data_2ANL
# 
_entry.id   2ANL 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2ANL         
RCSB  RCSB034101   
WWPDB D_1000034101 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2ANL 
_pdbx_database_status.recvd_initial_deposition_date   2005-08-11 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Clemente, J.C.'       1  
'Govindasamy, L.'      2  
'Madabushi, A.'        3  
'Fisher, S.Z.'         4  
'Moose, R.E.'          5  
'Yowell, C.A.'         6  
'Hidaka, K.'           7  
'Kimura, T.'           8  
'Hayashi, Y.'          9  
'Kiso, Y.'             10 
'Agbandje-McKenna, M.' 11 
'Dame, J.B.'           12 
'Dunn, B.M.'           13 
'McKenna, R.'          14 
# 
_citation.id                        primary 
_citation.title                     
;Structure of the aspartic protease plasmepsin 4 from the malarial parasite Plasmodium malariae bound to an allophenylnorstatine-based inhibitor.
;
_citation.journal_abbrev            'Acta Crystallogr.,Sect.D' 
_citation.journal_volume            62 
_citation.page_first                246 
_citation.page_last                 252 
_citation.year                      2006 
_citation.journal_id_ASTM           ABCRE6 
_citation.country                   DK 
_citation.journal_id_ISSN           0907-4449 
_citation.journal_id_CSD            0766 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16510971 
_citation.pdbx_database_id_DOI      10.1107/S0907444905041260 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Clemente, J.C.'       1  
primary 'Govindasamy, L.'      2  
primary 'Madabushi, A.'        3  
primary 'Fisher, S.Z.'         4  
primary 'Moose, R.E.'          5  
primary 'Yowell, C.A.'         6  
primary 'Hidaka, K.'           7  
primary 'Kimura, T.'           8  
primary 'Hayashi, Y.'          9  
primary 'Kiso, Y.'             10 
primary 'Agbandje-McKenna, M.' 11 
primary 'Dame, J.B.'           12 
primary 'Dunn, B.M.'           13 
primary 'McKenna, R.'          14 
# 
_cell.entry_id           2ANL 
_cell.length_a           95.884 
_cell.length_b           112.579 
_cell.length_c           90.404 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2ANL 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'plasmepsin IV' 37130.828 2  ? ? ? ? 
2 non-polymer syn 
;(4R)-3-{(2S,3S)-2-hydroxy-3-[(3-hydroxy-2-methylbenzoyl)amino]-4-phenylbutanoyl}-5,5-dimethyl-N-(2-methylbenzyl)-1,3-thiazolidine-4-carboxamide
;
575.718   2  ? ? ? ? 
3 water       nat water 18.015    14 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SENDVIELDDVANLMFYGEGEVGDNHQKFMLIFDTGSANLWVPSKKCNSIGCSTKHLYDSSKSKSYEKDGTKVEITYGSG
TVRGFFSKDLVTLGYLSLPYKFIEVTDTDDLEPLYTAAEFDGILGLGWKDLSIGSIDPIVVELKNQNKIDQALFTFYLPV
HDKHSGYLTIGGIEEKFYEGELTYEKLNHDLFWQVDLDVNFGKTSMEKANVIVDSGTSTITAPTSFINKFFKDLNVIKVP
FLPFYITTCNNKDMPTLEFKSANNTYTLEPEYYMEPLLDIDDTLCMLYILPVDIDKNTFILGDPFMRKYFTVFDYDKESI
GFAVAKN
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SENDVIELDDVANLMFYGEGEVGDNHQKFMLIFDTGSANLWVPSKKCNSIGCSTKHLYDSSKSKSYEKDGTKVEITYGSG
TVRGFFSKDLVTLGYLSLPYKFIEVTDTDDLEPLYTAAEFDGILGLGWKDLSIGSIDPIVVELKNQNKIDQALFTFYLPV
HDKHSGYLTIGGIEEKFYEGELTYEKLNHDLFWQVDLDVNFGKTSMEKANVIVDSGTSTITAPTSFINKFFKDLNVIKVP
FLPFYITTCNNKDMPTLEFKSANNTYTLEPEYYMEPLLDIDDTLCMLYILPVDIDKNTFILGDPFMRKYFTVFDYDKESI
GFAVAKN
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   GLU n 
1 3   ASN n 
1 4   ASP n 
1 5   VAL n 
1 6   ILE n 
1 7   GLU n 
1 8   LEU n 
1 9   ASP n 
1 10  ASP n 
1 11  VAL n 
1 12  ALA n 
1 13  ASN n 
1 14  LEU n 
1 15  MET n 
1 16  PHE n 
1 17  TYR n 
1 18  GLY n 
1 19  GLU n 
1 20  GLY n 
1 21  GLU n 
1 22  VAL n 
1 23  GLY n 
1 24  ASP n 
1 25  ASN n 
1 26  HIS n 
1 27  GLN n 
1 28  LYS n 
1 29  PHE n 
1 30  MET n 
1 31  LEU n 
1 32  ILE n 
1 33  PHE n 
1 34  ASP n 
1 35  THR n 
1 36  GLY n 
1 37  SER n 
1 38  ALA n 
1 39  ASN n 
1 40  LEU n 
1 41  TRP n 
1 42  VAL n 
1 43  PRO n 
1 44  SER n 
1 45  LYS n 
1 46  LYS n 
1 47  CYS n 
1 48  ASN n 
1 49  SER n 
1 50  ILE n 
1 51  GLY n 
1 52  CYS n 
1 53  SER n 
1 54  THR n 
1 55  LYS n 
1 56  HIS n 
1 57  LEU n 
1 58  TYR n 
1 59  ASP n 
1 60  SER n 
1 61  SER n 
1 62  LYS n 
1 63  SER n 
1 64  LYS n 
1 65  SER n 
1 66  TYR n 
1 67  GLU n 
1 68  LYS n 
1 69  ASP n 
1 70  GLY n 
1 71  THR n 
1 72  LYS n 
1 73  VAL n 
1 74  GLU n 
1 75  ILE n 
1 76  THR n 
1 77  TYR n 
1 78  GLY n 
1 79  SER n 
1 80  GLY n 
1 81  THR n 
1 82  VAL n 
1 83  ARG n 
1 84  GLY n 
1 85  PHE n 
1 86  PHE n 
1 87  SER n 
1 88  LYS n 
1 89  ASP n 
1 90  LEU n 
1 91  VAL n 
1 92  THR n 
1 93  LEU n 
1 94  GLY n 
1 95  TYR n 
1 96  LEU n 
1 97  SER n 
1 98  LEU n 
1 99  PRO n 
1 100 TYR n 
1 101 LYS n 
1 102 PHE n 
1 103 ILE n 
1 104 GLU n 
1 105 VAL n 
1 106 THR n 
1 107 ASP n 
1 108 THR n 
1 109 ASP n 
1 110 ASP n 
1 111 LEU n 
1 112 GLU n 
1 113 PRO n 
1 114 LEU n 
1 115 TYR n 
1 116 THR n 
1 117 ALA n 
1 118 ALA n 
1 119 GLU n 
1 120 PHE n 
1 121 ASP n 
1 122 GLY n 
1 123 ILE n 
1 124 LEU n 
1 125 GLY n 
1 126 LEU n 
1 127 GLY n 
1 128 TRP n 
1 129 LYS n 
1 130 ASP n 
1 131 LEU n 
1 132 SER n 
1 133 ILE n 
1 134 GLY n 
1 135 SER n 
1 136 ILE n 
1 137 ASP n 
1 138 PRO n 
1 139 ILE n 
1 140 VAL n 
1 141 VAL n 
1 142 GLU n 
1 143 LEU n 
1 144 LYS n 
1 145 ASN n 
1 146 GLN n 
1 147 ASN n 
1 148 LYS n 
1 149 ILE n 
1 150 ASP n 
1 151 GLN n 
1 152 ALA n 
1 153 LEU n 
1 154 PHE n 
1 155 THR n 
1 156 PHE n 
1 157 TYR n 
1 158 LEU n 
1 159 PRO n 
1 160 VAL n 
1 161 HIS n 
1 162 ASP n 
1 163 LYS n 
1 164 HIS n 
1 165 SER n 
1 166 GLY n 
1 167 TYR n 
1 168 LEU n 
1 169 THR n 
1 170 ILE n 
1 171 GLY n 
1 172 GLY n 
1 173 ILE n 
1 174 GLU n 
1 175 GLU n 
1 176 LYS n 
1 177 PHE n 
1 178 TYR n 
1 179 GLU n 
1 180 GLY n 
1 181 GLU n 
1 182 LEU n 
1 183 THR n 
1 184 TYR n 
1 185 GLU n 
1 186 LYS n 
1 187 LEU n 
1 188 ASN n 
1 189 HIS n 
1 190 ASP n 
1 191 LEU n 
1 192 PHE n 
1 193 TRP n 
1 194 GLN n 
1 195 VAL n 
1 196 ASP n 
1 197 LEU n 
1 198 ASP n 
1 199 VAL n 
1 200 ASN n 
1 201 PHE n 
1 202 GLY n 
1 203 LYS n 
1 204 THR n 
1 205 SER n 
1 206 MET n 
1 207 GLU n 
1 208 LYS n 
1 209 ALA n 
1 210 ASN n 
1 211 VAL n 
1 212 ILE n 
1 213 VAL n 
1 214 ASP n 
1 215 SER n 
1 216 GLY n 
1 217 THR n 
1 218 SER n 
1 219 THR n 
1 220 ILE n 
1 221 THR n 
1 222 ALA n 
1 223 PRO n 
1 224 THR n 
1 225 SER n 
1 226 PHE n 
1 227 ILE n 
1 228 ASN n 
1 229 LYS n 
1 230 PHE n 
1 231 PHE n 
1 232 LYS n 
1 233 ASP n 
1 234 LEU n 
1 235 ASN n 
1 236 VAL n 
1 237 ILE n 
1 238 LYS n 
1 239 VAL n 
1 240 PRO n 
1 241 PHE n 
1 242 LEU n 
1 243 PRO n 
1 244 PHE n 
1 245 TYR n 
1 246 ILE n 
1 247 THR n 
1 248 THR n 
1 249 CYS n 
1 250 ASN n 
1 251 ASN n 
1 252 LYS n 
1 253 ASP n 
1 254 MET n 
1 255 PRO n 
1 256 THR n 
1 257 LEU n 
1 258 GLU n 
1 259 PHE n 
1 260 LYS n 
1 261 SER n 
1 262 ALA n 
1 263 ASN n 
1 264 ASN n 
1 265 THR n 
1 266 TYR n 
1 267 THR n 
1 268 LEU n 
1 269 GLU n 
1 270 PRO n 
1 271 GLU n 
1 272 TYR n 
1 273 TYR n 
1 274 MET n 
1 275 GLU n 
1 276 PRO n 
1 277 LEU n 
1 278 LEU n 
1 279 ASP n 
1 280 ILE n 
1 281 ASP n 
1 282 ASP n 
1 283 THR n 
1 284 LEU n 
1 285 CYS n 
1 286 MET n 
1 287 LEU n 
1 288 TYR n 
1 289 ILE n 
1 290 LEU n 
1 291 PRO n 
1 292 VAL n 
1 293 ASP n 
1 294 ILE n 
1 295 ASP n 
1 296 LYS n 
1 297 ASN n 
1 298 THR n 
1 299 PHE n 
1 300 ILE n 
1 301 LEU n 
1 302 GLY n 
1 303 ASP n 
1 304 PRO n 
1 305 PHE n 
1 306 MET n 
1 307 ARG n 
1 308 LYS n 
1 309 TYR n 
1 310 PHE n 
1 311 THR n 
1 312 VAL n 
1 313 PHE n 
1 314 ASP n 
1 315 TYR n 
1 316 ASP n 
1 317 LYS n 
1 318 GLU n 
1 319 SER n 
1 320 ILE n 
1 321 GLY n 
1 322 PHE n 
1 323 ALA n 
1 324 VAL n 
1 325 ALA n 
1 326 LYS n 
1 327 ASN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Plasmodium 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Plasmodium malariae' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     5858 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    O60990_PLAMA 
_struct_ref.pdbx_db_accession          O60990 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;SENDVIELDDVANLMFYGEGEVGDNHQKFMLIFDTGSANLWVPSKKCNSIGCSTKHLYDSSKSKSYEKDGTKVEITYGSG
TVRGFFSKDLVTLGYLSLPYKFIEVTDTDDLEPLYTAAEFDGILGLGWKDLSIGSIDPIVVELKNQNKIDQALFTFYLPV
HDKHSGYLTIGGIEEKFYEGELTYEKLNHDLFWQVDLDVNFGKTSMEKANVIVDSGTSTITAPTSFINKFFKDLNVIKVP
FLPFYITTCNNKDMPTLEFKSANNTYTLEPEYYMEPLLDIDDTLCMLYILPVDIDKNTFILGDPFMRKYFTVFDYDKESI
GFAVAKN
;
_struct_ref.pdbx_align_begin           125 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2ANL A 1 ? 327 ? O60990 125 ? 451 ? 1 327 
2 1 2ANL B 1 ? 327 ? O60990 125 ? 451 ? 1 327 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE ?                          'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE ?                          'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE ?                          'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                          'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE ?                          'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking' y GLUTAMINE ?                          'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                          'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE ?                          'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE ?                          'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER ?                          'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE ?                          'C6 H13 N O2'     131.173 
JE2 peptide-like        . 
;(4R)-3-{(2S,3S)-2-hydroxy-3-[(3-hydroxy-2-methylbenzoyl)amino]-4-phenylbutanoyl}-5,5-dimethyl-N-(2-methylbenzyl)-1,3-thiazolidine-4-carboxamide
;
'JE-2147, AG1776, KNI-764' 'C32 H37 N3 O5 S' 575.718 
LEU 'L-peptide linking' y LEUCINE ?                          'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE ?                          'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE ?                          'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE ?                          'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE ?                          'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE ?                          'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE ?                          'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ?                          'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE ?                          'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE ?                          'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          2ANL 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.28 
_exptl_crystal.density_percent_sol   62.55 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pdbx_details    '0.2 M ammonium sulfate, 15% PEG 4000 + inhibitor, VAPOR DIFFUSION, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           298 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   RIGAKU 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                'osmic mirrors' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        RIGAKU 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.entry_id                     2ANL 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.d_resolution_high            3.3 
_reflns.d_resolution_low             25 
_reflns.number_all                   ? 
_reflns.number_obs                   14334 
_reflns.percent_possible_obs         94.0 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.104 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_refine.entry_id                                 2ANL 
_refine.ls_d_res_high                            3.3 
_refine.ls_d_res_low                             25 
_refine.pdbx_ls_sigma_F                          2 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     14334 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_work                       0.247 
_refine.ls_R_factor_R_free                       0.298 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'homology model' 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.details                                  ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5234 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         82 
_refine_hist.number_atoms_solvent             14 
_refine_hist.number_atoms_total               5330 
_refine_hist.d_res_high                       3.3 
_refine_hist.d_res_low                        25 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d    0.10 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg 1.8  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct_ncs_oper.id             1 
_struct_ncs_oper.code           given 
_struct_ncs_oper.details        ? 
_struct_ncs_oper.matrix[1][1]   -0.408904 
_struct_ncs_oper.matrix[1][2]   -0.912572 
_struct_ncs_oper.matrix[1][3]   -0.003283 
_struct_ncs_oper.matrix[2][1]   0.912284 
_struct_ncs_oper.matrix[2][2]   -0.408861 
_struct_ncs_oper.matrix[2][3]   0.023900 
_struct_ncs_oper.matrix[3][1]   -0.023153 
_struct_ncs_oper.matrix[3][2]   0.006777 
_struct_ncs_oper.matrix[3][3]   0.999709 
_struct_ncs_oper.vector[1]      116.80229 
_struct_ncs_oper.vector[2]      12.99195 
_struct_ncs_oper.vector[3]      4.22807 
# 
_struct.entry_id                  2ANL 
_struct.title                     
;X-ray crystal structure of the aspartic protease plasmepsin 4 from the malarial parasite plasmodium malariae bound to an allophenylnorstatine based inhibitor
;
_struct.pdbx_descriptor           plasmepsin 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2ANL 
_struct_keywords.pdbx_keywords   'HYDROLASE/HYDROLASE INHIBITOR' 
_struct_keywords.text            
'Plasmodium parasite, plasmepsin 4, aspartic protease, HYDROLASE, HYDROLASE-HYDROLASE INHIBITOR complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 49  ? THR A 54  ? SER A 49  THR A 54  1 ? 6  
HELX_P HELX_P2  2  PRO A 113 ? ALA A 118 ? PRO A 113 ALA A 118 1 ? 6  
HELX_P HELX_P3  3  TRP A 128 ? SER A 132 ? TRP A 128 SER A 132 5 ? 5  
HELX_P HELX_P4  4  VAL A 140 ? ASN A 145 ? VAL A 140 ASN A 145 1 ? 6  
HELX_P HELX_P5  5  GLU A 174 ? LYS A 176 ? GLU A 174 LYS A 176 5 ? 3  
HELX_P HELX_P6  6  PRO A 223 ? LEU A 234 ? PRO A 223 LEU A 234 1 ? 12 
HELX_P HELX_P7  7  GLU A 269 ? TYR A 272 ? GLU A 269 TYR A 272 5 ? 4  
HELX_P HELX_P8  8  GLY A 302 ? LYS A 308 ? GLY A 302 LYS A 308 1 ? 7  
HELX_P HELX_P9  9  SER B 49  ? THR B 54  ? SER B 49  THR B 54  1 ? 6  
HELX_P HELX_P10 10 PRO B 113 ? ALA B 118 ? PRO B 113 ALA B 118 1 ? 6  
HELX_P HELX_P11 11 TRP B 128 ? SER B 132 ? TRP B 128 SER B 132 5 ? 5  
HELX_P HELX_P12 12 VAL B 140 ? ASN B 145 ? VAL B 140 ASN B 145 1 ? 6  
HELX_P HELX_P13 13 GLU B 174 ? LYS B 176 ? GLU B 174 LYS B 176 5 ? 3  
HELX_P HELX_P14 14 PRO B 223 ? LEU B 234 ? PRO B 223 LEU B 234 1 ? 12 
HELX_P HELX_P15 15 GLU B 269 ? TYR B 272 ? GLU B 269 TYR B 272 5 ? 4  
HELX_P HELX_P16 16 GLY B 302 ? LYS B 308 ? GLY B 302 LYS B 308 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 47  SG ? ? ? 1_555 A CYS 52  SG ? ? A CYS 47  A CYS 52  1_555 ? ? ? ? ? ? ? 2.053 ? 
disulf2 disulf ? ? A CYS 249 SG ? ? ? 1_555 A CYS 285 SG ? ? A CYS 249 A CYS 285 1_555 ? ? ? ? ? ? ? 1.966 ? 
disulf3 disulf ? ? B CYS 47  SG ? ? ? 1_555 B CYS 52  SG ? ? B CYS 47  B CYS 52  1_555 ? ? ? ? ? ? ? 2.053 ? 
disulf4 disulf ? ? B CYS 249 SG ? ? ? 1_555 B CYS 285 SG ? ? B CYS 249 B CYS 285 1_555 ? ? ? ? ? ? ? 1.966 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4  ? 
B ? 12 ? 
C ? 7  ? 
D ? 4  ? 
E ? 4  ? 
F ? 12 ? 
G ? 7  ? 
H ? 4  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1  2  ? anti-parallel 
A 2  3  ? anti-parallel 
A 3  4  ? anti-parallel 
B 1  2  ? parallel      
B 2  3  ? anti-parallel 
B 3  4  ? parallel      
B 4  5  ? anti-parallel 
B 5  6  ? anti-parallel 
B 6  7  ? anti-parallel 
B 7  8  ? anti-parallel 
B 8  9  ? anti-parallel 
B 9  10 ? anti-parallel 
B 10 11 ? anti-parallel 
B 11 12 ? anti-parallel 
C 1  2  ? anti-parallel 
C 2  3  ? anti-parallel 
C 3  4  ? anti-parallel 
C 4  5  ? parallel      
C 5  6  ? anti-parallel 
C 6  7  ? parallel      
D 1  2  ? anti-parallel 
D 2  3  ? anti-parallel 
D 3  4  ? anti-parallel 
E 1  2  ? anti-parallel 
E 2  3  ? anti-parallel 
E 3  4  ? anti-parallel 
F 1  2  ? parallel      
F 2  3  ? anti-parallel 
F 3  4  ? parallel      
F 4  5  ? anti-parallel 
F 5  6  ? anti-parallel 
F 6  7  ? anti-parallel 
F 7  8  ? anti-parallel 
F 8  9  ? anti-parallel 
F 9  10 ? anti-parallel 
F 10 11 ? anti-parallel 
F 11 12 ? anti-parallel 
G 1  2  ? anti-parallel 
G 2  3  ? anti-parallel 
G 3  4  ? anti-parallel 
G 4  5  ? parallel      
G 5  6  ? anti-parallel 
G 6  7  ? parallel      
H 1  2  ? anti-parallel 
H 2  3  ? anti-parallel 
H 3  4  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  GLN A 27  ? MET A 30  ? GLN A 27  MET A 30  
A 2  MET A 15  ? VAL A 22  ? MET A 15  VAL A 22  
A 3  VAL A 82  ? THR A 92  ? VAL A 82  THR A 92  
A 4  LYS A 72  ? ILE A 75  ? LYS A 72  ILE A 75  
B 1  PHE A 33  ? ASP A 34  ? PHE A 33  ASP A 34  
B 2  ILE A 123 ? GLY A 125 ? ILE A 123 GLY A 125 
B 3  LEU A 40  ? PRO A 43  ? LEU A 40  PRO A 43  
B 4  PRO A 99  ? ASP A 107 ? PRO A 99  ASP A 107 
B 5  VAL A 82  ? THR A 92  ? VAL A 82  THR A 92  
B 6  MET A 15  ? VAL A 22  ? MET A 15  VAL A 22  
B 7  ASP A 4   ? VAL A 11  ? ASP A 4   VAL A 11  
B 8  GLY A 166 ? ILE A 170 ? GLY A 166 ILE A 170 
B 9  LEU A 153 ? TYR A 157 ? LEU A 153 TYR A 157 
B 10 TYR A 309 ? ASP A 314 ? TYR A 309 ASP A 314 
B 11 SER A 319 ? ALA A 325 ? SER A 319 ALA A 325 
B 12 TYR A 178 ? LYS A 186 ? TYR A 178 LYS A 186 
C 1  THR A 265 ? LEU A 268 ? THR A 265 LEU A 268 
C 2  LEU A 257 ? LYS A 260 ? LEU A 257 LYS A 260 
C 3  GLN A 194 ? PHE A 201 ? GLN A 194 PHE A 201 
C 4  THR A 204 ? VAL A 213 ? THR A 204 VAL A 213 
C 5  THR A 298 ? LEU A 301 ? THR A 298 LEU A 301 
C 6  ILE A 220 ? ALA A 222 ? ILE A 220 ALA A 222 
C 7  ILE A 289 ? PRO A 291 ? ILE A 289 PRO A 291 
D 1  ILE A 237 ? LYS A 238 ? ILE A 237 LYS A 238 
D 2  TYR A 245 ? THR A 248 ? TYR A 245 THR A 248 
D 3  LEU A 284 ? LEU A 287 ? LEU A 284 LEU A 287 
D 4  MET A 274 ? PRO A 276 ? MET A 274 PRO A 276 
E 1  GLN B 27  ? MET B 30  ? GLN B 27  MET B 30  
E 2  MET B 15  ? VAL B 22  ? MET B 15  VAL B 22  
E 3  VAL B 82  ? THR B 92  ? VAL B 82  THR B 92  
E 4  LYS B 72  ? ILE B 75  ? LYS B 72  ILE B 75  
F 1  PHE B 33  ? ASP B 34  ? PHE B 33  ASP B 34  
F 2  ILE B 123 ? GLY B 125 ? ILE B 123 GLY B 125 
F 3  LEU B 40  ? PRO B 43  ? LEU B 40  PRO B 43  
F 4  PRO B 99  ? ASP B 107 ? PRO B 99  ASP B 107 
F 5  VAL B 82  ? THR B 92  ? VAL B 82  THR B 92  
F 6  MET B 15  ? VAL B 22  ? MET B 15  VAL B 22  
F 7  ASP B 4   ? VAL B 11  ? ASP B 4   VAL B 11  
F 8  GLY B 166 ? ILE B 170 ? GLY B 166 ILE B 170 
F 9  LEU B 153 ? TYR B 157 ? LEU B 153 TYR B 157 
F 10 TYR B 309 ? ASP B 314 ? TYR B 309 ASP B 314 
F 11 SER B 319 ? ALA B 325 ? SER B 319 ALA B 325 
F 12 TYR B 178 ? LYS B 186 ? TYR B 178 LYS B 186 
G 1  THR B 265 ? LEU B 268 ? THR B 265 LEU B 268 
G 2  LEU B 257 ? LYS B 260 ? LEU B 257 LYS B 260 
G 3  GLN B 194 ? PHE B 201 ? GLN B 194 PHE B 201 
G 4  THR B 204 ? VAL B 213 ? THR B 204 VAL B 213 
G 5  THR B 298 ? LEU B 301 ? THR B 298 LEU B 301 
G 6  ILE B 220 ? ALA B 222 ? ILE B 220 ALA B 222 
G 7  ILE B 289 ? PRO B 291 ? ILE B 289 PRO B 291 
H 1  ILE B 237 ? LYS B 238 ? ILE B 237 LYS B 238 
H 2  TYR B 245 ? THR B 248 ? TYR B 245 THR B 248 
H 3  LEU B 284 ? LEU B 287 ? LEU B 284 LEU B 287 
H 4  MET B 274 ? PRO B 276 ? MET B 274 PRO B 276 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1  2  O GLN A 27  ? O GLN A 27  N VAL A 22  ? N VAL A 22  
A 2  3  N GLU A 21  ? N GLU A 21  O THR A 92  ? O THR A 92  
A 3  4  O VAL A 82  ? O VAL A 82  N ILE A 75  ? N ILE A 75  
B 1  2  N ASP A 34  ? N ASP A 34  O LEU A 124 ? O LEU A 124 
B 2  3  O ILE A 123 ? O ILE A 123 N TRP A 41  ? N TRP A 41  
B 3  4  N LEU A 40  ? N LEU A 40  O ILE A 103 ? O ILE A 103 
B 4  5  O TYR A 100 ? O TYR A 100 N ASP A 89  ? N ASP A 89  
B 5  6  O THR A 92  ? O THR A 92  N GLU A 21  ? N GLU A 21  
B 6  7  O TYR A 17  ? O TYR A 17  N ASP A 9   ? N ASP A 9   
B 7  8  N ILE A 6   ? N ILE A 6   O LEU A 168 ? O LEU A 168 
B 8  9  O THR A 169 ? O THR A 169 N THR A 155 ? N THR A 155 
B 9  10 N PHE A 156 ? N PHE A 156 O THR A 311 ? O THR A 311 
B 10 11 N VAL A 312 ? N VAL A 312 O GLY A 321 ? O GLY A 321 
B 11 12 O PHE A 322 ? O PHE A 322 N THR A 183 ? N THR A 183 
C 1  2  O TYR A 266 ? O TYR A 266 N PHE A 259 ? N PHE A 259 
C 2  3  O LYS A 260 ? O LYS A 260 N ASP A 198 ? N ASP A 198 
C 3  4  N PHE A 201 ? N PHE A 201 O THR A 204 ? O THR A 204 
C 4  5  N ILE A 212 ? N ILE A 212 O LEU A 301 ? O LEU A 301 
C 5  6  O ILE A 300 ? O ILE A 300 N THR A 221 ? N THR A 221 
C 6  7  N ILE A 220 ? N ILE A 220 O LEU A 290 ? O LEU A 290 
D 1  2  N ILE A 237 ? N ILE A 237 O ILE A 246 ? O ILE A 246 
D 2  3  N THR A 247 ? N THR A 247 O CYS A 285 ? O CYS A 285 
D 3  4  O MET A 286 ? O MET A 286 N GLU A 275 ? N GLU A 275 
E 1  2  O GLN B 27  ? O GLN B 27  N VAL B 22  ? N VAL B 22  
E 2  3  N GLU B 21  ? N GLU B 21  O THR B 92  ? O THR B 92  
E 3  4  O VAL B 82  ? O VAL B 82  N ILE B 75  ? N ILE B 75  
F 1  2  N ASP B 34  ? N ASP B 34  O LEU B 124 ? O LEU B 124 
F 2  3  O ILE B 123 ? O ILE B 123 N TRP B 41  ? N TRP B 41  
F 3  4  N LEU B 40  ? N LEU B 40  O ILE B 103 ? O ILE B 103 
F 4  5  O TYR B 100 ? O TYR B 100 N ASP B 89  ? N ASP B 89  
F 5  6  O THR B 92  ? O THR B 92  N GLU B 21  ? N GLU B 21  
F 6  7  O TYR B 17  ? O TYR B 17  N ASP B 9   ? N ASP B 9   
F 7  8  N ILE B 6   ? N ILE B 6   O LEU B 168 ? O LEU B 168 
F 8  9  O THR B 169 ? O THR B 169 N THR B 155 ? N THR B 155 
F 9  10 N PHE B 156 ? N PHE B 156 O THR B 311 ? O THR B 311 
F 10 11 N VAL B 312 ? N VAL B 312 O GLY B 321 ? O GLY B 321 
F 11 12 O PHE B 322 ? O PHE B 322 N THR B 183 ? N THR B 183 
G 1  2  O TYR B 266 ? O TYR B 266 N PHE B 259 ? N PHE B 259 
G 2  3  O LYS B 260 ? O LYS B 260 N ASP B 198 ? N ASP B 198 
G 3  4  N PHE B 201 ? N PHE B 201 O THR B 204 ? O THR B 204 
G 4  5  N ILE B 212 ? N ILE B 212 O LEU B 301 ? O LEU B 301 
G 5  6  O ILE B 300 ? O ILE B 300 N THR B 221 ? N THR B 221 
G 6  7  N ILE B 220 ? N ILE B 220 O LEU B 290 ? O LEU B 290 
H 1  2  N ILE B 237 ? N ILE B 237 O ILE B 246 ? O ILE B 246 
H 2  3  N THR B 247 ? N THR B 247 O CYS B 285 ? O CYS B 285 
H 3  4  O MET B 286 ? O MET B 286 N GLU B 275 ? N GLU B 275 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE JE2 A 3151' 
AC2 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE JE2 B 3152' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 11 ASP A 34  ? ASP A 34  . ? 1_555 ? 
2  AC1 11 GLY A 36  ? GLY A 36  . ? 1_555 ? 
3  AC1 11 TYR A 77  ? TYR A 77  . ? 1_555 ? 
4  AC1 11 GLY A 78  ? GLY A 78  . ? 1_555 ? 
5  AC1 11 SER A 79  ? SER A 79  . ? 1_555 ? 
6  AC1 11 LEU A 131 ? LEU A 131 . ? 1_555 ? 
7  AC1 11 PHE A 192 ? PHE A 192 . ? 1_555 ? 
8  AC1 11 ASP A 214 ? ASP A 214 . ? 1_555 ? 
9  AC1 11 THR A 217 ? THR A 217 . ? 1_555 ? 
10 AC1 11 VAL A 292 ? VAL A 292 . ? 1_555 ? 
11 AC1 11 HOH E .   ? HOH A 402 . ? 1_555 ? 
12 AC2 11 ASP B 34  ? ASP B 34  . ? 1_555 ? 
13 AC2 11 GLY B 36  ? GLY B 36  . ? 1_555 ? 
14 AC2 11 TYR B 77  ? TYR B 77  . ? 1_555 ? 
15 AC2 11 GLY B 78  ? GLY B 78  . ? 1_555 ? 
16 AC2 11 SER B 79  ? SER B 79  . ? 1_555 ? 
17 AC2 11 LEU B 131 ? LEU B 131 . ? 1_555 ? 
18 AC2 11 PHE B 192 ? PHE B 192 . ? 1_555 ? 
19 AC2 11 ASP B 214 ? ASP B 214 . ? 1_555 ? 
20 AC2 11 THR B 217 ? THR B 217 . ? 1_555 ? 
21 AC2 11 VAL B 292 ? VAL B 292 . ? 1_555 ? 
22 AC2 11 HOH F .   ? HOH B 409 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2ANL 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2ANL 
_atom_sites.fract_transf_matrix[1][1]   0.010429 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008883 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011061 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 1   ? 82.839  29.653 18.670 1.00 56.65 ? 1    SER A N   1 
ATOM   2    C CA  . SER A 1 1   ? 83.250  29.543 20.125 1.00 56.63 ? 1    SER A CA  1 
ATOM   3    C C   . SER A 1 1   ? 83.451  28.060 20.554 1.00 56.74 ? 1    SER A C   1 
ATOM   4    O O   . SER A 1 1   ? 83.211  27.113 19.744 1.00 56.85 ? 1    SER A O   1 
ATOM   5    C CB  . SER A 1 1   ? 82.229  30.274 21.038 1.00 56.74 ? 1    SER A CB  1 
ATOM   6    O OG  . SER A 1 1   ? 82.167  31.697 20.841 1.00 56.78 ? 1    SER A OG  1 
ATOM   7    N N   . GLU A 1 2   ? 83.912  27.867 21.800 1.00 56.45 ? 2    GLU A N   1 
ATOM   8    C CA  . GLU A 1 2   ? 84.050  26.504 22.384 1.00 56.57 ? 2    GLU A CA  1 
ATOM   9    C C   . GLU A 1 2   ? 82.703  25.643 22.223 1.00 56.33 ? 2    GLU A C   1 
ATOM   10   O O   . GLU A 1 2   ? 82.627  24.412 22.572 1.00 55.11 ? 2    GLU A O   1 
ATOM   11   C CB  . GLU A 1 2   ? 84.509  26.642 23.854 1.00 56.65 ? 2    GLU A CB  1 
ATOM   12   C CG  . GLU A 1 2   ? 83.473  27.355 24.763 1.00 57.08 ? 2    GLU A CG  1 
ATOM   13   C CD  . GLU A 1 2   ? 84.082  28.077 25.961 1.00 57.00 ? 2    GLU A CD  1 
ATOM   14   O OE1 . GLU A 1 2   ? 84.597  29.211 25.788 1.00 56.58 ? 2    GLU A OE1 1 
ATOM   15   O OE2 . GLU A 1 2   ? 84.029  27.506 27.085 1.00 57.16 ? 2    GLU A OE2 1 
ATOM   16   N N   . ASN A 1 3   ? 81.683  26.348 21.678 1.00 56.22 ? 3    ASN A N   1 
ATOM   17   C CA  . ASN A 1 3   ? 80.376  25.822 21.259 1.00 56.23 ? 3    ASN A CA  1 
ATOM   18   C C   . ASN A 1 3   ? 80.411  24.336 20.905 1.00 56.40 ? 3    ASN A C   1 
ATOM   19   O O   . ASN A 1 3   ? 80.891  23.954 19.840 1.00 56.77 ? 3    ASN A O   1 
ATOM   20   C CB  . ASN A 1 3   ? 79.817  26.656 20.079 1.00 56.10 ? 3    ASN A CB  1 
ATOM   21   C CG  . ASN A 1 3   ? 79.664  28.143 20.424 1.00 55.76 ? 3    ASN A CG  1 
ATOM   22   O OD1 . ASN A 1 3   ? 80.067  28.604 21.524 1.00 54.18 ? 3    ASN A OD1 1 
ATOM   23   N ND2 . ASN A 1 3   ? 79.043  28.896 19.506 1.00 55.88 ? 3    ASN A ND2 1 
ATOM   24   N N   . ASP A 1 4   ? 79.941  23.492 21.813 1.00 56.34 ? 4    ASP A N   1 
ATOM   25   C CA  . ASP A 1 4   ? 79.932  22.077 21.545 1.00 56.14 ? 4    ASP A CA  1 
ATOM   26   C C   . ASP A 1 4   ? 78.976  21.859 20.373 1.00 56.08 ? 4    ASP A C   1 
ATOM   27   O O   . ASP A 1 4   ? 77.905  22.466 20.314 1.00 56.46 ? 4    ASP A O   1 
ATOM   28   C CB  . ASP A 1 4   ? 79.501  21.308 22.791 1.00 56.05 ? 4    ASP A CB  1 
ATOM   29   C CG  . ASP A 1 4   ? 79.683  19.757 22.664 1.00 57.04 ? 4    ASP A CG  1 
ATOM   30   O OD1 . ASP A 1 4   ? 79.494  19.048 23.710 1.00 57.42 ? 4    ASP A OD1 1 
ATOM   31   O OD2 . ASP A 1 4   ? 80.042  19.132 21.601 1.00 58.42 ? 4    ASP A OD2 1 
ATOM   32   N N   . VAL A 1 5   ? 79.391  21.035 19.418 1.00 55.60 ? 5    VAL A N   1 
ATOM   33   C CA  . VAL A 1 5   ? 78.530  20.691 18.326 1.00 55.60 ? 5    VAL A CA  1 
ATOM   34   C C   . VAL A 1 5   ? 78.157  19.207 18.318 1.00 55.66 ? 5    VAL A C   1 
ATOM   35   O O   . VAL A 1 5   ? 79.039  18.350 18.392 1.00 56.04 ? 5    VAL A O   1 
ATOM   36   C CB  . VAL A 1 5   ? 79.190  21.033 17.054 1.00 55.49 ? 5    VAL A CB  1 
ATOM   37   C CG1 . VAL A 1 5   ? 78.162  20.927 15.926 1.00 56.22 ? 5    VAL A CG1 1 
ATOM   38   C CG2 . VAL A 1 5   ? 79.742  22.429 17.152 1.00 55.65 ? 5    VAL A CG2 1 
ATOM   39   N N   . ILE A 1 6   ? 76.857  18.916 18.261 1.00 55.48 ? 6    ILE A N   1 
ATOM   40   C CA  . ILE A 1 6   ? 76.362  17.549 18.315 1.00 55.42 ? 6    ILE A CA  1 
ATOM   41   C C   . ILE A 1 6   ? 75.706  17.257 17.018 1.00 55.14 ? 6    ILE A C   1 
ATOM   42   O O   . ILE A 1 6   ? 74.833  17.998 16.611 1.00 55.32 ? 6    ILE A O   1 
ATOM   43   C CB  . ILE A 1 6   ? 75.288  17.381 19.437 1.00 55.83 ? 6    ILE A CB  1 
ATOM   44   C CG1 . ILE A 1 6   ? 75.613  18.221 20.697 1.00 56.43 ? 6    ILE A CG1 1 
ATOM   45   C CG2 . ILE A 1 6   ? 75.067  15.868 19.797 1.00 55.50 ? 6    ILE A CG2 1 
ATOM   46   C CD1 . ILE A 1 6   ? 76.826  17.711 21.512 1.00 56.79 ? 6    ILE A CD1 1 
ATOM   47   N N   . GLU A 1 7   ? 76.072  16.162 16.384 1.00 54.94 ? 7    GLU A N   1 
ATOM   48   C CA  . GLU A 1 7   ? 75.530  15.893 15.080 1.00 55.22 ? 7    GLU A CA  1 
ATOM   49   C C   . GLU A 1 7   ? 74.323  15.063 15.136 1.00 55.36 ? 7    GLU A C   1 
ATOM   50   O O   . GLU A 1 7   ? 74.389  13.958 15.638 1.00 55.82 ? 7    GLU A O   1 
ATOM   51   C CB  . GLU A 1 7   ? 76.512  15.162 14.221 1.00 55.27 ? 7    GLU A CB  1 
ATOM   52   C CG  . GLU A 1 7   ? 75.986  14.900 12.821 1.00 55.22 ? 7    GLU A CG  1 
ATOM   53   C CD  . GLU A 1 7   ? 77.052  14.270 11.947 1.00 56.17 ? 7    GLU A CD  1 
ATOM   54   O OE1 . GLU A 1 7   ? 78.079  14.900 11.541 1.00 56.76 ? 7    GLU A OE1 1 
ATOM   55   O OE2 . GLU A 1 7   ? 76.865  13.088 11.681 1.00 57.47 ? 7    GLU A OE2 1 
ATOM   56   N N   . LEU A 1 8   ? 73.224  15.580 14.590 1.00 55.67 ? 8    LEU A N   1 
ATOM   57   C CA  . LEU A 1 8   ? 71.964  14.839 14.478 1.00 55.54 ? 8    LEU A CA  1 
ATOM   58   C C   . LEU A 1 8   ? 71.965  14.135 13.166 1.00 55.70 ? 8    LEU A C   1 
ATOM   59   O O   . LEU A 1 8   ? 72.103  14.796 12.144 1.00 55.84 ? 8    LEU A O   1 
ATOM   60   C CB  . LEU A 1 8   ? 70.774  15.765 14.465 1.00 55.12 ? 8    LEU A CB  1 
ATOM   61   C CG  . LEU A 1 8   ? 70.591  16.648 15.668 1.00 55.24 ? 8    LEU A CG  1 
ATOM   62   C CD1 . LEU A 1 8   ? 69.482  17.554 15.364 1.00 55.41 ? 8    LEU A CD1 1 
ATOM   63   C CD2 . LEU A 1 8   ? 70.276  15.881 16.933 1.00 55.64 ? 8    LEU A CD2 1 
ATOM   64   N N   . ASP A 1 9   ? 71.808  12.812 13.186 1.00 55.71 ? 9    ASP A N   1 
ATOM   65   C CA  . ASP A 1 9   ? 71.808  12.033 11.962 1.00 55.86 ? 9    ASP A CA  1 
ATOM   66   C C   . ASP A 1 9   ? 70.458  11.396 11.726 1.00 55.93 ? 9    ASP A C   1 
ATOM   67   O O   . ASP A 1 9   ? 69.937  10.673 12.564 1.00 55.59 ? 9    ASP A O   1 
ATOM   68   C CB  . ASP A 1 9   ? 72.923  10.981 11.984 1.00 56.29 ? 9    ASP A CB  1 
ATOM   69   C CG  . ASP A 1 9   ? 74.331  11.610 12.006 1.00 56.38 ? 9    ASP A CG  1 
ATOM   70   O OD1 . ASP A 1 9   ? 74.743  12.161 10.960 1.00 55.43 ? 9    ASP A OD1 1 
ATOM   71   O OD2 . ASP A 1 9   ? 75.081  11.588 13.010 1.00 55.98 ? 9    ASP A OD2 1 
ATOM   72   N N   . ASP A 1 10  ? 69.886  11.644 10.558 1.00 56.34 ? 10   ASP A N   1 
ATOM   73   C CA  . ASP A 1 10  ? 68.533  11.197 10.282 1.00 56.16 ? 10   ASP A CA  1 
ATOM   74   C C   . ASP A 1 10  ? 68.516  9.863  9.569  1.00 56.36 ? 10   ASP A C   1 
ATOM   75   O O   . ASP A 1 10  ? 69.534  9.419  9.049  1.00 56.68 ? 10   ASP A O   1 
ATOM   76   C CB  . ASP A 1 10  ? 67.783  12.221 9.447  1.00 55.74 ? 10   ASP A CB  1 
ATOM   77   C CG  . ASP A 1 10  ? 66.990  11.586 8.354  1.00 56.44 ? 10   ASP A CG  1 
ATOM   78   O OD1 . ASP A 1 10  ? 67.545  10.718 7.668  1.00 56.47 ? 10   ASP A OD1 1 
ATOM   79   O OD2 . ASP A 1 10  ? 65.813  11.875 8.103  1.00 58.10 ? 10   ASP A OD2 1 
ATOM   80   N N   . VAL A 1 11  ? 67.344  9.237  9.539  1.00 56.06 ? 11   VAL A N   1 
ATOM   81   C CA  . VAL A 1 11  ? 67.231  7.797  9.343  1.00 56.05 ? 11   VAL A CA  1 
ATOM   82   C C   . VAL A 1 11  ? 65.935  7.456  8.637  1.00 55.83 ? 11   VAL A C   1 
ATOM   83   O O   . VAL A 1 11  ? 64.915  8.099  8.848  1.00 54.49 ? 11   VAL A O   1 
ATOM   84   C CB  . VAL A 1 11  ? 67.248  7.056  10.663 1.00 56.14 ? 11   VAL A CB  1 
ATOM   85   C CG1 . VAL A 1 11  ? 68.546  6.341  10.848 1.00 56.16 ? 11   VAL A CG1 1 
ATOM   86   C CG2 . VAL A 1 11  ? 67.007  8.008  11.784 1.00 57.04 ? 11   VAL A CG2 1 
ATOM   87   N N   . ALA A 1 12  ? 65.982  6.424  7.808  1.00 56.27 ? 12   ALA A N   1 
ATOM   88   C CA  . ALA A 1 12  ? 65.297  6.431  6.530  1.00 56.66 ? 12   ALA A CA  1 
ATOM   89   C C   . ALA A 1 12  ? 64.131  7.400  6.537  1.00 57.23 ? 12   ALA A C   1 
ATOM   90   O O   . ALA A 1 12  ? 64.016  8.253  5.665  1.00 57.62 ? 12   ALA A O   1 
ATOM   91   C CB  . ALA A 1 12  ? 64.818  5.040  6.189  1.00 56.55 ? 12   ALA A CB  1 
ATOM   92   N N   . ASN A 1 13  ? 63.249  7.254  7.511  1.00 56.71 ? 13   ASN A N   1 
ATOM   93   C CA  . ASN A 1 13  ? 62.085  8.104  7.575  1.00 56.35 ? 13   ASN A CA  1 
ATOM   94   C C   . ASN A 1 13  ? 62.517  9.533  7.725  1.00 56.60 ? 13   ASN A C   1 
ATOM   95   O O   . ASN A 1 13  ? 63.338  10.026 6.963  1.00 56.74 ? 13   ASN A O   1 
ATOM   96   C CB  . ASN A 1 13  ? 61.191  7.698  8.733  1.00 56.08 ? 13   ASN A CB  1 
ATOM   97   C CG  . ASN A 1 13  ? 60.654  6.303  8.574  1.00 56.87 ? 13   ASN A CG  1 
ATOM   98   O OD1 . ASN A 1 13  ? 59.997  5.769  9.462  1.00 57.86 ? 13   ASN A OD1 1 
ATOM   99   N ND2 . ASN A 1 13  ? 60.933  5.697  7.429  1.00 55.76 ? 13   ASN A ND2 1 
ATOM   100  N N   . LEU A 1 14  ? 61.975  10.207 8.719  1.00 56.30 ? 14   LEU A N   1 
ATOM   101  C CA  . LEU A 1 14  ? 62.373  11.581 8.954  1.00 56.07 ? 14   LEU A CA  1 
ATOM   102  C C   . LEU A 1 14  ? 62.454  11.840 10.426 1.00 56.27 ? 14   LEU A C   1 
ATOM   103  O O   . LEU A 1 14  ? 61.913  12.826 10.883 1.00 57.01 ? 14   LEU A O   1 
ATOM   104  C CB  . LEU A 1 14  ? 61.389  12.547 8.302  1.00 56.01 ? 14   LEU A CB  1 
ATOM   105  C CG  . LEU A 1 14  ? 61.230  12.492 6.786  1.00 56.29 ? 14   LEU A CG  1 
ATOM   106  C CD1 . LEU A 1 14  ? 62.638  12.563 6.079  1.00 56.10 ? 14   LEU A CD1 1 
ATOM   107  C CD2 . LEU A 1 14  ? 60.364  11.244 6.341  1.00 56.19 ? 14   LEU A CD2 1 
ATOM   108  N N   . MET A 1 15  ? 63.091  10.954 11.190 1.00 56.29 ? 15   MET A N   1 
ATOM   109  C CA  . MET A 1 15  ? 63.430  11.285 12.575 1.00 55.91 ? 15   MET A CA  1 
ATOM   110  C C   . MET A 1 15  ? 64.922  11.085 12.765 1.00 55.59 ? 15   MET A C   1 
ATOM   111  O O   . MET A 1 15  ? 65.545  10.239 12.092 1.00 54.97 ? 15   MET A O   1 
ATOM   112  C CB  . MET A 1 15  ? 62.591  10.507 13.610 1.00 56.23 ? 15   MET A CB  1 
ATOM   113  C CG  . MET A 1 15  ? 62.771  11.058 15.117 1.00 56.85 ? 15   MET A CG  1 
ATOM   114  S SD  . MET A 1 15  ? 62.426  12.859 15.495 1.00 57.23 ? 15   MET A SD  1 
ATOM   115  C CE  . MET A 1 15  ? 63.745  13.279 16.666 1.00 55.41 ? 15   MET A CE  1 
ATOM   116  N N   . PHE A 1 16  ? 65.481  11.931 13.636 1.00 55.48 ? 16   PHE A N   1 
ATOM   117  C CA  . PHE A 1 16  ? 66.932  12.025 13.845 1.00 55.55 ? 16   PHE A CA  1 
ATOM   118  C C   . PHE A 1 16  ? 67.309  11.634 15.268 1.00 55.42 ? 16   PHE A C   1 
ATOM   119  O O   . PHE A 1 16  ? 66.561  11.875 16.227 1.00 55.22 ? 16   PHE A O   1 
ATOM   120  C CB  . PHE A 1 16  ? 67.427  13.444 13.562 1.00 55.57 ? 16   PHE A CB  1 
ATOM   121  C CG  . PHE A 1 16  ? 66.712  14.497 14.356 1.00 55.79 ? 16   PHE A CG  1 
ATOM   122  C CD1 . PHE A 1 16  ? 66.921  14.621 15.765 1.00 57.05 ? 16   PHE A CD1 1 
ATOM   123  C CD2 . PHE A 1 16  ? 65.812  15.353 13.732 1.00 55.81 ? 16   PHE A CD2 1 
ATOM   124  C CE1 . PHE A 1 16  ? 66.226  15.604 16.567 1.00 56.78 ? 16   PHE A CE1 1 
ATOM   125  C CE2 . PHE A 1 16  ? 65.126  16.364 14.499 1.00 56.51 ? 16   PHE A CE2 1 
ATOM   126  C CZ  . PHE A 1 16  ? 65.335  16.489 15.927 1.00 56.59 ? 16   PHE A CZ  1 
ATOM   127  N N   . TYR A 1 17  ? 68.477  11.030 15.381 1.00 55.29 ? 17   TYR A N   1 
ATOM   128  C CA  . TYR A 1 17  ? 69.048  10.632 16.645 1.00 55.43 ? 17   TYR A CA  1 
ATOM   129  C C   . TYR A 1 17  ? 70.392  11.409 16.823 1.00 55.43 ? 17   TYR A C   1 
ATOM   130  O O   . TYR A 1 17  ? 70.825  12.150 15.934 1.00 55.23 ? 17   TYR A O   1 
ATOM   131  C CB  . TYR A 1 17  ? 69.226  9.105  16.628 1.00 55.55 ? 17   TYR A CB  1 
ATOM   132  C CG  . TYR A 1 17  ? 70.482  8.626  15.849 1.00 56.73 ? 17   TYR A CG  1 
ATOM   133  C CD1 . TYR A 1 17  ? 71.731  8.471  16.495 1.00 56.95 ? 17   TYR A CD1 1 
ATOM   134  C CD2 . TYR A 1 17  ? 70.432  8.334  14.446 1.00 57.09 ? 17   TYR A CD2 1 
ATOM   135  C CE1 . TYR A 1 17  ? 72.894  8.030  15.774 1.00 56.76 ? 17   TYR A CE1 1 
ATOM   136  C CE2 . TYR A 1 17  ? 71.591  7.884  13.712 1.00 56.31 ? 17   TYR A CE2 1 
ATOM   137  C CZ  . TYR A 1 17  ? 72.818  7.747  14.382 1.00 56.90 ? 17   TYR A CZ  1 
ATOM   138  O OH  . TYR A 1 17  ? 73.961  7.335  13.689 1.00 56.30 ? 17   TYR A OH  1 
ATOM   139  N N   . GLY A 1 18  ? 71.057  11.266 17.955 1.00 55.43 ? 18   GLY A N   1 
ATOM   140  C CA  . GLY A 1 18  ? 72.396  11.856 18.114 1.00 55.43 ? 18   GLY A CA  1 
ATOM   141  C C   . GLY A 1 18  ? 73.238  10.895 18.930 1.00 55.61 ? 18   GLY A C   1 
ATOM   142  O O   . GLY A 1 18  ? 72.697  10.099 19.691 1.00 56.00 ? 18   GLY A O   1 
ATOM   143  N N   . GLU A 1 19  ? 74.557  10.943 18.813 1.00 55.75 ? 19   GLU A N   1 
ATOM   144  C CA  . GLU A 1 19  ? 75.375  10.030 19.614 1.00 55.74 ? 19   GLU A CA  1 
ATOM   145  C C   . GLU A 1 19  ? 75.320  10.505 21.047 1.00 55.47 ? 19   GLU A C   1 
ATOM   146  O O   . GLU A 1 19  ? 75.065  11.642 21.313 1.00 55.26 ? 19   GLU A O   1 
ATOM   147  C CB  . GLU A 1 19  ? 76.825  9.963  19.128 1.00 55.92 ? 19   GLU A CB  1 
ATOM   148  C CG  . GLU A 1 19  ? 77.516  8.621  19.434 1.00 55.84 ? 19   GLU A CG  1 
ATOM   149  C CD  . GLU A 1 19  ? 79.046  8.710  19.316 1.00 56.55 ? 19   GLU A CD  1 
ATOM   150  O OE1 . GLU A 1 19  ? 79.615  8.861  18.169 1.00 57.31 ? 19   GLU A OE1 1 
ATOM   151  O OE2 . GLU A 1 19  ? 79.691  8.668  20.419 1.00 57.15 ? 19   GLU A OE2 1 
ATOM   152  N N   . GLY A 1 20  ? 75.520  9.599  21.980 1.00 55.90 ? 20   GLY A N   1 
ATOM   153  C CA  . GLY A 1 20  ? 75.517  9.947  23.407 1.00 55.95 ? 20   GLY A CA  1 
ATOM   154  C C   . GLY A 1 20  ? 76.302  8.943  24.230 1.00 56.02 ? 20   GLY A C   1 
ATOM   155  O O   . GLY A 1 20  ? 76.000  7.740  24.195 1.00 56.37 ? 20   GLY A O   1 
ATOM   156  N N   . GLU A 1 21  ? 77.294  9.413  24.983 1.00 55.74 ? 21   GLU A N   1 
ATOM   157  C CA  . GLU A 1 21  ? 77.997  8.489  25.846 1.00 55.73 ? 21   GLU A CA  1 
ATOM   158  C C   . GLU A 1 21  ? 77.824  8.833  27.292 1.00 55.64 ? 21   GLU A C   1 
ATOM   159  O O   . GLU A 1 21  ? 77.730  10.029 27.656 1.00 55.00 ? 21   GLU A O   1 
ATOM   160  C CB  . GLU A 1 21  ? 79.473  8.345  25.491 1.00 55.99 ? 21   GLU A CB  1 
ATOM   161  C CG  . GLU A 1 21  ? 79.965  9.198  24.338 1.00 56.56 ? 21   GLU A CG  1 
ATOM   162  C CD  . GLU A 1 21  ? 81.432  8.978  24.046 1.00 56.21 ? 21   GLU A CD  1 
ATOM   163  O OE1 . GLU A 1 21  ? 82.135  9.979  23.910 1.00 56.49 ? 21   GLU A OE1 1 
ATOM   164  O OE2 . GLU A 1 21  ? 81.885  7.814  23.957 1.00 56.06 ? 21   GLU A OE2 1 
ATOM   165  N N   . VAL A 1 22  ? 77.724  7.756  28.090 1.00 55.67 ? 22   VAL A N   1 
ATOM   166  C CA  . VAL A 1 22  ? 77.714  7.837  29.550 1.00 55.63 ? 22   VAL A CA  1 
ATOM   167  C C   . VAL A 1 22  ? 78.852  7.049  30.148 1.00 55.49 ? 22   VAL A C   1 
ATOM   168  O O   . VAL A 1 22  ? 78.980  5.840  29.926 1.00 54.71 ? 22   VAL A O   1 
ATOM   169  C CB  . VAL A 1 22  ? 76.464  7.227  30.149 1.00 55.82 ? 22   VAL A CB  1 
ATOM   170  C CG1 . VAL A 1 22  ? 75.266  7.393  29.248 1.00 55.57 ? 22   VAL A CG1 1 
ATOM   171  C CG2 . VAL A 1 22  ? 76.643  5.814  30.353 1.00 55.48 ? 22   VAL A CG2 1 
ATOM   172  N N   . GLY A 1 23  ? 79.681  7.735  30.914 1.00 55.63 ? 23   GLY A N   1 
ATOM   173  C CA  . GLY A 1 23  ? 80.636  7.041  31.762 1.00 56.04 ? 23   GLY A CA  1 
ATOM   174  C C   . GLY A 1 23  ? 82.060  7.123  31.259 1.00 56.22 ? 23   GLY A C   1 
ATOM   175  O O   . GLY A 1 23  ? 82.304  7.480  30.085 1.00 55.92 ? 23   GLY A O   1 
ATOM   176  N N   . ASP A 1 24  ? 82.985  6.795  32.180 1.00 56.56 ? 24   ASP A N   1 
ATOM   177  C CA  . ASP A 1 24  ? 84.446  6.639  31.912 1.00 56.28 ? 24   ASP A CA  1 
ATOM   178  C C   . ASP A 1 24  ? 84.721  5.823  30.664 1.00 55.96 ? 24   ASP A C   1 
ATOM   179  O O   . ASP A 1 24  ? 85.470  6.226  29.798 1.00 55.86 ? 24   ASP A O   1 
ATOM   180  C CB  . ASP A 1 24  ? 85.162  5.967  33.105 1.00 56.19 ? 24   ASP A CB  1 
ATOM   181  C CG  . ASP A 1 24  ? 85.682  6.969  34.095 1.00 56.82 ? 24   ASP A CG  1 
ATOM   182  O OD1 . ASP A 1 24  ? 84.850  7.489  34.851 1.00 58.23 ? 24   ASP A OD1 1 
ATOM   183  O OD2 . ASP A 1 24  ? 86.884  7.318  34.197 1.00 57.26 ? 24   ASP A OD2 1 
ATOM   184  N N   . ASN A 1 25  ? 84.100  4.672  30.563 1.00 55.61 ? 25   ASN A N   1 
ATOM   185  C CA  . ASN A 1 25  ? 84.406  3.840  29.447 1.00 55.83 ? 25   ASN A CA  1 
ATOM   186  C C   . ASN A 1 25  ? 83.756  4.457  28.188 1.00 56.17 ? 25   ASN A C   1 
ATOM   187  O O   . ASN A 1 25  ? 84.017  4.012  27.044 1.00 56.47 ? 25   ASN A O   1 
ATOM   188  C CB  . ASN A 1 25  ? 83.962  2.390  29.712 1.00 55.62 ? 25   ASN A CB  1 
ATOM   189  C CG  . ASN A 1 25  ? 82.454  2.244  29.800 1.00 55.92 ? 25   ASN A CG  1 
ATOM   190  O OD1 . ASN A 1 25  ? 81.708  3.170  29.451 1.00 57.31 ? 25   ASN A OD1 1 
ATOM   191  N ND2 . ASN A 1 25  ? 81.992  1.102  30.279 1.00 54.25 ? 25   ASN A ND2 1 
ATOM   192  N N   . HIS A 1 26  ? 82.921  5.487  28.393 1.00 56.15 ? 26   HIS A N   1 
ATOM   193  C CA  . HIS A 1 26  ? 82.250  6.174  27.277 1.00 56.05 ? 26   HIS A CA  1 
ATOM   194  C C   . HIS A 1 26  ? 81.405  5.169  26.493 1.00 56.01 ? 26   HIS A C   1 
ATOM   195  O O   . HIS A 1 26  ? 81.718  4.900  25.325 1.00 56.38 ? 26   HIS A O   1 
ATOM   196  C CB  . HIS A 1 26  ? 83.277  6.830  26.327 1.00 56.16 ? 26   HIS A CB  1 
ATOM   197  C CG  . HIS A 1 26  ? 84.016  7.977  26.934 1.00 56.52 ? 26   HIS A CG  1 
ATOM   198  N ND1 . HIS A 1 26  ? 85.023  7.810  27.861 1.00 55.99 ? 26   HIS A ND1 1 
ATOM   199  C CD2 . HIS A 1 26  ? 83.896  9.311  26.745 1.00 56.58 ? 26   HIS A CD2 1 
ATOM   200  C CE1 . HIS A 1 26  ? 85.473  8.995  28.235 1.00 55.59 ? 26   HIS A CE1 1 
ATOM   201  N NE2 . HIS A 1 26  ? 84.815  9.922  27.565 1.00 55.72 ? 26   HIS A NE2 1 
ATOM   202  N N   . GLN A 1 27  ? 80.375  4.592  27.121 1.00 55.53 ? 27   GLN A N   1 
ATOM   203  C CA  . GLN A 1 27  ? 79.460  3.762  26.367 1.00 55.53 ? 27   GLN A CA  1 
ATOM   204  C C   . GLN A 1 27  ? 78.643  4.706  25.484 1.00 55.50 ? 27   GLN A C   1 
ATOM   205  O O   . GLN A 1 27  ? 78.135  5.737  25.971 1.00 54.90 ? 27   GLN A O   1 
ATOM   206  C CB  . GLN A 1 27  ? 78.530  2.924  27.250 1.00 55.63 ? 27   GLN A CB  1 
ATOM   207  C CG  . GLN A 1 27  ? 79.145  1.712  27.865 1.00 55.08 ? 27   GLN A CG  1 
ATOM   208  C CD  . GLN A 1 27  ? 78.202  1.023  28.813 1.00 55.13 ? 27   GLN A CD  1 
ATOM   209  O OE1 . GLN A 1 27  ? 77.150  0.527  28.409 1.00 55.08 ? 27   GLN A OE1 1 
ATOM   210  N NE2 . GLN A 1 27  ? 78.565  1.002  30.084 1.00 54.47 ? 27   GLN A NE2 1 
ATOM   211  N N   . LYS A 1 28  ? 78.544  4.329  24.196 1.00 55.56 ? 28   LYS A N   1 
ATOM   212  C CA  . LYS A 1 28  ? 77.834  5.090  23.162 1.00 55.65 ? 28   LYS A CA  1 
ATOM   213  C C   . LYS A 1 28  ? 76.348  4.720  22.975 1.00 55.19 ? 28   LYS A C   1 
ATOM   214  O O   . LYS A 1 28  ? 75.975  3.571  23.059 1.00 54.81 ? 28   LYS A O   1 
ATOM   215  C CB  . LYS A 1 28  ? 78.585  4.942  21.835 1.00 56.25 ? 28   LYS A CB  1 
ATOM   216  C CG  . LYS A 1 28  ? 80.082  5.443  21.864 1.00 56.54 ? 28   LYS A CG  1 
ATOM   217  C CD  . LYS A 1 28  ? 80.695  5.665  20.432 1.00 56.16 ? 28   LYS A CD  1 
ATOM   218  C CE  . LYS A 1 28  ? 82.037  6.450  20.542 1.00 56.58 ? 28   LYS A CE  1 
ATOM   219  N NZ  . LYS A 1 28  ? 82.623  6.916  19.243 1.00 57.81 ? 28   LYS A NZ  1 
ATOM   220  N N   . PHE A 1 29  ? 75.522  5.728  22.724 1.00 54.93 ? 29   PHE A N   1 
ATOM   221  C CA  . PHE A 1 29  ? 74.107  5.565  22.723 1.00 54.99 ? 29   PHE A CA  1 
ATOM   222  C C   . PHE A 1 29  ? 73.450  6.492  21.753 1.00 55.06 ? 29   PHE A C   1 
ATOM   223  O O   . PHE A 1 29  ? 73.771  7.654  21.676 1.00 54.69 ? 29   PHE A O   1 
ATOM   224  C CB  . PHE A 1 29  ? 73.549  5.862  24.097 1.00 55.02 ? 29   PHE A CB  1 
ATOM   225  C CG  . PHE A 1 29  ? 73.628  4.714  25.006 1.00 55.16 ? 29   PHE A CG  1 
ATOM   226  C CD1 . PHE A 1 29  ? 72.757  3.646  24.851 1.00 55.77 ? 29   PHE A CD1 1 
ATOM   227  C CD2 . PHE A 1 29  ? 74.564  4.666  26.009 1.00 55.61 ? 29   PHE A CD2 1 
ATOM   228  C CE1 . PHE A 1 29  ? 72.817  2.551  25.677 1.00 55.87 ? 29   PHE A CE1 1 
ATOM   229  C CE2 . PHE A 1 29  ? 74.645  3.562  26.825 1.00 55.62 ? 29   PHE A CE2 1 
ATOM   230  C CZ  . PHE A 1 29  ? 73.761  2.502  26.654 1.00 55.89 ? 29   PHE A CZ  1 
ATOM   231  N N   . MET A 1 30  ? 72.504  5.954  21.007 1.00 55.52 ? 30   MET A N   1 
ATOM   232  C CA  . MET A 1 30  ? 71.661  6.738  20.117 1.00 55.38 ? 30   MET A CA  1 
ATOM   233  C C   . MET A 1 30  ? 70.544  7.228  20.978 1.00 55.05 ? 30   MET A C   1 
ATOM   234  O O   . MET A 1 30  ? 69.792  6.430  21.511 1.00 55.29 ? 30   MET A O   1 
ATOM   235  C CB  . MET A 1 30  ? 71.127  5.863  18.964 1.00 55.61 ? 30   MET A CB  1 
ATOM   236  C CG  . MET A 1 30  ? 72.192  5.458  17.913 1.00 55.02 ? 30   MET A CG  1 
ATOM   237  S SD  . MET A 1 30  ? 71.528  4.172  16.835 1.00 56.12 ? 30   MET A SD  1 
ATOM   238  C CE  . MET A 1 30  ? 71.089  5.092  15.324 1.00 55.75 ? 30   MET A CE  1 
ATOM   239  N N   . LEU A 1 31  ? 70.459  8.533  21.146 1.00 54.92 ? 31   LEU A N   1 
ATOM   240  C CA  . LEU A 1 31  ? 69.458  9.122  22.024 1.00 55.30 ? 31   LEU A CA  1 
ATOM   241  C C   . LEU A 1 31  ? 68.352  9.744  21.209 1.00 55.12 ? 31   LEU A C   1 
ATOM   242  O O   . LEU A 1 31  ? 67.952  9.187  20.240 1.00 55.57 ? 31   LEU A O   1 
ATOM   243  C CB  . LEU A 1 31  ? 70.083  10.174 22.950 1.00 55.51 ? 31   LEU A CB  1 
ATOM   244  C CG  . LEU A 1 31  ? 71.318  9.821  23.771 1.00 55.46 ? 31   LEU A CG  1 
ATOM   245  C CD1 . LEU A 1 31  ? 71.583  10.872 24.849 1.00 54.73 ? 31   LEU A CD1 1 
ATOM   246  C CD2 . LEU A 1 31  ? 71.121  8.468  24.372 1.00 55.98 ? 31   LEU A CD2 1 
ATOM   247  N N   . ILE A 1 32  ? 67.853  10.884 21.643 1.00 54.98 ? 32   ILE A N   1 
ATOM   248  C CA  . ILE A 1 32  ? 66.821  11.635 20.982 1.00 55.10 ? 32   ILE A CA  1 
ATOM   249  C C   . ILE A 1 32  ? 66.823  12.919 21.764 1.00 55.10 ? 32   ILE A C   1 
ATOM   250  O O   . ILE A 1 32  ? 66.439  12.953 22.932 1.00 55.01 ? 32   ILE A O   1 
ATOM   251  C CB  . ILE A 1 32  ? 65.415  11.001 21.088 1.00 54.96 ? 32   ILE A CB  1 
ATOM   252  C CG1 . ILE A 1 32  ? 65.193  9.938  20.022 1.00 55.46 ? 32   ILE A CG1 1 
ATOM   253  C CG2 . ILE A 1 32  ? 64.334  12.041 20.821 1.00 54.70 ? 32   ILE A CG2 1 
ATOM   254  C CD1 . ILE A 1 32  ? 63.787  9.274  20.058 1.00 55.26 ? 32   ILE A CD1 1 
ATOM   255  N N   . PHE A 1 33  ? 67.224  13.997 21.142 1.00 55.00 ? 33   PHE A N   1 
ATOM   256  C CA  . PHE A 1 33  ? 67.260  15.204 21.881 1.00 54.90 ? 33   PHE A CA  1 
ATOM   257  C C   . PHE A 1 33  ? 65.893  15.773 21.713 1.00 54.51 ? 33   PHE A C   1 
ATOM   258  O O   . PHE A 1 33  ? 65.422  15.961 20.595 1.00 54.23 ? 33   PHE A O   1 
ATOM   259  C CB  . PHE A 1 33  ? 68.379  16.083 21.369 1.00 55.40 ? 33   PHE A CB  1 
ATOM   260  C CG  . PHE A 1 33  ? 69.701  15.452 21.529 1.00 54.80 ? 33   PHE A CG  1 
ATOM   261  C CD1 . PHE A 1 33  ? 69.976  14.230 20.890 1.00 55.35 ? 33   PHE A CD1 1 
ATOM   262  C CD2 . PHE A 1 33  ? 70.653  16.017 22.350 1.00 54.06 ? 33   PHE A CD2 1 
ATOM   263  C CE1 . PHE A 1 33  ? 71.216  13.610 21.030 1.00 55.63 ? 33   PHE A CE1 1 
ATOM   264  C CE2 . PHE A 1 33  ? 71.882  15.418 22.516 1.00 54.71 ? 33   PHE A CE2 1 
ATOM   265  C CZ  . PHE A 1 33  ? 72.180  14.206 21.852 1.00 55.89 ? 33   PHE A CZ  1 
ATOM   266  N N   . ASP A 1 34  ? 65.260  16.000 22.850 1.00 54.45 ? 34   ASP A N   1 
ATOM   267  C CA  . ASP A 1 34  ? 63.876  16.365 22.912 1.00 54.61 ? 34   ASP A CA  1 
ATOM   268  C C   . ASP A 1 34  ? 63.562  17.559 23.854 1.00 54.28 ? 34   ASP A C   1 
ATOM   269  O O   . ASP A 1 34  ? 63.823  17.507 25.046 1.00 53.77 ? 34   ASP A O   1 
ATOM   270  C CB  . ASP A 1 34  ? 63.141  15.131 23.354 1.00 54.68 ? 34   ASP A CB  1 
ATOM   271  C CG  . ASP A 1 34  ? 61.731  15.403 23.627 1.00 55.19 ? 34   ASP A CG  1 
ATOM   272  O OD1 . ASP A 1 34  ? 61.129  14.587 24.399 1.00 54.99 ? 34   ASP A OD1 1 
ATOM   273  O OD2 . ASP A 1 34  ? 61.193  16.445 23.123 1.00 54.49 ? 34   ASP A OD2 1 
ATOM   274  N N   . THR A 1 35  ? 62.961  18.605 23.308 1.00 54.23 ? 35   THR A N   1 
ATOM   275  C CA  . THR A 1 35  ? 62.632  19.795 24.076 1.00 54.41 ? 35   THR A CA  1 
ATOM   276  C C   . THR A 1 35  ? 61.248  19.662 24.670 1.00 54.39 ? 35   THR A C   1 
ATOM   277  O O   . THR A 1 35  ? 60.603  20.651 25.097 1.00 53.53 ? 35   THR A O   1 
ATOM   278  C CB  . THR A 1 35  ? 62.727  21.066 23.209 1.00 54.33 ? 35   THR A CB  1 
ATOM   279  O OG1 . THR A 1 35  ? 61.848  20.975 22.100 1.00 54.50 ? 35   THR A OG1 1 
ATOM   280  C CG2 . THR A 1 35  ? 64.042  21.169 22.557 1.00 54.31 ? 35   THR A CG2 1 
ATOM   281  N N   . GLY A 1 36  ? 60.802  18.412 24.682 1.00 54.72 ? 36   GLY A N   1 
ATOM   282  C CA  . GLY A 1 36  ? 59.497  18.021 25.197 1.00 54.53 ? 36   GLY A CA  1 
ATOM   283  C C   . GLY A 1 36  ? 59.563  17.280 26.503 1.00 53.93 ? 36   GLY A C   1 
ATOM   284  O O   . GLY A 1 36  ? 58.687  17.398 27.286 1.00 53.62 ? 36   GLY A O   1 
ATOM   285  N N   . SER A 1 37  ? 60.598  16.511 26.741 1.00 53.69 ? 37   SER A N   1 
ATOM   286  C CA  . SER A 1 37  ? 60.789  15.976 28.048 1.00 54.20 ? 37   SER A CA  1 
ATOM   287  C C   . SER A 1 37  ? 61.974  16.665 28.706 1.00 54.43 ? 37   SER A C   1 
ATOM   288  O O   . SER A 1 37  ? 62.645  17.515 28.099 1.00 54.19 ? 37   SER A O   1 
ATOM   289  C CB  . SER A 1 37  ? 60.972  14.482 27.997 1.00 53.91 ? 37   SER A CB  1 
ATOM   290  O OG  . SER A 1 37  ? 62.262  14.146 27.632 1.00 53.57 ? 37   SER A OG  1 
ATOM   291  N N   . ALA A 1 38  ? 62.198  16.360 29.977 1.00 54.67 ? 38   ALA A N   1 
ATOM   292  C CA  . ALA A 1 38  ? 63.277  17.005 30.677 1.00 54.96 ? 38   ALA A CA  1 
ATOM   293  C C   . ALA A 1 38  ? 64.066  16.031 31.498 1.00 55.17 ? 38   ALA A C   1 
ATOM   294  O O   . ALA A 1 38  ? 64.691  16.404 32.516 1.00 55.41 ? 38   ALA A O   1 
ATOM   295  C CB  . ALA A 1 38  ? 62.767  18.121 31.550 1.00 55.56 ? 38   ALA A CB  1 
ATOM   296  N N   . ASN A 1 39  ? 64.093  14.795 31.041 1.00 55.09 ? 39   ASN A N   1 
ATOM   297  C CA  . ASN A 1 39  ? 64.910  13.823 31.709 1.00 55.15 ? 39   ASN A CA  1 
ATOM   298  C C   . ASN A 1 39  ? 65.876  13.197 30.767 1.00 54.81 ? 39   ASN A C   1 
ATOM   299  O O   . ASN A 1 39  ? 65.974  13.564 29.622 1.00 54.52 ? 39   ASN A O   1 
ATOM   300  C CB  . ASN A 1 39  ? 64.023  12.754 32.356 1.00 55.37 ? 39   ASN A CB  1 
ATOM   301  C CG  . ASN A 1 39  ? 63.193  13.296 33.503 1.00 54.89 ? 39   ASN A CG  1 
ATOM   302  O OD1 . ASN A 1 39  ? 62.348  14.137 33.280 1.00 55.69 ? 39   ASN A OD1 1 
ATOM   303  N ND2 . ASN A 1 39  ? 63.434  12.820 34.722 1.00 53.74 ? 39   ASN A ND2 1 
ATOM   304  N N   . LEU A 1 40  ? 66.589  12.230 31.283 1.00 54.91 ? 40   LEU A N   1 
ATOM   305  C CA  . LEU A 1 40  ? 67.438  11.419 30.485 1.00 54.91 ? 40   LEU A CA  1 
ATOM   306  C C   . LEU A 1 40  ? 67.408  9.941  30.949 1.00 54.78 ? 40   LEU A C   1 
ATOM   307  O O   . LEU A 1 40  ? 67.415  9.595  32.151 1.00 54.37 ? 40   LEU A O   1 
ATOM   308  C CB  . LEU A 1 40  ? 68.822  11.994 30.544 1.00 54.86 ? 40   LEU A CB  1 
ATOM   309  C CG  . LEU A 1 40  ? 69.924  11.026 30.134 1.00 55.49 ? 40   LEU A CG  1 
ATOM   310  C CD1 . LEU A 1 40  ? 69.789  10.613 28.704 1.00 55.54 ? 40   LEU A CD1 1 
ATOM   311  C CD2 . LEU A 1 40  ? 71.308  11.658 30.374 1.00 55.45 ? 40   LEU A CD2 1 
ATOM   312  N N   . TRP A 1 41  ? 67.338  9.066  29.964 1.00 54.92 ? 41   TRP A N   1 
ATOM   313  C CA  . TRP A 1 41  ? 67.345  7.660  30.220 1.00 54.93 ? 41   TRP A CA  1 
ATOM   314  C C   . TRP A 1 41  ? 67.946  6.844  29.096 1.00 54.78 ? 41   TRP A C   1 
ATOM   315  O O   . TRP A 1 41  ? 67.887  7.207  27.932 1.00 54.38 ? 41   TRP A O   1 
ATOM   316  C CB  . TRP A 1 41  ? 65.939  7.175  30.485 1.00 54.93 ? 41   TRP A CB  1 
ATOM   317  C CG  . TRP A 1 41  ? 65.010  7.200  29.335 1.00 55.05 ? 41   TRP A CG  1 
ATOM   318  C CD1 . TRP A 1 41  ? 64.103  8.173  29.054 1.00 55.64 ? 41   TRP A CD1 1 
ATOM   319  C CD2 . TRP A 1 41  ? 64.822  6.179  28.331 1.00 55.73 ? 41   TRP A CD2 1 
ATOM   320  N NE1 . TRP A 1 41  ? 63.364  7.831  27.941 1.00 55.84 ? 41   TRP A NE1 1 
ATOM   321  C CE2 . TRP A 1 41  ? 63.793  6.615  27.472 1.00 55.75 ? 41   TRP A CE2 1 
ATOM   322  C CE3 . TRP A 1 41  ? 65.437  4.953  28.054 1.00 55.56 ? 41   TRP A CE3 1 
ATOM   323  C CZ2 . TRP A 1 41  ? 63.391  5.883  26.360 1.00 54.66 ? 41   TRP A CZ2 1 
ATOM   324  C CZ3 . TRP A 1 41  ? 65.010  4.231  26.967 1.00 54.87 ? 41   TRP A CZ3 1 
ATOM   325  C CH2 . TRP A 1 41  ? 64.005  4.702  26.135 1.00 54.53 ? 41   TRP A CH2 1 
ATOM   326  N N   . VAL A 1 42  ? 68.502  5.717  29.501 1.00 54.83 ? 42   VAL A N   1 
ATOM   327  C CA  . VAL A 1 42  ? 69.195  4.820  28.642 1.00 54.88 ? 42   VAL A CA  1 
ATOM   328  C C   . VAL A 1 42  ? 68.803  3.428  29.081 1.00 54.66 ? 42   VAL A C   1 
ATOM   329  O O   . VAL A 1 42  ? 68.860  3.129  30.245 1.00 54.32 ? 42   VAL A O   1 
ATOM   330  C CB  . VAL A 1 42  ? 70.717  4.999  28.801 1.00 55.20 ? 42   VAL A CB  1 
ATOM   331  C CG1 . VAL A 1 42  ? 71.156  6.423  28.434 1.00 54.57 ? 42   VAL A CG1 1 
ATOM   332  C CG2 . VAL A 1 42  ? 71.176  4.667  30.223 1.00 55.47 ? 42   VAL A CG2 1 
ATOM   333  N N   . PRO A 1 43  ? 68.421  2.566  28.160 1.00 54.95 ? 43   PRO A N   1 
ATOM   334  C CA  . PRO A 1 43  ? 67.978  1.231  28.504 1.00 55.11 ? 43   PRO A CA  1 
ATOM   335  C C   . PRO A 1 43  ? 69.091  0.450  29.164 1.00 55.39 ? 43   PRO A C   1 
ATOM   336  O O   . PRO A 1 43  ? 70.087  0.173  28.526 1.00 55.71 ? 43   PRO A O   1 
ATOM   337  C CB  . PRO A 1 43  ? 67.640  0.626  27.153 1.00 54.78 ? 43   PRO A CB  1 
ATOM   338  C CG  . PRO A 1 43  ? 68.451  1.349  26.245 1.00 55.34 ? 43   PRO A CG  1 
ATOM   339  C CD  . PRO A 1 43  ? 68.449  2.760  26.710 1.00 55.36 ? 43   PRO A CD  1 
ATOM   340  N N   . SER A 1 44  ? 68.940  0.131  30.447 1.00 55.67 ? 44   SER A N   1 
ATOM   341  C CA  . SER A 1 44  ? 70.039  -0.430 31.236 1.00 55.32 ? 44   SER A CA  1 
ATOM   342  C C   . SER A 1 44  ? 70.208  -1.844 30.913 1.00 55.13 ? 44   SER A C   1 
ATOM   343  O O   . SER A 1 44  ? 69.239  -2.513 30.564 1.00 55.00 ? 44   SER A O   1 
ATOM   344  C CB  . SER A 1 44  ? 69.739  -0.402 32.718 1.00 55.80 ? 44   SER A CB  1 
ATOM   345  O OG  . SER A 1 44  ? 70.699  -1.158 33.455 1.00 55.21 ? 44   SER A OG  1 
ATOM   346  N N   . LYS A 1 45  ? 71.428  -2.310 31.134 1.00 55.00 ? 45   LYS A N   1 
ATOM   347  C CA  . LYS A 1 45  ? 71.798  -3.679 30.854 1.00 55.30 ? 45   LYS A CA  1 
ATOM   348  C C   . LYS A 1 45  ? 70.887  -4.621 31.648 1.00 55.53 ? 45   LYS A C   1 
ATOM   349  O O   . LYS A 1 45  ? 70.497  -5.711 31.196 1.00 54.55 ? 45   LYS A O   1 
ATOM   350  C CB  . LYS A 1 45  ? 73.251  -3.906 31.221 1.00 54.91 ? 45   LYS A CB  1 
ATOM   351  C CG  . LYS A 1 45  ? 73.819  -5.084 30.493 1.00 55.27 ? 45   LYS A CG  1 
ATOM   352  C CD  . LYS A 1 45  ? 75.172  -5.424 31.019 1.00 55.46 ? 45   LYS A CD  1 
ATOM   353  C CE  . LYS A 1 45  ? 76.082  -5.941 29.920 1.00 56.01 ? 45   LYS A CE  1 
ATOM   354  N NZ  . LYS A 1 45  ? 77.548  -5.688 30.275 1.00 56.07 ? 45   LYS A NZ  1 
ATOM   355  N N   . LYS A 1 46  ? 70.543  -4.165 32.853 1.00 56.24 ? 46   LYS A N   1 
ATOM   356  C CA  . LYS A 1 46  ? 69.671  -4.911 33.756 1.00 56.20 ? 46   LYS A CA  1 
ATOM   357  C C   . LYS A 1 46  ? 68.227  -4.864 33.231 1.00 56.29 ? 46   LYS A C   1 
ATOM   358  O O   . LYS A 1 46  ? 67.289  -4.812 34.022 1.00 56.98 ? 46   LYS A O   1 
ATOM   359  C CB  . LYS A 1 46  ? 69.775  -4.350 35.209 1.00 56.23 ? 46   LYS A CB  1 
ATOM   360  C CG  . LYS A 1 46  ? 71.200  -4.407 35.856 1.00 56.05 ? 46   LYS A CG  1 
ATOM   361  C CD  . LYS A 1 46  ? 71.258  -3.607 37.177 1.00 56.20 ? 46   LYS A CD  1 
ATOM   362  C CE  . LYS A 1 46  ? 72.688  -3.500 37.721 1.00 56.18 ? 46   LYS A CE  1 
ATOM   363  N NZ  . LYS A 1 46  ? 72.831  -2.602 38.909 1.00 56.50 ? 46   LYS A NZ  1 
ATOM   364  N N   . CYS A 1 47  ? 68.058  -4.888 31.912 1.00 56.05 ? 47   CYS A N   1 
ATOM   365  C CA  . CYS A 1 47  ? 66.741  -4.907 31.297 1.00 56.14 ? 47   CYS A CA  1 
ATOM   366  C C   . CYS A 1 47  ? 66.708  -6.145 30.440 1.00 56.15 ? 47   CYS A C   1 
ATOM   367  O O   . CYS A 1 47  ? 67.728  -6.606 29.985 1.00 56.61 ? 47   CYS A O   1 
ATOM   368  C CB  . CYS A 1 47  ? 66.498  -3.652 30.432 1.00 56.37 ? 47   CYS A CB  1 
ATOM   369  S SG  . CYS A 1 47  ? 64.937  -3.689 29.457 1.00 56.64 ? 47   CYS A SG  1 
ATOM   370  N N   . ASN A 1 48  ? 65.537  -6.694 30.209 1.00 56.07 ? 48   ASN A N   1 
ATOM   371  C CA  . ASN A 1 48  ? 65.441  -7.918 29.433 1.00 55.92 ? 48   ASN A CA  1 
ATOM   372  C C   . ASN A 1 48  ? 64.234  -7.966 28.551 1.00 56.15 ? 48   ASN A C   1 
ATOM   373  O O   . ASN A 1 48  ? 64.118  -8.910 27.758 1.00 56.15 ? 48   ASN A O   1 
ATOM   374  C CB  . ASN A 1 48  ? 65.434  -9.101 30.370 1.00 55.67 ? 48   ASN A CB  1 
ATOM   375  C CG  . ASN A 1 48  ? 66.655  -9.128 31.214 1.00 55.58 ? 48   ASN A CG  1 
ATOM   376  O OD1 . ASN A 1 48  ? 67.738  -8.853 30.725 1.00 55.64 ? 48   ASN A OD1 1 
ATOM   377  N ND2 . ASN A 1 48  ? 66.501  -9.422 32.493 1.00 55.96 ? 48   ASN A ND2 1 
ATOM   378  N N   . SER A 1 49  ? 63.332  -6.978 28.717 1.00 56.21 ? 49   SER A N   1 
ATOM   379  C CA  . SER A 1 49  ? 62.287  -6.676 27.745 1.00 56.00 ? 49   SER A CA  1 
ATOM   380  C C   . SER A 1 49  ? 62.848  -6.869 26.359 1.00 56.09 ? 49   SER A C   1 
ATOM   381  O O   . SER A 1 49  ? 63.946  -6.323 26.022 1.00 55.44 ? 49   SER A O   1 
ATOM   382  C CB  . SER A 1 49  ? 61.817  -5.220 27.836 1.00 55.75 ? 49   SER A CB  1 
ATOM   383  O OG  . SER A 1 49  ? 61.633  -4.802 29.164 1.00 56.09 ? 49   SER A OG  1 
ATOM   384  N N   . ILE A 1 50  ? 62.120  -7.691 25.593 1.00 56.07 ? 50   ILE A N   1 
ATOM   385  C CA  . ILE A 1 50  ? 62.297  -7.758 24.150 1.00 56.09 ? 50   ILE A CA  1 
ATOM   386  C C   . ILE A 1 50  ? 62.866  -6.414 23.647 1.00 56.19 ? 50   ILE A C   1 
ATOM   387  O O   . ILE A 1 50  ? 64.004  -6.382 23.134 1.00 56.03 ? 50   ILE A O   1 
ATOM   388  C CB  . ILE A 1 50  ? 60.956  -8.135 23.409 1.00 56.08 ? 50   ILE A CB  1 
ATOM   389  C CG1 . ILE A 1 50  ? 59.753  -7.467 24.093 1.00 55.70 ? 50   ILE A CG1 1 
ATOM   390  C CG2 . ILE A 1 50  ? 60.804  -9.659 23.330 1.00 55.60 ? 50   ILE A CG2 1 
ATOM   391  C CD1 . ILE A 1 50  ? 58.472  -7.598 23.381 1.00 55.70 ? 50   ILE A CD1 1 
ATOM   392  N N   . GLY A 1 51  ? 62.107  -5.316 23.822 1.00 56.08 ? 51   GLY A N   1 
ATOM   393  C CA  . GLY A 1 51  ? 62.538  -4.016 23.307 1.00 56.16 ? 51   GLY A CA  1 
ATOM   394  C C   . GLY A 1 51  ? 64.064  -3.919 23.340 1.00 56.27 ? 51   GLY A C   1 
ATOM   395  O O   . GLY A 1 51  ? 64.729  -3.774 22.300 1.00 55.84 ? 51   GLY A O   1 
ATOM   396  N N   . CYS A 1 52  ? 64.578  -4.074 24.569 1.00 56.26 ? 52   CYS A N   1 
ATOM   397  C CA  . CYS A 1 52  ? 65.981  -3.941 24.927 1.00 55.98 ? 52   CYS A CA  1 
ATOM   398  C C   . CYS A 1 52  ? 66.872  -4.905 24.154 1.00 55.83 ? 52   CYS A C   1 
ATOM   399  O O   . CYS A 1 52  ? 68.018  -4.566 23.862 1.00 55.11 ? 52   CYS A O   1 
ATOM   400  C CB  . CYS A 1 52  ? 66.135  -4.186 26.457 1.00 56.27 ? 52   CYS A CB  1 
ATOM   401  S SG  . CYS A 1 52  ? 65.139  -3.067 27.511 1.00 55.75 ? 52   CYS A SG  1 
ATOM   402  N N   . SER A 1 53  ? 66.327  -6.103 23.864 1.00 56.09 ? 53   SER A N   1 
ATOM   403  C CA  . SER A 1 53  ? 66.959  -7.154 22.999 1.00 56.07 ? 53   SER A CA  1 
ATOM   404  C C   . SER A 1 53  ? 67.863  -6.574 21.935 1.00 56.22 ? 53   SER A C   1 
ATOM   405  O O   . SER A 1 53  ? 69.080  -6.748 21.981 1.00 56.77 ? 53   SER A O   1 
ATOM   406  C CB  . SER A 1 53  ? 65.924  -8.028 22.259 1.00 55.72 ? 53   SER A CB  1 
ATOM   407  O OG  . SER A 1 53  ? 64.897  -8.507 23.099 1.00 55.67 ? 53   SER A OG  1 
ATOM   408  N N   . THR A 1 54  ? 67.253  -5.857 20.997 1.00 56.02 ? 54   THR A N   1 
ATOM   409  C CA  . THR A 1 54  ? 67.972  -5.240 19.906 1.00 55.76 ? 54   THR A CA  1 
ATOM   410  C C   . THR A 1 54  ? 68.432  -3.882 20.219 1.00 55.34 ? 54   THR A C   1 
ATOM   411  O O   . THR A 1 54  ? 68.517  -3.103 19.304 1.00 55.20 ? 54   THR A O   1 
ATOM   412  C CB  . THR A 1 54  ? 67.072  -5.074 18.665 1.00 56.20 ? 54   THR A CB  1 
ATOM   413  O OG1 . THR A 1 54  ? 65.747  -4.599 19.034 1.00 55.81 ? 54   THR A OG1 1 
ATOM   414  C CG2 . THR A 1 54  ? 66.950  -6.453 17.895 1.00 56.40 ? 54   THR A CG2 1 
ATOM   415  N N   . LYS A 1 55  ? 68.699  -3.566 21.481 1.00 55.48 ? 55   LYS A N   1 
ATOM   416  C CA  . LYS A 1 55  ? 69.082  -2.195 21.837 1.00 55.75 ? 55   LYS A CA  1 
ATOM   417  C C   . LYS A 1 55  ? 70.363  -2.044 22.650 1.00 55.81 ? 55   LYS A C   1 
ATOM   418  O O   . LYS A 1 55  ? 70.747  -2.922 23.424 1.00 56.22 ? 55   LYS A O   1 
ATOM   419  C CB  . LYS A 1 55  ? 67.924  -1.478 22.532 1.00 55.67 ? 55   LYS A CB  1 
ATOM   420  C CG  . LYS A 1 55  ? 67.767  -0.036 22.029 1.00 55.90 ? 55   LYS A CG  1 
ATOM   421  C CD  . LYS A 1 55  ? 66.324  0.303  21.538 1.00 55.87 ? 55   LYS A CD  1 
ATOM   422  C CE  . LYS A 1 55  ? 65.791  -0.500 20.338 1.00 55.10 ? 55   LYS A CE  1 
ATOM   423  N NZ  . LYS A 1 55  ? 66.510  -0.282 19.045 1.00 55.22 ? 55   LYS A NZ  1 
ATOM   424  N N   . HIS A 1 56  ? 71.046  -0.927 22.441 1.00 55.74 ? 56   HIS A N   1 
ATOM   425  C CA  . HIS A 1 56  ? 72.252  -0.641 23.214 1.00 55.71 ? 56   HIS A CA  1 
ATOM   426  C C   . HIS A 1 56  ? 71.846  -0.503 24.663 1.00 55.95 ? 56   HIS A C   1 
ATOM   427  O O   . HIS A 1 56  ? 71.006  0.326  24.972 1.00 56.31 ? 56   HIS A O   1 
ATOM   428  C CB  . HIS A 1 56  ? 72.899  0.668  22.797 1.00 55.40 ? 56   HIS A CB  1 
ATOM   429  C CG  . HIS A 1 56  ? 73.549  0.610  21.466 1.00 55.47 ? 56   HIS A CG  1 
ATOM   430  N ND1 . HIS A 1 56  ? 74.821  0.120  21.291 1.00 55.90 ? 56   HIS A ND1 1 
ATOM   431  C CD2 . HIS A 1 56  ? 73.101  0.942  20.234 1.00 56.03 ? 56   HIS A CD2 1 
ATOM   432  C CE1 . HIS A 1 56  ? 75.141  0.167  20.010 1.00 55.56 ? 56   HIS A CE1 1 
ATOM   433  N NE2 . HIS A 1 56  ? 74.112  0.663  19.347 1.00 56.11 ? 56   HIS A NE2 1 
ATOM   434  N N   . LEU A 1 57  ? 72.456  -1.289 25.544 1.00 55.76 ? 57   LEU A N   1 
ATOM   435  C CA  . LEU A 1 57  ? 72.160  -1.256 26.957 1.00 55.40 ? 57   LEU A CA  1 
ATOM   436  C C   . LEU A 1 57  ? 73.339  -0.682 27.808 1.00 55.43 ? 57   LEU A C   1 
ATOM   437  O O   . LEU A 1 57  ? 74.530  -0.850 27.490 1.00 55.27 ? 57   LEU A O   1 
ATOM   438  C CB  . LEU A 1 57  ? 71.757  -2.674 27.377 1.00 55.37 ? 57   LEU A CB  1 
ATOM   439  C CG  . LEU A 1 57  ? 70.518  -3.247 26.659 1.00 55.53 ? 57   LEU A CG  1 
ATOM   440  C CD1 . LEU A 1 57  ? 70.171  -4.696 26.975 1.00 55.79 ? 57   LEU A CD1 1 
ATOM   441  C CD2 . LEU A 1 57  ? 69.316  -2.416 27.053 1.00 56.78 ? 57   LEU A CD2 1 
ATOM   442  N N   . TYR A 1 58  ? 73.007  0.016  28.889 1.00 55.49 ? 58   TYR A N   1 
ATOM   443  C CA  . TYR A 1 58  ? 74.028  0.619  29.747 1.00 55.62 ? 58   TYR A CA  1 
ATOM   444  C C   . TYR A 1 58  ? 74.391  -0.243 30.912 1.00 56.05 ? 58   TYR A C   1 
ATOM   445  O O   . TYR A 1 58  ? 73.497  -0.698 31.651 1.00 56.88 ? 58   TYR A O   1 
ATOM   446  C CB  . TYR A 1 58  ? 73.528  1.920  30.335 1.00 55.45 ? 58   TYR A CB  1 
ATOM   447  C CG  . TYR A 1 58  ? 74.389  2.448  31.483 1.00 55.36 ? 58   TYR A CG  1 
ATOM   448  C CD1 . TYR A 1 58  ? 74.070  2.207  32.806 1.00 55.03 ? 58   TYR A CD1 1 
ATOM   449  C CD2 . TYR A 1 58  ? 75.521  3.203  31.230 1.00 55.92 ? 58   TYR A CD2 1 
ATOM   450  C CE1 . TYR A 1 58  ? 74.850  2.717  33.853 1.00 55.52 ? 58   TYR A CE1 1 
ATOM   451  C CE2 . TYR A 1 58  ? 76.318  3.720  32.283 1.00 55.99 ? 58   TYR A CE2 1 
ATOM   452  C CZ  . TYR A 1 58  ? 75.983  3.481  33.590 1.00 55.65 ? 58   TYR A CZ  1 
ATOM   453  O OH  . TYR A 1 58  ? 76.793  4.010  34.597 1.00 54.45 ? 58   TYR A OH  1 
ATOM   454  N N   . ASP A 1 59  ? 75.691  -0.424 31.137 1.00 56.16 ? 59   ASP A N   1 
ATOM   455  C CA  . ASP A 1 59  ? 76.170  -1.290 32.249 1.00 56.24 ? 59   ASP A CA  1 
ATOM   456  C C   . ASP A 1 59  ? 77.228  -0.625 33.056 1.00 56.32 ? 59   ASP A C   1 
ATOM   457  O O   . ASP A 1 59  ? 78.198  -0.124 32.492 1.00 56.57 ? 59   ASP A O   1 
ATOM   458  C CB  . ASP A 1 59  ? 76.705  -2.617 31.720 1.00 56.29 ? 59   ASP A CB  1 
ATOM   459  C CG  . ASP A 1 59  ? 77.667  -3.288 32.647 1.00 55.45 ? 59   ASP A CG  1 
ATOM   460  O OD1 . ASP A 1 59  ? 77.993  -4.467 32.394 1.00 54.89 ? 59   ASP A OD1 1 
ATOM   461  O OD2 . ASP A 1 59  ? 78.135  -2.725 33.644 1.00 54.49 ? 59   ASP A OD2 1 
ATOM   462  N N   . SER A 1 60  ? 77.068  -0.735 34.376 1.00 56.21 ? 60   SER A N   1 
ATOM   463  C CA  . SER A 1 60  ? 77.511  0.273  35.323 1.00 56.10 ? 60   SER A CA  1 
ATOM   464  C C   . SER A 1 60  ? 78.799  -0.090 35.983 1.00 55.93 ? 60   SER A C   1 
ATOM   465  O O   . SER A 1 60  ? 79.667  0.770  36.136 1.00 56.10 ? 60   SER A O   1 
ATOM   466  C CB  . SER A 1 60  ? 76.451  0.414  36.401 1.00 56.26 ? 60   SER A CB  1 
ATOM   467  O OG  . SER A 1 60  ? 75.279  -0.349 36.041 1.00 56.70 ? 60   SER A OG  1 
ATOM   468  N N   . SER A 1 61  ? 78.916  -1.350 36.396 1.00 55.77 ? 61   SER A N   1 
ATOM   469  C CA  . SER A 1 61  ? 80.195  -1.860 36.849 1.00 55.84 ? 61   SER A CA  1 
ATOM   470  C C   . SER A 1 61  ? 81.253  -1.168 35.993 1.00 56.04 ? 61   SER A C   1 
ATOM   471  O O   . SER A 1 61  ? 82.082  -0.403 36.499 1.00 56.49 ? 61   SER A O   1 
ATOM   472  C CB  . SER A 1 61  ? 80.284  -3.347 36.627 1.00 55.62 ? 61   SER A CB  1 
ATOM   473  O OG  . SER A 1 61  ? 79.829  -3.638 35.344 1.00 57.00 ? 61   SER A OG  1 
ATOM   474  N N   . LYS A 1 62  ? 81.149  -1.344 34.681 1.00 55.75 ? 62   LYS A N   1 
ATOM   475  C CA  . LYS A 1 62  ? 82.218  -0.972 33.755 1.00 55.64 ? 62   LYS A CA  1 
ATOM   476  C C   . LYS A 1 62  ? 82.850  0.364  34.001 1.00 55.54 ? 62   LYS A C   1 
ATOM   477  O O   . LYS A 1 62  ? 84.022  0.568  33.701 1.00 55.70 ? 62   LYS A O   1 
ATOM   478  C CB  . LYS A 1 62  ? 81.711  -0.999 32.335 1.00 55.80 ? 62   LYS A CB  1 
ATOM   479  C CG  . LYS A 1 62  ? 80.897  -2.228 32.002 1.00 56.13 ? 62   LYS A CG  1 
ATOM   480  C CD  . LYS A 1 62  ? 81.306  -3.445 32.833 1.00 56.49 ? 62   LYS A CD  1 
ATOM   481  C CE  . LYS A 1 62  ? 82.065  -4.474 32.065 1.00 55.74 ? 62   LYS A CE  1 
ATOM   482  N NZ  . LYS A 1 62  ? 81.150  -5.079 31.064 1.00 55.78 ? 62   LYS A NZ  1 
ATOM   483  N N   . SER A 1 63  ? 82.089  1.287  34.536 1.00 55.53 ? 63   SER A N   1 
ATOM   484  C CA  . SER A 1 63  ? 82.682  2.538  34.883 1.00 55.81 ? 63   SER A CA  1 
ATOM   485  C C   . SER A 1 63  ? 82.986  2.614  36.371 1.00 55.78 ? 63   SER A C   1 
ATOM   486  O O   . SER A 1 63  ? 82.557  1.793  37.207 1.00 55.38 ? 63   SER A O   1 
ATOM   487  C CB  . SER A 1 63  ? 81.787  3.695  34.439 1.00 55.85 ? 63   SER A CB  1 
ATOM   488  O OG  . SER A 1 63  ? 81.986  4.827  35.271 1.00 56.58 ? 63   SER A OG  1 
ATOM   489  N N   . LYS A 1 64  ? 83.759  3.625  36.689 1.00 55.58 ? 64   LYS A N   1 
ATOM   490  C CA  . LYS A 1 64  ? 83.972  3.947  38.051 1.00 55.50 ? 64   LYS A CA  1 
ATOM   491  C C   . LYS A 1 64  ? 84.026  5.424  38.044 1.00 55.10 ? 64   LYS A C   1 
ATOM   492  O O   . LYS A 1 64  ? 85.066  6.045  37.897 1.00 54.81 ? 64   LYS A O   1 
ATOM   493  C CB  . LYS A 1 64  ? 85.226  3.289  38.579 1.00 55.71 ? 64   LYS A CB  1 
ATOM   494  C CG  . LYS A 1 64  ? 86.438  3.408  37.677 1.00 55.91 ? 64   LYS A CG  1 
ATOM   495  C CD  . LYS A 1 64  ? 87.526  2.420  38.103 1.00 55.97 ? 64   LYS A CD  1 
ATOM   496  C CE  . LYS A 1 64  ? 87.204  0.936  37.683 1.00 56.53 ? 64   LYS A CE  1 
ATOM   497  N NZ  . LYS A 1 64  ? 87.204  0.614  36.196 1.00 55.87 ? 64   LYS A NZ  1 
ATOM   498  N N   . SER A 1 65  ? 82.810  5.941  37.973 1.00 55.07 ? 65   SER A N   1 
ATOM   499  C CA  . SER A 1 65  ? 82.455  7.307  38.249 1.00 55.50 ? 65   SER A CA  1 
ATOM   500  C C   . SER A 1 65  ? 80.949  7.208  38.375 1.00 55.44 ? 65   SER A C   1 
ATOM   501  O O   . SER A 1 65  ? 80.294  8.087  38.917 1.00 55.34 ? 65   SER A O   1 
ATOM   502  C CB  . SER A 1 65  ? 82.798  8.178  37.051 1.00 55.69 ? 65   SER A CB  1 
ATOM   503  O OG  . SER A 1 65  ? 82.436  9.521  37.293 1.00 56.12 ? 65   SER A OG  1 
ATOM   504  N N   . TYR A 1 66  ? 80.409  6.112  37.860 1.00 55.01 ? 66   TYR A N   1 
ATOM   505  C CA  . TYR A 1 66  ? 79.183  5.551  38.387 1.00 55.15 ? 66   TYR A CA  1 
ATOM   506  C C   . TYR A 1 66  ? 79.057  5.778  39.871 1.00 55.31 ? 66   TYR A C   1 
ATOM   507  O O   . TYR A 1 66  ? 79.656  5.067  40.663 1.00 55.00 ? 66   TYR A O   1 
ATOM   508  C CB  . TYR A 1 66  ? 79.097  4.061  38.105 1.00 55.18 ? 66   TYR A CB  1 
ATOM   509  C CG  . TYR A 1 66  ? 77.830  3.439  38.622 1.00 55.54 ? 66   TYR A CG  1 
ATOM   510  C CD1 . TYR A 1 66  ? 76.699  4.203  38.823 1.00 56.91 ? 66   TYR A CD1 1 
ATOM   511  C CD2 . TYR A 1 66  ? 77.756  2.093  38.907 1.00 55.45 ? 66   TYR A CD2 1 
ATOM   512  C CE1 . TYR A 1 66  ? 75.537  3.646  39.299 1.00 55.94 ? 66   TYR A CE1 1 
ATOM   513  C CE2 . TYR A 1 66  ? 76.591  1.532  39.381 1.00 55.43 ? 66   TYR A CE2 1 
ATOM   514  C CZ  . TYR A 1 66  ? 75.491  2.314  39.576 1.00 54.77 ? 66   TYR A CZ  1 
ATOM   515  O OH  . TYR A 1 66  ? 74.330  1.772  40.045 1.00 54.96 ? 66   TYR A OH  1 
ATOM   516  N N   . GLU A 1 67  ? 78.251  6.760  40.245 1.00 55.67 ? 67   GLU A N   1 
ATOM   517  C CA  . GLU A 1 67  ? 77.740  6.849  41.617 1.00 55.66 ? 67   GLU A CA  1 
ATOM   518  C C   . GLU A 1 67  ? 76.331  6.157  41.689 1.00 55.53 ? 67   GLU A C   1 
ATOM   519  O O   . GLU A 1 67  ? 75.503  6.331  40.784 1.00 55.37 ? 67   GLU A O   1 
ATOM   520  C CB  . GLU A 1 67  ? 77.663  8.350  41.991 1.00 55.80 ? 67   GLU A CB  1 
ATOM   521  C CG  . GLU A 1 67  ? 77.395  8.688  43.457 1.00 55.71 ? 67   GLU A CG  1 
ATOM   522  C CD  . GLU A 1 67  ? 77.294  10.189 43.669 1.00 55.60 ? 67   GLU A CD  1 
ATOM   523  O OE1 . GLU A 1 67  ? 76.825  10.627 44.748 1.00 56.24 ? 67   GLU A OE1 1 
ATOM   524  O OE2 . GLU A 1 67  ? 77.671  10.938 42.744 1.00 55.31 ? 67   GLU A OE2 1 
ATOM   525  N N   . LYS A 1 68  ? 76.060  5.395  42.748 1.00 55.40 ? 68   LYS A N   1 
ATOM   526  C CA  . LYS A 1 68  ? 74.772  4.666  42.882 1.00 55.49 ? 68   LYS A CA  1 
ATOM   527  C C   . LYS A 1 68  ? 73.562  5.441  43.518 1.00 55.54 ? 68   LYS A C   1 
ATOM   528  O O   . LYS A 1 68  ? 73.696  6.323  44.395 1.00 55.40 ? 68   LYS A O   1 
ATOM   529  C CB  . LYS A 1 68  ? 74.979  3.351  43.634 1.00 55.54 ? 68   LYS A CB  1 
ATOM   530  C CG  . LYS A 1 68  ? 73.785  2.442  43.628 1.00 55.32 ? 68   LYS A CG  1 
ATOM   531  C CD  . LYS A 1 68  ? 73.987  1.220  44.511 1.00 55.30 ? 68   LYS A CD  1 
ATOM   532  C CE  . LYS A 1 68  ? 73.822  1.586  45.973 1.00 55.52 ? 68   LYS A CE  1 
ATOM   533  N NZ  . LYS A 1 68  ? 73.890  0.456  46.919 1.00 55.07 ? 68   LYS A NZ  1 
ATOM   534  N N   . ASP A 1 69  ? 72.376  5.095  43.014 1.00 55.31 ? 69   ASP A N   1 
ATOM   535  C CA  . ASP A 1 69  ? 71.143  5.706  43.435 1.00 55.12 ? 69   ASP A CA  1 
ATOM   536  C C   . ASP A 1 69  ? 70.117  4.635  43.595 1.00 54.55 ? 69   ASP A C   1 
ATOM   537  O O   . ASP A 1 69  ? 69.764  4.291  44.681 1.00 54.24 ? 69   ASP A O   1 
ATOM   538  C CB  . ASP A 1 69  ? 70.661  6.760  42.444 1.00 54.86 ? 69   ASP A CB  1 
ATOM   539  C CG  . ASP A 1 69  ? 69.492  7.532  42.965 1.00 54.65 ? 69   ASP A CG  1 
ATOM   540  O OD1 . ASP A 1 69  ? 68.848  7.054  43.903 1.00 54.28 ? 69   ASP A OD1 1 
ATOM   541  O OD2 . ASP A 1 69  ? 69.160  8.643  42.518 1.00 53.61 ? 69   ASP A OD2 1 
ATOM   542  N N   . GLY A 1 70  ? 69.594  4.120  42.516 1.00 54.49 ? 70   GLY A N   1 
ATOM   543  C CA  . GLY A 1 70  ? 68.637  3.034  42.644 1.00 54.78 ? 70   GLY A CA  1 
ATOM   544  C C   . GLY A 1 70  ? 67.215  3.426  43.044 1.00 54.83 ? 70   GLY A C   1 
ATOM   545  O O   . GLY A 1 70  ? 66.285  2.606  42.987 1.00 54.44 ? 70   GLY A O   1 
ATOM   546  N N   . THR A 1 71  ? 67.035  4.677  43.459 1.00 55.07 ? 71   THR A N   1 
ATOM   547  C CA  . THR A 1 71  ? 65.710  5.214  43.732 1.00 54.85 ? 71   THR A CA  1 
ATOM   548  C C   . THR A 1 71  ? 64.906  4.816  42.520 1.00 54.96 ? 71   THR A C   1 
ATOM   549  O O   . THR A 1 71  ? 65.319  5.107  41.402 1.00 55.65 ? 71   THR A O   1 
ATOM   550  C CB  . THR A 1 71  ? 65.815  6.767  43.931 1.00 54.75 ? 71   THR A CB  1 
ATOM   551  O OG1 . THR A 1 71  ? 65.736  7.093  45.310 1.00 54.08 ? 71   THR A OG1 1 
ATOM   552  C CG2 . THR A 1 71  ? 64.665  7.503  43.370 1.00 55.28 ? 71   THR A CG2 1 
ATOM   553  N N   . LYS A 1 72  ? 63.789  4.137  42.712 1.00 54.79 ? 72   LYS A N   1 
ATOM   554  C CA  . LYS A 1 72  ? 63.005  3.644  41.581 1.00 54.83 ? 72   LYS A CA  1 
ATOM   555  C C   . LYS A 1 72  ? 62.131  4.776  41.124 1.00 54.57 ? 72   LYS A C   1 
ATOM   556  O O   . LYS A 1 72  ? 61.731  5.608  41.943 1.00 53.73 ? 72   LYS A O   1 
ATOM   557  C CB  . LYS A 1 72  ? 62.135  2.446  41.972 1.00 55.02 ? 72   LYS A CB  1 
ATOM   558  C CG  . LYS A 1 72  ? 62.893  1.291  42.732 1.00 56.16 ? 72   LYS A CG  1 
ATOM   559  C CD  . LYS A 1 72  ? 63.087  1.544  44.329 1.00 56.80 ? 72   LYS A CD  1 
ATOM   560  C CE  . LYS A 1 72  ? 64.198  0.690  45.051 1.00 55.91 ? 72   LYS A CE  1 
ATOM   561  N NZ  . LYS A 1 72  ? 63.973  -0.790 45.124 1.00 56.02 ? 72   LYS A NZ  1 
ATOM   562  N N   . VAL A 1 73  ? 61.846  4.824  39.822 1.00 54.85 ? 73   VAL A N   1 
ATOM   563  C CA  . VAL A 1 73  ? 61.027  5.898  39.245 1.00 55.06 ? 73   VAL A CA  1 
ATOM   564  C C   . VAL A 1 73  ? 60.595  5.707  37.768 1.00 54.80 ? 73   VAL A C   1 
ATOM   565  O O   . VAL A 1 73  ? 61.239  5.011  37.019 1.00 54.43 ? 73   VAL A O   1 
ATOM   566  C CB  . VAL A 1 73  ? 61.800  7.225  39.347 1.00 55.30 ? 73   VAL A CB  1 
ATOM   567  C CG1 . VAL A 1 73  ? 62.573  7.491  38.035 1.00 55.30 ? 73   VAL A CG1 1 
ATOM   568  C CG2 . VAL A 1 73  ? 60.849  8.392  39.759 1.00 55.56 ? 73   VAL A CG2 1 
ATOM   569  N N   . GLU A 1 74  ? 59.532  6.386  37.351 1.00 55.08 ? 74   GLU A N   1 
ATOM   570  C CA  . GLU A 1 74  ? 59.007  6.271  35.977 1.00 55.22 ? 74   GLU A CA  1 
ATOM   571  C C   . GLU A 1 74  ? 58.515  7.551  35.314 1.00 54.93 ? 74   GLU A C   1 
ATOM   572  O O   . GLU A 1 74  ? 58.121  8.531  35.951 1.00 54.58 ? 74   GLU A O   1 
ATOM   573  C CB  . GLU A 1 74  ? 57.853  5.248  35.900 1.00 55.36 ? 74   GLU A CB  1 
ATOM   574  C CG  . GLU A 1 74  ? 56.927  5.269  37.095 1.00 55.98 ? 74   GLU A CG  1 
ATOM   575  C CD  . GLU A 1 74  ? 55.501  4.920  36.759 1.00 55.37 ? 74   GLU A CD  1 
ATOM   576  O OE1 . GLU A 1 74  ? 54.757  5.863  36.350 1.00 54.02 ? 74   GLU A OE1 1 
ATOM   577  O OE2 . GLU A 1 74  ? 55.142  3.731  36.957 1.00 55.30 ? 74   GLU A OE2 1 
ATOM   578  N N   . ILE A 1 75  ? 58.488  7.468  33.997 1.00 54.86 ? 75   ILE A N   1 
ATOM   579  C CA  . ILE A 1 75  ? 58.055  8.535  33.144 1.00 55.11 ? 75   ILE A CA  1 
ATOM   580  C C   . ILE A 1 75  ? 56.977  8.075  32.208 1.00 54.98 ? 75   ILE A C   1 
ATOM   581  O O   . ILE A 1 75  ? 57.121  7.048  31.595 1.00 55.12 ? 75   ILE A O   1 
ATOM   582  C CB  . ILE A 1 75  ? 59.176  8.997  32.244 1.00 55.36 ? 75   ILE A CB  1 
ATOM   583  C CG1 . ILE A 1 75  ? 60.450  9.316  33.031 1.00 55.54 ? 75   ILE A CG1 1 
ATOM   584  C CG2 . ILE A 1 75  ? 58.711  10.222 31.498 1.00 56.13 ? 75   ILE A CG2 1 
ATOM   585  C CD1 . ILE A 1 75  ? 61.593  9.894  32.195 1.00 55.28 ? 75   ILE A CD1 1 
ATOM   586  N N   . THR A 1 76  ? 55.946  8.899  32.045 1.00 55.17 ? 76   THR A N   1 
ATOM   587  C CA  . THR A 1 76  ? 54.808  8.611  31.175 1.00 55.06 ? 76   THR A CA  1 
ATOM   588  C C   . THR A 1 76  ? 54.757  9.605  30.036 1.00 55.12 ? 76   THR A C   1 
ATOM   589  O O   . THR A 1 76  ? 54.037  10.621 30.123 1.00 55.13 ? 76   THR A O   1 
ATOM   590  C CB  . THR A 1 76  ? 53.498  8.718  31.939 1.00 54.74 ? 76   THR A CB  1 
ATOM   591  O OG1 . THR A 1 76  ? 53.510  7.820  33.040 1.00 54.71 ? 76   THR A OG1 1 
ATOM   592  C CG2 . THR A 1 76  ? 52.346  8.246  31.088 1.00 54.94 ? 76   THR A CG2 1 
ATOM   593  N N   . TYR A 1 77  ? 55.497  9.299  28.969 1.00 54.96 ? 77   TYR A N   1 
ATOM   594  C CA  . TYR A 1 77  ? 55.487  10.116 27.782 1.00 55.06 ? 77   TYR A CA  1 
ATOM   595  C C   . TYR A 1 77  ? 54.157  10.040 27.085 1.00 55.02 ? 77   TYR A C   1 
ATOM   596  O O   . TYR A 1 77  ? 53.309  9.234  27.431 1.00 54.79 ? 77   TYR A O   1 
ATOM   597  C CB  . TYR A 1 77  ? 56.576  9.684  26.816 1.00 55.17 ? 77   TYR A CB  1 
ATOM   598  C CG  . TYR A 1 77  ? 57.983  9.862  27.355 1.00 55.60 ? 77   TYR A CG  1 
ATOM   599  C CD1 . TYR A 1 77  ? 58.608  8.830  28.045 1.00 56.11 ? 77   TYR A CD1 1 
ATOM   600  C CD2 . TYR A 1 77  ? 58.708  11.043 27.156 1.00 53.97 ? 77   TYR A CD2 1 
ATOM   601  C CE1 . TYR A 1 77  ? 59.913  8.971  28.521 1.00 54.90 ? 77   TYR A CE1 1 
ATOM   602  C CE2 . TYR A 1 77  ? 59.969  11.175 27.652 1.00 53.78 ? 77   TYR A CE2 1 
ATOM   603  C CZ  . TYR A 1 77  ? 60.559  10.134 28.317 1.00 53.82 ? 77   TYR A CZ  1 
ATOM   604  O OH  . TYR A 1 77  ? 61.807  10.244 28.789 1.00 55.07 ? 77   TYR A OH  1 
ATOM   605  N N   . GLY A 1 78  ? 53.983  10.895 26.093 1.00 55.22 ? 78   GLY A N   1 
ATOM   606  C CA  . GLY A 1 78  ? 52.768  10.898 25.315 1.00 55.60 ? 78   GLY A CA  1 
ATOM   607  C C   . GLY A 1 78  ? 52.428  9.538  24.732 1.00 55.73 ? 78   GLY A C   1 
ATOM   608  O O   . GLY A 1 78  ? 51.261  9.088  24.813 1.00 55.92 ? 78   GLY A O   1 
ATOM   609  N N   . SER A 1 79  ? 53.441  8.862  24.174 1.00 55.91 ? 79   SER A N   1 
ATOM   610  C CA  . SER A 1 79  ? 53.227  7.525  23.565 1.00 55.80 ? 79   SER A CA  1 
ATOM   611  C C   . SER A 1 79  ? 53.802  6.341  24.315 1.00 55.56 ? 79   SER A C   1 
ATOM   612  O O   . SER A 1 79  ? 54.241  5.380  23.706 1.00 55.17 ? 79   SER A O   1 
ATOM   613  C CB  . SER A 1 79  ? 53.710  7.493  22.128 1.00 56.00 ? 79   SER A CB  1 
ATOM   614  O OG  . SER A 1 79  ? 52.734  8.102  21.283 1.00 56.97 ? 79   SER A OG  1 
ATOM   615  N N   . GLY A 1 80  ? 53.746  6.406  25.641 1.00 55.74 ? 80   GLY A N   1 
ATOM   616  C CA  . GLY A 1 80  ? 54.075  5.259  26.491 1.00 55.81 ? 80   GLY A CA  1 
ATOM   617  C C   . GLY A 1 80  ? 54.545  5.595  27.909 1.00 55.88 ? 80   GLY A C   1 
ATOM   618  O O   . GLY A 1 80  ? 54.387  6.732  28.369 1.00 56.56 ? 80   GLY A O   1 
ATOM   619  N N   . THR A 1 81  ? 55.085  4.601  28.610 1.00 55.47 ? 81   THR A N   1 
ATOM   620  C CA  . THR A 1 81  ? 55.596  4.787  29.953 1.00 55.15 ? 81   THR A CA  1 
ATOM   621  C C   . THR A 1 81  ? 56.773  3.875  30.166 1.00 55.37 ? 81   THR A C   1 
ATOM   622  O O   . THR A 1 81  ? 56.761  2.729  29.703 1.00 56.03 ? 81   THR A O   1 
ATOM   623  C CB  . THR A 1 81  ? 54.519  4.473  30.969 1.00 54.93 ? 81   THR A CB  1 
ATOM   624  O OG1 . THR A 1 81  ? 53.813  5.672  31.279 1.00 54.89 ? 81   THR A OG1 1 
ATOM   625  C CG2 . THR A 1 81  ? 55.105  4.060  32.305 1.00 55.00 ? 81   THR A CG2 1 
ATOM   626  N N   . VAL A 1 82  ? 57.763  4.369  30.906 1.00 55.26 ? 82   VAL A N   1 
ATOM   627  C CA  . VAL A 1 82  ? 58.982  3.619  31.221 1.00 55.11 ? 82   VAL A CA  1 
ATOM   628  C C   . VAL A 1 82  ? 59.281  3.494  32.743 1.00 55.19 ? 82   VAL A C   1 
ATOM   629  O O   . VAL A 1 82  ? 58.818  4.286  33.554 1.00 55.06 ? 82   VAL A O   1 
ATOM   630  C CB  . VAL A 1 82  ? 60.154  4.220  30.507 1.00 54.81 ? 82   VAL A CB  1 
ATOM   631  C CG1 . VAL A 1 82  ? 60.051  3.911  29.049 1.00 54.79 ? 82   VAL A CG1 1 
ATOM   632  C CG2 . VAL A 1 82  ? 60.195  5.697  30.733 1.00 54.97 ? 82   VAL A CG2 1 
ATOM   633  N N   . ARG A 1 83  ? 60.037  2.454  33.137 1.00 55.00 ? 83   ARG A N   1 
ATOM   634  C CA  . ARG A 1 83  ? 60.322  2.177  34.540 1.00 55.20 ? 83   ARG A CA  1 
ATOM   635  C C   . ARG A 1 83  ? 61.781  1.781  34.738 1.00 55.18 ? 83   ARG A C   1 
ATOM   636  O O   . ARG A 1 83  ? 62.428  1.175  33.878 1.00 55.02 ? 83   ARG A O   1 
ATOM   637  C CB  . ARG A 1 83  ? 59.402  1.074  35.066 1.00 55.39 ? 83   ARG A CB  1 
ATOM   638  C CG  . ARG A 1 83  ? 57.939  1.476  35.156 1.00 55.42 ? 83   ARG A CG  1 
ATOM   639  C CD  . ARG A 1 83  ? 57.021  0.374  35.656 1.00 55.54 ? 83   ARG A CD  1 
ATOM   640  N NE  . ARG A 1 83  ? 55.625  0.802  35.703 1.00 54.32 ? 83   ARG A NE  1 
ATOM   641  C CZ  . ARG A 1 83  ? 54.614  0.012  36.035 1.00 56.43 ? 83   ARG A CZ  1 
ATOM   642  N NH1 . ARG A 1 83  ? 54.838  -1.256 36.356 1.00 55.67 ? 83   ARG A NH1 1 
ATOM   643  N NH2 . ARG A 1 83  ? 53.376  0.486  36.051 1.00 54.33 ? 83   ARG A NH2 1 
ATOM   644  N N   . GLY A 1 84  ? 62.344  2.082  35.915 1.00 54.57 ? 84   GLY A N   1 
ATOM   645  C CA  . GLY A 1 84  ? 63.741  1.844  36.138 1.00 54.70 ? 84   GLY A CA  1 
ATOM   646  C C   . GLY A 1 84  ? 64.167  2.520  37.400 1.00 54.65 ? 84   GLY A C   1 
ATOM   647  O O   . GLY A 1 84  ? 63.483  2.450  38.396 1.00 54.95 ? 84   GLY A O   1 
ATOM   648  N N   . PHE A 1 85  ? 65.304  3.185  37.368 1.00 54.83 ? 85   PHE A N   1 
ATOM   649  C CA  . PHE A 1 85  ? 65.814  3.843  38.574 1.00 55.09 ? 85   PHE A CA  1 
ATOM   650  C C   . PHE A 1 85  ? 66.977  4.819  38.370 1.00 55.02 ? 85   PHE A C   1 
ATOM   651  O O   . PHE A 1 85  ? 67.938  4.584  37.604 1.00 54.03 ? 85   PHE A O   1 
ATOM   652  C CB  . PHE A 1 85  ? 66.274  2.802  39.559 1.00 55.10 ? 85   PHE A CB  1 
ATOM   653  C CG  . PHE A 1 85  ? 67.111  1.783  38.943 1.00 54.69 ? 85   PHE A CG  1 
ATOM   654  C CD1 . PHE A 1 85  ? 66.559  0.863  38.109 1.00 54.99 ? 85   PHE A CD1 1 
ATOM   655  C CD2 . PHE A 1 85  ? 68.461  1.774  39.145 1.00 54.69 ? 85   PHE A CD2 1 
ATOM   656  C CE1 . PHE A 1 85  ? 67.318  -0.071 37.506 1.00 55.13 ? 85   PHE A CE1 1 
ATOM   657  C CE2 . PHE A 1 85  ? 69.242  0.826  38.536 1.00 54.84 ? 85   PHE A CE2 1 
ATOM   658  C CZ  . PHE A 1 85  ? 68.666  -0.100 37.704 1.00 54.91 ? 85   PHE A CZ  1 
ATOM   659  N N   . PHE A 1 86  ? 66.893  5.906  39.116 1.00 54.99 ? 86   PHE A N   1 
ATOM   660  C CA  . PHE A 1 86  ? 67.869  6.906  38.954 1.00 55.45 ? 86   PHE A CA  1 
ATOM   661  C C   . PHE A 1 86  ? 69.247  6.305  39.215 1.00 55.91 ? 86   PHE A C   1 
ATOM   662  O O   . PHE A 1 86  ? 69.405  5.415  40.080 1.00 56.25 ? 86   PHE A O   1 
ATOM   663  C CB  . PHE A 1 86  ? 67.638  8.039  39.908 1.00 55.33 ? 86   PHE A CB  1 
ATOM   664  C CG  . PHE A 1 86  ? 66.653  8.989  39.443 1.00 54.90 ? 86   PHE A CG  1 
ATOM   665  C CD1 . PHE A 1 86  ? 65.508  9.158  40.126 1.00 55.24 ? 86   PHE A CD1 1 
ATOM   666  C CD2 . PHE A 1 86  ? 66.877  9.744  38.317 1.00 55.21 ? 86   PHE A CD2 1 
ATOM   667  C CE1 . PHE A 1 86  ? 64.590  10.088 39.712 1.00 55.61 ? 86   PHE A CE1 1 
ATOM   668  C CE2 . PHE A 1 86  ? 65.933  10.675 37.877 1.00 55.22 ? 86   PHE A CE2 1 
ATOM   669  C CZ  . PHE A 1 86  ? 64.798  10.846 38.579 1.00 54.85 ? 86   PHE A CZ  1 
ATOM   670  N N   . SER A 1 87  ? 70.219  6.815  38.454 1.00 55.72 ? 87   SER A N   1 
ATOM   671  C CA  . SER A 1 87  ? 71.612  6.521  38.640 1.00 55.39 ? 87   SER A CA  1 
ATOM   672  C C   . SER A 1 87  ? 72.242  7.842  38.351 1.00 55.55 ? 87   SER A C   1 
ATOM   673  O O   . SER A 1 87  ? 71.588  8.710  37.773 1.00 55.95 ? 87   SER A O   1 
ATOM   674  C CB  . SER A 1 87  ? 72.083  5.499  37.620 1.00 55.24 ? 87   SER A CB  1 
ATOM   675  O OG  . SER A 1 87  ? 71.390  4.277  37.721 1.00 55.79 ? 87   SER A OG  1 
ATOM   676  N N   . LYS A 1 88  ? 73.492  8.016  38.761 1.00 55.71 ? 88   LYS A N   1 
ATOM   677  C CA  . LYS A 1 88  ? 74.248  9.215  38.429 1.00 55.59 ? 88   LYS A CA  1 
ATOM   678  C C   . LYS A 1 88  ? 75.618  8.718  37.936 1.00 55.72 ? 88   LYS A C   1 
ATOM   679  O O   . LYS A 1 88  ? 76.357  8.054  38.714 1.00 55.67 ? 88   LYS A O   1 
ATOM   680  C CB  . LYS A 1 88  ? 74.360  10.150 39.663 1.00 55.39 ? 88   LYS A CB  1 
ATOM   681  C CG  . LYS A 1 88  ? 75.145  11.497 39.414 1.00 56.12 ? 88   LYS A CG  1 
ATOM   682  C CD  . LYS A 1 88  ? 74.963  12.590 40.554 1.00 56.38 ? 88   LYS A CD  1 
ATOM   683  C CE  . LYS A 1 88  ? 75.818  13.889 40.341 1.00 55.67 ? 88   LYS A CE  1 
ATOM   684  N NZ  . LYS A 1 88  ? 77.239  13.720 40.831 1.00 55.78 ? 88   LYS A NZ  1 
ATOM   685  N N   . ASP A 1 89  ? 75.942  8.993  36.654 1.00 55.63 ? 89   ASP A N   1 
ATOM   686  C CA  . ASP A 1 89  ? 77.317  8.761  36.114 1.00 55.43 ? 89   ASP A CA  1 
ATOM   687  C C   . ASP A 1 89  ? 77.795  9.936  35.281 1.00 55.24 ? 89   ASP A C   1 
ATOM   688  O O   . ASP A 1 89  ? 77.298  11.043 35.425 1.00 55.48 ? 89   ASP A O   1 
ATOM   689  C CB  . ASP A 1 89  ? 77.385  7.468  35.289 1.00 55.67 ? 89   ASP A CB  1 
ATOM   690  C CG  . ASP A 1 89  ? 78.834  7.020  35.001 1.00 55.76 ? 89   ASP A CG  1 
ATOM   691  O OD1 . ASP A 1 89  ? 79.075  5.903  34.449 1.00 56.58 ? 89   ASP A OD1 1 
ATOM   692  O OD2 . ASP A 1 89  ? 79.798  7.747  35.298 1.00 54.66 ? 89   ASP A OD2 1 
ATOM   693  N N   . LEU A 1 90  ? 78.758  9.689  34.409 1.00 55.36 ? 90   LEU A N   1 
ATOM   694  C CA  . LEU A 1 90  ? 79.352  10.724 33.583 1.00 55.44 ? 90   LEU A CA  1 
ATOM   695  C C   . LEU A 1 90  ? 78.673  10.750 32.251 1.00 55.38 ? 90   LEU A C   1 
ATOM   696  O O   . LEU A 1 90  ? 78.680  9.751  31.525 1.00 55.30 ? 90   LEU A O   1 
ATOM   697  C CB  . LEU A 1 90  ? 80.806  10.393 33.352 1.00 55.72 ? 90   LEU A CB  1 
ATOM   698  C CG  . LEU A 1 90  ? 81.546  11.256 32.357 1.00 55.94 ? 90   LEU A CG  1 
ATOM   699  C CD1 . LEU A 1 90  ? 81.404  12.706 32.726 1.00 55.82 ? 90   LEU A CD1 1 
ATOM   700  C CD2 . LEU A 1 90  ? 83.031  10.852 32.314 1.00 55.97 ? 90   LEU A CD2 1 
ATOM   701  N N   . VAL A 1 91  ? 78.084  11.886 31.928 1.00 55.36 ? 91   VAL A N   1 
ATOM   702  C CA  . VAL A 1 91  ? 77.342  12.019 30.700 1.00 55.69 ? 91   VAL A CA  1 
ATOM   703  C C   . VAL A 1 91  ? 78.070  13.009 29.834 1.00 55.63 ? 91   VAL A C   1 
ATOM   704  O O   . VAL A 1 91  ? 78.380  14.104 30.272 1.00 55.45 ? 91   VAL A O   1 
ATOM   705  C CB  . VAL A 1 91  ? 75.941  12.540 30.962 1.00 55.63 ? 91   VAL A CB  1 
ATOM   706  C CG1 . VAL A 1 91  ? 75.423  13.251 29.761 1.00 55.03 ? 91   VAL A CG1 1 
ATOM   707  C CG2 . VAL A 1 91  ? 75.029  11.410 31.330 1.00 55.82 ? 91   VAL A CG2 1 
ATOM   708  N N   . THR A 1 92  ? 78.362  12.614 28.605 1.00 55.01 ? 92   THR A N   1 
ATOM   709  C CA  . THR A 1 92  ? 79.217  13.409 27.749 1.00 55.27 ? 92   THR A CA  1 
ATOM   710  C C   . THR A 1 92  ? 78.640  13.618 26.359 1.00 55.35 ? 92   THR A C   1 
ATOM   711  O O   . THR A 1 92  ? 78.063  12.715 25.772 1.00 55.06 ? 92   THR A O   1 
ATOM   712  C CB  . THR A 1 92  ? 80.627  12.821 27.688 1.00 55.45 ? 92   THR A CB  1 
ATOM   713  O OG1 . THR A 1 92  ? 81.027  12.680 26.326 1.00 55.78 ? 92   THR A OG1 1 
ATOM   714  C CG2 . THR A 1 92  ? 80.639  11.416 28.205 1.00 55.56 ? 92   THR A CG2 1 
ATOM   715  N N   . LEU A 1 93  ? 78.786  14.832 25.851 1.00 55.21 ? 93   LEU A N   1 
ATOM   716  C CA  . LEU A 1 93  ? 78.110  15.234 24.633 1.00 55.64 ? 93   LEU A CA  1 
ATOM   717  C C   . LEU A 1 93  ? 79.108  15.648 23.581 1.00 55.89 ? 93   LEU A C   1 
ATOM   718  O O   . LEU A 1 93  ? 79.141  16.789 23.130 1.00 55.36 ? 93   LEU A O   1 
ATOM   719  C CB  . LEU A 1 93  ? 77.117  16.345 24.909 1.00 55.53 ? 93   LEU A CB  1 
ATOM   720  C CG  . LEU A 1 93  ? 76.085  15.807 25.877 1.00 55.57 ? 93   LEU A CG  1 
ATOM   721  C CD1 . LEU A 1 93  ? 74.709  16.255 25.513 1.00 54.99 ? 93   LEU A CD1 1 
ATOM   722  C CD2 . LEU A 1 93  ? 76.201  14.317 25.817 1.00 55.98 ? 93   LEU A CD2 1 
ATOM   723  N N   . GLY A 1 94  ? 79.926  14.685 23.196 1.00 56.03 ? 94   GLY A N   1 
ATOM   724  C CA  . GLY A 1 94  ? 80.960  14.923 22.197 1.00 55.62 ? 94   GLY A CA  1 
ATOM   725  C C   . GLY A 1 94  ? 82.114  15.700 22.811 1.00 55.58 ? 94   GLY A C   1 
ATOM   726  O O   . GLY A 1 94  ? 82.928  15.109 23.539 1.00 55.15 ? 94   GLY A O   1 
ATOM   727  N N   . TYR A 1 95  ? 82.144  17.017 22.528 1.00 55.64 ? 95   TYR A N   1 
ATOM   728  C CA  . TYR A 1 95  ? 83.192  17.968 22.989 1.00 55.71 ? 95   TYR A CA  1 
ATOM   729  C C   . TYR A 1 95  ? 83.232  18.065 24.514 1.00 55.84 ? 95   TYR A C   1 
ATOM   730  O O   . TYR A 1 95  ? 84.316  18.180 25.118 1.00 55.44 ? 95   TYR A O   1 
ATOM   731  C CB  . TYR A 1 95  ? 82.884  19.348 22.426 1.00 55.83 ? 95   TYR A CB  1 
ATOM   732  C CG  . TYR A 1 95  ? 83.902  20.421 22.648 1.00 55.76 ? 95   TYR A CG  1 
ATOM   733  C CD1 . TYR A 1 95  ? 84.166  20.939 23.912 1.00 56.14 ? 95   TYR A CD1 1 
ATOM   734  C CD2 . TYR A 1 95  ? 84.573  20.972 21.561 1.00 57.05 ? 95   TYR A CD2 1 
ATOM   735  C CE1 . TYR A 1 95  ? 85.130  21.975 24.100 1.00 56.88 ? 95   TYR A CE1 1 
ATOM   736  C CE2 . TYR A 1 95  ? 85.535  22.008 21.696 1.00 56.78 ? 95   TYR A CE2 1 
ATOM   737  C CZ  . TYR A 1 95  ? 85.819  22.508 22.963 1.00 57.70 ? 95   TYR A CZ  1 
ATOM   738  O OH  . TYR A 1 95  ? 86.756  23.551 23.046 1.00 57.35 ? 95   TYR A OH  1 
ATOM   739  N N   . LEU A 1 96  ? 82.036  18.031 25.117 1.00 55.80 ? 96   LEU A N   1 
ATOM   740  C CA  . LEU A 1 96  ? 81.858  18.255 26.559 1.00 55.88 ? 96   LEU A CA  1 
ATOM   741  C C   . LEU A 1 96  ? 81.492  16.960 27.297 1.00 56.27 ? 96   LEU A C   1 
ATOM   742  O O   . LEU A 1 96  ? 80.818  16.056 26.702 1.00 56.22 ? 96   LEU A O   1 
ATOM   743  C CB  . LEU A 1 96  ? 80.749  19.280 26.805 1.00 55.75 ? 96   LEU A CB  1 
ATOM   744  C CG  . LEU A 1 96  ? 80.979  20.659 26.181 1.00 56.36 ? 96   LEU A CG  1 
ATOM   745  C CD1 . LEU A 1 96  ? 79.679  21.466 26.128 1.00 56.24 ? 96   LEU A CD1 1 
ATOM   746  C CD2 . LEU A 1 96  ? 82.077  21.458 26.923 1.00 56.59 ? 96   LEU A CD2 1 
ATOM   747  N N   . SER A 1 97  ? 81.912  16.900 28.581 1.00 55.85 ? 97   SER A N   1 
ATOM   748  C CA  . SER A 1 97  ? 81.610  15.778 29.472 1.00 55.57 ? 97   SER A CA  1 
ATOM   749  C C   . SER A 1 97  ? 80.826  16.362 30.624 1.00 55.26 ? 97   SER A C   1 
ATOM   750  O O   . SER A 1 97  ? 80.466  17.491 30.556 1.00 55.47 ? 97   SER A O   1 
ATOM   751  C CB  . SER A 1 97  ? 82.909  15.076 29.921 1.00 55.89 ? 97   SER A CB  1 
ATOM   752  O OG  . SER A 1 97  ? 83.271  13.969 29.065 1.00 55.31 ? 97   SER A OG  1 
ATOM   753  N N   . LEU A 1 98  ? 80.529  15.584 31.647 1.00 55.21 ? 98   LEU A N   1 
ATOM   754  C CA  . LEU A 1 98  ? 79.769  16.034 32.807 1.00 55.17 ? 98   LEU A CA  1 
ATOM   755  C C   . LEU A 1 98  ? 79.180  14.824 33.597 1.00 55.46 ? 98   LEU A C   1 
ATOM   756  O O   . LEU A 1 98  ? 78.718  13.839 32.979 1.00 55.41 ? 98   LEU A O   1 
ATOM   757  C CB  . LEU A 1 98  ? 78.630  16.914 32.359 1.00 54.90 ? 98   LEU A CB  1 
ATOM   758  C CG  . LEU A 1 98  ? 77.808  17.529 33.460 1.00 55.14 ? 98   LEU A CG  1 
ATOM   759  C CD1 . LEU A 1 98  ? 77.079  18.702 32.965 1.00 55.28 ? 98   LEU A CD1 1 
ATOM   760  C CD2 . LEU A 1 98  ? 76.821  16.551 34.000 1.00 55.54 ? 98   LEU A CD2 1 
ATOM   761  N N   . PRO A 1 99  ? 79.178  14.895 34.942 1.00 55.41 ? 99   PRO A N   1 
ATOM   762  C CA  . PRO A 1 99  ? 78.620  13.861 35.768 1.00 55.31 ? 99   PRO A CA  1 
ATOM   763  C C   . PRO A 1 99  ? 77.180  14.223 35.996 1.00 55.49 ? 99   PRO A C   1 
ATOM   764  O O   . PRO A 1 99  ? 76.952  15.299 36.529 1.00 55.83 ? 99   PRO A O   1 
ATOM   765  C CB  . PRO A 1 99  ? 79.403  14.028 37.051 1.00 55.23 ? 99   PRO A CB  1 
ATOM   766  C CG  . PRO A 1 99  ? 79.550  15.508 37.174 1.00 55.06 ? 99   PRO A CG  1 
ATOM   767  C CD  . PRO A 1 99  ? 79.703  15.985 35.785 1.00 55.49 ? 99   PRO A CD  1 
ATOM   768  N N   . TYR A 1 100 ? 76.226  13.376 35.589 1.00 55.37 ? 100  TYR A N   1 
ATOM   769  C CA  . TYR A 1 100 ? 74.800  13.725 35.619 1.00 55.13 ? 100  TYR A CA  1 
ATOM   770  C C   . TYR A 1 100 ? 73.912  12.620 36.155 1.00 55.16 ? 100  TYR A C   1 
ATOM   771  O O   . TYR A 1 100 ? 74.367  11.496 36.371 1.00 54.91 ? 100  TYR A O   1 
ATOM   772  C CB  . TYR A 1 100 ? 74.342  14.016 34.220 1.00 54.93 ? 100  TYR A CB  1 
ATOM   773  C CG  . TYR A 1 100 ? 73.240  15.021 34.064 1.00 54.31 ? 100  TYR A CG  1 
ATOM   774  C CD1 . TYR A 1 100 ? 73.412  16.318 34.416 1.00 54.27 ? 100  TYR A CD1 1 
ATOM   775  C CD2 . TYR A 1 100 ? 72.046  14.668 33.458 1.00 54.98 ? 100  TYR A CD2 1 
ATOM   776  C CE1 . TYR A 1 100 ? 72.415  17.231 34.196 1.00 55.10 ? 100  TYR A CE1 1 
ATOM   777  C CE2 . TYR A 1 100 ? 71.036  15.575 33.232 1.00 54.67 ? 100  TYR A CE2 1 
ATOM   778  C CZ  . TYR A 1 100 ? 71.218  16.845 33.603 1.00 54.38 ? 100  TYR A CZ  1 
ATOM   779  O OH  . TYR A 1 100 ? 70.220  17.759 33.391 1.00 53.99 ? 100  TYR A OH  1 
ATOM   780  N N   . LYS A 1 101 ? 72.633  12.969 36.343 1.00 55.15 ? 101  LYS A N   1 
ATOM   781  C CA  . LYS A 1 101 ? 71.617  12.096 36.912 1.00 54.91 ? 101  LYS A CA  1 
ATOM   782  C C   . LYS A 1 101 ? 70.668  11.657 35.853 1.00 54.49 ? 101  LYS A C   1 
ATOM   783  O O   . LYS A 1 101 ? 70.003  12.448 35.268 1.00 54.55 ? 101  LYS A O   1 
ATOM   784  C CB  . LYS A 1 101 ? 70.844  12.849 37.980 1.00 54.75 ? 101  LYS A CB  1 
ATOM   785  C CG  . LYS A 1 101 ? 69.802  12.021 38.686 1.00 54.98 ? 101  LYS A CG  1 
ATOM   786  C CD  . LYS A 1 101 ? 69.192  12.879 39.807 1.00 55.50 ? 101  LYS A CD  1 
ATOM   787  C CE  . LYS A 1 101 ? 68.081  12.189 40.612 1.00 55.35 ? 101  LYS A CE  1 
ATOM   788  N NZ  . LYS A 1 101 ? 67.449  13.205 41.519 1.00 53.99 ? 101  LYS A NZ  1 
ATOM   789  N N   . PHE A 1 102 ? 70.578  10.369 35.642 1.00 54.72 ? 102  PHE A N   1 
ATOM   790  C CA  . PHE A 1 102 ? 69.735  9.831  34.597 1.00 54.94 ? 102  PHE A CA  1 
ATOM   791  C C   . PHE A 1 102 ? 68.951  8.622  35.063 1.00 54.92 ? 102  PHE A C   1 
ATOM   792  O O   . PHE A 1 102 ? 69.119  8.166  36.198 1.00 54.94 ? 102  PHE A O   1 
ATOM   793  C CB  . PHE A 1 102 ? 70.604  9.450  33.413 1.00 55.01 ? 102  PHE A CB  1 
ATOM   794  C CG  . PHE A 1 102 ? 71.547  8.304  33.672 1.00 55.03 ? 102  PHE A CG  1 
ATOM   795  C CD1 . PHE A 1 102 ? 71.151  6.991  33.426 1.00 55.10 ? 102  PHE A CD1 1 
ATOM   796  C CD2 . PHE A 1 102 ? 72.843  8.540  34.121 1.00 54.88 ? 102  PHE A CD2 1 
ATOM   797  C CE1 . PHE A 1 102 ? 72.029  5.931  33.629 1.00 54.79 ? 102  PHE A CE1 1 
ATOM   798  C CE2 . PHE A 1 102 ? 73.714  7.504  34.317 1.00 54.77 ? 102  PHE A CE2 1 
ATOM   799  C CZ  . PHE A 1 102 ? 73.300  6.188  34.057 1.00 55.27 ? 102  PHE A CZ  1 
ATOM   800  N N   . ILE A 1 103 ? 68.104  8.086  34.201 1.00 54.76 ? 103  ILE A N   1 
ATOM   801  C CA  . ILE A 1 103 ? 67.347  6.923  34.624 1.00 55.02 ? 103  ILE A CA  1 
ATOM   802  C C   . ILE A 1 103 ? 67.876  5.711  33.941 1.00 55.02 ? 103  ILE A C   1 
ATOM   803  O O   . ILE A 1 103 ? 68.121  5.751  32.760 1.00 55.08 ? 103  ILE A O   1 
ATOM   804  C CB  . ILE A 1 103 ? 65.885  7.091  34.317 1.00 55.10 ? 103  ILE A CB  1 
ATOM   805  C CG1 . ILE A 1 103 ? 65.334  8.210  35.191 1.00 54.82 ? 103  ILE A CG1 1 
ATOM   806  C CG2 . ILE A 1 103 ? 65.156  5.765  34.487 1.00 54.59 ? 103  ILE A CG2 1 
ATOM   807  C CD1 . ILE A 1 103 ? 63.866  8.371  35.108 1.00 55.12 ? 103  ILE A CD1 1 
ATOM   808  N N   . GLU A 1 104 ? 68.065  4.640  34.701 1.00 55.01 ? 104  GLU A N   1 
ATOM   809  C CA  . GLU A 1 104 ? 68.567  3.400  34.147 1.00 55.07 ? 104  GLU A CA  1 
ATOM   810  C C   . GLU A 1 104 ? 67.320  2.637  33.878 1.00 55.15 ? 104  GLU A C   1 
ATOM   811  O O   . GLU A 1 104 ? 66.632  2.240  34.827 1.00 55.46 ? 104  GLU A O   1 
ATOM   812  C CB  . GLU A 1 104 ? 69.420  2.649  35.157 1.00 55.02 ? 104  GLU A CB  1 
ATOM   813  C CG  . GLU A 1 104 ? 70.729  2.084  34.636 1.00 55.08 ? 104  GLU A CG  1 
ATOM   814  C CD  . GLU A 1 104 ? 71.516  1.312  35.722 1.00 55.92 ? 104  GLU A CD  1 
ATOM   815  O OE1 . GLU A 1 104 ? 71.994  1.987  36.697 1.00 56.42 ? 104  GLU A OE1 1 
ATOM   816  O OE2 . GLU A 1 104 ? 71.677  0.047  35.627 1.00 55.27 ? 104  GLU A OE2 1 
ATOM   817  N N   . VAL A 1 105 ? 66.987  2.443  32.604 1.00 55.12 ? 105  VAL A N   1 
ATOM   818  C CA  . VAL A 1 105 ? 65.718  1.834  32.284 1.00 54.97 ? 105  VAL A CA  1 
ATOM   819  C C   . VAL A 1 105 ? 65.768  0.341  32.340 1.00 54.75 ? 105  VAL A C   1 
ATOM   820  O O   . VAL A 1 105 ? 66.676  -0.298 31.854 1.00 54.06 ? 105  VAL A O   1 
ATOM   821  C CB  . VAL A 1 105 ? 65.154  2.295  30.962 1.00 54.94 ? 105  VAL A CB  1 
ATOM   822  C CG1 . VAL A 1 105 ? 63.698  1.883  30.855 1.00 55.38 ? 105  VAL A CG1 1 
ATOM   823  C CG2 . VAL A 1 105 ? 65.190  3.778  30.904 1.00 55.90 ? 105  VAL A CG2 1 
ATOM   824  N N   . THR A 1 106 ? 64.730  -0.194 32.957 1.00 55.29 ? 106  THR A N   1 
ATOM   825  C CA  . THR A 1 106 ? 64.499  -1.613 33.050 1.00 55.27 ? 106  THR A CA  1 
ATOM   826  C C   . THR A 1 106 ? 63.283  -2.027 32.236 1.00 54.96 ? 106  THR A C   1 
ATOM   827  O O   . THR A 1 106 ? 63.414  -2.652 31.213 1.00 54.47 ? 106  THR A O   1 
ATOM   828  C CB  . THR A 1 106 ? 64.334  -1.932 34.508 1.00 55.38 ? 106  THR A CB  1 
ATOM   829  O OG1 . THR A 1 106 ? 65.644  -1.922 35.092 1.00 54.88 ? 106  THR A OG1 1 
ATOM   830  C CG2 . THR A 1 106 ? 63.741  -3.335 34.737 1.00 55.66 ? 106  THR A CG2 1 
ATOM   831  N N   . ASP A 1 107 ? 62.101  -1.648 32.682 1.00 55.23 ? 107  ASP A N   1 
ATOM   832  C CA  . ASP A 1 107 ? 60.894  -2.133 32.029 1.00 55.61 ? 107  ASP A CA  1 
ATOM   833  C C   . ASP A 1 107 ? 60.294  -1.167 31.018 1.00 55.61 ? 107  ASP A C   1 
ATOM   834  O O   . ASP A 1 107 ? 59.687  -0.154 31.380 1.00 55.25 ? 107  ASP A O   1 
ATOM   835  C CB  . ASP A 1 107 ? 59.804  -2.533 33.023 1.00 55.69 ? 107  ASP A CB  1 
ATOM   836  C CG  . ASP A 1 107 ? 58.549  -2.945 32.321 1.00 55.23 ? 107  ASP A CG  1 
ATOM   837  O OD1 . ASP A 1 107 ? 58.643  -3.704 31.337 1.00 54.01 ? 107  ASP A OD1 1 
ATOM   838  O OD2 . ASP A 1 107 ? 57.434  -2.516 32.649 1.00 56.20 ? 107  ASP A OD2 1 
ATOM   839  N N   . THR A 1 108 ? 60.412  -1.553 29.751 1.00 55.82 ? 108  THR A N   1 
ATOM   840  C CA  . THR A 1 108 ? 59.876  -0.747 28.627 1.00 55.81 ? 108  THR A CA  1 
ATOM   841  C C   . THR A 1 108 ? 58.525  -1.278 28.179 1.00 55.53 ? 108  THR A C   1 
ATOM   842  O O   . THR A 1 108 ? 57.502  -0.667 28.464 1.00 55.72 ? 108  THR A O   1 
ATOM   843  C CB  . THR A 1 108 ? 60.844  -0.746 27.413 1.00 55.99 ? 108  THR A CB  1 
ATOM   844  O OG1 . THR A 1 108 ? 60.078  -0.715 26.198 1.00 56.03 ? 108  THR A OG1 1 
ATOM   845  C CG2 . THR A 1 108 ? 61.719  -1.985 27.439 1.00 56.40 ? 108  THR A CG2 1 
ATOM   846  N N   . ASP A 1 109 ? 58.558  -2.426 27.515 1.00 55.55 ? 109  ASP A N   1 
ATOM   847  C CA  . ASP A 1 109 ? 57.493  -2.847 26.630 1.00 55.55 ? 109  ASP A CA  1 
ATOM   848  C C   . ASP A 1 109 ? 56.372  -1.885 26.844 1.00 55.54 ? 109  ASP A C   1 
ATOM   849  O O   . ASP A 1 109 ? 55.835  -1.828 27.940 1.00 55.52 ? 109  ASP A O   1 
ATOM   850  C CB  . ASP A 1 109 ? 56.998  -4.240 27.014 1.00 55.86 ? 109  ASP A CB  1 
ATOM   851  C CG  . ASP A 1 109 ? 58.116  -5.182 27.408 1.00 55.92 ? 109  ASP A CG  1 
ATOM   852  O OD1 . ASP A 1 109 ? 58.262  -6.223 26.753 1.00 56.39 ? 109  ASP A OD1 1 
ATOM   853  O OD2 . ASP A 1 109 ? 58.890  -4.988 28.360 1.00 55.92 ? 109  ASP A OD2 1 
ATOM   854  N N   . ASP A 1 110 ? 55.984  -1.118 25.832 1.00 56.01 ? 110  ASP A N   1 
ATOM   855  C CA  . ASP A 1 110 ? 54.806  -0.266 26.141 1.00 55.93 ? 110  ASP A CA  1 
ATOM   856  C C   . ASP A 1 110 ? 54.883  0.964  25.246 1.00 55.99 ? 110  ASP A C   1 
ATOM   857  O O   . ASP A 1 110 ? 53.929  1.486  24.675 1.00 55.49 ? 110  ASP A O   1 
ATOM   858  C CB  . ASP A 1 110 ? 54.859  0.070  27.648 1.00 55.23 ? 110  ASP A CB  1 
ATOM   859  C CG  . ASP A 1 110 ? 53.891  1.123  28.175 1.00 55.33 ? 110  ASP A CG  1 
ATOM   860  O OD1 . ASP A 1 110 ? 53.992  1.472  29.380 1.00 54.75 ? 110  ASP A OD1 1 
ATOM   861  O OD2 . ASP A 1 110 ? 53.036  1.581  27.392 1.00 55.28 ? 110  ASP A OD2 1 
ATOM   862  N N   . LEU A 1 111 ? 56.153  1.389  25.284 1.00 56.19 ? 111  LEU A N   1 
ATOM   863  C CA  . LEU A 1 111 ? 56.570  2.445  24.464 1.00 56.17 ? 111  LEU A CA  1 
ATOM   864  C C   . LEU A 1 111 ? 56.607  1.638  23.271 1.00 56.25 ? 111  LEU A C   1 
ATOM   865  O O   . LEU A 1 111 ? 57.400  1.840  22.354 1.00 56.46 ? 111  LEU A O   1 
ATOM   866  C CB  . LEU A 1 111 ? 57.938  3.016  24.786 1.00 56.17 ? 111  LEU A CB  1 
ATOM   867  C CG  . LEU A 1 111 ? 57.947  4.546  24.717 1.00 57.01 ? 111  LEU A CG  1 
ATOM   868  C CD1 . LEU A 1 111 ? 56.992  5.133  25.743 1.00 56.87 ? 111  LEU A CD1 1 
ATOM   869  C CD2 . LEU A 1 111 ? 59.368  5.085  24.917 1.00 56.19 ? 111  LEU A CD2 1 
ATOM   870  N N   . GLU A 1 112 ? 55.847  0.564  23.327 1.00 20.00 ? 112  GLU A N   1 
ATOM   871  C CA  . GLU A 1 112 ? 56.123  -0.549 22.462 1.00 20.00 ? 112  GLU A CA  1 
ATOM   872  C C   . GLU A 1 112 ? 54.910  -0.719 21.597 1.00 20.00 ? 112  GLU A C   1 
ATOM   873  O O   . GLU A 1 112 ? 53.886  -1.233 22.014 1.00 56.42 ? 112  GLU A O   1 
ATOM   874  C CB  . GLU A 1 112 ? 56.455  -1.803 23.255 1.00 20.00 ? 112  GLU A CB  1 
ATOM   875  C CG  . GLU A 1 112 ? 57.165  -2.867 22.450 1.00 20.00 ? 112  GLU A CG  1 
ATOM   876  C CD  . GLU A 1 112 ? 58.647  -2.644 22.353 1.00 20.00 ? 112  GLU A CD  1 
ATOM   877  O OE1 . GLU A 1 112 ? 59.360  -2.973 23.311 1.00 20.00 ? 112  GLU A OE1 1 
ATOM   878  O OE2 . GLU A 1 112 ? 59.099  -2.159 21.306 1.00 20.00 ? 112  GLU A OE2 1 
ATOM   879  N N   . PRO A 1 113 ? 55.043  -0.247 20.376 1.00 55.99 ? 113  PRO A N   1 
ATOM   880  C CA  . PRO A 1 113 ? 55.660  -1.069 19.338 1.00 56.09 ? 113  PRO A CA  1 
ATOM   881  C C   . PRO A 1 113 ? 56.793  -0.352 18.617 1.00 55.87 ? 113  PRO A C   1 
ATOM   882  O O   . PRO A 1 113 ? 57.806  -0.960 18.303 1.00 55.23 ? 113  PRO A O   1 
ATOM   883  C CB  . PRO A 1 113 ? 54.508  -1.298 18.363 1.00 56.20 ? 113  PRO A CB  1 
ATOM   884  C CG  . PRO A 1 113 ? 53.361  -0.470 18.881 1.00 56.24 ? 113  PRO A CG  1 
ATOM   885  C CD  . PRO A 1 113 ? 53.913  0.521  19.829 1.00 55.87 ? 113  PRO A CD  1 
ATOM   886  N N   . LEU A 1 114 ? 56.611  0.933  18.358 1.00 55.72 ? 114  LEU A N   1 
ATOM   887  C CA  . LEU A 1 114 ? 57.556  1.920  18.827 1.00 55.66 ? 114  LEU A CA  1 
ATOM   888  C C   . LEU A 1 114 ? 58.778  1.196  19.283 1.00 55.32 ? 114  LEU A C   1 
ATOM   889  O O   . LEU A 1 114 ? 59.479  0.606  18.486 1.00 55.41 ? 114  LEU A O   1 
ATOM   890  C CB  . LEU A 1 114 ? 56.980  2.684  20.000 1.00 55.88 ? 114  LEU A CB  1 
ATOM   891  C CG  . LEU A 1 114 ? 55.826  3.582  19.600 1.00 56.87 ? 114  LEU A CG  1 
ATOM   892  C CD1 . LEU A 1 114 ? 56.309  5.005  19.586 1.00 56.50 ? 114  LEU A CD1 1 
ATOM   893  C CD2 . LEU A 1 114 ? 55.356  3.167  18.229 1.00 56.67 ? 114  LEU A CD2 1 
ATOM   894  N N   . TYR A 1 115 ? 59.055  1.257  20.573 1.00 54.95 ? 115  TYR A N   1 
ATOM   895  C CA  . TYR A 1 115 ? 60.479  1.275  20.971 1.00 55.25 ? 115  TYR A CA  1 
ATOM   896  C C   . TYR A 1 115 ? 61.528  0.537  20.092 1.00 55.44 ? 115  TYR A C   1 
ATOM   897  O O   . TYR A 1 115 ? 62.652  1.013  19.944 1.00 55.45 ? 115  TYR A O   1 
ATOM   898  C CB  . TYR A 1 115 ? 60.608  0.865  22.420 1.00 55.24 ? 115  TYR A CB  1 
ATOM   899  C CG  . TYR A 1 115 ? 61.980  1.088  23.002 1.00 55.03 ? 115  TYR A CG  1 
ATOM   900  C CD1 . TYR A 1 115 ? 62.649  -0.003 23.530 1.00 55.04 ? 115  TYR A CD1 1 
ATOM   901  C CD2 . TYR A 1 115 ? 62.614  2.322  23.003 1.00 54.88 ? 115  TYR A CD2 1 
ATOM   902  C CE1 . TYR A 1 115 ? 63.912  0.147  24.061 1.00 55.22 ? 115  TYR A CE1 1 
ATOM   903  C CE2 . TYR A 1 115 ? 63.864  2.476  23.534 1.00 55.34 ? 115  TYR A CE2 1 
ATOM   904  C CZ  . TYR A 1 115 ? 64.519  1.404  24.068 1.00 55.10 ? 115  TYR A CZ  1 
ATOM   905  O OH  . TYR A 1 115 ? 65.782  1.547  24.612 1.00 54.40 ? 115  TYR A OH  1 
ATOM   906  N N   . THR A 1 116 ? 61.157  -0.596 19.521 1.00 55.70 ? 116  THR A N   1 
ATOM   907  C CA  . THR A 1 116 ? 62.048  -1.426 18.687 1.00 55.53 ? 116  THR A CA  1 
ATOM   908  C C   . THR A 1 116 ? 62.052  -0.918 17.254 1.00 55.38 ? 116  THR A C   1 
ATOM   909  O O   . THR A 1 116 ? 63.098  -0.825 16.599 1.00 54.79 ? 116  THR A O   1 
ATOM   910  C CB  . THR A 1 116 ? 61.568  -2.894 18.683 1.00 55.44 ? 116  THR A CB  1 
ATOM   911  O OG1 . THR A 1 116 ? 60.600  -3.064 17.636 1.00 55.77 ? 116  THR A OG1 1 
ATOM   912  C CG2 . THR A 1 116 ? 60.829  -3.237 19.958 1.00 55.01 ? 116  THR A CG2 1 
ATOM   913  N N   . ALA A 1 117 ? 60.836  -0.612 16.792 1.00 55.81 ? 117  ALA A N   1 
ATOM   914  C CA  . ALA A 1 117 ? 60.576  -0.024 15.477 1.00 55.81 ? 117  ALA A CA  1 
ATOM   915  C C   . ALA A 1 117 ? 61.435  1.225  15.165 1.00 55.69 ? 117  ALA A C   1 
ATOM   916  O O   . ALA A 1 117 ? 61.713  1.538  14.004 1.00 55.26 ? 117  ALA A O   1 
ATOM   917  C CB  . ALA A 1 117 ? 59.062  0.284  15.346 1.00 55.98 ? 117  ALA A CB  1 
ATOM   918  N N   . ALA A 1 118 ? 61.891  1.892  16.219 1.00 55.83 ? 118  ALA A N   1 
ATOM   919  C CA  . ALA A 1 118 ? 62.641  3.153  16.116 1.00 55.65 ? 118  ALA A CA  1 
ATOM   920  C C   . ALA A 1 118 ? 64.133  3.045  16.395 1.00 55.45 ? 118  ALA A C   1 
ATOM   921  O O   . ALA A 1 118 ? 64.572  2.499  17.399 1.00 55.59 ? 118  ALA A O   1 
ATOM   922  C CB  . ALA A 1 118 ? 62.040  4.164  17.076 1.00 56.06 ? 118  ALA A CB  1 
ATOM   923  N N   . GLU A 1 119 ? 64.911  3.621  15.509 1.00 55.23 ? 119  GLU A N   1 
ATOM   924  C CA  . GLU A 1 119 ? 66.358  3.593  15.619 1.00 55.25 ? 119  GLU A CA  1 
ATOM   925  C C   . GLU A 1 119 ? 66.833  4.383  16.833 1.00 54.94 ? 119  GLU A C   1 
ATOM   926  O O   . GLU A 1 119 ? 67.653  5.274  16.684 1.00 55.07 ? 119  GLU A O   1 
ATOM   927  C CB  . GLU A 1 119 ? 67.012  4.134  14.312 1.00 55.20 ? 119  GLU A CB  1 
ATOM   928  C CG  . GLU A 1 119 ? 67.375  3.067  13.251 1.00 56.14 ? 119  GLU A CG  1 
ATOM   929  C CD  . GLU A 1 119 ? 68.882  2.689  13.190 1.00 56.79 ? 119  GLU A CD  1 
ATOM   930  O OE1 . GLU A 1 119 ? 69.524  2.521  14.267 1.00 56.58 ? 119  GLU A OE1 1 
ATOM   931  O OE2 . GLU A 1 119 ? 69.426  2.524  12.058 1.00 55.90 ? 119  GLU A OE2 1 
ATOM   932  N N   . PHE A 1 120 ? 66.349  4.073  18.038 1.00 54.72 ? 120  PHE A N   1 
ATOM   933  C CA  . PHE A 1 120 ? 66.850  4.807  19.202 1.00 54.87 ? 120  PHE A CA  1 
ATOM   934  C C   . PHE A 1 120 ? 66.883  4.072  20.487 1.00 54.65 ? 120  PHE A C   1 
ATOM   935  O O   . PHE A 1 120 ? 66.087  3.194  20.725 1.00 54.17 ? 120  PHE A O   1 
ATOM   936  C CB  . PHE A 1 120 ? 66.076  6.119  19.420 1.00 55.32 ? 120  PHE A CB  1 
ATOM   937  C CG  . PHE A 1 120 ? 64.805  5.993  20.251 1.00 55.10 ? 120  PHE A CG  1 
ATOM   938  C CD1 . PHE A 1 120 ? 63.626  5.559  19.678 1.00 54.85 ? 120  PHE A CD1 1 
ATOM   939  C CD2 . PHE A 1 120 ? 64.794  6.377  21.586 1.00 55.45 ? 120  PHE A CD2 1 
ATOM   940  C CE1 . PHE A 1 120 ? 62.477  5.466  20.423 1.00 54.78 ? 120  PHE A CE1 1 
ATOM   941  C CE2 . PHE A 1 120 ? 63.625  6.295  22.340 1.00 55.02 ? 120  PHE A CE2 1 
ATOM   942  C CZ  . PHE A 1 120 ? 62.477  5.838  21.758 1.00 54.61 ? 120  PHE A CZ  1 
ATOM   943  N N   . ASP A 1 121 ? 67.813  4.495  21.329 1.00 54.83 ? 121  ASP A N   1 
ATOM   944  C CA  . ASP A 1 121 ? 68.055  3.866  22.616 1.00 54.96 ? 121  ASP A CA  1 
ATOM   945  C C   . ASP A 1 121 ? 67.402  4.667  23.696 1.00 54.86 ? 121  ASP A C   1 
ATOM   946  O O   . ASP A 1 121 ? 66.560  4.148  24.420 1.00 54.74 ? 121  ASP A O   1 
ATOM   947  C CB  . ASP A 1 121 ? 69.547  3.777  22.917 1.00 54.82 ? 121  ASP A CB  1 
ATOM   948  C CG  . ASP A 1 121 ? 70.314  3.216  21.785 1.00 54.58 ? 121  ASP A CG  1 
ATOM   949  O OD1 . ASP A 1 121 ? 70.050  2.077  21.382 1.00 55.67 ? 121  ASP A OD1 1 
ATOM   950  O OD2 . ASP A 1 121 ? 71.211  3.834  21.233 1.00 54.16 ? 121  ASP A OD2 1 
ATOM   951  N N   . GLY A 1 122 ? 67.807  5.930  23.796 1.00 54.85 ? 122  GLY A N   1 
ATOM   952  C CA  . GLY A 1 122 ? 67.407  6.797  24.899 1.00 54.86 ? 122  GLY A CA  1 
ATOM   953  C C   . GLY A 1 122 ? 66.900  8.162  24.516 1.00 54.57 ? 122  GLY A C   1 
ATOM   954  O O   . GLY A 1 122 ? 66.692  8.470  23.348 1.00 53.96 ? 122  GLY A O   1 
ATOM   955  N N   . ILE A 1 123 ? 66.681  8.974  25.529 1.00 54.51 ? 123  ILE A N   1 
ATOM   956  C CA  . ILE A 1 123 ? 66.148  10.284 25.317 1.00 54.82 ? 123  ILE A CA  1 
ATOM   957  C C   . ILE A 1 123 ? 66.861  11.227 26.231 1.00 54.71 ? 123  ILE A C   1 
ATOM   958  O O   . ILE A 1 123 ? 67.017  10.974 27.396 1.00 55.09 ? 123  ILE A O   1 
ATOM   959  C CB  . ILE A 1 123 ? 64.651  10.312 25.644 1.00 54.80 ? 123  ILE A CB  1 
ATOM   960  C CG1 . ILE A 1 123 ? 63.903  9.526  24.599 1.00 54.80 ? 123  ILE A CG1 1 
ATOM   961  C CG2 . ILE A 1 123 ? 64.121  11.732 25.644 1.00 54.90 ? 123  ILE A CG2 1 
ATOM   962  C CD1 . ILE A 1 123 ? 62.477  9.389  24.902 1.00 55.13 ? 123  ILE A CD1 1 
ATOM   963  N N   . LEU A 1 124 ? 67.256  12.353 25.721 1.00 54.30 ? 124  LEU A N   1 
ATOM   964  C CA  . LEU A 1 124 ? 67.809  13.325 26.568 1.00 54.52 ? 124  LEU A CA  1 
ATOM   965  C C   . LEU A 1 124 ? 66.888  14.492 26.444 1.00 54.52 ? 124  LEU A C   1 
ATOM   966  O O   . LEU A 1 124 ? 66.750  15.046 25.389 1.00 55.05 ? 124  LEU A O   1 
ATOM   967  C CB  . LEU A 1 124 ? 69.203  13.637 26.084 1.00 54.65 ? 124  LEU A CB  1 
ATOM   968  C CG  . LEU A 1 124 ? 69.806  14.980 26.422 1.00 54.63 ? 124  LEU A CG  1 
ATOM   969  C CD1 . LEU A 1 124 ? 69.626  15.281 27.863 1.00 55.02 ? 124  LEU A CD1 1 
ATOM   970  C CD2 . LEU A 1 124 ? 71.289  14.940 26.070 1.00 54.98 ? 124  LEU A CD2 1 
ATOM   971  N N   . GLY A 1 125 ? 66.232  14.869 27.519 1.00 54.68 ? 125  GLY A N   1 
ATOM   972  C CA  . GLY A 1 125 ? 65.257  15.948 27.457 1.00 54.72 ? 125  GLY A CA  1 
ATOM   973  C C   . GLY A 1 125 ? 65.926  17.288 27.437 1.00 54.63 ? 125  GLY A C   1 
ATOM   974  O O   . GLY A 1 125 ? 66.979  17.440 27.977 1.00 54.96 ? 125  GLY A O   1 
ATOM   975  N N   . LEU A 1 126 ? 65.301  18.281 26.851 1.00 54.76 ? 126  LEU A N   1 
ATOM   976  C CA  . LEU A 1 126 ? 65.877  19.632 26.844 1.00 55.01 ? 126  LEU A CA  1 
ATOM   977  C C   . LEU A 1 126 ? 64.897  20.722 27.370 1.00 55.02 ? 126  LEU A C   1 
ATOM   978  O O   . LEU A 1 126 ? 65.021  21.932 27.086 1.00 54.29 ? 126  LEU A O   1 
ATOM   979  C CB  . LEU A 1 126 ? 66.358  19.969 25.435 1.00 54.99 ? 126  LEU A CB  1 
ATOM   980  C CG  . LEU A 1 126 ? 67.484  19.136 24.844 1.00 55.18 ? 126  LEU A CG  1 
ATOM   981  C CD1 . LEU A 1 126 ? 67.964  19.769 23.559 1.00 55.35 ? 126  LEU A CD1 1 
ATOM   982  C CD2 . LEU A 1 126 ? 68.651  19.064 25.798 1.00 55.69 ? 126  LEU A CD2 1 
ATOM   983  N N   . GLY A 1 127 ? 63.921  20.278 28.145 1.00 54.94 ? 127  GLY A N   1 
ATOM   984  C CA  . GLY A 1 127 ? 62.959  21.193 28.676 1.00 55.22 ? 127  GLY A CA  1 
ATOM   985  C C   . GLY A 1 127 ? 63.459  21.847 29.947 1.00 55.24 ? 127  GLY A C   1 
ATOM   986  O O   . GLY A 1 127 ? 64.644  21.714 30.294 1.00 54.85 ? 127  GLY A O   1 
ATOM   987  N N   . TRP A 1 128 ? 62.532  22.527 30.641 1.00 55.25 ? 128  TRP A N   1 
ATOM   988  C CA  . TRP A 1 128 ? 62.856  23.251 31.863 1.00 55.44 ? 128  TRP A CA  1 
ATOM   989  C C   . TRP A 1 128 ? 62.809  22.278 33.030 1.00 55.91 ? 128  TRP A C   1 
ATOM   990  O O   . TRP A 1 128 ? 62.359  21.115 32.868 1.00 55.47 ? 128  TRP A O   1 
ATOM   991  C CB  . TRP A 1 128 ? 61.917  24.435 32.074 1.00 55.32 ? 128  TRP A CB  1 
ATOM   992  C CG  . TRP A 1 128 ? 62.075  25.384 31.008 1.00 55.02 ? 128  TRP A CG  1 
ATOM   993  C CD1 . TRP A 1 128 ? 61.590  25.266 29.744 1.00 55.71 ? 128  TRP A CD1 1 
ATOM   994  C CD2 . TRP A 1 128 ? 62.843  26.583 31.025 1.00 54.80 ? 128  TRP A CD2 1 
ATOM   995  N NE1 . TRP A 1 128 ? 61.995  26.323 28.967 1.00 55.87 ? 128  TRP A NE1 1 
ATOM   996  C CE2 . TRP A 1 128 ? 62.763  27.155 29.738 1.00 56.02 ? 128  TRP A CE2 1 
ATOM   997  C CE3 . TRP A 1 128 ? 63.601  27.237 31.992 1.00 54.94 ? 128  TRP A CE3 1 
ATOM   998  C CZ2 . TRP A 1 128 ? 63.403  28.356 29.405 1.00 55.77 ? 128  TRP A CZ2 1 
ATOM   999  C CZ3 . TRP A 1 128 ? 64.237  28.420 31.663 1.00 55.11 ? 128  TRP A CZ3 1 
ATOM   1000 C CH2 . TRP A 1 128 ? 64.126  28.972 30.381 1.00 55.30 ? 128  TRP A CH2 1 
ATOM   1001 N N   . LYS A 1 129 ? 63.268  22.745 34.204 1.00 55.77 ? 129  LYS A N   1 
ATOM   1002 C CA  . LYS A 1 129 ? 63.403  21.837 35.348 1.00 55.56 ? 129  LYS A CA  1 
ATOM   1003 C C   . LYS A 1 129 ? 62.060  21.262 35.721 1.00 55.51 ? 129  LYS A C   1 
ATOM   1004 O O   . LYS A 1 129 ? 61.931  20.067 35.813 1.00 55.66 ? 129  LYS A O   1 
ATOM   1005 C CB  . LYS A 1 129 ? 64.020  22.547 36.548 1.00 55.69 ? 129  LYS A CB  1 
ATOM   1006 C CG  . LYS A 1 129 ? 64.591  21.606 37.619 1.00 55.55 ? 129  LYS A CG  1 
ATOM   1007 C CD  . LYS A 1 129 ? 65.021  22.340 38.914 1.00 55.16 ? 129  LYS A CD  1 
ATOM   1008 C CE  . LYS A 1 129 ? 65.549  21.316 39.940 1.00 55.65 ? 129  LYS A CE  1 
ATOM   1009 N NZ  . LYS A 1 129 ? 65.596  21.727 41.375 1.00 55.73 ? 129  LYS A NZ  1 
ATOM   1010 N N   . ASP A 1 130 ? 61.064  22.124 35.911 1.00 55.53 ? 130  ASP A N   1 
ATOM   1011 C CA  . ASP A 1 130 ? 59.727  21.715 36.359 1.00 55.46 ? 130  ASP A CA  1 
ATOM   1012 C C   . ASP A 1 130 ? 59.074  20.662 35.485 1.00 55.25 ? 130  ASP A C   1 
ATOM   1013 O O   . ASP A 1 130 ? 58.056  20.091 35.865 1.00 55.08 ? 130  ASP A O   1 
ATOM   1014 C CB  . ASP A 1 130 ? 58.792  22.932 36.403 1.00 55.88 ? 130  ASP A CB  1 
ATOM   1015 C CG  . ASP A 1 130 ? 59.131  23.886 37.518 1.00 56.51 ? 130  ASP A CG  1 
ATOM   1016 O OD1 . ASP A 1 130 ? 58.233  24.656 37.976 1.00 56.83 ? 130  ASP A OD1 1 
ATOM   1017 O OD2 . ASP A 1 130 ? 60.284  23.921 38.010 1.00 57.68 ? 130  ASP A OD2 1 
ATOM   1018 N N   . LEU A 1 131 ? 59.641  20.416 34.313 1.00 55.04 ? 131  LEU A N   1 
ATOM   1019 C CA  . LEU A 1 131 ? 59.071  19.457 33.368 1.00 55.21 ? 131  LEU A CA  1 
ATOM   1020 C C   . LEU A 1 131 ? 59.637  18.054 33.603 1.00 55.00 ? 131  LEU A C   1 
ATOM   1021 O O   . LEU A 1 131 ? 59.225  17.057 33.001 1.00 54.47 ? 131  LEU A O   1 
ATOM   1022 C CB  . LEU A 1 131 ? 59.417  19.930 31.958 1.00 55.49 ? 131  LEU A CB  1 
ATOM   1023 C CG  . LEU A 1 131 ? 58.876  19.164 30.745 1.00 55.18 ? 131  LEU A CG  1 
ATOM   1024 C CD1 . LEU A 1 131 ? 57.403  19.370 30.639 1.00 55.51 ? 131  LEU A CD1 1 
ATOM   1025 C CD2 . LEU A 1 131 ? 59.557  19.620 29.478 1.00 55.12 ? 131  LEU A CD2 1 
ATOM   1026 N N   . SER A 1 132 ? 60.619  18.010 34.475 1.00 55.11 ? 132  SER A N   1 
ATOM   1027 C CA  . SER A 1 132 ? 61.350  16.826 34.717 1.00 55.46 ? 132  SER A CA  1 
ATOM   1028 C C   . SER A 1 132 ? 60.779  16.205 35.935 1.00 55.57 ? 132  SER A C   1 
ATOM   1029 O O   . SER A 1 132 ? 60.270  16.903 36.834 1.00 55.55 ? 132  SER A O   1 
ATOM   1030 C CB  . SER A 1 132 ? 62.812  17.134 35.050 1.00 55.99 ? 132  SER A CB  1 
ATOM   1031 O OG  . SER A 1 132 ? 62.970  17.341 36.475 1.00 56.88 ? 132  SER A OG  1 
ATOM   1032 N N   . ILE A 1 133 ? 60.994  14.891 35.985 1.00 55.67 ? 133  ILE A N   1 
ATOM   1033 C CA  . ILE A 1 133 ? 60.589  14.019 37.071 1.00 55.24 ? 133  ILE A CA  1 
ATOM   1034 C C   . ILE A 1 133 ? 61.774  13.804 38.006 1.00 55.16 ? 133  ILE A C   1 
ATOM   1035 O O   . ILE A 1 133 ? 62.763  13.190 37.624 1.00 55.32 ? 133  ILE A O   1 
ATOM   1036 C CB  . ILE A 1 133 ? 60.147  12.723 36.475 1.00 54.74 ? 133  ILE A CB  1 
ATOM   1037 C CG1 . ILE A 1 133 ? 59.012  13.023 35.503 1.00 54.46 ? 133  ILE A CG1 1 
ATOM   1038 C CG2 . ILE A 1 133 ? 59.749  11.809 37.566 1.00 54.93 ? 133  ILE A CG2 1 
ATOM   1039 C CD1 . ILE A 1 133 ? 58.622  11.876 34.682 1.00 55.50 ? 133  ILE A CD1 1 
ATOM   1040 N N   . GLY A 1 134 ? 61.682  14.321 39.220 1.00 55.09 ? 134  GLY A N   1 
ATOM   1041 C CA  . GLY A 1 134 ? 62.803  14.271 40.139 1.00 54.98 ? 134  GLY A CA  1 
ATOM   1042 C C   . GLY A 1 134 ? 63.575  15.561 40.166 1.00 54.77 ? 134  GLY A C   1 
ATOM   1043 O O   . GLY A 1 134 ? 64.627  15.632 40.763 1.00 54.43 ? 134  GLY A O   1 
ATOM   1044 N N   . SER A 1 135 ? 63.027  16.596 39.551 1.00 55.09 ? 135  SER A N   1 
ATOM   1045 C CA  . SER A 1 135 ? 63.614  17.913 39.592 1.00 55.33 ? 135  SER A CA  1 
ATOM   1046 C C   . SER A 1 135 ? 65.093  17.800 39.306 1.00 55.22 ? 135  SER A C   1 
ATOM   1047 O O   . SER A 1 135 ? 65.912  17.642 40.199 1.00 55.49 ? 135  SER A O   1 
ATOM   1048 C CB  . SER A 1 135 ? 63.365  18.611 40.949 1.00 55.33 ? 135  SER A CB  1 
ATOM   1049 O OG  . SER A 1 135 ? 62.164  19.371 40.911 1.00 55.87 ? 135  SER A OG  1 
ATOM   1050 N N   . ILE A 1 136 ? 65.419  17.878 38.036 1.00 55.14 ? 136  ILE A N   1 
ATOM   1051 C CA  . ILE A 1 136 ? 66.774  17.846 37.609 1.00 54.98 ? 136  ILE A CA  1 
ATOM   1052 C C   . ILE A 1 136 ? 67.047  19.018 36.718 1.00 55.01 ? 136  ILE A C   1 
ATOM   1053 O O   . ILE A 1 136 ? 66.250  19.387 35.845 1.00 55.15 ? 136  ILE A O   1 
ATOM   1054 C CB  . ILE A 1 136 ? 66.998  16.617 36.830 1.00 55.11 ? 136  ILE A CB  1 
ATOM   1055 C CG1 . ILE A 1 136 ? 67.207  15.443 37.763 1.00 55.10 ? 136  ILE A CG1 1 
ATOM   1056 C CG2 . ILE A 1 136 ? 68.225  16.779 35.971 1.00 56.10 ? 136  ILE A CG2 1 
ATOM   1057 C CD1 . ILE A 1 136 ? 67.350  14.100 37.023 1.00 55.10 ? 136  ILE A CD1 1 
ATOM   1058 N N   . ASP A 1 137 ? 68.225  19.561 36.907 1.00 55.04 ? 137  ASP A N   1 
ATOM   1059 C CA  . ASP A 1 137 ? 68.604  20.792 36.262 1.00 55.26 ? 137  ASP A CA  1 
ATOM   1060 C C   . ASP A 1 137 ? 69.023  20.483 34.807 1.00 54.88 ? 137  ASP A C   1 
ATOM   1061 O O   . ASP A 1 137 ? 69.883  19.662 34.548 1.00 53.98 ? 137  ASP A O   1 
ATOM   1062 C CB  . ASP A 1 137 ? 69.735  21.474 37.095 1.00 55.49 ? 137  ASP A CB  1 
ATOM   1063 C CG  . ASP A 1 137 ? 69.630  21.168 38.634 1.00 55.77 ? 137  ASP A CG  1 
ATOM   1064 O OD1 . ASP A 1 137 ? 69.642  19.986 39.095 1.00 56.22 ? 137  ASP A OD1 1 
ATOM   1065 O OD2 . ASP A 1 137 ? 69.506  22.052 39.472 1.00 56.37 ? 137  ASP A OD2 1 
ATOM   1066 N N   . PRO A 1 138 ? 68.380  21.167 33.866 1.00 55.11 ? 138  PRO A N   1 
ATOM   1067 C CA  . PRO A 1 138 ? 68.652  20.956 32.440 1.00 55.31 ? 138  PRO A CA  1 
ATOM   1068 C C   . PRO A 1 138 ? 70.137  21.084 32.119 1.00 55.15 ? 138  PRO A C   1 
ATOM   1069 O O   . PRO A 1 138 ? 70.728  22.141 32.342 1.00 54.28 ? 138  PRO A O   1 
ATOM   1070 C CB  . PRO A 1 138 ? 67.862  22.082 31.761 1.00 55.57 ? 138  PRO A CB  1 
ATOM   1071 C CG  . PRO A 1 138 ? 67.553  23.056 32.851 1.00 55.55 ? 138  PRO A CG  1 
ATOM   1072 C CD  . PRO A 1 138 ? 67.392  22.235 34.089 1.00 55.15 ? 138  PRO A CD  1 
ATOM   1073 N N   . ILE A 1 139 ? 70.728  20.013 31.600 1.00 55.73 ? 139  ILE A N   1 
ATOM   1074 C CA  . ILE A 1 139 ? 72.164  19.975 31.350 1.00 55.74 ? 139  ILE A CA  1 
ATOM   1075 C C   . ILE A 1 139 ? 72.700  21.359 31.003 1.00 55.38 ? 139  ILE A C   1 
ATOM   1076 O O   . ILE A 1 139 ? 73.602  21.870 31.667 1.00 55.52 ? 139  ILE A O   1 
ATOM   1077 C CB  . ILE A 1 139 ? 72.486  18.984 30.216 1.00 55.60 ? 139  ILE A CB  1 
ATOM   1078 C CG1 . ILE A 1 139 ? 71.315  18.895 29.236 1.00 56.28 ? 139  ILE A CG1 1 
ATOM   1079 C CG2 . ILE A 1 139 ? 72.816  17.612 30.785 1.00 55.49 ? 139  ILE A CG2 1 
ATOM   1080 C CD1 . ILE A 1 139 ? 71.717  18.477 27.839 1.00 57.04 ? 139  ILE A CD1 1 
ATOM   1081 N N   . VAL A 1 140 ? 72.140  21.961 29.959 1.00 55.16 ? 140  VAL A N   1 
ATOM   1082 C CA  . VAL A 1 140 ? 72.689  23.190 29.397 1.00 55.54 ? 140  VAL A CA  1 
ATOM   1083 C C   . VAL A 1 140 ? 72.747  24.296 30.445 1.00 55.90 ? 140  VAL A C   1 
ATOM   1084 O O   . VAL A 1 140 ? 73.756  24.990 30.574 1.00 55.86 ? 140  VAL A O   1 
ATOM   1085 C CB  . VAL A 1 140 ? 71.862  23.678 28.194 1.00 55.46 ? 140  VAL A CB  1 
ATOM   1086 C CG1 . VAL A 1 140 ? 72.432  24.979 27.649 1.00 54.95 ? 140  VAL A CG1 1 
ATOM   1087 C CG2 . VAL A 1 140 ? 71.817  22.612 27.110 1.00 55.61 ? 140  VAL A CG2 1 
ATOM   1088 N N   . VAL A 1 141 ? 71.659  24.455 31.192 1.00 55.98 ? 141  VAL A N   1 
ATOM   1089 C CA  . VAL A 1 141 ? 71.674  25.263 32.406 1.00 55.49 ? 141  VAL A CA  1 
ATOM   1090 C C   . VAL A 1 141 ? 72.897  24.950 33.262 1.00 55.10 ? 141  VAL A C   1 
ATOM   1091 O O   . VAL A 1 141 ? 73.426  25.825 33.947 1.00 55.13 ? 141  VAL A O   1 
ATOM   1092 C CB  . VAL A 1 141 ? 70.402  25.044 33.245 1.00 55.70 ? 141  VAL A CB  1 
ATOM   1093 C CG1 . VAL A 1 141 ? 70.604  25.558 34.662 1.00 56.07 ? 141  VAL A CG1 1 
ATOM   1094 C CG2 . VAL A 1 141 ? 69.208  25.721 32.590 1.00 56.20 ? 141  VAL A CG2 1 
ATOM   1095 N N   . GLU A 1 142 ? 73.340  23.698 33.217 1.00 55.07 ? 142  GLU A N   1 
ATOM   1096 C CA  . GLU A 1 142 ? 74.260  23.175 34.220 1.00 55.26 ? 142  GLU A CA  1 
ATOM   1097 C C   . GLU A 1 142 ? 75.620  22.855 33.608 1.00 55.58 ? 142  GLU A C   1 
ATOM   1098 O O   . GLU A 1 142 ? 76.441  22.172 34.219 1.00 56.13 ? 142  GLU A O   1 
ATOM   1099 C CB  . GLU A 1 142 ? 73.675  21.926 34.883 1.00 55.12 ? 142  GLU A CB  1 
ATOM   1100 C CG  . GLU A 1 142 ? 74.488  21.410 36.059 1.00 56.20 ? 142  GLU A CG  1 
ATOM   1101 C CD  . GLU A 1 142 ? 73.630  20.727 37.106 1.00 56.76 ? 142  GLU A CD  1 
ATOM   1102 O OE1 . GLU A 1 142 ? 73.626  19.479 37.151 1.00 56.33 ? 142  GLU A OE1 1 
ATOM   1103 O OE2 . GLU A 1 142 ? 72.959  21.438 37.883 1.00 55.30 ? 142  GLU A OE2 1 
ATOM   1104 N N   . LEU A 1 143 ? 75.850  23.352 32.397 1.00 55.43 ? 143  LEU A N   1 
ATOM   1105 C CA  . LEU A 1 143 ? 77.202  23.487 31.869 1.00 55.28 ? 143  LEU A CA  1 
ATOM   1106 C C   . LEU A 1 143 ? 77.668  24.939 31.909 1.00 55.24 ? 143  LEU A C   1 
ATOM   1107 O O   . LEU A 1 143 ? 78.681  25.259 32.530 1.00 55.80 ? 143  LEU A O   1 
ATOM   1108 C CB  . LEU A 1 143 ? 77.274  22.952 30.437 1.00 55.10 ? 143  LEU A CB  1 
ATOM   1109 C CG  . LEU A 1 143 ? 77.213  21.431 30.279 1.00 54.88 ? 143  LEU A CG  1 
ATOM   1110 C CD1 . LEU A 1 143 ? 76.904  21.053 28.838 1.00 55.26 ? 143  LEU A CD1 1 
ATOM   1111 C CD2 . LEU A 1 143 ? 78.512  20.789 30.739 1.00 54.70 ? 143  LEU A CD2 1 
ATOM   1112 N N   . LYS A 1 144 ? 76.921  25.813 31.243 1.00 55.02 ? 144  LYS A N   1 
ATOM   1113 C CA  . LYS A 1 144 ? 76.941  27.236 31.559 1.00 55.01 ? 144  LYS A CA  1 
ATOM   1114 C C   . LYS A 1 144 ? 77.323  27.472 33.017 1.00 55.09 ? 144  LYS A C   1 
ATOM   1115 O O   . LYS A 1 144 ? 78.252  28.224 33.311 1.00 55.38 ? 144  LYS A O   1 
ATOM   1116 C CB  . LYS A 1 144 ? 75.581  27.870 31.263 1.00 55.00 ? 144  LYS A CB  1 
ATOM   1117 C CG  . LYS A 1 144 ? 75.500  29.351 31.597 1.00 55.80 ? 144  LYS A CG  1 
ATOM   1118 C CD  . LYS A 1 144 ? 76.758  30.084 31.164 1.00 55.67 ? 144  LYS A CD  1 
ATOM   1119 C CE  . LYS A 1 144 ? 77.040  31.278 32.062 1.00 55.09 ? 144  LYS A CE  1 
ATOM   1120 N NZ  . LYS A 1 144 ? 78.452  31.736 31.951 1.00 55.38 ? 144  LYS A NZ  1 
ATOM   1121 N N   . ASN A 1 145 ? 76.601  26.824 33.925 1.00 55.03 ? 145  ASN A N   1 
ATOM   1122 C CA  . ASN A 1 145 ? 76.840  26.988 35.354 1.00 55.03 ? 145  ASN A CA  1 
ATOM   1123 C C   . ASN A 1 145 ? 78.279  26.660 35.738 1.00 55.05 ? 145  ASN A C   1 
ATOM   1124 O O   . ASN A 1 145 ? 78.979  27.486 36.323 1.00 55.47 ? 145  ASN A O   1 
ATOM   1125 C CB  . ASN A 1 145 ? 75.870  26.123 36.162 1.00 55.31 ? 145  ASN A CB  1 
ATOM   1126 C CG  . ASN A 1 145 ? 74.547  26.817 36.418 1.00 55.39 ? 145  ASN A CG  1 
ATOM   1127 O OD1 . ASN A 1 145 ? 74.267  27.874 35.854 1.00 55.56 ? 145  ASN A OD1 1 
ATOM   1128 N ND2 . ASN A 1 145 ? 73.723  26.222 37.274 1.00 54.21 ? 145  ASN A ND2 1 
ATOM   1129 N N   . GLN A 1 146 ? 78.714  25.449 35.405 1.00 55.19 ? 146  GLN A N   1 
ATOM   1130 C CA  . GLN A 1 146 ? 80.115  25.041 35.623 1.00 55.33 ? 146  GLN A CA  1 
ATOM   1131 C C   . GLN A 1 146 ? 81.109  25.775 34.700 1.00 55.18 ? 146  GLN A C   1 
ATOM   1132 O O   . GLN A 1 146 ? 82.237  25.333 34.548 1.00 54.79 ? 146  GLN A O   1 
ATOM   1133 C CB  . GLN A 1 146 ? 80.272  23.537 35.420 1.00 55.60 ? 146  GLN A CB  1 
ATOM   1134 C CG  . GLN A 1 146 ? 79.011  22.722 35.599 1.00 55.38 ? 146  GLN A CG  1 
ATOM   1135 C CD  . GLN A 1 146 ? 79.316  21.254 35.644 1.00 54.95 ? 146  GLN A CD  1 
ATOM   1136 O OE1 . GLN A 1 146 ? 80.142  20.769 34.870 1.00 53.97 ? 146  GLN A OE1 1 
ATOM   1137 N NE2 . GLN A 1 146 ? 78.655  20.532 36.542 1.00 55.61 ? 146  GLN A NE2 1 
ATOM   1138 N N   . ASN A 1 147 ? 80.655  26.872 34.086 1.00 55.54 ? 147  ASN A N   1 
ATOM   1139 C CA  . ASN A 1 147 ? 81.370  27.585 33.057 1.00 55.66 ? 147  ASN A CA  1 
ATOM   1140 C C   . ASN A 1 147 ? 82.171  26.592 32.200 1.00 55.97 ? 147  ASN A C   1 
ATOM   1141 O O   . ASN A 1 147 ? 83.398  26.455 32.321 1.00 56.55 ? 147  ASN A O   1 
ATOM   1142 C CB  . ASN A 1 147 ? 82.256  28.621 33.727 1.00 56.03 ? 147  ASN A CB  1 
ATOM   1143 C CG  . ASN A 1 147 ? 81.971  30.036 33.222 1.00 56.89 ? 147  ASN A CG  1 
ATOM   1144 O OD1 . ASN A 1 147 ? 82.139  30.314 32.011 1.00 56.69 ? 147  ASN A OD1 1 
ATOM   1145 N ND2 . ASN A 1 147 ? 81.531  30.956 34.158 1.00 56.84 ? 147  ASN A ND2 1 
ATOM   1146 N N   . LYS A 1 148 ? 81.468  25.821 31.391 1.00 55.75 ? 148  LYS A N   1 
ATOM   1147 C CA  . LYS A 1 148 ? 82.126  24.958 30.434 1.00 55.78 ? 148  LYS A CA  1 
ATOM   1148 C C   . LYS A 1 148 ? 81.572  25.266 29.061 1.00 55.83 ? 148  LYS A C   1 
ATOM   1149 O O   . LYS A 1 148 ? 81.868  24.541 28.105 1.00 56.34 ? 148  LYS A O   1 
ATOM   1150 C CB  . LYS A 1 148 ? 81.926  23.459 30.788 1.00 56.12 ? 148  LYS A CB  1 
ATOM   1151 C CG  . LYS A 1 148 ? 82.561  22.953 32.147 1.00 55.95 ? 148  LYS A CG  1 
ATOM   1152 C CD  . LYS A 1 148 ? 82.153  21.466 32.537 1.00 55.52 ? 148  LYS A CD  1 
ATOM   1153 C CE  . LYS A 1 148 ? 82.832  20.403 31.652 1.00 55.82 ? 148  LYS A CE  1 
ATOM   1154 N NZ  . LYS A 1 148 ? 82.752  19.001 32.188 1.00 55.19 ? 148  LYS A NZ  1 
ATOM   1155 N N   . ILE A 1 149 ? 80.782  26.335 28.962 1.00 55.68 ? 149  ILE A N   1 
ATOM   1156 C CA  . ILE A 1 149 ? 80.213  26.799 27.693 1.00 55.85 ? 149  ILE A CA  1 
ATOM   1157 C C   . ILE A 1 149 ? 79.919  28.270 27.860 1.00 55.67 ? 149  ILE A C   1 
ATOM   1158 O O   . ILE A 1 149 ? 79.790  28.749 28.982 1.00 55.60 ? 149  ILE A O   1 
ATOM   1159 C CB  . ILE A 1 149 ? 78.886  26.044 27.367 1.00 56.17 ? 149  ILE A CB  1 
ATOM   1160 C CG1 . ILE A 1 149 ? 77.924  26.076 28.575 1.00 56.35 ? 149  ILE A CG1 1 
ATOM   1161 C CG2 . ILE A 1 149 ? 79.122  24.591 26.913 1.00 55.35 ? 149  ILE A CG2 1 
ATOM   1162 C CD1 . ILE A 1 149 ? 76.509  25.599 28.251 1.00 56.22 ? 149  ILE A CD1 1 
ATOM   1163 N N   . ASP A 1 150 ? 79.782  28.989 26.765 1.00 55.93 ? 150  ASP A N   1 
ATOM   1164 C CA  . ASP A 1 150 ? 79.540  30.451 26.864 1.00 56.07 ? 150  ASP A CA  1 
ATOM   1165 C C   . ASP A 1 150 ? 78.290  30.715 27.621 1.00 56.06 ? 150  ASP A C   1 
ATOM   1166 O O   . ASP A 1 150 ? 78.360  31.271 28.709 1.00 56.60 ? 150  ASP A O   1 
ATOM   1167 C CB  . ASP A 1 150 ? 79.397  31.138 25.499 1.00 56.37 ? 150  ASP A CB  1 
ATOM   1168 C CG  . ASP A 1 150 ? 80.739  31.510 24.865 1.00 57.19 ? 150  ASP A CG  1 
ATOM   1169 O OD1 . ASP A 1 150 ? 80.677  31.922 23.677 1.00 57.20 ? 150  ASP A OD1 1 
ATOM   1170 O OD2 . ASP A 1 150 ? 81.875  31.386 25.438 1.00 56.84 ? 150  ASP A OD2 1 
ATOM   1171 N N   . GLN A 1 151 ? 77.138  30.370 27.042 1.00 56.14 ? 151  GLN A N   1 
ATOM   1172 C CA  . GLN A 1 151 ? 75.851  30.627 27.737 1.00 56.07 ? 151  GLN A CA  1 
ATOM   1173 C C   . GLN A 1 151 ? 74.901  29.432 27.641 1.00 56.08 ? 151  GLN A C   1 
ATOM   1174 O O   . GLN A 1 151 ? 75.129  28.445 26.904 1.00 55.69 ? 151  GLN A O   1 
ATOM   1175 C CB  . GLN A 1 151 ? 75.141  31.969 27.327 1.00 55.53 ? 151  GLN A CB  1 
ATOM   1176 C CG  . GLN A 1 151 ? 74.883  32.135 25.870 1.00 55.64 ? 151  GLN A CG  1 
ATOM   1177 C CD  . GLN A 1 151 ? 76.066  32.762 25.154 1.00 57.24 ? 151  GLN A CD  1 
ATOM   1178 O OE1 . GLN A 1 151 ? 76.037  32.973 23.907 1.00 57.60 ? 151  GLN A OE1 1 
ATOM   1179 N NE2 . GLN A 1 151 ? 77.134  33.068 25.928 1.00 57.60 ? 151  GLN A NE2 1 
ATOM   1180 N N   . ALA A 1 152 ? 73.833  29.570 28.424 1.00 56.13 ? 152  ALA A N   1 
ATOM   1181 C CA  . ALA A 1 152 ? 72.756  28.610 28.498 1.00 55.93 ? 152  ALA A CA  1 
ATOM   1182 C C   . ALA A 1 152 ? 71.769  28.761 27.330 1.00 55.95 ? 152  ALA A C   1 
ATOM   1183 O O   . ALA A 1 152 ? 70.744  29.505 27.405 1.00 55.81 ? 152  ALA A O   1 
ATOM   1184 C CB  . ALA A 1 152 ? 72.037  28.773 29.825 1.00 56.18 ? 152  ALA A CB  1 
ATOM   1185 N N   . LEU A 1 153 ? 72.089  28.060 26.247 1.00 55.53 ? 153  LEU A N   1 
ATOM   1186 C CA  . LEU A 1 153 ? 71.142  27.936 25.152 1.00 55.67 ? 153  LEU A CA  1 
ATOM   1187 C C   . LEU A 1 153 ? 71.564  26.807 24.251 1.00 55.74 ? 153  LEU A C   1 
ATOM   1188 O O   . LEU A 1 153 ? 72.744  26.391 24.280 1.00 55.88 ? 153  LEU A O   1 
ATOM   1189 C CB  . LEU A 1 153 ? 71.009  29.226 24.378 1.00 55.34 ? 153  LEU A CB  1 
ATOM   1190 C CG  . LEU A 1 153 ? 72.272  29.775 23.775 1.00 55.63 ? 153  LEU A CG  1 
ATOM   1191 C CD1 . LEU A 1 153 ? 72.720  29.039 22.567 1.00 55.90 ? 153  LEU A CD1 1 
ATOM   1192 C CD2 . LEU A 1 153 ? 71.971  31.208 23.400 1.00 55.96 ? 153  LEU A CD2 1 
ATOM   1193 N N   . PHE A 1 154 ? 70.600  26.291 23.486 1.00 55.43 ? 154  PHE A N   1 
ATOM   1194 C CA  . PHE A 1 154 ? 70.905  25.283 22.497 1.00 55.53 ? 154  PHE A CA  1 
ATOM   1195 C C   . PHE A 1 154 ? 70.223  25.584 21.151 1.00 55.57 ? 154  PHE A C   1 
ATOM   1196 O O   . PHE A 1 154 ? 69.167  26.184 21.121 1.00 55.94 ? 154  PHE A O   1 
ATOM   1197 C CB  . PHE A 1 154 ? 70.541  23.907 23.037 1.00 55.44 ? 154  PHE A CB  1 
ATOM   1198 C CG  . PHE A 1 154 ? 69.089  23.732 23.365 1.00 55.43 ? 154  PHE A CG  1 
ATOM   1199 C CD1 . PHE A 1 154 ? 68.674  23.589 24.672 1.00 55.49 ? 154  PHE A CD1 1 
ATOM   1200 C CD2 . PHE A 1 154 ? 68.137  23.657 22.355 1.00 55.79 ? 154  PHE A CD2 1 
ATOM   1201 C CE1 . PHE A 1 154 ? 67.346  23.379 24.971 1.00 55.56 ? 154  PHE A CE1 1 
ATOM   1202 C CE2 . PHE A 1 154 ? 66.818  23.462 22.651 1.00 55.23 ? 154  PHE A CE2 1 
ATOM   1203 C CZ  . PHE A 1 154 ? 66.419  23.322 23.969 1.00 55.36 ? 154  PHE A CZ  1 
ATOM   1204 N N   . THR A 1 155 ? 70.814  25.180 20.037 1.00 55.37 ? 155  THR A N   1 
ATOM   1205 C CA  . THR A 1 155 ? 70.182  25.447 18.770 1.00 55.34 ? 155  THR A CA  1 
ATOM   1206 C C   . THR A 1 155 ? 69.944  24.196 18.006 1.00 55.20 ? 155  THR A C   1 
ATOM   1207 O O   . THR A 1 155 ? 70.766  23.256 17.982 1.00 54.67 ? 155  THR A O   1 
ATOM   1208 C CB  . THR A 1 155 ? 70.984  26.439 17.908 1.00 55.88 ? 155  THR A CB  1 
ATOM   1209 O OG1 . THR A 1 155 ? 72.300  25.951 17.517 1.00 56.07 ? 155  THR A OG1 1 
ATOM   1210 C CG2 . THR A 1 155 ? 71.242  27.675 18.679 1.00 56.27 ? 155  THR A CG2 1 
ATOM   1211 N N   . PHE A 1 156 ? 68.788  24.204 17.368 1.00 55.27 ? 156  PHE A N   1 
ATOM   1212 C CA  . PHE A 1 156 ? 68.364  23.088 16.568 1.00 55.37 ? 156  PHE A CA  1 
ATOM   1213 C C   . PHE A 1 156 ? 68.384  23.473 15.141 1.00 55.17 ? 156  PHE A C   1 
ATOM   1214 O O   . PHE A 1 156 ? 67.600  24.302 14.713 1.00 55.42 ? 156  PHE A O   1 
ATOM   1215 C CB  . PHE A 1 156 ? 66.980  22.599 16.994 1.00 55.32 ? 156  PHE A CB  1 
ATOM   1216 C CG  . PHE A 1 156 ? 67.042  21.375 17.872 1.00 55.07 ? 156  PHE A CG  1 
ATOM   1217 C CD1 . PHE A 1 156 ? 66.881  21.456 19.231 1.00 54.41 ? 156  PHE A CD1 1 
ATOM   1218 C CD2 . PHE A 1 156 ? 67.324  20.140 17.325 1.00 54.95 ? 156  PHE A CD2 1 
ATOM   1219 C CE1 . PHE A 1 156 ? 66.959  20.324 20.015 1.00 54.98 ? 156  PHE A CE1 1 
ATOM   1220 C CE2 . PHE A 1 156 ? 67.409  19.028 18.109 1.00 55.17 ? 156  PHE A CE2 1 
ATOM   1221 C CZ  . PHE A 1 156 ? 67.228  19.126 19.458 1.00 55.37 ? 156  PHE A CZ  1 
ATOM   1222 N N   . TYR A 1 157 ? 69.364  22.898 14.393 1.00 55.37 ? 157  TYR A N   1 
ATOM   1223 C CA  . TYR A 1 157 ? 69.458  23.204 12.979 1.00 55.67 ? 157  TYR A CA  1 
ATOM   1224 C C   . TYR A 1 157 ? 69.066  21.960 12.186 1.00 55.77 ? 157  TYR A C   1 
ATOM   1225 O O   . TYR A 1 157 ? 69.649  20.887 12.293 1.00 54.71 ? 157  TYR A O   1 
ATOM   1226 C CB  . TYR A 1 157 ? 70.852  23.701 12.578 1.00 55.57 ? 157  TYR A CB  1 
ATOM   1227 C CG  . TYR A 1 157 ? 71.035  23.666 11.087 1.00 55.49 ? 157  TYR A CG  1 
ATOM   1228 C CD1 . TYR A 1 157 ? 70.158  24.327 10.265 1.00 54.69 ? 157  TYR A CD1 1 
ATOM   1229 C CD2 . TYR A 1 157 ? 72.069  22.947 10.517 1.00 56.06 ? 157  TYR A CD2 1 
ATOM   1230 C CE1 . TYR A 1 157 ? 70.296  24.249 8.883  1.00 54.54 ? 157  TYR A CE1 1 
ATOM   1231 C CE2 . TYR A 1 157 ? 72.207  22.854 9.160  1.00 55.20 ? 157  TYR A CE2 1 
ATOM   1232 C CZ  . TYR A 1 157 ? 71.324  23.484 8.335  1.00 54.50 ? 157  TYR A CZ  1 
ATOM   1233 O OH  . TYR A 1 157 ? 71.461  23.375 6.968  1.00 55.16 ? 157  TYR A OH  1 
ATOM   1234 N N   . LEU A 1 158 ? 68.030  22.176 11.369 1.00 56.26 ? 158  LEU A N   1 
ATOM   1235 C CA  . LEU A 1 158 ? 67.442  21.130 10.567 1.00 56.06 ? 158  LEU A CA  1 
ATOM   1236 C C   . LEU A 1 158 ? 67.357  21.322 9.059  1.00 55.89 ? 158  LEU A C   1 
ATOM   1237 O O   . LEU A 1 158 ? 67.068  22.385 8.500  1.00 55.37 ? 158  LEU A O   1 
ATOM   1238 C CB  . LEU A 1 158 ? 66.086  20.751 11.150 1.00 55.88 ? 158  LEU A CB  1 
ATOM   1239 C CG  . LEU A 1 158 ? 66.149  19.632 12.192 1.00 55.35 ? 158  LEU A CG  1 
ATOM   1240 C CD1 . LEU A 1 158 ? 64.756  19.322 12.717 1.00 55.03 ? 158  LEU A CD1 1 
ATOM   1241 C CD2 . LEU A 1 158 ? 66.789  18.383 11.615 1.00 54.84 ? 158  LEU A CD2 1 
ATOM   1242 N N   . PRO A 1 159 ? 67.615  20.245 8.325  1.00 56.02 ? 159  PRO A N   1 
ATOM   1243 C CA  . PRO A 1 159 ? 67.841  20.381 6.876  1.00 56.23 ? 159  PRO A CA  1 
ATOM   1244 C C   . PRO A 1 159 ? 66.706  19.827 6.007  1.00 56.60 ? 159  PRO A C   1 
ATOM   1245 O O   . PRO A 1 159 ? 65.916  20.578 5.434  1.00 56.67 ? 159  PRO A O   1 
ATOM   1246 C CB  . PRO A 1 159 ? 69.126  19.578 6.645  1.00 56.48 ? 159  PRO A CB  1 
ATOM   1247 C CG  . PRO A 1 159 ? 69.243  18.686 7.835  1.00 56.49 ? 159  PRO A CG  1 
ATOM   1248 C CD  . PRO A 1 159 ? 68.678  19.467 8.980  1.00 55.60 ? 159  PRO A CD  1 
ATOM   1249 N N   . VAL A 1 160 ? 66.651  18.504 5.927  1.00 56.70 ? 160  VAL A N   1 
ATOM   1250 C CA  . VAL A 1 160 ? 65.904  17.762 4.957  1.00 56.75 ? 160  VAL A CA  1 
ATOM   1251 C C   . VAL A 1 160 ? 66.496  16.330 5.046  1.00 57.08 ? 160  VAL A C   1 
ATOM   1252 O O   . VAL A 1 160 ? 67.039  15.970 6.099  1.00 57.18 ? 160  VAL A O   1 
ATOM   1253 C CB  . VAL A 1 160 ? 66.146  18.368 3.552  1.00 56.85 ? 160  VAL A CB  1 
ATOM   1254 C CG1 . VAL A 1 160 ? 64.833  18.735 2.884  1.00 56.46 ? 160  VAL A CG1 1 
ATOM   1255 C CG2 . VAL A 1 160 ? 67.035  19.592 3.646  1.00 56.44 ? 160  VAL A CG2 1 
ATOM   1256 N N   . HIS A 1 161 ? 66.377  15.535 3.989  1.00 57.18 ? 161  HIS A N   1 
ATOM   1257 C CA  . HIS A 1 161 ? 66.753  14.126 4.077  1.00 56.82 ? 161  HIS A CA  1 
ATOM   1258 C C   . HIS A 1 161 ? 68.053  13.711 3.401  1.00 56.75 ? 161  HIS A C   1 
ATOM   1259 O O   . HIS A 1 161 ? 69.143  13.977 3.910  1.00 56.20 ? 161  HIS A O   1 
ATOM   1260 C CB  . HIS A 1 161 ? 65.627  13.219 3.580  1.00 56.83 ? 161  HIS A CB  1 
ATOM   1261 C CG  . HIS A 1 161 ? 65.964  11.761 3.635  1.00 58.11 ? 161  HIS A CG  1 
ATOM   1262 N ND1 . HIS A 1 161 ? 65.155  10.787 3.092  1.00 58.29 ? 161  HIS A ND1 1 
ATOM   1263 C CD2 . HIS A 1 161 ? 67.026  11.112 4.170  1.00 58.76 ? 161  HIS A CD2 1 
ATOM   1264 C CE1 . HIS A 1 161 ? 65.703  9.601  3.290  1.00 57.76 ? 161  HIS A CE1 1 
ATOM   1265 N NE2 . HIS A 1 161 ? 66.839  9.770  3.942  1.00 58.03 ? 161  HIS A NE2 1 
ATOM   1266 N N   . ASP A 1 162 ? 67.931  13.050 2.254  1.00 57.13 ? 162  ASP A N   1 
ATOM   1267 C CA  . ASP A 1 162 ? 69.043  12.847 1.334  1.00 57.30 ? 162  ASP A CA  1 
ATOM   1268 C C   . ASP A 1 162 ? 70.001  14.032 1.364  1.00 57.26 ? 162  ASP A C   1 
ATOM   1269 O O   . ASP A 1 162 ? 71.195  13.885 1.105  1.00 57.92 ? 162  ASP A O   1 
ATOM   1270 C CB  . ASP A 1 162 ? 68.524  12.628 -0.089 1.00 57.09 ? 162  ASP A CB  1 
ATOM   1271 C CG  . ASP A 1 162 ? 67.866  11.274 -0.268 1.00 56.88 ? 162  ASP A CG  1 
ATOM   1272 O OD1 . ASP A 1 162 ? 68.020  10.414 0.625  1.00 57.10 ? 162  ASP A OD1 1 
ATOM   1273 O OD2 . ASP A 1 162 ? 67.176  10.980 -1.266 1.00 57.26 ? 162  ASP A OD2 1 
ATOM   1274 N N   . LYS A 1 163 ? 69.469  15.207 1.684  1.00 57.32 ? 163  LYS A N   1 
ATOM   1275 C CA  . LYS A 1 163 ? 70.210  16.453 1.536  1.00 57.31 ? 163  LYS A CA  1 
ATOM   1276 C C   . LYS A 1 163 ? 71.470  16.460 2.397  1.00 57.66 ? 163  LYS A C   1 
ATOM   1277 O O   . LYS A 1 163 ? 72.586  16.471 1.879  1.00 57.41 ? 163  LYS A O   1 
ATOM   1278 C CB  . LYS A 1 163 ? 69.323  17.649 1.887  1.00 57.24 ? 163  LYS A CB  1 
ATOM   1279 C CG  . LYS A 1 163 ? 67.930  17.586 1.281  1.00 57.31 ? 163  LYS A CG  1 
ATOM   1280 C CD  . LYS A 1 163 ? 67.820  18.479 0.056  1.00 57.10 ? 163  LYS A CD  1 
ATOM   1281 C CE  . LYS A 1 163 ? 66.552  18.186 -0.730 1.00 57.12 ? 163  LYS A CE  1 
ATOM   1282 N NZ  . LYS A 1 163 ? 65.885  19.433 -1.196 1.00 56.90 ? 163  LYS A NZ  1 
ATOM   1283 N N   . HIS A 1 164 ? 71.284  16.454 3.714  1.00 57.48 ? 164  HIS A N   1 
ATOM   1284 C CA  . HIS A 1 164 ? 72.367  16.764 4.640  1.00 57.30 ? 164  HIS A CA  1 
ATOM   1285 C C   . HIS A 1 164 ? 72.064  16.255 6.046  1.00 56.86 ? 164  HIS A C   1 
ATOM   1286 O O   . HIS A 1 164 ? 71.467  15.192 6.215  1.00 56.93 ? 164  HIS A O   1 
ATOM   1287 C CB  . HIS A 1 164 ? 72.630  18.271 4.672  1.00 57.51 ? 164  HIS A CB  1 
ATOM   1288 C CG  . HIS A 1 164 ? 73.418  18.770 3.501  1.00 57.90 ? 164  HIS A CG  1 
ATOM   1289 N ND1 . HIS A 1 164 ? 74.792  18.678 3.435  1.00 58.30 ? 164  HIS A ND1 1 
ATOM   1290 C CD2 . HIS A 1 164 ? 73.025  19.367 2.351  1.00 56.99 ? 164  HIS A CD2 1 
ATOM   1291 C CE1 . HIS A 1 164 ? 75.211  19.196 2.294  1.00 57.99 ? 164  HIS A CE1 1 
ATOM   1292 N NE2 . HIS A 1 164 ? 74.159  19.621 1.618  1.00 58.41 ? 164  HIS A NE2 1 
ATOM   1293 N N   . SER A 1 165 ? 72.481  17.019 7.050  1.00 56.21 ? 165  SER A N   1 
ATOM   1294 C CA  . SER A 1 165 ? 72.608  16.496 8.405  1.00 56.20 ? 165  SER A CA  1 
ATOM   1295 C C   . SER A 1 165 ? 72.134  17.495 9.457  1.00 55.93 ? 165  SER A C   1 
ATOM   1296 O O   . SER A 1 165 ? 72.394  18.693 9.357  1.00 54.79 ? 165  SER A O   1 
ATOM   1297 C CB  . SER A 1 165 ? 74.050  16.070 8.688  1.00 56.18 ? 165  SER A CB  1 
ATOM   1298 O OG  . SER A 1 165 ? 74.090  14.812 9.339  1.00 56.49 ? 165  SER A OG  1 
ATOM   1299 N N   . GLY A 1 166 ? 71.437  16.983 10.466 1.00 56.30 ? 166  GLY A N   1 
ATOM   1300 C CA  . GLY A 1 166 ? 70.910  17.795 11.541 1.00 56.33 ? 166  GLY A CA  1 
ATOM   1301 C C   . GLY A 1 166 ? 72.019  18.245 12.466 1.00 56.34 ? 166  GLY A C   1 
ATOM   1302 O O   . GLY A 1 166 ? 73.095  17.640 12.525 1.00 55.89 ? 166  GLY A O   1 
ATOM   1303 N N   . TYR A 1 167 ? 71.768  19.332 13.196 1.00 55.77 ? 167  TYR A N   1 
ATOM   1304 C CA  . TYR A 1 167 ? 72.826  19.859 14.057 1.00 55.20 ? 167  TYR A CA  1 
ATOM   1305 C C   . TYR A 1 167 ? 72.332  20.557 15.287 1.00 55.14 ? 167  TYR A C   1 
ATOM   1306 O O   . TYR A 1 167 ? 71.735  21.638 15.229 1.00 55.49 ? 167  TYR A O   1 
ATOM   1307 C CB  . TYR A 1 167 ? 73.678  20.854 13.289 1.00 55.05 ? 167  TYR A CB  1 
ATOM   1308 C CG  . TYR A 1 167 ? 74.698  20.170 12.448 1.00 54.84 ? 167  TYR A CG  1 
ATOM   1309 C CD1 . TYR A 1 167 ? 74.803  20.454 11.112 1.00 55.16 ? 167  TYR A CD1 1 
ATOM   1310 C CD2 . TYR A 1 167 ? 75.540  19.221 13.013 1.00 54.18 ? 167  TYR A CD2 1 
ATOM   1311 C CE1 . TYR A 1 167 ? 75.717  19.819 10.343 1.00 55.33 ? 167  TYR A CE1 1 
ATOM   1312 C CE2 . TYR A 1 167 ? 76.481  18.567 12.222 1.00 54.21 ? 167  TYR A CE2 1 
ATOM   1313 C CZ  . TYR A 1 167 ? 76.535  18.899 10.880 1.00 54.65 ? 167  TYR A CZ  1 
ATOM   1314 O OH  . TYR A 1 167 ? 77.443  18.238 10.077 1.00 54.63 ? 167  TYR A OH  1 
ATOM   1315 N N   . LEU A 1 168 ? 72.609  19.919 16.413 1.00 55.04 ? 168  LEU A N   1 
ATOM   1316 C CA  . LEU A 1 168 ? 72.314  20.476 17.698 1.00 54.95 ? 168  LEU A CA  1 
ATOM   1317 C C   . LEU A 1 168 ? 73.521  21.176 18.192 1.00 54.87 ? 168  LEU A C   1 
ATOM   1318 O O   . LEU A 1 168 ? 74.540  20.538 18.393 1.00 54.57 ? 168  LEU A O   1 
ATOM   1319 C CB  . LEU A 1 168 ? 72.037  19.366 18.676 1.00 55.16 ? 168  LEU A CB  1 
ATOM   1320 C CG  . LEU A 1 168 ? 72.273  19.764 20.147 1.00 55.54 ? 168  LEU A CG  1 
ATOM   1321 C CD1 . LEU A 1 168 ? 71.350  20.938 20.592 1.00 55.76 ? 168  LEU A CD1 1 
ATOM   1322 C CD2 . LEU A 1 168 ? 72.048  18.573 21.030 1.00 55.08 ? 168  LEU A CD2 1 
ATOM   1323 N N   . THR A 1 169 ? 73.418  22.468 18.445 1.00 55.25 ? 169  THR A N   1 
ATOM   1324 C CA  . THR A 1 169 ? 74.561  23.223 18.970 1.00 55.14 ? 169  THR A CA  1 
ATOM   1325 C C   . THR A 1 169 ? 74.289  23.781 20.335 1.00 54.99 ? 169  THR A C   1 
ATOM   1326 O O   . THR A 1 169 ? 73.316  24.500 20.529 1.00 55.03 ? 169  THR A O   1 
ATOM   1327 C CB  . THR A 1 169 ? 74.849  24.405 18.088 1.00 55.36 ? 169  THR A CB  1 
ATOM   1328 O OG1 . THR A 1 169 ? 75.195  23.968 16.776 1.00 55.86 ? 169  THR A OG1 1 
ATOM   1329 C CG2 . THR A 1 169 ? 76.084  25.127 18.581 1.00 55.51 ? 169  THR A CG2 1 
ATOM   1330 N N   . ILE A 1 170 ? 75.200  23.540 21.262 1.00 55.15 ? 170  ILE A N   1 
ATOM   1331 C CA  . ILE A 1 170 ? 75.106  24.110 22.621 1.00 55.12 ? 170  ILE A CA  1 
ATOM   1332 C C   . ILE A 1 170 ? 76.199  25.199 22.942 1.00 55.22 ? 170  ILE A C   1 
ATOM   1333 O O   . ILE A 1 170 ? 77.429  25.019 22.749 1.00 54.25 ? 170  ILE A O   1 
ATOM   1334 C CB  . ILE A 1 170 ? 75.226  23.024 23.614 1.00 54.74 ? 170  ILE A CB  1 
ATOM   1335 C CG1 . ILE A 1 170 ? 74.632  21.744 23.088 1.00 54.64 ? 170  ILE A CG1 1 
ATOM   1336 C CG2 . ILE A 1 170 ? 74.571  23.442 24.834 1.00 55.62 ? 170  ILE A CG2 1 
ATOM   1337 C CD1 . ILE A 1 170 ? 74.803  20.609 24.034 1.00 55.14 ? 170  ILE A CD1 1 
ATOM   1338 N N   . GLY A 1 171 ? 75.725  26.342 23.404 1.00 55.25 ? 171  GLY A N   1 
ATOM   1339 C CA  . GLY A 1 171 ? 76.614  27.436 23.725 1.00 55.67 ? 171  GLY A CA  1 
ATOM   1340 C C   . GLY A 1 171 ? 76.655  28.652 22.797 1.00 55.81 ? 171  GLY A C   1 
ATOM   1341 O O   . GLY A 1 171 ? 77.300  29.677 23.170 1.00 55.65 ? 171  GLY A O   1 
ATOM   1342 N N   . GLY A 1 172 ? 76.043  28.561 21.607 1.00 55.23 ? 172  GLY A N   1 
ATOM   1343 C CA  . GLY A 1 172 ? 76.070  29.702 20.713 1.00 55.56 ? 172  GLY A CA  1 
ATOM   1344 C C   . GLY A 1 172 ? 75.307  29.672 19.397 1.00 55.91 ? 172  GLY A C   1 
ATOM   1345 O O   . GLY A 1 172 ? 75.094  28.626 18.782 1.00 56.69 ? 172  GLY A O   1 
ATOM   1346 N N   . ILE A 1 173 ? 74.896  30.856 18.953 1.00 55.73 ? 173  ILE A N   1 
ATOM   1347 C CA  . ILE A 1 173 ? 74.313  31.019 17.648 1.00 55.41 ? 173  ILE A CA  1 
ATOM   1348 C C   . ILE A 1 173 ? 75.448  30.941 16.623 1.00 55.35 ? 173  ILE A C   1 
ATOM   1349 O O   . ILE A 1 173 ? 76.430  31.672 16.706 1.00 55.36 ? 173  ILE A O   1 
ATOM   1350 C CB  . ILE A 1 173 ? 73.567  32.387 17.513 1.00 55.33 ? 173  ILE A CB  1 
ATOM   1351 C CG1 . ILE A 1 173 ? 72.320  32.436 18.335 1.00 54.49 ? 173  ILE A CG1 1 
ATOM   1352 C CG2 . ILE A 1 173 ? 73.114  32.602 16.065 1.00 56.06 ? 173  ILE A CG2 1 
ATOM   1353 C CD1 . ILE A 1 173 ? 72.578  32.423 19.721 1.00 55.14 ? 173  ILE A CD1 1 
ATOM   1354 N N   . GLU A 1 174 ? 75.288  30.065 15.653 1.00 55.20 ? 174  GLU A N   1 
ATOM   1355 C CA  . GLU A 1 174 ? 76.205  29.982 14.566 1.00 55.47 ? 174  GLU A CA  1 
ATOM   1356 C C   . GLU A 1 174 ? 75.493  30.418 13.316 1.00 55.35 ? 174  GLU A C   1 
ATOM   1357 O O   . GLU A 1 174 ? 74.551  29.794 12.886 1.00 55.12 ? 174  GLU A O   1 
ATOM   1358 C CB  . GLU A 1 174 ? 76.642  28.553 14.437 1.00 55.77 ? 174  GLU A CB  1 
ATOM   1359 C CG  . GLU A 1 174 ? 77.384  27.996 15.642 1.00 56.04 ? 174  GLU A CG  1 
ATOM   1360 C CD  . GLU A 1 174 ? 78.866  28.010 15.407 1.00 56.78 ? 174  GLU A CD  1 
ATOM   1361 O OE1 . GLU A 1 174 ? 79.440  29.127 15.480 1.00 57.60 ? 174  GLU A OE1 1 
ATOM   1362 O OE2 . GLU A 1 174 ? 79.421  26.920 15.090 1.00 56.21 ? 174  GLU A OE2 1 
ATOM   1363 N N   . GLU A 1 175 ? 75.939  31.508 12.733 1.00 55.54 ? 175  GLU A N   1 
ATOM   1364 C CA  . GLU A 1 175 ? 75.243  32.073 11.581 1.00 55.50 ? 175  GLU A CA  1 
ATOM   1365 C C   . GLU A 1 175 ? 75.322  31.155 10.336 1.00 55.49 ? 175  GLU A C   1 
ATOM   1366 O O   . GLU A 1 175 ? 74.473  31.216 9.399  1.00 54.78 ? 175  GLU A O   1 
ATOM   1367 C CB  . GLU A 1 175 ? 75.801  33.446 11.272 1.00 55.44 ? 175  GLU A CB  1 
ATOM   1368 C CG  . GLU A 1 175 ? 75.905  34.363 12.454 1.00 55.06 ? 175  GLU A CG  1 
ATOM   1369 C CD  . GLU A 1 175 ? 76.420  35.707 12.024 1.00 55.39 ? 175  GLU A CD  1 
ATOM   1370 O OE1 . GLU A 1 175 ? 75.790  36.345 11.156 1.00 55.16 ? 175  GLU A OE1 1 
ATOM   1371 O OE2 . GLU A 1 175 ? 77.458  36.132 12.552 1.00 56.39 ? 175  GLU A OE2 1 
ATOM   1372 N N   . LYS A 1 176 ? 76.340  30.301 10.348 1.00 55.09 ? 176  LYS A N   1 
ATOM   1373 C CA  . LYS A 1 176 ? 76.445  29.254 9.375  1.00 55.20 ? 176  LYS A CA  1 
ATOM   1374 C C   . LYS A 1 176 ? 75.170  28.520 9.173  1.00 55.60 ? 176  LYS A C   1 
ATOM   1375 O O   . LYS A 1 176 ? 75.131  27.663 8.319  1.00 56.43 ? 176  LYS A O   1 
ATOM   1376 C CB  . LYS A 1 176 ? 77.476  28.229 9.794  1.00 54.94 ? 176  LYS A CB  1 
ATOM   1377 C CG  . LYS A 1 176 ? 77.752  28.210 11.256 1.00 55.53 ? 176  LYS A CG  1 
ATOM   1378 C CD  . LYS A 1 176 ? 78.660  27.037 11.758 1.00 55.57 ? 176  LYS A CD  1 
ATOM   1379 C CE  . LYS A 1 176 ? 79.704  26.571 10.785 1.00 54.95 ? 176  LYS A CE  1 
ATOM   1380 N NZ  . LYS A 1 176 ? 78.948  25.637 9.881  1.00 55.89 ? 176  LYS A NZ  1 
ATOM   1381 N N   . PHE A 1 177 ? 74.136  28.796 9.973  1.00 55.97 ? 177  PHE A N   1 
ATOM   1382 C CA  . PHE A 1 177 ? 72.899  28.009 9.951  1.00 55.52 ? 177  PHE A CA  1 
ATOM   1383 C C   . PHE A 1 177 ? 71.659  28.717 9.434  1.00 55.67 ? 177  PHE A C   1 
ATOM   1384 O O   . PHE A 1 177 ? 70.720  28.069 8.996  1.00 55.55 ? 177  PHE A O   1 
ATOM   1385 C CB  . PHE A 1 177 ? 72.590  27.491 11.353 1.00 55.40 ? 177  PHE A CB  1 
ATOM   1386 C CG  . PHE A 1 177 ? 73.576  26.485 11.892 1.00 54.71 ? 177  PHE A CG  1 
ATOM   1387 C CD1 . PHE A 1 177 ? 73.918  26.478 13.211 1.00 54.88 ? 177  PHE A CD1 1 
ATOM   1388 C CD2 . PHE A 1 177 ? 74.124  25.538 11.106 1.00 55.67 ? 177  PHE A CD2 1 
ATOM   1389 C CE1 . PHE A 1 177 ? 74.814  25.564 13.706 1.00 55.32 ? 177  PHE A CE1 1 
ATOM   1390 C CE2 . PHE A 1 177 ? 75.032  24.623 11.610 1.00 55.27 ? 177  PHE A CE2 1 
ATOM   1391 C CZ  . PHE A 1 177 ? 75.378  24.650 12.892 1.00 54.92 ? 177  PHE A CZ  1 
ATOM   1392 N N   . TYR A 1 178 ? 71.614  30.036 9.486  1.00 55.90 ? 178  TYR A N   1 
ATOM   1393 C CA  . TYR A 1 178 ? 70.363  30.712 9.136  1.00 55.79 ? 178  TYR A CA  1 
ATOM   1394 C C   . TYR A 1 178 ? 70.502  31.879 8.141  1.00 55.72 ? 178  TYR A C   1 
ATOM   1395 O O   . TYR A 1 178 ? 71.601  32.377 7.859  1.00 55.62 ? 178  TYR A O   1 
ATOM   1396 C CB  . TYR A 1 178 ? 69.679  31.170 10.407 1.00 55.49 ? 178  TYR A CB  1 
ATOM   1397 C CG  . TYR A 1 178 ? 70.492  32.155 11.182 1.00 55.81 ? 178  TYR A CG  1 
ATOM   1398 C CD1 . TYR A 1 178 ? 70.215  33.510 11.118 1.00 56.07 ? 178  TYR A CD1 1 
ATOM   1399 C CD2 . TYR A 1 178 ? 71.561  31.750 11.975 1.00 56.49 ? 178  TYR A CD2 1 
ATOM   1400 C CE1 . TYR A 1 178 ? 70.967  34.448 11.838 1.00 55.54 ? 178  TYR A CE1 1 
ATOM   1401 C CE2 . TYR A 1 178 ? 72.311  32.690 12.733 1.00 56.28 ? 178  TYR A CE2 1 
ATOM   1402 C CZ  . TYR A 1 178 ? 71.996  34.034 12.648 1.00 55.71 ? 178  TYR A CZ  1 
ATOM   1403 O OH  . TYR A 1 178 ? 72.669  34.999 13.359 1.00 55.55 ? 178  TYR A OH  1 
ATOM   1404 N N   . GLU A 1 179 ? 69.358  32.292 7.612  1.00 55.57 ? 179  GLU A N   1 
ATOM   1405 C CA  . GLU A 1 179 ? 69.257  33.438 6.726  1.00 55.93 ? 179  GLU A CA  1 
ATOM   1406 C C   . GLU A 1 179 ? 68.258  34.479 7.214  1.00 56.18 ? 179  GLU A C   1 
ATOM   1407 O O   . GLU A 1 179 ? 67.164  34.135 7.737  1.00 56.80 ? 179  GLU A O   1 
ATOM   1408 C CB  . GLU A 1 179 ? 68.786  32.962 5.385  1.00 56.00 ? 179  GLU A CB  1 
ATOM   1409 C CG  . GLU A 1 179 ? 69.809  32.089 4.707  1.00 56.46 ? 179  GLU A CG  1 
ATOM   1410 C CD  . GLU A 1 179 ? 69.325  31.595 3.349  1.00 56.77 ? 179  GLU A CD  1 
ATOM   1411 O OE1 . GLU A 1 179 ? 70.143  30.835 2.781  1.00 57.08 ? 179  GLU A OE1 1 
ATOM   1412 O OE2 . GLU A 1 179 ? 68.165  31.932 2.863  1.00 56.26 ? 179  GLU A OE2 1 
ATOM   1413 N N   . GLY A 1 180 ? 68.605  35.748 7.025  1.00 55.91 ? 180  GLY A N   1 
ATOM   1414 C CA  . GLY A 1 180 ? 67.802  36.806 7.583  1.00 55.92 ? 180  GLY A CA  1 
ATOM   1415 C C   . GLY A 1 180 ? 68.283  37.091 9.005  1.00 55.93 ? 180  GLY A C   1 
ATOM   1416 O O   . GLY A 1 180 ? 69.387  36.659 9.461  1.00 54.33 ? 180  GLY A O   1 
ATOM   1417 N N   . GLU A 1 181 ? 67.423  37.849 9.682  1.00 56.50 ? 181  GLU A N   1 
ATOM   1418 C CA  . GLU A 1 181 ? 67.636  38.279 11.053 1.00 56.82 ? 181  GLU A CA  1 
ATOM   1419 C C   . GLU A 1 181 ? 66.667  37.438 11.999 1.00 56.68 ? 181  GLU A C   1 
ATOM   1420 O O   . GLU A 1 181 ? 65.540  37.062 11.591 1.00 56.61 ? 181  GLU A O   1 
ATOM   1421 C CB  . GLU A 1 181 ? 67.432  39.824 11.131 1.00 56.84 ? 181  GLU A CB  1 
ATOM   1422 C CG  . GLU A 1 181 ? 68.529  40.612 10.391 1.00 57.54 ? 181  GLU A CG  1 
ATOM   1423 C CD  . GLU A 1 181 ? 68.379  42.139 10.415 1.00 58.17 ? 181  GLU A CD  1 
ATOM   1424 O OE1 . GLU A 1 181 ? 68.290  42.794 11.520 1.00 58.19 ? 181  GLU A OE1 1 
ATOM   1425 O OE2 . GLU A 1 181 ? 68.279  42.682 9.264  1.00 60.14 ? 181  GLU A OE2 1 
ATOM   1426 N N   . LEU A 1 182 ? 67.116  37.157 13.230 1.00 56.35 ? 182  LEU A N   1 
ATOM   1427 C CA  . LEU A 1 182 ? 66.335  36.337 14.168 1.00 56.27 ? 182  LEU A CA  1 
ATOM   1428 C C   . LEU A 1 182 ? 65.294  37.223 14.857 1.00 56.31 ? 182  LEU A C   1 
ATOM   1429 O O   . LEU A 1 182 ? 65.489  38.431 15.051 1.00 56.29 ? 182  LEU A O   1 
ATOM   1430 C CB  . LEU A 1 182 ? 67.173  35.665 15.279 1.00 56.13 ? 182  LEU A CB  1 
ATOM   1431 C CG  . LEU A 1 182 ? 68.327  34.759 14.896 1.00 55.95 ? 182  LEU A CG  1 
ATOM   1432 C CD1 . LEU A 1 182 ? 69.418  35.624 14.331 1.00 57.40 ? 182  LEU A CD1 1 
ATOM   1433 C CD2 . LEU A 1 182 ? 68.878  34.028 16.085 1.00 55.79 ? 182  LEU A CD2 1 
ATOM   1434 N N   . THR A 1 183 ? 64.189  36.583 15.210 1.00 56.14 ? 183  THR A N   1 
ATOM   1435 C CA  . THR A 1 183 ? 63.137  37.183 15.987 1.00 55.96 ? 183  THR A CA  1 
ATOM   1436 C C   . THR A 1 183 ? 62.989  36.233 17.158 1.00 56.39 ? 183  THR A C   1 
ATOM   1437 O O   . THR A 1 183 ? 63.372  35.052 17.059 1.00 57.02 ? 183  THR A O   1 
ATOM   1438 C CB  . THR A 1 183 ? 61.865  37.265 15.177 1.00 55.66 ? 183  THR A CB  1 
ATOM   1439 O OG1 . THR A 1 183 ? 61.791  36.148 14.241 1.00 55.48 ? 183  THR A OG1 1 
ATOM   1440 C CG2 . THR A 1 183 ? 61.911  38.507 14.335 1.00 55.59 ? 183  THR A CG2 1 
ATOM   1441 N N   . TYR A 1 184 ? 62.496  36.753 18.276 1.00 56.17 ? 184  TYR A N   1 
ATOM   1442 C CA  . TYR A 1 184 ? 62.354  35.954 19.443 1.00 55.54 ? 184  TYR A CA  1 
ATOM   1443 C C   . TYR A 1 184 ? 60.971  36.059 19.952 1.00 55.31 ? 184  TYR A C   1 
ATOM   1444 O O   . TYR A 1 184 ? 60.258  37.017 19.643 1.00 54.97 ? 184  TYR A O   1 
ATOM   1445 C CB  . TYR A 1 184 ? 63.276  36.445 20.504 1.00 55.72 ? 184  TYR A CB  1 
ATOM   1446 C CG  . TYR A 1 184 ? 64.724  36.372 20.153 1.00 55.50 ? 184  TYR A CG  1 
ATOM   1447 C CD1 . TYR A 1 184 ? 65.237  37.172 19.155 1.00 56.23 ? 184  TYR A CD1 1 
ATOM   1448 C CD2 . TYR A 1 184 ? 65.601  35.536 20.876 1.00 56.04 ? 184  TYR A CD2 1 
ATOM   1449 C CE1 . TYR A 1 184 ? 66.606  37.151 18.834 1.00 57.60 ? 184  TYR A CE1 1 
ATOM   1450 C CE2 . TYR A 1 184 ? 66.984  35.495 20.604 1.00 56.35 ? 184  TYR A CE2 1 
ATOM   1451 C CZ  . TYR A 1 184 ? 67.489  36.329 19.561 1.00 57.75 ? 184  TYR A CZ  1 
ATOM   1452 O OH  . TYR A 1 184 ? 68.833  36.397 19.179 1.00 57.12 ? 184  TYR A OH  1 
ATOM   1453 N N   . GLU A 1 185 ? 60.621  35.052 20.747 1.00 55.28 ? 185  GLU A N   1 
ATOM   1454 C CA  . GLU A 1 185 ? 59.386  35.024 21.481 1.00 55.05 ? 185  GLU A CA  1 
ATOM   1455 C C   . GLU A 1 185 ? 59.755  34.643 22.874 1.00 54.77 ? 185  GLU A C   1 
ATOM   1456 O O   . GLU A 1 185 ? 60.596  33.767 23.065 1.00 53.91 ? 185  GLU A O   1 
ATOM   1457 C CB  . GLU A 1 185 ? 58.467  33.973 20.901 1.00 55.37 ? 185  GLU A CB  1 
ATOM   1458 C CG  . GLU A 1 185 ? 58.133  34.123 19.427 1.00 55.27 ? 185  GLU A CG  1 
ATOM   1459 C CD  . GLU A 1 185 ? 57.495  35.435 19.143 1.00 55.34 ? 185  GLU A CD  1 
ATOM   1460 O OE1 . GLU A 1 185 ? 57.621  35.932 18.008 1.00 55.93 ? 185  GLU A OE1 1 
ATOM   1461 O OE2 . GLU A 1 185 ? 56.913  35.990 20.081 1.00 55.35 ? 185  GLU A OE2 1 
ATOM   1462 N N   . LYS A 1 186 ? 59.147  35.323 23.843 1.00 54.96 ? 186  LYS A N   1 
ATOM   1463 C CA  . LYS A 1 186 ? 59.379  34.987 25.230 1.00 55.27 ? 186  LYS A CA  1 
ATOM   1464 C C   . LYS A 1 186 ? 58.391  33.916 25.698 1.00 54.97 ? 186  LYS A C   1 
ATOM   1465 O O   . LYS A 1 186 ? 57.147  33.943 25.437 1.00 53.99 ? 186  LYS A O   1 
ATOM   1466 C CB  . LYS A 1 186 ? 59.298  36.216 26.131 1.00 55.53 ? 186  LYS A CB  1 
ATOM   1467 C CG  . LYS A 1 186 ? 60.590  36.986 26.327 1.00 56.23 ? 186  LYS A CG  1 
ATOM   1468 C CD  . LYS A 1 186 ? 60.464  38.147 27.404 1.00 56.48 ? 186  LYS A CD  1 
ATOM   1469 C CE  . LYS A 1 186 ? 61.793  39.046 27.546 1.00 56.72 ? 186  LYS A CE  1 
ATOM   1470 N NZ  . LYS A 1 186 ? 62.034  40.026 26.403 1.00 57.47 ? 186  LYS A NZ  1 
ATOM   1471 N N   . LEU A 1 187 ? 58.976  32.982 26.421 1.00 54.43 ? 187  LEU A N   1 
ATOM   1472 C CA  . LEU A 1 187 ? 58.225  31.893 26.877 1.00 54.65 ? 187  LEU A CA  1 
ATOM   1473 C C   . LEU A 1 187 ? 57.082  32.416 27.693 1.00 54.69 ? 187  LEU A C   1 
ATOM   1474 O O   . LEU A 1 187 ? 57.286  33.291 28.487 1.00 54.40 ? 187  LEU A O   1 
ATOM   1475 C CB  . LEU A 1 187 ? 59.109  31.014 27.708 1.00 54.54 ? 187  LEU A CB  1 
ATOM   1476 C CG  . LEU A 1 187 ? 60.278  30.500 26.904 1.00 54.96 ? 187  LEU A CG  1 
ATOM   1477 C CD1 . LEU A 1 187 ? 61.175  29.687 27.763 1.00 55.98 ? 187  LEU A CD1 1 
ATOM   1478 C CD2 . LEU A 1 187 ? 59.795  29.631 25.748 1.00 55.92 ? 187  LEU A CD2 1 
ATOM   1479 N N   . ASN A 1 188 ? 55.874  31.882 27.487 1.00 55.26 ? 188  ASN A N   1 
ATOM   1480 C CA  . ASN A 1 188 ? 54.711  32.162 28.371 1.00 54.76 ? 188  ASN A CA  1 
ATOM   1481 C C   . ASN A 1 188 ? 54.862  31.417 29.702 1.00 54.37 ? 188  ASN A C   1 
ATOM   1482 O O   . ASN A 1 188 ? 54.259  31.767 30.663 1.00 54.25 ? 188  ASN A O   1 
ATOM   1483 C CB  . ASN A 1 188 ? 53.350  31.952 27.661 1.00 54.35 ? 188  ASN A CB  1 
ATOM   1484 C CG  . ASN A 1 188 ? 53.093  30.531 27.234 1.00 54.36 ? 188  ASN A CG  1 
ATOM   1485 O OD1 . ASN A 1 188 ? 53.342  29.597 27.978 1.00 55.20 ? 188  ASN A OD1 1 
ATOM   1486 N ND2 . ASN A 1 188 ? 52.535  30.366 26.028 1.00 53.49 ? 188  ASN A ND2 1 
ATOM   1487 N N   . HIS A 1 189 ? 55.738  30.428 29.745 1.00 54.62 ? 189  HIS A N   1 
ATOM   1488 C CA  . HIS A 1 189 ? 56.055  29.666 30.945 1.00 54.98 ? 189  HIS A CA  1 
ATOM   1489 C C   . HIS A 1 189 ? 57.369  28.890 30.813 1.00 54.70 ? 189  HIS A C   1 
ATOM   1490 O O   . HIS A 1 189 ? 57.782  28.511 29.767 1.00 54.69 ? 189  HIS A O   1 
ATOM   1491 C CB  . HIS A 1 189 ? 54.983  28.599 31.232 1.00 55.40 ? 189  HIS A CB  1 
ATOM   1492 C CG  . HIS A 1 189 ? 53.658  29.137 31.657 1.00 55.49 ? 189  HIS A CG  1 
ATOM   1493 N ND1 . HIS A 1 189 ? 52.705  29.563 30.749 1.00 56.34 ? 189  HIS A ND1 1 
ATOM   1494 C CD2 . HIS A 1 189 ? 53.097  29.253 32.882 1.00 54.90 ? 189  HIS A CD2 1 
ATOM   1495 C CE1 . HIS A 1 189 ? 51.623  29.955 31.399 1.00 56.35 ? 189  HIS A CE1 1 
ATOM   1496 N NE2 . HIS A 1 189 ? 51.842  29.789 32.696 1.00 56.55 ? 189  HIS A NE2 1 
ATOM   1497 N N   . ASP A 1 190 ? 57.966  28.547 31.917 1.00 54.64 ? 190  ASP A N   1 
ATOM   1498 C CA  . ASP A 1 190 ? 59.191  27.825 31.878 1.00 54.88 ? 190  ASP A CA  1 
ATOM   1499 C C   . ASP A 1 190 ? 58.957  26.372 32.195 1.00 54.92 ? 190  ASP A C   1 
ATOM   1500 O O   . ASP A 1 190 ? 59.391  25.816 33.223 1.00 54.90 ? 190  ASP A O   1 
ATOM   1501 C CB  . ASP A 1 190 ? 60.112  28.427 32.883 1.00 55.27 ? 190  ASP A CB  1 
ATOM   1502 C CG  . ASP A 1 190 ? 60.466  29.824 32.548 1.00 56.16 ? 190  ASP A CG  1 
ATOM   1503 O OD1 . ASP A 1 190 ? 59.596  30.625 32.142 1.00 56.47 ? 190  ASP A OD1 1 
ATOM   1504 O OD2 . ASP A 1 190 ? 61.622  30.204 32.678 1.00 58.02 ? 190  ASP A OD2 1 
ATOM   1505 N N   . LEU A 1 191 ? 58.233  25.738 31.308 1.00 54.90 ? 191  LEU A N   1 
ATOM   1506 C CA  . LEU A 1 191 ? 58.007  24.348 31.483 1.00 54.90 ? 191  LEU A CA  1 
ATOM   1507 C C   . LEU A 1 191 ? 58.530  23.699 30.226 1.00 55.06 ? 191  LEU A C   1 
ATOM   1508 O O   . LEU A 1 191 ? 59.675  23.219 30.191 1.00 54.87 ? 191  LEU A O   1 
ATOM   1509 C CB  . LEU A 1 191 ? 56.531  24.144 31.696 1.00 54.62 ? 191  LEU A CB  1 
ATOM   1510 C CG  . LEU A 1 191 ? 56.152  22.813 32.235 1.00 54.33 ? 191  LEU A CG  1 
ATOM   1511 C CD1 . LEU A 1 191 ? 57.032  22.481 33.398 1.00 54.78 ? 191  LEU A CD1 1 
ATOM   1512 C CD2 . LEU A 1 191 ? 54.666  22.900 32.621 1.00 55.07 ? 191  LEU A CD2 1 
ATOM   1513 N N   . PHE A 1 192 ? 57.705  23.750 29.184 1.00 54.98 ? 192  PHE A N   1 
ATOM   1514 C CA  . PHE A 1 192 ? 58.099  23.385 27.865 1.00 55.11 ? 192  PHE A CA  1 
ATOM   1515 C C   . PHE A 1 192 ? 58.770  24.630 27.400 1.00 55.17 ? 192  PHE A C   1 
ATOM   1516 O O   . PHE A 1 192 ? 58.917  25.565 28.191 1.00 54.88 ? 192  PHE A O   1 
ATOM   1517 C CB  . PHE A 1 192 ? 56.888  23.095 26.961 1.00 55.14 ? 192  PHE A CB  1 
ATOM   1518 C CG  . PHE A 1 192 ? 56.114  21.908 27.377 1.00 54.98 ? 192  PHE A CG  1 
ATOM   1519 C CD1 . PHE A 1 192 ? 55.189  22.021 28.336 1.00 55.80 ? 192  PHE A CD1 1 
ATOM   1520 C CD2 . PHE A 1 192 ? 56.336  20.660 26.827 1.00 54.95 ? 192  PHE A CD2 1 
ATOM   1521 C CE1 . PHE A 1 192 ? 54.505  20.925 28.735 1.00 55.78 ? 192  PHE A CE1 1 
ATOM   1522 C CE2 . PHE A 1 192 ? 55.646  19.584 27.225 1.00 53.86 ? 192  PHE A CE2 1 
ATOM   1523 C CZ  . PHE A 1 192 ? 54.753  19.712 28.172 1.00 54.54 ? 192  PHE A CZ  1 
ATOM   1524 N N   . TRP A 1 193 ? 59.150  24.657 26.122 1.00 55.18 ? 193  TRP A N   1 
ATOM   1525 C CA  . TRP A 1 193 ? 59.519  25.895 25.507 1.00 55.12 ? 193  TRP A CA  1 
ATOM   1526 C C   . TRP A 1 193 ? 58.242  26.476 24.894 1.00 55.17 ? 193  TRP A C   1 
ATOM   1527 O O   . TRP A 1 193 ? 58.075  26.548 23.713 1.00 55.66 ? 193  TRP A O   1 
ATOM   1528 C CB  . TRP A 1 193 ? 60.611  25.660 24.505 1.00 55.04 ? 193  TRP A CB  1 
ATOM   1529 C CG  . TRP A 1 193 ? 61.817  25.302 25.156 1.00 54.75 ? 193  TRP A CG  1 
ATOM   1530 C CD1 . TRP A 1 193 ? 62.200  24.064 25.532 1.00 55.10 ? 193  TRP A CD1 1 
ATOM   1531 C CD2 . TRP A 1 193 ? 62.856  26.191 25.559 1.00 55.71 ? 193  TRP A CD2 1 
ATOM   1532 N NE1 . TRP A 1 193 ? 63.429  24.112 26.152 1.00 55.36 ? 193  TRP A NE1 1 
ATOM   1533 C CE2 . TRP A 1 193 ? 63.848  25.419 26.192 1.00 55.94 ? 193  TRP A CE2 1 
ATOM   1534 C CE3 . TRP A 1 193 ? 63.057  27.581 25.450 1.00 55.47 ? 193  TRP A CE3 1 
ATOM   1535 C CZ2 . TRP A 1 193 ? 65.015  25.986 26.711 1.00 55.20 ? 193  TRP A CZ2 1 
ATOM   1536 C CZ3 . TRP A 1 193 ? 64.201  28.132 25.954 1.00 54.83 ? 193  TRP A CZ3 1 
ATOM   1537 C CH2 . TRP A 1 193 ? 65.170  27.334 26.569 1.00 55.15 ? 193  TRP A CH2 1 
ATOM   1538 N N   . GLN A 1 194 ? 57.326  26.899 25.734 1.00 55.01 ? 194  GLN A N   1 
ATOM   1539 C CA  . GLN A 1 194 ? 56.049  27.325 25.270 1.00 54.92 ? 194  GLN A CA  1 
ATOM   1540 C C   . GLN A 1 194 ? 56.038  28.820 25.119 1.00 54.34 ? 194  GLN A C   1 
ATOM   1541 O O   . GLN A 1 194 ? 56.602  29.507 25.924 1.00 52.98 ? 194  GLN A O   1 
ATOM   1542 C CB  . GLN A 1 194 ? 54.958  26.838 26.227 1.00 55.29 ? 194  GLN A CB  1 
ATOM   1543 C CG  . GLN A 1 194 ? 55.405  26.710 27.617 1.00 55.05 ? 194  GLN A CG  1 
ATOM   1544 C CD  . GLN A 1 194 ? 54.462  25.997 28.455 1.00 54.76 ? 194  GLN A CD  1 
ATOM   1545 O OE1 . GLN A 1 194 ? 54.797  25.709 29.572 1.00 55.91 ? 194  GLN A OE1 1 
ATOM   1546 N NE2 . GLN A 1 194 ? 53.283  25.701 27.955 1.00 54.08 ? 194  GLN A NE2 1 
ATOM   1547 N N   . VAL A 1 195 ? 55.385  29.278 24.046 1.00 54.57 ? 195  VAL A N   1 
ATOM   1548 C CA  . VAL A 1 195 ? 55.180  30.677 23.750 1.00 54.80 ? 195  VAL A CA  1 
ATOM   1549 C C   . VAL A 1 195 ? 53.757  30.982 23.227 1.00 54.74 ? 195  VAL A C   1 
ATOM   1550 O O   . VAL A 1 195 ? 53.149  30.175 22.573 1.00 53.76 ? 195  VAL A O   1 
ATOM   1551 C CB  . VAL A 1 195 ? 56.151  31.162 22.710 1.00 54.40 ? 195  VAL A CB  1 
ATOM   1552 C CG1 . VAL A 1 195 ? 57.503  30.851 23.115 1.00 54.55 ? 195  VAL A CG1 1 
ATOM   1553 C CG2 . VAL A 1 195 ? 55.844  30.531 21.377 1.00 54.53 ? 195  VAL A CG2 1 
ATOM   1554 N N   . ASP A 1 196 ? 53.293  32.199 23.501 1.00 55.30 ? 196  ASP A N   1 
ATOM   1555 C CA  . ASP A 1 196 ? 52.028  32.686 23.031 1.00 55.45 ? 196  ASP A CA  1 
ATOM   1556 C C   . ASP A 1 196 ? 52.179  33.153 21.563 1.00 55.36 ? 196  ASP A C   1 
ATOM   1557 O O   . ASP A 1 196 ? 53.042  33.976 21.242 1.00 54.68 ? 196  ASP A O   1 
ATOM   1558 C CB  . ASP A 1 196 ? 51.525  33.889 23.871 1.00 55.87 ? 196  ASP A CB  1 
ATOM   1559 C CG  . ASP A 1 196 ? 50.811  33.509 25.184 1.00 56.34 ? 196  ASP A CG  1 
ATOM   1560 O OD1 . ASP A 1 196 ? 50.054  32.510 25.234 1.00 56.75 ? 196  ASP A OD1 1 
ATOM   1561 O OD2 . ASP A 1 196 ? 50.903  34.235 26.199 1.00 55.79 ? 196  ASP A OD2 1 
ATOM   1562 N N   . LEU A 1 197 ? 51.264  32.649 20.729 1.00 55.49 ? 197  LEU A N   1 
ATOM   1563 C CA  . LEU A 1 197 ? 51.171  32.928 19.312 1.00 55.29 ? 197  LEU A CA  1 
ATOM   1564 C C   . LEU A 1 197 ? 49.741  32.772 18.802 1.00 55.32 ? 197  LEU A C   1 
ATOM   1565 O O   . LEU A 1 197 ? 48.997  31.886 19.236 1.00 55.32 ? 197  LEU A O   1 
ATOM   1566 C CB  . LEU A 1 197 ? 52.002  31.920 18.542 1.00 55.44 ? 197  LEU A CB  1 
ATOM   1567 C CG  . LEU A 1 197 ? 53.515  31.948 18.699 1.00 55.76 ? 197  LEU A CG  1 
ATOM   1568 C CD1 . LEU A 1 197 ? 54.152  30.945 17.731 1.00 54.71 ? 197  LEU A CD1 1 
ATOM   1569 C CD2 . LEU A 1 197 ? 54.019  33.341 18.456 1.00 56.26 ? 197  LEU A CD2 1 
ATOM   1570 N N   . ASP A 1 198 ? 49.389  33.618 17.838 1.00 55.30 ? 198  ASP A N   1 
ATOM   1571 C CA  . ASP A 1 198 ? 48.106  33.576 17.141 1.00 55.26 ? 198  ASP A CA  1 
ATOM   1572 C C   . ASP A 1 198 ? 48.281  32.805 15.888 1.00 55.38 ? 198  ASP A C   1 
ATOM   1573 O O   . ASP A 1 198 ? 49.185  33.060 15.139 1.00 55.65 ? 198  ASP A O   1 
ATOM   1574 C CB  . ASP A 1 198 ? 47.659  34.970 16.728 1.00 55.05 ? 198  ASP A CB  1 
ATOM   1575 C CG  . ASP A 1 198 ? 46.944  35.695 17.818 1.00 55.36 ? 198  ASP A CG  1 
ATOM   1576 O OD1 . ASP A 1 198 ? 46.007  35.123 18.341 1.00 56.70 ? 198  ASP A OD1 1 
ATOM   1577 O OD2 . ASP A 1 198 ? 47.218  36.830 18.225 1.00 54.99 ? 198  ASP A OD2 1 
ATOM   1578 N N   . VAL A 1 199 ? 47.366  31.905 15.618 1.00 55.54 ? 199  VAL A N   1 
ATOM   1579 C CA  . VAL A 1 199 ? 47.623  30.811 14.733 1.00 55.61 ? 199  VAL A CA  1 
ATOM   1580 C C   . VAL A 1 199 ? 46.535  30.718 13.692 1.00 55.70 ? 199  VAL A C   1 
ATOM   1581 O O   . VAL A 1 199 ? 45.356  30.685 14.029 1.00 55.57 ? 199  VAL A O   1 
ATOM   1582 C CB  . VAL A 1 199 ? 47.636  29.529 15.557 1.00 55.46 ? 199  VAL A CB  1 
ATOM   1583 C CG1 . VAL A 1 199 ? 46.868  28.434 14.881 1.00 56.03 ? 199  VAL A CG1 1 
ATOM   1584 C CG2 . VAL A 1 199 ? 49.007  29.072 15.777 1.00 55.89 ? 199  VAL A CG2 1 
ATOM   1585 N N   . ASN A 1 200 ? 46.899  30.672 12.423 1.00 55.96 ? 200  ASN A N   1 
ATOM   1586 C CA  . ASN A 1 200 ? 45.900  30.374 11.402 1.00 56.08 ? 200  ASN A CA  1 
ATOM   1587 C C   . ASN A 1 200 ? 46.341  29.139 10.679 1.00 55.59 ? 200  ASN A C   1 
ATOM   1588 O O   . ASN A 1 200 ? 47.500  28.935 10.324 1.00 55.03 ? 200  ASN A O   1 
ATOM   1589 C CB  . ASN A 1 200 ? 45.697  31.502 10.366 1.00 56.39 ? 200  ASN A CB  1 
ATOM   1590 C CG  . ASN A 1 200 ? 45.658  32.924 10.981 1.00 58.26 ? 200  ASN A CG  1 
ATOM   1591 O OD1 . ASN A 1 200 ? 45.315  33.107 12.161 1.00 61.04 ? 200  ASN A OD1 1 
ATOM   1592 N ND2 . ASN A 1 200 ? 46.010  33.939 10.169 1.00 57.20 ? 200  ASN A ND2 1 
ATOM   1593 N N   . PHE A 1 201 ? 45.393  28.280 10.481 1.00 55.56 ? 201  PHE A N   1 
ATOM   1594 C CA  . PHE A 1 201 ? 45.627  27.220 9.598  1.00 55.67 ? 201  PHE A CA  1 
ATOM   1595 C C   . PHE A 1 201 ? 44.830  27.602 8.417  1.00 55.68 ? 201  PHE A C   1 
ATOM   1596 O O   . PHE A 1 201 ? 43.648  27.300 8.349  1.00 55.46 ? 201  PHE A O   1 
ATOM   1597 C CB  . PHE A 1 201 ? 45.202  25.909 10.227 1.00 55.66 ? 201  PHE A CB  1 
ATOM   1598 C CG  . PHE A 1 201 ? 46.294  25.265 11.016 1.00 55.32 ? 201  PHE A CG  1 
ATOM   1599 C CD1 . PHE A 1 201 ? 47.161  26.009 11.769 1.00 55.99 ? 201  PHE A CD1 1 
ATOM   1600 C CD2 . PHE A 1 201 ? 46.468  23.927 10.975 1.00 55.08 ? 201  PHE A CD2 1 
ATOM   1601 C CE1 . PHE A 1 201 ? 48.174  25.402 12.468 1.00 55.80 ? 201  PHE A CE1 1 
ATOM   1602 C CE2 . PHE A 1 201 ? 47.467  23.332 11.678 1.00 54.98 ? 201  PHE A CE2 1 
ATOM   1603 C CZ  . PHE A 1 201 ? 48.323  24.065 12.422 1.00 54.86 ? 201  PHE A CZ  1 
ATOM   1604 N N   . GLY A 1 202 ? 45.500  28.295 7.496  1.00 55.79 ? 202  GLY A N   1 
ATOM   1605 C CA  . GLY A 1 202 ? 44.873  28.768 6.276  1.00 55.60 ? 202  GLY A CA  1 
ATOM   1606 C C   . GLY A 1 202 ? 43.701  29.621 6.673  1.00 55.60 ? 202  GLY A C   1 
ATOM   1607 O O   . GLY A 1 202 ? 43.901  30.733 7.173  1.00 55.60 ? 202  GLY A O   1 
ATOM   1608 N N   . LYS A 1 203 ? 42.494  29.058 6.522  1.00 55.60 ? 203  LYS A N   1 
ATOM   1609 C CA  . LYS A 1 203 ? 41.224  29.777 6.752  1.00 55.57 ? 203  LYS A CA  1 
ATOM   1610 C C   . LYS A 1 203 ? 40.767  29.783 8.197  1.00 55.60 ? 203  LYS A C   1 
ATOM   1611 O O   . LYS A 1 203 ? 40.454  30.828 8.767  1.00 55.45 ? 203  LYS A O   1 
ATOM   1612 C CB  . LYS A 1 203 ? 40.106  29.109 5.969  1.00 55.69 ? 203  LYS A CB  1 
ATOM   1613 C CG  . LYS A 1 203 ? 39.936  29.640 4.576  1.00 56.30 ? 203  LYS A CG  1 
ATOM   1614 C CD  . LYS A 1 203 ? 39.003  30.891 4.535  1.00 56.75 ? 203  LYS A CD  1 
ATOM   1615 C CE  . LYS A 1 203 ? 37.491  30.506 4.469  1.00 56.98 ? 203  LYS A CE  1 
ATOM   1616 N NZ  . LYS A 1 203 ? 36.983  29.569 5.576  1.00 56.59 ? 203  LYS A NZ  1 
ATOM   1617 N N   . THR A 1 204 ? 40.684  28.582 8.756  1.00 55.69 ? 204  THR A N   1 
ATOM   1618 C CA  . THR A 1 204 ? 40.259  28.380 10.128 1.00 55.63 ? 204  THR A CA  1 
ATOM   1619 C C   . THR A 1 204 ? 41.342  28.762 11.137 1.00 55.05 ? 204  THR A C   1 
ATOM   1620 O O   . THR A 1 204 ? 42.478  28.304 11.027 1.00 54.43 ? 204  THR A O   1 
ATOM   1621 C CB  . THR A 1 204 ? 39.832  26.887 10.329 1.00 56.10 ? 204  THR A CB  1 
ATOM   1622 O OG1 . THR A 1 204 ? 39.494  26.637 11.701 1.00 57.01 ? 204  THR A OG1 1 
ATOM   1623 C CG2 . THR A 1 204 ? 40.984  25.921 10.105 1.00 56.49 ? 204  THR A CG2 1 
ATOM   1624 N N   . SER A 1 205 ? 40.966  29.561 12.135 1.00 54.88 ? 205  SER A N   1 
ATOM   1625 C CA  . SER A 1 205 ? 41.937  30.093 13.079 1.00 55.16 ? 205  SER A CA  1 
ATOM   1626 C C   . SER A 1 205 ? 41.593  30.141 14.572 1.00 54.67 ? 205  SER A C   1 
ATOM   1627 O O   . SER A 1 205 ? 40.484  29.948 14.973 1.00 54.30 ? 205  SER A O   1 
ATOM   1628 C CB  . SER A 1 205 ? 42.358  31.469 12.612 1.00 55.32 ? 205  SER A CB  1 
ATOM   1629 O OG  . SER A 1 205 ? 43.716  31.622 12.862 1.00 55.85 ? 205  SER A OG  1 
ATOM   1630 N N   . MET A 1 206 ? 42.613  30.344 15.384 1.00 54.70 ? 206  MET A N   1 
ATOM   1631 C CA  . MET A 1 206 ? 42.472  30.369 16.802 1.00 54.89 ? 206  MET A CA  1 
ATOM   1632 C C   . MET A 1 206 ? 43.435  31.396 17.281 1.00 54.78 ? 206  MET A C   1 
ATOM   1633 O O   . MET A 1 206 ? 44.579  31.377 16.944 1.00 54.38 ? 206  MET A O   1 
ATOM   1634 C CB  . MET A 1 206 ? 42.787  28.991 17.429 1.00 55.22 ? 206  MET A CB  1 
ATOM   1635 C CG  . MET A 1 206 ? 43.181  29.044 18.941 1.00 55.19 ? 206  MET A CG  1 
ATOM   1636 S SD  . MET A 1 206 ? 42.210  28.061 20.080 1.00 54.81 ? 206  MET A SD  1 
ATOM   1637 C CE  . MET A 1 206 ? 42.707  28.590 21.707 1.00 54.61 ? 206  MET A CE  1 
ATOM   1638 N N   . GLU A 1 207 ? 42.962  32.279 18.119 1.00 55.33 ? 207  GLU A N   1 
ATOM   1639 C CA  . GLU A 1 207 ? 43.796  33.319 18.663 1.00 55.63 ? 207  GLU A CA  1 
ATOM   1640 C C   . GLU A 1 207 ? 44.349  33.006 20.066 1.00 55.53 ? 207  GLU A C   1 
ATOM   1641 O O   . GLU A 1 207 ? 43.660  32.505 20.955 1.00 55.06 ? 207  GLU A O   1 
ATOM   1642 C CB  . GLU A 1 207 ? 43.005  34.654 18.682 1.00 56.13 ? 207  GLU A CB  1 
ATOM   1643 C CG  . GLU A 1 207 ? 43.732  35.894 19.232 1.00 56.22 ? 207  GLU A CG  1 
ATOM   1644 C CD  . GLU A 1 207 ? 42.811  37.028 19.721 1.00 55.77 ? 207  GLU A CD  1 
ATOM   1645 O OE1 . GLU A 1 207 ? 41.958  36.843 20.635 1.00 54.36 ? 207  GLU A OE1 1 
ATOM   1646 O OE2 . GLU A 1 207 ? 43.017  38.147 19.206 1.00 56.39 ? 207  GLU A OE2 1 
ATOM   1647 N N   . LYS A 1 208 ? 45.613  33.380 20.230 1.00 55.99 ? 208  LYS A N   1 
ATOM   1648 C CA  . LYS A 1 208 ? 46.334  33.400 21.514 1.00 56.09 ? 208  LYS A CA  1 
ATOM   1649 C C   . LYS A 1 208 ? 46.546  31.976 21.994 1.00 56.04 ? 208  LYS A C   1 
ATOM   1650 O O   . LYS A 1 208 ? 46.403  31.685 23.184 1.00 56.25 ? 208  LYS A O   1 
ATOM   1651 C CB  . LYS A 1 208 ? 45.583  34.273 22.556 1.00 56.26 ? 208  LYS A CB  1 
ATOM   1652 C CG  . LYS A 1 208 ? 46.365  34.640 23.832 1.00 56.33 ? 208  LYS A CG  1 
ATOM   1653 C CD  . LYS A 1 208 ? 45.498  35.438 24.822 1.00 55.81 ? 208  LYS A CD  1 
ATOM   1654 C CE  . LYS A 1 208 ? 46.180  35.536 26.203 1.00 55.75 ? 208  LYS A CE  1 
ATOM   1655 N NZ  . LYS A 1 208 ? 46.704  34.232 26.715 1.00 55.39 ? 208  LYS A NZ  1 
ATOM   1656 N N   . ALA A 1 209 ? 46.885  31.091 21.062 1.00 55.86 ? 209  ALA A N   1 
ATOM   1657 C CA  . ALA A 1 209 ? 47.145  29.716 21.421 1.00 55.87 ? 209  ALA A CA  1 
ATOM   1658 C C   . ALA A 1 209 ? 48.502  29.597 22.175 1.00 55.72 ? 209  ALA A C   1 
ATOM   1659 O O   . ALA A 1 209 ? 49.244  30.556 22.335 1.00 55.34 ? 209  ALA A O   1 
ATOM   1660 C CB  . ALA A 1 209 ? 47.095  28.804 20.176 1.00 56.13 ? 209  ALA A CB  1 
ATOM   1661 N N   . ASN A 1 210 ? 48.726  28.401 22.695 1.00 55.73 ? 210  ASN A N   1 
ATOM   1662 C CA  . ASN A 1 210 ? 49.900  28.025 23.404 1.00 55.33 ? 210  ASN A CA  1 
ATOM   1663 C C   . ASN A 1 210 ? 50.640  27.035 22.557 1.00 54.88 ? 210  ASN A C   1 
ATOM   1664 O O   . ASN A 1 210 ? 50.215  25.930 22.376 1.00 55.21 ? 210  ASN A O   1 
ATOM   1665 C CB  . ASN A 1 210 ? 49.525  27.341 24.713 1.00 55.55 ? 210  ASN A CB  1 
ATOM   1666 C CG  . ASN A 1 210 ? 50.740  26.978 25.561 1.00 56.08 ? 210  ASN A CG  1 
ATOM   1667 O OD1 . ASN A 1 210 ? 50.605  26.427 26.648 1.00 57.22 ? 210  ASN A OD1 1 
ATOM   1668 N ND2 . ASN A 1 210 ? 51.923  27.291 25.074 1.00 57.17 ? 210  ASN A ND2 1 
ATOM   1669 N N   . VAL A 1 211 ? 51.792  27.417 22.093 1.00 54.76 ? 211  VAL A N   1 
ATOM   1670 C CA  . VAL A 1 211 ? 52.474  26.649 21.150 1.00 54.94 ? 211  VAL A CA  1 
ATOM   1671 C C   . VAL A 1 211 ? 53.791  26.272 21.701 1.00 54.83 ? 211  VAL A C   1 
ATOM   1672 O O   . VAL A 1 211 ? 54.395  26.994 22.442 1.00 53.96 ? 211  VAL A O   1 
ATOM   1673 C CB  . VAL A 1 211 ? 52.742  27.476 19.962 1.00 55.25 ? 211  VAL A CB  1 
ATOM   1674 C CG1 . VAL A 1 211 ? 53.933  26.968 19.261 1.00 56.00 ? 211  VAL A CG1 1 
ATOM   1675 C CG2 . VAL A 1 211 ? 51.569  27.495 19.029 1.00 55.24 ? 211  VAL A CG2 1 
ATOM   1676 N N   . ILE A 1 212 ? 54.268  25.131 21.252 1.00 55.45 ? 212  ILE A N   1 
ATOM   1677 C CA  . ILE A 1 212 ? 55.480  24.600 21.774 1.00 55.28 ? 212  ILE A CA  1 
ATOM   1678 C C   . ILE A 1 212 ? 56.216  23.733 20.793 1.00 55.16 ? 212  ILE A C   1 
ATOM   1679 O O   . ILE A 1 212 ? 55.671  23.101 19.884 1.00 55.33 ? 212  ILE A O   1 
ATOM   1680 C CB  . ILE A 1 212 ? 55.162  23.829 22.998 1.00 55.43 ? 212  ILE A CB  1 
ATOM   1681 C CG1 . ILE A 1 212 ? 55.103  22.343 22.730 1.00 54.53 ? 212  ILE A CG1 1 
ATOM   1682 C CG2 . ILE A 1 212 ? 53.816  24.251 23.518 1.00 55.75 ? 212  ILE A CG2 1 
ATOM   1683 C CD1 . ILE A 1 212 ? 54.374  21.693 23.810 1.00 54.67 ? 212  ILE A CD1 1 
ATOM   1684 N N   . VAL A 1 213 ? 57.485  23.656 21.078 1.00 54.77 ? 213  VAL A N   1 
ATOM   1685 C CA  . VAL A 1 213 ? 58.429  23.505 20.071 1.00 54.59 ? 213  VAL A CA  1 
ATOM   1686 C C   . VAL A 1 213 ? 59.095  22.259 20.507 1.00 54.50 ? 213  VAL A C   1 
ATOM   1687 O O   . VAL A 1 213 ? 59.729  22.243 21.525 1.00 54.38 ? 213  VAL A O   1 
ATOM   1688 C CB  . VAL A 1 213 ? 59.284  24.720 20.106 1.00 54.38 ? 213  VAL A CB  1 
ATOM   1689 C CG1 . VAL A 1 213 ? 60.147  24.776 18.953 1.00 54.82 ? 213  VAL A CG1 1 
ATOM   1690 C CG2 . VAL A 1 213 ? 58.421  25.889 20.049 1.00 54.24 ? 213  VAL A CG2 1 
ATOM   1691 N N   . ASP A 1 214 ? 58.867  21.190 19.769 1.00 54.52 ? 214  ASP A N   1 
ATOM   1692 C CA  . ASP A 1 214 ? 59.175  19.859 20.238 1.00 54.79 ? 214  ASP A CA  1 
ATOM   1693 C C   . ASP A 1 214 ? 60.148  19.153 19.310 1.00 55.16 ? 214  ASP A C   1 
ATOM   1694 O O   . ASP A 1 214 ? 59.749  18.501 18.343 1.00 55.63 ? 214  ASP A O   1 
ATOM   1695 C CB  . ASP A 1 214 ? 57.902  19.034 20.336 1.00 54.36 ? 214  ASP A CB  1 
ATOM   1696 C CG  . ASP A 1 214 ? 58.103  17.798 21.120 1.00 53.76 ? 214  ASP A CG  1 
ATOM   1697 O OD1 . ASP A 1 214 ? 57.270  16.891 21.002 1.00 53.11 ? 214  ASP A OD1 1 
ATOM   1698 O OD2 . ASP A 1 214 ? 59.076  17.642 21.888 1.00 52.99 ? 214  ASP A OD2 1 
ATOM   1699 N N   . SER A 1 215 ? 61.428  19.248 19.606 1.00 54.87 ? 215  SER A N   1 
ATOM   1700 C CA  . SER A 1 215 ? 62.392  18.596 18.780 1.00 54.73 ? 215  SER A CA  1 
ATOM   1701 C C   . SER A 1 215 ? 62.174  17.107 18.693 1.00 54.64 ? 215  SER A C   1 
ATOM   1702 O O   . SER A 1 215 ? 62.659  16.475 17.748 1.00 54.57 ? 215  SER A O   1 
ATOM   1703 C CB  . SER A 1 215 ? 63.794  18.874 19.300 1.00 55.11 ? 215  SER A CB  1 
ATOM   1704 O OG  . SER A 1 215 ? 63.950  18.600 20.687 1.00 56.02 ? 215  SER A OG  1 
ATOM   1705 N N   . GLY A 1 216 ? 61.454  16.543 19.666 1.00 54.70 ? 216  GLY A N   1 
ATOM   1706 C CA  . GLY A 1 216 ? 61.284  15.088 19.769 1.00 54.71 ? 216  GLY A CA  1 
ATOM   1707 C C   . GLY A 1 216 ? 60.327  14.461 18.792 1.00 54.34 ? 216  GLY A C   1 
ATOM   1708 O O   . GLY A 1 216 ? 60.641  13.433 18.257 1.00 54.27 ? 216  GLY A O   1 
ATOM   1709 N N   . THR A 1 217 ? 59.179  15.084 18.555 1.00 54.56 ? 217  THR A N   1 
ATOM   1710 C CA  . THR A 1 217 ? 58.150  14.559 17.634 1.00 55.11 ? 217  THR A CA  1 
ATOM   1711 C C   . THR A 1 217 ? 58.366  14.963 16.218 1.00 54.93 ? 217  THR A C   1 
ATOM   1712 O O   . THR A 1 217 ? 58.971  15.977 15.963 1.00 55.38 ? 217  THR A O   1 
ATOM   1713 C CB  . THR A 1 217 ? 56.780  15.128 17.969 1.00 55.38 ? 217  THR A CB  1 
ATOM   1714 O OG1 . THR A 1 217 ? 56.492  14.902 19.342 1.00 58.02 ? 217  THR A OG1 1 
ATOM   1715 C CG2 . THR A 1 217 ? 55.672  14.398 17.251 1.00 55.08 ? 217  THR A CG2 1 
ATOM   1716 N N   . SER A 1 218 ? 57.804  14.195 15.306 1.00 54.67 ? 218  SER A N   1 
ATOM   1717 C CA  . SER A 1 218 ? 57.877  14.508 13.920 1.00 54.74 ? 218  SER A CA  1 
ATOM   1718 C C   . SER A 1 218 ? 56.545  14.998 13.376 1.00 54.28 ? 218  SER A C   1 
ATOM   1719 O O   . SER A 1 218 ? 56.279  14.905 12.197 1.00 53.98 ? 218  SER A O   1 
ATOM   1720 C CB  . SER A 1 218 ? 58.292  13.267 13.167 1.00 54.85 ? 218  SER A CB  1 
ATOM   1721 O OG  . SER A 1 218 ? 57.207  12.370 13.254 1.00 55.28 ? 218  SER A OG  1 
ATOM   1722 N N   . THR A 1 219 ? 55.721  15.575 14.207 1.00 54.25 ? 219  THR A N   1 
ATOM   1723 C CA  . THR A 1 219 ? 54.440  16.008 13.719 1.00 54.52 ? 219  THR A CA  1 
ATOM   1724 C C   . THR A 1 219 ? 54.109  17.365 14.271 1.00 54.90 ? 219  THR A C   1 
ATOM   1725 O O   . THR A 1 219 ? 54.870  17.963 15.046 1.00 54.81 ? 219  THR A O   1 
ATOM   1726 C CB  . THR A 1 219 ? 53.362  15.055 14.112 1.00 54.42 ? 219  THR A CB  1 
ATOM   1727 O OG1 . THR A 1 219 ? 52.787  15.458 15.349 1.00 54.09 ? 219  THR A OG1 1 
ATOM   1728 C CG2 . THR A 1 219 ? 53.933  13.668 14.392 1.00 55.53 ? 219  THR A CG2 1 
ATOM   1729 N N   . ILE A 1 220 ? 52.964  17.852 13.819 1.00 55.02 ? 220  ILE A N   1 
ATOM   1730 C CA  . ILE A 1 220 ? 52.444  19.139 14.193 1.00 54.74 ? 220  ILE A CA  1 
ATOM   1731 C C   . ILE A 1 220 ? 51.086  18.792 14.653 1.00 54.49 ? 220  ILE A C   1 
ATOM   1732 O O   . ILE A 1 220 ? 50.438  17.971 14.042 1.00 54.38 ? 220  ILE A O   1 
ATOM   1733 C CB  . ILE A 1 220 ? 52.329  20.013 12.979 1.00 54.73 ? 220  ILE A CB  1 
ATOM   1734 C CG1 . ILE A 1 220 ? 53.679  20.166 12.328 1.00 54.54 ? 220  ILE A CG1 1 
ATOM   1735 C CG2 . ILE A 1 220 ? 51.768  21.327 13.347 1.00 55.54 ? 220  ILE A CG2 1 
ATOM   1736 C CD1 . ILE A 1 220 ? 53.724  21.190 11.266 1.00 54.99 ? 220  ILE A CD1 1 
ATOM   1737 N N   . THR A 1 221 ? 50.647  19.388 15.730 1.00 54.65 ? 221  THR A N   1 
ATOM   1738 C CA  . THR A 1 221 ? 49.369  19.014 16.268 1.00 55.20 ? 221  THR A CA  1 
ATOM   1739 C C   . THR A 1 221 ? 48.563  20.209 16.715 1.00 55.47 ? 221  THR A C   1 
ATOM   1740 O O   . THR A 1 221 ? 49.090  21.312 16.886 1.00 55.69 ? 221  THR A O   1 
ATOM   1741 C CB  . THR A 1 221 ? 49.574  18.150 17.481 1.00 55.23 ? 221  THR A CB  1 
ATOM   1742 O OG1 . THR A 1 221 ? 50.086  18.962 18.537 1.00 56.14 ? 221  THR A OG1 1 
ATOM   1743 C CG2 . THR A 1 221 ? 50.638  17.102 17.251 1.00 54.80 ? 221  THR A CG2 1 
ATOM   1744 N N   . ALA A 1 222 ? 47.287  19.963 16.968 1.00 55.50 ? 222  ALA A N   1 
ATOM   1745 C CA  . ALA A 1 222 ? 46.394  20.999 17.436 1.00 55.37 ? 222  ALA A CA  1 
ATOM   1746 C C   . ALA A 1 222 ? 45.099  20.367 17.907 1.00 55.37 ? 222  ALA A C   1 
ATOM   1747 O O   . ALA A 1 222 ? 44.728  19.267 17.481 1.00 55.23 ? 222  ALA A O   1 
ATOM   1748 C CB  . ALA A 1 222 ? 46.109  21.964 16.303 1.00 55.31 ? 222  ALA A CB  1 
ATOM   1749 N N   . PRO A 1 223 ? 44.366  21.089 18.730 1.00 55.41 ? 223  PRO A N   1 
ATOM   1750 C CA  . PRO A 1 223 ? 43.091  20.616 19.244 1.00 55.55 ? 223  PRO A CA  1 
ATOM   1751 C C   . PRO A 1 223 ? 42.243  20.082 18.151 1.00 55.65 ? 223  PRO A C   1 
ATOM   1752 O O   . PRO A 1 223 ? 42.152  20.686 17.092 1.00 55.65 ? 223  PRO A O   1 
ATOM   1753 C CB  . PRO A 1 223 ? 42.447  21.880 19.761 1.00 55.71 ? 223  PRO A CB  1 
ATOM   1754 C CG  . PRO A 1 223 ? 43.656  22.674 20.237 1.00 56.08 ? 223  PRO A CG  1 
ATOM   1755 C CD  . PRO A 1 223 ? 44.662  22.455 19.172 1.00 55.23 ? 223  PRO A CD  1 
ATOM   1756 N N   . THR A 1 224 ? 41.606  18.954 18.417 1.00 55.87 ? 224  THR A N   1 
ATOM   1757 C CA  . THR A 1 224 ? 40.854  18.248 17.383 1.00 55.34 ? 224  THR A CA  1 
ATOM   1758 C C   . THR A 1 224 ? 39.781  19.123 16.710 1.00 54.94 ? 224  THR A C   1 
ATOM   1759 O O   . THR A 1 224 ? 39.713  19.259 15.477 1.00 54.40 ? 224  THR A O   1 
ATOM   1760 C CB  . THR A 1 224 ? 40.253  17.013 17.957 1.00 55.03 ? 224  THR A CB  1 
ATOM   1761 O OG1 . THR A 1 224 ? 39.098  16.715 17.189 1.00 55.12 ? 224  THR A OG1 1 
ATOM   1762 C CG2 . THR A 1 224 ? 39.790  17.239 19.371 1.00 55.17 ? 224  THR A CG2 1 
ATOM   1763 N N   . SER A 1 225 ? 38.971  19.732 17.552 1.00 54.94 ? 225  SER A N   1 
ATOM   1764 C CA  . SER A 1 225 ? 38.054  20.763 17.145 1.00 54.92 ? 225  SER A CA  1 
ATOM   1765 C C   . SER A 1 225 ? 38.658  21.642 16.068 1.00 54.51 ? 225  SER A C   1 
ATOM   1766 O O   . SER A 1 225 ? 38.191  21.678 14.956 1.00 54.34 ? 225  SER A O   1 
ATOM   1767 C CB  . SER A 1 225 ? 37.706  21.581 18.372 1.00 54.97 ? 225  SER A CB  1 
ATOM   1768 O OG  . SER A 1 225 ? 37.201  22.827 18.024 1.00 54.83 ? 225  SER A OG  1 
ATOM   1769 N N   . PHE A 1 226 ? 39.734  22.319 16.398 1.00 54.82 ? 226  PHE A N   1 
ATOM   1770 C CA  . PHE A 1 226 ? 40.435  23.192 15.453 1.00 55.05 ? 226  PHE A CA  1 
ATOM   1771 C C   . PHE A 1 226 ? 40.753  22.503 14.144 1.00 55.27 ? 226  PHE A C   1 
ATOM   1772 O O   . PHE A 1 226 ? 40.742  23.151 13.088 1.00 55.28 ? 226  PHE A O   1 
ATOM   1773 C CB  . PHE A 1 226 ? 41.729  23.706 16.085 1.00 54.86 ? 226  PHE A CB  1 
ATOM   1774 C CG  . PHE A 1 226 ? 42.544  24.638 15.203 1.00 54.64 ? 226  PHE A CG  1 
ATOM   1775 C CD1 . PHE A 1 226 ? 43.891  24.413 14.964 1.00 54.68 ? 226  PHE A CD1 1 
ATOM   1776 C CD2 . PHE A 1 226 ? 41.989  25.758 14.645 1.00 55.21 ? 226  PHE A CD2 1 
ATOM   1777 C CE1 . PHE A 1 226 ? 44.665  25.305 14.180 1.00 54.69 ? 226  PHE A CE1 1 
ATOM   1778 C CE2 . PHE A 1 226 ? 42.771  26.639 13.858 1.00 55.79 ? 226  PHE A CE2 1 
ATOM   1779 C CZ  . PHE A 1 226 ? 44.109  26.402 13.641 1.00 54.60 ? 226  PHE A CZ  1 
ATOM   1780 N N   . ILE A 1 227 ? 41.062  21.210 14.205 1.00 55.31 ? 227  ILE A N   1 
ATOM   1781 C CA  . ILE A 1 227 ? 41.402  20.495 13.004 1.00 55.32 ? 227  ILE A CA  1 
ATOM   1782 C C   . ILE A 1 227 ? 40.146  20.305 12.233 1.00 55.11 ? 227  ILE A C   1 
ATOM   1783 O O   . ILE A 1 227 ? 39.983  20.899 11.201 1.00 55.49 ? 227  ILE A O   1 
ATOM   1784 C CB  . ILE A 1 227 ? 42.107  19.209 13.324 1.00 55.25 ? 227  ILE A CB  1 
ATOM   1785 C CG1 . ILE A 1 227 ? 43.511  19.579 13.793 1.00 55.65 ? 227  ILE A CG1 1 
ATOM   1786 C CG2 . ILE A 1 227 ? 42.138  18.275 12.107 1.00 54.70 ? 227  ILE A CG2 1 
ATOM   1787 C CD1 . ILE A 1 227 ? 44.412  18.403 13.987 1.00 56.60 ? 227  ILE A CD1 1 
ATOM   1788 N N   . ASN A 1 228 ? 39.235  19.514 12.747 1.00 54.98 ? 228  ASN A N   1 
ATOM   1789 C CA  . ASN A 1 228 ? 38.022  19.227 12.002 1.00 55.17 ? 228  ASN A CA  1 
ATOM   1790 C C   . ASN A 1 228 ? 37.606  20.290 11.012 1.00 55.05 ? 228  ASN A C   1 
ATOM   1791 O O   . ASN A 1 228 ? 37.351  20.011 9.843  1.00 54.81 ? 228  ASN A O   1 
ATOM   1792 C CB  . ASN A 1 228 ? 36.888  19.023 12.969 1.00 55.25 ? 228  ASN A CB  1 
ATOM   1793 C CG  . ASN A 1 228 ? 37.121  17.854 13.880 1.00 55.44 ? 228  ASN A CG  1 
ATOM   1794 O OD1 . ASN A 1 228 ? 37.873  16.916 13.558 1.00 54.25 ? 228  ASN A OD1 1 
ATOM   1795 N ND2 . ASN A 1 228 ? 36.472  17.888 15.031 1.00 56.57 ? 228  ASN A ND2 1 
ATOM   1796 N N   . LYS A 1 229 ? 37.526  21.509 11.504 1.00 55.03 ? 229  LYS A N   1 
ATOM   1797 C CA  . LYS A 1 229 ? 37.169  22.636 10.668 1.00 55.34 ? 229  LYS A CA  1 
ATOM   1798 C C   . LYS A 1 229 ? 38.068  22.742 9.446  1.00 55.22 ? 229  LYS A C   1 
ATOM   1799 O O   . LYS A 1 229 ? 37.580  22.930 8.327  1.00 54.87 ? 229  LYS A O   1 
ATOM   1800 C CB  . LYS A 1 229 ? 37.273  23.935 11.470 1.00 55.63 ? 229  LYS A CB  1 
ATOM   1801 C CG  . LYS A 1 229 ? 36.441  23.998 12.797 1.00 56.03 ? 229  LYS A CG  1 
ATOM   1802 C CD  . LYS A 1 229 ? 36.656  25.381 13.514 1.00 56.02 ? 229  LYS A CD  1 
ATOM   1803 C CE  . LYS A 1 229 ? 36.290  25.373 15.016 1.00 55.75 ? 229  LYS A CE  1 
ATOM   1804 N NZ  . LYS A 1 229 ? 36.852  26.539 15.769 1.00 55.00 ? 229  LYS A NZ  1 
ATOM   1805 N N   . PHE A 1 230 ? 39.381  22.631 9.713  1.00 55.32 ? 230  PHE A N   1 
ATOM   1806 C CA  . PHE A 1 230 ? 40.486  22.640 8.717  1.00 55.06 ? 230  PHE A CA  1 
ATOM   1807 C C   . PHE A 1 230 ? 40.448  21.426 7.786  1.00 54.62 ? 230  PHE A C   1 
ATOM   1808 O O   . PHE A 1 230 ? 40.329  21.548 6.590  1.00 54.03 ? 230  PHE A O   1 
ATOM   1809 C CB  . PHE A 1 230 ? 41.862  22.678 9.436  1.00 54.83 ? 230  PHE A CB  1 
ATOM   1810 C CG  . PHE A 1 230 ? 43.032  22.860 8.508  1.00 54.75 ? 230  PHE A CG  1 
ATOM   1811 C CD1 . PHE A 1 230 ? 43.144  23.968 7.705  1.00 54.92 ? 230  PHE A CD1 1 
ATOM   1812 C CD2 . PHE A 1 230 ? 44.026  21.911 8.434  1.00 55.20 ? 230  PHE A CD2 1 
ATOM   1813 C CE1 . PHE A 1 230 ? 44.215  24.111 6.854  1.00 54.84 ? 230  PHE A CE1 1 
ATOM   1814 C CE2 . PHE A 1 230 ? 45.095  22.058 7.572  1.00 54.64 ? 230  PHE A CE2 1 
ATOM   1815 C CZ  . PHE A 1 230 ? 45.188  23.153 6.793  1.00 54.58 ? 230  PHE A CZ  1 
ATOM   1816 N N   . PHE A 1 231 ? 40.572  20.240 8.334  1.00 54.53 ? 231  PHE A N   1 
ATOM   1817 C CA  . PHE A 1 231 ? 40.616  19.110 7.485  1.00 55.00 ? 231  PHE A CA  1 
ATOM   1818 C C   . PHE A 1 231 ? 39.465  19.110 6.527  1.00 55.34 ? 231  PHE A C   1 
ATOM   1819 O O   . PHE A 1 231 ? 39.684  19.077 5.314  1.00 55.62 ? 231  PHE A O   1 
ATOM   1820 C CB  . PHE A 1 231 ? 40.663  17.837 8.300  1.00 55.01 ? 231  PHE A CB  1 
ATOM   1821 C CG  . PHE A 1 231 ? 42.029  17.522 8.820  1.00 55.10 ? 231  PHE A CG  1 
ATOM   1822 C CD1 . PHE A 1 231 ? 42.226  16.456 9.667  1.00 55.46 ? 231  PHE A CD1 1 
ATOM   1823 C CD2 . PHE A 1 231 ? 43.130  18.282 8.449  1.00 55.15 ? 231  PHE A CD2 1 
ATOM   1824 C CE1 . PHE A 1 231 ? 43.498  16.164 10.130 1.00 55.57 ? 231  PHE A CE1 1 
ATOM   1825 C CE2 . PHE A 1 231 ? 44.371  17.985 8.905  1.00 55.31 ? 231  PHE A CE2 1 
ATOM   1826 C CZ  . PHE A 1 231 ? 44.562  16.937 9.749  1.00 55.53 ? 231  PHE A CZ  1 
ATOM   1827 N N   . LYS A 1 232 ? 38.249  19.150 7.058  1.00 55.71 ? 232  LYS A N   1 
ATOM   1828 C CA  . LYS A 1 232 ? 37.048  19.217 6.224  1.00 55.58 ? 232  LYS A CA  1 
ATOM   1829 C C   . LYS A 1 232 ? 37.168  20.219 5.085  1.00 55.75 ? 232  LYS A C   1 
ATOM   1830 O O   . LYS A 1 232 ? 36.703  19.933 3.976  1.00 55.82 ? 232  LYS A O   1 
ATOM   1831 C CB  . LYS A 1 232 ? 35.853  19.606 7.063  1.00 55.85 ? 232  LYS A CB  1 
ATOM   1832 C CG  . LYS A 1 232 ? 34.634  20.145 6.269  1.00 55.86 ? 232  LYS A CG  1 
ATOM   1833 C CD  . LYS A 1 232 ? 34.320  21.650 6.543  1.00 56.16 ? 232  LYS A CD  1 
ATOM   1834 C CE  . LYS A 1 232 ? 35.419  22.626 6.119  1.00 55.64 ? 232  LYS A CE  1 
ATOM   1835 N NZ  . LYS A 1 232 ? 35.503  23.933 6.872  1.00 55.00 ? 232  LYS A NZ  1 
ATOM   1836 N N   . ASP A 1 233 ? 37.797  21.377 5.354  1.00 55.87 ? 233  ASP A N   1 
ATOM   1837 C CA  . ASP A 1 233 ? 38.036  22.438 4.325  1.00 55.76 ? 233  ASP A CA  1 
ATOM   1838 C C   . ASP A 1 233 ? 38.638  21.811 3.056  1.00 55.87 ? 233  ASP A C   1 
ATOM   1839 O O   . ASP A 1 233 ? 38.047  21.868 1.986  1.00 55.76 ? 233  ASP A O   1 
ATOM   1840 C CB  . ASP A 1 233 ? 38.980  23.544 4.866  1.00 55.96 ? 233  ASP A CB  1 
ATOM   1841 C CG  . ASP A 1 233 ? 38.260  24.865 5.197  1.00 55.34 ? 233  ASP A CG  1 
ATOM   1842 O OD1 . ASP A 1 233 ? 38.693  25.548 6.190  1.00 55.33 ? 233  ASP A OD1 1 
ATOM   1843 O OD2 . ASP A 1 233 ? 37.294  25.293 4.512  1.00 53.94 ? 233  ASP A OD2 1 
ATOM   1844 N N   . LEU A 1 234 ? 39.806  21.179 3.209  1.00 56.02 ? 234  LEU A N   1 
ATOM   1845 C CA  . LEU A 1 234 ? 40.550  20.570 2.079  1.00 55.84 ? 234  LEU A CA  1 
ATOM   1846 C C   . LEU A 1 234 ? 40.345  19.069 1.985  1.00 55.43 ? 234  LEU A C   1 
ATOM   1847 O O   . LEU A 1 234 ? 41.204  18.340 1.507  1.00 55.27 ? 234  LEU A O   1 
ATOM   1848 C CB  . LEU A 1 234 ? 42.052  20.925 2.125  1.00 55.84 ? 234  LEU A CB  1 
ATOM   1849 C CG  . LEU A 1 234 ? 42.862  20.300 3.240  1.00 55.89 ? 234  LEU A CG  1 
ATOM   1850 C CD1 . LEU A 1 234 ? 44.316  20.746 3.139  1.00 56.32 ? 234  LEU A CD1 1 
ATOM   1851 C CD2 . LEU A 1 234 ? 42.274  20.677 4.589  1.00 56.01 ? 234  LEU A CD2 1 
ATOM   1852 N N   . ASN A 1 235 ? 39.183  18.623 2.417  1.00 55.19 ? 235  ASN A N   1 
ATOM   1853 C CA  . ASN A 1 235 ? 38.734  17.259 2.179  1.00 55.38 ? 235  ASN A CA  1 
ATOM   1854 C C   . ASN A 1 235 ? 39.772  16.147 2.255  1.00 54.98 ? 235  ASN A C   1 
ATOM   1855 O O   . ASN A 1 235 ? 40.099  15.546 1.242  1.00 54.34 ? 235  ASN A O   1 
ATOM   1856 C CB  . ASN A 1 235 ? 38.044  17.174 0.798  1.00 55.95 ? 235  ASN A CB  1 
ATOM   1857 C CG  . ASN A 1 235 ? 37.692  18.587 0.184  1.00 56.66 ? 235  ASN A CG  1 
ATOM   1858 O OD1 . ASN A 1 235 ? 38.579  19.421 -0.112 1.00 55.74 ? 235  ASN A OD1 1 
ATOM   1859 N ND2 . ASN A 1 235 ? 36.390  18.826 -0.018 1.00 56.69 ? 235  ASN A ND2 1 
ATOM   1860 N N   . VAL A 1 236 ? 40.225  15.855 3.475  1.00 55.04 ? 236  VAL A N   1 
ATOM   1861 C CA  . VAL A 1 236 ? 41.302  14.886 3.739  1.00 54.89 ? 236  VAL A CA  1 
ATOM   1862 C C   . VAL A 1 236 ? 40.755  13.519 3.984  1.00 54.59 ? 236  VAL A C   1 
ATOM   1863 O O   . VAL A 1 236 ? 39.627  13.404 4.355  1.00 54.59 ? 236  VAL A O   1 
ATOM   1864 C CB  . VAL A 1 236 ? 42.089  15.244 5.003  1.00 54.72 ? 236  VAL A CB  1 
ATOM   1865 C CG1 . VAL A 1 236 ? 42.491  16.638 4.977  1.00 55.05 ? 236  VAL A CG1 1 
ATOM   1866 C CG2 . VAL A 1 236 ? 41.278  15.042 6.227  1.00 55.31 ? 236  VAL A CG2 1 
ATOM   1867 N N   . ILE A 1 237 ? 41.575  12.487 3.847  1.00 54.59 ? 237  ILE A N   1 
ATOM   1868 C CA  . ILE A 1 237 ? 41.077  11.114 3.963  1.00 54.71 ? 237  ILE A CA  1 
ATOM   1869 C C   . ILE A 1 237 ? 41.729  10.290 5.043  1.00 54.10 ? 237  ILE A C   1 
ATOM   1870 O O   . ILE A 1 237 ? 42.822  9.865  4.914  1.00 53.95 ? 237  ILE A O   1 
ATOM   1871 C CB  . ILE A 1 237 ? 41.217  10.346 2.628  1.00 54.91 ? 237  ILE A CB  1 
ATOM   1872 C CG1 . ILE A 1 237 ? 41.251  11.299 1.418  1.00 54.87 ? 237  ILE A CG1 1 
ATOM   1873 C CG2 . ILE A 1 237 ? 40.069  9.327  2.503  1.00 55.50 ? 237  ILE A CG2 1 
ATOM   1874 C CD1 . ILE A 1 237 ? 41.430  10.615 0.073  1.00 54.67 ? 237  ILE A CD1 1 
ATOM   1875 N N   . LYS A 1 238 ? 41.014  9.990  6.091  1.00 54.44 ? 238  LYS A N   1 
ATOM   1876 C CA  . LYS A 1 238 ? 41.610  9.253  7.192  1.00 54.75 ? 238  LYS A CA  1 
ATOM   1877 C C   . LYS A 1 238 ? 41.317  7.767  7.125  1.00 54.85 ? 238  LYS A C   1 
ATOM   1878 O O   . LYS A 1 238 ? 40.258  7.296  7.542  1.00 54.84 ? 238  LYS A O   1 
ATOM   1879 C CB  . LYS A 1 238 ? 41.134  9.817  8.537  1.00 54.95 ? 238  LYS A CB  1 
ATOM   1880 C CG  . LYS A 1 238 ? 42.186  9.738  9.630  1.00 54.60 ? 238  LYS A CG  1 
ATOM   1881 C CD  . LYS A 1 238 ? 42.675  8.330  9.853  1.00 55.05 ? 238  LYS A CD  1 
ATOM   1882 C CE  . LYS A 1 238 ? 43.789  8.295  10.845 1.00 54.41 ? 238  LYS A CE  1 
ATOM   1883 N NZ  . LYS A 1 238 ? 44.011  6.915  11.324 1.00 54.00 ? 238  LYS A NZ  1 
ATOM   1884 N N   . VAL A 1 239 ? 42.272  7.015  6.621  1.00 54.96 ? 239  VAL A N   1 
ATOM   1885 C CA  . VAL A 1 239 ? 42.050  5.598  6.434  1.00 55.01 ? 239  VAL A CA  1 
ATOM   1886 C C   . VAL A 1 239 ? 42.243  5.059  7.807  1.00 55.04 ? 239  VAL A C   1 
ATOM   1887 O O   . VAL A 1 239 ? 43.254  5.332  8.402  1.00 55.17 ? 239  VAL A O   1 
ATOM   1888 C CB  . VAL A 1 239 ? 43.059  4.945  5.467  1.00 54.66 ? 239  VAL A CB  1 
ATOM   1889 C CG1 . VAL A 1 239 ? 42.584  3.639  5.012  1.00 54.82 ? 239  VAL A CG1 1 
ATOM   1890 C CG2 . VAL A 1 239 ? 43.277  5.803  4.258  1.00 55.29 ? 239  VAL A CG2 1 
ATOM   1891 N N   . PRO A 1 240 ? 41.272  4.321  8.335  1.00 55.46 ? 240  PRO A N   1 
ATOM   1892 C CA  . PRO A 1 240 ? 41.409  3.735  9.676  1.00 55.18 ? 240  PRO A CA  1 
ATOM   1893 C C   . PRO A 1 240 ? 42.833  3.255  9.934  1.00 54.86 ? 240  PRO A C   1 
ATOM   1894 O O   . PRO A 1 240 ? 43.665  4.037  10.382 1.00 54.60 ? 240  PRO A O   1 
ATOM   1895 C CB  . PRO A 1 240 ? 40.375  2.585  9.672  1.00 54.96 ? 240  PRO A CB  1 
ATOM   1896 C CG  . PRO A 1 240 ? 39.284  3.136  8.825  1.00 55.73 ? 240  PRO A CG  1 
ATOM   1897 C CD  . PRO A 1 240 ? 39.977  3.943  7.708  1.00 55.87 ? 240  PRO A CD  1 
ATOM   1898 N N   . PHE A 1 241 ? 43.122  2.005  9.600  1.00 54.88 ? 241  PHE A N   1 
ATOM   1899 C CA  . PHE A 1 241 ? 44.405  1.386  9.951  1.00 55.08 ? 241  PHE A CA  1 
ATOM   1900 C C   . PHE A 1 241 ? 45.633  2.281  9.869  1.00 54.92 ? 241  PHE A C   1 
ATOM   1901 O O   . PHE A 1 241 ? 46.465  2.326  10.771 1.00 55.21 ? 241  PHE A O   1 
ATOM   1902 C CB  . PHE A 1 241 ? 44.636  0.137  9.138  1.00 55.12 ? 241  PHE A CB  1 
ATOM   1903 C CG  . PHE A 1 241 ? 44.416  0.314  7.663  1.00 55.31 ? 241  PHE A CG  1 
ATOM   1904 C CD1 . PHE A 1 241 ? 43.156  0.141  7.107  1.00 54.44 ? 241  PHE A CD1 1 
ATOM   1905 C CD2 . PHE A 1 241 ? 45.469  0.591  6.825  1.00 55.12 ? 241  PHE A CD2 1 
ATOM   1906 C CE1 . PHE A 1 241 ? 42.959  0.285  5.774  1.00 54.12 ? 241  PHE A CE1 1 
ATOM   1907 C CE2 . PHE A 1 241 ? 45.259  0.710  5.485  1.00 54.47 ? 241  PHE A CE2 1 
ATOM   1908 C CZ  . PHE A 1 241 ? 43.995  0.563  4.963  1.00 53.93 ? 241  PHE A CZ  1 
ATOM   1909 N N   . LEU A 1 242 ? 45.751  3.052  8.822  1.00 55.13 ? 242  LEU A N   1 
ATOM   1910 C CA  . LEU A 1 242 ? 46.906  3.942  8.788  1.00 55.27 ? 242  LEU A CA  1 
ATOM   1911 C C   . LEU A 1 242 ? 46.661  5.201  9.645  1.00 55.11 ? 242  LEU A C   1 
ATOM   1912 O O   . LEU A 1 242 ? 45.595  5.809  9.591  1.00 55.11 ? 242  LEU A O   1 
ATOM   1913 C CB  . LEU A 1 242 ? 47.373  4.260  7.363  1.00 55.18 ? 242  LEU A CB  1 
ATOM   1914 C CG  . LEU A 1 242 ? 46.360  4.638  6.303  1.00 55.01 ? 242  LEU A CG  1 
ATOM   1915 C CD1 . LEU A 1 242 ? 45.843  6.071  6.554  1.00 56.17 ? 242  LEU A CD1 1 
ATOM   1916 C CD2 . LEU A 1 242 ? 46.986  4.524  4.946  1.00 54.88 ? 242  LEU A CD2 1 
ATOM   1917 N N   . PRO A 1 243 ? 47.644  5.555  10.465 1.00 55.30 ? 243  PRO A N   1 
ATOM   1918 C CA  . PRO A 1 243 ? 47.536  6.666  11.450 1.00 55.27 ? 243  PRO A CA  1 
ATOM   1919 C C   . PRO A 1 243 ? 47.836  8.083  10.923 1.00 55.13 ? 243  PRO A C   1 
ATOM   1920 O O   . PRO A 1 243 ? 48.207  8.937  11.693 1.00 54.50 ? 243  PRO A O   1 
ATOM   1921 C CB  . PRO A 1 243 ? 48.616  6.301  12.450 1.00 55.43 ? 243  PRO A CB  1 
ATOM   1922 C CG  . PRO A 1 243 ? 49.729  5.734  11.530 1.00 55.18 ? 243  PRO A CG  1 
ATOM   1923 C CD  . PRO A 1 243 ? 48.946  4.867  10.558 1.00 55.31 ? 243  PRO A CD  1 
ATOM   1924 N N   . PHE A 1 244 ? 47.690  8.323  9.627  1.00 55.31 ? 244  PHE A N   1 
ATOM   1925 C CA  . PHE A 1 244 ? 47.947  9.648  9.031  1.00 55.08 ? 244  PHE A CA  1 
ATOM   1926 C C   . PHE A 1 244 ? 46.866  10.013 7.973  1.00 55.16 ? 244  PHE A C   1 
ATOM   1927 O O   . PHE A 1 244 ? 46.250  9.152  7.303  1.00 55.42 ? 244  PHE A O   1 
ATOM   1928 C CB  . PHE A 1 244 ? 49.338  9.671  8.398  1.00 54.91 ? 244  PHE A CB  1 
ATOM   1929 C CG  . PHE A 1 244 ? 49.538  8.599  7.358  1.00 54.97 ? 244  PHE A CG  1 
ATOM   1930 C CD1 . PHE A 1 244 ? 50.131  7.389  7.683  1.00 54.60 ? 244  PHE A CD1 1 
ATOM   1931 C CD2 . PHE A 1 244 ? 49.074  8.782  6.056  1.00 55.22 ? 244  PHE A CD2 1 
ATOM   1932 C CE1 . PHE A 1 244 ? 50.306  6.430  6.740  1.00 54.50 ? 244  PHE A CE1 1 
ATOM   1933 C CE2 . PHE A 1 244 ? 49.242  7.810  5.115  1.00 55.46 ? 244  PHE A CE2 1 
ATOM   1934 C CZ  . PHE A 1 244 ? 49.868  6.637  5.457  1.00 55.19 ? 244  PHE A CZ  1 
ATOM   1935 N N   . TYR A 1 245 ? 46.646  11.292 7.798  1.00 54.66 ? 245  TYR A N   1 
ATOM   1936 C CA  . TYR A 1 245 ? 45.588  11.710 6.934  1.00 54.55 ? 245  TYR A CA  1 
ATOM   1937 C C   . TYR A 1 245 ? 46.246  11.897 5.583  1.00 54.29 ? 245  TYR A C   1 
ATOM   1938 O O   . TYR A 1 245 ? 47.350  12.408 5.503  1.00 54.06 ? 245  TYR A O   1 
ATOM   1939 C CB  . TYR A 1 245 ? 44.984  12.969 7.510  1.00 54.83 ? 245  TYR A CB  1 
ATOM   1940 C CG  . TYR A 1 245 ? 44.300  12.756 8.842  1.00 54.54 ? 245  TYR A CG  1 
ATOM   1941 C CD1 . TYR A 1 245 ? 44.947  12.150 9.890  1.00 55.44 ? 245  TYR A CD1 1 
ATOM   1942 C CD2 . TYR A 1 245 ? 43.004  13.169 9.058  1.00 55.21 ? 245  TYR A CD2 1 
ATOM   1943 C CE1 . TYR A 1 245 ? 44.317  11.928 11.122 1.00 55.22 ? 245  TYR A CE1 1 
ATOM   1944 C CE2 . TYR A 1 245 ? 42.364  12.947 10.293 1.00 55.42 ? 245  TYR A CE2 1 
ATOM   1945 C CZ  . TYR A 1 245 ? 43.050  12.321 11.316 1.00 54.93 ? 245  TYR A CZ  1 
ATOM   1946 O OH  . TYR A 1 245 ? 42.500  12.080 12.539 1.00 54.41 ? 245  TYR A OH  1 
ATOM   1947 N N   . ILE A 1 246 ? 45.629  11.417 4.526  1.00 54.05 ? 246  ILE A N   1 
ATOM   1948 C CA  . ILE A 1 246 ? 46.289  11.467 3.247  1.00 54.52 ? 246  ILE A CA  1 
ATOM   1949 C C   . ILE A 1 246 ? 45.548  12.474 2.486  1.00 54.28 ? 246  ILE A C   1 
ATOM   1950 O O   . ILE A 1 246 ? 44.531  12.886 2.992  1.00 54.33 ? 246  ILE A O   1 
ATOM   1951 C CB  . ILE A 1 246 ? 46.195  10.183 2.532  1.00 54.55 ? 246  ILE A CB  1 
ATOM   1952 C CG1 . ILE A 1 246 ? 44.942  10.189 1.674  1.00 54.90 ? 246  ILE A CG1 1 
ATOM   1953 C CG2 . ILE A 1 246 ? 46.280  8.991  3.534  1.00 54.44 ? 246  ILE A CG2 1 
ATOM   1954 C CD1 . ILE A 1 246 ? 44.583  8.812  1.141  1.00 55.73 ? 246  ILE A CD1 1 
ATOM   1955 N N   . THR A 1 247 ? 46.031  12.841 1.291  1.00 54.39 ? 247  THR A N   1 
ATOM   1956 C CA  . THR A 1 247 ? 45.497  13.983 0.522  1.00 54.63 ? 247  THR A CA  1 
ATOM   1957 C C   . THR A 1 247 ? 46.351  14.310 -0.672 1.00 54.64 ? 247  THR A C   1 
ATOM   1958 O O   . THR A 1 247 ? 47.483  13.934 -0.692 1.00 55.23 ? 247  THR A O   1 
ATOM   1959 C CB  . THR A 1 247 ? 45.406  15.250 1.413  1.00 54.71 ? 247  THR A CB  1 
ATOM   1960 O OG1 . THR A 1 247 ? 44.713  16.314 0.743  1.00 54.86 ? 247  THR A OG1 1 
ATOM   1961 C CG2 . THR A 1 247 ? 46.791  15.797 1.743  1.00 54.72 ? 247  THR A CG2 1 
ATOM   1962 N N   . THR A 1 248 ? 45.826  15.045 -1.644 1.00 54.89 ? 248  THR A N   1 
ATOM   1963 C CA  . THR A 1 248 ? 46.513  15.278 -2.918 1.00 54.68 ? 248  THR A CA  1 
ATOM   1964 C C   . THR A 1 248 ? 47.529  16.319 -2.686 1.00 54.42 ? 248  THR A C   1 
ATOM   1965 O O   . THR A 1 248 ? 47.234  17.282 -2.018 1.00 54.26 ? 248  THR A O   1 
ATOM   1966 C CB  . THR A 1 248 ? 45.584  15.859 -3.927 1.00 54.64 ? 248  THR A CB  1 
ATOM   1967 O OG1 . THR A 1 248 ? 45.192  17.142 -3.467 1.00 55.22 ? 248  THR A OG1 1 
ATOM   1968 C CG2 . THR A 1 248 ? 44.277  15.140 -4.002 1.00 54.21 ? 248  THR A CG2 1 
ATOM   1969 N N   . CYS A 1 249 ? 48.714  16.168 -3.248 1.00 54.53 ? 249  CYS A N   1 
ATOM   1970 C CA  . CYS A 1 249 ? 49.820  17.081 -2.901 1.00 54.90 ? 249  CYS A CA  1 
ATOM   1971 C C   . CYS A 1 249 ? 49.695  18.374 -3.654 1.00 54.81 ? 249  CYS A C   1 
ATOM   1972 O O   . CYS A 1 249 ? 49.765  19.460 -3.090 1.00 53.60 ? 249  CYS A O   1 
ATOM   1973 C CB  . CYS A 1 249 ? 51.177  16.448 -3.215 1.00 55.02 ? 249  CYS A CB  1 
ATOM   1974 S SG  . CYS A 1 249 ? 51.409  14.697 -2.725 1.00 54.12 ? 249  CYS A SG  1 
ATOM   1975 N N   . ASN A 1 250 ? 49.501  18.201 -4.962 1.00 55.77 ? 250  ASN A N   1 
ATOM   1976 C CA  . ASN A 1 250 ? 49.249  19.297 -5.971 1.00 56.20 ? 250  ASN A CA  1 
ATOM   1977 C C   . ASN A 1 250 ? 47.884  20.011 -5.781 1.00 56.42 ? 250  ASN A C   1 
ATOM   1978 O O   . ASN A 1 250 ? 47.321  20.553 -6.731 1.00 56.26 ? 250  ASN A O   1 
ATOM   1979 C CB  . ASN A 1 250 ? 49.387  18.777 -7.471 1.00 56.11 ? 250  ASN A CB  1 
ATOM   1980 C CG  . ASN A 1 250 ? 49.264  17.211 -7.623 1.00 55.86 ? 250  ASN A CG  1 
ATOM   1981 O OD1 . ASN A 1 250 ? 50.229  16.455 -7.541 1.00 54.63 ? 250  ASN A OD1 1 
ATOM   1982 N ND2 . ASN A 1 250 ? 48.069  16.760 -7.859 1.00 56.55 ? 250  ASN A ND2 1 
ATOM   1983 N N   . ASN A 1 251 ? 47.365  19.976 -4.552 1.00 56.69 ? 251  ASN A N   1 
ATOM   1984 C CA  . ASN A 1 251 ? 46.023  20.466 -4.248 1.00 56.56 ? 251  ASN A CA  1 
ATOM   1985 C C   . ASN A 1 251 ? 45.960  21.911 -4.685 1.00 56.69 ? 251  ASN A C   1 
ATOM   1986 O O   . ASN A 1 251 ? 46.361  22.814 -3.963 1.00 56.62 ? 251  ASN A O   1 
ATOM   1987 C CB  . ASN A 1 251 ? 45.702  20.325 -2.737 1.00 56.71 ? 251  ASN A CB  1 
ATOM   1988 C CG  . ASN A 1 251 ? 44.597  21.272 -2.268 1.00 57.01 ? 251  ASN A CG  1 
ATOM   1989 O OD1 . ASN A 1 251 ? 43.704  21.683 -3.055 1.00 56.81 ? 251  ASN A OD1 1 
ATOM   1990 N ND2 . ASN A 1 251 ? 44.676  21.658 -0.962 1.00 57.30 ? 251  ASN A ND2 1 
ATOM   1991 N N   . LYS A 1 252 ? 45.505  22.120 -5.911 1.00 20.00 ? 252  LYS A N   1 
ATOM   1992 C CA  . LYS A 1 252 ? 45.103  23.442 -6.356 1.00 20.00 ? 252  LYS A CA  1 
ATOM   1993 C C   . LYS A 1 252 ? 44.468  23.992 -5.104 1.00 20.00 ? 252  LYS A C   1 
ATOM   1994 O O   . LYS A 1 252 ? 43.509  23.434 -4.590 1.00 57.02 ? 252  LYS A O   1 
ATOM   1995 C CB  . LYS A 1 252 ? 44.212  23.356 -7.596 1.00 20.00 ? 252  LYS A CB  1 
ATOM   1996 C CG  . LYS A 1 252 ? 43.227  22.208 -7.580 1.00 20.00 ? 252  LYS A CG  1 
ATOM   1997 C CD  . LYS A 1 252 ? 42.195  22.366 -6.473 1.00 20.00 ? 252  LYS A CD  1 
ATOM   1998 C CE  . LYS A 1 252 ? 41.405  21.088 -6.252 1.00 20.00 ? 252  LYS A CE  1 
ATOM   1999 N NZ  . LYS A 1 252 ? 40.568  20.740 -7.427 1.00 20.00 ? 252  LYS A NZ  1 
ATOM   2000 N N   . ASP A 1 253 ? 45.007  25.092 -4.612 1.00 56.63 ? 253  ASP A N   1 
ATOM   2001 C CA  . ASP A 1 253 ? 44.442  25.762 -3.442 1.00 56.68 ? 253  ASP A CA  1 
ATOM   2002 C C   . ASP A 1 253 ? 45.295  25.132 -2.282 1.00 56.73 ? 253  ASP A C   1 
ATOM   2003 O O   . ASP A 1 253 ? 44.962  24.071 -1.727 1.00 56.32 ? 253  ASP A O   1 
ATOM   2004 C CB  . ASP A 1 253 ? 43.109  26.362 -2.968 1.00 56.59 ? 253  ASP A CB  1 
ATOM   2005 C CG  . ASP A 1 253 ? 43.260  27.810 -2.553 1.00 57.48 ? 253  ASP A CG  1 
ATOM   2006 O OD1 . ASP A 1 253 ? 44.103  28.060 -1.636 1.00 57.96 ? 253  ASP A OD1 1 
ATOM   2007 O OD2 . ASP A 1 253 ? 42.590  28.743 -3.094 1.00 57.53 ? 253  ASP A OD2 1 
ATOM   2008 N N   . MET A 1 254 ? 46.426  25.767 -1.955 1.00 56.82 ? 254  MET A N   1 
ATOM   2009 C CA  . MET A 1 254 ? 47.251  25.273 -0.850 1.00 56.52 ? 254  MET A CA  1 
ATOM   2010 C C   . MET A 1 254 ? 47.587  26.306 0.192  1.00 55.70 ? 254  MET A C   1 
ATOM   2011 O O   . MET A 1 254 ? 48.322  27.270 -0.065 1.00 55.08 ? 254  MET A O   1 
ATOM   2012 C CB  . MET A 1 254 ? 48.511  24.613 -1.345 1.00 56.43 ? 254  MET A CB  1 
ATOM   2013 C CG  . MET A 1 254 ? 48.267  23.554 -2.431 1.00 56.99 ? 254  MET A CG  1 
ATOM   2014 S SD  . MET A 1 254 ? 49.170  21.992 -2.130 1.00 58.50 ? 254  MET A SD  1 
ATOM   2015 C CE  . MET A 1 254 ? 48.890  21.962 -0.327 1.00 56.93 ? 254  MET A CE  1 
ATOM   2016 N N   . PRO A 1 255 ? 46.974  26.090 1.351  1.00 55.31 ? 255  PRO A N   1 
ATOM   2017 C CA  . PRO A 1 255 ? 47.092  26.956 2.482  1.00 55.29 ? 255  PRO A CA  1 
ATOM   2018 C C   . PRO A 1 255 ? 48.392  26.844 3.180  1.00 55.33 ? 255  PRO A C   1 
ATOM   2019 O O   . PRO A 1 255 ? 48.977  25.769 3.264  1.00 55.51 ? 255  PRO A O   1 
ATOM   2020 C CB  . PRO A 1 255 ? 45.984  26.460 3.392  1.00 55.28 ? 255  PRO A CB  1 
ATOM   2021 C CG  . PRO A 1 255 ? 45.859  25.078 3.071  1.00 54.99 ? 255  PRO A CG  1 
ATOM   2022 C CD  . PRO A 1 255 ? 46.026  24.996 1.620  1.00 55.30 ? 255  PRO A CD  1 
ATOM   2023 N N   . THR A 1 256 ? 48.846  27.969 3.683  1.00 55.46 ? 256  THR A N   1 
ATOM   2024 C CA  . THR A 1 256 ? 50.013  27.966 4.523  1.00 55.59 ? 256  THR A CA  1 
ATOM   2025 C C   . THR A 1 256 ? 49.618  28.046 5.999  1.00 55.63 ? 256  THR A C   1 
ATOM   2026 O O   . THR A 1 256 ? 48.488  28.360 6.343  1.00 56.06 ? 256  THR A O   1 
ATOM   2027 C CB  . THR A 1 256 ? 50.905  29.100 4.177  1.00 55.18 ? 256  THR A CB  1 
ATOM   2028 O OG1 . THR A 1 256 ? 52.064  28.988 4.985  1.00 55.45 ? 256  THR A OG1 1 
ATOM   2029 C CG2 . THR A 1 256 ? 50.328  30.403 4.630  1.00 55.41 ? 256  THR A CG2 1 
ATOM   2030 N N   . LEU A 1 257 ? 50.549  27.752 6.881  1.00 55.59 ? 257  LEU A N   1 
ATOM   2031 C CA  . LEU A 1 257 ? 50.229  27.783 8.289  1.00 55.82 ? 257  LEU A CA  1 
ATOM   2032 C C   . LEU A 1 257 ? 50.858  29.007 8.907  1.00 55.81 ? 257  LEU A C   1 
ATOM   2033 O O   . LEU A 1 257 ? 52.068  29.189 8.842  1.00 55.59 ? 257  LEU A O   1 
ATOM   2034 C CB  . LEU A 1 257 ? 50.709  26.508 8.969  1.00 55.99 ? 257  LEU A CB  1 
ATOM   2035 C CG  . LEU A 1 257 ? 50.105  25.207 8.394  1.00 55.84 ? 257  LEU A CG  1 
ATOM   2036 C CD1 . LEU A 1 257 ? 50.798  23.972 8.987  1.00 55.55 ? 257  LEU A CD1 1 
ATOM   2037 C CD2 . LEU A 1 257 ? 48.622  25.163 8.691  1.00 55.69 ? 257  LEU A CD2 1 
ATOM   2038 N N   . GLU A 1 258 ? 50.009  29.846 9.495  1.00 55.99 ? 258  GLU A N   1 
ATOM   2039 C CA  . GLU A 1 258 ? 50.419  31.127 10.098 1.00 55.90 ? 258  GLU A CA  1 
ATOM   2040 C C   . GLU A 1 258 ? 50.624  31.043 11.607 1.00 55.80 ? 258  GLU A C   1 
ATOM   2041 O O   . GLU A 1 258 ? 49.800  30.504 12.341 1.00 56.12 ? 258  GLU A O   1 
ATOM   2042 C CB  . GLU A 1 258 ? 49.342  32.179 9.866  1.00 55.87 ? 258  GLU A CB  1 
ATOM   2043 C CG  . GLU A 1 258 ? 49.192  32.555 8.395  1.00 56.87 ? 258  GLU A CG  1 
ATOM   2044 C CD  . GLU A 1 258 ? 50.172  33.657 7.952  1.00 57.38 ? 258  GLU A CD  1 
ATOM   2045 O OE1 . GLU A 1 258 ? 49.956  34.199 6.830  1.00 57.21 ? 258  GLU A OE1 1 
ATOM   2046 O OE2 . GLU A 1 258 ? 51.123  33.999 8.722  1.00 55.90 ? 258  GLU A OE2 1 
ATOM   2047 N N   . PHE A 1 259 ? 51.717  31.616 12.063 1.00 55.41 ? 259  PHE A N   1 
ATOM   2048 C CA  . PHE A 1 259 ? 51.992  31.707 13.458 1.00 55.38 ? 259  PHE A CA  1 
ATOM   2049 C C   . PHE A 1 259 ? 52.411  33.148 13.730 1.00 55.72 ? 259  PHE A C   1 
ATOM   2050 O O   . PHE A 1 259 ? 53.506  33.594 13.334 1.00 56.25 ? 259  PHE A O   1 
ATOM   2051 C CB  . PHE A 1 259 ? 53.079  30.723 13.792 1.00 55.35 ? 259  PHE A CB  1 
ATOM   2052 C CG  . PHE A 1 259 ? 52.665  29.286 13.607 1.00 55.53 ? 259  PHE A CG  1 
ATOM   2053 C CD1 . PHE A 1 259 ? 51.922  28.653 14.574 1.00 55.65 ? 259  PHE A CD1 1 
ATOM   2054 C CD2 . PHE A 1 259 ? 53.032  28.554 12.483 1.00 56.16 ? 259  PHE A CD2 1 
ATOM   2055 C CE1 . PHE A 1 259 ? 51.536  27.332 14.434 1.00 55.25 ? 259  PHE A CE1 1 
ATOM   2056 C CE2 . PHE A 1 259 ? 52.628  27.211 12.333 1.00 55.55 ? 259  PHE A CE2 1 
ATOM   2057 C CZ  . PHE A 1 259 ? 51.883  26.612 13.311 1.00 55.46 ? 259  PHE A CZ  1 
ATOM   2058 N N   . LYS A 1 260 ? 51.521  33.877 14.389 1.00 55.62 ? 260  LYS A N   1 
ATOM   2059 C CA  . LYS A 1 260 ? 51.679  35.303 14.579 1.00 55.65 ? 260  LYS A CA  1 
ATOM   2060 C C   . LYS A 1 260 ? 52.092  35.721 16.018 1.00 56.07 ? 260  LYS A C   1 
ATOM   2061 O O   . LYS A 1 260 ? 51.430  35.431 17.043 1.00 56.02 ? 260  LYS A O   1 
ATOM   2062 C CB  . LYS A 1 260 ? 50.400  36.019 14.170 1.00 55.85 ? 260  LYS A CB  1 
ATOM   2063 C CG  . LYS A 1 260 ? 49.953  35.811 12.690 1.00 56.00 ? 260  LYS A CG  1 
ATOM   2064 C CD  . LYS A 1 260 ? 50.914  36.424 11.685 1.00 56.67 ? 260  LYS A CD  1 
ATOM   2065 C CE  . LYS A 1 260 ? 51.210  37.963 11.849 1.00 57.03 ? 260  LYS A CE  1 
ATOM   2066 N NZ  . LYS A 1 260 ? 50.039  38.902 11.637 1.00 58.34 ? 260  LYS A NZ  1 
ATOM   2067 N N   . SER A 1 261 ? 53.229  36.406 16.060 1.00 56.16 ? 261  SER A N   1 
ATOM   2068 C CA  . SER A 1 261 ? 53.680  37.106 17.230 1.00 55.71 ? 261  SER A CA  1 
ATOM   2069 C C   . SER A 1 261 ? 52.984  38.434 17.134 1.00 55.64 ? 261  SER A C   1 
ATOM   2070 O O   . SER A 1 261 ? 52.364  38.770 16.097 1.00 55.10 ? 261  SER A O   1 
ATOM   2071 C CB  . SER A 1 261 ? 55.192  37.301 17.157 1.00 55.98 ? 261  SER A CB  1 
ATOM   2072 O OG  . SER A 1 261 ? 55.677  38.268 18.080 1.00 55.47 ? 261  SER A OG  1 
ATOM   2073 N N   . ALA A 1 262 ? 53.071  39.190 18.220 1.00 55.84 ? 262  ALA A N   1 
ATOM   2074 C CA  . ALA A 1 262 ? 52.632  40.566 18.177 1.00 55.99 ? 262  ALA A CA  1 
ATOM   2075 C C   . ALA A 1 262 ? 53.203  41.216 16.861 1.00 56.21 ? 262  ALA A C   1 
ATOM   2076 O O   . ALA A 1 262 ? 52.448  41.658 15.970 1.00 56.42 ? 262  ALA A O   1 
ATOM   2077 C CB  . ALA A 1 262 ? 53.073  41.292 19.443 1.00 55.56 ? 262  ALA A CB  1 
ATOM   2078 N N   . ASN A 1 263 ? 54.524  41.190 16.695 1.00 56.10 ? 263  ASN A N   1 
ATOM   2079 C CA  . ASN A 1 263 ? 55.162  41.836 15.537 1.00 56.21 ? 263  ASN A CA  1 
ATOM   2080 C C   . ASN A 1 263 ? 56.048  40.943 14.673 1.00 56.80 ? 263  ASN A C   1 
ATOM   2081 O O   . ASN A 1 263 ? 56.900  41.456 13.920 1.00 57.57 ? 263  ASN A O   1 
ATOM   2082 C CB  . ASN A 1 263 ? 55.987  43.003 16.038 1.00 56.17 ? 263  ASN A CB  1 
ATOM   2083 C CG  . ASN A 1 263 ? 55.157  43.940 16.789 1.00 56.16 ? 263  ASN A CG  1 
ATOM   2084 O OD1 . ASN A 1 263 ? 54.526  43.552 17.764 1.00 55.94 ? 263  ASN A OD1 1 
ATOM   2085 N ND2 . ASN A 1 263 ? 55.061  45.171 16.306 1.00 56.10 ? 263  ASN A ND2 1 
ATOM   2086 N N   . ASN A 1 264 ? 55.895  39.622 14.803 1.00 56.52 ? 264  ASN A N   1 
ATOM   2087 C CA  . ASN A 1 264 ? 56.598  38.679 13.941 1.00 55.84 ? 264  ASN A CA  1 
ATOM   2088 C C   . ASN A 1 264 ? 55.551  37.828 13.347 1.00 55.81 ? 264  ASN A C   1 
ATOM   2089 O O   . ASN A 1 264 ? 54.414  37.817 13.806 1.00 55.74 ? 264  ASN A O   1 
ATOM   2090 C CB  . ASN A 1 264 ? 57.582  37.851 14.708 1.00 55.30 ? 264  ASN A CB  1 
ATOM   2091 C CG  . ASN A 1 264 ? 58.515  38.701 15.478 1.00 55.26 ? 264  ASN A CG  1 
ATOM   2092 O OD1 . ASN A 1 264 ? 59.036  39.708 14.948 1.00 53.53 ? 264  ASN A OD1 1 
ATOM   2093 N ND2 . ASN A 1 264 ? 58.737  38.338 16.752 1.00 55.04 ? 264  ASN A ND2 1 
ATOM   2094 N N   . THR A 1 265 ? 55.908  37.154 12.278 1.00 55.94 ? 265  THR A N   1 
ATOM   2095 C CA  . THR A 1 265 ? 54.951  36.279 11.642 1.00 55.73 ? 265  THR A CA  1 
ATOM   2096 C C   . THR A 1 265 ? 55.698  35.105 11.079 1.00 55.69 ? 265  THR A C   1 
ATOM   2097 O O   . THR A 1 265 ? 56.695  35.313 10.381 1.00 56.47 ? 265  THR A O   1 
ATOM   2098 C CB  . THR A 1 265 ? 54.213  37.057 10.560 1.00 55.86 ? 265  THR A CB  1 
ATOM   2099 O OG1 . THR A 1 265 ? 53.249  36.222 9.927  1.00 56.40 ? 265  THR A OG1 1 
ATOM   2100 C CG2 . THR A 1 265 ? 55.118  37.435 9.375  1.00 56.45 ? 265  THR A CG2 1 
ATOM   2101 N N   . TYR A 1 266 ? 55.286  33.897 11.462 1.00 55.11 ? 266  TYR A N   1 
ATOM   2102 C CA  . TYR A 1 266 ? 55.978  32.687 11.076 1.00 55.21 ? 266  TYR A CA  1 
ATOM   2103 C C   . TYR A 1 266 ? 55.060  31.878 10.222 1.00 55.61 ? 266  TYR A C   1 
ATOM   2104 O O   . TYR A 1 266 ? 53.922  31.668 10.618 1.00 56.35 ? 266  TYR A O   1 
ATOM   2105 C CB  . TYR A 1 266 ? 56.334  31.906 12.294 1.00 54.57 ? 266  TYR A CB  1 
ATOM   2106 C CG  . TYR A 1 266 ? 57.201  32.669 13.192 1.00 54.43 ? 266  TYR A CG  1 
ATOM   2107 C CD1 . TYR A 1 266 ? 58.463  33.072 12.792 1.00 54.78 ? 266  TYR A CD1 1 
ATOM   2108 C CD2 . TYR A 1 266 ? 56.785  32.999 14.458 1.00 55.22 ? 266  TYR A CD2 1 
ATOM   2109 C CE1 . TYR A 1 266 ? 59.302  33.789 13.643 1.00 54.95 ? 266  TYR A CE1 1 
ATOM   2110 C CE2 . TYR A 1 266 ? 57.628  33.722 15.327 1.00 55.71 ? 266  TYR A CE2 1 
ATOM   2111 C CZ  . TYR A 1 266 ? 58.877  34.106 14.900 1.00 54.98 ? 266  TYR A CZ  1 
ATOM   2112 O OH  . TYR A 1 266 ? 59.684  34.834 15.719 1.00 54.51 ? 266  TYR A OH  1 
ATOM   2113 N N   . THR A 1 267 ? 55.502  31.439 9.044  1.00 55.63 ? 267  THR A N   1 
ATOM   2114 C CA  . THR A 1 267 ? 54.586  30.706 8.159  1.00 55.60 ? 267  THR A CA  1 
ATOM   2115 C C   . THR A 1 267 ? 55.197  29.424 7.744  1.00 55.74 ? 267  THR A C   1 
ATOM   2116 O O   . THR A 1 267 ? 56.430  29.329 7.676  1.00 55.84 ? 267  THR A O   1 
ATOM   2117 C CB  . THR A 1 267 ? 54.263  31.429 6.871  1.00 55.29 ? 267  THR A CB  1 
ATOM   2118 O OG1 . THR A 1 267 ? 55.367  31.302 5.975  1.00 54.83 ? 267  THR A OG1 1 
ATOM   2119 C CG2 . THR A 1 267 ? 54.081  32.867 7.102  1.00 55.33 ? 267  THR A CG2 1 
ATOM   2120 N N   . LEU A 1 268 ? 54.319  28.475 7.402  1.00 55.63 ? 268  LEU A N   1 
ATOM   2121 C CA  . LEU A 1 268 ? 54.731  27.151 6.993  1.00 55.34 ? 268  LEU A CA  1 
ATOM   2122 C C   . LEU A 1 268 ? 53.961  26.837 5.772  1.00 55.40 ? 268  LEU A C   1 
ATOM   2123 O O   . LEU A 1 268 ? 52.739  26.732 5.860  1.00 55.76 ? 268  LEU A O   1 
ATOM   2124 C CB  . LEU A 1 268 ? 54.425  26.116 8.073  1.00 55.40 ? 268  LEU A CB  1 
ATOM   2125 C CG  . LEU A 1 268 ? 55.559  25.132 8.292  1.00 55.21 ? 268  LEU A CG  1 
ATOM   2126 C CD1 . LEU A 1 268 ? 56.920  25.813 8.181  1.00 54.20 ? 268  LEU A CD1 1 
ATOM   2127 C CD2 . LEU A 1 268 ? 55.416  24.391 9.635  1.00 55.00 ? 268  LEU A CD2 1 
ATOM   2128 N N   . GLU A 1 269 ? 54.673  26.734 4.641  1.00 55.26 ? 269  GLU A N   1 
ATOM   2129 C CA  . GLU A 1 269 ? 54.094  26.446 3.323  1.00 55.18 ? 269  GLU A CA  1 
ATOM   2130 C C   . GLU A 1 269 ? 53.490  25.031 3.326  1.00 55.04 ? 269  GLU A C   1 
ATOM   2131 O O   . GLU A 1 269 ? 53.719  24.254 4.245  1.00 54.69 ? 269  GLU A O   1 
ATOM   2132 C CB  . GLU A 1 269 ? 55.191  26.548 2.256  1.00 55.21 ? 269  GLU A CB  1 
ATOM   2133 C CG  . GLU A 1 269 ? 55.562  27.937 1.732  1.00 55.20 ? 269  GLU A CG  1 
ATOM   2134 C CD  . GLU A 1 269 ? 56.240  28.805 2.755  1.00 55.77 ? 269  GLU A CD  1 
ATOM   2135 O OE1 . GLU A 1 269 ? 57.503  28.907 2.820  1.00 55.13 ? 269  GLU A OE1 1 
ATOM   2136 O OE2 . GLU A 1 269 ? 55.464  29.381 3.516  1.00 56.98 ? 269  GLU A OE2 1 
ATOM   2137 N N   . PRO A 1 270 ? 52.758  24.658 2.290  1.00 55.29 ? 270  PRO A N   1 
ATOM   2138 C CA  . PRO A 1 270 ? 52.202  23.311 2.258  1.00 55.42 ? 270  PRO A CA  1 
ATOM   2139 C C   . PRO A 1 270 ? 53.255  22.217 2.073  1.00 55.19 ? 270  PRO A C   1 
ATOM   2140 O O   . PRO A 1 270 ? 53.040  21.075 2.441  1.00 55.04 ? 270  PRO A O   1 
ATOM   2141 C CB  . PRO A 1 270 ? 51.278  23.339 1.048  1.00 55.42 ? 270  PRO A CB  1 
ATOM   2142 C CG  . PRO A 1 270 ? 51.197  24.750 0.661  1.00 55.66 ? 270  PRO A CG  1 
ATOM   2143 C CD  . PRO A 1 270 ? 52.466  25.387 1.049  1.00 55.28 ? 270  PRO A CD  1 
ATOM   2144 N N   . GLU A 1 271 ? 54.377  22.573 1.479  1.00 54.99 ? 271  GLU A N   1 
ATOM   2145 C CA  . GLU A 1 271 ? 55.425  21.617 1.267  1.00 54.88 ? 271  GLU A CA  1 
ATOM   2146 C C   . GLU A 1 271 ? 56.162  21.243 2.542  1.00 54.30 ? 271  GLU A C   1 
ATOM   2147 O O   . GLU A 1 271 ? 56.877  20.297 2.539  1.00 53.87 ? 271  GLU A O   1 
ATOM   2148 C CB  . GLU A 1 271 ? 56.401  22.137 0.203  1.00 55.17 ? 271  GLU A CB  1 
ATOM   2149 C CG  . GLU A 1 271 ? 57.311  23.264 0.658  1.00 55.42 ? 271  GLU A CG  1 
ATOM   2150 C CD  . GLU A 1 271 ? 58.074  23.902 -0.472 1.00 55.05 ? 271  GLU A CD  1 
ATOM   2151 O OE1 . GLU A 1 271 ? 57.381  24.281 -1.454 1.00 56.03 ? 271  GLU A OE1 1 
ATOM   2152 O OE2 . GLU A 1 271 ? 59.334  24.040 -0.346 1.00 54.53 ? 271  GLU A OE2 1 
ATOM   2153 N N   . TYR A 1 272 ? 56.004  21.971 3.632  1.00 54.39 ? 272  TYR A N   1 
ATOM   2154 C CA  . TYR A 1 272 ? 56.763  21.666 4.851  1.00 54.61 ? 272  TYR A CA  1 
ATOM   2155 C C   . TYR A 1 272 ? 55.984  20.792 5.813  1.00 54.60 ? 272  TYR A C   1 
ATOM   2156 O O   . TYR A 1 272 ? 56.429  20.529 6.942  1.00 54.06 ? 272  TYR A O   1 
ATOM   2157 C CB  . TYR A 1 272 ? 57.172  22.935 5.572  1.00 54.68 ? 272  TYR A CB  1 
ATOM   2158 C CG  . TYR A 1 272 ? 58.293  23.675 4.938  1.00 54.39 ? 272  TYR A CG  1 
ATOM   2159 C CD1 . TYR A 1 272 ? 58.064  24.801 4.183  1.00 54.97 ? 272  TYR A CD1 1 
ATOM   2160 C CD2 . TYR A 1 272 ? 59.582  23.263 5.103  1.00 54.04 ? 272  TYR A CD2 1 
ATOM   2161 C CE1 . TYR A 1 272 ? 59.099  25.496 3.585  1.00 55.21 ? 272  TYR A CE1 1 
ATOM   2162 C CE2 . TYR A 1 272 ? 60.618  23.945 4.526  1.00 54.25 ? 272  TYR A CE2 1 
ATOM   2163 C CZ  . TYR A 1 272 ? 60.376  25.066 3.766  1.00 55.07 ? 272  TYR A CZ  1 
ATOM   2164 O OH  . TYR A 1 272 ? 61.418  25.752 3.175  1.00 55.52 ? 272  TYR A OH  1 
ATOM   2165 N N   . TYR A 1 273 ? 54.803  20.374 5.363  1.00 54.95 ? 273  TYR A N   1 
ATOM   2166 C CA  . TYR A 1 273 ? 53.936  19.511 6.141  1.00 54.71 ? 273  TYR A CA  1 
ATOM   2167 C C   . TYR A 1 273 ? 53.519  18.239 5.450  1.00 54.22 ? 273  TYR A C   1 
ATOM   2168 O O   . TYR A 1 273 ? 52.918  17.391 6.049  1.00 54.50 ? 273  TYR A O   1 
ATOM   2169 C CB  . TYR A 1 273 ? 52.865  20.298 6.918  1.00 54.82 ? 273  TYR A CB  1 
ATOM   2170 C CG  . TYR A 1 273 ? 51.817  21.063 6.143  1.00 54.18 ? 273  TYR A CG  1 
ATOM   2171 C CD1 . TYR A 1 273 ? 50.623  20.476 5.807  1.00 53.69 ? 273  TYR A CD1 1 
ATOM   2172 C CD2 . TYR A 1 273 ? 52.005  22.395 5.833  1.00 54.10 ? 273  TYR A CD2 1 
ATOM   2173 C CE1 . TYR A 1 273 ? 49.675  21.161 5.143  1.00 53.73 ? 273  TYR A CE1 1 
ATOM   2174 C CE2 . TYR A 1 273 ? 51.050  23.094 5.167  1.00 54.30 ? 273  TYR A CE2 1 
ATOM   2175 C CZ  . TYR A 1 273 ? 49.881  22.466 4.824  1.00 53.79 ? 273  TYR A CZ  1 
ATOM   2176 O OH  . TYR A 1 273 ? 48.913  23.131 4.139  1.00 53.79 ? 273  TYR A OH  1 
ATOM   2177 N N   . MET A 1 274 ? 53.864  18.085 4.198  1.00 53.89 ? 274  MET A N   1 
ATOM   2178 C CA  . MET A 1 274 ? 53.302  17.053 3.394  1.00 53.93 ? 274  MET A CA  1 
ATOM   2179 C C   . MET A 1 274 ? 54.361  16.129 2.853  1.00 54.46 ? 274  MET A C   1 
ATOM   2180 O O   . MET A 1 274 ? 55.491  16.506 2.676  1.00 54.77 ? 274  MET A O   1 
ATOM   2181 C CB  . MET A 1 274 ? 52.634  17.653 2.201  1.00 54.35 ? 274  MET A CB  1 
ATOM   2182 C CG  . MET A 1 274 ? 51.401  18.400 2.465  1.00 53.95 ? 274  MET A CG  1 
ATOM   2183 S SD  . MET A 1 274 ? 50.500  18.249 0.978  1.00 51.57 ? 274  MET A SD  1 
ATOM   2184 C CE  . MET A 1 274 ? 51.695  18.889 -0.176 1.00 54.41 ? 274  MET A CE  1 
ATOM   2185 N N   . GLU A 1 275 ? 53.985  14.913 2.538  1.00 54.79 ? 275  GLU A N   1 
ATOM   2186 C CA  . GLU A 1 275 ? 54.945  13.975 2.019  1.00 55.13 ? 275  GLU A CA  1 
ATOM   2187 C C   . GLU A 1 275 ? 54.249  13.076 1.026  1.00 54.86 ? 275  GLU A C   1 
ATOM   2188 O O   . GLU A 1 275 ? 53.258  12.451 1.349  1.00 55.19 ? 275  GLU A O   1 
ATOM   2189 C CB  . GLU A 1 275 ? 55.552  13.139 3.164  1.00 55.35 ? 275  GLU A CB  1 
ATOM   2190 C CG  . GLU A 1 275 ? 56.997  13.444 3.556  1.00 55.50 ? 275  GLU A CG  1 
ATOM   2191 C CD  . GLU A 1 275 ? 58.044  13.067 2.476  1.00 57.26 ? 275  GLU A CD  1 
ATOM   2192 O OE1 . GLU A 1 275 ? 58.281  13.941 1.598  1.00 58.02 ? 275  GLU A OE1 1 
ATOM   2193 O OE2 . GLU A 1 275 ? 58.651  11.918 2.490  1.00 57.06 ? 275  GLU A OE2 1 
ATOM   2194 N N   . PRO A 1 276 ? 54.714  13.026 -0.209 1.00 54.71 ? 276  PRO A N   1 
ATOM   2195 C CA  . PRO A 1 276 ? 54.311  11.916 -1.049 1.00 55.00 ? 276  PRO A CA  1 
ATOM   2196 C C   . PRO A 1 276 ? 53.934  10.786 -0.122 1.00 55.09 ? 276  PRO A C   1 
ATOM   2197 O O   . PRO A 1 276 ? 54.231  10.883 1.055  1.00 55.28 ? 276  PRO A O   1 
ATOM   2198 C CB  . PRO A 1 276 ? 55.588  11.609 -1.795 1.00 54.95 ? 276  PRO A CB  1 
ATOM   2199 C CG  . PRO A 1 276 ? 56.144  12.925 -2.028 1.00 55.04 ? 276  PRO A CG  1 
ATOM   2200 C CD  . PRO A 1 276 ? 55.828  13.758 -0.822 1.00 54.65 ? 276  PRO A CD  1 
ATOM   2201 N N   . LEU A 1 277 ? 53.272  9.756  -0.623 1.00 54.86 ? 277  LEU A N   1 
ATOM   2202 C CA  . LEU A 1 277 ? 52.870  8.659  0.229  1.00 54.69 ? 277  LEU A CA  1 
ATOM   2203 C C   . LEU A 1 277 ? 53.860  7.538  0.142  1.00 54.60 ? 277  LEU A C   1 
ATOM   2204 O O   . LEU A 1 277 ? 53.916  6.677  1.011  1.00 53.26 ? 277  LEU A O   1 
ATOM   2205 C CB  . LEU A 1 277 ? 51.500  8.140  -0.153 1.00 54.77 ? 277  LEU A CB  1 
ATOM   2206 C CG  . LEU A 1 277 ? 50.521  8.078  1.008  1.00 54.64 ? 277  LEU A CG  1 
ATOM   2207 C CD1 . LEU A 1 277 ? 49.255  7.420  0.592  1.00 54.38 ? 277  LEU A CD1 1 
ATOM   2208 C CD2 . LEU A 1 277 ? 51.138  7.374  2.171  1.00 55.21 ? 277  LEU A CD2 1 
ATOM   2209 N N   . LEU A 1 278 ? 54.649  7.536  -0.928 1.00 55.56 ? 278  LEU A N   1 
ATOM   2210 C CA  . LEU A 1 278 ? 54.468  6.574  -2.008 1.00 56.79 ? 278  LEU A CA  1 
ATOM   2211 C C   . LEU A 1 278 ? 55.334  6.919  -3.215 1.00 56.76 ? 278  LEU A C   1 
ATOM   2212 O O   . LEU A 1 278 ? 55.109  6.415  -4.315 1.00 56.39 ? 278  LEU A O   1 
ATOM   2213 C CB  . LEU A 1 278 ? 52.996  6.502  -2.420 1.00 57.40 ? 278  LEU A CB  1 
ATOM   2214 C CG  . LEU A 1 278 ? 52.719  6.292  -3.910 1.00 57.17 ? 278  LEU A CG  1 
ATOM   2215 C CD1 . LEU A 1 278 ? 53.100  4.882  -4.334 1.00 56.10 ? 278  LEU A CD1 1 
ATOM   2216 C CD2 . LEU A 1 278 ? 51.260  6.577  -4.232 1.00 56.79 ? 278  LEU A CD2 1 
ATOM   2217 N N   . ASP A 1 279 ? 56.239  7.826  -2.989 1.00 56.24 ? 279  ASP A N   1 
ATOM   2218 C CA  . ASP A 1 279 ? 57.611  7.521  -3.326 1.00 56.47 ? 279  ASP A CA  1 
ATOM   2219 C C   . ASP A 1 279 ? 57.880  7.093  -4.766 1.00 56.27 ? 279  ASP A C   1 
ATOM   2220 O O   . ASP A 1 279 ? 58.948  6.574  -5.079 1.00 56.39 ? 279  ASP A O   1 
ATOM   2221 C CB  . ASP A 1 279 ? 57.939  6.175  -3.116 1.00 57.04 ? 279  ASP A CB  1 
ATOM   2222 C CG  . ASP A 1 279 ? 59.396  5.848  -3.291 1.00 55.98 ? 279  ASP A CG  1 
ATOM   2223 O OD1 . ASP A 1 279 ? 60.244  6.616  -2.784 1.00 53.82 ? 279  ASP A OD1 1 
ATOM   2224 O OD2 . ASP A 1 279 ? 59.785  4.834  -3.903 1.00 55.91 ? 279  ASP A OD2 1 
ATOM   2225 N N   . ILE A 1 280 ? 56.965  7.277  -5.644 1.00 55.62 ? 280  ILE A N   1 
ATOM   2226 C CA  . ILE A 1 280 ? 57.057  6.856  -7.037 1.00 55.31 ? 280  ILE A CA  1 
ATOM   2227 C C   . ILE A 1 280 ? 56.292  7.954  -7.767 1.00 55.11 ? 280  ILE A C   1 
ATOM   2228 O O   . ILE A 1 280 ? 56.577  8.258  -8.925 1.00 55.07 ? 280  ILE A O   1 
ATOM   2229 C CB  . ILE A 1 280 ? 56.555  5.472  -7.488 1.00 55.24 ? 280  ILE A CB  1 
ATOM   2230 C CG1 . ILE A 1 280 ? 55.499  5.619  -8.586 1.00 55.64 ? 280  ILE A CG1 1 
ATOM   2231 C CG2 . ILE A 1 280 ? 55.995  4.696  -6.306 1.00 54.61 ? 280  ILE A CG2 1 
ATOM   2232 C CD1 . ILE A 1 280 ? 54.326  6.489  -8.192 1.00 55.61 ? 280  ILE A CD1 1 
ATOM   2233 N N   . ASP A 1 281 ? 55.319  8.547  -7.081 1.00 55.12 ? 281  ASP A N   1 
ATOM   2234 C CA  . ASP A 1 281 ? 54.379  9.460  -7.720 1.00 55.17 ? 281  ASP A CA  1 
ATOM   2235 C C   . ASP A 1 281 ? 53.753  10.408 -6.702 1.00 55.16 ? 281  ASP A C   1 
ATOM   2236 O O   . ASP A 1 281 ? 53.425  10.006 -5.585 1.00 54.97 ? 281  ASP A O   1 
ATOM   2237 C CB  . ASP A 1 281 ? 53.285  8.678  -8.451 1.00 54.64 ? 281  ASP A CB  1 
ATOM   2238 C CG  . ASP A 1 281 ? 51.891  9.149  -8.088 1.00 53.92 ? 281  ASP A CG  1 
ATOM   2239 O OD1 . ASP A 1 281 ? 51.078  9.373  -9.010 1.00 52.90 ? 281  ASP A OD1 1 
ATOM   2240 O OD2 . ASP A 1 281 ? 51.517  9.323  -6.909 1.00 54.60 ? 281  ASP A OD2 1 
ATOM   2241 N N   . ASP A 1 282 ? 53.592  11.667 -7.095 1.00 55.25 ? 282  ASP A N   1 
ATOM   2242 C CA  . ASP A 1 282 ? 53.322  12.738 -6.143 1.00 55.41 ? 282  ASP A CA  1 
ATOM   2243 C C   . ASP A 1 282 ? 51.845  13.119 -6.146 1.00 55.01 ? 282  ASP A C   1 
ATOM   2244 O O   . ASP A 1 282 ? 51.494  14.282 -5.948 1.00 54.63 ? 282  ASP A O   1 
ATOM   2245 C CB  . ASP A 1 282 ? 54.182  13.964 -6.457 1.00 55.58 ? 282  ASP A CB  1 
ATOM   2246 C CG  . ASP A 1 282 ? 53.979  14.471 -7.872 1.00 57.20 ? 282  ASP A CG  1 
ATOM   2247 O OD1 . ASP A 1 282 ? 52.816  14.520 -8.326 1.00 58.60 ? 282  ASP A OD1 1 
ATOM   2248 O OD2 . ASP A 1 282 ? 54.921  14.841 -8.603 1.00 58.04 ? 282  ASP A OD2 1 
ATOM   2249 N N   . THR A 1 283 ? 50.985  12.131 -6.370 1.00 54.80 ? 283  THR A N   1 
ATOM   2250 C CA  . THR A 1 283 ? 49.548  12.367 -6.435 1.00 54.55 ? 283  THR A CA  1 
ATOM   2251 C C   . THR A 1 283 ? 48.949  12.513 -5.040 1.00 54.13 ? 283  THR A C   1 
ATOM   2252 O O   . THR A 1 283 ? 48.286  13.505 -4.740 1.00 53.47 ? 283  THR A O   1 
ATOM   2253 C CB  . THR A 1 283 ? 48.847  11.224 -7.194 1.00 54.54 ? 283  THR A CB  1 
ATOM   2254 O OG1 . THR A 1 283 ? 47.429  11.427 -7.167 1.00 54.75 ? 283  THR A OG1 1 
ATOM   2255 C CG2 . THR A 1 283 ? 49.027  9.906  -6.457 1.00 54.98 ? 283  THR A CG2 1 
ATOM   2256 N N   . LEU A 1 284 ? 49.188  11.518 -4.192 1.00 54.48 ? 284  LEU A N   1 
ATOM   2257 C CA  . LEU A 1 284 ? 48.686  11.540 -2.828 1.00 54.54 ? 284  LEU A CA  1 
ATOM   2258 C C   . LEU A 1 284 ? 49.774  11.872 -1.859 1.00 54.33 ? 284  LEU A C   1 
ATOM   2259 O O   . LEU A 1 284 ? 50.915  11.521 -2.057 1.00 54.44 ? 284  LEU A O   1 
ATOM   2260 C CB  . LEU A 1 284 ? 48.153  10.180 -2.412 1.00 54.53 ? 284  LEU A CB  1 
ATOM   2261 C CG  . LEU A 1 284 ? 46.907  9.703  -3.123 1.00 54.69 ? 284  LEU A CG  1 
ATOM   2262 C CD1 . LEU A 1 284 ? 46.468  8.390  -2.562 1.00 54.94 ? 284  LEU A CD1 1 
ATOM   2263 C CD2 . LEU A 1 284 ? 45.804  10.699 -3.004 1.00 55.03 ? 284  LEU A CD2 1 
ATOM   2264 N N   . CYS A 1 285 ? 49.386  12.487 -0.764 1.00 54.09 ? 285  CYS A N   1 
ATOM   2265 C CA  . CYS A 1 285 ? 50.316  12.967 0.201  1.00 53.98 ? 285  CYS A CA  1 
ATOM   2266 C C   . CYS A 1 285 ? 49.864  12.584 1.567  1.00 54.08 ? 285  CYS A C   1 
ATOM   2267 O O   . CYS A 1 285 ? 48.705  12.378 1.803  1.00 54.24 ? 285  CYS A O   1 
ATOM   2268 C CB  . CYS A 1 285 ? 50.409  14.467 0.144  1.00 53.96 ? 285  CYS A CB  1 
ATOM   2269 S SG  . CYS A 1 285 ? 51.777  14.991 -0.816 1.00 52.68 ? 285  CYS A SG  1 
ATOM   2270 N N   . MET A 1 286 ? 50.827  12.485 2.457  1.00 54.43 ? 286  MET A N   1 
ATOM   2271 C CA  . MET A 1 286 ? 50.609  12.219 3.840  1.00 54.53 ? 286  MET A CA  1 
ATOM   2272 C C   . MET A 1 286 ? 50.855  13.556 4.540  1.00 54.66 ? 286  MET A C   1 
ATOM   2273 O O   . MET A 1 286 ? 51.877  14.170 4.324  1.00 54.60 ? 286  MET A O   1 
ATOM   2274 C CB  . MET A 1 286 ? 51.642  11.207 4.309  1.00 54.44 ? 286  MET A CB  1 
ATOM   2275 C CG  . MET A 1 286 ? 52.111  11.494 5.710  1.00 54.70 ? 286  MET A CG  1 
ATOM   2276 S SD  . MET A 1 286 ? 53.305  10.307 6.274  1.00 54.90 ? 286  MET A SD  1 
ATOM   2277 C CE  . MET A 1 286 ? 54.656  10.411 5.119  1.00 54.31 ? 286  MET A CE  1 
ATOM   2278 N N   . LEU A 1 287 ? 49.931  13.989 5.387  1.00 54.84 ? 287  LEU A N   1 
ATOM   2279 C CA  . LEU A 1 287 ? 50.087  15.216 6.186  1.00 54.69 ? 287  LEU A CA  1 
ATOM   2280 C C   . LEU A 1 287 ? 50.806  15.023 7.507  1.00 54.50 ? 287  LEU A C   1 
ATOM   2281 O O   . LEU A 1 287 ? 50.659  13.993 8.138  1.00 55.11 ? 287  LEU A O   1 
ATOM   2282 C CB  . LEU A 1 287 ? 48.700  15.748 6.510  1.00 54.86 ? 287  LEU A CB  1 
ATOM   2283 C CG  . LEU A 1 287 ? 47.946  16.289 5.300  1.00 55.23 ? 287  LEU A CG  1 
ATOM   2284 C CD1 . LEU A 1 287 ? 46.573  16.627 5.717  1.00 55.56 ? 287  LEU A CD1 1 
ATOM   2285 C CD2 . LEU A 1 287 ? 48.612  17.529 4.755  1.00 55.66 ? 287  LEU A CD2 1 
ATOM   2286 N N   . TYR A 1 288 ? 51.526  16.021 7.987  1.00 54.31 ? 288  TYR A N   1 
ATOM   2287 C CA  . TYR A 1 288 ? 52.163  15.877 9.309  1.00 54.71 ? 288  TYR A CA  1 
ATOM   2288 C C   . TYR A 1 288 ? 51.371  16.445 10.480 1.00 54.82 ? 288  TYR A C   1 
ATOM   2289 O O   . TYR A 1 288 ? 51.897  16.563 11.603 1.00 54.90 ? 288  TYR A O   1 
ATOM   2290 C CB  . TYR A 1 288 ? 53.512  16.527 9.340  1.00 54.89 ? 288  TYR A CB  1 
ATOM   2291 C CG  . TYR A 1 288 ? 54.534  15.867 8.450  1.00 55.30 ? 288  TYR A CG  1 
ATOM   2292 C CD1 . TYR A 1 288 ? 55.193  16.610 7.485  1.00 56.18 ? 288  TYR A CD1 1 
ATOM   2293 C CD2 . TYR A 1 288 ? 54.844  14.536 8.553  1.00 54.33 ? 288  TYR A CD2 1 
ATOM   2294 C CE1 . TYR A 1 288 ? 56.125  16.071 6.670  1.00 55.16 ? 288  TYR A CE1 1 
ATOM   2295 C CE2 . TYR A 1 288 ? 55.780  13.980 7.740  1.00 54.99 ? 288  TYR A CE2 1 
ATOM   2296 C CZ  . TYR A 1 288 ? 56.427  14.757 6.794  1.00 55.09 ? 288  TYR A CZ  1 
ATOM   2297 O OH  . TYR A 1 288 ? 57.397  14.230 5.963  1.00 55.87 ? 288  TYR A OH  1 
ATOM   2298 N N   . ILE A 1 289 ? 50.107  16.751 10.228 1.00 54.45 ? 289  ILE A N   1 
ATOM   2299 C CA  . ILE A 1 289 ? 49.239  17.329 11.203 1.00 54.15 ? 289  ILE A CA  1 
ATOM   2300 C C   . ILE A 1 289 ? 48.367  16.278 11.812 1.00 54.16 ? 289  ILE A C   1 
ATOM   2301 O O   . ILE A 1 289 ? 47.872  15.411 11.103 1.00 54.45 ? 289  ILE A O   1 
ATOM   2302 C CB  . ILE A 1 289 ? 48.397  18.270 10.475 1.00 54.22 ? 289  ILE A CB  1 
ATOM   2303 C CG1 . ILE A 1 289 ? 49.308  19.221 9.736  1.00 54.49 ? 289  ILE A CG1 1 
ATOM   2304 C CG2 . ILE A 1 289 ? 47.501  19.016 11.411 1.00 54.92 ? 289  ILE A CG2 1 
ATOM   2305 C CD1 . ILE A 1 289 ? 48.685  19.835 8.596  1.00 55.17 ? 289  ILE A CD1 1 
ATOM   2306 N N   . LEU A 1 290 ? 48.160  16.351 13.117 1.00 54.32 ? 290  LEU A N   1 
ATOM   2307 C CA  . LEU A 1 290 ? 47.358  15.362 13.835 1.00 54.40 ? 290  LEU A CA  1 
ATOM   2308 C C   . LEU A 1 290 ? 46.640  15.994 14.982 1.00 54.19 ? 290  LEU A C   1 
ATOM   2309 O O   . LEU A 1 290 ? 47.169  16.861 15.656 1.00 53.69 ? 290  LEU A O   1 
ATOM   2310 C CB  . LEU A 1 290 ? 48.243  14.240 14.371 1.00 54.50 ? 290  LEU A CB  1 
ATOM   2311 C CG  . LEU A 1 290 ? 48.796  13.286 13.304 1.00 55.06 ? 290  LEU A CG  1 
ATOM   2312 C CD1 . LEU A 1 290 ? 49.483  12.119 13.979 1.00 55.30 ? 290  LEU A CD1 1 
ATOM   2313 C CD2 . LEU A 1 290 ? 47.682  12.749 12.415 1.00 55.35 ? 290  LEU A CD2 1 
ATOM   2314 N N   . PRO A 1 291 ? 45.405  15.589 15.197 1.00 54.49 ? 291  PRO A N   1 
ATOM   2315 C CA  . PRO A 1 291 ? 44.653  16.122 16.298 1.00 54.76 ? 291  PRO A CA  1 
ATOM   2316 C C   . PRO A 1 291 ? 45.006  15.464 17.599 1.00 55.03 ? 291  PRO A C   1 
ATOM   2317 O O   . PRO A 1 291 ? 44.919  14.237 17.709 1.00 55.19 ? 291  PRO A O   1 
ATOM   2318 C CB  . PRO A 1 291 ? 43.227  15.806 15.916 1.00 54.49 ? 291  PRO A CB  1 
ATOM   2319 C CG  . PRO A 1 291 ? 43.312  14.624 15.135 1.00 54.16 ? 291  PRO A CG  1 
ATOM   2320 C CD  . PRO A 1 291 ? 44.579  14.697 14.377 1.00 54.49 ? 291  PRO A CD  1 
ATOM   2321 N N   . VAL A 1 292 ? 45.450  16.291 18.545 1.00 55.07 ? 292  VAL A N   1 
ATOM   2322 C CA  . VAL A 1 292 ? 45.782  15.890 19.891 1.00 55.00 ? 292  VAL A CA  1 
ATOM   2323 C C   . VAL A 1 292 ? 45.190  16.905 20.850 1.00 55.19 ? 292  VAL A C   1 
ATOM   2324 O O   . VAL A 1 292 ? 45.235  18.110 20.597 1.00 55.21 ? 292  VAL A O   1 
ATOM   2325 C CB  . VAL A 1 292 ? 47.280  15.879 20.129 1.00 54.75 ? 292  VAL A CB  1 
ATOM   2326 C CG1 . VAL A 1 292 ? 47.581  15.172 21.403 1.00 55.29 ? 292  VAL A CG1 1 
ATOM   2327 C CG2 . VAL A 1 292 ? 47.975  15.143 19.032 1.00 55.66 ? 292  VAL A CG2 1 
ATOM   2328 N N   . ASP A 1 293 ? 44.670  16.401 21.972 1.00 55.24 ? 293  ASP A N   1 
ATOM   2329 C CA  . ASP A 1 293 ? 43.984  17.224 22.954 1.00 55.09 ? 293  ASP A CA  1 
ATOM   2330 C C   . ASP A 1 293 ? 44.680  17.454 24.267 1.00 54.88 ? 293  ASP A C   1 
ATOM   2331 O O   . ASP A 1 293 ? 44.174  17.057 25.301 1.00 54.64 ? 293  ASP A O   1 
ATOM   2332 C CB  . ASP A 1 293 ? 42.653  16.601 23.255 1.00 55.18 ? 293  ASP A CB  1 
ATOM   2333 C CG  . ASP A 1 293 ? 41.711  16.740 22.111 1.00 56.28 ? 293  ASP A CG  1 
ATOM   2334 O OD1 . ASP A 1 293 ? 41.646  17.861 21.501 1.00 56.95 ? 293  ASP A OD1 1 
ATOM   2335 O OD2 . ASP A 1 293 ? 41.012  15.772 21.736 1.00 56.87 ? 293  ASP A OD2 1 
ATOM   2336 N N   . ILE A 1 294 ? 45.795  18.170 24.234 1.00 54.87 ? 294  ILE A N   1 
ATOM   2337 C CA  . ILE A 1 294 ? 46.536  18.490 25.445 1.00 55.06 ? 294  ILE A CA  1 
ATOM   2338 C C   . ILE A 1 294 ? 45.701  19.390 26.329 1.00 55.20 ? 294  ILE A C   1 
ATOM   2339 O O   . ILE A 1 294 ? 45.278  18.984 27.401 1.00 55.06 ? 294  ILE A O   1 
ATOM   2340 C CB  . ILE A 1 294 ? 47.815  19.233 25.159 1.00 54.99 ? 294  ILE A CB  1 
ATOM   2341 C CG1 . ILE A 1 294 ? 48.650  18.472 24.144 1.00 55.88 ? 294  ILE A CG1 1 
ATOM   2342 C CG2 . ILE A 1 294 ? 48.566  19.462 26.449 1.00 54.87 ? 294  ILE A CG2 1 
ATOM   2343 C CD1 . ILE A 1 294 ? 48.276  18.787 22.645 1.00 56.83 ? 294  ILE A CD1 1 
ATOM   2344 N N   . ASP A 1 295 ? 45.551  20.562 25.824 1.00 55.14 ? 295  ASP A N   1 
ATOM   2345 C CA  . ASP A 1 295 ? 44.758  21.533 26.366 1.00 55.17 ? 295  ASP A CA  1 
ATOM   2346 C C   . ASP A 1 295 ? 43.839  21.898 25.264 1.00 55.61 ? 295  ASP A C   1 
ATOM   2347 O O   . ASP A 1 295 ? 43.584  21.119 24.356 1.00 56.10 ? 295  ASP A O   1 
ATOM   2348 C CB  . ASP A 1 295 ? 45.504  22.781 26.751 1.00 55.00 ? 295  ASP A CB  1 
ATOM   2349 C CG  . ASP A 1 295 ? 46.278  22.605 28.039 1.00 56.27 ? 295  ASP A CG  1 
ATOM   2350 O OD1 . ASP A 1 295 ? 45.859  21.790 28.898 1.00 56.67 ? 295  ASP A OD1 1 
ATOM   2351 O OD2 . ASP A 1 295 ? 47.316  23.276 28.201 1.00 57.35 ? 295  ASP A OD2 1 
ATOM   2352 N N   . LYS A 1 296 ? 43.342  23.074 25.379 1.00 55.71 ? 296  LYS A N   1 
ATOM   2353 C CA  . LYS A 1 296 ? 42.272  23.559 24.539 1.00 55.90 ? 296  LYS A CA  1 
ATOM   2354 C C   . LYS A 1 296 ? 42.839  24.671 23.652 1.00 55.75 ? 296  LYS A C   1 
ATOM   2355 O O   . LYS A 1 296 ? 42.186  25.214 22.761 1.00 55.59 ? 296  LYS A O   1 
ATOM   2356 C CB  . LYS A 1 296 ? 41.124  24.054 25.413 1.00 55.85 ? 296  LYS A CB  1 
ATOM   2357 C CG  . LYS A 1 296 ? 41.495  25.167 26.398 1.00 56.10 ? 296  LYS A CG  1 
ATOM   2358 C CD  . LYS A 1 296 ? 42.247  24.678 27.650 1.00 57.15 ? 296  LYS A CD  1 
ATOM   2359 C CE  . LYS A 1 296 ? 42.121  25.684 28.889 1.00 57.11 ? 296  LYS A CE  1 
ATOM   2360 N NZ  . LYS A 1 296 ? 42.607  25.154 30.241 1.00 56.86 ? 296  LYS A NZ  1 
ATOM   2361 N N   . ASN A 1 297 ? 44.090  24.976 23.902 1.00 55.59 ? 297  ASN A N   1 
ATOM   2362 C CA  . ASN A 1 297 ? 44.759  26.051 23.234 1.00 55.64 ? 297  ASN A CA  1 
ATOM   2363 C C   . ASN A 1 297 ? 46.221  25.712 23.064 1.00 55.45 ? 297  ASN A C   1 
ATOM   2364 O O   . ASN A 1 297 ? 47.026  26.596 23.042 1.00 54.95 ? 297  ASN A O   1 
ATOM   2365 C CB  . ASN A 1 297 ? 44.698  27.216 24.163 1.00 55.91 ? 297  ASN A CB  1 
ATOM   2366 C CG  . ASN A 1 297 ? 45.192  26.829 25.555 1.00 57.16 ? 297  ASN A CG  1 
ATOM   2367 O OD1 . ASN A 1 297 ? 44.786  25.766 26.119 1.00 56.51 ? 297  ASN A OD1 1 
ATOM   2368 N ND2 . ASN A 1 297 ? 46.109  27.651 26.105 1.00 57.99 ? 297  ASN A ND2 1 
ATOM   2369 N N   . THR A 1 298 ? 46.551  24.421 22.999 1.00 55.65 ? 298  THR A N   1 
ATOM   2370 C CA  . THR A 1 298 ? 47.918  23.953 22.985 1.00 54.97 ? 298  THR A CA  1 
ATOM   2371 C C   . THR A 1 298 ? 48.181  23.226 21.741 1.00 54.70 ? 298  THR A C   1 
ATOM   2372 O O   . THR A 1 298 ? 47.489  22.261 21.402 1.00 54.63 ? 298  THR A O   1 
ATOM   2373 C CB  . THR A 1 298 ? 48.158  23.036 24.111 1.00 55.01 ? 298  THR A CB  1 
ATOM   2374 O OG1 . THR A 1 298 ? 47.841  23.736 25.318 1.00 55.76 ? 298  THR A OG1 1 
ATOM   2375 C CG2 . THR A 1 298 ? 49.620  22.730 24.252 1.00 54.96 ? 298  THR A CG2 1 
ATOM   2376 N N   . PHE A 1 299 ? 49.204  23.720 21.069 1.00 54.98 ? 299  PHE A N   1 
ATOM   2377 C CA  . PHE A 1 299 ? 49.741  23.171 19.828 1.00 55.26 ? 299  PHE A CA  1 
ATOM   2378 C C   . PHE A 1 299 ? 51.167  22.676 20.038 1.00 54.93 ? 299  PHE A C   1 
ATOM   2379 O O   . PHE A 1 299 ? 51.780  22.924 21.062 1.00 54.53 ? 299  PHE A O   1 
ATOM   2380 C CB  . PHE A 1 299 ? 49.826  24.266 18.795 1.00 55.42 ? 299  PHE A CB  1 
ATOM   2381 C CG  . PHE A 1 299 ? 48.522  24.703 18.231 1.00 55.38 ? 299  PHE A CG  1 
ATOM   2382 C CD1 . PHE A 1 299 ? 48.494  25.276 16.976 1.00 55.66 ? 299  PHE A CD1 1 
ATOM   2383 C CD2 . PHE A 1 299 ? 47.332  24.555 18.909 1.00 56.81 ? 299  PHE A CD2 1 
ATOM   2384 C CE1 . PHE A 1 299 ? 47.327  25.703 16.403 1.00 56.20 ? 299  PHE A CE1 1 
ATOM   2385 C CE2 . PHE A 1 299 ? 46.121  24.989 18.325 1.00 56.81 ? 299  PHE A CE2 1 
ATOM   2386 C CZ  . PHE A 1 299 ? 46.125  25.568 17.071 1.00 56.39 ? 299  PHE A CZ  1 
ATOM   2387 N N   . ILE A 1 300 ? 51.688  21.974 19.047 1.00 54.89 ? 300  ILE A N   1 
ATOM   2388 C CA  . ILE A 1 300 ? 53.037  21.429 19.140 1.00 54.89 ? 300  ILE A CA  1 
ATOM   2389 C C   . ILE A 1 300 ? 53.719  21.518 17.813 1.00 54.78 ? 300  ILE A C   1 
ATOM   2390 O O   . ILE A 1 300 ? 53.152  21.064 16.822 1.00 54.73 ? 300  ILE A O   1 
ATOM   2391 C CB  . ILE A 1 300 ? 53.017  19.960 19.573 1.00 54.81 ? 300  ILE A CB  1 
ATOM   2392 C CG1 . ILE A 1 300 ? 52.093  19.791 20.790 1.00 54.86 ? 300  ILE A CG1 1 
ATOM   2393 C CG2 . ILE A 1 300 ? 54.422  19.524 19.885 1.00 54.98 ? 300  ILE A CG2 1 
ATOM   2394 C CD1 . ILE A 1 300 ? 52.006  18.428 21.338 1.00 54.53 ? 300  ILE A CD1 1 
ATOM   2395 N N   . LEU A 1 301 ? 54.920  22.096 17.791 1.00 54.67 ? 301  LEU A N   1 
ATOM   2396 C CA  . LEU A 1 301 ? 55.684  22.215 16.563 1.00 54.79 ? 301  LEU A CA  1 
ATOM   2397 C C   . LEU A 1 301 ? 56.945  21.384 16.554 1.00 54.86 ? 301  LEU A C   1 
ATOM   2398 O O   . LEU A 1 301 ? 57.920  21.713 17.231 1.00 54.53 ? 301  LEU A O   1 
ATOM   2399 C CB  . LEU A 1 301 ? 56.050  23.642 16.304 1.00 54.71 ? 301  LEU A CB  1 
ATOM   2400 C CG  . LEU A 1 301 ? 54.875  24.576 16.091 1.00 54.83 ? 301  LEU A CG  1 
ATOM   2401 C CD1 . LEU A 1 301 ? 55.353  25.794 15.384 1.00 55.37 ? 301  LEU A CD1 1 
ATOM   2402 C CD2 . LEU A 1 301 ? 53.787  23.967 15.294 1.00 54.70 ? 301  LEU A CD2 1 
ATOM   2403 N N   . GLY A 1 302 ? 56.915  20.314 15.756 1.00 55.04 ? 302  GLY A N   1 
ATOM   2404 C CA  . GLY A 1 302 ? 58.013  19.375 15.651 1.00 55.01 ? 302  GLY A CA  1 
ATOM   2405 C C   . GLY A 1 302 ? 58.782  19.618 14.382 1.00 55.13 ? 302  GLY A C   1 
ATOM   2406 O O   . GLY A 1 302 ? 58.576  20.612 13.701 1.00 54.99 ? 302  GLY A O   1 
ATOM   2407 N N   . ASP A 1 303 ? 59.634  18.664 14.044 1.00 55.00 ? 303  ASP A N   1 
ATOM   2408 C CA  . ASP A 1 303 ? 60.543  18.786 12.930 1.00 54.96 ? 303  ASP A CA  1 
ATOM   2409 C C   . ASP A 1 303 ? 60.074  19.694 11.824 1.00 55.15 ? 303  ASP A C   1 
ATOM   2410 O O   . ASP A 1 303 ? 60.850  20.577 11.382 1.00 55.79 ? 303  ASP A O   1 
ATOM   2411 C CB  . ASP A 1 303 ? 60.856  17.421 12.401 1.00 54.46 ? 303  ASP A CB  1 
ATOM   2412 C CG  . ASP A 1 303 ? 61.036  16.444 13.508 1.00 54.63 ? 303  ASP A CG  1 
ATOM   2413 O OD1 . ASP A 1 303 ? 61.286  16.921 14.634 1.00 55.12 ? 303  ASP A OD1 1 
ATOM   2414 O OD2 . ASP A 1 303 ? 60.933  15.204 13.384 1.00 55.76 ? 303  ASP A OD2 1 
ATOM   2415 N N   . PRO A 1 304 ? 58.840  19.486 11.367 1.00 54.77 ? 304  PRO A N   1 
ATOM   2416 C CA  . PRO A 1 304 ? 58.312  20.211 10.222 1.00 54.84 ? 304  PRO A CA  1 
ATOM   2417 C C   . PRO A 1 304 ? 58.588  21.694 10.210 1.00 54.67 ? 304  PRO A C   1 
ATOM   2418 O O   . PRO A 1 304 ? 58.974  22.234 9.201  1.00 54.27 ? 304  PRO A O   1 
ATOM   2419 C CB  . PRO A 1 304 ? 56.853  19.940 10.326 1.00 55.02 ? 304  PRO A CB  1 
ATOM   2420 C CG  . PRO A 1 304 ? 56.820  18.593 10.822 1.00 54.94 ? 304  PRO A CG  1 
ATOM   2421 C CD  . PRO A 1 304 ? 57.883  18.480 11.832 1.00 54.45 ? 304  PRO A CD  1 
ATOM   2422 N N   . PHE A 1 305 ? 58.420  22.331 11.341 1.00 54.63 ? 305  PHE A N   1 
ATOM   2423 C CA  . PHE A 1 305 ? 58.815  23.714 11.519 1.00 54.60 ? 305  PHE A CA  1 
ATOM   2424 C C   . PHE A 1 305 ? 60.334  23.857 11.404 1.00 54.33 ? 305  PHE A C   1 
ATOM   2425 O O   . PHE A 1 305 ? 60.818  24.497 10.516 1.00 53.89 ? 305  PHE A O   1 
ATOM   2426 C CB  . PHE A 1 305 ? 58.349  24.133 12.914 1.00 54.82 ? 305  PHE A CB  1 
ATOM   2427 C CG  . PHE A 1 305 ? 58.316  25.588 13.140 1.00 54.01 ? 305  PHE A CG  1 
ATOM   2428 C CD1 . PHE A 1 305 ? 59.061  26.152 14.133 1.00 54.60 ? 305  PHE A CD1 1 
ATOM   2429 C CD2 . PHE A 1 305 ? 57.496  26.395 12.397 1.00 53.94 ? 305  PHE A CD2 1 
ATOM   2430 C CE1 . PHE A 1 305 ? 59.020  27.518 14.340 1.00 54.76 ? 305  PHE A CE1 1 
ATOM   2431 C CE2 . PHE A 1 305 ? 57.450  27.731 12.608 1.00 54.11 ? 305  PHE A CE2 1 
ATOM   2432 C CZ  . PHE A 1 305 ? 58.220  28.294 13.575 1.00 54.29 ? 305  PHE A CZ  1 
ATOM   2433 N N   . MET A 1 306 ? 61.063  23.210 12.303 1.00 54.58 ? 306  MET A N   1 
ATOM   2434 C CA  . MET A 1 306 ? 62.500  23.326 12.429 1.00 54.89 ? 306  MET A CA  1 
ATOM   2435 C C   . MET A 1 306 ? 63.258  22.955 11.183 1.00 55.08 ? 306  MET A C   1 
ATOM   2436 O O   . MET A 1 306 ? 64.425  23.386 11.005 1.00 55.28 ? 306  MET A O   1 
ATOM   2437 C CB  . MET A 1 306 ? 62.978  22.402 13.519 1.00 55.19 ? 306  MET A CB  1 
ATOM   2438 C CG  . MET A 1 306 ? 62.766  22.950 14.870 1.00 55.31 ? 306  MET A CG  1 
ATOM   2439 S SD  . MET A 1 306 ? 62.068  21.781 16.013 1.00 55.21 ? 306  MET A SD  1 
ATOM   2440 C CE  . MET A 1 306 ? 63.558  21.215 16.765 1.00 55.68 ? 306  MET A CE  1 
ATOM   2441 N N   . ARG A 1 307 ? 62.643  22.115 10.358 1.00 54.86 ? 307  ARG A N   1 
ATOM   2442 C CA  . ARG A 1 307 ? 63.149  21.906 9.016  1.00 55.18 ? 307  ARG A CA  1 
ATOM   2443 C C   . ARG A 1 307 ? 63.266  23.265 8.324  1.00 54.58 ? 307  ARG A C   1 
ATOM   2444 O O   . ARG A 1 307 ? 64.224  23.501 7.638  1.00 54.60 ? 307  ARG A O   1 
ATOM   2445 C CB  . ARG A 1 307 ? 62.253  20.943 8.161  1.00 55.67 ? 307  ARG A CB  1 
ATOM   2446 C CG  . ARG A 1 307 ? 62.301  19.397 8.492  1.00 55.76 ? 307  ARG A CG  1 
ATOM   2447 C CD  . ARG A 1 307 ? 60.968  18.671 8.219  1.00 55.77 ? 307  ARG A CD  1 
ATOM   2448 N NE  . ARG A 1 307 ? 60.870  17.275 8.707  1.00 56.82 ? 307  ARG A NE  1 
ATOM   2449 C CZ  . ARG A 1 307 ? 59.688  16.574 8.881  1.00 56.75 ? 307  ARG A CZ  1 
ATOM   2450 N NH1 . ARG A 1 307 ? 58.506  17.152 8.600  1.00 56.60 ? 307  ARG A NH1 1 
ATOM   2451 N NH2 . ARG A 1 307 ? 59.672  15.293 9.349  1.00 54.66 ? 307  ARG A NH2 1 
ATOM   2452 N N   . LYS A 1 308 ? 62.304  24.149 8.510  1.00 54.39 ? 308  LYS A N   1 
ATOM   2453 C CA  . LYS A 1 308 ? 62.327  25.445 7.858  1.00 54.75 ? 308  LYS A CA  1 
ATOM   2454 C C   . LYS A 1 308 ? 63.021  26.506 8.715  1.00 54.80 ? 308  LYS A C   1 
ATOM   2455 O O   . LYS A 1 308 ? 63.774  27.322 8.188  1.00 54.82 ? 308  LYS A O   1 
ATOM   2456 C CB  . LYS A 1 308 ? 60.910  25.906 7.491  1.00 54.73 ? 308  LYS A CB  1 
ATOM   2457 C CG  . LYS A 1 308 ? 60.846  27.269 6.814  1.00 54.53 ? 308  LYS A CG  1 
ATOM   2458 C CD  . LYS A 1 308 ? 59.427  27.839 6.773  1.00 55.16 ? 308  LYS A CD  1 
ATOM   2459 C CE  . LYS A 1 308 ? 59.315  29.138 5.894  1.00 55.16 ? 308  LYS A CE  1 
ATOM   2460 N NZ  . LYS A 1 308 ? 57.946  29.657 5.551  1.00 53.32 ? 308  LYS A NZ  1 
ATOM   2461 N N   . TYR A 1 309 ? 62.755  26.529 10.018 1.00 54.89 ? 309  TYR A N   1 
ATOM   2462 C CA  . TYR A 1 309 ? 63.316  27.567 10.852 1.00 54.80 ? 309  TYR A CA  1 
ATOM   2463 C C   . TYR A 1 309 ? 64.331  27.047 11.798 1.00 54.91 ? 309  TYR A C   1 
ATOM   2464 O O   . TYR A 1 309 ? 64.022  26.231 12.676 1.00 54.53 ? 309  TYR A O   1 
ATOM   2465 C CB  . TYR A 1 309 ? 62.258  28.284 11.654 1.00 54.78 ? 309  TYR A CB  1 
ATOM   2466 C CG  . TYR A 1 309 ? 61.271  29.074 10.841 1.00 54.41 ? 309  TYR A CG  1 
ATOM   2467 C CD1 . TYR A 1 309 ? 59.993  28.663 10.758 1.00 54.74 ? 309  TYR A CD1 1 
ATOM   2468 C CD2 . TYR A 1 309 ? 61.618  30.243 10.194 1.00 55.07 ? 309  TYR A CD2 1 
ATOM   2469 C CE1 . TYR A 1 309 ? 59.054  29.345 10.036 1.00 55.45 ? 309  TYR A CE1 1 
ATOM   2470 C CE2 . TYR A 1 309 ? 60.689  30.952 9.447  1.00 55.95 ? 309  TYR A CE2 1 
ATOM   2471 C CZ  . TYR A 1 309 ? 59.369  30.479 9.369  1.00 56.05 ? 309  TYR A CZ  1 
ATOM   2472 O OH  . TYR A 1 309 ? 58.307  31.088 8.672  1.00 55.35 ? 309  TYR A OH  1 
ATOM   2473 N N   . PHE A 1 310 ? 65.546  27.559 11.614 1.00 55.27 ? 310  PHE A N   1 
ATOM   2474 C CA  . PHE A 1 310 ? 66.626  27.393 12.583 1.00 55.28 ? 310  PHE A CA  1 
ATOM   2475 C C   . PHE A 1 310 ? 66.089  28.005 13.826 1.00 55.21 ? 310  PHE A C   1 
ATOM   2476 O O   . PHE A 1 310 ? 65.707  29.195 13.812 1.00 55.04 ? 310  PHE A O   1 
ATOM   2477 C CB  . PHE A 1 310 ? 67.870  28.167 12.179 1.00 55.05 ? 310  PHE A CB  1 
ATOM   2478 C CG  . PHE A 1 310 ? 68.895  28.213 13.231 1.00 54.69 ? 310  PHE A CG  1 
ATOM   2479 C CD1 . PHE A 1 310 ? 69.286  29.400 13.797 1.00 54.67 ? 310  PHE A CD1 1 
ATOM   2480 C CD2 . PHE A 1 310 ? 69.462  27.075 13.695 1.00 54.70 ? 310  PHE A CD2 1 
ATOM   2481 C CE1 . PHE A 1 310 ? 70.252  29.433 14.823 1.00 54.20 ? 310  PHE A CE1 1 
ATOM   2482 C CE2 . PHE A 1 310 ? 70.451  27.128 14.709 1.00 55.14 ? 310  PHE A CE2 1 
ATOM   2483 C CZ  . PHE A 1 310 ? 70.824  28.302 15.259 1.00 53.73 ? 310  PHE A CZ  1 
ATOM   2484 N N   . THR A 1 311 ? 66.029  27.201 14.878 1.00 54.79 ? 311  THR A N   1 
ATOM   2485 C CA  . THR A 1 311 ? 65.461  27.671 16.107 1.00 55.03 ? 311  THR A CA  1 
ATOM   2486 C C   . THR A 1 311 ? 66.486  27.726 17.176 1.00 55.27 ? 311  THR A C   1 
ATOM   2487 O O   . THR A 1 311 ? 67.354  26.829 17.262 1.00 55.09 ? 311  THR A O   1 
ATOM   2488 C CB  . THR A 1 311 ? 64.492  26.722 16.578 1.00 55.20 ? 311  THR A CB  1 
ATOM   2489 O OG1 . THR A 1 311 ? 65.104  25.420 16.466 1.00 54.83 ? 311  THR A OG1 1 
ATOM   2490 C CG2 . THR A 1 311 ? 63.217  26.786 15.711 1.00 55.47 ? 311  THR A CG2 1 
ATOM   2491 N N   . VAL A 1 312 ? 66.312  28.735 18.041 1.00 55.39 ? 312  VAL A N   1 
ATOM   2492 C CA  . VAL A 1 312 ? 67.215  29.018 19.150 1.00 55.25 ? 312  VAL A CA  1 
ATOM   2493 C C   . VAL A 1 312 ? 66.514  29.060 20.473 1.00 54.93 ? 312  VAL A C   1 
ATOM   2494 O O   . VAL A 1 312 ? 65.564  29.764 20.612 1.00 54.89 ? 312  VAL A O   1 
ATOM   2495 C CB  . VAL A 1 312 ? 67.833  30.387 19.001 1.00 55.27 ? 312  VAL A CB  1 
ATOM   2496 C CG1 . VAL A 1 312 ? 68.931  30.560 20.011 1.00 55.42 ? 312  VAL A CG1 1 
ATOM   2497 C CG2 . VAL A 1 312 ? 68.383  30.544 17.625 1.00 55.70 ? 312  VAL A CG2 1 
ATOM   2498 N N   . PHE A 1 313 ? 67.049  28.358 21.455 1.00 55.09 ? 313  PHE A N   1 
ATOM   2499 C CA  . PHE A 1 313 ? 66.459  28.251 22.792 1.00 55.19 ? 313  PHE A CA  1 
ATOM   2500 C C   . PHE A 1 313 ? 67.384  28.870 23.782 1.00 54.84 ? 313  PHE A C   1 
ATOM   2501 O O   . PHE A 1 313 ? 68.502  28.419 23.912 1.00 55.09 ? 313  PHE A O   1 
ATOM   2502 C CB  . PHE A 1 313 ? 66.207  26.772 23.116 1.00 54.98 ? 313  PHE A CB  1 
ATOM   2503 C CG  . PHE A 1 313 ? 65.366  26.102 22.071 1.00 55.36 ? 313  PHE A CG  1 
ATOM   2504 C CD1 . PHE A 1 313 ? 63.989  25.971 22.249 1.00 55.67 ? 313  PHE A CD1 1 
ATOM   2505 C CD2 . PHE A 1 313 ? 65.919  25.671 20.867 1.00 54.72 ? 313  PHE A CD2 1 
ATOM   2506 C CE1 . PHE A 1 313 ? 63.177  25.380 21.260 1.00 54.87 ? 313  PHE A CE1 1 
ATOM   2507 C CE2 . PHE A 1 313 ? 65.116  25.089 19.899 1.00 54.88 ? 313  PHE A CE2 1 
ATOM   2508 C CZ  . PHE A 1 313 ? 63.731  24.958 20.102 1.00 54.54 ? 313  PHE A CZ  1 
ATOM   2509 N N   . ASP A 1 314 ? 66.942  29.903 24.478 1.00 54.58 ? 314  ASP A N   1 
ATOM   2510 C CA  . ASP A 1 314 ? 67.830  30.572 25.416 1.00 54.90 ? 314  ASP A CA  1 
ATOM   2511 C C   . ASP A 1 314 ? 67.370  30.513 26.848 1.00 54.90 ? 314  ASP A C   1 
ATOM   2512 O O   . ASP A 1 314 ? 66.475  31.262 27.231 1.00 55.17 ? 314  ASP A O   1 
ATOM   2513 C CB  . ASP A 1 314 ? 67.958  32.036 25.015 1.00 55.51 ? 314  ASP A CB  1 
ATOM   2514 C CG  . ASP A 1 314 ? 69.252  32.687 25.524 1.00 55.16 ? 314  ASP A CG  1 
ATOM   2515 O OD1 . ASP A 1 314 ? 69.589  32.589 26.728 1.00 55.75 ? 314  ASP A OD1 1 
ATOM   2516 O OD2 . ASP A 1 314 ? 69.980  33.334 24.749 1.00 53.76 ? 314  ASP A OD2 1 
ATOM   2517 N N   . TYR A 1 315 ? 67.993  29.669 27.659 1.00 54.64 ? 315  TYR A N   1 
ATOM   2518 C CA  . TYR A 1 315 ? 67.559  29.539 29.025 1.00 54.83 ? 315  TYR A CA  1 
ATOM   2519 C C   . TYR A 1 315 ? 67.498  30.865 29.752 1.00 55.27 ? 315  TYR A C   1 
ATOM   2520 O O   . TYR A 1 315 ? 66.392  31.320 30.071 1.00 55.53 ? 315  TYR A O   1 
ATOM   2521 C CB  . TYR A 1 315 ? 68.466  28.615 29.777 1.00 54.97 ? 315  TYR A CB  1 
ATOM   2522 C CG  . TYR A 1 315 ? 68.133  27.152 29.596 1.00 55.23 ? 315  TYR A CG  1 
ATOM   2523 C CD1 . TYR A 1 315 ? 69.063  26.281 29.007 1.00 55.40 ? 315  TYR A CD1 1 
ATOM   2524 C CD2 . TYR A 1 315 ? 66.901  26.618 30.027 1.00 54.76 ? 315  TYR A CD2 1 
ATOM   2525 C CE1 . TYR A 1 315 ? 68.784  24.925 28.826 1.00 55.02 ? 315  TYR A CE1 1 
ATOM   2526 C CE2 . TYR A 1 315 ? 66.605  25.267 29.848 1.00 55.35 ? 315  TYR A CE2 1 
ATOM   2527 C CZ  . TYR A 1 315 ? 67.578  24.420 29.246 1.00 55.79 ? 315  TYR A CZ  1 
ATOM   2528 O OH  . TYR A 1 315 ? 67.397  23.070 29.029 1.00 55.99 ? 315  TYR A OH  1 
ATOM   2529 N N   . ASP A 1 316 ? 68.660  31.500 29.990 1.00 55.55 ? 316  ASP A N   1 
ATOM   2530 C CA  . ASP A 1 316 ? 68.757  32.852 30.641 1.00 55.29 ? 316  ASP A CA  1 
ATOM   2531 C C   . ASP A 1 316 ? 67.853  33.867 29.993 1.00 55.09 ? 316  ASP A C   1 
ATOM   2532 O O   . ASP A 1 316 ? 67.061  34.482 30.640 1.00 55.11 ? 316  ASP A O   1 
ATOM   2533 C CB  . ASP A 1 316 ? 70.169  33.432 30.562 1.00 55.36 ? 316  ASP A CB  1 
ATOM   2534 C CG  . ASP A 1 316 ? 71.242  32.425 30.965 1.00 56.63 ? 316  ASP A CG  1 
ATOM   2535 O OD1 . ASP A 1 316 ? 71.148  31.831 32.097 1.00 55.79 ? 316  ASP A OD1 1 
ATOM   2536 O OD2 . ASP A 1 316 ? 72.214  32.162 30.186 1.00 57.19 ? 316  ASP A OD2 1 
ATOM   2537 N N   . LYS A 1 317 ? 67.964  34.034 28.695 1.00 55.11 ? 317  LYS A N   1 
ATOM   2538 C CA  . LYS A 1 317 ? 67.116  34.964 28.006 1.00 55.50 ? 317  LYS A CA  1 
ATOM   2539 C C   . LYS A 1 317 ? 65.619  34.587 28.175 1.00 55.57 ? 317  LYS A C   1 
ATOM   2540 O O   . LYS A 1 317 ? 64.696  35.345 27.794 1.00 55.87 ? 317  LYS A O   1 
ATOM   2541 C CB  . LYS A 1 317 ? 67.565  35.027 26.535 1.00 55.75 ? 317  LYS A CB  1 
ATOM   2542 C CG  . LYS A 1 317 ? 68.942  35.637 26.291 1.00 56.29 ? 317  LYS A CG  1 
ATOM   2543 C CD  . LYS A 1 317 ? 69.369  35.704 24.802 1.00 55.66 ? 317  LYS A CD  1 
ATOM   2544 C CE  . LYS A 1 317 ? 70.794  36.322 24.597 1.00 56.76 ? 317  LYS A CE  1 
ATOM   2545 N NZ  . LYS A 1 317 ? 71.234  36.377 23.060 1.00 56.59 ? 317  LYS A NZ  1 
ATOM   2546 N N   . GLU A 1 318 ? 65.381  33.439 28.792 1.00 55.43 ? 318  GLU A N   1 
ATOM   2547 C CA  . GLU A 1 318 ? 64.029  32.936 29.026 1.00 55.54 ? 318  GLU A CA  1 
ATOM   2548 C C   . GLU A 1 318 ? 63.144  33.119 27.811 1.00 55.37 ? 318  GLU A C   1 
ATOM   2549 O O   . GLU A 1 318 ? 61.983  33.540 27.889 1.00 54.99 ? 318  GLU A O   1 
ATOM   2550 C CB  . GLU A 1 318 ? 63.416  33.615 30.241 1.00 55.90 ? 318  GLU A CB  1 
ATOM   2551 C CG  . GLU A 1 318 ? 62.272  32.847 30.897 1.00 55.74 ? 318  GLU A CG  1 
ATOM   2552 C CD  . GLU A 1 318 ? 61.717  33.557 32.123 1.00 55.94 ? 318  GLU A CD  1 
ATOM   2553 O OE1 . GLU A 1 318 ? 60.697  33.007 32.670 1.00 56.01 ? 318  GLU A OE1 1 
ATOM   2554 O OE2 . GLU A 1 318 ? 62.289  34.650 32.514 1.00 54.61 ? 318  GLU A OE2 1 
ATOM   2555 N N   . SER A 1 319 ? 63.717  32.765 26.667 1.00 55.70 ? 319  SER A N   1 
ATOM   2556 C CA  . SER A 1 319 ? 63.029  32.914 25.396 1.00 55.78 ? 319  SER A CA  1 
ATOM   2557 C C   . SER A 1 319 ? 63.611  32.035 24.287 1.00 55.32 ? 319  SER A C   1 
ATOM   2558 O O   . SER A 1 319 ? 64.630  31.359 24.461 1.00 54.44 ? 319  SER A O   1 
ATOM   2559 C CB  . SER A 1 319 ? 62.994  34.389 24.982 1.00 55.83 ? 319  SER A CB  1 
ATOM   2560 O OG  . SER A 1 319 ? 63.416  34.524 23.643 1.00 55.09 ? 319  SER A OG  1 
ATOM   2561 N N   . ILE A 1 320 ? 62.897  32.048 23.168 1.00 55.27 ? 320  ILE A N   1 
ATOM   2562 C CA  . ILE A 1 320 ? 63.292  31.300 22.017 1.00 55.58 ? 320  ILE A CA  1 
ATOM   2563 C C   . ILE A 1 320 ? 63.306  32.129 20.749 1.00 55.51 ? 320  ILE A C   1 
ATOM   2564 O O   . ILE A 1 320 ? 62.371  32.860 20.427 1.00 55.13 ? 320  ILE A O   1 
ATOM   2565 C CB  . ILE A 1 320 ? 62.468  30.011 21.790 1.00 55.37 ? 320  ILE A CB  1 
ATOM   2566 C CG1 . ILE A 1 320 ? 62.711  29.576 20.361 1.00 55.83 ? 320  ILE A CG1 1 
ATOM   2567 C CG2 . ILE A 1 320 ? 60.960  30.163 22.044 1.00 55.36 ? 320  ILE A CG2 1 
ATOM   2568 C CD1 . ILE A 1 320 ? 61.968  28.339 19.988 1.00 57.32 ? 320  ILE A CD1 1 
ATOM   2569 N N   . GLY A 1 321 ? 64.405  31.946 20.032 1.00 55.95 ? 321  GLY A N   1 
ATOM   2570 C CA  . GLY A 1 321 ? 64.681  32.619 18.797 1.00 55.82 ? 321  GLY A CA  1 
ATOM   2571 C C   . GLY A 1 321 ? 64.277  31.795 17.595 1.00 55.65 ? 321  GLY A C   1 
ATOM   2572 O O   . GLY A 1 321 ? 64.409  30.580 17.560 1.00 55.44 ? 321  GLY A O   1 
ATOM   2573 N N   . PHE A 1 322 ? 63.809  32.515 16.596 1.00 55.44 ? 322  PHE A N   1 
ATOM   2574 C CA  . PHE A 1 322 ? 63.402  31.962 15.369 1.00 55.30 ? 322  PHE A CA  1 
ATOM   2575 C C   . PHE A 1 322 ? 64.128  32.650 14.243 1.00 55.68 ? 322  PHE A C   1 
ATOM   2576 O O   . PHE A 1 322 ? 64.423  33.858 14.306 1.00 55.53 ? 322  PHE A O   1 
ATOM   2577 C CB  . PHE A 1 322 ? 61.931  32.169 15.239 1.00 54.94 ? 322  PHE A CB  1 
ATOM   2578 C CG  . PHE A 1 322 ? 61.194  31.540 16.324 1.00 55.52 ? 322  PHE A CG  1 
ATOM   2579 C CD1 . PHE A 1 322 ? 61.296  32.039 17.630 1.00 56.04 ? 322  PHE A CD1 1 
ATOM   2580 C CD2 . PHE A 1 322 ? 60.445  30.408 16.092 1.00 55.10 ? 322  PHE A CD2 1 
ATOM   2581 C CE1 . PHE A 1 322 ? 60.626  31.468 18.653 1.00 55.45 ? 322  PHE A CE1 1 
ATOM   2582 C CE2 . PHE A 1 322 ? 59.789  29.826 17.115 1.00 55.31 ? 322  PHE A CE2 1 
ATOM   2583 C CZ  . PHE A 1 322 ? 59.874  30.361 18.415 1.00 55.53 ? 322  PHE A CZ  1 
ATOM   2584 N N   . ALA A 1 323 ? 64.410  31.868 13.195 1.00 55.93 ? 323  ALA A N   1 
ATOM   2585 C CA  . ALA A 1 323 ? 64.933  32.418 11.948 1.00 55.73 ? 323  ALA A CA  1 
ATOM   2586 C C   . ALA A 1 323 ? 65.057  31.284 10.932 1.00 55.29 ? 323  ALA A C   1 
ATOM   2587 O O   . ALA A 1 323 ? 65.213  30.100 11.323 1.00 54.20 ? 323  ALA A O   1 
ATOM   2588 C CB  . ALA A 1 323 ? 66.298  33.119 12.196 1.00 56.18 ? 323  ALA A CB  1 
ATOM   2589 N N   . VAL A 1 324 ? 64.975  31.695 9.653  1.00 55.26 ? 324  VAL A N   1 
ATOM   2590 C CA  . VAL A 1 324 ? 64.984  30.797 8.483  1.00 55.47 ? 324  VAL A CA  1 
ATOM   2591 C C   . VAL A 1 324 ? 66.328  30.138 8.314  1.00 55.86 ? 324  VAL A C   1 
ATOM   2592 O O   . VAL A 1 324 ? 67.365  30.789 8.384  1.00 56.70 ? 324  VAL A O   1 
ATOM   2593 C CB  . VAL A 1 324 ? 64.751  31.541 7.187  1.00 55.13 ? 324  VAL A CB  1 
ATOM   2594 C CG1 . VAL A 1 324 ? 64.767  30.574 6.055  1.00 54.85 ? 324  VAL A CG1 1 
ATOM   2595 C CG2 . VAL A 1 324 ? 63.441  32.309 7.231  1.00 55.67 ? 324  VAL A CG2 1 
ATOM   2596 N N   . ALA A 1 325 ? 66.350  28.853 8.043  1.00 55.92 ? 325  ALA A N   1 
ATOM   2597 C CA  . ALA A 1 325 ? 67.627  28.163 8.102  1.00 55.84 ? 325  ALA A CA  1 
ATOM   2598 C C   . ALA A 1 325 ? 68.247  28.150 6.738  1.00 55.59 ? 325  ALA A C   1 
ATOM   2599 O O   . ALA A 1 325 ? 67.558  28.331 5.753  1.00 55.35 ? 325  ALA A O   1 
ATOM   2600 C CB  . ALA A 1 325 ? 67.434  26.738 8.640  1.00 56.28 ? 325  ALA A CB  1 
ATOM   2601 N N   . LYS A 1 326 ? 69.556  27.927 6.697  1.00 55.86 ? 326  LYS A N   1 
ATOM   2602 C CA  . LYS A 1 326 ? 70.306  27.771 5.431  1.00 55.89 ? 326  LYS A CA  1 
ATOM   2603 C C   . LYS A 1 326 ? 69.867  26.503 4.756  1.00 55.73 ? 326  LYS A C   1 
ATOM   2604 O O   . LYS A 1 326 ? 70.294  25.430 5.171  1.00 54.62 ? 326  LYS A O   1 
ATOM   2605 C CB  . LYS A 1 326 ? 71.822  27.726 5.684  1.00 55.70 ? 326  LYS A CB  1 
ATOM   2606 C CG  . LYS A 1 326 ? 72.664  28.230 4.519  1.00 56.21 ? 326  LYS A CG  1 
ATOM   2607 C CD  . LYS A 1 326 ? 72.723  29.811 4.431  1.00 57.05 ? 326  LYS A CD  1 
ATOM   2608 C CE  . LYS A 1 326 ? 73.651  30.367 3.257  1.00 57.30 ? 326  LYS A CE  1 
ATOM   2609 N NZ  . LYS A 1 326 ? 73.113  30.208 1.786  1.00 57.82 ? 326  LYS A NZ  1 
ATOM   2610 N N   . ASN A 1 327 ? 68.969  26.656 3.762  1.00 56.26 ? 327  ASN A N   1 
ATOM   2611 C CA  . ASN A 1 327 ? 68.397  25.542 2.924  1.00 56.34 ? 327  ASN A CA  1 
ATOM   2612 C C   . ASN A 1 327 ? 67.559  24.470 3.652  1.00 56.83 ? 327  ASN A C   1 
ATOM   2613 O O   . ASN A 1 327 ? 68.008  23.755 4.571  1.00 57.35 ? 327  ASN A O   1 
ATOM   2614 C CB  . ASN A 1 327 ? 69.506  24.864 2.146  1.00 56.44 ? 327  ASN A CB  1 
ATOM   2615 C CG  . ASN A 1 327 ? 70.575  25.884 1.642  1.00 57.19 ? 327  ASN A CG  1 
ATOM   2616 O OD1 . ASN A 1 327 ? 70.313  26.695 0.753  1.00 57.20 ? 327  ASN A OD1 1 
ATOM   2617 N ND2 . ASN A 1 327 ? 71.763  25.843 2.235  1.00 56.59 ? 327  ASN A ND2 1 
ATOM   2618 N N   . SER B 1 1   ? 55.807  76.887 21.176 1.00 56.65 ? 1    SER B N   1 
ATOM   2619 C CA  . SER B 1 1   ? 55.735  77.342 22.620 1.00 56.63 ? 1    SER B CA  1 
ATOM   2620 C C   . SER B 1 1   ? 57.005  78.142 23.034 1.00 56.74 ? 1    SER B C   1 
ATOM   2621 O O   . SER B 1 1   ? 57.970  78.290 22.224 1.00 56.85 ? 1    SER B O   1 
ATOM   2622 C CB  . SER B 1 1   ? 55.482  76.133 23.561 1.00 56.74 ? 1    SER B CB  1 
ATOM   2623 O OG  . SER B 1 1   ? 54.210  75.490 23.375 1.00 56.78 ? 1    SER B OG  1 
ATOM   2624 N N   . GLU B 1 2   ? 56.988  78.671 24.268 1.00 56.45 ? 2    GLU B N   1 
ATOM   2625 C CA  . GLU B 1 2   ? 58.174  79.368 24.839 1.00 56.57 ? 2    GLU B CA  1 
ATOM   2626 C C   . GLU B 1 2   ? 59.511  78.487 24.704 1.00 56.33 ? 2    GLU B C   1 
ATOM   2627 O O   . GLU B 1 2   ? 60.664  78.930 25.046 1.00 55.11 ? 2    GLU B O   1 
ATOM   2628 C CB  . GLU B 1 2   ? 57.855  79.765 26.299 1.00 56.65 ? 2    GLU B CB  1 
ATOM   2629 C CG  . GLU B 1 2   ? 57.625  78.550 27.237 1.00 57.08 ? 2    GLU B CG  1 
ATOM   2630 C CD  . GLU B 1 2   ? 56.713  78.839 28.425 1.00 57.00 ? 2    GLU B CD  1 
ATOM   2631 O OE1 . GLU B 1 2   ? 55.468  78.842 28.248 1.00 56.58 ? 2    GLU B OE1 1 
ATOM   2632 O OE2 . GLU B 1 2   ? 57.252  79.051 29.546 1.00 57.16 ? 2    GLU B OE2 1 
ATOM   2633 N N   . ASN B 1 3   ? 59.286  77.255 24.187 1.00 56.22 ? 3    ASN B N   1 
ATOM   2634 C CA  . ASN B 1 3   ? 60.302  76.268 23.795 1.00 56.23 ? 3    ASN B CA  1 
ATOM   2635 C C   . ASN B 1 3   ? 61.645  76.899 23.430 1.00 56.40 ? 3    ASN B C   1 
ATOM   2636 O O   . ASN B 1 3   ? 61.801  77.468 22.352 1.00 56.77 ? 3    ASN B O   1 
ATOM   2637 C CB  . ASN B 1 3   ? 59.773  75.389 22.634 1.00 56.10 ? 3    ASN B CB  1 
ATOM   2638 C CG  . ASN B 1 3   ? 58.478  74.650 22.992 1.00 55.76 ? 3    ASN B CG  1 
ATOM   2639 O OD1 . ASN B 1 3   ? 57.889  74.855 24.086 1.00 54.18 ? 3    ASN B OD1 1 
ATOM   2640 N ND2 . ASN B 1 3   ? 58.048  73.753 22.094 1.00 55.88 ? 3    ASN B ND2 1 
ATOM   2641 N N   . ASP B 1 4   ? 62.604  76.837 24.343 1.00 56.34 ? 4    ASP B N   1 
ATOM   2642 C CA  . ASP B 1 4   ? 63.900  77.401 24.066 1.00 56.14 ? 4    ASP B CA  1 
ATOM   2643 C C   . ASP B 1 4   ? 64.494  76.590 22.915 1.00 56.08 ? 4    ASP B C   1 
ATOM   2644 O O   . ASP B 1 4   ? 64.378  75.363 22.885 1.00 56.46 ? 4    ASP B O   1 
ATOM   2645 C CB  . ASP B 1 4   ? 64.774  77.352 25.316 1.00 56.05 ? 4    ASP B CB  1 
ATOM   2646 C CG  . ASP B 1 4   ? 66.116  78.149 25.175 1.00 57.04 ? 4    ASP B CG  1 
ATOM   2647 O OD1 . ASP B 1 4   ? 66.836  78.292 26.220 1.00 57.42 ? 4    ASP B OD1 1 
ATOM   2648 O OD2 . ASP B 1 4   ? 66.543  78.707 24.099 1.00 58.42 ? 4    ASP B OD2 1 
ATOM   2649 N N   . VAL B 1 5   ? 65.079  77.283 21.945 1.00 55.60 ? 5    VAL B N   1 
ATOM   2650 C CA  . VAL B 1 5   ? 65.749  76.612 20.871 1.00 55.60 ? 5    VAL B CA  1 
ATOM   2651 C C   . VAL B 1 5   ? 67.256  76.878 20.861 1.00 55.66 ? 5    VAL B C   1 
ATOM   2652 O O   . VAL B 1 5   ? 67.677  78.035 20.909 1.00 56.04 ? 5    VAL B O   1 
ATOM   2653 C CB  . VAL B 1 5   ? 65.171  77.044 19.586 1.00 55.49 ? 5    VAL B CB  1 
ATOM   2654 C CG1 . VAL B 1 5   ? 65.692  76.122 18.482 1.00 56.22 ? 5    VAL B CG1 1 
ATOM   2655 C CG2 . VAL B 1 5   ? 63.671  76.979 19.681 1.00 55.65 ? 5    VAL B CG2 1 
ATOM   2656 N N   . ILE B 1 6   ? 68.053  75.810 20.833 1.00 55.48 ? 6    ILE B N   1 
ATOM   2657 C CA  . ILE B 1 6   ? 69.503  75.918 20.889 1.00 55.42 ? 6    ILE B CA  1 
ATOM   2658 C C   . ILE B 1 6   ? 70.042  75.408 19.605 1.00 55.14 ? 6    ILE B C   1 
ATOM   2659 O O   . ILE B 1 6   ? 69.724  74.299 19.224 1.00 55.32 ? 6    ILE B O   1 
ATOM   2660 C CB  . ILE B 1 6   ? 70.092  75.034 22.034 1.00 55.83 ? 6    ILE B CB  1 
ATOM   2661 C CG1 . ILE B 1 6   ? 69.188  75.017 23.292 1.00 56.43 ? 6    ILE B CG1 1 
ATOM   2662 C CG2 . ILE B 1 6   ? 71.561  75.460 22.389 1.00 55.50 ? 6    ILE B CG2 1 
ATOM   2663 C CD1 . ILE B 1 6   ? 69.155  76.352 24.075 1.00 56.79 ? 6    ILE B CD1 1 
ATOM   2664 N N   . GLU B 1 7   ? 70.893  76.175 18.956 1.00 54.94 ? 7    GLU B N   1 
ATOM   2665 C CA  . GLU B 1 7   ? 71.365  75.759 17.663 1.00 55.22 ? 7    GLU B CA  1 
ATOM   2666 C C   . GLU B 1 7   ? 72.616  74.999 17.741 1.00 55.36 ? 7    GLU B C   1 
ATOM   2667 O O   . GLU B 1 7   ? 73.595  75.523 18.234 1.00 55.82 ? 7    GLU B O   1 
ATOM   2668 C CB  . GLU B 1 7   ? 71.633  76.933 16.776 1.00 55.27 ? 7    GLU B CB  1 
ATOM   2669 C CG  . GLU B 1 7   ? 72.092  76.527 15.387 1.00 55.22 ? 7    GLU B CG  1 
ATOM   2670 C CD  . GLU B 1 7   ? 72.234  77.736 14.484 1.00 56.17 ? 7    GLU B CD  1 
ATOM   2671 O OE1 . GLU B 1 7   ? 71.240  78.406 14.059 1.00 56.76 ? 7    GLU B OE1 1 
ATOM   2672 O OE2 . GLU B 1 7   ? 73.390  78.043 14.215 1.00 57.47 ? 7    GLU B OE2 1 
ATOM   2673 N N   . LEU B 1 8   ? 72.595  73.772 17.224 1.00 55.67 ? 8    LEU B N   1 
ATOM   2674 C CA  . LEU B 1 8   ? 73.787  72.922 17.136 1.00 55.54 ? 8    LEU B CA  1 
ATOM   2675 C C   . LEU B 1 8   ? 74.433  73.180 15.820 1.00 55.70 ? 8    LEU B C   1 
ATOM   2676 O O   . LEU B 1 8   ? 73.777  73.011 14.799 1.00 55.84 ? 8    LEU B O   1 
ATOM   2677 C CB  . LEU B 1 8   ? 73.428  71.458 17.157 1.00 55.12 ? 8    LEU B CB  1 
ATOM   2678 C CG  . LEU B 1 8   ? 72.693  70.959 18.370 1.00 55.24 ? 8    LEU B CG  1 
ATOM   2679 C CD1 . LEU B 1 8   ? 72.321  69.569 18.098 1.00 55.41 ? 8    LEU B CD1 1 
ATOM   2680 C CD2 . LEU B 1 8   ? 73.518  71.015 19.637 1.00 55.64 ? 8    LEU B CD2 1 
ATOM   2681 N N   . ASP B 1 9   ? 75.705  73.578 15.835 1.00 55.71 ? 9    ASP B N   1 
ATOM   2682 C CA  . ASP B 1 9   ? 76.419  73.867 14.606 1.00 55.86 ? 9    ASP B CA  1 
ATOM   2683 C C   . ASP B 1 9   ? 77.554  72.891 14.397 1.00 55.93 ? 9    ASP B C   1 
ATOM   2684 O O   . ASP B 1 9   ? 78.424  72.731 15.242 1.00 55.59 ? 9    ASP B O   1 
ATOM   2685 C CB  . ASP B 1 9   ? 76.924  75.315 14.595 1.00 56.29 ? 9    ASP B CB  1 
ATOM   2686 C CG  . ASP B 1 9   ? 75.774  76.343 14.588 1.00 56.38 ? 9    ASP B CG  1 
ATOM   2687 O OD1 . ASP B 1 9   ? 75.106  76.469 13.537 1.00 55.43 ? 9    ASP B OD1 1 
ATOM   2688 O OD2 . ASP B 1 9   ? 75.484  77.060 15.575 1.00 55.98 ? 9    ASP B OD2 1 
ATOM   2689 N N   . ASP B 1 10  ? 77.565  72.239 13.244 1.00 56.34 ? 10   ASP B N   1 
ATOM   2690 C CA  . ASP B 1 10  ? 78.527  71.181 12.996 1.00 56.16 ? 10   ASP B CA  1 
ATOM   2691 C C   . ASP B 1 10  ? 79.754  71.694 12.275 1.00 56.36 ? 10   ASP B C   1 
ATOM   2692 O O   . ASP B 1 10  ? 79.744  72.792 11.728 1.00 56.68 ? 10   ASP B O   1 
ATOM   2693 C CB  . ASP B 1 10  ? 77.902  70.058 12.186 1.00 55.74 ? 10   ASP B CB  1 
ATOM   2694 C CG  . ASP B 1 10  ? 78.809  69.568 11.107 1.00 56.44 ? 10   ASP B CG  1 
ATOM   2695 O OD1 . ASP B 1 10  ? 79.377  70.413 10.403 1.00 56.47 ? 10   ASP B OD1 1 
ATOM   2696 O OD2 . ASP B 1 10  ? 79.028  68.371 10.885 1.00 58.10 ? 10   ASP B OD2 1 
ATOM   2697 N N   . VAL B 1 11  ? 80.804  70.880 12.268 1.00 56.06 ? 11   VAL B N   1 
ATOM   2698 C CA  . VAL B 1 11  ? 82.165  71.361 12.065 1.00 56.05 ? 11   VAL B CA  1 
ATOM   2699 C C   . VAL B 1 11  ? 83.009  70.301 11.387 1.00 55.83 ? 11   VAL B C   1 
ATOM   2700 O O   . VAL B 1 11  ? 82.838  69.113 11.625 1.00 54.49 ? 11   VAL B O   1 
ATOM   2701 C CB  . VAL B 1 11  ? 82.830  71.711 13.379 1.00 56.14 ? 11   VAL B CB  1 
ATOM   2702 C CG1 . VAL B 1 11  ? 82.951  73.192 13.529 1.00 56.16 ? 11   VAL B CG1 1 
ATOM   2703 C CG2 . VAL B 1 11  ? 82.056  71.129 14.512 1.00 57.04 ? 11   VAL B CG2 1 
ATOM   2704 N N   . ALA B 1 12  ? 83.934  70.746 10.550 1.00 56.27 ? 12   ALA B N   1 
ATOM   2705 C CA  . ALA B 1 12  ? 84.212  70.088 9.288  1.00 56.66 ? 12   ALA B CA  1 
ATOM   2706 C C   . ALA B 1 12  ? 83.804  68.628 9.329  1.00 57.23 ? 12   ALA B C   1 
ATOM   2707 O O   . ALA B 1 12  ? 83.076  68.154 8.465  1.00 57.62 ? 12   ALA B O   1 
ATOM   2708 C CB  . ALA B 1 12  ? 85.678  70.212 8.949  1.00 56.55 ? 12   ALA B CB  1 
ATOM   2709 N N   . ASN B 1 13  ? 84.295  67.907 10.322 1.00 56.71 ? 13   ASN B N   1 
ATOM   2710 C CA  . ASN B 1 13  ? 83.995  66.499 10.418 1.00 56.35 ? 13   ASN B CA  1 
ATOM   2711 C C   . ASN B 1 13  ? 82.514  66.312 10.568 1.00 56.60 ? 13   ASN B C   1 
ATOM   2712 O O   . ASN B 1 13  ? 81.731  66.841 9.791  1.00 56.74 ? 13   ASN B O   1 
ATOM   2713 C CB  . ASN B 1 13  ? 84.727  65.877 11.594 1.00 56.08 ? 13   ASN B CB  1 
ATOM   2714 C CG  . ASN B 1 13  ? 86.221  65.953 11.438 1.00 56.87 ? 13   ASN B CG  1 
ATOM   2715 O OD1 . ASN B 1 13  ? 86.974  65.594 12.337 1.00 57.86 ? 13   ASN B OD1 1 
ATOM   2716 N ND2 . ASN B 1 13  ? 86.663  66.428 10.283 1.00 55.76 ? 13   ASN B ND2 1 
ATOM   2717 N N   . LEU B 1 14  ? 82.117  65.566 11.579 1.00 56.30 ? 14   LEU B N   1 
ATOM   2718 C CA  . LEU B 1 14  ? 80.700  65.373 11.814 1.00 56.07 ? 14   LEU B CA  1 
ATOM   2719 C C   . LEU B 1 14  ? 80.426  65.376 13.285 1.00 56.27 ? 14   LEU B C   1 
ATOM   2720 O O   . LEU B 1 14  ? 79.745  64.490 13.761 1.00 57.01 ? 14   LEU B O   1 
ATOM   2721 C CB  . LEU B 1 14  ? 80.223  64.065 11.191 1.00 56.01 ? 14   LEU B CB  1 
ATOM   2722 C CG  . LEU B 1 14  ? 80.343  63.906 9.679  1.00 56.29 ? 14   LEU B CG  1 
ATOM   2723 C CD1 . LEU B 1 14  ? 79.705  65.144 8.940  1.00 56.10 ? 14   LEU B CD1 1 
ATOM   2724 C CD2 . LEU B 1 14  ? 81.837  63.615 9.246  1.00 56.19 ? 14   LEU B CD2 1 
ATOM   2725 N N   . MET B 1 15  ? 80.971  66.338 14.028 1.00 56.29 ? 15   MET B N   1 
ATOM   2726 C CA  . MET B 1 15  ? 80.526  66.545 15.407 1.00 55.91 ? 15   MET B CA  1 
ATOM   2727 C C   . MET B 1 15  ? 80.098  67.992 15.561 1.00 55.59 ? 15   MET B C   1 
ATOM   2728 O O   . MET B 1 15  ? 80.617  68.890 14.868 1.00 54.97 ? 15   MET B O   1 
ATOM   2729 C CB  . MET B 1 15  ? 81.576  66.122 16.456 1.00 56.23 ? 15   MET B CB  1 
ATOM   2730 C CG  . MET B 1 15  ? 80.994  66.097 17.962 1.00 56.85 ? 15   MET B CG  1 
ATOM   2731 S SD  . MET B 1 15  ? 79.490  65.055 18.360 1.00 57.23 ? 15   MET B SD  1 
ATOM   2732 C CE  . MET B 1 15  ? 78.564  66.115 19.503 1.00 55.41 ? 15   MET B CE  1 
ATOM   2733 N N   . PHE B 1 16  ? 79.094  68.177 16.425 1.00 55.48 ? 16   PHE B N   1 
ATOM   2734 C CA  . PHE B 1 16  ? 78.414  69.467 16.601 1.00 55.55 ? 16   PHE B CA  1 
ATOM   2735 C C   . PHE B 1 16  ? 78.612  70.005 18.012 1.00 55.42 ? 16   PHE B C   1 
ATOM   2736 O O   . PHE B 1 16  ? 78.695  69.247 18.990 1.00 55.22 ? 16   PHE B O   1 
ATOM   2737 C CB  . PHE B 1 16  ? 76.918  69.332 16.316 1.00 55.57 ? 16   PHE B CB  1 
ATOM   2738 C CG  . PHE B 1 16  ? 76.247  68.268 17.134 1.00 55.79 ? 16   PHE B CG  1 
ATOM   2739 C CD1 . PHE B 1 16  ? 76.044  68.442 18.538 1.00 57.05 ? 16   PHE B CD1 1 
ATOM   2740 C CD2 . PHE B 1 16  ? 75.836  67.082 16.536 1.00 55.81 ? 16   PHE B CD2 1 
ATOM   2741 C CE1 . PHE B 1 16  ? 75.428  67.425 19.363 1.00 56.78 ? 16   PHE B CE1 1 
ATOM   2742 C CE2 . PHE B 1 16  ? 75.191  66.061 17.326 1.00 56.51 ? 16   PHE B CE2 1 
ATOM   2743 C CZ  . PHE B 1 16  ? 74.987  66.235 18.750 1.00 56.59 ? 16   PHE B CZ  1 
ATOM   2744 N N   . TYR B 1 17  ? 78.686  71.320 18.094 1.00 55.29 ? 17   TYR B N   1 
ATOM   2745 C CA  . TYR B 1 17  ? 78.811  72.034 19.342 1.00 55.43 ? 17   TYR B CA  1 
ATOM   2746 C C   . TYR B 1 17  ? 77.552  72.947 19.494 1.00 55.43 ? 17   TYR B C   1 
ATOM   2747 O O   . TYR B 1 17  ? 76.702  73.018 18.600 1.00 55.23 ? 17   TYR B O   1 
ATOM   2748 C CB  . TYR B 1 17  ? 80.132  72.820 19.310 1.00 55.55 ? 17   TYR B CB  1 
ATOM   2749 C CG  . TYR B 1 17  ? 80.058  74.143 18.499 1.00 56.73 ? 17   TYR B CG  1 
ATOM   2750 C CD1 . TYR B 1 17  ? 79.687  75.362 19.115 1.00 56.95 ? 17   TYR B CD1 1 
ATOM   2751 C CD2 . TYR B 1 17  ? 80.350  74.184 17.096 1.00 57.09 ? 17   TYR B CD2 1 
ATOM   2752 C CE1 . TYR B 1 17  ? 79.616  76.586 18.364 1.00 56.76 ? 17   TYR B CE1 1 
ATOM   2753 C CE2 . TYR B 1 17  ? 80.289  75.408 16.332 1.00 56.31 ? 17   TYR B CE2 1 
ATOM   2754 C CZ  . TYR B 1 17  ? 79.910  76.599 16.972 1.00 56.90 ? 17   TYR B CZ  1 
ATOM   2755 O OH  . TYR B 1 17  ? 79.821  77.794 16.250 1.00 56.30 ? 17   TYR B OH  1 
ATOM   2756 N N   . GLY B 1 18  ? 77.407  73.639 20.609 1.00 55.43 ? 18   GLY B N   1 
ATOM   2757 C CA  . GLY B 1 18  ? 76.320  74.623 20.741 1.00 55.43 ? 18   GLY B CA  1 
ATOM   2758 C C   . GLY B 1 18  ? 76.850  75.804 21.531 1.00 55.61 ? 18   GLY B C   1 
ATOM   2759 O O   . GLY B 1 18  ? 77.796  75.654 22.299 1.00 56.00 ? 18   GLY B O   1 
ATOM   2760 N N   . GLU B 1 19  ? 76.268  76.985 21.384 1.00 55.75 ? 19   GLU B N   1 
ATOM   2761 C CA  . GLU B 1 19  ? 76.764  78.123 22.159 1.00 55.74 ? 19   GLU B CA  1 
ATOM   2762 C C   . GLU B 1 19  ? 76.348  77.913 23.596 1.00 55.47 ? 19   GLU B C   1 
ATOM   2763 O O   . GLU B 1 19  ? 75.414  77.222 23.876 1.00 55.26 ? 19   GLU B O   1 
ATOM   2764 C CB  . GLU B 1 19  ? 76.234  79.462 21.639 1.00 55.92 ? 19   GLU B CB  1 
ATOM   2765 C CG  . GLU B 1 19  ? 77.175  80.648 21.920 1.00 55.84 ? 19   GLU B CG  1 
ATOM   2766 C CD  . GLU B 1 19  ? 76.468  82.005 21.767 1.00 56.55 ? 19   GLU B CD  1 
ATOM   2767 O OE1 . GLU B 1 19  ? 76.101  82.435 20.609 1.00 57.31 ? 19   GLU B OE1 1 
ATOM   2768 O OE2 . GLU B 1 19  ? 76.239  82.637 22.855 1.00 57.15 ? 19   GLU B OE2 1 
ATOM   2769 N N   . GLY B 1 20  ? 77.090  78.488 24.518 1.00 55.90 ? 20   GLY B N   1 
ATOM   2770 C CA  . GLY B 1 20  ? 76.769  78.377 25.947 1.00 55.95 ? 20   GLY B CA  1 
ATOM   2771 C C   . GLY B 1 20  ? 77.361  79.524 26.745 1.00 56.02 ? 20   GLY B C   1 
ATOM   2772 O O   . GLY B 1 20  ? 78.583  79.739 26.709 1.00 56.37 ? 20   GLY B O   1 
ATOM   2773 N N   . GLU B 1 21  ? 76.524  80.255 27.478 1.00 55.74 ? 21   GLU B N   1 
ATOM   2774 C CA  . GLU B 1 21  ? 77.077  81.294 28.318 1.00 55.73 ? 21   GLU B CA  1 
ATOM   2775 C C   . GLU B 1 21  ? 76.829  81.030 29.770 1.00 55.64 ? 21   GLU B C   1 
ATOM   2776 O O   . GLU B 1 21  ? 75.775  80.464 30.144 1.00 55.00 ? 21   GLU B O   1 
ATOM   2777 C CB  . GLU B 1 21  ? 76.606  82.691 27.928 1.00 55.99 ? 21   GLU B CB  1 
ATOM   2778 C CG  . GLU B 1 21  ? 75.631  82.764 26.770 1.00 56.56 ? 21   GLU B CG  1 
ATOM   2779 C CD  . GLU B 1 21  ? 75.232  84.185 26.443 1.00 56.21 ? 21   GLU B CD  1 
ATOM   2780 O OE1 . GLU B 1 21  ? 74.032  84.414 26.297 1.00 56.49 ? 21   GLU B OE1 1 
ATOM   2781 O OE2 . GLU B 1 21  ? 76.110  85.072 26.335 1.00 56.06 ? 21   GLU B OE2 1 
ATOM   2782 N N   . VAL B 1 22  ? 77.851  81.399 30.563 1.00 55.67 ? 22   VAL B N   1 
ATOM   2783 C CA  . VAL B 1 22  ? 77.776  81.391 32.023 1.00 55.63 ? 22   VAL B CA  1 
ATOM   2784 C C   . VAL B 1 22  ? 78.028  82.766 32.589 1.00 55.49 ? 22   VAL B C   1 
ATOM   2785 O O   . VAL B 1 22  ? 79.079  83.372 32.356 1.00 54.71 ? 22   VAL B O   1 
ATOM   2786 C CB  . VAL B 1 22  ? 78.842  80.515 32.647 1.00 55.82 ? 22   VAL B CB  1 
ATOM   2787 C CG1 . VAL B 1 22  ? 79.183  79.332 31.775 1.00 55.57 ? 22   VAL B CG1 1 
ATOM   2788 C CG2 . VAL B 1 22  ? 80.057  81.260 32.837 1.00 55.48 ? 22   VAL B CG2 1 
ATOM   2789 N N   . GLY B 1 23  ? 77.060  83.260 33.341 1.00 55.63 ? 23   GLY B N   1 
ATOM   2790 C CA  . GLY B 1 23  ? 77.300  84.435 34.162 1.00 56.04 ? 23   GLY B CA  1 
ATOM   2791 C C   . GLY B 1 23  ? 76.645  85.689 33.626 1.00 56.22 ? 23   GLY B C   1 
ATOM   2792 O O   . GLY B 1 23  ? 76.223  85.737 32.449 1.00 55.92 ? 23   GLY B O   1 
ATOM   2793 N N   . ASP B 1 24  ? 76.563  86.689 34.523 1.00 56.56 ? 24   ASP B N   1 
ATOM   2794 C CA  . ASP B 1 24  ? 76.109  88.079 34.221 1.00 56.28 ? 24   ASP B CA  1 
ATOM   2795 C C   . ASP B 1 24  ? 76.745  88.634 32.961 1.00 55.96 ? 24   ASP B C   1 
ATOM   2796 O O   . ASP B 1 24  ? 76.074  89.131 32.081 1.00 55.86 ? 24   ASP B O   1 
ATOM   2797 C CB  . ASP B 1 24  ? 76.425  89.035 35.392 1.00 56.19 ? 24   ASP B CB  1 
ATOM   2798 C CG  . ASP B 1 24  ? 75.295  89.124 36.377 1.00 56.82 ? 24   ASP B CG  1 
ATOM   2799 O OD1 . ASP B 1 24  ? 75.158  88.170 37.155 1.00 58.23 ? 24   ASP B OD1 1 
ATOM   2800 O OD2 . ASP B 1 24  ? 74.485  90.080 36.453 1.00 57.26 ? 24   ASP B OD2 1 
ATOM   2801 N N   . ASN B 1 25  ? 78.050  88.535 32.867 1.00 55.61 ? 25   ASN B N   1 
ATOM   2802 C CA  . ASN B 1 25  ? 78.687  89.128 31.738 1.00 55.83 ? 25   ASN B CA  1 
ATOM   2803 C C   . ASN B 1 25  ? 78.394  88.253 30.499 1.00 56.17 ? 25   ASN B C   1 
ATOM   2804 O O   . ASN B 1 25  ? 78.697  88.645 29.346 1.00 56.47 ? 25   ASN B O   1 
ATOM   2805 C CB  . ASN B 1 25  ? 80.191  89.322 32.004 1.00 55.62 ? 25   ASN B CB  1 
ATOM   2806 C CG  . ASN B 1 25  ? 80.941  88.008 32.126 1.00 55.92 ? 25   ASN B CG  1 
ATOM   2807 O OD1 . ASN B 1 25  ? 80.402  86.941 31.800 1.00 57.31 ? 25   ASN B OD1 1 
ATOM   2808 N ND2 . ASN B 1 25  ? 82.170  88.065 32.607 1.00 54.25 ? 25   ASN B ND2 1 
ATOM   2809 N N   . HIS B 1 26  ? 77.795  87.075 30.730 1.00 56.15 ? 26   HIS B N   1 
ATOM   2810 C CA  . HIS B 1 26  ? 77.446  86.155 29.635 1.00 56.05 ? 26   HIS B CA  1 
ATOM   2811 C C   . HIS B 1 26  ? 78.711  85.776 28.864 1.00 56.01 ? 26   HIS B C   1 
ATOM   2812 O O   . HIS B 1 26  ? 78.833  86.144 27.687 1.00 56.38 ? 26   HIS B O   1 
ATOM   2813 C CB  . HIS B 1 26  ? 76.431  86.801 28.666 1.00 56.16 ? 26   HIS B CB  1 
ATOM   2814 C CG  . HIS B 1 26  ? 75.080  87.021 29.263 1.00 56.52 ? 26   HIS B CG  1 
ATOM   2815 N ND1 . HIS B 1 26  ? 74.817  88.030 30.165 1.00 55.99 ? 26   HIS B ND1 1 
ATOM   2816 C CD2 . HIS B 1 26  ? 73.912  86.361 29.086 1.00 56.58 ? 26   HIS B CD2 1 
ATOM   2817 C CE1 . HIS B 1 26  ? 73.551  87.965 30.537 1.00 55.59 ? 26   HIS B CE1 1 
ATOM   2818 N NE2 . HIS B 1 26  ? 72.976  86.969 29.889 1.00 55.72 ? 26   HIS B NE2 1 
ATOM   2819 N N   . GLN B 1 27  ? 79.657  85.087 29.511 1.00 55.53 ? 27   GLN B N   1 
ATOM   2820 C CA  . GLN B 1 27  ? 80.791  84.574 28.773 1.00 55.53 ? 27   GLN B CA  1 
ATOM   2821 C C   . GLN B 1 27  ? 80.267  83.422 27.916 1.00 55.50 ? 27   GLN B C   1 
ATOM   2822 O O   . GLN B 1 27  ? 79.532  82.548 28.421 1.00 54.90 ? 27   GLN B O   1 
ATOM   2823 C CB  . GLN B 1 27  ? 81.933  84.089 29.672 1.00 55.63 ? 27   GLN B CB  1 
ATOM   2824 C CG  . GLN B 1 27  ? 82.786  85.161 30.264 1.00 55.08 ? 27   GLN B CG  1 
ATOM   2825 C CD  . GLN B 1 27  ? 83.797  84.605 31.229 1.00 55.13 ? 27   GLN B CD  1 
ATOM   2826 O OE1 . GLN B 1 27  ? 84.681  83.838 30.846 1.00 55.08 ? 27   GLN B OE1 1 
ATOM   2827 N NE2 . GLN B 1 27  ? 83.664  84.975 32.491 1.00 54.47 ? 27   GLN B NE2 1 
ATOM   2828 N N   . LYS B 1 28  ? 80.655  83.455 26.628 1.00 55.56 ? 28   LYS B N   1 
ATOM   2829 C CA  . LYS B 1 28  ? 80.255  82.471 25.616 1.00 55.65 ? 28   LYS B CA  1 
ATOM   2830 C C   . LYS B 1 28  ? 81.201  81.262 25.461 1.00 55.19 ? 28   LYS B C   1 
ATOM   2831 O O   . LYS B 1 28  ? 82.401  81.394 25.546 1.00 54.81 ? 28   LYS B O   1 
ATOM   2832 C CB  . LYS B 1 28  ? 80.087  83.185 24.271 1.00 56.25 ? 28   LYS B CB  1 
ATOM   2833 C CG  . LYS B 1 28  ? 79.018  84.347 24.269 1.00 56.54 ? 28   LYS B CG  1 
ATOM   2834 C CD  . LYS B 1 28  ? 78.569  84.781 22.824 1.00 56.16 ? 28   LYS B CD  1 
ATOM   2835 C CE  . LYS B 1 28  ? 77.304  85.687 22.908 1.00 56.58 ? 28   LYS B CE  1 
ATOM   2836 N NZ  . LYS B 1 28  ? 76.643  86.000 21.599 1.00 57.81 ? 28   LYS B NZ  1 
ATOM   2837 N N   . PHE B 1 29  ? 80.619  80.091 25.236 1.00 54.93 ? 29   PHE B N   1 
ATOM   2838 C CA  . PHE B 1 29  ? 81.347  78.866 25.266 1.00 54.99 ? 29   PHE B CA  1 
ATOM   2839 C C   . PHE B 1 29  ? 80.772  77.865 24.318 1.00 55.06 ? 29   PHE B C   1 
ATOM   2840 O O   . PHE B 1 29  ? 79.581  77.681 24.242 1.00 54.69 ? 29   PHE B O   1 
ATOM   2841 C CB  . PHE B 1 29  ? 81.299  78.269 26.655 1.00 55.02 ? 29   PHE B CB  1 
ATOM   2842 C CG  . PHE B 1 29  ? 82.312  78.832 27.554 1.00 55.16 ? 29   PHE B CG  1 
ATOM   2843 C CD1 . PHE B 1 29  ? 83.643  78.470 27.412 1.00 55.77 ? 29   PHE B CD1 1 
ATOM   2844 C CD2 . PHE B 1 29  ? 81.969  79.729 28.535 1.00 55.61 ? 29   PHE B CD2 1 
ATOM   2845 C CE1 . PHE B 1 29  ? 84.615  78.992 28.229 1.00 55.87 ? 29   PHE B CE1 1 
ATOM   2846 C CE2 . PHE B 1 29  ? 82.941  80.274 29.341 1.00 55.62 ? 29   PHE B CE2 1 
ATOM   2847 C CZ  . PHE B 1 29  ? 84.270  79.897 29.184 1.00 55.89 ? 29   PHE B CZ  1 
ATOM   2848 N N   . MET B 1 30  ? 81.653  77.204 23.591 1.00 55.52 ? 30   MET B N   1 
ATOM   2849 C CA  . MET B 1 30  ? 81.285  76.093 22.726 1.00 55.38 ? 30   MET B CA  1 
ATOM   2850 C C   . MET B 1 30  ? 81.292  74.894 23.616 1.00 55.05 ? 30   MET B C   1 
ATOM   2851 O O   . MET B 1 30  ? 82.326  74.547 24.161 1.00 55.29 ? 30   MET B O   1 
ATOM   2852 C CB  . MET B 1 30  ? 82.306  75.936 21.580 1.00 55.61 ? 30   MET B CB  1 
ATOM   2853 C CG  . MET B 1 30  ? 82.243  77.048 20.501 1.00 55.02 ? 30   MET B CG  1 
ATOM   2854 S SD  . MET B 1 30  ? 83.692  76.942 19.430 1.00 56.12 ? 30   MET B SD  1 
ATOM   2855 C CE  . MET B 1 30  ? 83.037  76.130 17.936 1.00 55.75 ? 30   MET B CE  1 
ATOM   2856 N N   . LEU B 1 31  ? 80.135  74.287 23.794 1.00 54.92 ? 31   LEU B N   1 
ATOM   2857 C CA  . LEU B 1 31  ? 80.004  73.154 24.699 1.00 55.30 ? 31   LEU B CA  1 
ATOM   2858 C C   . LEU B 1 31  ? 79.891  71.871 23.914 1.00 55.12 ? 31   LEU B C   1 
ATOM   2859 O O   . LEU B 1 31  ? 80.566  71.711 22.951 1.00 55.57 ? 31   LEU B O   1 
ATOM   2860 C CB  . LEU B 1 31  ? 78.785  73.316 25.618 1.00 55.51 ? 31   LEU B CB  1 
ATOM   2861 C CG  . LEU B 1 31  ? 78.600  74.607 26.408 1.00 55.46 ? 31   LEU B CG  1 
ATOM   2862 C CD1 . LEU B 1 31  ? 77.529  74.445 27.486 1.00 54.73 ? 31   LEU B CD1 1 
ATOM   2863 C CD2 . LEU B 1 31  ? 79.913  74.995 27.004 1.00 55.98 ? 31   LEU B CD2 1 
ATOM   2864 N N   . ILE B 1 32  ? 79.053  70.960 24.368 1.00 54.98 ? 32   ILE B N   1 
ATOM   2865 C CA  . ILE B 1 32  ? 78.792  69.696 23.736 1.00 55.10 ? 32   ILE B CA  1 
ATOM   2866 C C   . ILE B 1 32  ? 77.617  69.192 24.526 1.00 55.10 ? 32   ILE B C   1 
ATOM   2867 O O   . ILE B 1 32  ? 77.739  68.855 25.703 1.00 55.01 ? 32   ILE B O   1 
ATOM   2868 C CB  . ILE B 1 32  ? 79.945  68.675 23.870 1.00 54.96 ? 32   ILE B CB  1 
ATOM   2869 C CG1 . ILE B 1 32  ? 81.010  68.882 22.802 1.00 55.46 ? 32   ILE B CG1 1 
ATOM   2870 C CG2 . ILE B 1 32  ? 79.439  67.257 23.635 1.00 54.70 ? 32   ILE B CG2 1 
ATOM   2871 C CD1 . ILE B 1 32  ? 82.191  67.871 22.866 1.00 55.26 ? 32   ILE B CD1 1 
ATOM   2872 N N   . PHE B 1 33  ? 76.471  69.102 23.902 1.00 55.00 ? 33   PHE B N   1 
ATOM   2873 C CA  . PHE B 1 33  ? 75.353  68.659 24.649 1.00 54.90 ? 33   PHE B CA  1 
ATOM   2874 C C   . PHE B 1 33  ? 75.393  67.175 24.516 1.00 54.51 ? 33   PHE B C   1 
ATOM   2875 O O   . PHE B 1 33  ? 75.418  66.642 23.411 1.00 54.23 ? 33   PHE B O   1 
ATOM   2876 C CB  . PHE B 1 33  ? 74.095  69.308 24.117 1.00 55.40 ? 33   PHE B CB  1 
ATOM   2877 C CG  . PHE B 1 33  ? 74.130  70.776 24.242 1.00 54.80 ? 33   PHE B CG  1 
ATOM   2878 C CD1 . PHE B 1 33  ? 75.134  71.511 23.588 1.00 55.35 ? 33   PHE B CD1 1 
ATOM   2879 C CD2 . PHE B 1 33  ? 73.222  71.433 25.044 1.00 54.06 ? 33   PHE B CD2 1 
ATOM   2880 C CE1 . PHE B 1 33  ? 75.193  72.899 23.695 1.00 55.63 ? 33   PHE B CE1 1 
ATOM   2881 C CE2 . PHE B 1 33  ? 73.266  72.803 25.178 1.00 54.71 ? 33   PHE B CE2 1 
ATOM   2882 C CZ  . PHE B 1 33  ? 74.252  73.555 24.499 1.00 55.89 ? 33   PHE B CZ  1 
ATOM   2883 N N   . ASP B 1 34  ? 75.441  66.532 25.669 1.00 54.45 ? 34   ASP B N   1 
ATOM   2884 C CA  . ASP B 1 34  ? 75.674  65.122 25.765 1.00 54.61 ? 34   ASP B CA  1 
ATOM   2885 C C   . ASP B 1 34  ? 74.709  64.369 26.723 1.00 54.28 ? 34   ASP B C   1 
ATOM   2886 O O   . ASP B 1 34  ? 74.646  64.657 27.908 1.00 53.77 ? 34   ASP B O   1 
ATOM   2887 C CB  . ASP B 1 34  ? 77.099  64.966 26.216 1.00 54.68 ? 34   ASP B CB  1 
ATOM   2888 C CG  . ASP B 1 34  ? 77.426  63.575 26.523 1.00 55.19 ? 34   ASP B CG  1 
ATOM   2889 O OD1 . ASP B 1 34  ? 78.415  63.378 27.304 1.00 54.99 ? 34   ASP B OD1 1 
ATOM   2890 O OD2 . ASP B 1 34  ? 76.697  62.646 26.039 1.00 54.49 ? 34   ASP B OD2 1 
ATOM   2891 N N   . THR B 1 35  ? 74.002  63.380 26.198 1.00 54.23 ? 35   THR B N   1 
ATOM   2892 C CA  . THR B 1 35  ? 73.048  62.612 26.981 1.00 54.41 ? 35   THR B CA  1 
ATOM   2893 C C   . THR B 1 35  ? 73.734  61.418 27.606 1.00 54.39 ? 35   THR B C   1 
ATOM   2894 O O   . THR B 1 35  ? 73.094  60.436 28.055 1.00 53.53 ? 35   THR B O   1 
ATOM   2895 C CB  . THR B 1 35  ? 71.853  62.158 26.121 1.00 54.33 ? 35   THR B CB  1 
ATOM   2896 O OG1 . THR B 1 35  ? 72.299  61.367 25.032 1.00 54.50 ? 35   THR B OG1 1 
ATOM   2897 C CG2 . THR B 1 35  ? 71.223  63.300 25.439 1.00 54.31 ? 35   THR B CG2 1 
ATOM   2898 N N   . GLY B 1 36  ? 75.057  61.523 27.620 1.00 54.72 ? 36   GLY B N   1 
ATOM   2899 C CA  . GLY B 1 36  ? 75.946  60.504 28.162 1.00 54.53 ? 36   GLY B CA  1 
ATOM   2900 C C   . GLY B 1 36  ? 76.591  60.899 29.461 1.00 53.93 ? 36   GLY B C   1 
ATOM   2901 O O   . GLY B 1 36  ? 76.838  60.070 30.265 1.00 53.62 ? 36   GLY B O   1 
ATOM   2902 N N   . SER B 1 37  ? 76.868  62.163 29.670 1.00 53.69 ? 37   SER B N   1 
ATOM   2903 C CA  . SER B 1 37  ? 77.274  62.587 30.969 1.00 54.20 ? 37   SER B CA  1 
ATOM   2904 C C   . SER B 1 37  ? 76.159  63.402 31.604 1.00 54.43 ? 37   SER B C   1 
ATOM   2905 O O   . SER B 1 37  ? 75.111  63.652 30.987 1.00 54.19 ? 37   SER B O   1 
ATOM   2906 C CB  . SER B 1 37  ? 78.563  63.364 30.903 1.00 53.91 ? 37   SER B CB  1 
ATOM   2907 O OG  . SER B 1 37  ? 78.343  64.669 30.506 1.00 53.57 ? 37   SER B OG  1 
ATOM   2908 N N   . ALA B 1 38  ? 76.341  63.762 32.867 1.00 54.67 ? 38   ALA B N   1 
ATOM   2909 C CA  . ALA B 1 38  ? 75.309  64.499 33.546 1.00 54.96 ? 38   ALA B CA  1 
ATOM   2910 C C   . ALA B 1 38  ? 75.873  65.637 34.342 1.00 55.17 ? 38   ALA B C   1 
ATOM   2911 O O   . ALA B 1 38  ? 75.273  66.079 35.348 1.00 55.41 ? 38   ALA B O   1 
ATOM   2912 C CB  . ALA B 1 38  ? 74.496  63.598 34.438 1.00 55.56 ? 38   ALA B CB  1 
ATOM   2913 N N   . ASN B 1 39  ? 76.991  66.156 33.876 1.00 55.09 ? 39   ASN B N   1 
ATOM   2914 C CA  . ASN B 1 39  ? 77.542  67.314 34.519 1.00 55.15 ? 39   ASN B CA  1 
ATOM   2915 C C   . ASN B 1 39  ? 77.721  68.429 33.550 1.00 54.81 ? 39   ASN B C   1 
ATOM   2916 O O   . ASN B 1 39  ? 77.350  68.341 32.406 1.00 54.52 ? 39   ASN B O   1 
ATOM   2917 C CB  . ASN B 1 39  ? 78.878  66.958 35.179 1.00 55.37 ? 39   ASN B CB  1 
ATOM   2918 C CG  . ASN B 1 39  ? 78.719  66.006 36.348 1.00 54.89 ? 39   ASN B CG  1 
ATOM   2919 O OD1 . ASN B 1 39  ? 78.298  64.886 36.151 1.00 55.69 ? 39   ASN B OD1 1 
ATOM   2920 N ND2 . ASN B 1 39  ? 79.051  66.450 37.558 1.00 53.74 ? 39   ASN B ND2 1 
ATOM   2921 N N   . LEU B 1 40  ? 78.310  69.487 34.043 1.00 54.91 ? 40   LEU B N   1 
ATOM   2922 C CA  . LEU B 1 40  ? 78.706  70.574 33.220 1.00 54.91 ? 40   LEU B CA  1 
ATOM   2923 C C   . LEU B 1 40  ? 80.065  71.162 33.675 1.00 54.78 ? 40   LEU B C   1 
ATOM   2924 O O   . LEU B 1 40  ? 80.374  71.339 34.874 1.00 54.37 ? 40   LEU B O   1 
ATOM   2925 C CB  . LEU B 1 40  ? 77.615  71.603 33.251 1.00 54.86 ? 40   LEU B CB  1 
ATOM   2926 C CG  . LEU B 1 40  ? 78.049  72.995 32.809 1.00 55.49 ? 40   LEU B CG  1 
ATOM   2927 C CD1 . LEU B 1 40  ? 78.486  73.006 31.380 1.00 55.54 ? 40   LEU B CD1 1 
ATOM   2928 C CD2 . LEU B 1 40  ? 76.906  74.005 33.021 1.00 55.45 ? 40   LEU B CD2 1 
ATOM   2929 N N   . TRP B 1 41  ? 80.896  71.433 32.686 1.00 54.92 ? 41   TRP B N   1 
ATOM   2930 C CA  . TRP B 1 41  ? 82.175  72.020 32.932 1.00 54.93 ? 41   TRP B CA  1 
ATOM   2931 C C   . TRP B 1 41  ? 82.678  72.875 31.789 1.00 54.78 ? 41   TRP B C   1 
ATOM   2932 O O   . TRP B 1 41  ? 82.374  72.645 30.629 1.00 54.38 ? 41   TRP B O   1 
ATOM   2933 C CB  . TRP B 1 41  ? 83.192  70.942 33.226 1.00 54.93 ? 41   TRP B CB  1 
ATOM   2934 C CG  . TRP B 1 41  ? 83.553  70.057 32.098 1.00 55.05 ? 41   TRP B CG  1 
ATOM   2935 C CD1 . TRP B 1 41  ? 83.036  68.825 31.845 1.00 55.64 ? 41   TRP B CD1 1 
ATOM   2936 C CD2 . TRP B 1 41  ? 84.565  70.279 31.092 1.00 55.73 ? 41   TRP B CD2 1 
ATOM   2937 N NE1 . TRP B 1 41  ? 83.654  68.264 30.747 1.00 55.84 ? 41   TRP B NE1 1 
ATOM   2938 C CE2 . TRP B 1 41  ? 84.590  69.141 30.260 1.00 55.75 ? 41   TRP B CE2 1 
ATOM   2939 C CE3 . TRP B 1 41  ? 85.433  71.334 30.792 1.00 55.56 ? 41   TRP B CE3 1 
ATOM   2940 C CZ2 . TRP B 1 41  ? 85.426  69.047 29.153 1.00 54.66 ? 41   TRP B CZ2 1 
ATOM   2941 C CZ3 . TRP B 1 41  ? 86.270  71.214 29.711 1.00 54.87 ? 41   TRP B CZ3 1 
ATOM   2942 C CH2 . TRP B 1 41  ? 86.254  70.085 28.905 1.00 54.53 ? 41   TRP B CH2 1 
ATOM   2943 N N   . VAL B 1 42  ? 83.478  73.853 32.173 1.00 54.83 ? 42   VAL B N   1 
ATOM   2944 C CA  . VAL B 1 42  ? 84.016  74.831 31.292 1.00 54.88 ? 42   VAL B CA  1 
ATOM   2945 C C   . VAL B 1 42  ? 85.445  75.053 31.731 1.00 54.66 ? 42   VAL B C   1 
ATOM   2946 O O   . VAL B 1 42  ? 85.690  75.255 32.891 1.00 54.32 ? 42   VAL B O   1 
ATOM   2947 C CB  . VAL B 1 42  ? 83.229  76.150 31.417 1.00 55.20 ? 42   VAL B CB  1 
ATOM   2948 C CG1 . VAL B 1 42  ? 81.752  75.960 31.050 1.00 54.57 ? 42   VAL B CG1 1 
ATOM   2949 C CG2 . VAL B 1 42  ? 83.340  76.739 32.826 1.00 55.47 ? 42   VAL B CG2 1 
ATOM   2950 N N   . PRO B 1 43  ? 86.391  75.035 30.813 1.00 54.95 ? 43   PRO B N   1 
ATOM   2951 C CA  . PRO B 1 43  ? 87.789  75.185 31.158 1.00 55.11 ? 43   PRO B CA  1 
ATOM   2952 C C   . PRO B 1 43  ? 88.044  76.536 31.787 1.00 55.39 ? 43   PRO B C   1 
ATOM   2953 O O   . PRO B 1 43  ? 87.892  77.542 31.124 1.00 55.71 ? 43   PRO B O   1 
ATOM   2954 C CB  . PRO B 1 43  ? 88.484  75.092 29.811 1.00 54.78 ? 43   PRO B CB  1 
ATOM   2955 C CG  . PRO B 1 43  ? 87.495  75.514 28.890 1.00 55.34 ? 43   PRO B CG  1 
ATOM   2956 C CD  . PRO B 1 43  ? 86.207  74.947 29.364 1.00 55.36 ? 43   PRO B CD  1 
ATOM   2957 N N   . SER B 1 44  ? 88.393  76.559 33.071 1.00 55.67 ? 44   SER B N   1 
ATOM   2958 C CA  . SER B 1 44  ? 88.453  77.810 33.830 1.00 55.32 ? 44   SER B CA  1 
ATOM   2959 C C   . SER B 1 44  ? 89.675  78.534 33.494 1.00 55.13 ? 44   SER B C   1 
ATOM   2960 O O   . SER B 1 44  ? 90.683  77.916 33.163 1.00 55.00 ? 44   SER B O   1 
ATOM   2961 C CB  . SER B 1 44  ? 88.545  77.560 35.319 1.00 55.80 ? 44   SER B CB  1 
ATOM   2962 O OG  . SER B 1 44  ? 88.840  78.763 36.029 1.00 55.21 ? 44   SER B OG  1 
ATOM   2963 N N   . LYS B 1 45  ? 89.601  79.843 33.684 1.00 55.00 ? 45   LYS B N   1 
ATOM   2964 C CA  . LYS B 1 45  ? 90.700  80.734 33.386 1.00 55.30 ? 45   LYS B CA  1 
ATOM   2965 C C   . LYS B 1 45  ? 91.929  80.307 34.194 1.00 55.53 ? 45   LYS B C   1 
ATOM   2966 O O   . LYS B 1 45  ? 93.085  80.386 33.744 1.00 54.55 ? 45   LYS B O   1 
ATOM   2967 C CB  . LYS B 1 45  ? 90.312  82.161 33.718 1.00 54.91 ? 45   LYS B CB  1 
ATOM   2968 C CG  . LYS B 1 45  ? 91.157  83.143 32.969 1.00 55.27 ? 45   LYS B CG  1 
ATOM   2969 C CD  . LYS B 1 45  ? 90.912  84.529 33.461 1.00 55.46 ? 45   LYS B CD  1 
ATOM   2970 C CE  . LYS B 1 45  ? 91.015  85.544 32.338 1.00 56.01 ? 45   LYS B CE  1 
ATOM   2971 N NZ  . LYS B 1 45  ? 90.184  86.787 32.660 1.00 56.07 ? 45   LYS B NZ  1 
ATOM   2972 N N   . LYS B 1 46  ? 91.650  79.835 35.410 1.00 56.24 ? 46   LYS B N   1 
ATOM   2973 C CA  . LYS B 1 46  ? 92.684  79.366 36.328 1.00 56.20 ? 46   LYS B CA  1 
ATOM   2974 C C   . LYS B 1 46  ? 93.234  78.017 35.837 1.00 56.29 ? 46   LYS B C   1 
ATOM   2975 O O   . LYS B 1 46  ? 93.567  77.159 36.650 1.00 56.98 ? 46   LYS B O   1 
ATOM   2976 C CB  . LYS B 1 46  ? 92.125  79.267 37.782 1.00 56.23 ? 46   LYS B CB  1 
ATOM   2977 C CG  . LYS B 1 46  ? 91.592  80.605 38.395 1.00 56.05 ? 46   LYS B CG  1 
ATOM   2978 C CD  . LYS B 1 46  ? 90.834  80.363 39.720 1.00 56.20 ? 46   LYS B CD  1 
ATOM   2979 C CE  . LYS B 1 46  ? 90.150  81.637 40.231 1.00 56.18 ? 46   LYS B CE  1 
ATOM   2980 N NZ  . LYS B 1 46  ? 89.268  81.428 41.422 1.00 56.50 ? 46   LYS B NZ  1 
ATOM   2981 N N   . CYS B 1 47  ? 93.329  77.841 34.522 1.00 56.05 ? 47   CYS B N   1 
ATOM   2982 C CA  . CYS B 1 47  ? 93.887  76.633 33.937 1.00 56.14 ? 47   CYS B CA  1 
ATOM   2983 C C   . CYS B 1 47  ? 95.033  77.089 33.073 1.00 56.15 ? 47   CYS B C   1 
ATOM   2984 O O   . CYS B 1 47  ? 95.038  78.197 32.591 1.00 56.61 ? 47   CYS B O   1 
ATOM   2985 C CB  . CYS B 1 47  ? 92.844  75.877 33.087 1.00 56.37 ? 47   CYS B CB  1 
ATOM   2986 S SG  . CYS B 1 47  ? 93.519  74.445 32.148 1.00 56.64 ? 47   CYS B SG  1 
ATOM   2987 N N   . ASN B 1 48  ? 96.014  76.239 32.866 1.00 56.07 ? 48   ASN B N   1 
ATOM   2988 C CA  . ASN B 1 48  ? 97.172  76.634 32.084 1.00 55.92 ? 48   ASN B CA  1 
ATOM   2989 C C   . ASN B 1 48  ? 97.713  75.531 31.230 1.00 56.15 ? 48   ASN B C   1 
ATOM   2990 O O   . ASN B 1 48  ? 98.624  75.792 30.433 1.00 56.15 ? 48   ASN B O   1 
ATOM   2991 C CB  . ASN B 1 48  ? 98.252  77.133 33.013 1.00 55.67 ? 48   ASN B CB  1 
ATOM   2992 C CG  . ASN B 1 48  ? 97.774  78.278 33.828 1.00 55.58 ? 48   ASN B CG  1 
ATOM   2993 O OD1 . ASN B 1 48  ? 97.082  79.142 33.316 1.00 55.64 ? 48   ASN B OD1 1 
ATOM   2994 N ND2 . ASN B 1 48  ? 98.101  78.289 35.108 1.00 55.96 ? 48   ASN B ND2 1 
ATOM   2995 N N   . SER B 1 49  ? 97.179  74.308 31.423 1.00 56.21 ? 49   SER B N   1 
ATOM   2996 C CA  . SER B 1 49  ? 97.334  73.208 30.478 1.00 56.00 ? 49   SER B CA  1 
ATOM   2997 C C   . SER B 1 49  ? 97.285  73.766 29.078 1.00 56.09 ? 49   SER B C   1 
ATOM   2998 O O   . SER B 1 49  ? 96.339  74.536 28.719 1.00 55.44 ? 49   SER B O   1 
ATOM   2999 C CB  . SER B 1 49  ? 96.197  72.186 30.589 1.00 55.75 ? 49   SER B CB  1 
ATOM   3000 O OG  . SER B 1 49  ? 95.887  71.879 31.924 1.00 56.09 ? 49   SER B OG  1 
ATOM   3001 N N   . ILE B 1 50  ? 98.336  73.419 28.323 1.00 56.07 ? 50   ILE B N   1 
ATOM   3002 C CA  . ILE B 1 50  ? 98.329  73.574 26.876 1.00 56.09 ? 50   ILE B CA  1 
ATOM   3003 C C   . ILE B 1 50  ? 96.872  73.531 26.369 1.00 56.19 ? 50   ILE B C   1 
ATOM   3004 O O   . ILE B 1 50  ? 96.379  74.544 25.830 1.00 56.03 ? 50   ILE B O   1 
ATOM   3005 C CB  . ILE B 1 50  ? 99.224  72.487 26.164 1.00 56.08 ? 50   ILE B CB  1 
ATOM   3006 C CG1 . ILE B 1 50  ? 99.104  71.132 26.880 1.00 55.70 ? 50   ILE B CG1 1 
ATOM   3007 C CG2 . ILE B 1 50  ? 100.677 72.969 26.078 1.00 55.60 ? 50   ILE B CG2 1 
ATOM   3008 C CD1 . ILE B 1 50  ? 99.750  70.000 26.197 1.00 55.70 ? 50   ILE B CD1 1 
ATOM   3009 N N   . GLY B 1 51  ? 96.180  72.394 26.569 1.00 56.08 ? 51   GLY B N   1 
ATOM   3010 C CA  . GLY B 1 51  ? 94.819  72.243 26.053 1.00 56.16 ? 51   GLY B CA  1 
ATOM   3011 C C   . GLY B 1 51  ? 94.106  73.597 26.051 1.00 56.27 ? 51   GLY B C   1 
ATOM   3012 O O   . GLY B 1 51  ? 93.705  74.119 24.997 1.00 55.84 ? 51   GLY B O   1 
ATOM   3013 N N   . CYS B 1 52  ? 94.033  74.158 27.267 1.00 56.26 ? 52   CYS B N   1 
ATOM   3014 C CA  . CYS B 1 52  ? 93.337  75.392 27.593 1.00 55.98 ? 52   CYS B CA  1 
ATOM   3015 C C   . CYS B 1 52  ? 93.855  76.581 26.794 1.00 55.83 ? 52   CYS B C   1 
ATOM   3016 O O   . CYS B 1 52  ? 93.078  77.481 26.477 1.00 55.11 ? 52   CYS B O   1 
ATOM   3017 C CB  . CYS B 1 52  ? 93.493  75.670 29.118 1.00 56.27 ? 52   CYS B CB  1 
ATOM   3018 S SG  . CYS B 1 52  ? 92.875  74.329 30.202 1.00 55.75 ? 52   CYS B SG  1 
ATOM   3019 N N   . SER B 1 53  ? 95.172  76.567 26.508 1.00 56.09 ? 53   SER B N   1 
ATOM   3020 C CA  . SER B 1 53  ? 95.876  77.552 25.622 1.00 56.07 ? 53   SER B CA  1 
ATOM   3021 C C   . SER B 1 53  ? 94.980  78.114 24.541 1.00 56.22 ? 53   SER B C   1 
ATOM   3022 O O   . SER B 1 53  ? 94.641  79.297 24.558 1.00 56.77 ? 53   SER B O   1 
ATOM   3023 C CB  . SER B 1 53  ? 97.099  76.948 24.900 1.00 55.72 ? 53   SER B CB  1 
ATOM   3024 O OG  . SER B 1 53  ? 97.953  76.227 25.760 1.00 55.67 ? 53   SER B OG  1 
ATOM   3025 N N   . THR B 1 54  ? 94.578  77.242 23.622 1.00 56.02 ? 54   THR B N   1 
ATOM   3026 C CA  . THR B 1 54  ? 93.725  77.620 22.519 1.00 55.76 ? 54   THR B CA  1 
ATOM   3027 C C   . THR B 1 54  ? 92.296  77.492 22.831 1.00 55.34 ? 54   THR B C   1 
ATOM   3028 O O   . THR B 1 54  ? 91.554  77.229 21.919 1.00 55.20 ? 54   THR B O   1 
ATOM   3029 C CB  . THR B 1 54  ? 93.945  76.701 21.300 1.00 56.20 ? 54   THR B CB  1 
ATOM   3030 O OG1 . THR B 1 54  ? 94.053  75.307 21.703 1.00 55.81 ? 54   THR B OG1 1 
ATOM   3031 C CG2 . THR B 1 54  ? 95.256  77.135 20.524 1.00 56.40 ? 54   THR B CG2 1 
ATOM   3032 N N   . LYS B 1 55  ? 91.895  77.636 24.088 1.00 55.48 ? 55   LYS B N   1 
ATOM   3033 C CA  . LYS B 1 55  ? 90.486  77.434 24.444 1.00 55.75 ? 55   LYS B CA  1 
ATOM   3034 C C   . LYS B 1 55  ? 89.822  78.560 25.229 1.00 55.81 ? 55   LYS B C   1 
ATOM   3035 O O   . LYS B 1 55  ? 90.463  79.288 25.987 1.00 56.22 ? 55   LYS B O   1 
ATOM   3036 C CB  . LYS B 1 55  ? 90.303  76.101 25.171 1.00 55.67 ? 55   LYS B CB  1 
ATOM   3037 C CG  . LYS B 1 55  ? 89.053  75.356 24.681 1.00 55.90 ? 55   LYS B CG  1 
ATOM   3038 C CD  . LYS B 1 55  ? 89.335  73.889 24.226 1.00 55.87 ? 55   LYS B CD  1 
ATOM   3039 C CE  . LYS B 1 55  ? 90.290  73.703 23.034 1.00 55.10 ? 55   LYS B CE  1 
ATOM   3040 N NZ  . LYS B 1 55  ? 89.801  74.238 21.726 1.00 55.22 ? 55   LYS B NZ  1 
ATOM   3041 N N   . HIS B 1 56  ? 88.524  78.721 25.011 1.00 55.74 ? 56   HIS B N   1 
ATOM   3042 C CA  . HIS B 1 56  ? 87.767  79.723 25.758 1.00 55.71 ? 56   HIS B CA  1 
ATOM   3043 C C   . HIS B 1 56  ? 87.802  79.331 27.217 1.00 55.95 ? 56   HIS B C   1 
ATOM   3044 O O   . HIS B 1 56  ? 87.388  78.233 27.551 1.00 56.31 ? 56   HIS B O   1 
ATOM   3045 C CB  . HIS B 1 56  ? 86.309  79.768 25.335 1.00 55.40 ? 56   HIS B CB  1 
ATOM   3046 C CG  . HIS B 1 56  ? 86.101  80.353 23.989 1.00 55.47 ? 56   HIS B CG  1 
ATOM   3047 N ND1 . HIS B 1 56  ? 86.028  81.710 23.781 1.00 55.90 ? 56   HIS B ND1 1 
ATOM   3048 C CD2 . HIS B 1 56  ? 85.985  79.779 22.770 1.00 56.03 ? 56   HIS B CD2 1 
ATOM   3049 C CE1 . HIS B 1 56  ? 85.859  81.952 22.494 1.00 55.56 ? 56   HIS B CE1 1 
ATOM   3050 N NE2 . HIS B 1 56  ? 85.829  80.794 21.858 1.00 56.11 ? 56   HIS B NE2 1 
ATOM   3051 N N   . LEU B 1 57  ? 88.267  80.230 28.078 1.00 55.76 ? 57   LEU B N   1 
ATOM   3052 C CA  . LEU B 1 57  ? 88.353  79.980 29.498 1.00 55.40 ? 57   LEU B CA  1 
ATOM   3053 C C   . LEU B 1 57  ? 87.345  80.841 30.325 1.00 55.43 ? 57   LEU B C   1 
ATOM   3054 O O   . LEU B 1 57  ? 87.012  81.989 29.979 1.00 55.27 ? 57   LEU B O   1 
ATOM   3055 C CB  . LEU B 1 57  ? 89.811  80.202 29.918 1.00 55.37 ? 57   LEU B CB  1 
ATOM   3056 C CG  . LEU B 1 57  ? 90.843  79.289 29.225 1.00 55.53 ? 57   LEU B CG  1 
ATOM   3057 C CD1 . LEU B 1 57  ? 92.306  79.573 29.539 1.00 55.79 ? 57   LEU B CD1 1 
ATOM   3058 C CD2 . LEU B 1 57  ? 90.575  77.862 29.652 1.00 56.78 ? 57   LEU B CD2 1 
ATOM   3059 N N   . TYR B 1 58  ? 86.840  80.279 31.418 1.00 55.49 ? 58   TYR B N   1 
ATOM   3060 C CA  . TYR B 1 58  ? 85.869  80.984 32.257 1.00 55.62 ? 58   TYR B CA  1 
ATOM   3061 C C   . TYR B 1 58  ? 86.504  81.696 33.407 1.00 56.05 ? 58   TYR B C   1 
ATOM   3062 O O   . TYR B 1 58  ? 87.282  81.084 34.163 1.00 56.88 ? 58   TYR B O   1 
ATOM   3063 C CB  . TYR B 1 58  ? 84.885  80.010 32.865 1.00 55.45 ? 58   TYR B CB  1 
ATOM   3064 C CG  . TYR B 1 58  ? 84.047  80.607 33.996 1.00 55.36 ? 58   TYR B CG  1 
ATOM   3065 C CD1 . TYR B 1 58  ? 84.393  80.447 35.325 1.00 55.03 ? 58   TYR B CD1 1 
ATOM   3066 C CD2 . TYR B 1 58  ? 82.896  81.325 33.722 1.00 55.92 ? 58   TYR B CD2 1 
ATOM   3067 C CE1 . TYR B 1 58  ? 83.605  80.975 36.357 1.00 55.52 ? 58   TYR B CE1 1 
ATOM   3068 C CE2 . TYR B 1 58  ? 82.095  81.866 34.760 1.00 55.99 ? 58   TYR B CE2 1 
ATOM   3069 C CZ  . TYR B 1 58  ? 82.446  81.690 36.073 1.00 55.65 ? 58   TYR B CZ  1 
ATOM   3070 O OH  . TYR B 1 58  ? 81.628  82.236 37.064 1.00 54.45 ? 58   TYR B OH  1 
ATOM   3071 N N   . ASP B 1 59  ? 86.137  82.961 33.601 1.00 56.16 ? 59   ASP B N   1 
ATOM   3072 C CA  . ASP B 1 59  ? 86.727  83.779 34.695 1.00 56.24 ? 59   ASP B CA  1 
ATOM   3073 C C   . ASP B 1 59  ? 85.685  84.491 35.482 1.00 56.32 ? 59   ASP B C   1 
ATOM   3074 O O   . ASP B 1 59  ? 84.833  85.158 34.899 1.00 56.57 ? 59   ASP B O   1 
ATOM   3075 C CB  . ASP B 1 59  ? 87.721  84.797 34.145 1.00 56.29 ? 59   ASP B CB  1 
ATOM   3076 C CG  . ASP B 1 59  ? 87.937  85.971 35.045 1.00 55.45 ? 59   ASP B CG  1 
ATOM   3077 O OD1 . ASP B 1 59  ? 88.881  86.744 34.777 1.00 54.89 ? 59   ASP B OD1 1 
ATOM   3078 O OD2 . ASP B 1 59  ? 87.229  86.191 36.035 1.00 54.49 ? 59   ASP B OD2 1 
ATOM   3079 N N   . SER B 1 60  ? 85.847  84.422 36.805 1.00 56.21 ? 60   SER B N   1 
ATOM   3080 C CA  . SER B 1 60  ? 84.743  84.437 37.748 1.00 56.10 ? 60   SER B CA  1 
ATOM   3081 C C   . SER B 1 60  ? 84.545  85.776 38.376 1.00 55.93 ? 60   SER B C   1 
ATOM   3082 O O   . SER B 1 60  ? 83.405  86.220 38.514 1.00 56.10 ? 60   SER B O   1 
ATOM   3083 C CB  . SER B 1 60  ? 85.044  83.438 38.851 1.00 56.26 ? 60   SER B CB  1 
ATOM   3084 O OG  . SER B 1 60  ? 86.221  82.672 38.513 1.00 56.70 ? 60   SER B OG  1 
ATOM   3085 N N   . SER B 1 61  ? 85.646  86.408 38.777 1.00 55.77 ? 61   SER B N   1 
ATOM   3086 C CA  . SER B 1 61  ? 85.587  87.794 39.197 1.00 55.84 ? 61   SER B CA  1 
ATOM   3087 C C   . SER B 1 61  ? 84.525  88.456 38.321 1.00 56.04 ? 61   SER B C   1 
ATOM   3088 O O   . SER B 1 61  ? 83.487  88.911 38.813 1.00 56.49 ? 61   SER B O   1 
ATOM   3089 C CB  . SER B 1 61  ? 86.908  88.478 38.963 1.00 55.62 ? 61   SER B CB  1 
ATOM   3090 O OG  . SER B 1 61  ? 87.364  88.151 37.689 1.00 57.00 ? 61   SER B OG  1 
ATOM   3091 N N   . LYS B 1 62  ? 84.733  88.401 37.011 1.00 55.75 ? 62   LYS B N   1 
ATOM   3092 C CA  . LYS B 1 62  ? 83.959  89.202 36.063 1.00 55.64 ? 62   LYS B CA  1 
ATOM   3093 C C   . LYS B 1 62  ? 82.481  89.238 36.303 1.00 55.54 ? 62   LYS B C   1 
ATOM   3094 O O   . LYS B 1 62  ? 81.816  90.217 35.978 1.00 55.70 ? 62   LYS B O   1 
ATOM   3095 C CB  . LYS B 1 62  ? 84.196  88.717 34.655 1.00 55.80 ? 62   LYS B CB  1 
ATOM   3096 C CG  . LYS B 1 62  ? 85.651  88.469 34.333 1.00 56.13 ? 62   LYS B CG  1 
ATOM   3097 C CD  . LYS B 1 62  ? 86.592  89.359 35.146 1.00 56.49 ? 62   LYS B CD  1 
ATOM   3098 C CE  . LYS B 1 62  ? 87.223  90.454 34.353 1.00 55.74 ? 62   LYS B CE  1 
ATOM   3099 N NZ  . LYS B 1 62  ? 88.153  89.843 33.370 1.00 55.78 ? 62   LYS B NZ  1 
ATOM   3100 N N   . SER B 1 63  ? 81.948  88.180 36.862 1.00 55.53 ? 63   SER B N   1 
ATOM   3101 C CA  . SER B 1 63  ? 80.563  88.217 37.204 1.00 55.81 ? 63   SER B CA  1 
ATOM   3102 C C   . SER B 1 63  ? 80.364  88.499 38.685 1.00 55.78 ? 63   SER B C   1 
ATOM   3103 O O   . SER B 1 63  ? 81.286  88.464 39.525 1.00 55.38 ? 63   SER B O   1 
ATOM   3104 C CB  . SER B 1 63  ? 79.874  86.917 36.789 1.00 55.85 ? 63   SER B CB  1 
ATOM   3105 O OG  . SER B 1 63  ? 78.757  86.656 37.623 1.00 56.58 ? 63   SER B OG  1 
ATOM   3106 N N   . LYS B 1 64  ? 79.124  88.799 38.992 1.00 55.58 ? 64   LYS B N   1 
ATOM   3107 C CA  . LYS B 1 64  ? 78.739  88.894 40.351 1.00 55.50 ? 64   LYS B CA  1 
ATOM   3108 C C   . LYS B 1 64  ? 77.369  88.339 40.352 1.00 55.10 ? 64   LYS B C   1 
ATOM   3109 O O   . LYS B 1 64  ? 76.378  89.030 40.186 1.00 54.81 ? 64   LYS B O   1 
ATOM   3110 C CB  . LYS B 1 64  ? 78.825  90.320 40.845 1.00 55.71 ? 64   LYS B CB  1 
ATOM   3111 C CG  . LYS B 1 64  ? 78.224  91.355 39.916 1.00 55.91 ? 64   LYS B CG  1 
ATOM   3112 C CD  . LYS B 1 64  ? 78.679  92.762 40.310 1.00 55.97 ? 64   LYS B CD  1 
ATOM   3113 C CE  . LYS B 1 64  ? 80.166  93.065 39.887 1.00 56.53 ? 64   LYS B CE  1 
ATOM   3114 N NZ  . LYS B 1 64  ? 80.465  93.161 38.399 1.00 55.87 ? 64   LYS B NZ  1 
ATOM   3115 N N   . SER B 1 65  ? 77.395  87.017 40.313 1.00 55.07 ? 65   SER B N   1 
ATOM   3116 C CA  . SER B 1 65  ? 76.292  86.141 40.606 1.00 55.50 ? 65   SER B CA  1 
ATOM   3117 C C   . SER B 1 65  ? 76.998  84.811 40.767 1.00 55.44 ? 65   SER B C   1 
ATOM   3118 O O   . SER B 1 65  ? 76.462  83.867 41.330 1.00 55.34 ? 65   SER B O   1 
ATOM   3119 C CB  . SER B 1 65  ? 75.361  86.069 39.407 1.00 55.69 ? 65   SER B CB  1 
ATOM   3120 O OG  . SER B 1 65  ? 74.283  85.196 39.666 1.00 56.12 ? 65   SER B OG  1 
ATOM   3121 N N   . TYR B 1 66  ? 78.221  84.754 40.257 1.00 55.01 ? 66   TYR B N   1 
ATOM   3122 C CA  . TYR B 1 66  ? 79.232  83.877 40.808 1.00 55.15 ? 66   TYR B CA  1 
ATOM   3123 C C   . TYR B 1 66  ? 79.072  83.705 42.296 1.00 55.31 ? 66   TYR B C   1 
ATOM   3124 O O   . TYR B 1 66  ? 79.473  84.561 43.069 1.00 55.00 ? 66   TYR B O   1 
ATOM   3125 C CB  . TYR B 1 66  ? 80.628  84.401 40.518 1.00 55.18 ? 66   TYR B CB  1 
ATOM   3126 C CG  . TYR B 1 66  ? 81.712  83.512 41.060 1.00 55.54 ? 66   TYR B CG  1 
ATOM   3127 C CD1 . TYR B 1 66  ? 81.477  82.173 41.292 1.00 56.91 ? 66   TYR B CD1 1 
ATOM   3128 C CD2 . TYR B 1 66  ? 82.970  84.002 41.338 1.00 55.45 ? 66   TYR B CD2 1 
ATOM   3129 C CE1 . TYR B 1 66  ? 82.459  81.352 41.791 1.00 55.94 ? 66   TYR B CE1 1 
ATOM   3130 C CE2 . TYR B 1 66  ? 83.957  83.180 41.835 1.00 55.43 ? 66   TYR B CE2 1 
ATOM   3131 C CZ  . TYR B 1 66  ? 83.692  81.861 42.060 1.00 54.77 ? 66   TYR B CZ  1 
ATOM   3132 O OH  . TYR B 1 66  ? 84.660  81.035 42.553 1.00 54.96 ? 66   TYR B OH  1 
ATOM   3133 N N   . GLU B 1 67  ? 78.504  82.577 42.695 1.00 55.67 ? 67   GLU B N   1 
ATOM   3134 C CA  . GLU B 1 67  ? 78.627  82.107 44.080 1.00 55.66 ? 67   GLU B CA  1 
ATOM   3135 C C   . GLU B 1 67  ? 79.835  81.106 44.179 1.00 55.53 ? 67   GLU B C   1 
ATOM   3136 O O   . GLU B 1 67  ? 80.017  80.258 43.295 1.00 55.37 ? 67   GLU B O   1 
ATOM   3137 C CB  . GLU B 1 67  ? 77.288  81.432 44.465 1.00 55.80 ? 67   GLU B CB  1 
ATOM   3138 C CG  . GLU B 1 67  ? 77.084  81.085 45.939 1.00 55.71 ? 67   GLU B CG  1 
ATOM   3139 C CD  . GLU B 1 67  ? 75.755  80.384 46.164 1.00 55.60 ? 67   GLU B CD  1 
ATOM   3140 O OE1 . GLU B 1 67  ? 75.543  79.803 47.256 1.00 56.24 ? 67   GLU B OE1 1 
ATOM   3141 O OE2 . GLU B 1 67  ? 74.920  80.399 45.235 1.00 55.31 ? 67   GLU B OE2 1 
ATOM   3142 N N   . LYS B 1 68  ? 80.637  81.196 45.239 1.00 55.40 ? 68   LYS B N   1 
ATOM   3143 C CA  . LYS B 1 68  ? 81.829  80.322 45.398 1.00 55.49 ? 68   LYS B CA  1 
ATOM   3144 C C   . LYS B 1 68  ? 81.614  78.917 46.067 1.00 55.54 ? 68   LYS B C   1 
ATOM   3145 O O   . LYS B 1 68  ? 80.752  78.699 46.947 1.00 55.40 ? 68   LYS B O   1 
ATOM   3146 C CB  . LYS B 1 68  ? 82.942  81.067 46.136 1.00 55.54 ? 68   LYS B CB  1 
ATOM   3147 C CG  . LYS B 1 68  ? 84.260  80.349 46.152 1.00 55.32 ? 68   LYS B CG  1 
ATOM   3148 C CD  . LYS B 1 68  ? 85.289  81.054 47.021 1.00 55.30 ? 68   LYS B CD  1 
ATOM   3149 C CE  . LYS B 1 68  ? 85.018  80.789 48.489 1.00 55.52 ? 68   LYS B CE  1 
ATOM   3150 N NZ  . LYS B 1 68  ? 86.018  81.336 49.426 1.00 55.07 ? 68   LYS B NZ  1 
ATOM   3151 N N   . ASP B 1 69  ? 82.417  77.964 45.588 1.00 55.31 ? 69   ASP B N   1 
ATOM   3152 C CA  . ASP B 1 69  ? 82.362  76.600 46.042 1.00 55.12 ? 69   ASP B CA  1 
ATOM   3153 C C   . ASP B 1 69  ? 83.758  76.105 46.218 1.00 54.55 ? 69   ASP B C   1 
ATOM   3154 O O   . ASP B 1 69  ? 84.213  75.950 47.310 1.00 54.24 ? 69   ASP B O   1 
ATOM   3155 C CB  . ASP B 1 69  ? 81.600  75.705 45.070 1.00 54.86 ? 69   ASP B CB  1 
ATOM   3156 C CG  . ASP B 1 69  ? 81.372  74.336 45.623 1.00 54.65 ? 69   ASP B CG  1 
ATOM   3157 O OD1 . ASP B 1 69  ? 82.069  73.966 46.572 1.00 54.28 ? 69   ASP B OD1 1 
ATOM   3158 O OD2 . ASP B 1 69  ? 80.496  73.568 45.191 1.00 53.61 ? 69   ASP B OD2 1 
ATOM   3159 N N   . GLY B 1 70  ? 84.446  75.813 45.148 1.00 54.49 ? 70   GLY B N   1 
ATOM   3160 C CA  . GLY B 1 70  ? 85.828  75.387 45.291 1.00 54.78 ? 70   GLY B CA  1 
ATOM   3161 C C   . GLY B 1 70  ? 86.050  73.939 45.727 1.00 54.83 ? 70   GLY B C   1 
ATOM   3162 O O   . GLY B 1 70  ? 87.179  73.425 45.686 1.00 54.44 ? 70   GLY B O   1 
ATOM   3163 N N   . THR B 1 71  ? 84.981  73.273 46.154 1.00 55.07 ? 71   THR B N   1 
ATOM   3164 C CA  . THR B 1 71  ? 85.032  71.852 46.461 1.00 54.85 ? 71   THR B CA  1 
ATOM   3165 C C   . THR B 1 71  ? 85.727  71.252 45.266 1.00 54.96 ? 71   THR B C   1 
ATOM   3166 O O   . THR B 1 71  ? 85.297  71.483 44.140 1.00 55.65 ? 71   THR B O   1 
ATOM   3167 C CB  . THR B 1 71  ? 83.571  71.317 46.668 1.00 54.75 ? 71   THR B CB  1 
ATOM   3168 O OG1 . THR B 1 71  ? 83.301  71.145 48.051 1.00 54.08 ? 71   THR B OG1 1 
ATOM   3169 C CG2 . THR B 1 71  ? 83.371  69.954 46.139 1.00 55.28 ? 71   THR B CG2 1 
ATOM   3170 N N   . LYS B 1 72  ? 86.803  70.515 45.479 1.00 54.79 ? 72   LYS B N   1 
ATOM   3171 C CA  . LYS B 1 72  ? 87.577  69.974 44.363 1.00 54.83 ? 72   LYS B CA  1 
ATOM   3172 C C   . LYS B 1 72  ? 86.903  68.703 43.934 1.00 54.57 ? 72   LYS B C   1 
ATOM   3173 O O   . LYS B 1 72  ? 86.305  68.018 44.768 1.00 53.73 ? 72   LYS B O   1 
ATOM   3174 C CB  . LYS B 1 72  ? 89.025  69.680 44.766 1.00 55.02 ? 72   LYS B CB  1 
ATOM   3175 C CG  . LYS B 1 72  ? 89.767  70.862 45.500 1.00 56.16 ? 72   LYS B CG  1 
ATOM   3176 C CD  . LYS B 1 72  ? 89.451  70.973 47.094 1.00 56.80 ? 72   LYS B CD  1 
ATOM   3177 C CE  . LYS B 1 72  ? 89.774  72.353 47.784 1.00 55.91 ? 72   LYS B CE  1 
ATOM   3178 N NZ  . LYS B 1 72  ? 91.216  72.755 47.852 1.00 56.02 ? 72   LYS B NZ  1 
ATOM   3179 N N   . VAL B 1 73  ? 86.980  68.392 42.639 1.00 54.85 ? 73   VAL B N   1 
ATOM   3180 C CA  . VAL B 1 73  ? 86.337  67.192 42.089 1.00 55.06 ? 73   VAL B CA  1 
ATOM   3181 C C   . VAL B 1 73  ? 86.693  66.841 40.621 1.00 54.80 ? 73   VAL B C   1 
ATOM   3182 O O   . VAL B 1 73  ? 87.067  67.695 39.852 1.00 54.43 ? 73   VAL B O   1 
ATOM   3183 C CB  . VAL B 1 73  ? 84.810  67.357 42.182 1.00 55.30 ? 73   VAL B CB  1 
ATOM   3184 C CG1 . VAL B 1 73  ? 84.255  67.923 40.854 1.00 55.30 ? 73   VAL B CG1 1 
ATOM   3185 C CG2 . VAL B 1 73  ? 84.132  66.023 42.624 1.00 55.56 ? 73   VAL B CG2 1 
ATOM   3186 N N   . GLU B 1 74  ? 86.509  65.584 40.233 1.00 55.08 ? 74   GLU B N   1 
ATOM   3187 C CA  . GLU B 1 74  ? 86.833  65.119 38.871 1.00 55.22 ? 74   GLU B CA  1 
ATOM   3188 C C   . GLU B 1 74  ? 85.869  64.131 38.228 1.00 54.93 ? 74   GLU B C   1 
ATOM   3189 O O   . GLU B 1 74  ? 85.133  63.386 38.881 1.00 54.58 ? 74   GLU B O   1 
ATOM   3190 C CB  . GLU B 1 74  ? 88.239  64.483 38.814 1.00 55.36 ? 74   GLU B CB  1 
ATOM   3191 C CG  . GLU B 1 74  ? 88.595  63.658 40.030 1.00 55.98 ? 74   GLU B CG  1 
ATOM   3192 C CD  . GLU B 1 74  ? 89.497  62.492 39.725 1.00 55.37 ? 74   GLU B CD  1 
ATOM   3193 O OE1 . GLU B 1 74  ? 88.942  61.417 39.339 1.00 54.02 ? 74   GLU B OE1 1 
ATOM   3194 O OE2 . GLU B 1 74  ? 90.728  62.655 39.923 1.00 55.30 ? 74   GLU B OE2 1 
ATOM   3195 N N   . ILE B 1 75  ? 85.960  64.109 36.912 1.00 54.86 ? 75   ILE B N   1 
ATOM   3196 C CA  . ILE B 1 75  ? 85.166  63.257 36.076 1.00 55.11 ? 75   ILE B CA  1 
ATOM   3197 C C   . ILE B 1 75  ? 86.029  62.439 35.162 1.00 54.98 ? 75   ILE B C   1 
ATOM   3198 O O   . ILE B 1 75  ? 86.910  62.976 34.539 1.00 55.12 ? 75   ILE B O   1 
ATOM   3199 C CB  . ILE B 1 75  ? 84.289  64.069 35.154 1.00 55.36 ? 75   ILE B CB  1 
ATOM   3200 C CG1 . ILE B 1 75  ? 83.474  65.120 35.913 1.00 55.54 ? 75   ILE B CG1 1 
ATOM   3201 C CG2 . ILE B 1 75  ? 83.363  63.126 34.427 1.00 56.13 ? 75   ILE B CG2 1 
ATOM   3202 C CD1 . ILE B 1 75  ? 82.482  65.906 35.055 1.00 55.28 ? 75   ILE B CD1 1 
ATOM   3203 N N   . THR B 1 76  ? 85.700  61.158 35.029 1.00 55.17 ? 76   THR B N   1 
ATOM   3204 C CA  . THR B 1 76  ? 86.431  60.217 34.183 1.00 55.06 ? 76   THR B CA  1 
ATOM   3205 C C   . THR B 1 76  ? 85.548  59.737 33.053 1.00 55.12 ? 76   THR B C   1 
ATOM   3206 O O   . THR B 1 76  ? 84.915  58.666 33.163 1.00 55.13 ? 76   THR B O   1 
ATOM   3207 C CB  . THR B 1 76  ? 86.866  58.996 34.978 1.00 54.74 ? 76   THR B CB  1 
ATOM   3208 O OG1 . THR B 1 76  ? 87.677  59.401 36.073 1.00 54.71 ? 76   THR B OG1 1 
ATOM   3209 C CG2 . THR B 1 76  ? 87.771  58.118 34.151 1.00 54.94 ? 76   THR B CG2 1 
ATOM   3210 N N   . TYR B 1 77  ? 85.528  60.511 31.967 1.00 54.96 ? 77   TYR B N   1 
ATOM   3211 C CA  . TYR B 1 77  ? 84.791  60.140 30.786 1.00 55.06 ? 77   TYR B CA  1 
ATOM   3212 C C   . TYR B 1 77  ? 85.406  58.941 30.119 1.00 55.02 ? 77   TYR B C   1 
ATOM   3213 O O   . TYR B 1 77  ? 86.487  58.505 30.479 1.00 54.79 ? 77   TYR B O   1 
ATOM   3214 C CB  . TYR B 1 77  ? 84.743  61.287 29.792 1.00 55.17 ? 77   TYR B CB  1 
ATOM   3215 C CG  . TYR B 1 77  ? 84.003  62.510 30.299 1.00 55.60 ? 77   TYR B CG  1 
ATOM   3216 C CD1 . TYR B 1 77  ? 84.687  63.519 30.968 1.00 56.11 ? 77   TYR B CD1 1 
ATOM   3217 C CD2 . TYR B 1 77  ? 82.630  62.684 30.092 1.00 53.97 ? 77   TYR B CD2 1 
ATOM   3218 C CE1 . TYR B 1 77  ? 84.023  64.663 31.414 1.00 54.90 ? 77   TYR B CE1 1 
ATOM   3219 C CE2 . TYR B 1 77  ? 81.992  63.793 30.559 1.00 53.78 ? 77   TYR B CE2 1 
ATOM   3220 C CZ  . TYR B 1 77  ? 82.699  64.772 31.203 1.00 53.82 ? 77   TYR B CZ  1 
ATOM   3221 O OH  . TYR B 1 77  ? 82.086  65.877 31.647 1.00 55.07 ? 77   TYR B OH  1 
ATOM   3222 N N   . GLY B 1 78  ? 84.700  58.409 29.137 1.00 55.22 ? 78   GLY B N   1 
ATOM   3223 C CA  . GLY B 1 78  ? 85.197  57.281 28.388 1.00 55.60 ? 78   GLY B CA  1 
ATOM   3224 C C   . GLY B 1 78  ? 86.579  57.513 27.804 1.00 55.73 ? 78   GLY B C   1 
ATOM   3225 O O   . GLY B 1 78  ? 87.467  56.634 27.909 1.00 55.92 ? 78   GLY B O   1 
ATOM   3226 N N   . SER B 1 79  ? 86.783  58.700 27.218 1.00 55.91 ? 79   SER B N   1 
ATOM   3227 C CA  . SER B 1 79  ? 88.093  59.037 26.605 1.00 55.80 ? 79   SER B CA  1 
ATOM   3228 C C   . SER B 1 79  ? 88.936  60.063 27.333 1.00 55.56 ? 79   SER B C   1 
ATOM   3229 O O   . SER B 1 79  ? 89.635  60.842 26.708 1.00 55.17 ? 79   SER B O   1 
ATOM   3230 C CB  . SER B 1 79  ? 87.930  59.456 25.157 1.00 56.00 ? 79   SER B CB  1 
ATOM   3231 O OG  . SER B 1 79  ? 87.776  58.296 24.339 1.00 56.97 ? 79   SER B OG  1 
ATOM   3232 N N   . GLY B 1 80  ? 88.895  60.017 28.661 1.00 55.74 ? 80   GLY B N   1 
ATOM   3233 C CA  . GLY B 1 80  ? 89.805  60.807 29.495 1.00 55.81 ? 80   GLY B CA  1 
ATOM   3234 C C   . GLY B 1 80  ? 89.301  61.132 30.904 1.00 55.88 ? 80   GLY B C   1 
ATOM   3235 O O   . GLY B 1 80  ? 88.327  60.534 31.375 1.00 56.56 ? 80   GLY B O   1 
ATOM   3236 N N   . THR B 1 81  ? 89.985  62.048 31.586 1.00 55.47 ? 81   THR B N   1 
ATOM   3237 C CA  . THR B 1 81  ? 89.602  62.470 32.918 1.00 55.15 ? 81   THR B CA  1 
ATOM   3238 C C   . THR B 1 81  ? 89.952  63.922 33.097 1.00 55.37 ? 81   THR B C   1 
ATOM   3239 O O   . THR B 1 81  ? 91.005  64.368 32.627 1.00 56.03 ? 81   THR B O   1 
ATOM   3240 C CB  . THR B 1 81  ? 90.326  61.640 33.956 1.00 54.93 ? 81   THR B CB  1 
ATOM   3241 O OG1 . THR B 1 81  ? 89.519  60.513 34.291 1.00 54.89 ? 81   THR B OG1 1 
ATOM   3242 C CG2 . THR B 1 81  ? 90.459  62.375 35.275 1.00 55.00 ? 81   THR B CG2 1 
ATOM   3243 N N   . VAL B 1 82  ? 89.094  64.641 33.817 1.00 55.26 ? 82   VAL B N   1 
ATOM   3244 C CA  . VAL B 1 82  ? 89.279  66.067 34.099 1.00 55.11 ? 82   VAL B CA  1 
ATOM   3245 C C   . VAL B 1 82  ? 89.266  66.427 35.613 1.00 55.19 ? 82   VAL B C   1 
ATOM   3246 O O   . VAL B 1 82  ? 88.730  65.700 36.440 1.00 55.06 ? 82   VAL B O   1 
ATOM   3247 C CB  . VAL B 1 82  ? 88.254  66.873 33.362 1.00 54.81 ? 82   VAL B CB  1 
ATOM   3248 C CG1 . VAL B 1 82  ? 88.583  66.871 31.905 1.00 54.79 ? 82   VAL B CG1 1 
ATOM   3249 C CG2 . VAL B 1 82  ? 86.889  66.312 33.597 1.00 54.97 ? 82   VAL B CG2 1 
ATOM   3250 N N   . ARG B 1 83  ? 89.905  67.551 35.982 1.00 55.00 ? 83   ARG B N   1 
ATOM   3251 C CA  . ARG B 1 83  ? 90.036  67.958 37.376 1.00 55.20 ? 83   ARG B CA  1 
ATOM   3252 C C   . ARG B 1 83  ? 89.800  69.456 37.538 1.00 55.18 ? 83   ARG B C   1 
ATOM   3253 O O   . ARG B 1 83  ? 90.092  70.273 36.659 1.00 55.02 ? 83   ARG B O   1 
ATOM   3254 C CB  . ARG B 1 83  ? 91.417  67.582 37.916 1.00 55.39 ? 83   ARG B CB  1 
ATOM   3255 C CG  . ARG B 1 83  ? 91.648  66.086 38.042 1.00 55.42 ? 83   ARG B CG  1 
ATOM   3256 C CD  . ARG B 1 83  ? 93.028  65.711 38.556 1.00 55.54 ? 83   ARG B CD  1 
ATOM   3257 N NE  . ARG B 1 83  ? 93.208  64.263 38.638 1.00 54.32 ? 83   ARG B NE  1 
ATOM   3258 C CZ  . ARG B 1 83  ? 94.341  63.672 38.988 1.00 56.43 ? 83   ARG B CZ  1 
ATOM   3259 N NH1 . ARG B 1 83  ? 95.406  64.402 39.295 1.00 55.67 ? 83   ARG B NH1 1 
ATOM   3260 N NH2 . ARG B 1 83  ? 94.415  62.349 39.036 1.00 54.33 ? 83   ARG B NH2 1 
ATOM   3261 N N   . GLY B 1 84  ? 89.292  69.874 38.703 1.00 54.57 ? 84   GLY B N   1 
ATOM   3262 C CA  . GLY B 1 84  ? 88.937  71.252 38.892 1.00 54.70 ? 84   GLY B CA  1 
ATOM   3263 C C   . GLY B 1 84  ? 88.142  71.394 40.149 1.00 54.65 ? 84   GLY B C   1 
ATOM   3264 O O   . GLY B 1 84  ? 88.482  70.822 41.160 1.00 54.95 ? 84   GLY B O   1 
ATOM   3265 N N   . PHE B 1 85  ? 87.070  72.159 40.095 1.00 54.83 ? 85   PHE B N   1 
ATOM   3266 C CA  . PHE B 1 85  ? 86.257  72.384 41.293 1.00 55.09 ? 85   PHE B CA  1 
ATOM   3267 C C   . PHE B 1 85  ? 84.891  73.041 41.069 1.00 55.02 ? 85   PHE B C   1 
ATOM   3268 O O   . PHE B 1 85  ? 84.715  73.995 40.279 1.00 54.03 ? 85   PHE B O   1 
ATOM   3269 C CB  . PHE B 1 85  ? 87.016  73.252 42.260 1.00 55.10 ? 85   PHE B CB  1 
ATOM   3270 C CG  . PHE B 1 85  ? 87.605  74.418 41.618 1.00 54.69 ? 85   PHE B CG  1 
ATOM   3271 C CD1 . PHE B 1 85  ? 88.673  74.271 40.791 1.00 54.99 ? 85   PHE B CD1 1 
ATOM   3272 C CD2 . PHE B 1 85  ? 87.061  75.658 41.789 1.00 54.69 ? 85   PHE B CD2 1 
ATOM   3273 C CE1 . PHE B 1 85  ? 89.217  75.330 40.164 1.00 55.13 ? 85   PHE B CE1 1 
ATOM   3274 C CE2 . PHE B 1 85  ? 87.609  76.744 41.155 1.00 54.84 ? 85   PHE B CE2 1 
ATOM   3275 C CZ  . PHE B 1 85  ? 88.692  76.577 40.331 1.00 54.91 ? 85   PHE B CZ  1 
ATOM   3276 N N   . PHE B 1 86  ? 83.931  72.537 41.824 1.00 54.99 ? 86   PHE B N   1 
ATOM   3277 C CA  . PHE B 1 86  ? 82.620  73.015 41.646 1.00 55.45 ? 86   PHE B CA  1 
ATOM   3278 C C   . PHE B 1 86  ? 82.604  74.524 41.871 1.00 55.91 ? 86   PHE B C   1 
ATOM   3279 O O   . PHE B 1 86  ? 83.349  75.053 42.726 1.00 56.25 ? 86   PHE B O   1 
ATOM   3280 C CB  . PHE B 1 86  ? 81.678  72.364 42.613 1.00 55.33 ? 86   PHE B CB  1 
ATOM   3281 C CG  . PHE B 1 86  ? 81.215  71.066 42.177 1.00 54.90 ? 86   PHE B CG  1 
ATOM   3282 C CD1 . PHE B 1 86  ? 81.527  69.968 42.888 1.00 55.24 ? 86   PHE B CD1 1 
ATOM   3283 C CD2 . PHE B 1 86  ? 80.438  70.935 41.052 1.00 55.21 ? 86   PHE B CD2 1 
ATOM   3284 C CE1 . PHE B 1 86  ? 81.055  68.741 42.501 1.00 55.61 ? 86   PHE B CE1 1 
ATOM   3285 C CE2 . PHE B 1 86  ? 79.976  69.682 40.640 1.00 55.22 ? 86   PHE B CE2 1 
ATOM   3286 C CZ  . PHE B 1 86  ? 80.282  68.594 41.369 1.00 54.85 ? 86   PHE B CZ  1 
ATOM   3287 N N   . SER B 1 87  ? 81.744  75.184 41.091 1.00 55.72 ? 87   SER B N   1 
ATOM   3288 C CA  . SER B 1 87  ? 81.442  76.580 41.243 1.00 55.39 ? 87   SER B CA  1 
ATOM   3289 C C   . SER B 1 87  ? 79.980  76.607 40.948 1.00 55.55 ? 87   SER B C   1 
ATOM   3290 O O   . SER B 1 87  ? 79.457  75.642 40.392 1.00 55.95 ? 87   SER B O   1 
ATOM   3291 C CB  . SER B 1 87  ? 82.186  77.403 40.205 1.00 55.24 ? 87   SER B CB  1 
ATOM   3292 O OG  . SER B 1 87  ? 83.584  77.273 40.314 1.00 55.79 ? 87   SER B OG  1 
ATOM   3293 N N   . LYS B 1 88  ? 79.309  77.686 41.331 1.00 55.71 ? 88   LYS B N   1 
ATOM   3294 C CA  . LYS B 1 88  ? 77.906  77.878 40.989 1.00 55.59 ? 88   LYS B CA  1 
ATOM   3295 C C   . LYS B 1 88  ? 77.801  79.319 40.461 1.00 55.72 ? 88   LYS B C   1 
ATOM   3296 O O   . LYS B 1 88  ? 78.103  80.283 41.218 1.00 55.67 ? 88   LYS B O   1 
ATOM   3297 C CB  . LYS B 1 88  ? 77.003  77.627 42.227 1.00 55.39 ? 88   LYS B CB  1 
ATOM   3298 C CG  . LYS B 1 88  ? 75.454  77.787 41.969 1.00 56.12 ? 88   LYS B CG  1 
ATOM   3299 C CD  . LYS B 1 88  ? 74.527  77.201 43.120 1.00 56.38 ? 88   LYS B CD  1 
ATOM   3300 C CE  . LYS B 1 88  ? 72.993  77.445 42.896 1.00 55.67 ? 88   LYS B CE  1 
ATOM   3301 N NZ  . LYS B 1 88  ? 72.564  78.822 43.352 1.00 55.78 ? 88   LYS B NZ  1 
ATOM   3302 N N   . ASP B 1 89  ? 77.422  79.472 39.174 1.00 55.63 ? 89   ASP B N   1 
ATOM   3303 C CA  . ASP B 1 89  ? 77.073  80.808 38.601 1.00 55.43 ? 89   ASP B CA  1 
ATOM   3304 C C   . ASP B 1 89  ? 75.808  80.744 37.765 1.00 55.24 ? 89   ASP B C   1 
ATOM   3305 O O   . ASP B 1 89  ? 75.001  79.841 37.928 1.00 55.48 ? 89   ASP B O   1 
ATOM   3306 C CB  . ASP B 1 89  ? 78.228  81.379 37.766 1.00 55.67 ? 89   ASP B CB  1 
ATOM   3307 C CG  . ASP B 1 89  ? 78.046  82.877 37.441 1.00 55.76 ? 89   ASP B CG  1 
ATOM   3308 O OD1 . ASP B 1 89  ? 78.968  83.541 36.876 1.00 56.58 ? 89   ASP B OD1 1 
ATOM   3309 O OD2 . ASP B 1 89  ? 76.987  83.467 37.721 1.00 54.66 ? 89   ASP B OD2 1 
ATOM   3310 N N   . LEU B 1 90  ? 75.643  81.703 36.869 1.00 55.36 ? 90   LEU B N   1 
ATOM   3311 C CA  . LEU B 1 90  ? 74.458  81.801 36.037 1.00 55.44 ? 90   LEU B CA  1 
ATOM   3312 C C   . LEU B 1 90  ? 74.717  81.140 34.721 1.00 55.38 ? 90   LEU B C   1 
ATOM   3313 O O   . LEU B 1 90  ? 75.628  81.537 33.988 1.00 55.30 ? 90   LEU B O   1 
ATOM   3314 C CB  . LEU B 1 90  ? 74.167  83.258 35.770 1.00 55.72 ? 90   LEU B CB  1 
ATOM   3315 C CG  . LEU B 1 90  ? 73.080  83.556 34.764 1.00 55.94 ? 90   LEU B CG  1 
ATOM   3316 C CD1 . LEU B 1 90  ? 71.813  82.843 35.146 1.00 55.82 ? 90   LEU B CD1 1 
ATOM   3317 C CD2 . LEU B 1 90  ? 72.841  85.075 34.684 1.00 55.97 ? 90   LEU B CD2 1 
ATOM   3318 N N   . VAL B 1 91  ? 73.922  80.130 34.419 1.00 55.36 ? 91   VAL B N   1 
ATOM   3319 C CA  . VAL B 1 91  ? 74.108  79.369 33.210 1.00 55.69 ? 91   VAL B CA  1 
ATOM   3320 C C   . VAL B 1 91  ? 72.910  79.608 32.334 1.00 55.63 ? 91   VAL B C   1 
ATOM   3321 O O   . VAL B 1 91  ? 71.782  79.454 32.772 1.00 55.45 ? 91   VAL B O   1 
ATOM   3322 C CB  . VAL B 1 91  ? 74.204  77.885 33.508 1.00 55.63 ? 91   VAL B CB  1 
ATOM   3323 C CG1 . VAL B 1 91  ? 73.771  77.093 32.324 1.00 55.03 ? 91   VAL B CG1 1 
ATOM   3324 C CG2 . VAL B 1 91  ? 75.607  77.523 33.889 1.00 55.82 ? 91   VAL B CG2 1 
ATOM   3325 N N   . THR B 1 92  ? 73.155  80.007 31.096 1.00 55.01 ? 92   THR B N   1 
ATOM   3326 C CA  . THR B 1 92  ? 72.082  80.441 30.226 1.00 55.27 ? 92   THR B CA  1 
ATOM   3327 C C   . THR B 1 92  ? 72.132  79.796 28.851 1.00 55.35 ? 92   THR B C   1 
ATOM   3328 O O   . THR B 1 92  ? 73.194  79.625 28.271 1.00 55.06 ? 92   THR B O   1 
ATOM   3329 C CB  . THR B 1 92  ? 72.043  81.966 30.128 1.00 55.45 ? 92   THR B CB  1 
ATOM   3330 O OG1 . THR B 1 92  ? 72.012  82.356 28.756 1.00 55.78 ? 92   THR B OG1 1 
ATOM   3331 C CG2 . THR B 1 92  ? 73.318  82.564 30.635 1.00 55.56 ? 92   THR B CG2 1 
ATOM   3332 N N   . LEU B 1 93  ? 70.966  79.421 28.348 1.00 55.21 ? 93   LEU B N   1 
ATOM   3333 C CA  . LEU B 1 93  ? 70.880  78.611 27.149 1.00 55.64 ? 93   LEU B CA  1 
ATOM   3334 C C   . LEU B 1 93  ? 70.097  79.327 26.077 1.00 55.89 ? 93   LEU B C   1 
ATOM   3335 O O   . LEU B 1 93  ? 69.044  78.879 25.633 1.00 55.36 ? 93   LEU B O   1 
ATOM   3336 C CB  . LEU B 1 93  ? 70.271  77.257 27.455 1.00 55.53 ? 93   LEU B CB  1 
ATOM   3337 C CG  . LEU B 1 93  ? 71.181  76.559 28.443 1.00 55.57 ? 93   LEU B CG  1 
ATOM   3338 C CD1 . LEU B 1 93  ? 71.336  75.111 28.114 1.00 54.99 ? 93   LEU B CD1 1 
ATOM   3339 C CD2 . LEU B 1 93  ? 72.493  77.272 28.370 1.00 55.98 ? 93   LEU B CD2 1 
ATOM   3340 N N   . GLY B 1 94  ? 70.643  80.457 25.666 1.00 56.03 ? 94   GLY B N   1 
ATOM   3341 C CA  . GLY B 1 94  ? 70.006  81.280 24.645 1.00 55.62 ? 94   GLY B CA  1 
ATOM   3342 C C   . GLY B 1 94  ? 68.823  82.029 25.238 1.00 55.58 ? 94   GLY B C   1 
ATOM   3343 O O   . GLY B 1 94  ? 69.027  83.031 25.943 1.00 55.15 ? 94   GLY B O   1 
ATOM   3344 N N   . TYR B 1 95  ? 67.610  81.511 24.963 1.00 55.64 ? 95   TYR B N   1 
ATOM   3345 C CA  . TYR B 1 95  ? 66.312  82.090 25.406 1.00 55.71 ? 95   TYR B CA  1 
ATOM   3346 C C   . TYR B 1 95  ? 66.202  82.123 26.930 1.00 55.84 ? 95   TYR B C   1 
ATOM   3347 O O   . TYR B 1 95  ? 65.652  83.079 27.510 1.00 55.44 ? 95   TYR B O   1 
ATOM   3348 C CB  . TYR B 1 95  ? 65.181  81.231 24.860 1.00 55.83 ? 95   TYR B CB  1 
ATOM   3349 C CG  . TYR B 1 95  ? 63.784  81.726 25.065 1.00 55.76 ? 95   TYR B CG  1 
ATOM   3350 C CD1 . TYR B 1 95  ? 63.200  81.786 26.326 1.00 56.14 ? 95   TYR B CD1 1 
ATOM   3351 C CD2 . TYR B 1 95  ? 63.011  82.087 23.967 1.00 57.05 ? 95   TYR B CD2 1 
ATOM   3352 C CE1 . TYR B 1 95  ? 61.859  82.246 26.499 1.00 56.88 ? 95   TYR B CE1 1 
ATOM   3353 C CE2 . TYR B 1 95  ? 61.672  82.544 24.087 1.00 56.78 ? 95   TYR B CE2 1 
ATOM   3354 C CZ  . TYR B 1 95  ? 61.095  82.629 25.350 1.00 57.70 ? 95   TYR B CZ  1 
ATOM   3355 O OH  . TYR B 1 95  ? 59.760  83.060 25.418 1.00 57.35 ? 95   TYR B OH  1 
ATOM   3356 N N   . LEU B 1 96  ? 66.720  81.060 27.561 1.00 55.80 ? 96   LEU B N   1 
ATOM   3357 C CA  . LEU B 1 96  ? 66.584  80.841 29.008 1.00 55.88 ? 96   LEU B CA  1 
ATOM   3358 C C   . LEU B 1 96  ? 67.913  81.054 29.745 1.00 56.27 ? 96   LEU B C   1 
ATOM   3359 O O   . LEU B 1 96  ? 69.016  80.794 29.160 1.00 56.22 ? 96   LEU B O   1 
ATOM   3360 C CB  . LEU B 1 96  ? 66.101  79.416 29.286 1.00 55.75 ? 96   LEU B CB  1 
ATOM   3361 C CG  . LEU B 1 96  ? 64.751  79.047 28.667 1.00 56.36 ? 96   LEU B CG  1 
ATOM   3362 C CD1 . LEU B 1 96  ? 64.546  77.530 28.649 1.00 56.24 ? 96   LEU B CD1 1 
ATOM   3363 C CD2 . LEU B 1 96  ? 63.570  79.740 29.388 1.00 56.59 ? 96   LEU B CD2 1 
ATOM   3364 N N   . SER B 1 97  ? 67.792  81.492 31.019 1.00 55.85 ? 97   SER B N   1 
ATOM   3365 C CA  . SER B 1 97  ? 68.936  81.697 31.909 1.00 55.57 ? 97   SER B CA  1 
ATOM   3366 C C   . SER B 1 97  ? 68.720  80.770 33.083 1.00 55.26 ? 97   SER B C   1 
ATOM   3367 O O   . SER B 1 97  ? 67.837  79.979 33.031 1.00 55.47 ? 97   SER B O   1 
ATOM   3368 C CB  . SER B 1 97  ? 69.044  83.180 32.323 1.00 55.89 ? 97   SER B CB  1 
ATOM   3369 O OG  . SER B 1 97  ? 69.909  83.942 31.451 1.00 55.31 ? 97   SER B OG  1 
ATOM   3370 N N   . LEU B 1 98  ? 69.548  80.842 34.107 1.00 55.21 ? 98   LEU B N   1 
ATOM   3371 C CA  . LEU B 1 98  ? 69.445  79.992 35.287 1.00 55.17 ? 98   LEU B CA  1 
ATOM   3372 C C   . LEU B 1 98  ? 70.787  79.969 36.083 1.00 55.46 ? 98   LEU B C   1 
ATOM   3373 O O   . LEU B 1 98  ? 71.877  79.935 35.469 1.00 55.41 ? 98   LEU B O   1 
ATOM   3374 C CB  . LEU B 1 98  ? 69.109  78.583 34.872 1.00 54.90 ? 98   LEU B CB  1 
ATOM   3375 C CG  . LEU B 1 98  ? 68.880  77.608 35.996 1.00 55.14 ? 98   LEU B CG  1 
ATOM   3376 C CD1 . LEU B 1 98  ? 68.109  76.451 35.526 1.00 55.28 ? 98   LEU B CD1 1 
ATOM   3377 C CD2 . LEU B 1 98  ? 70.174  77.120 36.552 1.00 55.54 ? 98   LEU B CD2 1 
ATOM   3378 N N   . PRO B 1 99  ? 70.719  79.970 37.428 1.00 55.41 ? 99   PRO B N   1 
ATOM   3379 C CA  . PRO B 1 99  ? 71.888  79.903 38.259 1.00 55.31 ? 99   PRO B CA  1 
ATOM   3380 C C   . PRO B 1 99  ? 72.145  78.447 38.523 1.00 55.49 ? 99   PRO B C   1 
ATOM   3381 O O   . PRO B 1 99  ? 71.255  77.812 39.068 1.00 55.83 ? 99   PRO B O   1 
ATOM   3382 C CB  . PRO B 1 99  ? 71.411  80.580 39.525 1.00 55.23 ? 99   PRO B CB  1 
ATOM   3383 C CG  . PRO B 1 99  ? 70.000  80.112 39.655 1.00 55.06 ? 99   PRO B CG  1 
ATOM   3384 C CD  . PRO B 1 99  ? 69.506  80.023 38.266 1.00 55.49 ? 99   PRO B CD  1 
ATOM   3385 N N   . TYR B 1 100 ? 73.310  77.913 38.133 1.00 55.37 ? 100  TYR B N   1 
ATOM   3386 C CA  . TYR B 1 100 ? 73.574  76.470 38.198 1.00 55.13 ? 100  TYR B CA  1 
ATOM   3387 C C   . TYR B 1 100 ? 74.944  76.125 38.747 1.00 55.16 ? 100  TYR B C   1 
ATOM   3388 O O   . TYR B 1 100 ? 75.783  77.005 38.945 1.00 54.91 ? 100  TYR B O   1 
ATOM   3389 C CB  . TYR B 1 100 ? 73.501  75.900 36.812 1.00 54.93 ? 100  TYR B CB  1 
ATOM   3390 C CG  . TYR B 1 100 ? 73.035  74.480 36.688 1.00 54.31 ? 100  TYR B CG  1 
ATOM   3391 C CD1 . TYR B 1 100 ? 71.780  74.115 37.045 1.00 54.27 ? 100  TYR B CD1 1 
ATOM   3392 C CD2 . TYR B 1 100 ? 73.847  73.521 36.108 1.00 54.98 ? 100  TYR B CD2 1 
ATOM   3393 C CE1 . TYR B 1 100 ? 71.355  72.827 36.854 1.00 55.10 ? 100  TYR B CE1 1 
ATOM   3394 C CE2 . TYR B 1 100 ? 73.433  72.223 35.911 1.00 54.67 ? 100  TYR B CE2 1 
ATOM   3395 C CZ  . TYR B 1 100 ? 72.198  71.879 36.287 1.00 54.38 ? 100  TYR B CZ  1 
ATOM   3396 O OH  . TYR B 1 100 ? 71.773  70.590 36.104 1.00 53.99 ? 100  TYR B OH  1 
ATOM   3397 N N   . LYS B 1 101 ? 75.148  74.820 38.967 1.00 55.15 ? 101  LYS B N   1 
ATOM   3398 C CA  . LYS B 1 101 ? 76.358  74.264 39.553 1.00 54.91 ? 101  LYS B CA  1 
ATOM   3399 C C   . LYS B 1 101 ? 77.150  73.552 38.514 1.00 54.49 ? 101  LYS B C   1 
ATOM   3400 O O   . LYS B 1 101 ? 76.702  72.608 37.949 1.00 54.55 ? 101  LYS B O   1 
ATOM   3401 C CB  . LYS B 1 101 ? 75.984  73.276 40.644 1.00 54.75 ? 101  LYS B CB  1 
ATOM   3402 C CG  . LYS B 1 101 ? 77.163  72.681 41.368 1.00 54.98 ? 101  LYS B CG  1 
ATOM   3403 C CD  . LYS B 1 101 ? 76.626  71.800 42.509 1.00 55.50 ? 101  LYS B CD  1 
ATOM   3404 C CE  . LYS B 1 101 ? 77.707  71.088 43.335 1.00 55.35 ? 101  LYS B CE  1 
ATOM   3405 N NZ  . LYS B 1 101 ? 77.035  70.118 44.263 1.00 53.99 ? 101  LYS B NZ  1 
ATOM   3406 N N   . PHE B 1 102 ? 78.363  73.991 38.296 1.00 54.72 ? 102  PHE B N   1 
ATOM   3407 C CA  . PHE B 1 102 ? 79.202  73.417 37.267 1.00 54.94 ? 102  PHE B CA  1 
ATOM   3408 C C   . PHE B 1 102 ? 80.625  73.208 37.743 1.00 54.92 ? 102  PHE B C   1 
ATOM   3409 O O   . PHE B 1 102 ? 80.968  73.574 38.871 1.00 54.94 ? 102  PHE B O   1 
ATOM   3410 C CB  . PHE B 1 102 ? 79.199  74.338 36.061 1.00 55.01 ? 102  PHE B CB  1 
ATOM   3411 C CG  . PHE B 1 102 ? 79.858  75.673 36.290 1.00 55.03 ? 102  PHE B CG  1 
ATOM   3412 C CD1 . PHE B 1 102 ? 81.219  75.842 36.044 1.00 55.10 ? 102  PHE B CD1 1 
ATOM   3413 C CD2 . PHE B 1 102 ? 79.111  76.769 36.711 1.00 54.88 ? 102  PHE B CD2 1 
ATOM   3414 C CE1 . PHE B 1 102 ? 81.826  77.082 36.220 1.00 54.79 ? 102  PHE B CE1 1 
ATOM   3415 C CE2 . PHE B 1 102 ? 79.700  77.992 36.879 1.00 54.77 ? 102  PHE B CE2 1 
ATOM   3416 C CZ  . PHE B 1 102 ? 81.071  78.146 36.620 1.00 55.27 ? 102  PHE B CZ  1 
ATOM   3417 N N   . ILE B 1 103 ? 81.463  72.633 36.897 1.00 54.76 ? 103  ILE B N   1 
ATOM   3418 C CA  . ILE B 1 103 ? 82.832  72.428 37.330 1.00 55.02 ? 103  ILE B CA  1 
ATOM   3419 C C   . ILE B 1 103 ? 83.724  73.390 36.626 1.00 55.02 ? 103  ILE B C   1 
ATOM   3420 O O   . ILE B 1 103 ? 83.592  73.569 35.440 1.00 55.08 ? 103  ILE B O   1 
ATOM   3421 C CB  . ILE B 1 103 ? 83.278  71.019 37.058 1.00 55.10 ? 103  ILE B CB  1 
ATOM   3422 C CG1 . ILE B 1 103 ? 82.479  70.079 37.952 1.00 54.82 ? 103  ILE B CG1 1 
ATOM   3423 C CG2 . ILE B 1 103 ? 84.786  70.900 37.236 1.00 54.59 ? 103  ILE B CG2 1 
ATOM   3424 C CD1 . ILE B 1 103 ? 82.933  68.672 37.904 1.00 55.12 ? 103  ILE B CD1 1 
ATOM   3425 N N   . GLU B 1 104 ? 84.622  74.019 37.375 1.00 55.01 ? 104  GLU B N   1 
ATOM   3426 C CA  . GLU B 1 104 ? 85.550  74.970 36.801 1.00 55.07 ? 104  GLU B CA  1 
ATOM   3427 C C   . GLU B 1 104 ? 86.757  74.138 36.555 1.00 55.15 ? 104  GLU B C   1 
ATOM   3428 O O   . GLU B 1 104 ? 87.398  73.696 37.517 1.00 55.46 ? 104  GLU B O   1 
ATOM   3429 C CB  . GLU B 1 104 ? 85.883  76.080 37.786 1.00 55.02 ? 104  GLU B CB  1 
ATOM   3430 C CG  . GLU B 1 104 ? 85.865  77.493 37.231 1.00 55.08 ? 104  GLU B CG  1 
ATOM   3431 C CD  . GLU B 1 104 ? 86.245  78.552 38.293 1.00 55.92 ? 104  GLU B CD  1 
ATOM   3432 O OE1 . GLU B 1 104 ? 85.430  78.736 39.261 1.00 56.42 ? 104  GLU B OE1 1 
ATOM   3433 O OE2 . GLU B 1 104 ? 87.333  79.214 38.186 1.00 55.27 ? 104  GLU B OE2 1 
ATOM   3434 N N   . VAL B 1 105 ? 87.075  73.883 35.288 1.00 55.12 ? 105  VAL B N   1 
ATOM   3435 C CA  . VAL B 1 105 ? 88.150  72.967 34.994 1.00 54.97 ? 105  VAL B CA  1 
ATOM   3436 C C   . VAL B 1 105 ? 89.492  73.625 35.038 1.00 54.75 ? 105  VAL B C   1 
ATOM   3437 O O   . VAL B 1 105 ? 89.706  74.703 34.527 1.00 54.06 ? 105  VAL B O   1 
ATOM   3438 C CB  . VAL B 1 105 ? 87.965  72.233 33.688 1.00 54.94 ? 105  VAL B CB  1 
ATOM   3439 C CG1 . VAL B 1 105 ? 88.936  71.070 33.612 1.00 55.38 ? 105  VAL B CG1 1 
ATOM   3440 C CG2 . VAL B 1 105 ? 86.597  71.658 33.639 1.00 55.90 ? 105  VAL B CG2 1 
ATOM   3441 N N   . THR B 1 106 ? 90.403  72.911 35.676 1.00 55.29 ? 106  THR B N   1 
ATOM   3442 C CA  . THR B 1 106 ? 91.792  73.283 35.764 1.00 55.27 ? 106  THR B CA  1 
ATOM   3443 C C   . THR B 1 106 ? 92.670  72.323 34.976 1.00 54.96 ? 106  THR B C   1 
ATOM   3444 O O   . THR B 1 106 ? 93.190  72.674 33.946 1.00 54.47 ? 106  THR B O   1 
ATOM   3445 C CB  . THR B 1 106 ? 92.146  73.297 37.223 1.00 55.38 ? 106  THR B CB  1 
ATOM   3446 O OG1 . THR B 1 106 ? 91.599  74.502 37.777 1.00 54.88 ? 106  THR B OG1 1 
ATOM   3447 C CG2 . THR B 1 106 ? 93.668  73.336 37.457 1.00 55.66 ? 106  THR B CG2 1 
ATOM   3448 N N   . ASP B 1 107 ? 92.806  71.101 35.452 1.00 55.23 ? 107  ASP B N   1 
ATOM   3449 C CA  . ASP B 1 107 ? 93.744  70.182 34.823 1.00 55.61 ? 107  ASP B CA  1 
ATOM   3450 C C   . ASP B 1 107 ? 93.111  69.216 33.833 1.00 55.61 ? 107  ASP B C   1 
ATOM   3451 O O   . ASP B 1 107 ? 92.434  68.256 34.216 1.00 55.25 ? 107  ASP B O   1 
ATOM   3452 C CB  . ASP B 1 107 ? 94.551  69.375 35.840 1.00 55.69 ? 107  ASP B CB  1 
ATOM   3453 C CG  . ASP B 1 107 ? 95.443  68.382 35.164 1.00 55.23 ? 107  ASP B CG  1 
ATOM   3454 O OD1 . ASP B 1 107 ? 96.100  68.754 34.173 1.00 54.01 ? 107  ASP B OD1 1 
ATOM   3455 O OD2 . ASP B 1 107 ? 95.506  67.197 35.521 1.00 56.20 ? 107  ASP B OD2 1 
ATOM   3456 N N   . THR B 1 108 ? 93.419  69.451 32.561 1.00 55.82 ? 108  THR B N   1 
ATOM   3457 C CA  . THR B 1 108 ? 92.906  68.605 31.455 1.00 55.81 ? 108  THR B CA  1 
ATOM   3458 C C   . THR B 1 108 ? 93.945  67.579 31.035 1.00 55.53 ? 108  THR B C   1 
ATOM   3459 O O   . THR B 1 108 ? 93.805  66.403 31.348 1.00 55.72 ? 108  THR B O   1 
ATOM   3460 C CB  . THR B 1 108 ? 92.514  69.459 30.219 1.00 55.99 ? 108  THR B CB  1 
ATOM   3461 O OG1 . THR B 1 108 ? 92.803  68.719 29.023 1.00 56.03 ? 108  THR B OG1 1 
ATOM   3462 C CG2 . THR B 1 108 ? 93.287  70.765 30.217 1.00 56.40 ? 108  THR B CG2 1 
ATOM   3463 N N   . ASP B 1 109 ? 94.981  68.063 30.363 1.00 55.55 ? 109  ASP B N   1 
ATOM   3464 C CA  . ASP B 1 109 ? 95.804  67.242 29.500 1.00 55.55 ? 109  ASP B CA  1 
ATOM   3465 C C   . ASP B 1 109 ? 95.384  65.831 29.746 1.00 55.54 ? 109  ASP B C   1 
ATOM   3466 O O   . ASP B 1 109 ? 95.548  65.344 30.855 1.00 55.52 ? 109  ASP B O   1 
ATOM   3467 C CB  . ASP B 1 109 ? 97.276  67.370 29.886 1.00 55.86 ? 109  ASP B CB  1 
ATOM   3468 C CG  . ASP B 1 109 ? 97.677  68.784 30.247 1.00 55.92 ? 109  ASP B CG  1 
ATOM   3469 O OD1 . ASP B 1 109 ? 98.570  69.327 29.582 1.00 56.39 ? 109  ASP B OD1 1 
ATOM   3470 O OD2 . ASP B 1 109 ? 97.181  69.434 31.183 1.00 55.92 ? 109  ASP B OD2 1 
ATOM   3471 N N   . ASP B 1 110 ? 94.846  65.140 28.749 1.00 56.01 ? 110  ASP B N   1 
ATOM   3472 C CA  . ASP B 1 110 ? 94.549  63.724 29.091 1.00 55.93 ? 110  ASP B CA  1 
ATOM   3473 C C   . ASP B 1 110 ? 93.398  63.270 28.203 1.00 55.99 ? 110  ASP B C   1 
ATOM   3474 O O   . ASP B 1 110 ? 93.313  62.173 27.657 1.00 55.49 ? 110  ASP B O   1 
ATOM   3475 C CB  . ASP B 1 110 ? 94.216  63.671 30.598 1.00 55.23 ? 110  ASP B CB  1 
ATOM   3476 C CG  . ASP B 1 110 ? 93.649  62.370 31.155 1.00 55.33 ? 110  ASP B CG  1 
ATOM   3477 O OD1 . ASP B 1 110 ? 93.285  62.348 32.359 1.00 54.75 ? 110  ASP B OD1 1 
ATOM   3478 O OD2 . ASP B 1 110 ? 93.583  61.384 30.395 1.00 55.28 ? 110  ASP B OD2 1 
ATOM   3479 N N   . LEU B 1 111 ? 92.491  64.256 28.214 1.00 56.19 ? 111  LEU B N   1 
ATOM   3480 C CA  . LEU B 1 111 ? 91.359  64.185 27.392 1.00 56.17 ? 111  LEU B CA  1 
ATOM   3481 C C   . LEU B 1 111 ? 92.084  64.520 26.193 1.00 56.25 ? 111  LEU B C   1 
ATOM   3482 O O   . LEU B 1 111 ? 91.579  65.139 25.259 1.00 56.46 ? 111  LEU B O   1 
ATOM   3483 C CB  . LEU B 1 111 ? 90.278  65.207 27.686 1.00 56.17 ? 111  LEU B CB  1 
ATOM   3484 C CG  . LEU B 1 111 ? 88.878  64.588 27.627 1.00 57.01 ? 111  LEU B CG  1 
ATOM   3485 C CD1 . LEU B 1 111 ? 88.729  63.501 28.679 1.00 56.87 ? 111  LEU B CD1 1 
ATOM   3486 C CD2 . LEU B 1 111 ? 87.804  65.669 27.798 1.00 56.19 ? 111  LEU B CD2 1 
ATOM   3487 N N   . GLU B 1 112 ? 93.375  64.267 26.259 1.00 20.00 ? 112  GLU B N   1 
ATOM   3488 C CA  . GLU B 1 112 ? 94.281  64.953 25.380 1.00 20.00 ? 112  GLU B CA  1 
ATOM   3489 C C   . GLU B 1 112 ? 94.935  63.896 24.543 1.00 20.00 ? 112  GLU B C   1 
ATOM   3490 O O   . GLU B 1 112 ? 95.821  63.182 24.980 1.00 56.42 ? 112  GLU B O   1 
ATOM   3491 C CB  . GLU B 1 112 ? 95.287  65.788 26.157 1.00 20.00 ? 112  GLU B CB  1 
ATOM   3492 C CG  . GLU B 1 112 ? 95.970  66.851 25.329 1.00 20.00 ? 112  GLU B CG  1 
ATOM   3493 C CD  . GLU B 1 112 ? 95.161  68.110 25.199 1.00 20.00 ? 112  GLU B CD  1 
ATOM   3494 O OE1 . GLU B 1 112 ? 95.166  68.918 26.138 1.00 20.00 ? 112  GLU B OE1 1 
ATOM   3495 O OE2 . GLU B 1 112 ? 94.537  68.299 24.145 1.00 20.00 ? 112  GLU B OE2 1 
ATOM   3496 N N   . PRO B 1 113 ? 94.454  63.795 23.322 1.00 55.99 ? 113  PRO B N   1 
ATOM   3497 C CA  . PRO B 1 113 ? 94.955  64.669 22.265 1.00 56.09 ? 113  PRO B CA  1 
ATOM   3498 C C   . PRO B 1 113 ? 93.840  65.392 21.522 1.00 55.87 ? 113  PRO B C   1 
ATOM   3499 O O   . PRO B 1 113 ? 93.981  66.557 21.181 1.00 55.23 ? 113  PRO B O   1 
ATOM   3500 C CB  . PRO B 1 113 ? 95.638  63.688 21.315 1.00 56.20 ? 113  PRO B CB  1 
ATOM   3501 C CG  . PRO B 1 113 ? 95.350  62.316 21.865 1.00 56.24 ? 113  PRO B CG  1 
ATOM   3502 C CD  . PRO B 1 113 ? 94.217  62.437 22.807 1.00 55.87 ? 113  PRO B CD  1 
ATOM   3503 N N   . LEU B 1 114 ? 92.742  64.695 21.276 1.00 55.72 ? 114  LEU B N   1 
ATOM   3504 C CA  . LEU B 1 114 ? 91.453  65.164 21.730 1.00 55.66 ? 114  LEU B CA  1 
ATOM   3505 C C   . LEU B 1 114 ? 91.613  66.586 22.153 1.00 55.32 ? 114  LEU B C   1 
ATOM   3506 O O   . LEU B 1 114 ? 91.867  67.448 21.336 1.00 55.41 ? 114  LEU B O   1 
ATOM   3507 C CB  . LEU B 1 114 ? 90.988  64.354 22.921 1.00 55.88 ? 114  LEU B CB  1 
ATOM   3508 C CG  . LEU B 1 114 ? 90.642  62.925 22.554 1.00 56.87 ? 114  LEU B CG  1 
ATOM   3509 C CD1 . LEU B 1 114 ? 89.146  62.783 22.539 1.00 56.50 ? 114  LEU B CD1 1 
ATOM   3510 C CD2 . LEU B 1 114 ? 91.217  62.633 21.192 1.00 56.67 ? 114  LEU B CD2 1 
ATOM   3511 N N   . TYR B 1 115 ? 91.440  66.845 23.436 1.00 54.95 ? 115  TYR B N   1 
ATOM   3512 C CA  . TYR B 1 115 ? 90.840  68.146 23.801 1.00 55.25 ? 115  TYR B CA  1 
ATOM   3513 C C   . TYR B 1 115 ? 91.087  69.384 22.893 1.00 55.44 ? 115  TYR B C   1 
ATOM   3514 O O   . TYR B 1 115 ? 90.194  70.211 22.723 1.00 55.45 ? 115  TYR B O   1 
ATOM   3515 C CB  . TYR B 1 115 ? 91.156  68.466 25.244 1.00 55.24 ? 115  TYR B CB  1 
ATOM   3516 C CG  . TYR B 1 115 ? 90.390  69.640 25.796 1.00 55.03 ? 115  TYR B CG  1 
ATOM   3517 C CD1 . TYR B 1 115 ? 91.110  70.709 26.301 1.00 55.04 ? 115  TYR B CD1 1 
ATOM   3518 C CD2 . TYR B 1 115 ? 89.005  69.714 25.790 1.00 54.88 ? 115  TYR B CD2 1 
ATOM   3519 C CE1 . TYR B 1 115 ? 90.455  71.813 26.803 1.00 55.22 ? 115  TYR B CE1 1 
ATOM   3520 C CE2 . TYR B 1 115 ? 88.351  70.804 26.293 1.00 55.34 ? 115  TYR B CE2 1 
ATOM   3521 C CZ  . TYR B 1 115 ? 89.060  71.853 26.805 1.00 55.10 ? 115  TYR B CZ  1 
ATOM   3522 O OH  . TYR B 1 115 ? 88.411  72.960 27.320 1.00 54.40 ? 115  TYR B OH  1 
ATOM   3523 N N   . THR B 1 116 ? 92.275  69.495 22.323 1.00 55.70 ? 116  THR B N   1 
ATOM   3524 C CA  . THR B 1 116 ? 92.671  70.627 21.463 1.00 55.53 ? 116  THR B CA  1 
ATOM   3525 C C   . THR B 1 116 ? 92.210  70.389 20.034 1.00 55.38 ? 116  THR B C   1 
ATOM   3526 O O   . THR B 1 116 ? 91.700  71.289 19.356 1.00 54.79 ? 116  THR B O   1 
ATOM   3527 C CB  . THR B 1 116 ? 94.207  70.789 21.461 1.00 55.44 ? 116  THR B CB  1 
ATOM   3528 O OG1 . THR B 1 116 ? 94.761  69.951 20.435 1.00 55.77 ? 116  THR B OG1 1 
ATOM   3529 C CG2 . THR B 1 116 ? 94.818  70.286 22.750 1.00 55.01 ? 116  THR B CG2 1 
ATOM   3530 N N   . ALA B 1 117 ? 92.430  69.143 19.603 1.00 55.81 ? 117  ALA B N   1 
ATOM   3531 C CA  . ALA B 1 117 ? 92.004  68.634 18.298 1.00 55.81 ? 117  ALA B CA  1 
ATOM   3532 C C   . ALA B 1 117 ? 90.514  68.900 17.975 1.00 55.69 ? 117  ALA B C   1 
ATOM   3533 O O   . ALA B 1 117 ? 90.118  68.998 16.810 1.00 55.26 ? 117  ALA B O   1 
ATOM   3534 C CB  . ALA B 1 117 ? 92.342  67.124 18.204 1.00 55.98 ? 117  ALA B CB  1 
ATOM   3535 N N   . ALA B 1 118 ? 89.715  69.068 19.022 1.00 55.83 ? 118  ALA B N   1 
ATOM   3536 C CA  . ALA B 1 118 ? 88.258  69.234 18.910 1.00 55.65 ? 118  ALA B CA  1 
ATOM   3537 C C   . ALA B 1 118 ? 87.745  70.646 19.154 1.00 55.45 ? 118  ALA B C   1 
ATOM   3538 O O   . ALA B 1 118 ? 88.061  71.294 20.144 1.00 55.59 ? 118  ALA B O   1 
ATOM   3539 C CB  . ALA B 1 118 ? 87.578  68.296 19.891 1.00 56.06 ? 118  ALA B CB  1 
ATOM   3540 N N   . GLU B 1 119 ? 86.905  71.099 18.254 1.00 55.23 ? 119  GLU B N   1 
ATOM   3541 C CA  . GLU B 1 119 ? 86.338  72.434 18.331 1.00 55.25 ? 119  GLU B CA  1 
ATOM   3542 C C   . GLU B 1 119 ? 85.419  72.573 19.539 1.00 54.94 ? 119  GLU B C   1 
ATOM   3543 O O   . GLU B 1 119 ? 84.271  72.953 19.377 1.00 55.07 ? 119  GLU B O   1 
ATOM   3544 C CB  . GLU B 1 119 ? 85.581  72.778 17.012 1.00 55.20 ? 119  GLU B CB  1 
ATOM   3545 C CG  . GLU B 1 119 ? 86.410  73.520 15.936 1.00 56.14 ? 119  GLU B CG  1 
ATOM   3546 C CD  . GLU B 1 119 ? 86.139  75.048 15.838 1.00 56.79 ? 119  GLU B CD  1 
ATOM   3547 O OE1 . GLU B 1 119 ? 86.026  75.728 16.898 1.00 56.58 ? 119  GLU B OE1 1 
ATOM   3548 O OE2 . GLU B 1 119 ? 86.071  75.584 14.692 1.00 55.90 ? 119  GLU B OE2 1 
ATOM   3549 N N   . PHE B 1 120 ? 85.896  72.287 20.752 1.00 54.72 ? 120  PHE B N   1 
ATOM   3550 C CA  . PHE B 1 120 ? 85.017  72.472 21.909 1.00 54.87 ? 120  PHE B CA  1 
ATOM   3551 C C   . PHE B 1 120 ? 85.670  72.833 23.188 1.00 54.65 ? 120  PHE B C   1 
ATOM   3552 O O   . PHE B 1 120 ? 86.796  72.471 23.439 1.00 54.17 ? 120  PHE B O   1 
ATOM   3553 C CB  . PHE B 1 120 ? 84.136  71.234 22.154 1.00 55.32 ? 120  PHE B CB  1 
ATOM   3554 C CG  . PHE B 1 120 ? 84.768  70.146 23.013 1.00 55.10 ? 120  PHE B CG  1 
ATOM   3555 C CD1 . PHE B 1 120 ? 85.648  69.234 22.465 1.00 54.85 ? 120  PHE B CD1 1 
ATOM   3556 C CD2 . PHE B 1 120 ? 84.417  70.011 24.351 1.00 55.45 ? 120  PHE B CD2 1 
ATOM   3557 C CE1 . PHE B 1 120 ? 86.200  68.242 23.236 1.00 54.78 ? 120  PHE B CE1 1 
ATOM   3558 C CE2 . PHE B 1 120 ? 84.968  68.996 25.131 1.00 55.02 ? 120  PHE B CE2 1 
ATOM   3559 C CZ  . PHE B 1 120 ? 85.856  68.122 24.573 1.00 54.61 ? 120  PHE B CZ  1 
ATOM   3560 N N   . ASP B 1 121 ? 84.901  73.529 24.011 1.00 54.83 ? 121  ASP B N   1 
ATOM   3561 C CA  . ASP B 1 121 ? 85.372  74.037 25.288 1.00 54.96 ? 121  ASP B CA  1 
ATOM   3562 C C   . ASP B 1 121 ? 84.905  73.140 26.388 1.00 54.86 ? 121  ASP B C   1 
ATOM   3563 O O   . ASP B 1 121 ? 85.720  72.601 27.128 1.00 54.74 ? 121  ASP B O   1 
ATOM   3564 C CB  . ASP B 1 121 ? 84.842  75.442 25.554 1.00 54.82 ? 121  ASP B CB  1 
ATOM   3565 C CG  . ASP B 1 121 ? 85.044  76.344 24.401 1.00 54.58 ? 121  ASP B CG  1 
ATOM   3566 O OD1 . ASP B 1 121 ? 86.193  76.559 23.996 1.00 55.67 ? 121  ASP B OD1 1 
ATOM   3567 O OD2 . ASP B 1 121 ? 84.115  76.896 23.832 1.00 54.16 ? 121  ASP B OD2 1 
ATOM   3568 N N   . GLY B 1 122 ? 83.586  72.995 26.487 1.00 54.85 ? 122  GLY B N   1 
ATOM   3569 C CA  . GLY B 1 122 ? 82.955  72.302 27.605 1.00 54.86 ? 122  GLY B CA  1 
ATOM   3570 C C   . GLY B 1 122 ? 81.918  71.273 27.243 1.00 54.57 ? 122  GLY B C   1 
ATOM   3571 O O   . GLY B 1 122 ? 81.726  70.929 26.083 1.00 53.96 ? 122  GLY B O   1 
ATOM   3572 N N   . ILE B 1 123 ? 81.263  70.765 28.267 1.00 54.51 ? 123  ILE B N   1 
ATOM   3573 C CA  . ILE B 1 123 ? 80.286  69.738 28.076 1.00 54.82 ? 123  ILE B CA  1 
ATOM   3574 C C   . ILE B 1 123 ? 79.131  70.025 28.980 1.00 54.71 ? 123  ILE B C   1 
ATOM   3575 O O   . ILE B 1 123 ? 79.294  70.298 30.139 1.00 55.09 ? 123  ILE B O   1 
ATOM   3576 C CB  . ILE B 1 123 ? 80.872  68.369 28.438 1.00 54.80 ? 123  ILE B CB  1 
ATOM   3577 C CG1 . ILE B 1 123 ? 81.898  67.983 27.405 1.00 54.80 ? 123  ILE B CG1 1 
ATOM   3578 C CG2 . ILE B 1 123 ? 79.792  67.305 28.460 1.00 54.90 ? 123  ILE B CG2 1 
ATOM   3579 C CD1 . ILE B 1 123 ? 82.605  66.745 27.740 1.00 55.13 ? 123  ILE B CD1 1 
ATOM   3580 N N   . LEU B 1 124 ? 77.944  69.913 28.468 1.00 54.30 ? 124  LEU B N   1 
ATOM   3581 C CA  . LEU B 1 124 ? 76.828  70.040 29.309 1.00 54.52 ? 124  LEU B CA  1 
ATOM   3582 C C   . LEU B 1 124 ? 76.140  68.720 29.214 1.00 54.52 ? 124  LEU B C   1 
ATOM   3583 O O   . LEU B 1 124 ? 75.694  68.342 28.166 1.00 55.05 ? 124  LEU B O   1 
ATOM   3584 C CB  . LEU B 1 124 ? 75.975  71.173 28.795 1.00 54.65 ? 124  LEU B CB  1 
ATOM   3585 C CG  . LEU B 1 124 ? 74.501  71.182 29.128 1.00 54.63 ? 124  LEU B CG  1 
ATOM   3586 C CD1 . LEU B 1 124 ? 74.295  70.929 30.575 1.00 55.02 ? 124  LEU B CD1 1 
ATOM   3587 C CD2 . LEU B 1 124 ? 73.933  72.542 28.741 1.00 54.98 ? 124  LEU B CD2 1 
ATOM   3588 N N   . GLY B 1 125 ? 76.060  67.993 30.306 1.00 54.68 ? 125  GLY B N   1 
ATOM   3589 C CA  . GLY B 1 125 ? 75.475  66.661 30.274 1.00 54.72 ? 125  GLY B CA  1 
ATOM   3590 C C   . GLY B 1 125 ? 73.978  66.723 30.248 1.00 54.63 ? 125  GLY B C   1 
ATOM   3591 O O   . GLY B 1 125 ? 73.407  67.634 30.764 1.00 54.96 ? 125  GLY B O   1 
ATOM   3592 N N   . LEU B 1 126 ? 73.330  65.732 29.683 1.00 54.76 ? 126  LEU B N   1 
ATOM   3593 C CA  . LEU B 1 126 ? 71.861  65.705 29.672 1.00 55.01 ? 126  LEU B CA  1 
ATOM   3594 C C   . LEU B 1 126 ? 71.266  64.378 30.228 1.00 55.02 ? 126  LEU B C   1 
ATOM   3595 O O   . LEU B 1 126 ? 70.112  63.990 29.949 1.00 54.29 ? 126  LEU B O   1 
ATOM   3596 C CB  . LEU B 1 126 ? 71.362  65.973 28.255 1.00 54.99 ? 126  LEU B CB  1 
ATOM   3597 C CG  . LEU B 1 126 ? 71.663  67.326 27.632 1.00 55.18 ? 126  LEU B CG  1 
ATOM   3598 C CD1 . LEU B 1 126 ? 70.894  67.475 26.341 1.00 55.35 ? 126  LEU B CD1 1 
ATOM   3599 C CD2 . LEU B 1 126 ? 71.249  68.443 28.558 1.00 55.69 ? 126  LEU B CD2 1 
ATOM   3600 N N   . GLY B 1 127 ? 72.067  63.688 31.022 1.00 54.94 ? 127  GLY B N   1 
ATOM   3601 C CA  . GLY B 1 127 ? 71.624  62.449 31.582 1.00 55.22 ? 127  GLY B CA  1 
ATOM   3602 C C   . GLY B 1 127 ? 70.818  62.668 32.845 1.00 55.24 ? 127  GLY B C   1 
ATOM   3603 O O   . GLY B 1 127 ? 70.454  63.812 33.164 1.00 54.85 ? 127  GLY B O   1 
ATOM   3604 N N   . TRP B 1 128 ? 70.575  61.561 33.565 1.00 55.25 ? 128  TRP B N   1 
ATOM   3605 C CA  . TRP B 1 128 ? 69.777  61.590 34.784 1.00 55.44 ? 128  TRP B CA  1 
ATOM   3606 C C   . TRP B 1 128 ? 70.681  61.972 35.945 1.00 55.91 ? 128  TRP B C   1 
ATOM   3607 O O   . TRP B 1 128 ? 71.927  62.034 35.786 1.00 55.47 ? 128  TRP B O   1 
ATOM   3608 C CB  . TRP B 1 128 ? 69.080  60.254 35.025 1.00 55.32 ? 128  TRP B CB  1 
ATOM   3609 C CG  . TRP B 1 128 ? 68.153  59.985 33.962 1.00 55.02 ? 128  TRP B CG  1 
ATOM   3610 C CD1 . TRP B 1 128 ? 68.463  59.560 32.709 1.00 55.71 ? 128  TRP B CD1 1 
ATOM   3611 C CD2 . TRP B 1 128 ? 66.745  60.195 33.969 1.00 54.80 ? 128  TRP B CD2 1 
ATOM   3612 N NE1 . TRP B 1 128 ? 67.336  59.479 31.930 1.00 55.87 ? 128  TRP B NE1 1 
ATOM   3613 C CE2 . TRP B 1 128 ? 66.260  59.858 32.688 1.00 56.02 ? 128  TRP B CE2 1 
ATOM   3614 C CE3 . TRP B 1 128 ? 65.835  60.643 34.923 1.00 54.94 ? 128  TRP B CE3 1 
ATOM   3615 C CZ2 . TRP B 1 128 ? 64.903  59.943 32.349 1.00 55.77 ? 128  TRP B CZ2 1 
ATOM   3616 C CZ3 . TRP B 1 128 ? 64.496  60.731 34.587 1.00 55.11 ? 128  TRP B CZ3 1 
ATOM   3617 C CH2 . TRP B 1 128 ? 64.042  60.374 33.312 1.00 55.30 ? 128  TRP B CH2 1 
ATOM   3618 N N   . LYS B 1 129 ? 70.063  62.228 37.111 1.00 55.77 ? 129  LYS B N   1 
ATOM   3619 C CA  . LYS B 1 129 ? 70.833  62.750 38.246 1.00 55.56 ? 129  LYS B CA  1 
ATOM   3620 C C   . LYS B 1 129 ? 71.905  61.769 38.646 1.00 55.51 ? 129  LYS B C   1 
ATOM   3621 O O   . LYS B 1 129 ? 73.048  62.142 38.733 1.00 55.66 ? 129  LYS B O   1 
ATOM   3622 C CB  . LYS B 1 129 ? 69.929  63.051 39.436 1.00 55.69 ? 129  LYS B CB  1 
ATOM   3623 C CG  . LYS B 1 129 ? 70.550  63.983 40.487 1.00 55.55 ? 129  LYS B CG  1 
ATOM   3624 C CD  . LYS B 1 129 ? 69.700  64.106 41.777 1.00 55.16 ? 129  LYS B CD  1 
ATOM   3625 C CE  . LYS B 1 129 ? 70.416  65.031 42.783 1.00 55.65 ? 129  LYS B CE  1 
ATOM   3626 N NZ  . LYS B 1 129 ? 70.017  64.940 44.220 1.00 55.73 ? 129  LYS B NZ  1 
ATOM   3627 N N   . ASP B 1 130 ? 71.525  60.512 38.865 1.00 55.53 ? 130  ASP B N   1 
ATOM   3628 C CA  . ASP B 1 130 ? 72.444  59.470 39.341 1.00 55.46 ? 130  ASP B CA  1 
ATOM   3629 C C   . ASP B 1 130 ? 73.675  59.284 38.475 1.00 55.25 ? 130  ASP B C   1 
ATOM   3630 O O   . ASP B 1 130 ? 74.611  58.598 38.875 1.00 55.08 ? 130  ASP B O   1 
ATOM   3631 C CB  . ASP B 1 130 ? 71.715  58.121 39.415 1.00 55.88 ? 130  ASP B CB  1 
ATOM   3632 C CG  . ASP B 1 130 ? 70.703  58.067 40.528 1.00 56.51 ? 130  ASP B CG  1 
ATOM   3633 O OD1 . ASP B 1 130 ? 70.366  56.944 41.012 1.00 56.83 ? 130  ASP B OD1 1 
ATOM   3634 O OD2 . ASP B 1 130 ? 70.198  59.116 40.993 1.00 57.68 ? 130  ASP B OD2 1 
ATOM   3635 N N   . LEU B 1 131 ? 73.671  59.874 37.289 1.00 55.04 ? 131  LEU B N   1 
ATOM   3636 C CA  . LEU B 1 131 ? 74.782  59.724 36.351 1.00 55.21 ? 131  LEU B CA  1 
ATOM   3637 C C   . LEU B 1 131 ? 75.831  60.819 36.563 1.00 55.00 ? 131  LEU B C   1 
ATOM   3638 O O   . LEU B 1 131 ? 76.911  60.837 35.964 1.00 54.47 ? 131  LEU B O   1 
ATOM   3639 C CB  . LEU B 1 131 ? 74.214  59.812 34.936 1.00 55.49 ? 131  LEU B CB  1 
ATOM   3640 C CG  . LEU B 1 131 ? 75.138  59.603 33.731 1.00 55.18 ? 131  LEU B CG  1 
ATOM   3641 C CD1 . LEU B 1 131 ? 75.553  58.172 33.660 1.00 55.51 ? 131  LEU B CD1 1 
ATOM   3642 C CD2 . LEU B 1 131 ? 74.448  60.008 32.452 1.00 55.12 ? 131  LEU B CD2 1 
ATOM   3643 N N   . SER B 1 132 ? 75.466  61.754 37.412 1.00 55.11 ? 132  SER B N   1 
ATOM   3644 C CA  . SER B 1 132 ? 76.247  62.911 37.629 1.00 55.46 ? 132  SER B CA  1 
ATOM   3645 C C   . SER B 1 132 ? 77.043  62.673 38.855 1.00 55.57 ? 132  SER B C   1 
ATOM   3646 O O   . SER B 1 132 ? 76.612  61.945 39.771 1.00 55.55 ? 132  SER B O   1 
ATOM   3647 C CB  . SER B 1 132 ? 75.367  64.127 37.930 1.00 55.99 ? 132  SER B CB  1 
ATOM   3648 O OG  . SER B 1 132 ? 75.109  64.220 39.352 1.00 56.88 ? 132  SER B OG  1 
ATOM   3649 N N   . ILE B 1 133 ? 78.154  63.407 38.891 1.00 55.67 ? 133  ILE B N   1 
ATOM   3650 C CA  . ILE B 1 133 ? 79.112  63.420 39.981 1.00 55.24 ? 133  ILE B CA  1 
ATOM   3651 C C   . ILE B 1 133 ? 78.821  64.612 40.886 1.00 55.16 ? 133  ILE B C   1 
ATOM   3652 O O   . ILE B 1 133 ? 78.978  65.756 40.477 1.00 55.32 ? 133  ILE B O   1 
ATOM   3653 C CB  . ILE B 1 133 ? 80.478  63.533 39.386 1.00 54.74 ? 133  ILE B CB  1 
ATOM   3654 C CG1 . ILE B 1 133 ? 80.671  62.352 38.443 1.00 54.46 ? 133  ILE B CG1 1 
ATOM   3655 C CG2 . ILE B 1 133 ? 81.471  63.570 40.480 1.00 54.93 ? 133  ILE B CG2 1 
ATOM   3656 C CD1 . ILE B 1 133 ? 81.880  62.445 37.623 1.00 55.50 ? 133  ILE B CD1 1 
ATOM   3657 N N   . GLY B 1 134 ? 78.383  64.345 42.106 1.00 55.09 ? 134  GLY B N   1 
ATOM   3658 C CA  . GLY B 1 134 ? 77.967  65.411 42.998 1.00 54.98 ? 134  GLY B CA  1 
ATOM   3659 C C   . GLY B 1 134 ? 76.474  65.588 43.016 1.00 54.77 ? 134  GLY B C   1 
ATOM   3660 O O   . GLY B 1 134 ? 75.977  66.533 43.589 1.00 54.43 ? 134  GLY B O   1 
ATOM   3661 N N   . SER B 1 135 ? 75.755  64.650 42.421 1.00 55.09 ? 135  SER B N   1 
ATOM   3662 C CA  . SER B 1 135 ? 74.313  64.648 42.457 1.00 55.33 ? 135  SER B CA  1 
ATOM   3663 C C   . SER B 1 135 ? 73.813  66.037 42.136 1.00 55.22 ? 135  SER B C   1 
ATOM   3664 O O   . SER B 1 135 ? 73.619  66.870 43.009 1.00 55.49 ? 135  SER B O   1 
ATOM   3665 C CB  . SER B 1 135 ? 73.774  64.168 43.824 1.00 55.33 ? 135  SER B CB  1 
ATOM   3666 O OG  . SER B 1 135 ? 73.571  62.761 43.819 1.00 55.87 ? 135  SER B OG  1 
ATOM   3667 N N   . ILE B 1 136 ? 73.612  66.272 40.860 1.00 55.14 ? 136  ILE B N   1 
ATOM   3668 C CA  . ILE B 1 136 ? 73.089  67.511 40.401 1.00 54.98 ? 136  ILE B CA  1 
ATOM   3669 C C   . ILE B 1 136 ? 71.911  67.260 39.512 1.00 55.01 ? 136  ILE B C   1 
ATOM   3670 O O   . ILE B 1 136 ? 71.903  66.361 38.660 1.00 55.15 ? 136  ILE B O   1 
ATOM   3671 C CB  . ILE B 1 136 ? 74.121  68.199 39.609 1.00 55.11 ? 136  ILE B CB  1 
ATOM   3672 C CG1 . ILE B 1 136 ? 75.104  68.892 40.529 1.00 55.10 ? 136  ILE B CG1 1 
ATOM   3673 C CG2 . ILE B 1 136 ? 73.475  69.232 38.723 1.00 56.10 ? 136  ILE B CG2 1 
ATOM   3674 C CD1 . ILE B 1 136 ? 76.274  69.554 39.777 1.00 55.10 ? 136  ILE B CD1 1 
ATOM   3675 N N   . ASP B 1 137 ? 70.933  68.117 39.677 1.00 55.04 ? 137  ASP B N   1 
ATOM   3676 C CA  . ASP B 1 137 ? 69.657  67.944 39.032 1.00 55.26 ? 137  ASP B CA  1 
ATOM   3677 C C   . ASP B 1 137 ? 69.772  68.418 37.566 1.00 54.88 ? 137  ASP B C   1 
ATOM   3678 O O   . ASP B 1 137 ? 70.170  69.532 37.281 1.00 53.98 ? 137  ASP B O   1 
ATOM   3679 C CB  . ASP B 1 137 ? 68.569  68.717 39.843 1.00 55.49 ? 137  ASP B CB  1 
ATOM   3680 C CG  . ASP B 1 137 ? 68.886  68.783 41.382 1.00 55.77 ? 137  ASP B CG  1 
ATOM   3681 O OD1 . ASP B 1 137 ? 69.958  69.288 41.835 1.00 56.22 ? 137  ASP B OD1 1 
ATOM   3682 O OD2 . ASP B 1 137 ? 68.127  68.328 42.229 1.00 56.37 ? 137  ASP B OD2 1 
ATOM   3683 N N   . PRO B 1 138 ? 69.414  67.529 36.645 1.00 55.11 ? 138  PRO B N   1 
ATOM   3684 C CA  . PRO B 1 138 ? 69.500  67.829 35.211 1.00 55.31 ? 138  PRO B CA  1 
ATOM   3685 C C   . PRO B 1 138 ? 68.777  69.124 34.857 1.00 55.15 ? 138  PRO B C   1 
ATOM   3686 O O   . PRO B 1 138 ? 67.570  69.236 35.073 1.00 54.28 ? 138  PRO B O   1 
ATOM   3687 C CB  . PRO B 1 138 ? 68.798  66.632 34.558 1.00 55.57 ? 138  PRO B CB  1 
ATOM   3688 C CG  . PRO B 1 138 ? 68.032  65.978 35.662 1.00 55.55 ? 138  PRO B CG  1 
ATOM   3689 C CD  . PRO B 1 138 ? 68.842  66.196 36.898 1.00 55.15 ? 138  PRO B CD  1 
ATOM   3690 N N   . ILE B 1 139 ? 69.514  70.089 34.317 1.00 55.73 ? 139  ILE B N   1 
ATOM   3691 C CA  . ILE B 1 139 ? 68.963  71.408 34.034 1.00 55.74 ? 139  ILE B CA  1 
ATOM   3692 C C   . ILE B 1 139 ? 67.482  71.323 33.684 1.00 55.38 ? 139  ILE B C   1 
ATOM   3693 O O   . ILE B 1 139 ? 66.644  71.953 34.330 1.00 55.52 ? 139  ILE B O   1 
ATOM   3694 C CB  . ILE B 1 139 ? 69.739  72.080 32.886 1.00 55.60 ? 139  ILE B CB  1 
ATOM   3695 C CG1 . ILE B 1 139 ? 70.302  71.025 31.933 1.00 56.28 ? 139  ILE B CG1 1 
ATOM   3696 C CG2 . ILE B 1 139 ? 70.854  72.956 33.438 1.00 55.49 ? 139  ILE B CG2 1 
ATOM   3697 C CD1 . ILE B 1 139 ? 70.524  71.529 30.524 1.00 57.04 ? 139  ILE B CD1 1 
ATOM   3698 N N   . VAL B 1 140 ? 67.165  70.541 32.657 1.00 55.16 ? 140  VAL B N   1 
ATOM   3699 C CA  . VAL B 1 140 ? 65.820  70.526 32.091 1.00 55.54 ? 140  VAL B CA  1 
ATOM   3700 C C   . VAL B 1 140 ? 64.784  70.152 33.145 1.00 55.90 ? 140  VAL B C   1 
ATOM   3701 O O   . VAL B 1 140 ? 63.738  70.792 33.255 1.00 55.86 ? 140  VAL B O   1 
ATOM   3702 C CB  . VAL B 1 140 ? 65.717  69.543 30.911 1.00 55.46 ? 140  VAL B CB  1 
ATOM   3703 C CG1 . VAL B 1 140 ? 64.299  69.518 30.361 1.00 54.95 ? 140  VAL B CG1 1 
ATOM   3704 C CG2 . VAL B 1 140 ? 66.712  69.912 29.821 1.00 55.61 ? 140  VAL B CG2 1 
ATOM   3705 N N   . VAL B 1 141 ? 65.081  69.112 33.918 1.00 55.98 ? 141  VAL B N   1 
ATOM   3706 C CA  . VAL B 1 141 ? 64.334  68.824 35.136 1.00 55.49 ? 141  VAL B CA  1 
ATOM   3707 C C   . VAL B 1 141 ? 64.117  70.089 35.962 1.00 55.10 ? 141  VAL B C   1 
ATOM   3708 O O   . VAL B 1 141 ? 63.100  70.230 36.640 1.00 55.13 ? 141  VAL B O   1 
ATOM   3709 C CB  . VAL B 1 141 ? 65.051  67.774 36.003 1.00 55.70 ? 141  VAL B CB  1 
ATOM   3710 C CG1 . VAL B 1 141 ? 64.495  67.782 37.419 1.00 56.07 ? 141  VAL B CG1 1 
ATOM   3711 C CG2 . VAL B 1 141 ? 64.924  66.392 35.381 1.00 56.20 ? 141  VAL B CG2 1 
ATOM   3712 N N   . GLU B 1 142 ? 65.078  71.004 35.898 1.00 55.07 ? 142  GLU B N   1 
ATOM   3713 C CA  . GLU B 1 142 ? 65.176  72.081 36.876 1.00 55.26 ? 142  GLU B CA  1 
ATOM   3714 C C   . GLU B 1 142 ? 64.914  73.438 36.230 1.00 55.58 ? 142  GLU B C   1 
ATOM   3715 O O   . GLU B 1 142 ? 65.199  74.480 36.818 1.00 56.13 ? 142  GLU B O   1 
ATOM   3716 C CB  . GLU B 1 142 ? 66.553  72.073 37.544 1.00 55.12 ? 142  GLU B CB  1 
ATOM   3717 C CG  . GLU B 1 142 ? 66.687  73.054 38.697 1.00 56.20 ? 142  GLU B CG  1 
ATOM   3718 C CD  . GLU B 1 142 ? 67.658  72.576 39.759 1.00 56.76 ? 142  GLU B CD  1 
ATOM   3719 O OE1 . GLU B 1 142 ? 68.798  73.083 39.796 1.00 56.33 ? 142  GLU B OE1 1 
ATOM   3720 O OE2 . GLU B 1 142 ? 67.281  71.692 40.556 1.00 55.30 ? 142  GLU B OE2 1 
ATOM   3721 N N   . LEU B 1 143 ? 64.370  73.415 35.018 1.00 55.43 ? 143  LEU B N   1 
ATOM   3722 C CA  . LEU B 1 143 ? 63.696  74.581 34.460 1.00 55.28 ? 143  LEU B CA  1 
ATOM   3723 C C   . LEU B 1 143 ? 62.180  74.413 34.499 1.00 55.24 ? 143  LEU B C   1 
ATOM   3724 O O   . LEU B 1 143 ? 61.472  75.221 35.098 1.00 55.80 ? 143  LEU B O   1 
ATOM   3725 C CB  . LEU B 1 143 ? 64.159  74.831 33.023 1.00 55.10 ? 143  LEU B CB  1 
ATOM   3726 C CG  . LEU B 1 143 ? 65.573  75.393 32.856 1.00 54.88 ? 143  LEU B CG  1 
ATOM   3727 C CD1 . LEU B 1 143 ? 66.049  75.232 31.420 1.00 55.26 ? 143  LEU B CD1 1 
ATOM   3728 C CD2 . LEU B 1 143 ? 65.626  76.852 33.281 1.00 54.70 ? 143  LEU B CD2 1 
ATOM   3729 N N   . LYS B 1 144 ? 61.690  73.359 33.856 1.00 55.02 ? 144  LYS B N   1 
ATOM   3730 C CA  . LYS B 1 144 ? 60.382  72.803 34.181 1.00 55.01 ? 144  LYS B CA  1 
ATOM   3731 C C   . LYS B 1 144 ? 60.006  73.089 35.631 1.00 55.09 ? 144  LYS B C   1 
ATOM   3732 O O   . LYS B 1 144 ? 58.939  73.636 35.909 1.00 55.38 ? 144  LYS B O   1 
ATOM   3733 C CB  . LYS B 1 144 ? 60.361  71.296 33.921 1.00 55.00 ? 144  LYS B CB  1 
ATOM   3734 C CG  . LYS B 1 144 ? 59.041  70.624 34.267 1.00 55.80 ? 144  LYS B CG  1 
ATOM   3735 C CD  . LYS B 1 144 ? 57.860  71.462 33.810 1.00 55.67 ? 144  LYS B CD  1 
ATOM   3736 C CE  . LYS B 1 144 ? 56.652  71.252 34.709 1.00 55.09 ? 144  LYS B CE  1 
ATOM   3737 N NZ  . LYS B 1 144 ? 55.657  72.350 34.569 1.00 55.38 ? 144  LYS B NZ  1 
ATOM   3738 N N   . ASN B 1 145 ? 60.890  72.717 36.551 1.00 55.03 ? 145  ASN B N   1 
ATOM   3739 C CA  . ASN B 1 145 ? 60.638  72.902 37.976 1.00 55.03 ? 145  ASN B CA  1 
ATOM   3740 C C   . ASN B 1 145 ? 60.347  74.359 38.324 1.00 55.05 ? 145  ASN B C   1 
ATOM   3741 O O   . ASN B 1 145 ? 59.305  74.673 38.898 1.00 55.47 ? 145  ASN B O   1 
ATOM   3742 C CB  . ASN B 1 145 ? 61.821  72.391 38.800 1.00 55.31 ? 145  ASN B CB  1 
ATOM   3743 C CG  . ASN B 1 145 ? 61.728  70.906 39.091 1.00 55.39 ? 145  ASN B CG  1 
ATOM   3744 O OD1 . ASN B 1 145 ? 60.880  70.205 38.541 1.00 55.56 ? 145  ASN B OD1 1 
ATOM   3745 N ND2 . ASN B 1 145 ? 62.605  70.418 39.962 1.00 54.21 ? 145  ASN B ND2 1 
ATOM   3746 N N   . GLN B 1 146 ? 61.276  75.243 37.973 1.00 55.19 ? 146  GLN B N   1 
ATOM   3747 C CA  . GLN B 1 146 ? 61.074  76.693 38.156 1.00 55.33 ? 146  GLN B CA  1 
ATOM   3748 C C   . GLN B 1 146 ? 60.001  77.277 37.215 1.00 55.18 ? 146  GLN B C   1 
ATOM   3749 O O   . GLN B 1 146 ? 59.944  78.483 37.034 1.00 54.79 ? 146  GLN B O   1 
ATOM   3750 C CB  . GLN B 1 146 ? 62.383  77.446 37.939 1.00 55.60 ? 146  GLN B CB  1 
ATOM   3751 C CG  . GLN B 1 146 ? 63.642  76.633 38.141 1.00 55.38 ? 146  GLN B CG  1 
ATOM   3752 C CD  . GLN B 1 146 ? 64.857  77.513 38.169 1.00 54.95 ? 146  GLN B CD  1 
ATOM   3753 O OE1 . GLN B 1 146 ? 64.964  78.446 37.373 1.00 53.97 ? 146  GLN B OE1 1 
ATOM   3754 N NE2 . GLN B 1 146 ? 65.783  77.226 39.078 1.00 55.61 ? 146  GLN B NE2 1 
ATOM   3755 N N   . ASN B 1 147 ? 59.188  76.400 36.619 1.00 55.54 ? 147  ASN B N   1 
ATOM   3756 C CA  . ASN B 1 147 ? 58.248  76.736 35.578 1.00 55.66 ? 147  ASN B CA  1 
ATOM   3757 C C   . ASN B 1 147 ? 58.829  77.852 34.696 1.00 55.97 ? 147  ASN B C   1 
ATOM   3758 O O   . ASN B 1 147 ? 58.452  79.031 34.788 1.00 56.55 ? 147  ASN B O   1 
ATOM   3759 C CB  . ASN B 1 147 ? 56.938  77.137 36.235 1.00 56.03 ? 147  ASN B CB  1 
ATOM   3760 C CG  . ASN B 1 147 ? 55.765  76.286 35.746 1.00 56.89 ? 147  ASN B CG  1 
ATOM   3761 O OD1 . ASN B 1 147 ? 55.447  76.297 34.533 1.00 56.69 ? 147  ASN B OD1 1 
ATOM   3762 N ND2 . ASN B 1 147 ? 55.102  75.531 36.698 1.00 56.84 ? 147  ASN B ND2 1 
ATOM   3763 N N   . LYS B 1 148 ? 59.823  77.507 33.899 1.00 55.75 ? 148  LYS B N   1 
ATOM   3764 C CA  . LYS B 1 148 ? 60.345  78.437 32.921 1.00 55.78 ? 148  LYS B CA  1 
ATOM   3765 C C   . LYS B 1 148 ? 60.295  77.773 31.563 1.00 55.83 ? 148  LYS B C   1 
ATOM   3766 O O   . LYS B 1 148 ? 60.838  78.317 30.596 1.00 56.34 ? 148  LYS B O   1 
ATOM   3767 C CB  . LYS B 1 148 ? 61.793  78.876 33.269 1.00 56.12 ? 148  LYS B CB  1 
ATOM   3768 C CG  . LYS B 1 148 ? 61.991  79.695 34.610 1.00 55.95 ? 148  LYS B CG  1 
ATOM   3769 C CD  . LYS B 1 148 ? 63.514  79.940 34.999 1.00 55.52 ? 148  LYS B CD  1 
ATOM   3770 C CE  . LYS B 1 148 ? 64.209  80.973 34.091 1.00 55.82 ? 148  LYS B CE  1 
ATOM   3771 N NZ  . LYS B 1 148 ? 65.519  81.486 34.620 1.00 55.19 ? 148  LYS B NZ  1 
ATOM   3772 N N   . ILE B 1 149 ? 59.643  76.613 31.490 1.00 55.68 ? 149  ILE B N   1 
ATOM   3773 C CA  . ILE B 1 149 ? 59.456  75.874 30.238 1.00 55.85 ? 149  ILE B CA  1 
ATOM   3774 C C   . ILE B 1 149 ? 58.233  75.008 30.421 1.00 55.67 ? 149  ILE B C   1 
ATOM   3775 O O   . ILE B 1 149 ? 57.845  74.721 31.549 1.00 55.60 ? 149  ILE B O   1 
ATOM   3776 C CB  . ILE B 1 149 ? 60.689  74.964 29.937 1.00 56.17 ? 149  ILE B CB  1 
ATOM   3777 C CG1 . ILE B 1 149 ? 61.049  74.102 31.167 1.00 56.35 ? 149  ILE B CG1 1 
ATOM   3778 C CG2 . ILE B 1 149 ? 61.920  75.763 29.468 1.00 55.35 ? 149  ILE B CG2 1 
ATOM   3779 C CD1 . ILE B 1 149 ? 62.064  72.999 30.873 1.00 56.22 ? 149  ILE B CD1 1 
ATOM   3780 N N   . ASP B 1 150 ? 57.637  74.563 29.335 1.00 55.93 ? 150  ASP B N   1 
ATOM   3781 C CA  . ASP B 1 150 ? 56.401  73.747 29.449 1.00 56.07 ? 150  ASP B CA  1 
ATOM   3782 C C   . ASP B 1 150 ? 56.669  72.517 30.237 1.00 56.06 ? 150  ASP B C   1 
ATOM   3783 O O   . ASP B 1 150 ? 56.129  72.379 31.326 1.00 56.60 ? 150  ASP B O   1 
ATOM   3784 C CB  . ASP B 1 150 ? 55.837  73.303 28.092 1.00 56.37 ? 150  ASP B CB  1 
ATOM   3785 C CG  . ASP B 1 150 ? 54.951  74.360 27.430 1.00 57.19 ? 150  ASP B CG  1 
ATOM   3786 O OD1 . ASP B 1 150 ? 54.604  74.107 26.247 1.00 57.20 ? 150  ASP B OD1 1 
ATOM   3787 O OD2 . ASP B 1 150 ? 54.598  75.461 27.976 1.00 56.84 ? 150  ASP B OD2 1 
ATOM   3788 N N   . GLN B 1 151 ? 57.457  71.593 29.682 1.00 56.14 ? 151  GLN B N   1 
ATOM   3789 C CA  . GLN B 1 151 ? 57.746  70.330 30.408 1.00 56.07 ? 151  GLN B CA  1 
ATOM   3790 C C   . GLN B 1 151 ? 59.225  69.950 30.326 1.00 56.08 ? 151  GLN B C   1 
ATOM   3791 O O   . GLN B 1 151 ? 60.035  70.544 29.578 1.00 55.69 ? 151  GLN B O   1 
ATOM   3792 C CB  . GLN B 1 151 ? 56.813  69.124 30.024 1.00 55.53 ? 151  GLN B CB  1 
ATOM   3793 C CG  . GLN B 1 151 ? 56.772  68.786 28.575 1.00 55.64 ? 151  GLN B CG  1 
ATOM   3794 C CD  . GLN B 1 151 ? 55.718  69.592 27.836 1.00 57.24 ? 151  GLN B CD  1 
ATOM   3795 O OE1 . GLN B 1 151 ? 55.542  69.449 26.591 1.00 57.60 ? 151  GLN B OE1 1 
ATOM   3796 N NE2 . GLN B 1 151 ? 55.000  70.460 28.587 1.00 57.60 ? 151  GLN B NE2 1 
ATOM   3797 N N   . ALA B 1 152 ? 59.534  68.938 31.135 1.00 56.13 ? 152  ALA B N   1 
ATOM   3798 C CA  . ALA B 1 152 ? 60.850  68.350 31.227 1.00 55.93 ? 152  ALA B CA  1 
ATOM   3799 C C   . ALA B 1 152 ? 61.119  67.360 30.083 1.00 55.95 ? 152  ALA B C   1 
ATOM   3800 O O   . ALA B 1 152 ? 60.859  66.122 30.187 1.00 55.81 ? 152  ALA B O   1 
ATOM   3801 C CB  . ALA B 1 152 ? 60.991  67.659 32.572 1.00 56.18 ? 152  ALA B CB  1 
ATOM   3802 N N   . LEU B 1 153 ? 61.632  67.912 28.989 1.00 55.53 ? 153  LEU B N   1 
ATOM   3803 C CA  . LEU B 1 153 ? 62.136  67.073 27.915 1.00 55.67 ? 153  LEU B CA  1 
ATOM   3804 C C   . LEU B 1 153 ? 62.997  67.898 26.997 1.00 55.74 ? 153  LEU B C   1 
ATOM   3805 O O   . LEU B 1 153 ? 62.894  69.145 26.996 1.00 55.88 ? 153  LEU B O   1 
ATOM   3806 C CB  . LEU B 1 153 ? 61.016  66.406 27.153 1.00 55.34 ? 153  LEU B CB  1 
ATOM   3807 C CG  . LEU B 1 153 ? 60.000  67.319 26.525 1.00 55.63 ? 153  LEU B CG  1 
ATOM   3808 C CD1 . LEU B 1 153 ? 60.493  68.000 25.302 1.00 55.90 ? 153  LEU B CD1 1 
ATOM   3809 C CD2 . LEU B 1 153 ? 58.817  66.449 26.166 1.00 55.96 ? 153  LEU B CD2 1 
ATOM   3810 N N   . PHE B 1 154 ? 63.864  67.211 26.251 1.00 55.43 ? 154  PHE B N   1 
ATOM   3811 C CA  . PHE B 1 154 ? 64.663  67.878 25.248 1.00 55.53 ? 154  PHE B CA  1 
ATOM   3812 C C   . PHE B 1 154 ? 64.671  67.100 23.920 1.00 55.57 ? 154  PHE B C   1 
ATOM   3813 O O   . PHE B 1 154 ? 64.556  65.891 23.919 1.00 55.94 ? 154  PHE B O   1 
ATOM   3814 C CB  . PHE B 1 154 ? 66.065  68.121 25.787 1.00 55.44 ? 154  PHE B CB  1 
ATOM   3815 C CG  . PHE B 1 154 ? 66.818  66.876 26.148 1.00 55.43 ? 154  PHE B CG  1 
ATOM   3816 C CD1 . PHE B 1 154 ? 67.114  66.587 27.463 1.00 55.49 ? 154  PHE B CD1 1 
ATOM   3817 C CD2 . PHE B 1 154 ? 67.279  66.014 25.159 1.00 55.79 ? 154  PHE B CD2 1 
ATOM   3818 C CE1 . PHE B 1 154 ? 67.847  65.469 27.791 1.00 55.56 ? 154  PHE B CE1 1 
ATOM   3819 C CE2 . PHE B 1 154 ? 67.995  64.898 25.484 1.00 55.23 ? 154  PHE B CE2 1 
ATOM   3820 C CZ  . PHE B 1 154 ? 68.282  64.622 26.810 1.00 55.36 ? 154  PHE B CZ  1 
ATOM   3821 N N   . THR B 1 155 ? 64.802  67.778 22.790 1.00 55.37 ? 155  THR B N   1 
ATOM   3822 C CA  . THR B 1 155 ? 64.821  67.062 21.540 1.00 55.34 ? 155  THR B CA  1 
ATOM   3823 C C   . THR B 1 155 ? 66.062  67.338 20.773 1.00 55.20 ? 155  THR B C   1 
ATOM   3824 O O   . THR B 1 155 ? 66.584  68.472 20.724 1.00 54.67 ? 155  THR B O   1 
ATOM   3825 C CB  . THR B 1 155 ? 63.590  67.368 20.667 1.00 55.88 ? 155  THR B CB  1 
ATOM   3826 O OG1 . THR B 1 155 ? 63.499  68.758 20.242 1.00 56.07 ? 155  THR B OG1 1 
ATOM   3827 C CG2 . THR B 1 155 ? 62.354  67.116 21.440 1.00 56.27 ? 155  THR B CG2 1 
ATOM   3828 N N   . PHE B 1 156 ? 66.530  66.265 20.162 1.00 55.27 ? 156  PHE B N   1 
ATOM   3829 C CA  . PHE B 1 156 ? 67.724  66.316 19.365 1.00 55.37 ? 156  PHE B CA  1 
ATOM   3830 C C   . PHE B 1 156 ? 67.369  66.142 17.940 1.00 55.17 ? 156  PHE B C   1 
ATOM   3831 O O   . PHE B 1 156 ? 66.935  65.078 17.536 1.00 55.42 ? 156  PHE B O   1 
ATOM   3832 C CB  . PHE B 1 156 ? 68.735  65.263 19.820 1.00 55.32 ? 156  PHE B CB  1 
ATOM   3833 C CG  . PHE B 1 156 ? 69.824  65.841 20.688 1.00 55.07 ? 156  PHE B CG  1 
ATOM   3834 C CD1 . PHE B 1 156 ? 69.811  65.694 22.050 1.00 54.41 ? 156  PHE B CD1 1 
ATOM   3835 C CD2 . PHE B 1 156 ? 70.837  66.590 20.126 1.00 54.95 ? 156  PHE B CD2 1 
ATOM   3836 C CE1 . PHE B 1 156 ? 70.810  66.246 22.825 1.00 54.98 ? 156  PHE B CE1 1 
ATOM   3837 C CE2 . PHE B 1 156 ? 71.815  67.141 20.900 1.00 55.17 ? 156  PHE B CE2 1 
ATOM   3838 C CZ  . PHE B 1 156 ? 71.795  66.968 22.254 1.00 55.37 ? 156  PHE B CZ  1 
ATOM   3839 N N   . TYR B 1 157 ? 67.496  67.254 17.166 1.00 55.37 ? 157  TYR B N   1 
ATOM   3840 C CA  . TYR B 1 157 ? 67.183  67.180 15.752 1.00 55.67 ? 157  TYR B CA  1 
ATOM   3841 C C   . TYR B 1 157 ? 68.481  67.312 14.960 1.00 55.77 ? 157  TYR B C   1 
ATOM   3842 O O   . TYR B 1 157 ? 69.221  68.286 15.047 1.00 54.71 ? 157  TYR B O   1 
ATOM   3843 C CB  . TYR B 1 157 ? 66.160  68.239 15.323 1.00 55.57 ? 157  TYR B CB  1 
ATOM   3844 C CG  . TYR B 1 157 ? 66.122  68.385 13.828 1.00 55.49 ? 157  TYR B CG  1 
ATOM   3845 C CD1 . TYR B 1 157 ? 65.881  67.295 13.031 1.00 54.69 ? 157  TYR B CD1 1 
ATOM   3846 C CD2 . TYR B 1 157 ? 66.358  69.609 13.229 1.00 56.06 ? 157  TYR B CD2 1 
ATOM   3847 C CE1 . TYR B 1 157 ? 65.900  67.420 11.645 1.00 54.54 ? 157  TYR B CE1 1 
ATOM   3848 C CE2 . TYR B 1 157 ? 66.391  69.740 11.869 1.00 55.20 ? 157  TYR B CE2 1 
ATOM   3849 C CZ  . TYR B 1 157 ? 66.179  68.657 11.068 1.00 54.50 ? 157  TYR B CZ  1 
ATOM   3850 O OH  . TYR B 1 157 ? 66.227  68.794 9.698  1.00 55.16 ? 157  TYR B OH  1 
ATOM   3851 N N   . LEU B 1 158 ? 68.710  66.259 14.169 1.00 56.26 ? 158  LEU B N   1 
ATOM   3852 C CA  . LEU B 1 158 ? 69.908  66.132 13.374 1.00 56.06 ? 158  LEU B CA  1 
ATOM   3853 C C   . LEU B 1 158 ? 69.772  65.939 11.869 1.00 55.89 ? 158  LEU B C   1 
ATOM   3854 O O   . LEU B 1 158 ? 68.922  65.228 11.325 1.00 55.37 ? 158  LEU B O   1 
ATOM   3855 C CB  . LEU B 1 158 ? 70.806  65.063 13.985 1.00 55.88 ? 158  LEU B CB  1 
ATOM   3856 C CG  . LEU B 1 158 ? 71.798  65.603 15.018 1.00 55.35 ? 158  LEU B CG  1 
ATOM   3857 C CD1 . LEU B 1 158 ? 72.649  64.472 15.573 1.00 55.03 ? 158  LEU B CD1 1 
ATOM   3858 C CD2 . LEU B 1 158 ? 72.678  66.684 14.418 1.00 54.84 ? 158  LEU B CD2 1 
ATOM   3859 N N   . PRO B 1 159 ? 70.652  66.598 11.122 1.00 56.02 ? 159  PRO B N   1 
ATOM   3860 C CA  . PRO B 1 159 ? 70.440  66.714 9.670  1.00 56.23 ? 159  PRO B CA  1 
ATOM   3861 C C   . PRO B 1 159 ? 71.413  65.884 8.823  1.00 56.60 ? 159  PRO B C   1 
ATOM   3862 O O   . PRO B 1 159 ? 71.052  64.842 8.274  1.00 56.67 ? 159  PRO B O   1 
ATOM   3863 C CB  . PRO B 1 159 ? 70.648  68.209 9.403  1.00 56.48 ? 159  PRO B CB  1 
ATOM   3864 C CG  . PRO B 1 159 ? 71.411  68.708 10.584 1.00 56.49 ? 159  PRO B CG  1 
ATOM   3865 C CD  . PRO B 1 159 ? 70.925  67.901 11.747 1.00 55.60 ? 159  PRO B CD  1 
ATOM   3866 N N   . VAL B 1 160 ? 72.643  66.373 8.736  1.00 56.70 ? 160  VAL B N   1 
ATOM   3867 C CA  . VAL B 1 160 ? 73.629  65.971 7.778  1.00 56.75 ? 160  VAL B CA  1 
ATOM   3868 C C   . VAL B 1 160 ? 74.693  67.099 7.844  1.00 57.08 ? 160  VAL B C   1 
ATOM   3869 O O   . VAL B 1 160 ? 74.796  67.767 8.881  1.00 57.18 ? 160  VAL B O   1 
ATOM   3870 C CB  . VAL B 1 160 ? 72.981  65.911 6.372  1.00 56.85 ? 160  VAL B CB  1 
ATOM   3871 C CG1 . VAL B 1 160 ? 73.185  64.547 5.737  1.00 56.46 ? 160  VAL B CG1 1 
ATOM   3872 C CG2 . VAL B 1 160 ? 71.500  66.224 6.454  1.00 56.44 ? 160  VAL B CG2 1 
ATOM   3873 N N   . HIS B 1 161 ? 75.471  67.290 6.784  1.00 57.18 ? 161  HIS B N   1 
ATOM   3874 C CA  . HIS B 1 161 ? 76.602  68.212 6.854  1.00 56.82 ? 161  HIS B CA  1 
ATOM   3875 C C   . HIS B 1 161 ? 76.452  69.551 6.145  1.00 56.75 ? 161  HIS B C   1 
ATOM   3876 O O   . HIS B 1 161 ? 75.762  70.449 6.631  1.00 56.20 ? 161  HIS B O   1 
ATOM   3877 C CB  . HIS B 1 161 ? 77.892  67.543 6.377  1.00 56.83 ? 161  HIS B CB  1 
ATOM   3878 C CG  . HIS B 1 161 ? 79.085  68.448 6.414  1.00 58.11 ? 161  HIS B CG  1 
ATOM   3879 N ND1 . HIS B 1 161 ? 80.306  68.095 5.884  1.00 58.29 ? 161  HIS B ND1 1 
ATOM   3880 C CD2 . HIS B 1 161 ? 79.241  69.695 6.920  1.00 58.76 ? 161  HIS B CD2 1 
ATOM   3881 C CE1 . HIS B 1 161 ? 81.164  69.085 6.061  1.00 57.76 ? 161  HIS B CE1 1 
ATOM   3882 N NE2 . HIS B 1 161 ? 80.543  70.068 6.688  1.00 58.03 ? 161  HIS B NE2 1 
ATOM   3883 N N   . ASP B 1 162 ? 77.109  69.683 4.997  1.00 57.13 ? 162  ASP B N   1 
ATOM   3884 C CA  . ASP B 1 162 ? 76.842  70.758 4.050  1.00 57.30 ? 162  ASP B CA  1 
ATOM   3885 C C   . ASP B 1 162 ? 75.369  71.148 4.066  1.00 57.26 ? 162  ASP B C   1 
ATOM   3886 O O   . ASP B 1 162 ? 75.016  72.291 3.779  1.00 57.92 ? 162  ASP B O   1 
ATOM   3887 C CB  . ASP B 1 162 ? 77.259  70.340 2.638  1.00 57.09 ? 162  ASP B CB  1 
ATOM   3888 C CG  . ASP B 1 162 ? 78.425  71.152 2.110  1.00 56.88 ? 162  ASP B CG  1 
ATOM   3889 O OD1 . ASP B 1 162 ? 79.364  71.424 2.888  1.00 57.10 ? 162  ASP B OD1 1 
ATOM   3890 O OD2 . ASP B 1 162 ? 78.491  71.560 0.932  1.00 57.26 ? 162  ASP B OD2 1 
ATOM   3891 N N   . LYS B 1 163 ? 74.513  70.190 4.406  1.00 57.32 ? 163  LYS B N   1 
ATOM   3892 C CA  . LYS B 1 163 ? 73.074  70.353 4.250  1.00 57.31 ? 163  LYS B CA  1 
ATOM   3893 C C   . LYS B 1 163 ? 72.549  71.520 5.081  1.00 57.66 ? 163  LYS B C   1 
ATOM   3894 O O   . LYS B 1 163 ? 72.084  72.522 4.538  1.00 57.41 ? 163  LYS B O   1 
ATOM   3895 C CB  . LYS B 1 163 ? 72.344  69.063 4.629  1.00 57.24 ? 163  LYS B CB  1 
ATOM   3896 C CG  . LYS B 1 163 ? 72.973  67.804 4.055  1.00 57.31 ? 163  LYS B CG  1 
ATOM   3897 C CD  . LYS B 1 163 ? 72.207  67.309 2.839  1.00 57.10 ? 163  LYS B CD  1 
ATOM   3898 C CE  . LYS B 1 163 ? 72.995  66.253 2.081  1.00 57.12 ? 163  LYS B CE  1 
ATOM   3899 N NZ  . LYS B 1 163 ? 72.132  65.124 1.639  1.00 56.90 ? 163  LYS B NZ  1 
ATOM   3900 N N   . HIS B 1 164 ? 72.626  71.385 6.402  1.00 57.48 ? 164  HIS B N   1 
ATOM   3901 C CA  . HIS B 1 164 ? 71.898  72.268 7.305  1.00 57.30 ? 164  HIS B CA  1 
ATOM   3902 C C   . HIS B 1 164 ? 72.481  72.233 8.714  1.00 56.86 ? 164  HIS B C   1 
ATOM   3903 O O   . HIS B 1 164 ? 73.695  72.127 8.890  1.00 56.93 ? 164  HIS B O   1 
ATOM   3904 C CB  . HIS B 1 164 ? 70.415  71.892 7.341  1.00 57.51 ? 164  HIS B CB  1 
ATOM   3905 C CG  . HIS B 1 164 ? 69.641  72.379 6.155  1.00 57.90 ? 164  HIS B CG  1 
ATOM   3906 N ND1 . HIS B 1 164 ? 69.163  73.669 6.057  1.00 58.30 ? 164  HIS B ND1 1 
ATOM   3907 C CD2 . HIS B 1 164 ? 69.261  71.749 5.019  1.00 56.99 ? 164  HIS B CD2 1 
ATOM   3908 C CE1 . HIS B 1 164 ? 68.523  73.812 4.910  1.00 57.99 ? 164  HIS B CE1 1 
ATOM   3909 N NE2 . HIS B 1 164 ? 68.568  72.662 4.262  1.00 58.41 ? 164  HIS B NE2 1 
ATOM   3910 N N   . SER B 1 165 ? 71.610  72.325 9.713  1.00 56.21 ? 165  SER B N   1 
ATOM   3911 C CA  . SER B 1 165 ? 72.031  72.687 11.061 1.00 56.20 ? 165  SER B CA  1 
ATOM   3912 C C   . SER B 1 165 ? 71.310  71.872 12.131 1.00 55.93 ? 165  SER B C   1 
ATOM   3913 O O   . SER B 1 165 ? 70.111  71.617 12.033 1.00 54.79 ? 165  SER B O   1 
ATOM   3914 C CB  . SER B 1 165 ? 71.829  74.184 11.308 1.00 56.18 ? 165  SER B CB  1 
ATOM   3915 O OG  . SER B 1 165 ? 72.959  74.750 11.949 1.00 56.49 ? 165  SER B OG  1 
ATOM   3916 N N   . GLY B 1 166 ? 72.059  71.469 13.152 1.00 56.30 ? 166  GLY B N   1 
ATOM   3917 C CA  . GLY B 1 166 ? 71.530  70.682 14.245 1.00 56.33 ? 166  GLY B CA  1 
ATOM   3918 C C   . GLY B 1 166 ? 70.663  71.532 15.147 1.00 56.34 ? 166  GLY B C   1 
ATOM   3919 O O   . GLY B 1 166 ? 70.775  72.762 15.177 1.00 55.89 ? 166  GLY B O   1 
ATOM   3920 N N   . TYR B 1 167 ? 69.771  70.876 15.890 1.00 55.77 ? 167  TYR B N   1 
ATOM   3921 C CA  . TYR B 1 167 ? 68.855  71.646 16.729 1.00 55.20 ? 167  TYR B CA  1 
ATOM   3922 C C   . TYR B 1 167 ? 68.416  70.940 17.975 1.00 55.14 ? 167  TYR B C   1 
ATOM   3923 O O   . TYR B 1 167 ? 67.673  69.952 17.938 1.00 55.49 ? 167  TYR B O   1 
ATOM   3924 C CB  . TYR B 1 167 ? 67.601  71.998 15.949 1.00 55.05 ? 167  TYR B CB  1 
ATOM   3925 C CG  . TYR B 1 167 ? 67.811  73.189 15.080 1.00 54.84 ? 167  TYR B CG  1 
ATOM   3926 C CD1 . TYR B 1 167 ? 67.513  73.136 13.744 1.00 55.16 ? 167  TYR B CD1 1 
ATOM   3927 C CD2 . TYR B 1 167 ? 68.330  74.358 15.619 1.00 54.18 ? 167  TYR B CD2 1 
ATOM   3928 C CE1 . TYR B 1 167 ? 67.721  74.211 12.949 1.00 55.33 ? 167  TYR B CE1 1 
ATOM   3929 C CE2 . TYR B 1 167 ? 68.545  75.465 14.802 1.00 54.21 ? 167  TYR B CE2 1 
ATOM   3930 C CZ  . TYR B 1 167 ? 68.224  75.347 13.461 1.00 54.65 ? 167  TYR B CZ  1 
ATOM   3931 O OH  . TYR B 1 167 ? 68.459  76.426 12.633 1.00 54.63 ? 167  TYR B OH  1 
ATOM   3932 N N   . LEU B 1 168 ? 68.881  71.480 19.090 1.00 55.04 ? 168  LEU B N   1 
ATOM   3933 C CA  . LEU B 1 168 ? 68.489  71.014 20.385 1.00 54.95 ? 168  LEU B CA  1 
ATOM   3934 C C   . LEU B 1 168 ? 67.355  71.841 20.856 1.00 54.87 ? 168  LEU B C   1 
ATOM   3935 O O   . LEU B 1 168 ? 67.520  73.036 21.029 1.00 54.57 ? 168  LEU B O   1 
ATOM   3936 C CB  . LEU B 1 168 ? 69.612  71.239 21.362 1.00 55.16 ? 168  LEU B CB  1 
ATOM   3937 C CG  . LEU B 1 168 ? 69.147  71.326 22.830 1.00 55.54 ? 168  LEU B CG  1 
ATOM   3938 C CD1 . LEU B 1 168 ? 68.452  70.015 23.304 1.00 55.76 ? 168  LEU B CD1 1 
ATOM   3939 C CD2 . LEU B 1 168 ? 70.323  71.629 23.710 1.00 55.08 ? 168  LEU B CD2 1 
ATOM   3940 N N   . THR B 1 169 ? 66.217  71.225 21.120 1.00 55.25 ? 169  THR B N   1 
ATOM   3941 C CA  . THR B 1 169 ? 65.059  71.971 21.624 1.00 55.14 ? 169  THR B CA  1 
ATOM   3942 C C   . THR B 1 169 ? 64.657  71.527 22.998 1.00 54.99 ? 169  THR B C   1 
ATOM   3943 O O   . THR B 1 169 ? 64.398  70.351 23.220 1.00 55.03 ? 169  THR B O   1 
ATOM   3944 C CB  . THR B 1 169 ? 63.866  71.730 20.743 1.00 55.36 ? 169  THR B CB  1 
ATOM   3945 O OG1 . THR B 1 169 ? 64.127  72.193 19.421 1.00 55.86 ? 169  THR B OG1 1 
ATOM   3946 C CG2 . THR B 1 169 ? 62.700  72.573 21.212 1.00 55.51 ? 169  THR B CG2 1 
ATOM   3947 N N   . ILE B 1 170 ? 64.501  72.479 23.902 1.00 55.15 ? 170  ILE B N   1 
ATOM   3948 C CA  . ILE B 1 170 ? 64.015  72.193 25.267 1.00 55.12 ? 170  ILE B CA  1 
ATOM   3949 C C   . ILE B 1 170 ? 62.573  72.752 25.570 1.00 55.22 ? 170  ILE B C   1 
ATOM   3950 O O   . ILE B 1 170 ? 62.235  73.944 25.347 1.00 54.25 ? 170  ILE B O   1 
ATOM   3951 C CB  . ILE B 1 170 ? 64.954  72.770 26.250 1.00 54.74 ? 170  ILE B CB  1 
ATOM   3952 C CG1 . ILE B 1 170 ? 66.366  72.739 25.729 1.00 54.64 ? 170  ILE B CG1 1 
ATOM   3953 C CG2 . ILE B 1 170 ? 64.836  72.031 27.487 1.00 55.62 ? 170  ILE B CG2 1 
ATOM   3954 C CD1 . ILE B 1 170 ? 67.329  73.382 26.663 1.00 55.14 ? 170  ILE B CD1 1 
ATOM   3955 N N   . GLY B 1 171 ? 61.722  71.864 26.051 1.00 55.25 ? 171  GLY B N   1 
ATOM   3956 C CA  . GLY B 1 171 ? 60.359  72.235 26.358 1.00 55.67 ? 171  GLY B CA  1 
ATOM   3957 C C   . GLY B 1 171 ? 59.236  71.753 25.438 1.00 55.81 ? 171  GLY B C   1 
ATOM   3958 O O   . GLY B 1 171 ? 58.036  71.931 25.803 1.00 55.65 ? 171  GLY B O   1 
ATOM   3959 N N   . GLY B 1 172 ? 59.573  71.204 24.262 1.00 55.23 ? 172  GLY B N   1 
ATOM   3960 C CA  . GLY B 1 172 ? 58.524  70.740 23.375 1.00 55.56 ? 172  GLY B CA  1 
ATOM   3961 C C   . GLY B 1 172 ? 58.867  70.025 22.077 1.00 55.91 ? 172  GLY B C   1 
ATOM   3962 O O   . GLY B 1 172 ? 59.911  70.244 21.460 1.00 56.69 ? 172  GLY B O   1 
ATOM   3963 N N   . ILE B 1 173 ? 57.957  69.156 21.651 1.00 55.73 ? 173  ILE B N   1 
ATOM   3964 C CA  . ILE B 1 173 ? 58.050  68.526 20.361 1.00 55.41 ? 173  ILE B CA  1 
ATOM   3965 C C   . ILE B 1 173 ? 57.661  69.569 19.309 1.00 55.35 ? 173  ILE B C   1 
ATOM   3966 O O   . ILE B 1 173 ? 56.592  70.168 19.374 1.00 55.36 ? 173  ILE B O   1 
ATOM   3967 C CB  . ILE B 1 173 ? 57.108  67.283 20.252 1.00 55.33 ? 173  ILE B CB  1 
ATOM   3968 C CG1 . ILE B 1 173 ? 57.570  66.145 21.103 1.00 54.49 ? 173  ILE B CG1 1 
ATOM   3969 C CG2 . ILE B 1 173 ? 57.101  66.747 18.817 1.00 56.06 ? 173  ILE B CG2 1 
ATOM   3970 C CD1 . ILE B 1 173 ? 57.472  66.419 22.483 1.00 55.14 ? 173  ILE B CD1 1 
ATOM   3971 N N   . GLU B 1 174 ? 58.529  69.758 18.337 1.00 55.20 ? 174  GLU B N   1 
ATOM   3972 C CA  . GLU B 1 174 ? 58.233  70.602 17.229 1.00 55.47 ? 174  GLU B CA  1 
ATOM   3973 C C   . GLU B 1 174 ? 58.131  69.745 15.999 1.00 55.35 ? 174  GLU B C   1 
ATOM   3974 O O   . GLU B 1 174 ? 59.087  69.130 15.586 1.00 55.12 ? 174  GLU B O   1 
ATOM   3975 C CB  . GLU B 1 174 ? 59.359  71.582 17.080 1.00 55.77 ? 174  GLU B CB  1 
ATOM   3976 C CG  . GLU B 1 174 ? 59.560  72.516 18.264 1.00 56.04 ? 174  GLU B CG  1 
ATOM   3977 C CD  . GLU B 1 174 ? 58.942  73.856 17.994 1.00 56.78 ? 174  GLU B CD  1 
ATOM   3978 O OE1 . GLU B 1 174 ? 57.688  73.925 18.062 1.00 57.60 ? 174  GLU B OE1 1 
ATOM   3979 O OE2 . GLU B 1 174 ? 59.711  74.801 17.657 1.00 56.21 ? 174  GLU B OE2 1 
ATOM   3980 N N   . GLU B 1 175 ? 56.955  69.692 15.413 1.00 55.54 ? 175  GLU B N   1 
ATOM   3981 C CA  . GLU B 1 175 ? 56.728  68.798 14.281 1.00 55.50 ? 175  GLU B CA  1 
ATOM   3982 C C   . GLU B 1 175 ? 57.538  69.216 13.028 1.00 55.49 ? 175  GLU B C   1 
ATOM   3983 O O   . GLU B 1 175 ? 57.832  68.394 12.112 1.00 54.78 ? 175  GLU B O   1 
ATOM   3984 C CB  . GLU B 1 175 ? 55.248  68.739 13.968 1.00 55.44 ? 175  GLU B CB  1 
ATOM   3985 C CG  . GLU B 1 175 ? 54.365  68.487 15.154 1.00 55.06 ? 175  GLU B CG  1 
ATOM   3986 C CD  . GLU B 1 175 ? 52.929  68.397 14.721 1.00 55.39 ? 175  GLU B CD  1 
ATOM   3987 O OE1 . GLU B 1 175 ? 52.607  67.541 13.872 1.00 55.16 ? 175  GLU B OE1 1 
ATOM   3988 O OE2 . GLU B 1 175 ? 52.115  69.183 15.228 1.00 56.39 ? 175  GLU B OE2 1 
ATOM   3989 N N   . LYS B 1 176 ? 57.901  70.494 13.011 1.00 55.09 ? 176  LYS B N   1 
ATOM   3990 C CA  . LYS B 1 176 ? 58.816  70.995 12.029 1.00 55.20 ? 176  LYS B CA  1 
ATOM   3991 C C   . LYS B 1 176 ? 60.008  70.127 11.851 1.00 55.60 ? 176  LYS B C   1 
ATOM   3992 O O   . LYS B 1 176 ? 60.809  70.421 10.993 1.00 56.43 ? 176  LYS B O   1 
ATOM   3993 C CB  . LYS B 1 176 ? 59.329  72.364 12.417 1.00 54.94 ? 176  LYS B CB  1 
ATOM   3994 C CG  . LYS B 1 176 ? 59.229  72.659 13.872 1.00 55.53 ? 176  LYS B CG  1 
ATOM   3995 C CD  . LYS B 1 176 ? 59.926  73.979 14.345 1.00 55.57 ? 176  LYS B CD  1 
ATOM   3996 C CE  . LYS B 1 176 ? 59.928  75.099 13.345 1.00 54.95 ? 176  LYS B CE  1 
ATOM   3997 N NZ  . LYS B 1 176 ? 61.092  74.769 12.452 1.00 55.89 ? 176  LYS B NZ  1 
ATOM   3998 N N   . PHE B 1 177 ? 60.177  69.090 12.677 1.00 55.97 ? 177  PHE B N   1 
ATOM   3999 C CA  . PHE B 1 177 ? 61.401  68.283 12.678 1.00 55.52 ? 177  PHE B CA  1 
ATOM   4000 C C   . PHE B 1 177 ? 61.263  66.850 12.195 1.00 55.67 ? 177  PHE B C   1 
ATOM   4001 O O   . PHE B 1 177 ? 62.240  66.247 11.774 1.00 55.55 ? 177  PHE B O   1 
ATOM   4002 C CB  . PHE B 1 177 ? 61.995  68.246 14.083 1.00 55.40 ? 177  PHE B CB  1 
ATOM   4003 C CG  . PHE B 1 177 ? 62.508  69.570 14.593 1.00 54.71 ? 177  PHE B CG  1 
ATOM   4004 C CD1 . PHE B 1 177 ? 62.371  69.916 15.903 1.00 54.88 ? 177  PHE B CD1 1 
ATOM   4005 C CD2 . PHE B 1 177 ? 63.151  70.438 13.788 1.00 55.67 ? 177  PHE B CD2 1 
ATOM   4006 C CE1 . PHE B 1 177 ? 62.837  71.119 16.371 1.00 55.32 ? 177  PHE B CE1 1 
ATOM   4007 C CE2 . PHE B 1 177 ? 63.613  71.653 14.264 1.00 55.27 ? 177  PHE B CE2 1 
ATOM   4008 C CZ  . PHE B 1 177 ? 63.443  71.988 15.538 1.00 54.92 ? 177  PHE B CZ  1 
ATOM   4009 N N   . TYR B 1 178 ? 60.078  66.270 12.257 1.00 55.90 ? 178  TYR B N   1 
ATOM   4010 C CA  . TYR B 1 178 ? 59.974  64.844 11.940 1.00 55.79 ? 178  TYR B CA  1 
ATOM   4011 C C   . TYR B 1 178 ? 58.855  64.470 10.950 1.00 55.72 ? 178  TYR B C   1 
ATOM   4012 O O   . TYR B 1 178 ? 57.952  65.263 10.646 1.00 55.62 ? 178  TYR B O   1 
ATOM   4013 C CB  . TYR B 1 178 ? 59.831  64.064 13.230 1.00 55.49 ? 178  TYR B CB  1 
ATOM   4014 C CG  . TYR B 1 178 ? 58.597  64.421 13.993 1.00 55.81 ? 178  TYR B CG  1 
ATOM   4015 C CD1 . TYR B 1 178 ? 57.474  63.613 13.944 1.00 56.07 ? 178  TYR B CD1 1 
ATOM   4016 C CD2 . TYR B 1 178 ? 58.527  65.581 14.758 1.00 56.49 ? 178  TYR B CD2 1 
ATOM   4017 C CE1 . TYR B 1 178 ? 56.308  63.932 14.653 1.00 55.54 ? 178  TYR B CE1 1 
ATOM   4018 C CE2 . TYR B 1 178 ? 57.360  65.899 15.505 1.00 56.28 ? 178  TYR B CE2 1 
ATOM   4019 C CZ  . TYR B 1 178 ? 56.263  65.060 15.436 1.00 55.71 ? 178  TYR B CZ  1 
ATOM   4020 O OH  . TYR B 1 178 ? 55.105  65.296 16.138 1.00 55.55 ? 178  TYR B OH  1 
ATOM   4021 N N   . GLU B 1 179 ? 58.948  63.245 10.451 1.00 55.57 ? 179  GLU B N   1 
ATOM   4022 C CA  . GLU B 1 179 ? 57.946  62.663 9.575  1.00 55.93 ? 179  GLU B CA  1 
ATOM   4023 C C   . GLU B 1 179 ? 57.403  61.338 10.093 1.00 56.18 ? 179  GLU B C   1 
ATOM   4024 O O   . GLU B 1 179 ? 58.163  60.493 10.639 1.00 56.80 ? 179  GLU B O   1 
ATOM   4025 C CB  . GLU B 1 179 ? 58.578  62.396 8.242  1.00 56.00 ? 179  GLU B CB  1 
ATOM   4026 C CG  . GLU B 1 179 ? 58.958  63.670 7.535  1.00 56.46 ? 179  GLU B CG  1 
ATOM   4027 C CD  . GLU B 1 179 ? 59.611  63.398 6.185  1.00 56.77 ? 179  GLU B CD  1 
ATOM   4028 O OE1 . GLU B 1 179 ? 59.972  64.442 5.593  1.00 57.08 ? 179  GLU B OE1 1 
ATOM   4029 O OE2 . GLU B 1 179 ? 59.780  62.190 5.728  1.00 56.26 ? 179  GLU B OE2 1 
ATOM   4030 N N   . GLY B 1 180 ? 56.104  61.131 9.905  1.00 55.91 ? 180  GLY B N   1 
ATOM   4031 C CA  . GLY B 1 180 ? 55.465  59.979 10.489 1.00 55.92 ? 180  GLY B CA  1 
ATOM   4032 C C   . GLY B 1 180 ? 55.003  60.336 11.901 1.00 55.93 ? 180  GLY B C   1 
ATOM   4033 O O   . GLY B 1 180 ? 54.945  61.530 12.328 1.00 54.33 ? 180  GLY B O   1 
ATOM   4034 N N   . GLU B 1 181 ? 54.661  59.257 12.603 1.00 56.50 ? 181  GLU B N   1 
ATOM   4035 C CA  . GLU B 1 181 ? 54.177  59.309 13.971 1.00 56.82 ? 181  GLU B CA  1 
ATOM   4036 C C   . GLU B 1 181 ? 55.338  58.791 14.934 1.00 56.68 ? 181  GLU B C   1 
ATOM   4037 O O   . GLU B 1 181 ? 56.143  57.907 14.549 1.00 56.61 ? 181  GLU B O   1 
ATOM   4038 C CB  . GLU B 1 181 ? 52.850  58.493 14.065 1.00 56.84 ? 181  GLU B CB  1 
ATOM   4039 C CG  . GLU B 1 181 ? 53.077  56.970 14.015 1.00 57.54 ? 181  GLU B CG  1 
ATOM   4040 C CD  . GLU B 1 181 ? 51.872  56.106 14.408 1.00 58.17 ? 181  GLU B CD  1 
ATOM   4041 O OE1 . GLU B 1 181 ? 51.287  56.238 15.549 1.00 58.19 ? 181  GLU B OE1 1 
ATOM   4042 O OE2 . GLU B 1 181 ? 51.554  55.214 13.552 1.00 60.14 ? 181  GLU B OE2 1 
ATOM   4043 N N   . LEU B 1 182 ? 55.406  59.345 16.152 1.00 56.35 ? 182  LEU B N   1 
ATOM   4044 C CA  . LEU B 1 182 ? 56.471  58.990 17.102 1.00 56.27 ? 182  LEU B CA  1 
ATOM   4045 C C   . LEU B 1 182 ? 56.086  57.695 17.821 1.00 56.31 ? 182  LEU B C   1 
ATOM   4046 O O   . LEU B 1 182 ? 54.903  57.383 18.019 1.00 56.29 ? 182  LEU B O   1 
ATOM   4047 C CB  . LEU B 1 182 ? 56.738  60.056 18.189 1.00 56.13 ? 182  LEU B CB  1 
ATOM   4048 C CG  . LEU B 1 182 ? 57.094  61.470 17.773 1.00 55.95 ? 182  LEU B CG  1 
ATOM   4049 C CD1 . LEU B 1 182 ? 55.861  62.098 17.189 1.00 57.40 ? 182  LEU B CD1 1 
ATOM   4050 C CD2 . LEU B 1 182 ? 57.532  62.300 18.944 1.00 55.79 ? 182  LEU B CD2 1 
ATOM   4051 N N   . THR B 1 183 ? 57.121  56.957 18.195 1.00 56.14 ? 183  THR B N   1 
ATOM   4052 C CA  . THR B 1 183 ? 57.001  55.770 19.001 1.00 55.96 ? 183  THR B CA  1 
ATOM   4053 C C   . THR B 1 183 ? 57.924  56.052 20.168 1.00 56.39 ? 183  THR B C   1 
ATOM   4054 O O   . THR B 1 183 ? 58.846  56.882 20.052 1.00 57.02 ? 183  THR B O   1 
ATOM   4055 C CB  . THR B 1 183 ? 57.449  54.557 18.221 1.00 55.66 ? 183  THR B CB  1 
ATOM   4056 O OG1 . THR B 1 183 ? 58.501  54.924 17.279 1.00 55.48 ? 183  THR B OG1 1 
ATOM   4057 C CG2 . THR B 1 183 ? 56.299  54.071 17.386 1.00 55.59 ? 183  THR B CG2 1 
ATOM   4058 N N   . TYR B 1 184 ? 57.648  55.416 21.301 1.00 56.17 ? 184  TYR B N   1 
ATOM   4059 C CA  . TYR B 1 184 ? 58.431  55.641 22.465 1.00 55.54 ? 184  TYR B CA  1 
ATOM   4060 C C   . TYR B 1 184 ? 58.899  54.349 23.007 1.00 55.31 ? 184  TYR B C   1 
ATOM   4061 O O   . TYR B 1 184 ? 58.317  53.299 22.721 1.00 54.97 ? 184  TYR B O   1 
ATOM   4062 C CB  . TYR B 1 184 ? 57.603  56.307 23.508 1.00 55.72 ? 184  TYR B CB  1 
ATOM   4063 C CG  . TYR B 1 184 ? 57.078  57.649 23.123 1.00 55.50 ? 184  TYR B CG  1 
ATOM   4064 C CD1 . TYR B 1 184 ? 56.142  57.766 22.119 1.00 56.23 ? 184  TYR B CD1 1 
ATOM   4065 C CD2 . TYR B 1 184 ? 57.480  58.808 23.820 1.00 56.04 ? 184  TYR B CD2 1 
ATOM   4066 C CE1 . TYR B 1 184 ? 55.602  59.016 21.766 1.00 57.60 ? 184  TYR B CE1 1 
ATOM   4067 C CE2 . TYR B 1 184 ? 56.953  60.080 23.516 1.00 56.35 ? 184  TYR B CE2 1 
ATOM   4068 C CZ  . TYR B 1 184 ? 55.989  60.175 22.467 1.00 57.75 ? 184  TYR B CZ  1 
ATOM   4069 O OH  . TYR B 1 184 ? 55.378  61.364 22.055 1.00 57.12 ? 184  TYR B OH  1 
ATOM   4070 N N   . GLU B 1 185 ? 59.959  54.460 23.803 1.00 55.28 ? 185  GLU B N   1 
ATOM   4071 C CA  . GLU B 1 185 ? 60.487  53.362 24.565 1.00 55.05 ? 185  GLU B CA  1 
ATOM   4072 C C   . GLU B 1 185 ? 60.679  53.888 25.947 1.00 54.77 ? 185  GLU B C   1 
ATOM   4073 O O   . GLU B 1 185 ? 61.134  55.018 26.112 1.00 53.91 ? 185  GLU B O   1 
ATOM   4074 C CB  . GLU B 1 185 ? 61.824  52.940 24.000 1.00 55.37 ? 185  GLU B CB  1 
ATOM   4075 C CG  . GLU B 1 185 ? 61.828  52.538 22.535 1.00 55.27 ? 185  GLU B CG  1 
ATOM   4076 C CD  . GLU B 1 185 ? 60.893  51.413 22.275 1.00 55.34 ? 185  GLU B CD  1 
ATOM   4077 O OE1 . GLU B 1 185 ? 60.391  51.298 21.140 1.00 55.93 ? 185  GLU B OE1 1 
ATOM   4078 O OE2 . GLU B 1 185 ? 60.621  50.678 23.229 1.00 55.35 ? 185  GLU B OE2 1 
ATOM   4079 N N   . LYS B 1 186 ? 60.304  53.078 26.934 1.00 54.96 ? 186  LYS B N   1 
ATOM   4080 C CA  . LYS B 1 186 ? 60.511  53.461 28.313 1.00 55.27 ? 186  LYS B CA  1 
ATOM   4081 C C   . LYS B 1 186 ? 61.891  53.008 28.797 1.00 54.97 ? 186  LYS B C   1 
ATOM   4082 O O   . LYS B 1 186 ? 62.376  51.856 28.565 1.00 53.99 ? 186  LYS B O   1 
ATOM   4083 C CB  . LYS B 1 186 ? 59.420  52.906 29.224 1.00 55.53 ? 186  LYS B CB  1 
ATOM   4084 C CG  . LYS B 1 186 ? 58.188  53.774 29.395 1.00 56.23 ? 186  LYS B CG  1 
ATOM   4085 C CD  . LYS B 1 186 ? 57.176  53.210 30.483 1.00 56.48 ? 186  LYS B CD  1 
ATOM   4086 C CE  . LYS B 1 186 ? 55.812  54.059 30.600 1.00 56.72 ? 186  LYS B CE  1 
ATOM   4087 N NZ  . LYS B 1 186 ? 54.823  53.851 29.458 1.00 57.47 ? 186  LYS B NZ  1 
ATOM   4088 N N   . LEU B 1 187 ? 62.502  53.941 29.499 1.00 54.43 ? 187  LEU B N   1 
ATOM   4089 C CA  . LEU B 1 187 ? 63.801  53.712 29.965 1.00 54.65 ? 187  LEU B CA  1 
ATOM   4090 C C   . LEU B 1 187 ? 63.788  52.475 30.811 1.00 54.69 ? 187  LEU B C   1 
ATOM   4091 O O   . LEU B 1 187 ? 62.904  52.322 31.606 1.00 54.40 ? 187  LEU B O   1 
ATOM   4092 C CB  . LEU B 1 187 ? 64.239  54.898 30.770 1.00 54.54 ? 187  LEU B CB  1 
ATOM   4093 C CG  . LEU B 1 187 ? 64.233  56.155 29.935 1.00 54.96 ? 187  LEU B CG  1 
ATOM   4094 C CD1 . LEU B 1 187 ? 64.605  57.327 30.768 1.00 55.98 ? 187  LEU B CD1 1 
ATOM   4095 C CD2 . LEU B 1 187 ? 65.227  56.042 28.785 1.00 55.92 ? 187  LEU B CD2 1 
ATOM   4096 N N   . ASN B 1 188 ? 64.770  51.587 30.630 1.00 55.26 ? 188  ASN B N   1 
ATOM   4097 C CA  . ASN B 1 188 ? 64.987  50.432 31.542 1.00 54.76 ? 188  ASN B CA  1 
ATOM   4098 C C   . ASN B 1 188 ? 65.601  50.906 32.864 1.00 54.37 ? 188  ASN B C   1 
ATOM   4099 O O   . ASN B 1 188 ? 65.525  50.236 33.841 1.00 54.25 ? 188  ASN B O   1 
ATOM   4100 C CB  . ASN B 1 188 ? 65.738  49.259 30.862 1.00 54.35 ? 188  ASN B CB  1 
ATOM   4101 C CG  . ASN B 1 188 ? 67.141  49.596 30.432 1.00 54.36 ? 188  ASN B CG  1 
ATOM   4102 O OD1 . ASN B 1 188 ? 67.889  50.223 31.164 1.00 55.20 ? 188  ASN B OD1 1 
ATOM   4103 N ND2 . ASN B 1 188 ? 67.524  49.125 29.238 1.00 53.49 ? 188  ASN B ND2 1 
ATOM   4104 N N   . HIS B 1 189 ? 66.145  52.111 32.880 1.00 54.62 ? 189  HIS B N   1 
ATOM   4105 C CA  . HIS B 1 189 ? 66.707  52.740 34.067 1.00 54.98 ? 189  HIS B CA  1 
ATOM   4106 C C   . HIS B 1 189 ? 66.879  54.253 33.900 1.00 54.70 ? 189  HIS B C   1 
ATOM   4107 O O   . HIS B 1 189 ? 67.059  54.760 32.842 1.00 54.69 ? 189  HIS B O   1 
ATOM   4108 C CB  . HIS B 1 189 ? 68.118  52.205 34.372 1.00 55.40 ? 189  HIS B CB  1 
ATOM   4109 C CG  . HIS B 1 189 ? 68.168  50.787 34.831 1.00 55.49 ? 189  HIS B CG  1 
ATOM   4110 N ND1 . HIS B 1 189 ? 68.172  49.722 33.948 1.00 56.34 ? 189  HIS B ND1 1 
ATOM   4111 C CD2 . HIS B 1 189 ? 68.287  50.257 36.069 1.00 54.90 ? 189  HIS B CD2 1 
ATOM   4112 C CE1 . HIS B 1 189 ? 68.254  48.590 34.626 1.00 56.35 ? 189  HIS B CE1 1 
ATOM   4113 N NE2 . HIS B 1 189 ? 68.312  48.888 35.916 1.00 56.55 ? 189  HIS B NE2 1 
ATOM   4114 N N   . ASP B 1 190 ? 66.944  54.964 34.987 1.00 54.64 ? 190  ASP B N   1 
ATOM   4115 C CA  . ASP B 1 190 ? 67.102  56.376 34.915 1.00 54.88 ? 190  ASP B CA  1 
ATOM   4116 C C   . ASP B 1 190 ? 68.523  56.764 35.227 1.00 54.92 ? 190  ASP B C   1 
ATOM   4117 O O   . ASP B 1 190 ? 68.849  57.412 36.241 1.00 54.90 ? 190  ASP B O   1 
ATOM   4118 C CB  . ASP B 1 190 ? 66.173  56.994 35.902 1.00 55.27 ? 190  ASP B CB  1 
ATOM   4119 C CG  . ASP B 1 190 ? 64.754  56.738 35.569 1.00 56.16 ? 190  ASP B CG  1 
ATOM   4120 O OD1 . ASP B 1 190 ? 64.380  55.607 35.188 1.00 56.47 ? 190  ASP B OD1 1 
ATOM   4121 O OD2 . ASP B 1 190 ? 63.934  57.640 35.675 1.00 58.02 ? 190  ASP B OD2 1 
ATOM   4122 N N   . LEU B 1 191 ? 69.400  56.342 34.353 1.00 54.90 ? 191  LEU B N   1 
ATOM   4123 C CA  . LEU B 1 191 ? 70.760  56.708 34.524 1.00 54.90 ? 191  LEU B CA  1 
ATOM   4124 C C   . LEU B 1 191 ? 71.143  57.421 33.251 1.00 55.06 ? 191  LEU B C   1 
ATOM   4125 O O   . LEU B 1 191 ? 71.113  58.661 33.186 1.00 54.87 ? 191  LEU B O   1 
ATOM   4126 C CB  . LEU B 1 191 ? 71.549  55.450 34.770 1.00 54.62 ? 191  LEU B CB  1 
ATOM   4127 C CG  . LEU B 1 191 ? 72.917  55.662 35.308 1.00 54.33 ? 191  LEU B CG  1 
ATOM   4128 C CD1 . LEU B 1 191 ? 72.857  56.628 36.448 1.00 54.78 ? 191  LEU B CD1 1 
ATOM   4129 C CD2 . LEU B 1 191 ? 73.444  54.280 35.729 1.00 55.07 ? 191  LEU B CD2 1 
ATOM   4130 N N   . PHE B 1 192 ? 71.437  56.622 32.229 1.00 54.98 ? 192  PHE B N   1 
ATOM   4131 C CA  . PHE B 1 192 ? 71.613  57.099 30.898 1.00 55.11 ? 192  PHE B CA  1 
ATOM   4132 C C   . PHE B 1 192 ? 70.204  57.191 30.426 1.00 55.17 ? 192  PHE B C   1 
ATOM   4133 O O   . PHE B 1 192 ? 69.288  56.962 31.220 1.00 54.88 ? 192  PHE B O   1 
ATOM   4134 C CB  . PHE B 1 192 ? 72.376  56.092 30.021 1.00 55.14 ? 192  PHE B CB  1 
ATOM   4135 C CG  . PHE B 1 192 ? 73.775  55.881 30.446 1.00 54.98 ? 192  PHE B CG  1 
ATOM   4136 C CD1 . PHE B 1 192 ? 74.047  55.014 31.427 1.00 55.80 ? 192  PHE B CD1 1 
ATOM   4137 C CD2 . PHE B 1 192 ? 74.824  56.580 29.883 1.00 54.95 ? 192  PHE B CD2 1 
ATOM   4138 C CE1 . PHE B 1 192 ? 75.325  54.847 31.835 1.00 55.78 ? 192  PHE B CE1 1 
ATOM   4139 C CE2 . PHE B 1 192 ? 76.087  56.400 30.290 1.00 53.86 ? 192  PHE B CE2 1 
ATOM   4140 C CZ  . PHE B 1 192 ? 76.332  55.556 31.258 1.00 54.54 ? 192  PHE B CZ  1 
ATOM   4141 N N   . TRP B 1 193 ? 70.029  57.497 29.140 1.00 55.18 ? 193  TRP B N   1 
ATOM   4142 C CA  . TRP B 1 193 ? 68.750  57.312 28.525 1.00 55.12 ? 193  TRP B CA  1 
ATOM   4143 C C   . TRP B 1 193 ? 68.744  55.895 27.946 1.00 55.17 ? 193  TRP B C   1 
ATOM   4144 O O   . TRP B 1 193 ? 68.750  55.685 26.770 1.00 55.66 ? 193  TRP B O   1 
ATOM   4145 C CB  . TRP B 1 193 ? 68.521  58.381 27.497 1.00 55.04 ? 193  TRP B CB  1 
ATOM   4146 C CG  . TRP B 1 193 ? 68.353  59.643 28.117 1.00 54.75 ? 193  TRP B CG  1 
ATOM   4147 C CD1 . TRP B 1 193 ? 69.325  60.507 28.476 1.00 55.10 ? 193  TRP B CD1 1 
ATOM   4148 C CD2 . TRP B 1 193 ? 67.115  60.237 28.502 1.00 55.71 ? 193  TRP B CD2 1 
ATOM   4149 N NE1 . TRP B 1 193 ? 68.776  61.624 29.067 1.00 55.36 ? 193  TRP B NE1 1 
ATOM   4150 C CE2 . TRP B 1 193 ? 67.412  61.473 29.106 1.00 55.94 ? 193  TRP B CE2 1 
ATOM   4151 C CE3 . TRP B 1 193 ? 65.765  59.849 28.398 1.00 55.47 ? 193  TRP B CE3 1 
ATOM   4152 C CZ2 . TRP B 1 193 ? 66.416  62.318 29.602 1.00 55.20 ? 193  TRP B CZ2 1 
ATOM   4153 C CZ3 . TRP B 1 193 ? 64.793  60.680 28.879 1.00 54.83 ? 193  TRP B CZ3 1 
ATOM   4154 C CH2 . TRP B 1 193 ? 65.123  61.905 29.466 1.00 55.15 ? 193  TRP B CH2 1 
ATOM   4155 N N   . GLN B 1 194 ? 68.730  54.907 28.810 1.00 55.01 ? 194  GLN B N   1 
ATOM   4156 C CA  . GLN B 1 194 ? 68.865  53.556 28.378 1.00 54.92 ? 194  GLN B CA  1 
ATOM   4157 C C   . GLN B 1 194 ? 67.505  52.931 28.238 1.00 54.34 ? 194  GLN B C   1 
ATOM   4158 O O   . GLN B 1 194 ? 66.645  53.184 29.034 1.00 52.98 ? 194  GLN B O   1 
ATOM   4159 C CB  . GLN B 1 194 ? 69.752  52.783 29.357 1.00 55.29 ? 194  GLN B CB  1 
ATOM   4160 C CG  . GLN B 1 194 ? 69.682  53.276 30.735 1.00 55.05 ? 194  GLN B CG  1 
ATOM   4161 C CD  . GLN B 1 194 ? 70.715  52.728 31.590 1.00 54.76 ? 194  GLN B CD  1 
ATOM   4162 O OE1 . GLN B 1 194 ? 70.837  53.178 32.697 1.00 55.91 ? 194  GLN B OE1 1 
ATOM   4163 N NE2 . GLN B 1 194 ? 71.469  51.761 31.115 1.00 54.08 ? 194  GLN B NE2 1 
ATOM   4164 N N   . VAL B 1 195 ? 67.358  52.123 27.183 1.00 54.57 ? 195  VAL B N   1 
ATOM   4165 C CA  . VAL B 1 195 ? 66.166  51.357 26.902 1.00 54.80 ? 195  VAL B CA  1 
ATOM   4166 C C   . VAL B 1 195 ? 66.471  49.921 26.414 1.00 54.74 ? 195  VAL B C   1 
ATOM   4167 O O   . VAL B 1 195 ? 67.459  49.681 25.768 1.00 53.76 ? 195  VAL B O   1 
ATOM   4168 C CB  . VAL B 1 195 ? 65.330  52.019 25.843 1.00 54.40 ? 195  VAL B CB  1 
ATOM   4169 C CG1 . VAL B 1 195 ? 65.059  53.390 26.214 1.00 54.55 ? 195  VAL B CG1 1 
ATOM   4170 C CG2 . VAL B 1 195 ? 66.036  51.966 24.513 1.00 54.53 ? 195  VAL B CG2 1 
ATOM   4171 N N   . ASP B 1 196 ? 65.550  49.007 26.707 1.00 55.30 ? 196  ASP B N   1 
ATOM   4172 C CA  . ASP B 1 196 ? 65.624  47.643 26.269 1.00 55.45 ? 196  ASP B CA  1 
ATOM   4173 C C   . ASP B 1 196 ? 65.141  47.554 24.801 1.00 55.36 ? 196  ASP B C   1 
ATOM   4174 O O   . ASP B 1 196 ? 64.038  47.998 24.466 1.00 54.68 ? 196  ASP B O   1 
ATOM   4175 C CB  . ASP B 1 196 ? 64.729  46.712 27.129 1.00 55.87 ? 196  ASP B CB  1 
ATOM   4176 C CG  . ASP B 1 196 ? 65.363  46.247 28.455 1.00 56.34 ? 196  ASP B CG  1 
ATOM   4177 O OD1 . ASP B 1 196 ? 66.584  45.966 28.516 1.00 56.75 ? 196  ASP B OD1 1 
ATOM   4178 O OD2 . ASP B 1 196 ? 64.660  46.059 29.473 1.00 55.79 ? 196  ASP B OD2 1 
ATOM   4179 N N   . LEU B 1 197 ? 65.978  46.906 23.985 1.00 55.49 ? 197  LEU B N   1 
ATOM   4180 C CA  . LEU B 1 197 ? 65.766  46.673 22.573 1.00 55.29 ? 197  LEU B CA  1 
ATOM   4181 C C   . LEU B 1 197 ? 66.494  45.420 22.095 1.00 55.32 ? 197  LEU B C   1 
ATOM   4182 O O   . LEU B 1 197 ? 67.606  45.114 22.540 1.00 55.32 ? 197  LEU B O   1 
ATOM   4183 C CB  . LEU B 1 197 ? 66.348  47.825 21.777 1.00 55.44 ? 197  LEU B CB  1 
ATOM   4184 C CG  . LEU B 1 197 ? 65.704  49.197 21.899 1.00 55.76 ? 197  LEU B CG  1 
ATOM   4185 C CD1 . LEU B 1 197 ? 66.362  50.166 20.910 1.00 54.71 ? 197  LEU B CD1 1 
ATOM   4186 C CD2 . LEU B 1 197 ? 64.227  49.082 21.654 1.00 56.26 ? 197  LEU B CD2 1 
ATOM   4187 N N   . ASP B 1 198 ? 65.870  44.730 21.145 1.00 55.30 ? 198  ASP B N   1 
ATOM   4188 C CA  . ASP B 1 198 ? 66.435  43.560 20.478 1.00 55.26 ? 198  ASP B CA  1 
ATOM   4189 C C   . ASP B 1 198 ? 67.071  44.005 19.216 1.00 55.38 ? 198  ASP B C   1 
ATOM   4190 O O   . ASP B 1 198 ? 66.471  44.708 18.448 1.00 55.65 ? 198  ASP B O   1 
ATOM   4191 C CB  . ASP B 1 198 ? 65.347  42.572 20.085 1.00 55.05 ? 198  ASP B CB  1 
ATOM   4192 C CG  . ASP B 1 198 ? 64.974  41.650 21.196 1.00 55.36 ? 198  ASP B CG  1 
ATOM   4193 O OD1 . ASP B 1 198 ? 65.877  41.041 21.737 1.00 56.70 ? 198  ASP B OD1 1 
ATOM   4194 O OD2 . ASP B 1 198 ? 63.825  41.445 21.604 1.00 54.99 ? 198  ASP B OD2 1 
ATOM   4195 N N   . VAL B 1 199 ? 68.267  43.532 18.961 1.00 55.54 ? 199  VAL B N   1 
ATOM   4196 C CA  . VAL B 1 199 ? 69.163  44.192 18.063 1.00 55.61 ? 199  VAL B CA  1 
ATOM   4197 C C   . VAL B 1 199 ? 69.697  43.213 17.047 1.00 55.70 ? 199  VAL B C   1 
ATOM   4198 O O   . VAL B 1 199 ? 70.208  42.159 17.411 1.00 55.57 ? 199  VAL B O   1 
ATOM   4199 C CB  . VAL B 1 199 ? 70.325  44.748 18.878 1.00 55.46 ? 199  VAL B CB  1 
ATOM   4200 C CG1 . VAL B 1 199 ? 71.641  44.479 18.212 1.00 56.03 ? 199  VAL B CG1 1 
ATOM   4201 C CG2 . VAL B 1 199 ? 70.181  46.191 19.063 1.00 55.89 ? 199  VAL B CG2 1 
ATOM   4202 N N   . ASN B 1 200 ? 69.594  43.533 15.770 1.00 55.96 ? 200  ASN B N   1 
ATOM   4203 C CA  . ASN B 1 200 ? 70.278  42.720 14.770 1.00 56.08 ? 200  ASN B CA  1 
ATOM   4204 C C   . ASN B 1 200 ? 71.227  43.610 14.029 1.00 55.59 ? 200  ASN B C   1 
ATOM   4205 O O   . ASN B 1 200 ? 70.940  44.742 13.645 1.00 55.03 ? 200  ASN B O   1 
ATOM   4206 C CB  . ASN B 1 200 ? 69.335  42.048 13.747 1.00 56.39 ? 200  ASN B CB  1 
ATOM   4207 C CG  . ASN B 1 200 ? 68.051  41.446 14.372 1.00 58.26 ? 200  ASN B CG  1 
ATOM   4208 O OD1 . ASN B 1 200 ? 68.020  41.087 15.561 1.00 61.04 ? 200  ASN B OD1 1 
ATOM   4209 N ND2 . ASN B 1 200 ? 66.983  41.333 13.559 1.00 57.20 ? 200  ASN B ND2 1 
ATOM   4210 N N   . PHE B 1 201 ? 72.399  43.091 13.847 1.00 55.56 ? 201  PHE B N   1 
ATOM   4211 C CA  . PHE B 1 201 ? 73.274  43.717 12.951 1.00 55.67 ? 201  PHE B CA  1 
ATOM   4212 C C   . PHE B 1 201 ? 73.255  42.805 11.792 1.00 55.68 ? 201  PHE B C   1 
ATOM   4213 O O   . PHE B 1 201 ? 74.014  41.849 11.749 1.00 55.46 ? 201  PHE B O   1 
ATOM   4214 C CB  . PHE B 1 201 ? 74.642  43.880 13.581 1.00 55.66 ? 201  PHE B CB  1 
ATOM   4215 C CG  . PHE B 1 201 ? 74.780  45.159 14.340 1.00 55.32 ? 201  PHE B CG  1 
ATOM   4216 C CD1 . PHE B 1 201 ? 73.744  45.663 15.078 1.00 55.99 ? 201  PHE B CD1 1 
ATOM   4217 C CD2 . PHE B 1 201 ? 75.930  45.863 14.286 1.00 55.08 ? 201  PHE B CD2 1 
ATOM   4218 C CE1 . PHE B 1 201 ? 73.882  46.852 15.749 1.00 55.80 ? 201  PHE B CE1 1 
ATOM   4219 C CE2 . PHE B 1 201 ? 76.062  47.035 14.962 1.00 54.98 ? 201  PHE B CE2 1 
ATOM   4220 C CZ  . PHE B 1 201 ? 75.041  47.534 15.691 1.00 54.86 ? 201  PHE B CZ  1 
ATOM   4221 N N   . GLY B 1 202 ? 72.351  43.111 10.860 1.00 55.79 ? 202  GLY B N   1 
ATOM   4222 C CA  . GLY B 1 202 ? 72.180  42.317 9.658  1.00 55.60 ? 202  GLY B CA  1 
ATOM   4223 C C   . GLY B 1 202 ? 71.880  40.908 10.088 1.00 55.60 ? 202  GLY B C   1 
ATOM   4224 O O   . GLY B 1 202 ? 70.781  40.648 10.591 1.00 55.60 ? 202  GLY B O   1 
ATOM   4225 N N   . LYS B 1 203 ? 72.887  40.034 9.961  1.00 55.60 ? 203  LYS B N   1 
ATOM   4226 C CA  . LYS B 1 203 ? 72.750  38.587 10.225 1.00 55.57 ? 203  LYS B CA  1 
ATOM   4227 C C   . LYS B 1 203 ? 72.926  38.202 11.681 1.00 55.60 ? 203  LYS B C   1 
ATOM   4228 O O   . LYS B 1 203 ? 72.099  37.503 12.265 1.00 55.45 ? 203  LYS B O   1 
ATOM   4229 C CB  . LYS B 1 203 ? 73.819  37.821 9.464  1.00 55.69 ? 203  LYS B CB  1 
ATOM   4230 C CG  . LYS B 1 203 ? 73.409  37.416 8.079  1.00 56.30 ? 203  LYS B CG  1 
ATOM   4231 C CD  . LYS B 1 203 ? 72.649  36.052 8.068  1.00 56.75 ? 203  LYS B CD  1 
ATOM   4232 C CE  . LYS B 1 203 ? 73.618  34.828 8.035  1.00 56.98 ? 203  LYS B CE  1 
ATOM   4233 N NZ  . LYS B 1 203 ? 74.678  34.775 9.147  1.00 56.59 ? 203  LYS B NZ  1 
ATOM   4234 N N   . THR B 1 204 ? 74.055  38.631 12.233 1.00 55.69 ? 204  THR B N   1 
ATOM   4235 C CA  . THR B 1 204 ? 74.408  38.358 13.613 1.00 55.63 ? 204  THR B CA  1 
ATOM   4236 C C   . THR B 1 204 ? 73.613  39.214 14.600 1.00 55.05 ? 204  THR B C   1 
ATOM   4237 O O   . THR B 1 204 ? 73.567  40.435 14.460 1.00 54.43 ? 204  THR B O   1 
ATOM   4238 C CB  . THR B 1 204 ? 75.945  38.584 13.814 1.00 56.10 ? 204  THR B CB  1 
ATOM   4239 O OG1 . THR B 1 204 ? 76.306  38.411 15.192 1.00 57.01 ? 204  THR B OG1 1 
ATOM   4240 C CG2 . THR B 1 204 ? 76.356  40.024 13.557 1.00 56.49 ? 204  THR B CG2 1 
ATOM   4241 N N   . SER B 1 205 ? 73.035  38.568 15.611 1.00 54.88 ? 205  SER B N   1 
ATOM   4242 C CA  . SER B 1 205 ? 72.149  39.259 16.536 1.00 55.16 ? 205  SER B CA  1 
ATOM   4243 C C   . SER B 1 205 ? 72.241  38.961 18.037 1.00 54.67 ? 205  SER B C   1 
ATOM   4244 O O   . SER B 1 205 ? 72.869  38.038 18.462 1.00 54.30 ? 205  SER B O   1 
ATOM   4245 C CB  . SER B 1 205 ? 70.723  39.069 16.069 1.00 55.32 ? 205  SER B CB  1 
ATOM   4246 O OG  . SER B 1 205 ? 70.027  40.252 16.289 1.00 55.85 ? 205  SER B OG  1 
ATOM   4247 N N   . MET B 1 206 ? 71.636  39.828 18.827 1.00 54.70 ? 206  MET B N   1 
ATOM   4248 C CA  . MET B 1 206 ? 71.666  39.723 20.248 1.00 54.89 ? 206  MET B CA  1 
ATOM   4249 C C   . MET B 1 206 ? 70.334  40.193 20.711 1.00 54.78 ? 206  MET B C   1 
ATOM   4250 O O   . MET B 1 206 ? 69.884  41.237 20.348 1.00 54.38 ? 206  MET B O   1 
ATOM   4251 C CB  . MET B 1 206 ? 72.793  40.589 20.858 1.00 55.22 ? 206  MET B CB  1 
ATOM   4252 C CG  . MET B 1 206 ? 72.579  40.963 22.361 1.00 55.19 ? 206  MET B CG  1 
ATOM   4253 S SD  . MET B 1 206 ? 73.869  40.506 23.515 1.00 54.81 ? 206  MET B SD  1 
ATOM   4254 C CE  . MET B 1 206 ? 73.178  40.782 25.134 1.00 54.61 ? 206  MET B CE  1 
ATOM   4255 N N   . GLU B 1 207 ? 69.719  39.421 21.566 1.00 55.33 ? 207  GLU B N   1 
ATOM   4256 C CA  . GLU B 1 207 ? 68.427  39.770 22.097 1.00 55.63 ? 207  GLU B CA  1 
ATOM   4257 C C   . GLU B 1 207 ? 68.482  40.436 23.485 1.00 55.53 ? 207  GLU B C   1 
ATOM   4258 O O   . GLU B 1 207 ? 69.218  40.033 24.386 1.00 55.06 ? 207  GLU B O   1 
ATOM   4259 C CB  . GLU B 1 207 ? 67.532  38.503 22.144 1.00 56.13 ? 207  GLU B CB  1 
ATOM   4260 C CG  . GLU B 1 207 ? 66.101  38.672 22.685 1.00 56.22 ? 207  GLU B CG  1 
ATOM   4261 C CD  . GLU B 1 207 ? 65.441  37.380 23.203 1.00 55.77 ? 207  GLU B CD  1 
ATOM   4262 O OE1 . GLU B 1 207 ? 65.956  36.699 24.135 1.00 54.36 ? 207  GLU B OE1 1 
ATOM   4263 O OE2 . GLU B 1 207 ? 64.338  37.098 22.691 1.00 56.39 ? 207  GLU B OE2 1 
ATOM   4264 N N   . LYS B 1 208 ? 67.623  41.440 23.622 1.00 55.99 ? 208  LYS B N   1 
ATOM   4265 C CA  . LYS B 1 208 ? 67.306  42.120 24.889 1.00 56.09 ? 208  LYS B CA  1 
ATOM   4266 C C   . LYS B 1 208 ? 68.517  42.907 25.355 1.00 56.04 ? 208  LYS B C   1 
ATOM   4267 O O   . LYS B 1 208 ? 68.837  42.924 26.546 1.00 56.25 ? 208  LYS B O   1 
ATOM   4268 C CB  . LYS B 1 208 ? 66.813  41.103 25.954 1.00 56.26 ? 208  LYS B CB  1 
ATOM   4269 C CG  . LYS B 1 208 ? 66.154  41.697 27.214 1.00 56.33 ? 208  LYS B CG  1 
ATOM   4270 C CD  . LYS B 1 208 ? 65.777  40.603 28.230 1.00 55.81 ? 208  LYS B CD  1 
ATOM   4271 C CE  . LYS B 1 208 ? 65.404  41.218 29.595 1.00 55.75 ? 208  LYS B CE  1 
ATOM   4272 N NZ  . LYS B 1 208 ? 66.378  42.242 30.086 1.00 55.39 ? 208  LYS B NZ  1 
ATOM   4273 N N   . ALA B 1 209 ? 69.189  43.556 24.409 1.00 55.86 ? 209  ALA B N   1 
ATOM   4274 C CA  . ALA B 1 209 ? 70.336  44.364 24.753 1.00 55.87 ? 209  ALA B CA  1 
ATOM   4275 C C   . ALA B 1 209 ? 69.887  45.668 25.474 1.00 55.72 ? 209  ALA B C   1 
ATOM   4276 O O   . ALA B 1 209 ? 68.708  45.957 25.624 1.00 55.34 ? 209  ALA B O   1 
ATOM   4277 C CB  . ALA B 1 209 ? 71.193  44.661 23.503 1.00 56.13 ? 209  ALA B CB  1 
ATOM   4278 N N   . ASN B 1 210 ? 70.886  46.374 25.981 1.00 55.73 ? 210  ASN B N   1 
ATOM   4279 C CA  . ASN B 1 210 ? 70.746  47.616 26.660 1.00 55.33 ? 210  ASN B CA  1 
ATOM   4280 C C   . ASN B 1 210 ? 71.350  48.676 25.789 1.00 54.88 ? 210  ASN B C   1 
ATOM   4281 O O   . ASN B 1 210 ? 72.533  48.735 25.611 1.00 55.21 ? 210  ASN B O   1 
ATOM   4282 C CB  . ASN B 1 210 ? 71.520  47.585 27.973 1.00 55.55 ? 210  ASN B CB  1 
ATOM   4283 C CG  . ASN B 1 210 ? 71.351  48.862 28.790 1.00 56.08 ? 210  ASN B CG  1 
ATOM   4284 O OD1 . ASN B 1 210 ? 71.906  48.990 29.876 1.00 57.22 ? 210  ASN B OD1 1 
ATOM   4285 N ND2 . ASN B 1 210 ? 70.583  49.802 28.278 1.00 57.17 ? 210  ASN B ND2 1 
ATOM   4286 N N   . VAL B 1 211 ? 70.532  49.559 25.301 1.00 54.76 ? 211  VAL B N   1 
ATOM   4287 C CA  . VAL B 1 211 ? 70.957  50.473 24.338 1.00 54.94 ? 211  VAL B CA  1 
ATOM   4288 C C   . VAL B 1 211 ? 70.761  51.842 24.855 1.00 54.83 ? 211  VAL B C   1 
ATOM   4289 O O   . VAL B 1 211 ? 69.852  52.115 25.587 1.00 53.96 ? 211  VAL B O   1 
ATOM   4290 C CB  . VAL B 1 211 ? 70.097  50.351 23.149 1.00 55.25 ? 211  VAL B CB  1 
ATOM   4291 C CG1 . VAL B 1 211 ? 70.075  51.628 22.418 1.00 56.00 ? 211  VAL B CG1 1 
ATOM   4292 C CG2 . VAL B 1 211 ? 70.562  49.251 22.244 1.00 55.24 ? 211  VAL B CG2 1 
ATOM   4293 N N   . ILE B 1 212 ? 71.608  52.733 24.388 1.00 55.45 ? 212  ILE B N   1 
ATOM   4294 C CA  . ILE B 1 212 ? 71.596  54.068 24.878 1.00 55.28 ? 212  ILE B CA  1 
ATOM   4295 C C   . ILE B 1 212 ? 72.089  55.070 23.874 1.00 55.16 ? 212  ILE B C   1 
ATOM   4296 O O   . ILE B 1 212 ? 72.892  54.810 22.974 1.00 55.33 ? 212  ILE B O   1 
ATOM   4297 C CB  . ILE B 1 212 ? 72.425  54.122 26.104 1.00 55.43 ? 212  ILE B CB  1 
ATOM   4298 C CG1 . ILE B 1 212 ? 73.806  54.670 25.827 1.00 54.53 ? 212  ILE B CG1 1 
ATOM   4299 C CG2 . ILE B 1 212 ? 72.589  52.734 26.658 1.00 55.75 ? 212  ILE B CG2 1 
ATOM   4300 C CD1 . ILE B 1 212 ? 74.694  54.296 26.919 1.00 54.67 ? 212  ILE B CD1 1 
ATOM   4301 N N   . VAL B 1 213 ? 71.639  56.266 24.129 1.00 54.77 ? 213  VAL B N   1 
ATOM   4302 C CA  . VAL B 1 213 ? 71.395  57.165 23.100 1.00 54.59 ? 213  VAL B CA  1 
ATOM   4303 C C   . VAL B 1 213 ? 72.258  58.293 23.512 1.00 54.50 ? 213  VAL B C   1 
ATOM   4304 O O   . VAL B 1 213 ? 72.010  58.902 24.515 1.00 54.38 ? 213  VAL B O   1 
ATOM   4305 C CB  . VAL B 1 213 ? 69.936  57.449 23.123 1.00 54.38 ? 213  VAL B CB  1 
ATOM   4306 C CG1 . VAL B 1 213 ? 69.536  58.186 21.951 1.00 54.82 ? 213  VAL B CG1 1 
ATOM   4307 C CG2 . VAL B 1 213 ? 69.222  56.183 23.094 1.00 54.24 ? 213  VAL B CG2 1 
ATOM   4308 N N   . ASP B 1 214 ? 73.329  58.504 22.772 1.00 54.52 ? 214  ASP B N   1 
ATOM   4309 C CA  . ASP B 1 214 ? 74.416  59.340 23.225 1.00 54.79 ? 214  ASP B CA  1 
ATOM   4310 C C   . ASP B 1 214 ? 74.666  60.495 22.270 1.00 55.16 ? 214  ASP B C   1 
ATOM   4311 O O   . ASP B 1 214 ? 75.427  60.374 21.308 1.00 55.63 ? 214  ASP B O   1 
ATOM   4312 C CB  . ASP B 1 214 ? 75.689  58.519 23.347 1.00 54.36 ? 214  ASP B CB  1 
ATOM   4313 C CG  . ASP B 1 214 ? 76.732  59.226 24.117 1.00 53.76 ? 214  ASP B CG  1 
ATOM   4314 O OD1 . ASP B 1 214 ? 77.901  58.834 24.012 1.00 53.11 ? 214  ASP B OD1 1 
ATOM   4315 O OD2 . ASP B 1 214 ? 76.474  60.196 24.862 1.00 52.99 ? 214  ASP B OD2 1 
ATOM   4316 N N   . SER B 1 215 ? 74.055  61.631 22.537 1.00 54.87 ? 215  SER B N   1 
ATOM   4317 C CA  . SER B 1 215 ? 74.258  62.757 21.684 1.00 54.73 ? 215  SER B CA  1 
ATOM   4318 C C   . SER B 1 215 ? 75.706  63.165 21.592 1.00 54.64 ? 215  SER B C   1 
ATOM   4319 O O   . SER B 1 215 ? 76.088  63.843 20.632 1.00 54.57 ? 215  SER B O   1 
ATOM   4320 C CB  . SER B 1 215 ? 73.429  63.935 22.173 1.00 55.11 ? 215  SER B CB  1 
ATOM   4321 O OG  . SER B 1 215 ? 73.611  64.222 23.555 1.00 56.02 ? 215  SER B OG  1 
ATOM   4322 N N   . GLY B 1 216 ? 76.512  62.762 22.578 1.00 54.70 ? 216  GLY B N   1 
ATOM   4323 C CA  . GLY B 1 216 ? 77.909  63.204 22.675 1.00 54.71 ? 216  GLY B CA  1 
ATOM   4324 C C   . GLY B 1 216 ? 78.876  62.564 21.716 1.00 54.34 ? 216  GLY B C   1 
ATOM   4325 O O   . GLY B 1 216 ? 79.687  63.258 21.167 1.00 54.27 ? 216  GLY B O   1 
ATOM   4326 N N   . THR B 1 217 ? 78.778  61.256 21.510 1.00 54.56 ? 217  THR B N   1 
ATOM   4327 C CA  . THR B 1 217 ? 79.681  60.510 20.609 1.00 55.11 ? 217  THR B CA  1 
ATOM   4328 C C   . THR B 1 217 ? 79.228  60.508 19.191 1.00 54.93 ? 217  THR B C   1 
ATOM   4329 O O   . THR B 1 217 ? 78.056  60.639 18.929 1.00 55.38 ? 217  THR B O   1 
ATOM   4330 C CB  . THR B 1 217 ? 79.720  59.036 20.980 1.00 55.38 ? 217  THR B CB  1 
ATOM   4331 O OG1 . THR B 1 217 ? 80.040  58.898 22.358 1.00 58.02 ? 217  THR B OG1 1 
ATOM   4332 C CG2 . THR B 1 217 ? 80.842  58.306 20.283 1.00 55.08 ? 217  THR B CG2 1 
ATOM   4333 N N   . SER B 1 218 ? 80.162  60.288 18.288 1.00 54.67 ? 218  SER B N   1 
ATOM   4334 C CA  . SER B 1 218 ? 79.851  60.193 16.902 1.00 54.74 ? 218  SER B CA  1 
ATOM   4335 C C   . SER B 1 218 ? 79.950  58.765 16.393 1.00 54.28 ? 218  SER B C   1 
ATOM   4336 O O   . SER B 1 218 ? 80.148  58.532 15.220 1.00 53.98 ? 218  SER B O   1 
ATOM   4337 C CB  . SER B 1 218 ? 80.816  61.061 16.132 1.00 54.85 ? 218  SER B CB  1 
ATOM   4338 O OG  . SER B 1 218 ? 82.078  60.440 16.238 1.00 55.28 ? 218  SER B OG  1 
ATOM   4339 N N   . THR B 1 219 ? 79.758  57.797 17.246 1.00 54.25 ? 219  THR B N   1 
ATOM   4340 C CA  . THR B 1 219 ? 79.888  56.440 16.791 1.00 54.52 ? 219  THR B CA  1 
ATOM   4341 C C   . THR B 1 219 ? 78.783  55.596 17.360 1.00 54.90 ? 219  THR B C   1 
ATOM   4342 O O   . THR B 1 219 ? 77.924  56.064 18.121 1.00 54.81 ? 219  THR B O   1 
ATOM   4343 C CB  . THR B 1 219 ? 81.197  55.855 17.203 1.00 54.42 ? 219  THR B CB  1 
ATOM   4344 O OG1 . THR B 1 219 ? 81.061  55.195 18.455 1.00 54.09 ? 219  THR B OG1 1 
ATOM   4345 C CG2 . THR B 1 219 ? 82.229  56.950 17.460 1.00 55.53 ? 219  THR B CG2 1 
ATOM   4346 N N   . ILE B 1 220 ? 78.809  54.341 16.938 1.00 55.02 ? 220  ILE B N   1 
ATOM   4347 C CA  . ILE B 1 220 ? 77.845  53.350 17.332 1.00 54.74 ? 220  ILE B CA  1 
ATOM   4348 C C   . ILE B 1 220 ? 78.716  52.264 17.821 1.00 54.49 ? 220  ILE B C   1 
ATOM   4349 O O   . ILE B 1 220 ? 79.732  51.994 17.220 1.00 54.38 ? 220  ILE B O   1 
ATOM   4350 C CB  . ILE B 1 220 ? 77.099  52.859 16.127 1.00 54.73 ? 220  ILE B CB  1 
ATOM   4351 C CG1 . ILE B 1 220 ? 76.409  54.012 15.446 1.00 54.54 ? 220  ILE B CG1 1 
ATOM   4352 C CG2 . ILE B 1 220 ? 76.128  51.818 16.517 1.00 55.54 ? 220  ILE B CG2 1 
ATOM   4353 C CD1 . ILE B 1 220 ? 75.460  53.609 14.391 1.00 54.99 ? 220  ILE B CD1 1 
ATOM   4354 N N   . THR B 1 221 ? 78.348  51.645 18.912 1.00 54.65 ? 221  THR B N   1 
ATOM   4355 C CA  . THR B 1 221 ? 79.210  50.645 19.477 1.00 55.20 ? 221  THR B CA  1 
ATOM   4356 C C   . THR B 1 221 ? 78.448  49.432 19.951 1.00 55.47 ? 221  THR B C   1 
ATOM   4357 O O   . THR B 1 221 ? 77.225  49.466 20.117 1.00 55.69 ? 221  THR B O   1 
ATOM   4358 C CB  . THR B 1 221 ? 79.911  51.214 20.679 1.00 55.23 ? 221  THR B CB  1 
ATOM   4359 O OG1 . THR B 1 221 ? 78.957  51.375 21.729 1.00 56.14 ? 221  THR B OG1 1 
ATOM   4360 C CG2 . THR B 1 221 ? 80.433  52.608 20.418 1.00 54.80 ? 221  THR B CG2 1 
ATOM   4361 N N   . ALA B 1 222 ? 79.193  48.375 20.232 1.00 55.50 ? 222  ALA B N   1 
ATOM   4362 C CA  . ALA B 1 222 ? 78.611  47.147 20.727 1.00 55.37 ? 222  ALA B CA  1 
ATOM   4363 C C   . ALA B 1 222 ? 79.716  46.236 21.224 1.00 55.37 ? 222  ALA B C   1 
ATOM   4364 O O   . ALA B 1 222 ? 80.873  46.337 20.799 1.00 55.23 ? 222  ALA B O   1 
ATOM   4365 C CB  . ALA B 1 222 ? 77.851  46.466 19.608 1.00 55.31 ? 222  ALA B CB  1 
ATOM   4366 N N   . PRO B 1 223 ? 79.354  45.292 22.068 1.00 55.41 ? 223  PRO B N   1 
ATOM   4367 C CA  . PRO B 1 223 ? 80.305  44.334 22.609 1.00 55.55 ? 223  PRO B CA  1 
ATOM   4368 C C   . PRO B 1 223 ? 81.143  43.753 21.532 1.00 55.65 ? 223  PRO B C   1 
ATOM   4369 O O   . PRO B 1 223 ? 80.633  43.397 20.479 1.00 55.65 ? 223  PRO B O   1 
ATOM   4370 C CB  . PRO B 1 223 ? 79.414  43.242 23.149 1.00 55.71 ? 223  PRO B CB  1 
ATOM   4371 C CG  . PRO B 1 223 ? 78.193  44.032 23.602 1.00 56.08 ? 223  PRO B CG  1 
ATOM   4372 C CD  . PRO B 1 223 ? 77.985  45.014 22.513 1.00 55.23 ? 223  PRO B CD  1 
ATOM   4373 N N   . THR B 1 224 ? 82.432  43.639 21.805 1.00 55.87 ? 224  THR B N   1 
ATOM   4374 C CA  . THR B 1 224 ? 83.387  43.217 20.784 1.00 55.34 ? 224  THR B CA  1 
ATOM   4375 C C   . THR B 1 224 ? 83.030  41.864 20.142 1.00 54.94 ? 224  THR B C   1 
ATOM   4376 O O   . THR B 1 224 ? 82.937  41.717 18.912 1.00 54.40 ? 224  THR B O   1 
ATOM   4377 C CB  . THR B 1 224 ? 84.758  43.187 21.363 1.00 55.03 ? 224  THR B CB  1 
ATOM   4378 O OG1 . THR B 1 224 ? 85.505  42.237 20.620 1.00 55.12 ? 224  THR B OG1 1 
ATOM   4379 C CG2 . THR B 1 224 ? 84.737  42.706 22.789 1.00 55.17 ? 224  THR B CG2 1 
ATOM   4380 N N   . SER B 1 225 ? 82.802  40.896 21.006 1.00 54.94 ? 225  SER B N   1 
ATOM   4381 C CA  . SER B 1 225 ? 82.238  39.629 20.628 1.00 54.92 ? 225  SER B CA  1 
ATOM   4382 C C   . SER B 1 225 ? 81.192  39.794 19.543 1.00 54.51 ? 225  SER B C   1 
ATOM   4383 O O   . SER B 1 225 ? 81.354  39.327 18.442 1.00 54.34 ? 225  SER B O   1 
ATOM   4384 C CB  . SER B 1 225 ? 81.630  39.006 21.868 1.00 54.97 ? 225  SER B CB  1 
ATOM   4385 O OG  . SER B 1 225 ? 80.700  38.028 21.540 1.00 54.83 ? 225  SER B OG  1 
ATOM   4386 N N   . PHE B 1 226 ? 80.133  40.507 19.853 1.00 54.82 ? 226  PHE B N   1 
ATOM   4387 C CA  . PHE B 1 226 ? 79.053  40.767 18.898 1.00 55.05 ? 226  PHE B CA  1 
ATOM   4388 C C   . PHE B 1 226 ? 79.556  41.308 17.577 1.00 55.27 ? 226  PHE B C   1 
ATOM   4389 O O   . PHE B 1 226 ? 78.973  41.007 16.526 1.00 55.28 ? 226  PHE B O   1 
ATOM   4390 C CB  . PHE B 1 226 ? 78.053  41.753 19.503 1.00 54.86 ? 226  PHE B CB  1 
ATOM   4391 C CG  . PHE B 1 226 ? 76.872  42.094 18.609 1.00 54.64 ? 226  PHE B CG  1 
ATOM   4392 C CD1 . PHE B 1 226 ? 76.527  43.409 18.337 1.00 54.68 ? 226  PHE B CD1 1 
ATOM   4393 C CD2 . PHE B 1 226 ? 76.079  41.116 18.071 1.00 55.21 ? 226  PHE B CD2 1 
ATOM   4394 C CE1 . PHE B 1 226 ? 75.399  43.732 17.541 1.00 54.69 ? 226  PHE B CE1 1 
ATOM   4395 C CE2 . PHE B 1 226 ? 74.958  41.451 17.272 1.00 55.79 ? 226  PHE B CE2 1 
ATOM   4396 C CZ  . PHE B 1 226 ? 74.627  42.763 17.023 1.00 54.60 ? 226  PHE B CZ  1 
ATOM   4397 N N   . ILE B 1 227 ? 80.610  42.120 17.622 1.00 55.31 ? 227  ILE B N   1 
ATOM   4398 C CA  . ILE B 1 227 ? 81.127  42.694 16.409 1.00 55.32 ? 227  ILE B CA  1 
ATOM   4399 C C   . ILE B 1 227 ? 81.817  41.607 15.666 1.00 55.11 ? 227  ILE B C   1 
ATOM   4400 O O   . ILE B 1 227 ? 81.344  41.191 14.642 1.00 55.49 ? 227  ILE B O   1 
ATOM   4401 C CB  . ILE B 1 227 ? 82.011  43.870 16.704 1.00 55.25 ? 227  ILE B CB  1 
ATOM   4402 C CG1 . ILE B 1 227 ? 81.098  45.011 17.142 1.00 55.65 ? 227  ILE B CG1 1 
ATOM   4403 C CG2 . ILE B 1 227 ? 82.855  44.251 15.480 1.00 54.70 ? 227  ILE B CG2 1 
ATOM   4404 C CD1 . ILE B 1 227 ? 81.802  46.318 17.307 1.00 56.60 ? 227  ILE B CD1 1 
ATOM   4405 N N   . ASN B 1 228 ? 82.909  41.112 16.195 1.00 54.98 ? 228  ASN B N   1 
ATOM   4406 C CA  . ASN B 1 228 ? 83.670  40.104 15.477 1.00 55.17 ? 228  ASN B CA  1 
ATOM   4407 C C   . ASN B 1 228 ? 82.873  39.267 14.504 1.00 55.05 ? 228  ASN B C   1 
ATOM   4408 O O   . ASN B 1 228 ? 83.236  39.120 13.339 1.00 54.81 ? 228  ASN B O   1 
ATOM   4409 C CB  . ASN B 1 228 ? 84.316  39.176 16.468 1.00 55.25 ? 228  ASN B CB  1 
ATOM   4410 C CG  . ASN B 1 228 ? 85.285  39.889 17.366 1.00 55.44 ? 228  ASN B CG  1 
ATOM   4411 O OD1 . ASN B 1 228 ? 85.834  40.951 17.020 1.00 54.25 ? 228  ASN B OD1 1 
ATOM   4412 N ND2 . ASN B 1 228 ? 85.515  39.310 18.532 1.00 56.57 ? 228  ASN B ND2 1 
ATOM   4413 N N   . LYS B 1 229 ? 81.792  38.707 15.006 1.00 55.03 ? 229  LYS B N   1 
ATOM   4414 C CA  . LYS B 1 229 ? 80.912  37.901 14.186 1.00 55.34 ? 229  LYS B CA  1 
ATOM   4415 C C   . LYS B 1 229 ? 80.451  38.648 12.944 1.00 55.22 ? 229  LYS B C   1 
ATOM   4416 O O   . LYS B 1 229 ? 80.483  38.099 11.838 1.00 54.87 ? 229  LYS B O   1 
ATOM   4417 C CB  . LYS B 1 229 ? 79.681  37.484 14.994 1.00 55.63 ? 229  LYS B CB  1 
ATOM   4418 C CG  . LYS B 1 229 ? 79.960  36.730 16.340 1.00 56.03 ? 229  LYS B CG  1 
ATOM   4419 C CD  . LYS B 1 229 ? 78.607  36.378 17.061 1.00 56.02 ? 229  LYS B CD  1 
ATOM   4420 C CE  . LYS B 1 229 ? 78.759  36.084 18.571 1.00 55.75 ? 229  LYS B CE  1 
ATOM   4421 N NZ  . LYS B 1 229 ? 77.463  36.138 19.319 1.00 55.00 ? 229  LYS B NZ  1 
ATOM   4422 N N   . PHE B 1 230 ? 80.015  39.898 13.180 1.00 55.32 ? 230  PHE B N   1 
ATOM   4423 C CA  . PHE B 1 230 ? 79.558  40.878 12.159 1.00 55.06 ? 230  PHE B CA  1 
ATOM   4424 C C   . PHE B 1 230 ? 80.685  41.318 11.221 1.00 54.62 ? 230  PHE B C   1 
ATOM   4425 O O   . PHE B 1 230 ? 80.626  41.131 10.028 1.00 54.03 ? 230  PHE B O   1 
ATOM   4426 C CB  . PHE B 1 230 ? 78.958  42.135 12.846 1.00 54.83 ? 230  PHE B CB  1 
ATOM   4427 C CG  . PHE B 1 230 ? 78.317  43.106 11.892 1.00 54.75 ? 230  PHE B CG  1 
ATOM   4428 C CD1 . PHE B 1 230 ? 77.263  42.736 11.094 1.00 54.92 ? 230  PHE B CD1 1 
ATOM   4429 C CD2 . PHE B 1 230 ? 78.777  44.399 11.789 1.00 55.20 ? 230  PHE B CD2 1 
ATOM   4430 C CE1 . PHE B 1 230 ? 76.697  43.634 10.220 1.00 54.84 ? 230  PHE B CE1 1 
ATOM   4431 C CE2 . PHE B 1 230 ? 78.208  45.294 10.903 1.00 54.64 ? 230  PHE B CE2 1 
ATOM   4432 C CZ  . PHE B 1 230 ? 77.174  44.912 10.130 1.00 54.58 ? 230  PHE B CZ  1 
ATOM   4433 N N   . PHE B 1 231 ? 81.714  41.929 11.757 1.00 54.53 ? 231  PHE B N   1 
ATOM   4434 C CA  . PHE B 1 231 ? 82.730  42.411 10.900 1.00 55.00 ? 231  PHE B CA  1 
ATOM   4435 C C   . PHE B 1 231 ? 83.204  41.338 9.969  1.00 55.34 ? 231  PHE B C   1 
ATOM   4436 O O   . PHE B 1 231 ? 83.149  41.522 8.751  1.00 55.62 ? 231  PHE B O   1 
ATOM   4437 C CB  . PHE B 1 231 ? 83.870  42.994 11.705 1.00 55.01 ? 231  PHE B CB  1 
ATOM   4438 C CG  . PHE B 1 231 ? 83.597  44.381 12.191 1.00 55.10 ? 231  PHE B CG  1 
ATOM   4439 C CD1 . PHE B 1 231 ? 84.487  45.017 13.026 1.00 55.46 ? 231  PHE B CD1 1 
ATOM   4440 C CD2 . PHE B 1 231 ? 82.455  45.066 11.800 1.00 55.15 ? 231  PHE B CD2 1 
ATOM   4441 C CE1 . PHE B 1 231 ? 84.232  46.308 13.458 1.00 55.57 ? 231  PHE B CE1 1 
ATOM   4442 C CE2 . PHE B 1 231 ? 82.217  46.330 12.225 1.00 55.31 ? 231  PHE B CE2 1 
ATOM   4443 C CZ  . PHE B 1 231 ? 83.092  46.953 13.057 1.00 55.53 ? 231  PHE B CZ  1 
ATOM   4444 N N   . LYS B 1 232 ? 83.663  40.225 10.528 1.00 55.71 ? 232  LYS B N   1 
ATOM   4445 C CA  . LYS B 1 232 ? 84.096  39.082 9.723  1.00 55.58 ? 232  LYS B CA  1 
ATOM   4446 C C   . LYS B 1 232 ? 83.136  38.754 8.588  1.00 55.75 ? 232  LYS B C   1 
ATOM   4447 O O   . LYS B 1 232 ? 83.591  38.421 7.488  1.00 55.82 ? 232  LYS B O   1 
ATOM   4448 C CB  . LYS B 1 232 ? 84.227  37.853 10.592 1.00 55.85 ? 232  LYS B CB  1 
ATOM   4449 C CG  . LYS B 1 232 ? 84.236  36.501 9.830  1.00 55.86 ? 232  LYS B CG  1 
ATOM   4450 C CD  . LYS B 1 232 ? 82.990  35.606 10.121 1.00 56.16 ? 232  LYS B CD  1 
ATOM   4451 C CE  . LYS B 1 232 ? 81.651  36.199 9.679  1.00 55.64 ? 232  LYS B CE  1 
ATOM   4452 N NZ  . LYS B 1 232 ? 80.422  35.760 10.438 1.00 55.00 ? 232  LYS B NZ  1 
ATOM   4453 N N   . ASP B 1 233 ? 81.821  38.861 8.850  1.00 55.87 ? 233  ASP B N   1 
ATOM   4454 C CA  . ASP B 1 233 ? 80.759  38.621 7.823  1.00 55.76 ? 233  ASP B CA  1 
ATOM   4455 C C   . ASP B 1 233 ? 81.089  39.396 6.536  1.00 55.87 ? 233  ASP B C   1 
ATOM   4456 O O   . ASP B 1 233 ? 81.282  38.808 5.481  1.00 55.76 ? 233  ASP B O   1 
ATOM   4457 C CB  . ASP B 1 233 ? 79.362  39.043 8.350  1.00 55.96 ? 233  ASP B CB  1 
ATOM   4458 C CG  . ASP B 1 233 ? 78.449  37.854 8.706  1.00 55.34 ? 233  ASP B CG  1 
ATOM   4459 O OD1 . ASP B 1 233 ? 77.646  37.993 9.694  1.00 55.33 ? 233  ASP B OD1 1 
ATOM   4460 O OD2 . ASP B 1 233 ? 78.456  36.781 8.047  1.00 53.94 ? 233  ASP B OD2 1 
ATOM   4461 N N   . LEU B 1 234 ? 81.188  40.724 6.658  1.00 56.02 ? 234  LEU B N   1 
ATOM   4462 C CA  . LEU B 1 234 ? 81.443  41.624 5.507  1.00 55.84 ? 234  LEU B CA  1 
ATOM   4463 C C   . LEU B 1 234 ? 82.897  42.049 5.408  1.00 55.43 ? 234  LEU B C   1 
ATOM   4464 O O   . LEU B 1 234 ? 83.212  43.119 4.905  1.00 55.27 ? 234  LEU B O   1 
ATOM   4465 C CB  . LEU B 1 234 ? 80.505  42.851 5.521  1.00 55.84 ? 234  LEU B CB  1 
ATOM   4466 C CG  . LEU B 1 234 ? 80.740  43.872 6.612  1.00 55.89 ? 234  LEU B CG  1 
ATOM   4467 C CD1 . LEU B 1 234 ? 79.739  45.014 6.481  1.00 56.32 ? 234  LEU B CD1 1 
ATOM   4468 C CD2 . LEU B 1 234 ? 80.632  43.214 7.977  1.00 56.01 ? 234  LEU B CD2 1 
ATOM   4469 N N   . ASN B 1 235 ? 83.777  41.182 5.863  1.00 55.19 ? 235  ASN B N   1 
ATOM   4470 C CA  . ASN B 1 235 ? 85.207  41.324 5.627  1.00 55.38 ? 235  ASN B CA  1 
ATOM   4471 C C   . ASN B 1 235 ? 85.797  42.727 5.671  1.00 54.98 ? 235  ASN B C   1 
ATOM   4472 O O   . ASN B 1 235 ? 86.215  43.247 4.647  1.00 54.34 ? 235  ASN B O   1 
ATOM   4473 C CB  . ASN B 1 235 ? 85.571  40.696 4.261  1.00 55.95 ? 235  ASN B CB  1 
ATOM   4474 C CG  . ASN B 1 235 ? 84.427  39.783 3.665  1.00 56.66 ? 235  ASN B CG  1 
ATOM   4475 O OD1 . ASN B 1 235 ? 83.305  40.244 3.355  1.00 55.74 ? 235  ASN B OD1 1 
ATOM   4476 N ND2 . ASN B 1 235 ? 84.742  38.492 3.495  1.00 56.69 ? 235  ASN B ND2 1 
ATOM   4477 N N   . VAL B 1 236 ? 85.874  43.289 6.878  1.00 55.04 ? 236  VAL B N   1 
ATOM   4478 C CA  . VAL B 1 236 ? 86.317  44.674 7.111  1.00 54.89 ? 236  VAL B CA  1 
ATOM   4479 C C   . VAL B 1 236 ? 87.787  44.740 7.359  1.00 54.59 ? 236  VAL B C   1 
ATOM   4480 O O   . VAL B 1 236 ? 88.352  43.767 7.755  1.00 54.59 ? 236  VAL B O   1 
ATOM   4481 C CB  . VAL B 1 236 ? 85.664  45.276 8.358  1.00 54.72 ? 236  VAL B CB  1 
ATOM   4482 C CG1 . VAL B 1 236 ? 84.228  45.072 8.333  1.00 55.05 ? 236  VAL B CG1 1 
ATOM   4483 C CG2 . VAL B 1 236 ? 86.176  44.648 9.600  1.00 55.31 ? 236  VAL B CG2 1 
ATOM   4484 N N   . ILE B 1 237 ? 88.394  45.907 7.196  1.00 54.59 ? 237  ILE B N   1 
ATOM   4485 C CA  . ILE B 1 237 ? 89.850  46.016 7.314  1.00 54.71 ? 237  ILE B CA  1 
ATOM   4486 C C   . ILE B 1 237 ? 90.332  46.974 8.373  1.00 54.10 ? 237  ILE B C   1 
ATOM   4487 O O   . ILE B 1 237 ? 90.274  48.142 8.216  1.00 53.95 ? 237  ILE B O   1 
ATOM   4488 C CB  . ILE B 1 237 ? 90.498  46.426 5.971  1.00 54.91 ? 237  ILE B CB  1 
ATOM   4489 C CG1 . ILE B 1 237 ? 89.619  46.039 4.767  1.00 54.87 ? 237  ILE B CG1 1 
ATOM   4490 C CG2 . ILE B 1 237 ? 91.898  45.793 5.866  1.00 55.50 ? 237  ILE B CG2 1 
ATOM   4491 C CD1 . ILE B 1 237 ? 90.174  46.450 3.414  1.00 54.67 ? 237  ILE B CD1 1 
ATOM   4492 N N   . LYS B 1 238 ? 90.895  46.469 9.435  1.00 54.44 ? 238  LYS B N   1 
ATOM   4493 C CA  . LYS B 1 238 ? 91.320  47.341 10.517 1.00 54.75 ? 238  LYS B CA  1 
ATOM   4494 C C   . LYS B 1 238 ? 92.796  47.679 10.447 1.00 54.85 ? 238  LYS B C   1 
ATOM   4495 O O   . LYS B 1 238 ? 93.658  46.916 10.885 1.00 54.84 ? 238  LYS B O   1 
ATOM   4496 C CB  . LYS B 1 238 ? 90.996  46.708 11.877 1.00 54.95 ? 238  LYS B CB  1 
ATOM   4497 C CG  . LYS B 1 238 ? 90.634  47.726 12.945 1.00 54.60 ? 238  LYS B CG  1 
ATOM   4498 C CD  . LYS B 1 238 ? 91.718  48.753 13.147 1.00 55.05 ? 238  LYS B CD  1 
ATOM   4499 C CE  . LYS B 1 238 ? 91.291  49.808 14.112 1.00 54.41 ? 238  LYS B CE  1 
ATOM   4500 N NZ  . LYS B 1 238 ? 92.458  50.586 14.577 1.00 54.00 ? 238  LYS B NZ  1 
ATOM   4501 N N   . VAL B 1 239 ? 93.094  48.846 9.916  1.00 54.96 ? 239  VAL B N   1 
ATOM   4502 C CA  . VAL B 1 239 ? 94.478  49.218 9.725  1.00 55.01 ? 239  VAL B CA  1 
ATOM   4503 C C   . VAL B 1 239 ? 94.887  49.648 11.089 1.00 55.04 ? 239  VAL B C   1 
ATOM   4504 O O   . VAL B 1 239 ? 94.222  50.473 11.662 1.00 55.17 ? 239  VAL B O   1 
ATOM   4505 C CB  . VAL B 1 239 ? 94.665  50.383 8.730  1.00 54.66 ? 239  VAL B CB  1 
ATOM   4506 C CG1 . VAL B 1 239 ? 96.052  50.473 8.277  1.00 54.82 ? 239  VAL B CG1 1 
ATOM   4507 C CG2 . VAL B 1 239 ? 93.797  50.202 7.522  1.00 55.29 ? 239  VAL B CG2 1 
ATOM   4508 N N   . PRO B 1 240 ? 95.955  49.076 11.634 1.00 55.46 ? 240  PRO B N   1 
ATOM   4509 C CA  . PRO B 1 240 ? 96.430  49.473 12.968 1.00 55.18 ? 240  PRO B CA  1 
ATOM   4510 C C   . PRO B 1 240 ? 96.285  50.974 13.190 1.00 54.86 ? 240  PRO B C   1 
ATOM   4511 O O   . PRO B 1 240 ? 95.229  51.424 13.623 1.00 54.60 ? 240  PRO B O   1 
ATOM   4512 C CB  . PRO B 1 240 ? 97.902  49.000 12.980 1.00 54.96 ? 240  PRO B CB  1 
ATOM   4513 C CG  . PRO B 1 240 ? 97.848  47.759 12.162 1.00 55.73 ? 240  PRO B CG  1 
ATOM   4514 C CD  . PRO B 1 240 ? 96.832  48.034 11.035 1.00 55.87 ? 240  PRO B CD  1 
ATOM   4515 N N   . PHE B 1 241 ? 97.308  51.741 12.840 1.00 54.88 ? 241  PHE B N   1 
ATOM   4516 C CA  . PHE B 1 241 ? 97.347  53.173 13.157 1.00 55.08 ? 241  PHE B CA  1 
ATOM   4517 C C   . PHE B 1 241 ? 96.029  53.925 13.053 1.00 54.92 ? 241  PHE B C   1 
ATOM   4518 O O   . PHE B 1 241 ? 95.645  54.688 13.936 1.00 55.21 ? 241  PHE B O   1 
ATOM   4519 C CB  . PHE B 1 241 ? 98.395  53.875 12.331 1.00 55.12 ? 241  PHE B CB  1 
ATOM   4520 C CG  . PHE B 1 241 ? 98.329  53.567 10.863 1.00 55.31 ? 241  PHE B CG  1 
ATOM   4521 C CD1 . PHE B 1 241 ? 99.004  52.475 10.335 1.00 54.44 ? 241  PHE B CD1 1 
ATOM   4522 C CD2 . PHE B 1 241 ? 97.648  54.394 10.002 1.00 55.12 ? 241  PHE B CD2 1 
ATOM   4523 C CE1 . PHE B 1 241 ? 98.957  52.204 9.008  1.00 54.12 ? 241  PHE B CE1 1 
ATOM   4524 C CE2 . PHE B 1 241 ? 97.630  54.122 8.668  1.00 54.47 ? 241  PHE B CE2 1 
ATOM   4525 C CZ  . PHE B 1 241 ? 98.283  53.016 8.175  1.00 53.93 ? 241  PHE B CZ  1 
ATOM   4526 N N   . LEU B 1 242 ? 95.280  53.693 12.009 1.00 55.13 ? 242  LEU B N   1 
ATOM   4527 C CA  . LEU B 1 242 ? 93.996  54.382 11.954 1.00 55.27 ? 242  LEU B CA  1 
ATOM   4528 C C   . LEU B 1 242 ? 92.944  53.664 12.825 1.00 55.11 ? 242  LEU B C   1 
ATOM   4529 O O   . LEU B 1 242 ? 92.826  52.442 12.800 1.00 55.11 ? 242  LEU B O   1 
ATOM   4530 C CB  . LEU B 1 242 ? 93.520  54.644 10.521 1.00 55.18 ? 242  LEU B CB  1 
ATOM   4531 C CG  . LEU B 1 242 ? 93.592  53.540 9.487  1.00 55.01 ? 242  LEU B CG  1 
ATOM   4532 C CD1 . LEU B 1 242 ? 92.495  52.488 9.760  1.00 56.17 ? 242  LEU B CD1 1 
ATOM   4533 C CD2 . LEU B 1 242 ? 93.445  54.125 8.115  1.00 54.88 ? 242  LEU B CD2 1 
ATOM   4534 N N   . PRO B 1 243 ? 92.217  54.436 13.625 1.00 55.30 ? 243  PRO B N   1 
ATOM   4535 C CA  . PRO B 1 243 ? 91.244  53.906 14.619 1.00 55.27 ? 243  PRO B CA  1 
ATOM   4536 C C   . PRO B 1 243 ? 89.830  53.588 14.095 1.00 55.13 ? 243  PRO B C   1 
ATOM   4537 O O   . PRO B 1 243 ? 88.896  53.596 14.862 1.00 54.50 ? 243  PRO B O   1 
ATOM   4538 C CB  . PRO B 1 243 ? 91.132  55.065 15.592 1.00 55.43 ? 243  PRO B CB  1 
ATOM   4539 C CG  . PRO B 1 243 ? 91.197  56.290 14.642 1.00 55.18 ? 243  PRO B CG  1 
ATOM   4540 C CD  . PRO B 1 243 ? 92.312  55.907 13.683 1.00 55.31 ? 243  PRO B CD  1 
ATOM   4541 N N   . PHE B 1 244 ? 89.675  53.326 12.805 1.00 55.31 ? 244  PHE B N   1 
ATOM   4542 C CA  . PHE B 1 244 ? 88.362  53.004 12.212 1.00 55.08 ? 244  PHE B CA  1 
ATOM   4543 C C   . PHE B 1 244 ? 88.475  51.844 11.182 1.00 55.16 ? 244  PHE B C   1 
ATOM   4544 O O   . PHE B 1 244 ? 89.515  51.618 10.520 1.00 55.42 ? 244  PHE B O   1 
ATOM   4545 C CB  . PHE B 1 244 ? 87.775  54.249 11.547 1.00 54.91 ? 244  PHE B CB  1 
ATOM   4546 C CG  . PHE B 1 244 ? 88.675  54.845 10.495 1.00 54.97 ? 244  PHE B CG  1 
ATOM   4547 C CD1 . PHE B 1 244 ? 89.535  55.888 10.798 1.00 54.60 ? 244  PHE B CD1 1 
ATOM   4548 C CD2 . PHE B 1 244 ? 88.702  54.315 9.206  1.00 55.22 ? 244  PHE B CD2 1 
ATOM   4549 C CE1 . PHE B 1 244 ? 90.342  56.417 9.845  1.00 54.50 ? 244  PHE B CE1 1 
ATOM   4550 C CE2 . PHE B 1 244 ? 89.523  54.844 8.254  1.00 55.46 ? 244  PHE B CE2 1 
ATOM   4551 C CZ  . PHE B 1 244 ? 90.336  55.903 8.574  1.00 55.19 ? 244  PHE B CZ  1 
ATOM   4552 N N   . TYR B 1 245 ? 87.398  51.116 11.020 1.00 54.66 ? 245  TYR B N   1 
ATOM   4553 C CA  . TYR B 1 245 ? 87.452  49.959 10.184 1.00 54.55 ? 245  TYR B CA  1 
ATOM   4554 C C   . TYR B 1 245 ? 87.017  50.451 8.819  1.00 54.29 ? 245  TYR B C   1 
ATOM   4555 O O   . TYR B 1 245 ? 86.099  51.247 8.717  1.00 54.06 ? 245  TYR B O   1 
ATOM   4556 C CB  . TYR B 1 245 ? 86.548  48.907 10.782 1.00 54.83 ? 245  TYR B CB  1 
ATOM   4557 C CG  . TYR B 1 245 ? 87.018  48.402 12.128 1.00 54.54 ? 245  TYR B CG  1 
ATOM   4558 C CD1 . TYR B 1 245 ? 87.303  49.265 13.157 1.00 55.44 ? 245  TYR B CD1 1 
ATOM   4559 C CD2 . TYR B 1 245 ? 87.170  47.056 12.377 1.00 55.21 ? 245  TYR B CD2 1 
ATOM   4560 C CE1 . TYR B 1 245 ? 87.759  48.811 14.402 1.00 55.22 ? 245  TYR B CE1 1 
ATOM   4561 C CE2 . TYR B 1 245 ? 87.631  46.592 13.625 1.00 55.42 ? 245  TYR B CE2 1 
ATOM   4562 C CZ  . TYR B 1 245 ? 87.918  47.499 14.628 1.00 54.93 ? 245  TYR B CZ  1 
ATOM   4563 O OH  . TYR B 1 245 ? 88.359  47.125 15.861 1.00 54.41 ? 245  TYR B OH  1 
ATOM   4564 N N   . ILE B 1 246 ? 87.711  50.059 7.774  1.00 54.05 ? 246  ILE B N   1 
ATOM   4565 C CA  . ILE B 1 246 ? 87.399  50.610 6.480  1.00 54.52 ? 246  ILE B CA  1 
ATOM   4566 C C   . ILE B 1 246 ? 86.786  49.504 5.743  1.00 54.28 ? 246  ILE B C   1 
ATOM   4567 O O   . ILE B 1 246 ? 86.824  48.420 6.276  1.00 54.33 ? 246  ILE B O   1 
ATOM   4568 C CB  . ILE B 1 246 ? 88.612  51.032 5.759  1.00 54.55 ? 246  ILE B CB  1 
ATOM   4569 C CG1 . ILE B 1 246 ? 89.122  49.866 4.930  1.00 54.90 ? 246  ILE B CG1 1 
ATOM   4570 C CG2 . ILE B 1 246 ? 89.662  51.621 6.750  1.00 54.44 ? 246  ILE B CG2 1 
ATOM   4571 C CD1 . ILE B 1 246 ? 90.527  50.089 4.396  1.00 55.73 ? 246  ILE B CD1 1 
ATOM   4572 N N   . THR B 1 247 ? 86.257  49.766 4.540  1.00 54.39 ? 247  THR B N   1 
ATOM   4573 C CA  . THR B 1 247 ? 85.436  48.794 3.791  1.00 54.63 ? 247  THR B CA  1 
ATOM   4574 C C   . THR B 1 247 ? 84.792  49.410 2.580  1.00 54.64 ? 247  THR B C   1 
ATOM   4575 O O   . THR B 1 247 ? 84.673  50.596 2.531  1.00 55.23 ? 247  THR B O   1 
ATOM   4576 C CB  . THR B 1 247 ? 84.314  48.214 4.693  1.00 54.71 ? 247  THR B CB  1 
ATOM   4577 O OG1 . THR B 1 247 ? 83.629  47.131 4.046  1.00 54.86 ? 247  THR B OG1 1 
ATOM   4578 C CG2 . THR B 1 247 ? 83.248  49.262 4.994  1.00 54.72 ? 247  THR B CG2 1 
ATOM   4579 N N   . THR B 1 248 ? 84.340  48.608 1.626  1.00 54.89 ? 248  THR B N   1 
ATOM   4580 C CA  . THR B 1 248 ? 83.850  49.109 0.338  1.00 54.68 ? 248  THR B CA  1 
ATOM   4581 C C   . THR B 1 248 ? 82.484  49.616 0.553  1.00 54.42 ? 248  THR B C   1 
ATOM   4582 O O   . THR B 1 248 ? 81.724  48.969 1.234  1.00 54.26 ? 248  THR B O   1 
ATOM   4583 C CB  . THR B 1 248 ? 83.703  48.000 -0.646 1.00 54.64 ? 248  THR B CB  1 
ATOM   4584 O OG1 . THR B 1 248 ? 82.691  47.128 -0.168 1.00 55.22 ? 248  THR B OG1 1 
ATOM   4585 C CG2 . THR B 1 248 ? 84.894  47.099 -0.695 1.00 54.21 ? 248  THR B CG2 1 
ATOM   4586 N N   . CYS B 1 249 ? 82.139  50.745 -0.037 1.00 54.53 ? 249  CYS B N   1 
ATOM   4587 C CA  . CYS B 1 249 ? 80.853  51.389 0.290  1.00 54.90 ? 249  CYS B CA  1 
ATOM   4588 C C   . CYS B 1 249 ? 79.726  50.728 -0.451 1.00 54.81 ? 249  CYS B C   1 
ATOM   4589 O O   . CYS B 1 249 ? 78.705  50.361 0.119  1.00 53.60 ? 249  CYS B O   1 
ATOM   4590 C CB  . CYS B 1 249 ? 80.876  52.878 -0.059 1.00 55.02 ? 249  CYS B CB  1 
ATOM   4591 S SG  . CYS B 1 249 ? 82.378  53.817 0.413  1.00 54.12 ? 249  CYS B SG  1 
ATOM   4592 N N   . ASN B 1 250 ? 79.968  50.591 -1.755 1.00 55.77 ? 250  ASN B N   1 
ATOM   4593 C CA  . ASN B 1 250 ? 79.074  49.889 -2.751 1.00 56.20 ? 250  ASN B CA  1 
ATOM   4594 C C   . ASN B 1 250 ? 78.980  48.356 -2.524 1.00 56.42 ? 250  ASN B C   1 
ATOM   4595 O O   . ASN B 1 250 ? 78.719  47.598 -3.457 1.00 56.26 ? 250  ASN B O   1 
ATOM   4596 C CB  . ASN B 1 250 ? 79.497  50.191 -4.257 1.00 56.11 ? 250  ASN B CB  1 
ATOM   4597 C CG  . ASN B 1 250 ? 80.977  50.716 -4.417 1.00 55.86 ? 250  ASN B CG  1 
ATOM   4598 O OD1 . ASN B 1 250 ? 81.272  51.907 -4.362 1.00 54.63 ? 250  ASN B OD1 1 
ATOM   4599 N ND2 . ASN B 1 250 ? 81.878  49.804 -4.628 1.00 56.55 ? 250  ASN B ND2 1 
ATOM   4600 N N   . ASN B 1 251 ? 79.220  47.926 -1.284 1.00 56.69 ? 251  ASN B N   1 
ATOM   4601 C CA  . ASN B 1 251 ? 79.321  46.509 -0.946 1.00 56.56 ? 251  ASN B CA  1 
ATOM   4602 C C   . ASN B 1 251 ? 78.029  45.850 -1.371 1.00 56.69 ? 251  ASN B C   1 
ATOM   4603 O O   . ASN B 1 251 ? 77.039  45.864 -0.653 1.00 56.62 ? 251  ASN B O   1 
ATOM   4604 C CB  . ASN B 1 251 ? 79.576  46.310 0.572  1.00 56.71 ? 251  ASN B CB  1 
ATOM   4605 C CG  . ASN B 1 251 ? 79.162  44.926 1.072  1.00 57.01 ? 251  ASN B CG  1 
ATOM   4606 O OD1 . ASN B 1 251 ? 79.154  43.924 0.309  1.00 56.81 ? 251  ASN B OD1 1 
ATOM   4607 N ND2 . ASN B 1 251 ? 78.773  44.871 2.379  1.00 57.30 ? 251  ASN B ND2 1 
ATOM   4608 N N   . LYS B 1 252 ? 78.028  45.320 -2.585 1.00 20.00 ? 252  LYS B N   1 
ATOM   4609 C CA  . LYS B 1 252 ? 76.988  44.402 -3.011 1.00 20.00 ? 252  LYS B CA  1 
ATOM   4610 C C   . LYS B 1 252 ? 76.742  43.628 -1.741 1.00 20.00 ? 252  LYS B C   1 
ATOM   4611 O O   . LYS B 1 252 ? 77.641  42.994 -1.209 1.00 57.02 ? 252  LYS B O   1 
ATOM   4612 C CB  . LYS B 1 252 ? 77.435  43.595 -4.231 1.00 20.00 ? 252  LYS B CB  1 
ATOM   4613 C CG  . LYS B 1 252 ? 78.885  43.166 -4.200 1.00 20.00 ? 252  LYS B CG  1 
ATOM   4614 C CD  . LYS B 1 252 ? 79.159  42.186 -3.068 1.00 20.00 ? 252  LYS B CD  1 
ATOM   4615 C CE  . LYS B 1 252 ? 80.648  41.994 -2.838 1.00 20.00 ? 252  LYS B CE  1 
ATOM   4616 N NZ  . LYS B 1 252 ? 81.312  41.344 -3.995 1.00 20.00 ? 252  LYS B NZ  1 
ATOM   4617 N N   . ASP B 1 253 ? 75.516  43.682 -1.255 1.00 56.63 ? 253  ASP B N   1 
ATOM   4618 C CA  . ASP B 1 253 ? 75.131  42.920 -0.067 1.00 56.68 ? 253  ASP B CA  1 
ATOM   4619 C C   . ASP B 1 253 ? 75.354  43.984 1.068  1.00 56.73 ? 253  ASP B C   1 
ATOM   4620 O O   . ASP B 1 253 ? 76.456  44.127 1.624  1.00 56.32 ? 253  ASP B O   1 
ATOM   4621 C CB  . ASP B 1 253 ? 75.127  41.470 0.442  1.00 56.59 ? 253  ASP B CB  1 
ATOM   4622 C CG  . ASP B 1 253 ? 73.743  41.026 0.863  1.00 57.48 ? 253  ASP B CG  1 
ATOM   4623 O OD1 . ASP B 1 253 ? 73.167  41.715 1.762  1.00 57.96 ? 253  ASP B OD1 1 
ATOM   4624 O OD2 . ASP B 1 253 ? 73.167  40.020 0.344  1.00 57.53 ? 253  ASP B OD2 1 
ATOM   4625 N N   . MET B 1 254 ? 74.311  44.764 1.373  1.00 56.82 ? 254  MET B N   1 
ATOM   4626 C CA  . MET B 1 254 ? 74.421  45.745 2.456  1.00 56.52 ? 254  MET B CA  1 
ATOM   4627 C C   . MET B 1 254 ? 73.337  45.654 3.497  1.00 55.70 ? 254  MET B C   1 
ATOM   4628 O O   . MET B 1 254 ? 72.158  45.924 3.229  1.00 55.08 ? 254  MET B O   1 
ATOM   4629 C CB  . MET B 1 254 ? 74.509  47.152 1.927  1.00 56.43 ? 254  MET B CB  1 
ATOM   4630 C CG  . MET B 1 254 ? 75.579  47.337 0.840  1.00 56.99 ? 254  MET B CG  1 
ATOM   4631 S SD  . MET B 1 254 ? 76.634  48.806 1.109  1.00 58.50 ? 254  MET B SD  1 
ATOM   4632 C CE  . MET B 1 254 ? 76.770  48.606 2.918  1.00 56.93 ? 254  MET B CE  1 
ATOM   4633 N N   . PRO B 1 255 ? 73.781  45.211 4.668  1.00 55.31 ? 255  PRO B N   1 
ATOM   4634 C CA  . PRO B 1 255 ? 72.939  44.991 5.802  1.00 55.29 ? 255  PRO B CA  1 
ATOM   4635 C C   . PRO B 1 255 ? 72.507  46.240 6.469  1.00 55.33 ? 255  PRO B C   1 
ATOM   4636 O O   . PRO B 1 255 ? 73.249  47.215 6.532  1.00 55.51 ? 255  PRO B O   1 
ATOM   4637 C CB  . PRO B 1 255 ? 73.841  44.205 6.734  1.00 55.28 ? 255  PRO B CB  1 
ATOM   4638 C CG  . PRO B 1 255 ? 75.155  44.648 6.406  1.00 54.99 ? 255  PRO B CG  1 
ATOM   4639 C CD  . PRO B 1 255 ? 75.166  44.800 4.951  1.00 55.30 ? 255  PRO B CD  1 
ATOM   4640 N N   . THR B 1 256 ? 71.293  46.206 6.969  1.00 55.46 ? 256  THR B N   1 
ATOM   4641 C CA  . THR B 1 256 ? 70.816  47.292 7.781  1.00 55.59 ? 256  THR B CA  1 
ATOM   4642 C C   . THR B 1 256 ? 70.900  46.934 9.267  1.00 55.63 ? 256  THR B C   1 
ATOM   4643 O O   . THR B 1 256 ? 71.074  45.783 9.639  1.00 56.06 ? 256  THR B O   1 
ATOM   4644 C CB  . THR B 1 256 ? 69.417  47.634 7.423  1.00 55.18 ? 256  THR B CB  1 
ATOM   4645 O OG1 . THR B 1 256 ? 69.043  48.756 8.203  1.00 55.45 ? 256  THR B OG1 1 
ATOM   4646 C CG2 . THR B 1 256 ? 68.463  46.585 7.898  1.00 55.41 ? 256  THR B CG2 1 
ATOM   4647 N N   . LEU B 1 257 ? 70.784  47.925 10.125 1.00 55.59 ? 257  LEU B N   1 
ATOM   4648 C CA  . LEU B 1 257 ? 70.882  47.654 11.540 1.00 55.82 ? 257  LEU B CA  1 
ATOM   4649 C C   . LEU B 1 257 ? 69.506  47.742 12.152 1.00 55.81 ? 257  LEU B C   1 
ATOM   4650 O O   . LEU B 1 257 ? 68.845  48.770 12.060 1.00 55.59 ? 257  LEU B O   1 
ATOM   4651 C CB  . LEU B 1 257 ? 71.847  48.629 12.200 1.00 55.99 ? 257  LEU B CB  1 
ATOM   4652 C CG  . LEU B 1 257 ? 73.283  48.596 11.630 1.00 55.84 ? 257  LEU B CG  1 
ATOM   4653 C CD1 . LEU B 1 257 ? 74.125  49.748 12.199 1.00 55.55 ? 257  LEU B CD1 1 
ATOM   4654 C CD2 . LEU B 1 257 ? 73.929  47.269 11.961 1.00 55.69 ? 257  LEU B CD2 1 
ATOM   4655 N N   . GLU B 1 258 ? 69.086  46.638 12.765 1.00 55.99 ? 258  GLU B N   1 
ATOM   4656 C CA  . GLU B 1 258 ? 67.747  46.503 13.367 1.00 55.90 ? 258  GLU B CA  1 
ATOM   4657 C C   . GLU B 1 258 ? 67.735  46.761 14.870 1.00 55.80 ? 258  GLU B C   1 
ATOM   4658 O O   . GLU B 1 258 ? 68.561  46.247 15.619 1.00 56.12 ? 258  GLU B O   1 
ATOM   4659 C CB  . GLU B 1 258 ? 67.228  45.085 13.167 1.00 55.87 ? 258  GLU B CB  1 
ATOM   4660 C CG  . GLU B 1 258 ? 66.951  44.759 11.702 1.00 56.87 ? 258  GLU B CG  1 
ATOM   4661 C CD  . GLU B 1 258 ? 65.546  45.192 11.244 1.00 57.38 ? 258  GLU B CD  1 
ATOM   4662 O OE1 . GLU B 1 258 ? 65.144  44.747 10.131 1.00 57.21 ? 258  GLU B OE1 1 
ATOM   4663 O OE2 . GLU B 1 258 ? 64.843  45.938 11.994 1.00 55.90 ? 258  GLU B OE2 1 
ATOM   4664 N N   . PHE B 1 259 ? 66.764  47.534 15.304 1.00 55.41 ? 259  PHE B N   1 
ATOM   4665 C CA  . PHE B 1 259 ? 66.563  47.781 16.693 1.00 55.38 ? 259  PHE B CA  1 
ATOM   4666 C C   . PHE B 1 259 ? 65.076  47.581 16.965 1.00 55.72 ? 259  PHE B C   1 
ATOM   4667 O O   . PHE B 1 259 ? 64.223  48.388 16.547 1.00 56.25 ? 259  PHE B O   1 
ATOM   4668 C CB  . PHE B 1 259 ? 67.016  49.183 16.995 1.00 55.35 ? 259  PHE B CB  1 
ATOM   4669 C CG  . PHE B 1 259 ? 68.497  49.389 16.810 1.00 55.53 ? 259  PHE B CG  1 
ATOM   4670 C CD1 . PHE B 1 259 ? 69.375  48.993 17.790 1.00 55.65 ? 259  PHE B CD1 1 
ATOM   4671 C CD2 . PHE B 1 259 ? 69.019  49.996 15.673 1.00 56.16 ? 259  PHE B CD2 1 
ATOM   4672 C CE1 . PHE B 1 259 ? 70.739  49.177 17.650 1.00 55.25 ? 259  PHE B CE1 1 
ATOM   4673 C CE2 . PHE B 1 259 ? 70.410  50.173 15.523 1.00 55.55 ? 259  PHE B CE2 1 
ATOM   4674 C CZ  . PHE B 1 259 ? 71.258  49.762 16.514 1.00 55.46 ? 259  PHE B CZ  1 
ATOM   4675 N N   . LYS B 1 260 ? 64.773  46.487 17.650 1.00 55.62 ? 260  LYS B N   1 
ATOM   4676 C CA  . LYS B 1 260 ? 63.406  46.052 17.846 1.00 55.65 ? 260  LYS B CA  1 
ATOM   4677 C C   . LYS B 1 260 ? 62.851  46.293 19.277 1.00 56.07 ? 260  LYS B C   1 
ATOM   4678 O O   . LYS B 1 260 ? 63.383  45.832 20.316 1.00 56.02 ? 260  LYS B O   1 
ATOM   4679 C CB  . LYS B 1 260 ? 63.277  44.583 17.471 1.00 55.85 ? 260  LYS B CB  1 
ATOM   4680 C CG  . LYS B 1 260 ? 63.655  44.225 16.001 1.00 56.00 ? 260  LYS B CG  1 
ATOM   4681 C CD  . LYS B 1 260 ? 62.705  44.827 14.978 1.00 56.67 ? 260  LYS B CD  1 
ATOM   4682 C CE  . LYS B 1 260 ? 61.179  44.472 15.145 1.00 57.03 ? 260  LYS B CE  1 
ATOM   4683 N NZ  . LYS B 1 260 ? 60.802  43.014 14.967 1.00 58.34 ? 260  LYS B NZ  1 
ATOM   4684 N N   . SER B 1 261 ? 61.761  47.051 19.298 1.00 56.16 ? 261  SER B N   1 
ATOM   4685 C CA  . SER B 1 261 ? 60.934  47.204 20.462 1.00 55.71 ? 261  SER B CA  1 
ATOM   4686 C C   . SER B 1 261 ? 60.007  46.024 20.391 1.00 55.64 ? 261  SER B C   1 
ATOM   4687 O O   . SER B 1 261 ? 59.957  45.296 19.371 1.00 55.10 ? 261  SER B O   1 
ATOM   4688 C CB  . SER B 1 261 ? 60.138  48.502 20.355 1.00 55.98 ? 261  SER B CB  1 
ATOM   4689 O OG  . SER B 1 261 ? 59.054  48.571 21.273 1.00 55.47 ? 261  SER B OG  1 
ATOM   4690 N N   . ALA B 1 262 ? 59.278  45.820 21.480 1.00 55.84 ? 262  ALA B N   1 
ATOM   4691 C CA  . ALA B 1 262 ? 58.202  44.856 21.456 1.00 55.99 ? 262  ALA B CA  1 
ATOM   4692 C C   . ALA B 1 262 ? 57.379  45.080 20.132 1.00 56.21 ? 262  ALA B C   1 
ATOM   4693 O O   . ALA B 1 262 ? 57.288  44.189 19.261 1.00 56.42 ? 262  ALA B O   1 
ATOM   4694 C CB  . ALA B 1 262 ? 57.355  44.992 22.716 1.00 55.56 ? 262  ALA B CB  1 
ATOM   4695 N N   . ASN B 1 263 ? 56.864  46.291 19.935 1.00 56.10 ? 263  ASN B N   1 
ATOM   4696 C CA  . ASN B 1 263 ? 56.017  46.582 18.767 1.00 56.21 ? 263  ASN B CA  1 
ATOM   4697 C C   . ASN B 1 263 ? 56.472  47.734 17.877 1.00 56.80 ? 263  ASN B C   1 
ATOM   4698 O O   . ASN B 1 263 ? 55.658  48.284 17.108 1.00 57.57 ? 263  ASN B O   1 
ATOM   4699 C CB  . ASN B 1 263 ? 54.613  46.869 19.257 1.00 56.17 ? 263  ASN B CB  1 
ATOM   4700 C CG  . ASN B 1 263 ? 54.095  45.747 20.033 1.00 56.16 ? 263  ASN B CG  1 
ATOM   4701 O OD1 . ASN B 1 263 ? 54.704  45.353 21.020 1.00 55.94 ? 263  ASN B OD1 1 
ATOM   4702 N ND2 . ASN B 1 263 ? 53.012  45.144 19.561 1.00 56.10 ? 263  ASN B ND2 1 
ATOM   4703 N N   . ASN B 1 264 ? 57.740  48.138 18.001 1.00 56.52 ? 264  ASN B N   1 
ATOM   4704 C CA  . ASN B 1 264 ? 58.316  49.144 17.117 1.00 55.84 ? 264  ASN B CA  1 
ATOM   4705 C C   . ASN B 1 264 ? 59.523  48.523 16.541 1.00 55.81 ? 264  ASN B C   1 
ATOM   4706 O O   . ASN B 1 264 ? 59.996  47.501 17.027 1.00 55.74 ? 264  ASN B O   1 
ATOM   4707 C CB  . ASN B 1 264 ? 58.667  50.399 17.855 1.00 55.30 ? 264  ASN B CB  1 
ATOM   4708 C CG  . ASN B 1 264 ? 57.507  50.921 18.609 1.00 55.26 ? 264  ASN B CG  1 
ATOM   4709 O OD1 . ASN B 1 264 ? 56.377  50.972 18.074 1.00 53.53 ? 264  ASN B OD1 1 
ATOM   4710 N ND2 . ASN B 1 264 ? 57.743  51.302 19.875 1.00 55.04 ? 264  ASN B ND2 1 
ATOM   4711 N N   . THR B 1 265 ? 59.995  49.099 15.460 1.00 55.94 ? 265  THR B N   1 
ATOM   4712 C CA  . THR B 1 265 ? 61.187  48.568 14.840 1.00 55.73 ? 265  THR B CA  1 
ATOM   4713 C C   . THR B 1 265 ? 61.955  49.716 14.252 1.00 55.69 ? 265  THR B C   1 
ATOM   4714 O O   . THR B 1 265 ? 61.360  50.524 13.533 1.00 56.47 ? 265  THR B O   1 
ATOM   4715 C CB  . THR B 1 265 ? 60.783  47.551 13.781 1.00 55.86 ? 265  THR B CB  1 
ATOM   4716 O OG1 . THR B 1 265 ? 61.941  46.998 13.165 1.00 56.40 ? 265  THR B OG1 1 
ATOM   4717 C CG2 . THR B 1 265 ? 60.071  48.194 12.578 1.00 56.45 ? 265  THR B CG2 1 
ATOM   4718 N N   . TYR B 1 266 ? 63.225  49.843 14.636 1.00 55.11 ? 266  TYR B N   1 
ATOM   4719 C CA  . TYR B 1 266 ? 64.047  50.960 14.226 1.00 55.21 ? 266  TYR B CA  1 
ATOM   4720 C C   . TYR B 1 266 ? 65.164  50.433 13.388 1.00 55.61 ? 266  TYR B C   1 
ATOM   4721 O O   . TYR B 1 266 ? 65.819  49.490 13.809 1.00 56.35 ? 266  TYR B O   1 
ATOM   4722 C CB  . TYR B 1 266 ? 64.610  51.633 15.430 1.00 54.57 ? 266  TYR B CB  1 
ATOM   4723 C CG  . TYR B 1 266 ? 63.556  52.134 16.313 1.00 54.43 ? 266  TYR B CG  1 
ATOM   4724 C CD1 . TYR B 1 266 ? 62.674  53.111 15.887 1.00 54.78 ? 266  TYR B CD1 1 
ATOM   4725 C CD2 . TYR B 1 266 ? 63.421  51.650 17.591 1.00 55.22 ? 266  TYR B CD2 1 
ATOM   4726 C CE1 . TYR B 1 266 ? 61.674  53.603 16.723 1.00 54.95 ? 266  TYR B CE1 1 
ATOM   4727 C CE2 . TYR B 1 266 ? 62.414  52.144 18.445 1.00 55.71 ? 266  TYR B CE2 1 
ATOM   4728 C CZ  . TYR B 1 266 ? 61.554  53.116 17.992 1.00 54.98 ? 266  TYR B CZ  1 
ATOM   4729 O OH  . TYR B 1 266 ? 60.557  53.574 18.797 1.00 54.51 ? 266  TYR B OH  1 
ATOM   4730 N N   . THR B 1 267 ? 65.387  50.988 12.198 1.00 55.63 ? 267  THR B N   1 
ATOM   4731 C CA  . THR B 1 267 ? 66.434  50.430 11.329 1.00 55.60 ? 267  THR B CA  1 
ATOM   4732 C C   . THR B 1 267 ? 67.355  51.502 10.891 1.00 55.74 ? 267  THR B C   1 
ATOM   4733 O O   . THR B 1 267 ? 66.938  52.664 10.794 1.00 55.84 ? 267  THR B O   1 
ATOM   4734 C CB  . THR B 1 267 ? 65.910  49.809 10.054 1.00 55.29 ? 267  THR B CB  1 
ATOM   4735 O OG1 . THR B 1 267 ? 65.578  50.847 9.132  1.00 54.83 ? 267  THR B OG1 1 
ATOM   4736 C CG2 . THR B 1 267 ? 64.672  49.061 10.299 1.00 55.33 ? 267  THR B CG2 1 
ATOM   4737 N N   . LEU B 1 268 ? 68.581  51.081 10.563 1.00 55.63 ? 268  LEU B N   1 
ATOM   4738 C CA  . LEU B 1 268 ? 69.622  51.988 10.136 1.00 55.34 ? 268  LEU B CA  1 
ATOM   4739 C C   . LEU B 1 268 ? 70.228  51.385 8.931  1.00 55.40 ? 268  LEU B C   1 
ATOM   4740 O O   . LEU B 1 268 ? 70.823  50.315 9.047  1.00 55.76 ? 268  LEU B O   1 
ATOM   4741 C CB  . LEU B 1 268 ? 70.688  52.158 11.216 1.00 55.40 ? 268  LEU B CB  1 
ATOM   4742 C CG  . LEU B 1 268 ? 71.122  53.600 11.402 1.00 55.21 ? 268  LEU B CG  1 
ATOM   4743 C CD1 . LEU B 1 268 ? 69.944  54.561 11.264 1.00 54.20 ? 268  LEU B CD1 1 
ATOM   4744 C CD2 . LEU B 1 268 ? 71.852  53.805 12.743 1.00 55.00 ? 268  LEU B CD2 1 
ATOM   4745 N N   . GLU B 1 269 ? 70.034  52.050 7.783  1.00 55.26 ? 269  GLU B N   1 
ATOM   4746 C CA  . GLU B 1 269 ? 70.538  51.608 6.477  1.00 55.18 ? 269  GLU B CA  1 
ATOM   4747 C C   . GLU B 1 269 ? 72.077  51.635 6.484  1.00 55.04 ? 269  GLU B C   1 
ATOM   4748 O O   . GLU B 1 269 ? 72.689  52.184 7.392  1.00 54.69 ? 269  GLU B O   1 
ATOM   4749 C CB  . GLU B 1 269 ? 70.000  52.541 5.386  1.00 55.21 ? 269  GLU B CB  1 
ATOM   4750 C CG  . GLU B 1 269 ? 68.583  52.299 4.863  1.00 55.20 ? 269  GLU B CG  1 
ATOM   4751 C CD  . GLU B 1 269 ? 67.510  52.587 5.875  1.00 55.77 ? 269  GLU B CD  1 
ATOM   4752 O OE1 . GLU B 1 269 ? 66.900  53.699 5.912  1.00 55.13 ? 269  GLU B OE1 1 
ATOM   4753 O OE2 . GLU B 1 269 ? 67.299  51.662 6.658  1.00 56.98 ? 269  GLU B OE2 1 
ATOM   4754 N N   . PRO B 1 270 ? 72.720  51.095 5.463  1.00 55.29 ? 270  PRO B N   1 
ATOM   4755 C CA  . PRO B 1 270 ? 74.176  51.138 5.435  1.00 55.42 ? 270  PRO B CA  1 
ATOM   4756 C C   . PRO B 1 270 ? 74.745  52.542 5.218  1.00 55.19 ? 270  PRO B C   1 
ATOM   4757 O O   . PRO B 1 270 ? 75.874  52.821 5.583  1.00 55.04 ? 270  PRO B O   1 
ATOM   4758 C CB  . PRO B 1 270 ? 74.533  50.255 4.247  1.00 55.42 ? 270  PRO B CB  1 
ATOM   4759 C CG  . PRO B 1 270 ? 73.279  49.595 3.871  1.00 55.66 ? 270  PRO B CG  1 
ATOM   4760 C CD  . PRO B 1 270 ? 72.178  50.501 4.234  1.00 55.28 ? 270  PRO B CD  1 
ATOM   4761 N N   . GLU B 1 271 ? 73.963  53.405 4.601  1.00 54.99 ? 271  GLU B N   1 
ATOM   4762 C CA  . GLU B 1 271 ? 74.408  54.747 4.358  1.00 54.88 ? 271  GLU B CA  1 
ATOM   4763 C C   . GLU B 1 271 ? 74.443  55.603 5.613  1.00 54.30 ? 271  GLU B C   1 
ATOM   4764 O O   . GLU B 1 271 ? 75.014  56.642 5.587  1.00 53.87 ? 271  GLU B O   1 
ATOM   4765 C CB  . GLU B 1 271 ? 73.537  55.400 3.275  1.00 55.17 ? 271  GLU B CB  1 
ATOM   4766 C CG  . GLU B 1 271 ? 72.135  55.780 3.717  1.00 55.42 ? 271  GLU B CG  1 
ATOM   4767 C CD  . GLU B 1 271 ? 71.245  56.188 2.574  1.00 55.05 ? 271  GLU B CD  1 
ATOM   4768 O OE1 . GLU B 1 271 ? 71.186  55.377 1.611  1.00 56.03 ? 271  GLU B OE1 1 
ATOM   4769 O OE2 . GLU B 1 271 ? 70.603  57.284 2.671  1.00 54.53 ? 271  GLU B OE2 1 
ATOM   4770 N N   . TYR B 1 272 ? 73.840  55.187 6.711  1.00 54.39 ? 272  TYR B N   1 
ATOM   4771 C CA  . TYR B 1 272 ? 73.804  56.033 7.910  1.00 54.61 ? 272  TYR B CA  1 
ATOM   4772 C C   . TYR B 1 272 ? 74.917  55.703 8.884  1.00 54.60 ? 272  TYR B C   1 
ATOM   4773 O O   . TYR B 1 272 ? 74.971  56.244 10.001 1.00 54.06 ? 272  TYR B O   1 
ATOM   4774 C CB  . TYR B 1 272 ? 72.476  55.905 8.630  1.00 54.68 ? 272  TYR B CB  1 
ATOM   4775 C CG  . TYR B 1 272 ? 71.345  56.610 7.975  1.00 54.39 ? 272  TYR B CG  1 
ATOM   4776 C CD1 . TYR B 1 272 ? 70.413  55.923 7.234  1.00 54.97 ? 272  TYR B CD1 1 
ATOM   4777 C CD2 . TYR B 1 272 ? 71.193  57.958 8.108  1.00 54.04 ? 272  TYR B CD2 1 
ATOM   4778 C CE1 . TYR B 1 272 ? 69.358  56.568 6.617  1.00 55.21 ? 272  TYR B CE1 1 
ATOM   4779 C CE2 . TYR B 1 272 ? 70.149  58.611 7.512  1.00 54.25 ? 272  TYR B CE2 1 
ATOM   4780 C CZ  . TYR B 1 272 ? 69.227  57.914 6.765  1.00 55.07 ? 272  TYR B CZ  1 
ATOM   4781 O OH  . TYR B 1 272 ? 68.177  58.570 6.155  1.00 55.52 ? 272  TYR B OH  1 
ATOM   4782 N N   . TYR B 1 273 ? 75.783  54.786 8.459  1.00 54.95 ? 273  TYR B N   1 
ATOM   4783 C CA  . TYR B 1 273 ? 76.922  54.366 9.251  1.00 54.71 ? 273  TYR B CA  1 
ATOM   4784 C C   . TYR B 1 273 ? 78.256  54.490 8.561  1.00 54.22 ? 273  TYR B C   1 
ATOM   4785 O O   . TYR B 1 273 ? 79.274  54.302 9.168  1.00 54.50 ? 273  TYR B O   1 
ATOM   4786 C CB  . TYR B 1 273 ? 76.640  53.086 10.058 1.00 54.82 ? 273  TYR B CB  1 
ATOM   4787 C CG  . TYR B 1 273 ? 76.372  51.799 9.312  1.00 54.18 ? 273  TYR B CG  1 
ATOM   4788 C CD1 . TYR B 1 273 ? 77.397  50.941 9.000  1.00 53.69 ? 273  TYR B CD1 1 
ATOM   4789 C CD2 . TYR B 1 273 ? 75.081  51.418 9.007  1.00 54.10 ? 273  TYR B CD2 1 
ATOM   4790 C CE1 . TYR B 1 273 ? 77.162  49.781 8.363  1.00 53.73 ? 273  TYR B CE1 1 
ATOM   4791 C CE2 . TYR B 1 273 ? 74.836  50.245 8.368  1.00 54.30 ? 273  TYR B CE2 1 
ATOM   4792 C CZ  . TYR B 1 273 ? 75.888  49.427 8.048  1.00 53.79 ? 273  TYR B CZ  1 
ATOM   4793 O OH  . TYR B 1 273 ? 75.679  48.256 7.390  1.00 53.79 ? 273  TYR B OH  1 
ATOM   4794 N N   . MET B 1 274 ? 78.259  54.837 7.300  1.00 53.89 ? 274  MET B N   1 
ATOM   4795 C CA  . MET B 1 274 ? 79.434  54.727 6.503  1.00 53.93 ? 274  MET B CA  1 
ATOM   4796 C C   . MET B 1 274 ? 79.846  56.058 5.931  1.00 54.46 ? 274  MET B C   1 
ATOM   4797 O O   . MET B 1 274 ? 79.040  56.931 5.730  1.00 54.77 ? 274  MET B O   1 
ATOM   4798 C CB  . MET B 1 274 ? 79.163  53.844 5.329  1.00 54.35 ? 274  MET B CB  1 
ATOM   4799 C CG  . MET B 1 274 ? 78.985  52.420 5.627  1.00 53.95 ? 274  MET B CG  1 
ATOM   4800 S SD  . MET B 1 274 ? 79.496  51.624 4.160  1.00 51.57 ? 274  MET B SD  1 
ATOM   4801 C CE  . MET B 1 274 ? 78.427  52.425 2.983  1.00 54.41 ? 274  MET B CE  1 
ATOM   4802 N N   . GLU B 1 275 ? 81.110  56.205 5.617  1.00 54.79 ? 275  GLU B N   1 
ATOM   4803 C CA  . GLU B 1 275 ? 81.575  57.452 5.069  1.00 55.13 ? 275  GLU B CA  1 
ATOM   4804 C C   . GLU B 1 275 ? 82.684  57.161 4.086  1.00 54.86 ? 275  GLU B C   1 
ATOM   4805 O O   . GLU B 1 275 ? 83.658  56.520 4.428  1.00 55.19 ? 275  GLU B O   1 
ATOM   4806 C CB  . GLU B 1 275 ? 82.086  58.375 6.194  1.00 55.35 ? 275  GLU B CB  1 
ATOM   4807 C CG  . GLU B 1 275 ? 81.216  59.578 6.555  1.00 55.50 ? 275  GLU B CG  1 
ATOM   4808 C CD  . GLU B 1 275 ? 81.135  60.661 5.448  1.00 57.26 ? 275  GLU B CD  1 
ATOM   4809 O OE1 . GLU B 1 275 ? 80.244  60.499 4.571  1.00 58.02 ? 275  GLU B OE1 1 
ATOM   4810 O OE2 . GLU B 1 275 ? 81.935  61.685 5.440  1.00 57.06 ? 275  GLU B OE2 1 
ATOM   4811 N N   . PRO B 1 276 ? 82.543  57.576 2.841  1.00 54.71 ? 276  PRO B N   1 
ATOM   4812 C CA  . PRO B 1 276 ? 83.724  57.642 2.003  1.00 55.00 ? 276  PRO B CA  1 
ATOM   4813 C C   . PRO B 1 276 ? 84.906  57.782 2.931  1.00 55.09 ? 276  PRO B C   1 
ATOM   4814 O O   . PRO B 1 276 ? 84.692  58.042 4.101  1.00 55.28 ? 276  PRO B O   1 
ATOM   4815 C CB  . PRO B 1 276 ? 83.484  58.915 1.225  1.00 54.95 ? 276  PRO B CB  1 
ATOM   4816 C CG  . PRO B 1 276 ? 82.056  58.878 0.988  1.00 55.04 ? 276  PRO B CG  1 
ATOM   4817 C CD  . PRO B 1 276 ? 81.422  58.278 2.207  1.00 54.65 ? 276  PRO B CD  1 
ATOM   4818 N N   . LEU B 1 277 ? 86.118  57.587 2.438  1.00 54.86 ? 277  LEU B N   1 
ATOM   4819 C CA  . LEU B 1 277 ? 87.281  57.690 3.292  1.00 54.69 ? 277  LEU B CA  1 
ATOM   4820 C C   . LEU B 1 277 ? 87.899  59.049 3.174  1.00 54.60 ? 277  LEU B C   1 
ATOM   4821 O O   . LEU B 1 277 ? 88.659  59.473 4.036  1.00 53.26 ? 277  LEU B O   1 
ATOM   4822 C CB  . LEU B 1 277 ? 88.316  56.643 2.938  1.00 54.77 ? 277  LEU B CB  1 
ATOM   4823 C CG  . LEU B 1 277 ? 88.769  55.803 4.121  1.00 54.64 ? 277  LEU B CG  1 
ATOM   4824 C CD1 . LEU B 1 277 ? 89.889  54.907 3.730  1.00 54.38 ? 277  LEU B CD1 1 
ATOM   4825 C CD2 . LEU B 1 277 ? 89.155  56.681 5.264  1.00 55.21 ? 277  LEU B CD2 1 
ATOM   4826 N N   . LEU B 1 278 ? 87.582  59.744 2.086  1.00 55.56 ? 278  LEU B N   1 
ATOM   4827 C CA  . LEU B 1 278 ? 88.537  59.946 1.004  1.00 56.79 ? 278  LEU B CA  1 
ATOM   4828 C C   . LEU B 1 278 ? 87.872  60.567 -0.220 1.00 56.76 ? 278  LEU B C   1 
ATOM   4829 O O   . LEU B 1 278 ? 88.428  60.541 -1.318 1.00 56.39 ? 278  LEU B O   1 
ATOM   4830 C CB  . LEU B 1 278 ? 89.206  58.623 0.626  1.00 57.40 ? 278  LEU B CB  1 
ATOM   4831 C CG  . LEU B 1 278 ? 89.516  58.421 -0.859 1.00 57.17 ? 278  LEU B CG  1 
ATOM   4832 C CD1 . LEU B 1 278 ? 90.649  59.335 -1.301 1.00 56.10 ? 278  LEU B CD1 1 
ATOM   4833 C CD2 . LEU B 1 278 ? 89.854  56.965 -1.145 1.00 56.79 ? 278  LEU B CD2 1 
ATOM   4834 N N   . ASP B 1 279 ? 86.674  61.027 -0.009 1.00 56.24 ? 279  ASP B N   1 
ATOM   4835 C CA  . ASP B 1 279 ? 86.392  62.395 -0.380 1.00 56.47 ? 279  ASP B CA  1 
ATOM   4836 C C   . ASP B 1 279 ? 86.678  62.781 -1.829 1.00 56.27 ? 279  ASP B C   1 
ATOM   4837 O O   . ASP B 1 279 ? 86.716  63.960 -2.170 1.00 56.39 ? 279  ASP B O   1 
ATOM   4838 C CB  . ASP B 1 279 ? 87.485  63.304 0.159  1.00 57.04 ? 279  ASP B CB  1 
ATOM   4839 C CG  . ASP B 1 279 ? 87.174  64.764 -0.023 1.00 55.98 ? 279  ASP B CG  1 
ATOM   4840 O OD1 . ASP B 1 279 ? 86.104  65.078 -0.589 1.00 53.82 ? 279  ASP B OD1 1 
ATOM   4841 O OD2 . ASP B 1 279 ? 87.932  65.665 0.384  1.00 55.91 ? 279  ASP B OD2 1 
ATOM   4842 N N   . ILE B 1 280 ? 86.887  61.850 -2.684 1.00 55.62 ? 280  ILE B N   1 
ATOM   4843 C CA  . ILE B 1 280 ? 87.238  62.073 -4.081 1.00 55.31 ? 280  ILE B CA  1 
ATOM   4844 C C   . ILE B 1 280 ? 86.551  60.909 -4.786 1.00 55.11 ? 280  ILE B C   1 
ATOM   4845 O O   . ILE B 1 280 ? 86.161  61.017 -5.948 1.00 55.07 ? 280  ILE B O   1 
ATOM   4846 C CB  . ILE B 1 280 ? 88.708  62.170 -4.530 1.00 55.24 ? 280  ILE B CB  1 
ATOM   4847 C CG1 . ILE B 1 280 ? 89.009  61.120 -5.602 1.00 55.64 ? 280  ILE B CG1 1 
ATOM   4848 C CG2 . ILE B 1 280 ? 89.641  62.005 -3.341 1.00 54.61 ? 280  ILE B CG2 1 
ATOM   4849 C CD1 . ILE B 1 280 ? 88.693  59.704 -5.175 1.00 55.61 ? 280  ILE B CD1 1 
ATOM   4850 N N   . ASP B 1 281 ? 86.406  59.795 -4.074 1.00 55.12 ? 281  ASP B N   1 
ATOM   4851 C CA  . ASP B 1 281 ? 85.959  58.549 -4.685 1.00 55.17 ? 281  ASP B CA  1 
ATOM   4852 C C   . ASP B 1 281 ? 85.346  57.614 -3.646 1.00 55.16 ? 281  ASP B C   1 
ATOM   4853 O O   . ASP B 1 281 ? 85.844  57.506 -2.524 1.00 54.97 ? 281  ASP B O   1 
ATOM   4854 C CB  . ASP B 1 281 ? 87.122  57.853 -5.395 1.00 54.64 ? 281  ASP B CB  1 
ATOM   4855 C CG  . ASP B 1 281 ? 87.261  56.397 -4.997 1.00 53.92 ? 281  ASP B CG  1 
ATOM   4856 O OD1 . ASP B 1 281 ? 87.392  55.542 -5.898 1.00 52.90 ? 281  ASP B OD1 1 
ATOM   4857 O OD2 . ASP B 1 281 ? 87.252  56.013 -3.808 1.00 54.60 ? 281  ASP B OD2 1 
ATOM   4858 N N   . ASP B 1 282 ? 84.265  56.943 -4.027 1.00 55.25 ? 282  ASP B N   1 
ATOM   4859 C CA  . ASP B 1 282 ? 83.395  56.282 -3.061 1.00 55.41 ? 282  ASP B CA  1 
ATOM   4860 C C   . ASP B 1 282 ? 83.651  54.779 -3.028 1.00 55.01 ? 282  ASP B C   1 
ATOM   4861 O O   . ASP B 1 282 ? 82.732  53.988 -2.814 1.00 54.63 ? 282  ASP B O   1 
ATOM   4862 C CB  . ASP B 1 282 ? 81.925  56.558 -3.387 1.00 55.58 ? 282  ASP B CB  1 
ATOM   4863 C CG  . ASP B 1 282 ? 81.550  56.131 -4.793 1.00 57.20 ? 282  ASP B CG  1 
ATOM   4864 O OD1 . ASP B 1 282 ? 81.982  55.039 -5.220 1.00 58.60 ? 282  ASP B OD1 1 
ATOM   4865 O OD2 . ASP B 1 282 ? 80.830  56.822 -5.543 1.00 58.04 ? 282  ASP B OD2 1 
ATOM   4866 N N   . THR B 1 283 ? 84.905  54.393 -3.238 1.00 54.80 ? 283  THR B N   1 
ATOM   4867 C CA  . THR B 1 283 ? 85.277  52.984 -3.268 1.00 54.55 ? 283  THR B CA  1 
ATOM   4868 C C   . THR B 1 283 ? 85.384  52.411 -1.859 1.00 54.13 ? 283  THR B C   1 
ATOM   4869 O O   . THR B 1 283 ? 84.749  51.408 -1.537 1.00 53.47 ? 283  THR B O   1 
ATOM   4870 C CB  . THR B 1 283 ? 86.609  52.793 -4.019 1.00 54.54 ? 283  THR B CB  1 
ATOM   4871 O OG1 . THR B 1 283 ? 87.004  51.417 -3.957 1.00 54.75 ? 283  THR B OG1 1 
ATOM   4872 C CG2 . THR B 1 283 ? 87.736  53.514 -3.295 1.00 54.98 ? 283  THR B CG2 1 
ATOM   4873 N N   . LEU B 1 284 ? 86.192  53.056 -1.023 1.00 54.48 ? 284  LEU B N   1 
ATOM   4874 C CA  . LEU B 1 284 ? 86.373  52.622 0.352  1.00 54.54 ? 284  LEU B CA  1 
ATOM   4875 C C   . LEU B 1 284 ? 85.622  53.502 1.298  1.00 54.33 ? 284  LEU B C   1 
ATOM   4876 O O   . LEU B 1 284 ? 85.476  54.681 1.071  1.00 54.44 ? 284  LEU B O   1 
ATOM   4877 C CB  . LEU B 1 284 ? 87.830  52.701 0.771  1.00 54.53 ? 284  LEU B CB  1 
ATOM   4878 C CG  . LEU B 1 284 ? 88.777  51.743 0.086  1.00 54.69 ? 284  LEU B CG  1 
ATOM   4879 C CD1 . LEU B 1 284 ? 90.153  51.892 0.648  1.00 54.94 ? 284  LEU B CD1 1 
ATOM   4880 C CD2 . LEU B 1 284 ? 88.319  50.332 0.237  1.00 55.03 ? 284  LEU B CD2 1 
ATOM   4881 N N   . CYS B 1 285 ? 85.215  52.922 2.406  1.00 54.09 ? 285  CYS B N   1 
ATOM   4882 C CA  . CYS B 1 285 ? 84.394  53.598 3.352  1.00 53.98 ? 285  CYS B CA  1 
ATOM   4883 C C   . CYS B 1 285 ? 84.924  53.374 4.725  1.00 54.08 ? 285  CYS B C   1 
ATOM   4884 O O   . CYS B 1 285 ? 85.585  52.407 4.987  1.00 54.24 ? 285  CYS B O   1 
ATOM   4885 C CB  . CYS B 1 285 ? 82.987  53.068 3.303  1.00 53.96 ? 285  CYS B CB  1 
ATOM   4886 S SG  . CYS B 1 285 ? 81.953  54.079 2.315  1.00 52.68 ? 285  CYS B SG  1 
ATOM   4887 N N   . MET B 1 286 ? 84.617  54.315 5.592  1.00 54.43 ? 286  MET B N   1 
ATOM   4888 C CA  . MET B 1 286 ? 84.945  54.258 6.978  1.00 54.53 ? 286  MET B CA  1 
ATOM   4889 C C   . MET B 1 286 ? 83.622  53.952 7.681  1.00 54.66 ? 286  MET B C   1 
ATOM   4890 O O   . MET B 1 286 ? 82.644  54.628 7.446  1.00 54.60 ? 286  MET B O   1 
ATOM   4891 C CB  . MET B 1 286 ? 85.444  55.625 7.416  1.00 54.44 ? 286  MET B CB  1 
ATOM   4892 C CG  . MET B 1 286 ? 84.986  55.969 8.808  1.00 54.70 ? 286  MET B CG  1 
ATOM   4893 S SD  . MET B 1 286 ? 85.579  57.557 9.336  1.00 54.90 ? 286  MET B SD  1 
ATOM   4894 C CE  . MET B 1 286 ? 84.936  58.719 8.151  1.00 54.31 ? 286  MET B CE  1 
ATOM   4895 N N   . LEU B 1 287 ? 83.602  52.952 8.552  1.00 54.84 ? 287  LEU B N   1 
ATOM   4896 C CA  . LEU B 1 287 ? 82.416  52.612 9.356  1.00 54.69 ? 287  LEU B CA  1 
ATOM   4897 C C   . LEU B 1 287 ? 82.293  53.379 10.658 1.00 54.50 ? 287  LEU B C   1 
ATOM   4898 O O   . LEU B 1 287 ? 83.291  53.681 11.286 1.00 55.11 ? 287  LEU B O   1 
ATOM   4899 C CB  . LEU B 1 287 ? 82.496  51.137 9.715  1.00 54.86 ? 287  LEU B CB  1 
ATOM   4900 C CG  . LEU B 1 287 ? 82.315  50.199 8.527  1.00 55.23 ? 287  LEU B CG  1 
ATOM   4901 C CD1 . LEU B 1 287 ? 82.566  48.818 8.978  1.00 55.56 ? 287  LEU B CD1 1 
ATOM   4902 C CD2 . LEU B 1 287 ? 80.913  50.287 7.975  1.00 55.66 ? 287  LEU B CD2 1 
ATOM   4903 N N   . TYR B 1 288 ? 81.087  53.639 11.128 1.00 54.31 ? 288  TYR B N   1 
ATOM   4904 C CA  . TYR B 1 288 ? 80.953  54.310 12.434 1.00 54.71 ? 288  TYR B CA  1 
ATOM   4905 C C   . TYR B 1 288 ? 80.755  53.384 13.627 1.00 54.82 ? 288  TYR B C   1 
ATOM   4906 O O   . TYR B 1 288 ? 80.428  53.842 14.738 1.00 54.90 ? 288  TYR B O   1 
ATOM   4907 C CB  . TYR B 1 288 ? 79.808  55.276 12.438 1.00 54.89 ? 288  TYR B CB  1 
ATOM   4908 C CG  . TYR B 1 288 ? 79.996  56.457 11.521 1.00 55.30 ? 288  TYR B CG  1 
ATOM   4909 C CD1 . TYR B 1 288 ? 79.051  56.731 10.546 1.00 56.18 ? 288  TYR B CD1 1 
ATOM   4910 C CD2 . TYR B 1 288 ? 81.083  57.286 11.607 1.00 54.33 ? 288  TYR B CD2 1 
ATOM   4911 C CE1 . TYR B 1 288 ? 79.165  57.782 9.706  1.00 55.16 ? 288  TYR B CE1 1 
ATOM   4912 C CE2 . TYR B 1 288 ? 81.210  58.348 10.769 1.00 54.99 ? 288  TYR B CE2 1 
ATOM   4913 C CZ  . TYR B 1 288 ? 80.240  58.598 9.814  1.00 55.09 ? 288  TYR B CZ  1 
ATOM   4914 O OH  . TYR B 1 288 ? 80.327  59.679 8.957  1.00 55.87 ? 288  TYR B OH  1 
ATOM   4915 N N   . ILE B 1 289 ? 80.993  52.099 13.407 1.00 54.45 ? 289  ILE B N   1 
ATOM   4916 C CA  . ILE B 1 289 ? 80.818  51.094 14.405 1.00 54.15 ? 289  ILE B CA  1 
ATOM   4917 C C   . ILE B 1 289 ? 82.131  50.743 15.027 1.00 54.16 ? 289  ILE B C   1 
ATOM   4918 O O   . ILE B 1 289 ? 83.127  50.629 14.324 1.00 54.45 ? 289  ILE B O   1 
ATOM   4919 C CB  . ILE B 1 289 ? 80.306  49.924 13.703 1.00 54.22 ? 289  ILE B CB  1 
ATOM   4920 C CG1 . ILE B 1 289 ? 79.068  50.349 12.950 1.00 54.49 ? 289  ILE B CG1 1 
ATOM   4921 C CG2 . ILE B 1 289 ? 79.988  48.824 14.665 1.00 54.92 ? 289  ILE B CG2 1 
ATOM   4922 C CD1 . ILE B 1 289 ? 78.766  49.502 11.829 1.00 55.17 ? 289  ILE B CD1 1 
ATOM   4923 N N   . LEU B 1 290 ? 82.145  50.556 16.337 1.00 54.32 ? 290  LEU B N   1 
ATOM   4924 C CA  . LEU B 1 290 ? 83.373  50.246 17.067 1.00 54.40 ? 290  LEU B CA  1 
ATOM   4925 C C   . LEU B 1 290 ? 83.086  49.360 18.234 1.00 54.19 ? 290  LEU B C   1 
ATOM   4926 O O   . LEU B 1 290 ? 82.076  49.504 18.902 1.00 53.69 ? 290  LEU B O   1 
ATOM   4927 C CB  . LEU B 1 290 ? 84.033  51.525 17.574 1.00 54.50 ? 290  LEU B CB  1 
ATOM   4928 C CG  . LEU B 1 290 ? 84.681  52.394 16.488 1.00 55.06 ? 290  LEU B CG  1 
ATOM   4929 C CD1 . LEU B 1 290 ? 85.463  53.514 17.139 1.00 55.30 ? 290  LEU B CD1 1 
ATOM   4930 C CD2 . LEU B 1 290 ? 85.630  51.576 15.622 1.00 55.35 ? 290  LEU B CD2 1 
ATOM   4931 N N   . PRO B 1 291 ? 83.960  48.404 18.475 1.00 54.49 ? 291  PRO B N   1 
ATOM   4932 C CA  . PRO B 1 291 ? 83.778  47.526 19.597 1.00 54.76 ? 291  PRO B CA  1 
ATOM   4933 C C   . PRO B 1 291 ? 84.229  48.148 20.885 1.00 55.03 ? 291  PRO B C   1 
ATOM   4934 O O   . PRO B 1 291 ? 85.384  48.573 20.988 1.00 55.19 ? 291  PRO B O   1 
ATOM   4935 C CB  . PRO B 1 291 ? 84.650  46.345 19.246 1.00 54.49 ? 291  PRO B CB  1 
ATOM   4936 C CG  . PRO B 1 291 ? 85.697  46.887 18.455 1.00 54.16 ? 291  PRO B CG  1 
ATOM   4937 C CD  . PRO B 1 291 ? 85.115  47.995 17.668 1.00 54.49 ? 291  PRO B CD  1 
ATOM   4938 N N   . VAL B 1 292 ? 83.290  48.238 21.826 1.00 55.07 ? 292  VAL B N   1 
ATOM   4939 C CA  . VAL B 1 292 ? 83.516  48.737 23.161 1.00 55.00 ? 292  VAL B CA  1 
ATOM   4940 C C   . VAL B 1 292 ? 82.828  47.805 24.140 1.00 55.19 ? 292  VAL B C   1 
ATOM   4941 O O   . VAL B 1 292 ? 81.711  47.347 23.895 1.00 55.21 ? 292  VAL B O   1 
ATOM   4942 C CB  . VAL B 1 292 ? 82.913  50.114 23.364 1.00 54.75 ? 292  VAL B CB  1 
ATOM   4943 C CG1 . VAL B 1 292 ? 83.430  50.708 24.626 1.00 55.29 ? 292  VAL B CG1 1 
ATOM   4944 C CG2 . VAL B 1 292 ? 83.304  51.022 22.246 1.00 55.66 ? 292  VAL B CG2 1 
ATOM   4945 N N   . ASP B 1 293 ? 83.497  47.563 25.271 1.00 55.24 ? 293  ASP B N   1 
ATOM   4946 C CA  . ASP B 1 293 ? 83.024  46.624 26.274 1.00 55.09 ? 293  ASP B CA  1 
ATOM   4947 C C   . ASP B 1 293 ? 82.525  47.197 27.572 1.00 54.88 ? 293  ASP B C   1 
ATOM   4948 O O   . ASP B 1 293 ? 83.091  46.922 28.615 1.00 54.64 ? 293  ASP B O   1 
ATOM   4949 C CB  . ASP B 1 293 ? 84.135  45.672 26.601 1.00 55.18 ? 293  ASP B CB  1 
ATOM   4950 C CG  . ASP B 1 293 ? 84.397  44.728 25.480 1.00 56.28 ? 293  ASP B CG  1 
ATOM   4951 O OD1 . ASP B 1 293 ? 83.403  44.196 24.880 1.00 56.95 ? 293  ASP B OD1 1 
ATOM   4952 O OD2 . ASP B 1 293 ? 85.568  44.477 25.115 1.00 56.87 ? 293  ASP B OD2 1 
ATOM   4953 N N   . ILE B 1 294 ? 81.416  47.920 27.518 1.00 54.87 ? 294  ILE B N   1 
ATOM   4954 C CA  . ILE B 1 294 ? 80.817  48.494 28.714 1.00 55.06 ? 294  ILE B CA  1 
ATOM   4955 C C   . ILE B 1 294 ? 80.334  47.386 29.623 1.00 55.20 ? 294  ILE B C   1 
ATOM   4956 O O   . ILE B 1 294 ? 80.874  47.191 30.701 1.00 55.06 ? 294  ILE B O   1 
ATOM   4957 C CB  . ILE B 1 294 ? 79.616  49.350 28.403 1.00 54.99 ? 294  ILE B CB  1 
ATOM   4958 C CG1 . ILE B 1 294 ? 79.973  50.399 27.364 1.00 55.88 ? 294  ILE B CG1 1 
ATOM   4959 C CG2 . ILE B 1 294 ? 79.096  49.973 29.677 1.00 54.87 ? 294  ILE B CG2 1 
ATOM   4960 C CD1 . ILE B 1 294 ? 79.843  49.893 25.876 1.00 56.83 ? 294  ILE B CD1 1 
ATOM   4961 N N   . ASP B 1 295 ? 79.327  46.758 29.129 1.00 55.14 ? 295  ASP B N   1 
ATOM   4962 C CA  . ASP B 1 295 ? 78.764  45.650 29.696 1.00 55.17 ? 295  ASP B CA  1 
ATOM   4963 C C   . ASP B 1 295 ? 78.810  44.636 28.618 1.00 55.61 ? 295  ASP B C   1 
ATOM   4964 O O   . ASP B 1 295 ? 79.628  44.700 27.711 1.00 56.10 ? 295  ASP B O   1 
ATOM   4965 C CB  . ASP B 1 295 ? 77.318  45.830 30.072 1.00 55.00 ? 295  ASP B CB  1 
ATOM   4966 C CG  . ASP B 1 295 ? 77.158  46.638 31.341 1.00 56.27 ? 295  ASP B CG  1 
ATOM   4967 O OD1 . ASP B 1 295 ? 78.071  46.610 32.204 1.00 56.67 ? 295  ASP B OD1 1 
ATOM   4968 O OD2 . ASP B 1 295 ? 76.121  47.315 31.483 1.00 57.35 ? 295  ASP B OD2 1 
ATOM   4969 N N   . LYS B 1 296 ? 77.940  43.705 28.753 1.00 55.71 ? 296  LYS B N   1 
ATOM   4970 C CA  . LYS B 1 296 ? 77.937  42.510 27.941 1.00 55.90 ? 296  LYS B CA  1 
ATOM   4971 C C   . LYS B 1 296 ? 76.694  42.552 27.049 1.00 55.75 ? 296  LYS B C   1 
ATOM   4972 O O   . LYS B 1 296 ? 76.468  41.713 26.177 1.00 55.59 ? 296  LYS B O   1 
ATOM   4973 C CB  . LYS B 1 296 ? 77.952  41.281 28.845 1.00 55.85 ? 296  LYS B CB  1 
ATOM   4974 C CG  . LYS B 1 296 ? 76.781  41.188 29.828 1.00 56.10 ? 296  LYS B CG  1 
ATOM   4975 C CD  . LYS B 1 296 ? 76.916  42.104 31.059 1.00 57.15 ? 296  LYS B CD  1 
ATOM   4976 C CE  . LYS B 1 296 ? 76.046  41.608 32.308 1.00 57.11 ? 296  LYS B CE  1 
ATOM   4977 N NZ  . LYS B 1 296 ? 76.326  42.300 33.644 1.00 56.86 ? 296  LYS B NZ  1 
ATOM   4978 N N   . ASN B 1 297 ? 75.903  43.574 27.272 1.00 55.59 ? 297  ASN B N   1 
ATOM   4979 C CA  . ASN B 1 297 ? 74.650  43.729 26.596 1.00 55.64 ? 297  ASN B CA  1 
ATOM   4980 C C   . ASN B 1 297 ? 74.363  45.197 26.389 1.00 55.45 ? 297  ASN B C   1 
ATOM   4981 O O   . ASN B 1 297 ? 73.227  45.570 26.355 1.00 54.95 ? 297  ASN B O   1 
ATOM   4982 C CB  . ASN B 1 297 ? 73.609  43.219 27.534 1.00 55.91 ? 297  ASN B CB  1 
ATOM   4983 C CG  . ASN B 1 297 ? 73.756  43.861 28.911 1.00 57.16 ? 297  ASN B CG  1 
ATOM   4984 O OD1 . ASN B 1 297 ? 74.890  43.939 29.477 1.00 56.51 ? 297  ASN B OD1 1 
ATOM   4985 N ND2 . ASN B 1 297 ? 72.629  44.375 29.445 1.00 57.99 ? 297  ASN B ND2 1 
ATOM   4986 N N   . THR B 1 298 ? 75.406  46.025 26.308 1.00 55.65 ? 298  THR B N   1 
ATOM   4987 C CA  . THR B 1 298 ? 75.274  47.463 26.259 1.00 54.97 ? 298  THR B CA  1 
ATOM   4988 C C   . THR B 1 298 ? 75.834  47.970 25.005 1.00 54.70 ? 298  THR B C   1 
ATOM   4989 O O   . THR B 1 298 ? 76.999  47.725 24.675 1.00 54.63 ? 298  THR B O   1 
ATOM   4990 C CB  . THR B 1 298 ? 76.009  48.083 27.373 1.00 55.01 ? 298  THR B CB  1 
ATOM   4991 O OG1 . THR B 1 298 ? 75.496  47.537 28.592 1.00 55.76 ? 298  THR B OG1 1 
ATOM   4992 C CG2 . THR B 1 298 ? 75.690  49.546 27.478 1.00 54.96 ? 298  THR B CG2 1 
ATOM   4993 N N   . PHE B 1 299 ? 74.967  48.685 24.313 1.00 54.98 ? 299  PHE B N   1 
ATOM   4994 C CA  . PHE B 1 299 ? 75.253  49.370 23.056 1.00 55.26 ? 299  PHE B CA  1 
ATOM   4995 C C   . PHE B 1 299 ? 75.121  50.878 23.229 1.00 54.93 ? 299  PHE B C   1 
ATOM   4996 O O   . PHE B 1 299 ? 74.640  51.361 24.240 1.00 54.53 ? 299  PHE B O   1 
ATOM   4997 C CB  . PHE B 1 299 ? 74.222  48.975 22.028 1.00 55.42 ? 299  PHE B CB  1 
ATOM   4998 C CG  . PHE B 1 299 ? 74.358  47.593 21.498 1.00 55.38 ? 299  PHE B CG  1 
ATOM   4999 C CD1 . PHE B 1 299 ? 73.851  47.304 20.248 1.00 55.66 ? 299  PHE B CD1 1 
ATOM   5000 C CD2 . PHE B 1 299 ? 74.978  46.585 22.202 1.00 56.81 ? 299  PHE B CD2 1 
ATOM   5001 C CE1 . PHE B 1 299 ? 73.940  46.051 19.705 1.00 56.20 ? 299  PHE B CE1 1 
ATOM   5002 C CE2 . PHE B 1 299 ? 75.079  45.288 21.649 1.00 56.81 ? 299  PHE B CE2 1 
ATOM   5003 C CZ  . PHE B 1 299 ? 74.553  45.025 20.399 1.00 56.39 ? 299  PHE B CZ  1 
ATOM   5004 N N   . ILE B 1 300 ? 75.551  51.617 22.222 1.00 54.89 ? 300  ILE B N   1 
ATOM   5005 C CA  . ILE B 1 300 ? 75.497  53.073 22.280 1.00 54.89 ? 300  ILE B CA  1 
ATOM   5006 C C   . ILE B 1 300 ? 75.141  53.627 20.938 1.00 54.78 ? 300  ILE B C   1 
ATOM   5007 O O   . ILE B 1 300 ? 75.791  53.271 19.957 1.00 54.73 ? 300  ILE B O   1 
ATOM   5008 C CB  . ILE B 1 300 ? 76.844  53.665 22.703 1.00 54.81 ? 300  ILE B CB  1 
ATOM   5009 C CG1 . ILE B 1 300 ? 77.372  52.921 23.940 1.00 54.86 ? 300  ILE B CG1 1 
ATOM   5010 C CG2 . ILE B 1 300 ? 76.667  55.133 22.980 1.00 54.98 ? 300  ILE B CG2 1 
ATOM   5011 C CD1 . ILE B 1 300 ? 78.650  53.412 24.481 1.00 54.53 ? 300  ILE B CD1 1 
ATOM   5012 N N   . LEU B 1 301 ? 74.123  54.486 20.892 1.00 54.67 ? 301  LEU B N   1 
ATOM   5013 C CA  . LEU B 1 301 ? 73.706  55.105 19.648 1.00 54.79 ? 301  LEU B CA  1 
ATOM   5014 C C   . LEU B 1 301 ? 73.948  56.595 19.604 1.00 54.86 ? 301  LEU B C   1 
ATOM   5015 O O   . LEU B 1 301 ? 73.247  57.366 20.260 1.00 54.53 ? 301  LEU B O   1 
ATOM   5016 C CB  . LEU B 1 301 ? 72.255  54.849 19.390 1.00 54.71 ? 301  LEU B CB  1 
ATOM   5017 C CG  . LEU B 1 301 ? 71.884  53.390 19.210 1.00 54.83 ? 301  LEU B CG  1 
ATOM   5018 C CD1 . LEU B 1 301 ? 70.579  53.311 18.501 1.00 55.37 ? 301  LEU B CD1 1 
ATOM   5019 C CD2 . LEU B 1 301 ? 72.887  52.627 18.435 1.00 54.70 ? 301  LEU B CD2 1 
ATOM   5020 N N   . GLY B 1 302 ? 74.940  56.986 18.799 1.00 55.04 ? 302  GLY B N   1 
ATOM   5021 C CA  . GLY B 1 302 ? 75.348  58.369 18.663 1.00 55.01 ? 302  GLY B CA  1 
ATOM   5022 C C   . GLY B 1 302 ? 74.816  58.941 17.378 1.00 55.13 ? 302  GLY B C   1 
ATOM   5023 O O   . GLY B 1 302 ? 73.995  58.330 16.709 1.00 54.99 ? 302  GLY B O   1 
ATOM   5024 N N   . ASP B 1 303 ? 75.339  60.100 17.014 1.00 55.00 ? 303  ASP B N   1 
ATOM   5025 C CA  . ASP B 1 303 ? 74.860  60.853 15.880 1.00 54.96 ? 303  ASP B CA  1 
ATOM   5026 C C   . ASP B 1 303 ? 74.227  60.027 14.791 1.00 55.15 ? 303  ASP B C   1 
ATOM   5027 O O   . ASP B 1 303 ? 73.105  60.363 14.337 1.00 55.79 ? 303  ASP B O   1 
ATOM   5028 C CB  . ASP B 1 303 ? 75.979  61.684 15.335 1.00 54.46 ? 303  ASP B CB  1 
ATOM   5029 C CG  . ASP B 1 303 ? 76.794  62.274 16.430 1.00 54.63 ? 303  ASP B CG  1 
ATOM   5030 O OD1 . ASP B 1 303 ? 76.253  62.334 17.554 1.00 55.12 ? 303  ASP B OD1 1 
ATOM   5031 O OD2 . ASP B 1 303 ? 77.968  62.684 16.300 1.00 55.76 ? 303  ASP B OD2 1 
ATOM   5032 N N   . PRO B 1 304 ? 74.923  58.975 14.362 1.00 54.77 ? 304  PRO B N   1 
ATOM   5033 C CA  . PRO B 1 304 ? 74.481  58.170 13.234 1.00 54.84 ? 304  PRO B CA  1 
ATOM   5034 C C   . PRO B 1 304 ? 73.015  57.815 13.226 1.00 54.67 ? 304  PRO B C   1 
ATOM   5035 O O   . PRO B 1 304 ? 72.367  57.922 12.212 1.00 54.27 ? 304  PRO B O   1 
ATOM   5036 C CB  . PRO B 1 304 ? 75.324  56.952 13.370 1.00 55.02 ? 304  PRO B CB  1 
ATOM   5037 C CG  . PRO B 1 304 ? 76.565  57.485 13.857 1.00 54.94 ? 304  PRO B CG  1 
ATOM   5038 C CD  . PRO B 1 304 ? 76.231  58.525 14.842 1.00 54.45 ? 304  PRO B CD  1 
ATOM   5039 N N   . PHE B 1 305 ? 72.498  57.428 14.365 1.00 54.63 ? 305  PHE B N   1 
ATOM   5040 C CA  . PHE B 1 305 ? 71.074  57.228 14.543 1.00 54.60 ? 305  PHE B CA  1 
ATOM   5041 C C   . PHE B 1 305 ? 70.323  58.552 14.394 1.00 54.33 ? 305  PHE B C   1 
ATOM   5042 O O   . PHE B 1 305 ? 69.544  58.711 13.499 1.00 53.89 ? 305  PHE B O   1 
ATOM   5043 C CB  . PHE B 1 305 ? 70.878  56.664 15.951 1.00 54.82 ? 305  PHE B CB  1 
ATOM   5044 C CG  . PHE B 1 305 ? 69.563  56.045 16.188 1.00 54.01 ? 305  PHE B CG  1 
ATOM   5045 C CD1 . PHE B 1 305 ? 68.740  56.518 17.167 1.00 54.60 ? 305  PHE B CD1 1 
ATOM   5046 C CD2 . PHE B 1 305 ? 69.164  54.949 15.469 1.00 53.94 ? 305  PHE B CD2 1 
ATOM   5047 C CE1 . PHE B 1 305 ? 67.510  55.927 17.384 1.00 54.76 ? 305  PHE B CE1 1 
ATOM   5048 C CE2 . PHE B 1 305 ? 67.963  54.366 15.690 1.00 54.11 ? 305  PHE B CE2 1 
ATOM   5049 C CZ  . PHE B 1 305 ? 67.131  54.861 16.643 1.00 54.29 ? 305  PHE B CZ  1 
ATOM   5050 N N   . MET B 1 306 ? 70.612  59.503 15.271 1.00 54.58 ? 306  MET B N   1 
ATOM   5051 C CA  . MET B 1 306 ? 69.918  60.770 15.365 1.00 54.89 ? 306  MET B CA  1 
ATOM   5052 C C   . MET B 1 306 ? 69.951  61.583 14.099 1.00 55.08 ? 306  MET B C   1 
ATOM   5053 O O   . MET B 1 306 ? 69.081  62.467 13.897 1.00 55.28 ? 306  MET B O   1 
ATOM   5054 C CB  . MET B 1 306 ? 70.563  61.610 16.437 1.00 55.19 ? 306  MET B CB  1 
ATOM   5055 C CG  . MET B 1 306 ? 70.145  61.224 17.796 1.00 55.31 ? 306  MET B CG  1 
ATOM   5056 S SD  . MET B 1 306 ? 71.493  61.093 18.947 1.00 55.21 ? 306  MET B SD  1 
ATOM   5057 C CE  . MET B 1 306 ? 71.398  62.702 19.660 1.00 55.68 ? 306  MET B CE  1 
ATOM   5058 N N   . ARG B 1 307 ? 70.972  61.346 13.283 1.00 54.86 ? 307  ARG B N   1 
ATOM   5059 C CA  . ARG B 1 307 ? 70.960  61.861 11.928 1.00 55.18 ? 307  ARG B CA  1 
ATOM   5060 C C   . ARG B 1 307 ? 69.674  61.395 11.243 1.00 54.58 ? 307  ARG B C   1 
ATOM   5061 O O   . ARG B 1 307 ? 69.069  62.156 10.536 1.00 54.60 ? 307  ARG B O   1 
ATOM   5062 C CB  . ARG B 1 307 ? 72.208  61.417 11.087 1.00 55.67 ? 307  ARG B CB  1 
ATOM   5063 C CG  . ARG B 1 307 ? 73.598  62.100 11.407 1.00 55.76 ? 307  ARG B CG  1 
ATOM   5064 C CD  . ARG B 1 307 ? 74.807  61.175 11.160 1.00 55.77 ? 307  ARG B CD  1 
ATOM   5065 N NE  . ARG B 1 307 ? 76.119  61.668 11.640 1.00 56.82 ? 307  ARG B NE  1 
ATOM   5066 C CZ  . ARG B 1 307 ? 77.242  60.880 11.837 1.00 56.75 ? 307  ARG B CZ  1 
ATOM   5067 N NH1 . ARG B 1 307 ? 77.198  59.559 11.587 1.00 56.60 ? 307  ARG B NH1 1 
ATOM   5068 N NH2 . ARG B 1 307 ? 78.416  61.400 12.296 1.00 54.66 ? 307  ARG B NH2 1 
ATOM   5069 N N   . LYS B 1 308 ? 69.260  60.161 11.457 1.00 54.39 ? 308  LYS B N   1 
ATOM   5070 C CA  . LYS B 1 308 ? 68.070  59.636 10.813 1.00 54.75 ? 308  LYS B CA  1 
ATOM   5071 C C   . LYS B 1 308 ? 66.816  59.856 11.661 1.00 54.80 ? 308  LYS B C   1 
ATOM   5072 O O   . LYS B 1 308 ? 65.765  60.197 11.122 1.00 54.82 ? 308  LYS B O   1 
ATOM   5073 C CB  . LYS B 1 308 ? 68.230  58.146 10.482 1.00 54.73 ? 308  LYS B CB  1 
ATOM   5074 C CG  . LYS B 1 308 ? 67.015  57.514 9.816  1.00 54.53 ? 308  LYS B CG  1 
ATOM   5075 C CD  . LYS B 1 308 ? 67.075  55.986 9.812  1.00 55.16 ? 308  LYS B CD  1 
ATOM   5076 C CE  . LYS B 1 308 ? 65.938  55.332 8.945  1.00 55.16 ? 308  LYS B CE  1 
ATOM   5077 N NZ  . LYS B 1 308 ? 66.026  53.862 8.637  1.00 53.32 ? 308  LYS B NZ  1 
ATOM   5078 N N   . TYR B 1 309 ? 66.899  59.635 12.970 1.00 54.89 ? 309  TYR B N   1 
ATOM   5079 C CA  . TYR B 1 309 ? 65.720  59.742 13.798 1.00 54.80 ? 309  TYR B CA  1 
ATOM   5080 C C   . TYR B 1 309 ? 65.776  60.904 14.717 1.00 54.91 ? 309  TYR B C   1 
ATOM   5081 O O   . TYR B 1 309 ? 66.644  60.976 15.596 1.00 54.53 ? 309  TYR B O   1 
ATOM   5082 C CB  . TYR B 1 309 ? 65.495  58.503 14.629 1.00 54.78 ? 309  TYR B CB  1 
ATOM   5083 C CG  . TYR B 1 309 ? 65.181  57.260 13.844 1.00 54.41 ? 309  TYR B CG  1 
ATOM   5084 C CD1 . TYR B 1 309 ? 66.079  56.261 13.788 1.00 54.74 ? 309  TYR B CD1 1 
ATOM   5085 C CD2 . TYR B 1 309 ? 63.974  57.084 13.197 1.00 55.07 ? 309  TYR B CD2 1 
ATOM   5086 C CE1 . TYR B 1 309 ? 65.843  55.108 13.093 1.00 55.45 ? 309  TYR B CE1 1 
ATOM   5087 C CE2 . TYR B 1 309 ? 63.709  55.928 12.477 1.00 55.95 ? 309  TYR B CE2 1 
ATOM   5088 C CZ  . TYR B 1 309 ? 64.681  54.916 12.426 1.00 56.05 ? 309  TYR B CZ  1 
ATOM   5089 O OH  . TYR B 1 309 ? 64.562  53.681 11.758 1.00 55.35 ? 309  TYR B OH  1 
ATOM   5090 N N   . PHE B 1 310 ? 64.813  61.798 14.508 1.00 55.27 ? 310  PHE B N   1 
ATOM   5091 C CA  . PHE B 1 310 ? 64.519  62.875 15.451 1.00 55.28 ? 310  PHE B CA  1 
ATOM   5092 C C   . PHE B 1 310 ? 64.176  62.164 16.710 1.00 55.21 ? 310  PHE B C   1 
ATOM   5093 O O   . PHE B 1 310 ? 63.247  61.329 16.713 1.00 55.04 ? 310  PHE B O   1 
ATOM   5094 C CB  . PHE B 1 310 ? 63.306  63.683 15.023 1.00 55.05 ? 310  PHE B CB  1 
ATOM   5095 C CG  . PHE B 1 310 ? 62.841  64.625 16.051 1.00 54.69 ? 310  PHE B CG  1 
ATOM   5096 C CD1 . PHE B 1 310 ? 61.596  64.510 16.616 1.00 54.67 ? 310  PHE B CD1 1 
ATOM   5097 C CD2 . PHE B 1 310 ? 63.646  65.618 16.494 1.00 54.70 ? 310  PHE B CD2 1 
ATOM   5098 C CE1 . PHE B 1 310 ? 61.168  65.402 17.620 1.00 54.20 ? 310  PHE B CE1 1 
ATOM   5099 C CE2 . PHE B 1 310 ? 63.190  66.523 17.486 1.00 55.14 ? 310  PHE B CE2 1 
ATOM   5100 C CZ  . PHE B 1 310 ? 61.964  66.397 18.035 1.00 53.73 ? 310  PHE B CZ  1 
ATOM   5101 N N   . THR B 1 311 ? 64.931  62.463 17.757 1.00 54.79 ? 311  THR B N   1 
ATOM   5102 C CA  . THR B 1 311 ? 64.730  61.782 19.002 1.00 55.03 ? 311  THR B CA  1 
ATOM   5103 C C   . THR B 1 311 ? 64.258  62.720 20.048 1.00 55.27 ? 311  THR B C   1 
ATOM   5104 O O   . THR B 1 311 ? 64.721  63.881 20.107 1.00 55.09 ? 311  THR B O   1 
ATOM   5105 C CB  . THR B 1 311 ? 65.991  61.298 19.489 1.00 55.20 ? 311  THR B CB  1 
ATOM   5106 O OG1 . THR B 1 311 ? 66.929  62.386 19.354 1.00 54.83 ? 311  THR B OG1 1 
ATOM   5107 C CG2 . THR B 1 311 ? 66.457  60.088 18.652 1.00 55.47 ? 311  THR B CG2 1 
ATOM   5108 N N   . VAL B 1 312 ? 63.405  62.170 20.923 1.00 55.39 ? 312  VAL B N   1 
ATOM   5109 C CA  . VAL B 1 312 ? 62.774  62.904 22.013 1.00 55.25 ? 312  VAL B CA  1 
ATOM   5110 C C   . VAL B 1 312 ? 63.018  62.279 23.352 1.00 54.93 ? 312  VAL B C   1 
ATOM   5111 O O   . VAL B 1 312 ? 62.763  61.128 23.518 1.00 54.89 ? 312  VAL B O   1 
ATOM   5112 C CB  . VAL B 1 312 ? 61.272  62.905 21.859 1.00 55.27 ? 312  VAL B CB  1 
ATOM   5113 C CG1 . VAL B 1 312 ? 60.662  63.860 22.844 1.00 55.42 ? 312  VAL B CG1 1 
ATOM   5114 C CG2 . VAL B 1 312 ? 60.909  63.310 20.472 1.00 55.70 ? 312  VAL B CG2 1 
ATOM   5115 N N   . PHE B 1 313 ? 63.437  63.078 24.317 1.00 55.09 ? 313  PHE B N   1 
ATOM   5116 C CA  . PHE B 1 313 ? 63.771  62.615 25.666 1.00 55.19 ? 313  PHE B CA  1 
ATOM   5117 C C   . PHE B 1 313 ? 62.825  63.230 26.639 1.00 54.84 ? 313  PHE B C   1 
ATOM   5118 O O   . PHE B 1 313 ? 62.779  64.437 26.740 1.00 55.09 ? 313  PHE B O   1 
ATOM   5119 C CB  . PHE B 1 313 ? 65.223  62.998 25.986 1.00 54.98 ? 313  PHE B CB  1 
ATOM   5120 C CG  . PHE B 1 313 ? 66.181  62.480 24.956 1.00 55.36 ? 313  PHE B CG  1 
ATOM   5121 C CD1 . PHE B 1 313 ? 66.864  61.281 25.165 1.00 55.67 ? 313  PHE B CD1 1 
ATOM   5122 C CD2 . PHE B 1 313 ? 66.353  63.132 23.737 1.00 54.72 ? 313  PHE B CD2 1 
ATOM   5123 C CE1 . PHE B 1 313 ? 67.738  60.759 24.191 1.00 54.87 ? 313  PHE B CE1 1 
ATOM   5124 C CE2 . PHE B 1 313 ? 67.215  62.614 22.784 1.00 54.88 ? 313  PHE B CE2 1 
ATOM   5125 C CZ  . PHE B 1 313 ? 67.900  61.409 23.018 1.00 54.54 ? 313  PHE B CZ  1 
ATOM   5126 N N   . ASP B 1 314 ? 62.060  62.421 27.352 1.00 54.58 ? 314  ASP B N   1 
ATOM   5127 C CA  . ASP B 1 314 ? 61.084  62.980 28.273 1.00 54.90 ? 314  ASP B CA  1 
ATOM   5128 C C   . ASP B 1 314 ? 61.321  62.619 29.715 1.00 54.90 ? 314  ASP B C   1 
ATOM   5129 O O   . ASP B 1 314 ? 61.002  61.505 30.124 1.00 55.17 ? 314  ASP B O   1 
ATOM   5130 C CB  . ASP B 1 314 ? 59.697  62.489 27.880 1.00 55.51 ? 314  ASP B CB  1 
ATOM   5131 C CG  . ASP B 1 314 ? 58.572  63.415 28.363 1.00 55.16 ? 314  ASP B CG  1 
ATOM   5132 O OD1 . ASP B 1 314 ? 58.520  63.791 29.558 1.00 55.75 ? 314  ASP B OD1 1 
ATOM   5133 O OD2 . ASP B 1 314 ? 57.686  63.796 27.576 1.00 53.76 ? 314  ASP B OD2 1 
ATOM   5134 N N   . TYR B 1 315 ? 61.834  63.551 30.506 1.00 54.64 ? 315  TYR B N   1 
ATOM   5135 C CA  . TYR B 1 315 ? 62.125  63.241 31.881 1.00 54.83 ? 315  TYR B CA  1 
ATOM   5136 C C   . TYR B 1 315 ? 60.938  62.661 32.618 1.00 55.27 ? 315  TYR B C   1 
ATOM   5137 O O   . TYR B 1 315 ? 60.974  61.473 32.965 1.00 55.53 ? 315  TYR B O   1 
ATOM   5138 C CB  . TYR B 1 315 ? 62.595  64.464 32.605 1.00 54.97 ? 315  TYR B CB  1 
ATOM   5139 C CG  . TYR B 1 315 ? 64.067  64.755 32.422 1.00 55.23 ? 315  TYR B CG  1 
ATOM   5140 C CD1 . TYR B 1 315 ? 64.484  65.945 31.806 1.00 55.40 ? 315  TYR B CD1 1 
ATOM   5141 C CD2 . TYR B 1 315 ? 65.057  63.859 32.878 1.00 54.76 ? 315  TYR B CD2 1 
ATOM   5142 C CE1 . TYR B 1 315 ? 65.836  66.241 31.622 1.00 55.02 ? 315  TYR B CE1 1 
ATOM   5143 C CE2 . TYR B 1 315 ? 66.411  64.137 32.697 1.00 55.35 ? 315  TYR B CE2 1 
ATOM   5144 C CZ  . TYR B 1 315 ? 66.788  65.357 32.066 1.00 55.79 ? 315  TYR B CZ  1 
ATOM   5145 O OH  . TYR B 1 315 ? 68.095  65.739 31.845 1.00 55.99 ? 315  TYR B OH  1 
ATOM   5146 N N   . ASP B 1 316 ? 59.882  63.467 32.833 1.00 55.55 ? 316  ASP B N   1 
ATOM   5147 C CA  . ASP B 1 316 ? 58.607  63.018 33.491 1.00 55.29 ? 316  ASP B CA  1 
ATOM   5148 C C   . ASP B 1 316 ? 58.052  61.763 32.871 1.00 55.09 ? 316  ASP B C   1 
ATOM   5149 O O   . ASP B 1 316 ? 57.813  60.805 33.540 1.00 55.11 ? 316  ASP B O   1 
ATOM   5150 C CB  . ASP B 1 316 ? 57.500  64.067 33.383 1.00 55.36 ? 316  ASP B CB  1 
ATOM   5151 C CG  . ASP B 1 316 ? 57.979  65.468 33.754 1.00 56.63 ? 316  ASP B CG  1 
ATOM   5152 O OD1 . ASP B 1 316 ? 58.556  65.652 34.884 1.00 55.79 ? 316  ASP B OD1 1 
ATOM   5153 O OD2 . ASP B 1 316 ? 57.824  66.443 32.951 1.00 57.19 ? 316  ASP B OD2 1 
ATOM   5154 N N   . LYS B 1 317 ? 57.859  61.765 31.572 1.00 55.11 ? 317  LYS B N   1 
ATOM   5155 C CA  . LYS B 1 317 ? 57.359  60.595 30.909 1.00 55.50 ? 317  LYS B CA  1 
ATOM   5156 C C   . LYS B 1 317 ? 58.315  59.387 31.110 1.00 55.57 ? 317  LYS B C   1 
ATOM   5157 O O   . LYS B 1 317 ? 58.002  58.226 30.756 1.00 55.87 ? 317  LYS B O   1 
ATOM   5158 C CB  . LYS B 1 317 ? 57.123  60.943 29.428 1.00 55.75 ? 317  LYS B CB  1 
ATOM   5159 C CG  . LYS B 1 317 ? 56.019  60.153 28.733 1.00 56.29 ? 317  LYS B CG  1 
ATOM   5160 C CD  . LYS B 1 317 ? 55.008  61.014 27.932 1.00 55.66 ? 317  LYS B CD  1 
ATOM   5161 C CE  . LYS B 1 317 ? 55.601  61.577 26.595 1.00 56.76 ? 317  LYS B CE  1 
ATOM   5162 N NZ  . LYS B 1 317 ? 54.475  62.094 25.584 1.00 56.59 ? 317  LYS B NZ  1 
ATOM   5163 N N   . GLU B 1 318 ? 59.458  59.654 31.725 1.00 55.43 ? 318  GLU B N   1 
ATOM   5164 C CA  . GLU B 1 318 ? 60.469  58.632 31.986 1.00 55.54 ? 318  GLU B CA  1 
ATOM   5165 C C   . GLU B 1 318 ? 60.668  57.721 30.793 1.00 55.37 ? 318  GLU B C   1 
ATOM   5166 O O   . GLU B 1 318 ? 60.758  56.491 30.901 1.00 54.99 ? 318  GLU B O   1 
ATOM   5167 C CB  . GLU B 1 318 ? 60.096  57.824 33.220 1.00 55.90 ? 318  GLU B CB  1 
ATOM   5168 C CG  . GLU B 1 318 ? 61.262  57.110 33.897 1.00 55.74 ? 318  GLU B CG  1 
ATOM   5169 C CD  . GLU B 1 318 ? 60.837  56.343 35.140 1.00 55.94 ? 318  GLU B CD  1 
ATOM   5170 O OE1 . GLU B 1 318 ? 61.755  55.650 35.707 1.00 56.01 ? 318  GLU B OE1 1 
ATOM   5171 O OE2 . GLU B 1 318 ? 59.605  56.427 35.525 1.00 54.61 ? 318  GLU B OE2 1 
ATOM   5172 N N   . SER B 1 319 ? 60.760  58.361 29.634 1.00 55.70 ? 319  SER B N   1 
ATOM   5173 C CA  . SER B 1 319 ? 60.910  57.642 28.380 1.00 55.78 ? 319  SER B CA  1 
ATOM   5174 C C   . SER B 1 319 ? 61.478  58.506 27.252 1.00 55.32 ? 319  SER B C   1 
ATOM   5175 O O   . SER B 1 319 ? 61.677  59.716 27.398 1.00 54.44 ? 319  SER B O   1 
ATOM   5176 C CB  . SER B 1 319 ? 59.579  56.997 27.977 1.00 55.83 ? 319  SER B CB  1 
ATOM   5177 O OG  . SER B 1 319 ? 59.288  57.295 26.630 1.00 55.09 ? 319  SER B OG  1 
ATOM   5178 N N   . ILE B 1 320 ? 61.761  57.822 26.150 1.00 55.27 ? 320  ILE B N   1 
ATOM   5179 C CA  . ILE B 1 320 ? 62.286  58.461 24.985 1.00 55.58 ? 320  ILE B CA  1 
ATOM   5180 C C   . ILE B 1 320 ? 61.528  58.105 23.723 1.00 55.51 ? 320  ILE B C   1 
ATOM   5181 O O   . ILE B 1 320 ? 61.244  56.945 23.428 1.00 55.13 ? 320  ILE B O   1 
ATOM   5182 C CB  . ILE B 1 320 ? 63.800  58.231 24.769 1.00 55.37 ? 320  ILE B CB  1 
ATOM   5183 C CG1 . ILE B 1 320 ? 64.102  58.596 23.332 1.00 55.83 ? 320  ILE B CG1 1 
ATOM   5184 C CG2 . ILE B 1 320 ? 64.277  56.799 25.059 1.00 55.36 ? 320  ILE B CG2 1 
ATOM   5185 C CD1 . ILE B 1 320 ? 65.536  58.415 22.968 1.00 57.32 ? 320  ILE B CD1 1 
ATOM   5186 N N   . GLY B 1 321 ? 61.248  59.165 22.980 1.00 55.95 ? 321  GLY B N   1 
ATOM   5187 C CA  . GLY B 1 321 ? 60.525  59.112 21.743 1.00 55.82 ? 321  GLY B CA  1 
ATOM   5188 C C   . GLY B 1 321 ? 61.446  59.052 20.545 1.00 55.65 ? 321  GLY B C   1 
ATOM   5189 O O   . GLY B 1 321 ? 62.501  59.668 20.499 1.00 55.44 ? 321  GLY B O   1 
ATOM   5190 N N   . PHE B 1 322 ? 60.984  58.306 19.562 1.00 55.44 ? 322  PHE B N   1 
ATOM   5191 C CA  . PHE B 1 322 ? 61.659  58.132 18.341 1.00 55.30 ? 322  PHE B CA  1 
ATOM   5192 C C   . PHE B 1 322 ? 60.738  58.486 17.203 1.00 55.68 ? 322  PHE B C   1 
ATOM   5193 O O   . PHE B 1 322 ? 59.515  58.263 17.268 1.00 55.53 ? 322  PHE B O   1 
ATOM   5194 C CB  . PHE B 1 322 ? 62.072  56.702 18.247 1.00 54.94 ? 322  PHE B CB  1 
ATOM   5195 C CG  . PHE B 1 322 ? 62.944  56.313 19.344 1.00 55.52 ? 322  PHE B CG  1 
ATOM   5196 C CD1 . PHE B 1 322 ? 62.442  56.233 20.651 1.00 56.04 ? 322  PHE B CD1 1 
ATOM   5197 C CD2 . PHE B 1 322 ? 64.284  56.087 19.122 1.00 55.10 ? 322  PHE B CD2 1 
ATOM   5198 C CE1 . PHE B 1 322 ? 63.234  55.880 21.685 1.00 55.45 ? 322  PHE B CE1 1 
ATOM   5199 C CE2 . PHE B 1 322 ? 65.080  55.751 20.156 1.00 55.31 ? 322  PHE B CE2 1 
ATOM   5200 C CZ  . PHE B 1 322 ? 64.553  55.641 21.457 1.00 55.53 ? 322  PHE B CZ  1 
ATOM   5201 N N   . ALA B 1 323 ? 61.340  59.038 16.144 1.00 55.93 ? 323  ALA B N   1 
ATOM   5202 C CA  . ALA B 1 323 ? 60.628  59.260 14.889 1.00 55.73 ? 323  ALA B CA  1 
ATOM   5203 C C   . ALA B 1 323 ? 61.615  59.813 13.863 1.00 55.29 ? 323  ALA B C   1 
ATOM   5204 O O   . ALA B 1 323 ? 62.631  60.449 14.242 1.00 54.20 ? 323  ALA B O   1 
ATOM   5205 C CB  . ALA B 1 323 ? 59.429  60.225 15.110 1.00 56.18 ? 323  ALA B CB  1 
ATOM   5206 N N   . VAL B 1 324 ? 61.278  59.539 12.589 1.00 55.26 ? 324  VAL B N   1 
ATOM   5207 C CA  . VAL B 1 324 ? 62.098  59.887 11.413 1.00 55.47 ? 324  VAL B CA  1 
ATOM   5208 C C   . VAL B 1 324 ? 62.150  61.378 11.208 1.00 55.86 ? 324  VAL B C   1 
ATOM   5209 O O   . VAL B 1 324 ? 61.132  62.060 11.259 1.00 56.70 ? 324  VAL B O   1 
ATOM   5210 C CB  . VAL B 1 324 ? 61.518  59.339 10.128 1.00 55.13 ? 324  VAL B CB  1 
ATOM   5211 C CG1 . VAL B 1 324 ? 62.398  59.722 8.989  1.00 54.85 ? 324  VAL B CG1 1 
ATOM   5212 C CG2 . VAL B 1 324 ? 61.353  57.831 10.207 1.00 55.67 ? 324  VAL B CG2 1 
ATOM   5213 N N   . ALA B 1 325 ? 63.315  61.917 10.928 1.00 55.92 ? 325  ALA B N   1 
ATOM   5214 C CA  . ALA B 1 325 ? 63.422  63.366 10.953 1.00 55.84 ? 325  ALA B CA  1 
ATOM   5215 C C   . ALA B 1 325 ? 63.185  63.904 9.575  1.00 55.59 ? 325  ALA B C   1 
ATOM   5216 O O   . ALA B 1 325 ? 63.305  63.178 8.607  1.00 55.35 ? 325  ALA B O   1 
ATOM   5217 C CB  . ALA B 1 325 ? 64.800  63.785 11.486 1.00 56.28 ? 325  ALA B CB  1 
ATOM   5218 N N   . LYS B 1 326 ? 62.853  65.189 9.502  1.00 55.86 ? 326  LYS B N   1 
ATOM   5219 C CA  . LYS B 1 326 ? 62.693  65.906 8.218  1.00 55.89 ? 326  LYS B CA  1 
ATOM   5220 C C   . LYS B 1 326 ? 64.032  66.008 7.545  1.00 55.73 ? 326  LYS B C   1 
ATOM   5221 O O   . LYS B 1 326 ? 64.835  66.846 7.942  1.00 54.62 ? 326  LYS B O   1 
ATOM   5222 C CB  . LYS B 1 326 ? 62.113  67.314 8.435  1.00 55.70 ? 326  LYS B CB  1 
ATOM   5223 C CG  . LYS B 1 326 ? 61.313  67.848 7.255  1.00 56.21 ? 326  LYS B CG  1 
ATOM   5224 C CD  . LYS B 1 326 ? 59.846  67.253 7.176  1.00 57.05 ? 326  LYS B CD  1 
ATOM   5225 C CE  . LYS B 1 326 ? 58.963  67.845 5.985  1.00 57.30 ? 326  LYS B CE  1 
ATOM   5226 N NZ  . LYS B 1 326 ? 59.333  67.384 4.526  1.00 57.82 ? 326  LYS B NZ  1 
ATOM   5227 N N   . ASN B 1 327 ? 64.263  65.103 6.573  1.00 56.26 ? 327  ASN B N   1 
ATOM   5228 C CA  . ASN B 1 327 ? 65.516  65.016 5.741  1.00 56.34 ? 327  ASN B CA  1 
ATOM   5229 C C   . ASN B 1 327 ? 66.835  64.707 6.481  1.00 56.83 ? 327  ASN B C   1 
ATOM   5230 O O   . ASN B 1 327 ? 67.300  65.431 7.384  1.00 57.35 ? 327  ASN B O   1 
ATOM   5231 C CB  . ASN B 1 327 ? 65.684  66.287 4.933  1.00 56.44 ? 327  ASN B CB  1 
ATOM   5232 C CG  . ASN B 1 327 ? 64.318  66.833 4.411  1.00 57.19 ? 327  ASN B CG  1 
ATOM   5233 O OD1 . ASN B 1 327 ? 63.687  66.241 3.534  1.00 57.20 ? 327  ASN B OD1 1 
ATOM   5234 N ND2 . ASN B 1 327 ? 63.867  67.947 4.976  1.00 56.59 ? 327  ASN B ND2 1 
HETATM 5235 C C3  . JE2 C 2 .   ? 55.857  15.881 30.812 1.00 55.09 ? 3151 JE2 A C3  1 
HETATM 5236 C C4  . JE2 C 2 .   ? 55.372  16.552 29.719 1.00 54.84 ? 3151 JE2 A C4  1 
HETATM 5237 C C5  . JE2 C 2 .   ? 55.519  16.013 28.435 1.00 55.11 ? 3151 JE2 A C5  1 
HETATM 5238 C C6  . JE2 C 2 .   ? 56.135  14.800 28.210 1.00 52.47 ? 3151 JE2 A C6  1 
HETATM 5239 C C7  . JE2 C 2 .   ? 56.621  14.134 29.295 1.00 53.06 ? 3151 JE2 A C7  1 
HETATM 5240 C C1  . JE2 C 2 .   ? 56.485  14.661 30.600 1.00 55.88 ? 3151 JE2 A C1  1 
HETATM 5241 C C8  . JE2 C 2 .   ? 57.277  12.822 29.063 1.00 53.60 ? 3151 JE2 A C8  1 
HETATM 5242 C C9  . JE2 C 2 .   ? 56.246  14.283 26.801 1.00 54.16 ? 3151 JE2 A C9  1 
HETATM 5243 O O2  . JE2 C 2 .   ? 56.917  14.018 31.750 1.00 57.69 ? 3151 JE2 A O2  1 
HETATM 5244 O O10 . JE2 C 2 .   ? 56.367  12.989 26.528 1.00 51.27 ? 3151 JE2 A O10 1 
HETATM 5245 C C22 . JE2 C 2 .   ? 57.782  14.030 22.632 1.00 48.80 ? 3151 JE2 A C22 1 
HETATM 5246 N N11 . JE2 C 2 .   ? 56.237  15.098 25.838 1.00 51.55 ? 3151 JE2 A N11 1 
HETATM 5247 O O23 . JE2 C 2 .   ? 57.849  14.740 21.677 1.00 46.66 ? 3151 JE2 A O23 1 
HETATM 5248 C C20 . JE2 C 2 .   ? 57.768  14.676 23.966 1.00 48.17 ? 3151 JE2 A C20 1 
HETATM 5249 C C14 . JE2 C 2 .   ? 54.211  15.874 24.429 1.00 50.85 ? 3151 JE2 A C14 1 
HETATM 5250 C C13 . JE2 C 2 .   ? 55.522  15.688 23.706 1.00 50.72 ? 3151 JE2 A C13 1 
HETATM 5251 C C17 . JE2 C 2 .   ? 51.799  16.219 25.717 1.00 49.94 ? 3151 JE2 A C17 1 
HETATM 5252 C C12 . JE2 C 2 .   ? 56.334  14.657 24.456 1.00 50.04 ? 3151 JE2 A C12 1 
HETATM 5253 O O21 . JE2 C 2 .   ? 58.203  16.002 23.776 1.00 44.28 ? 3151 JE2 A O21 1 
HETATM 5254 C C15 . JE2 C 2 .   ? 53.290  14.839 24.464 1.00 51.32 ? 3151 JE2 A C15 1 
HETATM 5255 C C19 . JE2 C 2 .   ? 53.917  17.077 25.034 1.00 50.16 ? 3151 JE2 A C19 1 
HETATM 5256 C C16 . JE2 C 2 .   ? 52.078  15.015 25.101 1.00 50.61 ? 3151 JE2 A C16 1 
HETATM 5257 C C18 . JE2 C 2 .   ? 52.702  17.245 25.671 1.00 50.04 ? 3151 JE2 A C18 1 
HETATM 5258 C C31 . JE2 C 2 .   ? 56.581  12.165 20.314 1.00 54.03 ? 3151 JE2 A C31 1 
HETATM 5259 N N24 . JE2 C 2 .   ? 57.664  12.704 22.567 1.00 52.90 ? 3151 JE2 A N24 1 
HETATM 5260 O O32 . JE2 C 2 .   ? 56.921  12.266 19.118 1.00 52.60 ? 3151 JE2 A O32 1 
HETATM 5261 C C30 . JE2 C 2 .   ? 57.679  11.909 21.318 1.00 51.74 ? 3151 JE2 A C30 1 
HETATM 5262 C C27 . JE2 C 2 .   ? 57.625  10.402 21.670 1.00 52.16 ? 3151 JE2 A C27 1 
HETATM 5263 C C25 . JE2 C 2 .   ? 57.585  11.825 23.742 1.00 54.95 ? 3151 JE2 A C25 1 
HETATM 5264 C C28 . JE2 C 2 .   ? 58.460  9.651  20.649 1.00 51.18 ? 3151 JE2 A C28 1 
HETATM 5265 C C29 . JE2 C 2 .   ? 56.272  9.731  22.010 1.00 50.84 ? 3151 JE2 A C29 1 
HETATM 5266 S S26 . JE2 C 2 .   ? 58.395  10.374 23.209 1.00 53.93 ? 3151 JE2 A S26 1 
HETATM 5267 N N33 . JE2 C 2 .   ? 55.300  12.166 20.778 1.00 53.46 ? 3151 JE2 A N33 1 
HETATM 5268 C C34 . JE2 C 2 .   ? 54.169  12.171 19.867 1.00 54.56 ? 3151 JE2 A C34 1 
HETATM 5269 C C35 . JE2 C 2 .   ? 52.946  12.615 20.623 1.00 55.70 ? 3151 JE2 A C35 1 
HETATM 5270 C C36 . JE2 C 2 .   ? 52.339  13.879 20.482 1.00 56.11 ? 3151 JE2 A C36 1 
HETATM 5271 C C37 . JE2 C 2 .   ? 51.204  14.226 21.209 1.00 54.23 ? 3151 JE2 A C37 1 
HETATM 5272 C C38 . JE2 C 2 .   ? 50.675  13.315 22.094 1.00 55.31 ? 3151 JE2 A C38 1 
HETATM 5273 C C39 . JE2 C 2 .   ? 51.257  12.051 22.229 1.00 57.19 ? 3151 JE2 A C39 1 
HETATM 5274 C C40 . JE2 C 2 .   ? 52.397  11.704 21.505 1.00 56.95 ? 3151 JE2 A C40 1 
HETATM 5275 C C41 . JE2 C 2 .   ? 52.882  14.925 19.533 1.00 57.04 ? 3151 JE2 A C41 1 
HETATM 5276 C C3  . JE2 D 2 .   ? 79.368  58.193 33.845 1.00 55.09 ? 3152 JE2 B C3  1 
HETATM 5277 C C4  . JE2 D 2 .   ? 78.958  57.450 32.769 1.00 54.84 ? 3152 JE2 B C4  1 
HETATM 5278 C C5  . JE2 D 2 .   ? 79.394  57.774 31.478 1.00 55.11 ? 3152 JE2 B C5  1 
HETATM 5279 C C6  . JE2 D 2 .   ? 80.250  58.826 31.230 1.00 52.47 ? 3152 JE2 B C6  1 
HETATM 5280 C C7  . JE2 D 2 .   ? 80.655  59.568 32.299 1.00 53.06 ? 3152 JE2 B C7  1 
HETATM 5281 C C1  . JE2 D 2 .   ? 80.226  59.259 33.611 1.00 55.88 ? 3152 JE2 B C1  1 
HETATM 5282 C C8  . JE2 D 2 .   ? 81.585  60.697 32.043 1.00 53.60 ? 3152 JE2 B C8  1 
HETATM 5283 C C9  . JE2 D 2 .   ? 80.681  59.105 29.816 1.00 54.16 ? 3152 JE2 B C9  1 
HETATM 5284 O O2  . JE2 D 2 .   ? 80.632  59.944 34.746 1.00 57.69 ? 3152 JE2 B O2  1 
HETATM 5285 O O10 . JE2 D 2 .   ? 81.813  59.738 29.531 1.00 51.27 ? 3152 JE2 B O10 1 
HETATM 5286 C C22 . JE2 D 2 .   ? 80.297  60.510 25.611 1.00 48.80 ? 3152 JE2 B C22 1 
HETATM 5287 N N11 . JE2 D 2 .   ? 79.944  58.741 28.859 1.00 51.55 ? 3152 JE2 B N11 1 
HETATM 5288 O O23 . JE2 D 2 .   ? 79.625  60.258 24.659 1.00 46.66 ? 3152 JE2 B O23 1 
HETATM 5289 C C20 . JE2 D 2 .   ? 79.709  60.265 26.949 1.00 48.17 ? 3152 JE2 B C20 1 
HETATM 5290 C C14 . JE2 D 2 .   ? 80.069  56.541 27.502 1.00 50.85 ? 3152 JE2 B C14 1 
HETATM 5291 C C13 . JE2 D 2 .   ? 79.705  57.796 26.748 1.00 50.72 ? 3152 JE2 B C13 1 
HETATM 5292 C C17 . JE2 D 2 .   ? 80.736  54.231 28.848 1.00 49.94 ? 3152 JE2 B C17 1 
HETATM 5293 C C12 . JE2 D 2 .   ? 80.311  58.976 27.472 1.00 50.04 ? 3152 JE2 B C12 1 
HETATM 5294 O O21 . JE2 D 2 .   ? 78.322  60.115 26.758 1.00 44.28 ? 3152 JE2 B O21 1 
HETATM 5295 C C15 . JE2 D 2 .   ? 81.390  56.125 27.552 1.00 51.32 ? 3152 JE2 B C15 1 
HETATM 5296 C C19 . JE2 D 2 .   ? 79.089  55.796 28.122 1.00 50.16 ? 3152 JE2 B C19 1 
HETATM 5297 C C16 . JE2 D 2 .   ? 81.723  54.963 28.218 1.00 50.61 ? 3152 JE2 B C16 1 
HETATM 5298 C C18 . JE2 D 2 .   ? 79.431  54.634 28.788 1.00 50.04 ? 3152 JE2 B C18 1 
HETATM 5299 C C31 . JE2 D 2 .   ? 82.498  60.122 23.309 1.00 54.03 ? 3152 JE2 B C31 1 
HETATM 5300 N N24 . JE2 D 2 .   ? 81.556  60.943 25.540 1.00 52.90 ? 3152 JE2 B N24 1 
HETATM 5301 O O32 . JE2 D 2 .   ? 82.271  60.362 22.106 1.00 52.60 ? 3152 JE2 B O32 1 
HETATM 5302 C C30 . JE2 D 2 .   ? 82.279  61.252 24.285 1.00 51.74 ? 3152 JE2 B C30 1 
HETATM 5303 C C27 . JE2 D 2 .   ? 83.675  61.827 24.628 1.00 52.16 ? 3152 JE2 B C27 1 
HETATM 5304 C C25 . JE2 D 2 .   ? 82.386  61.258 26.710 1.00 54.95 ? 3152 JE2 B C25 1 
HETATM 5305 C C28 . JE2 D 2 .   ? 84.023  62.872 23.583 1.00 51.18 ? 3152 JE2 B C28 1 
HETATM 5306 C C29 . JE2 D 2 .   ? 84.840  60.875 24.995 1.00 50.84 ? 3152 JE2 B C29 1 
HETATM 5307 S S26 . JE2 D 2 .   ? 83.381  62.578 26.149 1.00 53.93 ? 3152 JE2 B S26 1 
HETATM 5308 N N33 . JE2 D 2 .   ? 83.019  58.964 23.802 1.00 53.46 ? 3152 JE2 B N33 1 
HETATM 5309 C C34 . JE2 D 2 .   ? 83.480  57.908 22.918 1.00 54.56 ? 3152 JE2 B C34 1 
HETATM 5310 C C35 . JE2 D 2 .   ? 83.573  56.629 23.705 1.00 55.70 ? 3152 JE2 B C35 1 
HETATM 5311 C C36 . JE2 D 2 .   ? 82.668  55.555 23.586 1.00 56.11 ? 3152 JE2 B C36 1 
HETATM 5312 C C37 . JE2 D 2 .   ? 82.813  54.395 24.342 1.00 54.23 ? 3152 JE2 B C37 1 
HETATM 5313 C C38 . JE2 D 2 .   ? 83.858  54.306 25.233 1.00 55.31 ? 3152 JE2 B C38 1 
HETATM 5314 C C39 . JE2 D 2 .   ? 84.773  55.357 25.346 1.00 57.19 ? 3152 JE2 B C39 1 
HETATM 5315 C C40 . JE2 D 2 .   ? 84.626  56.522 24.593 1.00 56.95 ? 3152 JE2 B C40 1 
HETATM 5316 C C41 . JE2 D 2 .   ? 81.494  55.600 22.632 1.00 57.04 ? 3152 JE2 B C41 1 
HETATM 5317 O O   . HOH E 3 .   ? 51.084  9.513  -4.242 1.00 52.80 ? 401  HOH A O   1 
HETATM 5318 O O   . HOH E 3 .   ? 54.953  12.173 32.778 1.00 48.36 ? 402  HOH A O   1 
HETATM 5319 O O   . HOH E 3 .   ? 83.824  29.873 23.331 1.00 52.65 ? 403  HOH A O   1 
HETATM 5320 O O   . HOH E 3 .   ? 56.709  41.108 18.163 1.00 55.10 ? 404  HOH A O   1 
HETATM 5321 O O   . HOH E 3 .   ? 56.751  17.169 0.910  1.00 54.24 ? 405  HOH A O   1 
HETATM 5322 O O   . HOH E 3 .   ? 50.203  33.637 28.654 1.00 57.60 ? 406  HOH A O   1 
HETATM 5323 O O   . HOH E 3 .   ? 73.675  33.510 4.300  1.00 53.75 ? 407  HOH A O   1 
HETATM 5324 O O   . HOH F 3 .   ? 87.246  55.604 -1.131 1.00 52.80 ? 408  HOH B O   1 
HETATM 5325 O O   . HOH F 3 .   ? 83.115  58.931 35.807 1.00 48.36 ? 409  HOH B O   1 
HETATM 5326 O O   . HOH F 3 .   ? 55.188  77.807 25.814 1.00 52.65 ? 410  HOH B O   1 
HETATM 5327 O O   . HOH F 3 .   ? 56.040  48.353 21.351 1.00 55.10 ? 411  HOH B O   1 
HETATM 5328 O O   . HOH F 3 .   ? 77.926  57.767 3.940  1.00 54.24 ? 412  HOH B O   1 
HETATM 5329 O O   . HOH F 3 .   ? 65.484  45.723 31.939 1.00 57.60 ? 413  HOH B O   1 
HETATM 5330 O O   . HOH F 3 .   ? 56.082  66.606 7.048  1.00 53.75 ? 414  HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   1   1   SER SER A . n 
A 1 2   GLU 2   2   2   GLU GLU A . n 
A 1 3   ASN 3   3   3   ASN ASN A . n 
A 1 4   ASP 4   4   4   ASP ASP A . n 
A 1 5   VAL 5   5   5   VAL VAL A . n 
A 1 6   ILE 6   6   6   ILE ILE A . n 
A 1 7   GLU 7   7   7   GLU GLU A . n 
A 1 8   LEU 8   8   8   LEU LEU A . n 
A 1 9   ASP 9   9   9   ASP ASP A . n 
A 1 10  ASP 10  10  10  ASP ASP A . n 
A 1 11  VAL 11  11  11  VAL VAL A . n 
A 1 12  ALA 12  12  12  ALA ALA A . n 
A 1 13  ASN 13  13  13  ASN ASN A . n 
A 1 14  LEU 14  14  14  LEU LEU A . n 
A 1 15  MET 15  15  15  MET MET A . n 
A 1 16  PHE 16  16  16  PHE PHE A . n 
A 1 17  TYR 17  17  17  TYR TYR A . n 
A 1 18  GLY 18  18  18  GLY GLY A . n 
A 1 19  GLU 19  19  19  GLU GLU A . n 
A 1 20  GLY 20  20  20  GLY GLY A . n 
A 1 21  GLU 21  21  21  GLU GLU A . n 
A 1 22  VAL 22  22  22  VAL VAL A . n 
A 1 23  GLY 23  23  23  GLY GLY A . n 
A 1 24  ASP 24  24  24  ASP ASP A . n 
A 1 25  ASN 25  25  25  ASN ASN A . n 
A 1 26  HIS 26  26  26  HIS HIS A . n 
A 1 27  GLN 27  27  27  GLN GLN A . n 
A 1 28  LYS 28  28  28  LYS LYS A . n 
A 1 29  PHE 29  29  29  PHE PHE A . n 
A 1 30  MET 30  30  30  MET MET A . n 
A 1 31  LEU 31  31  31  LEU LEU A . n 
A 1 32  ILE 32  32  32  ILE ILE A . n 
A 1 33  PHE 33  33  33  PHE PHE A . n 
A 1 34  ASP 34  34  34  ASP ASP A . n 
A 1 35  THR 35  35  35  THR THR A . n 
A 1 36  GLY 36  36  36  GLY GLY A . n 
A 1 37  SER 37  37  37  SER SER A . n 
A 1 38  ALA 38  38  38  ALA ALA A . n 
A 1 39  ASN 39  39  39  ASN ASN A . n 
A 1 40  LEU 40  40  40  LEU LEU A . n 
A 1 41  TRP 41  41  41  TRP TRP A . n 
A 1 42  VAL 42  42  42  VAL VAL A . n 
A 1 43  PRO 43  43  43  PRO PRO A . n 
A 1 44  SER 44  44  44  SER SER A . n 
A 1 45  LYS 45  45  45  LYS LYS A . n 
A 1 46  LYS 46  46  46  LYS LYS A . n 
A 1 47  CYS 47  47  47  CYS CYS A . n 
A 1 48  ASN 48  48  48  ASN ASN A . n 
A 1 49  SER 49  49  49  SER SER A . n 
A 1 50  ILE 50  50  50  ILE ILE A . n 
A 1 51  GLY 51  51  51  GLY GLY A . n 
A 1 52  CYS 52  52  52  CYS CYS A . n 
A 1 53  SER 53  53  53  SER SER A . n 
A 1 54  THR 54  54  54  THR THR A . n 
A 1 55  LYS 55  55  55  LYS LYS A . n 
A 1 56  HIS 56  56  56  HIS HIS A . n 
A 1 57  LEU 57  57  57  LEU LEU A . n 
A 1 58  TYR 58  58  58  TYR TYR A . n 
A 1 59  ASP 59  59  59  ASP ASP A . n 
A 1 60  SER 60  60  60  SER SER A . n 
A 1 61  SER 61  61  61  SER SER A . n 
A 1 62  LYS 62  62  62  LYS LYS A . n 
A 1 63  SER 63  63  63  SER SER A . n 
A 1 64  LYS 64  64  64  LYS LYS A . n 
A 1 65  SER 65  65  65  SER SER A . n 
A 1 66  TYR 66  66  66  TYR TYR A . n 
A 1 67  GLU 67  67  67  GLU GLU A . n 
A 1 68  LYS 68  68  68  LYS LYS A . n 
A 1 69  ASP 69  69  69  ASP ASP A . n 
A 1 70  GLY 70  70  70  GLY GLY A . n 
A 1 71  THR 71  71  71  THR THR A . n 
A 1 72  LYS 72  72  72  LYS LYS A . n 
A 1 73  VAL 73  73  73  VAL VAL A . n 
A 1 74  GLU 74  74  74  GLU GLU A . n 
A 1 75  ILE 75  75  75  ILE ILE A . n 
A 1 76  THR 76  76  76  THR THR A . n 
A 1 77  TYR 77  77  77  TYR TYR A . n 
A 1 78  GLY 78  78  78  GLY GLY A . n 
A 1 79  SER 79  79  79  SER SER A . n 
A 1 80  GLY 80  80  80  GLY GLY A . n 
A 1 81  THR 81  81  81  THR THR A . n 
A 1 82  VAL 82  82  82  VAL VAL A . n 
A 1 83  ARG 83  83  83  ARG ARG A . n 
A 1 84  GLY 84  84  84  GLY GLY A . n 
A 1 85  PHE 85  85  85  PHE PHE A . n 
A 1 86  PHE 86  86  86  PHE PHE A . n 
A 1 87  SER 87  87  87  SER SER A . n 
A 1 88  LYS 88  88  88  LYS LYS A . n 
A 1 89  ASP 89  89  89  ASP ASP A . n 
A 1 90  LEU 90  90  90  LEU LEU A . n 
A 1 91  VAL 91  91  91  VAL VAL A . n 
A 1 92  THR 92  92  92  THR THR A . n 
A 1 93  LEU 93  93  93  LEU LEU A . n 
A 1 94  GLY 94  94  94  GLY GLY A . n 
A 1 95  TYR 95  95  95  TYR TYR A . n 
A 1 96  LEU 96  96  96  LEU LEU A . n 
A 1 97  SER 97  97  97  SER SER A . n 
A 1 98  LEU 98  98  98  LEU LEU A . n 
A 1 99  PRO 99  99  99  PRO PRO A . n 
A 1 100 TYR 100 100 100 TYR TYR A . n 
A 1 101 LYS 101 101 101 LYS LYS A . n 
A 1 102 PHE 102 102 102 PHE PHE A . n 
A 1 103 ILE 103 103 103 ILE ILE A . n 
A 1 104 GLU 104 104 104 GLU GLU A . n 
A 1 105 VAL 105 105 105 VAL VAL A . n 
A 1 106 THR 106 106 106 THR THR A . n 
A 1 107 ASP 107 107 107 ASP ASP A . n 
A 1 108 THR 108 108 108 THR THR A . n 
A 1 109 ASP 109 109 109 ASP ASP A . n 
A 1 110 ASP 110 110 110 ASP ASP A . n 
A 1 111 LEU 111 111 111 LEU LEU A . n 
A 1 112 GLU 112 112 112 GLU GLU A . n 
A 1 113 PRO 113 113 113 PRO PRO A . n 
A 1 114 LEU 114 114 114 LEU LEU A . n 
A 1 115 TYR 115 115 115 TYR TYR A . n 
A 1 116 THR 116 116 116 THR THR A . n 
A 1 117 ALA 117 117 117 ALA ALA A . n 
A 1 118 ALA 118 118 118 ALA ALA A . n 
A 1 119 GLU 119 119 119 GLU GLU A . n 
A 1 120 PHE 120 120 120 PHE PHE A . n 
A 1 121 ASP 121 121 121 ASP ASP A . n 
A 1 122 GLY 122 122 122 GLY GLY A . n 
A 1 123 ILE 123 123 123 ILE ILE A . n 
A 1 124 LEU 124 124 124 LEU LEU A . n 
A 1 125 GLY 125 125 125 GLY GLY A . n 
A 1 126 LEU 126 126 126 LEU LEU A . n 
A 1 127 GLY 127 127 127 GLY GLY A . n 
A 1 128 TRP 128 128 128 TRP TRP A . n 
A 1 129 LYS 129 129 129 LYS LYS A . n 
A 1 130 ASP 130 130 130 ASP ASP A . n 
A 1 131 LEU 131 131 131 LEU LEU A . n 
A 1 132 SER 132 132 132 SER SER A . n 
A 1 133 ILE 133 133 133 ILE ILE A . n 
A 1 134 GLY 134 134 134 GLY GLY A . n 
A 1 135 SER 135 135 135 SER SER A . n 
A 1 136 ILE 136 136 136 ILE ILE A . n 
A 1 137 ASP 137 137 137 ASP ASP A . n 
A 1 138 PRO 138 138 138 PRO PRO A . n 
A 1 139 ILE 139 139 139 ILE ILE A . n 
A 1 140 VAL 140 140 140 VAL VAL A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 GLU 142 142 142 GLU GLU A . n 
A 1 143 LEU 143 143 143 LEU LEU A . n 
A 1 144 LYS 144 144 144 LYS LYS A . n 
A 1 145 ASN 145 145 145 ASN ASN A . n 
A 1 146 GLN 146 146 146 GLN GLN A . n 
A 1 147 ASN 147 147 147 ASN ASN A . n 
A 1 148 LYS 148 148 148 LYS LYS A . n 
A 1 149 ILE 149 149 149 ILE ILE A . n 
A 1 150 ASP 150 150 150 ASP ASP A . n 
A 1 151 GLN 151 151 151 GLN GLN A . n 
A 1 152 ALA 152 152 152 ALA ALA A . n 
A 1 153 LEU 153 153 153 LEU LEU A . n 
A 1 154 PHE 154 154 154 PHE PHE A . n 
A 1 155 THR 155 155 155 THR THR A . n 
A 1 156 PHE 156 156 156 PHE PHE A . n 
A 1 157 TYR 157 157 157 TYR TYR A . n 
A 1 158 LEU 158 158 158 LEU LEU A . n 
A 1 159 PRO 159 159 159 PRO PRO A . n 
A 1 160 VAL 160 160 160 VAL VAL A . n 
A 1 161 HIS 161 161 161 HIS HIS A . n 
A 1 162 ASP 162 162 162 ASP ASP A . n 
A 1 163 LYS 163 163 163 LYS LYS A . n 
A 1 164 HIS 164 164 164 HIS HIS A . n 
A 1 165 SER 165 165 165 SER SER A . n 
A 1 166 GLY 166 166 166 GLY GLY A . n 
A 1 167 TYR 167 167 167 TYR TYR A . n 
A 1 168 LEU 168 168 168 LEU LEU A . n 
A 1 169 THR 169 169 169 THR THR A . n 
A 1 170 ILE 170 170 170 ILE ILE A . n 
A 1 171 GLY 171 171 171 GLY GLY A . n 
A 1 172 GLY 172 172 172 GLY GLY A . n 
A 1 173 ILE 173 173 173 ILE ILE A . n 
A 1 174 GLU 174 174 174 GLU GLU A . n 
A 1 175 GLU 175 175 175 GLU GLU A . n 
A 1 176 LYS 176 176 176 LYS LYS A . n 
A 1 177 PHE 177 177 177 PHE PHE A . n 
A 1 178 TYR 178 178 178 TYR TYR A . n 
A 1 179 GLU 179 179 179 GLU GLU A . n 
A 1 180 GLY 180 180 180 GLY GLY A . n 
A 1 181 GLU 181 181 181 GLU GLU A . n 
A 1 182 LEU 182 182 182 LEU LEU A . n 
A 1 183 THR 183 183 183 THR THR A . n 
A 1 184 TYR 184 184 184 TYR TYR A . n 
A 1 185 GLU 185 185 185 GLU GLU A . n 
A 1 186 LYS 186 186 186 LYS LYS A . n 
A 1 187 LEU 187 187 187 LEU LEU A . n 
A 1 188 ASN 188 188 188 ASN ASN A . n 
A 1 189 HIS 189 189 189 HIS HIS A . n 
A 1 190 ASP 190 190 190 ASP ASP A . n 
A 1 191 LEU 191 191 191 LEU LEU A . n 
A 1 192 PHE 192 192 192 PHE PHE A . n 
A 1 193 TRP 193 193 193 TRP TRP A . n 
A 1 194 GLN 194 194 194 GLN GLN A . n 
A 1 195 VAL 195 195 195 VAL VAL A . n 
A 1 196 ASP 196 196 196 ASP ASP A . n 
A 1 197 LEU 197 197 197 LEU LEU A . n 
A 1 198 ASP 198 198 198 ASP ASP A . n 
A 1 199 VAL 199 199 199 VAL VAL A . n 
A 1 200 ASN 200 200 200 ASN ASN A . n 
A 1 201 PHE 201 201 201 PHE PHE A . n 
A 1 202 GLY 202 202 202 GLY GLY A . n 
A 1 203 LYS 203 203 203 LYS LYS A . n 
A 1 204 THR 204 204 204 THR THR A . n 
A 1 205 SER 205 205 205 SER SER A . n 
A 1 206 MET 206 206 206 MET MET A . n 
A 1 207 GLU 207 207 207 GLU GLU A . n 
A 1 208 LYS 208 208 208 LYS LYS A . n 
A 1 209 ALA 209 209 209 ALA ALA A . n 
A 1 210 ASN 210 210 210 ASN ASN A . n 
A 1 211 VAL 211 211 211 VAL VAL A . n 
A 1 212 ILE 212 212 212 ILE ILE A . n 
A 1 213 VAL 213 213 213 VAL VAL A . n 
A 1 214 ASP 214 214 214 ASP ASP A . n 
A 1 215 SER 215 215 215 SER SER A . n 
A 1 216 GLY 216 216 216 GLY GLY A . n 
A 1 217 THR 217 217 217 THR THR A . n 
A 1 218 SER 218 218 218 SER SER A . n 
A 1 219 THR 219 219 219 THR THR A . n 
A 1 220 ILE 220 220 220 ILE ILE A . n 
A 1 221 THR 221 221 221 THR THR A . n 
A 1 222 ALA 222 222 222 ALA ALA A . n 
A 1 223 PRO 223 223 223 PRO PRO A . n 
A 1 224 THR 224 224 224 THR THR A . n 
A 1 225 SER 225 225 225 SER SER A . n 
A 1 226 PHE 226 226 226 PHE PHE A . n 
A 1 227 ILE 227 227 227 ILE ILE A . n 
A 1 228 ASN 228 228 228 ASN ASN A . n 
A 1 229 LYS 229 229 229 LYS LYS A . n 
A 1 230 PHE 230 230 230 PHE PHE A . n 
A 1 231 PHE 231 231 231 PHE PHE A . n 
A 1 232 LYS 232 232 232 LYS LYS A . n 
A 1 233 ASP 233 233 233 ASP ASP A . n 
A 1 234 LEU 234 234 234 LEU LEU A . n 
A 1 235 ASN 235 235 235 ASN ASN A . n 
A 1 236 VAL 236 236 236 VAL VAL A . n 
A 1 237 ILE 237 237 237 ILE ILE A . n 
A 1 238 LYS 238 238 238 LYS LYS A . n 
A 1 239 VAL 239 239 239 VAL VAL A . n 
A 1 240 PRO 240 240 240 PRO PRO A . n 
A 1 241 PHE 241 241 241 PHE PHE A . n 
A 1 242 LEU 242 242 242 LEU LEU A . n 
A 1 243 PRO 243 243 243 PRO PRO A . n 
A 1 244 PHE 244 244 244 PHE PHE A . n 
A 1 245 TYR 245 245 245 TYR TYR A . n 
A 1 246 ILE 246 246 246 ILE ILE A . n 
A 1 247 THR 247 247 247 THR THR A . n 
A 1 248 THR 248 248 248 THR THR A . n 
A 1 249 CYS 249 249 249 CYS CYS A . n 
A 1 250 ASN 250 250 250 ASN ASN A . n 
A 1 251 ASN 251 251 251 ASN ASN A . n 
A 1 252 LYS 252 252 252 LYS LYS A . n 
A 1 253 ASP 253 253 253 ASP ASP A . n 
A 1 254 MET 254 254 254 MET MET A . n 
A 1 255 PRO 255 255 255 PRO PRO A . n 
A 1 256 THR 256 256 256 THR THR A . n 
A 1 257 LEU 257 257 257 LEU LEU A . n 
A 1 258 GLU 258 258 258 GLU GLU A . n 
A 1 259 PHE 259 259 259 PHE PHE A . n 
A 1 260 LYS 260 260 260 LYS LYS A . n 
A 1 261 SER 261 261 261 SER SER A . n 
A 1 262 ALA 262 262 262 ALA ALA A . n 
A 1 263 ASN 263 263 263 ASN ASN A . n 
A 1 264 ASN 264 264 264 ASN ASN A . n 
A 1 265 THR 265 265 265 THR THR A . n 
A 1 266 TYR 266 266 266 TYR TYR A . n 
A 1 267 THR 267 267 267 THR THR A . n 
A 1 268 LEU 268 268 268 LEU LEU A . n 
A 1 269 GLU 269 269 269 GLU GLU A . n 
A 1 270 PRO 270 270 270 PRO PRO A . n 
A 1 271 GLU 271 271 271 GLU GLU A . n 
A 1 272 TYR 272 272 272 TYR TYR A . n 
A 1 273 TYR 273 273 273 TYR TYR A . n 
A 1 274 MET 274 274 274 MET MET A . n 
A 1 275 GLU 275 275 275 GLU GLU A . n 
A 1 276 PRO 276 276 276 PRO PRO A . n 
A 1 277 LEU 277 277 277 LEU LEU A . n 
A 1 278 LEU 278 278 278 LEU LEU A . n 
A 1 279 ASP 279 279 279 ASP ASP A . n 
A 1 280 ILE 280 280 280 ILE ILE A . n 
A 1 281 ASP 281 281 281 ASP ASP A . n 
A 1 282 ASP 282 282 282 ASP ASP A . n 
A 1 283 THR 283 283 283 THR THR A . n 
A 1 284 LEU 284 284 284 LEU LEU A . n 
A 1 285 CYS 285 285 285 CYS CYS A . n 
A 1 286 MET 286 286 286 MET MET A . n 
A 1 287 LEU 287 287 287 LEU LEU A . n 
A 1 288 TYR 288 288 288 TYR TYR A . n 
A 1 289 ILE 289 289 289 ILE ILE A . n 
A 1 290 LEU 290 290 290 LEU LEU A . n 
A 1 291 PRO 291 291 291 PRO PRO A . n 
A 1 292 VAL 292 292 292 VAL VAL A . n 
A 1 293 ASP 293 293 293 ASP ASP A . n 
A 1 294 ILE 294 294 294 ILE ILE A . n 
A 1 295 ASP 295 295 295 ASP ASP A . n 
A 1 296 LYS 296 296 296 LYS LYS A . n 
A 1 297 ASN 297 297 297 ASN ASN A . n 
A 1 298 THR 298 298 298 THR THR A . n 
A 1 299 PHE 299 299 299 PHE PHE A . n 
A 1 300 ILE 300 300 300 ILE ILE A . n 
A 1 301 LEU 301 301 301 LEU LEU A . n 
A 1 302 GLY 302 302 302 GLY GLY A . n 
A 1 303 ASP 303 303 303 ASP ASP A . n 
A 1 304 PRO 304 304 304 PRO PRO A . n 
A 1 305 PHE 305 305 305 PHE PHE A . n 
A 1 306 MET 306 306 306 MET MET A . n 
A 1 307 ARG 307 307 307 ARG ARG A . n 
A 1 308 LYS 308 308 308 LYS LYS A . n 
A 1 309 TYR 309 309 309 TYR TYR A . n 
A 1 310 PHE 310 310 310 PHE PHE A . n 
A 1 311 THR 311 311 311 THR THR A . n 
A 1 312 VAL 312 312 312 VAL VAL A . n 
A 1 313 PHE 313 313 313 PHE PHE A . n 
A 1 314 ASP 314 314 314 ASP ASP A . n 
A 1 315 TYR 315 315 315 TYR TYR A . n 
A 1 316 ASP 316 316 316 ASP ASP A . n 
A 1 317 LYS 317 317 317 LYS LYS A . n 
A 1 318 GLU 318 318 318 GLU GLU A . n 
A 1 319 SER 319 319 319 SER SER A . n 
A 1 320 ILE 320 320 320 ILE ILE A . n 
A 1 321 GLY 321 321 321 GLY GLY A . n 
A 1 322 PHE 322 322 322 PHE PHE A . n 
A 1 323 ALA 323 323 323 ALA ALA A . n 
A 1 324 VAL 324 324 324 VAL VAL A . n 
A 1 325 ALA 325 325 325 ALA ALA A . n 
A 1 326 LYS 326 326 326 LYS LYS A . n 
A 1 327 ASN 327 327 327 ASN ASN A . n 
B 1 1   SER 1   1   1   SER SER B . n 
B 1 2   GLU 2   2   2   GLU GLU B . n 
B 1 3   ASN 3   3   3   ASN ASN B . n 
B 1 4   ASP 4   4   4   ASP ASP B . n 
B 1 5   VAL 5   5   5   VAL VAL B . n 
B 1 6   ILE 6   6   6   ILE ILE B . n 
B 1 7   GLU 7   7   7   GLU GLU B . n 
B 1 8   LEU 8   8   8   LEU LEU B . n 
B 1 9   ASP 9   9   9   ASP ASP B . n 
B 1 10  ASP 10  10  10  ASP ASP B . n 
B 1 11  VAL 11  11  11  VAL VAL B . n 
B 1 12  ALA 12  12  12  ALA ALA B . n 
B 1 13  ASN 13  13  13  ASN ASN B . n 
B 1 14  LEU 14  14  14  LEU LEU B . n 
B 1 15  MET 15  15  15  MET MET B . n 
B 1 16  PHE 16  16  16  PHE PHE B . n 
B 1 17  TYR 17  17  17  TYR TYR B . n 
B 1 18  GLY 18  18  18  GLY GLY B . n 
B 1 19  GLU 19  19  19  GLU GLU B . n 
B 1 20  GLY 20  20  20  GLY GLY B . n 
B 1 21  GLU 21  21  21  GLU GLU B . n 
B 1 22  VAL 22  22  22  VAL VAL B . n 
B 1 23  GLY 23  23  23  GLY GLY B . n 
B 1 24  ASP 24  24  24  ASP ASP B . n 
B 1 25  ASN 25  25  25  ASN ASN B . n 
B 1 26  HIS 26  26  26  HIS HIS B . n 
B 1 27  GLN 27  27  27  GLN GLN B . n 
B 1 28  LYS 28  28  28  LYS LYS B . n 
B 1 29  PHE 29  29  29  PHE PHE B . n 
B 1 30  MET 30  30  30  MET MET B . n 
B 1 31  LEU 31  31  31  LEU LEU B . n 
B 1 32  ILE 32  32  32  ILE ILE B . n 
B 1 33  PHE 33  33  33  PHE PHE B . n 
B 1 34  ASP 34  34  34  ASP ASP B . n 
B 1 35  THR 35  35  35  THR THR B . n 
B 1 36  GLY 36  36  36  GLY GLY B . n 
B 1 37  SER 37  37  37  SER SER B . n 
B 1 38  ALA 38  38  38  ALA ALA B . n 
B 1 39  ASN 39  39  39  ASN ASN B . n 
B 1 40  LEU 40  40  40  LEU LEU B . n 
B 1 41  TRP 41  41  41  TRP TRP B . n 
B 1 42  VAL 42  42  42  VAL VAL B . n 
B 1 43  PRO 43  43  43  PRO PRO B . n 
B 1 44  SER 44  44  44  SER SER B . n 
B 1 45  LYS 45  45  45  LYS LYS B . n 
B 1 46  LYS 46  46  46  LYS LYS B . n 
B 1 47  CYS 47  47  47  CYS CYS B . n 
B 1 48  ASN 48  48  48  ASN ASN B . n 
B 1 49  SER 49  49  49  SER SER B . n 
B 1 50  ILE 50  50  50  ILE ILE B . n 
B 1 51  GLY 51  51  51  GLY GLY B . n 
B 1 52  CYS 52  52  52  CYS CYS B . n 
B 1 53  SER 53  53  53  SER SER B . n 
B 1 54  THR 54  54  54  THR THR B . n 
B 1 55  LYS 55  55  55  LYS LYS B . n 
B 1 56  HIS 56  56  56  HIS HIS B . n 
B 1 57  LEU 57  57  57  LEU LEU B . n 
B 1 58  TYR 58  58  58  TYR TYR B . n 
B 1 59  ASP 59  59  59  ASP ASP B . n 
B 1 60  SER 60  60  60  SER SER B . n 
B 1 61  SER 61  61  61  SER SER B . n 
B 1 62  LYS 62  62  62  LYS LYS B . n 
B 1 63  SER 63  63  63  SER SER B . n 
B 1 64  LYS 64  64  64  LYS LYS B . n 
B 1 65  SER 65  65  65  SER SER B . n 
B 1 66  TYR 66  66  66  TYR TYR B . n 
B 1 67  GLU 67  67  67  GLU GLU B . n 
B 1 68  LYS 68  68  68  LYS LYS B . n 
B 1 69  ASP 69  69  69  ASP ASP B . n 
B 1 70  GLY 70  70  70  GLY GLY B . n 
B 1 71  THR 71  71  71  THR THR B . n 
B 1 72  LYS 72  72  72  LYS LYS B . n 
B 1 73  VAL 73  73  73  VAL VAL B . n 
B 1 74  GLU 74  74  74  GLU GLU B . n 
B 1 75  ILE 75  75  75  ILE ILE B . n 
B 1 76  THR 76  76  76  THR THR B . n 
B 1 77  TYR 77  77  77  TYR TYR B . n 
B 1 78  GLY 78  78  78  GLY GLY B . n 
B 1 79  SER 79  79  79  SER SER B . n 
B 1 80  GLY 80  80  80  GLY GLY B . n 
B 1 81  THR 81  81  81  THR THR B . n 
B 1 82  VAL 82  82  82  VAL VAL B . n 
B 1 83  ARG 83  83  83  ARG ARG B . n 
B 1 84  GLY 84  84  84  GLY GLY B . n 
B 1 85  PHE 85  85  85  PHE PHE B . n 
B 1 86  PHE 86  86  86  PHE PHE B . n 
B 1 87  SER 87  87  87  SER SER B . n 
B 1 88  LYS 88  88  88  LYS LYS B . n 
B 1 89  ASP 89  89  89  ASP ASP B . n 
B 1 90  LEU 90  90  90  LEU LEU B . n 
B 1 91  VAL 91  91  91  VAL VAL B . n 
B 1 92  THR 92  92  92  THR THR B . n 
B 1 93  LEU 93  93  93  LEU LEU B . n 
B 1 94  GLY 94  94  94  GLY GLY B . n 
B 1 95  TYR 95  95  95  TYR TYR B . n 
B 1 96  LEU 96  96  96  LEU LEU B . n 
B 1 97  SER 97  97  97  SER SER B . n 
B 1 98  LEU 98  98  98  LEU LEU B . n 
B 1 99  PRO 99  99  99  PRO PRO B . n 
B 1 100 TYR 100 100 100 TYR TYR B . n 
B 1 101 LYS 101 101 101 LYS LYS B . n 
B 1 102 PHE 102 102 102 PHE PHE B . n 
B 1 103 ILE 103 103 103 ILE ILE B . n 
B 1 104 GLU 104 104 104 GLU GLU B . n 
B 1 105 VAL 105 105 105 VAL VAL B . n 
B 1 106 THR 106 106 106 THR THR B . n 
B 1 107 ASP 107 107 107 ASP ASP B . n 
B 1 108 THR 108 108 108 THR THR B . n 
B 1 109 ASP 109 109 109 ASP ASP B . n 
B 1 110 ASP 110 110 110 ASP ASP B . n 
B 1 111 LEU 111 111 111 LEU LEU B . n 
B 1 112 GLU 112 112 112 GLU GLU B . n 
B 1 113 PRO 113 113 113 PRO PRO B . n 
B 1 114 LEU 114 114 114 LEU LEU B . n 
B 1 115 TYR 115 115 115 TYR TYR B . n 
B 1 116 THR 116 116 116 THR THR B . n 
B 1 117 ALA 117 117 117 ALA ALA B . n 
B 1 118 ALA 118 118 118 ALA ALA B . n 
B 1 119 GLU 119 119 119 GLU GLU B . n 
B 1 120 PHE 120 120 120 PHE PHE B . n 
B 1 121 ASP 121 121 121 ASP ASP B . n 
B 1 122 GLY 122 122 122 GLY GLY B . n 
B 1 123 ILE 123 123 123 ILE ILE B . n 
B 1 124 LEU 124 124 124 LEU LEU B . n 
B 1 125 GLY 125 125 125 GLY GLY B . n 
B 1 126 LEU 126 126 126 LEU LEU B . n 
B 1 127 GLY 127 127 127 GLY GLY B . n 
B 1 128 TRP 128 128 128 TRP TRP B . n 
B 1 129 LYS 129 129 129 LYS LYS B . n 
B 1 130 ASP 130 130 130 ASP ASP B . n 
B 1 131 LEU 131 131 131 LEU LEU B . n 
B 1 132 SER 132 132 132 SER SER B . n 
B 1 133 ILE 133 133 133 ILE ILE B . n 
B 1 134 GLY 134 134 134 GLY GLY B . n 
B 1 135 SER 135 135 135 SER SER B . n 
B 1 136 ILE 136 136 136 ILE ILE B . n 
B 1 137 ASP 137 137 137 ASP ASP B . n 
B 1 138 PRO 138 138 138 PRO PRO B . n 
B 1 139 ILE 139 139 139 ILE ILE B . n 
B 1 140 VAL 140 140 140 VAL VAL B . n 
B 1 141 VAL 141 141 141 VAL VAL B . n 
B 1 142 GLU 142 142 142 GLU GLU B . n 
B 1 143 LEU 143 143 143 LEU LEU B . n 
B 1 144 LYS 144 144 144 LYS LYS B . n 
B 1 145 ASN 145 145 145 ASN ASN B . n 
B 1 146 GLN 146 146 146 GLN GLN B . n 
B 1 147 ASN 147 147 147 ASN ASN B . n 
B 1 148 LYS 148 148 148 LYS LYS B . n 
B 1 149 ILE 149 149 149 ILE ILE B . n 
B 1 150 ASP 150 150 150 ASP ASP B . n 
B 1 151 GLN 151 151 151 GLN GLN B . n 
B 1 152 ALA 152 152 152 ALA ALA B . n 
B 1 153 LEU 153 153 153 LEU LEU B . n 
B 1 154 PHE 154 154 154 PHE PHE B . n 
B 1 155 THR 155 155 155 THR THR B . n 
B 1 156 PHE 156 156 156 PHE PHE B . n 
B 1 157 TYR 157 157 157 TYR TYR B . n 
B 1 158 LEU 158 158 158 LEU LEU B . n 
B 1 159 PRO 159 159 159 PRO PRO B . n 
B 1 160 VAL 160 160 160 VAL VAL B . n 
B 1 161 HIS 161 161 161 HIS HIS B . n 
B 1 162 ASP 162 162 162 ASP ASP B . n 
B 1 163 LYS 163 163 163 LYS LYS B . n 
B 1 164 HIS 164 164 164 HIS HIS B . n 
B 1 165 SER 165 165 165 SER SER B . n 
B 1 166 GLY 166 166 166 GLY GLY B . n 
B 1 167 TYR 167 167 167 TYR TYR B . n 
B 1 168 LEU 168 168 168 LEU LEU B . n 
B 1 169 THR 169 169 169 THR THR B . n 
B 1 170 ILE 170 170 170 ILE ILE B . n 
B 1 171 GLY 171 171 171 GLY GLY B . n 
B 1 172 GLY 172 172 172 GLY GLY B . n 
B 1 173 ILE 173 173 173 ILE ILE B . n 
B 1 174 GLU 174 174 174 GLU GLU B . n 
B 1 175 GLU 175 175 175 GLU GLU B . n 
B 1 176 LYS 176 176 176 LYS LYS B . n 
B 1 177 PHE 177 177 177 PHE PHE B . n 
B 1 178 TYR 178 178 178 TYR TYR B . n 
B 1 179 GLU 179 179 179 GLU GLU B . n 
B 1 180 GLY 180 180 180 GLY GLY B . n 
B 1 181 GLU 181 181 181 GLU GLU B . n 
B 1 182 LEU 182 182 182 LEU LEU B . n 
B 1 183 THR 183 183 183 THR THR B . n 
B 1 184 TYR 184 184 184 TYR TYR B . n 
B 1 185 GLU 185 185 185 GLU GLU B . n 
B 1 186 LYS 186 186 186 LYS LYS B . n 
B 1 187 LEU 187 187 187 LEU LEU B . n 
B 1 188 ASN 188 188 188 ASN ASN B . n 
B 1 189 HIS 189 189 189 HIS HIS B . n 
B 1 190 ASP 190 190 190 ASP ASP B . n 
B 1 191 LEU 191 191 191 LEU LEU B . n 
B 1 192 PHE 192 192 192 PHE PHE B . n 
B 1 193 TRP 193 193 193 TRP TRP B . n 
B 1 194 GLN 194 194 194 GLN GLN B . n 
B 1 195 VAL 195 195 195 VAL VAL B . n 
B 1 196 ASP 196 196 196 ASP ASP B . n 
B 1 197 LEU 197 197 197 LEU LEU B . n 
B 1 198 ASP 198 198 198 ASP ASP B . n 
B 1 199 VAL 199 199 199 VAL VAL B . n 
B 1 200 ASN 200 200 200 ASN ASN B . n 
B 1 201 PHE 201 201 201 PHE PHE B . n 
B 1 202 GLY 202 202 202 GLY GLY B . n 
B 1 203 LYS 203 203 203 LYS LYS B . n 
B 1 204 THR 204 204 204 THR THR B . n 
B 1 205 SER 205 205 205 SER SER B . n 
B 1 206 MET 206 206 206 MET MET B . n 
B 1 207 GLU 207 207 207 GLU GLU B . n 
B 1 208 LYS 208 208 208 LYS LYS B . n 
B 1 209 ALA 209 209 209 ALA ALA B . n 
B 1 210 ASN 210 210 210 ASN ASN B . n 
B 1 211 VAL 211 211 211 VAL VAL B . n 
B 1 212 ILE 212 212 212 ILE ILE B . n 
B 1 213 VAL 213 213 213 VAL VAL B . n 
B 1 214 ASP 214 214 214 ASP ASP B . n 
B 1 215 SER 215 215 215 SER SER B . n 
B 1 216 GLY 216 216 216 GLY GLY B . n 
B 1 217 THR 217 217 217 THR THR B . n 
B 1 218 SER 218 218 218 SER SER B . n 
B 1 219 THR 219 219 219 THR THR B . n 
B 1 220 ILE 220 220 220 ILE ILE B . n 
B 1 221 THR 221 221 221 THR THR B . n 
B 1 222 ALA 222 222 222 ALA ALA B . n 
B 1 223 PRO 223 223 223 PRO PRO B . n 
B 1 224 THR 224 224 224 THR THR B . n 
B 1 225 SER 225 225 225 SER SER B . n 
B 1 226 PHE 226 226 226 PHE PHE B . n 
B 1 227 ILE 227 227 227 ILE ILE B . n 
B 1 228 ASN 228 228 228 ASN ASN B . n 
B 1 229 LYS 229 229 229 LYS LYS B . n 
B 1 230 PHE 230 230 230 PHE PHE B . n 
B 1 231 PHE 231 231 231 PHE PHE B . n 
B 1 232 LYS 232 232 232 LYS LYS B . n 
B 1 233 ASP 233 233 233 ASP ASP B . n 
B 1 234 LEU 234 234 234 LEU LEU B . n 
B 1 235 ASN 235 235 235 ASN ASN B . n 
B 1 236 VAL 236 236 236 VAL VAL B . n 
B 1 237 ILE 237 237 237 ILE ILE B . n 
B 1 238 LYS 238 238 238 LYS LYS B . n 
B 1 239 VAL 239 239 239 VAL VAL B . n 
B 1 240 PRO 240 240 240 PRO PRO B . n 
B 1 241 PHE 241 241 241 PHE PHE B . n 
B 1 242 LEU 242 242 242 LEU LEU B . n 
B 1 243 PRO 243 243 243 PRO PRO B . n 
B 1 244 PHE 244 244 244 PHE PHE B . n 
B 1 245 TYR 245 245 245 TYR TYR B . n 
B 1 246 ILE 246 246 246 ILE ILE B . n 
B 1 247 THR 247 247 247 THR THR B . n 
B 1 248 THR 248 248 248 THR THR B . n 
B 1 249 CYS 249 249 249 CYS CYS B . n 
B 1 250 ASN 250 250 250 ASN ASN B . n 
B 1 251 ASN 251 251 251 ASN ASN B . n 
B 1 252 LYS 252 252 252 LYS LYS B . n 
B 1 253 ASP 253 253 253 ASP ASP B . n 
B 1 254 MET 254 254 254 MET MET B . n 
B 1 255 PRO 255 255 255 PRO PRO B . n 
B 1 256 THR 256 256 256 THR THR B . n 
B 1 257 LEU 257 257 257 LEU LEU B . n 
B 1 258 GLU 258 258 258 GLU GLU B . n 
B 1 259 PHE 259 259 259 PHE PHE B . n 
B 1 260 LYS 260 260 260 LYS LYS B . n 
B 1 261 SER 261 261 261 SER SER B . n 
B 1 262 ALA 262 262 262 ALA ALA B . n 
B 1 263 ASN 263 263 263 ASN ASN B . n 
B 1 264 ASN 264 264 264 ASN ASN B . n 
B 1 265 THR 265 265 265 THR THR B . n 
B 1 266 TYR 266 266 266 TYR TYR B . n 
B 1 267 THR 267 267 267 THR THR B . n 
B 1 268 LEU 268 268 268 LEU LEU B . n 
B 1 269 GLU 269 269 269 GLU GLU B . n 
B 1 270 PRO 270 270 270 PRO PRO B . n 
B 1 271 GLU 271 271 271 GLU GLU B . n 
B 1 272 TYR 272 272 272 TYR TYR B . n 
B 1 273 TYR 273 273 273 TYR TYR B . n 
B 1 274 MET 274 274 274 MET MET B . n 
B 1 275 GLU 275 275 275 GLU GLU B . n 
B 1 276 PRO 276 276 276 PRO PRO B . n 
B 1 277 LEU 277 277 277 LEU LEU B . n 
B 1 278 LEU 278 278 278 LEU LEU B . n 
B 1 279 ASP 279 279 279 ASP ASP B . n 
B 1 280 ILE 280 280 280 ILE ILE B . n 
B 1 281 ASP 281 281 281 ASP ASP B . n 
B 1 282 ASP 282 282 282 ASP ASP B . n 
B 1 283 THR 283 283 283 THR THR B . n 
B 1 284 LEU 284 284 284 LEU LEU B . n 
B 1 285 CYS 285 285 285 CYS CYS B . n 
B 1 286 MET 286 286 286 MET MET B . n 
B 1 287 LEU 287 287 287 LEU LEU B . n 
B 1 288 TYR 288 288 288 TYR TYR B . n 
B 1 289 ILE 289 289 289 ILE ILE B . n 
B 1 290 LEU 290 290 290 LEU LEU B . n 
B 1 291 PRO 291 291 291 PRO PRO B . n 
B 1 292 VAL 292 292 292 VAL VAL B . n 
B 1 293 ASP 293 293 293 ASP ASP B . n 
B 1 294 ILE 294 294 294 ILE ILE B . n 
B 1 295 ASP 295 295 295 ASP ASP B . n 
B 1 296 LYS 296 296 296 LYS LYS B . n 
B 1 297 ASN 297 297 297 ASN ASN B . n 
B 1 298 THR 298 298 298 THR THR B . n 
B 1 299 PHE 299 299 299 PHE PHE B . n 
B 1 300 ILE 300 300 300 ILE ILE B . n 
B 1 301 LEU 301 301 301 LEU LEU B . n 
B 1 302 GLY 302 302 302 GLY GLY B . n 
B 1 303 ASP 303 303 303 ASP ASP B . n 
B 1 304 PRO 304 304 304 PRO PRO B . n 
B 1 305 PHE 305 305 305 PHE PHE B . n 
B 1 306 MET 306 306 306 MET MET B . n 
B 1 307 ARG 307 307 307 ARG ARG B . n 
B 1 308 LYS 308 308 308 LYS LYS B . n 
B 1 309 TYR 309 309 309 TYR TYR B . n 
B 1 310 PHE 310 310 310 PHE PHE B . n 
B 1 311 THR 311 311 311 THR THR B . n 
B 1 312 VAL 312 312 312 VAL VAL B . n 
B 1 313 PHE 313 313 313 PHE PHE B . n 
B 1 314 ASP 314 314 314 ASP ASP B . n 
B 1 315 TYR 315 315 315 TYR TYR B . n 
B 1 316 ASP 316 316 316 ASP ASP B . n 
B 1 317 LYS 317 317 317 LYS LYS B . n 
B 1 318 GLU 318 318 318 GLU GLU B . n 
B 1 319 SER 319 319 319 SER SER B . n 
B 1 320 ILE 320 320 320 ILE ILE B . n 
B 1 321 GLY 321 321 321 GLY GLY B . n 
B 1 322 PHE 322 322 322 PHE PHE B . n 
B 1 323 ALA 323 323 323 ALA ALA B . n 
B 1 324 VAL 324 324 324 VAL VAL B . n 
B 1 325 ALA 325 325 325 ALA ALA B . n 
B 1 326 LYS 326 326 326 LYS LYS B . n 
B 1 327 ASN 327 327 327 ASN ASN B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 JE2 1 3151 3151 JE2 JE2 A . 
D 2 JE2 1 3152 3152 JE2 JE2 B . 
E 3 HOH 1 401  401  HOH HOH A . 
E 3 HOH 2 402  402  HOH HOH A . 
E 3 HOH 3 403  403  HOH HOH A . 
E 3 HOH 4 404  404  HOH HOH A . 
E 3 HOH 5 405  405  HOH HOH A . 
E 3 HOH 6 406  406  HOH HOH A . 
E 3 HOH 7 407  407  HOH HOH A . 
F 3 HOH 1 408  408  HOH HOH B . 
F 3 HOH 2 409  409  HOH HOH B . 
F 3 HOH 3 410  410  HOH HOH B . 
F 3 HOH 4 411  411  HOH HOH B . 
F 3 HOH 5 412  412  HOH HOH B . 
F 3 HOH 6 413  413  HOH HOH B . 
F 3 HOH 7 414  414  HOH HOH B . 
# 
_pdbx_molecule_features.prd_id    PRD_000566 
_pdbx_molecule_features.name      KNI-764 
_pdbx_molecule_features.type      Peptide-like 
_pdbx_molecule_features.class     'Enzyme inhibitor' 
_pdbx_molecule_features.details   ? 
# 
loop_
_pdbx_molecule.instance_id 
_pdbx_molecule.prd_id 
_pdbx_molecule.asym_id 
1 PRD_000566 C 
2 PRD_000566 D 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? monomeric 1 
2 author_defined_assembly ? monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,E 
2 1 B,D,F 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-04-04 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2012-12-12 
5 'Structure model' 1 4 2017-10-11 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Atomic model'              
3 3 'Structure model' 'Database references'       
4 3 'Structure model' 'Derived calculations'      
5 3 'Structure model' 'Non-polymer description'   
6 3 'Structure model' 'Structure summary'         
7 3 'Structure model' 'Version format compliance' 
8 4 'Structure model' Other                       
9 5 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    5 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
SCALEPACK 'data scaling' .   ? 1 
MOLREP    phasing        .   ? 2 
CNS       refinement     1.1 ? 3 
# 
_pdbx_database_remark.id     295 
_pdbx_database_remark.text   
;

NON-CRYSTALLOGRAPHIC SYMMETRY
THE TRANSFORMATIONS PRESENTED ON THE MTRIX RECORDS BELOW
DESCRIBE NON-CRYSTALLOGRAPHIC RELATIONSHIPS AMONG ATOMS
IN THIS ENTRY.  APPLYING THE APPROPRIATE MTRIX
TRANSFORMATION TO THE RESIDUES LISTED FIRST WILL YIELD
APPROXIMATE COORDINATES FOR THE RESIDUES LISTED SECOND.
CHAIN IDENTIFIERS GIVEN AS "?" REFER TO CHAINS FOR WHICH
ATOMS ARE NOT FOUND IN THIS ENTRY.

              APPLIED TO          TRANSFORMED TO
  TRANSFORM CHAIN  RESIDUES       CHAIN  RESIDUES     RMSD
    SSS       A    1 .. 327         B    1 .. 327     ?

   WHERE SSS -> COLUMNS 8-10 OF MTRIX RECORDS

REMARK: NULL
;
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 C A ASP 110 ? ? N A GLU 112 ? ? 2.18 
2 1 C B ASP 110 ? ? N B GLU 112 ? ? 2.18 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    N 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    LEU 
_pdbx_validate_symm_contact.auth_seq_id_1     278 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    CB 
_pdbx_validate_symm_contact.auth_asym_id_2    B 
_pdbx_validate_symm_contact.auth_comp_id_2    ASP 
_pdbx_validate_symm_contact.auth_seq_id_2     279 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   3_645 
_pdbx_validate_symm_contact.dist              1.93 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CA 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            ASP 
_pdbx_validate_rmsd_bond.auth_seq_id_1             279 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            CB 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            ASP 
_pdbx_validate_rmsd_bond.auth_seq_id_2             279 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.401 
_pdbx_validate_rmsd_bond.bond_target_value         1.535 
_pdbx_validate_rmsd_bond.bond_deviation            -0.134 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.022 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 CB A ASP 4   ? ? CG A ASP 4   ? ? OD2 A ASP 4   ? ? 125.54 118.30 7.24   0.90 N 
2  1 CB A ASP 24  ? ? CG A ASP 24  ? ? OD2 A ASP 24  ? ? 124.79 118.30 6.49   0.90 N 
3  1 CB A ASP 109 ? ? CG A ASP 109 ? ? OD2 A ASP 109 ? ? 124.22 118.30 5.92   0.90 N 
4  1 N  A LEU 111 ? ? CA A LEU 111 ? ? C   A LEU 111 ? ? 94.02  111.00 -16.98 2.70 N 
5  1 CB A ASP 150 ? ? CG A ASP 150 ? ? OD2 A ASP 150 ? ? 124.76 118.30 6.46   0.90 N 
6  1 C  A LEU 158 ? ? N  A PRO 159 ? ? CD  A PRO 159 ? ? 108.85 128.40 -19.55 2.10 Y 
7  1 CB A ASP 198 ? ? CG A ASP 198 ? ? OD2 A ASP 198 ? ? 125.48 118.30 7.18   0.90 N 
8  1 N  A ASP 253 ? ? CA A ASP 253 ? ? CB  A ASP 253 ? ? 139.56 110.60 28.96  1.80 N 
9  1 CB A ASP 279 ? ? CA A ASP 279 ? ? C   A ASP 279 ? ? 80.26  110.40 -30.14 2.00 N 
10 1 CB A ASP 303 ? ? CG A ASP 303 ? ? OD2 A ASP 303 ? ? 124.58 118.30 6.28   0.90 N 
11 1 CB B ASP 4   ? ? CG B ASP 4   ? ? OD2 B ASP 4   ? ? 125.50 118.30 7.20   0.90 N 
12 1 CB B ASP 10  ? ? CG B ASP 10  ? ? OD2 B ASP 10  ? ? 123.72 118.30 5.42   0.90 N 
13 1 CB B ASP 24  ? ? CG B ASP 24  ? ? OD2 B ASP 24  ? ? 124.78 118.30 6.48   0.90 N 
14 1 CB B ASP 109 ? ? CG B ASP 109 ? ? OD2 B ASP 109 ? ? 124.23 118.30 5.93   0.90 N 
15 1 N  B LEU 111 ? ? CA B LEU 111 ? ? C   B LEU 111 ? ? 94.01  111.00 -16.99 2.70 N 
16 1 CB B ASP 150 ? ? CG B ASP 150 ? ? OD2 B ASP 150 ? ? 124.75 118.30 6.45   0.90 N 
17 1 C  B LEU 158 ? ? N  B PRO 159 ? ? CD  B PRO 159 ? ? 108.86 128.40 -19.54 2.10 Y 
18 1 CB B ASP 198 ? ? CG B ASP 198 ? ? OD2 B ASP 198 ? ? 125.51 118.30 7.21   0.90 N 
19 1 N  B ASP 253 ? ? CA B ASP 253 ? ? CB  B ASP 253 ? ? 139.56 110.60 28.96  1.80 N 
20 1 CB B ASP 279 ? ? CA B ASP 279 ? ? C   B ASP 279 ? ? 92.90  110.40 -17.50 2.00 N 
21 1 CB B ASP 303 ? ? CG B ASP 303 ? ? OD2 B ASP 303 ? ? 124.62 118.30 6.32   0.90 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1   1 GLU A 2   ? ? -50.55  -4.36   
2   1 ASN A 3   ? ? -25.36  101.95  
3   1 ALA A 12  ? ? -24.16  -53.50  
4   1 ASN A 13  ? ? -61.17  -127.88 
5   1 LEU A 14  ? ? -141.58 46.82   
6   1 LEU A 31  ? ? -104.95 -141.25 
7   1 ILE A 32  ? ? -170.59 112.65  
8   1 LYS A 46  ? ? -72.74  35.65   
9   1 ASN A 48  ? ? -143.43 -8.18   
10  1 SER A 49  ? ? -37.14  126.43  
11  1 ILE A 50  ? ? -25.72  -62.62  
12  1 SER A 53  ? ? -29.49  -66.55  
13  1 SER A 65  ? ? -165.22 -17.71  
14  1 TYR A 66  ? ? -32.45  101.58  
15  1 ASP A 69  ? ? -137.27 -75.15  
16  1 ASP A 89  ? ? -135.19 -158.19 
17  1 LEU A 98  ? ? 161.15  141.25  
18  1 THR A 106 ? ? -111.79 -70.04  
19  1 THR A 108 ? ? -98.33  -72.66  
20  1 ASP A 109 ? ? -9.48   116.78  
21  1 ASP A 110 ? ? 153.12  -44.64  
22  1 LEU A 111 ? ? -75.73  22.78   
23  1 LEU A 114 ? ? 13.07   -114.25 
24  1 TYR A 115 ? ? -30.88  -36.11  
25  1 GLU A 119 ? ? -66.32  55.32   
26  1 SER A 135 ? ? 46.69   89.39   
27  1 LYS A 144 ? ? -26.76  -53.72  
28  1 GLN A 146 ? ? -69.13  15.70   
29  1 ASN A 147 ? ? 34.29   71.77   
30  1 PRO A 159 ? ? -109.02 -74.99  
31  1 VAL A 160 ? ? 164.30  -156.21 
32  1 HIS A 161 ? ? -105.81 -104.74 
33  1 ASP A 162 ? ? -33.07  -28.17  
34  1 HIS A 164 ? ? -161.08 -143.75 
35  1 LYS A 176 ? ? -46.22  -6.54   
36  1 ASP A 190 ? ? -103.21 65.38   
37  1 LEU A 191 ? ? -122.52 -80.37  
38  1 ASN A 228 ? ? -26.31  -51.99  
39  1 ASN A 235 ? ? 38.22   71.49   
40  1 PRO A 240 ? ? -37.82  -89.89  
41  1 THR A 247 ? ? 170.99  161.78  
42  1 ASN A 250 ? ? -67.46  24.95   
43  1 ASN A 251 ? ? -57.06  93.10   
44  1 LYS A 252 ? ? -36.99  120.43  
45  1 ASP A 253 ? ? 94.09   89.86   
46  1 PRO A 276 ? ? -24.22  166.24  
47  1 LEU A 278 ? ? 170.47  12.16   
48  1 ASP A 279 ? ? 55.39   13.57   
49  1 ILE A 280 ? ? -146.03 -29.30  
50  1 ASP A 293 ? ? -109.43 66.68   
51  1 ASP A 295 ? ? -124.48 -156.65 
52  1 ASN A 297 ? ? -147.23 27.06   
53  1 ASP A 303 ? ? -27.43  -50.13  
54  1 LYS A 317 ? ? -59.97  -6.20   
55  1 LYS A 326 ? ? -67.07  99.53   
56  1 GLU B 2   ? ? -50.59  -4.31   
57  1 ASN B 3   ? ? -25.40  101.95  
58  1 ALA B 12  ? ? -24.14  -53.52  
59  1 ASN B 13  ? ? -61.19  -127.83 
60  1 LEU B 14  ? ? -141.61 46.86   
61  1 LEU B 31  ? ? -104.99 -141.26 
62  1 ILE B 32  ? ? -170.55 112.66  
63  1 LYS B 46  ? ? -72.74  35.59   
64  1 ASN B 48  ? ? -143.44 -8.08   
65  1 SER B 49  ? ? -37.19  126.45  
66  1 ILE B 50  ? ? -25.78  -62.58  
67  1 SER B 53  ? ? -29.51  -66.56  
68  1 SER B 65  ? ? -165.22 -17.76  
69  1 TYR B 66  ? ? -32.50  101.61  
70  1 ASP B 69  ? ? -137.30 -75.07  
71  1 ASP B 89  ? ? -135.17 -158.17 
72  1 LEU B 98  ? ? 161.18  141.23  
73  1 THR B 106 ? ? -111.80 -70.01  
74  1 THR B 108 ? ? -98.34  -72.64  
75  1 ASP B 109 ? ? -9.46   116.74  
76  1 ASP B 110 ? ? 153.13  -44.61  
77  1 LEU B 111 ? ? -75.77  22.78   
78  1 LEU B 114 ? ? 13.09   -114.27 
79  1 TYR B 115 ? ? -30.89  -36.11  
80  1 GLU B 119 ? ? -66.27  55.34   
81  1 SER B 135 ? ? 46.67   89.45   
82  1 LYS B 144 ? ? -26.76  -53.68  
83  1 GLN B 146 ? ? -69.13  15.73   
84  1 ASN B 147 ? ? 34.30   71.74   
85  1 PRO B 159 ? ? -109.00 -74.95  
86  1 VAL B 160 ? ? 164.29  -156.22 
87  1 HIS B 161 ? ? -105.83 -104.71 
88  1 ASP B 162 ? ? -33.01  -28.20  
89  1 HIS B 164 ? ? -161.12 -143.74 
90  1 LYS B 176 ? ? -46.23  -6.59   
91  1 ASP B 190 ? ? -103.17 65.37   
92  1 LEU B 191 ? ? -122.53 -80.36  
93  1 ASN B 228 ? ? -26.24  -52.08  
94  1 LEU B 234 ? ? -99.91  30.06   
95  1 ASN B 235 ? ? 38.14   71.52   
96  1 PRO B 240 ? ? -37.76  -89.85  
97  1 THR B 247 ? ? 171.01  161.76  
98  1 ASN B 250 ? ? -67.45  24.94   
99  1 ASN B 251 ? ? -57.11  93.11   
100 1 LYS B 252 ? ? -36.96  120.43  
101 1 ASP B 253 ? ? 94.06   89.90   
102 1 PRO B 276 ? ? -24.21  166.25  
103 1 LEU B 278 ? ? 170.50  12.12   
104 1 ASP B 279 ? ? 55.35   13.62   
105 1 ILE B 280 ? ? -146.02 -29.33  
106 1 ASP B 293 ? ? -109.42 66.67   
107 1 ASP B 295 ? ? -124.48 -156.63 
108 1 ASN B 297 ? ? -147.16 26.99   
109 1 ASP B 303 ? ? -27.42  -50.11  
110 1 LYS B 326 ? ? -67.08  99.57   
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1  1 VAL A 11  ? ? ALA A 12  ? ? -139.77 
2  1 ASP A 59  ? ? SER A 60  ? ? -149.24 
3  1 GLU A 112 ? ? PRO A 113 ? ? 84.58   
4  1 PRO A 113 ? ? LEU A 114 ? ? 123.68  
5  1 LEU A 114 ? ? TYR A 115 ? ? -146.09 
6  1 ILE A 212 ? ? VAL A 213 ? ? -148.48 
7  1 LEU A 277 ? ? LEU A 278 ? ? -107.06 
8  1 LEU A 278 ? ? ASP A 279 ? ? 126.74  
9  1 VAL B 11  ? ? ALA B 12  ? ? -139.74 
10 1 ASP B 59  ? ? SER B 60  ? ? -149.28 
11 1 GLU B 112 ? ? PRO B 113 ? ? 84.57   
12 1 PRO B 113 ? ? LEU B 114 ? ? 123.60  
13 1 LEU B 114 ? ? TYR B 115 ? ? -146.06 
14 1 ILE B 212 ? ? VAL B 213 ? ? -148.56 
15 1 LEU B 277 ? ? LEU B 278 ? ? -107.03 
16 1 LEU B 278 ? ? ASP B 279 ? ? 126.80  
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 
;(4R)-3-{(2S,3S)-2-hydroxy-3-[(3-hydroxy-2-methylbenzoyl)amino]-4-phenylbutanoyl}-5,5-dimethyl-N-(2-methylbenzyl)-1,3-thiazolidine-4-carboxamide
;
JE2 
3 water HOH 
#