data_2AF0
# 
_entry.id   2AF0 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2AF0         
RCSB  RCSB033815   
WWPDB D_1000033815 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2AF0 
_pdbx_database_status.recvd_initial_deposition_date   2005-07-25 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Papagrigoriou, E.'                    1  
'Johannson, C.'                        2  
'Phillips, C.'                         3  
'Smee, C.'                             4  
'Elkins, J.M.'                         5  
'Weigelt, J.'                          6  
'Arrowsmith, C.'                       7  
'Edwards, A.'                          8  
'Sundstrom, M.'                        9  
'Von Delft, F.'                        10 
'Doyle, D.A.'                          11 
'Structural Genomics Consortium (SGC)' 12 
# 
_citation.id                        primary 
_citation.title                     
'Structural diversity in the RGS domain and its interaction with heterotrimeric G protein alpha-subunits.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.Usa 
_citation.journal_volume            105 
_citation.page_first                6457 
_citation.page_last                 6462 
_citation.year                      2008 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18434541 
_citation.pdbx_database_id_DOI      10.1073/pnas.0801508105 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Soundararajan, M.' 1  
primary 'Willard, F.S.'     2  
primary 'Kimple, A.J.'      3  
primary 'Turnbull, A.P.'    4  
primary 'Ball, L.J.'        5  
primary 'Schoch, G.A.'      6  
primary 'Gileadi, C.'       7  
primary 'Fedorov, O.Y.'     8  
primary 'Dowler, E.F.'      9  
primary 'Higman, V.A.'      10 
primary 'Hutsell, S.Q.'     11 
primary 'Sundstrom, M.'     12 
primary 'Doyle, D.A.'       13 
primary 'Siderovski, D.P.'  14 
# 
_cell.entry_id           2AF0 
_cell.length_a           43.754 
_cell.length_b           43.754 
_cell.length_c           158.451 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2AF0 
_symmetry.space_group_name_H-M             'P 43 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                96 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Regulator of G-protein signaling 2' 16994.148 1  ? ? 'residues 71-203' ? 
2 water   nat water                                18.015    17 ? ? ?                 ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'RGS2, G0/G1 switch regulatory protein 8' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;ADLGTENLYFQSMKPSPEEAQLWSEAFDELLASKYGLAAFRAFLKSEFCEENIEFWLACEDFKKTKSPQKLSSKARKIYT
DFIEKEAPKEINIDFQTKTLIAQNIQEATSGCFTTAQKRVYSLMENNSYPRFLESEFYQDLCKKPQ
;
_entity_poly.pdbx_seq_one_letter_code_can   
;ADLGTENLYFQSMKPSPEEAQLWSEAFDELLASKYGLAAFRAFLKSEFCEENIEFWLACEDFKKTKSPQKLSSKARKIYT
DFIEKEAPKEINIDFQTKTLIAQNIQEATSGCFTTAQKRVYSLMENNSYPRFLESEFYQDLCKKPQ
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   ASP n 
1 3   LEU n 
1 4   GLY n 
1 5   THR n 
1 6   GLU n 
1 7   ASN n 
1 8   LEU n 
1 9   TYR n 
1 10  PHE n 
1 11  GLN n 
1 12  SER n 
1 13  MET n 
1 14  LYS n 
1 15  PRO n 
1 16  SER n 
1 17  PRO n 
1 18  GLU n 
1 19  GLU n 
1 20  ALA n 
1 21  GLN n 
1 22  LEU n 
1 23  TRP n 
1 24  SER n 
1 25  GLU n 
1 26  ALA n 
1 27  PHE n 
1 28  ASP n 
1 29  GLU n 
1 30  LEU n 
1 31  LEU n 
1 32  ALA n 
1 33  SER n 
1 34  LYS n 
1 35  TYR n 
1 36  GLY n 
1 37  LEU n 
1 38  ALA n 
1 39  ALA n 
1 40  PHE n 
1 41  ARG n 
1 42  ALA n 
1 43  PHE n 
1 44  LEU n 
1 45  LYS n 
1 46  SER n 
1 47  GLU n 
1 48  PHE n 
1 49  CYS n 
1 50  GLU n 
1 51  GLU n 
1 52  ASN n 
1 53  ILE n 
1 54  GLU n 
1 55  PHE n 
1 56  TRP n 
1 57  LEU n 
1 58  ALA n 
1 59  CYS n 
1 60  GLU n 
1 61  ASP n 
1 62  PHE n 
1 63  LYS n 
1 64  LYS n 
1 65  THR n 
1 66  LYS n 
1 67  SER n 
1 68  PRO n 
1 69  GLN n 
1 70  LYS n 
1 71  LEU n 
1 72  SER n 
1 73  SER n 
1 74  LYS n 
1 75  ALA n 
1 76  ARG n 
1 77  LYS n 
1 78  ILE n 
1 79  TYR n 
1 80  THR n 
1 81  ASP n 
1 82  PHE n 
1 83  ILE n 
1 84  GLU n 
1 85  LYS n 
1 86  GLU n 
1 87  ALA n 
1 88  PRO n 
1 89  LYS n 
1 90  GLU n 
1 91  ILE n 
1 92  ASN n 
1 93  ILE n 
1 94  ASP n 
1 95  PHE n 
1 96  GLN n 
1 97  THR n 
1 98  LYS n 
1 99  THR n 
1 100 LEU n 
1 101 ILE n 
1 102 ALA n 
1 103 GLN n 
1 104 ASN n 
1 105 ILE n 
1 106 GLN n 
1 107 GLU n 
1 108 ALA n 
1 109 THR n 
1 110 SER n 
1 111 GLY n 
1 112 CYS n 
1 113 PHE n 
1 114 THR n 
1 115 THR n 
1 116 ALA n 
1 117 GLN n 
1 118 LYS n 
1 119 ARG n 
1 120 VAL n 
1 121 TYR n 
1 122 SER n 
1 123 LEU n 
1 124 MET n 
1 125 GLU n 
1 126 ASN n 
1 127 ASN n 
1 128 SER n 
1 129 TYR n 
1 130 PRO n 
1 131 ARG n 
1 132 PHE n 
1 133 LEU n 
1 134 GLU n 
1 135 SER n 
1 136 GLU n 
1 137 PHE n 
1 138 TYR n 
1 139 GLN n 
1 140 ASP n 
1 141 LEU n 
1 142 CYS n 
1 143 LYS n 
1 144 LYS n 
1 145 PRO n 
1 146 GLN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    RGS2_HUMAN 
_struct_ref.pdbx_db_accession          P41220 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;KPSPEEAQLWSEAFDELLASKYGLAAFRAFLKSEFCEENIEFWLACEDFKKTKSPQKLSSKARKIYTDFIEKEAPKEINI
DFQTKTLIAQNIQEATSGCFTTAQKRVYSLMENNSYPRFLESEFYQDLCKKPQ
;
_struct_ref.pdbx_align_begin           71 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2AF0 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 14 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 146 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P41220 
_struct_ref_seq.db_align_beg                  71 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  203 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       71 
_struct_ref_seq.pdbx_auth_seq_align_end       203 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2AF0 ALA A 1  ? UNP P41220 ? ? 'CLONING ARTIFACT' 58 1  
1 2AF0 ASP A 2  ? UNP P41220 ? ? 'CLONING ARTIFACT' 59 2  
1 2AF0 LEU A 3  ? UNP P41220 ? ? 'CLONING ARTIFACT' 60 3  
1 2AF0 GLY A 4  ? UNP P41220 ? ? 'CLONING ARTIFACT' 61 4  
1 2AF0 THR A 5  ? UNP P41220 ? ? 'CLONING ARTIFACT' 62 5  
1 2AF0 GLU A 6  ? UNP P41220 ? ? 'CLONING ARTIFACT' 63 6  
1 2AF0 ASN A 7  ? UNP P41220 ? ? 'CLONING ARTIFACT' 64 7  
1 2AF0 LEU A 8  ? UNP P41220 ? ? 'CLONING ARTIFACT' 65 8  
1 2AF0 TYR A 9  ? UNP P41220 ? ? 'CLONING ARTIFACT' 66 9  
1 2AF0 PHE A 10 ? UNP P41220 ? ? 'CLONING ARTIFACT' 67 10 
1 2AF0 GLN A 11 ? UNP P41220 ? ? 'CLONING ARTIFACT' 68 11 
1 2AF0 SER A 12 ? UNP P41220 ? ? 'CLONING ARTIFACT' 69 12 
1 2AF0 MET A 13 ? UNP P41220 ? ? 'CLONING ARTIFACT' 70 13 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2AF0 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.0 
_exptl_crystal.density_percent_sol   37.9 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    '(NH4)2SO4,  NaCl, cacodylate, pH 6.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2005-06-10 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97730 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X10SA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X10SA 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.97730 
# 
_reflns.entry_id                     2AF0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.d_resolution_high            2.3 
_reflns.d_resolution_low             36.9 
_reflns.number_all                   7531 
_reflns.number_obs                   7422 
_reflns.percent_possible_obs         98.6 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.3 
_reflns_shell.d_res_low              2.38 
_reflns_shell.percent_possible_all   99.7 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 2AF0 
_refine.ls_number_reflns_obs                     6833 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             33.69 
_refine.ls_d_res_high                            2.30 
_refine.ls_percent_reflns_obs                    96.54 
_refine.ls_R_factor_obs                          0.22721 
_refine.ls_R_factor_all                          0.2721 
_refine.ls_R_factor_R_work                       0.22575 
_refine.ls_R_factor_R_free                       0.2561 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.8 
_refine.ls_number_reflns_R_free                  345 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.948 
_refine.correlation_coeff_Fo_to_Fc_free          0.946 
_refine.B_iso_mean                               55.407 
_refine.aniso_B[1][1]                            3.24 
_refine.aniso_B[2][2]                            3.24 
_refine.aniso_B[3][3]                            -6.47 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.394 
_refine.pdbx_overall_ESU_R_Free                  0.251 
_refine.overall_SU_ML                            0.233 
_refine.overall_SU_B                             22.428 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1149 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             17 
_refine_hist.number_atoms_total               1166 
_refine_hist.d_res_high                       2.30 
_refine_hist.d_res_low                        33.69 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.012  0.022  ? 1176 'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.001  0.020  ? 1008 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.248  1.952  ? 1592 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            0.829  3.000  ? 2349 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.543  5.000  ? 145  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       41.306 25.088 ? 57   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       16.832 15.000 ? 191  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       11.876 15.000 ? 4    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.068  0.200  ? 171  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.004  0.020  ? 1325 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.001  0.020  ? 249  'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.217  0.200  ? 274  'X-RAY DIFFRACTION' ? 
r_nbd_other                  0.174  0.200  ? 937  'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.189  0.200  ? 594  'X-RAY DIFFRACTION' ? 
r_nbtor_other                0.087  0.200  ? 590  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.154  0.200  ? 25   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.270  0.200  ? 9    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         0.197  0.200  ? 37   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.080  0.200  ? 3    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.533  1.500  ? 755  'X-RAY DIFFRACTION' ? 
r_mcbond_other               0.105  1.500  ? 291  'X-RAY DIFFRACTION' ? 
r_mcangle_it                 0.937  2.000  ? 1169 'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.331  3.000  ? 489  'X-RAY DIFFRACTION' ? 
r_scangle_it                 2.103  4.500  ? 423  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.300 
_refine_ls_shell.d_res_low                        2.359 
_refine_ls_shell.number_reflns_R_work             478 
_refine_ls_shell.R_factor_R_work                  0.294 
_refine_ls_shell.percent_reflns_obs               100.00 
_refine_ls_shell.R_factor_R_free                  0.287 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             31 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  2AF0 
_struct.title                     'Structure of the Regulator of G-Protein Signaling Domain of RGS2' 
_struct.pdbx_descriptor           'Regulator of G-protein signaling 2' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2AF0 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            'HELIX, Structural Genomics, Structural Genomics Consortium, SGC, SIGNALING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY A 4   ? MET A 13  ? GLY A 61  MET A 70  1 ? 10 
HELX_P HELX_P2  2  SER A 16  ? TRP A 23  ? SER A 73  TRP A 80  1 ? 8  
HELX_P HELX_P3  3  ALA A 26  ? SER A 33  ? ALA A 83  SER A 90  1 ? 8  
HELX_P HELX_P4  4  SER A 33  ? GLU A 47  ? SER A 90  GLU A 104 1 ? 15 
HELX_P HELX_P5  5  GLU A 50  ? LYS A 64  ? GLU A 107 LYS A 121 1 ? 15 
HELX_P HELX_P6  6  SER A 67  ? ILE A 83  ? SER A 124 ILE A 140 1 ? 17 
HELX_P HELX_P7  7  ASP A 94  ? ILE A 105 ? ASP A 151 ILE A 162 1 ? 12 
HELX_P HELX_P8  8  GLN A 106 ? ALA A 108 ? GLN A 163 ALA A 165 5 ? 3  
HELX_P HELX_P9  9  PHE A 113 ? ASN A 127 ? PHE A 170 ASN A 184 1 ? 15 
HELX_P HELX_P10 10 ASN A 127 ? SER A 135 ? ASN A 184 SER A 192 1 ? 9  
HELX_P HELX_P11 11 SER A 135 ? LYS A 143 ? SER A 192 LYS A 200 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_database_PDB_matrix.entry_id          2AF0 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2AF0 
_atom_sites.fract_transf_matrix[1][1]   0.022855 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.022855 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006311 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ALA A 1 1   ? 14.700  10.483  14.289  1.00 74.75 ? 58  ALA A N   1 
ATOM   2    C CA  . ALA A 1 1   ? 14.088  10.434  12.930  1.00 74.79 ? 58  ALA A CA  1 
ATOM   3    C C   . ALA A 1 1   ? 12.718  11.145  12.901  1.00 74.64 ? 58  ALA A C   1 
ATOM   4    O O   . ALA A 1 1   ? 12.403  11.922  13.807  1.00 74.75 ? 58  ALA A O   1 
ATOM   5    C CB  . ALA A 1 1   ? 13.982  8.969   12.454  1.00 74.97 ? 58  ALA A CB  1 
ATOM   6    N N   . ASP A 1 2   ? 11.920  10.883  11.861  1.00 74.27 ? 59  ASP A N   1 
ATOM   7    C CA  . ASP A 1 2   ? 10.649  11.577  11.616  1.00 73.75 ? 59  ASP A CA  1 
ATOM   8    C C   . ASP A 1 2   ? 9.471   10.662  11.978  1.00 72.99 ? 59  ASP A C   1 
ATOM   9    O O   . ASP A 1 2   ? 9.382   9.539   11.486  1.00 72.76 ? 59  ASP A O   1 
ATOM   10   C CB  . ASP A 1 2   ? 10.585  11.982  10.127  1.00 73.86 ? 59  ASP A CB  1 
ATOM   11   C CG  . ASP A 1 2   ? 9.536   13.050  9.829   1.00 74.37 ? 59  ASP A CG  1 
ATOM   12   O OD1 . ASP A 1 2   ? 8.664   12.798  8.972   1.00 75.26 ? 59  ASP A OD1 1 
ATOM   13   O OD2 . ASP A 1 2   ? 9.585   14.149  10.421  1.00 75.10 ? 59  ASP A OD2 1 
ATOM   14   N N   . LEU A 1 3   ? 8.598   11.134  12.869  1.00 72.15 ? 60  LEU A N   1 
ATOM   15   C CA  . LEU A 1 3   ? 7.272   10.529  13.088  1.00 71.40 ? 60  LEU A CA  1 
ATOM   16   C C   . LEU A 1 3   ? 6.167   11.430  12.508  1.00 70.59 ? 60  LEU A C   1 
ATOM   17   O O   . LEU A 1 3   ? 5.068   11.529  13.075  1.00 70.82 ? 60  LEU A O   1 
ATOM   18   C CB  . LEU A 1 3   ? 7.023   10.281  14.584  1.00 71.33 ? 60  LEU A CB  1 
ATOM   19   N N   . GLY A 1 4   ? 6.472   12.092  11.387  1.00 69.34 ? 61  GLY A N   1 
ATOM   20   C CA  . GLY A 1 4   ? 5.526   12.976  10.702  1.00 68.15 ? 61  GLY A CA  1 
ATOM   21   C C   . GLY A 1 4   ? 4.540   12.158  9.888   1.00 66.90 ? 61  GLY A C   1 
ATOM   22   O O   . GLY A 1 4   ? 4.846   11.035  9.479   1.00 66.72 ? 61  GLY A O   1 
ATOM   23   N N   . THR A 1 5   ? 3.360   12.719  9.639   1.00 65.29 ? 62  THR A N   1 
ATOM   24   C CA  . THR A 1 5   ? 2.281   11.949  9.033   1.00 63.97 ? 62  THR A CA  1 
ATOM   25   C C   . THR A 1 5   ? 2.692   11.392  7.676   1.00 63.37 ? 62  THR A C   1 
ATOM   26   O O   . THR A 1 5   ? 2.458   10.217  7.389   1.00 62.73 ? 62  THR A O   1 
ATOM   27   C CB  . THR A 1 5   ? 0.988   12.756  8.913   1.00 63.52 ? 62  THR A CB  1 
ATOM   28   O OG1 . THR A 1 5   ? 0.694   13.377  10.163  1.00 62.16 ? 62  THR A OG1 1 
ATOM   29   C CG2 . THR A 1 5   ? -0.165  11.847  8.561   1.00 63.27 ? 62  THR A CG2 1 
ATOM   30   N N   . GLU A 1 6   ? 3.338   12.235  6.872   1.00 62.89 ? 63  GLU A N   1 
ATOM   31   C CA  . GLU A 1 6   ? 3.768   11.876  5.517   1.00 62.64 ? 63  GLU A CA  1 
ATOM   32   C C   . GLU A 1 6   ? 4.685   10.651  5.548   1.00 61.99 ? 63  GLU A C   1 
ATOM   33   O O   . GLU A 1 6   ? 4.433   9.656   4.873   1.00 61.42 ? 63  GLU A O   1 
ATOM   34   C CB  . GLU A 1 6   ? 4.500   13.055  4.856   1.00 62.73 ? 63  GLU A CB  1 
ATOM   35   C CG  . GLU A 1 6   ? 3.629   14.298  4.569   1.00 63.93 ? 63  GLU A CG  1 
ATOM   36   C CD  . GLU A 1 6   ? 3.638   15.387  5.678   1.00 65.15 ? 63  GLU A CD  1 
ATOM   37   O OE1 . GLU A 1 6   ? 3.881   15.072  6.870   1.00 64.43 ? 63  GLU A OE1 1 
ATOM   38   O OE2 . GLU A 1 6   ? 3.371   16.574  5.345   1.00 65.59 ? 63  GLU A OE2 1 
ATOM   39   N N   . ASN A 1 7   ? 5.738   10.738  6.356   1.00 61.61 ? 64  ASN A N   1 
ATOM   40   C CA  . ASN A 1 7   ? 6.729   9.670   6.491   1.00 61.23 ? 64  ASN A CA  1 
ATOM   41   C C   . ASN A 1 7   ? 6.132   8.391   7.035   1.00 60.69 ? 64  ASN A C   1 
ATOM   42   O O   . ASN A 1 7   ? 6.448   7.319   6.550   1.00 60.46 ? 64  ASN A O   1 
ATOM   43   C CB  . ASN A 1 7   ? 7.883   10.115  7.398   1.00 61.35 ? 64  ASN A CB  1 
ATOM   44   C CG  . ASN A 1 7   ? 8.958   9.048   7.551   1.00 62.39 ? 64  ASN A CG  1 
ATOM   45   O OD1 . ASN A 1 7   ? 9.426   8.772   8.660   1.00 64.16 ? 64  ASN A OD1 1 
ATOM   46   N ND2 . ASN A 1 7   ? 9.344   8.432   6.437   1.00 62.97 ? 64  ASN A ND2 1 
ATOM   47   N N   . LEU A 1 8   ? 5.276   8.491   8.047   1.00 60.37 ? 65  LEU A N   1 
ATOM   48   C CA  . LEU A 1 8   ? 4.627   7.288   8.582   1.00 60.30 ? 65  LEU A CA  1 
ATOM   49   C C   . LEU A 1 8   ? 3.785   6.589   7.515   1.00 59.73 ? 65  LEU A C   1 
ATOM   50   O O   . LEU A 1 8   ? 3.889   5.382   7.346   1.00 59.24 ? 65  LEU A O   1 
ATOM   51   C CB  . LEU A 1 8   ? 3.771   7.600   9.819   1.00 60.38 ? 65  LEU A CB  1 
ATOM   52   C CG  . LEU A 1 8   ? 4.559   8.047   11.040  1.00 60.95 ? 65  LEU A CG  1 
ATOM   53   C CD1 . LEU A 1 8   ? 3.645   8.503   12.162  1.00 61.52 ? 65  LEU A CD1 1 
ATOM   54   C CD2 . LEU A 1 8   ? 5.475   6.936   11.520  1.00 62.88 ? 65  LEU A CD2 1 
ATOM   55   N N   . TYR A 1 9   ? 2.971   7.354   6.791   1.00 59.20 ? 66  TYR A N   1 
ATOM   56   C CA  . TYR A 1 9   ? 2.220   6.809   5.663   1.00 59.27 ? 66  TYR A CA  1 
ATOM   57   C C   . TYR A 1 9   ? 3.141   5.967   4.745   1.00 58.91 ? 66  TYR A C   1 
ATOM   58   O O   . TYR A 1 9   ? 2.871   4.785   4.477   1.00 58.52 ? 66  TYR A O   1 
ATOM   59   C CB  . TYR A 1 9   ? 1.533   7.944   4.881   1.00 59.48 ? 66  TYR A CB  1 
ATOM   60   C CG  . TYR A 1 9   ? 0.573   7.501   3.790   1.00 59.79 ? 66  TYR A CG  1 
ATOM   61   C CD1 . TYR A 1 9   ? -0.551  6.751   4.095   1.00 60.00 ? 66  TYR A CD1 1 
ATOM   62   C CD2 . TYR A 1 9   ? 0.773   7.872   2.451   1.00 60.70 ? 66  TYR A CD2 1 
ATOM   63   C CE1 . TYR A 1 9   ? -1.449  6.353   3.100   1.00 60.96 ? 66  TYR A CE1 1 
ATOM   64   C CE2 . TYR A 1 9   ? -0.118  7.480   1.445   1.00 60.99 ? 66  TYR A CE2 1 
ATOM   65   C CZ  . TYR A 1 9   ? -1.233  6.715   1.778   1.00 61.49 ? 66  TYR A CZ  1 
ATOM   66   O OH  . TYR A 1 9   ? -2.152  6.318   0.813   1.00 60.76 ? 66  TYR A OH  1 
ATOM   67   N N   . PHE A 1 10  ? 4.235   6.572   4.298   1.00 58.52 ? 67  PHE A N   1 
ATOM   68   C CA  . PHE A 1 10  ? 5.179   5.886   3.418   1.00 58.69 ? 67  PHE A CA  1 
ATOM   69   C C   . PHE A 1 10  ? 5.810   4.636   4.055   1.00 58.70 ? 67  PHE A C   1 
ATOM   70   O O   . PHE A 1 10  ? 5.945   3.609   3.384   1.00 58.77 ? 67  PHE A O   1 
ATOM   71   C CB  . PHE A 1 10  ? 6.237   6.860   2.880   1.00 58.83 ? 67  PHE A CB  1 
ATOM   72   C CG  . PHE A 1 10  ? 5.675   7.886   1.911   1.00 58.79 ? 67  PHE A CG  1 
ATOM   73   C CD1 . PHE A 1 10  ? 5.787   9.251   2.162   1.00 59.13 ? 67  PHE A CD1 1 
ATOM   74   C CD2 . PHE A 1 10  ? 5.015   7.481   0.759   1.00 59.10 ? 67  PHE A CD2 1 
ATOM   75   C CE1 . PHE A 1 10  ? 5.268   10.192  1.273   1.00 59.26 ? 67  PHE A CE1 1 
ATOM   76   C CE2 . PHE A 1 10  ? 4.499   8.415   -0.141  1.00 59.47 ? 67  PHE A CE2 1 
ATOM   77   C CZ  . PHE A 1 10  ? 4.621   9.772   0.122   1.00 59.41 ? 67  PHE A CZ  1 
ATOM   78   N N   . GLN A 1 11  ? 6.131   4.701   5.347   1.00 58.72 ? 68  GLN A N   1 
ATOM   79   C CA  . GLN A 1 11  ? 6.658   3.545   6.080   1.00 58.80 ? 68  GLN A CA  1 
ATOM   80   C C   . GLN A 1 11  ? 5.644   2.414   6.228   1.00 58.79 ? 68  GLN A C   1 
ATOM   81   O O   . GLN A 1 11  ? 6.022   1.224   6.315   1.00 59.46 ? 68  GLN A O   1 
ATOM   82   C CB  . GLN A 1 11  ? 7.123   3.974   7.472   1.00 58.98 ? 68  GLN A CB  1 
ATOM   83   C CG  . GLN A 1 11  ? 8.276   4.948   7.445   1.00 60.74 ? 68  GLN A CG  1 
ATOM   84   C CD  . GLN A 1 11  ? 9.370   4.522   6.473   1.00 62.96 ? 68  GLN A CD  1 
ATOM   85   O OE1 . GLN A 1 11  ? 10.002  3.477   6.656   1.00 65.67 ? 68  GLN A OE1 1 
ATOM   86   N NE2 . GLN A 1 11  ? 9.579   5.315   5.426   1.00 63.04 ? 68  GLN A NE2 1 
ATOM   87   N N   . SER A 1 12  ? 4.365   2.786   6.257   1.00 58.19 ? 69  SER A N   1 
ATOM   88   C CA  . SER A 1 12  ? 3.273   1.837   6.438   1.00 57.84 ? 69  SER A CA  1 
ATOM   89   C C   . SER A 1 12  ? 3.096   0.954   5.222   1.00 57.88 ? 69  SER A C   1 
ATOM   90   O O   . SER A 1 12  ? 2.476   -0.117  5.315   1.00 58.34 ? 69  SER A O   1 
ATOM   91   C CB  . SER A 1 12  ? 1.942   2.559   6.736   1.00 57.80 ? 69  SER A CB  1 
ATOM   92   O OG  . SER A 1 12  ? 1.272   3.030   5.558   1.00 56.50 ? 69  SER A OG  1 
ATOM   93   N N   . MET A 1 13  ? 3.587   1.420   4.078   1.00 57.86 ? 70  MET A N   1 
ATOM   94   C CA  . MET A 1 13  ? 3.499   0.656   2.838   1.00 57.89 ? 70  MET A CA  1 
ATOM   95   C C   . MET A 1 13  ? 4.814   -0.050  2.490   1.00 57.80 ? 70  MET A C   1 
ATOM   96   O O   . MET A 1 13  ? 4.879   -0.771  1.500   1.00 57.95 ? 70  MET A O   1 
ATOM   97   C CB  . MET A 1 13  ? 3.030   1.538   1.676   1.00 58.05 ? 70  MET A CB  1 
ATOM   98   N N   . LYS A 1 14  ? 5.851   0.137   3.300   1.00 57.48 ? 71  LYS A N   1 
ATOM   99   C CA  . LYS A 1 14  ? 7.054   -0.660  3.136   1.00 57.33 ? 71  LYS A CA  1 
ATOM   100  C C   . LYS A 1 14  ? 6.869   -1.996  3.859   1.00 56.64 ? 71  LYS A C   1 
ATOM   101  O O   . LYS A 1 14  ? 6.365   -2.038  4.976   1.00 56.89 ? 71  LYS A O   1 
ATOM   102  C CB  . LYS A 1 14  ? 8.314   0.058   3.661   1.00 57.19 ? 71  LYS A CB  1 
ATOM   103  C CG  . LYS A 1 14  ? 8.876   1.098   2.706   1.00 57.45 ? 71  LYS A CG  1 
ATOM   104  C CD  . LYS A 1 14  ? 10.338  1.465   3.019   1.00 57.67 ? 71  LYS A CD  1 
ATOM   105  N N   . PRO A 1 15  ? 7.316   -3.095  3.234   1.00 55.88 ? 72  PRO A N   1 
ATOM   106  C CA  . PRO A 1 15  ? 7.357   -4.369  3.945   1.00 54.84 ? 72  PRO A CA  1 
ATOM   107  C C   . PRO A 1 15  ? 8.433   -4.276  5.005   1.00 54.06 ? 72  PRO A C   1 
ATOM   108  O O   . PRO A 1 15  ? 9.256   -3.364  4.957   1.00 53.31 ? 72  PRO A O   1 
ATOM   109  C CB  . PRO A 1 15  ? 7.787   -5.347  2.851   1.00 55.06 ? 72  PRO A CB  1 
ATOM   110  C CG  . PRO A 1 15  ? 8.603   -4.520  1.913   1.00 54.79 ? 72  PRO A CG  1 
ATOM   111  C CD  . PRO A 1 15  ? 7.874   -3.213  1.872   1.00 55.73 ? 72  PRO A CD  1 
ATOM   112  N N   . SER A 1 16  ? 8.425   -5.185  5.970   1.00 53.35 ? 73  SER A N   1 
ATOM   113  C CA  . SER A 1 16  ? 9.588   -5.335  6.837   1.00 53.16 ? 73  SER A CA  1 
ATOM   114  C C   . SER A 1 16  ? 10.739  -5.969  6.027   1.00 51.93 ? 73  SER A C   1 
ATOM   115  O O   . SER A 1 16  ? 10.499  -6.681  5.073   1.00 51.05 ? 73  SER A O   1 
ATOM   116  C CB  . SER A 1 16  ? 9.241   -6.178  8.072   1.00 53.36 ? 73  SER A CB  1 
ATOM   117  O OG  . SER A 1 16  ? 8.852   -7.496  7.709   1.00 55.24 ? 73  SER A OG  1 
ATOM   118  N N   . PRO A 1 17  ? 11.995  -5.687  6.391   1.00 51.43 ? 74  PRO A N   1 
ATOM   119  C CA  . PRO A 1 17  ? 13.123  -6.421  5.802   1.00 51.19 ? 74  PRO A CA  1 
ATOM   120  C C   . PRO A 1 17  ? 12.927  -7.931  5.796   1.00 50.92 ? 74  PRO A C   1 
ATOM   121  O O   . PRO A 1 17  ? 13.227  -8.607  4.810   1.00 50.90 ? 74  PRO A O   1 
ATOM   122  C CB  . PRO A 1 17  ? 14.279  -6.055  6.726   1.00 51.15 ? 74  PRO A CB  1 
ATOM   123  C CG  . PRO A 1 17  ? 13.970  -4.687  7.140   1.00 51.68 ? 74  PRO A CG  1 
ATOM   124  C CD  . PRO A 1 17  ? 12.460  -4.632  7.302   1.00 51.21 ? 74  PRO A CD  1 
ATOM   125  N N   . GLU A 1 18  ? 12.404  -8.426  6.912   1.00 50.88 ? 75  GLU A N   1 
ATOM   126  C CA  . GLU A 1 18  ? 12.169  -9.853  7.149   1.00 50.45 ? 75  GLU A CA  1 
ATOM   127  C C   . GLU A 1 18  ? 11.294  -10.458 6.089   1.00 50.38 ? 75  GLU A C   1 
ATOM   128  O O   . GLU A 1 18  ? 11.668  -11.439 5.468   1.00 50.42 ? 75  GLU A O   1 
ATOM   129  C CB  . GLU A 1 18  ? 11.533  -10.047 8.534   1.00 50.71 ? 75  GLU A CB  1 
ATOM   130  C CG  . GLU A 1 18  ? 12.536  -9.905  9.689   1.00 50.57 ? 75  GLU A CG  1 
ATOM   131  C CD  . GLU A 1 18  ? 12.871  -8.456  10.050  1.00 51.58 ? 75  GLU A CD  1 
ATOM   132  O OE1 . GLU A 1 18  ? 13.817  -8.263  10.833  1.00 51.97 ? 75  GLU A OE1 1 
ATOM   133  O OE2 . GLU A 1 18  ? 12.201  -7.518  9.554   1.00 52.36 ? 75  GLU A OE2 1 
ATOM   134  N N   . GLU A 1 19  ? 10.146  -9.832  5.838   1.00 50.62 ? 76  GLU A N   1 
ATOM   135  C CA  . GLU A 1 19  ? 9.216   -10.352 4.844   1.00 50.31 ? 76  GLU A CA  1 
ATOM   136  C C   . GLU A 1 19  ? 9.724   -10.229 3.410   1.00 49.84 ? 76  GLU A C   1 
ATOM   137  O O   . GLU A 1 19  ? 9.613   -11.176 2.650   1.00 48.91 ? 76  GLU A O   1 
ATOM   138  C CB  . GLU A 1 19  ? 7.822   -9.754  5.024   1.00 50.58 ? 76  GLU A CB  1 
ATOM   139  C CG  . GLU A 1 19  ? 7.609   -8.330  4.547   1.00 51.15 ? 76  GLU A CG  1 
ATOM   140  C CD  . GLU A 1 19  ? 6.159   -7.882  4.798   1.00 51.29 ? 76  GLU A CD  1 
ATOM   141  O OE1 . GLU A 1 19  ? 5.256   -8.492  4.181   1.00 52.76 ? 76  GLU A OE1 1 
ATOM   142  O OE2 . GLU A 1 19  ? 5.928   -6.944  5.594   1.00 50.04 ? 76  GLU A OE2 1 
ATOM   143  N N   . ALA A 1 20  ? 10.336  -9.096  3.059   1.00 50.21 ? 77  ALA A N   1 
ATOM   144  C CA  . ALA A 1 20  ? 11.009  -8.966  1.758   1.00 50.48 ? 77  ALA A CA  1 
ATOM   145  C C   . ALA A 1 20  ? 12.031  -10.078 1.499   1.00 51.45 ? 77  ALA A C   1 
ATOM   146  O O   . ALA A 1 20  ? 12.029  -10.660 0.415   1.00 52.36 ? 77  ALA A O   1 
ATOM   147  C CB  . ALA A 1 20  ? 11.669  -7.610  1.618   1.00 50.51 ? 77  ALA A CB  1 
ATOM   148  N N   . GLN A 1 21  ? 12.896  -10.389 2.472   1.00 51.71 ? 78  GLN A N   1 
ATOM   149  C CA  . GLN A 1 21  ? 13.863  -11.509 2.293   1.00 51.93 ? 78  GLN A CA  1 
ATOM   150  C C   . GLN A 1 21  ? 13.190  -12.819 1.832   1.00 52.10 ? 78  GLN A C   1 
ATOM   151  O O   . GLN A 1 21  ? 13.720  -13.519 0.975   1.00 52.30 ? 78  GLN A O   1 
ATOM   152  C CB  . GLN A 1 21  ? 14.703  -11.741 3.553   1.00 51.55 ? 78  GLN A CB  1 
ATOM   153  C CG  . GLN A 1 21  ? 15.947  -10.853 3.614   1.00 52.03 ? 78  GLN A CG  1 
ATOM   154  C CD  . GLN A 1 21  ? 16.554  -10.740 5.008   1.00 51.92 ? 78  GLN A CD  1 
ATOM   155  O OE1 . GLN A 1 21  ? 16.822  -11.753 5.671   1.00 51.74 ? 78  GLN A OE1 1 
ATOM   156  N NE2 . GLN A 1 21  ? 16.775  -9.507  5.457   1.00 49.24 ? 78  GLN A NE2 1 
ATOM   157  N N   . LEU A 1 22  ? 12.005  -13.111 2.350   1.00 51.83 ? 79  LEU A N   1 
ATOM   158  C CA  . LEU A 1 22  ? 11.302  -14.351 2.016   1.00 51.95 ? 79  LEU A CA  1 
ATOM   159  C C   . LEU A 1 22  ? 10.872  -14.489 0.528   1.00 52.30 ? 79  LEU A C   1 
ATOM   160  O O   . LEU A 1 22  ? 10.598  -15.597 0.038   1.00 51.81 ? 79  LEU A O   1 
ATOM   161  C CB  . LEU A 1 22  ? 10.066  -14.510 2.917   1.00 51.60 ? 79  LEU A CB  1 
ATOM   162  C CG  . LEU A 1 22  ? 10.245  -14.598 4.437   1.00 50.99 ? 79  LEU A CG  1 
ATOM   163  C CD1 . LEU A 1 22  ? 8.880   -14.583 5.151   1.00 49.11 ? 79  LEU A CD1 1 
ATOM   164  C CD2 . LEU A 1 22  ? 11.068  -15.825 4.838   1.00 50.21 ? 79  LEU A CD2 1 
ATOM   165  N N   . TRP A 1 23  ? 10.822  -13.365 -0.188  1.00 52.62 ? 80  TRP A N   1 
ATOM   166  C CA  . TRP A 1 23  ? 10.404  -13.350 -1.582  1.00 52.38 ? 80  TRP A CA  1 
ATOM   167  C C   . TRP A 1 23  ? 11.406  -14.045 -2.509  1.00 53.13 ? 80  TRP A C   1 
ATOM   168  O O   . TRP A 1 23  ? 11.100  -14.314 -3.671  1.00 52.90 ? 80  TRP A O   1 
ATOM   169  C CB  . TRP A 1 23  ? 10.162  -11.904 -2.040  1.00 51.91 ? 80  TRP A CB  1 
ATOM   170  C CG  . TRP A 1 23  ? 9.131   -11.162 -1.227  1.00 51.59 ? 80  TRP A CG  1 
ATOM   171  C CD1 . TRP A 1 23  ? 8.146   -11.703 -0.455  1.00 51.05 ? 80  TRP A CD1 1 
ATOM   172  C CD2 . TRP A 1 23  ? 8.969   -9.735  -1.133  1.00 51.59 ? 80  TRP A CD2 1 
ATOM   173  N NE1 . TRP A 1 23  ? 7.389   -10.705 0.119   1.00 50.40 ? 80  TRP A NE1 1 
ATOM   174  C CE2 . TRP A 1 23  ? 7.874   -9.493  -0.280  1.00 50.61 ? 80  TRP A CE2 1 
ATOM   175  C CE3 . TRP A 1 23  ? 9.651   -8.640  -1.678  1.00 51.14 ? 80  TRP A CE3 1 
ATOM   176  C CZ2 . TRP A 1 23  ? 7.460   -8.209  0.052   1.00 51.34 ? 80  TRP A CZ2 1 
ATOM   177  C CZ3 . TRP A 1 23  ? 9.214   -7.353  -1.359  1.00 51.01 ? 80  TRP A CZ3 1 
ATOM   178  C CH2 . TRP A 1 23  ? 8.142   -7.154  -0.500  1.00 50.76 ? 80  TRP A CH2 1 
ATOM   179  N N   . SER A 1 24  ? 12.603  -14.309 -1.990  1.00 54.47 ? 81  SER A N   1 
ATOM   180  C CA  . SER A 1 24  ? 13.657  -15.050 -2.698  1.00 55.73 ? 81  SER A CA  1 
ATOM   181  C C   . SER A 1 24  ? 13.404  -16.570 -2.757  1.00 56.48 ? 81  SER A C   1 
ATOM   182  O O   . SER A 1 24  ? 13.837  -17.236 -3.695  1.00 56.83 ? 81  SER A O   1 
ATOM   183  C CB  . SER A 1 24  ? 15.013  -14.763 -2.026  1.00 55.83 ? 81  SER A CB  1 
ATOM   184  O OG  . SER A 1 24  ? 15.219  -13.352 -1.979  1.00 56.37 ? 81  SER A OG  1 
ATOM   185  N N   . GLU A 1 25  ? 12.706  -17.102 -1.759  1.00 57.22 ? 82  GLU A N   1 
ATOM   186  C CA  . GLU A 1 25  ? 12.322  -18.519 -1.732  1.00 58.18 ? 82  GLU A CA  1 
ATOM   187  C C   . GLU A 1 25  ? 11.639  -19.032 -3.012  1.00 58.28 ? 82  GLU A C   1 
ATOM   188  O O   . GLU A 1 25  ? 12.082  -20.025 -3.586  1.00 59.08 ? 82  GLU A O   1 
ATOM   189  C CB  . GLU A 1 25  ? 11.401  -18.805 -0.531  1.00 58.48 ? 82  GLU A CB  1 
ATOM   190  C CG  . GLU A 1 25  ? 12.153  -19.364 0.679   1.00 60.87 ? 82  GLU A CG  1 
ATOM   191  C CD  . GLU A 1 25  ? 12.267  -20.895 0.660   1.00 62.46 ? 82  GLU A CD  1 
ATOM   192  O OE1 . GLU A 1 25  ? 11.318  -21.559 0.157   1.00 62.72 ? 82  GLU A OE1 1 
ATOM   193  O OE2 . GLU A 1 25  ? 13.302  -21.420 1.156   1.00 62.69 ? 82  GLU A OE2 1 
ATOM   194  N N   . ALA A 1 26  ? 10.558  -18.377 -3.430  1.00 57.76 ? 83  ALA A N   1 
ATOM   195  C CA  . ALA A 1 26  ? 9.804   -18.781 -4.621  1.00 57.72 ? 83  ALA A CA  1 
ATOM   196  C C   . ALA A 1 26  ? 9.021   -17.610 -5.187  1.00 57.37 ? 83  ALA A C   1 
ATOM   197  O O   . ALA A 1 26  ? 8.573   -16.752 -4.447  1.00 57.22 ? 83  ALA A O   1 
ATOM   198  C CB  . ALA A 1 26  ? 8.845   -19.928 -4.299  1.00 57.75 ? 83  ALA A CB  1 
ATOM   199  N N   . PHE A 1 27  ? 8.865   -17.607 -6.507  1.00 57.28 ? 84  PHE A N   1 
ATOM   200  C CA  . PHE A 1 27  ? 8.111   -16.590 -7.239  1.00 57.12 ? 84  PHE A CA  1 
ATOM   201  C C   . PHE A 1 27  ? 6.682   -16.489 -6.678  1.00 57.42 ? 84  PHE A C   1 
ATOM   202  O O   . PHE A 1 27  ? 6.180   -15.387 -6.427  1.00 57.00 ? 84  PHE A O   1 
ATOM   203  C CB  . PHE A 1 27  ? 8.120   -16.962 -8.730  1.00 56.70 ? 84  PHE A CB  1 
ATOM   204  C CG  . PHE A 1 27  ? 7.622   -15.875 -9.667  1.00 57.13 ? 84  PHE A CG  1 
ATOM   205  C CD1 . PHE A 1 27  ? 7.927   -14.539 -9.472  1.00 57.11 ? 84  PHE A CD1 1 
ATOM   206  C CD2 . PHE A 1 27  ? 6.893   -16.212 -10.794 1.00 57.07 ? 84  PHE A CD2 1 
ATOM   207  C CE1 . PHE A 1 27  ? 7.471   -13.561 -10.343 1.00 55.59 ? 84  PHE A CE1 1 
ATOM   208  C CE2 . PHE A 1 27  ? 6.448   -15.220 -11.677 1.00 57.13 ? 84  PHE A CE2 1 
ATOM   209  C CZ  . PHE A 1 27  ? 6.747   -13.906 -11.443 1.00 55.23 ? 84  PHE A CZ  1 
ATOM   210  N N   . ASP A 1 28  ? 6.053   -17.646 -6.442  1.00 57.84 ? 85  ASP A N   1 
ATOM   211  C CA  . ASP A 1 28  ? 4.678   -17.708 -5.934  1.00 58.19 ? 85  ASP A CA  1 
ATOM   212  C C   . ASP A 1 28  ? 4.560   -16.931 -4.636  1.00 57.71 ? 85  ASP A C   1 
ATOM   213  O O   . ASP A 1 28  ? 3.512   -16.384 -4.349  1.00 57.32 ? 85  ASP A O   1 
ATOM   214  C CB  . ASP A 1 28  ? 4.209   -19.140 -5.654  1.00 58.72 ? 85  ASP A CB  1 
ATOM   215  C CG  . ASP A 1 28  ? 4.782   -20.159 -6.613  1.00 61.49 ? 85  ASP A CG  1 
ATOM   216  O OD1 . ASP A 1 28  ? 5.476   -21.090 -6.130  1.00 64.73 ? 85  ASP A OD1 1 
ATOM   217  O OD2 . ASP A 1 28  ? 4.542   -20.033 -7.834  1.00 64.59 ? 85  ASP A OD2 1 
ATOM   218  N N   . GLU A 1 29  ? 5.645   -16.901 -3.864  1.00 57.80 ? 86  GLU A N   1 
ATOM   219  C CA  . GLU A 1 29  ? 5.672   -16.238 -2.554  1.00 58.27 ? 86  GLU A CA  1 
ATOM   220  C C   . GLU A 1 29  ? 5.741   -14.729 -2.673  1.00 57.49 ? 86  GLU A C   1 
ATOM   221  O O   . GLU A 1 29  ? 5.078   -14.032 -1.924  1.00 57.70 ? 86  GLU A O   1 
ATOM   222  C CB  . GLU A 1 29  ? 6.848   -16.734 -1.693  1.00 58.85 ? 86  GLU A CB  1 
ATOM   223  C CG  . GLU A 1 29  ? 6.806   -18.220 -1.356  1.00 60.84 ? 86  GLU A CG  1 
ATOM   224  C CD  . GLU A 1 29  ? 5.427   -18.699 -0.883  1.00 63.74 ? 86  GLU A CD  1 
ATOM   225  O OE1 . GLU A 1 29  ? 4.814   -18.049 0.004   1.00 64.42 ? 86  GLU A OE1 1 
ATOM   226  O OE2 . GLU A 1 29  ? 4.964   -19.735 -1.414  1.00 65.57 ? 86  GLU A OE2 1 
ATOM   227  N N   . LEU A 1 30  ? 6.560   -14.238 -3.598  1.00 57.42 ? 87  LEU A N   1 
ATOM   228  C CA  . LEU A 1 30  ? 6.564   -12.831 -3.988  1.00 57.14 ? 87  LEU A CA  1 
ATOM   229  C C   . LEU A 1 30  ? 5.156   -12.375 -4.379  1.00 57.07 ? 87  LEU A C   1 
ATOM   230  O O   . LEU A 1 30  ? 4.661   -11.370 -3.899  1.00 56.64 ? 87  LEU A O   1 
ATOM   231  C CB  . LEU A 1 30  ? 7.512   -12.644 -5.169  1.00 56.96 ? 87  LEU A CB  1 
ATOM   232  C CG  . LEU A 1 30  ? 7.699   -11.244 -5.761  1.00 56.94 ? 87  LEU A CG  1 
ATOM   233  C CD1 . LEU A 1 30  ? 8.124   -10.260 -4.705  1.00 57.77 ? 87  LEU A CD1 1 
ATOM   234  C CD2 . LEU A 1 30  ? 8.748   -11.252 -6.885  1.00 57.13 ? 87  LEU A CD2 1 
ATOM   235  N N   . LEU A 1 31  ? 4.520   -13.160 -5.242  1.00 57.97 ? 88  LEU A N   1 
ATOM   236  C CA  . LEU A 1 31  ? 3.165   -12.874 -5.784  1.00 58.25 ? 88  LEU A CA  1 
ATOM   237  C C   . LEU A 1 31  ? 2.033   -12.977 -4.774  1.00 57.57 ? 88  LEU A C   1 
ATOM   238  O O   . LEU A 1 31  ? 1.051   -12.261 -4.897  1.00 58.27 ? 88  LEU A O   1 
ATOM   239  C CB  . LEU A 1 31  ? 2.836   -13.836 -6.946  1.00 58.57 ? 88  LEU A CB  1 
ATOM   240  C CG  . LEU A 1 31  ? 3.827   -13.874 -8.121  1.00 59.84 ? 88  LEU A CG  1 
ATOM   241  C CD1 . LEU A 1 31  ? 3.271   -14.706 -9.264  1.00 60.93 ? 88  LEU A CD1 1 
ATOM   242  C CD2 . LEU A 1 31  ? 4.169   -12.479 -8.595  1.00 61.43 ? 88  LEU A CD2 1 
ATOM   243  N N   . ALA A 1 32  ? 2.142   -13.890 -3.812  1.00 56.64 ? 89  ALA A N   1 
ATOM   244  C CA  . ALA A 1 32  ? 1.104   -14.046 -2.795  1.00 56.04 ? 89  ALA A CA  1 
ATOM   245  C C   . ALA A 1 32  ? 1.114   -12.927 -1.744  1.00 55.77 ? 89  ALA A C   1 
ATOM   246  O O   . ALA A 1 32  ? 0.181   -12.815 -0.971  1.00 55.26 ? 89  ALA A O   1 
ATOM   247  C CB  . ALA A 1 32  ? 1.225   -15.408 -2.124  1.00 55.88 ? 89  ALA A CB  1 
ATOM   248  N N   . SER A 1 33  ? 2.185   -12.128 -1.713  1.00 55.77 ? 90  SER A N   1 
ATOM   249  C CA  . SER A 1 33  ? 2.343   -11.006 -0.780  1.00 55.84 ? 90  SER A CA  1 
ATOM   250  C C   . SER A 1 33  ? 1.912   -9.735  -1.458  1.00 56.15 ? 90  SER A C   1 
ATOM   251  O O   . SER A 1 33  ? 2.320   -9.471  -2.574  1.00 56.50 ? 90  SER A O   1 
ATOM   252  C CB  . SER A 1 33  ? 3.825   -10.836 -0.354  1.00 56.33 ? 90  SER A CB  1 
ATOM   253  O OG  . SER A 1 33  ? 4.073   -9.589  0.284   1.00 53.29 ? 90  SER A OG  1 
ATOM   254  N N   . LYS A 1 34  ? 1.123   -8.932  -0.768  1.00 56.38 ? 91  LYS A N   1 
ATOM   255  C CA  . LYS A 1 34  ? 0.658   -7.688  -1.337  1.00 57.01 ? 91  LYS A CA  1 
ATOM   256  C C   . LYS A 1 34  ? 1.826   -6.720  -1.566  1.00 56.83 ? 91  LYS A C   1 
ATOM   257  O O   . LYS A 1 34  ? 1.898   -6.047  -2.600  1.00 56.38 ? 91  LYS A O   1 
ATOM   258  C CB  . LYS A 1 34  ? -0.469  -7.059  -0.476  1.00 57.05 ? 91  LYS A CB  1 
ATOM   259  C CG  . LYS A 1 34  ? -0.094  -6.680  0.939   1.00 57.96 ? 91  LYS A CG  1 
ATOM   260  N N   . TYR A 1 35  ? 2.731   -6.670  -0.600  1.00 57.13 ? 92  TYR A N   1 
ATOM   261  C CA  . TYR A 1 35  ? 3.930   -5.831  -0.686  1.00 57.30 ? 92  TYR A CA  1 
ATOM   262  C C   . TYR A 1 35  ? 4.879   -6.292  -1.781  1.00 56.47 ? 92  TYR A C   1 
ATOM   263  O O   . TYR A 1 35  ? 5.365   -5.471  -2.556  1.00 55.87 ? 92  TYR A O   1 
ATOM   264  C CB  . TYR A 1 35  ? 4.663   -5.774  0.662   1.00 58.00 ? 92  TYR A CB  1 
ATOM   265  C CG  . TYR A 1 35  ? 3.892   -5.035  1.732   1.00 58.92 ? 92  TYR A CG  1 
ATOM   266  C CD1 . TYR A 1 35  ? 3.321   -3.793  1.477   1.00 58.85 ? 92  TYR A CD1 1 
ATOM   267  C CD2 . TYR A 1 35  ? 3.743   -5.570  3.001   1.00 60.14 ? 92  TYR A CD2 1 
ATOM   268  C CE1 . TYR A 1 35  ? 2.638   -3.123  2.428   1.00 58.07 ? 92  TYR A CE1 1 
ATOM   269  C CE2 . TYR A 1 35  ? 3.056   -4.891  3.976   1.00 59.77 ? 92  TYR A CE2 1 
ATOM   270  C CZ  . TYR A 1 35  ? 2.502   -3.662  3.681   1.00 59.97 ? 92  TYR A CZ  1 
ATOM   271  O OH  . TYR A 1 35  ? 1.785   -2.967  4.645   1.00 61.24 ? 92  TYR A OH  1 
ATOM   272  N N   . GLY A 1 36  ? 5.120   -7.603  -1.833  1.00 56.34 ? 93  GLY A N   1 
ATOM   273  C CA  . GLY A 1 36  ? 5.936   -8.243  -2.873  1.00 55.68 ? 93  GLY A CA  1 
ATOM   274  C C   . GLY A 1 36  ? 5.409   -8.022  -4.275  1.00 55.74 ? 93  GLY A C   1 
ATOM   275  O O   . GLY A 1 36  ? 6.186   -7.847  -5.232  1.00 55.66 ? 93  GLY A O   1 
ATOM   276  N N   . LEU A 1 37  ? 4.081   -8.044  -4.399  1.00 55.26 ? 94  LEU A N   1 
ATOM   277  C CA  . LEU A 1 37  ? 3.421   -7.747  -5.662  1.00 54.77 ? 94  LEU A CA  1 
ATOM   278  C C   . LEU A 1 37  ? 3.611   -6.288  -6.074  1.00 53.71 ? 94  LEU A C   1 
ATOM   279  O O   . LEU A 1 37  ? 3.936   -6.012  -7.225  1.00 53.19 ? 94  LEU A O   1 
ATOM   280  C CB  . LEU A 1 37  ? 1.931   -8.061  -5.563  1.00 54.72 ? 94  LEU A CB  1 
ATOM   281  C CG  . LEU A 1 37  ? 1.152   -7.898  -6.859  1.00 55.26 ? 94  LEU A CG  1 
ATOM   282  C CD1 . LEU A 1 37  ? 1.750   -8.753  -7.934  1.00 55.89 ? 94  LEU A CD1 1 
ATOM   283  C CD2 . LEU A 1 37  ? -0.324  -8.282  -6.607  1.00 56.23 ? 94  LEU A CD2 1 
ATOM   284  N N   . ALA A 1 38  ? 3.368   -5.364  -5.140  1.00 52.50 ? 95  ALA A N   1 
ATOM   285  C CA  . ALA A 1 38  ? 3.579   -3.943  -5.389  1.00 51.68 ? 95  ALA A CA  1 
ATOM   286  C C   . ALA A 1 38  ? 5.051   -3.625  -5.727  1.00 51.55 ? 95  ALA A C   1 
ATOM   287  O O   . ALA A 1 38  ? 5.320   -2.831  -6.610  1.00 51.95 ? 95  ALA A O   1 
ATOM   288  C CB  . ALA A 1 38  ? 3.120   -3.137  -4.173  1.00 51.56 ? 95  ALA A CB  1 
ATOM   289  N N   . ALA A 1 39  ? 5.984   -4.265  -5.023  1.00 51.23 ? 96  ALA A N   1 
ATOM   290  C CA  . ALA A 1 39  ? 7.428   -4.122  -5.267  1.00 51.50 ? 96  ALA A CA  1 
ATOM   291  C C   . ALA A 1 39  ? 7.821   -4.569  -6.672  1.00 51.55 ? 96  ALA A C   1 
ATOM   292  O O   . ALA A 1 39  ? 8.464   -3.841  -7.404  1.00 52.18 ? 96  ALA A O   1 
ATOM   293  C CB  . ALA A 1 39  ? 8.205   -4.912  -4.226  1.00 51.16 ? 96  ALA A CB  1 
ATOM   294  N N   . PHE A 1 40  ? 7.394   -5.769  -7.030  1.00 51.97 ? 97  PHE A N   1 
ATOM   295  C CA  . PHE A 1 40  ? 7.598   -6.364  -8.350  1.00 52.05 ? 97  PHE A CA  1 
ATOM   296  C C   . PHE A 1 40  ? 6.994   -5.506  -9.446  1.00 51.58 ? 97  PHE A C   1 
ATOM   297  O O   . PHE A 1 40  ? 7.657   -5.175  -10.399 1.00 52.62 ? 97  PHE A O   1 
ATOM   298  C CB  . PHE A 1 40  ? 6.951   -7.760  -8.379  1.00 52.20 ? 97  PHE A CB  1 
ATOM   299  C CG  . PHE A 1 40  ? 7.347   -8.615  -9.569  1.00 51.94 ? 97  PHE A CG  1 
ATOM   300  C CD1 . PHE A 1 40  ? 6.378   -9.286  -10.310 1.00 52.04 ? 97  PHE A CD1 1 
ATOM   301  C CD2 . PHE A 1 40  ? 8.667   -8.772  -9.923  1.00 52.50 ? 97  PHE A CD2 1 
ATOM   302  C CE1 . PHE A 1 40  ? 6.718   -10.086 -11.383 1.00 52.11 ? 97  PHE A CE1 1 
ATOM   303  C CE2 . PHE A 1 40  ? 9.014   -9.565  -10.993 1.00 52.91 ? 97  PHE A CE2 1 
ATOM   304  C CZ  . PHE A 1 40  ? 8.022   -10.225 -11.727 1.00 53.10 ? 97  PHE A CZ  1 
ATOM   305  N N   . ARG A 1 41  ? 5.752   -5.091  -9.291  1.00 51.13 ? 98  ARG A N   1 
ATOM   306  C CA  . ARG A 1 41  ? 5.171   -4.190  -10.269 1.00 50.81 ? 98  ARG A CA  1 
ATOM   307  C C   . ARG A 1 41  ? 5.941   -2.887  -10.489 1.00 49.73 ? 98  ARG A C   1 
ATOM   308  O O   . ARG A 1 41  ? 5.933   -2.368  -11.592 1.00 49.04 ? 98  ARG A O   1 
ATOM   309  C CB  . ARG A 1 41  ? 3.738   -3.862  -9.900  1.00 51.09 ? 98  ARG A CB  1 
ATOM   310  C CG  . ARG A 1 41  ? 2.815   -5.054  -10.014 1.00 55.68 ? 98  ARG A CG  1 
ATOM   311  C CD  . ARG A 1 41  ? 1.395   -4.658  -9.763  1.00 58.85 ? 98  ARG A CD  1 
ATOM   312  N NE  . ARG A 1 41  ? 0.937   -3.731  -10.800 1.00 61.23 ? 98  ARG A NE  1 
ATOM   313  C CZ  . ARG A 1 41  ? -0.312  -3.283  -10.882 1.00 62.44 ? 98  ARG A CZ  1 
ATOM   314  N NH1 . ARG A 1 41  ? -0.652  -2.444  -11.847 1.00 62.38 ? 98  ARG A NH1 1 
ATOM   315  N NH2 . ARG A 1 41  ? -1.226  -3.686  -10.006 1.00 64.61 ? 98  ARG A NH2 1 
ATOM   316  N N   . ALA A 1 42  ? 6.530   -2.333  -9.433  1.00 49.90 ? 99  ALA A N   1 
ATOM   317  C CA  . ALA A 1 42  ? 7.246   -1.061  -9.516  1.00 50.72 ? 99  ALA A CA  1 
ATOM   318  C C   . ALA A 1 42  ? 8.582   -1.240  -10.206 1.00 50.72 ? 99  ALA A C   1 
ATOM   319  O O   . ALA A 1 42  ? 8.976   -0.409  -10.989 1.00 50.24 ? 99  ALA A O   1 
ATOM   320  C CB  . ALA A 1 42  ? 7.446   -0.448  -8.130  1.00 50.98 ? 99  ALA A CB  1 
ATOM   321  N N   . PHE A 1 43  ? 9.258   -2.348  -9.904  1.00 51.37 ? 100 PHE A N   1 
ATOM   322  C CA  . PHE A 1 43  ? 10.474  -2.755  -10.619 1.00 51.21 ? 100 PHE A CA  1 
ATOM   323  C C   . PHE A 1 43  ? 10.201  -2.853  -12.102 1.00 51.72 ? 100 PHE A C   1 
ATOM   324  O O   . PHE A 1 43  ? 10.905  -2.244  -12.897 1.00 51.81 ? 100 PHE A O   1 
ATOM   325  C CB  . PHE A 1 43  ? 10.958  -4.104  -10.124 1.00 50.70 ? 100 PHE A CB  1 
ATOM   326  C CG  . PHE A 1 43  ? 12.115  -4.658  -10.915 1.00 51.82 ? 100 PHE A CG  1 
ATOM   327  C CD1 . PHE A 1 43  ? 11.959  -5.786  -11.716 1.00 51.55 ? 100 PHE A CD1 1 
ATOM   328  C CD2 . PHE A 1 43  ? 13.375  -4.040  -10.853 1.00 51.92 ? 100 PHE A CD2 1 
ATOM   329  C CE1 . PHE A 1 43  ? 13.015  -6.308  -12.407 1.00 51.07 ? 100 PHE A CE1 1 
ATOM   330  C CE2 . PHE A 1 43  ? 14.449  -4.550  -11.548 1.00 50.59 ? 100 PHE A CE2 1 
ATOM   331  C CZ  . PHE A 1 43  ? 14.278  -5.682  -12.330 1.00 51.49 ? 100 PHE A CZ  1 
ATOM   332  N N   . LEU A 1 44  ? 9.140   -3.591  -12.458 1.00 52.08 ? 101 LEU A N   1 
ATOM   333  C CA  . LEU A 1 44  ? 8.764   -3.798  -13.851 1.00 52.15 ? 101 LEU A CA  1 
ATOM   334  C C   . LEU A 1 44  ? 8.304   -2.520  -14.547 1.00 51.92 ? 101 LEU A C   1 
ATOM   335  O O   . LEU A 1 44  ? 8.562   -2.325  -15.718 1.00 51.80 ? 101 LEU A O   1 
ATOM   336  C CB  . LEU A 1 44  ? 7.645   -4.844  -13.956 1.00 52.08 ? 101 LEU A CB  1 
ATOM   337  C CG  . LEU A 1 44  ? 7.985   -6.254  -13.491 1.00 54.13 ? 101 LEU A CG  1 
ATOM   338  C CD1 . LEU A 1 44  ? 6.747   -7.146  -13.611 1.00 55.45 ? 101 LEU A CD1 1 
ATOM   339  C CD2 . LEU A 1 44  ? 9.141   -6.828  -14.239 1.00 54.39 ? 101 LEU A CD2 1 
ATOM   340  N N   . LYS A 1 45  ? 7.592   -1.667  -13.834 1.00 52.33 ? 102 LYS A N   1 
ATOM   341  C CA  . LYS A 1 45  ? 7.161   -0.383  -14.398 1.00 52.90 ? 102 LYS A CA  1 
ATOM   342  C C   . LYS A 1 45  ? 8.373   0.510   -14.663 1.00 53.48 ? 102 LYS A C   1 
ATOM   343  O O   . LYS A 1 45  ? 8.378   1.262   -15.637 1.00 53.44 ? 102 LYS A O   1 
ATOM   344  C CB  . LYS A 1 45  ? 6.199   0.315   -13.439 1.00 52.35 ? 102 LYS A CB  1 
ATOM   345  C CG  . LYS A 1 45  ? 5.526   1.546   -13.987 1.00 53.31 ? 102 LYS A CG  1 
ATOM   346  C CD  . LYS A 1 45  ? 4.279   1.868   -13.155 1.00 56.33 ? 102 LYS A CD  1 
ATOM   347  C CE  . LYS A 1 45  ? 3.222   2.654   -13.930 1.00 58.80 ? 102 LYS A CE  1 
ATOM   348  N NZ  . LYS A 1 45  ? 3.440   4.145   -13.772 1.00 59.51 ? 102 LYS A NZ  1 
ATOM   349  N N   . SER A 1 46  ? 9.392   0.428   -13.799 1.00 54.73 ? 103 SER A N   1 
ATOM   350  C CA  . SER A 1 46  ? 10.632  1.224   -13.984 1.00 56.26 ? 103 SER A CA  1 
ATOM   351  C C   . SER A 1 46  ? 11.362  0.767   -15.216 1.00 56.87 ? 103 SER A C   1 
ATOM   352  O O   . SER A 1 46  ? 12.086  1.528   -15.790 1.00 58.15 ? 103 SER A O   1 
ATOM   353  C CB  . SER A 1 46  ? 11.571  1.134   -12.784 1.00 56.26 ? 103 SER A CB  1 
ATOM   354  O OG  . SER A 1 46  ? 12.305  -0.085  -12.766 1.00 57.58 ? 103 SER A OG  1 
ATOM   355  N N   . GLU A 1 47  ? 11.129  -0.472  -15.635 1.00 58.53 ? 104 GLU A N   1 
ATOM   356  C CA  . GLU A 1 47  ? 11.698  -1.016  -16.858 1.00 59.29 ? 104 GLU A CA  1 
ATOM   357  C C   . GLU A 1 47  ? 10.686  -1.121  -17.985 1.00 59.55 ? 104 GLU A C   1 
ATOM   358  O O   . GLU A 1 47  ? 10.931  -1.817  -18.975 1.00 59.33 ? 104 GLU A O   1 
ATOM   359  C CB  . GLU A 1 47  ? 12.254  -2.398  -16.580 1.00 59.84 ? 104 GLU A CB  1 
ATOM   360  C CG  . GLU A 1 47  ? 13.288  -2.405  -15.492 1.00 62.11 ? 104 GLU A CG  1 
ATOM   361  C CD  . GLU A 1 47  ? 14.032  -3.696  -15.484 1.00 64.97 ? 104 GLU A CD  1 
ATOM   362  O OE1 . GLU A 1 47  ? 13.366  -4.744  -15.705 1.00 67.00 ? 104 GLU A OE1 1 
ATOM   363  O OE2 . GLU A 1 47  ? 15.269  -3.657  -15.298 1.00 64.04 ? 104 GLU A OE2 1 
ATOM   364  N N   . PHE A 1 48  ? 9.555   -0.434  -17.837 1.00 59.86 ? 105 PHE A N   1 
ATOM   365  C CA  . PHE A 1 48  ? 8.560   -0.358  -18.886 1.00 60.38 ? 105 PHE A CA  1 
ATOM   366  C C   . PHE A 1 48  ? 8.154   -1.729  -19.408 1.00 60.87 ? 105 PHE A C   1 
ATOM   367  O O   . PHE A 1 48  ? 8.016   -1.909  -20.623 1.00 61.26 ? 105 PHE A O   1 
ATOM   368  C CB  . PHE A 1 48  ? 9.088   0.506   -20.048 1.00 60.38 ? 105 PHE A CB  1 
ATOM   369  C CG  . PHE A 1 48  ? 9.771   1.752   -19.597 1.00 60.02 ? 105 PHE A CG  1 
ATOM   370  C CD1 . PHE A 1 48  ? 11.147  1.770   -19.384 1.00 60.04 ? 105 PHE A CD1 1 
ATOM   371  C CD2 . PHE A 1 48  ? 9.039   2.901   -19.347 1.00 59.63 ? 105 PHE A CD2 1 
ATOM   372  C CE1 . PHE A 1 48  ? 11.790  2.928   -18.938 1.00 59.58 ? 105 PHE A CE1 1 
ATOM   373  C CE2 . PHE A 1 48  ? 9.686   4.072   -18.908 1.00 60.53 ? 105 PHE A CE2 1 
ATOM   374  C CZ  . PHE A 1 48  ? 11.057  4.076   -18.703 1.00 59.14 ? 105 PHE A CZ  1 
ATOM   375  N N   . CYS A 1 49  ? 7.953   -2.691  -18.513 1.00 61.31 ? 106 CYS A N   1 
ATOM   376  C CA  . CYS A 1 49  ? 7.377   -3.986  -18.931 1.00 62.25 ? 106 CYS A CA  1 
ATOM   377  C C   . CYS A 1 49  ? 6.414   -4.565  -17.885 1.00 61.77 ? 106 CYS A C   1 
ATOM   378  O O   . CYS A 1 49  ? 6.336   -5.786  -17.674 1.00 62.29 ? 106 CYS A O   1 
ATOM   379  C CB  . CYS A 1 49  ? 8.489   -4.971  -19.312 1.00 62.62 ? 106 CYS A CB  1 
ATOM   380  S SG  . CYS A 1 49  ? 9.501   -5.470  -17.925 1.00 65.58 ? 106 CYS A SG  1 
ATOM   381  N N   . GLU A 1 50  ? 5.650   -3.659  -17.278 1.00 61.17 ? 107 GLU A N   1 
ATOM   382  C CA  . GLU A 1 50  ? 4.648   -3.974  -16.262 1.00 60.88 ? 107 GLU A CA  1 
ATOM   383  C C   . GLU A 1 50  ? 3.425   -4.733  -16.842 1.00 60.99 ? 107 GLU A C   1 
ATOM   384  O O   . GLU A 1 50  ? 2.607   -5.279  -16.114 1.00 60.89 ? 107 GLU A O   1 
ATOM   385  C CB  A GLU A 1 50  ? 4.194   -2.669  -15.592 0.65 60.79 ? 107 GLU A CB  1 
ATOM   386  C CB  B GLU A 1 50  ? 4.181   -2.687  -15.557 0.35 60.92 ? 107 GLU A CB  1 
ATOM   387  C CG  A GLU A 1 50  ? 3.363   -1.719  -16.490 0.65 60.65 ? 107 GLU A CG  1 
ATOM   388  C CG  B GLU A 1 50  ? 3.527   -2.891  -14.174 0.35 60.97 ? 107 GLU A CG  1 
ATOM   389  C CD  A GLU A 1 50  ? 4.189   -0.721  -17.313 0.65 60.44 ? 107 GLU A CD  1 
ATOM   390  C CD  B GLU A 1 50  ? 2.838   -1.630  -13.638 0.35 61.01 ? 107 GLU A CD  1 
ATOM   391  O OE1 A GLU A 1 50  ? 3.830   0.465   -17.284 0.65 60.85 ? 107 GLU A OE1 1 
ATOM   392  O OE1 B GLU A 1 50  ? 2.512   -1.587  -12.429 0.35 60.61 ? 107 GLU A OE1 1 
ATOM   393  O OE2 A GLU A 1 50  ? 5.171   -1.099  -17.991 0.65 59.49 ? 107 GLU A OE2 1 
ATOM   394  O OE2 B GLU A 1 50  ? 2.626   -0.676  -14.422 0.35 61.36 ? 107 GLU A OE2 1 
ATOM   395  N N   . GLU A 1 51  ? 3.279   -4.720  -18.158 1.00 61.15 ? 108 GLU A N   1 
ATOM   396  C CA  . GLU A 1 51  ? 2.107   -5.298  -18.814 1.00 60.78 ? 108 GLU A CA  1 
ATOM   397  C C   . GLU A 1 51  ? 1.969   -6.803  -18.607 1.00 59.63 ? 108 GLU A C   1 
ATOM   398  O O   . GLU A 1 51  ? 0.857   -7.315  -18.494 1.00 58.55 ? 108 GLU A O   1 
ATOM   399  C CB  . GLU A 1 51  ? 2.130   -4.974  -20.312 1.00 61.79 ? 108 GLU A CB  1 
ATOM   400  C CG  . GLU A 1 51  ? 3.314   -5.559  -21.122 1.00 63.46 ? 108 GLU A CG  1 
ATOM   401  C CD  . GLU A 1 51  ? 4.464   -4.572  -21.329 1.00 66.38 ? 108 GLU A CD  1 
ATOM   402  O OE1 . GLU A 1 51  ? 4.337   -3.394  -20.933 1.00 65.89 ? 108 GLU A OE1 1 
ATOM   403  O OE2 . GLU A 1 51  ? 5.492   -4.997  -21.910 1.00 68.97 ? 108 GLU A OE2 1 
ATOM   404  N N   . ASN A 1 52  ? 3.101   -7.502  -18.532 1.00 58.70 ? 109 ASN A N   1 
ATOM   405  C CA  . ASN A 1 52  ? 3.104   -8.944  -18.247 1.00 57.87 ? 109 ASN A CA  1 
ATOM   406  C C   . ASN A 1 52  ? 2.501   -9.284  -16.901 1.00 56.84 ? 109 ASN A C   1 
ATOM   407  O O   . ASN A 1 52  ? 1.695   -10.214 -16.791 1.00 54.90 ? 109 ASN A O   1 
ATOM   408  C CB  . ASN A 1 52  ? 4.526   -9.507  -18.260 1.00 58.31 ? 109 ASN A CB  1 
ATOM   409  C CG  . ASN A 1 52  ? 5.139   -9.496  -19.621 1.00 58.53 ? 109 ASN A CG  1 
ATOM   410  O OD1 . ASN A 1 52  ? 6.326   -9.196  -19.759 1.00 59.55 ? 109 ASN A OD1 1 
ATOM   411  N ND2 . ASN A 1 52  ? 4.341   -9.811  -20.647 1.00 56.82 ? 109 ASN A ND2 1 
ATOM   412  N N   . ILE A 1 53  ? 2.919   -8.546  -15.870 1.00 56.13 ? 110 ILE A N   1 
ATOM   413  C CA  . ILE A 1 53  ? 2.372   -8.778  -14.530 1.00 56.43 ? 110 ILE A CA  1 
ATOM   414  C C   . ILE A 1 53  ? 0.907   -8.303  -14.450 1.00 55.43 ? 110 ILE A C   1 
ATOM   415  O O   . ILE A 1 53  ? 0.091   -9.006  -13.895 1.00 55.45 ? 110 ILE A O   1 
ATOM   416  C CB  . ILE A 1 53  ? 3.269   -8.204  -13.388 1.00 56.51 ? 110 ILE A CB  1 
ATOM   417  C CG1 . ILE A 1 53  ? 2.779   -8.647  -12.007 1.00 56.80 ? 110 ILE A CG1 1 
ATOM   418  C CG2 . ILE A 1 53  ? 3.300   -6.697  -13.421 1.00 57.34 ? 110 ILE A CG2 1 
ATOM   419  C CD1 . ILE A 1 53  ? 2.861   -10.155 -11.714 1.00 56.95 ? 110 ILE A CD1 1 
ATOM   420  N N   . GLU A 1 54  ? 0.575   -7.159  -15.043 1.00 54.83 ? 111 GLU A N   1 
ATOM   421  C CA  . GLU A 1 54  ? -0.832  -6.711  -15.128 1.00 55.10 ? 111 GLU A CA  1 
ATOM   422  C C   . GLU A 1 54  ? -1.701  -7.706  -15.905 1.00 53.83 ? 111 GLU A C   1 
ATOM   423  O O   . GLU A 1 54  ? -2.820  -7.953  -15.541 1.00 53.26 ? 111 GLU A O   1 
ATOM   424  C CB  . GLU A 1 54  ? -0.939  -5.352  -15.790 1.00 54.83 ? 111 GLU A CB  1 
ATOM   425  C CG  . GLU A 1 54  ? -0.338  -4.220  -14.974 1.00 58.73 ? 111 GLU A CG  1 
ATOM   426  C CD  . GLU A 1 54  ? -0.421  -2.884  -15.698 1.00 61.71 ? 111 GLU A CD  1 
ATOM   427  O OE1 . GLU A 1 54  ? -0.980  -2.841  -16.808 1.00 67.49 ? 111 GLU A OE1 1 
ATOM   428  O OE2 . GLU A 1 54  ? 0.066   -1.876  -15.177 1.00 65.58 ? 111 GLU A OE2 1 
ATOM   429  N N   . PHE A 1 55  ? -1.158  -8.246  -16.989 1.00 53.93 ? 112 PHE A N   1 
ATOM   430  C CA  . PHE A 1 55  ? -1.810  -9.307  -17.739 1.00 53.52 ? 112 PHE A CA  1 
ATOM   431  C C   . PHE A 1 55  ? -2.110  -10.496 -16.842 1.00 53.54 ? 112 PHE A C   1 
ATOM   432  O O   . PHE A 1 55  ? -3.250  -10.991 -16.787 1.00 53.77 ? 112 PHE A O   1 
ATOM   433  C CB  . PHE A 1 55  ? -0.964  -9.767  -18.927 1.00 52.62 ? 112 PHE A CB  1 
ATOM   434  C CG  . PHE A 1 55  ? -1.613  -10.869 -19.698 1.00 53.11 ? 112 PHE A CG  1 
ATOM   435  C CD1 . PHE A 1 55  ? -2.835  -10.652 -20.316 1.00 51.97 ? 112 PHE A CD1 1 
ATOM   436  C CD2 . PHE A 1 55  ? -1.065  -12.146 -19.724 1.00 52.91 ? 112 PHE A CD2 1 
ATOM   437  C CE1 . PHE A 1 55  ? -3.459  -11.655 -20.979 1.00 53.54 ? 112 PHE A CE1 1 
ATOM   438  C CE2 . PHE A 1 55  ? -1.696  -13.162 -20.382 1.00 53.21 ? 112 PHE A CE2 1 
ATOM   439  C CZ  . PHE A 1 55  ? -2.893  -12.920 -21.022 1.00 53.14 ? 112 PHE A CZ  1 
ATOM   440  N N   . TRP A 1 56  ? -1.087  -10.912 -16.107 1.00 53.70 ? 113 TRP A N   1 
ATOM   441  C CA  . TRP A 1 56  ? -1.142  -12.093 -15.311 1.00 53.94 ? 113 TRP A CA  1 
ATOM   442  C C   . TRP A 1 56  ? -2.212  -11.930 -14.225 1.00 54.68 ? 113 TRP A C   1 
ATOM   443  O O   . TRP A 1 56  ? -3.016  -12.851 -13.972 1.00 54.44 ? 113 TRP A O   1 
ATOM   444  C CB  . TRP A 1 56  ? 0.231   -12.365 -14.702 1.00 54.31 ? 113 TRP A CB  1 
ATOM   445  C CG  . TRP A 1 56  ? 0.290   -13.636 -13.905 1.00 53.76 ? 113 TRP A CG  1 
ATOM   446  C CD1 . TRP A 1 56  ? 0.565   -14.871 -14.376 1.00 54.15 ? 113 TRP A CD1 1 
ATOM   447  C CD2 . TRP A 1 56  ? 0.024   -13.785 -12.505 1.00 54.69 ? 113 TRP A CD2 1 
ATOM   448  N NE1 . TRP A 1 56  ? 0.497   -15.793 -13.362 1.00 55.57 ? 113 TRP A NE1 1 
ATOM   449  C CE2 . TRP A 1 56  ? 0.167   -15.152 -12.197 1.00 55.12 ? 113 TRP A CE2 1 
ATOM   450  C CE3 . TRP A 1 56  ? -0.315  -12.897 -11.481 1.00 54.61 ? 113 TRP A CE3 1 
ATOM   451  C CZ2 . TRP A 1 56  ? -0.005  -15.652 -10.913 1.00 54.39 ? 113 TRP A CZ2 1 
ATOM   452  C CZ3 . TRP A 1 56  ? -0.493  -13.395 -10.209 1.00 54.32 ? 113 TRP A CZ3 1 
ATOM   453  C CH2 . TRP A 1 56  ? -0.346  -14.763 -9.934  1.00 54.39 ? 113 TRP A CH2 1 
ATOM   454  N N   . LEU A 1 57  ? -2.241  -10.751 -13.606 1.00 54.70 ? 114 LEU A N   1 
ATOM   455  C CA  . LEU A 1 57  ? -3.235  -10.476 -12.565 1.00 54.56 ? 114 LEU A CA  1 
ATOM   456  C C   . LEU A 1 57  ? -4.671  -10.480 -13.069 1.00 54.21 ? 114 LEU A C   1 
ATOM   457  O O   . LEU A 1 57  ? -5.592  -10.912 -12.369 1.00 54.16 ? 114 LEU A O   1 
ATOM   458  C CB  . LEU A 1 57  ? -2.945  -9.134  -11.895 1.00 54.24 ? 114 LEU A CB  1 
ATOM   459  C CG  . LEU A 1 57  ? -1.738  -9.086  -10.964 1.00 53.45 ? 114 LEU A CG  1 
ATOM   460  C CD1 . LEU A 1 57  ? -1.437  -7.637  -10.581 1.00 51.78 ? 114 LEU A CD1 1 
ATOM   461  C CD2 . LEU A 1 57  ? -1.955  -9.943  -9.725  1.00 53.50 ? 114 LEU A CD2 1 
ATOM   462  N N   . ALA A 1 58  ? -4.874  -9.961  -14.269 1.00 54.07 ? 115 ALA A N   1 
ATOM   463  C CA  . ALA A 1 58  ? -6.220  -9.953  -14.853 1.00 53.78 ? 115 ALA A CA  1 
ATOM   464  C C   . ALA A 1 58  ? -6.687  -11.379 -15.187 1.00 53.58 ? 115 ALA A C   1 
ATOM   465  O O   . ALA A 1 58  ? -7.841  -11.708 -14.968 1.00 53.14 ? 115 ALA A O   1 
ATOM   466  C CB  . ALA A 1 58  ? -6.240  -9.071  -16.088 1.00 53.65 ? 115 ALA A CB  1 
ATOM   467  N N   . CYS A 1 59  ? -5.788  -12.230 -15.701 1.00 54.32 ? 116 CYS A N   1 
ATOM   468  C CA  . CYS A 1 59  ? -6.079  -13.693 -15.875 1.00 54.85 ? 116 CYS A CA  1 
ATOM   469  C C   . CYS A 1 59  ? -6.395  -14.460 -14.565 1.00 55.12 ? 116 CYS A C   1 
ATOM   470  O O   . CYS A 1 59  ? -7.225  -15.370 -14.535 1.00 55.24 ? 116 CYS A O   1 
ATOM   471  C CB  . CYS A 1 59  ? -4.905  -14.385 -16.566 1.00 55.26 ? 116 CYS A CB  1 
ATOM   472  S SG  . CYS A 1 59  ? -4.575  -13.801 -18.231 1.00 55.25 ? 116 CYS A SG  1 
ATOM   473  N N   . GLU A 1 60  ? -5.693  -14.125 -13.489 1.00 55.84 ? 117 GLU A N   1 
ATOM   474  C CA  . GLU A 1 60  ? -6.051  -14.630 -12.165 1.00 56.02 ? 117 GLU A CA  1 
ATOM   475  C C   . GLU A 1 60  ? -7.471  -14.189 -11.778 1.00 55.96 ? 117 GLU A C   1 
ATOM   476  O O   . GLU A 1 60  ? -8.264  -15.014 -11.306 1.00 55.87 ? 117 GLU A O   1 
ATOM   477  C CB  . GLU A 1 60  ? -5.048  -14.163 -11.109 1.00 56.26 ? 117 GLU A CB  1 
ATOM   478  C CG  . GLU A 1 60  ? -3.679  -14.807 -11.251 1.00 57.25 ? 117 GLU A CG  1 
ATOM   479  C CD  . GLU A 1 60  ? -3.718  -16.306 -10.958 1.00 57.80 ? 117 GLU A CD  1 
ATOM   480  O OE1 . GLU A 1 60  ? -3.634  -17.103 -11.901 1.00 57.62 ? 117 GLU A OE1 1 
ATOM   481  O OE2 . GLU A 1 60  ? -3.837  -16.689 -9.779  1.00 59.99 ? 117 GLU A OE2 1 
ATOM   482  N N   . ASP A 1 61  ? -7.805  -12.908 -11.970 1.00 55.52 ? 118 ASP A N   1 
ATOM   483  C CA  . ASP A 1 61  ? -9.178  -12.452 -11.650 1.00 55.67 ? 118 ASP A CA  1 
ATOM   484  C C   . ASP A 1 61  ? -10.182 -13.193 -12.561 1.00 55.28 ? 118 ASP A C   1 
ATOM   485  O O   . ASP A 1 61  ? -11.272 -13.576 -12.146 1.00 54.67 ? 118 ASP A O   1 
ATOM   486  C CB  . ASP A 1 61  ? -9.332  -10.915 -11.767 1.00 55.36 ? 118 ASP A CB  1 
ATOM   487  C CG  . ASP A 1 61  ? -10.804 -10.465 -11.749 1.00 56.75 ? 118 ASP A CG  1 
ATOM   488  O OD1 . ASP A 1 61  ? -11.487 -10.493 -12.793 1.00 54.36 ? 118 ASP A OD1 1 
ATOM   489  O OD2 . ASP A 1 61  ? -11.300 -10.093 -10.673 1.00 59.53 ? 118 ASP A OD2 1 
ATOM   490  N N   . PHE A 1 62  ? -9.778  -13.393 -13.813 1.00 55.83 ? 119 PHE A N   1 
ATOM   491  C CA  . PHE A 1 62  ? -10.611 -14.055 -14.814 1.00 55.65 ? 119 PHE A CA  1 
ATOM   492  C C   . PHE A 1 62  ? -10.887 -15.538 -14.472 1.00 56.00 ? 119 PHE A C   1 
ATOM   493  O O   . PHE A 1 62  ? -12.018 -16.040 -14.620 1.00 55.60 ? 119 PHE A O   1 
ATOM   494  C CB  . PHE A 1 62  ? -9.939  -13.926 -16.182 1.00 55.25 ? 119 PHE A CB  1 
ATOM   495  C CG  . PHE A 1 62  ? -10.717 -14.572 -17.303 1.00 55.87 ? 119 PHE A CG  1 
ATOM   496  C CD1 . PHE A 1 62  ? -11.829 -13.945 -17.841 1.00 53.80 ? 119 PHE A CD1 1 
ATOM   497  C CD2 . PHE A 1 62  ? -10.326 -15.812 -17.816 1.00 55.93 ? 119 PHE A CD2 1 
ATOM   498  C CE1 . PHE A 1 62  ? -12.536 -14.524 -18.864 1.00 54.81 ? 119 PHE A CE1 1 
ATOM   499  C CE2 . PHE A 1 62  ? -11.040 -16.409 -18.843 1.00 56.56 ? 119 PHE A CE2 1 
ATOM   500  C CZ  . PHE A 1 62  ? -12.157 -15.765 -19.371 1.00 55.57 ? 119 PHE A CZ  1 
ATOM   501  N N   . LYS A 1 63  ? -9.838  -16.235 -14.034 1.00 56.24 ? 120 LYS A N   1 
ATOM   502  C CA  . LYS A 1 63  ? -9.939  -17.651 -13.641 1.00 56.38 ? 120 LYS A CA  1 
ATOM   503  C C   . LYS A 1 63  ? -10.954 -17.879 -12.531 1.00 55.92 ? 120 LYS A C   1 
ATOM   504  O O   . LYS A 1 63  ? -11.547 -18.937 -12.446 1.00 55.16 ? 120 LYS A O   1 
ATOM   505  C CB  . LYS A 1 63  ? -8.563  -18.191 -13.172 1.00 56.53 ? 120 LYS A CB  1 
ATOM   506  C CG  . LYS A 1 63  ? -7.712  -18.825 -14.290 1.00 56.89 ? 120 LYS A CG  1 
ATOM   507  C CD  . LYS A 1 63  ? -6.582  -19.703 -13.742 1.00 56.90 ? 120 LYS A CD  1 
ATOM   508  C CE  . LYS A 1 63  ? -5.436  -18.877 -13.199 1.00 56.71 ? 120 LYS A CE  1 
ATOM   509  N NZ  . LYS A 1 63  ? -4.173  -19.640 -12.997 1.00 55.17 ? 120 LYS A NZ  1 
ATOM   510  N N   . LYS A 1 64  ? -11.106 -16.883 -11.662 1.00 55.95 ? 121 LYS A N   1 
ATOM   511  C CA  . LYS A 1 64  ? -11.955 -16.985 -10.476 1.00 55.63 ? 121 LYS A CA  1 
ATOM   512  C C   . LYS A 1 64  ? -13.398 -16.664 -10.801 1.00 55.39 ? 121 LYS A C   1 
ATOM   513  O O   . LYS A 1 64  ? -14.235 -16.664 -9.921  1.00 55.54 ? 121 LYS A O   1 
ATOM   514  C CB  . LYS A 1 64  ? -11.449 -16.018 -9.390  1.00 55.45 ? 121 LYS A CB  1 
ATOM   515  N N   . THR A 1 65  ? -13.688 -16.373 -12.061 1.00 55.35 ? 122 THR A N   1 
ATOM   516  C CA  . THR A 1 65  ? -15.025 -15.978 -12.484 1.00 55.36 ? 122 THR A CA  1 
ATOM   517  C C   . THR A 1 65  ? -15.957 -17.197 -12.680 1.00 55.36 ? 122 THR A C   1 
ATOM   518  O O   . THR A 1 65  ? -15.623 -18.150 -13.383 1.00 54.56 ? 122 THR A O   1 
ATOM   519  C CB  . THR A 1 65  ? -14.930 -15.095 -13.746 1.00 55.28 ? 122 THR A CB  1 
ATOM   520  O OG1 . THR A 1 65  ? -14.148 -13.932 -13.422 1.00 56.20 ? 122 THR A OG1 1 
ATOM   521  C CG2 . THR A 1 65  ? -16.312 -14.670 -14.249 1.00 55.82 ? 122 THR A CG2 1 
ATOM   522  N N   . LYS A 1 66  ? -17.122 -17.135 -12.038 1.00 55.62 ? 123 LYS A N   1 
ATOM   523  C CA  . LYS A 1 66  ? -18.069 -18.244 -11.998 1.00 56.16 ? 123 LYS A CA  1 
ATOM   524  C C   . LYS A 1 66  ? -19.309 -18.006 -12.874 1.00 56.48 ? 123 LYS A C   1 
ATOM   525  O O   . LYS A 1 66  ? -20.170 -18.893 -12.993 1.00 56.95 ? 123 LYS A O   1 
ATOM   526  C CB  . LYS A 1 66  ? -18.492 -18.501 -10.545 1.00 56.15 ? 123 LYS A CB  1 
ATOM   527  N N   . SER A 1 67  ? -19.405 -16.826 -13.490 1.00 56.75 ? 124 SER A N   1 
ATOM   528  C CA  . SER A 1 67  ? -20.537 -16.495 -14.354 1.00 57.00 ? 124 SER A CA  1 
ATOM   529  C C   . SER A 1 67  ? -20.140 -16.478 -15.835 1.00 57.65 ? 124 SER A C   1 
ATOM   530  O O   . SER A 1 67  ? -19.193 -15.788 -16.206 1.00 57.45 ? 124 SER A O   1 
ATOM   531  C CB  . SER A 1 67  ? -21.105 -15.130 -13.972 1.00 56.96 ? 124 SER A CB  1 
ATOM   532  O OG  . SER A 1 67  ? -22.100 -14.705 -14.899 1.00 56.37 ? 124 SER A OG  1 
ATOM   533  N N   . PRO A 1 68  ? -20.871 -17.218 -16.693 1.00 58.27 ? 125 PRO A N   1 
ATOM   534  C CA  . PRO A 1 68  ? -20.577 -17.169 -18.139 1.00 58.83 ? 125 PRO A CA  1 
ATOM   535  C C   . PRO A 1 68  ? -20.755 -15.783 -18.794 1.00 59.27 ? 125 PRO A C   1 
ATOM   536  O O   . PRO A 1 68  ? -20.017 -15.449 -19.728 1.00 59.40 ? 125 PRO A O   1 
ATOM   537  C CB  . PRO A 1 68  ? -21.575 -18.165 -18.747 1.00 58.74 ? 125 PRO A CB  1 
ATOM   538  C CG  . PRO A 1 68  ? -22.069 -18.994 -17.607 1.00 58.75 ? 125 PRO A CG  1 
ATOM   539  C CD  . PRO A 1 68  ? -21.984 -18.134 -16.387 1.00 58.49 ? 125 PRO A CD  1 
ATOM   540  N N   . GLN A 1 69  ? -21.734 -15.008 -18.313 1.00 59.53 ? 126 GLN A N   1 
ATOM   541  C CA  . GLN A 1 69  ? -21.997 -13.642 -18.796 1.00 59.43 ? 126 GLN A CA  1 
ATOM   542  C C   . GLN A 1 69  ? -20.785 -12.710 -18.612 1.00 59.27 ? 126 GLN A C   1 
ATOM   543  O O   . GLN A 1 69  ? -20.218 -12.213 -19.590 1.00 59.03 ? 126 GLN A O   1 
ATOM   544  C CB  . GLN A 1 69  ? -23.229 -13.057 -18.082 1.00 59.29 ? 126 GLN A CB  1 
ATOM   545  N N   . LYS A 1 70  ? -20.391 -12.483 -17.363 1.00 59.27 ? 127 LYS A N   1 
ATOM   546  C CA  . LYS A 1 70  ? -19.235 -11.613 -17.078 1.00 59.84 ? 127 LYS A CA  1 
ATOM   547  C C   . LYS A 1 70  ? -17.879 -12.231 -17.499 1.00 59.47 ? 127 LYS A C   1 
ATOM   548  O O   . LYS A 1 70  ? -16.904 -11.506 -17.645 1.00 59.61 ? 127 LYS A O   1 
ATOM   549  C CB  . LYS A 1 70  ? -19.211 -11.124 -15.606 1.00 60.05 ? 127 LYS A CB  1 
ATOM   550  C CG  . LYS A 1 70  ? -19.570 -12.169 -14.536 1.00 60.55 ? 127 LYS A CG  1 
ATOM   551  C CD  . LYS A 1 70  ? -19.184 -11.752 -13.094 1.00 60.29 ? 127 LYS A CD  1 
ATOM   552  C CE  . LYS A 1 70  ? -19.168 -12.962 -12.136 1.00 60.20 ? 127 LYS A CE  1 
ATOM   553  N NZ  . LYS A 1 70  ? -18.211 -12.813 -11.009 1.00 60.47 ? 127 LYS A NZ  1 
ATOM   554  N N   . LEU A 1 71  ? -17.841 -13.547 -17.721 1.00 59.21 ? 128 LEU A N   1 
ATOM   555  C CA  . LEU A 1 71  ? -16.652 -14.254 -18.238 1.00 59.05 ? 128 LEU A CA  1 
ATOM   556  C C   . LEU A 1 71  ? -16.396 -13.945 -19.730 1.00 59.01 ? 128 LEU A C   1 
ATOM   557  O O   . LEU A 1 71  ? -15.244 -13.853 -20.174 1.00 58.55 ? 128 LEU A O   1 
ATOM   558  C CB  . LEU A 1 71  ? -16.807 -15.770 -17.996 1.00 58.97 ? 128 LEU A CB  1 
ATOM   559  C CG  . LEU A 1 71  ? -15.754 -16.835 -18.338 1.00 58.86 ? 128 LEU A CG  1 
ATOM   560  C CD1 . LEU A 1 71  ? -14.597 -16.878 -17.347 1.00 58.48 ? 128 LEU A CD1 1 
ATOM   561  C CD2 . LEU A 1 71  ? -16.428 -18.198 -18.362 1.00 59.39 ? 128 LEU A CD2 1 
ATOM   562  N N   . SER A 1 72  ? -17.462 -13.775 -20.508 1.00 58.87 ? 129 SER A N   1 
ATOM   563  C CA  . SER A 1 72  ? -17.308 -13.352 -21.904 1.00 58.70 ? 129 SER A CA  1 
ATOM   564  C C   . SER A 1 72  ? -16.837 -11.873 -21.973 1.00 58.32 ? 129 SER A C   1 
ATOM   565  O O   . SER A 1 72  ? -15.939 -11.525 -22.759 1.00 58.28 ? 129 SER A O   1 
ATOM   566  C CB  . SER A 1 72  ? -18.623 -13.560 -22.662 1.00 58.97 ? 129 SER A CB  1 
ATOM   567  O OG  . SER A 1 72  ? -18.410 -13.594 -24.063 1.00 59.79 ? 129 SER A OG  1 
ATOM   568  N N   . SER A 1 73  ? -17.418 -11.025 -21.120 1.00 57.55 ? 130 SER A N   1 
ATOM   569  C CA  . SER A 1 73  ? -17.107 -9.600  -21.099 1.00 56.91 ? 130 SER A CA  1 
ATOM   570  C C   . SER A 1 73  ? -15.715 -9.310  -20.545 1.00 56.68 ? 130 SER A C   1 
ATOM   571  O O   . SER A 1 73  ? -15.012 -8.430  -21.061 1.00 56.07 ? 130 SER A O   1 
ATOM   572  C CB  . SER A 1 73  ? -18.159 -8.829  -20.294 1.00 56.93 ? 130 SER A CB  1 
ATOM   573  O OG  . SER A 1 73  ? -17.994 -9.001  -18.893 1.00 57.14 ? 130 SER A OG  1 
ATOM   574  N N   . LYS A 1 74  ? -15.318 -10.035 -19.495 1.00 56.54 ? 131 LYS A N   1 
ATOM   575  C CA  . LYS A 1 74  ? -13.939 -9.945  -18.980 1.00 56.44 ? 131 LYS A CA  1 
ATOM   576  C C   . LYS A 1 74  ? -12.945 -10.382 -20.040 1.00 55.96 ? 131 LYS A C   1 
ATOM   577  O O   . LYS A 1 74  ? -11.850 -9.837  -20.136 1.00 55.52 ? 131 LYS A O   1 
ATOM   578  C CB  . LYS A 1 74  ? -13.726 -10.798 -17.714 1.00 56.53 ? 131 LYS A CB  1 
ATOM   579  C CG  . LYS A 1 74  ? -14.351 -10.225 -16.410 1.00 57.17 ? 131 LYS A CG  1 
ATOM   580  C CD  . LYS A 1 74  ? -13.645 -10.717 -15.134 1.00 57.11 ? 131 LYS A CD  1 
ATOM   581  C CE  . LYS A 1 74  ? -14.612 -11.118 -14.016 1.00 58.66 ? 131 LYS A CE  1 
ATOM   582  N NZ  . LYS A 1 74  ? -15.791 -10.208 -13.780 1.00 60.35 ? 131 LYS A NZ  1 
ATOM   583  N N   . ALA A 1 75  ? -13.313 -11.384 -20.826 1.00 55.95 ? 132 ALA A N   1 
ATOM   584  C CA  . ALA A 1 75  ? -12.425 -11.850 -21.879 1.00 56.11 ? 132 ALA A CA  1 
ATOM   585  C C   . ALA A 1 75  ? -12.237 -10.784 -22.953 1.00 56.22 ? 132 ALA A C   1 
ATOM   586  O O   . ALA A 1 75  ? -11.122 -10.536 -23.389 1.00 55.23 ? 132 ALA A O   1 
ATOM   587  C CB  . ALA A 1 75  ? -12.921 -13.136 -22.475 1.00 56.36 ? 132 ALA A CB  1 
ATOM   588  N N   . ARG A 1 76  ? -13.325 -10.145 -23.367 1.00 56.93 ? 133 ARG A N   1 
ATOM   589  C CA  . ARG A 1 76  ? -13.240 -9.011  -24.309 1.00 57.53 ? 133 ARG A CA  1 
ATOM   590  C C   . ARG A 1 76  ? -12.358 -7.845  -23.772 1.00 57.13 ? 133 ARG A C   1 
ATOM   591  O O   . ARG A 1 76  ? -11.593 -7.249  -24.527 1.00 57.01 ? 133 ARG A O   1 
ATOM   592  C CB  . ARG A 1 76  ? -14.653 -8.536  -24.675 1.00 57.72 ? 133 ARG A CB  1 
ATOM   593  C CG  . ARG A 1 76  ? -14.742 -7.204  -25.453 1.00 58.65 ? 133 ARG A CG  1 
ATOM   594  C CD  . ARG A 1 76  ? -16.039 -7.081  -26.254 1.00 59.14 ? 133 ARG A CD  1 
ATOM   595  N NE  . ARG A 1 76  ? -16.192 -8.115  -27.303 1.00 61.01 ? 133 ARG A NE  1 
ATOM   596  C CZ  . ARG A 1 76  ? -16.936 -9.226  -27.203 1.00 61.52 ? 133 ARG A CZ  1 
ATOM   597  N NH1 . ARG A 1 76  ? -17.635 -9.500  -26.091 1.00 61.51 ? 133 ARG A NH1 1 
ATOM   598  N NH2 . ARG A 1 76  ? -16.985 -10.083 -28.238 1.00 60.61 ? 133 ARG A NH2 1 
ATOM   599  N N   . LYS A 1 77  ? -12.457 -7.546  -22.478 1.00 57.03 ? 134 LYS A N   1 
ATOM   600  C CA  . LYS A 1 77  ? -11.693 -6.454  -21.863 1.00 57.63 ? 134 LYS A CA  1 
ATOM   601  C C   . LYS A 1 77  ? -10.204 -6.797  -21.807 1.00 57.06 ? 134 LYS A C   1 
ATOM   602  O O   . LYS A 1 77  ? -9.375  -6.005  -22.210 1.00 56.22 ? 134 LYS A O   1 
ATOM   603  C CB  . LYS A 1 77  ? -12.212 -6.145  -20.450 1.00 58.21 ? 134 LYS A CB  1 
ATOM   604  C CG  . LYS A 1 77  ? -11.372 -5.121  -19.641 1.00 60.03 ? 134 LYS A CG  1 
ATOM   605  C CD  . LYS A 1 77  ? -11.704 -3.639  -19.988 1.00 62.85 ? 134 LYS A CD  1 
ATOM   606  C CE  . LYS A 1 77  ? -10.847 -3.066  -21.165 1.00 64.22 ? 134 LYS A CE  1 
ATOM   607  N NZ  . LYS A 1 77  ? -11.561 -2.050  -21.979 1.00 63.58 ? 134 LYS A NZ  1 
ATOM   608  N N   . ILE A 1 78  ? -9.884  -7.991  -21.320 1.00 57.15 ? 135 ILE A N   1 
ATOM   609  C CA  . ILE A 1 78  ? -8.487  -8.482  -21.287 1.00 57.12 ? 135 ILE A CA  1 
ATOM   610  C C   . ILE A 1 78  ? -7.872  -8.423  -22.689 1.00 57.27 ? 135 ILE A C   1 
ATOM   611  O O   . ILE A 1 78  ? -6.743  -7.973  -22.868 1.00 56.59 ? 135 ILE A O   1 
ATOM   612  C CB  . ILE A 1 78  ? -8.423  -9.917  -20.719 1.00 56.57 ? 135 ILE A CB  1 
ATOM   613  C CG1 . ILE A 1 78  ? -8.684  -9.879  -19.208 1.00 57.15 ? 135 ILE A CG1 1 
ATOM   614  C CG2 . ILE A 1 78  ? -7.095  -10.555 -21.010 1.00 56.91 ? 135 ILE A CG2 1 
ATOM   615  C CD1 . ILE A 1 78  ? -9.067  -11.207 -18.577 1.00 58.05 ? 135 ILE A CD1 1 
ATOM   616  N N   . TYR A 1 79  ? -8.644  -8.888  -23.671 1.00 57.36 ? 136 TYR A N   1 
ATOM   617  C CA  . TYR A 1 79  ? -8.272  -8.810  -25.079 1.00 57.63 ? 136 TYR A CA  1 
ATOM   618  C C   . TYR A 1 79  ? -7.946  -7.374  -25.493 1.00 57.07 ? 136 TYR A C   1 
ATOM   619  O O   . TYR A 1 79  ? -6.904  -7.104  -26.069 1.00 56.43 ? 136 TYR A O   1 
ATOM   620  C CB  . TYR A 1 79  ? -9.402  -9.325  -25.974 1.00 58.19 ? 136 TYR A CB  1 
ATOM   621  C CG  . TYR A 1 79  ? -8.928  -9.607  -27.372 1.00 59.25 ? 136 TYR A CG  1 
ATOM   622  C CD1 . TYR A 1 79  ? -8.935  -8.630  -28.346 1.00 58.76 ? 136 TYR A CD1 1 
ATOM   623  C CD2 . TYR A 1 79  ? -8.409  -10.852 -27.693 1.00 59.49 ? 136 TYR A CD2 1 
ATOM   624  C CE1 . TYR A 1 79  ? -8.470  -8.904  -29.626 1.00 59.60 ? 136 TYR A CE1 1 
ATOM   625  C CE2 . TYR A 1 79  ? -7.946  -11.120 -28.945 1.00 60.30 ? 136 TYR A CE2 1 
ATOM   626  C CZ  . TYR A 1 79  ? -7.975  -10.151 -29.908 1.00 59.36 ? 136 TYR A CZ  1 
ATOM   627  O OH  . TYR A 1 79  ? -7.505  -10.463 -31.149 1.00 59.06 ? 136 TYR A OH  1 
ATOM   628  N N   . THR A 1 80  ? -8.854  -6.466  -25.190 1.00 56.62 ? 137 THR A N   1 
ATOM   629  C CA  . THR A 1 80  ? -8.685  -5.078  -25.588 1.00 56.91 ? 137 THR A CA  1 
ATOM   630  C C   . THR A 1 80  ? -7.431  -4.477  -24.979 1.00 56.55 ? 137 THR A C   1 
ATOM   631  O O   . THR A 1 80  ? -6.723  -3.730  -25.634 1.00 56.14 ? 137 THR A O   1 
ATOM   632  C CB  . THR A 1 80  ? -9.898  -4.205  -25.143 1.00 56.82 ? 137 THR A CB  1 
ATOM   633  O OG1 . THR A 1 80  ? -11.117 -4.764  -25.675 1.00 58.07 ? 137 THR A OG1 1 
ATOM   634  C CG2 . THR A 1 80  ? -9.723  -2.776  -25.607 1.00 55.29 ? 137 THR A CG2 1 
ATOM   635  N N   . ASP A 1 81  ? -7.180  -4.804  -23.718 1.00 56.67 ? 138 ASP A N   1 
ATOM   636  C CA  . ASP A 1 81  ? -6.076  -4.201  -22.969 1.00 56.87 ? 138 ASP A CA  1 
ATOM   637  C C   . ASP A 1 81  ? -4.714  -4.789  -23.290 1.00 56.27 ? 138 ASP A C   1 
ATOM   638  O O   . ASP A 1 81  ? -3.742  -4.063  -23.382 1.00 57.01 ? 138 ASP A O   1 
ATOM   639  C CB  . ASP A 1 81  ? -6.313  -4.372  -21.480 1.00 57.02 ? 138 ASP A CB  1 
ATOM   640  C CG  . ASP A 1 81  ? -7.361  -3.461  -20.958 1.00 58.89 ? 138 ASP A CG  1 
ATOM   641  O OD1 . ASP A 1 81  ? -7.391  -2.285  -21.382 1.00 63.32 ? 138 ASP A OD1 1 
ATOM   642  O OD2 . ASP A 1 81  ? -8.143  -3.914  -20.096 1.00 62.08 ? 138 ASP A OD2 1 
ATOM   643  N N   . PHE A 1 82  ? -4.644  -6.093  -23.450 1.00 55.90 ? 139 PHE A N   1 
ATOM   644  C CA  . PHE A 1 82  ? -3.366  -6.811  -23.506 1.00 56.16 ? 139 PHE A CA  1 
ATOM   645  C C   . PHE A 1 82  ? -3.048  -7.594  -24.793 1.00 56.91 ? 139 PHE A C   1 
ATOM   646  O O   . PHE A 1 82  ? -1.882  -7.890  -25.072 1.00 56.88 ? 139 PHE A O   1 
ATOM   647  C CB  . PHE A 1 82  ? -3.319  -7.791  -22.337 1.00 55.37 ? 139 PHE A CB  1 
ATOM   648  C CG  . PHE A 1 82  ? -3.462  -7.136  -21.009 1.00 54.83 ? 139 PHE A CG  1 
ATOM   649  C CD1 . PHE A 1 82  ? -2.387  -6.488  -20.425 1.00 55.19 ? 139 PHE A CD1 1 
ATOM   650  C CD2 . PHE A 1 82  ? -4.665  -7.166  -20.331 1.00 52.68 ? 139 PHE A CD2 1 
ATOM   651  C CE1 . PHE A 1 82  ? -2.524  -5.845  -19.184 1.00 54.39 ? 139 PHE A CE1 1 
ATOM   652  C CE2 . PHE A 1 82  ? -4.808  -6.547  -19.111 1.00 52.45 ? 139 PHE A CE2 1 
ATOM   653  C CZ  . PHE A 1 82  ? -3.732  -5.880  -18.535 1.00 54.34 ? 139 PHE A CZ  1 
ATOM   654  N N   . ILE A 1 83  ? -4.072  -7.953  -25.559 1.00 57.98 ? 140 ILE A N   1 
ATOM   655  C CA  . ILE A 1 83  ? -3.891  -8.894  -26.659 1.00 58.57 ? 140 ILE A CA  1 
ATOM   656  C C   . ILE A 1 83  ? -3.992  -8.278  -28.067 1.00 58.84 ? 140 ILE A C   1 
ATOM   657  O O   . ILE A 1 83  ? -3.174  -8.626  -28.936 1.00 58.59 ? 140 ILE A O   1 
ATOM   658  C CB  . ILE A 1 83  ? -4.845  -10.111 -26.529 1.00 58.56 ? 140 ILE A CB  1 
ATOM   659  C CG1 . ILE A 1 83  ? -4.232  -11.209 -25.645 1.00 60.71 ? 140 ILE A CG1 1 
ATOM   660  C CG2 . ILE A 1 83  ? -5.020  -10.765 -27.860 1.00 58.39 ? 140 ILE A CG2 1 
ATOM   661  C CD1 . ILE A 1 83  ? -4.284  -10.996 -24.212 1.00 61.99 ? 140 ILE A CD1 1 
ATOM   662  N N   . GLU A 1 84  ? -4.951  -7.385  -28.311 1.00 59.34 ? 141 GLU A N   1 
ATOM   663  C CA  . GLU A 1 84  ? -5.141  -6.874  -29.675 1.00 60.47 ? 141 GLU A CA  1 
ATOM   664  C C   . GLU A 1 84  ? -4.009  -5.999  -30.190 1.00 60.87 ? 141 GLU A C   1 
ATOM   665  O O   . GLU A 1 84  ? -3.209  -5.478  -29.415 1.00 60.98 ? 141 GLU A O   1 
ATOM   666  C CB  . GLU A 1 84  ? -6.527  -6.223  -29.883 1.00 60.76 ? 141 GLU A CB  1 
ATOM   667  C CG  . GLU A 1 84  ? -6.848  -4.936  -29.215 1.00 62.00 ? 141 GLU A CG  1 
ATOM   668  C CD  . GLU A 1 84  ? -8.213  -4.373  -29.677 1.00 62.62 ? 141 GLU A CD  1 
ATOM   669  O OE1 . GLU A 1 84  ? -9.234  -5.096  -29.707 1.00 66.14 ? 141 GLU A OE1 1 
ATOM   670  O OE2 . GLU A 1 84  ? -8.265  -3.188  -30.010 1.00 66.47 ? 141 GLU A OE2 1 
ATOM   671  N N   . LYS A 1 85  ? -3.929  -5.874  -31.514 1.00 61.94 ? 142 LYS A N   1 
ATOM   672  C CA  . LYS A 1 85  ? -2.946  -4.995  -32.171 1.00 62.50 ? 142 LYS A CA  1 
ATOM   673  C C   . LYS A 1 85  ? -2.978  -3.605  -31.567 1.00 63.08 ? 142 LYS A C   1 
ATOM   674  O O   . LYS A 1 85  ? -4.047  -2.990  -31.480 1.00 63.23 ? 142 LYS A O   1 
ATOM   675  C CB  . LYS A 1 85  ? -3.202  -4.881  -33.681 1.00 62.26 ? 142 LYS A CB  1 
ATOM   676  N N   . GLU A 1 86  ? -1.799  -3.143  -31.139 1.00 63.79 ? 143 GLU A N   1 
ATOM   677  C CA  . GLU A 1 86  ? -1.582  -1.785  -30.616 1.00 64.57 ? 143 GLU A CA  1 
ATOM   678  C C   . GLU A 1 86  ? -2.285  -1.525  -29.279 1.00 65.07 ? 143 GLU A C   1 
ATOM   679  O O   . GLU A 1 86  ? -2.460  -0.360  -28.875 1.00 65.41 ? 143 GLU A O   1 
ATOM   680  C CB  . GLU A 1 86  ? -1.942  -0.699  -31.665 1.00 64.90 ? 143 GLU A CB  1 
ATOM   681  N N   . ALA A 1 87  ? -2.628  -2.605  -28.569 1.00 65.26 ? 144 ALA A N   1 
ATOM   682  C CA  . ALA A 1 87  ? -3.189  -2.499  -27.225 1.00 65.27 ? 144 ALA A CA  1 
ATOM   683  C C   . ALA A 1 87  ? -2.241  -1.706  -26.333 1.00 65.64 ? 144 ALA A C   1 
ATOM   684  O O   . ALA A 1 87  ? -1.015  -1.811  -26.474 1.00 65.45 ? 144 ALA A O   1 
ATOM   685  C CB  . ALA A 1 87  ? -3.428  -3.871  -26.625 1.00 65.34 ? 144 ALA A CB  1 
ATOM   686  N N   . PRO A 1 88  ? -2.804  -0.913  -25.399 1.00 65.83 ? 145 PRO A N   1 
ATOM   687  C CA  . PRO A 1 88  ? -1.925  -0.102  -24.562 1.00 65.64 ? 145 PRO A CA  1 
ATOM   688  C C   . PRO A 1 88  ? -0.957  -0.950  -23.777 1.00 65.44 ? 145 PRO A C   1 
ATOM   689  O O   . PRO A 1 88  ? 0.197   -0.568  -23.668 1.00 65.35 ? 145 PRO A O   1 
ATOM   690  C CB  . PRO A 1 88  ? -2.887  0.638   -23.631 1.00 65.89 ? 145 PRO A CB  1 
ATOM   691  C CG  . PRO A 1 88  ? -4.238  0.549   -24.324 1.00 66.55 ? 145 PRO A CG  1 
ATOM   692  C CD  . PRO A 1 88  ? -4.231  -0.733  -25.066 1.00 65.63 ? 145 PRO A CD  1 
ATOM   693  N N   . LYS A 1 89  ? -1.419  -2.091  -23.254 1.00 65.26 ? 146 LYS A N   1 
ATOM   694  C CA  . LYS A 1 89  ? -0.577  -2.995  -22.451 1.00 65.32 ? 146 LYS A CA  1 
ATOM   695  C C   . LYS A 1 89  ? -0.220  -4.265  -23.233 1.00 65.03 ? 146 LYS A C   1 
ATOM   696  O O   . LYS A 1 89  ? -0.171  -5.361  -22.677 1.00 64.66 ? 146 LYS A O   1 
ATOM   697  C CB  . LYS A 1 89  ? -1.291  -3.378  -21.143 1.00 65.99 ? 146 LYS A CB  1 
ATOM   698  C CG  . LYS A 1 89  ? -1.700  -2.210  -20.213 1.00 66.55 ? 146 LYS A CG  1 
ATOM   699  C CD  . LYS A 1 89  ? -0.484  -1.420  -19.709 1.00 68.60 ? 146 LYS A CD  1 
ATOM   700  C CE  . LYS A 1 89  ? -0.868  -0.400  -18.611 1.00 69.08 ? 146 LYS A CE  1 
ATOM   701  N NZ  . LYS A 1 89  ? -0.448  0.985   -18.930 1.00 70.00 ? 146 LYS A NZ  1 
ATOM   702  N N   . GLU A 1 90  ? 0.034   -4.114  -24.530 1.00 64.94 ? 147 GLU A N   1 
ATOM   703  C CA  . GLU A 1 90  ? 0.175   -5.259  -25.418 1.00 64.99 ? 147 GLU A CA  1 
ATOM   704  C C   . GLU A 1 90  ? 1.254   -6.204  -24.921 1.00 64.93 ? 147 GLU A C   1 
ATOM   705  O O   . GLU A 1 90  ? 2.342   -5.787  -24.597 1.00 64.86 ? 147 GLU A O   1 
ATOM   706  C CB  . GLU A 1 90  ? 0.487   -4.819  -26.849 1.00 64.50 ? 147 GLU A CB  1 
ATOM   707  C CG  . GLU A 1 90  ? 0.137   -5.893  -27.886 1.00 65.50 ? 147 GLU A CG  1 
ATOM   708  C CD  . GLU A 1 90  ? 0.432   -5.498  -29.331 1.00 65.88 ? 147 GLU A CD  1 
ATOM   709  O OE1 . GLU A 1 90  ? 0.796   -4.321  -29.597 1.00 69.29 ? 147 GLU A OE1 1 
ATOM   710  O OE2 . GLU A 1 90  ? 0.282   -6.378  -30.210 1.00 66.10 ? 147 GLU A OE2 1 
ATOM   711  N N   . ILE A 1 91  ? 0.935   -7.481  -24.854 1.00 65.77 ? 148 ILE A N   1 
ATOM   712  C CA  . ILE A 1 91  ? 1.930   -8.499  -24.547 1.00 66.12 ? 148 ILE A CA  1 
ATOM   713  C C   . ILE A 1 91  ? 2.424   -9.170  -25.833 1.00 67.32 ? 148 ILE A C   1 
ATOM   714  O O   . ILE A 1 91  ? 1.824   -9.034  -26.914 1.00 67.07 ? 148 ILE A O   1 
ATOM   715  C CB  . ILE A 1 91  ? 1.379   -9.570  -23.595 1.00 65.73 ? 148 ILE A CB  1 
ATOM   716  C CG1 . ILE A 1 91  ? 0.211   -10.316 -24.250 1.00 65.60 ? 148 ILE A CG1 1 
ATOM   717  C CG2 . ILE A 1 91  ? 0.982   -8.925  -22.269 1.00 65.60 ? 148 ILE A CG2 1 
ATOM   718  C CD1 . ILE A 1 91  ? -0.285  -11.527 -23.479 1.00 65.99 ? 148 ILE A CD1 1 
ATOM   719  N N   . ASN A 1 92  ? 3.529   -9.897  -25.711 1.00 68.26 ? 149 ASN A N   1 
ATOM   720  C CA  . ASN A 1 92  ? 4.101   -10.565 -26.848 1.00 68.92 ? 149 ASN A CA  1 
ATOM   721  C C   . ASN A 1 92  ? 3.627   -12.004 -26.811 1.00 69.50 ? 149 ASN A C   1 
ATOM   722  O O   . ASN A 1 92  ? 4.145   -12.816 -26.068 1.00 70.19 ? 149 ASN A O   1 
ATOM   723  C CB  . ASN A 1 92  ? 5.632   -10.459 -26.835 1.00 68.83 ? 149 ASN A CB  1 
ATOM   724  C CG  . ASN A 1 92  ? 6.220   -10.516 -28.230 1.00 68.90 ? 149 ASN A CG  1 
ATOM   725  N N   . ILE A 1 93  ? 2.584   -12.306 -27.561 1.00 69.98 ? 150 ILE A N   1 
ATOM   726  C CA  . ILE A 1 93  ? 2.247   -13.693 -27.811 1.00 70.11 ? 150 ILE A CA  1 
ATOM   727  C C   . ILE A 1 93  ? 2.204   -13.870 -29.287 1.00 70.13 ? 150 ILE A C   1 
ATOM   728  O O   . ILE A 1 93  ? 2.191   -12.894 -30.043 1.00 69.98 ? 150 ILE A O   1 
ATOM   729  C CB  . ILE A 1 93  ? 0.904   -14.138 -27.203 1.00 70.22 ? 150 ILE A CB  1 
ATOM   730  C CG1 . ILE A 1 93  ? -0.192  -13.096 -27.466 1.00 69.96 ? 150 ILE A CG1 1 
ATOM   731  C CG2 . ILE A 1 93  ? 1.093   -14.417 -25.729 1.00 70.53 ? 150 ILE A CG2 1 
ATOM   732  C CD1 . ILE A 1 93  ? -1.590  -13.671 -27.388 1.00 68.96 ? 150 ILE A CD1 1 
ATOM   733  N N   . ASP A 1 94  ? 2.206   -15.129 -29.692 1.00 70.41 ? 151 ASP A N   1 
ATOM   734  C CA  . ASP A 1 94  ? 2.186   -15.475 -31.103 1.00 70.54 ? 151 ASP A CA  1 
ATOM   735  C C   . ASP A 1 94  ? 0.809   -15.190 -31.703 1.00 69.80 ? 151 ASP A C   1 
ATOM   736  O O   . ASP A 1 94  ? -0.214  -15.227 -31.017 1.00 69.15 ? 151 ASP A O   1 
ATOM   737  C CB  . ASP A 1 94  ? 2.603   -16.933 -31.315 1.00 71.16 ? 151 ASP A CB  1 
ATOM   738  C CG  . ASP A 1 94  ? 2.188   -17.838 -30.168 1.00 73.29 ? 151 ASP A CG  1 
ATOM   739  O OD1 . ASP A 1 94  ? 2.578   -17.548 -28.994 1.00 77.52 ? 151 ASP A OD1 1 
ATOM   740  O OD2 . ASP A 1 94  ? 1.481   -18.838 -30.445 1.00 75.99 ? 151 ASP A OD2 1 
ATOM   741  N N   . PHE A 1 95  ? 0.805   -14.901 -32.996 1.00 69.41 ? 152 PHE A N   1 
ATOM   742  C CA  . PHE A 1 95  ? -0.420  -14.577 -33.711 1.00 69.29 ? 152 PHE A CA  1 
ATOM   743  C C   . PHE A 1 95  ? -1.484  -15.694 -33.642 1.00 68.59 ? 152 PHE A C   1 
ATOM   744  O O   . PHE A 1 95  ? -2.666  -15.442 -33.865 1.00 67.91 ? 152 PHE A O   1 
ATOM   745  C CB  . PHE A 1 95  ? -0.095  -14.235 -35.172 1.00 69.49 ? 152 PHE A CB  1 
ATOM   746  C CG  . PHE A 1 95  ? -1.280  -13.751 -35.949 1.00 69.40 ? 152 PHE A CG  1 
ATOM   747  C CD1 . PHE A 1 95  ? -2.014  -14.629 -36.750 1.00 69.68 ? 152 PHE A CD1 1 
ATOM   748  C CD2 . PHE A 1 95  ? -1.678  -12.427 -35.859 1.00 69.38 ? 152 PHE A CD2 1 
ATOM   749  C CE1 . PHE A 1 95  ? -3.124  -14.185 -37.453 1.00 69.77 ? 152 PHE A CE1 1 
ATOM   750  C CE2 . PHE A 1 95  ? -2.777  -11.969 -36.553 1.00 69.70 ? 152 PHE A CE2 1 
ATOM   751  C CZ  . PHE A 1 95  ? -3.509  -12.846 -37.354 1.00 69.72 ? 152 PHE A CZ  1 
ATOM   752  N N   . GLN A 1 96  ? -1.063  -16.912 -33.312 1.00 67.86 ? 153 GLN A N   1 
ATOM   753  C CA  . GLN A 1 96  ? -1.948  -18.067 -33.351 1.00 67.41 ? 153 GLN A CA  1 
ATOM   754  C C   . GLN A 1 96  ? -2.599  -18.337 -31.983 1.00 66.25 ? 153 GLN A C   1 
ATOM   755  O O   . GLN A 1 96  ? -3.737  -18.804 -31.918 1.00 65.48 ? 153 GLN A O   1 
ATOM   756  C CB  . GLN A 1 96  ? -1.182  -19.291 -33.860 1.00 68.08 ? 153 GLN A CB  1 
ATOM   757  C CG  . GLN A 1 96  ? -0.169  -19.012 -35.014 1.00 69.75 ? 153 GLN A CG  1 
ATOM   758  C CD  . GLN A 1 96  ? 1.249   -18.598 -34.525 1.00 71.16 ? 153 GLN A CD  1 
ATOM   759  O OE1 . GLN A 1 96  ? 1.888   -19.312 -33.745 1.00 73.03 ? 153 GLN A OE1 1 
ATOM   760  N NE2 . GLN A 1 96  ? 1.734   -17.450 -35.004 1.00 70.61 ? 153 GLN A NE2 1 
ATOM   761  N N   . THR A 1 97  ? -1.873  -18.052 -30.899 1.00 65.28 ? 154 THR A N   1 
ATOM   762  C CA  . THR A 1 97  ? -2.478  -17.925 -29.565 1.00 64.69 ? 154 THR A CA  1 
ATOM   763  C C   . THR A 1 97  ? -3.530  -16.803 -29.516 1.00 64.44 ? 154 THR A C   1 
ATOM   764  O O   . THR A 1 97  ? -4.605  -16.978 -28.944 1.00 64.15 ? 154 THR A O   1 
ATOM   765  C CB  . THR A 1 97  ? -1.440  -17.572 -28.520 1.00 64.68 ? 154 THR A CB  1 
ATOM   766  O OG1 . THR A 1 97  ? -0.511  -18.641 -28.420 1.00 65.26 ? 154 THR A OG1 1 
ATOM   767  N N   . LYS A 1 98  ? -3.206  -15.655 -30.104 1.00 63.92 ? 155 LYS A N   1 
ATOM   768  C CA  . LYS A 1 98  ? -4.145  -14.538 -30.166 1.00 64.39 ? 155 LYS A CA  1 
ATOM   769  C C   . LYS A 1 98  ? -5.406  -14.931 -30.914 1.00 63.81 ? 155 LYS A C   1 
ATOM   770  O O   . LYS A 1 98  ? -6.505  -14.635 -30.474 1.00 64.17 ? 155 LYS A O   1 
ATOM   771  C CB  . LYS A 1 98  ? -3.510  -13.335 -30.861 1.00 64.63 ? 155 LYS A CB  1 
ATOM   772  C CG  . LYS A 1 98  ? -4.476  -12.186 -31.199 1.00 65.04 ? 155 LYS A CG  1 
ATOM   773  C CD  . LYS A 1 98  ? -3.874  -11.222 -32.211 1.00 65.73 ? 155 LYS A CD  1 
ATOM   774  C CE  . LYS A 1 98  ? -2.454  -10.820 -31.897 1.00 66.95 ? 155 LYS A CE  1 
ATOM   775  N NZ  . LYS A 1 98  ? -2.011  -9.791  -32.879 1.00 69.07 ? 155 LYS A NZ  1 
ATOM   776  N N   . THR A 1 99  ? -5.230  -15.567 -32.062 1.00 63.39 ? 156 THR A N   1 
ATOM   777  C CA  . THR A 1 99  ? -6.339  -16.074 -32.854 1.00 63.13 ? 156 THR A CA  1 
ATOM   778  C C   . THR A 1 99  ? -7.262  -16.935 -32.002 1.00 63.04 ? 156 THR A C   1 
ATOM   779  O O   . THR A 1 99  ? -8.464  -16.724 -32.020 1.00 63.27 ? 156 THR A O   1 
ATOM   780  C CB  . THR A 1 99  ? -5.844  -16.858 -34.104 1.00 63.22 ? 156 THR A CB  1 
ATOM   781  O OG1 . THR A 1 99  ? -5.176  -15.962 -35.000 1.00 63.87 ? 156 THR A OG1 1 
ATOM   782  C CG2 . THR A 1 99  ? -6.998  -17.513 -34.863 1.00 62.92 ? 156 THR A CG2 1 
ATOM   783  N N   . LEU A 1 100 ? -6.710  -17.882 -31.244 1.00 62.95 ? 157 LEU A N   1 
ATOM   784  C CA  . LEU A 1 100 ? -7.541  -18.823 -30.489 1.00 62.90 ? 157 LEU A CA  1 
ATOM   785  C C   . LEU A 1 100 ? -8.347  -18.112 -29.412 1.00 61.97 ? 157 LEU A C   1 
ATOM   786  O O   . LEU A 1 100 ? -9.510  -18.414 -29.183 1.00 62.02 ? 157 LEU A O   1 
ATOM   787  C CB  . LEU A 1 100 ? -6.694  -19.936 -29.867 1.00 62.80 ? 157 LEU A CB  1 
ATOM   788  C CG  . LEU A 1 100 ? -6.256  -21.005 -30.851 1.00 64.72 ? 157 LEU A CG  1 
ATOM   789  C CD1 . LEU A 1 100 ? -5.175  -21.954 -30.258 1.00 64.24 ? 157 LEU A CD1 1 
ATOM   790  C CD2 . LEU A 1 100 ? -7.482  -21.811 -31.347 1.00 65.79 ? 157 LEU A CD2 1 
ATOM   791  N N   . ILE A 1 101 ? -7.710  -17.164 -28.755 1.00 61.25 ? 158 ILE A N   1 
ATOM   792  C CA  . ILE A 1 101 ? -8.379  -16.323 -27.784 1.00 60.64 ? 158 ILE A CA  1 
ATOM   793  C C   . ILE A 1 101 ? -9.555  -15.590 -28.446 1.00 59.87 ? 158 ILE A C   1 
ATOM   794  O O   . ILE A 1 101 ? -10.682 -15.695 -27.993 1.00 58.95 ? 158 ILE A O   1 
ATOM   795  C CB  . ILE A 1 101 ? -7.388  -15.282 -27.200 1.00 60.65 ? 158 ILE A CB  1 
ATOM   796  C CG1 . ILE A 1 101 ? -6.370  -15.969 -26.300 1.00 60.44 ? 158 ILE A CG1 1 
ATOM   797  C CG2 . ILE A 1 101 ? -8.132  -14.203 -26.442 1.00 60.84 ? 158 ILE A CG2 1 
ATOM   798  C CD1 . ILE A 1 101 ? -5.198  -15.088 -25.920 1.00 61.00 ? 158 ILE A CD1 1 
ATOM   799  N N   . ALA A 1 102 ? -9.253  -14.842 -29.506 1.00 59.57 ? 159 ALA A N   1 
ATOM   800  C CA  . ALA A 1 102 ? -10.250 -14.120 -30.314 1.00 59.21 ? 159 ALA A CA  1 
ATOM   801  C C   . ALA A 1 102 ? -11.378 -15.030 -30.800 1.00 59.19 ? 159 ALA A C   1 
ATOM   802  O O   . ALA A 1 102 ? -12.526 -14.614 -30.824 1.00 58.64 ? 159 ALA A O   1 
ATOM   803  C CB  . ALA A 1 102 ? -9.572  -13.465 -31.495 1.00 58.94 ? 159 ALA A CB  1 
ATOM   804  N N   . GLN A 1 103 ? -11.030 -16.266 -31.185 1.00 59.38 ? 160 GLN A N   1 
ATOM   805  C CA  . GLN A 1 103 ? -12.005 -17.323 -31.510 1.00 59.73 ? 160 GLN A CA  1 
ATOM   806  C C   . GLN A 1 103 ? -12.838 -17.764 -30.307 1.00 59.53 ? 160 GLN A C   1 
ATOM   807  O O   . GLN A 1 103 ? -13.985 -18.168 -30.474 1.00 59.26 ? 160 GLN A O   1 
ATOM   808  C CB  . GLN A 1 103 ? -11.303 -18.554 -32.122 1.00 59.56 ? 160 GLN A CB  1 
ATOM   809  C CG  . GLN A 1 103 ? -10.837 -18.305 -33.554 1.00 60.64 ? 160 GLN A CG  1 
ATOM   810  C CD  . GLN A 1 103 ? -10.085 -19.459 -34.200 1.00 60.95 ? 160 GLN A CD  1 
ATOM   811  O OE1 . GLN A 1 103 ? -9.622  -20.394 -33.539 1.00 62.16 ? 160 GLN A OE1 1 
ATOM   812  N NE2 . GLN A 1 103 ? -9.975  -19.395 -35.525 1.00 63.39 ? 160 GLN A NE2 1 
ATOM   813  N N   . ASN A 1 104 ? -12.268 -17.674 -29.107 1.00 59.55 ? 161 ASN A N   1 
ATOM   814  C CA  . ASN A 1 104 ? -12.922 -18.158 -27.892 1.00 60.25 ? 161 ASN A CA  1 
ATOM   815  C C   . ASN A 1 104 ? -13.693 -17.122 -27.065 1.00 60.19 ? 161 ASN A C   1 
ATOM   816  O O   . ASN A 1 104 ? -14.492 -17.494 -26.220 1.00 60.04 ? 161 ASN A O   1 
ATOM   817  C CB  . ASN A 1 104 ? -11.900 -18.892 -27.000 1.00 60.35 ? 161 ASN A CB  1 
ATOM   818  C CG  . ASN A 1 104 ? -11.586 -20.309 -27.507 1.00 61.33 ? 161 ASN A CG  1 
ATOM   819  O OD1 . ASN A 1 104 ? -12.417 -20.959 -28.146 1.00 61.34 ? 161 ASN A OD1 1 
ATOM   820  N ND2 . ASN A 1 104 ? -10.377 -20.783 -27.221 1.00 64.01 ? 161 ASN A ND2 1 
ATOM   821  N N   . ILE A 1 105 ? -13.476 -15.838 -27.320 1.00 60.85 ? 162 ILE A N   1 
ATOM   822  C CA  . ILE A 1 105 ? -14.103 -14.763 -26.531 1.00 61.27 ? 162 ILE A CA  1 
ATOM   823  C C   . ILE A 1 105 ? -15.617 -14.900 -26.383 1.00 61.70 ? 162 ILE A C   1 
ATOM   824  O O   . ILE A 1 105 ? -16.175 -14.601 -25.319 1.00 61.61 ? 162 ILE A O   1 
ATOM   825  C CB  . ILE A 1 105 ? -13.796 -13.381 -27.135 1.00 61.26 ? 162 ILE A CB  1 
ATOM   826  C CG1 . ILE A 1 105 ? -12.367 -12.986 -26.822 1.00 62.05 ? 162 ILE A CG1 1 
ATOM   827  C CG2 . ILE A 1 105 ? -14.713 -12.292 -26.570 1.00 61.53 ? 162 ILE A CG2 1 
ATOM   828  C CD1 . ILE A 1 105 ? -11.925 -11.774 -27.583 1.00 64.03 ? 162 ILE A CD1 1 
ATOM   829  N N   . GLN A 1 106 ? -16.272 -15.325 -27.454 1.00 62.14 ? 163 GLN A N   1 
ATOM   830  C CA  . GLN A 1 106 ? -17.719 -15.408 -27.467 1.00 63.16 ? 163 GLN A CA  1 
ATOM   831  C C   . GLN A 1 106 ? -18.216 -16.464 -26.465 1.00 63.62 ? 163 GLN A C   1 
ATOM   832  O O   . GLN A 1 106 ? -19.172 -16.227 -25.725 1.00 63.59 ? 163 GLN A O   1 
ATOM   833  C CB  . GLN A 1 106 ? -18.233 -15.705 -28.886 1.00 63.14 ? 163 GLN A CB  1 
ATOM   834  N N   . GLU A 1 107 ? -17.552 -17.615 -26.437 1.00 64.29 ? 164 GLU A N   1 
ATOM   835  C CA  . GLU A 1 107 ? -17.964 -18.725 -25.567 1.00 64.94 ? 164 GLU A CA  1 
ATOM   836  C C   . GLU A 1 107 ? -16.876 -19.006 -24.549 1.00 65.19 ? 164 GLU A C   1 
ATOM   837  O O   . GLU A 1 107 ? -16.588 -20.171 -24.249 1.00 65.56 ? 164 GLU A O   1 
ATOM   838  C CB  . GLU A 1 107 ? -18.253 -19.990 -26.393 1.00 64.99 ? 164 GLU A CB  1 
ATOM   839  N N   . ALA A 1 108 ? -16.293 -17.928 -24.013 1.00 65.45 ? 165 ALA A N   1 
ATOM   840  C CA  . ALA A 1 108 ? -15.095 -17.990 -23.160 1.00 65.14 ? 165 ALA A CA  1 
ATOM   841  C C   . ALA A 1 108 ? -15.263 -18.967 -22.001 1.00 65.40 ? 165 ALA A C   1 
ATOM   842  O O   . ALA A 1 108 ? -16.369 -19.128 -21.444 1.00 65.22 ? 165 ALA A O   1 
ATOM   843  C CB  . ALA A 1 108 ? -14.741 -16.599 -22.626 1.00 64.76 ? 165 ALA A CB  1 
ATOM   844  N N   . THR A 1 109 ? -14.159 -19.634 -21.665 1.00 65.40 ? 166 THR A N   1 
ATOM   845  C CA  . THR A 1 109 ? -14.077 -20.434 -20.453 1.00 65.30 ? 166 THR A CA  1 
ATOM   846  C C   . THR A 1 109 ? -12.945 -19.910 -19.574 1.00 65.18 ? 166 THR A C   1 
ATOM   847  O O   . THR A 1 109 ? -12.212 -18.989 -19.942 1.00 65.10 ? 166 THR A O   1 
ATOM   848  C CB  . THR A 1 109 ? -13.888 -21.983 -20.735 1.00 65.24 ? 166 THR A CB  1 
ATOM   849  O OG1 . THR A 1 109 ? -12.505 -22.302 -20.955 1.00 64.57 ? 166 THR A OG1 1 
ATOM   850  C CG2 . THR A 1 109 ? -14.714 -22.440 -21.914 1.00 64.91 ? 166 THR A CG2 1 
ATOM   851  N N   . SER A 1 110 ? -12.821 -20.527 -18.407 1.00 65.30 ? 167 SER A N   1 
ATOM   852  C CA  . SER A 1 110 ? -11.763 -20.224 -17.438 1.00 65.57 ? 167 SER A CA  1 
ATOM   853  C C   . SER A 1 110 ? -10.348 -20.372 -18.035 1.00 64.71 ? 167 SER A C   1 
ATOM   854  O O   . SER A 1 110 ? -9.425  -19.716 -17.588 1.00 65.18 ? 167 SER A O   1 
ATOM   855  C CB  . SER A 1 110 ? -11.933 -21.136 -16.201 1.00 65.60 ? 167 SER A CB  1 
ATOM   856  O OG  . SER A 1 110 ? -10.859 -20.996 -15.279 1.00 67.96 ? 167 SER A OG  1 
ATOM   857  N N   . GLY A 1 111 ? -10.192 -21.234 -19.040 1.00 64.26 ? 168 GLY A N   1 
ATOM   858  C CA  . GLY A 1 111 ? -8.896  -21.463 -19.693 1.00 63.26 ? 168 GLY A CA  1 
ATOM   859  C C   . GLY A 1 111 ? -8.719  -20.780 -21.039 1.00 62.35 ? 168 GLY A C   1 
ATOM   860  O O   . GLY A 1 111 ? -7.906  -21.201 -21.864 1.00 61.57 ? 168 GLY A O   1 
ATOM   861  N N   . CYS A 1 112 ? -9.484  -19.718 -21.253 1.00 61.38 ? 169 CYS A N   1 
ATOM   862  C CA  . CYS A 1 112 ? -9.322  -18.871 -22.422 1.00 61.29 ? 169 CYS A CA  1 
ATOM   863  C C   . CYS A 1 112 ? -7.902  -18.322 -22.586 1.00 60.89 ? 169 CYS A C   1 
ATOM   864  O O   . CYS A 1 112 ? -7.398  -18.238 -23.695 1.00 60.13 ? 169 CYS A O   1 
ATOM   865  C CB  . CYS A 1 112 ? -10.287 -17.686 -22.339 1.00 61.05 ? 169 CYS A CB  1 
ATOM   866  S SG  . CYS A 1 112 ? -10.460 -16.814 -23.907 1.00 61.50 ? 169 CYS A SG  1 
ATOM   867  N N   . PHE A 1 113 ? -7.271  -17.951 -21.473 1.00 61.27 ? 170 PHE A N   1 
ATOM   868  C CA  . PHE A 1 113 ? -5.957  -17.301 -21.493 1.00 61.01 ? 170 PHE A CA  1 
ATOM   869  C C   . PHE A 1 113 ? -4.870  -18.164 -20.863 1.00 60.72 ? 170 PHE A C   1 
ATOM   870  O O   . PHE A 1 113 ? -3.792  -17.670 -20.555 1.00 60.23 ? 170 PHE A O   1 
ATOM   871  C CB  . PHE A 1 113 ? -6.020  -15.980 -20.734 1.00 60.86 ? 170 PHE A CB  1 
ATOM   872  C CG  . PHE A 1 113 ? -7.037  -14.993 -21.268 1.00 61.34 ? 170 PHE A CG  1 
ATOM   873  C CD1 . PHE A 1 113 ? -6.707  -14.126 -22.308 1.00 61.17 ? 170 PHE A CD1 1 
ATOM   874  C CD2 . PHE A 1 113 ? -8.292  -14.885 -20.689 1.00 61.01 ? 170 PHE A CD2 1 
ATOM   875  C CE1 . PHE A 1 113 ? -7.619  -13.209 -22.786 1.00 61.20 ? 170 PHE A CE1 1 
ATOM   876  C CE2 . PHE A 1 113 ? -9.217  -13.960 -21.170 1.00 60.96 ? 170 PHE A CE2 1 
ATOM   877  C CZ  . PHE A 1 113 ? -8.880  -13.122 -22.212 1.00 60.64 ? 170 PHE A CZ  1 
ATOM   878  N N   . THR A 1 114 ? -5.122  -19.449 -20.669 1.00 60.91 ? 171 THR A N   1 
ATOM   879  C CA  . THR A 1 114 ? -4.106  -20.294 -20.040 1.00 61.43 ? 171 THR A CA  1 
ATOM   880  C C   . THR A 1 114 ? -2.804  -20.371 -20.866 1.00 61.02 ? 171 THR A C   1 
ATOM   881  O O   . THR A 1 114 ? -1.719  -20.139 -20.356 1.00 60.90 ? 171 THR A O   1 
ATOM   882  C CB  . THR A 1 114 ? -4.631  -21.710 -19.748 1.00 61.86 ? 171 THR A CB  1 
ATOM   883  O OG1 . THR A 1 114 ? -5.104  -22.281 -20.965 1.00 64.13 ? 171 THR A OG1 1 
ATOM   884  C CG2 . THR A 1 114 ? -5.758  -21.680 -18.701 1.00 61.31 ? 171 THR A CG2 1 
ATOM   885  N N   . THR A 1 115 ? -2.899  -20.678 -22.143 1.00 61.39 ? 172 THR A N   1 
ATOM   886  C CA  . THR A 1 115 ? -1.696  -20.716 -22.977 1.00 61.56 ? 172 THR A CA  1 
ATOM   887  C C   . THR A 1 115 ? -0.909  -19.409 -22.855 1.00 61.37 ? 172 THR A C   1 
ATOM   888  O O   . THR A 1 115 ? 0.293   -19.421 -22.612 1.00 60.93 ? 172 THR A O   1 
ATOM   889  C CB  . THR A 1 115 ? -2.050  -20.996 -24.447 1.00 61.61 ? 172 THR A CB  1 
ATOM   890  O OG1 . THR A 1 115 ? -2.806  -22.204 -24.520 1.00 61.64 ? 172 THR A OG1 1 
ATOM   891  C CG2 . THR A 1 115 ? -0.782  -21.129 -25.336 1.00 62.65 ? 172 THR A CG2 1 
ATOM   892  N N   . ALA A 1 116 ? -1.603  -18.285 -23.004 1.00 61.41 ? 173 ALA A N   1 
ATOM   893  C CA  . ALA A 1 116 ? -0.953  -16.986 -22.943 1.00 61.47 ? 173 ALA A CA  1 
ATOM   894  C C   . ALA A 1 116 ? -0.442  -16.683 -21.543 1.00 61.25 ? 173 ALA A C   1 
ATOM   895  O O   . ALA A 1 116 ? 0.620   -16.084 -21.384 1.00 61.26 ? 173 ALA A O   1 
ATOM   896  C CB  . ALA A 1 116 ? -1.907  -15.883 -23.421 1.00 61.61 ? 173 ALA A CB  1 
ATOM   897  N N   . GLN A 1 117 ? -1.196  -17.085 -20.530 1.00 61.07 ? 174 GLN A N   1 
ATOM   898  C CA  . GLN A 1 117 ? -0.811  -16.795 -19.146 1.00 61.66 ? 174 GLN A CA  1 
ATOM   899  C C   . GLN A 1 117 ? 0.467   -17.535 -18.743 1.00 61.39 ? 174 GLN A C   1 
ATOM   900  O O   . GLN A 1 117 ? 1.349   -16.975 -18.069 1.00 60.74 ? 174 GLN A O   1 
ATOM   901  C CB  . GLN A 1 117 ? -1.933  -17.167 -18.160 1.00 61.70 ? 174 GLN A CB  1 
ATOM   902  C CG  . GLN A 1 117 ? -1.529  -16.938 -16.717 1.00 63.09 ? 174 GLN A CG  1 
ATOM   903  C CD  . GLN A 1 117 ? -2.678  -16.957 -15.742 1.00 64.59 ? 174 GLN A CD  1 
ATOM   904  O OE1 . GLN A 1 117 ? -3.618  -17.722 -15.900 1.00 66.61 ? 174 GLN A OE1 1 
ATOM   905  N NE2 . GLN A 1 117 ? -2.586  -16.135 -14.704 1.00 65.82 ? 174 GLN A NE2 1 
ATOM   906  N N   . LYS A 1 118 ? 0.534   -18.802 -19.147 1.00 61.13 ? 175 LYS A N   1 
ATOM   907  C CA  . LYS A 1 118 ? 1.603   -19.681 -18.742 1.00 61.23 ? 175 LYS A CA  1 
ATOM   908  C C   . LYS A 1 118 ? 2.887   -19.191 -19.397 1.00 61.19 ? 175 LYS A C   1 
ATOM   909  O O   . LYS A 1 118 ? 3.947   -19.208 -18.772 1.00 60.98 ? 175 LYS A O   1 
ATOM   910  C CB  . LYS A 1 118 ? 1.270   -21.119 -19.150 1.00 61.43 ? 175 LYS A CB  1 
ATOM   911  C CG  . LYS A 1 118 ? 2.230   -22.173 -18.629 1.00 62.65 ? 175 LYS A CG  1 
ATOM   912  N N   . ARG A 1 119 ? 2.785   -18.753 -20.653 1.00 60.77 ? 176 ARG A N   1 
ATOM   913  C CA  . ARG A 1 119 ? 3.918   -18.163 -21.360 1.00 61.08 ? 176 ARG A CA  1 
ATOM   914  C C   . ARG A 1 119 ? 4.405   -16.956 -20.554 1.00 60.95 ? 176 ARG A C   1 
ATOM   915  O O   . ARG A 1 119 ? 5.589   -16.848 -20.230 1.00 60.49 ? 176 ARG A O   1 
ATOM   916  C CB  . ARG A 1 119 ? 3.497   -17.752 -22.780 1.00 61.43 ? 176 ARG A CB  1 
ATOM   917  C CG  . ARG A 1 119 ? 4.625   -17.474 -23.784 1.00 63.50 ? 176 ARG A CG  1 
ATOM   918  C CD  . ARG A 1 119 ? 5.085   -15.994 -23.778 1.00 66.68 ? 176 ARG A CD  1 
ATOM   919  N NE  . ARG A 1 119 ? 6.091   -15.683 -24.820 1.00 68.30 ? 176 ARG A NE  1 
ATOM   920  C CZ  . ARG A 1 119 ? 6.799   -14.544 -24.879 1.00 68.65 ? 176 ARG A CZ  1 
ATOM   921  N NH1 . ARG A 1 119 ? 7.678   -14.352 -25.846 1.00 68.05 ? 176 ARG A NH1 1 
ATOM   922  N NH2 . ARG A 1 119 ? 6.628   -13.582 -23.976 1.00 69.55 ? 176 ARG A NH2 1 
ATOM   923  N N   . VAL A 1 120 ? 3.466   -16.078 -20.198 1.00 60.82 ? 177 VAL A N   1 
ATOM   924  C CA  . VAL A 1 120 ? 3.767   -14.853 -19.469 1.00 60.83 ? 177 VAL A CA  1 
ATOM   925  C C   . VAL A 1 120 ? 4.290   -15.153 -18.062 1.00 60.81 ? 177 VAL A C   1 
ATOM   926  O O   . VAL A 1 120 ? 5.243   -14.532 -17.617 1.00 61.01 ? 177 VAL A O   1 
ATOM   927  C CB  . VAL A 1 120 ? 2.524   -13.915 -19.417 1.00 60.90 ? 177 VAL A CB  1 
ATOM   928  C CG1 . VAL A 1 120 ? 2.643   -12.897 -18.313 1.00 60.70 ? 177 VAL A CG1 1 
ATOM   929  C CG2 . VAL A 1 120 ? 2.329   -13.223 -20.758 1.00 60.50 ? 177 VAL A CG2 1 
ATOM   930  N N   . TYR A 1 121 ? 3.666   -16.096 -17.369 1.00 60.74 ? 178 TYR A N   1 
ATOM   931  C CA  . TYR A 1 121 ? 4.170   -16.540 -16.073 1.00 60.89 ? 178 TYR A CA  1 
ATOM   932  C C   . TYR A 1 121 ? 5.616   -17.001 -16.161 1.00 60.63 ? 178 TYR A C   1 
ATOM   933  O O   . TYR A 1 121 ? 6.475   -16.532 -15.404 1.00 60.40 ? 178 TYR A O   1 
ATOM   934  C CB  . TYR A 1 121 ? 3.357   -17.701 -15.524 1.00 61.29 ? 178 TYR A CB  1 
ATOM   935  C CG  . TYR A 1 121 ? 3.796   -18.099 -14.146 1.00 62.06 ? 178 TYR A CG  1 
ATOM   936  C CD1 . TYR A 1 121 ? 4.720   -19.114 -13.946 1.00 63.38 ? 178 TYR A CD1 1 
ATOM   937  C CD2 . TYR A 1 121 ? 3.295   -17.443 -13.028 1.00 63.91 ? 178 TYR A CD2 1 
ATOM   938  C CE1 . TYR A 1 121 ? 5.128   -19.460 -12.661 1.00 63.65 ? 178 TYR A CE1 1 
ATOM   939  C CE2 . TYR A 1 121 ? 3.678   -17.789 -11.745 1.00 63.44 ? 178 TYR A CE2 1 
ATOM   940  C CZ  . TYR A 1 121 ? 4.590   -18.792 -11.565 1.00 63.22 ? 178 TYR A CZ  1 
ATOM   941  O OH  . TYR A 1 121 ? 4.980   -19.107 -10.277 1.00 64.57 ? 178 TYR A OH  1 
ATOM   942  N N   . SER A 1 122 ? 5.875   -17.937 -17.073 1.00 60.14 ? 179 SER A N   1 
ATOM   943  C CA  . SER A 1 122 ? 7.182   -18.542 -17.165 1.00 60.04 ? 179 SER A CA  1 
ATOM   944  C C   . SER A 1 122 ? 8.182   -17.499 -17.615 1.00 59.90 ? 179 SER A C   1 
ATOM   945  O O   . SER A 1 122 ? 9.341   -17.561 -17.233 1.00 60.06 ? 179 SER A O   1 
ATOM   946  C CB  . SER A 1 122 ? 7.164   -19.745 -18.099 1.00 60.31 ? 179 SER A CB  1 
ATOM   947  O OG  . SER A 1 122 ? 6.333   -20.765 -17.562 1.00 60.75 ? 179 SER A OG  1 
ATOM   948  N N   . LEU A 1 123 ? 7.717   -16.517 -18.388 1.00 59.84 ? 180 LEU A N   1 
ATOM   949  C CA  . LEU A 1 123 ? 8.558   -15.389 -18.792 1.00 59.46 ? 180 LEU A CA  1 
ATOM   950  C C   . LEU A 1 123 ? 9.062   -14.675 -17.547 1.00 58.67 ? 180 LEU A C   1 
ATOM   951  O O   . LEU A 1 123 ? 10.259  -14.524 -17.346 1.00 57.92 ? 180 LEU A O   1 
ATOM   952  C CB  . LEU A 1 123 ? 7.777   -14.399 -19.683 1.00 59.67 ? 180 LEU A CB  1 
ATOM   953  C CG  . LEU A 1 123 ? 8.567   -13.243 -20.341 1.00 60.47 ? 180 LEU A CG  1 
ATOM   954  C CD1 . LEU A 1 123 ? 9.102   -12.207 -19.336 1.00 61.13 ? 180 LEU A CD1 1 
ATOM   955  C CD2 . LEU A 1 123 ? 9.726   -13.806 -21.192 1.00 61.84 ? 180 LEU A CD2 1 
ATOM   956  N N   . MET A 1 124 ? 8.126   -14.257 -16.708 1.00 58.07 ? 181 MET A N   1 
ATOM   957  C CA  . MET A 1 124 ? 8.454   -13.535 -15.490 1.00 57.63 ? 181 MET A CA  1 
ATOM   958  C C   . MET A 1 124 ? 9.272   -14.393 -14.533 1.00 57.05 ? 181 MET A C   1 
ATOM   959  O O   . MET A 1 124 ? 10.272  -13.932 -13.993 1.00 56.59 ? 181 MET A O   1 
ATOM   960  C CB  . MET A 1 124 ? 7.189   -13.050 -14.799 1.00 57.42 ? 181 MET A CB  1 
ATOM   961  C CG  . MET A 1 124 ? 6.416   -12.026 -15.587 1.00 57.81 ? 181 MET A CG  1 
ATOM   962  S SD  . MET A 1 124 ? 4.949   -11.403 -14.739 1.00 58.20 ? 181 MET A SD  1 
ATOM   963  C CE  . MET A 1 124 ? 3.933   -12.827 -14.484 1.00 57.74 ? 181 MET A CE  1 
ATOM   964  N N   . GLU A 1 125 ? 8.853   -15.641 -14.351 1.00 57.00 ? 182 GLU A N   1 
ATOM   965  C CA  . GLU A 1 125 ? 9.499   -16.546 -13.397 1.00 57.35 ? 182 GLU A CA  1 
ATOM   966  C C   . GLU A 1 125 ? 10.965  -16.776 -13.706 1.00 57.06 ? 182 GLU A C   1 
ATOM   967  O O   . GLU A 1 125 ? 11.793  -16.736 -12.812 1.00 56.82 ? 182 GLU A O   1 
ATOM   968  C CB  . GLU A 1 125 ? 8.791   -17.903 -13.337 1.00 57.02 ? 182 GLU A CB  1 
ATOM   969  C CG  . GLU A 1 125 ? 9.420   -18.843 -12.309 1.00 58.24 ? 182 GLU A CG  1 
ATOM   970  C CD  . GLU A 1 125 ? 8.775   -20.221 -12.239 1.00 58.76 ? 182 GLU A CD  1 
ATOM   971  O OE1 . GLU A 1 125 ? 8.715   -20.760 -11.108 1.00 59.29 ? 182 GLU A OE1 1 
ATOM   972  O OE2 . GLU A 1 125 ? 8.353   -20.770 -13.298 1.00 60.44 ? 182 GLU A OE2 1 
ATOM   973  N N   . ASN A 1 126 ? 11.271  -17.039 -14.969 1.00 57.60 ? 183 ASN A N   1 
ATOM   974  C CA  . ASN A 1 126 ? 12.641  -17.356 -15.382 1.00 57.90 ? 183 ASN A CA  1 
ATOM   975  C C   . ASN A 1 126 ? 13.444  -16.118 -15.757 1.00 58.13 ? 183 ASN A C   1 
ATOM   976  O O   . ASN A 1 126 ? 14.657  -16.194 -15.916 1.00 58.42 ? 183 ASN A O   1 
ATOM   977  C CB  . ASN A 1 126 ? 12.624  -18.331 -16.552 1.00 57.75 ? 183 ASN A CB  1 
ATOM   978  C CG  . ASN A 1 126 ? 11.922  -19.636 -16.209 1.00 58.12 ? 183 ASN A CG  1 
ATOM   979  O OD1 . ASN A 1 126 ? 10.693  -19.725 -16.270 1.00 59.28 ? 183 ASN A OD1 1 
ATOM   980  N ND2 . ASN A 1 126 ? 12.697  -20.650 -15.839 1.00 56.06 ? 183 ASN A ND2 1 
ATOM   981  N N   . ASN A 1 127 ? 12.773  -14.970 -15.866 1.00 58.33 ? 184 ASN A N   1 
ATOM   982  C CA  . ASN A 1 127 ? 13.416  -13.772 -16.383 1.00 58.22 ? 184 ASN A CA  1 
ATOM   983  C C   . ASN A 1 127 ? 13.373  -12.566 -15.451 1.00 58.12 ? 184 ASN A C   1 
ATOM   984  O O   . ASN A 1 127 ? 14.387  -12.233 -14.837 1.00 57.62 ? 184 ASN A O   1 
ATOM   985  C CB  . ASN A 1 127 ? 12.819  -13.436 -17.737 1.00 58.53 ? 184 ASN A CB  1 
ATOM   986  C CG  . ASN A 1 127 ? 13.683  -12.509 -18.531 1.00 59.57 ? 184 ASN A CG  1 
ATOM   987  O OD1 . ASN A 1 127 ? 14.369  -12.925 -19.478 1.00 56.86 ? 184 ASN A OD1 1 
ATOM   988  N ND2 . ASN A 1 127 ? 13.659  -11.224 -18.154 1.00 61.85 ? 184 ASN A ND2 1 
ATOM   989  N N   . SER A 1 128 ? 12.215  -11.909 -15.328 1.00 58.29 ? 185 SER A N   1 
ATOM   990  C CA  . SER A 1 128 ? 12.162  -10.630 -14.603 1.00 58.14 ? 185 SER A CA  1 
ATOM   991  C C   . SER A 1 128 ? 12.316  -10.798 -13.103 1.00 57.60 ? 185 SER A C   1 
ATOM   992  O O   . SER A 1 128 ? 12.877  -9.929  -12.449 1.00 57.59 ? 185 SER A O   1 
ATOM   993  C CB  . SER A 1 128 ? 10.898  -9.839  -14.936 1.00 58.32 ? 185 SER A CB  1 
ATOM   994  O OG  . SER A 1 128 ? 9.793   -10.696 -15.056 1.00 59.75 ? 185 SER A OG  1 
ATOM   995  N N   . TYR A 1 129 ? 11.852  -11.931 -12.581 1.00 57.44 ? 186 TYR A N   1 
ATOM   996  C CA  . TYR A 1 129 ? 11.961  -12.255 -11.164 1.00 57.41 ? 186 TYR A CA  1 
ATOM   997  C C   . TYR A 1 129 ? 13.416  -12.348 -10.666 1.00 57.91 ? 186 TYR A C   1 
ATOM   998  O O   . TYR A 1 129 ? 13.776  -11.630 -9.727  1.00 58.15 ? 186 TYR A O   1 
ATOM   999  C CB  . TYR A 1 129 ? 11.149  -13.520 -10.867 1.00 57.42 ? 186 TYR A CB  1 
ATOM   1000 C CG  . TYR A 1 129 ? 11.336  -14.136 -9.492  1.00 57.28 ? 186 TYR A CG  1 
ATOM   1001 C CD1 . TYR A 1 129 ? 10.943  -13.445 -8.345  1.00 57.29 ? 186 TYR A CD1 1 
ATOM   1002 C CD2 . TYR A 1 129 ? 11.852  -15.434 -9.341  1.00 55.82 ? 186 TYR A CD2 1 
ATOM   1003 C CE1 . TYR A 1 129 ? 11.082  -13.992 -7.085  1.00 56.07 ? 186 TYR A CE1 1 
ATOM   1004 C CE2 . TYR A 1 129 ? 12.000  -16.002 -8.075  1.00 56.79 ? 186 TYR A CE2 1 
ATOM   1005 C CZ  . TYR A 1 129 ? 11.609  -15.265 -6.944  1.00 58.02 ? 186 TYR A CZ  1 
ATOM   1006 O OH  . TYR A 1 129 ? 11.740  -15.792 -5.682  1.00 57.14 ? 186 TYR A OH  1 
ATOM   1007 N N   . PRO A 1 130 ? 14.257  -13.227 -11.267 1.00 58.14 ? 187 PRO A N   1 
ATOM   1008 C CA  . PRO A 1 130 ? 15.688  -13.188 -10.954 1.00 58.45 ? 187 PRO A CA  1 
ATOM   1009 C C   . PRO A 1 130 ? 16.339  -11.805 -11.023 1.00 58.74 ? 187 PRO A C   1 
ATOM   1010 O O   . PRO A 1 130 ? 17.255  -11.530 -10.241 1.00 58.87 ? 187 PRO A O   1 
ATOM   1011 C CB  . PRO A 1 130 ? 16.301  -14.098 -12.022 1.00 58.17 ? 187 PRO A CB  1 
ATOM   1012 C CG  . PRO A 1 130 ? 15.254  -15.067 -12.313 1.00 58.46 ? 187 PRO A CG  1 
ATOM   1013 C CD  . PRO A 1 130 ? 13.953  -14.339 -12.191 1.00 58.08 ? 187 PRO A CD  1 
ATOM   1014 N N   . ARG A 1 131 ? 15.886  -10.961 -11.955 1.00 59.11 ? 188 ARG A N   1 
ATOM   1015 C CA  . ARG A 1 131 ? 16.456  -9.621  -12.122 1.00 59.68 ? 188 ARG A CA  1 
ATOM   1016 C C   . ARG A 1 131 ? 15.940  -8.751  -11.000 1.00 59.02 ? 188 ARG A C   1 
ATOM   1017 O O   . ARG A 1 131 ? 16.681  -7.908  -10.484 1.00 59.39 ? 188 ARG A O   1 
ATOM   1018 C CB  . ARG A 1 131 ? 16.087  -8.994  -13.476 1.00 59.92 ? 188 ARG A CB  1 
ATOM   1019 C CG  . ARG A 1 131 ? 17.265  -8.265  -14.147 1.00 61.28 ? 188 ARG A CG  1 
ATOM   1020 C CD  . ARG A 1 131 ? 16.874  -7.159  -15.174 1.00 61.63 ? 188 ARG A CD  1 
ATOM   1021 N NE  . ARG A 1 131 ? 15.451  -7.089  -15.549 1.00 61.82 ? 188 ARG A NE  1 
ATOM   1022 C CZ  . ARG A 1 131 ? 14.821  -7.970  -16.323 1.00 64.08 ? 188 ARG A CZ  1 
ATOM   1023 N NH1 . ARG A 1 131 ? 13.536  -7.798  -16.631 1.00 62.85 ? 188 ARG A NH1 1 
ATOM   1024 N NH2 . ARG A 1 131 ? 15.466  -9.039  -16.782 1.00 66.10 ? 188 ARG A NH2 1 
ATOM   1025 N N   . PHE A 1 132 ? 14.666  -8.950  -10.642 1.00 58.03 ? 189 PHE A N   1 
ATOM   1026 C CA  . PHE A 1 132 ? 14.083  -8.314  -9.466  1.00 57.06 ? 189 PHE A CA  1 
ATOM   1027 C C   . PHE A 1 132 ? 14.937  -8.563  -8.237  1.00 56.76 ? 189 PHE A C   1 
ATOM   1028 O O   . PHE A 1 132 ? 15.291  -7.631  -7.532  1.00 56.38 ? 189 PHE A O   1 
ATOM   1029 C CB  . PHE A 1 132 ? 12.654  -8.794  -9.212  1.00 56.44 ? 189 PHE A CB  1 
ATOM   1030 C CG  . PHE A 1 132 ? 12.062  -8.271  -7.936  1.00 55.05 ? 189 PHE A CG  1 
ATOM   1031 C CD1 . PHE A 1 132 ? 11.919  -9.091  -6.836  1.00 53.11 ? 189 PHE A CD1 1 
ATOM   1032 C CD2 . PHE A 1 132 ? 11.697  -6.931  -7.821  1.00 56.18 ? 189 PHE A CD2 1 
ATOM   1033 C CE1 . PHE A 1 132 ? 11.403  -8.600  -5.656  1.00 54.94 ? 189 PHE A CE1 1 
ATOM   1034 C CE2 . PHE A 1 132 ? 11.158  -6.432  -6.627  1.00 55.20 ? 189 PHE A CE2 1 
ATOM   1035 C CZ  . PHE A 1 132 ? 11.017  -7.265  -5.553  1.00 54.60 ? 189 PHE A CZ  1 
ATOM   1036 N N   . LEU A 1 133 ? 15.278  -9.825  -8.008  1.00 56.79 ? 190 LEU A N   1 
ATOM   1037 C CA  . LEU A 1 133 ? 16.023  -10.223 -6.819  1.00 56.60 ? 190 LEU A CA  1 
ATOM   1038 C C   . LEU A 1 133 ? 17.418  -9.642  -6.763  1.00 57.07 ? 190 LEU A C   1 
ATOM   1039 O O   . LEU A 1 133 ? 17.945  -9.416  -5.678  1.00 57.15 ? 190 LEU A O   1 
ATOM   1040 C CB  . LEU A 1 133 ? 16.090  -11.743 -6.720  1.00 56.37 ? 190 LEU A CB  1 
ATOM   1041 C CG  . LEU A 1 133 ? 14.721  -12.408 -6.529  1.00 55.66 ? 190 LEU A CG  1 
ATOM   1042 C CD1 . LEU A 1 133 ? 14.868  -13.915 -6.427  1.00 54.98 ? 190 LEU A CD1 1 
ATOM   1043 C CD2 . LEU A 1 133 ? 13.964  -11.839 -5.307  1.00 55.56 ? 190 LEU A CD2 1 
ATOM   1044 N N   . GLU A 1 134 ? 18.015  -9.388  -7.922  1.00 57.55 ? 191 GLU A N   1 
ATOM   1045 C CA  . GLU A 1 134 ? 19.344  -8.777  -7.973  1.00 58.00 ? 191 GLU A CA  1 
ATOM   1046 C C   . GLU A 1 134 ? 19.332  -7.244  -7.943  1.00 57.58 ? 191 GLU A C   1 
ATOM   1047 O O   . GLU A 1 134 ? 20.375  -6.635  -7.846  1.00 57.81 ? 191 GLU A O   1 
ATOM   1048 C CB  . GLU A 1 134 ? 20.093  -9.277  -9.208  1.00 58.29 ? 191 GLU A CB  1 
ATOM   1049 C CG  . GLU A 1 134 ? 20.359  -10.798 -9.189  1.00 59.33 ? 191 GLU A CG  1 
ATOM   1050 C CD  . GLU A 1 134 ? 20.819  -11.342 -10.533 1.00 59.64 ? 191 GLU A CD  1 
ATOM   1051 O OE1 . GLU A 1 134 ? 22.049  -11.342 -10.799 1.00 63.19 ? 191 GLU A OE1 1 
ATOM   1052 O OE2 . GLU A 1 134 ? 19.955  -11.791 -11.319 1.00 61.33 ? 191 GLU A OE2 1 
ATOM   1053 N N   . SER A 1 135 ? 18.155  -6.618  -8.000  1.00 57.45 ? 192 SER A N   1 
ATOM   1054 C CA  . SER A 1 135 ? 18.055  -5.152  -8.120  1.00 56.63 ? 192 SER A CA  1 
ATOM   1055 C C   . SER A 1 135 ? 18.556  -4.445  -6.876  1.00 56.64 ? 192 SER A C   1 
ATOM   1056 O O   . SER A 1 135 ? 18.395  -4.953  -5.786  1.00 55.66 ? 192 SER A O   1 
ATOM   1057 C CB  . SER A 1 135 ? 16.594  -4.749  -8.349  1.00 56.55 ? 192 SER A CB  1 
ATOM   1058 O OG  . SER A 1 135 ? 15.795  -5.071  -7.216  1.00 54.53 ? 192 SER A OG  1 
ATOM   1059 N N   . GLU A 1 136 ? 19.119  -3.252  -7.030  1.00 57.27 ? 193 GLU A N   1 
ATOM   1060 C CA  . GLU A 1 136 ? 19.470  -2.448  -5.858  1.00 58.27 ? 193 GLU A CA  1 
ATOM   1061 C C   . GLU A 1 136 ? 18.205  -2.173  -5.003  1.00 57.93 ? 193 GLU A C   1 
ATOM   1062 O O   . GLU A 1 136 ? 18.249  -2.185  -3.788  1.00 57.75 ? 193 GLU A O   1 
ATOM   1063 C CB  . GLU A 1 136 ? 20.200  -1.152  -6.278  1.00 58.58 ? 193 GLU A CB  1 
ATOM   1064 C CG  . GLU A 1 136 ? 21.767  -1.306  -6.454  1.00 58.93 ? 193 GLU A CG  1 
ATOM   1065 C CD  . GLU A 1 136 ? 22.426  -0.219  -7.358  1.00 60.75 ? 193 GLU A CD  1 
ATOM   1066 O OE1 . GLU A 1 136 ? 21.671  0.560   -8.008  1.00 64.88 ? 193 GLU A OE1 1 
ATOM   1067 O OE2 . GLU A 1 136 ? 23.702  -0.136  -7.438  1.00 61.53 ? 193 GLU A OE2 1 
ATOM   1068 N N   . PHE A 1 137 ? 17.071  -1.967  -5.664  1.00 58.25 ? 194 PHE A N   1 
ATOM   1069 C CA  . PHE A 1 137 ? 15.789  -1.691  -5.001  1.00 57.80 ? 194 PHE A CA  1 
ATOM   1070 C C   . PHE A 1 137 ? 15.353  -2.797  -4.036  1.00 57.59 ? 194 PHE A C   1 
ATOM   1071 O O   . PHE A 1 137 ? 14.988  -2.522  -2.910  1.00 57.33 ? 194 PHE A O   1 
ATOM   1072 C CB  . PHE A 1 137 ? 14.730  -1.446  -6.071  1.00 57.72 ? 194 PHE A CB  1 
ATOM   1073 C CG  . PHE A 1 137 ? 13.331  -1.344  -5.544  1.00 58.30 ? 194 PHE A CG  1 
ATOM   1074 C CD1 . PHE A 1 137 ? 12.933  -0.232  -4.804  1.00 56.25 ? 194 PHE A CD1 1 
ATOM   1075 C CD2 . PHE A 1 137 ? 12.390  -2.354  -5.822  1.00 58.32 ? 194 PHE A CD2 1 
ATOM   1076 C CE1 . PHE A 1 137 ? 11.634  -0.130  -4.327  1.00 55.73 ? 194 PHE A CE1 1 
ATOM   1077 C CE2 . PHE A 1 137 ? 11.074  -2.252  -5.342  1.00 58.19 ? 194 PHE A CE2 1 
ATOM   1078 C CZ  . PHE A 1 137 ? 10.704  -1.148  -4.591  1.00 57.24 ? 194 PHE A CZ  1 
ATOM   1079 N N   . TYR A 1 138 ? 15.414  -4.041  -4.479  1.00 57.78 ? 195 TYR A N   1 
ATOM   1080 C CA  . TYR A 1 138 ? 15.064  -5.167  -3.639  1.00 58.19 ? 195 TYR A CA  1 
ATOM   1081 C C   . TYR A 1 138 ? 16.066  -5.404  -2.515  1.00 58.98 ? 195 TYR A C   1 
ATOM   1082 O O   . TYR A 1 138 ? 15.674  -5.847  -1.427  1.00 58.94 ? 195 TYR A O   1 
ATOM   1083 C CB  . TYR A 1 138 ? 14.953  -6.448  -4.474  1.00 58.26 ? 195 TYR A CB  1 
ATOM   1084 C CG  . TYR A 1 138 ? 14.683  -7.678  -3.628  1.00 58.32 ? 195 TYR A CG  1 
ATOM   1085 C CD1 . TYR A 1 138 ? 15.634  -8.672  -3.493  1.00 59.30 ? 195 TYR A CD1 1 
ATOM   1086 C CD2 . TYR A 1 138 ? 13.499  -7.818  -2.924  1.00 57.82 ? 195 TYR A CD2 1 
ATOM   1087 C CE1 . TYR A 1 138 ? 15.394  -9.794  -2.712  1.00 59.29 ? 195 TYR A CE1 1 
ATOM   1088 C CE2 . TYR A 1 138 ? 13.266  -8.920  -2.136  1.00 58.11 ? 195 TYR A CE2 1 
ATOM   1089 C CZ  . TYR A 1 138 ? 14.210  -9.909  -2.043  1.00 58.29 ? 195 TYR A CZ  1 
ATOM   1090 O OH  . TYR A 1 138 ? 13.993  -11.015 -1.254  1.00 58.09 ? 195 TYR A OH  1 
ATOM   1091 N N   . GLN A 1 139 ? 17.349  -5.136  -2.773  1.00 59.70 ? 196 GLN A N   1 
ATOM   1092 C CA  . GLN A 1 139 ? 18.378  -5.340  -1.764  1.00 60.55 ? 196 GLN A CA  1 
ATOM   1093 C C   . GLN A 1 139 ? 18.107  -4.420  -0.599  1.00 60.78 ? 196 GLN A C   1 
ATOM   1094 O O   . GLN A 1 139 ? 18.125  -4.855  0.545   1.00 60.89 ? 196 GLN A O   1 
ATOM   1095 C CB  . GLN A 1 139 ? 19.778  -5.027  -2.276  1.00 60.93 ? 196 GLN A CB  1 
ATOM   1096 C CG  . GLN A 1 139 ? 20.211  -5.695  -3.571  1.00 63.25 ? 196 GLN A CG  1 
ATOM   1097 C CD  . GLN A 1 139 ? 20.441  -7.174  -3.443  1.00 65.46 ? 196 GLN A CD  1 
ATOM   1098 O OE1 . GLN A 1 139 ? 19.487  -7.943  -3.251  1.00 66.76 ? 196 GLN A OE1 1 
ATOM   1099 N NE2 . GLN A 1 139 ? 21.717  -7.598  -3.570  1.00 64.57 ? 196 GLN A NE2 1 
ATOM   1100 N N   . ASP A 1 140 ? 17.872  -3.142  -0.896  1.00 61.22 ? 197 ASP A N   1 
ATOM   1101 C CA  . ASP A 1 140 ? 17.549  -2.151  0.138   1.00 61.65 ? 197 ASP A CA  1 
ATOM   1102 C C   . ASP A 1 140 ? 16.279  -2.507  0.915   1.00 62.06 ? 197 ASP A C   1 
ATOM   1103 O O   . ASP A 1 140 ? 16.184  -2.172  2.084   1.00 62.11 ? 197 ASP A O   1 
ATOM   1104 C CB  . ASP A 1 140 ? 17.392  -0.750  -0.466  1.00 61.78 ? 197 ASP A CB  1 
ATOM   1105 N N   . LEU A 1 141 ? 15.303  -3.153  0.270   1.00 62.28 ? 198 LEU A N   1 
ATOM   1106 C CA  . LEU A 1 141 ? 14.098  -3.606  0.979   1.00 63.17 ? 198 LEU A CA  1 
ATOM   1107 C C   . LEU A 1 141 ? 14.433  -4.700  1.984   1.00 63.49 ? 198 LEU A C   1 
ATOM   1108 O O   . LEU A 1 141 ? 13.827  -4.772  3.033   1.00 63.23 ? 198 LEU A O   1 
ATOM   1109 C CB  . LEU A 1 141 ? 13.031  -4.138  0.019   1.00 63.08 ? 198 LEU A CB  1 
ATOM   1110 C CG  . LEU A 1 141 ? 12.409  -3.143  -0.952  1.00 63.30 ? 198 LEU A CG  1 
ATOM   1111 C CD1 . LEU A 1 141 ? 11.429  -3.877  -1.816  1.00 63.90 ? 198 LEU A CD1 1 
ATOM   1112 C CD2 . LEU A 1 141 ? 11.728  -1.993  -0.233  1.00 64.07 ? 198 LEU A CD2 1 
ATOM   1113 N N   . CYS A 1 142 ? 15.397  -5.544  1.639   1.00 64.12 ? 199 CYS A N   1 
ATOM   1114 C CA  . CYS A 1 142 ? 15.856  -6.601  2.518   1.00 65.25 ? 199 CYS A CA  1 
ATOM   1115 C C   . CYS A 1 142 ? 16.789  -6.173  3.646   1.00 66.16 ? 199 CYS A C   1 
ATOM   1116 O O   . CYS A 1 142 ? 16.907  -6.887  4.626   1.00 65.93 ? 199 CYS A O   1 
ATOM   1117 C CB  . CYS A 1 142 ? 16.548  -7.671  1.692   1.00 65.06 ? 199 CYS A CB  1 
ATOM   1118 S SG  . CYS A 1 142 ? 15.388  -8.433  0.608   1.00 64.58 ? 199 CYS A SG  1 
ATOM   1119 N N   . LYS A 1 143 ? 17.450  -5.029  3.498   1.00 68.18 ? 200 LYS A N   1 
ATOM   1120 C CA  . LYS A 1 143 ? 18.424  -4.534  4.479   1.00 69.53 ? 200 LYS A CA  1 
ATOM   1121 C C   . LYS A 1 143 ? 17.710  -4.191  5.790   1.00 71.15 ? 200 LYS A C   1 
ATOM   1122 O O   . LYS A 1 143 ? 16.711  -3.454  5.785   1.00 71.31 ? 200 LYS A O   1 
ATOM   1123 C CB  . LYS A 1 143 ? 19.152  -3.305  3.931   1.00 69.47 ? 200 LYS A CB  1 
ATOM   1124 C CG  . LYS A 1 143 ? 20.432  -2.923  4.659   1.00 70.42 ? 200 LYS A CG  1 
ATOM   1125 N N   . LYS A 1 144 ? 18.204  -4.777  6.889   1.00 72.85 ? 201 LYS A N   1 
ATOM   1126 C CA  . LYS A 1 144 ? 17.750  -4.470  8.251   1.00 74.20 ? 201 LYS A CA  1 
ATOM   1127 C C   . LYS A 1 144 ? 18.456  -3.186  8.716   1.00 75.54 ? 201 LYS A C   1 
ATOM   1128 O O   . LYS A 1 144 ? 19.679  -3.049  8.518   1.00 75.88 ? 201 LYS A O   1 
ATOM   1129 C CB  . LYS A 1 144 ? 18.117  -5.617  9.210   1.00 74.26 ? 201 LYS A CB  1 
ATOM   1130 C CG  . LYS A 1 144 ? 17.606  -7.015  8.816   1.00 74.19 ? 201 LYS A CG  1 
ATOM   1131 C CD  . LYS A 1 144 ? 16.615  -7.605  9.819   1.00 74.55 ? 201 LYS A CD  1 
ATOM   1132 C CE  . LYS A 1 144 ? 17.285  -8.478  10.890  1.00 75.06 ? 201 LYS A CE  1 
ATOM   1133 N NZ  . LYS A 1 144 ? 17.166  -9.952  10.634  1.00 74.46 ? 201 LYS A NZ  1 
ATOM   1134 N N   . PRO A 1 145 ? 17.727  -2.263  9.379   1.00 76.92 ? 202 PRO A N   1 
ATOM   1135 C CA  . PRO A 1 145 ? 18.349  -0.942  9.638   1.00 77.64 ? 202 PRO A CA  1 
ATOM   1136 C C   . PRO A 1 145 ? 19.392  -0.948  10.759  1.00 78.01 ? 202 PRO A C   1 
ATOM   1137 O O   . PRO A 1 145 ? 19.659  -2.005  11.340  1.00 78.18 ? 202 PRO A O   1 
ATOM   1138 C CB  . PRO A 1 145 ? 17.152  -0.051  10.021  1.00 77.76 ? 202 PRO A CB  1 
ATOM   1139 C CG  . PRO A 1 145 ? 15.898  -0.920  9.792   1.00 77.87 ? 202 PRO A CG  1 
ATOM   1140 C CD  . PRO A 1 145 ? 16.368  -2.334  9.940   1.00 77.12 ? 202 PRO A CD  1 
ATOM   1141 N N   . GLN A 1 146 ? 19.958  0.231   11.041  1.00 78.31 ? 203 GLN A N   1 
ATOM   1142 C CA  . GLN A 1 146 ? 20.954  0.460   12.117  1.00 78.66 ? 203 GLN A CA  1 
ATOM   1143 C C   . GLN A 1 146 ? 22.377  0.237   11.606  1.00 78.36 ? 203 GLN A C   1 
ATOM   1144 O O   . GLN A 1 146 ? 23.214  1.122   11.681  1.00 77.37 ? 203 GLN A O   1 
ATOM   1145 C CB  . GLN A 1 146 ? 20.716  -0.416  13.368  1.00 79.07 ? 203 GLN A CB  1 
ATOM   1146 C CG  . GLN A 1 146 ? 19.322  -0.301  14.014  1.00 80.21 ? 203 GLN A CG  1 
ATOM   1147 C CD  . GLN A 1 146 ? 19.179  0.882   14.970  1.00 81.81 ? 203 GLN A CD  1 
ATOM   1148 O OE1 . GLN A 1 146 ? 18.219  0.945   15.747  1.00 82.07 ? 203 GLN A OE1 1 
ATOM   1149 N NE2 . GLN A 1 146 ? 20.133  1.816   14.923  1.00 81.98 ? 203 GLN A NE2 1 
HETATM 1150 O O   . HOH B 2 .   ? -12.118 -20.612 -23.871 1.00 30.14 ? 1   HOH A O   1 
HETATM 1151 O O   . HOH B 2 .   ? 0.331   -10.610 2.106   1.00 47.38 ? 2   HOH A O   1 
HETATM 1152 O O   . HOH B 2 .   ? 8.285   -9.086  -17.389 1.00 59.23 ? 3   HOH A O   1 
HETATM 1153 O O   . HOH B 2 .   ? 11.497  -2.893  3.777   1.00 51.03 ? 4   HOH A O   1 
HETATM 1154 O O   . HOH B 2 .   ? 1.256   -17.162 -5.521  1.00 68.33 ? 5   HOH A O   1 
HETATM 1155 O O   . HOH B 2 .   ? -7.289  -0.595  -23.092 1.00 49.30 ? 6   HOH A O   1 
HETATM 1156 O O   . HOH B 2 .   ? 18.276  -13.838 -8.940  1.00 43.01 ? 7   HOH A O   1 
HETATM 1157 O O   . HOH B 2 .   ? -18.532 -17.500 -21.822 1.00 54.81 ? 8   HOH A O   1 
HETATM 1158 O O   . HOH B 2 .   ? -4.170  -18.493 -24.300 1.00 52.99 ? 9   HOH A O   1 
HETATM 1159 O O   . HOH B 2 .   ? 4.741   -23.663 -18.324 1.00 58.72 ? 10  HOH A O   1 
HETATM 1160 O O   . HOH B 2 .   ? -0.895  3.574   7.168   1.00 32.18 ? 11  HOH A O   1 
HETATM 1161 O O   . HOH B 2 .   ? -5.121  -19.130 -27.029 1.00 52.12 ? 12  HOH A O   1 
HETATM 1162 O O   . HOH B 2 .   ? 5.254   -10.845 2.465   1.00 64.08 ? 13  HOH A O   1 
HETATM 1163 O O   . HOH B 2 .   ? 4.373   -2.136  6.831   1.00 63.00 ? 14  HOH A O   1 
HETATM 1164 O O   . HOH B 2 .   ? -7.962  -18.162 -18.538 1.00 51.72 ? 15  HOH A O   1 
HETATM 1165 O O   . HOH B 2 .   ? 17.320  -0.917  -8.542  1.00 59.57 ? 16  HOH A O   1 
HETATM 1166 O O   . HOH B 2 .   ? -0.006  -5.221  -4.119  1.00 57.48 ? 17  HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ALA 1   58  58  ALA ALA A . n 
A 1 2   ASP 2   59  59  ASP ASP A . n 
A 1 3   LEU 3   60  60  LEU LEU A . n 
A 1 4   GLY 4   61  61  GLY GLY A . n 
A 1 5   THR 5   62  62  THR THR A . n 
A 1 6   GLU 6   63  63  GLU GLU A . n 
A 1 7   ASN 7   64  64  ASN ASN A . n 
A 1 8   LEU 8   65  65  LEU LEU A . n 
A 1 9   TYR 9   66  66  TYR TYR A . n 
A 1 10  PHE 10  67  67  PHE PHE A . n 
A 1 11  GLN 11  68  68  GLN GLN A . n 
A 1 12  SER 12  69  69  SER SER A . n 
A 1 13  MET 13  70  70  MET MET A . n 
A 1 14  LYS 14  71  71  LYS LYS A . n 
A 1 15  PRO 15  72  72  PRO PRO A . n 
A 1 16  SER 16  73  73  SER SER A . n 
A 1 17  PRO 17  74  74  PRO PRO A . n 
A 1 18  GLU 18  75  75  GLU GLU A . n 
A 1 19  GLU 19  76  76  GLU GLU A . n 
A 1 20  ALA 20  77  77  ALA ALA A . n 
A 1 21  GLN 21  78  78  GLN GLN A . n 
A 1 22  LEU 22  79  79  LEU LEU A . n 
A 1 23  TRP 23  80  80  TRP TRP A . n 
A 1 24  SER 24  81  81  SER SER A . n 
A 1 25  GLU 25  82  82  GLU GLU A . n 
A 1 26  ALA 26  83  83  ALA ALA A . n 
A 1 27  PHE 27  84  84  PHE PHE A . n 
A 1 28  ASP 28  85  85  ASP ASP A . n 
A 1 29  GLU 29  86  86  GLU GLU A . n 
A 1 30  LEU 30  87  87  LEU LEU A . n 
A 1 31  LEU 31  88  88  LEU LEU A . n 
A 1 32  ALA 32  89  89  ALA ALA A . n 
A 1 33  SER 33  90  90  SER SER A . n 
A 1 34  LYS 34  91  91  LYS LYS A . n 
A 1 35  TYR 35  92  92  TYR TYR A . n 
A 1 36  GLY 36  93  93  GLY GLY A . n 
A 1 37  LEU 37  94  94  LEU LEU A . n 
A 1 38  ALA 38  95  95  ALA ALA A . n 
A 1 39  ALA 39  96  96  ALA ALA A . n 
A 1 40  PHE 40  97  97  PHE PHE A . n 
A 1 41  ARG 41  98  98  ARG ARG A . n 
A 1 42  ALA 42  99  99  ALA ALA A . n 
A 1 43  PHE 43  100 100 PHE PHE A . n 
A 1 44  LEU 44  101 101 LEU LEU A . n 
A 1 45  LYS 45  102 102 LYS LYS A . n 
A 1 46  SER 46  103 103 SER SER A . n 
A 1 47  GLU 47  104 104 GLU GLU A . n 
A 1 48  PHE 48  105 105 PHE PHE A . n 
A 1 49  CYS 49  106 106 CYS CYS A . n 
A 1 50  GLU 50  107 107 GLU GLU A . n 
A 1 51  GLU 51  108 108 GLU GLU A . n 
A 1 52  ASN 52  109 109 ASN ASN A . n 
A 1 53  ILE 53  110 110 ILE ILE A . n 
A 1 54  GLU 54  111 111 GLU GLU A . n 
A 1 55  PHE 55  112 112 PHE PHE A . n 
A 1 56  TRP 56  113 113 TRP TRP A . n 
A 1 57  LEU 57  114 114 LEU LEU A . n 
A 1 58  ALA 58  115 115 ALA ALA A . n 
A 1 59  CYS 59  116 116 CYS CYS A . n 
A 1 60  GLU 60  117 117 GLU GLU A . n 
A 1 61  ASP 61  118 118 ASP ASP A . n 
A 1 62  PHE 62  119 119 PHE PHE A . n 
A 1 63  LYS 63  120 120 LYS LYS A . n 
A 1 64  LYS 64  121 121 LYS LYS A . n 
A 1 65  THR 65  122 122 THR THR A . n 
A 1 66  LYS 66  123 123 LYS LYS A . n 
A 1 67  SER 67  124 124 SER SER A . n 
A 1 68  PRO 68  125 125 PRO PRO A . n 
A 1 69  GLN 69  126 126 GLN GLN A . n 
A 1 70  LYS 70  127 127 LYS LYS A . n 
A 1 71  LEU 71  128 128 LEU LEU A . n 
A 1 72  SER 72  129 129 SER SER A . n 
A 1 73  SER 73  130 130 SER SER A . n 
A 1 74  LYS 74  131 131 LYS LYS A . n 
A 1 75  ALA 75  132 132 ALA ALA A . n 
A 1 76  ARG 76  133 133 ARG ARG A . n 
A 1 77  LYS 77  134 134 LYS LYS A . n 
A 1 78  ILE 78  135 135 ILE ILE A . n 
A 1 79  TYR 79  136 136 TYR TYR A . n 
A 1 80  THR 80  137 137 THR THR A . n 
A 1 81  ASP 81  138 138 ASP ASP A . n 
A 1 82  PHE 82  139 139 PHE PHE A . n 
A 1 83  ILE 83  140 140 ILE ILE A . n 
A 1 84  GLU 84  141 141 GLU GLU A . n 
A 1 85  LYS 85  142 142 LYS LYS A . n 
A 1 86  GLU 86  143 143 GLU GLU A . n 
A 1 87  ALA 87  144 144 ALA ALA A . n 
A 1 88  PRO 88  145 145 PRO PRO A . n 
A 1 89  LYS 89  146 146 LYS LYS A . n 
A 1 90  GLU 90  147 147 GLU GLU A . n 
A 1 91  ILE 91  148 148 ILE ILE A . n 
A 1 92  ASN 92  149 149 ASN ASN A . n 
A 1 93  ILE 93  150 150 ILE ILE A . n 
A 1 94  ASP 94  151 151 ASP ASP A . n 
A 1 95  PHE 95  152 152 PHE PHE A . n 
A 1 96  GLN 96  153 153 GLN GLN A . n 
A 1 97  THR 97  154 154 THR THR A . n 
A 1 98  LYS 98  155 155 LYS LYS A . n 
A 1 99  THR 99  156 156 THR THR A . n 
A 1 100 LEU 100 157 157 LEU LEU A . n 
A 1 101 ILE 101 158 158 ILE ILE A . n 
A 1 102 ALA 102 159 159 ALA ALA A . n 
A 1 103 GLN 103 160 160 GLN GLN A . n 
A 1 104 ASN 104 161 161 ASN ASN A . n 
A 1 105 ILE 105 162 162 ILE ILE A . n 
A 1 106 GLN 106 163 163 GLN GLN A . n 
A 1 107 GLU 107 164 164 GLU GLU A . n 
A 1 108 ALA 108 165 165 ALA ALA A . n 
A 1 109 THR 109 166 166 THR THR A . n 
A 1 110 SER 110 167 167 SER SER A . n 
A 1 111 GLY 111 168 168 GLY GLY A . n 
A 1 112 CYS 112 169 169 CYS CYS A . n 
A 1 113 PHE 113 170 170 PHE PHE A . n 
A 1 114 THR 114 171 171 THR THR A . n 
A 1 115 THR 115 172 172 THR THR A . n 
A 1 116 ALA 116 173 173 ALA ALA A . n 
A 1 117 GLN 117 174 174 GLN GLN A . n 
A 1 118 LYS 118 175 175 LYS LYS A . n 
A 1 119 ARG 119 176 176 ARG ARG A . n 
A 1 120 VAL 120 177 177 VAL VAL A . n 
A 1 121 TYR 121 178 178 TYR TYR A . n 
A 1 122 SER 122 179 179 SER SER A . n 
A 1 123 LEU 123 180 180 LEU LEU A . n 
A 1 124 MET 124 181 181 MET MET A . n 
A 1 125 GLU 125 182 182 GLU GLU A . n 
A 1 126 ASN 126 183 183 ASN ASN A . n 
A 1 127 ASN 127 184 184 ASN ASN A . n 
A 1 128 SER 128 185 185 SER SER A . n 
A 1 129 TYR 129 186 186 TYR TYR A . n 
A 1 130 PRO 130 187 187 PRO PRO A . n 
A 1 131 ARG 131 188 188 ARG ARG A . n 
A 1 132 PHE 132 189 189 PHE PHE A . n 
A 1 133 LEU 133 190 190 LEU LEU A . n 
A 1 134 GLU 134 191 191 GLU GLU A . n 
A 1 135 SER 135 192 192 SER SER A . n 
A 1 136 GLU 136 193 193 GLU GLU A . n 
A 1 137 PHE 137 194 194 PHE PHE A . n 
A 1 138 TYR 138 195 195 TYR TYR A . n 
A 1 139 GLN 139 196 196 GLN GLN A . n 
A 1 140 ASP 140 197 197 ASP ASP A . n 
A 1 141 LEU 141 198 198 LEU LEU A . n 
A 1 142 CYS 142 199 199 CYS CYS A . n 
A 1 143 LYS 143 200 200 LYS LYS A . n 
A 1 144 LYS 144 201 201 LYS LYS A . n 
A 1 145 PRO 145 202 202 PRO PRO A . n 
A 1 146 GLN 146 203 203 GLN GLN A . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Structural Genomics Consortium' 
_pdbx_SG_project.initial_of_center     SGC 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1  1  1  HOH HOH A . 
B 2 HOH 2  2  2  HOH HOH A . 
B 2 HOH 3  3  3  HOH HOH A . 
B 2 HOH 4  4  4  HOH HOH A . 
B 2 HOH 5  5  5  HOH HOH A . 
B 2 HOH 6  6  6  HOH HOH A . 
B 2 HOH 7  7  7  HOH HOH A . 
B 2 HOH 8  8  8  HOH HOH A . 
B 2 HOH 9  9  9  HOH HOH A . 
B 2 HOH 10 10 10 HOH HOH A . 
B 2 HOH 11 11 11 HOH HOH A . 
B 2 HOH 12 12 12 HOH HOH A . 
B 2 HOH 13 13 13 HOH HOH A . 
B 2 HOH 14 14 14 HOH HOH A . 
B 2 HOH 15 15 15 HOH HOH A . 
B 2 HOH 16 16 16 HOH HOH A . 
B 2 HOH 17 17 17 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2005-08-02 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC refinement       5.2.0005 ? 1 
MOSFLM 'data reduction' .        ? 2 
XDS    'data scaling'   .        ? 3 
PHASER phasing          .        ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 CYS A 106 ? ? -142.58 38.33  
2 1 ASN A 184 ? ? -123.38 -74.89 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LEU 60  ? CG  ? A LEU 3   CG  
2  1 Y 1 A LEU 60  ? CD1 ? A LEU 3   CD1 
3  1 Y 1 A LEU 60  ? CD2 ? A LEU 3   CD2 
4  1 Y 1 A MET 70  ? CG  ? A MET 13  CG  
5  1 Y 1 A MET 70  ? SD  ? A MET 13  SD  
6  1 Y 1 A MET 70  ? CE  ? A MET 13  CE  
7  1 Y 1 A LYS 71  ? CE  ? A LYS 14  CE  
8  1 Y 1 A LYS 71  ? NZ  ? A LYS 14  NZ  
9  1 Y 1 A LYS 91  ? CD  ? A LYS 34  CD  
10 1 Y 1 A LYS 91  ? CE  ? A LYS 34  CE  
11 1 Y 1 A LYS 91  ? NZ  ? A LYS 34  NZ  
12 1 Y 1 A LYS 121 ? CG  ? A LYS 64  CG  
13 1 Y 1 A LYS 121 ? CD  ? A LYS 64  CD  
14 1 Y 1 A LYS 121 ? CE  ? A LYS 64  CE  
15 1 Y 1 A LYS 121 ? NZ  ? A LYS 64  NZ  
16 1 Y 1 A LYS 123 ? CG  ? A LYS 66  CG  
17 1 Y 1 A LYS 123 ? CD  ? A LYS 66  CD  
18 1 Y 1 A LYS 123 ? CE  ? A LYS 66  CE  
19 1 Y 1 A LYS 123 ? NZ  ? A LYS 66  NZ  
20 1 Y 1 A GLN 126 ? CG  ? A GLN 69  CG  
21 1 Y 1 A GLN 126 ? CD  ? A GLN 69  CD  
22 1 Y 1 A GLN 126 ? OE1 ? A GLN 69  OE1 
23 1 Y 1 A GLN 126 ? NE2 ? A GLN 69  NE2 
24 1 Y 1 A LYS 142 ? CG  ? A LYS 85  CG  
25 1 Y 1 A LYS 142 ? CD  ? A LYS 85  CD  
26 1 Y 1 A LYS 142 ? CE  ? A LYS 85  CE  
27 1 Y 1 A LYS 142 ? NZ  ? A LYS 85  NZ  
28 1 Y 1 A GLU 143 ? CG  ? A GLU 86  CG  
29 1 Y 1 A GLU 143 ? CD  ? A GLU 86  CD  
30 1 Y 1 A GLU 143 ? OE1 ? A GLU 86  OE1 
31 1 Y 1 A GLU 143 ? OE2 ? A GLU 86  OE2 
32 1 Y 1 A ASN 149 ? OD1 ? A ASN 92  OD1 
33 1 Y 1 A ASN 149 ? ND2 ? A ASN 92  ND2 
34 1 Y 1 A THR 154 ? CG2 ? A THR 97  CG2 
35 1 Y 1 A GLN 163 ? CG  ? A GLN 106 CG  
36 1 Y 1 A GLN 163 ? CD  ? A GLN 106 CD  
37 1 Y 1 A GLN 163 ? OE1 ? A GLN 106 OE1 
38 1 Y 1 A GLN 163 ? NE2 ? A GLN 106 NE2 
39 1 Y 1 A GLU 164 ? CG  ? A GLU 107 CG  
40 1 Y 1 A GLU 164 ? CD  ? A GLU 107 CD  
41 1 Y 1 A GLU 164 ? OE1 ? A GLU 107 OE1 
42 1 Y 1 A GLU 164 ? OE2 ? A GLU 107 OE2 
43 1 Y 1 A LYS 175 ? CD  ? A LYS 118 CD  
44 1 Y 1 A LYS 175 ? CE  ? A LYS 118 CE  
45 1 Y 1 A LYS 175 ? NZ  ? A LYS 118 NZ  
46 1 Y 1 A ASP 197 ? CG  ? A ASP 140 CG  
47 1 Y 1 A ASP 197 ? OD1 ? A ASP 140 OD1 
48 1 Y 1 A ASP 197 ? OD2 ? A ASP 140 OD2 
49 1 Y 1 A LYS 200 ? CD  ? A LYS 143 CD  
50 1 Y 1 A LYS 200 ? CE  ? A LYS 143 CE  
51 1 Y 1 A LYS 200 ? NZ  ? A LYS 143 NZ  
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#