATOM   23   O  O   . GLU A 1 4   ? -2.638  23.933  37.807 1.00 37.96 ? 321 GLU A O   1 
ATOM   24   C  CB  . GLU A 1 4   ? -0.154  25.836  37.734 1.00 37.40 ? 321 GLU A CB  1 
ATOM   25   N  N   . PRO A 1 5   ? -0.840  22.577  37.955 1.00 37.27 ? 322 PRO A N   1 
ATOM   26   C  CA  . PRO A 1 5   ? -1.481  21.605  38.845 1.00 37.01 ? 322 PRO A CA  1 
ATOM   27   C  C   . PRO A 1 5   ? -1.939  22.285  40.114 1.00 36.12 ? 322 PRO A C   1 
ATOM   28   O  O   . PRO A 1 5   ? -1.142  23.011  40.727 1.00 35.98 ? 322 PRO A O   1 
ATOM   29   C  CB  . PRO A 1 5   ? -0.359  20.630  39.197 1.00 36.86 ? 322 PRO A CB  1 
ATOM   30   C  CG  . PRO A 1 5   ? 0.747   20.926  38.329 1.00 37.87 ? 322 PRO A CG  1 
ATOM   31   C  CD  . PRO A 1 5   ? 0.507   22.154  37.550 1.00 37.14 ? 322 PRO A CD  1 
ATOM   32   N  N   . SER A 1 6   ? -3.189  22.062  40.514 1.00 35.19 ? 323 SER A N   1 
ATOM   33   C  CA  . SER A 1 6   ? -3.684  22.625  41.776 1.00 34.67 ? 323 SER A CA  1 
ATOM   34   C  C   . SER A 1 6   ? -2.911  22.044  42.966 1.00 34.53 ? 323 SER A C   1 
ATOM   35   O  O   . SER A 1 6   ? -2.295  20.987  42.857 1.00 33.24 ? 323 SER A O   1 
ATOM   36   C  CB  . SER A 1 6   ? -5.173  22.342  41.959 1.00 34.56 ? 323 SER A CB  1 
ATOM   37   O  OG  . SER A 1 6   ? -5.377  20.983  42.293 1.00 33.49 ? 323 SER A OG  1 
ATOM   38   N  N   . GLN A 1 7   ? -2.976  22.721  44.109 1.00 34.97 ? 324 GLN A N   1 
ATOM   39   C  CA  . GLN A 1 7   ? -2.394  22.180  45.330 1.00 35.78 ? 324 GLN A CA  1 
ATOM   40   C  C   . GLN A 1 7   ? -2.989  20.791  45.693 1.00 35.04 ? 324 GLN A C   1 
ATOM   41   O  O   . GLN A 1 7   ? -2.258  19.887  46.111 1.00 35.24 ? 324 GLN A O   1 
ATOM   42   C  CB  . GLN A 1 7   ? -2.541  23.161  46.501 1.00 36.12 ? 324 GLN A CB  1 
ATOM   43   C  CG  . GLN A 1 7   ? -1.873  22.636  47.788 1.00 37.69 ? 324 GLN A CG  1 
ATOM   44   C  CD  . GLN A 1 7   ? -2.063  23.540  48.978 1.00 38.80 ? 324 GLN A CD  1 
ATOM   45   O  OE1 . GLN A 1 7   ? -3.027  23.400  49.733 1.00 40.70 ? 324 GLN A OE1 1 
ATOM   46   N  NE2 . GLN A 1 7   ? -1.121  24.463  49.173 1.00 42.13 ? 324 GLN A NE2 1 
ATOM   47   N  N   . GLN A 1 8   ? -4.295  20.624  45.501 1.00 34.16 ? 325 GLN A N   1 
ATOM   48   C  CA  . GLN A 1 8   ? -4.978  19.336  45.732 1.00 34.34 ? 325 GLN A CA  1 
ATOM   49   C  C   . GLN A 1 8   ? -4.409  18.191  44.885 1.00 33.37 ? 325 GLN A C   1 
ATOM   50   O  O   . GLN A 1 8   ? -4.242  17.069  45.353 1.00 33.82 ? 325 GLN A O   1 
ATOM   51   C  CB  . GLN A 1 8   ? -6.477  19.487  45.435 1.00 34.48 ? 325 GLN A CB  1 
ATOM   52   C  CG  . GLN A 1 8   ? -7.310  18.263  45.750 1.00 36.20 ? 325 GLN A CG  1 
ATOM   53   N  N   . ARG A 1 9   ? -4.127  18.485  43.632 1.00 32.10 ? 326 ARG A N   1 
ATOM   54   C  CA  . ARG A 1 9   ? -3.561  17.511  42.721 1.00 31.22 ? 326 ARG A CA  1 
ATOM   55   C  C   . ARG A 1 9   ? -2.152  17.076  43.153 1.00 30.90 ? 326 ARG A C   1 
ATOM   56   O  O   . ARG A 1 9   ? -1.817  15.878  43.165 1.00 29.73 ? 326 ARG A O   1 
ATOM   57   C  CB  . ARG A 1 9   ? -3.527  18.139  41.323 1.00 31.49 ? 326 ARG A CB  1 
ATOM   58   C  CG  . ARG A 1 9   ? -3.240  17.183  40.223 1.00 30.66 ? 326 ARG A CG  1 
ATOM   59   C  CD  . ARG A 1 9   ? -3.442  17.856  38.884 1.00 31.03 ? 326 ARG A CD  1 
ATOM   60   N  NE  . ARG A 1 9   ? -2.900  17.055  37.789 1.00 30.61 ? 326 ARG A NE  1 
ATOM   61   C  CZ  . ARG A 1 9   ? -2.959  17.421  36.516 1.00 29.73 ? 326 ARG A CZ  1 
ATOM   62   N  NH1 . ARG A 1 9   ? -3.499  18.575  36.180 1.00 27.55 ? 326 ARG A NH1 1 
ATOM   63   N  NH2 . ARG A 1 9   ? -2.450  16.638  35.578 1.00 31.52 ? 326 ARG A NH2 1 
ATOM   64   N  N   . VAL A 1 10  ? -1.314  18.062  43.472 1.00 30.39 ? 327 VAL A N   1 
ATOM   65   C  CA  . VAL A 1 10  ? 0.051   17.799  43.908 1.00 30.40 ? 327 VAL A CA  1 
ATOM   66   C  C   . VAL A 1 10  ? 0.075   16.985  45.219 1.00 30.33 ? 327 VAL A C   1 
ATOM   67   O  O   . VAL A 1 10  ? 0.838   16.021  45.353 1.00 29.87 ? 327 VAL A O   1 
ATOM   68   C  CB  . VAL A 1 10  ? 0.836   19.119  44.056 1.00 30.70 ? 327 VAL A CB  1 
ATOM   69   C  CG1 . VAL A 1 10  ? 2.236   18.867  44.634 1.00 32.00 ? 327 VAL A CG1 1 
ATOM   70   C  CG2 . VAL A 1 10  ? 0.947   19.821  42.699 1.00 30.35 ? 327 VAL A CG2 1 
ATOM   71   N  N   . LYS A 1 11  ? -0.778  17.369  46.165 1.00 30.36 ? 328 LYS A N   1 
ATOM   72   C  CA  . LYS A 1 11  ? -0.973  16.616  47.388 1.00 30.75 ? 328 LYS A CA  1 
ATOM   73   C  C   . LYS A 1 11  ? -1.326  15.160  47.135 1.00 30.60 ? 328 LYS A C   1 
ATOM   74   O  O   . LYS A 1 11  ? -0.780  14.251  47.788 1.00 30.17 ? 328 LYS A O   1 
ATOM   75   C  CB  . LYS A 1 11  ? -2.042  17.271  48.271 1.00 31.17 ? 328 LYS A CB  1 
ATOM   76   C  CG  . LYS A 1 11  ? -1.509  18.452  49.027 1.00 33.78 ? 328 LYS A CG  1 
ATOM   77   C  CD  . LYS A 1 11  ? -2.600  19.439  49.479 1.00 36.00 ? 328 LYS A CD  1 
ATOM   78   C  CE  . LYS A 1 11  ? -3.444  18.929  50.617 1.00 36.48 ? 328 LYS A CE  1 
ATOM   79   N  NZ  . LYS A 1 11  ? -4.114  20.108  51.308 1.00 37.58 ? 328 LYS A NZ  1 
ATOM   80   N  N   . ARG A 1 12  ? -2.206  14.926  46.167 1.00 30.76 ? 329 ARG A N   1 
ATOM   81   C  CA  . ARG A 1 12  ? -2.647  13.566  45.868 1.00 30.82 ? 329 ARG A CA  1 
ATOM   82   C  C   . ARG A 1 12  ? -1.496  12.623  45.530 1.00 30.00 ? 329 ARG A C   1 
ATOM   83   O  O   . ARG A 1 12  ? -1.544  11.447  45.857 1.00 30.04 ? 329 ARG A O   1 
ATOM   84   C  CB  . ARG A 1 12  ? -3.662  13.553  44.736 1.00 31.13 ? 329 ARG A CB  1 
ATOM   85   C  CG  . ARG A 1 12  ? -4.558  12.319  44.720 1.00 33.33 ? 329 ARG A CG  1 
ATOM   86   C  CD  . ARG A 1 12  ? -5.970  12.664  44.170 1.00 37.60 ? 329 ARG A CD  1 
ATOM   87   N  NE  . ARG A 1 12  ? -5.840  13.376  42.904 1.00 39.92 ? 329 ARG A NE  1 
ATOM   88   C  CZ  . ARG A 1 12  ? -6.403  14.546  42.577 1.00 39.62 ? 329 ARG A CZ  1 
ATOM   89   N  NH1 . ARG A 1 12  ? -7.294  15.179  43.348 1.00 39.64 ? 329 ARG A NH1 1 
ATOM   90   N  NH2 . ARG A 1 12  ? -6.119  15.050  41.386 1.00 40.31 ? 329 ARG A NH2 1 
ATOM   91   N  N   . TRP A 1 13  ? -0.475  13.133  44.867 1.00 29.93 ? 330 TRP A N   1 
ATOM   92   C  CA  . TRP A 1 13  ? 0.689   12.291  44.503 1.00 30.46 ? 330 TRP A CA  1 
ATOM   93   C  C   . TRP A 1 13  ? 1.395   11.718  45.757 1.00 30.44 ? 330 TRP A C   1 
ATOM   94   O  O   . TRP A 1 13  ? 2.134   10.737  45.672 1.00 30.33 ? 330 TRP A O   1 
ATOM   95   C  CB  . TRP A 1 13  ? 1.706   13.081  43.698 1.00 31.03 ? 330 TRP A CB  1 
ATOM   96   C  CG  . TRP A 1 13  ? 1.185   13.788  42.502 1.00 30.31 ? 330 TRP A CG  1 
ATOM   97   C  CD1 . TRP A 1 13  ? 0.026   13.543  41.829 1.00 31.37 ? 330 TRP A CD1 1 
ATOM   98   C  CD2 . TRP A 1 13  ? 1.825   14.861  41.827 1.00 32.27 ? 330 TRP A CD2 1 
ATOM   99   N  NE1 . TRP A 1 13  ? -0.096  14.406  40.773 1.00 31.21 ? 330 TRP A NE1 1 
ATOM   100  C  CE2 . TRP A 1 13  ? 0.998   15.227  40.743 1.00 32.59 ? 330 TRP A CE2 1 
ATOM   101  C  CE3 . TRP A 1 13  ? 3.028   15.549  42.023 1.00 31.97 ? 330 TRP A CE3 1 
ATOM   102  C  CZ2 . TRP A 1 13  ? 1.319   16.272  39.874 1.00 32.69 ? 330 TRP A CZ2 1 
ATOM   103  C  CZ3 . TRP A 1 13  ? 3.347   16.568  41.154 1.00 32.39 ? 330 TRP A CZ3 1 
ATOM   104  C  CH2 . TRP A 1 13  ? 2.497   16.925  40.092 1.00 31.37 ? 330 TRP A CH2 1 
ATOM   105  N  N   . GLY A 1 14  ? 1.156   12.349  46.904 1.00 30.67 ? 331 GLY A N   1 
ATOM   106  C  CA  . GLY A 1 14  ? 1.683   11.893  48.209 1.00 30.37 ? 331 GLY A CA  1 
ATOM   107  C  C   . GLY A 1 14  ? 0.916   10.787  48.903 1.00 30.63 ? 331 GLY A C   1 
ATOM   108  O  O   . GLY A 1 14  ? 1.324   10.348  49.977 1.00 31.36 ? 331 GLY A O   1 
ATOM   109  N  N   . PHE A 1 15  ? -0.178  10.311  48.308 1.00 30.29 ? 332 PHE A N   1 
ATOM   110  C  CA  . PHE A 1 15  ? -0.952  9.216   48.889 1.00 30.95 ? 332 PHE A CA  1 
ATOM   111  C  C   . PHE A 1 15  ? -0.555  7.848   48.352 1.00 30.70 ? 332 PHE A C   1 
ATOM   112  O  O   . PHE A 1 15  ? -1.240  6.857   48.579 1.00 31.42 ? 332 PHE A O   1 
ATOM   113  C  CB  . PHE A 1 15  ? -2.453  9.454   48.694 1.00 31.10 ? 332 PHE A CB  1 
ATOM   114  C  CG  . PHE A 1 15  ? -3.013  10.534  49.577 1.00 30.64 ? 332 PHE A CG  1 
ATOM   115  C  CD1 . PHE A 1 15  ? -2.832  11.876  49.263 1.00 34.07 ? 332 PHE A CD1 1 
ATOM   116  C  CD2 . PHE A 1 15  ? -3.705  10.217  50.722 1.00 31.95 ? 332 PHE A CD2 1 
ATOM   117  C  CE1 . PHE A 1 15  ? -3.356  12.872  50.089 1.00 33.19 ? 332 PHE A CE1 1 
ATOM   118  C  CE2 . PHE A 1 15  ? -4.231  11.205  51.531 1.00 31.80 ? 332 PHE A CE2 1 
ATOM   119  C  CZ  . PHE A 1 15  ? -4.053  12.524  51.215 1.00 30.72 ? 332 PHE A CZ  1 
ATOM   120  N  N   . GLY A 1 16  ? 0.595   7.771   47.704 1.00 30.86 ? 333 GLY A N   1 
ATOM   121  C  CA  . GLY A 1 16  ? 1.076   6.500   47.185 1.00 30.26 ? 333 GLY A CA  1 
ATOM   122  C  C   . GLY A 1 16  ? 1.705   6.645   45.830 1.00 29.98 ? 333 GLY A C   1 
ATOM   123  O  O   . GLY A 1 16  ? 1.323   7.511   45.032 1.00 28.84 ? 333 GLY A O   1 
ATOM   124  N  N   . MET A 1 17  ? 2.699   5.799   45.577 1.00 29.29 ? 334 MET A N   1 
ATOM   125  C  CA  . MET A 1 17  ? 3.405   5.852   44.330 1.00 29.97 ? 334 MET A CA  1 
ATOM   126  C  C   . MET A 1 17  ? 2.453   5.639   43.163 1.00 29.35 ? 334 MET A C   1 
ATOM   127  O  O   . MET A 1 17  ? 2.623   6.238   42.111 1.00 29.32 ? 334 MET A O   1 
ATOM   128  C  CB  . MET A 1 17  ? 4.555   4.822   44.307 1.00 30.10 ? 334 MET A CB  1 
ATOM   129  C  CG  . MET A 1 17  ? 5.442   4.995   43.080 1.00 30.60 ? 334 MET A CG  1 
ATOM   130  S  SD  . MET A 1 17  ? 6.900   3.950   43.026 1.00 31.58 ? 334 MET A SD  1 
ATOM   131  C  CE  . MET A 1 17  ? 6.133   2.356   42.773 1.00 30.27 ? 334 MET A CE  1 
ATOM   132  N  N   . ASP A 1 18  ? 1.442   4.800   43.355 1.00 29.81 ? 335 ASP A N   1 
ATOM   133  C  CA  . ASP A 1 18  ? 0.472   4.540   42.305 1.00 31.60 ? 335 ASP A CA  1 
ATOM   134  C  C   . ASP A 1 18  ? -0.248  5.822   41.867 1.00 31.73 ? 335 ASP A C   1 
ATOM   135  O  O   . ASP A 1 18  ? -0.482  6.015   40.670 1.00 31.25 ? 335 ASP A O   1 
ATOM   136  C  CB  . ASP A 1 18  ? -0.536  3.485   42.756 1.00 32.27 ? 335 ASP A CB  1 
ATOM   137  C  CG  . ASP A 1 18  ? 0.071   2.080   42.835 1.00 34.42 ? 335 ASP A CG  1 
ATOM   138  O  OD1 . ASP A 1 18  ? 1.180   1.850   42.277 1.00 36.66 ? 335 ASP A OD1 1 
ATOM   139  O  OD2 . ASP A 1 18  ? -0.607  1.199   43.428 1.00 39.70 ? 335 ASP A OD2 1 
ATOM   140  N  N   . GLU A 1 19  ? -0.538  6.690   42.840 1.00 32.03 ? 336 GLU A N   1 
ATOM   141  C  CA  . GLU A 1 19  ? -1.167  8.009   42.609 1.00 33.14 ? 336 GLU A CA  1 
ATOM   142  C  C   . GLU A 1 19  ? -0.321  8.933   41.787 1.00 32.88 ? 336 GLU A C   1 
ATOM   143  O  O   . GLU A 1 19  ? -0.831  9.647   40.916 1.00 32.83 ? 336 GLU A O   1 
ATOM   144  C  CB  . GLU A 1 19  ? -1.461  8.725   43.942 1.00 34.07 ? 336 GLU A CB  1 
ATOM   145  C  CG  . GLU A 1 19  ? -2.496  8.045   44.754 1.00 35.81 ? 336 GLU A CG  1 
ATOM   146  C  CD  . GLU A 1 19  ? -3.779  7.890   43.996 1.00 41.22 ? 336 GLU A CD  1 
ATOM   147  O  OE1 . GLU A 1 19  ? -4.217  8.886   43.358 1.00 44.71 ? 336 GLU A OE1 1 
ATOM   148  O  OE2 . GLU A 1 19  ? -4.344  6.765   44.022 1.00 44.98 ? 336 GLU A OE2 1 
ATOM   149  N  N   . ALA A 1 20  ? 0.981   8.910   42.063 1.00 32.98 ? 337 ALA A N   1 
ATOM   150  C  CA  . ALA A 1 20  ? 1.918   9.745   41.354 1.00 32.56 ? 337 ALA A CA  1 
ATOM   151  C  C   . ALA A 1 20  ? 2.064   9.234   39.922 1.00 32.98 ? 337 ALA A C   1 
ATOM   152  O  O   . ALA A 1 20  ? 2.170   10.028  38.992 1.00 32.41 ? 337 ALA A O   1 
ATOM   153  C  CB  . ALA A 1 20  ? 3.223   9.762   42.044 1.00 32.68 ? 337 ALA A CB  1 
ATOM   154  N  N   . LEU A 1 21  ? 2.043   7.915   39.759 1.00 32.09 ? 338 LEU A N   1 
ATOM   155  C  CA  . LEU A 1 21  ? 2.282   7.303   38.457 1.00 32.26 ? 338 LEU A CA  1 
ATOM   156  C  C   . LEU A 1 21  ? 1.100   7.407   37.496 1.00 32.09 ? 338 LEU A C   1 
ATOM   157  O  O   . LEU A 1 21  ? 1.320   7.511   36.303 1.00 32.33 ? 338 LEU A O   1 
ATOM   158  C  CB  . LEU A 1 21  ? 2.697   5.838   38.615 1.00 31.49 ? 338 LEU A CB  1 
ATOM   159  C  CG  . LEU A 1 21  ? 4.104   5.621   39.159 1.00 33.52 ? 338 LEU A CG  1 
ATOM   160  C  CD1 . LEU A 1 21  ? 4.351   4.144   39.466 1.00 34.24 ? 338 LEU A CD1 1 
ATOM   161  C  CD2 . LEU A 1 21  ? 5.147   6.164   38.205 1.00 35.33 ? 338 LEU A CD2 1 
ATOM   162  N  N   . LYS A 1 22  ? -0.132  7.358   38.009 1.00 32.26 ? 339 LYS A N   1 
ATOM   163  C  CA  . LYS A 1 22  ? -1.321  7.409   37.178 1.00 32.70 ? 339 LYS A CA  1 
ATOM   164  C  C   . LYS A 1 22  ? -1.656  8.831   36.733 1.00 32.09 ? 339 LYS A C   1 
ATOM   165  O  O   . LYS A 1 22  ? -2.423  9.007   35.791 1.00 31.83 ? 339 LYS A O   1 
ATOM   166  C  CB  . LYS A 1 22  ? -2.522  6.762   37.886 1.00 32.91 ? 339 LYS A CB  1 
ATOM   167  C  CG  . LYS A 1 22  ? -3.171  7.607   38.968 1.00 33.79 ? 339 LYS A CG  1 
ATOM   168  C  CD  . LYS A 1 22  ? -4.114  6.806   39.881 1.00 34.96 ? 339 LYS A CD  1 
ATOM   169  C  CE  . LYS A 1 22  ? -5.267  6.182   39.096 1.00 38.85 ? 339 LYS A CE  1 
ATOM   170  N  NZ  . LYS A 1 22  ? -6.529  5.943   39.873 1.00 39.45 ? 339 LYS A NZ  1 
ATOM   171  N  N   . ASP A 1 23  ? -1.126  9.845   37.422 1.00 31.05 ? 340 ASP A N   1 
ATOM   172  C  CA  . ASP A 1 23  ? -1.258  11.237  36.973 1.00 30.79 ? 340 ASP A CA  1 
ATOM   173  C  C   . ASP A 1 23  ? -0.088  11.518  36.020 1.00 31.25 ? 340 ASP A C   1 
ATOM   174  O  O   . ASP A 1 23  ? 1.072   11.412  36.410 1.00 31.25 ? 340 ASP A O   1 
ATOM   175  C  CB  . ASP A 1 23  ? -1.272  12.194  38.170 1.00 31.27 ? 340 ASP A CB  1 
ATOM   176  C  CG  . ASP A 1 23  ? -1.565  13.652  37.779 1.00 29.41 ? 340 ASP A CG  1 
ATOM   177  O  OD1 . ASP A 1 23  ? -1.249  14.087  36.653 1.00 28.82 ? 340 ASP A OD1 1 
ATOM   178  O  OD2 . ASP A 1 23  ? -2.102  14.382  38.626 1.00 29.17 ? 340 ASP A OD2 1 
ATOM   179  N  N   . PRO A 1 24  ? -0.381  11.831  34.743 1.00 31.90 ? 341 PRO A N   1 
ATOM   180  C  CA  . PRO A 1 24  ? 0.728   11.981  33.774 1.00 31.90 ? 341 PRO A CA  1 
ATOM   181  C  C   . PRO A 1 24  ? 1.649   13.166  34.086 1.00 31.71 ? 341 PRO A C   1 
ATOM   182  O  O   . PRO A 1 24  ? 2.792   13.142  33.686 1.00 31.51 ? 341 PRO A O   1 
ATOM   183  C  CB  . PRO A 1 24  ? 0.008   12.207  32.439 1.00 31.86 ? 341 PRO A CB  1 
ATOM   184  C  CG  . PRO A 1 24  ? -1.300  12.759  32.803 1.00 33.25 ? 341 PRO A CG  1 
ATOM   185  C  CD  . PRO A 1 24  ? -1.686  12.084  34.111 1.00 32.11 ? 341 PRO A CD  1 
ATOM   186  N  N   . VAL A 1 25  ? 1.142   14.186  34.788 1.00 31.46 ? 342 VAL A N   1 
ATOM   187  C  CA  . VAL A 1 25  ? 1.977   15.294  35.280 1.00 30.88 ? 342 VAL A CA  1 
ATOM   188  C  C   . VAL A 1 25  ? 2.792   14.853  36.509 1.00 31.19 ? 342 VAL A C   1 
ATOM   189  O  O   . VAL A 1 25  ? 3.957   15.239  36.647 1.00 31.24 ? 342 VAL A O   1 
ATOM   190  C  CB  . VAL A 1 25  ? 1.131   16.553  35.571 1.00 30.87 ? 342 VAL A CB  1 
ATOM   191  C  CG1 . VAL A 1 25  ? 1.980   17.673  36.268 1.00 31.66 ? 342 VAL A CG1 1 
ATOM   192  C  CG2 . VAL A 1 25  ? 0.493   17.047  34.284 1.00 29.35 ? 342 VAL A CG2 1 
ATOM   193  N  N   . GLY A 1 26  ? 2.178   14.050  37.390 1.00 30.97 ? 343 GLY A N   1 
ATOM   194  C  CA  . GLY A 1 26  ? 2.883   13.423  38.498 1.00 30.90 ? 343 GLY A CA  1 
ATOM   195  C  C   . GLY A 1 26  ? 4.007   12.503  38.038 1.00 30.62 ? 343 GLY A C   1 
ATOM   196  O  O   . GLY A 1 26  ? 5.145   12.541  38.572 1.00 30.10 ? 343 GLY A O   1 
ATOM   197  N  N   . ARG A 1 27  ? 3.708   11.680  37.037 1.00 30.67 ? 344 ARG A N   1 
ATOM   198  C  CA  . ARG A 1 27  ? 4.724   10.789  36.429 1.00 30.43 ? 344 ARG A CA  1 
ATOM   199  C  C   . ARG A 1 27  ? 5.895   11.595  35.845 1.00 30.55 ? 344 ARG A C   1 
ATOM   200  O  O   . ARG A 1 27  ? 7.065   11.257  36.053 1.00 29.62 ? 344 ARG A O   1 
ATOM   201  C  CB  . ARG A 1 27  ? 4.092   9.934   35.344 1.00 30.38 ? 344 ARG A CB  1 
ATOM   202  C  CG  . ARG A 1 27  ? 4.987   8.844   34.766 1.00 31.02 ? 344 ARG A CG  1 
ATOM   203  C  CD  . ARG A 1 27  ? 4.256   8.059   33.649 1.00 32.80 ? 344 ARG A CD  1 
ATOM   204  N  NE  . ARG A 1 27  ? 3.280   7.111   34.207 1.00 35.07 ? 344 ARG A NE  1 
ATOM   205  C  CZ  . ARG A 1 27  ? 2.821   6.030   33.567 1.00 36.71 ? 344 ARG A CZ  1 
ATOM   206  N  NH1 . ARG A 1 27  ? 3.212   5.735   32.323 1.00 37.29 ? 344 ARG A NH1 1 
ATOM   207  N  NH2 . ARG A 1 27  ? 1.950   5.239   34.172 1.00 37.30 ? 344 ARG A NH2 1 
ATOM   208  N  N   . GLU A 1 28  ? 5.567   12.665  35.134 1.00 30.94 ? 345 GLU A N   1 
ATOM   209  C  CA  . GLU A 1 28  ? 6.566   13.562  34.537 1.00 32.44 ? 345 GLU A CA  1 
ATOM   210  C  C   . GLU A 1 28  ? 7.486   14.188  35.586 1.00 31.62 ? 345 GLU A C   1 
ATOM   211  O  O   . GLU A 1 28  ? 8.723   14.229  35.435 1.00 31.29 ? 345 GLU A O   1 
ATOM   212  C  CB  . GLU A 1 28  ? 5.871   14.695  33.764 1.00 32.47 ? 345 GLU A CB  1 
ATOM   213  C  CG  . GLU A 1 28  ? 5.389   14.288  32.385 1.00 34.45 ? 345 GLU A CG  1 
ATOM   214  C  CD  . GLU A 1 28  ? 4.665   15.413  31.636 1.00 35.31 ? 345 GLU A CD  1 
ATOM   215  O  OE1 . GLU A 1 28  ? 4.044   16.298  32.287 1.00 38.83 ? 345 GLU A OE1 1 
ATOM   216  O  OE2 . GLU A 1 28  ? 4.717   15.402  30.379 1.00 37.63 ? 345 GLU A OE2 1 
ATOM   217  N  N   . GLN A 1 29  ? 6.873   14.699  36.644 1.00 31.17 ? 346 GLN A N   1 
ATOM   218  C  CA  . GLN A 1 29  ? 7.633   15.338  37.716 1.00 30.88 ? 346 GLN A CA  1 
ATOM   219  C  C   . GLN A 1 29  ? 8.534   14.350  38.461 1.00 30.05 ? 346 GLN A C   1 
ATOM   220  O  O   . GLN A 1 29  ? 9.663   14.682  38.771 1.00 30.23 ? 346 GLN A O   1 
ATOM   221  C  CB  . GLN A 1 29  ? 6.690   16.050  38.695 1.00 30.99 ? 346 GLN A CB  1 
ATOM   222  C  CG  . GLN A 1 29  ? 6.044   17.290  38.096 1.00 31.49 ? 346 GLN A CG  1 
ATOM   223  C  CD  . GLN A 1 29  ? 7.071   18.307  37.614 1.00 31.67 ? 346 GLN A CD  1 
ATOM   224  O  OE1 . GLN A 1 29  ? 7.937   18.714  38.372 1.00 29.92 ? 346 GLN A OE1 1 
ATOM   225  N  NE2 . GLN A 1 29  ? 7.011   18.666  36.327 1.00 30.37 ? 346 GLN A NE2 1 
ATOM   226  N  N   . PHE A 1 30  ? 8.021   13.146  38.709 1.00 29.57 ? 347 PHE A N   1 
ATOM   227  C  CA  . PHE A 1 30  ? 8.723   12.067  39.409 1.00 29.17 ? 347 PHE A CA  1 
ATOM   228  C  C   . PHE A 1 30  ? 9.973   11.710  38.575 1.00 28.91 ? 347 PHE A C   1 
ATOM   229  O  O   . PHE A 1 30  ? 11.076  11.656  39.088 1.00 28.19 ? 347 PHE A O   1 
ATOM   230  C  CB  . PHE A 1 30  ? 7.724   10.861  39.583 1.00 28.45 ? 347 PHE A CB  1 
ATOM   231  C  CG  . PHE A 1 30  ? 8.240   9.660   40.371 1.00 28.31 ? 347 PHE A CG  1 
ATOM   232  C  CD1 . PHE A 1 30  ? 9.291   9.752   41.292 1.00 27.39 ? 347 PHE A CD1 1 
ATOM   233  C  CD2 . PHE A 1 30  ? 7.605   8.423   40.231 1.00 27.66 ? 347 PHE A CD2 1 
ATOM   234  C  CE1 . PHE A 1 30  ? 9.731   8.626   42.002 1.00 27.43 ? 347 PHE A CE1 1 
ATOM   235  C  CE2 . PHE A 1 30  ? 8.033   7.288   40.949 1.00 28.04 ? 347 PHE A CE2 1 
ATOM   236  C  CZ  . PHE A 1 30  ? 9.106   7.394   41.840 1.00 28.66 ? 347 PHE A CZ  1 
ATOM   237  N  N   . LEU A 1 31  ? 9.782   11.490  37.278 1.00 29.12 ? 348 LEU A N   1 
ATOM   238  C  CA  . LEU A 1 31  ? 10.873  11.187  36.379 1.00 28.63 ? 348 LEU A CA  1 
ATOM   239  C  C   . LEU A 1 31  ? 11.878  12.326  36.314 1.00 28.53 ? 348 LEU A C   1 
ATOM   240  O  O   . LEU A 1 31  ? 13.078  12.075  36.344 1.00 27.39 ? 348 LEU A O   1 
ATOM   241  C  CB  . LEU A 1 31  ? 10.344  10.903  34.969 1.00 28.73 ? 348 LEU A CB  1 
ATOM   242  C  CG  . LEU A 1 31  ? 11.374  10.501  33.893 1.00 30.09 ? 348 LEU A CG  1 
ATOM   243  C  CD1 . LEU A 1 31  ? 12.202  9.208   34.261 1.00 30.60 ? 348 LEU A CD1 1 
ATOM   244  C  CD2 . LEU A 1 31  ? 10.673  10.331  32.548 1.00 30.08 ? 348 LEU A CD2 1 
ATOM   245  N  N   . LYS A 1 32  ? 11.399  13.569  36.204 1.00 28.35 ? 349 LYS A N   1 
ATOM   246  C  CA  . LYS A 1 32  ? 12.282  14.747  36.108 1.00 29.26 ? 349 LYS A CA  1 
ATOM   247  C  C   . LYS A 1 32  ? 13.183  14.804  37.337 1.00 28.85 ? 349 LYS A C   1 
ATOM   248  O  O   . LYS A 1 32  ? 14.409  14.996  37.222 1.00 28.16 ? 349 LYS A O   1 
ATOM   249  C  CB  . LYS A 1 32  ? 11.458  16.049  36.010 1.00 29.23 ? 349 LYS A CB  1 
ATOM   250  C  CG  . LYS A 1 32  ? 12.254  17.300  35.724 1.00 31.31 ? 349 LYS A CG  1 
ATOM   251  C  CD  . LYS A 1 32  ? 11.331  18.505  35.409 1.00 32.19 ? 349 LYS A CD  1 
ATOM   252  C  CE  . LYS A 1 32  ? 12.067  19.869  35.453 1.00 34.15 ? 349 LYS A CE  1 
ATOM   253  N  NZ  . LYS A 1 32  ? 11.546  20.772  36.543 1.00 37.34 ? 349 LYS A NZ  1 
ATOM   254  N  N   . PHE A 1 33  ? 12.566  14.593  38.505 1.00 28.54 ? 350 PHE A N   1 
ATOM   255  C  CA  . PHE A 1 33  ? 13.297  14.571  39.768 1.00 29.16 ? 350 PHE A CA  1 
ATOM   256  C  C   . PHE A 1 33  ? 14.411  13.532  39.763 1.00 28.65 ? 350 PHE A C   1 
ATOM   257  O  O   . PHE A 1 33  ? 15.538  13.825  40.143 1.00 28.15 ? 350 PHE A O   1 
ATOM   258  C  CB  . PHE A 1 33  ? 12.370  14.313  40.965 1.00 29.15 ? 350 PHE A CB  1 
ATOM   259  C  CG  . PHE A 1 33  ? 13.121  13.924  42.207 1.00 30.21 ? 350 PHE A CG  1 
ATOM   260  C  CD1 . PHE A 1 33  ? 13.833  14.888  42.932 1.00 30.24 ? 350 PHE A CD1 1 
ATOM   261  C  CD2 . PHE A 1 33  ? 13.195  12.586  42.608 1.00 29.44 ? 350 PHE A CD2 1 
ATOM   262  C  CE1 . PHE A 1 33  ? 14.563  14.527  44.050 1.00 29.95 ? 350 PHE A CE1 1 
ATOM   263  C  CE2 . PHE A 1 33  ? 13.938  12.222  43.729 1.00 28.99 ? 350 PHE A CE2 1 
ATOM   264  C  CZ  . PHE A 1 33  ? 14.603  13.202  44.452 1.00 29.87 ? 350 PHE A CZ  1 
ATOM   265  N  N   . LEU A 1 34  ? 14.091  12.319  39.332 1.00 28.62 ? 351 LEU A N   1 
ATOM   266  C  CA  . LEU A 1 34  ? 15.056  11.212  39.367 1.00 28.72 ? 351 LEU A CA  1 
ATOM   267  C  C   . LEU A 1 34  ? 16.216  11.431  38.402 1.00 29.33 ? 351 LEU A C   1 
ATOM   268  O  O   . LEU A 1 34  ? 17.360  11.036  38.685 1.00 28.38 ? 351 LEU A O   1 
ATOM   269  C  CB  . LEU A 1 34  ? 14.377  9.880   39.069 1.00 28.37 ? 351 LEU A CB  1 
ATOM   270  C  CG  . LEU A 1 34  ? 13.288  9.456   40.062 1.00 28.49 ? 351 LEU A CG  1 
ATOM   271  C  CD1 . LEU A 1 34  ? 12.532  8.301   39.477 1.00 29.26 ? 351 LEU A CD1 1 
ATOM   272  C  CD2 . LEU A 1 34  ? 13.852  9.104   41.467 1.00 29.49 ? 351 LEU A CD2 1 
ATOM   273  N  N   . GLU A 1 35  ? 15.914  12.054  37.266 1.00 29.80 ? 352 GLU A N   1 
ATOM   274  C  CA  . GLU A 1 35  ? 16.928  12.419  36.280 1.00 30.51 ? 352 GLU A CA  1 
ATOM   275  C  C   . GLU A 1 35  ? 17.862  13.482  36.806 1.00 30.07 ? 352 GLU A C   1 
ATOM   276  O  O   . GLU A 1 35  ? 19.051  13.443  36.507 1.00 29.62 ? 352 GLU A O   1 
ATOM   277  C  CB  . GLU A 1 35  ? 16.274  12.849  34.956 1.00 30.91 ? 352 GLU A CB  1 
ATOM   278  C  CG  . GLU A 1 35  ? 15.552  11.672  34.336 1.00 34.60 ? 352 GLU A CG  1 
ATOM   279  C  CD  . GLU A 1 35  ? 15.097  11.874  32.925 1.00 39.96 ? 352 GLU A CD  1 
ATOM   280  O  OE1 . GLU A 1 35  ? 14.548  12.958  32.615 1.00 42.87 ? 352 GLU A OE1 1 
ATOM   281  O  OE2 . GLU A 1 35  ? 15.252  10.908  32.145 1.00 42.30 ? 352 GLU A OE2 1 
ATOM   282  N  N   . SER A 1 36  ? 17.343  14.413  37.602 1.00 30.05 ? 353 SER A N   1 
ATOM   283  C  CA  . SER A 1 36  ? 18.187  15.474  38.183 1.00 30.51 ? 353 SER A CA  1 
ATOM   284  C  C   . SER A 1 36  ? 19.243  14.920  39.152 1.00 31.05 ? 353 SER A C   1 
ATOM   285  O  O   . SER A 1 36  ? 20.290  15.528  39.334 1.00 30.35 ? 353 SER A O   1 
ATOM   286  C  CB  . SER A 1 36  ? 17.343  16.558  38.861 1.00 30.36 ? 353 SER A CB  1 
ATOM   287  O  OG  . SER A 1 36  ? 16.766  16.101  40.064 1.00 30.13 ? 353 SER A OG  1 
ATOM   288  N  N   . GLU A 1 37  ? 18.956  13.759  39.747 1.00 31.59 ? 354 GLU A N   1 
ATOM   289  C  CA  . GLU A 1 37  ? 19.859  13.097  40.684 1.00 32.61 ? 354 GLU A CA  1 
ATOM   290  C  C   . GLU A 1 37  ? 20.492  11.840  40.092 1.00 31.73 ? 354 GLU A C   1 
ATOM   291  O  O   . GLU A 1 37  ? 21.014  11.022  40.838 1.00 32.46 ? 354 GLU A O   1 
ATOM   292  C  CB  . GLU A 1 37  ? 19.111  12.726  41.983 1.00 32.70 ? 354 GLU A CB  1 
ATOM   293  C  CG  . GLU A 1 37  ? 18.357  13.900  42.621 1.00 34.96 ? 354 GLU A CG  1 
ATOM   294  C  CD  . GLU A 1 37  ? 18.093  13.736  44.126 1.00 35.65 ? 354 GLU A CD  1 
ATOM   295  O  OE1 . GLU A 1 37  ? 17.977  12.579  44.586 1.00 39.20 ? 354 GLU A OE1 1 
ATOM   296  O  OE2 . GLU A 1 37  ? 18.004  14.779  44.838 1.00 37.07 ? 354 GLU A OE2 1 
ATOM   297  N  N   . PHE A 1 38  ? 20.427  11.680  38.770 1.00 31.13 ? 355 PHE A N   1 
ATOM   298  C  CA  . PHE A 1 38  ? 21.034  10.543  38.063 1.00 30.90 ? 355 PHE A CA  1 
ATOM   299  C  C   . PHE A 1 38  ? 20.569  9.179   38.550 1.00 31.67 ? 355 PHE A C   1 
ATOM   300  O  O   . PHE A 1 38  ? 21.336  8.206   38.524 1.00 31.75 ? 355 PHE A O   1 
ATOM   301  C  CB  . PHE A 1 38  ? 22.582  10.655  38.097 1.00 30.91 ? 355 PHE A CB  1 
ATOM   302  C  CG  . PHE A 1 38  ? 23.090  11.887  37.412 1.00 29.85 ? 355 PHE A CG  1 
ATOM   303  C  CD1 . PHE A 1 38  ? 23.176  13.090  38.094 1.00 30.40 ? 355 PHE A CD1 1 
ATOM   304  C  CD2 . PHE A 1 38  ? 23.392  11.866  36.072 1.00 29.51 ? 355 PHE A CD2 1 
ATOM   305  C  CE1 . PHE A 1 38  ? 23.596  14.242  37.453 1.00 30.96 ? 355 PHE A CE1 1 
ATOM   306  C  CE2 . PHE A 1 38  ? 23.817  13.011  35.426 1.00 29.20 ? 355 PHE A CE2 1 
ATOM   307  C  CZ  . PHE A 1 38  ? 23.918  14.197  36.114 1.00 30.36 ? 355 PHE A CZ  1 
ATOM   308  N  N   . SER A 1 39  ? 19.304  9.072   38.956 1.00 31.91 ? 356 SER A N   1 
ATOM   309  C  CA  . SER A 1 39  ? 18.826  7.796   39.491 1.00 32.63 ? 356 SER A CA  1 
ATOM   310  C  C   . SER A 1 39  ? 17.527  7.303   38.861 1.00 32.04 ? 356 SER A C   1 
ATOM   311  O  O   . SER A 1 39  ? 16.702  6.671   39.533 1.00 33.02 ? 356 SER A O   1 
ATOM   312  C  CB  . SER A 1 39  ? 18.732  7.875   41.019 1.00 32.76 ? 356 SER A CB  1 
ATOM   313  O  OG  . SER A 1 39  ? 17.655  8.678   41.429 1.00 36.44 ? 356 SER A OG  1 
ATOM   314  N  N   . SER A 1 40  ? 17.383  7.517   37.556 1.00 31.27 ? 357 SER A N   1 
ATOM   315  C  CA  . SER A 1 40  ? 16.118  7.276   36.877 1.00 31.09 ? 357 SER A CA  1 
ATOM   316  C  C   . SER A 1 40  ? 15.990  5.921   36.177 1.00 31.26 ? 357 SER A C   1 
ATOM   317  O  O   . SER A 1 40  ? 14.923  5.610   35.642 1.00 31.43 ? 357 SER A O   1 
ATOM   318  C  CB  . SER A 1 40  ? 15.836  8.402   35.864 1.00 31.18 ? 357 SER A CB  1 
ATOM   319  O  OG  . SER A 1 40  ? 16.769  8.398   34.802 1.00 29.90 ? 357 SER A OG  1 
ATOM   320  N  N   . GLU A 1 41  ? 17.054  5.121   36.170 1.00 31.40 ? 358 GLU A N   1 
ATOM   321  C  CA  . GLU A 1 41  ? 17.037  3.868   35.420 1.00 32.01 ? 358 GLU A CA  1 
ATOM   322  C  C   . GLU A 1 41  ? 15.909  2.908   35.869 1.00 31.27 ? 358 GLU A C   1 
ATOM   323  O  O   . GLU A 1 41  ? 15.248  2.301   35.029 1.00 30.57 ? 358 GLU A O   1 
ATOM   324  C  CB  . GLU A 1 41  ? 18.420  3.181   35.442 1.00 32.10 ? 358 GLU A CB  1 
ATOM   325  C  CG  . GLU A 1 41  ? 19.032  3.010   36.848 1.00 34.78 ? 358 GLU A CG  1 
ATOM   326  C  CD  . GLU A 1 41  ? 19.839  4.215   37.339 1.00 36.26 ? 358 GLU A CD  1 
ATOM   327  O  OE1 . GLU A 1 41  ? 20.709  4.014   38.204 1.00 42.67 ? 358 GLU A OE1 1 
ATOM   328  O  OE2 . GLU A 1 41  ? 19.624  5.353   36.887 1.00 36.47 ? 358 GLU A OE2 1 
ATOM   329  N  N   . ASN A 1 42  ? 15.670  2.827   37.177 1.00 31.58 ? 359 ASN A N   1 
ATOM   330  C  CA  . ASN A 1 42  ? 14.651  1.947   37.735 1.00 32.00 ? 359 ASN A CA  1 
ATOM   331  C  C   . ASN A 1 42  ? 13.236  2.297   37.231 1.00 31.96 ? 359 ASN A C   1 
ATOM   332  O  O   . ASN A 1 42  ? 12.499  1.404   36.785 1.00 32.45 ? 359 ASN A O   1 
ATOM   333  C  CB  . ASN A 1 42  ? 14.727  1.931   39.275 1.00 31.57 ? 359 ASN A CB  1 
ATOM   334  C  CG  . ASN A 1 42  ? 15.779  0.939   39.817 1.00 33.28 ? 359 ASN A CG  1 
ATOM   335  O  OD1 . ASN A 1 42  ? 16.541  0.308   39.049 1.00 33.21 ? 359 ASN A OD1 1 
ATOM   336  N  ND2 . ASN A 1 42  ? 15.813  0.786   41.155 1.00 31.57 ? 359 ASN A ND2 1 
ATOM   337  N  N   . LEU A 1 43  ? 12.861  3.582   37.275 1.00 31.99 ? 360 LEU A N   1 
ATOM   338  C  CA  . LEU A 1 43  ? 11.554  4.033   36.732 1.00 31.74 ? 360 LEU A CA  1 
ATOM   339  C  C   . LEU A 1 43  ? 11.511  3.907   35.213 1.00 31.56 ? 360 LEU A C   1 
ATOM   340  O  O   . LEU A 1 43  ? 10.492  3.492   34.660 1.00 31.16 ? 360 LEU A O   1 
ATOM   341  C  CB  . LEU A 1 43  ? 11.246  5.484   37.158 1.00 31.75 ? 360 LEU A CB  1 
ATOM   342  C  CG  . LEU A 1 43  ? 9.892   6.089   36.782 1.00 31.24 ? 360 LEU A CG  1 
ATOM   343  C  CD1 . LEU A 1 43  ? 8.738   5.259   37.309 1.00 30.19 ? 360 LEU A CD1 1 
ATOM   344  C  CD2 . LEU A 1 43  ? 9.805   7.548   37.287 1.00 31.67 ? 360 LEU A CD2 1 
ATOM   345  N  N   . ARG A 1 44  ? 12.622  4.216   34.530 1.00 31.63 ? 361 ARG A N   1 
ATOM   346  C  CA  . ARG A 1 44  ? 12.654  4.116   33.063 1.00 30.99 ? 361 ARG A CA  1 
ATOM   347  C  C   . ARG A 1 44  ? 12.441  2.666   32.610 1.00 31.13 ? 361 ARG A C   1 
ATOM   348  O  O   . ARG A 1 44  ? 11.731  2.413   31.648 1.00 30.95 ? 361 ARG A O   1 
ATOM   349  C  CB  . ARG A 1 44  ? 13.927  4.734   32.484 1.00 31.61 ? 361 ARG A CB  1 
ATOM   350  C  CG  . ARG A 1 44  ? 13.928  6.278   32.598 1.00 31.11 ? 361 ARG A CG  1 
ATOM   351  C  CD  . ARG A 1 44  ? 14.899  7.012   31.709 1.00 31.11 ? 361 ARG A CD  1 
ATOM   352  N  NE  . ARG A 1 44  ? 16.267  6.849   32.182 1.00 32.58 ? 361 ARG A NE  1 
ATOM   353  C  CZ  . ARG A 1 44  ? 17.111  5.930   31.709 1.00 33.02 ? 361 ARG A CZ  1 
ATOM   354  N  NH1 . ARG A 1 44  ? 16.742  5.103   30.728 1.00 31.93 ? 361 ARG A NH1 1 
ATOM   355  N  NH2 . ARG A 1 44  ? 18.330  5.848   32.217 1.00 33.11 ? 361 ARG A NH2 1 
ATOM   356  N  N   . PHE A 1 45  ? 13.030  1.722   33.332 1.00 31.62 ? 362 PHE A N   1 
ATOM   357  C  CA  . PHE A 1 45  ? 12.822  0.281   33.080 1.00 31.53 ? 362 PHE A CA  1 
ATOM   358  C  C   . PHE A 1 45  ? 11.371  -0.078  33.313 1.00 31.32 ? 362 PHE A C   1 
ATOM   359  O  O   . PHE A 1 45  ? 10.757  -0.760  32.487 1.00 31.21 ? 362 PHE A O   1 
ATOM   360  C  CB  . PHE A 1 45  ? 13.666  -0.568  34.018 1.00 31.22 ? 362 PHE A CB  1 
ATOM   361  C  CG  . PHE A 1 45  ? 13.371  -2.060  33.938 1.00 31.68 ? 362 PHE A CG  1 
ATOM   362  C  CD1 . PHE A 1 45  ? 13.814  -2.819  32.848 1.00 30.14 ? 362 PHE A CD1 1 
ATOM   363  C  CD2 . PHE A 1 45  ? 12.688  -2.701  34.962 1.00 30.47 ? 362 PHE A CD2 1 
ATOM   364  C  CE1 . PHE A 1 45  ? 13.547  -4.193  32.767 1.00 31.88 ? 362 PHE A CE1 1 
ATOM   365  C  CE2 . PHE A 1 45  ? 12.428  -4.093  34.901 1.00 32.62 ? 362 PHE A CE2 1 
ATOM   366  C  CZ  . PHE A 1 45  ? 12.860  -4.836  33.803 1.00 31.24 ? 362 PHE A CZ  1 
ATOM   367  N  N   . TRP A 1 46  ? 10.847  0.349   34.463 1.00 31.20 ? 363 TRP A N   1 
ATOM   368  C  CA  . TRP A 1 46  ? 9.453   0.096   34.819 1.00 30.92 ? 363 TRP A CA  1 
ATOM   369  C  C   . TRP A 1 46  ? 8.485   0.608   33.736 1.00 30.78 ? 363 TRP A C   1 
ATOM   370  O  O   . TRP A 1 46  ? 7.533   -0.097  33.339 1.00 29.94 ? 363 TRP A O   1 
ATOM   371  C  CB  . TRP A 1 46  ? 9.107   0.701   36.186 1.00 31.33 ? 363 TRP A CB  1 
ATOM   372  C  CG  . TRP A 1 46  ? 7.740   0.265   36.676 1.00 31.26 ? 363 TRP A CG  1 
ATOM   373  C  CD1 . TRP A 1 46  ? 7.448   -0.853  37.413 1.00 32.90 ? 363 TRP A CD1 1 
ATOM   374  C  CD2 . TRP A 1 46  ? 6.500   0.941   36.462 1.00 31.93 ? 363 TRP A CD2 1 
ATOM   375  N  NE1 . TRP A 1 46  ? 6.089   -0.923  37.655 1.00 32.16 ? 363 TRP A NE1 1 
ATOM   376  C  CE2 . TRP A 1 46  ? 5.485   0.168   37.082 1.00 33.27 ? 363 TRP A CE2 1 
ATOM   377  C  CE3 . TRP A 1 46  ? 6.145   2.119   35.803 1.00 31.31 ? 363 TRP A CE3 1 
ATOM   378  C  CZ2 . TRP A 1 46  ? 4.138   0.547   37.065 1.00 32.84 ? 363 TRP A CZ2 1 
ATOM   379  C  CZ3 . TRP A 1 46  ? 4.807   2.503   35.789 1.00 32.19 ? 363 TRP A CZ3 1 
ATOM   380  C  CH2 . TRP A 1 46  ? 3.815   1.710   36.401 1.00 32.79 ? 363 TRP A CH2 1 
ATOM   381  N  N   . LEU A 1 47  ? 8.735   1.822   33.256 1.00 30.33 ? 364 LEU A N   1 
ATOM   382  C  CA  . LEU A 1 47  ? 7.909   2.418   32.206 1.00 30.64 ? 364 LEU A CA  1 
ATOM   383  C  C   . LEU A 1 47  ? 8.062   1.679   30.873 1.00 30.17 ? 364 LEU A C   1 
ATOM   384  O  O   . LEU A 1 47  ? 7.090   1.508   30.148 1.00 31.18 ? 364 LEU A O   1 
ATOM   385  C  CB  . LEU A 1 47  ? 8.234   3.908   32.036 1.00 31.10 ? 364 LEU A CB  1 
ATOM   386  C  CG  . LEU A 1 47  ? 7.951   4.777   33.259 1.00 31.88 ? 364 LEU A CG  1 
ATOM   387  C  CD1 . LEU A 1 47  ? 8.635   6.130   33.107 1.00 33.87 ? 364 LEU A CD1 1 
ATOM   388  C  CD2 . LEU A 1 47  ? 6.445   4.921   33.455 1.00 33.36 ? 364 LEU A CD2 1 
ATOM   389  N  N   . ALA A 1 48  ? 9.270   1.237   30.544 1.00 30.51 ? 365 ALA A N   1 
ATOM   390  C  CA  . ALA A 1 48  ? 9.496   0.465   29.308 1.00 29.74 ? 365 ALA A CA  1 
ATOM   391  C  C   . ALA A 1 48  ? 8.692   -0.871  29.333 1.00 29.08 ? 365 ALA A C   1 
ATOM   392  O  O   . ALA A 1 48  ? 8.137   -1.292  28.332 1.00 27.71 ? 365 ALA A O   1 
ATOM   393  C  CB  . ALA A 1 48  ? 10.964  0.172   29.142 1.00 30.71 ? 365 ALA A CB  1 
ATOM   394  N  N   . VAL A 1 49  ? 8.611   -1.507  30.494 1.00 28.94 ? 366 VAL A N   1 
ATOM   395  C  CA  . VAL A 1 49  ? 7.864   -2.765  30.620 1.00 28.77 ? 366 VAL A CA  1 
ATOM   396  C  C   . VAL A 1 49  ? 6.349   -2.531  30.564 1.00 29.04 ? 366 VAL A C   1 
ATOM   397  O  O   . VAL A 1 49  ? 5.602   -3.336  29.994 1.00 29.05 ? 366 VAL A O   1 
ATOM   398  C  CB  . VAL A 1 49  ? 8.275   -3.523  31.881 1.00 29.05 ? 366 VAL A CB  1 
ATOM   399  C  CG1 . VAL A 1 49  ? 7.421   -4.798  32.082 1.00 28.50 ? 366 VAL A CG1 1 
ATOM   400  C  CG2 . VAL A 1 49  ? 9.764   -3.929  31.763 1.00 29.27 ? 366 VAL A CG2 1 
ATOM   401  N  N   . GLU A 1 50  ? 5.902   -1.410  31.116 1.00 28.60 ? 367 GLU A N   1 
ATOM   402  C  CA  . GLU A 1 50  ? 4.520   -1.026  30.986 1.00 29.15 ? 367 GLU A CA  1 
ATOM   403  C  C   . GLU A 1 50  ? 4.154   -0.841  29.512 1.00 29.20 ? 367 GLU A C   1 
ATOM   404  O  O   . GLU A 1 50  ? 3.108   -1.314  29.077 1.00 28.72 ? 367 GLU A O   1 
ATOM   405  C  CB  . GLU A 1 50  ? 4.220   0.219   31.802 1.00 29.48 ? 367 GLU A CB  1 
ATOM   406  C  CG  . GLU A 1 50  ? 4.239   -0.056  33.303 1.00 30.21 ? 367 GLU A CG  1 
ATOM   407  C  CD  . GLU A 1 50  ? 3.157   -1.032  33.729 1.00 34.32 ? 367 GLU A CD  1 
ATOM   408  O  OE1 . GLU A 1 50  ? 2.020   -0.573  33.884 1.00 38.42 ? 367 GLU A OE1 1 
ATOM   409  O  OE2 . GLU A 1 50  ? 3.417   -2.250  33.900 1.00 34.26 ? 367 GLU A OE2 1 
ATOM   410  N  N   . ASP A 1 51  ? 5.031   -0.175  28.767 1.00 29.42 ? 368 ASP A N   1 
ATOM   411  C  CA  . ASP A 1 51  ? 4.893   0.000   27.322 1.00 29.67 ? 368 ASP A CA  1 
ATOM   412  C  C   . ASP A 1 51  ? 4.852   -1.325  26.538 1.00 28.88 ? 368 ASP A C   1 
ATOM   413  O  O   . ASP A 1 51  ? 4.047   -1.484  25.634 1.00 28.42 ? 368 ASP A O   1 
ATOM   414  C  CB  . ASP A 1 51  ? 6.062   0.861   26.799 1.00 29.96 ? 368 ASP A CB  1 
ATOM   415  C  CG  . ASP A 1 51  ? 6.013   1.048   25.312 1.00 32.74 ? 368 ASP A CG  1 
ATOM   416  O  OD1 . ASP A 1 51  ? 5.289   1.952   24.856 1.00 36.25 ? 368 ASP A OD1 1 
ATOM   417  O  OD2 . ASP A 1 51  ? 6.689   0.280   24.599 1.00 35.35 ? 368 ASP A OD2 1 
ATOM   418  N  N   . LEU A 1 52  ? 5.745   -2.250  26.878 1.00 28.99 ? 369 LEU A N   1 
ATOM   419  C  CA  . LEU A 1 52  ? 5.767   -3.592  26.300 1.00 29.13 ? 369 LEU A CA  1 
ATOM   420  C  C   . LEU A 1 52  ? 4.407   -4.288  26.375 1.00 29.35 ? 369 LEU A C   1 
ATOM   421  O  O   . LEU A 1 52  ? 3.947   -4.882  25.393 1.00 28.50 ? 369 LEU A O   1 
ATOM   422  C  CB  . LEU A 1 52  ? 6.809   -4.463  27.006 1.00 29.18 ? 369 LEU A CB  1 
ATOM   423  C  CG  . LEU A 1 52  ? 6.887   -5.900  26.467 1.00 30.40 ? 369 LEU A CG  1 
ATOM   424  C  CD1 . LEU A 1 52  ? 7.316   -5.919  25.008 1.00 28.76 ? 369 LEU A CD1 1 
ATOM   425  C  CD2 . LEU A 1 52  ? 7.796   -6.754  27.323 1.00 29.88 ? 369 LEU A CD2 1 
ATOM   426  N  N   . LYS A 1 53  ? 3.752   -4.184  27.536 1.00 29.55 ? 370 LYS A N   1 
ATOM   427  C  CA  . LYS A 1 53  ? 2.455   -4.838  27.757 1.00 29.69 ? 370 LYS A CA  1 
ATOM   428  C  C   . LYS A 1 53  ? 1.342   -4.282  26.859 1.00 30.24 ? 370 LYS A C   1 
ATOM   429  O  O   . LYS A 1 53  ? 0.297   -4.920  26.708 1.00 30.31 ? 370 LYS A O   1 
ATOM   430  C  CB  . LYS A 1 53  ? 2.042   -4.665  29.196 1.00 30.27 ? 370 LYS A CB  1 
ATOM   431  C  CG  . LYS A 1 53  ? 2.904   -5.381  30.244 1.00 31.22 ? 370 LYS A CG  1 
ATOM   432  C  CD  . LYS A 1 53  ? 2.368   -4.945  31.612 1.00 34.06 ? 370 LYS A CD  1 
ATOM   433  C  CE  . LYS A 1 53  ? 3.018   -5.618  32.775 1.00 35.61 ? 370 LYS A CE  1 
ATOM   434  N  NZ  . LYS A 1 53  ? 2.456   -5.044  34.009 1.00 36.67 ? 370 LYS A NZ  1 
ATOM   435  N  N   . LYS A 1 54  ? 1.561   -3.097  26.277 1.00 30.26 ? 371 LYS A N   1 
ATOM   436  C  CA  . LYS A 1 54  ? 0.625   -2.493  25.320 1.00 31.22 ? 371 LYS A CA  1 
ATOM   437  C  C   . LYS A 1 54  ? 0.945   -2.796  23.850 1.00 29.98 ? 371 LYS A C   1 
ATOM   438  O  O   . LYS A 1 54  ? 0.108   -2.539  22.992 1.00 28.93 ? 371 LYS A O   1 
ATOM   439  C  CB  . LYS A 1 54  ? 0.591   -0.959  25.473 1.00 31.04 ? 371 LYS A CB  1 
ATOM   440  C  CG  . LYS A 1 54  ? 0.518   -0.461  26.896 1.00 34.17 ? 371 LYS A CG  1 
ATOM   441  C  CD  . LYS A 1 54  ? 0.269   1.060   26.953 1.00 35.34 ? 371 LYS A CD  1 
ATOM   442  C  CE  . LYS A 1 54  ? -0.202  1.491   28.365 1.00 39.13 ? 371 LYS A CE  1 
ATOM   443  N  NZ  . LYS A 1 54  ? 0.949   1.596   29.326 1.00 41.82 ? 371 LYS A NZ  1 
ATOM   444  N  N   . ARG A 1 55  ? 2.137   -3.313  23.548 1.00 29.82 ? 372 ARG A N   1 
ATOM   445  C  CA  . ARG A 1 55  ? 2.574   -3.426  22.139 1.00 30.30 ? 372 ARG A CA  1 
ATOM   446  C  C   . ARG A 1 55  ? 1.864   -4.541  21.352 1.00 29.67 ? 372 ARG A C   1 
ATOM   447  O  O   . ARG A 1 55  ? 1.404   -5.515  21.928 1.00 29.68 ? 372 ARG A O   1 
ATOM   448  C  CB  . ARG A 1 55  ? 4.098   -3.601  22.043 1.00 30.68 ? 372 ARG A CB  1 
ATOM   449  C  CG  . ARG A 1 55  ? 4.902   -2.354  22.448 1.00 34.48 ? 372 ARG A CG  1 
ATOM   450  C  CD  . ARG A 1 55  ? 4.681   -1.157  21.498 1.00 38.82 ? 372 ARG A CD  1 
ATOM   451  N  NE  . ARG A 1 55  ? 5.217   0.085   22.060 1.00 41.86 ? 372 ARG A NE  1 
ATOM   452  C  CZ  . ARG A 1 55  ? 4.958   1.319   21.596 1.00 43.74 ? 372 ARG A CZ  1 
ATOM   453  N  NH1 . ARG A 1 55  ? 4.177   1.511   20.526 1.00 43.41 ? 372 ARG A NH1 1 
ATOM   454  N  NH2 . ARG A 1 55  ? 5.496   2.381   22.207 1.00 43.06 ? 372 ARG A NH2 1 
ATOM   455  N  N   . PRO A 1 56  ? 1.792   -4.417  20.019 1.00 29.07 ? 373 PRO A N   1 
ATOM   456  C  CA  . PRO A 1 56  ? 1.233   -5.547  19.302 1.00 28.97 ? 373 PRO A CA  1 
ATOM   457  C  C   . PRO A 1 56  ? 2.121   -6.796  19.482 1.00 29.27 ? 373 PRO A C   1 
ATOM   458  O  O   . PRO A 1 56  ? 3.341   -6.669  19.607 1.00 28.17 ? 373 PRO A O   1 
ATOM   459  C  CB  . PRO A 1 56  ? 1.208   -5.072  17.832 1.00 29.10 ? 373 PRO A CB  1 
ATOM   460  C  CG  . PRO A 1 56  ? 1.489   -3.631  17.848 1.00 28.23 ? 373 PRO A CG  1 
ATOM   461  C  CD  . PRO A 1 56  ? 2.222   -3.334  19.112 1.00 29.29 ? 373 PRO A CD  1 
ATOM   462  N  N   . ILE A 1 57  ? 1.519   -7.984  19.503 1.00 30.14 ? 374 ILE A N   1 
ATOM   463  C  CA  . ILE A 1 57  ? 2.285   -9.197  19.812 1.00 31.02 ? 374 ILE A CA  1 
ATOM   464  C  C   . ILE A 1 57  ? 3.452   -9.470  18.830 1.00 31.93 ? 374 ILE A C   1 
ATOM   465  O  O   . ILE A 1 57  ? 4.540   -9.833  19.278 1.00 32.15 ? 374 ILE A O   1 
ATOM   466  C  CB  . ILE A 1 57  ? 1.385   -10.450 19.941 1.00 31.12 ? 374 ILE A CB  1 
ATOM   467  C  CG1 . ILE A 1 57  ? 2.095   -11.542 20.771 1.00 30.84 ? 374 ILE A CG1 1 
ATOM   468  C  CG2 . ILE A 1 57  ? 0.973   -10.983 18.546 1.00 31.41 ? 374 ILE A CG2 1 
ATOM   469  C  CD1 . ILE A 1 57  ? 2.212   -11.237 22.270 1.00 31.00 ? 374 ILE A CD1 1 
ATOM   470  N  N   . LYS A 1 58  ? 3.252   -9.270  17.523 1.00 32.58 ? 375 LYS A N   1 
ATOM   471  C  CA  . LYS A 1 58  ? 4.341   -9.453  16.535 1.00 33.36 ? 375 LYS A CA  1 
ATOM   472  C  C   . LYS A 1 58  ? 5.568   -8.578  16.829 1.00 33.72 ? 375 LYS A C   1 
ATOM   473  O  O   . LYS A 1 58  ? 6.696   -8.922  16.466 1.00 33.95 ? 375 LYS A O   1 
ATOM   474  C  CB  . LYS A 1 58  ? 3.859   -9.153  15.116 1.00 33.46 ? 375 LYS A CB  1 
ATOM   475  C  CG  . LYS A 1 58  ? 2.937   -10.213 14.512 1.00 35.08 ? 375 LYS A CG  1 
ATOM   476  N  N   . GLU A 1 59  ? 5.332   -7.448  17.478 1.00 33.94 ? 376 GLU A N   1 
ATOM   477  C  CA  . GLU A 1 59  ? 6.385   -6.517  17.873 1.00 34.64 ? 376 GLU A CA  1 
ATOM   478  C  C   . GLU A 1 59  ? 7.068   -6.922  19.193 1.00 34.04 ? 376 GLU A C   1 
ATOM   479  O  O   . GLU A 1 59  ? 8.131   -6.406  19.523 1.00 33.79 ? 376 GLU A O   1 
ATOM   480  C  CB  . GLU A 1 59  ? 5.784   -5.103  18.003 1.00 34.66 ? 376 GLU A CB  1 
ATOM   481  C  CG  . GLU A 1 59  ? 6.800   -3.972  17.828 1.00 36.53 ? 376 GLU A CG  1 
ATOM   482  C  CD  . GLU A 1 59  ? 6.236   -2.599  18.164 1.00 36.44 ? 376 GLU A CD  1 
ATOM   483  O  OE1 . GLU A 1 59  ? 5.475   -2.070  17.334 1.00 39.52 ? 376 GLU A OE1 1 
ATOM   484  O  OE2 . GLU A 1 59  ? 6.557   -2.048  19.253 1.00 39.11 ? 376 GLU A OE2 1 
ATOM   485  N  N   . VAL A 1 60  ? 6.459   -7.835  19.953 1.00 33.86 ? 377 VAL A N   1 
ATOM   486  C  CA  . VAL A 1 60  ? 6.978   -8.188  21.282 1.00 33.54 ? 377 VAL A CA  1 
ATOM   487  C  C   . VAL A 1 60  ? 8.409   -8.776  21.304 1.00 33.54 ? 377 VAL A C   1 
ATOM   488  O  O   . VAL A 1 60  ? 9.217   -8.370  22.125 1.00 33.21 ? 377 VAL A O   1 
ATOM   489  C  CB  . VAL A 1 60  ? 5.956   -9.075  22.066 1.00 33.91 ? 377 VAL A CB  1 
ATOM   490  C  CG1 . VAL A 1 60  ? 6.598   -9.767  23.285 1.00 34.34 ? 377 VAL A CG1 1 
ATOM   491  C  CG2 . VAL A 1 60  ? 4.779   -8.222  22.520 1.00 32.47 ? 377 VAL A CG2 1 
ATOM   492  N  N   . PRO A 1 61  ? 8.732   -9.723  20.406 1.00 33.87 ? 378 PRO A N   1 
ATOM   493  C  CA  . PRO A 1 61  ? 10.102  -10.228 20.400 1.00 33.92 ? 378 PRO A CA  1 
ATOM   494  C  C   . PRO A 1 61  ? 11.180  -9.150  20.207 1.00 34.21 ? 378 PRO A C   1 
ATOM   495  O  O   . PRO A 1 61  ? 12.129  -9.081  20.998 1.00 33.59 ? 378 PRO A O   1 
ATOM   496  C  CB  . PRO A 1 61  ? 10.101  -11.230 19.248 1.00 33.70 ? 378 PRO A CB  1 
ATOM   497  C  CG  . PRO A 1 61  ? 8.693   -11.655 19.123 1.00 33.91 ? 378 PRO A CG  1 
ATOM   498  C  CD  . PRO A 1 61  ? 7.895   -10.427 19.426 1.00 33.92 ? 378 PRO A CD  1 
ATOM   499  N  N   . SER A 1 62  ? 11.033  -8.302  19.187 1.00 34.76 ? 379 SER A N   1 
ATOM   500  C  CA  . SER A 1 62  ? 11.992  -7.230  18.977 1.00 34.94 ? 379 SER A CA  1 
ATOM   501  C  C   . SER A 1 62  ? 11.979  -6.241  20.150 1.00 35.01 ? 379 SER A C   1 
ATOM   502  O  O   . SER A 1 62  ? 13.044  -5.800  20.596 1.00 34.78 ? 379 SER A O   1 
ATOM   503  C  CB  . SER A 1 62  ? 11.750  -6.516  17.629 1.00 35.73 ? 379 SER A CB  1 
ATOM   504  O  OG  . SER A 1 62  ? 10.499  -5.836  17.591 1.00 36.60 ? 379 SER A OG  1 
ATOM   505  N  N   . ARG A 1 63  ? 10.796  -5.916  20.683 1.00 34.80 ? 380 ARG A N   1 
ATOM   506  C  CA  . ARG A 1 63  ? 10.719  -4.996  21.832 1.00 34.54 ? 380 ARG A CA  1 
ATOM   507  C  C   . ARG A 1 63  ? 11.358  -5.583  23.089 1.00 33.94 ? 380 ARG A C   1 
ATOM   508  O  O   . ARG A 1 63  ? 12.058  -4.882  23.803 1.00 33.39 ? 380 ARG A O   1 
ATOM   509  C  CB  . ARG A 1 63  ? 9.277   -4.586  22.136 1.00 35.18 ? 380 ARG A CB  1 
ATOM   510  C  CG  . ARG A 1 63  ? 8.603   -3.775  21.020 1.00 37.16 ? 380 ARG A CG  1 
ATOM   511  N  N   . VAL A 1 64  ? 11.095  -6.863  23.361 1.00 33.36 ? 381 VAL A N   1 
ATOM   512  C  CA  . VAL A 1 64  ? 11.761  -7.573  24.450 1.00 33.52 ? 381 VAL A CA  1 
ATOM   513  C  C   . VAL A 1 64  ? 13.282  -7.420  24.332 1.00 33.49 ? 381 VAL A C   1 
ATOM   514  O  O   . VAL A 1 64  ? 13.963  -7.107  25.314 1.00 33.03 ? 381 VAL A O   1 
ATOM   515  C  CB  . VAL A 1 64  ? 11.389  -9.091  24.452 1.00 33.54 ? 381 VAL A CB  1 
ATOM   516  C  CG1 . VAL A 1 64  ? 12.325  -9.902  25.339 1.00 33.83 ? 381 VAL A CG1 1 
ATOM   517  C  CG2 . VAL A 1 64  ? 9.946   -9.295  24.901 1.00 33.92 ? 381 VAL A CG2 1 
ATOM   518  N  N   . GLN A 1 65  ? 13.803  -7.657  23.127 1.00 33.48 ? 382 GLN A N   1 
ATOM   519  C  CA  . GLN A 1 65  ? 15.231  -7.553  22.881 1.00 34.16 ? 382 GLN A CA  1 
ATOM   520  C  C   . GLN A 1 65  ? 15.734  -6.122  23.070 1.00 33.92 ? 382 GLN A C   1 
ATOM   521  O  O   . GLN A 1 65  ? 16.831  -5.925  23.589 1.00 33.50 ? 382 GLN A O   1 
ATOM   522  C  CB  . GLN A 1 65  ? 15.601  -8.076  21.479 1.00 34.50 ? 382 GLN A CB  1 
ATOM   523  C  CG  . GLN A 1 65  ? 15.409  -9.607  21.277 1.00 36.24 ? 382 GLN A CG  1 
ATOM   524  C  CD  . GLN A 1 65  ? 16.141  -10.471 22.310 1.00 37.71 ? 382 GLN A CD  1 
ATOM   525  O  OE1 . GLN A 1 65  ? 17.261  -10.155 22.718 1.00 37.98 ? 382 GLN A OE1 1 
ATOM   526  N  NE2 . GLN A 1 65  ? 15.490  -11.558 22.753 1.00 40.79 ? 382 GLN A NE2 1 
ATOM   527  N  N   . GLU A 1 66  ? 14.934  -5.134  22.666 1.00 34.01 ? 383 GLU A N   1 
ATOM   528  C  CA  . GLU A 1 66  ? 15.309  -3.723  22.856 1.00 34.99 ? 383 GLU A CA  1 
ATOM   529  C  C   . GLU A 1 66  ? 15.372  -3.343  24.339 1.00 33.86 ? 383 GLU A C   1 
ATOM   530  O  O   . GLU A 1 66  ? 16.275  -2.631  24.747 1.00 33.44 ? 383 GLU A O   1 
ATOM   531  C  CB  . GLU A 1 66  ? 14.342  -2.783  22.124 1.00 35.13 ? 383 GLU A CB  1 
ATOM   532  C  CG  . GLU A 1 66  ? 14.406  -2.905  20.613 1.00 36.90 ? 383 GLU A CG  1 
ATOM   533  C  CD  . GLU A 1 66  ? 13.352  -2.067  19.895 1.00 38.22 ? 383 GLU A CD  1 
ATOM   534  O  OE1 . GLU A 1 66  ? 12.374  -1.623  20.544 1.00 42.49 ? 383 GLU A OE1 1 
ATOM   535  O  OE2 . GLU A 1 66  ? 13.520  -1.846  18.671 1.00 42.50 ? 383 GLU A OE2 1 
ATOM   536  N  N   . ILE A 1 67  ? 14.427  -3.832  25.146 1.00 33.29 ? 384 ILE A N   1 
ATOM   537  C  CA  . ILE A 1 67  ? 14.467  -3.576  26.586 1.00 32.71 ? 384 ILE A CA  1 
ATOM   538  C  C   . ILE A 1 67  ? 15.676  -4.250  27.250 1.00 32.30 ? 384 ILE A C   1 
ATOM   539  O  O   . ILE A 1 67  ? 16.304  -3.669  28.143 1.00 32.41 ? 384 ILE A O   1 
ATOM   540  C  CB  . ILE A 1 67  ? 13.138  -3.995  27.288 1.00 33.00 ? 384 ILE A CB  1 
ATOM   541  C  CG1 . ILE A 1 67  ? 11.983  -3.134  26.768 1.00 34.09 ? 384 ILE A CG1 1 
ATOM   542  C  CG2 . ILE A 1 67  ? 13.246  -3.813  28.791 1.00 32.20 ? 384 ILE A CG2 1 
ATOM   543  C  CD1 . ILE A 1 67  ? 10.627  -3.769  26.908 1.00 34.45 ? 384 ILE A CD1 1 
ATOM   544  N  N   . TRP A 1 68  ? 15.989  -5.474  26.821 1.00 31.80 ? 385 TRP A N   1 
ATOM   545  C  CA  . TRP A 1 68  ? 17.155  -6.206  27.327 1.00 31.93 ? 385 TRP A CA  1 
ATOM   546  C  C   . TRP A 1 68  ? 18.448  -5.434  27.043 1.00 31.22 ? 385 TRP A C   1 
ATOM   547  O  O   . TRP A 1 68  ? 19.249  -5.189  27.952 1.00 30.17 ? 385 TRP A O   1 
ATOM   548  C  CB  . TRP A 1 68  ? 17.224  -7.609  26.708 1.00 32.30 ? 385 TRP A CB  1 
ATOM   549  C  CG  . TRP A 1 68  ? 18.499  -8.348  27.020 1.00 32.39 ? 385 TRP A CG  1 
ATOM   550  C  CD1 . TRP A 1 68  ? 19.562  -8.518  26.191 1.00 32.91 ? 385 TRP A CD1 1 
ATOM   551  C  CD2 . TRP A 1 68  ? 18.841  -8.997  28.254 1.00 32.60 ? 385 TRP A CD2 1 
ATOM   552  N  NE1 . TRP A 1 68  ? 20.543  -9.238  26.823 1.00 32.93 ? 385 TRP A NE1 1 
ATOM   553  C  CE2 . TRP A 1 68  ? 20.125  -9.546  28.092 1.00 33.13 ? 385 TRP A CE2 1 
ATOM   554  C  CE3 . TRP A 1 68  ? 18.178  -9.176  29.479 1.00 33.60 ? 385 TRP A CE3 1 
ATOM   555  C  CZ2 . TRP A 1 68  ? 20.768  -10.263 29.108 1.00 32.67 ? 385 TRP A CZ2 1 
ATOM   556  C  CZ3 . TRP A 1 68  ? 18.816  -9.873  30.485 1.00 32.86 ? 385 TRP A CZ3 1 
ATOM   557  C  CH2 . TRP A 1 68  ? 20.105  -10.408 30.291 1.00 32.61 ? 385 TRP A CH2 1 
ATOM   558  N  N   . GLN A 1 69  ? 18.618  -5.034  25.783 1.00 31.37 ? 386 GLN A N   1 
ATOM   559  C  CA  . GLN A 1 69  ? 19.738  -4.182  25.361 1.00 31.71 ? 386 GLN A CA  1 
ATOM   560  C  C   . GLN A 1 69  ? 19.928  -2.868  26.153 1.00 31.75 ? 386 GLN A C   1 
ATOM   561  O  O   . GLN A 1 69  ? 21.055  -2.532  26.519 1.00 31.44 ? 386 GLN A O   1 
ATOM   562  C  CB  . GLN A 1 69  ? 19.630  -3.867  23.860 1.00 32.24 ? 386 GLN A CB  1 
ATOM   563  C  CG  . GLN A 1 69  ? 19.922  -5.046  22.924 1.00 32.98 ? 386 GLN A CG  1 
ATOM   564  C  CD  . GLN A 1 69  ? 21.203  -5.772  23.277 1.00 34.06 ? 386 GLN A CD  1 
ATOM   565  O  OE1 . GLN A 1 69  ? 22.210  -5.152  23.613 1.00 37.27 ? 386 GLN A OE1 1 
ATOM   566  N  NE2 . GLN A 1 69  ? 21.170  -7.080  23.211 1.00 34.67 ? 386 GLN A NE2 1 
ATOM   567  N  N   . GLU A 1 70  ? 18.842  -2.148  26.429 1.00 32.01 ? 387 GLU A N   1 
ATOM   568  C  CA  . GLU A 1 70  ? 18.909  -0.841  27.126 1.00 32.36 ? 387 GLU A CA  1 
ATOM   569  C  C   . GLU A 1 70  ? 19.143  -0.923  28.666 1.00 31.81 ? 387 GLU A C   1 
ATOM   570  O  O   . GLU A 1 70  ? 19.791  -0.042  29.234 1.00 30.70 ? 387 GLU A O   1 
ATOM   571  C  CB  . GLU A 1 70  ? 17.619  -0.036  26.824 1.00 32.63 ? 387 GLU A CB  1 
ATOM   572  C  CG  . GLU A 1 70  ? 17.586  1.428   27.290 1.00 33.67 ? 387 GLU A CG  1 
ATOM   573  C  CD  . GLU A 1 70  ? 18.639  2.309   26.650 1.00 36.49 ? 387 GLU A CD  1 
ATOM   574  O  OE1 . GLU A 1 70  ? 19.031  2.072   25.482 1.00 39.67 ? 387 GLU A OE1 1 
ATOM   575  O  OE2 . GLU A 1 70  ? 19.084  3.263   27.324 1.00 39.34 ? 387 GLU A OE2 1 
ATOM   576  N  N   . PHE A 1 71  ? 18.626  -1.966  29.334 1.00 31.59 ? 388 PHE A N   1 
ATOM   577  C  CA  . PHE A 1 71  ? 18.660  -2.031  30.809 1.00 31.02 ? 388 PHE A CA  1 
ATOM   578  C  C   . PHE A 1 71  ? 19.415  -3.202  31.407 1.00 30.75 ? 388 PHE A C   1 
ATOM   579  O  O   . PHE A 1 71  ? 19.766  -3.168  32.595 1.00 30.18 ? 388 PHE A O   1 
ATOM   580  C  CB  . PHE A 1 71  ? 17.230  -2.015  31.383 1.00 32.19 ? 388 PHE A CB  1 
ATOM   581  C  CG  . PHE A 1 71  ? 16.477  -0.738  31.093 1.00 32.41 ? 388 PHE A CG  1 
ATOM   582  C  CD1 . PHE A 1 71  ? 16.698  0.396   31.851 1.00 32.40 ? 388 PHE A CD1 1 
ATOM   583  C  CD2 . PHE A 1 71  ? 15.566  -0.672  30.040 1.00 33.20 ? 388 PHE A CD2 1 
ATOM   584  C  CE1 . PHE A 1 71  ? 16.035  1.584   31.573 1.00 31.85 ? 388 PHE A CE1 1 
ATOM   585  C  CE2 . PHE A 1 71  ? 14.898  0.501   29.757 1.00 32.69 ? 388 PHE A CE2 1 
ATOM   586  C  CZ  . PHE A 1 71  ? 15.137  1.636   30.525 1.00 31.93 ? 388 PHE A CZ  1 
ATOM   587  N  N   . LEU A 1 72  ? 19.672  -4.243  30.612 1.00 30.18 ? 389 LEU A N   1 
ATOM   588  C  CA  . LEU A 1 72  ? 20.059  -5.518  31.203 1.00 30.34 ? 389 LEU A CA  1 
ATOM   589  C  C   . LEU A 1 72  ? 21.211  -6.246  30.545 1.00 29.91 ? 389 LEU A C   1 
ATOM   590  O  O   . LEU A 1 72  ? 21.938  -6.950  31.238 1.00 30.11 ? 389 LEU A O   1 
ATOM   591  C  CB  . LEU A 1 72  ? 18.831  -6.445  31.320 1.00 30.17 ? 389 LEU A CB  1 
ATOM   592  C  CG  . LEU A 1 72  ? 17.796  -6.053  32.387 1.00 30.75 ? 389 LEU A CG  1 
ATOM   593  C  CD1 . LEU A 1 72  ? 16.490  -6.833  32.214 1.00 28.88 ? 389 LEU A CD1 1 
ATOM   594  C  CD2 . LEU A 1 72  ? 18.351  -6.279  33.795 1.00 31.86 ? 389 LEU A CD2 1 
ATOM   595  N  N   . ALA A 1 73  ? 21.379  -6.080  29.234 1.00 29.83 ? 390 ALA A N   1 
ATOM   596  C  CA  . ALA A 1 73  ? 22.485  -6.707  28.497 1.00 29.85 ? 390 ALA A CA  1 
ATOM   597  C  C   . ALA A 1 73  ? 23.807  -6.239  29.051 1.00 29.66 ? 390 ALA A C   1 
ATOM   598  O  O   . ALA A 1 73  ? 23.849  -5.211  29.759 1.00 29.31 ? 390 ALA A O   1 
ATOM   599  C  CB  . ALA A 1 73  ? 22.410  -6.377  26.997 1.00 29.65 ? 390 ALA A CB  1 
ATOM   600  N  N   . PRO A 1 74  ? 24.887  -6.981  28.731 1.00 29.94 ? 391 PRO A N   1 
ATOM   601  C  CA  . PRO A 1 74  ? 26.203  -6.454  29.044 1.00 29.98 ? 391 PRO A CA  1 
ATOM   602  C  C   . PRO A 1 74  ? 26.280  -5.013  28.502 1.00 30.11 ? 391 PRO A C   1 
ATOM   603  O  O   . PRO A 1 74  ? 25.831  -4.697  27.416 1.00 30.46 ? 391 PRO A O   1 
ATOM   604  C  CB  . PRO A 1 74  ? 27.150  -7.400  28.295 1.00 29.87 ? 391 PRO A CB  1 
ATOM   605  C  CG  . PRO A 1 74  ? 26.391  -8.693  28.195 1.00 30.33 ? 391 PRO A CG  1 
ATOM   606  C  CD  . PRO A 1 74  ? 24.955  -8.300  28.065 1.00 29.79 ? 391 PRO A CD  1 
ATOM   607  N  N   . GLY A 1 75  ? 26.925  -4.145  29.296 1.00 30.24 ? 392 GLY A N   1 
ATOM   608  C  CA  . GLY A 1 75  ? 27.245  -2.791  28.850 1.00 30.74 ? 392 GLY A CA  1 
ATOM   609  C  C   . GLY A 1 75  ? 26.025  -1.940  28.529 1.00 31.37 ? 392 GLY A C   1 
ATOM   610  O  O   . GLY A 1 75  ? 26.132  -0.973  27.778 1.00 31.05 ? 392 GLY A O   1 
ATOM   611  N  N   . ALA A 1 76  ? 24.867  -2.303  29.089 1.00 31.38 ? 393 ALA A N   1 
ATOM   612  C  CA  . ALA A 1 76  ? 23.638  -1.564  28.836 1.00 32.39 ? 393 ALA A CA  1 
ATOM   613  C  C   . ALA A 1 76  ? 23.768  -0.110  29.327 1.00 32.95 ? 393 ALA A C   1 
ATOM   614  O  O   . ALA A 1 76  ? 24.216  0.135   30.448 1.00 33.07 ? 393 ALA A O   1 
ATOM   615  C  CB  . ALA A 1 76  ? 22.431  -2.246  29.501 1.00 32.17 ? 393 ALA A CB  1 
ATOM   616  N  N   . PRO A 1 77  ? 23.386  0.855   28.479 1.00 33.45 ? 394 PRO A N   1 
ATOM   617  C  CA  . PRO A 1 77  ? 23.565  2.253   28.849 1.00 33.68 ? 394 PRO A CA  1 
ATOM   618  C  C   . PRO A 1 77  ? 22.742  2.675   30.069 1.00 34.22 ? 394 PRO A C   1 
ATOM   619  O  O   . PRO A 1 77  ? 23.167  3.552   30.815 1.00 34.11 ? 394 PRO A O   1 
ATOM   620  C  CB  . PRO A 1 77  ? 23.108  3.003   27.592 1.00 33.93 ? 394 PRO A CB  1 
ATOM   621  C  CG  . PRO A 1 77  ? 22.196  2.078   26.912 1.00 34.21 ? 394 PRO A CG  1 
ATOM   622  C  CD  . PRO A 1 77  ? 22.774  0.719   27.145 1.00 33.48 ? 394 PRO A CD  1 
ATOM   623  N  N   . SER A 1 78  ? 21.584  2.045   30.275 1.00 34.47 ? 395 SER A N   1 
ATOM   624  C  CA  . SER A 1 78  ? 20.714  2.361   31.409 1.00 34.96 ? 395 SER A CA  1 
ATOM   625  C  C   . SER A 1 78  ? 20.628  1.163   32.346 1.00 35.42 ? 395 SER A C   1 
ATOM   626  O  O   . SER A 1 78  ? 19.545  0.741   32.761 1.00 34.94 ? 395 SER A O   1 
ATOM   627  C  CB  . SER A 1 78  ? 19.332  2.751   30.895 1.00 35.06 ? 395 SER A CB  1 
ATOM   628  O  OG  . SER A 1 78  ? 19.443  3.793   29.933 1.00 34.30 ? 395 SER A OG  1 
ATOM   629  N  N   . ALA A 1 79  ? 21.794  0.614   32.676 1.00 35.80 ? 396 ALA A N   1 
ATOM   630  C  CA  . ALA A 1 79  ? 21.869  -0.621  33.447 1.00 36.16 ? 396 ALA A CA  1 
ATOM   631  C  C   . ALA A 1 79  ? 21.149  -0.497  34.791 1.00 36.36 ? 396 ALA A C   1 
ATOM   632  O  O   . ALA A 1 79  ? 21.306  0.503   35.491 1.00 35.67 ? 396 ALA A O   1 
ATOM   633  C  CB  . ALA A 1 79  ? 23.325  -1.030  33.651 1.00 36.10 ? 396 ALA A CB  1 
ATOM   634  N  N   . ILE A 1 80  ? 20.338  -1.515  35.113 1.00 36.92 ? 397 ILE A N   1 
ATOM   635  C  CA  . ILE A 1 80  ? 19.658  -1.631  36.412 1.00 37.01 ? 397 ILE A CA  1 
ATOM   636  C  C   . ILE A 1 80  ? 20.220  -2.820  37.196 1.00 37.17 ? 397 ILE A C   1 
ATOM   637  O  O   . ILE A 1 80  ? 20.885  -3.694  36.638 1.00 36.56 ? 397 ILE A O   1 
ATOM   638  C  CB  . ILE A 1 80  ? 18.127  -1.803  36.249 1.00 37.28 ? 397 ILE A CB  1 
ATOM   639  C  CG1 . ILE A 1 80  ? 17.769  -3.164  35.625 1.00 37.52 ? 397 ILE A CG1 1 
ATOM   640  C  CG2 . ILE A 1 80  ? 17.549  -0.671  35.396 1.00 37.62 ? 397 ILE A CG2 1 
ATOM   641  C  CD1 . ILE A 1 80  ? 16.269  -3.438  35.579 1.00 37.16 ? 397 ILE A CD1 1 
ATOM   642  N  N   . ASN A 1 81  ? 19.931  -2.843  38.491 1.00 37.42 ? 398 ASN A N   1 
ATOM   643  C  CA  . ASN A 1 81  ? 20.323  -3.931  39.363 1.00 37.92 ? 398 ASN A CA  1 
ATOM   644  C  C   . ASN A 1 81  ? 19.105  -4.777  39.674 1.00 38.04 ? 398 ASN A C   1 
ATOM   645  O  O   . ASN A 1 81  ? 18.069  -4.229  40.042 1.00 38.46 ? 398 ASN A O   1 
ATOM   646  C  CB  . ASN A 1 81  ? 20.880  -3.373  40.668 1.00 38.41 ? 398 ASN A CB  1 
ATOM   647  C  CG  . ASN A 1 81  ? 22.071  -4.153  41.173 1.00 39.33 ? 398 ASN A CG  1 
ATOM   648  O  OD1 . ASN A 1 81  ? 23.203  -3.697  41.053 1.00 42.13 ? 398 ASN A OD1 1 
ATOM   649  N  ND2 . ASN A 1 81  ? 21.829  -5.341  41.725 1.00 40.35 ? 398 ASN A ND2 1 
ATOM   650  N  N   . LEU A 1 82  ? 19.217  -6.095  39.502 1.00 37.57 ? 399 LEU A N   1 
ATOM   651  C  CA  . LEU A 1 82  ? 18.175  -7.024  39.947 1.00 37.35 ? 399 LEU A CA  1 
ATOM   652  C  C   . LEU A 1 82  ? 18.755  -8.010  40.957 1.00 36.97 ? 399 LEU A C   1 
ATOM   653  O  O   . LEU A 1 82  ? 19.955  -8.276  40.941 1.00 36.59 ? 399 LEU A O   1 
ATOM   654  C  CB  . LEU A 1 82  ? 17.604  -7.813  38.763 1.00 37.51 ? 399 LEU A CB  1 
ATOM   655  C  CG  . LEU A 1 82  ? 16.806  -7.106  37.667 1.00 37.51 ? 399 LEU A CG  1 
ATOM   656  C  CD1 . LEU A 1 82  ? 16.474  -8.135  36.571 1.00 37.87 ? 399 LEU A CD1 1 
ATOM   657  C  CD2 . LEU A 1 82  ? 15.539  -6.475  38.228 1.00 37.61 ? 399 LEU A CD2 1 
ATOM   658  N  N   . ASP A 1 83  ? 17.898  -8.548  41.826 1.00 36.73 ? 400 ASP A N   1 
ATOM   659  C  CA  . ASP A 1 83  ? 18.251  -9.728  42.614 1.00 36.88 ? 400 ASP A CA  1 
ATOM   660  C  C   . ASP A 1 83  ? 18.464  -10.926 41.676 1.00 36.17 ? 400 ASP A C   1 
ATOM   661  O  O   . ASP A 1 83  ? 17.847  -10.996 40.597 1.00 35.63 ? 400 ASP A O   1 
ATOM   662  C  CB  . ASP A 1 83  ? 17.149  -10.073 43.620 1.00 37.43 ? 400 ASP A CB  1 
ATOM   663  C  CG  . ASP A 1 83  ? 15.861  -10.505 42.941 1.00 38.93 ? 400 ASP A CG  1 
ATOM   664  O  OD1 . ASP A 1 83  ? 15.483  -11.698 43.083 1.00 41.07 ? 400 ASP A OD1 1 
ATOM   665  O  OD2 . ASP A 1 83  ? 15.253  -9.651  42.246 1.00 39.78 ? 400 ASP A OD2 1 
ATOM   666  N  N   . SER A 1 84  ? 19.324  -11.852 42.108 1.00 35.44 ? 401 SER A N   1 
ATOM   667  C  CA  . SER A 1 84  ? 19.722  -13.032 41.324 1.00 35.27 ? 401 SER A CA  1 
ATOM   668  C  C   . SER A 1 84  ? 18.548  -13.801 40.714 1.00 35.13 ? 401 SER A C   1 
ATOM   669  O  O   . SER A 1 84  ? 18.531  -14.086 39.508 1.00 35.17 ? 401 SER A O   1 
ATOM   670  C  CB  . SER A 1 84  ? 20.519  -14.000 42.208 1.00 35.50 ? 401 SER A CB  1 
ATOM   671  O  OG  . SER A 1 84  ? 21.621  -13.363 42.831 1.00 35.33 ? 401 SER A OG  1 
ATOM   672  N  N   . LYS A 1 85  ? 17.576  -14.138 41.561 1.00 34.66 ? 402 LYS A N   1 
ATOM   673  C  CA  . LYS A 1 85  ? 16.380  -14.873 41.142 1.00 34.38 ? 402 LYS A CA  1 
ATOM   674  C  C   . LYS A 1 85  ? 15.668  -14.201 39.961 1.00 33.62 ? 402 LYS A C   1 
ATOM   675  O  O   . LYS A 1 85  ? 15.401  -14.868 38.956 1.00 32.66 ? 402 LYS A O   1 
ATOM   676  C  CB  . LYS A 1 85  ? 15.418  -15.046 42.327 1.00 34.71 ? 402 LYS A CB  1 
ATOM   677  C  CG  . LYS A 1 85  ? 14.342  -16.107 42.126 1.00 35.60 ? 402 LYS A CG  1 
ATOM   678  N  N   . SER A 1 86  ? 15.385  -12.896 40.079 1.00 33.38 ? 403 SER A N   1 
ATOM   679  C  CA  . SER A 1 86  ? 14.787  -12.103 38.992 1.00 33.69 ? 403 SER A CA  1 
ATOM   680  C  C   . SER A 1 86  ? 15.641  -12.061 37.735 1.00 33.21 ? 403 SER A C   1 
ATOM   681  O  O   . SER A 1 86  ? 15.136  -12.140 36.621 1.00 32.68 ? 403 SER A O   1 
ATOM   682  C  CB  . SER A 1 86  ? 14.610  -10.625 39.396 1.00 34.07 ? 403 SER A CB  1 
ATOM   683  O  OG  . SER A 1 86  ? 13.485  -10.421 40.212 1.00 36.73 ? 403 SER A OG  1 
ATOM   684  N  N   . TYR A 1 87  ? 16.932  -11.829 37.927 1.00 33.37 ? 404 TYR A N   1 
ATOM   685  C  CA  . TYR A 1 87  ? 17.853  -11.766 36.812 1.00 33.32 ? 404 TYR A CA  1 
ATOM   686  C  C   . TYR A 1 87  ? 17.953  -13.118 36.059 1.00 32.32 ? 404 TYR A C   1 
ATOM   687  O  O   . TYR A 1 87  ? 17.968  -13.149 34.821 1.00 31.19 ? 404 TYR A O   1 
ATOM   688  C  CB  . TYR A 1 87  ? 19.226  -11.291 37.281 1.00 34.22 ? 404 TYR A CB  1 
ATOM   689  C  CG  . TYR A 1 87  ? 20.198  -11.248 36.145 1.00 35.29 ? 404 TYR A CG  1 
ATOM   690  C  CD1 . TYR A 1 87  ? 20.259  -10.136 35.298 1.00 35.86 ? 404 TYR A CD1 1 
ATOM   691  C  CD2 . TYR A 1 87  ? 21.022  -12.344 35.875 1.00 35.92 ? 404 TYR A CD2 1 
ATOM   692  C  CE1 . TYR A 1 87  ? 21.147  -10.104 34.230 1.00 36.33 ? 404 TYR A CE1 1 
ATOM   693  C  CE2 . TYR A 1 87  ? 21.909  -12.325 34.813 1.00 36.94 ? 404 TYR A CE2 1 
ATOM   694  C  CZ  . TYR A 1 87  ? 21.966  -11.200 33.992 1.00 36.35 ? 404 TYR A CZ  1 
ATOM   695  O  OH  . TYR A 1 87  ? 22.841  -11.204 32.931 1.00 36.97 ? 404 TYR A OH  1 
ATOM   696  N  N   . ASP A 1 88  ? 18.003  -14.219 36.802 1.00 31.81 ? 405 ASP A N   1 
ATOM   697  C  CA  . ASP A 1 88  ? 18.030  -15.558 36.193 1.00 31.52 ? 405 ASP A CA  1 
ATOM   698  C  C   . ASP A 1 88  ? 16.804  -15.849 35.339 1.00 31.43 ? 405 ASP A C   1 
ATOM   699  O  O   . ASP A 1 88  ? 16.926  -16.305 34.204 1.00 30.39 ? 405 ASP A O   1 
ATOM   700  C  CB  . ASP A 1 88  ? 18.118  -16.637 37.263 1.00 32.05 ? 405 ASP A CB  1 
ATOM   701  C  CG  . ASP A 1 88  ? 19.448  -16.666 37.954 1.00 31.89 ? 405 ASP A CG  1 
ATOM   702  O  OD1 . ASP A 1 88  ? 20.280  -15.792 37.650 1.00 32.80 ? 405 ASP A OD1 1 
ATOM   703  O  OD2 . ASP A 1 88  ? 19.645  -17.556 38.813 1.00 32.86 ? 405 ASP A OD2 1 
ATOM   704  N  N   . LYS A 1 89  ? 15.626  -15.591 35.901 1.00 31.70 ? 406 LYS A N   1 
ATOM   705  C  CA  . LYS A 1 89  ? 14.375  -15.766 35.181 1.00 32.13 ? 406 LYS A CA  1 
ATOM   706  C  C   . LYS A 1 89  ? 14.305  -14.876 33.949 1.00 32.15 ? 406 LYS A C   1 
ATOM   707  O  O   . LYS A 1 89  ? 13.818  -15.301 32.900 1.00 32.56 ? 406 LYS A O   1 
ATOM   708  C  CB  . LYS A 1 89  ? 13.192  -15.446 36.073 1.00 32.34 ? 406 LYS A CB  1 
ATOM   709  C  CG  . LYS A 1 89  ? 12.786  -16.533 36.991 1.00 34.54 ? 406 LYS A CG  1 
ATOM   710  C  CD  . LYS A 1 89  ? 11.439  -16.174 37.641 1.00 37.48 ? 406 LYS A CD  1 
ATOM   711  C  CE  . LYS A 1 89  ? 11.007  -17.171 38.717 1.00 39.37 ? 406 LYS A CE  1 
ATOM   712  N  NZ  . LYS A 1 89  ? 10.052  -18.226 38.217 1.00 41.93 ? 406 LYS A NZ  1 
ATOM   713  N  N   . THR A 1 90  ? 14.787  -13.640 34.072 1.00 31.42 ? 407 THR A N   1 
ATOM   714  C  CA  . THR A 1 90  ? 14.702  -12.685 32.981 1.00 30.91 ? 407 THR A CA  1 
ATOM   715  C  C   . THR A 1 90  ? 15.577  -13.113 31.806 1.00 30.96 ? 407 THR A C   1 
ATOM   716  O  O   . THR A 1 90  ? 15.130  -13.104 30.662 1.00 30.59 ? 407 THR A O   1 
ATOM   717  C  CB  . THR A 1 90  ? 15.061  -11.263 33.455 1.00 30.33 ? 407 THR A CB  1 
ATOM   718  O  OG1 . THR A 1 90  ? 14.261  -10.928 34.598 1.00 30.92 ? 407 THR A OG1 1 
ATOM   719  C  CG2 . THR A 1 90  ? 14.798  -10.251 32.358 1.00 30.30 ? 407 THR A CG2 1 
ATOM   720  N  N   . THR A 1 91  ? 16.818  -13.490 32.102 1.00 31.72 ? 408 THR A N   1 
ATOM   721  C  CA  . THR A 1 91  ? 17.781  -13.930 31.095 1.00 31.99 ? 408 THR A CA  1 
ATOM   722  C  C   . THR A 1 91  ? 17.268  -15.131 30.305 1.00 31.68 ? 408 THR A C   1 
ATOM   723  O  O   . THR A 1 91  ? 17.381  -15.168 29.084 1.00 31.16 ? 408 THR A O   1 
ATOM   724  C  CB  . THR A 1 91  ? 19.099  -14.305 31.768 1.00 32.48 ? 408 THR A CB  1 
ATOM   725  O  OG1 . THR A 1 91  ? 18.810  -14.990 32.990 1.00 36.30 ? 408 THR A OG1 1 
ATOM   726  C  CG2 . THR A 1 91  ? 19.882  -13.096 32.127 1.00 31.86 ? 408 THR A CG2 1 
ATOM   727  N  N   . HIS A 1 92  ? 16.708  -16.110 31.019 1.00 31.73 ? 409 HIS A N   1 
ATOM   728  C  CA  . HIS A 1 92  ? 16.128  -17.308 30.411 1.00 31.99 ? 409 HIS A CA  1 
ATOM   729  C  C   . HIS A 1 92  ? 14.996  -16.961 29.457 1.00 31.59 ? 409 HIS A C   1 
ATOM   730  O  O   . HIS A 1 92  ? 14.888  -17.557 28.384 1.00 31.18 ? 409 HIS A O   1 
ATOM   731  C  CB  . HIS A 1 92  ? 15.548  -18.231 31.489 1.00 32.80 ? 409 HIS A CB  1 
ATOM   732  C  CG  . HIS A 1 92  ? 16.495  -19.274 31.986 1.00 33.84 ? 409 HIS A CG  1 
ATOM   733  N  ND1 . HIS A 1 92  ? 16.415  -19.798 33.261 1.00 38.20 ? 409 HIS A ND1 1 
ATOM   734  C  CD2 . HIS A 1 92  ? 17.496  -19.944 31.370 1.00 36.28 ? 409 HIS A CD2 1 
ATOM   735  C  CE1 . HIS A 1 92  ? 17.342  -20.730 33.415 1.00 36.12 ? 409 HIS A CE1 1 
ATOM   736  N  NE2 . HIS A 1 92  ? 18.008  -20.842 32.280 1.00 35.57 ? 409 HIS A NE2 1 
ATOM   737  N  N   . ASN A 1 93  ? 14.139  -16.022 29.873 1.00 30.60 ? 410 ASN A N   1 
ATOM   738  C  CA  . ASN A 1 93  ? 13.037  -15.562 29.042 1.00 30.00 ? 410 ASN A CA  1 
ATOM   739  C  C   . ASN A 1 93  ? 13.492  -14.817 27.810 1.00 30.12 ? 410 ASN A C   1 
ATOM   740  O  O   . ASN A 1 93  ? 12.903  -14.972 26.742 1.00 30.32 ? 410 ASN A O   1 
ATOM   741  C  CB  . ASN A 1 93  ? 12.077  -14.691 29.845 1.00 30.01 ? 410 ASN A CB  1 
ATOM   742  C  CG  . ASN A 1 93  ? 11.269  -15.483 30.860 1.00 29.14 ? 410 ASN A CG  1 
ATOM   743  O  OD1 . ASN A 1 93  ? 11.202  -16.718 30.812 1.00 30.56 ? 410 ASN A OD1 1 
ATOM   744  N  ND2 . ASN A 1 93  ? 10.667  -14.773 31.799 1.00 28.71 ? 410 ASN A ND2 1 
ATOM   745  N  N   . VAL A 1 94  ? 14.541  -14.012 27.962 1.00 30.14 ? 411 VAL A N   1 
ATOM   746  C  CA  . VAL A 1 94  ? 15.106  -13.239 26.859 1.00 30.32 ? 411 VAL A CA  1 
ATOM   747  C  C   . VAL A 1 94  ? 15.846  -14.150 25.858 1.00 30.43 ? 411 VAL A C   1 
ATOM   748  O  O   . VAL A 1 94  ? 15.660  -14.026 24.647 1.00 31.30 ? 411 VAL A O   1 
ATOM   749  C  CB  . VAL A 1 94  ? 16.008  -12.083 27.407 1.00 30.23 ? 411 VAL A CB  1 
ATOM   750  C  CG1 . VAL A 1 94  ? 16.855  -11.441 26.305 1.00 30.80 ? 411 VAL A CG1 1 
ATOM   751  C  CG2 . VAL A 1 94  ? 15.145  -11.019 28.101 1.00 29.48 ? 411 VAL A CG2 1 
ATOM   752  N  N   . LYS A 1 95  ? 16.659  -15.077 26.356 1.00 30.16 ? 412 LYS A N   1 
ATOM   753  C  CA  . LYS A 1 95  ? 17.487  -15.913 25.489 1.00 29.98 ? 412 LYS A CA  1 
ATOM   754  C  C   . LYS A 1 95  ? 16.779  -17.160 24.970 1.00 29.98 ? 412 LYS A C   1 
ATOM   755  O  O   . LYS A 1 95  ? 17.200  -17.733 23.970 1.00 29.54 ? 412 LYS A O   1 
ATOM   756  C  CB  . LYS A 1 95  ? 18.773  -16.311 26.214 1.00 29.82 ? 412 LYS A CB  1 
ATOM   757  C  CG  . LYS A 1 95  ? 19.612  -15.102 26.641 1.00 31.58 ? 412 LYS A CG  1 
ATOM   758  C  CD  . LYS A 1 95  ? 20.217  -14.346 25.444 1.00 34.05 ? 412 LYS A CD  1 
ATOM   759  C  CE  . LYS A 1 95  ? 20.635  -12.926 25.831 1.00 36.20 ? 412 LYS A CE  1 
ATOM   760  N  NZ  . LYS A 1 95  ? 21.519  -12.924 27.031 1.00 37.51 ? 412 LYS A NZ  1 
ATOM   761  N  N   . GLU A 1 96  ? 15.722  -17.581 25.656 1.00 29.55 ? 413 GLU A N   1 
ATOM   762  C  CA  . GLU A 1 96  ? 14.992  -18.797 25.306 1.00 30.12 ? 413 GLU A CA  1 
ATOM   763  C  C   . GLU A 1 96  ? 13.488  -18.499 25.339 1.00 30.11 ? 413 GLU A C   1 
ATOM   764  O  O   . GLU A 1 96  ? 12.771  -19.068 26.159 1.00 29.59 ? 413 GLU A O   1 
ATOM   765  C  CB  . GLU A 1 96  ? 15.310  -19.944 26.300 1.00 30.25 ? 413 GLU A CB  1 
ATOM   766  C  CG  . GLU A 1 96  ? 16.793  -20.261 26.535 1.00 30.59 ? 413 GLU A CG  1 
ATOM   767  C  CD  . GLU A 1 96  ? 17.464  -20.984 25.363 1.00 33.00 ? 413 GLU A CD  1 
ATOM   768  O  OE1 . GLU A 1 96  ? 18.670  -20.729 25.122 1.00 35.00 ? 413 GLU A OE1 1 
ATOM   769  O  OE2 . GLU A 1 96  ? 16.805  -21.807 24.684 1.00 32.51 ? 413 GLU A OE2 1 
ATOM   770  N  N   . PRO A 1 97  ? 13.005  -17.601 24.448 1.00 30.77 ? 414 PRO A N   1 
ATOM   771  C  CA  . PRO A 1 97  ? 11.606  -17.219 24.546 1.00 30.74 ? 414 PRO A CA  1 
ATOM   772  C  C   . PRO A 1 97  ? 10.709  -18.430 24.467 1.00 31.15 ? 414 PRO A C   1 
ATOM   773  O  O   . PRO A 1 97  ? 10.905  -19.297 23.582 1.00 30.99 ? 414 PRO A O   1 
ATOM   774  C  CB  . PRO A 1 97  ? 11.391  -16.300 23.335 1.00 31.11 ? 414 PRO A CB  1 
ATOM   775  C  CG  . PRO A 1 97  ? 12.735  -15.792 23.002 1.00 31.42 ? 414 PRO A CG  1 
ATOM   776  C  CD  . PRO A 1 97  ? 13.675  -16.922 23.331 1.00 30.49 ? 414 PRO A CD  1 
ATOM   777  N  N   . GLY A 1 98  ? 9.752   -18.506 25.393 1.00 30.83 ? 415 GLY A N   1 
ATOM   778  C  CA  . GLY A 1 98  ? 8.793   -19.603 25.422 1.00 31.35 ? 415 GLY A CA  1 
ATOM   779  C  C   . GLY A 1 98  ? 9.219   -20.823 26.247 1.00 31.25 ? 415 GLY A C   1 
ATOM   780  O  O   . GLY A 1 98  ? 8.369   -21.548 26.775 1.00 31.80 ? 415 GLY A O   1 
ATOM   781  N  N   . ARG A 1 99  ? 10.524  -21.056 26.370 1.00 30.94 ? 416 ARG A N   1 
ATOM   782  C  CA  . ARG A 1 99  ? 11.006  -22.338 26.906 1.00 30.77 ? 416 ARG A CA  1 
ATOM   783  C  C   . ARG A 1 99  ? 10.622  -22.539 28.382 1.00 31.11 ? 416 ARG A C   1 
ATOM   784  O  O   . ARG A 1 99  ? 10.408  -23.674 28.839 1.00 30.01 ? 416 ARG A O   1 
ATOM   785  C  CB  . ARG A 1 99  ? 12.517  -22.455 26.717 1.00 30.39 ? 416 ARG A CB  1 
ATOM   786  C  CG  . ARG A 1 99  ? 13.047  -23.861 26.916 1.00 30.87 ? 416 ARG A CG  1 
ATOM   787  C  CD  . ARG A 1 99  ? 14.540  -23.995 26.600 1.00 29.86 ? 416 ARG A CD  1 
ATOM   788  N  NE  . ARG A 1 99  ? 14.901  -23.728 25.200 1.00 30.22 ? 416 ARG A NE  1 
ATOM   789  C  CZ  . ARG A 1 99  ? 14.592  -24.511 24.160 1.00 29.02 ? 416 ARG A CZ  1 
ATOM   790  N  NH1 . ARG A 1 99  ? 13.840  -25.604 24.312 1.00 29.09 ? 416 ARG A NH1 1 
ATOM   791  N  NH2 . ARG A 1 99  ? 15.013  -24.174 22.959 1.00 27.00 ? 416 ARG A NH2 1 
ATOM   792  N  N   . TYR A 1 100 ? 10.538  -21.428 29.118 1.00 31.11 ? 417 TYR A N   1 
ATOM   793  C  CA  . TYR A 1 100 ? 10.205  -21.452 30.536 1.00 30.94 ? 417 TYR A CA  1 
ATOM   794  C  C   . TYR A 1 100 ? 8.779   -20.977 30.822 1.00 30.83 ? 417 TYR A C   1 
ATOM   795  O  O   . TYR A 1 100 ? 8.464   -20.555 31.934 1.00 29.93 ? 417 TYR A O   1 
ATOM   796  C  CB  . TYR A 1 100 ? 11.271  -20.680 31.326 1.00 31.26 ? 417 TYR A CB  1 
ATOM   797  C  CG  . TYR A 1 100 ? 12.617  -21.343 31.191 1.00 31.61 ? 417 TYR A CG  1 
ATOM   798  C  CD1 . TYR A 1 100 ? 13.487  -20.996 30.156 1.00 32.98 ? 417 TYR A CD1 1 
ATOM   799  C  CD2 . TYR A 1 100 ? 12.997  -22.358 32.052 1.00 31.82 ? 417 TYR A CD2 1 
ATOM   800  C  CE1 . TYR A 1 100 ? 14.694  -21.634 29.989 1.00 32.64 ? 417 TYR A CE1 1 
ATOM   801  C  CE2 . TYR A 1 100 ? 14.212  -23.005 31.901 1.00 32.19 ? 417 TYR A CE2 1 
ATOM   802  C  CZ  . TYR A 1 100 ? 15.055  -22.644 30.863 1.00 32.96 ? 417 TYR A CZ  1 
ATOM   803  O  OH  . TYR A 1 100 ? 16.283  -23.265 30.717 1.00 34.44 ? 417 TYR A OH  1 
ATOM   804  N  N   . THR A 1 101 ? 7.908   -21.090 29.819 1.00 30.55 ? 418 THR A N   1 
ATOM   805  C  CA  . THR A 1 101 ? 6.481   -20.817 29.988 1.00 30.86 ? 418 THR A CA  1 
ATOM   806  C  C   . THR A 1 101 ? 5.855   -21.485 31.231 1.00 30.74 ? 418 THR A C   1 
ATOM   807  O  O   . THR A 1 101 ? 5.006   -20.869 31.898 1.00 29.68 ? 418 THR A O   1 
ATOM   808  C  CB  . THR A 1 101 ? 5.705   -21.309 28.762 1.00 31.26 ? 418 THR A CB  1 
ATOM   809  O  OG1 . THR A 1 101 ? 6.116   -20.575 27.599 1.00 31.99 ? 418 THR A OG1 1 
ATOM   810  C  CG2 . THR A 1 101 ? 4.210   -21.186 28.971 1.00 31.12 ? 418 THR A CG2 1 
ATOM   811  N  N   . PHE A 1 102 ? 6.277   -22.727 31.518 1.00 30.39 ? 419 PHE A N   1 
ATOM   812  C  CA  . PHE A 1 102 ? 5.699   -23.560 32.592 1.00 30.25 ? 419 PHE A CA  1 
ATOM   813  C  C   . PHE A 1 102 ? 6.547   -23.639 33.868 1.00 30.72 ? 419 PHE A C   1 
ATOM   814  O  O   . PHE A 1 102 ? 6.252   -24.461 34.744 1.00 30.37 ? 419 PHE A O   1 
ATOM   815  C  CB  . PHE A 1 102 ? 5.383   -24.988 32.077 1.00 29.97 ? 419 PHE A CB  1 
ATOM   816  C  CG  . PHE A 1 102 ? 4.479   -25.000 30.856 1.00 29.35 ? 419 PHE A CG  1 
ATOM   817  C  CD1 . PHE A 1 102 ? 3.100   -24.829 30.988 1.00 27.67 ? 419 PHE A CD1 1 
ATOM   818  C  CD2 . PHE A 1 102 ? 5.013   -25.158 29.581 1.00 28.71 ? 419 PHE A CD2 1 
ATOM   819  C  CE1 . PHE A 1 102 ? 2.289   -24.810 29.890 1.00 28.94 ? 419 PHE A CE1 1 
ATOM   820  C  CE2 . PHE A 1 102 ? 4.195   -25.159 28.468 1.00 28.92 ? 419 PHE A CE2 1 
ATOM   821  C  CZ  . PHE A 1 102 ? 2.827   -24.952 28.621 1.00 29.10 ? 419 PHE A CZ  1 
ATOM   822  N  N   . GLU A 1 103 ? 7.540   -22.750 34.016 1.00 31.15 ? 420 GLU A N   1 
ATOM   823  C  CA  . GLU A 1 103 ? 8.483   -22.807 35.146 1.00 31.43 ? 420 GLU A CA  1 
ATOM   824  C  C   . GLU A 1 103 ? 7.826   -22.869 36.532 1.00 30.53 ? 420 GLU A C   1 
ATOM   825  O  O   . GLU A 1 103 ? 8.126   -23.765 37.334 1.00 30.36 ? 420 GLU A O   1 
ATOM   826  C  CB  . GLU A 1 103 ? 9.460   -21.618 35.107 1.00 31.65 ? 420 GLU A CB  1 
ATOM   827  C  CG  . GLU A 1 103 ? 10.560  -21.659 36.200 1.00 32.50 ? 420 GLU A CG  1 
ATOM   828  C  CD  . GLU A 1 103 ? 11.541  -20.460 36.141 1.00 34.55 ? 420 GLU A CD  1 
ATOM   829  O  OE1 . GLU A 1 103 ? 11.615  -19.763 35.082 1.00 39.75 ? 420 GLU A OE1 1 
ATOM   830  O  OE2 . GLU A 1 103 ? 12.224  -20.195 37.175 1.00 37.96 ? 420 GLU A OE2 1 
ATOM   831  N  N   . ASP A 1 104 ? 6.977   -21.891 36.834 1.00 30.12 ? 421 ASP A N   1 
ATOM   832  C  CA  . ASP A 1 104 ? 6.301   -21.837 38.131 1.00 30.57 ? 421 ASP A CA  1 
ATOM   833  C  C   . ASP A 1 104 ? 5.287   -22.987 38.340 1.00 30.18 ? 421 ASP A C   1 
ATOM   834  O  O   . ASP A 1 104 ? 5.141   -23.488 39.438 1.00 29.79 ? 421 ASP A O   1 
ATOM   835  C  CB  . ASP A 1 104 ? 5.628   -20.477 38.328 1.00 31.41 ? 421 ASP A CB  1 
ATOM   836  C  CG  . ASP A 1 104 ? 6.646   -19.334 38.572 1.00 32.97 ? 421 ASP A CG  1 
ATOM   837  O  OD1 . ASP A 1 104 ? 7.811   -19.422 38.113 1.00 37.85 ? 421 ASP A OD1 1 
ATOM   838  O  OD2 . ASP A 1 104 ? 6.285   -18.356 39.227 1.00 33.02 ? 421 ASP A OD2 1 
ATOM   839  N  N   . ALA A 1 105 ? 4.614   -23.417 37.280 1.00 30.04 ? 422 ALA A N   1 
ATOM   840  C  CA  . ALA A 1 105 ? 3.663   -24.533 37.367 1.00 29.95 ? 422 ALA A CA  1 
ATOM   841  C  C   . ALA A 1 105 ? 4.423   -25.833 37.609 1.00 30.00 ? 422 ALA A C   1 
ATOM   842  O  O   . ALA A 1 105 ? 4.014   -26.637 38.442 1.00 29.16 ? 422 ALA A O   1 
ATOM   843  C  CB  . ALA A 1 105 ? 2.841   -24.631 36.082 1.00 29.96 ? 422 ALA A CB  1 
ATOM   844  N  N   . GLN A 1 106 ? 5.524   -26.028 36.880 1.00 30.18 ? 423 GLN A N   1 
ATOM   845  C  CA  . GLN A 1 106 ? 6.340   -27.212 37.035 1.00 31.30 ? 423 GLN A CA  1 
ATOM   846  C  C   . GLN A 1 106 ? 6.914   -27.298 38.448 1.00 31.56 ? 423 GLN A C   1 
ATOM   847  O  O   . GLN A 1 106 ? 6.992   -28.376 39.001 1.00 31.04 ? 423 GLN A O   1 
ATOM   848  C  CB  . GLN A 1 106 ? 7.484   -27.279 36.017 1.00 31.72 ? 423 GLN A CB  1 
ATOM   849  C  CG  . GLN A 1 106 ? 8.167   -28.694 35.978 1.00 32.30 ? 423 GLN A CG  1 
ATOM   850  C  CD  . GLN A 1 106 ? 9.437   -28.722 35.161 1.00 32.35 ? 423 GLN A CD  1 
ATOM   851  O  OE1 . GLN A 1 106 ? 10.068  -27.686 34.965 1.00 32.27 ? 423 GLN A OE1 1 
ATOM   852  N  NE2 . GLN A 1 106 ? 9.835   -29.921 34.692 1.00 30.78 ? 423 GLN A NE2 1 
ATOM   853  N  N   . GLU A 1 107 ? 7.311   -26.172 39.024 1.00 32.48 ? 424 GLU A N   1 
ATOM   854  C  CA  . GLU A 1 107 ? 7.798   -26.180 40.425 1.00 32.92 ? 424 GLU A CA  1 
ATOM   855  C  C   . GLU A 1 107 ? 6.690   -26.564 41.412 1.00 32.34 ? 424 GLU A C   1 
ATOM   856  O  O   . GLU A 1 107 ? 6.924   -27.399 42.300 1.00 31.79 ? 424 GLU A O   1 
ATOM   857  C  CB  . GLU A 1 107 ? 8.447   -24.860 40.811 1.00 33.12 ? 424 GLU A CB  1 
ATOM   858  C  CG  . GLU A 1 107 ? 8.871   -24.739 42.289 1.00 35.23 ? 424 GLU A CG  1 
ATOM   859  C  CD  . GLU A 1 107 ? 10.012  -25.681 42.778 1.00 40.97 ? 424 GLU A CD  1 
ATOM   860  O  OE1 . GLU A 1 107 ? 10.394  -26.670 42.113 1.00 46.08 ? 424 GLU A OE1 1 
ATOM   861  O  OE2 . GLU A 1 107 ? 10.521  -25.414 43.897 1.00 45.31 ? 424 GLU A OE2 1 
ATOM   862  N  N   . HIS A 1 108 ? 5.493   -25.994 41.224 1.00 31.27 ? 425 HIS A N   1 
ATOM   863  C  CA  . HIS A 1 108 ? 4.318   -26.375 42.018 1.00 30.76 ? 425 HIS A CA  1 
ATOM   864  C  C   . HIS A 1 108 ? 4.072   -27.888 41.980 1.00 31.24 ? 425 HIS A C   1 
ATOM   865  O  O   . HIS A 1 108 ? 3.901   -28.530 43.007 1.00 31.23 ? 425 HIS A O   1 
ATOM   866  C  CB  . HIS A 1 108 ? 3.070   -25.665 41.498 1.00 30.78 ? 425 HIS A CB  1 
ATOM   867  C  CG  . HIS A 1 108 ? 1.822   -26.026 42.234 1.00 30.45 ? 425 HIS A CG  1 
ATOM   868  N  ND1 . HIS A 1 108 ? 1.527   -25.521 43.479 1.00 30.35 ? 425 HIS A ND1 1 
ATOM   869  C  CD2 . HIS A 1 108 ? 0.801   -26.855 41.910 1.00 31.24 ? 425 HIS A CD2 1 
ATOM   870  C  CE1 . HIS A 1 108 ? 0.374   -26.014 43.891 1.00 30.70 ? 425 HIS A CE1 1 
ATOM   871  N  NE2 . HIS A 1 108 ? -0.085  -26.832 42.961 1.00 32.02 ? 425 HIS A NE2 1 
ATOM   872  N  N   . ILE A 1 109 ? 4.067   -28.441 40.781 1.00 31.47 ? 426 ILE A N   1 
ATOM   873  C  CA  . ILE A 1 109 ? 3.783   -29.869 40.565 1.00 32.72 ? 426 ILE A CA  1 
ATOM   874  C  C   . ILE A 1 109 ? 4.899   -30.780 41.092 1.00 32.64 ? 426 ILE A C   1 
ATOM   875  O  O   . ILE A 1 109 ? 4.616   -31.813 41.693 1.00 32.66 ? 426 ILE A O   1 
ATOM   876  C  CB  . ILE A 1 109 ? 3.529   -30.176 39.059 1.00 32.31 ? 426 ILE A CB  1 
ATOM   877  C  CG1 . ILE A 1 109 ? 2.258   -29.486 38.550 1.00 32.27 ? 426 ILE A CG1 1 
ATOM   878  C  CG2 . ILE A 1 109 ? 3.474   -31.699 38.798 1.00 35.04 ? 426 ILE A CG2 1 
ATOM   879  C  CD1 . ILE A 1 109 ? 0.984   -29.956 39.216 1.00 31.71 ? 426 ILE A CD1 1 
ATOM   880  N  N   . TYR A 1 110 ? 6.155   -30.412 40.846 1.00 32.25 ? 427 TYR A N   1 
ATOM   881  C  CA  . TYR A 1 110 ? 7.283   -31.117 41.451 1.00 32.64 ? 427 TYR A CA  1 
ATOM   882  C  C   . TYR A 1 110 ? 7.120   -31.272 42.993 1.00 33.12 ? 427 TYR A C   1 
ATOM   883  O  O   . TYR A 1 110 ? 7.286   -32.369 43.537 1.00 32.72 ? 427 TYR A O   1 
ATOM   884  C  CB  . TYR A 1 110 ? 8.584   -30.390 41.106 1.00 32.58 ? 427 TYR A CB  1 
ATOM   885  C  CG  . TYR A 1 110 ? 9.824   -31.008 41.681 1.00 33.26 ? 427 TYR A CG  1 
ATOM   886  C  CD1 . TYR A 1 110 ? 10.370  -32.186 41.158 1.00 33.41 ? 427 TYR A CD1 1 
ATOM   887  C  CD2 . TYR A 1 110 ? 10.473  -30.401 42.749 1.00 33.60 ? 427 TYR A CD2 1 
ATOM   888  C  CE1 . TYR A 1 110 ? 11.544  -32.749 41.721 1.00 33.36 ? 427 TYR A CE1 1 
ATOM   889  C  CE2 . TYR A 1 110 ? 11.612  -30.936 43.290 1.00 34.39 ? 427 TYR A CE2 1 
ATOM   890  C  CZ  . TYR A 1 110 ? 12.148  -32.106 42.777 1.00 33.96 ? 427 TYR A CZ  1 
ATOM   891  O  OH  . TYR A 1 110 ? 13.290  -32.577 43.391 1.00 34.54 ? 427 TYR A OH  1 
ATOM   892  N  N   . LYS A 1 111 ? 6.770   -30.183 43.675 1.00 33.57 ? 428 LYS A N   1 
ATOM   893  C  CA  . LYS A 1 111 ? 6.621   -30.194 45.141 1.00 34.42 ? 428 LYS A CA  1 
ATOM   894  C  C   . LYS A 1 111 ? 5.386   -30.980 45.617 1.00 34.37 ? 428 LYS A C   1 
ATOM   895  O  O   . LYS A 1 111 ? 5.398   -31.622 46.656 1.00 33.89 ? 428 LYS A O   1 
ATOM   896  C  CB  . LYS A 1 111 ? 6.583   -28.760 45.682 1.00 34.26 ? 428 LYS A CB  1 
ATOM   897  C  CG  . LYS A 1 111 ? 7.963   -28.135 45.755 1.00 35.62 ? 428 LYS A CG  1 
ATOM   898  C  CD  . LYS A 1 111 ? 8.009   -26.837 46.589 1.00 35.64 ? 428 LYS A CD  1 
ATOM   899  C  CE  . LYS A 1 111 ? 7.449   -25.640 45.819 1.00 36.74 ? 428 LYS A CE  1 
ATOM   900  N  NZ  . LYS A 1 111 ? 8.332   -24.440 45.875 1.00 37.31 ? 428 LYS A NZ  1 
ATOM   901  N  N   . LEU A 1 112 ? 4.324   -30.905 44.838 1.00 34.64 ? 429 LEU A N   1 
ATOM   902  C  CA  . LEU A 1 112 ? 3.130   -31.699 45.063 1.00 35.53 ? 429 LEU A CA  1 
ATOM   903  C  C   . LEU A 1 112 ? 3.373   -33.223 44.964 1.00 34.46 ? 429 LEU A C   1 
ATOM   904  O  O   . LEU A 1 112 ? 2.886   -33.971 45.795 1.00 34.49 ? 429 LEU A O   1 
ATOM   905  C  CB  . LEU A 1 112 ? 2.063   -31.272 44.046 1.00 36.02 ? 429 LEU A CB  1 
ATOM   906  C  CG  . LEU A 1 112 ? 0.608   -31.503 44.408 1.00 37.30 ? 429 LEU A CG  1 
ATOM   907  C  CD1 . LEU A 1 112 ? 0.239   -30.702 45.653 1.00 39.58 ? 429 LEU A CD1 1 
ATOM   908  C  CD2 . LEU A 1 112 ? -0.275  -31.109 43.214 1.00 37.12 ? 429 LEU A CD2 1 
ATOM   909  N  N   . MET A 1 113 ? 4.118   -33.671 43.956 1.00 33.91 ? 430 MET A N   1 
ATOM   910  C  CA  . MET A 1 113 ? 4.460   -35.096 43.800 1.00 34.26 ? 430 MET A CA  1 
ATOM   911  C  C   . MET A 1 113 ? 5.293   -35.624 44.962 1.00 34.08 ? 430 MET A C   1 
ATOM   912  O  O   . MET A 1 113 ? 5.111   -36.755 45.383 1.00 33.74 ? 430 MET A O   1 
ATOM   913  C  CB  . MET A 1 113 ? 5.187   -35.344 42.478 1.00 33.71 ? 430 MET A CB  1 
ATOM   914  C  CG  . MET A 1 113 ? 4.305   -35.143 41.282 1.00 35.11 ? 430 MET A CG  1 
ATOM   915  S  SD  . MET A 1 113 ? 5.070   -35.721 39.782 1.00 36.35 ? 430 MET A SD  1 
ATOM   916  C  CE  . MET A 1 113 ? 6.512   -34.660 39.609 1.00 34.10 ? 430 MET A CE  1 
ATOM   917  N  N   . LYS A 1 114 ? 6.183   -34.790 45.496 1.00 34.16 ? 431 LYS A N   1 
ATOM   918  C  CA  . LYS A 1 114 ? 6.878   -35.111 46.750 1.00 34.32 ? 431 LYS A CA  1 
ATOM   919  C  C   . LYS A 1 114 ? 5.940   -35.410 47.932 1.00 33.92 ? 431 LYS A C   1 
ATOM   920  O  O   . LYS A 1 114 ? 6.302   -36.179 48.800 1.00 34.15 ? 431 LYS A O   1 
ATOM   921  C  CB  . LYS A 1 114 ? 7.872   -34.006 47.142 1.00 34.19 ? 431 LYS A CB  1 
ATOM   922  C  CG  . LYS A 1 114 ? 9.156   -34.018 46.343 1.00 34.53 ? 431 LYS A CG  1 
ATOM   923  C  CD  . LYS A 1 114 ? 10.231  -33.123 46.940 1.00 36.09 ? 431 LYS A CD  1 
ATOM   924  C  CE  . LYS A 1 114 ? 11.507  -33.226 46.097 1.00 38.37 ? 431 LYS A CE  1 
ATOM   925  N  NZ  . LYS A 1 114 ? 12.491  -32.131 46.320 1.00 39.05 ? 431 LYS A NZ  1 
ATOM   926  N  N   . SER A 1 115 ? 4.758   -34.805 47.976 1.00 33.60 ? 432 SER A N   1 
ATOM   927  C  CA  . SER A 1 115 ? 3.840   -35.017 49.099 1.00 33.80 ? 432 SER A CA  1 
ATOM   928  C  C   . SER A 1 115 ? 2.691   -35.973 48.762 1.00 33.24 ? 432 SER A C   1 
ATOM   929  O  O   . SER A 1 115 ? 1.958   -36.386 49.668 1.00 33.29 ? 432 SER A O   1 
ATOM   930  C  CB  . SER A 1 115 ? 3.263   -33.676 49.599 1.00 33.74 ? 432 SER A CB  1 
ATOM   931  O  OG  . SER A 1 115 ? 2.443   -33.056 48.604 1.00 35.05 ? 432 SER A OG  1 
ATOM   932  N  N   . ASP A 1 116 ? 2.535   -36.322 47.479 1.00 32.81 ? 433 ASP A N   1 
ATOM   933  C  CA  . ASP A 1 116 ? 1.358   -37.064 47.014 1.00 32.70 ? 433 ASP A CA  1 
ATOM   934  C  C   . ASP A 1 116 ? 1.746   -38.279 46.171 1.00 31.40 ? 433 ASP A C   1 
ATOM   935  O  O   . ASP A 1 116 ? 1.817   -39.395 46.697 1.00 30.59 ? 433 ASP A O   1 
ATOM   936  C  CB  . ASP A 1 116 ? 0.401   -36.136 46.243 1.00 33.54 ? 433 ASP A CB  1 
ATOM   937  C  CG  . ASP A 1 116 ? -0.844  -36.866 45.692 1.00 37.04 ? 433 ASP A CG  1 
ATOM   938  O  OD1 . ASP A 1 116 ? -1.257  -37.920 46.238 1.00 40.46 ? 433 ASP A OD1 1 
ATOM   939  O  OD2 . ASP A 1 116 ? -1.425  -36.371 44.699 1.00 42.73 ? 433 ASP A OD2 1 
ATOM   940  N  N   . SER A 1 117 ? 1.989   -38.064 44.881 1.00 30.54 ? 434 SER A N   1 
ATOM   941  C  CA  . SER A 1 117 ? 2.274   -39.161 43.952 1.00 30.59 ? 434 SER A CA  1 
ATOM   942  C  C   . SER A 1 117 ? 3.426   -40.049 44.449 1.00 29.90 ? 434 SER A C   1 
ATOM   943  O  O   . SER A 1 117 ? 3.312   -41.276 44.406 1.00 30.01 ? 434 SER A O   1 
ATOM   944  C  CB  . SER A 1 117 ? 2.616   -38.637 42.546 1.00 30.59 ? 434 SER A CB  1 
ATOM   945  O  OG  . SER A 1 117 ? 1.563   -37.925 41.948 1.00 30.53 ? 434 SER A OG  1 
ATOM   946  N  N   . TYR A 1 118 ? 4.512   -39.441 44.925 1.00 29.67 ? 435 TYR A N   1 
ATOM   947  C  CA  . TYR A 1 118 ? 5.717   -40.210 45.248 1.00 29.80 ? 435 TYR A CA  1 
ATOM   948  C  C   . TYR A 1 118 ? 5.524   -41.159 46.439 1.00 30.23 ? 435 TYR A C   1 
ATOM   949  O  O   . TYR A 1 118 ? 5.778   -42.353 46.297 1.00 29.62 ? 435 TYR A O   1 
ATOM   950  C  CB  . TYR A 1 118 ? 6.946   -39.327 45.410 1.00 30.02 ? 435 TYR A CB  1 
ATOM   951  C  CG  . TYR A 1 118 ? 8.167   -40.079 45.870 1.00 29.20 ? 435 TYR A CG  1 
ATOM   952  C  CD1 . TYR A 1 118 ? 8.772   -41.032 45.036 1.00 30.19 ? 435 TYR A CD1 1 
ATOM   953  C  CD2 . TYR A 1 118 ? 8.706   -39.869 47.123 1.00 28.93 ? 435 TYR A CD2 1 
ATOM   954  C  CE1 . TYR A 1 118 ? 9.896   -41.744 45.450 1.00 28.22 ? 435 TYR A CE1 1 
ATOM   955  C  CE2 . TYR A 1 118 ? 9.834   -40.571 47.541 1.00 29.27 ? 435 TYR A CE2 1 
ATOM   956  C  CZ  . TYR A 1 118 ? 10.413  -41.513 46.697 1.00 28.83 ? 435 TYR A CZ  1 
ATOM   957  O  OH  . TYR A 1 118 ? 11.522  -42.196 47.100 1.00 28.77 ? 435 TYR A OH  1 
ATOM   958  N  N   . PRO A 1 119 ? 5.066   -40.632 47.593 1.00 30.27 ? 436 PRO A N   1 
ATOM   959  C  CA  . PRO A 1 119 ? 4.731   -41.493 48.721 1.00 30.41 ? 436 PRO A CA  1 
ATOM   960  C  C   . PRO A 1 119 ? 3.712   -42.590 48.382 1.00 29.94 ? 436 PRO A C   1 
ATOM   961  O  O   . PRO A 1 119 ? 3.854   -43.735 48.817 1.00 28.80 ? 436 PRO A O   1 
ATOM   962  C  CB  . PRO A 1 119 ? 4.173   -40.511 49.762 1.00 30.74 ? 436 PRO A CB  1 
ATOM   963  C  CG  . PRO A 1 119 ? 4.672   -39.146 49.357 1.00 29.89 ? 436 PRO A CG  1 
ATOM   964  C  CD  . PRO A 1 119 ? 4.873   -39.190 47.908 1.00 30.39 ? 436 PRO A CD  1 
ATOM   965  N  N   . ARG A 1 120 ? 2.710   -42.266 47.574 1.00 30.44 ? 437 ARG A N   1 
ATOM   966  C  CA  . ARG A 1 120 ? 1.748   -43.276 47.155 1.00 30.44 ? 437 ARG A CA  1 
ATOM   967  C  C   . ARG A 1 120 ? 2.419   -44.451 46.396 1.00 30.16 ? 437 ARG A C   1 
ATOM   968  O  O   . ARG A 1 120 ? 2.051   -45.616 46.580 1.00 29.05 ? 437 ARG A O   1 
ATOM   969  C  CB  . ARG A 1 120 ? 0.644   -42.632 46.316 1.00 31.52 ? 437 ARG A CB  1 
ATOM   970  C  CG  . ARG A 1 120 ? -0.394  -43.616 45.914 1.00 34.35 ? 437 ARG A CG  1 
ATOM   971  C  CD  . ARG A 1 120 ? -1.810  -43.128 46.132 1.00 39.19 ? 437 ARG A CD  1 
ATOM   972  N  NE  . ARG A 1 120 ? -2.295  -42.365 44.985 1.00 40.01 ? 437 ARG A NE  1 
ATOM   973  C  CZ  . ARG A 1 120 ? -3.330  -42.712 44.215 1.00 40.24 ? 437 ARG A CZ  1 
ATOM   974  N  NH1 . ARG A 1 120 ? -4.024  -43.818 44.436 1.00 41.66 ? 437 ARG A NH1 1 
ATOM   975  N  NH2 . ARG A 1 120 ? -3.680  -41.931 43.206 1.00 40.41 ? 437 ARG A NH2 1 
ATOM   976  N  N   . PHE A 1 121 ? 3.402   -44.132 45.551 1.00 29.66 ? 438 PHE A N   1 
ATOM   977  C  CA  . PHE A 1 121 ? 4.170   -45.140 44.834 1.00 29.60 ? 438 PHE A CA  1 
ATOM   978  C  C   . PHE A 1 121 ? 4.978   -46.025 45.805 1.00 29.11 ? 438 PHE A C   1 
ATOM   979  O  O   . PHE A 1 121 ? 4.934   -47.245 45.723 1.00 29.62 ? 438 PHE A O   1 
ATOM   980  C  CB  . PHE A 1 121 ? 5.085   -44.487 43.783 1.00 29.67 ? 438 PHE A CB  1 
ATOM   981  C  CG  . PHE A 1 121 ? 6.046   -45.450 43.137 1.00 29.95 ? 438 PHE A CG  1 
ATOM   982  C  CD1 . PHE A 1 121 ? 5.586   -46.634 42.578 1.00 31.66 ? 438 PHE A CD1 1 
ATOM   983  C  CD2 . PHE A 1 121 ? 7.407   -45.200 43.141 1.00 31.28 ? 438 PHE A CD2 1 
ATOM   984  C  CE1 . PHE A 1 121 ? 6.479   -47.554 41.996 1.00 32.48 ? 438 PHE A CE1 1 
ATOM   985  C  CE2 . PHE A 1 121 ? 8.298   -46.112 42.577 1.00 31.86 ? 438 PHE A CE2 1 
ATOM   986  C  CZ  . PHE A 1 121 ? 7.829   -47.282 41.994 1.00 31.55 ? 438 PHE A CZ  1 
ATOM   987  N  N   . ILE A 1 122 ? 5.698   -45.402 46.729 1.00 29.73 ? 439 ILE A N   1 
ATOM   988  C  CA  . ILE A 1 122 ? 6.546   -46.151 47.665 1.00 29.49 ? 439 ILE A CA  1 
ATOM   989  C  C   . ILE A 1 122 ? 5.699   -47.060 48.596 1.00 28.93 ? 439 ILE A C   1 
ATOM   990  O  O   . ILE A 1 122 ? 6.107   -48.185 48.880 1.00 28.82 ? 439 ILE A O   1 
ATOM   991  C  CB  . ILE A 1 122 ? 7.458   -45.233 48.476 1.00 29.26 ? 439 ILE A CB  1 
ATOM   992  C  CG1 . ILE A 1 122 ? 8.384   -44.426 47.532 1.00 29.90 ? 439 ILE A CG1 1 
ATOM   993  C  CG2 . ILE A 1 122 ? 8.318   -46.053 49.509 1.00 29.51 ? 439 ILE A CG2 1 
ATOM   994  C  CD1 . ILE A 1 122 ? 9.211   -45.286 46.608 1.00 28.50 ? 439 ILE A CD1 1 
ATOM   995  N  N   . ARG A 1 123 ? 4.531   -46.602 49.032 1.00 28.40 ? 440 ARG A N   1 
ATOM   996  C  CA  . ARG A 1 123 ? 3.656   -47.464 49.880 1.00 28.85 ? 440 ARG A CA  1 
ATOM   997  C  C   . ARG A 1 123 ? 2.817   -48.497 49.111 1.00 28.83 ? 440 ARG A C   1 
ATOM   998  O  O   . ARG A 1 123 ? 2.179   -49.353 49.725 1.00 28.64 ? 440 ARG A O   1 
ATOM   999  C  CB  . ARG A 1 123 ? 2.774   -46.626 50.823 1.00 28.26 ? 440 ARG A CB  1 
ATOM   1000 C  CG  . ARG A 1 123 ? 1.581   -45.998 50.198 1.00 29.49 ? 440 ARG A CG  1 
ATOM   1001 C  CD  . ARG A 1 123 ? 0.666   -45.422 51.242 1.00 28.25 ? 440 ARG A CD  1 
ATOM   1002 N  NE  . ARG A 1 123 ? -0.539  -44.856 50.656 1.00 26.24 ? 440 ARG A NE  1 
ATOM   1003 C  CZ  . ARG A 1 123 ? -0.704  -43.589 50.295 1.00 28.79 ? 440 ARG A CZ  1 
ATOM   1004 N  NH1 . ARG A 1 123 ? 0.264   -42.698 50.436 1.00 29.15 ? 440 ARG A NH1 1 
ATOM   1005 N  NH2 . ARG A 1 123 ? -1.858  -43.199 49.777 1.00 30.37 ? 440 ARG A NH2 1 
ATOM   1006 N  N   . SER A 1 124 ? 2.836   -48.448 47.779 1.00 29.01 ? 441 SER A N   1 
ATOM   1007 C  CA  . SER A 1 124 ? 2.056   -49.374 46.962 1.00 29.30 ? 441 SER A CA  1 
ATOM   1008 C  C   . SER A 1 124 ? 2.531   -50.832 47.073 1.00 29.90 ? 441 SER A C   1 
ATOM   1009 O  O   . SER A 1 124 ? 3.679   -51.095 47.408 1.00 29.42 ? 441 SER A O   1 
ATOM   1010 C  CB  . SER A 1 124 ? 2.107   -48.957 45.490 1.00 29.37 ? 441 SER A CB  1 
ATOM   1011 O  OG  . SER A 1 124 ? 3.379   -49.233 44.943 1.00 30.00 ? 441 SER A OG  1 
ATOM   1012 N  N   . SER A 1 125 ? 1.620   -51.766 46.799 1.00 30.77 ? 442 SER A N   1 
ATOM   1013 C  CA  . SER A 1 125 ? 1.962   -53.181 46.603 1.00 31.56 ? 442 SER A CA  1 
ATOM   1014 C  C   . SER A 1 125 ? 2.960   -53.366 45.461 1.00 31.48 ? 442 SER A C   1 
ATOM   1015 O  O   . SER A 1 125 ? 3.842   -54.199 45.541 1.00 31.46 ? 442 SER A O   1 
ATOM   1016 C  CB  . SER A 1 125 ? 0.704   -53.997 46.285 1.00 32.10 ? 442 SER A CB  1 
ATOM   1017 O  OG  . SER A 1 125 ? -0.075  -54.188 47.449 1.00 35.23 ? 442 SER A OG  1 
ATOM   1018 N  N   . ALA A 1 126 ? 2.806   -52.595 44.395 1.00 31.80 ? 443 ALA A N   1 
ATOM   1019 C  CA  . ALA A 1 126 ? 3.756   -52.623 43.263 1.00 32.33 ? 443 ALA A CA  1 
ATOM   1020 C  C   . ALA A 1 126 ? 5.221   -52.462 43.736 1.00 32.39 ? 443 ALA A C   1 
ATOM   1021 O  O   . ALA A 1 126 ? 6.069   -53.322 43.449 1.00 32.84 ? 443 ALA A O   1 
ATOM   1022 C  CB  . ALA A 1 126 ? 3.401   -51.552 42.238 1.00 32.54 ? 443 ALA A CB  1 
ATOM   1023 N  N   . TYR A 1 127 ? 5.512   -51.412 44.500 1.00 31.72 ? 444 TYR A N   1 
ATOM   1024 C  CA  . TYR A 1 127 ? 6.877   -51.224 45.002 1.00 31.34 ? 444 TYR A CA  1 
ATOM   1025 C  C   . TYR A 1 127 ? 7.265   -52.224 46.087 1.00 31.96 ? 444 TYR A C   1 
ATOM   1026 O  O   . TYR A 1 127 ? 8.342   -52.806 46.055 1.00 30.68 ? 444 TYR A O   1 
ATOM   1027 C  CB  . TYR A 1 127 ? 7.088   -49.795 45.529 1.00 31.08 ? 444 TYR A CB  1 
ATOM   1028 C  CG  . TYR A 1 127 ? 8.513   -49.530 45.969 1.00 29.57 ? 444 TYR A CG  1 
ATOM   1029 C  CD1 . TYR A 1 127 ? 9.550   -49.493 45.039 1.00 29.79 ? 444 TYR A CD1 1 
ATOM   1030 C  CD2 . TYR A 1 127 ? 8.825   -49.330 47.299 1.00 29.37 ? 444 TYR A CD2 1 
ATOM   1031 C  CE1 . TYR A 1 127 ? 10.849  -49.268 45.426 1.00 28.69 ? 444 TYR A CE1 1 
ATOM   1032 C  CE2 . TYR A 1 127 ? 10.140  -49.092 47.710 1.00 30.13 ? 444 TYR A CE2 1 
ATOM   1033 C  CZ  . TYR A 1 127 ? 11.152  -49.062 46.766 1.00 29.70 ? 444 TYR A CZ  1 
ATOM   1034 O  OH  . TYR A 1 127 ? 12.463  -48.829 47.140 1.00 29.16 ? 444 TYR A OH  1 
ATOM   1035 N  N   . GLN A 1 128 ? 6.386   -52.398 47.068 1.00 33.50 ? 445 GLN A N   1 
ATOM   1036 C  CA  . GLN A 1 128 ? 6.670   -53.255 48.201 1.00 34.43 ? 445 GLN A CA  1 
ATOM   1037 C  C   . GLN A 1 128 ? 6.852   -54.692 47.744 1.00 35.13 ? 445 GLN A C   1 
ATOM   1038 O  O   . GLN A 1 128 ? 7.691   -55.388 48.276 1.00 35.05 ? 445 GLN A O   1 
ATOM   1039 C  CB  . GLN A 1 128 ? 5.566   -53.124 49.260 1.00 34.78 ? 445 GLN A CB  1 
ATOM   1040 C  CG  . GLN A 1 128 ? 5.533   -51.720 49.912 1.00 34.64 ? 445 GLN A CG  1 
ATOM   1041 C  CD  . GLN A 1 128 ? 6.756   -51.467 50.769 1.00 35.92 ? 445 GLN A CD  1 
ATOM   1042 O  OE1 . GLN A 1 128 ? 7.139   -52.312 51.560 1.00 36.09 ? 445 GLN A OE1 1 
ATOM   1043 N  NE2 . GLN A 1 128 ? 7.378   -50.306 50.604 1.00 34.73 ? 445 GLN A NE2 1 
ATOM   1044 N  N   . GLU A 1 129 ? 6.113   -55.118 46.720 1.00 36.30 ? 446 GLU A N   1 
ATOM   1045 C  CA  . GLU A 1 129 ? 6.299   -56.463 46.165 1.00 37.64 ? 446 GLU A CA  1 
ATOM   1046 C  C   . GLU A 1 129 ? 7.685   -56.647 45.535 1.00 37.65 ? 446 GLU A C   1 
ATOM   1047 O  O   . GLU A 1 129 ? 8.331   -57.669 45.762 1.00 37.91 ? 446 GLU A O   1 
ATOM   1048 C  CB  . GLU A 1 129 ? 5.176   -56.837 45.190 1.00 37.43 ? 446 GLU A CB  1 
ATOM   1049 C  CG  . GLU A 1 129 ? 3.880   -57.193 45.921 1.00 38.64 ? 446 GLU A CG  1 
ATOM   1050 C  CD  . GLU A 1 129 ? 2.711   -57.521 45.001 1.00 39.45 ? 446 GLU A CD  1 
ATOM   1051 O  OE1 . GLU A 1 129 ? 2.771   -57.220 43.779 1.00 40.85 ? 446 GLU A OE1 1 
ATOM   1052 O  OE2 . GLU A 1 129 ? 1.721   -58.093 45.522 1.00 43.16 ? 446 GLU A OE2 1 
ATOM   1053 N  N   . LEU A 1 130 ? 8.144   -55.658 44.778 1.00 38.55 ? 447 LEU A N   1 
ATOM   1054 C  CA  . LEU A 1 130 ? 9.520   -55.663 44.267 1.00 38.98 ? 447 LEU A CA  1 
ATOM   1055 C  C   . LEU A 1 130 ? 10.523  -55.901 45.382 1.00 39.16 ? 447 LEU A C   1 
ATOM   1056 O  O   . LEU A 1 130 ? 11.323  -56.831 45.312 1.00 38.78 ? 447 LEU A O   1 
ATOM   1057 C  CB  . LEU A 1 130 ? 9.868   -54.347 43.597 1.00 39.09 ? 447 LEU A CB  1 
ATOM   1058 C  CG  . LEU A 1 130 ? 9.514   -54.208 42.132 1.00 40.01 ? 447 LEU A CG  1 
ATOM   1059 C  CD1 . LEU A 1 130 ? 9.990   -52.853 41.639 1.00 39.68 ? 447 LEU A CD1 1 
ATOM   1060 C  CD2 . LEU A 1 130 ? 10.128  -55.361 41.330 1.00 40.08 ? 447 LEU A CD2 1 
ATOM   1061 N  N   . LEU A 1 131 ? 10.470  -55.058 46.412 1.00 39.27 ? 448 LEU A N   1 
ATOM   1062 C  CA  . LEU A 1 131 ? 11.386  -55.191 47.542 1.00 39.44 ? 448 LEU A CA  1 
ATOM   1063 C  C   . LEU A 1 131 ? 11.411  -56.618 48.079 1.00 39.71 ? 448 LEU A C   1 
ATOM   1064 O  O   . LEU A 1 131 ? 12.458  -57.253 48.049 1.00 40.02 ? 448 LEU A O   1 
ATOM   1065 C  CB  . LEU A 1 131 ? 11.045  -54.200 48.649 1.00 39.19 ? 448 LEU A CB  1 
ATOM   1066 C  CG  . LEU A 1 131 ? 11.456  -52.764 48.330 1.00 38.02 ? 448 LEU A CG  1 
ATOM   1067 C  CD1 . LEU A 1 131 ? 10.901  -51.843 49.417 1.00 37.96 ? 448 LEU A CD1 1 
ATOM   1068 C  CD2 . LEU A 1 131 ? 12.968  -52.626 48.217 1.00 36.81 ? 448 LEU A CD2 1 
ATOM   1069 N  N   . GLN A 1 132 ? 10.259  -57.116 48.537 1.00 40.15 ? 449 GLN A N   1 
ATOM   1070 C  CA  . GLN A 1 132 ? 10.118  -58.501 49.013 1.00 40.54 ? 449 GLN A CA  1 
ATOM   1071 C  C   . GLN A 1 132 ? 10.650  -59.542 48.023 1.00 40.57 ? 449 GLN A C   1 
ATOM   1072 O  O   . GLN A 1 132 ? 11.408  -60.432 48.401 1.00 40.21 ? 449 GLN A O   1 
ATOM   1073 C  CB  . GLN A 1 132 ? 8.640   -58.827 49.312 1.00 40.92 ? 449 GLN A CB  1 
ATOM   1074 C  CG  . GLN A 1 132 ? 8.110   -58.269 50.635 1.00 41.66 ? 449 GLN A CG  1 
ATOM   1075 N  N   . ALA A 1 133 ? 10.223  -59.416 46.766 1.00 40.75 ? 450 ALA A N   1 
ATOM   1076 C  CA  . ALA A 1 133 ? 10.492  -60.394 45.721 1.00 40.86 ? 450 ALA A CA  1 
ATOM   1077 C  C   . ALA A 1 133 ? 10.366  -59.749 44.358 1.00 40.90 ? 450 ALA A C   1 
ATOM   1078 O  O   . ALA A 1 133 ? 11.368  -59.434 43.725 1.00 41.56 ? 450 ALA A O   1 
ATOM   1079 C  CB  . ALA A 1 133 ? 9.517   -61.555 45.827 1.00 41.09 ? 450 ALA A CB  1 
ATOM   1080 N  N   . SER B 1 1   ? 20.272  -58.070 26.317 1.00 32.05 ? 318 SER B N   1 
ATOM   1081 C  CA  . SER B 1 1   ? 19.109  -57.601 27.112 1.00 31.97 ? 318 SER B CA  1 
ATOM   1082 C  C   . SER B 1 1   ? 19.564  -57.031 28.451 1.00 32.33 ? 318 SER B C   1 
ATOM   1083 O  O   . SER B 1 1   ? 20.614  -57.417 28.968 1.00 31.35 ? 318 SER B O   1 
ATOM   1084 C  CB  . SER B 1 1   ? 18.129  -58.751 27.324 1.00 31.64 ? 318 SER B CB  1 
ATOM   1085 O  OG  . SER B 1 1   ? 17.717  -59.270 26.077 1.00 31.27 ? 318 SER B OG  1 
ATOM   1086 N  N   . MET B 1 2   ? 18.762  -56.115 28.994 1.00 33.41 ? 319 MET B N   1 
ATOM   1087 C  CA  . MET B 1 2   ? 19.030  -55.476 30.287 1.00 35.09 ? 319 MET B CA  1 
ATOM   1088 C  C   . MET B 1 2   ? 19.107  -56.526 31.399 1.00 34.27 ? 319 MET B C   1 
ATOM   1089 O  O   . MET B 1 2   ? 18.449  -57.567 31.321 1.00 34.21 ? 319 MET B O   1 
ATOM   1090 C  CB  . MET B 1 2   ? 17.934  -54.451 30.610 1.00 35.00 ? 319 MET B CB  1 
ATOM   1091 C  CG  . MET B 1 2   ? 17.883  -53.264 29.641 1.00 36.54 ? 319 MET B CG  1 
ATOM   1092 S  SD  . MET B 1 2   ? 16.574  -52.055 29.951 1.00 41.56 ? 319 MET B SD  1 
ATOM   1093 C  CE  . MET B 1 2   ? 15.076  -53.009 29.747 1.00 41.16 ? 319 MET B CE  1 
ATOM   1094 N  N   . LYS B 1 3   ? 19.930  -56.265 32.413 1.00 34.18 ? 320 LYS B N   1 
ATOM   1095 C  CA  . LYS B 1 3   ? 19.996  -57.141 33.595 1.00 34.19 ? 320 LYS B CA  1 
ATOM   1096 C  C   . LYS B 1 3   ? 18.999  -56.705 34.676 1.00 34.44 ? 320 LYS B C   1 
ATOM   1097 O  O   . LYS B 1 3   ? 18.675  -55.517 34.801 1.00 33.79 ? 320 LYS B O   1 
ATOM   1098 C  CB  . LYS B 1 3   ? 21.412  -57.183 34.173 1.00 34.26 ? 320 LYS B CB  1 
ATOM   1099 N  N   . GLU B 1 4   ? 18.518  -57.680 35.454 1.00 34.79 ? 321 GLU B N   1 
ATOM   1100 C  CA  . GLU B 1 4   ? 17.587  -57.406 36.541 1.00 35.41 ? 321 GLU B CA  1 
ATOM   1101 C  C   . GLU B 1 4   ? 18.195  -56.383 37.494 1.00 34.64 ? 321 GLU B C   1 
ATOM   1102 O  O   . GLU B 1 4   ? 19.359  -56.516 37.893 1.00 34.61 ? 321 GLU B O   1 
ATOM   1103 C  CB  . GLU B 1 4   ? 17.236  -58.681 37.327 1.00 36.26 ? 321 GLU B CB  1 
ATOM   1104 C  CG  . GLU B 1 4   ? 15.837  -58.636 37.962 1.00 38.43 ? 321 GLU B CG  1 
ATOM   1105 C  CD  . GLU B 1 4   ? 14.749  -58.717 36.899 1.00 41.77 ? 321 GLU B CD  1 
ATOM   1106 O  OE1 . GLU B 1 4   ? 14.665  -59.785 36.266 1.00 45.82 ? 321 GLU B OE1 1 
ATOM   1107 O  OE2 . GLU B 1 4   ? 13.994  -57.736 36.679 1.00 44.28 ? 321 GLU B OE2 1 
ATOM   1108 N  N   . PRO B 1 5   ? 17.423  -55.355 37.856 1.00 33.94 ? 322 PRO B N   1 
ATOM   1109 C  CA  . PRO B 1 5   ? 17.921  -54.409 38.861 1.00 33.45 ? 322 PRO B CA  1 
ATOM   1110 C  C   . PRO B 1 5   ? 18.236  -55.112 40.171 1.00 32.57 ? 322 PRO B C   1 
ATOM   1111 O  O   . PRO B 1 5   ? 17.483  -55.994 40.611 1.00 32.44 ? 322 PRO B O   1 
ATOM   1112 C  CB  . PRO B 1 5   ? 16.755  -53.432 39.056 1.00 33.38 ? 322 PRO B CB  1 
ATOM   1113 C  CG  . PRO B 1 5   ? 15.867  -53.631 37.912 1.00 33.74 ? 322 PRO B CG  1 
ATOM   1114 C  CD  . PRO B 1 5   ? 16.076  -55.004 37.378 1.00 34.07 ? 322 PRO B CD  1 
ATOM   1115 N  N   . SER B 1 6   ? 19.352  -54.734 40.779 1.00 32.37 ? 323 SER B N   1 
ATOM   1116 C  CA  . SER B 1 6   ? 19.741  -55.274 42.075 1.00 31.82 ? 323 SER B CA  1 
ATOM   1117 C  C   . SER B 1 6   ? 18.793  -54.799 43.182 1.00 31.75 ? 323 SER B C   1 
ATOM   1118 O  O   . SER B 1 6   ? 18.003  -53.864 42.999 1.00 31.50 ? 323 SER B O   1 
ATOM   1119 C  CB  . SER B 1 6   ? 21.152  -54.820 42.412 1.00 31.92 ? 323 SER B CB  1 
ATOM   1120 O  OG  . SER B 1 6   ? 21.198  -53.412 42.534 1.00 30.52 ? 323 SER B OG  1 
ATOM   1121 N  N   . GLN B 1 7   ? 18.886  -55.454 44.332 1.00 31.98 ? 324 GLN B N   1 
ATOM   1122 C  CA  . GLN B 1 7   ? 18.118  -55.063 45.507 1.00 32.14 ? 324 GLN B CA  1 
ATOM   1123 C  C   . GLN B 1 7   ? 18.422  -53.621 45.917 1.00 31.69 ? 324 GLN B C   1 
ATOM   1124 O  O   . GLN B 1 7   ? 17.515  -52.846 46.193 1.00 30.80 ? 324 GLN B O   1 
ATOM   1125 C  CB  . GLN B 1 7   ? 18.420  -56.018 46.650 1.00 32.49 ? 324 GLN B CB  1 
ATOM   1126 C  CG  . GLN B 1 7   ? 17.395  -56.005 47.733 1.00 34.18 ? 324 GLN B CG  1 
ATOM   1127 C  CD  . GLN B 1 7   ? 17.699  -56.988 48.832 1.00 35.54 ? 324 GLN B CD  1 
ATOM   1128 O  OE1 . GLN B 1 7   ? 18.782  -57.592 48.876 1.00 37.25 ? 324 GLN B OE1 1 
ATOM   1129 N  NE2 . GLN B 1 7   ? 16.743  -57.164 49.736 1.00 35.73 ? 324 GLN B NE2 1 
ATOM   1130 N  N   . GLN B 1 8   ? 19.700  -53.254 45.911 1.00 31.74 ? 325 GLN B N   1 
ATOM   1131 C  CA  . GLN B 1 8   ? 20.102  -51.923 46.339 1.00 32.10 ? 325 GLN B CA  1 
ATOM   1132 C  C   . GLN B 1 8   ? 19.596  -50.829 45.438 1.00 31.57 ? 325 GLN B C   1 
ATOM   1133 O  O   . GLN B 1 8   ? 19.173  -49.784 45.927 1.00 31.79 ? 325 GLN B O   1 
ATOM   1134 C  CB  . GLN B 1 8   ? 21.622  -51.782 46.447 1.00 32.85 ? 325 GLN B CB  1 
ATOM   1135 C  CG  . GLN B 1 8   ? 22.024  -50.440 47.079 1.00 35.44 ? 325 GLN B CG  1 
ATOM   1136 C  CD  . GLN B 1 8   ? 21.207  -50.125 48.352 1.00 38.83 ? 325 GLN B CD  1 
ATOM   1137 O  OE1 . GLN B 1 8   ? 21.234  -50.895 49.321 1.00 39.72 ? 325 GLN B OE1 1 
ATOM   1138 N  NE2 . GLN B 1 8   ? 20.458  -49.003 48.331 1.00 38.92 ? 325 GLN B NE2 1 
ATOM   1139 N  N   . ARG B 1 9   ? 19.679  -51.061 44.129 1.00 30.74 ? 326 ARG B N   1 
ATOM   1140 C  CA  . ARG B 1 9   ? 19.146  -50.143 43.138 1.00 30.34 ? 326 ARG B CA  1 
ATOM   1141 C  C   . ARG B 1 9   ? 17.636  -49.857 43.343 1.00 30.75 ? 326 ARG B C   1 
ATOM   1142 O  O   . ARG B 1 9   ? 17.182  -48.710 43.219 1.00 30.66 ? 326 ARG B O   1 
ATOM   1143 C  CB  . ARG B 1 9   ? 19.423  -50.724 41.743 1.00 30.39 ? 326 ARG B CB  1 
ATOM   1144 C  CG  . ARG B 1 9   ? 18.847  -49.931 40.606 1.00 29.96 ? 326 ARG B CG  1 
ATOM   1145 C  CD  . ARG B 1 9   ? 19.218  -50.527 39.278 1.00 28.85 ? 326 ARG B CD  1 
ATOM   1146 N  NE  . ARG B 1 9   ? 18.636  -49.788 38.168 1.00 26.99 ? 326 ARG B NE  1 
ATOM   1147 C  CZ  . ARG B 1 9   ? 18.698  -50.166 36.899 1.00 25.87 ? 326 ARG B CZ  1 
ATOM   1148 N  NH1 . ARG B 1 9   ? 19.293  -51.293 36.568 1.00 25.89 ? 326 ARG B NH1 1 
ATOM   1149 N  NH2 . ARG B 1 9   ? 18.135  -49.424 35.961 1.00 25.60 ? 326 ARG B NH2 1 
ATOM   1150 N  N   . VAL B 1 10  ? 16.872  -50.908 43.652 1.00 30.48 ? 327 VAL B N   1 
ATOM   1151 C  CA  . VAL B 1 10  ? 15.445  -50.794 43.875 1.00 30.66 ? 327 VAL B CA  1 
ATOM   1152 C  C   . VAL B 1 10  ? 15.163  -50.071 45.191 1.00 30.42 ? 327 VAL B C   1 
ATOM   1153 O  O   . VAL B 1 10  ? 14.289  -49.185 45.236 1.00 30.42 ? 327 VAL B O   1 
ATOM   1154 C  CB  . VAL B 1 10  ? 14.766  -52.176 43.867 1.00 30.98 ? 327 VAL B CB  1 
ATOM   1155 C  CG1 . VAL B 1 10  ? 13.294  -52.065 44.301 1.00 32.12 ? 327 VAL B CG1 1 
ATOM   1156 C  CG2 . VAL B 1 10  ? 14.853  -52.790 42.466 1.00 31.93 ? 327 VAL B CG2 1 
ATOM   1157 N  N   . LYS B 1 11  ? 15.899  -50.445 46.243 1.00 29.77 ? 328 LYS B N   1 
ATOM   1158 C  CA  . LYS B 1 11  ? 15.803  -49.763 47.543 1.00 30.54 ? 328 LYS B CA  1 
ATOM   1159 C  C   . LYS B 1 11  ? 16.073  -48.266 47.427 1.00 30.63 ? 328 LYS B C   1 
ATOM   1160 O  O   . LYS B 1 11  ? 15.433  -47.470 48.097 1.00 29.86 ? 328 LYS B O   1 
ATOM   1161 C  CB  . LYS B 1 11  ? 16.779  -50.355 48.579 1.00 30.45 ? 328 LYS B CB  1 
ATOM   1162 C  CG  . LYS B 1 11  ? 16.310  -51.631 49.251 1.00 31.64 ? 328 LYS B CG  1 
ATOM   1163 C  CD  . LYS B 1 11  ? 17.340  -52.136 50.248 1.00 31.00 ? 328 LYS B CD  1 
ATOM   1164 C  CE  . LYS B 1 11  ? 16.885  -53.399 50.931 1.00 32.82 ? 328 LYS B CE  1 
ATOM   1165 N  NZ  . LYS B 1 11  ? 17.985  -54.082 51.707 1.00 33.45 ? 328 LYS B NZ  1 
ATOM   1166 N  N   . ARG B 1 12  ? 17.045  -47.910 46.586 1.00 31.50 ? 329 ARG B N   1 
ATOM   1167 C  CA  . ARG B 1 12  ? 17.482  -46.528 46.414 1.00 32.62 ? 329 ARG B CA  1 
ATOM   1168 C  C   . ARG B 1 12  ? 16.368  -45.630 45.826 1.00 32.23 ? 329 ARG B C   1 
ATOM   1169 O  O   . ARG B 1 12  ? 16.327  -44.433 46.104 1.00 32.52 ? 329 ARG B O   1 
ATOM   1170 C  CB  . ARG B 1 12  ? 18.775  -46.498 45.575 1.00 32.48 ? 329 ARG B CB  1 
ATOM   1171 C  CG  . ARG B 1 12  ? 19.368  -45.111 45.356 1.00 34.92 ? 329 ARG B CG  1 
ATOM   1172 C  CD  . ARG B 1 12  ? 20.626  -45.108 44.441 1.00 35.52 ? 329 ARG B CD  1 
ATOM   1173 N  NE  . ARG B 1 12  ? 21.531  -46.233 44.704 1.00 37.86 ? 329 ARG B NE  1 
ATOM   1174 C  CZ  . ARG B 1 12  ? 21.839  -47.204 43.837 1.00 39.94 ? 329 ARG B CZ  1 
ATOM   1175 N  NH1 . ARG B 1 12  ? 21.334  -47.226 42.597 1.00 40.74 ? 329 ARG B NH1 1 
ATOM   1176 N  NH2 . ARG B 1 12  ? 22.670  -48.176 44.212 1.00 40.66 ? 329 ARG B NH2 1 
ATOM   1177 N  N   . TRP B 1 13  ? 15.435  -46.213 45.071 1.00 32.16 ? 330 TRP B N   1 
ATOM   1178 C  CA  . TRP B 1 13  ? 14.276  -45.465 44.591 1.00 31.95 ? 330 TRP B CA  1 
ATOM   1179 C  C   . TRP B 1 13  ? 13.394  -44.935 45.711 1.00 31.27 ? 330 TRP B C   1 
ATOM   1180 O  O   . TRP B 1 13  ? 12.657  -43.972 45.496 1.00 30.58 ? 330 TRP B O   1 
ATOM   1181 C  CB  . TRP B 1 13  ? 13.377  -46.296 43.683 1.00 32.64 ? 330 TRP B CB  1 
ATOM   1182 C  CG  . TRP B 1 13  ? 14.025  -46.943 42.523 1.00 32.91 ? 330 TRP B CG  1 
ATOM   1183 C  CD1 . TRP B 1 13  ? 15.213  -46.595 41.930 1.00 34.00 ? 330 TRP B CD1 1 
ATOM   1184 C  CD2 . TRP B 1 13  ? 13.510  -48.047 41.778 1.00 33.99 ? 330 TRP B CD2 1 
ATOM   1185 N  NE1 . TRP B 1 13  ? 15.466  -47.430 40.866 1.00 34.24 ? 330 TRP B NE1 1 
ATOM   1186 C  CE2 . TRP B 1 13  ? 14.446  -48.336 40.751 1.00 34.25 ? 330 TRP B CE2 1 
ATOM   1187 C  CE3 . TRP B 1 13  ? 12.362  -48.844 41.891 1.00 34.75 ? 330 TRP B CE3 1 
ATOM   1188 C  CZ2 . TRP B 1 13  ? 14.265  -49.379 39.833 1.00 33.76 ? 330 TRP B CZ2 1 
ATOM   1189 C  CZ3 . TRP B 1 13  ? 12.179  -49.892 40.960 1.00 34.67 ? 330 TRP B CZ3 1 
ATOM   1190 C  CH2 . TRP B 1 13  ? 13.139  -50.147 39.958 1.00 33.41 ? 330 TRP B CH2 1 
ATOM   1191 N  N   . GLY B 1 14  ? 13.440  -45.578 46.877 1.00 30.94 ? 331 GLY B N   1 
ATOM   1192 C  CA  . GLY B 1 14  ? 12.696  -45.119 48.046 1.00 30.58 ? 331 GLY B CA  1 
ATOM   1193 C  C   . GLY B 1 14  ? 13.419  -44.076 48.882 1.00 31.03 ? 331 GLY B C   1 
ATOM   1194 O  O   . GLY B 1 14  ? 12.883  -43.637 49.910 1.00 31.14 ? 331 GLY B O   1 
ATOM   1195 N  N   . PHE B 1 15  ? 14.642  -43.700 48.486 1.00 30.87 ? 332 PHE B N   1 
ATOM   1196 C  CA  . PHE B 1 15  ? 15.399  -42.686 49.227 1.00 30.53 ? 332 PHE B CA  1 
ATOM   1197 C  C   . PHE B 1 15  ? 14.997  -41.254 48.891 1.00 30.87 ? 332 PHE B C   1 
ATOM   1198 O  O   . PHE B 1 15  ? 15.357  -40.330 49.612 1.00 31.73 ? 332 PHE B O   1 
ATOM   1199 C  CB  . PHE B 1 15  ? 16.904  -42.877 49.034 1.00 30.72 ? 332 PHE B CB  1 
ATOM   1200 C  CG  . PHE B 1 15  ? 17.449  -44.161 49.617 1.00 30.29 ? 332 PHE B CG  1 
ATOM   1201 C  CD1 . PHE B 1 15  ? 16.702  -44.944 50.500 1.00 30.38 ? 332 PHE B CD1 1 
ATOM   1202 C  CD2 . PHE B 1 15  ? 18.736  -44.564 49.301 1.00 31.45 ? 332 PHE B CD2 1 
ATOM   1203 C  CE1 . PHE B 1 15  ? 17.231  -46.123 51.034 1.00 31.43 ? 332 PHE B CE1 1 
ATOM   1204 C  CE2 . PHE B 1 15  ? 19.279  -45.734 49.840 1.00 31.31 ? 332 PHE B CE2 1 
ATOM   1205 C  CZ  . PHE B 1 15  ? 18.528  -46.513 50.704 1.00 30.74 ? 332 PHE B CZ  1 
ATOM   1206 N  N   . GLY B 1 16  ? 14.249  -41.045 47.806 1.00 30.68 ? 333 GLY B N   1 
ATOM   1207 C  CA  . GLY B 1 16  ? 13.724  -39.728 47.507 1.00 30.00 ? 333 GLY B CA  1 
ATOM   1208 C  C   . GLY B 1 16  ? 13.223  -39.724 46.089 1.00 29.92 ? 333 GLY B C   1 
ATOM   1209 O  O   . GLY B 1 16  ? 13.580  -40.592 45.297 1.00 29.22 ? 333 GLY B O   1 
ATOM   1210 N  N   . MET B 1 17  ? 12.370  -38.772 45.770 1.00 29.81 ? 334 MET B N   1 
ATOM   1211 C  CA  . MET B 1 17  ? 11.784  -38.747 44.438 1.00 30.35 ? 334 MET B CA  1 
ATOM   1212 C  C   . MET B 1 17  ? 12.829  -38.549 43.328 1.00 30.04 ? 334 MET B C   1 
ATOM   1213 O  O   . MET B 1 17  ? 12.706  -39.102 42.244 1.00 29.37 ? 334 MET B O   1 
ATOM   1214 C  CB  . MET B 1 17  ? 10.670  -37.695 44.356 1.00 30.79 ? 334 MET B CB  1 
ATOM   1215 C  CG  . MET B 1 17  ? 9.787   -37.887 43.116 1.00 30.05 ? 334 MET B CG  1 
ATOM   1216 S  SD  . MET B 1 17  ? 8.437   -36.725 42.970 1.00 31.59 ? 334 MET B SD  1 
ATOM   1217 C  CE  . MET B 1 17  ? 9.306   -35.156 42.750 1.00 30.03 ? 334 MET B CE  1 
ATOM   1218 N  N   . ASP B 1 18  ? 13.858  -37.752 43.596 1.00 30.90 ? 335 ASP B N   1 
ATOM   1219 C  CA  . ASP B 1 18  ? 14.912  -37.524 42.606 1.00 32.07 ? 335 ASP B CA  1 
ATOM   1220 C  C   . ASP B 1 18  ? 15.646  -38.819 42.238 1.00 32.57 ? 335 ASP B C   1 
ATOM   1221 O  O   . ASP B 1 18  ? 15.963  -39.068 41.057 1.00 32.15 ? 335 ASP B O   1 
ATOM   1222 C  CB  . ASP B 1 18  ? 15.883  -36.444 43.101 1.00 32.87 ? 335 ASP B CB  1 
ATOM   1223 C  CG  . ASP B 1 18  ? 15.213  -35.063 43.191 1.00 35.39 ? 335 ASP B CG  1 
ATOM   1224 O  OD1 . ASP B 1 18  ? 14.196  -34.828 42.474 1.00 35.62 ? 335 ASP B OD1 1 
ATOM   1225 O  OD2 . ASP B 1 18  ? 15.700  -34.220 43.981 1.00 39.33 ? 335 ASP B OD2 1 
ATOM   1226 N  N   . GLU B 1 19  ? 15.837  -39.673 43.235 1.00 32.97 ? 336 GLU B N   1 
ATOM   1227 C  CA  . GLU B 1 19  ? 16.472  -40.975 43.028 1.00 33.87 ? 336 GLU B CA  1 
ATOM   1228 C  C   . GLU B 1 19  ? 15.652  -41.819 42.108 1.00 32.51 ? 336 GLU B C   1 
ATOM   1229 O  O   . GLU B 1 19  ? 16.180  -42.486 41.222 1.00 32.85 ? 336 GLU B O   1 
ATOM   1230 C  CB  . GLU B 1 19  ? 16.625  -41.751 44.349 1.00 34.20 ? 336 GLU B CB  1 
ATOM   1231 C  CG  . GLU B 1 19  ? 17.429  -41.042 45.396 1.00 38.69 ? 336 GLU B CG  1 
ATOM   1232 C  CD  . GLU B 1 19  ? 18.924  -41.130 45.170 1.00 42.66 ? 336 GLU B CD  1 
ATOM   1233 O  OE1 . GLU B 1 19  ? 19.353  -41.717 44.142 1.00 44.35 ? 336 GLU B OE1 1 
ATOM   1234 O  OE2 . GLU B 1 19  ? 19.659  -40.598 46.037 1.00 46.41 ? 336 GLU B OE2 1 
ATOM   1235 N  N   . ALA B 1 20  ? 14.352  -41.835 42.337 1.00 32.40 ? 337 ALA B N   1 
ATOM   1236 C  CA  . ALA B 1 20  ? 13.474  -42.652 41.499 1.00 32.43 ? 337 ALA B CA  1 
ATOM   1237 C  C   . ALA B 1 20  ? 13.440  -42.091 40.074 1.00 32.13 ? 337 ALA B C   1 
ATOM   1238 O  O   . ALA B 1 20  ? 13.407  -42.857 39.118 1.00 32.47 ? 337 ALA B O   1 
ATOM   1239 C  CB  . ALA B 1 20  ? 12.072  -42.712 42.067 1.00 31.67 ? 337 ALA B CB  1 
ATOM   1240 N  N   . LEU B 1 21  ? 13.443  -40.768 39.938 1.00 32.07 ? 338 LEU B N   1 
ATOM   1241 C  CA  . LEU B 1 21  ? 13.297  -40.144 38.596 1.00 33.13 ? 338 LEU B CA  1 
ATOM   1242 C  C   . LEU B 1 21  ? 14.573  -40.247 37.750 1.00 32.93 ? 338 LEU B C   1 
ATOM   1243 O  O   . LEU B 1 21  ? 14.500  -40.345 36.511 1.00 33.88 ? 338 LEU B O   1 
ATOM   1244 C  CB  . LEU B 1 21  ? 12.877  -38.674 38.690 1.00 32.71 ? 338 LEU B CB  1 
ATOM   1245 C  CG  . LEU B 1 21  ? 11.483  -38.415 39.240 1.00 34.15 ? 338 LEU B CG  1 
ATOM   1246 C  CD1 . LEU B 1 21  ? 11.249  -36.951 39.561 1.00 34.63 ? 338 LEU B CD1 1 
ATOM   1247 C  CD2 . LEU B 1 21  ? 10.419  -38.918 38.260 1.00 34.91 ? 338 LEU B CD2 1 
ATOM   1248 N  N   . LYS B 1 22  ? 15.735  -40.208 38.398 1.00 33.28 ? 339 LYS B N   1 
ATOM   1249 C  CA  . LYS B 1 22  ? 16.993  -40.262 37.654 1.00 33.19 ? 339 LYS B CA  1 
ATOM   1250 C  C   . LYS B 1 22  ? 17.320  -41.682 37.166 1.00 32.42 ? 339 LYS B C   1 
ATOM   1251 O  O   . LYS B 1 22  ? 18.018  -41.842 36.174 1.00 32.36 ? 339 LYS B O   1 
ATOM   1252 C  CB  . LYS B 1 22  ? 18.147  -39.666 38.454 1.00 34.12 ? 339 LYS B CB  1 
ATOM   1253 C  CG  . LYS B 1 22  ? 18.671  -40.527 39.589 1.00 36.25 ? 339 LYS B CG  1 
ATOM   1254 C  CD  . LYS B 1 22  ? 20.187  -40.515 39.653 1.00 39.44 ? 339 LYS B CD  1 
ATOM   1255 C  CE  . LYS B 1 22  ? 20.736  -39.445 40.574 1.00 40.70 ? 339 LYS B CE  1 
ATOM   1256 N  NZ  . LYS B 1 22  ? 22.178  -39.713 40.836 1.00 42.50 ? 339 LYS B NZ  1 
ATOM   1257 N  N   . ASP B 1 23  ? 16.797  -42.708 37.841 1.00 31.42 ? 340 ASP B N   1 
ATOM   1258 C  CA  . ASP B 1 23  ? 16.974  -44.088 37.383 1.00 31.04 ? 340 ASP B CA  1 
ATOM   1259 C  C   . ASP B 1 23  ? 15.915  -44.373 36.308 1.00 31.12 ? 340 ASP B C   1 
ATOM   1260 O  O   . ASP B 1 23  ? 14.737  -44.244 36.594 1.00 31.68 ? 340 ASP B O   1 
ATOM   1261 C  CB  . ASP B 1 23  ? 16.818  -45.040 38.579 1.00 30.76 ? 340 ASP B CB  1 
ATOM   1262 C  CG  . ASP B 1 23  ? 17.140  -46.488 38.226 1.00 29.74 ? 340 ASP B CG  1 
ATOM   1263 O  OD1 . ASP B 1 23  ? 16.735  -46.977 37.166 1.00 26.88 ? 340 ASP B OD1 1 
ATOM   1264 O  OD2 . ASP B 1 23  ? 17.812  -47.135 39.012 1.00 28.44 ? 340 ASP B OD2 1 
ATOM   1265 N  N   . PRO B 1 24  ? 16.315  -44.770 35.070 1.00 31.85 ? 341 PRO B N   1 
ATOM   1266 C  CA  . PRO B 1 24  ? 15.296  -44.928 34.006 1.00 31.58 ? 341 PRO B CA  1 
ATOM   1267 C  C   . PRO B 1 24  ? 14.254  -46.021 34.302 1.00 31.65 ? 341 PRO B C   1 
ATOM   1268 O  O   . PRO B 1 24  ? 13.087  -45.858 33.953 1.00 32.04 ? 341 PRO B O   1 
ATOM   1269 C  CB  . PRO B 1 24  ? 16.123  -45.305 32.761 1.00 32.20 ? 341 PRO B CB  1 
ATOM   1270 C  CG  . PRO B 1 24  ? 17.535  -45.048 33.113 1.00 32.17 ? 341 PRO B CG  1 
ATOM   1271 C  CD  . PRO B 1 24  ? 17.660  -45.143 34.588 1.00 31.61 ? 341 PRO B CD  1 
ATOM   1272 N  N   . VAL B 1 25  ? 14.672  -47.110 34.951 1.00 31.04 ? 342 VAL B N   1 
ATOM   1273 C  CA  . VAL B 1 25  ? 13.749  -48.166 35.371 1.00 31.21 ? 342 VAL B CA  1 
ATOM   1274 C  C   . VAL B 1 25  ? 12.854  -47.694 36.547 1.00 31.55 ? 342 VAL B C   1 
ATOM   1275 O  O   . VAL B 1 25  ? 11.656  -47.963 36.579 1.00 31.53 ? 342 VAL B O   1 
ATOM   1276 C  CB  . VAL B 1 25  ? 14.508  -49.456 35.738 1.00 30.87 ? 342 VAL B CB  1 
ATOM   1277 C  CG1 . VAL B 1 25  ? 13.567  -50.493 36.280 1.00 30.90 ? 342 VAL B CG1 1 
ATOM   1278 C  CG2 . VAL B 1 25  ? 15.263  -49.992 34.509 1.00 30.96 ? 342 VAL B CG2 1 
ATOM   1279 N  N   . GLY B 1 26  ? 13.445  -46.979 37.496 1.00 31.98 ? 343 GLY B N   1 
ATOM   1280 C  CA  . GLY B 1 26  ? 12.693  -46.385 38.592 1.00 31.86 ? 343 GLY B CA  1 
ATOM   1281 C  C   . GLY B 1 26  ? 11.617  -45.456 38.068 1.00 31.85 ? 343 GLY B C   1 
ATOM   1282 O  O   . GLY B 1 26  ? 10.460  -45.491 38.533 1.00 30.61 ? 343 GLY B O   1 
ATOM   1283 N  N   . ARG B 1 27  ? 11.996  -44.637 37.081 1.00 31.76 ? 344 ARG B N   1 
ATOM   1284 C  CA  . ARG B 1 27  ? 11.072  -43.670 36.517 1.00 32.18 ? 344 ARG B CA  1 
ATOM   1285 C  C   . ARG B 1 27  ? 9.929   -44.419 35.807 1.00 31.82 ? 344 ARG B C   1 
ATOM   1286 O  O   . ARG B 1 27  ? 8.766   -44.002 35.881 1.00 30.41 ? 344 ARG B O   1 
ATOM   1287 C  CB  . ARG B 1 27  ? 11.810  -42.674 35.593 1.00 32.26 ? 344 ARG B CB  1 
ATOM   1288 C  CG  . ARG B 1 27  ? 10.913  -41.709 34.861 1.00 32.85 ? 344 ARG B CG  1 
ATOM   1289 C  CD  . ARG B 1 27  ? 11.659  -40.841 33.836 1.00 33.82 ? 344 ARG B CD  1 
ATOM   1290 N  NE  . ARG B 1 27  ? 12.528  -39.858 34.482 1.00 35.68 ? 344 ARG B NE  1 
ATOM   1291 C  CZ  . ARG B 1 27  ? 13.063  -38.793 33.878 1.00 36.47 ? 344 ARG B CZ  1 
ATOM   1292 N  NH1 . ARG B 1 27  ? 12.831  -38.549 32.594 1.00 35.60 ? 344 ARG B NH1 1 
ATOM   1293 N  NH2 . ARG B 1 27  ? 13.844  -37.967 34.571 1.00 35.61 ? 344 ARG B NH2 1 
ATOM   1294 N  N   . GLU B 1 28  ? 10.272  -45.510 35.118 1.00 32.31 ? 345 GLU B N   1 
ATOM   1295 C  CA  . GLU B 1 28  ? 9.286   -46.311 34.379 1.00 32.99 ? 345 GLU B CA  1 
ATOM   1296 C  C   . GLU B 1 28  ? 8.294   -46.936 35.352 1.00 32.50 ? 345 GLU B C   1 
ATOM   1297 O  O   . GLU B 1 28  ? 7.075   -46.970 35.098 1.00 32.10 ? 345 GLU B O   1 
ATOM   1298 C  CB  . GLU B 1 28  ? 9.952   -47.429 33.572 1.00 32.83 ? 345 GLU B CB  1 
ATOM   1299 C  CG  . GLU B 1 28  ? 10.487  -46.973 32.216 1.00 35.04 ? 345 GLU B CG  1 
ATOM   1300 C  CD  . GLU B 1 28  ? 11.335  -48.039 31.482 1.00 35.76 ? 345 GLU B CD  1 
ATOM   1301 O  OE1 . GLU B 1 28  ? 11.814  -49.011 32.116 1.00 37.47 ? 345 GLU B OE1 1 
ATOM   1302 O  OE2 . GLU B 1 28  ? 11.521  -47.868 30.253 1.00 40.59 ? 345 GLU B OE2 1 
ATOM   1303 N  N   . GLN B 1 29  ? 8.825   -47.420 36.471 1.00 31.87 ? 346 GLN B N   1 
ATOM   1304 C  CA  . GLN B 1 29  ? 7.988   -48.093 37.458 1.00 31.10 ? 346 GLN B CA  1 
ATOM   1305 C  C   . GLN B 1 29  ? 7.061   -47.103 38.181 1.00 29.88 ? 346 GLN B C   1 
ATOM   1306 O  O   . GLN B 1 29  ? 5.903   -47.416 38.448 1.00 29.11 ? 346 GLN B O   1 
ATOM   1307 C  CB  . GLN B 1 29  ? 8.862   -48.886 38.427 1.00 31.14 ? 346 GLN B CB  1 
ATOM   1308 C  CG  . GLN B 1 29  ? 9.607   -50.035 37.743 1.00 33.44 ? 346 GLN B CG  1 
ATOM   1309 C  CD  . GLN B 1 29  ? 8.676   -51.085 37.204 1.00 36.87 ? 346 GLN B CD  1 
ATOM   1310 O  OE1 . GLN B 1 29  ? 7.811   -51.573 37.923 1.00 40.69 ? 346 GLN B OE1 1 
ATOM   1311 N  NE2 . GLN B 1 29  ? 8.825   -51.425 35.916 1.00 40.16 ? 346 GLN B NE2 1 
ATOM   1312 N  N   . PHE B 1 30  ? 7.570   -45.911 38.469 1.00 29.30 ? 347 PHE B N   1 
ATOM   1313 C  CA  . PHE B 1 30  ? 6.812   -44.844 39.135 1.00 29.29 ? 347 PHE B CA  1 
ATOM   1314 C  C   . PHE B 1 30  ? 5.611   -44.454 38.261 1.00 29.14 ? 347 PHE B C   1 
ATOM   1315 O  O   . PHE B 1 30  ? 4.467   -44.402 38.724 1.00 28.15 ? 347 PHE B O   1 
ATOM   1316 C  CB  . PHE B 1 30  ? 7.775   -43.662 39.384 1.00 29.20 ? 347 PHE B CB  1 
ATOM   1317 C  CG  . PHE B 1 30  ? 7.194   -42.482 40.128 1.00 28.93 ? 347 PHE B CG  1 
ATOM   1318 C  CD1 . PHE B 1 30  ? 6.005   -42.555 40.888 1.00 28.45 ? 347 PHE B CD1 1 
ATOM   1319 C  CD2 . PHE B 1 30  ? 7.896   -41.265 40.114 1.00 28.02 ? 347 PHE B CD2 1 
ATOM   1320 C  CE1 . PHE B 1 30  ? 5.543   -41.443 41.575 1.00 27.03 ? 347 PHE B CE1 1 
ATOM   1321 C  CE2 . PHE B 1 30  ? 7.427   -40.151 40.821 1.00 27.98 ? 347 PHE B CE2 1 
ATOM   1322 C  CZ  . PHE B 1 30  ? 6.254   -40.241 41.549 1.00 27.17 ? 347 PHE B CZ  1 
ATOM   1323 N  N   . LEU B 1 31  ? 5.877   -44.233 36.982 1.00 29.88 ? 348 LEU B N   1 
ATOM   1324 C  CA  . LEU B 1 31  ? 4.832   -43.878 36.031 1.00 30.20 ? 348 LEU B CA  1 
ATOM   1325 C  C   . LEU B 1 31  ? 3.819   -45.005 35.813 1.00 30.26 ? 348 LEU B C   1 
ATOM   1326 O  O   . LEU B 1 31  ? 2.603   -44.767 35.768 1.00 29.99 ? 348 LEU B O   1 
ATOM   1327 C  CB  . LEU B 1 31  ? 5.454   -43.452 34.691 1.00 30.48 ? 348 LEU B CB  1 
ATOM   1328 C  CG  . LEU B 1 31  ? 4.503   -43.077 33.549 1.00 31.47 ? 348 LEU B CG  1 
ATOM   1329 C  CD1 . LEU B 1 31  ? 3.786   -41.761 33.858 1.00 31.48 ? 348 LEU B CD1 1 
ATOM   1330 C  CD2 . LEU B 1 31  ? 5.263   -42.944 32.221 1.00 30.80 ? 348 LEU B CD2 1 
ATOM   1331 N  N   . LYS B 1 32  ? 4.309   -46.224 35.652 1.00 29.97 ? 349 LYS B N   1 
ATOM   1332 C  CA  . LYS B 1 32  ? 3.435   -47.360 35.426 1.00 30.40 ? 349 LYS B CA  1 
ATOM   1333 C  C   . LYS B 1 32  ? 2.463   -47.476 36.594 1.00 29.41 ? 349 LYS B C   1 
ATOM   1334 O  O   . LYS B 1 32  ? 1.277   -47.686 36.386 1.00 28.99 ? 349 LYS B O   1 
ATOM   1335 C  CB  . LYS B 1 32  ? 4.262   -48.646 35.233 1.00 31.10 ? 349 LYS B CB  1 
ATOM   1336 C  CG  . LYS B 1 32  ? 3.502   -49.883 34.801 1.00 32.41 ? 349 LYS B CG  1 
ATOM   1337 C  CD  . LYS B 1 32  ? 4.371   -51.173 34.982 1.00 32.51 ? 349 LYS B CD  1 
ATOM   1338 C  CE  . LYS B 1 32  ? 3.589   -52.429 34.612 1.00 33.94 ? 349 LYS B CE  1 
ATOM   1339 N  NZ  . LYS B 1 32  ? 4.436   -53.683 34.613 1.00 35.37 ? 349 LYS B NZ  1 
ATOM   1340 N  N   . PHE B 1 33  ? 2.959   -47.335 37.818 1.00 29.72 ? 350 PHE B N   1 
ATOM   1341 C  CA  . PHE B 1 33  ? 2.091   -47.370 38.995 1.00 29.92 ? 350 PHE B CA  1 
ATOM   1342 C  C   . PHE B 1 33  ? 0.981   -46.309 38.923 1.00 30.31 ? 350 PHE B C   1 
ATOM   1343 O  O   . PHE B 1 33  ? -0.206  -46.606 39.125 1.00 30.58 ? 350 PHE B O   1 
ATOM   1344 C  CB  . PHE B 1 33  ? 2.905   -47.173 40.287 1.00 30.46 ? 350 PHE B CB  1 
ATOM   1345 C  CG  . PHE B 1 33  ? 2.043   -46.822 41.459 1.00 30.83 ? 350 PHE B CG  1 
ATOM   1346 C  CD1 . PHE B 1 33  ? 1.223   -47.789 42.036 1.00 31.93 ? 350 PHE B CD1 1 
ATOM   1347 C  CD2 . PHE B 1 33  ? 1.952   -45.505 41.904 1.00 30.23 ? 350 PHE B CD2 1 
ATOM   1348 C  CE1 . PHE B 1 33  ? 0.366   -47.463 43.083 1.00 31.11 ? 350 PHE B CE1 1 
ATOM   1349 C  CE2 . PHE B 1 33  ? 1.115   -45.181 42.961 1.00 30.45 ? 350 PHE B CE2 1 
ATOM   1350 C  CZ  . PHE B 1 33  ? 0.314   -46.161 43.547 1.00 31.41 ? 350 PHE B CZ  1 
ATOM   1351 N  N   . LEU B 1 34  ? 1.367   -45.067 38.641 1.00 29.67 ? 351 LEU B N   1 
ATOM   1352 C  CA  . LEU B 1 34  ? 0.408   -43.961 38.616 1.00 30.26 ? 351 LEU B CA  1 
ATOM   1353 C  C   . LEU B 1 34  ? -0.661  -44.154 37.535 1.00 30.94 ? 351 LEU B C   1 
ATOM   1354 O  O   . LEU B 1 34  ? -1.828  -43.816 37.740 1.00 30.80 ? 351 LEU B O   1 
ATOM   1355 C  CB  . LEU B 1 34  ? 1.133   -42.604 38.432 1.00 29.53 ? 351 LEU B CB  1 
ATOM   1356 C  CG  . LEU B 1 34  ? 2.069   -42.199 39.589 1.00 29.94 ? 351 LEU B CG  1 
ATOM   1357 C  CD1 . LEU B 1 34  ? 2.917   -40.997 39.169 1.00 29.84 ? 351 LEU B CD1 1 
ATOM   1358 C  CD2 . LEU B 1 34  ? 1.295   -41.898 40.866 1.00 30.21 ? 351 LEU B CD2 1 
ATOM   1359 N  N   . GLU B 1 35  ? -0.260  -44.692 36.385 1.00 31.93 ? 352 GLU B N   1 
ATOM   1360 C  CA  . GLU B 1 35  ? -1.206  -44.999 35.295 1.00 32.87 ? 352 GLU B CA  1 
ATOM   1361 C  C   . GLU B 1 35  ? -2.226  -46.041 35.743 1.00 32.30 ? 352 GLU B C   1 
ATOM   1362 O  O   . GLU B 1 35  ? -3.422  -45.901 35.495 1.00 32.44 ? 352 GLU B O   1 
ATOM   1363 C  CB  . GLU B 1 35  ? -0.480  -45.537 34.062 1.00 33.50 ? 352 GLU B CB  1 
ATOM   1364 C  CG  . GLU B 1 35  ? 0.631   -44.646 33.558 1.00 38.11 ? 352 GLU B CG  1 
ATOM   1365 C  CD  . GLU B 1 35  ? 0.315   -43.908 32.290 1.00 44.02 ? 352 GLU B CD  1 
ATOM   1366 O  OE1 . GLU B 1 35  ? -0.853  -43.470 32.113 1.00 48.35 ? 352 GLU B OE1 1 
ATOM   1367 O  OE2 . GLU B 1 35  ? 1.265   -43.753 31.474 1.00 47.64 ? 352 GLU B OE2 1 
ATOM   1368 N  N   . SER B 1 36  ? -1.740  -47.083 36.412 1.00 31.84 ? 353 SER B N   1 
ATOM   1369 C  CA  . SER B 1 36  ? -2.599  -48.140 36.956 1.00 31.61 ? 353 SER B CA  1 
ATOM   1370 C  C   . SER B 1 36  ? -3.689  -47.617 37.912 1.00 31.82 ? 353 SER B C   1 
ATOM   1371 O  O   . SER B 1 36  ? -4.680  -48.290 38.113 1.00 31.71 ? 353 SER B O   1 
ATOM   1372 C  CB  . SER B 1 36  ? -1.768  -49.188 37.699 1.00 31.41 ? 353 SER B CB  1 
ATOM   1373 O  OG  . SER B 1 36  ? -1.475  -48.756 39.031 1.00 31.26 ? 353 SER B OG  1 
ATOM   1374 N  N   . GLU B 1 37  ? -3.497  -46.441 38.504 1.00 32.07 ? 354 GLU B N   1 
ATOM   1375 C  CA  . GLU B 1 37  ? -4.508  -45.838 39.378 1.00 33.38 ? 354 GLU B CA  1 
ATOM   1376 C  C   . GLU B 1 37  ? -5.060  -44.487 38.858 1.00 32.40 ? 354 GLU B C   1 
ATOM   1377 O  O   . GLU B 1 37  ? -5.594  -43.668 39.625 1.00 32.77 ? 354 GLU B O   1 
ATOM   1378 C  CB  . GLU B 1 37  ? -3.934  -45.738 40.809 1.00 33.49 ? 354 GLU B CB  1 
ATOM   1379 C  CG  . GLU B 1 37  ? -4.134  -47.070 41.572 1.00 35.89 ? 354 GLU B CG  1 
ATOM   1380 C  CD  . GLU B 1 37  ? -3.456  -47.112 42.931 1.00 36.73 ? 354 GLU B CD  1 
ATOM   1381 O  OE1 . GLU B 1 37  ? -3.326  -46.037 43.566 1.00 39.34 ? 354 GLU B OE1 1 
ATOM   1382 O  OE2 . GLU B 1 37  ? -3.061  -48.226 43.360 1.00 38.38 ? 354 GLU B OE2 1 
ATOM   1383 N  N   . PHE B 1 38  ? -4.941  -44.271 37.550 1.00 31.36 ? 355 PHE B N   1 
ATOM   1384 C  CA  . PHE B 1 38  ? -5.505  -43.076 36.891 1.00 31.19 ? 355 PHE B CA  1 
ATOM   1385 C  C   . PHE B 1 38  ? -5.061  -41.770 37.539 1.00 30.84 ? 355 PHE B C   1 
ATOM   1386 O  O   . PHE B 1 38  ? -5.825  -40.832 37.659 1.00 31.05 ? 355 PHE B O   1 
ATOM   1387 C  CB  . PHE B 1 38  ? -7.039  -43.176 36.849 1.00 31.09 ? 355 PHE B CB  1 
ATOM   1388 C  CG  . PHE B 1 38  ? -7.513  -44.528 36.476 1.00 30.38 ? 355 PHE B CG  1 
ATOM   1389 C  CD1 . PHE B 1 38  ? -7.462  -44.941 35.161 1.00 30.11 ? 355 PHE B CD1 1 
ATOM   1390 C  CD2 . PHE B 1 38  ? -7.930  -45.426 37.459 1.00 30.48 ? 355 PHE B CD2 1 
ATOM   1391 C  CE1 . PHE B 1 38  ? -7.869  -46.211 34.808 1.00 31.36 ? 355 PHE B CE1 1 
ATOM   1392 C  CE2 . PHE B 1 38  ? -8.332  -46.687 37.130 1.00 31.11 ? 355 PHE B CE2 1 
ATOM   1393 C  CZ  . PHE B 1 38  ? -8.308  -47.093 35.796 1.00 31.90 ? 355 PHE B CZ  1 
ATOM   1394 N  N   . SER B 1 39  ? -3.807  -41.717 37.950 1.00 31.33 ? 356 SER B N   1 
ATOM   1395 C  CA  . SER B 1 39  ? -3.307  -40.569 38.678 1.00 31.41 ? 356 SER B CA  1 
ATOM   1396 C  C   . SER B 1 39  ? -1.978  -40.064 38.141 1.00 30.92 ? 356 SER B C   1 
ATOM   1397 O  O   . SER B 1 39  ? -1.209  -39.493 38.884 1.00 30.95 ? 356 SER B O   1 
ATOM   1398 C  CB  . SER B 1 39  ? -3.200  -40.958 40.156 1.00 31.49 ? 356 SER B CB  1 
ATOM   1399 O  OG  . SER B 1 39  ? -4.488  -41.370 40.595 1.00 32.52 ? 356 SER B OG  1 
ATOM   1400 N  N   . SER B 1 40  ? -1.734  -40.213 36.839 1.00 31.02 ? 357 SER B N   1 
ATOM   1401 C  CA  . SER B 1 40  ? -0.406  -39.917 36.291 1.00 30.81 ? 357 SER B CA  1 
ATOM   1402 C  C   . SER B 1 40  ? -0.269  -38.532 35.664 1.00 31.45 ? 357 SER B C   1 
ATOM   1403 O  O   . SER B 1 40  ? 0.812   -38.189 35.130 1.00 31.03 ? 357 SER B O   1 
ATOM   1404 C  CB  . SER B 1 40  ? -0.014  -40.981 35.278 1.00 30.50 ? 357 SER B CB  1 
ATOM   1405 O  OG  . SER B 1 40  ? -0.901  -40.984 34.188 1.00 30.06 ? 357 SER B OG  1 
ATOM   1406 N  N   . GLU B 1 41  ? -1.336  -37.726 35.710 1.00 31.65 ? 358 GLU B N   1 
ATOM   1407 C  CA  . GLU B 1 41  ? -1.338  -36.440 34.977 1.00 31.79 ? 358 GLU B CA  1 
ATOM   1408 C  C   . GLU B 1 41  ? -0.218  -35.502 35.445 1.00 31.94 ? 358 GLU B C   1 
ATOM   1409 O  O   . GLU B 1 41  ? 0.462   -34.883 34.619 1.00 32.25 ? 358 GLU B O   1 
ATOM   1410 C  CB  . GLU B 1 41  ? -2.708  -35.740 35.065 1.00 31.68 ? 358 GLU B CB  1 
ATOM   1411 N  N   . ASN B 1 42  ? -0.011  -35.430 36.765 1.00 31.71 ? 359 ASN B N   1 
ATOM   1412 C  CA  . ASN B 1 42  ? 1.031   -34.591 37.352 1.00 31.39 ? 359 ASN B CA  1 
ATOM   1413 C  C   . ASN B 1 42  ? 2.446   -34.990 36.893 1.00 31.69 ? 359 ASN B C   1 
ATOM   1414 O  O   . ASN B 1 42  ? 3.202   -34.144 36.404 1.00 30.23 ? 359 ASN B O   1 
ATOM   1415 C  CB  . ASN B 1 42  ? 0.930   -34.563 38.893 1.00 31.07 ? 359 ASN B CB  1 
ATOM   1416 C  CG  . ASN B 1 42  ? -0.179  -33.633 39.411 1.00 31.19 ? 359 ASN B CG  1 
ATOM   1417 O  OD1 . ASN B 1 42  ? -0.898  -33.015 38.646 1.00 33.51 ? 359 ASN B OD1 1 
ATOM   1418 N  ND2 . ASN B 1 42  ? -0.307  -33.541 40.727 1.00 33.98 ? 359 ASN B ND2 1 
ATOM   1419 N  N   . LEU B 1 43  ? 2.786   -36.276 36.989 1.00 32.23 ? 360 LEU B N   1 
ATOM   1420 C  CA  . LEU B 1 43  ? 4.089   -36.731 36.475 1.00 32.09 ? 360 LEU B CA  1 
ATOM   1421 C  C   . LEU B 1 43  ? 4.205   -36.565 34.955 1.00 31.94 ? 360 LEU B C   1 
ATOM   1422 O  O   . LEU B 1 43  ? 5.222   -36.095 34.448 1.00 31.95 ? 360 LEU B O   1 
ATOM   1423 C  CB  . LEU B 1 43  ? 4.392   -38.172 36.915 1.00 32.44 ? 360 LEU B CB  1 
ATOM   1424 C  CG  . LEU B 1 43  ? 5.768   -38.763 36.531 1.00 33.01 ? 360 LEU B CG  1 
ATOM   1425 C  CD1 . LEU B 1 43  ? 6.944   -37.929 37.063 1.00 33.05 ? 360 LEU B CD1 1 
ATOM   1426 C  CD2 . LEU B 1 43  ? 5.870   -40.200 37.006 1.00 32.38 ? 360 LEU B CD2 1 
ATOM   1427 N  N   . ARG B 1 44  ? 3.166   -36.911 34.215 1.00 31.56 ? 361 ARG B N   1 
ATOM   1428 C  CA  . ARG B 1 44  ? 3.211   -36.723 32.771 1.00 31.02 ? 361 ARG B CA  1 
ATOM   1429 C  C   . ARG B 1 44  ? 3.385   -35.230 32.394 1.00 30.30 ? 361 ARG B C   1 
ATOM   1430 O  O   . ARG B 1 44  ? 4.073   -34.919 31.453 1.00 29.19 ? 361 ARG B O   1 
ATOM   1431 C  CB  . ARG B 1 44  ? 1.982   -37.340 32.094 1.00 31.24 ? 361 ARG B CB  1 
ATOM   1432 C  CG  . ARG B 1 44  ? 2.081   -38.879 31.962 1.00 33.08 ? 361 ARG B CG  1 
ATOM   1433 C  CD  . ARG B 1 44  ? 1.013   -39.537 31.094 1.00 32.58 ? 361 ARG B CD  1 
ATOM   1434 N  NE  . ARG B 1 44  ? -0.336  -39.359 31.623 1.00 33.30 ? 361 ARG B NE  1 
ATOM   1435 C  CZ  . ARG B 1 44  ? -1.201  -38.425 31.216 1.00 36.06 ? 361 ARG B CZ  1 
ATOM   1436 N  NH1 . ARG B 1 44  ? -0.889  -37.571 30.237 1.00 35.19 ? 361 ARG B NH1 1 
ATOM   1437 N  NH2 . ARG B 1 44  ? -2.409  -38.369 31.777 1.00 34.39 ? 361 ARG B NH2 1 
ATOM   1438 N  N   . PHE B 1 45  ? 2.762   -34.312 33.127 1.00 30.49 ? 362 PHE B N   1 
ATOM   1439 C  CA  . PHE B 1 45  ? 2.961   -32.873 32.877 1.00 30.71 ? 362 PHE B CA  1 
ATOM   1440 C  C   . PHE B 1 45  ? 4.411   -32.499 33.185 1.00 30.76 ? 362 PHE B C   1 
ATOM   1441 O  O   . PHE B 1 45  ? 5.030   -31.786 32.428 1.00 30.68 ? 362 PHE B O   1 
ATOM   1442 C  CB  . PHE B 1 45  ? 2.011   -32.009 33.722 1.00 31.03 ? 362 PHE B CB  1 
ATOM   1443 C  CG  . PHE B 1 45  ? 2.344   -30.508 33.702 1.00 31.32 ? 362 PHE B CG  1 
ATOM   1444 C  CD1 . PHE B 1 45  ? 1.986   -29.714 32.619 1.00 29.99 ? 362 PHE B CD1 1 
ATOM   1445 C  CD2 . PHE B 1 45  ? 2.999   -29.911 34.769 1.00 32.06 ? 362 PHE B CD2 1 
ATOM   1446 C  CE1 . PHE B 1 45  ? 2.277   -28.357 32.589 1.00 31.31 ? 362 PHE B CE1 1 
ATOM   1447 C  CE2 . PHE B 1 45  ? 3.303   -28.525 34.746 1.00 31.85 ? 362 PHE B CE2 1 
ATOM   1448 C  CZ  . PHE B 1 45  ? 2.933   -27.761 33.651 1.00 29.96 ? 362 PHE B CZ  1 
ATOM   1449 N  N   . TRP B 1 46  ? 4.938   -32.997 34.299 1.00 31.01 ? 363 TRP B N   1 
ATOM   1450 C  CA  . TRP B 1 46  ? 6.321   -32.713 34.675 1.00 31.23 ? 363 TRP B CA  1 
ATOM   1451 C  C   . TRP B 1 46  ? 7.292   -33.219 33.598 1.00 30.90 ? 363 TRP B C   1 
ATOM   1452 O  O   . TRP B 1 46  ? 8.213   -32.499 33.206 1.00 31.28 ? 363 TRP B O   1 
ATOM   1453 C  CB  . TRP B 1 46  ? 6.650   -33.310 36.047 1.00 31.44 ? 363 TRP B CB  1 
ATOM   1454 C  CG  . TRP B 1 46  ? 8.018   -32.931 36.540 1.00 31.54 ? 363 TRP B CG  1 
ATOM   1455 C  CD1 . TRP B 1 46  ? 8.368   -31.805 37.248 1.00 31.48 ? 363 TRP B CD1 1 
ATOM   1456 C  CD2 . TRP B 1 46  ? 9.221   -33.676 36.353 1.00 31.34 ? 363 TRP B CD2 1 
ATOM   1457 N  NE1 . TRP B 1 46  ? 9.708   -31.808 37.500 1.00 30.43 ? 363 TRP B NE1 1 
ATOM   1458 C  CE2 . TRP B 1 46  ? 10.263  -32.944 36.969 1.00 31.11 ? 363 TRP B CE2 1 
ATOM   1459 C  CE3 . TRP B 1 46  ? 9.517   -34.894 35.734 1.00 30.29 ? 363 TRP B CE3 1 
ATOM   1460 C  CZ2 . TRP B 1 46  ? 11.585  -33.395 36.991 1.00 31.77 ? 363 TRP B CZ2 1 
ATOM   1461 C  CZ3 . TRP B 1 46  ? 10.833  -35.340 35.744 1.00 31.65 ? 363 TRP B CZ3 1 
ATOM   1462 C  CH2 . TRP B 1 46  ? 11.856  -34.583 36.356 1.00 32.02 ? 363 TRP B CH2 1 
ATOM   1463 N  N   . LEU B 1 47  ? 7.058   -34.427 33.105 1.00 29.89 ? 364 LEU B N   1 
ATOM   1464 C  CA  . LEU B 1 47  ? 7.874   -34.994 32.054 1.00 30.62 ? 364 LEU B CA  1 
ATOM   1465 C  C   . LEU B 1 47  ? 7.731   -34.242 30.749 1.00 29.87 ? 364 LEU B C   1 
ATOM   1466 O  O   . LEU B 1 47  ? 8.707   -34.097 30.033 1.00 30.35 ? 364 LEU B O   1 
ATOM   1467 C  CB  . LEU B 1 47  ? 7.539   -36.474 31.834 1.00 30.92 ? 364 LEU B CB  1 
ATOM   1468 C  CG  . LEU B 1 47  ? 7.893   -37.444 32.961 1.00 31.39 ? 364 LEU B CG  1 
ATOM   1469 C  CD1 . LEU B 1 47  ? 7.228   -38.841 32.715 1.00 32.87 ? 364 LEU B CD1 1 
ATOM   1470 C  CD2 . LEU B 1 47  ? 9.394   -37.560 33.106 1.00 32.84 ? 364 LEU B CD2 1 
ATOM   1471 N  N   . ALA B 1 48  ? 6.532   -33.747 30.440 1.00 29.29 ? 365 ALA B N   1 
ATOM   1472 C  CA  . ALA B 1 48  ? 6.325   -32.988 29.171 1.00 29.25 ? 365 ALA B CA  1 
ATOM   1473 C  C   . ALA B 1 48  ? 7.110   -31.654 29.194 1.00 28.52 ? 365 ALA B C   1 
ATOM   1474 O  O   . ALA B 1 48  ? 7.609   -31.219 28.177 1.00 26.95 ? 365 ALA B O   1 
ATOM   1475 C  CB  . ALA B 1 48  ? 4.823   -32.709 28.924 1.00 29.09 ? 365 ALA B CB  1 
ATOM   1476 N  N   . VAL B 1 49  ? 7.181   -31.014 30.367 1.00 28.84 ? 366 VAL B N   1 
ATOM   1477 C  CA  . VAL B 1 49  ? 7.926   -29.748 30.530 1.00 29.14 ? 366 VAL B CA  1 
ATOM   1478 C  C   . VAL B 1 49  ? 9.445   -29.972 30.475 1.00 29.33 ? 366 VAL B C   1 
ATOM   1479 O  O   . VAL B 1 49  ? 10.190  -29.196 29.859 1.00 29.05 ? 366 VAL B O   1 
ATOM   1480 C  CB  . VAL B 1 49  ? 7.496   -29.007 31.822 1.00 28.92 ? 366 VAL B CB  1 
ATOM   1481 C  CG1 . VAL B 1 49  ? 8.288   -27.704 32.003 1.00 28.85 ? 366 VAL B CG1 1 
ATOM   1482 C  CG2 . VAL B 1 49  ? 5.969   -28.717 31.773 1.00 28.93 ? 366 VAL B CG2 1 
ATOM   1483 N  N   . GLU B 1 50  ? 9.903   -31.055 31.100 1.00 30.07 ? 367 GLU B N   1 
ATOM   1484 C  CA  . GLU B 1 50  ? 11.291  -31.490 30.938 1.00 29.68 ? 367 GLU B CA  1 
ATOM   1485 C  C   . GLU B 1 50  ? 11.685  -31.681 29.464 1.00 28.95 ? 367 GLU B C   1 
ATOM   1486 O  O   . GLU B 1 50  ? 12.719  -31.172 29.014 1.00 27.68 ? 367 GLU B O   1 
ATOM   1487 C  CB  . GLU B 1 50  ? 11.533  -32.760 31.742 1.00 30.17 ? 367 GLU B CB  1 
ATOM   1488 C  CG  . GLU B 1 50  ? 11.582  -32.522 33.219 1.00 31.88 ? 367 GLU B CG  1 
ATOM   1489 C  CD  . GLU B 1 50  ? 12.682  -31.545 33.587 1.00 35.64 ? 367 GLU B CD  1 
ATOM   1490 O  OE1 . GLU B 1 50  ? 13.848  -31.959 33.491 1.00 38.92 ? 367 GLU B OE1 1 
ATOM   1491 O  OE2 . GLU B 1 50  ? 12.390  -30.369 33.946 1.00 34.81 ? 367 GLU B OE2 1 
ATOM   1492 N  N   . ASP B 1 51  ? 10.856  -32.397 28.718 1.00 29.09 ? 368 ASP B N   1 
ATOM   1493 C  CA  . ASP B 1 51  ? 11.030  -32.520 27.266 1.00 29.14 ? 368 ASP B CA  1 
ATOM   1494 C  C   . ASP B 1 51  ? 11.033  -31.144 26.565 1.00 28.39 ? 368 ASP B C   1 
ATOM   1495 O  O   . ASP B 1 51  ? 11.833  -30.901 25.690 1.00 28.21 ? 368 ASP B O   1 
ATOM   1496 C  CB  . ASP B 1 51  ? 9.929   -33.379 26.679 1.00 29.53 ? 368 ASP B CB  1 
ATOM   1497 C  CG  . ASP B 1 51  ? 10.143  -33.665 25.211 1.00 31.70 ? 368 ASP B CG  1 
ATOM   1498 O  OD1 . ASP B 1 51  ? 10.916  -34.606 24.912 1.00 31.10 ? 368 ASP B OD1 1 
ATOM   1499 O  OD2 . ASP B 1 51  ? 9.553   -32.959 24.370 1.00 33.35 ? 368 ASP B OD2 1 
ATOM   1500 N  N   . LEU B 1 52  ? 10.137  -30.246 26.949 1.00 28.55 ? 369 LEU B N   1 
ATOM   1501 C  CA  . LEU B 1 52  ? 10.105  -28.907 26.346 1.00 29.38 ? 369 LEU B CA  1 
ATOM   1502 C  C   . LEU B 1 52  ? 11.486  -28.202 26.407 1.00 29.10 ? 369 LEU B C   1 
ATOM   1503 O  O   . LEU B 1 52  ? 11.950  -27.595 25.428 1.00 28.27 ? 369 LEU B O   1 
ATOM   1504 C  CB  . LEU B 1 52  ? 9.027   -28.033 27.006 1.00 29.43 ? 369 LEU B CB  1 
ATOM   1505 C  CG  . LEU B 1 52  ? 8.921   -26.597 26.447 1.00 30.67 ? 369 LEU B CG  1 
ATOM   1506 C  CD1 . LEU B 1 52  ? 8.490   -26.597 25.007 1.00 32.14 ? 369 LEU B CD1 1 
ATOM   1507 C  CD2 . LEU B 1 52  ? 7.978   -25.756 27.288 1.00 30.29 ? 369 LEU B CD2 1 
ATOM   1508 N  N   . LYS B 1 53  ? 12.157  -28.338 27.542 1.00 28.48 ? 370 LYS B N   1 
ATOM   1509 C  CA  . LYS B 1 53  ? 13.451  -27.684 27.739 1.00 28.36 ? 370 LYS B CA  1 
ATOM   1510 C  C   . LYS B 1 53  ? 14.555  -28.148 26.777 1.00 28.19 ? 370 LYS B C   1 
ATOM   1511 O  O   . LYS B 1 53  ? 15.525  -27.419 26.558 1.00 25.88 ? 370 LYS B O   1 
ATOM   1512 C  CB  . LYS B 1 53  ? 13.907  -27.870 29.180 1.00 28.11 ? 370 LYS B CB  1 
ATOM   1513 C  CG  . LYS B 1 53  ? 13.025  -27.154 30.180 1.00 28.80 ? 370 LYS B CG  1 
ATOM   1514 C  CD  . LYS B 1 53  ? 13.496  -27.534 31.581 1.00 32.24 ? 370 LYS B CD  1 
ATOM   1515 C  CE  . LYS B 1 53  ? 12.507  -27.191 32.649 1.00 33.20 ? 370 LYS B CE  1 
ATOM   1516 N  NZ  . LYS B 1 53  ? 13.025  -27.602 33.980 1.00 34.97 ? 370 LYS B NZ  1 
ATOM   1517 N  N   . LYS B 1 54  ? 14.398  -29.347 26.211 1.00 28.72 ? 371 LYS B N   1 
ATOM   1518 C  CA  . LYS B 1 54  ? 15.404  -29.893 25.293 1.00 30.13 ? 371 LYS B CA  1 
ATOM   1519 C  C   . LYS B 1 54  ? 15.089  -29.626 23.805 1.00 29.55 ? 371 LYS B C   1 
ATOM   1520 O  O   . LYS B 1 54  ? 15.950  -29.778 22.943 1.00 28.04 ? 371 LYS B O   1 
ATOM   1521 C  CB  . LYS B 1 54  ? 15.619  -31.389 25.587 1.00 30.62 ? 371 LYS B CB  1 
ATOM   1522 C  CG  . LYS B 1 54  ? 14.547  -32.334 25.094 1.00 33.35 ? 371 LYS B CG  1 
ATOM   1523 C  CD  . LYS B 1 54  ? 14.720  -33.785 25.648 1.00 33.68 ? 371 LYS B CD  1 
ATOM   1524 C  CE  . LYS B 1 54  ? 14.537  -33.887 27.181 1.00 39.27 ? 371 LYS B CE  1 
ATOM   1525 N  NZ  . LYS B 1 54  ? 13.819  -35.150 27.721 1.00 39.86 ? 371 LYS B NZ  1 
ATOM   1526 N  N   . ARG B 1 55  ? 13.875  -29.188 23.506 1.00 29.18 ? 372 ARG B N   1 
ATOM   1527 C  CA  . ARG B 1 55  ? 13.464  -29.019 22.106 1.00 30.08 ? 372 ARG B CA  1 
ATOM   1528 C  C   . ARG B 1 55  ? 14.134  -27.855 21.343 1.00 29.67 ? 372 ARG B C   1 
ATOM   1529 O  O   . ARG B 1 55  ? 14.513  -26.849 21.930 1.00 29.16 ? 372 ARG B O   1 
ATOM   1530 C  CB  . ARG B 1 55  ? 11.939  -28.928 22.022 1.00 30.08 ? 372 ARG B CB  1 
ATOM   1531 C  CG  . ARG B 1 55  ? 11.258  -30.207 22.448 1.00 32.83 ? 372 ARG B CG  1 
ATOM   1532 C  CD  . ARG B 1 55  ? 11.553  -31.385 21.485 1.00 34.84 ? 372 ARG B CD  1 
ATOM   1533 N  NE  . ARG B 1 55  ? 11.267  -32.676 22.086 1.00 35.85 ? 372 ARG B NE  1 
ATOM   1534 C  CZ  . ARG B 1 55  ? 11.482  -33.850 21.493 1.00 36.52 ? 372 ARG B CZ  1 
ATOM   1535 N  NH1 . ARG B 1 55  ? 11.997  -33.913 20.284 1.00 37.44 ? 372 ARG B NH1 1 
ATOM   1536 N  NH2 . ARG B 1 55  ? 11.197  -34.973 22.132 1.00 38.08 ? 372 ARG B NH2 1 
ATOM   1537 N  N   . PRO B 1 56  ? 14.301  -27.996 20.012 1.00 29.77 ? 373 PRO B N   1 
ATOM   1538 C  CA  . PRO B 1 56  ? 14.859  -26.859 19.269 1.00 29.79 ? 373 PRO B CA  1 
ATOM   1539 C  C   . PRO B 1 56  ? 13.957  -25.626 19.386 1.00 30.39 ? 373 PRO B C   1 
ATOM   1540 O  O   . PRO B 1 56  ? 12.734  -25.754 19.415 1.00 29.85 ? 373 PRO B O   1 
ATOM   1541 C  CB  . PRO B 1 56  ? 14.947  -27.376 17.825 1.00 29.71 ? 373 PRO B CB  1 
ATOM   1542 C  CG  . PRO B 1 56  ? 14.846  -28.877 17.942 1.00 29.58 ? 373 PRO B CG  1 
ATOM   1543 C  CD  . PRO B 1 56  ? 14.025  -29.151 19.137 1.00 29.94 ? 373 PRO B CD  1 
ATOM   1544 N  N   . ILE B 1 57  ? 14.567  -24.448 19.475 1.00 31.13 ? 374 ILE B N   1 
ATOM   1545 C  CA  . ILE B 1 57  ? 13.837  -23.223 19.825 1.00 31.74 ? 374 ILE B CA  1 
ATOM   1546 C  C   . ILE B 1 57  ? 12.679  -22.912 18.852 1.00 32.49 ? 374 ILE B C   1 
ATOM   1547 O  O   . ILE B 1 57  ? 11.618  -22.465 19.278 1.00 32.45 ? 374 ILE B O   1 
ATOM   1548 C  CB  . ILE B 1 57  ? 14.803  -22.001 19.935 1.00 31.58 ? 374 ILE B CB  1 
ATOM   1549 C  CG1 . ILE B 1 57  ? 14.093  -20.784 20.544 1.00 31.55 ? 374 ILE B CG1 1 
ATOM   1550 C  CG2 . ILE B 1 57  ? 15.425  -21.650 18.576 1.00 31.65 ? 374 ILE B CG2 1 
ATOM   1551 C  CD1 . ILE B 1 57  ? 13.752  -20.934 22.018 1.00 31.90 ? 374 ILE B CD1 1 
ATOM   1552 N  N   . LYS B 1 58  ? 12.868  -23.180 17.558 1.00 32.93 ? 375 LYS B N   1 
ATOM   1553 C  CA  . LYS B 1 58  ? 11.797  -22.939 16.578 1.00 33.35 ? 375 LYS B CA  1 
ATOM   1554 C  C   . LYS B 1 58  ? 10.569  -23.830 16.831 1.00 33.41 ? 375 LYS B C   1 
ATOM   1555 O  O   . LYS B 1 58  ? 9.452   -23.478 16.439 1.00 33.61 ? 375 LYS B O   1 
ATOM   1556 C  CB  . LYS B 1 58  ? 12.311  -23.110 15.138 1.00 33.40 ? 375 LYS B CB  1 
ATOM   1557 C  CG  . LYS B 1 58  ? 13.329  -22.046 14.728 1.00 33.62 ? 375 LYS B CG  1 
ATOM   1558 C  CD  . LYS B 1 58  ? 13.572  -22.017 13.240 1.00 33.58 ? 375 LYS B CD  1 
ATOM   1559 N  N   . GLU B 1 59  ? 10.783  -24.969 17.483 1.00 33.09 ? 376 GLU B N   1 
ATOM   1560 C  CA  . GLU B 1 59  ? 9.690   -25.864 17.885 1.00 33.58 ? 376 GLU B CA  1 
ATOM   1561 C  C   . GLU B 1 59  ? 8.940   -25.420 19.142 1.00 32.71 ? 376 GLU B C   1 
ATOM   1562 O  O   . GLU B 1 59  ? 7.853   -25.911 19.410 1.00 31.81 ? 376 GLU B O   1 
ATOM   1563 C  CB  . GLU B 1 59  ? 10.214  -27.273 18.153 1.00 33.80 ? 376 GLU B CB  1 
ATOM   1564 C  CG  . GLU B 1 59  ? 10.255  -28.173 16.949 1.00 37.52 ? 376 GLU B CG  1 
ATOM   1565 C  CD  . GLU B 1 59  ? 10.377  -29.618 17.385 1.00 42.26 ? 376 GLU B CD  1 
ATOM   1566 O  OE1 . GLU B 1 59  ? 9.322   -30.276 17.527 1.00 46.84 ? 376 GLU B OE1 1 
ATOM   1567 O  OE2 . GLU B 1 59  ? 11.511  -30.077 17.650 1.00 44.84 ? 376 GLU B OE2 1 
ATOM   1568 N  N   . VAL B 1 60  ? 9.522   -24.514 19.918 1.00 32.65 ? 377 VAL B N   1 
ATOM   1569 C  CA  . VAL B 1 60  ? 8.957   -24.171 21.230 1.00 32.35 ? 377 VAL B CA  1 
ATOM   1570 C  C   . VAL B 1 60  ? 7.504   -23.662 21.176 1.00 32.35 ? 377 VAL B C   1 
ATOM   1571 O  O   . VAL B 1 60  ? 6.670   -24.143 21.933 1.00 31.98 ? 377 VAL B O   1 
ATOM   1572 C  CB  . VAL B 1 60  ? 9.887   -23.193 21.983 1.00 32.39 ? 377 VAL B CB  1 
ATOM   1573 C  CG1 . VAL B 1 60  ? 9.181   -22.535 23.178 1.00 31.68 ? 377 VAL B CG1 1 
ATOM   1574 C  CG2 . VAL B 1 60  ? 11.149  -23.940 22.411 1.00 32.67 ? 377 VAL B CG2 1 
ATOM   1575 N  N   . PRO B 1 61  ? 7.199   -22.670 20.310 1.00 32.78 ? 378 PRO B N   1 
ATOM   1576 C  CA  . PRO B 1 61  ? 5.816   -22.156 20.261 1.00 32.61 ? 378 PRO B CA  1 
ATOM   1577 C  C   . PRO B 1 61  ? 4.722   -23.226 20.044 1.00 32.68 ? 378 PRO B C   1 
ATOM   1578 O  O   . PRO B 1 61  ? 3.695   -23.199 20.736 1.00 31.32 ? 378 PRO B O   1 
ATOM   1579 C  CB  . PRO B 1 61  ? 5.849   -21.159 19.099 1.00 32.82 ? 378 PRO B CB  1 
ATOM   1580 C  CG  . PRO B 1 61  ? 7.272   -20.769 18.977 1.00 32.59 ? 378 PRO B CG  1 
ATOM   1581 C  CD  . PRO B 1 61  ? 8.090   -21.930 19.400 1.00 32.65 ? 378 PRO B CD  1 
ATOM   1582 N  N   . SER B 1 62  ? 4.938   -24.151 19.103 1.00 32.70 ? 379 SER B N   1 
ATOM   1583 C  CA  . SER B 1 62  ? 3.953   -25.210 18.872 1.00 33.25 ? 379 SER B CA  1 
ATOM   1584 C  C   . SER B 1 62  ? 3.944   -26.218 20.044 1.00 33.60 ? 379 SER B C   1 
ATOM   1585 O  O   . SER B 1 62  ? 2.879   -26.630 20.507 1.00 33.97 ? 379 SER B O   1 
ATOM   1586 C  CB  . SER B 1 62  ? 4.169   -25.902 17.520 1.00 33.28 ? 379 SER B CB  1 
ATOM   1587 O  OG  . SER B 1 62  ? 4.975   -27.064 17.649 1.00 33.36 ? 379 SER B OG  1 
ATOM   1588 N  N   . ARG B 1 63  ? 5.115   -26.568 20.562 1.00 33.35 ? 380 ARG B N   1 
ATOM   1589 C  CA  A ARG B 1 63  ? 5.163   -27.500 21.687 0.50 33.43 ? 380 ARG B CA  1 
ATOM   1590 C  CA  B ARG B 1 63  ? 5.219   -27.494 21.698 0.50 33.57 ? 380 ARG B CA  1 
ATOM   1591 C  C   . ARG B 1 63  ? 4.563   -26.907 22.957 1.00 33.05 ? 380 ARG B C   1 
ATOM   1592 O  O   . ARG B 1 63  ? 3.906   -27.621 23.725 1.00 32.46 ? 380 ARG B O   1 
ATOM   1593 C  CB  A ARG B 1 63  ? 6.579   -28.001 21.922 0.50 33.24 ? 380 ARG B CB  1 
ATOM   1594 C  CB  B ARG B 1 63  ? 6.691   -27.826 21.998 0.50 33.50 ? 380 ARG B CB  1 
ATOM   1595 C  CG  A ARG B 1 63  ? 7.053   -28.853 20.771 0.50 33.77 ? 380 ARG B CG  1 
ATOM   1596 C  CG  B ARG B 1 63  ? 7.028   -29.301 22.157 0.50 34.61 ? 380 ARG B CG  1 
ATOM   1597 C  CD  A ARG B 1 63  ? 8.392   -29.455 21.054 0.50 34.46 ? 380 ARG B CD  1 
ATOM   1598 C  CD  B ARG B 1 63  ? 5.901   -30.115 22.768 0.50 35.74 ? 380 ARG B CD  1 
ATOM   1599 N  NE  A ARG B 1 63  ? 8.720   -30.518 20.110 0.50 34.24 ? 380 ARG B NE  1 
ATOM   1600 N  NE  B ARG B 1 63  ? 6.377   -31.234 23.563 0.50 34.97 ? 380 ARG B NE  1 
ATOM   1601 C  CZ  A ARG B 1 63  ? 8.257   -31.765 20.189 0.50 35.05 ? 380 ARG B CZ  1 
ATOM   1602 C  CZ  B ARG B 1 63  ? 5.578   -32.126 24.134 0.50 36.35 ? 380 ARG B CZ  1 
ATOM   1603 N  NH1 A ARG B 1 63  ? 7.441   -32.132 21.178 0.50 34.42 ? 380 ARG B NH1 1 
ATOM   1604 N  NH1 B ARG B 1 63  ? 4.260   -32.041 23.975 0.50 36.01 ? 380 ARG B NH1 1 
ATOM   1605 N  NH2 A ARG B 1 63  ? 8.619   -32.659 19.270 0.50 35.08 ? 380 ARG B NH2 1 
ATOM   1606 N  NH2 B ARG B 1 63  ? 6.098   -33.112 24.863 0.50 36.41 ? 380 ARG B NH2 1 
ATOM   1607 N  N   . VAL B 1 64  ? 4.756   -25.609 23.174 1.00 32.93 ? 381 VAL B N   1 
ATOM   1608 C  CA  . VAL B 1 64  ? 4.122   -24.942 24.318 1.00 32.85 ? 381 VAL B CA  1 
ATOM   1609 C  C   . VAL B 1 64  ? 2.605   -25.058 24.245 1.00 33.36 ? 381 VAL B C   1 
ATOM   1610 O  O   . VAL B 1 64  ? 1.946   -25.369 25.252 1.00 33.62 ? 381 VAL B O   1 
ATOM   1611 C  CB  . VAL B 1 64  ? 4.523   -23.459 24.436 1.00 33.12 ? 381 VAL B CB  1 
ATOM   1612 C  CG1 . VAL B 1 64  ? 3.533   -22.701 25.337 1.00 32.89 ? 381 VAL B CG1 1 
ATOM   1613 C  CG2 . VAL B 1 64  ? 5.927   -23.324 24.977 1.00 32.19 ? 381 VAL B CG2 1 
ATOM   1614 N  N   . GLN B 1 65  ? 2.060   -24.821 23.053 1.00 33.51 ? 382 GLN B N   1 
ATOM   1615 C  CA  . GLN B 1 65  ? 0.625   -24.956 22.807 1.00 34.03 ? 382 GLN B CA  1 
ATOM   1616 C  C   . GLN B 1 65  ? 0.112   -26.396 22.983 1.00 33.62 ? 382 GLN B C   1 
ATOM   1617 O  O   . GLN B 1 65  ? -0.970  -26.590 23.529 1.00 32.57 ? 382 GLN B O   1 
ATOM   1618 C  CB  . GLN B 1 65  ? 0.257   -24.433 21.404 1.00 34.05 ? 382 GLN B CB  1 
ATOM   1619 C  CG  . GLN B 1 65  ? 0.442   -22.900 21.202 1.00 35.72 ? 382 GLN B CG  1 
ATOM   1620 C  CD  . GLN B 1 65  ? -0.269  -22.044 22.261 1.00 36.23 ? 382 GLN B CD  1 
ATOM   1621 O  OE1 . GLN B 1 65  ? -1.442  -22.260 22.565 1.00 35.66 ? 382 GLN B OE1 1 
ATOM   1622 N  NE2 . GLN B 1 65  ? 0.461   -21.078 22.837 1.00 38.93 ? 382 GLN B NE2 1 
ATOM   1623 N  N   . GLU B 1 66  ? 0.890   -27.388 22.541 1.00 33.90 ? 383 GLU B N   1 
ATOM   1624 C  CA  . GLU B 1 66  ? 0.553   -28.812 22.774 1.00 34.45 ? 383 GLU B CA  1 
ATOM   1625 C  C   . GLU B 1 66  ? 0.422   -29.137 24.276 1.00 33.22 ? 383 GLU B C   1 
ATOM   1626 O  O   . GLU B 1 66  ? -0.526  -29.784 24.691 1.00 32.73 ? 383 GLU B O   1 
ATOM   1627 C  CB  . GLU B 1 66  ? 1.598   -29.756 22.153 1.00 34.52 ? 383 GLU B CB  1 
ATOM   1628 C  CG  . GLU B 1 66  ? 1.718   -29.666 20.626 1.00 35.87 ? 383 GLU B CG  1 
ATOM   1629 C  CD  . GLU B 1 66  ? 2.841   -30.557 20.056 1.00 37.39 ? 383 GLU B CD  1 
ATOM   1630 O  OE1 . GLU B 1 66  ? 3.492   -31.302 20.832 1.00 41.46 ? 383 GLU B OE1 1 
ATOM   1631 O  OE2 . GLU B 1 66  ? 3.052   -30.539 18.814 1.00 42.94 ? 383 GLU B OE2 1 
ATOM   1632 N  N   . ILE B 1 67  ? 1.374   -28.675 25.082 1.00 32.81 ? 384 ILE B N   1 
ATOM   1633 C  CA  . ILE B 1 67  ? 1.353   -28.960 26.522 1.00 32.14 ? 384 ILE B CA  1 
ATOM   1634 C  C   . ILE B 1 67  ? 0.139   -28.296 27.165 1.00 31.75 ? 384 ILE B C   1 
ATOM   1635 O  O   . ILE B 1 67  ? -0.552  -28.888 28.010 1.00 31.89 ? 384 ILE B O   1 
ATOM   1636 C  CB  . ILE B 1 67  ? 2.680   -28.526 27.210 1.00 32.00 ? 384 ILE B CB  1 
ATOM   1637 C  CG1 . ILE B 1 67  ? 3.825   -29.396 26.681 1.00 32.62 ? 384 ILE B CG1 1 
ATOM   1638 C  CG2 . ILE B 1 67  ? 2.555   -28.646 28.708 1.00 31.22 ? 384 ILE B CG2 1 
ATOM   1639 C  CD1 . ILE B 1 67  ? 5.231   -28.913 27.049 1.00 32.53 ? 384 ILE B CD1 1 
ATOM   1640 N  N   . TRP B 1 68  ? -0.144  -27.068 26.740 1.00 31.51 ? 385 TRP B N   1 
ATOM   1641 C  CA  . TRP B 1 68  ? -1.314  -26.355 27.231 1.00 30.97 ? 385 TRP B CA  1 
ATOM   1642 C  C   . TRP B 1 68  ? -2.600  -27.122 26.850 1.00 30.76 ? 385 TRP B C   1 
ATOM   1643 O  O   . TRP B 1 68  ? -3.458  -27.370 27.694 1.00 29.26 ? 385 TRP B O   1 
ATOM   1644 C  CB  . TRP B 1 68  ? -1.304  -24.945 26.677 1.00 31.51 ? 385 TRP B CB  1 
ATOM   1645 C  CG  . TRP B 1 68  ? -2.574  -24.209 26.865 1.00 31.79 ? 385 TRP B CG  1 
ATOM   1646 C  CD1 . TRP B 1 68  ? -3.573  -24.041 25.950 1.00 32.20 ? 385 TRP B CD1 1 
ATOM   1647 C  CD2 . TRP B 1 68  ? -2.996  -23.545 28.059 1.00 31.48 ? 385 TRP B CD2 1 
ATOM   1648 N  NE1 . TRP B 1 68  ? -4.596  -23.303 26.502 1.00 31.97 ? 385 TRP B NE1 1 
ATOM   1649 C  CE2 . TRP B 1 68  ? -4.262  -22.985 27.798 1.00 31.57 ? 385 TRP B CE2 1 
ATOM   1650 C  CE3 . TRP B 1 68  ? -2.432  -23.388 29.330 1.00 32.79 ? 385 TRP B CE3 1 
ATOM   1651 C  CZ2 . TRP B 1 68  ? -4.959  -22.257 28.750 1.00 31.29 ? 385 TRP B CZ2 1 
ATOM   1652 C  CZ3 . TRP B 1 68  ? -3.127  -22.658 30.279 1.00 32.09 ? 385 TRP B CZ3 1 
ATOM   1653 C  CH2 . TRP B 1 68  ? -4.371  -22.096 29.980 1.00 31.93 ? 385 TRP B CH2 1 
ATOM   1654 N  N   . GLN B 1 69  ? -2.708  -27.528 25.584 1.00 30.85 ? 386 GLN B N   1 
ATOM   1655 C  CA  . GLN B 1 69  ? -3.873  -28.289 25.124 1.00 31.11 ? 386 GLN B CA  1 
ATOM   1656 C  C   . GLN B 1 69  ? -4.074  -29.605 25.882 1.00 31.04 ? 386 GLN B C   1 
ATOM   1657 O  O   . GLN B 1 69  ? -5.203  -29.954 26.202 1.00 30.83 ? 386 GLN B O   1 
ATOM   1658 C  CB  . GLN B 1 69  ? -3.777  -28.578 23.617 1.00 32.08 ? 386 GLN B CB  1 
ATOM   1659 C  CG  . GLN B 1 69  ? -3.938  -27.338 22.735 1.00 32.04 ? 386 GLN B CG  1 
ATOM   1660 C  CD  . GLN B 1 69  ? -5.328  -26.775 22.818 1.00 34.50 ? 386 GLN B CD  1 
ATOM   1661 O  OE1 . GLN B 1 69  ? -6.269  -27.351 22.272 1.00 39.90 ? 386 GLN B OE1 1 
ATOM   1662 N  NE2 . GLN B 1 69  ? -5.473  -25.644 23.473 1.00 33.52 ? 386 GLN B NE2 1 
ATOM   1663 N  N   . GLU B 1 70  ? -2.985  -30.304 26.197 1.00 31.27 ? 387 GLU B N   1 
ATOM   1664 C  CA  . GLU B 1 70  ? -3.070  -31.622 26.850 1.00 31.19 ? 387 GLU B CA  1 
ATOM   1665 C  C   . GLU B 1 70  ? -3.347  -31.533 28.348 1.00 30.30 ? 387 GLU B C   1 
ATOM   1666 O  O   . GLU B 1 70  ? -4.095  -32.352 28.858 1.00 29.66 ? 387 GLU B O   1 
ATOM   1667 C  CB  . GLU B 1 70  ? -1.786  -32.443 26.613 1.00 31.89 ? 387 GLU B CB  1 
ATOM   1668 C  CG  . GLU B 1 70  ? -1.780  -33.877 27.243 1.00 33.24 ? 387 GLU B CG  1 
ATOM   1669 C  CD  . GLU B 1 70  ? -2.800  -34.807 26.609 1.00 37.18 ? 387 GLU B CD  1 
ATOM   1670 O  OE1 . GLU B 1 70  ? -3.081  -34.650 25.397 1.00 41.02 ? 387 GLU B OE1 1 
ATOM   1671 O  OE2 . GLU B 1 70  ? -3.321  -35.710 27.304 1.00 40.15 ? 387 GLU B OE2 1 
ATOM   1672 N  N   . PHE B 1 71  ? -2.772  -30.539 29.037 1.00 29.79 ? 388 PHE B N   1 
ATOM   1673 C  CA  . PHE B 1 71  ? -2.784  -30.493 30.515 1.00 29.48 ? 388 PHE B CA  1 
ATOM   1674 C  C   . PHE B 1 71  ? -3.544  -29.336 31.180 1.00 29.66 ? 388 PHE B C   1 
ATOM   1675 O  O   . PHE B 1 71  ? -3.887  -29.430 32.373 1.00 28.91 ? 388 PHE B O   1 
ATOM   1676 C  CB  . PHE B 1 71  ? -1.339  -30.484 31.051 1.00 30.02 ? 388 PHE B CB  1 
ATOM   1677 C  CG  . PHE B 1 71  ? -0.552  -31.728 30.693 1.00 30.37 ? 388 PHE B CG  1 
ATOM   1678 C  CD1 . PHE B 1 71  ? -0.732  -32.900 31.400 1.00 30.94 ? 388 PHE B CD1 1 
ATOM   1679 C  CD2 . PHE B 1 71  ? 0.324   -31.729 29.619 1.00 31.02 ? 388 PHE B CD2 1 
ATOM   1680 C  CE1 . PHE B 1 71  ? -0.038  -34.059 31.049 1.00 31.50 ? 388 PHE B CE1 1 
ATOM   1681 C  CE2 . PHE B 1 71  ? 1.024   -32.879 29.259 1.00 30.71 ? 388 PHE B CE2 1 
ATOM   1682 C  CZ  . PHE B 1 71  ? 0.831   -34.043 29.969 1.00 31.11 ? 388 PHE B CZ  1 
ATOM   1683 N  N   . LEU B 1 72  ? -3.760  -28.233 30.462 1.00 29.61 ? 389 LEU B N   1 
ATOM   1684 C  CA  . LEU B 1 72  ? -4.220  -27.012 31.126 1.00 29.82 ? 389 LEU B CA  1 
ATOM   1685 C  C   . LEU B 1 72  ? -5.370  -26.276 30.490 1.00 29.55 ? 389 LEU B C   1 
ATOM   1686 O  O   . LEU B 1 72  ? -6.092  -25.574 31.193 1.00 29.85 ? 389 LEU B O   1 
ATOM   1687 C  CB  . LEU B 1 72  ? -3.038  -26.057 31.344 1.00 30.11 ? 389 LEU B CB  1 
ATOM   1688 C  CG  . LEU B 1 72  ? -2.062  -26.538 32.422 1.00 29.51 ? 389 LEU B CG  1 
ATOM   1689 C  CD1 . LEU B 1 72  ? -0.665  -26.026 32.125 1.00 30.36 ? 389 LEU B CD1 1 
ATOM   1690 C  CD2 . LEU B 1 72  ? -2.549  -26.102 33.806 1.00 29.57 ? 389 LEU B CD2 1 
ATOM   1691 N  N   . ALA B 1 73  ? -5.570  -26.434 29.180 1.00 29.47 ? 390 ALA B N   1 
ATOM   1692 C  CA  . ALA B 1 73  ? -6.644  -25.750 28.497 1.00 29.27 ? 390 ALA B CA  1 
ATOM   1693 C  C   . ALA B 1 73  ? -8.010  -26.239 29.001 1.00 29.21 ? 390 ALA B C   1 
ATOM   1694 O  O   . ALA B 1 73  ? -8.102  -27.271 29.657 1.00 28.51 ? 390 ALA B O   1 
ATOM   1695 C  CB  . ALA B 1 73  ? -6.527  -25.947 26.967 1.00 29.23 ? 390 ALA B CB  1 
ATOM   1696 N  N   . PRO B 1 74  ? -9.078  -25.497 28.673 1.00 29.50 ? 391 PRO B N   1 
ATOM   1697 C  CA  . PRO B 1 74  ? -10.421 -26.016 28.922 1.00 29.82 ? 391 PRO B CA  1 
ATOM   1698 C  C   . PRO B 1 74  ? -10.624 -27.401 28.283 1.00 29.87 ? 391 PRO B C   1 
ATOM   1699 O  O   . PRO B 1 74  ? -10.313 -27.593 27.111 1.00 29.75 ? 391 PRO B O   1 
ATOM   1700 C  CB  . PRO B 1 74  ? -11.322 -24.984 28.250 1.00 29.51 ? 391 PRO B CB  1 
ATOM   1701 C  CG  . PRO B 1 74  ? -10.510 -23.752 28.147 1.00 29.47 ? 391 PRO B CG  1 
ATOM   1702 C  CD  . PRO B 1 74  ? -9.105  -24.164 28.042 1.00 29.64 ? 391 PRO B CD  1 
ATOM   1703 N  N   . GLY B 1 75  ? -11.133 -28.351 29.058 1.00 29.95 ? 392 GLY B N   1 
ATOM   1704 C  CA  . GLY B 1 75  ? -11.430 -29.679 28.541 1.00 30.25 ? 392 GLY B CA  1 
ATOM   1705 C  C   . GLY B 1 75  ? -10.206 -30.551 28.287 1.00 30.33 ? 392 GLY B C   1 
ATOM   1706 O  O   . GLY B 1 75  ? -10.330 -31.591 27.667 1.00 30.09 ? 392 GLY B O   1 
ATOM   1707 N  N   . ALA B 1 76  ? -9.038  -30.130 28.766 1.00 30.76 ? 393 ALA B N   1 
ATOM   1708 C  CA  . ALA B 1 76  ? -7.785  -30.886 28.572 1.00 31.61 ? 393 ALA B CA  1 
ATOM   1709 C  C   . ALA B 1 76  ? -7.917  -32.364 29.019 1.00 32.30 ? 393 ALA B C   1 
ATOM   1710 O  O   . ALA B 1 76  ? -8.357  -32.643 30.147 1.00 31.93 ? 393 ALA B O   1 
ATOM   1711 C  CB  . ALA B 1 76  ? -6.633  -30.219 29.295 1.00 31.13 ? 393 ALA B CB  1 
ATOM   1712 N  N   . PRO B 1 77  ? -7.536  -33.307 28.133 1.00 32.91 ? 394 PRO B N   1 
ATOM   1713 C  CA  . PRO B 1 77  ? -7.695  -34.729 28.436 1.00 33.21 ? 394 PRO B CA  1 
ATOM   1714 C  C   . PRO B 1 77  ? -6.842  -35.243 29.602 1.00 33.59 ? 394 PRO B C   1 
ATOM   1715 O  O   . PRO B 1 77  ? -7.197  -36.242 30.213 1.00 33.25 ? 394 PRO B O   1 
ATOM   1716 C  CB  . PRO B 1 77  ? -7.342  -35.419 27.102 1.00 33.48 ? 394 PRO B CB  1 
ATOM   1717 C  CG  . PRO B 1 77  ? -6.539  -34.451 26.359 1.00 33.51 ? 394 PRO B CG  1 
ATOM   1718 C  CD  . PRO B 1 77  ? -6.963  -33.087 26.790 1.00 33.04 ? 394 PRO B CD  1 
ATOM   1719 N  N   . SER B 1 78  ? -5.745  -34.558 29.917 1.00 33.79 ? 395 SER B N   1 
ATOM   1720 C  CA  . SER B 1 78  ? -4.951  -34.850 31.104 1.00 34.44 ? 395 SER B CA  1 
ATOM   1721 C  C   . SER B 1 78  ? -4.914  -33.671 32.076 1.00 35.00 ? 395 SER B C   1 
ATOM   1722 O  O   . SER B 1 78  ? -3.834  -33.306 32.555 1.00 35.57 ? 395 SER B O   1 
ATOM   1723 C  CB  . SER B 1 78  ? -3.500  -35.168 30.696 1.00 34.55 ? 395 SER B CB  1 
ATOM   1724 O  OG  . SER B 1 78  ? -3.464  -36.183 29.718 1.00 33.16 ? 395 SER B OG  1 
ATOM   1725 N  N   . ALA B 1 79  ? -6.069  -33.076 32.366 1.00 35.36 ? 396 ALA B N   1 
ATOM   1726 C  CA  . ALA B 1 79  ? -6.117  -31.817 33.154 1.00 35.70 ? 396 ALA B CA  1 
ATOM   1727 C  C   . ALA B 1 79  ? -5.436  -31.971 34.516 1.00 35.76 ? 396 ALA B C   1 
ATOM   1728 O  O   . ALA B 1 79  ? -5.609  -32.996 35.171 1.00 35.50 ? 396 ALA B O   1 
ATOM   1729 C  CB  . ALA B 1 79  ? -7.577  -31.337 33.339 1.00 35.81 ? 396 ALA B CB  1 
ATOM   1730 N  N   . ILE B 1 80  ? -4.647  -30.959 34.901 1.00 36.21 ? 397 ILE B N   1 
ATOM   1731 C  CA  . ILE B 1 80  ? -3.982  -30.880 36.213 1.00 36.64 ? 397 ILE B CA  1 
ATOM   1732 C  C   . ILE B 1 80  ? -4.500  -29.670 36.978 1.00 36.99 ? 397 ILE B C   1 
ATOM   1733 O  O   . ILE B 1 80  ? -5.047  -28.728 36.376 1.00 37.09 ? 397 ILE B O   1 
ATOM   1734 C  CB  . ILE B 1 80  ? -2.437  -30.698 36.109 1.00 36.57 ? 397 ILE B CB  1 
ATOM   1735 C  CG1 . ILE B 1 80  ? -2.072  -29.425 35.318 1.00 36.34 ? 397 ILE B CG1 1 
ATOM   1736 C  CG2 . ILE B 1 80  ? -1.781  -31.924 35.501 1.00 36.62 ? 397 ILE B CG2 1 
ATOM   1737 C  CD1 . ILE B 1 80  ? -0.589  -29.045 35.414 1.00 37.03 ? 397 ILE B CD1 1 
ATOM   1738 N  N   . ASN B 1 81  ? -4.297  -29.683 38.292 1.00 37.21 ? 398 ASN B N   1 
ATOM   1739 C  CA  . ASN B 1 81  ? -4.713  -28.572 39.141 1.00 38.18 ? 398 ASN B CA  1 
ATOM   1740 C  C   . ASN B 1 81  ? -3.503  -27.740 39.511 1.00 37.90 ? 398 ASN B C   1 
ATOM   1741 O  O   . ASN B 1 81  ? -2.479  -28.277 39.922 1.00 38.53 ? 398 ASN B O   1 
ATOM   1742 C  CB  . ASN B 1 81  ? -5.397  -29.075 40.416 1.00 38.66 ? 398 ASN B CB  1 
ATOM   1743 C  CG  . ASN B 1 81  ? -6.672  -29.849 40.133 1.00 41.04 ? 398 ASN B CG  1 
ATOM   1744 O  OD1 . ASN B 1 81  ? -7.183  -29.848 39.010 1.00 44.77 ? 398 ASN B OD1 1 
ATOM   1745 N  ND2 . ASN B 1 81  ? -7.192  -30.528 41.158 1.00 44.94 ? 398 ASN B ND2 1 
ATOM   1746 N  N   . LEU B 1 82  ? -3.599  -26.431 39.350 1.00 37.14 ? 399 LEU B N   1 
ATOM   1747 C  CA  . LEU B 1 82  ? -2.538  -25.557 39.846 1.00 36.43 ? 399 LEU B CA  1 
ATOM   1748 C  C   . LEU B 1 82  ? -3.096  -24.605 40.887 1.00 35.89 ? 399 LEU B C   1 
ATOM   1749 O  O   . LEU B 1 82  ? -4.311  -24.371 40.942 1.00 35.00 ? 399 LEU B O   1 
ATOM   1750 C  CB  . LEU B 1 82  ? -1.911  -24.748 38.720 1.00 36.09 ? 399 LEU B CB  1 
ATOM   1751 C  CG  . LEU B 1 82  ? -1.304  -25.521 37.564 1.00 35.60 ? 399 LEU B CG  1 
ATOM   1752 C  CD1 . LEU B 1 82  ? -0.910  -24.532 36.463 1.00 35.08 ? 399 LEU B CD1 1 
ATOM   1753 C  CD2 . LEU B 1 82  ? -0.121  -26.357 38.051 1.00 35.36 ? 399 LEU B CD2 1 
ATOM   1754 N  N   . ASP B 1 83  ? -2.200  -24.069 41.712 1.00 35.30 ? 400 ASP B N   1 
ATOM   1755 C  CA  . ASP B 1 83  ? -2.515  -22.885 42.490 1.00 35.29 ? 400 ASP B CA  1 
ATOM   1756 C  C   . ASP B 1 83  ? -2.825  -21.724 41.524 1.00 35.05 ? 400 ASP B C   1 
ATOM   1757 O  O   . ASP B 1 83  ? -2.352  -21.707 40.370 1.00 34.32 ? 400 ASP B O   1 
ATOM   1758 C  CB  . ASP B 1 83  ? -1.355  -22.521 43.421 1.00 35.21 ? 400 ASP B CB  1 
ATOM   1759 C  CG  . ASP B 1 83  ? -0.079  -22.200 42.669 1.00 35.47 ? 400 ASP B CG  1 
ATOM   1760 O  OD1 . ASP B 1 83  ? 0.433   -23.080 41.916 1.00 32.23 ? 400 ASP B OD1 1 
ATOM   1761 O  OD2 . ASP B 1 83  ? 0.408   -21.053 42.829 1.00 36.03 ? 400 ASP B OD2 1 
ATOM   1762 N  N   . SER B 1 84  ? -3.608  -20.755 42.000 1.00 34.71 ? 401 SER B N   1 
ATOM   1763 C  CA  . SER B 1 84  ? -4.063  -19.659 41.152 1.00 34.84 ? 401 SER B CA  1 
ATOM   1764 C  C   . SER B 1 84  ? -2.905  -18.822 40.632 1.00 34.12 ? 401 SER B C   1 
ATOM   1765 O  O   . SER B 1 84  ? -2.878  -18.475 39.460 1.00 34.28 ? 401 SER B O   1 
ATOM   1766 C  CB  . SER B 1 84  ? -5.079  -18.779 41.887 1.00 35.32 ? 401 SER B CB  1 
ATOM   1767 O  OG  . SER B 1 84  ? -4.582  -18.368 43.146 1.00 37.39 ? 401 SER B OG  1 
ATOM   1768 N  N   . LYS B 1 85  ? -1.940  -18.523 41.496 1.00 33.62 ? 402 LYS B N   1 
ATOM   1769 C  CA  . LYS B 1 85  ? -0.780  -17.713 41.104 1.00 33.53 ? 402 LYS B CA  1 
ATOM   1770 C  C   . LYS B 1 85  ? -0.054  -18.324 39.902 1.00 32.85 ? 402 LYS B C   1 
ATOM   1771 O  O   . LYS B 1 85  ? 0.160   -17.655 38.880 1.00 31.49 ? 402 LYS B O   1 
ATOM   1772 C  CB  . LYS B 1 85  ? 0.170   -17.532 42.298 1.00 34.01 ? 402 LYS B CB  1 
ATOM   1773 C  CG  . LYS B 1 85  ? 1.338   -16.595 42.045 1.00 35.44 ? 402 LYS B CG  1 
ATOM   1774 N  N   . SER B 1 86  ? 0.265   -19.612 40.002 1.00 32.72 ? 403 SER B N   1 
ATOM   1775 C  CA  . SER B 1 86  ? 0.999   -20.290 38.945 1.00 32.62 ? 403 SER B CA  1 
ATOM   1776 C  C   . SER B 1 86  ? 0.126   -20.512 37.691 1.00 32.63 ? 403 SER B C   1 
ATOM   1777 O  O   . SER B 1 86  ? 0.650   -20.429 36.584 1.00 32.09 ? 403 SER B O   1 
ATOM   1778 C  CB  . SER B 1 86  ? 1.630   -21.594 39.458 1.00 32.72 ? 403 SER B CB  1 
ATOM   1779 O  OG  . SER B 1 86  ? 0.766   -22.697 39.298 1.00 33.28 ? 403 SER B OG  1 
ATOM   1780 N  N   . TYR B 1 87  ? -1.180  -20.781 37.863 1.00 33.01 ? 404 TYR B N   1 
ATOM   1781 C  CA  . TYR B 1 87  ? -2.139  -20.842 36.733 1.00 33.44 ? 404 TYR B CA  1 
ATOM   1782 C  C   . TYR B 1 87  ? -2.127  -19.493 35.980 1.00 32.91 ? 404 TYR B C   1 
ATOM   1783 O  O   . TYR B 1 87  ? -1.943  -19.465 34.766 1.00 32.27 ? 404 TYR B O   1 
ATOM   1784 C  CB  . TYR B 1 87  ? -3.600  -21.213 37.156 1.00 34.57 ? 404 TYR B CB  1 
ATOM   1785 C  CG  . TYR B 1 87  ? -4.258  -22.301 36.281 1.00 35.93 ? 404 TYR B CG  1 
ATOM   1786 C  CD1 . TYR B 1 87  ? -4.416  -22.133 34.905 1.00 37.96 ? 404 TYR B CD1 1 
ATOM   1787 C  CD2 . TYR B 1 87  ? -4.707  -23.499 36.838 1.00 39.13 ? 404 TYR B CD2 1 
ATOM   1788 C  CE1 . TYR B 1 87  ? -4.986  -23.133 34.093 1.00 38.80 ? 404 TYR B CE1 1 
ATOM   1789 C  CE2 . TYR B 1 87  ? -5.282  -24.518 36.045 1.00 40.27 ? 404 TYR B CE2 1 
ATOM   1790 C  CZ  . TYR B 1 87  ? -5.425  -24.332 34.664 1.00 39.98 ? 404 TYR B CZ  1 
ATOM   1791 O  OH  . TYR B 1 87  ? -5.992  -25.352 33.883 1.00 37.15 ? 404 TYR B OH  1 
ATOM   1792 N  N   . ASP B 1 88  ? -2.265  -18.395 36.714 1.00 32.59 ? 405 ASP B N   1 
ATOM   1793 C  CA  . ASP B 1 88  ? -2.310  -17.061 36.104 1.00 33.24 ? 405 ASP B CA  1 
ATOM   1794 C  C   . ASP B 1 88  ? -1.084  -16.757 35.260 1.00 33.02 ? 405 ASP B C   1 
ATOM   1795 O  O   . ASP B 1 88  ? -1.213  -16.343 34.097 1.00 32.60 ? 405 ASP B O   1 
ATOM   1796 C  CB  . ASP B 1 88  ? -2.492  -15.983 37.171 1.00 33.61 ? 405 ASP B CB  1 
ATOM   1797 C  CG  . ASP B 1 88  ? -3.844  -16.057 37.834 1.00 35.40 ? 405 ASP B CG  1 
ATOM   1798 O  OD1 . ASP B 1 88  ? -4.717  -16.738 37.261 1.00 38.80 ? 405 ASP B OD1 1 
ATOM   1799 O  OD2 . ASP B 1 88  ? -4.039  -15.449 38.920 1.00 39.34 ? 405 ASP B OD2 1 
ATOM   1800 N  N   . LYS B 1 89  ? 0.096   -17.008 35.824 1.00 32.83 ? 406 LYS B N   1 
ATOM   1801 C  CA  . LYS B 1 89  ? 1.335   -16.782 35.098 1.00 33.31 ? 406 LYS B CA  1 
ATOM   1802 C  C   . LYS B 1 89  ? 1.372   -17.591 33.819 1.00 32.35 ? 406 LYS B C   1 
ATOM   1803 O  O   . LYS B 1 89  ? 1.683   -17.066 32.751 1.00 31.37 ? 406 LYS B O   1 
ATOM   1804 C  CB  . LYS B 1 89  ? 2.544   -17.126 35.951 1.00 33.87 ? 406 LYS B CB  1 
ATOM   1805 C  CG  . LYS B 1 89  ? 2.729   -16.215 37.112 1.00 36.65 ? 406 LYS B CG  1 
ATOM   1806 C  CD  . LYS B 1 89  ? 4.141   -16.311 37.669 1.00 40.08 ? 406 LYS B CD  1 
ATOM   1807 C  CE  . LYS B 1 89  ? 4.372   -15.267 38.748 1.00 41.22 ? 406 LYS B CE  1 
ATOM   1808 N  NZ  . LYS B 1 89  ? 3.612   -15.558 39.993 1.00 41.95 ? 406 LYS B NZ  1 
ATOM   1809 N  N   . THR B 1 90  ? 1.026   -18.869 33.945 1.00 31.56 ? 407 THR B N   1 
ATOM   1810 C  CA  . THR B 1 90  ? 1.056   -19.797 32.838 1.00 31.81 ? 407 THR B CA  1 
ATOM   1811 C  C   . THR B 1 90  ? 0.163   -19.345 31.703 1.00 31.03 ? 407 THR B C   1 
ATOM   1812 O  O   . THR B 1 90  ? 0.597   -19.284 30.569 1.00 31.63 ? 407 THR B O   1 
ATOM   1813 C  CB  . THR B 1 90  ? 0.651   -21.242 33.301 1.00 31.96 ? 407 THR B CB  1 
ATOM   1814 O  OG1 . THR B 1 90  ? 1.396   -21.591 34.475 1.00 32.00 ? 407 THR B OG1 1 
ATOM   1815 C  CG2 . THR B 1 90  ? 0.919   -22.260 32.208 1.00 32.65 ? 407 THR B CG2 1 
ATOM   1816 N  N   . THR B 1 91  ? -1.079  -19.012 32.007 1.00 31.51 ? 408 THR B N   1 
ATOM   1817 C  CA  . THR B 1 91  ? -2.048  -18.591 30.972 1.00 31.54 ? 408 THR B CA  1 
ATOM   1818 C  C   . THR B 1 91  ? -1.545  -17.356 30.214 1.00 31.23 ? 408 THR B C   1 
ATOM   1819 O  O   . THR B 1 91  ? -1.602  -17.318 28.981 1.00 31.01 ? 408 THR B O   1 
ATOM   1820 C  CB  . THR B 1 91  ? -3.435  -18.289 31.564 1.00 31.25 ? 408 THR B CB  1 
ATOM   1821 O  OG1 . THR B 1 91  ? -3.383  -17.070 32.319 1.00 35.25 ? 408 THR B OG1 1 
ATOM   1822 C  CG2 . THR B 1 91  ? -3.915  -19.422 32.464 1.00 30.51 ? 408 THR B CG2 1 
ATOM   1823 N  N   . HIS B 1 92  ? -1.026  -16.372 30.959 1.00 31.24 ? 409 HIS B N   1 
ATOM   1824 C  CA  . HIS B 1 92  ? -0.453  -15.157 30.377 1.00 31.52 ? 409 HIS B CA  1 
ATOM   1825 C  C   . HIS B 1 92  ? 0.719   -15.514 29.464 1.00 31.06 ? 409 HIS B C   1 
ATOM   1826 O  O   . HIS B 1 92  ? 0.824   -14.994 28.352 1.00 30.66 ? 409 HIS B O   1 
ATOM   1827 C  CB  . HIS B 1 92  ? 0.009   -14.165 31.474 1.00 32.11 ? 409 HIS B CB  1 
ATOM   1828 C  CG  . HIS B 1 92  ? -1.107  -13.387 32.108 1.00 34.03 ? 409 HIS B CG  1 
ATOM   1829 N  ND1 . HIS B 1 92  ? -1.151  -12.006 32.100 1.00 37.89 ? 409 HIS B ND1 1 
ATOM   1830 C  CD2 . HIS B 1 92  ? -2.212  -13.789 32.790 1.00 36.47 ? 409 HIS B CD2 1 
ATOM   1831 C  CE1 . HIS B 1 92  ? -2.233  -11.591 32.740 1.00 36.26 ? 409 HIS B CE1 1 
ATOM   1832 N  NE2 . HIS B 1 92  ? -2.897  -12.652 33.166 1.00 38.36 ? 409 HIS B NE2 1 
ATOM   1833 N  N   . ASN B 1 93  ? 1.580   -16.427 29.910 1.00 30.46 ? 410 ASN B N   1 
ATOM   1834 C  CA  . ASN B 1 93  ? 2.683   -16.880 29.072 1.00 29.96 ? 410 ASN B CA  1 
ATOM   1835 C  C   . ASN B 1 93  ? 2.250   -17.559 27.777 1.00 29.81 ? 410 ASN B C   1 
ATOM   1836 O  O   . ASN B 1 93  ? 2.867   -17.331 26.742 1.00 29.75 ? 410 ASN B O   1 
ATOM   1837 C  CB  . ASN B 1 93  ? 3.640   -17.785 29.859 1.00 30.07 ? 410 ASN B CB  1 
ATOM   1838 C  CG  . ASN B 1 93  ? 4.433   -17.021 30.924 1.00 30.51 ? 410 ASN B CG  1 
ATOM   1839 O  OD1 . ASN B 1 93  ? 4.581   -15.789 30.863 1.00 29.03 ? 410 ASN B OD1 1 
ATOM   1840 N  ND2 . ASN B 1 93  ? 4.947   -17.754 31.908 1.00 30.82 ? 410 ASN B ND2 1 
ATOM   1841 N  N   . VAL B 1 94  ? 1.226   -18.416 27.855 1.00 30.12 ? 411 VAL B N   1 
ATOM   1842 C  CA  . VAL B 1 94  ? 0.720   -19.198 26.704 1.00 30.28 ? 411 VAL B CA  1 
ATOM   1843 C  C   . VAL B 1 94  ? 0.007   -18.302 25.694 1.00 30.20 ? 411 VAL B C   1 
ATOM   1844 O  O   . VAL B 1 94  ? 0.241   -18.403 24.482 1.00 30.00 ? 411 VAL B O   1 
ATOM   1845 C  CB  . VAL B 1 94  ? -0.245  -20.379 27.166 1.00 30.51 ? 411 VAL B CB  1 
ATOM   1846 C  CG1 . VAL B 1 94  ? -0.926  -21.084 25.985 1.00 30.99 ? 411 VAL B CG1 1 
ATOM   1847 C  CG2 . VAL B 1 94  ? 0.516   -21.429 28.002 1.00 30.51 ? 411 VAL B CG2 1 
ATOM   1848 N  N   . LYS B 1 95  ? -0.820  -17.400 26.215 1.00 30.32 ? 412 LYS B N   1 
ATOM   1849 C  CA  . LYS B 1 95  ? -1.675  -16.528 25.415 1.00 30.48 ? 412 LYS B CA  1 
ATOM   1850 C  C   . LYS B 1 95  ? -0.992  -15.252 24.941 1.00 30.49 ? 412 LYS B C   1 
ATOM   1851 O  O   . LYS B 1 95  ? -1.468  -14.606 23.992 1.00 30.45 ? 412 LYS B O   1 
ATOM   1852 C  CB  . LYS B 1 95  ? -2.910  -16.156 26.234 1.00 30.57 ? 412 LYS B CB  1 
ATOM   1853 C  CG  . LYS B 1 95  ? -3.744  -17.376 26.613 1.00 32.52 ? 412 LYS B CG  1 
ATOM   1854 C  CD  . LYS B 1 95  ? -4.681  -17.788 25.471 1.00 35.04 ? 412 LYS B CD  1 
ATOM   1855 C  CE  . LYS B 1 95  ? -5.256  -19.188 25.645 1.00 36.03 ? 412 LYS B CE  1 
ATOM   1856 N  NZ  . LYS B 1 95  ? -4.711  -20.144 24.634 1.00 36.70 ? 412 LYS B NZ  1 
ATOM   1857 N  N   . GLU B 1 96  ? 0.091   -14.875 25.624 1.00 29.78 ? 413 GLU B N   1 
ATOM   1858 C  CA  . GLU B 1 96  ? 0.811   -13.650 25.344 1.00 29.75 ? 413 GLU B CA  1 
ATOM   1859 C  C   . GLU B 1 96  ? 2.313   -13.950 25.387 1.00 30.24 ? 413 GLU B C   1 
ATOM   1860 O  O   . GLU B 1 96  ? 3.054   -13.401 26.224 1.00 30.67 ? 413 GLU B O   1 
ATOM   1861 C  CB  . GLU B 1 96  ? 0.450   -12.557 26.367 1.00 29.56 ? 413 GLU B CB  1 
ATOM   1862 C  CG  . GLU B 1 96  ? -1.048  -12.249 26.517 1.00 29.90 ? 413 GLU B CG  1 
ATOM   1863 C  CD  . GLU B 1 96  ? -1.650  -11.493 25.332 1.00 31.67 ? 413 GLU B CD  1 
ATOM   1864 O  OE1 . GLU B 1 96  ? -2.866  -11.651 25.097 1.00 31.23 ? 413 GLU B OE1 1 
ATOM   1865 O  OE2 . GLU B 1 96  ? -0.923  -10.731 24.635 1.00 32.77 ? 413 GLU B OE2 1 
ATOM   1866 N  N   . PRO B 1 97  ? 2.777   -14.829 24.486 1.00 31.00 ? 414 PRO B N   1 
ATOM   1867 C  CA  . PRO B 1 97  ? 4.171   -15.248 24.565 1.00 31.05 ? 414 PRO B CA  1 
ATOM   1868 C  C   . PRO B 1 97  ? 5.143   -14.088 24.473 1.00 30.95 ? 414 PRO B C   1 
ATOM   1869 O  O   . PRO B 1 97  ? 5.026   -13.228 23.593 1.00 31.87 ? 414 PRO B O   1 
ATOM   1870 C  CB  . PRO B 1 97  ? 4.330   -16.239 23.398 1.00 31.29 ? 414 PRO B CB  1 
ATOM   1871 C  CG  . PRO B 1 97  ? 3.144   -16.069 22.550 1.00 31.83 ? 414 PRO B CG  1 
ATOM   1872 C  CD  . PRO B 1 97  ? 2.054   -15.483 23.383 1.00 30.87 ? 414 PRO B CD  1 
ATOM   1873 N  N   . GLY B 1 98  ? 6.094   -14.054 25.399 1.00 30.64 ? 415 GLY B N   1 
ATOM   1874 C  CA  . GLY B 1 98  ? 7.074   -12.985 25.456 1.00 30.40 ? 415 GLY B CA  1 
ATOM   1875 C  C   . GLY B 1 98  ? 6.631   -11.736 26.210 1.00 29.99 ? 415 GLY B C   1 
ATOM   1876 O  O   . GLY B 1 98  ? 7.467   -11.032 26.725 1.00 30.81 ? 415 GLY B O   1 
ATOM   1877 N  N   . ARG B 1 99  ? 5.330   -11.462 26.292 1.00 29.81 ? 416 ARG B N   1 
ATOM   1878 C  CA  . ARG B 1 99  ? 4.847   -10.176 26.863 1.00 30.13 ? 416 ARG B CA  1 
ATOM   1879 C  C   . ARG B 1 99  ? 5.199   -9.996  28.347 1.00 30.82 ? 416 ARG B C   1 
ATOM   1880 O  O   . ARG B 1 99  ? 5.414   -8.860  28.810 1.00 31.80 ? 416 ARG B O   1 
ATOM   1881 C  CB  . ARG B 1 99  ? 3.341   -10.018 26.660 1.00 29.91 ? 416 ARG B CB  1 
ATOM   1882 C  CG  . ARG B 1 99  ? 2.837   -8.619  26.913 1.00 29.38 ? 416 ARG B CG  1 
ATOM   1883 C  CD  . ARG B 1 99  ? 1.347   -8.499  26.677 1.00 28.11 ? 416 ARG B CD  1 
ATOM   1884 N  NE  . ARG B 1 99  ? 0.932   -8.725  25.285 1.00 26.64 ? 416 ARG B NE  1 
ATOM   1885 C  CZ  . ARG B 1 99  ? 1.207   -7.920  24.252 1.00 24.06 ? 416 ARG B CZ  1 
ATOM   1886 N  NH1 . ARG B 1 99  ? 1.954   -6.836  24.398 1.00 24.90 ? 416 ARG B NH1 1 
ATOM   1887 N  NH2 . ARG B 1 99  ? 0.742   -8.226  23.052 1.00 24.49 ? 416 ARG B NH2 1 
ATOM   1888 N  N   . TYR B 1 100 ? 5.306   -11.112 29.067 1.00 31.10 ? 417 TYR B N   1 
ATOM   1889 C  CA  . TYR B 1 100 ? 5.546   -11.103 30.506 1.00 31.70 ? 417 TYR B CA  1 
ATOM   1890 C  C   . TYR B 1 100 ? 6.944   -11.548 30.866 1.00 31.52 ? 417 TYR B C   1 
ATOM   1891 O  O   . TYR B 1 100 ? 7.199   -11.995 31.983 1.00 31.51 ? 417 TYR B O   1 
ATOM   1892 C  CB  . TYR B 1 100 ? 4.462   -11.927 31.199 1.00 32.37 ? 417 TYR B CB  1 
ATOM   1893 C  CG  . TYR B 1 100 ? 3.149   -11.213 31.081 1.00 33.18 ? 417 TYR B CG  1 
ATOM   1894 C  CD1 . TYR B 1 100 ? 2.840   -10.167 31.930 1.00 34.41 ? 417 TYR B CD1 1 
ATOM   1895 C  CD2 . TYR B 1 100 ? 2.231   -11.555 30.091 1.00 35.02 ? 417 TYR B CD2 1 
ATOM   1896 C  CE1 . TYR B 1 100 ? 1.651   -9.481  31.815 1.00 35.53 ? 417 TYR B CE1 1 
ATOM   1897 C  CE2 . TYR B 1 100 ? 1.037   -10.880 29.967 1.00 35.83 ? 417 TYR B CE2 1 
ATOM   1898 C  CZ  . TYR B 1 100 ? 0.762   -9.829  30.821 1.00 34.68 ? 417 TYR B CZ  1 
ATOM   1899 O  OH  . TYR B 1 100 ? -0.425  -9.153  30.717 1.00 36.54 ? 417 TYR B OH  1 
ATOM   1900 N  N   . THR B 1 101 ? 7.851   -11.355 29.912 1.00 31.16 ? 418 THR B N   1 
ATOM   1901 C  CA  . THR B 1 101 ? 9.269   -11.682 30.044 1.00 31.00 ? 418 THR B CA  1 
ATOM   1902 C  C   . THR B 1 101 ? 9.942   -11.057 31.274 1.00 30.54 ? 418 THR B C   1 
ATOM   1903 O  O   . THR B 1 101 ? 10.787  -11.679 31.897 1.00 28.72 ? 418 THR B O   1 
ATOM   1904 C  CB  . THR B 1 101 ? 9.989   -11.201 28.765 1.00 31.26 ? 418 THR B CB  1 
ATOM   1905 O  OG1 . THR B 1 101 ? 9.542   -11.988 27.647 1.00 32.59 ? 418 THR B OG1 1 
ATOM   1906 C  CG2 . THR B 1 101 ? 11.496  -11.267 28.896 1.00 31.24 ? 418 THR B CG2 1 
ATOM   1907 N  N   . PHE B 1 102 ? 9.568   -9.810  31.596 1.00 30.42 ? 419 PHE B N   1 
ATOM   1908 C  CA  . PHE B 1 102 ? 10.189  -9.065  32.687 1.00 30.07 ? 419 PHE B CA  1 
ATOM   1909 C  C   . PHE B 1 102 ? 9.314   -8.967  33.949 1.00 30.57 ? 419 PHE B C   1 
ATOM   1910 O  O   . PHE B 1 102 ? 9.555   -8.079  34.774 1.00 30.19 ? 419 PHE B O   1 
ATOM   1911 C  CB  . PHE B 1 102 ? 10.550  -7.641  32.220 1.00 30.44 ? 419 PHE B CB  1 
ATOM   1912 C  CG  . PHE B 1 102 ? 11.364  -7.598  30.961 1.00 29.47 ? 419 PHE B CG  1 
ATOM   1913 C  CD1 . PHE B 1 102 ? 12.740  -7.725  31.006 1.00 28.41 ? 419 PHE B CD1 1 
ATOM   1914 C  CD2 . PHE B 1 102 ? 10.755  -7.400  29.738 1.00 29.85 ? 419 PHE B CD2 1 
ATOM   1915 C  CE1 . PHE B 1 102 ? 13.486  -7.704  29.860 1.00 27.84 ? 419 PHE B CE1 1 
ATOM   1916 C  CE2 . PHE B 1 102 ? 11.505  -7.348  28.595 1.00 29.43 ? 419 PHE B CE2 1 
ATOM   1917 C  CZ  . PHE B 1 102 ? 12.871  -7.521  28.655 1.00 28.52 ? 419 PHE B CZ  1 
ATOM   1918 N  N   . GLU B 1 103 ? 8.338   -9.884  34.114 1.00 30.43 ? 420 GLU B N   1 
ATOM   1919 C  CA  . GLU B 1 103 ? 7.326   -9.781  35.165 1.00 31.31 ? 420 GLU B CA  1 
ATOM   1920 C  C   . GLU B 1 103 ? 7.921   -9.788  36.584 1.00 30.58 ? 420 GLU B C   1 
ATOM   1921 O  O   . GLU B 1 103 ? 7.578   -8.927  37.400 1.00 30.71 ? 420 GLU B O   1 
ATOM   1922 C  CB  . GLU B 1 103 ? 6.272   -10.897 35.029 1.00 31.36 ? 420 GLU B CB  1 
ATOM   1923 C  CG  . GLU B 1 103 ? 5.206   -10.880 36.128 1.00 34.00 ? 420 GLU B CG  1 
ATOM   1924 C  CD  . GLU B 1 103 ? 4.162   -11.983 35.985 1.00 34.33 ? 420 GLU B CD  1 
ATOM   1925 O  OE1 . GLU B 1 103 ? 4.082   -12.626 34.908 1.00 40.03 ? 420 GLU B OE1 1 
ATOM   1926 O  OE2 . GLU B 1 103 ? 3.427   -12.229 36.967 1.00 39.00 ? 420 GLU B OE2 1 
ATOM   1927 N  N   . ASP B 1 104 ? 8.803   -10.737 36.874 1.00 29.97 ? 421 ASP B N   1 
ATOM   1928 C  CA  . ASP B 1 104 ? 9.418   -10.817 38.205 1.00 30.31 ? 421 ASP B CA  1 
ATOM   1929 C  C   . ASP B 1 104 ? 10.394  -9.639  38.426 1.00 29.67 ? 421 ASP B C   1 
ATOM   1930 O  O   . ASP B 1 104 ? 10.420  -9.048  39.504 1.00 28.86 ? 421 ASP B O   1 
ATOM   1931 C  CB  . ASP B 1 104 ? 10.085  -12.173 38.438 1.00 30.45 ? 421 ASP B CB  1 
ATOM   1932 C  CG  . ASP B 1 104 ? 9.062   -13.317 38.623 1.00 32.64 ? 421 ASP B CG  1 
ATOM   1933 O  OD1 . ASP B 1 104 ? 8.025   -13.330 37.922 1.00 38.03 ? 421 ASP B OD1 1 
ATOM   1934 O  OD2 . ASP B 1 104 ? 9.287   -14.210 39.467 1.00 32.52 ? 421 ASP B OD2 1 
ATOM   1935 N  N   . ALA B 1 105 ? 11.140  -9.273  37.386 1.00 29.49 ? 422 ALA B N   1 
ATOM   1936 C  CA  . ALA B 1 105 ? 12.028  -8.106  37.443 1.00 29.37 ? 422 ALA B CA  1 
ATOM   1937 C  C   . ALA B 1 105 ? 11.249  -6.821  37.710 1.00 29.37 ? 422 ALA B C   1 
ATOM   1938 O  O   . ALA B 1 105 ? 11.653  -6.038  38.546 1.00 28.50 ? 422 ALA B O   1 
ATOM   1939 C  CB  . ALA B 1 105 ? 12.834  -7.975  36.150 1.00 29.50 ? 422 ALA B CB  1 
ATOM   1940 N  N   . GLN B 1 106 ? 10.141  -6.623  36.996 1.00 29.79 ? 423 GLN B N   1 
ATOM   1941 C  CA  . GLN B 1 106 ? 9.292   -5.426  37.175 1.00 31.12 ? 423 GLN B CA  1 
ATOM   1942 C  C   . GLN B 1 106 ? 8.697   -5.316  38.587 1.00 30.82 ? 423 GLN B C   1 
ATOM   1943 O  O   . GLN B 1 106 ? 8.626   -4.211  39.138 1.00 30.13 ? 423 GLN B O   1 
ATOM   1944 C  CB  . GLN B 1 106 ? 8.162   -5.351  36.144 1.00 30.67 ? 423 GLN B CB  1 
ATOM   1945 C  CG  . GLN B 1 106 ? 7.407   -3.998  36.190 1.00 32.00 ? 423 GLN B CG  1 
ATOM   1946 C  CD  . GLN B 1 106 ? 6.231   -3.914  35.212 1.00 33.07 ? 423 GLN B CD  1 
ATOM   1947 O  OE1 . GLN B 1 106 ? 5.581   -4.920  34.912 1.00 33.94 ? 423 GLN B OE1 1 
ATOM   1948 N  NE2 . GLN B 1 106 ? 5.948   -2.696  34.720 1.00 33.31 ? 423 GLN B NE2 1 
ATOM   1949 N  N   . GLU B 1 107 ? 8.267   -6.450  39.142 1.00 31.29 ? 424 GLU B N   1 
ATOM   1950 C  CA  A GLU B 1 107 ? 7.755   -6.475  40.509 0.50 31.60 ? 424 GLU B CA  1 
ATOM   1951 C  CA  B GLU B 1 107 ? 7.767   -6.520  40.513 0.50 31.51 ? 424 GLU B CA  1 
ATOM   1952 C  C   . GLU B 1 107 ? 8.861   -6.148  41.505 1.00 31.80 ? 424 GLU B C   1 
ATOM   1953 O  O   . GLU B 1 107 ? 8.616   -5.409  42.463 1.00 31.97 ? 424 GLU B O   1 
ATOM   1954 C  CB  A GLU B 1 107 ? 7.105   -7.826  40.858 0.50 31.82 ? 424 GLU B CB  1 
ATOM   1955 C  CB  B GLU B 1 107 ? 7.233   -7.928  40.840 0.50 31.55 ? 424 GLU B CB  1 
ATOM   1956 C  CG  A GLU B 1 107 ? 6.560   -7.927  42.301 0.50 32.20 ? 424 GLU B CG  1 
ATOM   1957 C  CG  B GLU B 1 107 ? 5.952   -8.278  40.098 0.50 31.47 ? 424 GLU B CG  1 
ATOM   1958 C  CD  A GLU B 1 107 ? 5.607   -6.788  42.675 0.50 34.33 ? 424 GLU B CD  1 
ATOM   1959 C  CD  B GLU B 1 107 ? 5.329   -9.606  40.508 0.50 31.74 ? 424 GLU B CD  1 
ATOM   1960 O  OE1 A GLU B 1 107 ? 5.945   -5.991  43.574 0.50 35.65 ? 424 GLU B OE1 1 
ATOM   1961 O  OE1 B GLU B 1 107 ? 6.010   -10.466 41.116 0.50 31.06 ? 424 GLU B OE1 1 
ATOM   1962 O  OE2 A GLU B 1 107 ? 4.524   -6.675  42.063 0.50 36.34 ? 424 GLU B OE2 1 
ATOM   1963 O  OE2 B GLU B 1 107 ? 4.132   -9.785  40.198 0.50 32.93 ? 424 GLU B OE2 1 
ATOM   1964 N  N   . HIS B 1 108 ? 10.064  -6.687  41.279 1.00 31.39 ? 425 HIS B N   1 
ATOM   1965 C  CA  . HIS B 1 108 ? 11.201  -6.332  42.099 1.00 31.89 ? 425 HIS B CA  1 
ATOM   1966 C  C   . HIS B 1 108 ? 11.472  -4.823  42.064 1.00 32.27 ? 425 HIS B C   1 
ATOM   1967 O  O   . HIS B 1 108 ? 11.611  -4.210  43.099 1.00 32.43 ? 425 HIS B O   1 
ATOM   1968 C  CB  . HIS B 1 108 ? 12.467  -7.081  41.681 1.00 32.03 ? 425 HIS B CB  1 
ATOM   1969 C  CG  . HIS B 1 108 ? 13.614  -6.846  42.612 1.00 32.09 ? 425 HIS B CG  1 
ATOM   1970 N  ND1 . HIS B 1 108 ? 14.598  -5.914  42.362 1.00 32.12 ? 425 HIS B ND1 1 
ATOM   1971 C  CD2 . HIS B 1 108 ? 13.893  -7.375  43.825 1.00 31.06 ? 425 HIS B CD2 1 
ATOM   1972 C  CE1 . HIS B 1 108 ? 15.450  -5.902  43.368 1.00 30.95 ? 425 HIS B CE1 1 
ATOM   1973 N  NE2 . HIS B 1 108 ? 15.044  -6.776  44.270 1.00 32.19 ? 425 HIS B NE2 1 
ATOM   1974 N  N   . ILE B 1 109 ? 11.511  -4.234  40.873 1.00 33.11 ? 426 ILE B N   1 
ATOM   1975 C  CA  . ILE B 1 109 ? 11.819  -2.796  40.706 1.00 34.10 ? 426 ILE B CA  1 
ATOM   1976 C  C   . ILE B 1 109 ? 10.697  -1.876  41.264 1.00 34.03 ? 426 ILE B C   1 
ATOM   1977 O  O   . ILE B 1 109 ? 10.963  -0.831  41.869 1.00 34.46 ? 426 ILE B O   1 
ATOM   1978 C  CB  . ILE B 1 109 ? 12.119  -2.486  39.222 1.00 34.08 ? 426 ILE B CB  1 
ATOM   1979 C  CG1 . ILE B 1 109 ? 13.442  -3.135  38.785 1.00 34.49 ? 426 ILE B CG1 1 
ATOM   1980 C  CG2 . ILE B 1 109 ? 12.103  -0.980  38.950 1.00 37.11 ? 426 ILE B CG2 1 
ATOM   1981 C  CD1 . ILE B 1 109 ? 14.706  -2.623  39.502 1.00 34.68 ? 426 ILE B CD1 1 
ATOM   1982 N  N   . TYR B 1 110 ? 9.451   -2.287  41.091 1.00 33.82 ? 427 TYR B N   1 
ATOM   1983 C  CA  . TYR B 1 110 ? 8.326   -1.571  41.668 1.00 33.98 ? 427 TYR B CA  1 
ATOM   1984 C  C   . TYR B 1 110 ? 8.456   -1.498  43.200 1.00 34.15 ? 427 TYR B C   1 
ATOM   1985 O  O   . TYR B 1 110 ? 8.259   -0.444  43.797 1.00 33.71 ? 427 TYR B O   1 
ATOM   1986 C  CB  . TYR B 1 110 ? 7.033   -2.268  41.273 1.00 33.88 ? 427 TYR B CB  1 
ATOM   1987 C  CG  . TYR B 1 110 ? 5.788   -1.682  41.856 1.00 33.86 ? 427 TYR B CG  1 
ATOM   1988 C  CD1 . TYR B 1 110 ? 5.136   -0.610  41.240 1.00 34.48 ? 427 TYR B CD1 1 
ATOM   1989 C  CD2 . TYR B 1 110 ? 5.220   -2.234  42.991 1.00 34.10 ? 427 TYR B CD2 1 
ATOM   1990 C  CE1 . TYR B 1 110 ? 3.957   -0.096  41.775 1.00 34.73 ? 427 TYR B CE1 1 
ATOM   1991 C  CE2 . TYR B 1 110 ? 4.057   -1.735  43.521 1.00 35.61 ? 427 TYR B CE2 1 
ATOM   1992 C  CZ  . TYR B 1 110 ? 3.429   -0.661  42.925 1.00 34.18 ? 427 TYR B CZ  1 
ATOM   1993 O  OH  . TYR B 1 110 ? 2.263   -0.196  43.505 1.00 35.78 ? 427 TYR B OH  1 
ATOM   1994 N  N   . LYS B 1 111 ? 8.791   -2.621  43.822 1.00 34.62 ? 428 LYS B N   1 
ATOM   1995 C  CA  . LYS B 1 111 ? 8.991   -2.671  45.270 1.00 35.22 ? 428 LYS B CA  1 
ATOM   1996 C  C   . LYS B 1 111 ? 10.144  -1.781  45.747 1.00 35.29 ? 428 LYS B C   1 
ATOM   1997 O  O   . LYS B 1 111 ? 10.032  -1.118  46.772 1.00 35.25 ? 428 LYS B O   1 
ATOM   1998 C  CB  . LYS B 1 111 ? 9.216   -4.119  45.724 1.00 35.55 ? 428 LYS B CB  1 
ATOM   1999 C  CG  . LYS B 1 111 ? 7.934   -4.923  45.836 1.00 37.30 ? 428 LYS B CG  1 
ATOM   2000 C  CD  . LYS B 1 111 ? 8.197   -6.426  45.821 1.00 39.73 ? 428 LYS B CD  1 
ATOM   2001 C  CE  . LYS B 1 111 ? 7.003   -7.223  46.376 1.00 41.75 ? 428 LYS B CE  1 
ATOM   2002 N  NZ  . LYS B 1 111 ? 6.991   -8.658  45.931 1.00 42.62 ? 428 LYS B NZ  1 
ATOM   2003 N  N   . LEU B 1 112 ? 11.252  -1.778  45.017 1.00 35.27 ? 429 LEU B N   1 
ATOM   2004 C  CA  . LEU B 1 112 ? 12.365  -0.908  45.354 1.00 35.86 ? 429 LEU B CA  1 
ATOM   2005 C  C   . LEU B 1 112 ? 11.986  0.570   45.278 1.00 35.19 ? 429 LEU B C   1 
ATOM   2006 O  O   . LEU B 1 112 ? 12.241  1.325   46.204 1.00 35.06 ? 429 LEU B O   1 
ATOM   2007 C  CB  . LEU B 1 112 ? 13.571  -1.169  44.449 1.00 36.06 ? 429 LEU B CB  1 
ATOM   2008 C  CG  . LEU B 1 112 ? 14.390  -2.421  44.741 1.00 38.03 ? 429 LEU B CG  1 
ATOM   2009 C  CD1 . LEU B 1 112 ? 15.569  -2.455  43.766 1.00 39.50 ? 429 LEU B CD1 1 
ATOM   2010 C  CD2 . LEU B 1 112 ? 14.878  -2.487  46.206 1.00 38.91 ? 429 LEU B CD2 1 
ATOM   2011 N  N   . MET B 1 113 ? 11.370  0.976   44.179 1.00 35.14 ? 430 MET B N   1 
ATOM   2012 C  CA  . MET B 1 113 ? 10.956  2.369   44.013 1.00 35.21 ? 430 MET B CA  1 
ATOM   2013 C  C   . MET B 1 113 ? 10.049  2.873   45.139 1.00 34.34 ? 430 MET B C   1 
ATOM   2014 O  O   . MET B 1 113 ? 10.159  4.020   45.549 1.00 33.35 ? 430 MET B O   1 
ATOM   2015 C  CB  . MET B 1 113 ? 10.265  2.554   42.662 1.00 35.19 ? 430 MET B CB  1 
ATOM   2016 C  CG  . MET B 1 113 ? 11.206  2.589   41.501 1.00 35.29 ? 430 MET B CG  1 
ATOM   2017 S  SD  . MET B 1 113 ? 10.429  3.031   39.960 1.00 38.92 ? 430 MET B SD  1 
ATOM   2018 C  CE  . MET B 1 113 ? 9.102   1.849   39.777 1.00 37.34 ? 430 MET B CE  1 
ATOM   2019 N  N   . LYS B 1 114 ? 9.168   2.010   45.645 1.00 34.09 ? 431 LYS B N   1 
ATOM   2020 C  CA  . LYS B 1 114 ? 8.334   2.363   46.791 1.00 34.09 ? 431 LYS B CA  1 
ATOM   2021 C  C   . LYS B 1 114 ? 9.144   2.653   48.032 1.00 33.31 ? 431 LYS B C   1 
ATOM   2022 O  O   . LYS B 1 114 ? 8.670   3.395   48.870 1.00 32.88 ? 431 LYS B O   1 
ATOM   2023 C  CB  . LYS B 1 114 ? 7.320   1.262   47.135 1.00 34.46 ? 431 LYS B CB  1 
ATOM   2024 C  CG  . LYS B 1 114 ? 6.073   1.258   46.300 1.00 36.12 ? 431 LYS B CG  1 
ATOM   2025 C  CD  . LYS B 1 114 ? 4.972   0.513   47.025 1.00 39.77 ? 431 LYS B CD  1 
ATOM   2026 C  CE  . LYS B 1 114 ? 3.670   0.532   46.260 1.00 43.84 ? 431 LYS B CE  1 
ATOM   2027 N  NZ  . LYS B 1 114 ? 3.305   1.911   45.767 1.00 47.58 ? 431 LYS B NZ  1 
ATOM   2028 N  N   . SER B 1 115 ? 10.338  2.050   48.145 1.00 32.60 ? 432 SER B N   1 
ATOM   2029 C  CA  . SER B 1 115 ? 11.218  2.209   49.299 1.00 32.51 ? 432 SER B CA  1 
ATOM   2030 C  C   . SER B 1 115 ? 12.353  3.219   49.138 1.00 31.63 ? 432 SER B C   1 
ATOM   2031 O  O   . SER B 1 115 ? 12.988  3.555   50.114 1.00 31.38 ? 432 SER B O   1 
ATOM   2032 C  CB  . SER B 1 115 ? 11.837  0.850   49.669 1.00 33.14 ? 432 SER B CB  1 
ATOM   2033 O  OG  . SER B 1 115 ? 12.863  0.475   48.758 1.00 34.52 ? 432 SER B OG  1 
ATOM   2034 N  N   . ASP B 1 116 ? 12.608  3.697   47.923 1.00 31.26 ? 433 ASP B N   1 
ATOM   2035 C  CA  . ASP B 1 116 ? 13.769  4.558   47.649 1.00 31.06 ? 433 ASP B CA  1 
ATOM   2036 C  C   . ASP B 1 116 ? 13.391  5.752   46.735 1.00 30.67 ? 433 ASP B C   1 
ATOM   2037 O  O   . ASP B 1 116 ? 13.208  6.872   47.216 1.00 30.63 ? 433 ASP B O   1 
ATOM   2038 C  CB  . ASP B 1 116 ? 14.920  3.702   47.066 1.00 31.23 ? 433 ASP B CB  1 
ATOM   2039 C  CG  . ASP B 1 116 ? 16.241  4.443   47.027 1.00 33.27 ? 433 ASP B CG  1 
ATOM   2040 O  OD1 . ASP B 1 116 ? 16.239  5.640   46.655 1.00 35.73 ? 433 ASP B OD1 1 
ATOM   2041 O  OD2 . ASP B 1 116 ? 17.282  3.841   47.385 1.00 36.09 ? 433 ASP B OD2 1 
ATOM   2042 N  N   . SER B 1 117 ? 13.206  5.515   45.443 1.00 30.16 ? 434 SER B N   1 
ATOM   2043 C  CA  . SER B 1 117 ? 12.913  6.601   44.491 1.00 29.80 ? 434 SER B CA  1 
ATOM   2044 C  C   . SER B 1 117 ? 11.726  7.492   44.890 1.00 29.60 ? 434 SER B C   1 
ATOM   2045 O  O   . SER B 1 117 ? 11.812  8.729   44.874 1.00 28.84 ? 434 SER B O   1 
ATOM   2046 C  CB  . SER B 1 117 ? 12.653  6.015   43.086 1.00 29.91 ? 434 SER B CB  1 
ATOM   2047 O  OG  . SER B 1 117 ? 13.794  5.354   42.570 1.00 30.93 ? 434 SER B OG  1 
ATOM   2048 N  N   . TYR B 1 118 ? 10.595  6.868   45.208 1.00 29.47 ? 435 TYR B N   1 
ATOM   2049 C  CA  . TYR B 1 118 ? 9.392   7.636   45.488 1.00 29.43 ? 435 TYR B CA  1 
ATOM   2050 C  C   . TYR B 1 118 ? 9.474   8.440   46.795 1.00 29.22 ? 435 TYR B C   1 
ATOM   2051 O  O   . TYR B 1 118 ? 9.152   9.614   46.774 1.00 29.33 ? 435 TYR B O   1 
ATOM   2052 C  CB  . TYR B 1 118 ? 8.142   6.753   45.401 1.00 28.97 ? 435 TYR B CB  1 
ATOM   2053 C  CG  . TYR B 1 118 ? 6.870   7.395   45.894 1.00 27.95 ? 435 TYR B CG  1 
ATOM   2054 C  CD1 . TYR B 1 118 ? 6.207   8.377   45.143 1.00 28.84 ? 435 TYR B CD1 1 
ATOM   2055 C  CD2 . TYR B 1 118 ? 6.301   6.999   47.090 1.00 28.92 ? 435 TYR B CD2 1 
ATOM   2056 C  CE1 . TYR B 1 118 ? 5.008   8.967   45.606 1.00 25.88 ? 435 TYR B CE1 1 
ATOM   2057 C  CE2 . TYR B 1 118 ? 5.104   7.584   47.554 1.00 28.79 ? 435 TYR B CE2 1 
ATOM   2058 C  CZ  . TYR B 1 118 ? 4.468   8.562   46.813 1.00 26.73 ? 435 TYR B CZ  1 
ATOM   2059 O  OH  . TYR B 1 118 ? 3.284   9.120   47.299 1.00 27.42 ? 435 TYR B OH  1 
ATOM   2060 N  N   . PRO B 1 119 ? 9.880   7.816   47.922 1.00 30.22 ? 436 PRO B N   1 
ATOM   2061 C  CA  . PRO B 1 119 ? 10.055  8.588   49.167 1.00 30.32 ? 436 PRO B CA  1 
ATOM   2062 C  C   . PRO B 1 119 ? 11.019  9.778   49.029 1.00 30.33 ? 436 PRO B C   1 
ATOM   2063 O  O   . PRO B 1 119 ? 10.784  10.817  49.628 1.00 30.78 ? 436 PRO B O   1 
ATOM   2064 C  CB  . PRO B 1 119 ? 10.610  7.560   50.167 1.00 30.15 ? 436 PRO B CB  1 
ATOM   2065 C  CG  . PRO B 1 119 ? 10.369  6.261   49.593 1.00 31.01 ? 436 PRO B CG  1 
ATOM   2066 C  CD  . PRO B 1 119 ? 10.148  6.381   48.122 1.00 30.20 ? 436 PRO B CD  1 
ATOM   2067 N  N   . ARG B 1 120 ? 12.091  9.627   48.252 1.00 30.52 ? 437 ARG B N   1 
ATOM   2068 C  CA  . ARG B 1 120 ? 12.985  10.759  47.929 1.00 30.67 ? 437 ARG B CA  1 
ATOM   2069 C  C   . ARG B 1 120 ? 12.277  11.894  47.158 1.00 30.00 ? 437 ARG B C   1 
ATOM   2070 O  O   . ARG B 1 120 ? 12.529  13.094  47.389 1.00 29.10 ? 437 ARG B O   1 
ATOM   2071 C  CB  . ARG B 1 120 ? 14.180  10.271  47.111 1.00 30.76 ? 437 ARG B CB  1 
ATOM   2072 C  CG  . ARG B 1 120 ? 15.256  9.545   47.920 1.00 32.54 ? 437 ARG B CG  1 
ATOM   2073 C  CD  . ARG B 1 120 ? 16.448  9.077   47.026 1.00 33.34 ? 437 ARG B CD  1 
ATOM   2074 N  NE  . ARG B 1 120 ? 17.186  7.976   47.653 1.00 35.57 ? 437 ARG B NE  1 
ATOM   2075 C  CZ  . ARG B 1 120 ? 18.381  8.064   48.246 1.00 36.75 ? 437 ARG B CZ  1 
ATOM   2076 N  NH1 . ARG B 1 120 ? 19.048  9.217   48.346 1.00 38.19 ? 437 ARG B NH1 1 
ATOM   2077 N  NH2 . ARG B 1 120 ? 18.920  6.966   48.767 1.00 37.07 ? 437 ARG B NH2 1 
ATOM   2078 N  N   . PHE B 1 121 ? 11.396  11.508  46.232 1.00 29.46 ? 438 PHE B N   1 
ATOM   2079 C  CA  . PHE B 1 121 ? 10.642  12.470  45.444 1.00 28.61 ? 438 PHE B CA  1 
ATOM   2080 C  C   . PHE B 1 121 ? 9.727   13.298  46.339 1.00 28.27 ? 438 PHE B C   1 
ATOM   2081 O  O   . PHE B 1 121 ? 9.711   14.518  46.240 1.00 28.05 ? 438 PHE B O   1 
ATOM   2082 C  CB  . PHE B 1 121 ? 9.853   11.761  44.323 1.00 28.03 ? 438 PHE B CB  1 
ATOM   2083 C  CG  . PHE B 1 121 ? 8.896   12.671  43.572 1.00 27.32 ? 438 PHE B CG  1 
ATOM   2084 C  CD1 . PHE B 1 121 ? 9.336   13.872  43.017 1.00 27.25 ? 438 PHE B CD1 1 
ATOM   2085 C  CD2 . PHE B 1 121 ? 7.568   12.321  43.409 1.00 27.55 ? 438 PHE B CD2 1 
ATOM   2086 C  CE1 . PHE B 1 121 ? 8.452   14.719  42.307 1.00 26.59 ? 438 PHE B CE1 1 
ATOM   2087 C  CE2 . PHE B 1 121 ? 6.678   13.156  42.690 1.00 27.78 ? 438 PHE B CE2 1 
ATOM   2088 C  CZ  . PHE B 1 121 ? 7.136   14.362  42.150 1.00 26.72 ? 438 PHE B CZ  1 
ATOM   2089 N  N   . ILE B 1 122 ? 8.984   12.625  47.217 1.00 28.88 ? 439 ILE B N   1 
ATOM   2090 C  CA  . ILE B 1 122 ? 8.045   13.276  48.132 1.00 29.03 ? 439 ILE B CA  1 
ATOM   2091 C  C   . ILE B 1 122 ? 8.795   14.237  49.078 1.00 29.73 ? 439 ILE B C   1 
ATOM   2092 O  O   . ILE B 1 122 ? 8.274   15.310  49.409 1.00 29.50 ? 439 ILE B O   1 
ATOM   2093 C  CB  . ILE B 1 122 ? 7.208   12.220  48.898 1.00 29.47 ? 439 ILE B CB  1 
ATOM   2094 C  CG1 . ILE B 1 122 ? 6.303   11.453  47.920 1.00 30.34 ? 439 ILE B CG1 1 
ATOM   2095 C  CG2 . ILE B 1 122 ? 6.376   12.852  49.984 1.00 30.49 ? 439 ILE B CG2 1 
ATOM   2096 C  CD1 . ILE B 1 122 ? 5.419   12.356  47.024 1.00 31.38 ? 439 ILE B CD1 1 
ATOM   2097 N  N   . ARG B 1 123 ? 10.029  13.880  49.437 1.00 28.77 ? 440 ARG B N   1 
ATOM   2098 C  CA  . ARG B 1 123 ? 10.897  14.728  50.269 1.00 29.51 ? 440 ARG B CA  1 
ATOM   2099 C  C   . ARG B 1 123 ? 11.615  15.848  49.501 1.00 28.99 ? 440 ARG B C   1 
ATOM   2100 O  O   . ARG B 1 123 ? 12.211  16.722  50.106 1.00 28.20 ? 440 ARG B O   1 
ATOM   2101 C  CB  . ARG B 1 123 ? 11.944  13.853  50.967 1.00 28.95 ? 440 ARG B CB  1 
ATOM   2102 C  CG  . ARG B 1 123 ? 11.368  13.006  52.104 1.00 30.77 ? 440 ARG B CG  1 
ATOM   2103 C  CD  . ARG B 1 123 ? 12.384  11.979  52.656 1.00 31.39 ? 440 ARG B CD  1 
ATOM   2104 N  NE  . ARG B 1 123 ? 11.880  11.209  53.806 1.00 31.83 ? 440 ARG B NE  1 
ATOM   2105 C  CZ  . ARG B 1 123 ? 10.881  10.324  53.762 1.00 32.65 ? 440 ARG B CZ  1 
ATOM   2106 N  NH1 . ARG B 1 123 ? 10.243  10.050  52.635 1.00 35.47 ? 440 ARG B NH1 1 
ATOM   2107 N  NH2 . ARG B 1 123 ? 10.522  9.685   54.864 1.00 34.54 ? 440 ARG B NH2 1 
ATOM   2108 N  N   . SER B 1 124 ? 11.586  15.814  48.173 1.00 29.01 ? 441 SER B N   1 
ATOM   2109 C  CA  . SER B 1 124 ? 12.410  16.730  47.382 1.00 29.34 ? 441 SER B CA  1 
ATOM   2110 C  C   . SER B 1 124 ? 11.951  18.195  47.413 1.00 29.48 ? 441 SER B C   1 
ATOM   2111 O  O   . SER B 1 124 ? 10.784  18.491  47.620 1.00 30.05 ? 441 SER B O   1 
ATOM   2112 C  CB  . SER B 1 124 ? 12.487  16.253  45.929 1.00 29.58 ? 441 SER B CB  1 
ATOM   2113 O  OG  . SER B 1 124 ? 11.252  16.408  45.260 1.00 28.18 ? 441 SER B OG  1 
ATOM   2114 N  N   . SER B 1 125 ? 12.887  19.104  47.187 1.00 29.79 ? 442 SER B N   1 
ATOM   2115 C  CA  . SER B 1 125 ? 12.556  20.517  47.038 1.00 30.65 ? 442 SER B CA  1 
ATOM   2116 C  C   . SER B 1 125 ? 11.656  20.745  45.830 1.00 30.51 ? 442 SER B C   1 
ATOM   2117 O  O   . SER B 1 125 ? 10.787  21.601  45.875 1.00 30.23 ? 442 SER B O   1 
ATOM   2118 C  CB  . SER B 1 125 ? 13.818  21.384  46.931 1.00 30.46 ? 442 SER B CB  1 
ATOM   2119 O  OG  . SER B 1 125 ? 14.400  21.228  45.661 1.00 33.10 ? 442 SER B OG  1 
ATOM   2120 N  N   . ALA B 1 126 ? 11.856  19.981  44.754 1.00 31.09 ? 443 ALA B N   1 
ATOM   2121 C  CA  . ALA B 1 126 ? 10.985  20.073  43.578 1.00 31.19 ? 443 ALA B CA  1 
ATOM   2122 C  C   . ALA B 1 126 ? 9.512   19.846  43.937 1.00 31.28 ? 443 ALA B C   1 
ATOM   2123 O  O   . ALA B 1 126 ? 8.642   20.618  43.510 1.00 30.96 ? 443 ALA B O   1 
ATOM   2124 C  CB  . ALA B 1 126 ? 11.418  19.090  42.509 1.00 31.63 ? 443 ALA B CB  1 
ATOM   2125 N  N   . TYR B 1 127 ? 9.230   18.805  44.728 1.00 30.96 ? 444 TYR B N   1 
ATOM   2126 C  CA  . TYR B 1 127 ? 7.844   18.507  45.120 1.00 30.89 ? 444 TYR B CA  1 
ATOM   2127 C  C   . TYR B 1 127 ? 7.286   19.553  46.093 1.00 31.73 ? 444 TYR B C   1 
ATOM   2128 O  O   . TYR B 1 127 ? 6.150   19.996  45.950 1.00 31.45 ? 444 TYR B O   1 
ATOM   2129 C  CB  . TYR B 1 127 ? 7.719   17.086  45.684 1.00 30.45 ? 444 TYR B CB  1 
ATOM   2130 C  CG  . TYR B 1 127 ? 6.328   16.712  46.106 1.00 29.03 ? 444 TYR B CG  1 
ATOM   2131 C  CD1 . TYR B 1 127 ? 5.353   16.353  45.169 1.00 28.46 ? 444 TYR B CD1 1 
ATOM   2132 C  CD2 . TYR B 1 127 ? 5.968   16.724  47.455 1.00 30.37 ? 444 TYR B CD2 1 
ATOM   2133 C  CE1 . TYR B 1 127 ? 4.035   16.018  45.581 1.00 27.99 ? 444 TYR B CE1 1 
ATOM   2134 C  CE2 . TYR B 1 127 ? 4.665   16.386  47.869 1.00 29.41 ? 444 TYR B CE2 1 
ATOM   2135 C  CZ  . TYR B 1 127 ? 3.707   16.026  46.933 1.00 27.28 ? 444 TYR B CZ  1 
ATOM   2136 O  OH  . TYR B 1 127 ? 2.436   15.710  47.379 1.00 27.32 ? 444 TYR B OH  1 
ATOM   2137 N  N   . GLN B 1 128 ? 8.092   19.980  47.058 1.00 33.51 ? 445 GLN B N   1 
ATOM   2138 C  CA  . GLN B 1 128 ? 7.664   21.032  47.981 1.00 35.17 ? 445 GLN B CA  1 
ATOM   2139 C  C   . GLN B 1 128 ? 7.320   22.333  47.277 1.00 35.87 ? 445 GLN B C   1 
ATOM   2140 O  O   . GLN B 1 128 ? 6.392   23.022  47.676 1.00 35.54 ? 445 GLN B O   1 
ATOM   2141 C  CB  . GLN B 1 128 ? 8.715   21.308  49.066 1.00 35.95 ? 445 GLN B CB  1 
ATOM   2142 C  CG  . GLN B 1 128 ? 8.884   20.178  50.095 1.00 38.02 ? 445 GLN B CG  1 
ATOM   2143 C  CD  . GLN B 1 128 ? 7.562   19.656  50.647 1.00 40.76 ? 445 GLN B CD  1 
ATOM   2144 O  OE1 . GLN B 1 128 ? 6.658   20.436  50.941 1.00 41.38 ? 445 GLN B OE1 1 
ATOM   2145 N  NE2 . GLN B 1 128 ? 7.442   18.325  50.784 1.00 42.95 ? 445 GLN B NE2 1 
ATOM   2146 N  N   . GLU B 1 129 ? 8.058   22.658  46.223 1.00 36.99 ? 446 GLU B N   1 
ATOM   2147 C  CA  . GLU B 1 129 ? 7.803   23.867  45.463 1.00 38.04 ? 446 GLU B CA  1 
ATOM   2148 C  C   . GLU B 1 129 ? 6.494   23.775  44.649 1.00 38.33 ? 446 GLU B C   1 
ATOM   2149 O  O   . GLU B 1 129 ? 5.764   24.763  44.519 1.00 38.64 ? 446 GLU B O   1 
ATOM   2150 C  CB  . GLU B 1 129 ? 9.031   24.198  44.607 1.00 37.85 ? 446 GLU B CB  1 
ATOM   2151 C  CG  . GLU B 1 129 ? 10.258  24.548  45.478 1.00 39.30 ? 446 GLU B CG  1 
ATOM   2152 C  CD  . GLU B 1 129 ? 11.487  25.021  44.683 1.00 39.95 ? 446 GLU B CD  1 
ATOM   2153 O  OE1 . GLU B 1 129 ? 11.736  24.542  43.552 1.00 41.71 ? 446 GLU B OE1 1 
ATOM   2154 O  OE2 . GLU B 1 129 ? 12.215  25.888  45.219 1.00 44.35 ? 446 GLU B OE2 1 
ATOM   2155 N  N   . LEU B 1 130 ? 6.176   22.591  44.136 1.00 38.79 ? 447 LEU B N   1 
ATOM   2156 C  CA  . LEU B 1 130 ? 4.859   22.343  43.525 1.00 39.10 ? 447 LEU B CA  1 
ATOM   2157 C  C   . LEU B 1 130 ? 3.709   22.412  44.539 1.00 39.85 ? 447 LEU B C   1 
ATOM   2158 O  O   . LEU B 1 130 ? 2.594   22.812  44.185 1.00 39.64 ? 447 LEU B O   1 
ATOM   2159 C  CB  . LEU B 1 130 ? 4.838   20.991  42.835 1.00 39.09 ? 447 LEU B CB  1 
ATOM   2160 C  CG  . LEU B 1 130 ? 5.614   20.962  41.529 1.00 40.06 ? 447 LEU B CG  1 
ATOM   2161 C  CD1 . LEU B 1 130 ? 5.970   19.552  41.163 1.00 41.03 ? 447 LEU B CD1 1 
ATOM   2162 C  CD2 . LEU B 1 130 ? 4.807   21.633  40.403 1.00 40.61 ? 447 LEU B CD2 1 
ATOM   2163 N  N   . LEU B 1 131 ? 3.972   22.023  45.788 1.00 40.46 ? 448 LEU B N   1 
ATOM   2164 C  CA  . LEU B 1 131 ? 2.959   22.120  46.847 1.00 41.46 ? 448 LEU B CA  1 
ATOM   2165 C  C   . LEU B 1 131 ? 2.587   23.578  47.152 1.00 42.71 ? 448 LEU B C   1 
ATOM   2166 O  O   . LEU B 1 131 ? 1.407   23.949  47.062 1.00 42.88 ? 448 LEU B O   1 
ATOM   2167 C  CB  . LEU B 1 131 ? 3.422   21.414  48.132 1.00 41.41 ? 448 LEU B CB  1 
ATOM   2168 C  CG  . LEU B 1 131 ? 3.054   19.940  48.313 1.00 40.16 ? 448 LEU B CG  1 
ATOM   2169 C  CD1 . LEU B 1 131 ? 3.730   19.386  49.566 1.00 40.30 ? 448 LEU B CD1 1 
ATOM   2170 C  CD2 . LEU B 1 131 ? 1.558   19.756  48.405 1.00 39.34 ? 448 LEU B CD2 1 
ATOM   2171 N  N   . GLN B 1 132 ? 3.595   24.382  47.514 1.00 44.09 ? 449 GLN B N   1 
ATOM   2172 C  CA  . GLN B 1 132 ? 3.439   25.832  47.798 1.00 45.12 ? 449 GLN B CA  1 
ATOM   2173 C  C   . GLN B 1 132 ? 2.342   26.527  46.974 1.00 45.37 ? 449 GLN B C   1 
ATOM   2174 O  O   . GLN B 1 132 ? 1.334   26.985  47.524 1.00 45.85 ? 449 GLN B O   1 
ATOM   2175 C  CB  . GLN B 1 132 ? 4.751   26.578  47.523 1.00 45.25 ? 449 GLN B CB  1 
ATOM   2176 C  CG  . GLN B 1 132 ? 5.896   26.344  48.505 1.00 46.14 ? 449 GLN B CG  1 
ATOM   2177 C  CD  . GLN B 1 132 ? 7.125   27.201  48.163 1.00 46.56 ? 449 GLN B CD  1 
ATOM   2178 O  OE1 . GLN B 1 132 ? 7.719   27.842  49.042 1.00 48.78 ? 449 GLN B OE1 1 
ATOM   2179 N  NE2 . GLN B 1 132 ? 7.494   27.232  46.874 1.00 48.41 ? 449 GLN B NE2 1 
ATOM   2180 N  N   . ALA B 1 133 ? 2.553   26.623  45.661 1.00 45.50 ? 450 ALA B N   1 
ATOM   2181 C  CA  . ALA B 1 133 ? 1.615   27.317  44.778 1.00 45.68 ? 450 ALA B CA  1 
HETATM 2182 CL CL  . CL  C 2 .   ? -3.683  -45.450 48.072 1.00 51.34 ? 301 CL  A CL  1 
HETATM 2183 O  O   . HOH D 3 .   ? 14.444  5.300   39.579 1.00 24.76 ? 2   HOH A O   1 
HETATM 2184 O  O   . HOH D 3 .   ? 8.580   -24.351 30.780 1.00 16.77 ? 3   HOH A O   1 
HETATM 2185 O  O   . HOH D 3 .   ? 11.058  -18.609 28.464 1.00 25.15 ? 4   HOH A O   1 
HETATM 2186 O  O   . HOH D 3 .   ? 10.016  -25.215 33.108 1.00 23.30 ? 5   HOH A O   1 
HETATM 2187 O  O   . HOH D 3 .   ? 0.166   4.034   36.361 1.00 27.79 ? 6   HOH A O   1 
HETATM 2188 O  O   . HOH D 3 .   ? 0.885   -35.507 42.783 1.00 21.89 ? 7   HOH A O   1 
HETATM 2189 O  O   . HOH D 3 .   ? 2.472   -49.907 52.291 1.00 24.84 ? 12  HOH A O   1 
HETATM 2190 O  O   . HOH D 3 .   ? 3.567   11.424  31.837 1.00 25.90 ? 13  HOH A O   1 
HETATM 2191 O  O   . HOH D 3 .   ? 11.422  3.894   29.682 1.00 35.88 ? 22  HOH A O   1 
HETATM 2192 O  O   . HOH D 3 .   ? 1.263   1.873   39.513 1.00 26.03 ? 24  HOH A O   1 
HETATM 2193 O  O   . HOH D 3 .   ? 9.237   -8.286  16.812 1.00 36.53 ? 25  HOH A O   1 
HETATM 2194 O  O   . HOH D 3 .   ? 4.436   -3.267  38.371 1.00 34.25 ? 26  HOH A O   1 
HETATM 2195 O  O   . HOH D 3 .   ? -3.262  10.697  41.321 1.00 24.19 ? 27  HOH A O   1 
HETATM 2196 O  O   . HOH D 3 .   ? 0.757   -1.009  30.235 1.00 30.98 ? 31  HOH A O   1 
HETATM 2197 O  O   . HOH D 3 .   ? 5.221   3.159   29.705 1.00 28.37 ? 34  HOH A O   1 
HETATM 2198 O  O   . HOH D 3 .   ? -3.612  13.318  40.955 1.00 32.26 ? 35  HOH A O   1 
HETATM 2199 O  O   . HOH D 3 .   ? 10.158  17.161  39.740 1.00 26.24 ? 36  HOH A O   1 
HETATM 2200 O  O   . HOH D 3 .   ? 21.853  -14.749 38.944 1.00 34.59 ? 37  HOH A O   1 
HETATM 2201 O  O   . HOH D 3 .   ? 13.618  -22.101 35.272 1.00 41.24 ? 41  HOH A O   1 
HETATM 2202 O  O   . HOH D 3 .   ? 1.778   -38.037 51.797 1.00 24.17 ? 43  HOH A O   1 
HETATM 2203 O  O   . HOH D 3 .   ? -0.367  3.872   39.042 1.00 25.10 ? 45  HOH A O   1 
HETATM 2204 O  O   . HOH D 3 .   ? 17.560  3.694   39.785 1.00 42.65 ? 49  HOH A O   1 
HETATM 2205 O  O   . HOH D 3 .   ? 19.912  11.548  34.523 1.00 31.75 ? 51  HOH A O   1 
HETATM 2206 O  O   . HOH D 3 .   ? 8.976   -37.246 49.371 1.00 28.73 ? 52  HOH A O   1 
HETATM 2207 O  O   . HOH D 3 .   ? 0.107   8.534   33.140 1.00 42.44 ? 59  HOH A O   1 
HETATM 2208 O  O   . HOH D 3 .   ? 12.882  18.066  39.422 1.00 27.42 ? 65  HOH A O   1 
HETATM 2209 O  O   . HOH D 3 .   ? 17.107  -5.074  19.960 1.00 39.75 ? 66  HOH A O   1 
HETATM 2210 O  O   . HOH D 3 .   ? 24.097  -4.536  32.276 1.00 28.37 ? 67  HOH A O   1 
HETATM 2211 O  O   . HOH D 3 .   ? 10.609  -0.948  23.523 1.00 39.02 ? 68  HOH A O   1 
HETATM 2212 O  O   . HOH D 3 .   ? 16.595  -25.579 32.538 1.00 38.42 ? 69  HOH A O   1 
HETATM 2213 O  O   . HOH D 3 .   ? 14.735  5.139   28.724 1.00 37.24 ? 70  HOH A O   1 
HETATM 2214 O  O   . HOH D 3 .   ? 18.390  -2.279  20.698 1.00 34.57 ? 72  HOH A O   1 
HETATM 2215 O  O   . HOH D 3 .   ? 9.452   -15.791 26.671 1.00 25.27 ? 74  HOH A O   1 
HETATM 2216 O  O   . HOH D 3 .   ? 7.273   -18.383 21.944 1.00 25.34 ? 75  HOH A O   1 
HETATM 2217 O  O   . HOH D 3 .   ? 14.758  18.095  41.039 1.00 33.07 ? 76  HOH A O   1 
HETATM 2218 O  O   . HOH D 3 .   ? 2.992   -14.714 18.862 1.00 37.90 ? 77  HOH A O   1 
HETATM 2219 O  O   . HOH D 3 .   ? 7.718   -16.950 33.948 1.00 47.06 ? 78  HOH A O   1 
HETATM 2220 O  O   . HOH D 3 .   ? 19.880  -22.659 36.069 1.00 45.75 ? 79  HOH A O   1 
HETATM 2221 O  O   . HOH D 3 .   ? -2.756  2.609   39.305 1.00 37.63 ? 83  HOH A O   1 
HETATM 2222 O  O   . HOH D 3 .   ? 15.888  16.657  35.578 1.00 28.76 ? 84  HOH A O   1 
HETATM 2223 O  O   . HOH D 3 .   ? -4.365  25.676  43.953 1.00 39.95 ? 87  HOH A O   1 
HETATM 2224 O  O   . HOH D 3 .   ? -6.123  22.998  45.301 1.00 34.16 ? 88  HOH A O   1 
HETATM 2225 O  O   . HOH D 3 .   ? 1.705   9.485   31.503 1.00 40.21 ? 89  HOH A O   1 
HETATM 2226 O  O   . HOH D 3 .   ? 18.680  -7.573  19.354 1.00 37.51 ? 91  HOH A O   1 
HETATM 2227 O  O   . HOH D 3 .   ? 19.974  0.233   24.018 1.00 37.31 ? 92  HOH A O   1 
HETATM 2228 O  O   . HOH D 3 .   ? 25.930  -1.024  24.784 1.00 39.36 ? 93  HOH A O   1 
HETATM 2229 O  O   . HOH D 3 .   ? 27.523  -4.796  32.100 1.00 33.08 ? 94  HOH A O   1 
HETATM 2230 O  O   . HOH D 3 .   ? -4.965  20.869  38.496 1.00 28.51 ? 96  HOH A O   1 
HETATM 2231 O  O   . HOH D 3 .   ? 11.410  -11.223 34.852 1.00 26.17 ? 97  HOH A O   1 
HETATM 2232 O  O   . HOH D 3 .   ? -0.199  -46.936 47.189 1.00 29.03 ? 101 HOH A O   1 
HETATM 2233 O  O   . HOH D 3 .   ? 3.525   4.183   47.849 1.00 23.62 ? 102 HOH A O   1 
HETATM 2234 O  O   . HOH D 3 .   ? 13.968  -19.353 34.126 1.00 49.26 ? 103 HOH A O   1 
HETATM 2235 O  O   . HOH D 3 .   ? 10.982  -13.556 25.869 1.00 28.95 ? 108 HOH A O   1 
HETATM 2236 O  O   . HOH D 3 .   ? 4.872   -12.775 19.152 1.00 43.03 ? 112 HOH A O   1 
HETATM 2237 O  O   . HOH D 3 .   ? 17.308  12.269  47.562 1.00 37.33 ? 114 HOH A O   1 
HETATM 2238 O  O   . HOH D 3 .   ? -0.521  20.830  34.353 1.00 44.08 ? 115 HOH A O   1 
HETATM 2239 O  O   . HOH D 3 .   ? 6.737   -31.125 48.931 1.00 46.59 ? 116 HOH A O   1 
HETATM 2240 O  O   . HOH D 3 .   ? -0.706  -39.797 42.491 1.00 33.71 ? 122 HOH A O   1 
HETATM 2241 O  O   . HOH D 3 .   ? 6.078   -19.523 34.858 1.00 37.06 ? 123 HOH A O   1 
HETATM 2242 O  O   . HOH D 3 .   ? 0.022   -51.322 43.612 1.00 27.85 ? 124 HOH A O   1 
HETATM 2243 O  O   . HOH D 3 .   ? 5.863   -23.935 43.865 1.00 52.44 ? 125 HOH A O   1 
HETATM 2244 O  O   . HOH D 3 .   ? 0.238   -39.775 49.669 1.00 30.04 ? 127 HOH A O   1 
HETATM 2245 O  O   . HOH D 3 .   ? 10.498  -25.486 37.443 1.00 40.65 ? 128 HOH A O   1 
HETATM 2246 O  O   . HOH D 3 .   ? 12.502  -11.557 21.738 1.00 30.21 ? 130 HOH A O   1 
HETATM 2247 O  O   . HOH D 3 .   ? 12.287  -17.500 33.018 1.00 35.81 ? 131 HOH A O   1 
HETATM 2248 O  O   . HOH D 3 .   ? 9.690   14.003  32.829 1.00 29.20 ? 133 HOH A O   1 
HETATM 2249 O  O   . HOH D 3 .   ? 18.998  -23.645 32.347 1.00 39.99 ? 135 HOH A O   1 
HETATM 2250 O  O   . HOH D 3 .   ? 3.591   -23.794 45.035 1.00 39.73 ? 136 HOH A O   1 
HETATM 2251 O  O   . HOH D 3 .   ? 4.951   18.136  34.012 1.00 34.30 ? 137 HOH A O   1 
HETATM 2252 O  O   . HOH D 3 .   ? -2.974  16.750  32.689 1.00 35.53 ? 139 HOH A O   1 
HETATM 2253 O  O   . HOH D 3 .   ? 1.519   2.299   32.985 1.00 34.47 ? 140 HOH A O   1 
HETATM 2254 O  O   . HOH D 3 .   ? 18.087  -4.435  42.676 1.00 43.07 ? 141 HOH A O   1 
HETATM 2255 O  O   . HOH D 3 .   ? -0.978  -49.029 49.443 1.00 39.71 ? 142 HOH A O   1 
HETATM 2256 O  O   . HOH D 3 .   ? 5.291   -22.233 41.833 1.00 32.78 ? 143 HOH A O   1 
HETATM 2257 O  O   . HOH D 3 .   ? 10.149  -18.276 33.980 1.00 38.74 ? 145 HOH A O   1 
HETATM 2258 O  O   . HOH D 3 .   ? 6.669   -60.045 46.452 1.00 43.38 ? 149 HOH A O   1 
HETATM 2259 O  O   . HOH D 3 .   ? 6.762   -11.087 15.144 1.00 43.84 ? 150 HOH A O   1 
HETATM 2260 O  O   . HOH D 3 .   ? 10.542  -27.638 39.130 1.00 47.94 ? 154 HOH A O   1 
HETATM 2261 O  O   . HOH D 3 .   ? -1.521  -50.896 46.918 1.00 44.59 ? 157 HOH A O   1 
HETATM 2262 O  O   . HOH D 3 .   ? 19.228  -8.684  21.896 1.00 39.32 ? 161 HOH A O   1 
HETATM 2263 O  O   . HOH D 3 .   ? 19.687  -17.028 41.527 1.00 54.97 ? 162 HOH A O   1 
HETATM 2264 O  O   . HOH D 3 .   ? 15.458  -7.858  17.345 1.00 57.79 ? 168 HOH A O   1 
HETATM 2265 O  O   . HOH D 3 .   ? -2.300  -39.395 44.126 1.00 49.39 ? 169 HOH A O   1 
HETATM 2266 O  O   . HOH D 3 .   ? 15.147  -17.997 38.995 1.00 48.95 ? 170 HOH A O   1 
HETATM 2267 O  O   . HOH D 3 .   ? 9.709   -19.203 21.306 1.00 43.69 ? 171 HOH A O   1 
HETATM 2268 O  O   . HOH D 3 .   ? -8.208  15.460  46.415 1.00 44.99 ? 173 HOH A O   1 
HETATM 2269 O  O   . HOH D 3 .   ? 13.474  -59.285 46.320 1.00 56.12 ? 180 HOH A O   1 
HETATM 2270 O  O   . HOH D 3 .   ? 13.435  -10.616 17.953 1.00 46.55 ? 182 HOH A O   1 
HETATM 2271 O  O   . HOH D 3 .   ? 12.335  14.140  32.216 1.00 38.00 ? 202 HOH A O   1 
HETATM 2272 O  O   . HOH D 3 .   ? 8.193   12.743  30.893 1.00 40.73 ? 203 HOH A O   1 
HETATM 2273 O  O   . HOH D 3 .   ? 6.500   10.696  31.585 1.00 44.36 ? 204 HOH A O   1 
HETATM 2274 O  O   . HOH D 3 .   ? 8.528   4.018   27.576 1.00 35.52 ? 205 HOH A O   1 
HETATM 2275 O  O   . HOH D 3 .   ? 15.046  5.904   26.450 1.00 41.46 ? 206 HOH A O   1 
HETATM 2276 O  O   . HOH D 3 .   ? 17.822  -1.141  23.003 1.00 36.62 ? 208 HOH A O   1 
HETATM 2277 O  O   . HOH D 3 .   ? -6.837  20.004  39.085 1.00 34.32 ? 209 HOH A O   1 
HETATM 2278 O  O   . HOH D 3 .   ? -4.278  20.142  30.460 1.00 50.01 ? 210 HOH A O   1 
HETATM 2279 O  O   . HOH D 3 .   ? 9.177   21.089  38.790 1.00 38.23 ? 211 HOH A O   1 
HETATM 2280 O  O   . HOH D 3 .   ? 20.494  15.330  34.461 1.00 41.44 ? 212 HOH A O   1 
HETATM 2281 O  O   . HOH D 3 .   ? -2.144  3.851   27.186 1.00 41.10 ? 213 HOH A O   1 
HETATM 2282 O  O   . HOH D 3 .   ? 13.591  -13.186 19.798 1.00 42.21 ? 215 HOH A O   1 
HETATM 2283 O  O   . HOH D 3 .   ? -0.874  4.117   49.020 1.00 41.48 ? 223 HOH A O   1 
HETATM 2284 O  O   . HOH D 3 .   ? 23.073  -10.248 25.531 1.00 51.51 ? 224 HOH A O   1 
HETATM 2285 O  O   . HOH D 3 .   ? -2.508  19.315  33.572 1.00 35.78 ? 226 HOH A O   1 
HETATM 2286 O  O   . HOH D 3 .   ? 19.087  9.209   35.574 1.00 39.13 ? 227 HOH A O   1 
HETATM 2287 O  O   . HOH D 3 .   ? 0.313   -6.717  34.478 1.00 45.43 ? 229 HOH A O   1 
HETATM 2288 O  O   . HOH D 3 .   ? 17.840  16.965  43.301 1.00 45.46 ? 230 HOH A O   1 
HETATM 2289 O  O   . HOH D 3 .   ? 13.947  16.240  32.658 1.00 47.37 ? 233 HOH A O   1 
HETATM 2290 O  O   . HOH D 3 .   ? 22.195  17.231  40.236 1.00 41.74 ? 234 HOH A O   1 
HETATM 2291 O  O   . HOH D 3 .   ? 18.752  -0.823  39.386 1.00 34.56 ? 235 HOH A O   1 
HETATM 2292 O  O   . HOH D 3 .   ? 18.802  -12.236 22.970 1.00 42.98 ? 236 HOH A O   1 
HETATM 2293 O  O   . HOH D 3 .   ? 14.974  -5.557  18.755 1.00 52.38 ? 239 HOH A O   1 
HETATM 2294 O  O   . HOH D 3 .   ? 12.093  -22.367 39.460 1.00 48.71 ? 240 HOH A O   1 
HETATM 2295 O  O   . HOH D 3 .   ? 16.359  15.622  46.854 1.00 36.39 ? 242 HOH A O   1 
HETATM 2296 O  O   . HOH D 3 .   ? 17.313  -19.402 21.740 1.00 44.63 ? 245 HOH A O   1 
HETATM 2297 O  O   . HOH E 3 .   ? 14.324  2.868   43.718 1.00 18.81 ? 1   HOH B O   1 
HETATM 2298 O  O   . HOH E 3 .   ? 1.282   -37.890 38.964 1.00 22.28 ? 8   HOH B O   1 
HETATM 2299 O  O   . HOH E 3 .   ? 7.015   -24.065 16.856 1.00 28.63 ? 9   HOH B O   1 
HETATM 2300 O  O   . HOH E 3 .   ? 7.184   -8.220  30.893 1.00 23.15 ? 10  HOH B O   1 
HETATM 2301 O  O   . HOH E 3 .   ? 15.259  -24.384 16.341 1.00 32.38 ? 11  HOH B O   1 
HETATM 2302 O  O   . HOH E 3 .   ? 11.131  -36.990 47.856 1.00 24.40 ? 14  HOH B O   1 
HETATM 2303 O  O   . HOH E 3 .   ? 10.704  -35.780 29.689 1.00 16.92 ? 15  HOH B O   1 
HETATM 2304 O  O   . HOH E 3 .   ? 14.380  -36.108 46.245 1.00 31.71 ? 16  HOH B O   1 
HETATM 2305 O  O   . HOH E 3 .   ? 4.412   -36.441 29.371 1.00 24.30 ? 17  HOH B O   1 
HETATM 2306 O  O   . HOH E 3 .   ? 4.783   -13.971 28.343 1.00 25.46 ? 18  HOH B O   1 
HETATM 2307 O  O   . HOH E 3 .   ? 4.368   -21.440 34.878 1.00 31.00 ? 19  HOH B O   1 
HETATM 2308 O  O   . HOH E 3 .   ? -1.901  -36.430 38.995 1.00 28.54 ? 20  HOH B O   1 
HETATM 2309 O  O   . HOH E 3 .   ? -11.686 -27.891 31.881 1.00 31.13 ? 21  HOH B O   1 
HETATM 2310 O  O   . HOH E 3 .   ? 5.815   -7.401  33.163 1.00 21.28 ? 23  HOH B O   1 
HETATM 2311 O  O   . HOH E 3 .   ? 15.973  -36.952 39.278 1.00 30.71 ? 28  HOH B O   1 
HETATM 2312 O  O   . HOH E 3 .   ? 15.756  -37.244 36.481 1.00 30.32 ? 29  HOH B O   1 
HETATM 2313 O  O   . HOH E 3 .   ? -3.445  -41.660 34.571 1.00 31.11 ? 30  HOH B O   1 
HETATM 2314 O  O   . HOH E 3 .   ? 14.554  -34.744 39.948 1.00 39.68 ? 32  HOH B O   1 
HETATM 2315 O  O   . HOH E 3 .   ? 11.642  -29.679 38.570 1.00 32.55 ? 33  HOH B O   1 
HETATM 2316 O  O   . HOH E 3 .   ? 11.939  -24.543 34.827 1.00 28.44 ? 38  HOH B O   1 
HETATM 2317 O  O   . HOH E 3 .   ? 6.237   -46.772 32.304 1.00 34.99 ? 39  HOH B O   1 
HETATM 2318 O  O   . HOH E 3 .   ? -1.147  -7.249  32.541 1.00 38.58 ? 40  HOH B O   1 
HETATM 2319 O  O   . HOH E 3 .   ? 3.240   -20.751 21.792 1.00 26.43 ? 42  HOH B O   1 
HETATM 2320 O  O   . HOH E 3 .   ? 0.135   -49.239 34.021 1.00 35.13 ? 44  HOH B O   1 
HETATM 2321 O  O   . HOH E 3 .   ? 14.483  18.690  43.915 1.00 26.30 ? 46  HOH B O   1 
HETATM 2322 O  O   . HOH E 3 .   ? 16.340  -37.977 46.213 1.00 47.52 ? 47  HOH B O   1 
HETATM 2323 O  O   . HOH E 3 .   ? -1.587  -31.511 22.492 1.00 32.49 ? 48  HOH B O   1 
HETATM 2324 O  O   . HOH E 3 .   ? 15.384  -25.502 34.603 1.00 47.46 ? 50  HOH B O   1 
HETATM 2325 O  O   . HOH E 3 .   ? 20.102  -58.168 44.126 1.00 42.74 ? 53  HOH B O   1 
HETATM 2326 O  O   . HOH E 3 .   ? -7.286  -29.537 24.901 1.00 31.88 ? 54  HOH B O   1 
HETATM 2327 O  O   . HOH E 3 .   ? 5.042   -49.900 39.035 1.00 28.29 ? 55  HOH B O   1 
HETATM 2328 O  O   . HOH E 3 .   ? -3.492  -23.714 21.800 1.00 39.20 ? 56  HOH B O   1 
HETATM 2329 O  O   . HOH E 3 .   ? 18.394  -46.633 41.506 1.00 37.24 ? 57  HOH B O   1 
HETATM 2330 O  O   . HOH E 3 .   ? 12.382  -31.321 14.589 1.00 47.06 ? 58  HOH B O   1 
HETATM 2331 O  O   . HOH E 3 .   ? 22.016  -55.412 45.778 1.00 34.45 ? 60  HOH B O   1 
HETATM 2332 O  O   . HOH E 3 .   ? 21.459  -53.192 39.248 1.00 39.83 ? 61  HOH B O   1 
HETATM 2333 O  O   . HOH E 3 .   ? 18.194  -38.516 48.204 1.00 34.01 ? 62  HOH B O   1 
HETATM 2334 O  O   . HOH E 3 .   ? -8.269  -27.996 32.140 1.00 29.18 ? 63  HOH B O   1 
HETATM 2335 O  O   . HOH E 3 .   ? 5.480   -20.030 23.184 1.00 28.85 ? 64  HOH B O   1 
HETATM 2336 O  O   . HOH E 3 .   ? 2.350   -21.930 17.449 1.00 42.49 ? 71  HOH B O   1 
HETATM 2337 O  O   . HOH E 3 .   ? 2.619   -51.226 38.549 1.00 38.12 ? 73  HOH B O   1 
HETATM 2338 O  O   . HOH E 3 .   ? 9.700   -19.181 17.005 1.00 40.27 ? 80  HOH B O   1 
HETATM 2339 O  O   . HOH E 3 .   ? 1.366   -47.953 31.935 1.00 39.69 ? 81  HOH B O   1 
HETATM 2340 O  O   . HOH E 3 .   ? -2.596  -48.853 33.166 1.00 41.07 ? 82  HOH B O   1 
HETATM 2341 O  O   . HOH E 3 .   ? 4.786   -7.309  37.304 1.00 47.88 ? 85  HOH B O   1 
HETATM 2342 O  O   . HOH E 3 .   ? 3.770   -8.199  34.888 1.00 33.21 ? 86  HOH B O   1 
HETATM 2343 O  O   . HOH E 3 .   ? 7.967   -15.058 28.610 1.00 34.53 ? 90  HOH B O   1 
HETATM 2344 O  O   . HOH E 3 .   ? 1.630   -12.934 34.296 1.00 39.95 ? 95  HOH B O   1 
HETATM 2345 O  O   . HOH E 3 .   ? 9.239   17.621  49.620 1.00 36.01 ? 99  HOH B O   1 
HETATM 2346 O  O   . HOH E 3 .   ? 14.976  13.770  48.294 1.00 25.05 ? 100 HOH B O   1 
HETATM 2347 O  O   . HOH E 3 .   ? 2.121   -32.846 25.638 1.00 39.42 ? 104 HOH B O   1 
HETATM 2348 O  O   . HOH E 3 .   ? 4.825   -18.915 25.795 1.00 25.48 ? 105 HOH B O   1 
HETATM 2349 O  O   . HOH E 3 .   ? 15.209  -61.084 34.422 1.00 35.72 ? 106 HOH B O   1 
HETATM 2350 O  O   . HOH E 3 .   ? -9.959  -31.165 24.921 1.00 30.79 ? 107 HOH B O   1 
HETATM 2351 O  O   . HOH E 3 .   ? -7.639  -23.274 30.974 1.00 37.58 ? 109 HOH B O   1 
HETATM 2352 O  O   . HOH E 3 .   ? 5.917   4.442   49.631 1.00 32.81 ? 110 HOH B O   1 
HETATM 2353 O  O   . HOH E 3 .   ? 1.648   -37.329 28.362 1.00 41.03 ? 111 HOH B O   1 
HETATM 2354 O  O   . HOH E 3 .   ? 9.811   -13.319 35.039 1.00 32.36 ? 113 HOH B O   1 
HETATM 2355 O  O   . HOH E 3 .   ? 10.640  -50.933 33.864 1.00 35.94 ? 117 HOH B O   1 
HETATM 2356 O  O   . HOH E 3 .   ? 15.811  18.034  46.845 1.00 36.39 ? 118 HOH B O   1 
HETATM 2357 O  O   . HOH E 3 .   ? 14.956  -31.437 30.476 1.00 35.10 ? 119 HOH B O   1 
HETATM 2358 O  O   . HOH E 3 .   ? 6.151   -13.261 21.397 1.00 43.56 ? 120 HOH B O   1 
HETATM 2359 O  O   . HOH E 3 .   ? 12.484  -43.872 31.977 1.00 31.66 ? 121 HOH B O   1 
HETATM 2360 O  O   . HOH E 3 .   ? -6.250  -25.208 39.016 1.00 39.78 ? 126 HOH B O   1 
HETATM 2361 O  O   . HOH E 3 .   ? 7.923   -16.205 23.919 1.00 31.86 ? 129 HOH B O   1 
HETATM 2362 O  O   . HOH E 3 .   ? -3.630  -32.039 39.324 1.00 36.50 ? 132 HOH B O   1 
HETATM 2363 O  O   . HOH E 3 .   ? 0.931   3.125   45.925 1.00 36.39 ? 134 HOH B O   1 
HETATM 2364 O  O   . HOH E 3 .   ? 3.141   -14.690 33.268 1.00 49.02 ? 138 HOH B O   1 
HETATM 2365 O  O   . HOH E 3 .   ? 18.512  -43.949 41.491 1.00 38.58 ? 144 HOH B O   1 
HETATM 2366 O  O   . HOH E 3 .   ? -0.759  -17.786 21.409 1.00 35.81 ? 146 HOH B O   1 
HETATM 2367 O  O   . HOH E 3 .   ? -7.120  -35.330 34.503 1.00 35.89 ? 147 HOH B O   1 
HETATM 2368 O  O   . HOH E 3 .   ? 5.439   -14.501 34.097 1.00 41.47 ? 148 HOH B O   1 
HETATM 2369 O  O   . HOH E 3 .   ? 8.959   -20.812 15.285 1.00 41.71 ? 151 HOH B O   1 
HETATM 2370 O  O   . HOH E 3 .   ? 3.615   -46.556 31.737 1.00 35.03 ? 152 HOH B O   1 
HETATM 2371 O  O   . HOH E 3 .   ? 15.967  -41.252 34.146 1.00 45.27 ? 153 HOH B O   1 
HETATM 2372 O  O   . HOH E 3 .   ? 24.104  -50.663 42.898 1.00 42.36 ? 155 HOH B O   1 
HETATM 2373 O  O   . HOH E 3 .   ? -2.123  -42.045 30.413 1.00 51.10 ? 156 HOH B O   1 
HETATM 2374 O  O   . HOH E 3 .   ? 14.394  -34.926 32.894 1.00 37.64 ? 158 HOH B O   1 
HETATM 2375 O  O   . HOH E 3 .   ? 12.221  -32.403 17.702 1.00 39.33 ? 159 HOH B O   1 
HETATM 2376 O  O   . HOH E 3 .   ? 16.183  7.043   43.800 1.00 48.01 ? 160 HOH B O   1 
HETATM 2377 O  O   . HOH E 3 .   ? 7.782   -32.097 16.348 1.00 40.49 ? 163 HOH B O   1 
HETATM 2378 O  O   . HOH E 3 .   ? 7.035   -36.371 27.441 1.00 42.78 ? 164 HOH B O   1 
HETATM 2379 O  O   . HOH E 3 .   ? 14.840  -36.676 24.566 1.00 44.45 ? 165 HOH B O   1 
HETATM 2380 O  O   . HOH E 3 .   ? 6.038   -29.542 17.778 1.00 48.18 ? 166 HOH B O   1 
HETATM 2381 O  O   . HOH E 3 .   ? -6.752  -43.192 42.377 1.00 48.82 ? 167 HOH B O   1 
HETATM 2382 O  O   . HOH E 3 .   ? -4.242  -37.922 36.450 1.00 36.30 ? 172 HOH B O   1 
HETATM 2383 O  O   . HOH E 3 .   ? 14.532  -55.820 49.286 1.00 34.07 ? 174 HOH B O   1 
HETATM 2384 O  O   . HOH E 3 .   ? 9.215   22.257  41.306 1.00 33.32 ? 176 HOH B O   1 
HETATM 2385 O  O   . HOH E 3 .   ? 18.045  -60.638 30.988 1.00 49.40 ? 177 HOH B O   1 
HETATM 2386 O  O   . HOH E 3 .   ? 5.150   16.970  52.007 1.00 45.37 ? 181 HOH B O   1 
HETATM 2387 O  O   . HOH E 3 .   ? 17.253  -53.209 34.464 1.00 42.96 ? 184 HOH B O   1 
HETATM 2388 O  O   . HOH E 3 .   ? 6.239   -16.863 26.790 1.00 34.87 ? 185 HOH B O   1 
HETATM 2389 O  O   . HOH E 3 .   ? 13.803  22.689  43.028 1.00 42.81 ? 186 HOH B O   1 
HETATM 2390 O  O   . HOH E 3 .   ? -6.236  -18.266 38.493 1.00 43.67 ? 187 HOH B O   1 
HETATM 2391 O  O   . HOH E 3 .   ? 22.132  -38.410 38.041 1.00 40.73 ? 188 HOH B O   1 
HETATM 2392 O  O   . HOH E 3 .   ? -4.146  -44.016 33.190 1.00 39.77 ? 190 HOH B O   1 
HETATM 2393 O  O   . HOH E 3 .   ? 4.769   -5.189  39.818 1.00 49.07 ? 192 HOH B O   1 
HETATM 2394 O  O   . HOH E 3 .   ? 10.317  -10.171 41.911 1.00 31.27 ? 195 HOH B O   1 
HETATM 2395 O  O   . HOH E 3 .   ? -3.463  -8.370  32.180 1.00 44.15 ? 198 HOH B O   1 
HETATM 2396 O  O   . HOH E 3 .   ? 14.465  -32.260 39.312 1.00 46.07 ? 207 HOH B O   1 
HETATM 2397 O  O   . HOH E 3 .   ? 8.628   -14.198 22.122 1.00 28.32 ? 214 HOH B O   1 
HETATM 2398 O  O   . HOH E 3 .   ? 11.794  -40.903 51.665 1.00 43.20 ? 216 HOH B O   1 
HETATM 2399 O  O   . HOH E 3 .   ? 18.587  -34.012 24.243 1.00 51.42 ? 217 HOH B O   1 
HETATM 2400 O  O   . HOH E 3 .   ? 18.156  -35.395 26.820 1.00 53.12 ? 218 HOH B O   1 
HETATM 2401 O  O   . HOH E 3 .   ? -1.392  -27.265 19.849 1.00 37.91 ? 219 HOH B O   1 
HETATM 2402 O  O   . HOH E 3 .   ? -2.160  -29.929 20.197 1.00 37.25 ? 220 HOH B O   1 
HETATM 2403 O  O   . HOH E 3 .   ? 12.532  21.058  50.593 1.00 49.14 ? 221 HOH B O   1 
HETATM 2404 O  O   . HOH E 3 .   ? -3.208  -32.528 41.797 1.00 44.31 ? 222 HOH B O   1 
HETATM 2405 O  O   . HOH E 3 .   ? 21.854  -53.651 32.466 1.00 48.92 ? 225 HOH B O   1 
HETATM 2406 O  O   . HOH E 3 .   ? -0.757  -12.865 22.143 1.00 45.07 ? 228 HOH B O   1 
HETATM 2407 O  O   . HOH E 3 .   ? 21.121  -60.977 27.195 1.00 50.33 ? 232 HOH B O   1 
HETATM 2408 O  O   . HOH E 3 .   ? 8.728   -1.713  48.866 1.00 36.17 ? 237 HOH B O   1 
HETATM 2409 O  O   . HOH E 3 .   ? -3.180  -20.051 22.805 1.00 40.94 ? 238 HOH B O   1 
HETATM 2410 O  O   . HOH E 3 .   ? 7.354   -14.798 30.713 1.00 46.26 ? 241 HOH B O   1 
HETATM 2411 O  O   . HOH E 3 .   ? -4.632  -11.836 27.256 1.00 50.38 ? 243 HOH B O   1 
HETATM 2412 O  O   . HOH E 3 .   ? 16.699  0.955   47.106 1.00 46.64 ? 244 HOH B O   1 
HETATM 2413 O  O   . HOH E 3 .   ? -5.676  -15.782 43.882 1.00 50.91 ? 246 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   318 318 SER SER A . n 
A 1 2   MET 2   319 319 MET MET A . n 
A 1 3   LYS 3   320 320 LYS LYS A . n 
A 1 4   GLU 4   321 321 GLU GLU A . n 
A 1 5   PRO 5   322 322 PRO PRO A . n 
A 1 6   SER 6   323 323 SER SER A . n 
A 1 7   GLN 7   324 324 GLN GLN A . n 
A 1 8   GLN 8   325 325 GLN GLN A . n 
A 1 9   ARG 9   326 326 ARG ARG A . n 
A 1 10  VAL 10  327 327 VAL VAL A . n 
A 1 11  LYS 11  328 328 LYS LYS A . n 
A 1 12  ARG 12  329 329 ARG ARG A . n 
A 1 13  TRP 13  330 330 TRP TRP A . n 
A 1 14  GLY 14  331 331 GLY GLY A . n 
A 1 15  PHE 15  332 332 PHE PHE A . n 
A 1 16  GLY 16  333 333 GLY GLY A . n 
A 1 17  MET 17  334 334 MET MET A . n 
A 1 18  ASP 18  335 335 ASP ASP A . n 
A 1 19  GLU 19  336 336 GLU GLU A . n 
A 1 20  ALA 20  337 337 ALA ALA A . n 
A 1 21  LEU 21  338 338 LEU LEU A . n 
A 1 22  LYS 22  339 339 LYS LYS A . n 
A 1 23  ASP 23  340 340 ASP ASP A . n 
A 1 24  PRO 24  341 341 PRO PRO A . n 
A 1 25  VAL 25  342 342 VAL VAL A . n 
A 1 26  GLY 26  343 343 GLY GLY A . n 
A 1 27  ARG 27  344 344 ARG ARG A . n 
A 1 28  GLU 28  345 345 GLU GLU A . n 
A 1 29  GLN 29  346 346 GLN GLN A . n 
A 1 30  PHE 30  347 347 PHE PHE A . n 
A 1 31  LEU 31  348 348 LEU LEU A . n 
A 1 32  LYS 32  349 349 LYS LYS A . n 
A 1 33  PHE 33  350 350 PHE PHE A . n 
A 1 34  LEU 34  351 351 LEU LEU A . n 
A 1 35  GLU 35  352 352 GLU GLU A . n 
A 1 36  SER 36  353 353 SER SER A . n 
A 1 37  GLU 37  354 354 GLU GLU A . n 
A 1 38  PHE 38  355 355 PHE PHE A . n 
A 1 39  SER 39  356 356 SER SER A . n 
A 1 40  SER 40  357 357 SER SER A . n 
A 1 41  GLU 41  358 358 GLU GLU A . n 
A 1 42  ASN 42  359 359 ASN ASN A . n 
A 1 43  LEU 43  360 360 LEU LEU A . n 
A 1 44  ARG 44  361 361 ARG ARG A . n 
A 1 45  PHE 45  362 362 PHE PHE A . n 
A 1 46  TRP 46  363 363 TRP TRP A . n 
A 1 47  LEU 47  364 364 LEU LEU A . n 
A 1 48  ALA 48  365 365 ALA ALA A . n 
A 1 49  VAL 49  366 366 VAL VAL A . n 
A 1 50  GLU 50  367 367 GLU GLU A . n 
A 1 51  ASP 51  368 368 ASP ASP A . n 
A 1 52  LEU 52  369 369 LEU LEU A . n 
A 1 53  LYS 53  370 370 LYS LYS A . n 
A 1 54  LYS 54  371 371 LYS LYS A . n 
A 1 55  ARG 55  372 372 ARG ARG A . n 
A 1 56  PRO 56  373 373 PRO PRO A . n 
A 1 57  ILE 57  374 374 ILE ILE A . n 
A 1 58  LYS 58  375 375 LYS LYS A . n 
A 1 59  GLU 59  376 376 GLU GLU A . n 
A 1 60  VAL 60  377 377 VAL VAL A . n 
A 1 61  PRO 61  378 378 PRO PRO A . n 
A 1 62  SER 62  379 379 SER SER A . n 
A 1 63  ARG 63  380 380 ARG ARG A . n 
A 1 64  VAL 64  381 381 VAL VAL A . n 
A 1 65  GLN 65  382 382 GLN GLN A . n 
A 1 66  GLU 66  383 383 GLU GLU A . n 
A 1 67  ILE 67  384 384 ILE ILE A . n 
A 1 68  TRP 68  385 385 TRP TRP A . n 
A 1 69  GLN 69  386 386 GLN GLN A . n 
A 1 70  GLU 70  387 387 GLU GLU A . n 
A 1 71  PHE 71  388 388 PHE PHE A . n 
A 1 72  LEU 72  389 389 LEU LEU A . n 
A 1 73  ALA 73  390 390 ALA ALA A . n 
A 1 74  PRO 74  391 391 PRO PRO A . n 
A 1 75  GLY 75  392 392 GLY GLY A . n 
A 1 76  ALA 76  393 393 ALA ALA A . n 
A 1 77  PRO 77  394 394 PRO PRO A . n 
A 1 78  SER 78  395 395 SER SER A . n 
A 1 79  ALA 79  396 396 ALA ALA A . n 
A 1 80  ILE 80  397 397 ILE ILE A . n 
A 1 81  ASN 81  398 398 ASN ASN A . n 
A 1 82  LEU 82  399 399 LEU LEU A . n 
A 1 83  ASP 83  400 400 ASP ASP A . n 
A 1 84  SER 84  401 401 SER SER A . n 
A 1 85  LYS 85  402 402 LYS LYS A . n 
A 1 86  SER 86  403 403 SER SER A . n 
A 1 87  TYR 87  404 404 TYR TYR A . n 
A 1 88  ASP 88  405 405 ASP ASP A . n 
A 1 89  LYS 89  406 406 LYS LYS A . n 
A 1 90  THR 90  407 407 THR THR A . n 
A 1 91  THR 91  408 408 THR THR A . n 
A 1 92  HIS 92  409 409 HIS HIS A . n 
A 1 93  ASN 93  410 410 ASN ASN A . n 
A 1 94  VAL 94  411 411 VAL VAL A . n 
A 1 95  LYS 95  412 412 LYS LYS A . n 
A 1 96  GLU 96  413 413 GLU GLU A . n 
A 1 97  PRO 97  414 414 PRO PRO A . n 
A 1 98  GLY 98  415 415 GLY GLY A . n 
A 1 99  ARG 99  416 416 ARG ARG A . n 
A 1 100 TYR 100 417 417 TYR TYR A . n 
A 1 101 THR 101 418 418 THR THR A . n 
A 1 102 PHE 102 419 419 PHE PHE A . n 
A 1 103 GLU 103 420 420 GLU GLU A . n 
A 1 104 ASP 104 421 421 ASP ASP A . n 
A 1 105 ALA 105 422 422 ALA ALA A . n 
A 1 106 GLN 106 423 423 GLN GLN A . n 
A 1 107 GLU 107 424 424 GLU GLU A . n 
A 1 108 HIS 108 425 425 HIS HIS A . n 
A 1 109 ILE 109 426 426 ILE ILE A . n 
A 1 110 TYR 110 427 427 TYR TYR A . n 
A 1 111 LYS 111 428 428 LYS LYS A . n 
A 1 112 LEU 112 429 429 LEU LEU A . n 
A 1 113 MET 113 430 430 MET MET A . n 
A 1 114 LYS 114 431 431 LYS LYS A . n 
A 1 115 SER 115 432 432 SER SER A . n 
A 1 116 ASP 116 433 433 ASP ASP A . n 
A 1 117 SER 117 434 434 SER SER A . n 
A 1 118 TYR 118 435 435 TYR TYR A . n 
A 1 119 PRO 119 436 436 PRO PRO A . n 
A 1 120 ARG 120 437 437 ARG ARG A . n 
A 1 121 PHE 121 438 438 PHE PHE A . n 
A 1 122 ILE 122 439 439 ILE ILE A . n 
A 1 123 ARG 123 440 440 ARG ARG A . n 
A 1 124 SER 124 441 441 SER SER A . n 
A 1 125 SER 125 442 442 SER SER A . n 
A 1 126 ALA 126 443 443 ALA ALA A . n 
A 1 127 TYR 127 444 444 TYR TYR A . n 
A 1 128 GLN 128 445 445 GLN GLN A . n 
A 1 129 GLU 129 446 446 GLU GLU A . n 
A 1 130 LEU 130 447 447 LEU LEU A . n 
A 1 131 LEU 131 448 448 LEU LEU A . n 
A 1 132 GLN 132 449 449 GLN GLN A . n 
A 1 133 ALA 133 450 450 ALA ALA A . n 
A 1 134 LYS 134 451 ?   ?   ?   A . n 
A 1 135 LYS 135 452 ?   ?   ?   A . n 
A 1 136 LYS 136 453 ?   ?   ?   A . n 
A 1 137 SER 137 454 ?   ?   ?   A . n 
A 1 138 GLY 138 455 ?   ?   ?   A . n 
A 1 139 ASN 139 456 ?   ?   ?   A . n 
A 1 140 SER 140 457 ?   ?   ?   A . n 
A 1 141 MET 141 458 ?   ?   ?   A . n 
A 1 142 ASP 142 459 ?   ?   ?   A . n 
A 1 143 ARG 143 460 ?   ?   ?   A . n 
A 1 144 ARG 144 461 ?   ?   ?   A . n 
A 1 145 THR 145 462 ?   ?   ?   A . n 
A 1 146 SER 146 463 ?   ?   ?   A . n 
B 1 1   SER 1   318 318 SER SER B . n 
B 1 2   MET 2   319 319 MET MET B . n 
B 1 3   LYS 3   320 320 LYS LYS B . n 
B 1 4   GLU 4   321 321 GLU GLU B . n 
B 1 5   PRO 5   322 322 PRO PRO B . n 
B 1 6   SER 6   323 323 SER SER B . n 
B 1 7   GLN 7   324 324 GLN GLN B . n 
B 1 8   GLN 8   325 325 GLN GLN B . n 
B 1 9   ARG 9   326 326 ARG ARG B . n 
B 1 10  VAL 10  327 327 VAL VAL B . n 
B 1 11  LYS 11  328 328 LYS LYS B . n 
B 1 12  ARG 12  329 329 ARG ARG B . n 
B 1 13  TRP 13  330 330 TRP TRP B . n 
B 1 14  GLY 14  331 331 GLY GLY B . n 
B 1 15  PHE 15  332 332 PHE PHE B . n 
B 1 16  GLY 16  333 333 GLY GLY B . n 
B 1 17  MET 17  334 334 MET MET B . n 
B 1 18  ASP 18  335 335 ASP ASP B . n 
B 1 19  GLU 19  336 336 GLU GLU B . n 
B 1 20  ALA 20  337 337 ALA ALA B . n 
B 1 21  LEU 21  338 338 LEU LEU B . n 
B 1 22  LYS 22  339 339 LYS LYS B . n 
B 1 23  ASP 23  340 340 ASP ASP B . n 
B 1 24  PRO 24  341 341 PRO PRO B . n 
B 1 25  VAL 25  342 342 VAL VAL B . n 
B 1 26  GLY 26  343 343 GLY GLY B . n 
B 1 27  ARG 27  344 344 ARG ARG B . n 
B 1 28  GLU 28  345 345 GLU GLU B . n 
B 1 29  GLN 29  346 346 GLN GLN B . n 
B 1 30  PHE 30  347 347 PHE PHE B . n 
B 1 31  LEU 31  348 348 LEU LEU B . n 
B 1 32  LYS 32  349 349 LYS LYS B . n 
B 1 33  PHE 33  350 350 PHE PHE B . n 
B 1 34  LEU 34  351 351 LEU LEU B . n 
B 1 35  GLU 35  352 352 GLU GLU B . n 
B 1 36  SER 36  353 353 SER SER B . n 
B 1 37  GLU 37  354 354 GLU GLU B . n 
B 1 38  PHE 38  355 355 PHE PHE B . n 
B 1 39  SER 39  356 356 SER SER B . n 
B 1 40  SER 40  357 357 SER SER B . n 
B 1 41  GLU 41  358 358 GLU GLU B . n 
B 1 42  ASN 42  359 359 ASN ASN B . n 
B 1 43  LEU 43  360 360 LEU LEU B . n 
B 1 44  ARG 44  361 361 ARG ARG B . n 
B 1 45  PHE 45  362 362 PHE PHE B . n 
B 1 46  TRP 46  363 363 TRP TRP B . n 
B 1 47  LEU 47  364 364 LEU LEU B . n 
B 1 48  ALA 48  365 365 ALA ALA B . n 
B 1 49  VAL 49  366 366 VAL VAL B . n 
B 1 50  GLU 50  367 367 GLU GLU B . n 
B 1 51  ASP 51  368 368 ASP ASP B . n 
B 1 52  LEU 52  369 369 LEU LEU B . n 
B 1 53  LYS 53  370 370 LYS LYS B . n 
B 1 54  LYS 54  371 371 LYS LYS B . n 
B 1 55  ARG 55  372 372 ARG ARG B . n 
B 1 56  PRO 56  373 373 PRO PRO B . n 
B 1 57  ILE 57  374 374 ILE ILE B . n 
B 1 58  LYS 58  375 375 LYS LYS B . n 
B 1 59  GLU 59  376 376 GLU GLU B . n 
B 1 60  VAL 60  377 377 VAL VAL B . n 
B 1 61  PRO 61  378 378 PRO PRO B . n 
B 1 62  SER 62  379 379 SER SER B . n 
B 1 63  ARG 63  380 380 ARG ARG B . n 
B 1 64  VAL 64  381 381 VAL VAL B . n 
B 1 65  GLN 65  382 382 GLN GLN B . n 
B 1 66  GLU 66  383 383 GLU GLU B . n 
B 1 67  ILE 67  384 384 ILE ILE B . n 
B 1 68  TRP 68  385 385 TRP TRP B . n 
B 1 69  GLN 69  386 386 GLN GLN B . n 
B 1 70  GLU 70  387 387 GLU GLU B . n 
B 1 71  PHE 71  388 388 PHE PHE B . n 
B 1 72  LEU 72  389 389 LEU LEU B . n 
B 1 73  ALA 73  390 390 ALA ALA B . n 
B 1 74  PRO 74  391 391 PRO PRO B . n 
B 1 75  GLY 75  392 392 GLY GLY B . n 
B 1 76  ALA 76  393 393 ALA ALA B . n 
B 1 77  PRO 77  394 394 PRO PRO B . n 
B 1 78  SER 78  395 395 SER SER B . n 
B 1 79  ALA 79  396 396 ALA ALA B . n 
B 1 80  ILE 80  397 397 ILE ILE B . n 
B 1 81  ASN 81  398 398 ASN ASN B . n 
B 1 82  LEU 82  399 399 LEU LEU B . n 
B 1 83  ASP 83  400 400 ASP ASP B . n 
B 1 84  SER 84  401 401 SER SER B . n 
B 1 85  LYS 85  402 402 LYS LYS B . n 
B 1 86  SER 86  403 403 SER SER B . n 
B 1 87  TYR 87  404 404 TYR TYR B . n 
B 1 88  ASP 88  405 405 ASP ASP B . n 
B 1 89  LYS 89  406 406 LYS LYS B . n 
B 1 90  THR 90  407 407 THR THR B . n 
B 1 91  THR 91  408 408 THR THR B . n 
B 1 92  HIS 92  409 409 HIS HIS B . n 
B 1 93  ASN 93  410 410 ASN ASN B . n 
B 1 94  VAL 94  411 411 VAL VAL B . n 
B 1 95  LYS 95  412 412 LYS LYS B . n 
B 1 96  GLU 96  413 413 GLU GLU B . n 
B 1 97  PRO 97  414 414 PRO PRO B . n 
B 1 98  GLY 98  415 415 GLY GLY B . n 
B 1 99  ARG 99  416 416 ARG ARG B . n 
B 1 100 TYR 100 417 417 TYR TYR B . n 
B 1 101 THR 101 418 418 THR THR B . n 
B 1 102 PHE 102 419 419 PHE PHE B . n 
B 1 103 GLU 103 420 420 GLU GLU B . n 
B 1 104 ASP 104 421 421 ASP ASP B . n 
B 1 105 ALA 105 422 422 ALA ALA B . n 
B 1 106 GLN 106 423 423 GLN GLN B . n 
B 1 107 GLU 107 424 424 GLU GLU B . n 
B 1 108 HIS 108 425 425 HIS HIS B . n 
B 1 109 ILE 109 426 426 ILE ILE B . n 
B 1 110 TYR 110 427 427 TYR TYR B . n 
B 1 111 LYS 111 428 428 LYS LYS B . n 
B 1 112 LEU 112 429 429 LEU LEU B . n 
B 1 113 MET 113 430 430 MET MET B . n 
B 1 114 LYS 114 431 431 LYS LYS B . n 
B 1 115 SER 115 432 432 SER SER B . n 
B 1 116 ASP 116 433 433 ASP ASP B . n 
B 1 117 SER 117 434 434 SER SER B . n 
B 1 118 TYR 118 435 435 TYR TYR B . n 
B 1 119 PRO 119 436 436 PRO PRO B . n 
B 1 120 ARG 120 437 437 ARG ARG B . n 
B 1 121 PHE 121 438 438 PHE PHE B . n 
B 1 122 ILE 122 439 439 ILE ILE B . n 
B 1 123 ARG 123 440 440 ARG ARG B . n 
B 1 124 SER 124 441 441 SER SER B . n 
B 1 125 SER 125 442 442 SER SER B . n 
B 1 126 ALA 126 443 443 ALA ALA B . n 
B 1 127 TYR 127 444 444 TYR TYR B . n 
B 1 128 GLN 128 445 445 GLN GLN B . n 
B 1 129 GLU 129 446 446 GLU GLU B . n 
B 1 130 LEU 130 447 447 LEU LEU B . n 
B 1 131 LEU 131 448 448 LEU LEU B . n 
B 1 132 GLN 132 449 449 GLN GLN B . n 
B 1 133 ALA 133 450 450 ALA ALA B . n 
B 1 134 LYS 134 451 ?   ?   ?   B . n 
B 1 135 LYS 135 452 ?   ?   ?   B . n 
B 1 136 LYS 136 453 ?   ?   ?   B . n 
B 1 137 SER 137 454 ?   ?   ?   B . n 
B 1 138 GLY 138 455 ?   ?   ?   B . n 
B 1 139 ASN 139 456 ?   ?   ?   B . n 
B 1 140 SER 140 457 ?   ?   ?   B . n 
B 1 141 MET 141 458 ?   ?   ?   B . n 
B 1 142 ASP 142 459 ?   ?   ?   B . n 
B 1 143 ARG 143 460 ?   ?   ?   B . n 
B 1 144 ARG 144 461 ?   ?   ?   B . n 
B 1 145 THR 145 462 ?   ?   ?   B . n 
B 1 146 SER 146 463 ?   ?   ?   B . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Structural Genomics Consortium' 
_pdbx_SG_project.initial_of_center     SGC 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 CL  1   301 1   CL  CL  A . 
D 3 HOH 1   2   2   HOH HOH A . 
D 3 HOH 2   3   3   HOH HOH A . 
D 3 HOH 3   4   4   HOH HOH A . 
D 3 HOH 4   5   5   HOH HOH A . 
D 3 HOH 5   6   6   HOH HOH A . 
D 3 HOH 6   7   7   HOH HOH A . 
D 3 HOH 7   12  12  HOH HOH A . 
D 3 HOH 8   13  13  HOH HOH A . 
D 3 HOH 9   22  22  HOH HOH A . 
D 3 HOH 10  24  24  HOH HOH A . 
D 3 HOH 11  25  25  HOH HOH A . 
D 3 HOH 12  26  26  HOH HOH A . 
D 3 HOH 13  27  27  HOH HOH A . 
D 3 HOH 14  31  31  HOH HOH A . 
D 3 HOH 15  34  34  HOH HOH A . 
D 3 HOH 16  35  35  HOH HOH A . 
D 3 HOH 17  36  36  HOH HOH A . 
D 3 HOH 18  37  37  HOH HOH A . 
D 3 HOH 19  41  41  HOH HOH A . 
D 3 HOH 20  43  43  HOH HOH A . 
D 3 HOH 21  45  45  HOH HOH A . 
D 3 HOH 22  49  49  HOH HOH A . 
D 3 HOH 23  51  51  HOH HOH A . 
D 3 HOH 24  52  52  HOH HOH A . 
D 3 HOH 25  59  59  HOH HOH A . 
D 3 HOH 26  65  65  HOH HOH A . 
D 3 HOH 27  66  66  HOH HOH A . 
D 3 HOH 28  67  67  HOH HOH A . 
D 3 HOH 29  68  68  HOH HOH A . 
D 3 HOH 30  69  69  HOH HOH A . 
D 3 HOH 31  70  70  HOH HOH A . 
D 3 HOH 32  72  72  HOH HOH A . 
D 3 HOH 33  74  74  HOH HOH A . 
D 3 HOH 34  75  75  HOH HOH A . 
D 3 HOH 35  76  76  HOH HOH A . 
D 3 HOH 36  77  77  HOH HOH A . 
D 3 HOH 37  78  78  HOH HOH A . 
D 3 HOH 38  79  79  HOH HOH A . 
D 3 HOH 39  83  83  HOH HOH A . 
D 3 HOH 40  84  84  HOH HOH A . 
D 3 HOH 41  87  87  HOH HOH A . 
D 3 HOH 42  88  88  HOH HOH A . 
D 3 HOH 43  89  89  HOH HOH A . 
D 3 HOH 44  91  91  HOH HOH A . 
D 3 HOH 45  92  92  HOH HOH A . 
D 3 HOH 46  93  93  HOH HOH A . 
D 3 HOH 47  94  94  HOH HOH A . 
D 3 HOH 48  96  96  HOH HOH A . 
D 3 HOH 49  97  97  HOH HOH A . 
D 3 HOH 50  101 101 HOH HOH A . 
D 3 HOH 51  102 102 HOH HOH A . 
D 3 HOH 52  103 103 HOH HOH A . 
D 3 HOH 53  108 108 HOH HOH A . 
D 3 HOH 54  112 112 HOH HOH A . 
D 3 HOH 55  114 114 HOH HOH A . 
D 3 HOH 56  115 115 HOH HOH A . 
D 3 HOH 57  116 116 HOH HOH A . 
D 3 HOH 58  122 122 HOH HOH A . 
D 3 HOH 59  123 123 HOH HOH A . 
D 3 HOH 60  124 124 HOH HOH A . 
D 3 HOH 61  125 125 HOH HOH A . 
D 3 HOH 62  127 127 HOH HOH A . 
D 3 HOH 63  128 128 HOH HOH A . 
D 3 HOH 64  130 130 HOH HOH A . 
D 3 HOH 65  131 131 HOH HOH A . 
D 3 HOH 66  133 133 HOH HOH A . 
D 3 HOH 67  135 135 HOH HOH A . 
D 3 HOH 68  136 136 HOH HOH A . 
D 3 HOH 69  137 137 HOH HOH A . 
D 3 HOH 70  139 139 HOH HOH A . 
D 3 HOH 71  140 140 HOH HOH A . 
D 3 HOH 72  141 141 HOH HOH A . 
D 3 HOH 73  142 142 HOH HOH A . 
D 3 HOH 74  143 143 HOH HOH A . 
D 3 HOH 75  145 145 HOH HOH A . 
D 3 HOH 76  149 149 HOH HOH A . 
D 3 HOH 77  150 150 HOH HOH A . 
D 3 HOH 78  154 154 HOH HOH A . 
D 3 HOH 79  157 157 HOH HOH A . 
D 3 HOH 80  161 161 HOH HOH A . 
D 3 HOH 81  162 162 HOH HOH A . 
D 3 HOH 82  168 168 HOH HOH A . 
D 3 HOH 83  169 169 HOH HOH A . 
D 3 HOH 84  170 170 HOH HOH A . 
D 3 HOH 85  171 171 HOH HOH A . 
D 3 HOH 86  173 173 HOH HOH A . 
D 3 HOH 87  180 180 HOH HOH A . 
D 3 HOH 88  182 182 HOH HOH A . 
D 3 HOH 89  202 202 HOH HOH A . 
D 3 HOH 90  203 203 HOH HOH A . 
D 3 HOH 91  204 204 HOH HOH A . 
D 3 HOH 92  205 205 HOH HOH A . 
D 3 HOH 93  206 206 HOH HOH A . 
D 3 HOH 94  208 208 HOH HOH A . 
D 3 HOH 95  209 209 HOH HOH A . 
D 3 HOH 96  210 210 HOH HOH A . 
D 3 HOH 97  211 211 HOH HOH A . 
D 3 HOH 98  212 212 HOH HOH A . 
D 3 HOH 99  213 213 HOH HOH A . 
D 3 HOH 100 215 215 HOH HOH A . 
D 3 HOH 101 223 223 HOH HOH A . 
D 3 HOH 102 224 224 HOH HOH A . 
D 3 HOH 103 226 226 HOH HOH A . 
D 3 HOH 104 227 227 HOH HOH A . 
D 3 HOH 105 229 229 HOH HOH A . 
D 3 HOH 106 230 230 HOH HOH A . 
D 3 HOH 107 233 233 HOH HOH A . 
D 3 HOH 108 234 234 HOH HOH A . 
D 3 HOH 109 235 235 HOH HOH A . 
D 3 HOH 110 236 236 HOH HOH A . 
D 3 HOH 111 239 239 HOH HOH A . 
D 3 HOH 112 240 240 HOH HOH A . 
D 3 HOH 113 242 242 HOH HOH A . 
D 3 HOH 114 245 245 HOH HOH A . 
E 3 HOH 1   1   1   HOH HOH B . 
E 3 HOH 2   8   8   HOH HOH B . 
E 3 HOH 3   9   9   HOH HOH B . 
E 3 HOH 4   10  10  HOH HOH B . 
E 3 HOH 5   11  11  HOH HOH B . 
E 3 HOH 6   14  14  HOH HOH B . 
E 3 HOH 7   15  15  HOH HOH B . 
E 3 HOH 8   16  16  HOH HOH B . 
E 3 HOH 9   17  17  HOH HOH B . 
E 3 HOH 10  18  18  HOH HOH B . 
E 3 HOH 11  19  19  HOH HOH B . 
E 3 HOH 12  20  20  HOH HOH B . 
E 3 HOH 13  21  21  HOH HOH B . 
E 3 HOH 14  23  23  HOH HOH B . 
E 3 HOH 15  28  28  HOH HOH B . 
E 3 HOH 16  29  29  HOH HOH B . 
E 3 HOH 17  30  30  HOH HOH B . 
E 3 HOH 18  32  32  HOH HOH B . 
E 3 HOH 19  33  33  HOH HOH B . 
E 3 HOH 20  38  38  HOH HOH B . 
E 3 HOH 21  39  39  HOH HOH B . 
E 3 HOH 22  40  40  HOH HOH B . 
E 3 HOH 23  42  42  HOH HOH B . 
E 3 HOH 24  44  44  HOH HOH B . 
E 3 HOH 25  46  46  HOH HOH B . 
E 3 HOH 26  47  47  HOH HOH B . 
E 3 HOH 27  48  48  HOH HOH B . 
E 3 HOH 28  50  50  HOH HOH B . 
E 3 HOH 29  53  53  HOH HOH B . 
E 3 HOH 30  54  54  HOH HOH B . 
E 3 HOH 31  55  55  HOH HOH B . 
E 3 HOH 32  56  56  HOH HOH B . 
E 3 HOH 33  57  57  HOH HOH B . 
E 3 HOH 34  58  58  HOH HOH B . 
E 3 HOH 35  60  60  HOH HOH B . 
E 3 HOH 36  61  61  HOH HOH B . 
E 3 HOH 37  62  62  HOH HOH B . 
E 3 HOH 38  63  63  HOH HOH B . 
E 3 HOH 39  64  64  HOH HOH B . 
E 3 HOH 40  71  71  HOH HOH B . 
E 3 HOH 41  73  73  HOH HOH B . 
E 3 HOH 42  80  80  HOH HOH B . 
E 3 HOH 43  81  81  HOH HOH B . 
E 3 HOH 44  82  82  HOH HOH B . 
E 3 HOH 45  85  85  HOH HOH B . 
E 3 HOH 46  86  86  HOH HOH B . 
E 3 HOH 47  90  90  HOH HOH B . 
E 3 HOH 48  95  95  HOH HOH B . 
E 3 HOH 49  99  99  HOH HOH B . 
E 3 HOH 50  100 100 HOH HOH B . 
E 3 HOH 51  104 104 HOH HOH B . 
E 3 HOH 52  105 105 HOH HOH B . 
E 3 HOH 53  106 106 HOH HOH B . 
E 3 HOH 54  107 107 HOH HOH B . 
E 3 HOH 55  109 109 HOH HOH B . 
E 3 HOH 56  110 110 HOH HOH B . 
E 3 HOH 57  111 111 HOH HOH B . 
E 3 HOH 58  113 113 HOH HOH B . 
E 3 HOH 59  117 117 HOH HOH B . 
E 3 HOH 60  118 118 HOH HOH B . 
E 3 HOH 61  119 119 HOH HOH B . 
E 3 HOH 62  120 120 HOH HOH B . 
E 3 HOH 63  121 121 HOH HOH B . 
E 3 HOH 64  126 126 HOH HOH B . 
E 3 HOH 65  129 129 HOH HOH B . 
E 3 HOH 66  132 132 HOH HOH B . 
E 3 HOH 67  134 134 HOH HOH B . 
E 3 HOH 68  138 138 HOH HOH B . 
E 3 HOH 69  144 144 HOH HOH B . 
E 3 HOH 70  146 146 HOH HOH B . 
E 3 HOH 71  147 147 HOH HOH B . 
E 3 HOH 72  148 148 HOH HOH B . 
E 3 HOH 73  151 151 HOH HOH B . 
E 3 HOH 74  152 152 HOH HOH B . 
E 3 HOH 75  153 153 HOH HOH B . 
E 3 HOH 76  155 155 HOH HOH B . 
E 3 HOH 77  156 156 HOH HOH B . 
E 3 HOH 78  158 158 HOH HOH B . 
E 3 HOH 79  159 159 HOH HOH B . 
E 3 HOH 80  160 160 HOH HOH B . 
E 3 HOH 81  163 163 HOH HOH B . 
E 3 HOH 82  164 164 HOH HOH B . 
E 3 HOH 83  165 165 HOH HOH B . 
E 3 HOH 84  166 166 HOH HOH B . 
E 3 HOH 85  167 167 HOH HOH B . 
E 3 HOH 86  172 172 HOH HOH B . 
E 3 HOH 87  174 174 HOH HOH B . 
E 3 HOH 88  176 176 HOH HOH B . 
E 3 HOH 89  177 177 HOH HOH B . 
E 3 HOH 90  181 181 HOH HOH B . 
E 3 HOH 91  184 184 HOH HOH B . 
E 3 HOH 92  185 185 HOH HOH B . 
E 3 HOH 93  186 186 HOH HOH B . 
E 3 HOH 94  187 187 HOH HOH B . 
E 3 HOH 95  188 188 HOH HOH B . 
E 3 HOH 96  190 190 HOH HOH B . 
E 3 HOH 97  192 192 HOH HOH B . 
E 3 HOH 98  195 195 HOH HOH B . 
E 3 HOH 99  198 198 HOH HOH B . 
E 3 HOH 100 207 207 HOH HOH B . 
E 3 HOH 101 214 214 HOH HOH B . 
E 3 HOH 102 216 216 HOH HOH B . 
E 3 HOH 103 217 217 HOH HOH B . 
E 3 HOH 104 218 218 HOH HOH B . 
E 3 HOH 105 219 219 HOH HOH B . 
E 3 HOH 106 220 220 HOH HOH B . 
E 3 HOH 107 221 221 HOH HOH B . 
E 3 HOH 108 222 222 HOH HOH B . 
E 3 HOH 109 225 225 HOH HOH B . 
E 3 HOH 110 228 228 HOH HOH B . 
E 3 HOH 111 232 232 HOH HOH B . 
E 3 HOH 112 237 237 HOH HOH B . 
E 3 HOH 113 238 238 HOH HOH B . 
E 3 HOH 114 241 241 HOH HOH B . 
E 3 HOH 115 243 243 HOH HOH B . 
E 3 HOH 116 244 244 HOH HOH B . 
E 3 HOH 117 246 246 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 6130  ? 
1 MORE         -56   ? 
1 'SSA (A^2)'  15130 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2005-07-12 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2018-03-07 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' Advisory                    
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Data collection'           
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            diffrn_source 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_diffrn_source.source' 
2 4 'Structure model' '_diffrn_source.type'   
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined 9.5671 2.3874   33.8216 -0.1695 -0.1015 -0.0693 0.0007  0.0455  0.0331  0.3834 5.9962  1.9808 0.1271  -0.6237 1.6394  
-0.0146 -0.0002 -0.1141 -0.3795 -0.0299 -0.6755 -0.0442 -0.0392 0.0444  'X-RAY DIFFRACTION' 
2 ? refined 6.4066 -37.0862 41.7432 -0.1966 -0.0805 -0.2124 -0.0370 -0.0334 -0.0528 1.3497 12.0316 7.3717 1.6077  -0.6128 -8.1563 
0.1724  -0.1943 -0.0498 0.2661  -0.1392 0.0585  -0.0975 0.0245  -0.0332 'X-RAY DIFFRACTION' 
3 ? refined 6.2798 -35.1283 33.5945 -0.1375 -0.1084 -0.2083 -0.0270 -0.0324 -0.0433 1.2146 5.0849  2.4870 -0.3693 0.1525  -2.3456 
0.1117  -0.0214 0.0353  -0.2917 -0.1176 0.0859  0.0529  0.1225  0.0059  'X-RAY DIFFRACTION' 
4 ? refined 8.6861 4.2037   41.9490 -0.2300 -0.0702 -0.0998 0.0021  -0.0331 0.0452  1.0900 9.9117  6.6979 1.9816  0.1686  6.4217  
0.1530  -0.2499 -0.1427 0.2433  -0.2077 -0.3099 0.0565  -0.0307 0.0546  'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1 1 A 318 A 1  A 413 A 96  ? 'X-RAY DIFFRACTION' ? 
2 2 A 414 A 97 A 450 A 133 ? 'X-RAY DIFFRACTION' ? 
3 3 B 318 B 1  B 413 B 96  ? 'X-RAY DIFFRACTION' ? 
4 4 B 414 B 97 B 450 B 133 ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
_software.date 
_software.type 
_software.location 
_software.language 
REFMAC refinement       5.2.0005  ? 1 ? ? ? ? 
MOSFLM 'data reduction' .         ? 2 ? ? ? ? 
CCP4   'data scaling'   '(SCALA)' ? 3 ? ? ? ? 
PHASER phasing          .         ? 4 ? ? ? ? 
# 
_pdbx_database_remark.id     300 
_pdbx_database_remark.text   
;BIOMOLECULE:
Two biological units are present in the asymmetric 
unit that are formed from the combinations of 
residues 320 to 414 of chain A with 415 to 450 of 
chain B and residues 320 to 414 of chain B with 415 
to 450 of chain A.
;
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   HOH 
_pdbx_validate_close_contact.auth_seq_id_1    96 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    209 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.14 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             NE 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_1              329 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CZ 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_2              329 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             NH1 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_3              329 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                123.56 
_pdbx_validate_rmsd_angle.angle_target_value         120.30 
_pdbx_validate_rmsd_angle.angle_deviation            3.26 
_pdbx_validate_rmsd_angle.angle_standard_deviation   0.50 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LEU A 389 ? ? -136.07 -30.66 
2 1 ASP A 433 ? ? -130.24 -83.77 
3 1 ASP B 433 ? ? -136.65 -75.43 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 320 ? CG  ? A LYS 3   CG  
2  1 Y 1 A LYS 320 ? CD  ? A LYS 3   CD  
3  1 Y 1 A LYS 320 ? CE  ? A LYS 3   CE  
4  1 Y 1 A LYS 320 ? NZ  ? A LYS 3   NZ  
5  1 Y 1 A GLU 321 ? CG  ? A GLU 4   CG  
6  1 Y 1 A GLU 321 ? CD  ? A GLU 4   CD  
7  1 Y 1 A GLU 321 ? OE1 ? A GLU 4   OE1 
8  1 Y 1 A GLU 321 ? OE2 ? A GLU 4   OE2 
9  1 Y 1 A GLN 325 ? CD  ? A GLN 8   CD  
10 1 Y 1 A GLN 325 ? OE1 ? A GLN 8   OE1 
11 1 Y 1 A GLN 325 ? NE2 ? A GLN 8   NE2 
12 1 Y 1 A LYS 375 ? CD  ? A LYS 58  CD  
13 1 Y 1 A LYS 375 ? CE  ? A LYS 58  CE  
14 1 Y 1 A LYS 375 ? NZ  ? A LYS 58  NZ  
15 1 Y 1 A ARG 380 ? CD  ? A ARG 63  CD  
16 1 Y 1 A ARG 380 ? NE  ? A ARG 63  NE  
17 1 Y 1 A ARG 380 ? CZ  ? A ARG 63  CZ  
18 1 Y 1 A ARG 380 ? NH1 ? A ARG 63  NH1 
19 1 Y 1 A ARG 380 ? NH2 ? A ARG 63  NH2 
20 1 Y 1 A LYS 402 ? CD  ? A LYS 85  CD  
21 1 Y 1 A LYS 402 ? CE  ? A LYS 85  CE  
22 1 Y 1 A LYS 402 ? NZ  ? A LYS 85  NZ  
23 1 Y 1 A GLN 449 ? CD  ? A GLN 132 CD  
24 1 Y 1 A GLN 449 ? OE1 ? A GLN 132 OE1 
25 1 Y 1 A GLN 449 ? NE2 ? A GLN 132 NE2 
26 1 Y 1 B LYS 320 ? CG  ? B LYS 3   CG  
27 1 Y 1 B LYS 320 ? CD  ? B LYS 3   CD  
28 1 Y 1 B LYS 320 ? CE  ? B LYS 3   CE  
29 1 Y 1 B LYS 320 ? NZ  ? B LYS 3   NZ  
30 1 Y 1 B GLU 358 ? CG  ? B GLU 41  CG  
31 1 Y 1 B GLU 358 ? CD  ? B GLU 41  CD  
32 1 Y 1 B GLU 358 ? OE1 ? B GLU 41  OE1 
33 1 Y 1 B GLU 358 ? OE2 ? B GLU 41  OE2 
34 1 Y 1 B LYS 375 ? CE  ? B LYS 58  CE  
35 1 Y 1 B LYS 375 ? NZ  ? B LYS 58  NZ  
36 1 Y 1 B LYS 402 ? CD  ? B LYS 85  CD  
37 1 Y 1 B LYS 402 ? CE  ? B LYS 85  CE  
38 1 Y 1 B LYS 402 ? NZ  ? B LYS 85  NZ  
39 1 Y 1 B ALA 450 ? C   ? B ALA 133 C   
40 1 Y 1 B ALA 450 ? O   ? B ALA 133 O   
41 1 Y 1 B ALA 450 ? CB  ? B ALA 133 CB  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A LYS 451 ? A LYS 134 
2  1 Y 1 A LYS 452 ? A LYS 135 
3  1 Y 1 A LYS 453 ? A LYS 136 
4  1 Y 1 A SER 454 ? A SER 137 
5  1 Y 1 A GLY 455 ? A GLY 138 
6  1 Y 1 A ASN 456 ? A ASN 139 
7  1 Y 1 A SER 457 ? A SER 140 
8  1 Y 1 A MET 458 ? A MET 141 
9  1 Y 1 A ASP 459 ? A ASP 142 
10 1 Y 1 A ARG 460 ? A ARG 143 
11 1 Y 1 A ARG 461 ? A ARG 144 
12 1 Y 1 A THR 462 ? A THR 145 
13 1 Y 1 A SER 463 ? A SER 146 
14 1 Y 1 B LYS 451 ? B LYS 134 
15 1 Y 1 B LYS 452 ? B LYS 135 
16 1 Y 1 B LYS 453 ? B LYS 136 
17 1 Y 1 B SER 454 ? B SER 137 
18 1 Y 1 B GLY 455 ? B GLY 138 
19 1 Y 1 B ASN 456 ? B ASN 139 
20 1 Y 1 B SER 457 ? B SER 140 
21 1 Y 1 B MET 458 ? B MET 141 
22 1 Y 1 B ASP 459 ? B ASP 142 
23 1 Y 1 B ARG 460 ? B ARG 143 
24 1 Y 1 B ARG 461 ? B ARG 144 
25 1 Y 1 B THR 462 ? B THR 145 
26 1 Y 1 B SER 463 ? B SER 146 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'CHLORIDE ION' CL  
3 water          HOH 
#