data_2BV1
# 
_entry.id   2BV1 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.292 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2BV1         
PDBE  EBI-24572    
WWPDB D_1290024572 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2BV1 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2005-06-20 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Elkins, J.M.'      1 ? 
'Yang, X.'          2 ? 
'Soundararajan, M.' 3 ? 
'Schoch, G.A.'      4 ? 
'Haroniti, A.'      5 ? 
'Sundstrom, M.'     6 ? 
'Edwards, A.'       7 ? 
'Arrowsmith, C.'    8 ? 
'Doyle, D.A.'       9 ? 
# 
_citation.id                        primary 
_citation.title                     
'Structural diversity in the RGS domain and its interaction with heterotrimeric G protein alpha-subunits.' 
_citation.journal_abbrev            'Proc. Natl. Acad. Sci. U.S.A.' 
_citation.journal_volume            105 
_citation.page_first                6457 
_citation.page_last                 6462 
_citation.year                      2008 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           1091-6490 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18434541 
_citation.pdbx_database_id_DOI      10.1073/pnas.0801508105 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Soundararajan, M.' 1  
primary 'Willard, F.S.'     2  
primary 'Kimple, A.J.'      3  
primary 'Turnbull, A.P.'    4  
primary 'Ball, L.J.'        5  
primary 'Schoch, G.A.'      6  
primary 'Gileadi, C.'       7  
primary 'Fedorov, O.Y.'     8  
primary 'Dowler, E.F.'      9  
primary 'Higman, V.A.'      10 
primary 'Hutsell, S.Q.'     11 
primary 'Sundstrom, M.'     12 
primary 'Doyle, D.A.'       13 
primary 'Siderovski, D.P.'  14 
# 
_cell.entry_id           2BV1 
_cell.length_a           40.738 
_cell.length_b           43.202 
_cell.length_c           58.651 
_cell.angle_alpha        78.43 
_cell.angle_beta         85.30 
_cell.angle_gamma        69.74 
_cell.Z_PDB              2 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2BV1 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'REGULATOR OF G-PROTEIN SIGNALLING 1' 16575.793 2   ? ? 'RESIDUES 50-192' ? 
2 water   nat water                                 18.015    155 ? ? ?                 ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'RGS1, EARLY RESPONSE PROTEIN 1R20, B-CELL ACTIVATION PROTEIN BL34' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SMSGMKSSKSKDVLSAAEVMQWSQSLEKLLANQTGQNVFGSFLKSEFSEENIEFWLACEDYKKTESDLLPCKAEEIYKAF
VHSDAAKQINIDFRTRESTAKKIKAPTPTCFDEAQKVIYTLMEKDSYPRFLKSDIYLNLLNDLQA
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SMSGMKSSKSKDVLSAAEVMQWSQSLEKLLANQTGQNVFGSFLKSEFSEENIEFWLACEDYKKTESDLLPCKAEEIYKAF
VHSDAAKQINIDFRTRESTAKKIKAPTPTCFDEAQKVIYTLMEKDSYPRFLKSDIYLNLLNDLQA
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   MET n 
1 3   SER n 
1 4   GLY n 
1 5   MET n 
1 6   LYS n 
1 7   SER n 
1 8   SER n 
1 9   LYS n 
1 10  SER n 
1 11  LYS n 
1 12  ASP n 
1 13  VAL n 
1 14  LEU n 
1 15  SER n 
1 16  ALA n 
1 17  ALA n 
1 18  GLU n 
1 19  VAL n 
1 20  MET n 
1 21  GLN n 
1 22  TRP n 
1 23  SER n 
1 24  GLN n 
1 25  SER n 
1 26  LEU n 
1 27  GLU n 
1 28  LYS n 
1 29  LEU n 
1 30  LEU n 
1 31  ALA n 
1 32  ASN n 
1 33  GLN n 
1 34  THR n 
1 35  GLY n 
1 36  GLN n 
1 37  ASN n 
1 38  VAL n 
1 39  PHE n 
1 40  GLY n 
1 41  SER n 
1 42  PHE n 
1 43  LEU n 
1 44  LYS n 
1 45  SER n 
1 46  GLU n 
1 47  PHE n 
1 48  SER n 
1 49  GLU n 
1 50  GLU n 
1 51  ASN n 
1 52  ILE n 
1 53  GLU n 
1 54  PHE n 
1 55  TRP n 
1 56  LEU n 
1 57  ALA n 
1 58  CYS n 
1 59  GLU n 
1 60  ASP n 
1 61  TYR n 
1 62  LYS n 
1 63  LYS n 
1 64  THR n 
1 65  GLU n 
1 66  SER n 
1 67  ASP n 
1 68  LEU n 
1 69  LEU n 
1 70  PRO n 
1 71  CYS n 
1 72  LYS n 
1 73  ALA n 
1 74  GLU n 
1 75  GLU n 
1 76  ILE n 
1 77  TYR n 
1 78  LYS n 
1 79  ALA n 
1 80  PHE n 
1 81  VAL n 
1 82  HIS n 
1 83  SER n 
1 84  ASP n 
1 85  ALA n 
1 86  ALA n 
1 87  LYS n 
1 88  GLN n 
1 89  ILE n 
1 90  ASN n 
1 91  ILE n 
1 92  ASP n 
1 93  PHE n 
1 94  ARG n 
1 95  THR n 
1 96  ARG n 
1 97  GLU n 
1 98  SER n 
1 99  THR n 
1 100 ALA n 
1 101 LYS n 
1 102 LYS n 
1 103 ILE n 
1 104 LYS n 
1 105 ALA n 
1 106 PRO n 
1 107 THR n 
1 108 PRO n 
1 109 THR n 
1 110 CYS n 
1 111 PHE n 
1 112 ASP n 
1 113 GLU n 
1 114 ALA n 
1 115 GLN n 
1 116 LYS n 
1 117 VAL n 
1 118 ILE n 
1 119 TYR n 
1 120 THR n 
1 121 LEU n 
1 122 MET n 
1 123 GLU n 
1 124 LYS n 
1 125 ASP n 
1 126 SER n 
1 127 TYR n 
1 128 PRO n 
1 129 ARG n 
1 130 PHE n 
1 131 LEU n 
1 132 LYS n 
1 133 SER n 
1 134 ASP n 
1 135 ILE n 
1 136 TYR n 
1 137 LEU n 
1 138 ASN n 
1 139 LEU n 
1 140 LEU n 
1 141 ASN n 
1 142 ASP n 
1 143 LEU n 
1 144 GLN n 
1 145 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PLIC-SGC 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'THE MAMMALIAN GENE COLLECTION, I.M.A.G.E. CONSORTIUM CLONEID 3916789' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 PDB 2BV1       1 ? ? 2BV1   ? 
2 UNP RGS1_HUMAN 1 ? ? Q08116 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2BV1 A 1 ? 2   ? 2BV1   48 ? 49  ? 48 49  
2 2 2BV1 A 3 ? 145 ? Q08116 50 ? 192 ? 50 192 
3 1 2BV1 B 1 ? 2   ? 2BV1   48 ? 49  ? 48 49  
4 2 2BV1 B 3 ? 145 ? Q08116 50 ? 192 ? 50 192 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2BV1 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.8 
_exptl_crystal.density_percent_sol   56 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.00 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '4.1M SODIUM FORMATE, 3% GLYCEROL. 1:1 MIXTURE WITH RGS1 PROTEIN AT 23MG/ML., pH 8.00' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS HTC' 
_diffrn_detector.pdbx_collection_date   2005-04-26 
_diffrn_detector.details                'OSMIC MIRRORS' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU FR-E' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2BV1 
_reflns.observed_criterion_sigma_I   0.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             32.030 
_reflns.d_resolution_high            2.000 
_reflns.number_obs                   22497 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         90.6 
_reflns.pdbx_Rmerge_I_obs            0.05000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        16.3000 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.100 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.00 
_reflns_shell.d_res_low              2.11 
_reflns_shell.percent_possible_all   65.7 
_reflns_shell.Rmerge_I_obs           0.34000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.700 
_reflns_shell.pdbx_redundancy        2.90 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2BV1 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.ls_number_reflns_obs                     21324 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             57.45 
_refine.ls_d_res_high                            2.00 
_refine.ls_percent_reflns_obs                    90.6 
_refine.ls_R_factor_obs                          0.191 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.188 
_refine.ls_R_factor_R_free                       0.241 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.200 
_refine.ls_number_reflns_R_free                  1170 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.958 
_refine.correlation_coeff_Fo_to_Fc_free          0.931 
_refine.B_iso_mean                               36.81 
_refine.aniso_B[1][1]                            0.18000 
_refine.aniso_B[2][2]                            0.26000 
_refine.aniso_B[3][3]                            -0.25000 
_refine.aniso_B[1][2]                            -0.41000 
_refine.aniso_B[1][3]                            0.41000 
_refine.aniso_B[2][3]                            0.05000 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.' 
_refine.pdbx_starting_model                      'PDB ENTRIES 1AGR AND 1FQJ' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.170 
_refine.pdbx_overall_ESU_R_Free                  0.165 
_refine.overall_SU_ML                            0.109 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             7.626 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2096 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             155 
_refine_hist.number_atoms_total               2251 
_refine_hist.d_res_high                       2.00 
_refine_hist.d_res_low                        57.45 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.017  0.022  ? 2150 'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.003  0.020  ? 1896 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.534  1.954  ? 2912 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            0.899  3.000  ? 4424 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.619  5.000  ? 262  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       37.563 25.619 ? 105  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       15.697 15.000 ? 376  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       22.882 15.000 ? 7    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.090  0.200  ? 327  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.006  0.020  ? 2385 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.001  0.020  ? 426  'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.207  0.200  ? 511  'X-RAY DIFFRACTION' ? 
r_nbd_other                  0.166  0.200  ? 1896 'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.187  0.200  ? 1072 'X-RAY DIFFRACTION' ? 
r_nbtor_other                0.090  0.200  ? 1157 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.195  0.200  ? 131  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.219  0.200  ? 9    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         0.246  0.200  ? 38   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.108  0.200  ? 5    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  1.057  1.500  ? 1485 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.435  2.000  ? 2133 'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  2.375  3.000  ? 918  'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 3.368  4.500  ? 779  'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1 A 1887 0.32 0.50 'medium positional' 1 1 'X-RAY DIFFRACTION' ? ? ? 
1 A 1887 0.73 2.00 'medium thermal'    1 2 'X-RAY DIFFRACTION' ? ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.00 
_refine_ls_shell.d_res_low                        2.05 
_refine_ls_shell.number_reflns_R_work             983 
_refine_ls_shell.R_factor_R_work                  0.2320 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.3680 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             42 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct_ncs_oper.id             1 
_struct_ncs_oper.code           given 
_struct_ncs_oper.details        ? 
_struct_ncs_oper.matrix[1][1]   -0.447160 
_struct_ncs_oper.matrix[1][2]   -0.894130 
_struct_ncs_oper.matrix[1][3]   -0.023960 
_struct_ncs_oper.matrix[2][1]   -0.892680 
_struct_ncs_oper.matrix[2][2]   0.447800 
_struct_ncs_oper.matrix[2][3]   -0.051050 
_struct_ncs_oper.matrix[3][1]   0.056380 
_struct_ncs_oper.matrix[3][2]   -0.001440 
_struct_ncs_oper.matrix[3][3]   -0.998410 
_struct_ncs_oper.vector[1]      -2.55667 
_struct_ncs_oper.vector[2]      1.33661 
_struct_ncs_oper.vector[3]      -4.67071 
# 
loop_
_struct_ncs_dom.id 
_struct_ncs_dom.details 
_struct_ncs_dom.pdbx_ens_id 
1 A 1 
2 B 1 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1 A 61 A 192 1 4 ? ? ? ? ? ? ? ? 1 ? 
2 B 61 B 192 1 4 ? ? ? ? ? ? ? ? 1 ? 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                  2BV1 
_struct.title                     'Regulator of G-protein Signalling 1 (Human)' 
_struct.pdbx_descriptor           'REGULATOR OF G-PROTEIN SIGNALLING 1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2BV1 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            
;RGS1, RGS, G-PROTEIN, REGULATOR, STRUCTURAL GENOMICS, STRUCTURAL GENOMICS CONSORTIUM, B-CELL ACTIVATION, PHOSPHORYLATION, SIGNAL TRANSDUCTION INHIBITOR, SIGNALING PROTEIN
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ALA A 16  ? TRP A 22  ? ALA A 63  TRP A 69  1 ? 7  
HELX_P HELX_P2  2  SER A 25  ? ASN A 32  ? SER A 72  ASN A 79  1 ? 8  
HELX_P HELX_P3  3  ASN A 32  ? GLU A 46  ? ASN A 79  GLU A 93  1 ? 15 
HELX_P HELX_P4  4  GLU A 49  ? LYS A 63  ? GLU A 96  LYS A 110 1 ? 15 
HELX_P HELX_P5  5  GLU A 65  ? ASP A 67  ? GLU A 112 ASP A 114 5 ? 3  
HELX_P HELX_P6  6  LEU A 68  ? VAL A 81  ? LEU A 115 VAL A 128 1 ? 14 
HELX_P HELX_P7  7  ASP A 92  ? LYS A 104 ? ASP A 139 LYS A 151 1 ? 13 
HELX_P HELX_P8  8  PHE A 111 ? ASP A 125 ? PHE A 158 ASP A 172 1 ? 15 
HELX_P HELX_P9  9  ASP A 125 ? LYS A 132 ? ASP A 172 LYS A 179 1 ? 8  
HELX_P HELX_P10 10 SER A 133 ? LEU A 143 ? SER A 180 LEU A 190 1 ? 11 
HELX_P HELX_P11 11 ALA B 16  ? TRP B 22  ? ALA B 63  TRP B 69  1 ? 7  
HELX_P HELX_P12 12 SER B 25  ? ALA B 31  ? SER B 72  ALA B 78  1 ? 7  
HELX_P HELX_P13 13 ASN B 32  ? GLU B 46  ? ASN B 79  GLU B 93  1 ? 15 
HELX_P HELX_P14 14 GLU B 49  ? LYS B 63  ? GLU B 96  LYS B 110 1 ? 15 
HELX_P HELX_P15 15 GLU B 65  ? ASP B 67  ? GLU B 112 ASP B 114 5 ? 3  
HELX_P HELX_P16 16 LEU B 68  ? VAL B 81  ? LEU B 115 VAL B 128 1 ? 14 
HELX_P HELX_P17 17 ASP B 92  ? ILE B 103 ? ASP B 139 ILE B 150 1 ? 12 
HELX_P HELX_P18 18 PHE B 111 ? ASP B 125 ? PHE B 158 ASP B 172 1 ? 15 
HELX_P HELX_P19 19 ASP B 125 ? LYS B 132 ? ASP B 172 LYS B 179 1 ? 8  
HELX_P HELX_P20 20 SER B 133 ? ASN B 141 ? SER B 180 ASN B 188 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               AA 
_struct_sheet.type             ? 
_struct_sheet.number_strands   2 
_struct_sheet.details          ? 
# 
_struct_sheet_order.sheet_id     AA 
_struct_sheet_order.range_id_1   1 
_struct_sheet_order.range_id_2   2 
_struct_sheet_order.offset       ? 
_struct_sheet_order.sense        anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 ASP A 12 ? SER A 15 ? ASP A 59 SER A 62 
AA 2 VAL B 13 ? SER B 15 ? VAL B 60 SER B 62 
# 
_pdbx_struct_sheet_hbond.sheet_id                AA 
_pdbx_struct_sheet_hbond.range_id_1              1 
_pdbx_struct_sheet_hbond.range_id_2              2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id   N 
_pdbx_struct_sheet_hbond.range_1_label_comp_id   VAL 
_pdbx_struct_sheet_hbond.range_1_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_1_label_seq_id    13 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id    N 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id    VAL 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id     60 
_pdbx_struct_sheet_hbond.range_2_label_atom_id   O 
_pdbx_struct_sheet_hbond.range_2_label_comp_id   LEU 
_pdbx_struct_sheet_hbond.range_2_label_asym_id   B 
_pdbx_struct_sheet_hbond.range_2_label_seq_id    14 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id    O 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id    LEU 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id    B 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id     61 
# 
_database_PDB_matrix.entry_id          2BV1 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2BV1 
_atom_sites.fract_transf_matrix[1][1]   0.024547 
_atom_sites.fract_transf_matrix[1][2]   -0.009061 
_atom_sites.fract_transf_matrix[1][3]   -0.000356 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.024674 
_atom_sites.fract_transf_matrix[2][3]   -0.004623 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.017405 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . LYS A 1 11  ? -17.619 33.780  -7.549  1.00 47.92 ? 58   LYS A N   1 
ATOM   2    C CA  . LYS A 1 11  ? -17.938 32.442  -8.154  1.00 47.32 ? 58   LYS A CA  1 
ATOM   3    C C   . LYS A 1 11  ? -17.620 31.311  -7.179  1.00 46.38 ? 58   LYS A C   1 
ATOM   4    O O   . LYS A 1 11  ? -16.445 31.045  -6.884  1.00 46.26 ? 58   LYS A O   1 
ATOM   5    C CB  . LYS A 1 11  ? -17.166 32.215  -9.463  1.00 47.71 ? 58   LYS A CB  1 
ATOM   6    N N   . ASP A 1 12  ? -18.671 30.668  -6.667  1.00 44.67 ? 59   ASP A N   1 
ATOM   7    C CA  . ASP A 1 12  ? -18.527 29.467  -5.857  1.00 43.79 ? 59   ASP A CA  1 
ATOM   8    C C   . ASP A 1 12  ? -18.125 28.304  -6.767  1.00 41.09 ? 59   ASP A C   1 
ATOM   9    O O   . ASP A 1 12  ? -18.557 28.238  -7.908  1.00 41.91 ? 59   ASP A O   1 
ATOM   10   C CB  . ASP A 1 12  ? -19.834 29.135  -5.133  1.00 44.37 ? 59   ASP A CB  1 
ATOM   11   C CG  . ASP A 1 12  ? -20.358 30.314  -4.298  1.00 46.13 ? 59   ASP A CG  1 
ATOM   12   O OD1 . ASP A 1 12  ? -19.533 31.149  -3.834  1.00 49.17 ? 59   ASP A OD1 1 
ATOM   13   O OD2 . ASP A 1 12  ? -21.594 30.393  -4.109  1.00 47.65 ? 59   ASP A OD2 1 
ATOM   14   N N   . VAL A 1 13  ? -17.239 27.449  -6.284  1.00 37.87 ? 60   VAL A N   1 
ATOM   15   C CA  . VAL A 1 13  ? -16.781 26.295  -7.053  1.00 36.36 ? 60   VAL A CA  1 
ATOM   16   C C   . VAL A 1 13  ? -17.174 24.980  -6.365  1.00 36.25 ? 60   VAL A C   1 
ATOM   17   O O   . VAL A 1 13  ? -17.162 23.927  -7.000  1.00 36.90 ? 60   VAL A O   1 
ATOM   18   C CB  . VAL A 1 13  ? -15.267 26.348  -7.292  1.00 35.40 ? 60   VAL A CB  1 
ATOM   19   C CG1 . VAL A 1 13  ? -14.923 27.546  -8.207  1.00 34.60 ? 60   VAL A CG1 1 
ATOM   20   C CG2 . VAL A 1 13  ? -14.512 26.413  -5.991  1.00 33.29 ? 60   VAL A CG2 1 
ATOM   21   N N   . LEU A 1 14  ? -17.481 25.040  -5.060  1.00 36.00 ? 61   LEU A N   1 
ATOM   22   C CA  . LEU A 1 14  ? -17.961 23.893  -4.286  1.00 35.91 ? 61   LEU A CA  1 
ATOM   23   C C   . LEU A 1 14  ? -18.767 24.414  -3.106  1.00 35.61 ? 61   LEU A C   1 
ATOM   24   O O   . LEU A 1 14  ? -18.514 25.500  -2.603  1.00 37.02 ? 61   LEU A O   1 
ATOM   25   C CB  . LEU A 1 14  ? -16.798 23.019  -3.769  1.00 35.56 ? 61   LEU A CB  1 
ATOM   26   C CG  . LEU A 1 14  ? -17.152 21.626  -3.206  1.00 36.45 ? 61   LEU A CG  1 
ATOM   27   C CD1 . LEU A 1 14  ? -17.855 20.736  -4.235  1.00 38.24 ? 61   LEU A CD1 1 
ATOM   28   C CD2 . LEU A 1 14  ? -15.914 20.909  -2.644  1.00 35.96 ? 61   LEU A CD2 1 
ATOM   29   N N   . SER A 1 15  ? -19.779 23.668  -2.704  1.00 36.28 ? 62   SER A N   1 
ATOM   30   C CA  . SER A 1 15  ? -20.581 23.992  -1.484  1.00 36.11 ? 62   SER A CA  1 
ATOM   31   C C   . SER A 1 15  ? -20.814 22.767  -0.637  1.00 36.14 ? 62   SER A C   1 
ATOM   32   O O   . SER A 1 15  ? -20.789 21.621  -1.145  1.00 35.92 ? 62   SER A O   1 
ATOM   33   C CB  . SER A 1 15  ? -21.947 24.579  -1.835  1.00 35.65 ? 62   SER A CB  1 
ATOM   34   O OG  . SER A 1 15  ? -22.768 23.604  -2.449  1.00 36.78 ? 62   SER A OG  1 
ATOM   35   N N   . ALA A 1 16  ? -21.089 23.011  0.646   1.00 35.92 ? 63   ALA A N   1 
ATOM   36   C CA  . ALA A 1 16  ? -21.420 21.943  1.579   1.00 36.03 ? 63   ALA A CA  1 
ATOM   37   C C   . ALA A 1 16  ? -22.676 21.207  1.059   1.00 35.94 ? 63   ALA A C   1 
ATOM   38   O O   . ALA A 1 16  ? -22.758 19.975  1.111   1.00 35.40 ? 63   ALA A O   1 
ATOM   39   C CB  . ALA A 1 16  ? -21.641 22.510  2.995   1.00 35.42 ? 63   ALA A CB  1 
ATOM   40   N N   . ALA A 1 17  ? -23.627 21.978  0.525   1.00 35.65 ? 64   ALA A N   1 
ATOM   41   C CA  . ALA A 1 17  ? -24.871 21.424  -0.028  1.00 35.94 ? 64   ALA A CA  1 
ATOM   42   C C   . ALA A 1 17  ? -24.540 20.418  -1.100  1.00 36.88 ? 64   ALA A C   1 
ATOM   43   O O   . ALA A 1 17  ? -25.056 19.303  -1.085  1.00 34.47 ? 64   ALA A O   1 
ATOM   44   C CB  . ALA A 1 17  ? -25.773 22.506  -0.568  1.00 36.46 ? 64   ALA A CB  1 
ATOM   45   N N   . GLU A 1 18  ? -23.633 20.784  -2.015  1.00 37.28 ? 65   GLU A N   1 
ATOM   46   C CA  . GLU A 1 18  ? -23.284 19.891  -3.117  1.00 37.16 ? 65   GLU A CA  1 
ATOM   47   C C   . GLU A 1 18  ? -22.654 18.611  -2.629  1.00 36.90 ? 65   GLU A C   1 
ATOM   48   O O   . GLU A 1 18  ? -23.012 17.533  -3.083  1.00 35.94 ? 65   GLU A O   1 
ATOM   49   C CB  . GLU A 1 18  ? -22.334 20.605  -4.122  1.00 38.57 ? 65   GLU A CB  1 
ATOM   50   C CG  . GLU A 1 18  ? -21.846 19.748  -5.261  1.00 40.20 ? 65   GLU A CG  1 
ATOM   51   C CD  . GLU A 1 18  ? -22.981 19.081  -6.046  1.00 46.59 ? 65   GLU A CD  1 
ATOM   52   O OE1 . GLU A 1 18  ? -24.045 19.719  -6.240  1.00 52.81 ? 65   GLU A OE1 1 
ATOM   53   O OE2 . GLU A 1 18  ? -22.792 17.932  -6.500  1.00 48.35 ? 65   GLU A OE2 1 
ATOM   54   N N   . VAL A 1 19  ? -21.695 18.741  -1.721  1.00 36.18 ? 66   VAL A N   1 
ATOM   55   C CA  . VAL A 1 19  ? -21.009 17.616  -1.155  1.00 37.00 ? 66   VAL A CA  1 
ATOM   56   C C   . VAL A 1 19  ? -22.015 16.732  -0.358  1.00 37.53 ? 66   VAL A C   1 
ATOM   57   O O   . VAL A 1 19  ? -21.892 15.523  -0.392  1.00 36.63 ? 66   VAL A O   1 
ATOM   58   C CB  . VAL A 1 19  ? -19.874 18.071  -0.256  1.00 36.63 ? 66   VAL A CB  1 
ATOM   59   C CG1 . VAL A 1 19  ? -19.254 16.882  0.534   1.00 37.71 ? 66   VAL A CG1 1 
ATOM   60   C CG2 . VAL A 1 19  ? -18.835 18.832  -1.079  1.00 37.31 ? 66   VAL A CG2 1 
ATOM   61   N N   . MET A 1 20  ? -22.993 17.332  0.352   1.00 38.09 ? 67   MET A N   1 
ATOM   62   C CA  . MET A 1 20  ? -24.116 16.554  0.959   1.00 38.75 ? 67   MET A CA  1 
ATOM   63   C C   . MET A 1 20  ? -24.888 15.713  -0.080  1.00 37.17 ? 67   MET A C   1 
ATOM   64   O O   . MET A 1 20  ? -25.219 14.565  0.171   1.00 36.88 ? 67   MET A O   1 
ATOM   65   C CB  . MET A 1 20  ? -25.139 17.466  1.689   1.00 38.71 ? 67   MET A CB  1 
ATOM   66   C CG  . MET A 1 20  ? -24.670 18.242  2.891   1.00 42.60 ? 67   MET A CG  1 
ATOM   67   S SD  . MET A 1 20  ? -25.844 19.470  3.672   1.00 45.82 ? 67   MET A SD  1 
ATOM   68   C CE  . MET A 1 20  ? -27.426 18.718  3.229   1.00 43.28 ? 67   MET A CE  1 
ATOM   69   N N   . GLN A 1 21  ? -25.218 16.302  -1.226  1.00 37.12 ? 68   GLN A N   1 
ATOM   70   C CA  . GLN A 1 21  ? -25.904 15.618  -2.314  1.00 37.73 ? 68   GLN A CA  1 
ATOM   71   C C   . GLN A 1 21  ? -25.255 14.326  -2.845  1.00 37.55 ? 68   GLN A C   1 
ATOM   72   O O   . GLN A 1 21  ? -25.953 13.416  -3.320  1.00 36.21 ? 68   GLN A O   1 
ATOM   73   C CB  . GLN A 1 21  ? -26.164 16.588  -3.470  1.00 38.79 ? 68   GLN A CB  1 
ATOM   74   C CG  . GLN A 1 21  ? -27.326 17.564  -3.226  1.00 41.49 ? 68   GLN A CG  1 
ATOM   75   C CD  . GLN A 1 21  ? -28.704 16.893  -3.257  1.00 47.85 ? 68   GLN A CD  1 
ATOM   76   O OE1 . GLN A 1 21  ? -29.171 16.404  -4.309  1.00 51.25 ? 68   GLN A OE1 1 
ATOM   77   N NE2 . GLN A 1 21  ? -29.374 16.885  -2.102  1.00 51.37 ? 68   GLN A NE2 1 
ATOM   78   N N   . TRP A 1 22  ? -23.935 14.257  -2.756  1.00 36.71 ? 69   TRP A N   1 
ATOM   79   C CA  . TRP A 1 22  ? -23.173 13.074  -3.147  1.00 36.97 ? 69   TRP A CA  1 
ATOM   80   C C   . TRP A 1 22  ? -23.550 11.841  -2.306  1.00 37.69 ? 69   TRP A C   1 
ATOM   81   O O   . TRP A 1 22  ? -23.338 10.715  -2.759  1.00 35.16 ? 69   TRP A O   1 
ATOM   82   C CB  . TRP A 1 22  ? -21.673 13.288  -2.973  1.00 36.79 ? 69   TRP A CB  1 
ATOM   83   C CG  . TRP A 1 22  ? -21.079 14.457  -3.762  1.00 36.65 ? 69   TRP A CG  1 
ATOM   84   C CD1 . TRP A 1 22  ? -21.665 15.157  -4.747  1.00 36.61 ? 69   TRP A CD1 1 
ATOM   85   C CD2 . TRP A 1 22  ? -19.761 14.990  -3.618  1.00 35.12 ? 69   TRP A CD2 1 
ATOM   86   N NE1 . TRP A 1 22  ? -20.810 16.108  -5.240  1.00 36.06 ? 69   TRP A NE1 1 
ATOM   87   C CE2 . TRP A 1 22  ? -19.636 16.044  -4.556  1.00 35.67 ? 69   TRP A CE2 1 
ATOM   88   C CE3 . TRP A 1 22  ? -18.674 14.671  -2.799  1.00 37.51 ? 69   TRP A CE3 1 
ATOM   89   C CZ2 . TRP A 1 22  ? -18.482 16.820  -4.674  1.00 38.43 ? 69   TRP A CZ2 1 
ATOM   90   C CZ3 . TRP A 1 22  ? -17.481 15.435  -2.948  1.00 39.00 ? 69   TRP A CZ3 1 
ATOM   91   C CH2 . TRP A 1 22  ? -17.421 16.509  -3.850  1.00 36.94 ? 69   TRP A CH2 1 
ATOM   92   N N   . SER A 1 23  ? -24.022 12.082  -1.068  1.00 37.56 ? 70   SER A N   1 
ATOM   93   C CA  . SER A 1 23  ? -24.567 11.006  -0.228  1.00 38.28 ? 70   SER A CA  1 
ATOM   94   C C   . SER A 1 23  ? -25.951 10.544  -0.655  1.00 38.29 ? 70   SER A C   1 
ATOM   95   O O   . SER A 1 23  ? -26.432 9.530   -0.172  1.00 39.47 ? 70   SER A O   1 
ATOM   96   C CB  . SER A 1 23  ? -24.569 11.427  1.247   1.00 37.57 ? 70   SER A CB  1 
ATOM   97   O OG  . SER A 1 23  ? -25.658 12.268  1.457   1.00 40.37 ? 70   SER A OG  1 
ATOM   98   N N   . GLN A 1 24  ? -26.603 11.232  -1.588  1.00 39.05 ? 71   GLN A N   1 
ATOM   99   C CA  . GLN A 1 24  ? -27.903 10.794  -2.057  1.00 39.74 ? 71   GLN A CA  1 
ATOM   100  C C   . GLN A 1 24  ? -27.846 9.509   -2.934  1.00 39.77 ? 71   GLN A C   1 
ATOM   101  O O   . GLN A 1 24  ? -28.679 8.622   -2.786  1.00 38.88 ? 71   GLN A O   1 
ATOM   102  C CB  . GLN A 1 24  ? -28.650 11.937  -2.750  1.00 40.02 ? 71   GLN A CB  1 
ATOM   103  C CG  . GLN A 1 24  ? -29.024 13.103  -1.744  1.00 43.64 ? 71   GLN A CG  1 
ATOM   104  C CD  . GLN A 1 24  ? -30.320 12.864  -0.910  1.00 47.33 ? 71   GLN A CD  1 
ATOM   105  O OE1 . GLN A 1 24  ? -30.332 12.149  0.117   1.00 49.31 ? 71   GLN A OE1 1 
ATOM   106  N NE2 . GLN A 1 24  ? -31.399 13.519  -1.325  1.00 48.66 ? 71   GLN A NE2 1 
ATOM   107  N N   . SER A 1 25  ? -26.875 9.432   -3.832  1.00 38.79 ? 72   SER A N   1 
ATOM   108  C CA  . SER A 1 25  ? -26.702 8.283   -4.696  1.00 38.45 ? 72   SER A CA  1 
ATOM   109  C C   . SER A 1 25  ? -25.347 8.360   -5.337  1.00 39.15 ? 72   SER A C   1 
ATOM   110  O O   . SER A 1 25  ? -24.786 9.457   -5.478  1.00 37.09 ? 72   SER A O   1 
ATOM   111  C CB  . SER A 1 25  ? -27.788 8.201   -5.777  1.00 38.70 ? 72   SER A CB  1 
ATOM   112  O OG  . SER A 1 25  ? -27.632 9.200   -6.758  1.00 37.43 ? 72   SER A OG  1 
ATOM   113  N N   . LEU A 1 26  ? -24.809 7.197   -5.689  1.00 38.00 ? 73   LEU A N   1 
ATOM   114  C CA  . LEU A 1 26  ? -23.552 7.146   -6.364  1.00 39.08 ? 73   LEU A CA  1 
ATOM   115  C C   . LEU A 1 26  ? -23.671 7.989   -7.665  1.00 39.82 ? 73   LEU A C   1 
ATOM   116  O O   . LEU A 1 26  ? -22.727 8.694   -8.068  1.00 37.50 ? 73   LEU A O   1 
ATOM   117  C CB  . LEU A 1 26  ? -23.167 5.686   -6.651  1.00 38.29 ? 73   LEU A CB  1 
ATOM   118  C CG  . LEU A 1 26  ? -21.916 5.450   -7.517  1.00 39.44 ? 73   LEU A CG  1 
ATOM   119  C CD1 . LEU A 1 26  ? -20.682 6.014   -6.896  1.00 36.95 ? 73   LEU A CD1 1 
ATOM   120  C CD2 . LEU A 1 26  ? -21.790 3.958   -7.746  1.00 40.50 ? 73   LEU A CD2 1 
ATOM   121  N N   . GLU A 1 27  ? -24.831 7.908   -8.299  1.00 39.81 ? 74   GLU A N   1 
ATOM   122  C CA  . GLU A 1 27  ? -25.079 8.647   -9.518  1.00 42.66 ? 74   GLU A CA  1 
ATOM   123  C C   . GLU A 1 27  ? -24.895 10.174  -9.334  1.00 42.32 ? 74   GLU A C   1 
ATOM   124  O O   . GLU A 1 27  ? -24.340 10.787  -10.213 1.00 41.26 ? 74   GLU A O   1 
ATOM   125  C CB  . GLU A 1 27  ? -26.435 8.302   -10.123 1.00 42.28 ? 74   GLU A CB  1 
ATOM   126  C CG  . GLU A 1 27  ? -26.776 9.099   -11.363 1.00 45.61 ? 74   GLU A CG  1 
ATOM   127  C CD  . GLU A 1 27  ? -28.159 8.771   -11.903 1.00 46.55 ? 74   GLU A CD  1 
ATOM   128  O OE1 . GLU A 1 27  ? -28.912 8.027   -11.236 1.00 51.25 ? 74   GLU A OE1 1 
ATOM   129  O OE2 . GLU A 1 27  ? -28.490 9.245   -13.003 1.00 51.11 ? 74   GLU A OE2 1 
ATOM   130  N N   . LYS A 1 28  ? -25.339 10.771  -8.220  1.00 42.85 ? 75   LYS A N   1 
ATOM   131  C CA  . LYS A 1 28  ? -25.097 12.202  -7.970  1.00 42.54 ? 75   LYS A CA  1 
ATOM   132  C C   . LYS A 1 28  ? -23.620 12.461  -7.699  1.00 42.62 ? 75   LYS A C   1 
ATOM   133  O O   . LYS A 1 28  ? -23.056 13.438  -8.188  1.00 42.37 ? 75   LYS A O   1 
ATOM   134  C CB  . LYS A 1 28  ? -25.934 12.755  -6.813  1.00 43.50 ? 75   LYS A CB  1 
ATOM   135  C CG  . LYS A 1 28  ? -27.414 12.555  -6.978  1.00 45.47 ? 75   LYS A CG  1 
ATOM   136  C CD  . LYS A 1 28  ? -28.202 13.642  -6.258  1.00 50.01 ? 75   LYS A CD  1 
ATOM   137  C CE  . LYS A 1 28  ? -29.693 13.371  -6.295  1.00 49.78 ? 75   LYS A CE  1 
ATOM   138  N NZ  . LYS A 1 28  ? -30.421 14.629  -6.041  1.00 52.39 ? 75   LYS A NZ  1 
ATOM   139  N N   . LEU A 1 29  ? -22.964 11.583  -6.959  1.00 41.63 ? 76   LEU A N   1 
ATOM   140  C CA  . LEU A 1 29  ? -21.535 11.759  -6.744  1.00 42.27 ? 76   LEU A CA  1 
ATOM   141  C C   . LEU A 1 29  ? -20.758 11.763  -8.101  1.00 42.48 ? 76   LEU A C   1 
ATOM   142  O O   . LEU A 1 29  ? -19.891 12.636  -8.352  1.00 42.56 ? 76   LEU A O   1 
ATOM   143  C CB  . LEU A 1 29  ? -21.000 10.652  -5.815  1.00 41.12 ? 76   LEU A CB  1 
ATOM   144  C CG  . LEU A 1 29  ? -19.492 10.554  -5.568  1.00 42.17 ? 76   LEU A CG  1 
ATOM   145  C CD1 . LEU A 1 29  ? -18.908 11.777  -4.832  1.00 41.77 ? 76   LEU A CD1 1 
ATOM   146  C CD2 . LEU A 1 29  ? -19.219 9.270   -4.805  1.00 43.26 ? 76   LEU A CD2 1 
ATOM   147  N N   . LEU A 1 30  ? -21.063 10.787  -8.960  1.00 41.60 ? 77   LEU A N   1 
ATOM   148  C CA  . LEU A 1 30  ? -20.364 10.691  -10.245 1.00 43.22 ? 77   LEU A CA  1 
ATOM   149  C C   . LEU A 1 30  ? -20.740 11.759  -11.278 1.00 43.41 ? 77   LEU A C   1 
ATOM   150  O O   . LEU A 1 30  ? -20.020 11.910  -12.243 1.00 43.86 ? 77   LEU A O   1 
ATOM   151  C CB  . LEU A 1 30  ? -20.512 9.293   -10.861 1.00 42.02 ? 77   LEU A CB  1 
ATOM   152  C CG  . LEU A 1 30  ? -20.015 8.159   -9.998  1.00 43.17 ? 77   LEU A CG  1 
ATOM   153  C CD1 . LEU A 1 30  ? -20.377 6.866   -10.682 1.00 43.63 ? 77   LEU A CD1 1 
ATOM   154  C CD2 . LEU A 1 30  ? -18.556 8.197   -9.673  1.00 45.31 ? 77   LEU A CD2 1 
ATOM   155  N N   . ALA A 1 31  ? -21.874 12.456  -11.106 1.00 43.70 ? 78   ALA A N   1 
ATOM   156  C CA  . ALA A 1 31  ? -22.267 13.512  -12.011 1.00 44.39 ? 78   ALA A CA  1 
ATOM   157  C C   . ALA A 1 31  ? -21.527 14.845  -11.755 1.00 44.86 ? 78   ALA A C   1 
ATOM   158  O O   . ALA A 1 31  ? -21.632 15.756  -12.540 1.00 45.39 ? 78   ALA A O   1 
ATOM   159  C CB  . ALA A 1 31  ? -23.745 13.744  -11.934 1.00 44.76 ? 78   ALA A CB  1 
ATOM   160  N N   . ASN A 1 32  ? -20.824 14.929  -10.629 1.00 45.13 ? 79   ASN A N   1 
ATOM   161  C CA  . ASN A 1 32  ? -19.997 16.058  -10.230 1.00 44.04 ? 79   ASN A CA  1 
ATOM   162  C C   . ASN A 1 32  ? -18.503 15.712  -10.447 1.00 42.58 ? 79   ASN A C   1 
ATOM   163  O O   . ASN A 1 32  ? -17.981 14.739  -9.912  1.00 40.55 ? 79   ASN A O   1 
ATOM   164  C CB  . ASN A 1 32  ? -20.289 16.394  -8.760  1.00 43.83 ? 79   ASN A CB  1 
ATOM   165  C CG  . ASN A 1 32  ? -19.494 17.580  -8.270  1.00 44.42 ? 79   ASN A CG  1 
ATOM   166  O OD1 . ASN A 1 32  ? -18.308 17.465  -7.951  1.00 42.63 ? 79   ASN A OD1 1 
ATOM   167  N ND2 . ASN A 1 32  ? -20.141 18.730  -8.191  1.00 47.43 ? 79   ASN A ND2 1 
ATOM   168  N N   . GLN A 1 33  ? -17.821 16.530  -11.245 1.00 41.02 ? 80   GLN A N   1 
ATOM   169  C CA  . GLN A 1 33  ? -16.427 16.245  -11.597 1.00 39.98 ? 80   GLN A CA  1 
ATOM   170  C C   . GLN A 1 33  ? -15.555 16.198  -10.338 1.00 38.66 ? 80   GLN A C   1 
ATOM   171  O O   . GLN A 1 33  ? -14.694 15.313  -10.166 1.00 38.32 ? 80   GLN A O   1 
ATOM   172  C CB  A GLN A 1 33  ? -15.906 17.293  -12.592 0.50 39.90 ? 80   GLN A CB  1 
ATOM   173  C CB  B GLN A 1 33  ? -15.903 17.283  -12.601 0.50 40.10 ? 80   GLN A CB  1 
ATOM   174  C CG  A GLN A 1 33  ? -15.069 16.732  -13.729 0.50 39.32 ? 80   GLN A CG  1 
ATOM   175  C CG  B GLN A 1 33  ? -14.458 17.082  -13.037 0.50 40.55 ? 80   GLN A CG  1 
ATOM   176  C CD  A GLN A 1 33  ? -14.360 17.832  -14.512 0.50 38.24 ? 80   GLN A CD  1 
ATOM   177  C CD  B GLN A 1 33  ? -14.235 15.780  -13.810 0.50 39.47 ? 80   GLN A CD  1 
ATOM   178  O OE1 A GLN A 1 33  ? -14.516 19.015  -14.221 0.50 35.45 ? 80   GLN A OE1 1 
ATOM   179  O OE1 B GLN A 1 33  ? -14.214 15.773  -15.045 0.50 38.68 ? 80   GLN A OE1 1 
ATOM   180  N NE2 A GLN A 1 33  ? -13.577 17.441  -15.499 0.50 34.21 ? 80   GLN A NE2 1 
ATOM   181  N NE2 B GLN A 1 33  ? -14.025 14.688  -13.085 0.50 37.40 ? 80   GLN A NE2 1 
ATOM   182  N N   . THR A 1 34  ? -15.790 17.128  -9.423  1.00 37.48 ? 81   THR A N   1 
ATOM   183  C CA  . THR A 1 34  ? -15.028 17.117  -8.182  1.00 37.41 ? 81   THR A CA  1 
ATOM   184  C C   . THR A 1 34  ? -15.354 15.925  -7.290  1.00 37.06 ? 81   THR A C   1 
ATOM   185  O O   . THR A 1 34  ? -14.459 15.328  -6.688  1.00 35.96 ? 81   THR A O   1 
ATOM   186  C CB  . THR A 1 34  ? -15.122 18.485  -7.443  1.00 38.09 ? 81   THR A CB  1 
ATOM   187  O OG1 . THR A 1 34  ? -14.352 19.415  -8.197  1.00 36.13 ? 81   THR A OG1 1 
ATOM   188  C CG2 . THR A 1 34  ? -14.547 18.374  -6.035  1.00 37.39 ? 81   THR A CG2 1 
ATOM   189  N N   . GLY A 1 35  ? -16.623 15.534  -7.257  1.00 37.91 ? 82   GLY A N   1 
ATOM   190  C CA  . GLY A 1 35  ? -17.023 14.288  -6.552  1.00 38.46 ? 82   GLY A CA  1 
ATOM   191  C C   . GLY A 1 35  ? -16.325 13.087  -7.117  1.00 37.48 ? 82   GLY A C   1 
ATOM   192  O O   . GLY A 1 35  ? -15.771 12.277  -6.383  1.00 38.73 ? 82   GLY A O   1 
ATOM   193  N N   . GLN A 1 36  ? -16.269 13.010  -8.441  1.00 37.62 ? 83   GLN A N   1 
ATOM   194  C CA  . GLN A 1 36  ? -15.502 11.939  -9.078  1.00 37.51 ? 83   GLN A CA  1 
ATOM   195  C C   . GLN A 1 36  ? -14.052 11.921  -8.636  1.00 36.40 ? 83   GLN A C   1 
ATOM   196  O O   . GLN A 1 36  ? -13.524 10.871  -8.312  1.00 37.16 ? 83   GLN A O   1 
ATOM   197  C CB  . GLN A 1 36  ? -15.497 12.083  -10.601 1.00 38.11 ? 83   GLN A CB  1 
ATOM   198  C CG  . GLN A 1 36  ? -16.537 11.402  -11.366 1.00 39.06 ? 83   GLN A CG  1 
ATOM   199  C CD  . GLN A 1 36  ? -16.491 11.851  -12.804 1.00 39.26 ? 83   GLN A CD  1 
ATOM   200  O OE1 . GLN A 1 36  ? -15.429 12.056  -13.332 1.00 39.33 ? 83   GLN A OE1 1 
ATOM   201  N NE2 . GLN A 1 36  ? -17.641 12.051  -13.413 1.00 42.99 ? 83   GLN A NE2 1 
ATOM   202  N N   . ASN A 1 37  ? -13.418 13.098  -8.650  1.00 35.65 ? 84   ASN A N   1 
ATOM   203  C CA  . ASN A 1 37  ? -12.046 13.254  -8.278  1.00 35.67 ? 84   ASN A CA  1 
ATOM   204  C C   . ASN A 1 37  ? -11.793 12.857  -6.810  1.00 35.89 ? 84   ASN A C   1 
ATOM   205  O O   . ASN A 1 37  ? -10.771 12.263  -6.501  1.00 36.34 ? 84   ASN A O   1 
ATOM   206  C CB  . ASN A 1 37  ? -11.552 14.747  -8.510  1.00 34.25 ? 84   ASN A CB  1 
ATOM   207  C CG  . ASN A 1 37  ? -11.460 15.168  -10.003 1.00 37.51 ? 84   ASN A CG  1 
ATOM   208  O OD1 . ASN A 1 37  ? -11.488 16.389  -10.345 1.00 34.66 ? 84   ASN A OD1 1 
ATOM   209  N ND2 . ASN A 1 37  ? -11.287 14.197  -10.874 1.00 32.65 ? 84   ASN A ND2 1 
ATOM   210  N N   . VAL A 1 38  ? -12.665 13.280  -5.902  1.00 35.55 ? 85   VAL A N   1 
ATOM   211  C CA  . VAL A 1 38  ? -12.487 12.967  -4.467  1.00 35.36 ? 85   VAL A CA  1 
ATOM   212  C C   . VAL A 1 38  ? -12.773 11.452  -4.194  1.00 34.42 ? 85   VAL A C   1 
ATOM   213  O O   . VAL A 1 38  ? -12.035 10.768  -3.513  1.00 34.65 ? 85   VAL A O   1 
ATOM   214  C CB  . VAL A 1 38  ? -13.383 13.908  -3.595  1.00 35.30 ? 85   VAL A CB  1 
ATOM   215  C CG1 . VAL A 1 38  ? -13.252 13.576  -2.099  1.00 37.56 ? 85   VAL A CG1 1 
ATOM   216  C CG2 . VAL A 1 38  ? -12.984 15.401  -3.751  1.00 34.70 ? 85   VAL A CG2 1 
ATOM   217  N N   . PHE A 1 39  ? -13.825 10.937  -4.791  1.00 35.84 ? 86   PHE A N   1 
ATOM   218  C CA  . PHE A 1 39  ? -14.115 9.487   -4.695  1.00 36.59 ? 86   PHE A CA  1 
ATOM   219  C C   . PHE A 1 39  ? -12.974 8.648   -5.292  1.00 36.53 ? 86   PHE A C   1 
ATOM   220  O O   . PHE A 1 39  ? -12.461 7.717   -4.659  1.00 36.18 ? 86   PHE A O   1 
ATOM   221  C CB  . PHE A 1 39  ? -15.446 9.219   -5.360  1.00 35.95 ? 86   PHE A CB  1 
ATOM   222  C CG  . PHE A 1 39  ? -15.912 7.796   -5.259  1.00 38.19 ? 86   PHE A CG  1 
ATOM   223  C CD1 . PHE A 1 39  ? -15.896 7.106   -4.055  1.00 37.81 ? 86   PHE A CD1 1 
ATOM   224  C CD2 . PHE A 1 39  ? -16.375 7.137   -6.377  1.00 39.10 ? 86   PHE A CD2 1 
ATOM   225  C CE1 . PHE A 1 39  ? -16.404 5.788   -3.979  1.00 39.21 ? 86   PHE A CE1 1 
ATOM   226  C CE2 . PHE A 1 39  ? -16.820 5.786   -6.282  1.00 38.51 ? 86   PHE A CE2 1 
ATOM   227  C CZ  . PHE A 1 39  ? -16.831 5.153   -5.093  1.00 35.31 ? 86   PHE A CZ  1 
ATOM   228  N N   . GLY A 1 40  ? -12.552 9.037   -6.493  1.00 38.12 ? 87   GLY A N   1 
ATOM   229  C CA  . GLY A 1 40  ? -11.356 8.511   -7.096  1.00 37.34 ? 87   GLY A CA  1 
ATOM   230  C C   . GLY A 1 40  ? -10.158 8.436   -6.186  1.00 38.55 ? 87   GLY A C   1 
ATOM   231  O O   . GLY A 1 40  ? -9.456  7.414   -6.166  1.00 36.61 ? 87   GLY A O   1 
ATOM   232  N N   . SER A 1 41  ? -9.871  9.548   -5.472  1.00 38.98 ? 88   SER A N   1 
ATOM   233  C CA  . SER A 1 41  ? -8.736  9.593   -4.585  1.00 39.09 ? 88   SER A CA  1 
ATOM   234  C C   . SER A 1 41  ? -8.883  8.570   -3.449  1.00 37.86 ? 88   SER A C   1 
ATOM   235  O O   . SER A 1 41  ? -7.937  7.901   -3.080  1.00 36.90 ? 88   SER A O   1 
ATOM   236  C CB  . SER A 1 41  ? -8.566  11.005  -3.993  1.00 40.27 ? 88   SER A CB  1 
ATOM   237  O OG  . SER A 1 41  ? -8.465  11.978  -5.042  1.00 45.96 ? 88   SER A OG  1 
ATOM   238  N N   . PHE A 1 42  ? -10.076 8.475   -2.890  1.00 37.60 ? 89   PHE A N   1 
ATOM   239  C CA  . PHE A 1 42  ? -10.382 7.456   -1.834  1.00 38.20 ? 89   PHE A CA  1 
ATOM   240  C C   . PHE A 1 42  ? -10.221 6.005   -2.337  1.00 37.23 ? 89   PHE A C   1 
ATOM   241  O O   . PHE A 1 42  ? -9.624  5.186   -1.679  1.00 37.95 ? 89   PHE A O   1 
ATOM   242  C CB  . PHE A 1 42  ? -11.811 7.691   -1.250  1.00 37.33 ? 89   PHE A CB  1 
ATOM   243  C CG  . PHE A 1 42  ? -12.325 6.544   -0.415  1.00 38.03 ? 89   PHE A CG  1 
ATOM   244  C CD1 . PHE A 1 42  ? -12.014 6.455   0.929   1.00 40.03 ? 89   PHE A CD1 1 
ATOM   245  C CD2 . PHE A 1 42  ? -13.160 5.568   -0.972  1.00 40.22 ? 89   PHE A CD2 1 
ATOM   246  C CE1 . PHE A 1 42  ? -12.500 5.411   1.709   1.00 40.51 ? 89   PHE A CE1 1 
ATOM   247  C CE2 . PHE A 1 42  ? -13.641 4.529   -0.202  1.00 39.44 ? 89   PHE A CE2 1 
ATOM   248  C CZ  . PHE A 1 42  ? -13.324 4.458   1.134   1.00 38.25 ? 89   PHE A CZ  1 
ATOM   249  N N   . LEU A 1 43  ? -10.702 5.723   -3.541  1.00 38.08 ? 90   LEU A N   1 
ATOM   250  C CA  . LEU A 1 43  ? -10.534 4.396   -4.154  1.00 38.33 ? 90   LEU A CA  1 
ATOM   251  C C   . LEU A 1 43  ? -9.058  4.079   -4.365  1.00 38.95 ? 90   LEU A C   1 
ATOM   252  O O   . LEU A 1 43  ? -8.595  2.967   -4.064  1.00 39.02 ? 90   LEU A O   1 
ATOM   253  C CB  . LEU A 1 43  ? -11.321 4.295   -5.465  1.00 38.19 ? 90   LEU A CB  1 
ATOM   254  C CG  . LEU A 1 43  ? -12.862 4.446   -5.437  1.00 37.94 ? 90   LEU A CG  1 
ATOM   255  C CD1 . LEU A 1 43  ? -13.397 4.182   -6.786  1.00 39.20 ? 90   LEU A CD1 1 
ATOM   256  C CD2 . LEU A 1 43  ? -13.537 3.503   -4.404  1.00 42.47 ? 90   LEU A CD2 1 
ATOM   257  N N   . LYS A 1 44  ? -8.292  5.077   -4.830  1.00 40.85 ? 91   LYS A N   1 
ATOM   258  C CA  . LYS A 1 44  ? -6.869  4.921   -5.018  1.00 41.75 ? 91   LYS A CA  1 
ATOM   259  C C   . LYS A 1 44  ? -6.202  4.608   -3.677  1.00 41.29 ? 91   LYS A C   1 
ATOM   260  O O   . LYS A 1 44  ? -5.438  3.662   -3.591  1.00 42.43 ? 91   LYS A O   1 
ATOM   261  C CB  . LYS A 1 44  ? -6.245  6.162   -5.718  1.00 42.28 ? 91   LYS A CB  1 
ATOM   262  C CG  . LYS A 1 44  ? -5.221  5.799   -6.781  1.00 45.27 ? 91   LYS A CG  1 
ATOM   263  C CD  . LYS A 1 44  ? -4.739  6.967   -7.689  1.00 45.46 ? 91   LYS A CD  1 
ATOM   264  C CE  . LYS A 1 44  ? -3.530  6.544   -8.533  1.00 47.96 ? 91   LYS A CE  1 
ATOM   265  N NZ  . LYS A 1 44  ? -3.900  5.786   -9.794  1.00 52.91 ? 91   LYS A NZ  1 
ATOM   266  N N   . SER A 1 45  ? -6.531  5.336   -2.617  1.00 41.74 ? 92   SER A N   1 
ATOM   267  C CA  . SER A 1 45  ? -6.005  4.977   -1.284  1.00 42.98 ? 92   SER A CA  1 
ATOM   268  C C   . SER A 1 45  ? -6.367  3.555   -0.806  1.00 43.34 ? 92   SER A C   1 
ATOM   269  O O   . SER A 1 45  ? -5.679  3.017   0.066   1.00 43.31 ? 92   SER A O   1 
ATOM   270  C CB  . SER A 1 45  ? -6.383  6.015   -0.194  1.00 42.43 ? 92   SER A CB  1 
ATOM   271  O OG  . SER A 1 45  ? -7.786  6.128   0.062   1.00 41.15 ? 92   SER A OG  1 
ATOM   272  N N   . GLU A 1 46  ? -7.417  2.982   -1.406  1.00 44.22 ? 93   GLU A N   1 
ATOM   273  C CA  . GLU A 1 46  ? -8.009  1.665   -1.067  1.00 45.18 ? 93   GLU A CA  1 
ATOM   274  C C   . GLU A 1 46  ? -7.705  0.543   -2.057  1.00 45.77 ? 93   GLU A C   1 
ATOM   275  O O   . GLU A 1 46  ? -8.317  -0.536  -1.968  1.00 46.01 ? 93   GLU A O   1 
ATOM   276  C CB  . GLU A 1 46  ? -9.536  1.802   -1.113  1.00 46.41 ? 93   GLU A CB  1 
ATOM   277  C CG  . GLU A 1 46  ? -10.222 1.919   0.182   1.00 48.75 ? 93   GLU A CG  1 
ATOM   278  C CD  . GLU A 1 46  ? -11.597 1.285   0.148   1.00 49.99 ? 93   GLU A CD  1 
ATOM   279  O OE1 . GLU A 1 46  ? -12.198 1.117   -0.936  1.00 52.76 ? 93   GLU A OE1 1 
ATOM   280  O OE2 . GLU A 1 46  ? -12.064 0.942   1.241   1.00 55.00 ? 93   GLU A OE2 1 
ATOM   281  N N   . PHE A 1 47  ? -6.821  0.827   -3.021  1.00 45.78 ? 94   PHE A N   1 
ATOM   282  C CA  . PHE A 1 47  ? -6.485  -0.035  -4.150  1.00 45.05 ? 94   PHE A CA  1 
ATOM   283  C C   . PHE A 1 47  ? -7.689  -0.594  -4.926  1.00 45.02 ? 94   PHE A C   1 
ATOM   284  O O   . PHE A 1 47  ? -7.681  -1.763  -5.315  1.00 45.10 ? 94   PHE A O   1 
ATOM   285  C CB  . PHE A 1 47  ? -5.579  -1.188  -3.674  1.00 46.38 ? 94   PHE A CB  1 
ATOM   286  C CG  . PHE A 1 47  ? -4.450  -0.754  -2.803  1.00 45.92 ? 94   PHE A CG  1 
ATOM   287  C CD1 . PHE A 1 47  ? -4.566  -0.821  -1.412  1.00 47.57 ? 94   PHE A CD1 1 
ATOM   288  C CD2 . PHE A 1 47  ? -3.277  -0.280  -3.357  1.00 46.77 ? 94   PHE A CD2 1 
ATOM   289  C CE1 . PHE A 1 47  ? -3.524  -0.430  -0.572  1.00 48.12 ? 94   PHE A CE1 1 
ATOM   290  C CE2 . PHE A 1 47  ? -2.211  0.107   -2.542  1.00 48.63 ? 94   PHE A CE2 1 
ATOM   291  C CZ  . PHE A 1 47  ? -2.333  0.033   -1.125  1.00 48.86 ? 94   PHE A CZ  1 
ATOM   292  N N   . SER A 1 48  ? -8.696  0.242   -5.179  1.00 44.11 ? 95   SER A N   1 
ATOM   293  C CA  . SER A 1 48  ? -9.860  -0.155  -5.961  1.00 44.57 ? 95   SER A CA  1 
ATOM   294  C C   . SER A 1 48  ? -10.237 0.853   -7.035  1.00 43.30 ? 95   SER A C   1 
ATOM   295  O O   . SER A 1 48  ? -11.367 0.848   -7.535  1.00 42.52 ? 95   SER A O   1 
ATOM   296  C CB  . SER A 1 48  ? -11.068 -0.441  -5.043  1.00 44.94 ? 95   SER A CB  1 
ATOM   297  O OG  . SER A 1 48  ? -11.563 0.739   -4.464  1.00 46.97 ? 95   SER A OG  1 
ATOM   298  N N   . GLU A 1 49  ? -9.280  1.706   -7.411  1.00 42.23 ? 96   GLU A N   1 
ATOM   299  C CA  . GLU A 1 49  ? -9.548  2.771   -8.365  1.00 41.49 ? 96   GLU A CA  1 
ATOM   300  C C   . GLU A 1 49  ? -9.772  2.265   -9.785  1.00 40.61 ? 96   GLU A C   1 
ATOM   301  O O   . GLU A 1 49  ? -10.351 2.989   -10.560 1.00 39.50 ? 96   GLU A O   1 
ATOM   302  C CB  . GLU A 1 49  ? -8.456  3.870   -8.336  1.00 41.40 ? 96   GLU A CB  1 
ATOM   303  C CG  . GLU A 1 49  ? -7.175  3.582   -9.132  1.00 44.27 ? 96   GLU A CG  1 
ATOM   304  C CD  . GLU A 1 49  ? -6.243  2.565   -8.496  1.00 45.04 ? 96   GLU A CD  1 
ATOM   305  O OE1 . GLU A 1 49  ? -6.413  2.138   -7.318  1.00 47.40 ? 96   GLU A OE1 1 
ATOM   306  O OE2 . GLU A 1 49  ? -5.326  2.170   -9.212  1.00 49.89 ? 96   GLU A OE2 1 
ATOM   307  N N   . GLU A 1 50  ? -9.380  1.019   -10.093 1.00 40.55 ? 97   GLU A N   1 
ATOM   308  C CA  . GLU A 1 50  ? -9.680  0.393   -11.392 1.00 40.72 ? 97   GLU A CA  1 
ATOM   309  C C   . GLU A 1 50  ? -11.166 0.442   -11.674 1.00 39.19 ? 97   GLU A C   1 
ATOM   310  O O   . GLU A 1 50  ? -11.577 0.495   -12.827 1.00 38.60 ? 97   GLU A O   1 
ATOM   311  C CB  . GLU A 1 50  ? -9.156  -1.061  -11.516 1.00 41.11 ? 97   GLU A CB  1 
ATOM   312  C CG  . GLU A 1 50  ? -9.917  -2.167  -10.738 1.00 44.57 ? 97   GLU A CG  1 
ATOM   313  C CD  . GLU A 1 50  ? -9.530  -2.237  -9.255  1.00 49.97 ? 97   GLU A CD  1 
ATOM   314  O OE1 . GLU A 1 50  ? -8.794  -1.330  -8.773  1.00 51.18 ? 97   GLU A OE1 1 
ATOM   315  O OE2 . GLU A 1 50  ? -9.959  -3.209  -8.578  1.00 52.89 ? 97   GLU A OE2 1 
ATOM   316  N N   . ASN A 1 51  ? -11.977 0.463   -10.619 1.00 38.08 ? 98   ASN A N   1 
ATOM   317  C CA  . ASN A 1 51  ? -13.435 0.473   -10.793 1.00 38.56 ? 98   ASN A CA  1 
ATOM   318  C C   . ASN A 1 51  ? -13.946 1.754   -11.399 1.00 37.72 ? 98   ASN A C   1 
ATOM   319  O O   . ASN A 1 51  ? -14.755 1.733   -12.335 1.00 36.65 ? 98   ASN A O   1 
ATOM   320  C CB  . ASN A 1 51  ? -14.175 0.139   -9.469  1.00 38.67 ? 98   ASN A CB  1 
ATOM   321  C CG  . ASN A 1 51  ? -14.124 -1.319  -9.147  1.00 39.98 ? 98   ASN A CG  1 
ATOM   322  O OD1 . ASN A 1 51  ? -13.930 -2.150  -10.038 1.00 43.47 ? 98   ASN A OD1 1 
ATOM   323  N ND2 . ASN A 1 51  ? -14.221 -1.653  -7.868  1.00 45.51 ? 98   ASN A ND2 1 
ATOM   324  N N   . ILE A 1 52  ? -13.521 2.894   -10.849 1.00 39.49 ? 99   ILE A N   1 
ATOM   325  C CA  . ILE A 1 52  ? -14.022 4.178   -11.343 1.00 38.77 ? 99   ILE A CA  1 
ATOM   326  C C   . ILE A 1 52  ? -13.354 4.527   -12.669 1.00 38.54 ? 99   ILE A C   1 
ATOM   327  O O   . ILE A 1 52  ? -13.958 5.107   -13.561 1.00 38.92 ? 99   ILE A O   1 
ATOM   328  C CB  . ILE A 1 52  ? -13.862 5.331   -10.308 1.00 39.45 ? 99   ILE A CB  1 
ATOM   329  C CG1 . ILE A 1 52  ? -14.699 6.549   -10.757 1.00 38.99 ? 99   ILE A CG1 1 
ATOM   330  C CG2 . ILE A 1 52  ? -12.397 5.738   -10.124 1.00 39.34 ? 99   ILE A CG2 1 
ATOM   331  C CD1 . ILE A 1 52  ? -14.556 7.769   -9.850  1.00 41.30 ? 99   ILE A CD1 1 
ATOM   332  N N   . GLU A 1 53  ? -12.102 4.153   -12.797 1.00 38.03 ? 100  GLU A N   1 
ATOM   333  C CA  . GLU A 1 53  ? -11.382 4.374   -14.035 1.00 38.61 ? 100  GLU A CA  1 
ATOM   334  C C   . GLU A 1 53  ? -11.967 3.599   -15.183 1.00 37.64 ? 100  GLU A C   1 
ATOM   335  O O   . GLU A 1 53  ? -12.178 4.142   -16.269 1.00 36.07 ? 100  GLU A O   1 
ATOM   336  C CB  . GLU A 1 53  ? -9.939  4.026   -13.817 1.00 38.91 ? 100  GLU A CB  1 
ATOM   337  C CG  . GLU A 1 53  ? -9.280  5.048   -12.973 1.00 43.34 ? 100  GLU A CG  1 
ATOM   338  C CD  . GLU A 1 53  ? -7.807  4.828   -12.887 1.00 49.83 ? 100  GLU A CD  1 
ATOM   339  O OE1 . GLU A 1 53  ? -7.327  3.716   -13.257 1.00 55.29 ? 100  GLU A OE1 1 
ATOM   340  O OE2 . GLU A 1 53  ? -7.134  5.773   -12.427 1.00 58.37 ? 100  GLU A OE2 1 
ATOM   341  N N   . PHE A 1 54  ? -12.311 2.331   -14.923 1.00 36.24 ? 101  PHE A N   1 
ATOM   342  C CA  . PHE A 1 54  ? -13.048 1.553   -15.897 1.00 35.99 ? 101  PHE A CA  1 
ATOM   343  C C   . PHE A 1 54  ? -14.351 2.193   -16.243 1.00 36.12 ? 101  PHE A C   1 
ATOM   344  O O   . PHE A 1 54  ? -14.672 2.347   -17.425 1.00 35.52 ? 101  PHE A O   1 
ATOM   345  C CB  . PHE A 1 54  ? -13.304 0.086   -15.413 1.00 35.99 ? 101  PHE A CB  1 
ATOM   346  C CG  . PHE A 1 54  ? -14.101 -0.709  -16.366 1.00 35.85 ? 101  PHE A CG  1 
ATOM   347  C CD1 . PHE A 1 54  ? -13.579 -1.037  -17.624 1.00 34.73 ? 101  PHE A CD1 1 
ATOM   348  C CD2 . PHE A 1 54  ? -15.423 -1.082  -16.067 1.00 36.15 ? 101  PHE A CD2 1 
ATOM   349  C CE1 . PHE A 1 54  ? -14.354 -1.785  -18.553 1.00 37.52 ? 101  PHE A CE1 1 
ATOM   350  C CE2 . PHE A 1 54  ? -16.180 -1.823  -16.957 1.00 34.80 ? 101  PHE A CE2 1 
ATOM   351  C CZ  . PHE A 1 54  ? -15.668 -2.177  -18.230 1.00 34.66 ? 101  PHE A CZ  1 
ATOM   352  N N   . TRP A 1 55  ? -15.108 2.583   -15.217 1.00 37.04 ? 102  TRP A N   1 
ATOM   353  C CA  . TRP A 1 55  ? -16.407 3.206   -15.433 1.00 37.83 ? 102  TRP A CA  1 
ATOM   354  C C   . TRP A 1 55  ? -16.303 4.484   -16.304 1.00 37.76 ? 102  TRP A C   1 
ATOM   355  O O   . TRP A 1 55  ? -17.024 4.640   -17.261 1.00 37.66 ? 102  TRP A O   1 
ATOM   356  C CB  . TRP A 1 55  ? -17.080 3.493   -14.078 1.00 39.44 ? 102  TRP A CB  1 
ATOM   357  C CG  . TRP A 1 55  ? -18.473 3.941   -14.230 1.00 40.05 ? 102  TRP A CG  1 
ATOM   358  C CD1 . TRP A 1 55  ? -19.572 3.152   -14.290 1.00 42.14 ? 102  TRP A CD1 1 
ATOM   359  C CD2 . TRP A 1 55  ? -18.947 5.293   -14.347 1.00 41.17 ? 102  TRP A CD2 1 
ATOM   360  N NE1 . TRP A 1 55  ? -20.692 3.915   -14.448 1.00 42.31 ? 102  TRP A NE1 1 
ATOM   361  C CE2 . TRP A 1 55  ? -20.339 5.230   -14.487 1.00 41.11 ? 102  TRP A CE2 1 
ATOM   362  C CE3 . TRP A 1 55  ? -18.322 6.548   -14.350 1.00 42.12 ? 102  TRP A CE3 1 
ATOM   363  C CZ2 . TRP A 1 55  ? -21.122 6.352   -14.641 1.00 42.79 ? 102  TRP A CZ2 1 
ATOM   364  C CZ3 . TRP A 1 55  ? -19.109 7.668   -14.480 1.00 41.84 ? 102  TRP A CZ3 1 
ATOM   365  C CH2 . TRP A 1 55  ? -20.500 7.561   -14.618 1.00 40.59 ? 102  TRP A CH2 1 
ATOM   366  N N   . LEU A 1 56  ? -15.378 5.382   -15.963 1.00 38.26 ? 103  LEU A N   1 
ATOM   367  C CA  . LEU A 1 56  ? -15.116 6.583   -16.767 1.00 38.28 ? 103  LEU A CA  1 
ATOM   368  C C   . LEU A 1 56  ? -14.623 6.264   -18.186 1.00 37.68 ? 103  LEU A C   1 
ATOM   369  O O   . LEU A 1 56  ? -14.952 6.977   -19.133 1.00 38.81 ? 103  LEU A O   1 
ATOM   370  C CB  . LEU A 1 56  ? -14.083 7.474   -16.057 1.00 38.73 ? 103  LEU A CB  1 
ATOM   371  C CG  . LEU A 1 56  ? -14.516 8.029   -14.710 1.00 40.61 ? 103  LEU A CG  1 
ATOM   372  C CD1 . LEU A 1 56  ? -13.298 8.473   -13.826 1.00 42.56 ? 103  LEU A CD1 1 
ATOM   373  C CD2 . LEU A 1 56  ? -15.547 9.141   -14.930 1.00 42.04 ? 103  LEU A CD2 1 
ATOM   374  N N   . ALA A 1 57  ? -13.817 5.213   -18.354 1.00 37.61 ? 104  ALA A N   1 
ATOM   375  C CA  . ALA A 1 57  ? -13.391 4.803   -19.706 1.00 37.09 ? 104  ALA A CA  1 
ATOM   376  C C   . ALA A 1 57  ? -14.590 4.356   -20.546 1.00 36.89 ? 104  ALA A C   1 
ATOM   377  O O   . ALA A 1 57  ? -14.669 4.593   -21.759 1.00 34.33 ? 104  ALA A O   1 
ATOM   378  C CB  . ALA A 1 57  ? -12.352 3.691   -19.630 1.00 38.16 ? 104  ALA A CB  1 
ATOM   379  N N   . CYS A 1 58  ? -15.545 3.684   -19.896 1.00 36.76 ? 105  CYS A N   1 
ATOM   380  C CA  . CYS A 1 58  ? -16.728 3.204   -20.609 1.00 37.54 ? 105  CYS A CA  1 
ATOM   381  C C   . CYS A 1 58  ? -17.583 4.371   -21.079 1.00 37.11 ? 105  CYS A C   1 
ATOM   382  O O   . CYS A 1 58  ? -18.126 4.330   -22.168 1.00 36.70 ? 105  CYS A O   1 
ATOM   383  C CB  . CYS A 1 58  ? -17.568 2.260   -19.711 1.00 36.75 ? 105  CYS A CB  1 
ATOM   384  S SG  . CYS A 1 58  ? -16.759 0.699   -19.414 1.00 39.98 ? 105  CYS A SG  1 
ATOM   385  N N   . GLU A 1 59  ? -17.687 5.406   -20.248 1.00 38.16 ? 106  GLU A N   1 
ATOM   386  C CA  . GLU A 1 59  ? -18.437 6.627   -20.578 1.00 39.46 ? 106  GLU A CA  1 
ATOM   387  C C   . GLU A 1 59  ? -17.787 7.284   -21.791 1.00 40.00 ? 106  GLU A C   1 
ATOM   388  O O   . GLU A 1 59  ? -18.451 7.654   -22.741 1.00 40.46 ? 106  GLU A O   1 
ATOM   389  C CB  . GLU A 1 59  ? -18.472 7.600   -19.389 1.00 39.36 ? 106  GLU A CB  1 
ATOM   390  C CG  . GLU A 1 59  ? -19.333 7.090   -18.195 1.00 41.92 ? 106  GLU A CG  1 
ATOM   391  C CD  . GLU A 1 59  ? -20.758 6.865   -18.610 1.00 46.65 ? 106  GLU A CD  1 
ATOM   392  O OE1 . GLU A 1 59  ? -21.164 5.692   -18.776 1.00 47.80 ? 106  GLU A OE1 1 
ATOM   393  O OE2 . GLU A 1 59  ? -21.457 7.876   -18.855 1.00 51.89 ? 106  GLU A OE2 1 
ATOM   394  N N   . ASP A 1 60  ? -16.468 7.318   -21.767 1.00 40.17 ? 107  ASP A N   1 
ATOM   395  C CA  . ASP A 1 60  ? -15.694 7.902   -22.842 1.00 41.03 ? 107  ASP A CA  1 
ATOM   396  C C   . ASP A 1 60  ? -15.732 7.030   -24.121 1.00 40.32 ? 107  ASP A C   1 
ATOM   397  O O   . ASP A 1 60  ? -15.777 7.558   -25.253 1.00 38.74 ? 107  ASP A O   1 
ATOM   398  C CB  . ASP A 1 60  ? -14.317 8.318   -22.271 1.00 42.09 ? 107  ASP A CB  1 
ATOM   399  C CG  . ASP A 1 60  ? -13.171 7.847   -23.064 1.00 47.41 ? 107  ASP A CG  1 
ATOM   400  O OD1 . ASP A 1 60  ? -12.999 8.352   -24.198 1.00 48.93 ? 107  ASP A OD1 1 
ATOM   401  O OD2 . ASP A 1 60  ? -12.408 6.993   -22.514 1.00 56.38 ? 107  ASP A OD2 1 
ATOM   402  N N   . TYR A 1 61  ? -15.836 5.710   -23.953 1.00 39.57 ? 108  TYR A N   1 
ATOM   403  C CA  . TYR A 1 61  ? -15.999 4.808   -25.104 1.00 39.47 ? 108  TYR A CA  1 
ATOM   404  C C   . TYR A 1 61  ? -17.310 5.073   -25.861 1.00 40.86 ? 108  TYR A C   1 
ATOM   405  O O   . TYR A 1 61  ? -17.359 5.038   -27.106 1.00 39.95 ? 108  TYR A O   1 
ATOM   406  C CB  . TYR A 1 61  ? -15.881 3.346   -24.673 1.00 38.16 ? 108  TYR A CB  1 
ATOM   407  C CG  . TYR A 1 61  ? -16.265 2.346   -25.710 1.00 37.63 ? 108  TYR A CG  1 
ATOM   408  C CD1 . TYR A 1 61  ? -15.320 1.883   -26.642 1.00 35.71 ? 108  TYR A CD1 1 
ATOM   409  C CD2 . TYR A 1 61  ? -17.568 1.792   -25.742 1.00 36.12 ? 108  TYR A CD2 1 
ATOM   410  C CE1 . TYR A 1 61  ? -15.665 0.938   -27.606 1.00 36.44 ? 108  TYR A CE1 1 
ATOM   411  C CE2 . TYR A 1 61  ? -17.925 0.840   -26.728 1.00 36.95 ? 108  TYR A CE2 1 
ATOM   412  C CZ  . TYR A 1 61  ? -16.961 0.418   -27.647 1.00 36.99 ? 108  TYR A CZ  1 
ATOM   413  O OH  . TYR A 1 61  ? -17.277 -0.504  -28.626 1.00 37.44 ? 108  TYR A OH  1 
ATOM   414  N N   . LYS A 1 62  ? -18.355 5.374   -25.098 1.00 42.54 ? 109  LYS A N   1 
ATOM   415  C CA  . LYS A 1 62  ? -19.715 5.544   -25.621 1.00 43.91 ? 109  LYS A CA  1 
ATOM   416  C C   . LYS A 1 62  ? -19.901 6.789   -26.448 1.00 43.63 ? 109  LYS A C   1 
ATOM   417  O O   . LYS A 1 62  ? -20.823 6.850   -27.253 1.00 45.05 ? 109  LYS A O   1 
ATOM   418  C CB  . LYS A 1 62  ? -20.728 5.554   -24.465 1.00 43.60 ? 109  LYS A CB  1 
ATOM   419  C CG  . LYS A 1 62  ? -21.179 4.167   -24.076 1.00 46.38 ? 109  LYS A CG  1 
ATOM   420  C CD  . LYS A 1 62  ? -22.229 4.202   -22.929 1.00 46.36 ? 109  LYS A CD  1 
ATOM   421  C CE  . LYS A 1 62  ? -21.609 4.336   -21.576 1.00 48.95 ? 109  LYS A CE  1 
ATOM   422  N NZ  . LYS A 1 62  ? -22.597 4.049   -20.456 1.00 48.87 ? 109  LYS A NZ  1 
ATOM   423  N N   . LYS A 1 63  ? -19.051 7.790   -26.240 1.00 43.99 ? 110  LYS A N   1 
ATOM   424  C CA  . LYS A 1 63  ? -19.074 8.994   -27.051 1.00 43.50 ? 110  LYS A CA  1 
ATOM   425  C C   . LYS A 1 63  ? -17.938 8.965   -28.106 1.00 43.29 ? 110  LYS A C   1 
ATOM   426  O O   . LYS A 1 63  ? -17.568 10.000  -28.629 1.00 43.35 ? 110  LYS A O   1 
ATOM   427  C CB  . LYS A 1 63  ? -18.916 10.248  -26.178 1.00 44.05 ? 110  LYS A CB  1 
ATOM   428  C CG  . LYS A 1 63  ? -19.764 10.347  -24.864 1.00 45.02 ? 110  LYS A CG  1 
ATOM   429  C CD  . LYS A 1 63  ? -18.982 11.194  -23.823 1.00 45.19 ? 110  LYS A CD  1 
ATOM   430  C CE  . LYS A 1 63  ? -19.800 11.634  -22.607 1.00 47.61 ? 110  LYS A CE  1 
ATOM   431  N NZ  . LYS A 1 63  ? -19.112 11.348  -21.277 1.00 49.12 ? 110  LYS A NZ  1 
ATOM   432  N N   . THR A 1 64  ? -17.370 7.792   -28.400 1.00 42.56 ? 111  THR A N   1 
ATOM   433  C CA  . THR A 1 64  ? -16.236 7.698   -29.336 1.00 41.53 ? 111  THR A CA  1 
ATOM   434  C C   . THR A 1 64  ? -16.782 7.428   -30.730 1.00 41.10 ? 111  THR A C   1 
ATOM   435  O O   . THR A 1 64  ? -17.780 6.691   -30.897 1.00 40.75 ? 111  THR A O   1 
ATOM   436  C CB  . THR A 1 64  ? -15.213 6.573   -28.911 1.00 41.26 ? 111  THR A CB  1 
ATOM   437  O OG1 . THR A 1 64  ? -14.515 6.960   -27.723 1.00 40.06 ? 111  THR A OG1 1 
ATOM   438  C CG2 . THR A 1 64  ? -14.165 6.270   -30.020 1.00 41.47 ? 111  THR A CG2 1 
ATOM   439  N N   . GLU A 1 65  ? -16.104 8.011   -31.729 1.00 40.30 ? 112  GLU A N   1 
ATOM   440  C CA  . GLU A 1 65  ? -16.513 7.903   -33.121 1.00 40.02 ? 112  GLU A CA  1 
ATOM   441  C C   . GLU A 1 65  ? -16.389 6.466   -33.561 1.00 39.69 ? 112  GLU A C   1 
ATOM   442  O O   . GLU A 1 65  ? -15.460 5.770   -33.169 1.00 39.90 ? 112  GLU A O   1 
ATOM   443  C CB  . GLU A 1 65  ? -15.685 8.846   -34.039 1.00 39.64 ? 112  GLU A CB  1 
ATOM   444  C CG  . GLU A 1 65  ? -14.203 8.467   -34.200 1.00 39.82 ? 112  GLU A CG  1 
ATOM   445  C CD  . GLU A 1 65  ? -13.412 9.427   -35.103 1.00 40.97 ? 112  GLU A CD  1 
ATOM   446  O OE1 . GLU A 1 65  ? -13.044 9.019   -36.225 1.00 38.87 ? 112  GLU A OE1 1 
ATOM   447  O OE2 . GLU A 1 65  ? -13.161 10.585  -34.690 1.00 43.94 ? 112  GLU A OE2 1 
ATOM   448  N N   . SER A 1 66  ? -17.338 6.048   -34.385 1.00 39.60 ? 113  SER A N   1 
ATOM   449  C CA  . SER A 1 66  ? -17.497 4.665   -34.819 1.00 40.07 ? 113  SER A CA  1 
ATOM   450  C C   . SER A 1 66  ? -16.201 3.971   -35.297 1.00 40.22 ? 113  SER A C   1 
ATOM   451  O O   . SER A 1 66  ? -15.911 2.852   -34.881 1.00 40.45 ? 113  SER A O   1 
ATOM   452  C CB  . SER A 1 66  ? -18.535 4.659   -35.953 1.00 40.21 ? 113  SER A CB  1 
ATOM   453  O OG  . SER A 1 66  ? -18.727 3.379   -36.477 1.00 41.89 ? 113  SER A OG  1 
ATOM   454  N N   . ASP A 1 67  ? -15.453 4.635   -36.184 1.00 39.75 ? 114  ASP A N   1 
ATOM   455  C CA  . ASP A 1 67  ? -14.145 4.154   -36.671 1.00 39.48 ? 114  ASP A CA  1 
ATOM   456  C C   . ASP A 1 67  ? -13.102 3.813   -35.586 1.00 38.86 ? 114  ASP A C   1 
ATOM   457  O O   . ASP A 1 67  ? -12.208 3.008   -35.837 1.00 38.66 ? 114  ASP A O   1 
ATOM   458  C CB  . ASP A 1 67  ? -13.505 5.197   -37.613 1.00 39.37 ? 114  ASP A CB  1 
ATOM   459  C CG  . ASP A 1 67  ? -14.142 5.233   -39.000 1.00 40.91 ? 114  ASP A CG  1 
ATOM   460  O OD1 . ASP A 1 67  ? -14.836 4.258   -39.381 1.00 43.26 ? 114  ASP A OD1 1 
ATOM   461  O OD2 . ASP A 1 67  ? -13.917 6.234   -39.727 1.00 40.44 ? 114  ASP A OD2 1 
ATOM   462  N N   . LEU A 1 68  ? -13.172 4.440   -34.413 1.00 38.42 ? 115  LEU A N   1 
ATOM   463  C CA  . LEU A 1 68  ? -12.159 4.203   -33.381 1.00 38.23 ? 115  LEU A CA  1 
ATOM   464  C C   . LEU A 1 68  ? -12.621 3.275   -32.256 1.00 38.66 ? 115  LEU A C   1 
ATOM   465  O O   . LEU A 1 68  ? -11.913 3.100   -31.261 1.00 37.75 ? 115  LEU A O   1 
ATOM   466  C CB  . LEU A 1 68  ? -11.687 5.525   -32.803 1.00 38.14 ? 115  LEU A CB  1 
ATOM   467  C CG  . LEU A 1 68  ? -11.001 6.461   -33.804 1.00 37.27 ? 115  LEU A CG  1 
ATOM   468  C CD1 . LEU A 1 68  ? -10.463 7.699   -33.106 1.00 37.51 ? 115  LEU A CD1 1 
ATOM   469  C CD2 . LEU A 1 68  ? -9.901  5.731   -34.592 1.00 36.85 ? 115  LEU A CD2 1 
ATOM   470  N N   . LEU A 1 69  ? -13.804 2.683   -32.422 1.00 39.19 ? 116  LEU A N   1 
ATOM   471  C CA  . LEU A 1 69  ? -14.328 1.760   -31.414 1.00 39.77 ? 116  LEU A CA  1 
ATOM   472  C C   . LEU A 1 69  ? -13.496 0.468   -31.360 1.00 39.66 ? 116  LEU A C   1 
ATOM   473  O O   . LEU A 1 69  ? -13.130 0.031   -30.273 1.00 40.35 ? 116  LEU A O   1 
ATOM   474  C CB  . LEU A 1 69  ? -15.824 1.480   -31.639 1.00 39.80 ? 116  LEU A CB  1 
ATOM   475  C CG  . LEU A 1 69  ? -16.771 2.683   -31.480 1.00 40.26 ? 116  LEU A CG  1 
ATOM   476  C CD1 . LEU A 1 69  ? -18.227 2.215   -31.600 1.00 42.25 ? 116  LEU A CD1 1 
ATOM   477  C CD2 . LEU A 1 69  ? -16.600 3.415   -30.178 1.00 39.77 ? 116  LEU A CD2 1 
ATOM   478  N N   . PRO A 1 70  ? -13.146 -0.124  -32.518 1.00 39.86 ? 117  PRO A N   1 
ATOM   479  C CA  . PRO A 1 70  ? -12.313 -1.328  -32.361 1.00 39.64 ? 117  PRO A CA  1 
ATOM   480  C C   . PRO A 1 70  ? -11.055 -1.087  -31.492 1.00 39.70 ? 117  PRO A C   1 
ATOM   481  O O   . PRO A 1 70  ? -10.803 -1.853  -30.541 1.00 38.13 ? 117  PRO A O   1 
ATOM   482  C CB  . PRO A 1 70  ? -11.979 -1.713  -33.793 1.00 40.45 ? 117  PRO A CB  1 
ATOM   483  C CG  . PRO A 1 70  ? -13.088 -1.093  -34.615 1.00 40.69 ? 117  PRO A CG  1 
ATOM   484  C CD  . PRO A 1 70  ? -13.444 0.173   -33.928 1.00 39.60 ? 117  PRO A CD  1 
ATOM   485  N N   . CYS A 1 71  ? -10.323 -0.001  -31.772 1.00 39.06 ? 118  CYS A N   1 
ATOM   486  C CA  . CYS A 1 71  ? -9.122  0.373   -30.993 1.00 39.00 ? 118  CYS A CA  1 
ATOM   487  C C   . CYS A 1 71  ? -9.358  0.711   -29.521 1.00 38.75 ? 118  CYS A C   1 
ATOM   488  O O   . CYS A 1 71  ? -8.616  0.250   -28.655 1.00 38.46 ? 118  CYS A O   1 
ATOM   489  C CB  . CYS A 1 71  ? -8.387  1.556   -31.642 1.00 38.83 ? 118  CYS A CB  1 
ATOM   490  S SG  . CYS A 1 71  ? -7.350  1.038   -33.019 1.00 37.73 ? 118  CYS A SG  1 
ATOM   491  N N   . LYS A 1 72  ? -10.331 1.576   -29.253 1.00 39.20 ? 119  LYS A N   1 
ATOM   492  C CA  . LYS A 1 72  ? -10.735 1.910   -27.886 1.00 38.99 ? 119  LYS A CA  1 
ATOM   493  C C   . LYS A 1 72  ? -11.198 0.679   -27.099 1.00 38.49 ? 119  LYS A C   1 
ATOM   494  O O   . LYS A 1 72  ? -10.842 0.512   -25.934 1.00 38.99 ? 119  LYS A O   1 
ATOM   495  C CB  . LYS A 1 72  ? -11.851 2.963   -27.896 1.00 39.24 ? 119  LYS A CB  1 
ATOM   496  C CG  . LYS A 1 72  ? -12.092 3.666   -26.553 1.00 40.86 ? 119  LYS A CG  1 
ATOM   497  C CD  . LYS A 1 72  ? -10.860 4.332   -26.001 1.00 44.23 ? 119  LYS A CD  1 
ATOM   498  C CE  . LYS A 1 72  ? -11.161 5.154   -24.756 1.00 45.51 ? 119  LYS A CE  1 
ATOM   499  N N   . ALA A 1 73  ? -12.023 -0.153  -27.708 1.00 37.75 ? 120  ALA A N   1 
ATOM   500  C CA  . ALA A 1 73  ? -12.479 -1.371  -27.035 1.00 37.24 ? 120  ALA A CA  1 
ATOM   501  C C   . ALA A 1 73  ? -11.278 -2.259  -26.677 1.00 36.88 ? 120  ALA A C   1 
ATOM   502  O O   . ALA A 1 73  ? -11.169 -2.737  -25.544 1.00 35.93 ? 120  ALA A O   1 
ATOM   503  C CB  . ALA A 1 73  ? -13.471 -2.123  -27.904 1.00 37.24 ? 120  ALA A CB  1 
ATOM   504  N N   . GLU A 1 74  ? -10.364 -2.470  -27.638 1.00 36.56 ? 121  GLU A N   1 
ATOM   505  C CA  . GLU A 1 74  ? -9.150  -3.243  -27.372 1.00 36.79 ? 121  GLU A CA  1 
ATOM   506  C C   . GLU A 1 74  ? -8.323  -2.640  -26.254 1.00 36.82 ? 121  GLU A C   1 
ATOM   507  O O   . GLU A 1 74  ? -7.778  -3.389  -25.452 1.00 37.98 ? 121  GLU A O   1 
ATOM   508  C CB  . GLU A 1 74  ? -8.279  -3.433  -28.641 1.00 36.65 ? 121  GLU A CB  1 
ATOM   509  N N   . GLU A 1 75  ? -8.197  -1.310  -26.200 1.00 37.74 ? 122  GLU A N   1 
ATOM   510  C CA  . GLU A 1 75  ? -7.436  -0.645  -25.129 1.00 38.79 ? 122  GLU A CA  1 
ATOM   511  C C   . GLU A 1 75  ? -8.082  -0.851  -23.738 1.00 37.40 ? 122  GLU A C   1 
ATOM   512  O O   . GLU A 1 75  ? -7.408  -1.076  -22.750 1.00 35.99 ? 122  GLU A O   1 
ATOM   513  C CB  . GLU A 1 75  ? -7.335  0.879   -25.331 1.00 38.82 ? 122  GLU A CB  1 
ATOM   514  C CG  . GLU A 1 75  ? -6.410  1.542   -24.250 1.00 40.85 ? 122  GLU A CG  1 
ATOM   515  C CD  . GLU A 1 75  ? -6.633  3.042   -23.961 1.00 43.09 ? 122  GLU A CD  1 
ATOM   516  O OE1 . GLU A 1 75  ? -7.772  3.436   -23.613 1.00 47.96 ? 122  GLU A OE1 1 
ATOM   517  O OE2 . GLU A 1 75  ? -5.637  3.816   -24.063 1.00 48.62 ? 122  GLU A OE2 1 
ATOM   518  N N   . ILE A 1 76  ? -9.387  -0.682  -23.679 1.00 37.55 ? 123  ILE A N   1 
ATOM   519  C CA  . ILE A 1 76  ? -10.110 -0.814  -22.426 1.00 37.68 ? 123  ILE A CA  1 
ATOM   520  C C   . ILE A 1 76  ? -10.033 -2.265  -21.942 1.00 37.55 ? 123  ILE A C   1 
ATOM   521  O O   . ILE A 1 76  ? -9.813  -2.530  -20.756 1.00 36.54 ? 123  ILE A O   1 
ATOM   522  C CB  . ILE A 1 76  ? -11.567 -0.363  -22.604 1.00 37.85 ? 123  ILE A CB  1 
ATOM   523  C CG1 . ILE A 1 76  ? -11.617 1.165   -22.728 1.00 38.38 ? 123  ILE A CG1 1 
ATOM   524  C CG2 . ILE A 1 76  ? -12.445 -0.866  -21.420 1.00 38.36 ? 123  ILE A CG2 1 
ATOM   525  C CD1 . ILE A 1 76  ? -12.989 1.742   -23.158 1.00 38.34 ? 123  ILE A CD1 1 
ATOM   526  N N   . TYR A 1 77  ? -10.198 -3.188  -22.881 1.00 37.88 ? 124  TYR A N   1 
ATOM   527  C CA  . TYR A 1 77  ? -10.097 -4.611  -22.592 1.00 39.04 ? 124  TYR A CA  1 
ATOM   528  C C   . TYR A 1 77  ? -8.724  -5.023  -22.019 1.00 38.54 ? 124  TYR A C   1 
ATOM   529  O O   . TYR A 1 77  ? -8.642  -5.693  -20.983 1.00 38.00 ? 124  TYR A O   1 
ATOM   530  C CB  . TYR A 1 77  ? -10.435 -5.400  -23.851 1.00 40.40 ? 124  TYR A CB  1 
ATOM   531  C CG  . TYR A 1 77  ? -10.409 -6.888  -23.641 1.00 42.74 ? 124  TYR A CG  1 
ATOM   532  C CD1 . TYR A 1 77  ? -9.346  -7.634  -24.119 1.00 44.39 ? 124  TYR A CD1 1 
ATOM   533  C CD2 . TYR A 1 77  ? -11.430 -7.545  -22.950 1.00 44.00 ? 124  TYR A CD2 1 
ATOM   534  C CE1 . TYR A 1 77  ? -9.292  -8.981  -23.939 1.00 45.70 ? 124  TYR A CE1 1 
ATOM   535  C CE2 . TYR A 1 77  ? -11.372 -8.943  -22.751 1.00 45.10 ? 124  TYR A CE2 1 
ATOM   536  C CZ  . TYR A 1 77  ? -10.292 -9.630  -23.253 1.00 43.66 ? 124  TYR A CZ  1 
ATOM   537  O OH  . TYR A 1 77  ? -10.147 -10.984 -23.130 1.00 45.82 ? 124  TYR A OH  1 
ATOM   538  N N   . LYS A 1 78  ? -7.640  -4.569  -22.639 1.00 37.98 ? 125  LYS A N   1 
ATOM   539  C CA  . LYS A 1 78  ? -6.311  -4.922  -22.137 1.00 37.79 ? 125  LYS A CA  1 
ATOM   540  C C   . LYS A 1 78  ? -6.016  -4.245  -20.792 1.00 37.40 ? 125  LYS A C   1 
ATOM   541  O O   . LYS A 1 78  ? -5.400  -4.832  -19.915 1.00 37.32 ? 125  LYS A O   1 
ATOM   542  C CB  . LYS A 1 78  ? -5.215  -4.615  -23.184 1.00 38.24 ? 125  LYS A CB  1 
ATOM   543  N N   . ALA A 1 79  ? -6.469  -3.013  -20.627 1.00 37.44 ? 126  ALA A N   1 
ATOM   544  C CA  . ALA A 1 79  ? -6.140  -2.248  -19.442 1.00 39.02 ? 126  ALA A CA  1 
ATOM   545  C C   . ALA A 1 79  ? -6.914  -2.708  -18.187 1.00 38.68 ? 126  ALA A C   1 
ATOM   546  O O   . ALA A 1 79  ? -6.417  -2.565  -17.104 1.00 38.16 ? 126  ALA A O   1 
ATOM   547  C CB  . ALA A 1 79  ? -6.383  -0.756  -19.680 1.00 39.62 ? 126  ALA A CB  1 
ATOM   548  N N   . PHE A 1 80  ? -8.084  -3.298  -18.356 1.00 39.26 ? 127  PHE A N   1 
ATOM   549  C CA  . PHE A 1 80  ? -9.046  -3.488  -17.226 1.00 40.23 ? 127  PHE A CA  1 
ATOM   550  C C   . PHE A 1 80  ? -9.683  -4.882  -17.155 1.00 40.71 ? 127  PHE A C   1 
ATOM   551  O O   . PHE A 1 80  ? -9.858  -5.428  -16.093 1.00 41.46 ? 127  PHE A O   1 
ATOM   552  C CB  . PHE A 1 80  ? -10.202 -2.473  -17.346 1.00 40.71 ? 127  PHE A CB  1 
ATOM   553  C CG  . PHE A 1 80  ? -9.785  -1.030  -17.165 1.00 41.04 ? 127  PHE A CG  1 
ATOM   554  C CD1 . PHE A 1 80  ? -9.321  -0.579  -15.942 1.00 41.37 ? 127  PHE A CD1 1 
ATOM   555  C CD2 . PHE A 1 80  ? -9.913  -0.116  -18.214 1.00 40.70 ? 127  PHE A CD2 1 
ATOM   556  C CE1 . PHE A 1 80  ? -8.938  0.755   -15.777 1.00 41.94 ? 127  PHE A CE1 1 
ATOM   557  C CE2 . PHE A 1 80  ? -9.519  1.217   -18.067 1.00 42.43 ? 127  PHE A CE2 1 
ATOM   558  C CZ  . PHE A 1 80  ? -9.051  1.661   -16.849 1.00 41.29 ? 127  PHE A CZ  1 
ATOM   559  N N   . VAL A 1 81  ? -10.029 -5.440  -18.296 1.00 41.88 ? 128  VAL A N   1 
ATOM   560  C CA  . VAL A 1 81  ? -10.915 -6.597  -18.357 1.00 42.82 ? 128  VAL A CA  1 
ATOM   561  C C   . VAL A 1 81  ? -10.132 -7.862  -18.524 1.00 44.57 ? 128  VAL A C   1 
ATOM   562  O O   . VAL A 1 81  ? -10.461 -8.887  -17.920 1.00 45.17 ? 128  VAL A O   1 
ATOM   563  C CB  . VAL A 1 81  ? -11.905 -6.480  -19.528 1.00 42.16 ? 128  VAL A CB  1 
ATOM   564  C CG1 . VAL A 1 81  ? -12.758 -7.763  -19.657 1.00 41.98 ? 128  VAL A CG1 1 
ATOM   565  C CG2 . VAL A 1 81  ? -12.770 -5.260  -19.358 1.00 40.93 ? 128  VAL A CG2 1 
ATOM   566  N N   . HIS A 1 82  ? -9.100  -7.789  -19.357 1.00 46.58 ? 129  HIS A N   1 
ATOM   567  C CA  . HIS A 1 82  ? -8.312  -8.950  -19.698 1.00 48.09 ? 129  HIS A CA  1 
ATOM   568  C C   . HIS A 1 82  ? -7.619  -9.476  -18.446 1.00 50.15 ? 129  HIS A C   1 
ATOM   569  O O   . HIS A 1 82  ? -7.177  -8.712  -17.568 1.00 50.04 ? 129  HIS A O   1 
ATOM   570  C CB  . HIS A 1 82  ? -7.282  -8.630  -20.797 1.00 47.58 ? 129  HIS A CB  1 
ATOM   571  C CG  . HIS A 1 82  ? -6.515  -9.825  -21.258 1.00 47.99 ? 129  HIS A CG  1 
ATOM   572  N ND1 . HIS A 1 82  ? -5.287  -10.165 -20.738 1.00 48.68 ? 129  HIS A ND1 1 
ATOM   573  C CD2 . HIS A 1 82  ? -6.799  -10.766 -22.189 1.00 48.34 ? 129  HIS A CD2 1 
ATOM   574  C CE1 . HIS A 1 82  ? -4.852  -11.270 -21.318 1.00 48.06 ? 129  HIS A CE1 1 
ATOM   575  N NE2 . HIS A 1 82  ? -5.751  -11.653 -22.204 1.00 47.96 ? 129  HIS A NE2 1 
ATOM   576  N N   . SER A 1 83  ? -7.546  -10.806 -18.409 1.00 52.49 ? 130  SER A N   1 
ATOM   577  C CA  . SER A 1 83  ? -6.908  -11.598 -17.367 1.00 54.30 ? 130  SER A CA  1 
ATOM   578  C C   . SER A 1 83  ? -5.547  -11.053 -16.914 1.00 54.89 ? 130  SER A C   1 
ATOM   579  O O   . SER A 1 83  ? -5.186  -11.139 -15.746 1.00 55.46 ? 130  SER A O   1 
ATOM   580  C CB  . SER A 1 83  ? -6.774  -13.028 -17.920 1.00 55.17 ? 130  SER A CB  1 
ATOM   581  O OG  . SER A 1 83  ? -7.734  -13.229 -18.985 1.00 56.59 ? 130  SER A OG  1 
ATOM   582  N N   . ASP A 1 84  ? -4.813  -10.463 -17.846 1.00 55.63 ? 131  ASP A N   1 
ATOM   583  C CA  . ASP A 1 84  ? -3.470  -9.978  -17.602 1.00 55.70 ? 131  ASP A CA  1 
ATOM   584  C C   . ASP A 1 84  ? -3.428  -8.464  -17.483 1.00 56.01 ? 131  ASP A C   1 
ATOM   585  O O   . ASP A 1 84  ? -2.378  -7.860  -17.734 1.00 56.61 ? 131  ASP A O   1 
ATOM   586  C CB  . ASP A 1 84  ? -2.565  -10.424 -18.751 1.00 56.16 ? 131  ASP A CB  1 
ATOM   587  N N   . ALA A 1 85  ? -4.564  -7.850  -17.114 1.00 55.80 ? 132  ALA A N   1 
ATOM   588  C CA  . ALA A 1 85  ? -4.634  -6.409  -16.849 1.00 54.88 ? 132  ALA A CA  1 
ATOM   589  C C   . ALA A 1 85  ? -3.866  -6.076  -15.589 1.00 54.61 ? 132  ALA A C   1 
ATOM   590  O O   . ALA A 1 85  ? -3.875  -6.841  -14.633 1.00 54.43 ? 132  ALA A O   1 
ATOM   591  C CB  . ALA A 1 85  ? -6.084  -5.975  -16.690 1.00 54.66 ? 132  ALA A CB  1 
ATOM   592  N N   . ALA A 1 86  ? -3.211  -4.921  -15.571 1.00 54.56 ? 133  ALA A N   1 
ATOM   593  C CA  . ALA A 1 86  ? -2.651  -4.380  -14.327 1.00 54.22 ? 133  ALA A CA  1 
ATOM   594  C C   . ALA A 1 86  ? -3.797  -4.077  -13.380 1.00 53.79 ? 133  ALA A C   1 
ATOM   595  O O   . ALA A 1 86  ? -3.710  -4.274  -12.164 1.00 54.57 ? 133  ALA A O   1 
ATOM   596  C CB  . ALA A 1 86  ? -1.868  -3.104  -14.607 1.00 54.52 ? 133  ALA A CB  1 
ATOM   597  N N   . LYS A 1 87  ? -4.894  -3.641  -13.988 1.00 53.01 ? 134  LYS A N   1 
ATOM   598  C CA  . LYS A 1 87  ? -6.038  -3.079  -13.302 1.00 51.45 ? 134  LYS A CA  1 
ATOM   599  C C   . LYS A 1 87  ? -7.261  -4.014  -13.230 1.00 50.31 ? 134  LYS A C   1 
ATOM   600  O O   . LYS A 1 87  ? -8.360  -3.513  -13.191 1.00 50.94 ? 134  LYS A O   1 
ATOM   601  C CB  . LYS A 1 87  ? -6.413  -1.772  -14.022 1.00 51.42 ? 134  LYS A CB  1 
ATOM   602  C CG  . LYS A 1 87  ? -5.491  -0.564  -13.690 1.00 52.20 ? 134  LYS A CG  1 
ATOM   603  N N   . GLN A 1 88  ? -7.095  -5.344  -13.142 1.00 49.55 ? 135  GLN A N   1 
ATOM   604  C CA  . GLN A 1 88  ? -8.208  -6.250  -13.537 1.00 48.77 ? 135  GLN A CA  1 
ATOM   605  C C   . GLN A 1 88  ? -9.467  -6.094  -12.688 1.00 46.78 ? 135  GLN A C   1 
ATOM   606  O O   . GLN A 1 88  ? -9.470  -6.347  -11.475 1.00 47.62 ? 135  GLN A O   1 
ATOM   607  C CB  . GLN A 1 88  ? -7.836  -7.734  -13.625 1.00 48.42 ? 135  GLN A CB  1 
ATOM   608  C CG  . GLN A 1 88  ? -8.873  -8.484  -14.492 1.00 49.39 ? 135  GLN A CG  1 
ATOM   609  C CD  . GLN A 1 88  ? -8.821  -10.003 -14.422 1.00 49.91 ? 135  GLN A CD  1 
ATOM   610  O OE1 . GLN A 1 88  ? -9.152  -10.691 -15.399 1.00 51.89 ? 135  GLN A OE1 1 
ATOM   611  N NE2 . GLN A 1 88  ? -8.434  -10.537 -13.276 1.00 52.19 ? 135  GLN A NE2 1 
ATOM   612  N N   . ILE A 1 89  ? -10.541 -5.702  -13.353 1.00 44.26 ? 136  ILE A N   1 
ATOM   613  C CA  . ILE A 1 89  ? -11.786 -5.417  -12.687 1.00 42.11 ? 136  ILE A CA  1 
ATOM   614  C C   . ILE A 1 89  ? -12.447 -6.738  -12.269 1.00 42.14 ? 136  ILE A C   1 
ATOM   615  O O   . ILE A 1 89  ? -12.252 -7.785  -12.916 1.00 39.57 ? 136  ILE A O   1 
ATOM   616  C CB  . ILE A 1 89  ? -12.747 -4.568  -13.574 1.00 41.69 ? 136  ILE A CB  1 
ATOM   617  C CG1 . ILE A 1 89  ? -13.116 -5.311  -14.868 1.00 39.88 ? 136  ILE A CG1 1 
ATOM   618  C CG2 . ILE A 1 89  ? -12.147 -3.196  -13.853 1.00 42.64 ? 136  ILE A CG2 1 
ATOM   619  C CD1 . ILE A 1 89  ? -14.135 -4.615  -15.716 1.00 40.37 ? 136  ILE A CD1 1 
ATOM   620  N N   . ASN A 1 90  ? -13.200 -6.659  -11.166 1.00 42.13 ? 137  ASN A N   1 
ATOM   621  C CA  . ASN A 1 90  ? -13.838 -7.823  -10.546 1.00 42.39 ? 137  ASN A CA  1 
ATOM   622  C C   . ASN A 1 90  ? -15.227 -8.061  -11.124 1.00 41.27 ? 137  ASN A C   1 
ATOM   623  O O   . ASN A 1 90  ? -16.238 -7.860  -10.447 1.00 43.07 ? 137  ASN A O   1 
ATOM   624  C CB  . ASN A 1 90  ? -14.019 -7.617  -9.045  1.00 43.36 ? 137  ASN A CB  1 
ATOM   625  C CG  . ASN A 1 90  ? -12.792 -7.872  -8.248  1.00 45.03 ? 137  ASN A CG  1 
ATOM   626  O OD1 . ASN A 1 90  ? -12.170 -8.936  -8.333  1.00 48.52 ? 137  ASN A OD1 1 
ATOM   627  N ND2 . ASN A 1 90  ? -12.480 -6.915  -7.368  1.00 49.43 ? 137  ASN A ND2 1 
ATOM   628  N N   . ILE A 1 91  ? -15.291 -8.452  -12.380 1.00 39.72 ? 138  ILE A N   1 
ATOM   629  C CA  . ILE A 1 91  ? -16.546 -8.931  -12.965 1.00 37.71 ? 138  ILE A CA  1 
ATOM   630  C C   . ILE A 1 91  ? -16.445 -10.422 -12.903 1.00 36.52 ? 138  ILE A C   1 
ATOM   631  O O   . ILE A 1 91  ? -15.353 -10.957 -12.710 1.00 34.32 ? 138  ILE A O   1 
ATOM   632  C CB  . ILE A 1 91  ? -16.798 -8.454  -14.403 1.00 37.33 ? 138  ILE A CB  1 
ATOM   633  C CG1 . ILE A 1 91  ? -15.663 -8.902  -15.347 1.00 37.64 ? 138  ILE A CG1 1 
ATOM   634  C CG2 . ILE A 1 91  ? -16.973 -6.959  -14.409 1.00 38.48 ? 138  ILE A CG2 1 
ATOM   635  C CD1 . ILE A 1 91  ? -15.742 -8.249  -16.767 1.00 37.89 ? 138  ILE A CD1 1 
ATOM   636  N N   . ASP A 1 92  ? -17.596 -11.081 -13.006 1.00 35.65 ? 139  ASP A N   1 
ATOM   637  C CA  . ASP A 1 92  ? -17.651 -12.521 -12.993 1.00 35.06 ? 139  ASP A CA  1 
ATOM   638  C C   . ASP A 1 92  ? -17.167 -13.041 -14.352 1.00 35.47 ? 139  ASP A C   1 
ATOM   639  O O   . ASP A 1 92  ? -17.200 -12.341 -15.376 1.00 35.51 ? 139  ASP A O   1 
ATOM   640  C CB  . ASP A 1 92  ? -19.092 -12.989 -12.729 1.00 34.55 ? 139  ASP A CB  1 
ATOM   641  C CG  . ASP A 1 92  ? -20.033 -12.539 -13.838 1.00 33.06 ? 139  ASP A CG  1 
ATOM   642  O OD1 . ASP A 1 92  ? -20.414 -11.348 -13.870 1.00 35.58 ? 139  ASP A OD1 1 
ATOM   643  O OD2 . ASP A 1 92  ? -20.313 -13.355 -14.711 1.00 32.83 ? 139  ASP A OD2 1 
ATOM   644  N N   . PHE A 1 93  ? -16.756 -14.291 -14.328 1.00 35.51 ? 140  PHE A N   1 
ATOM   645  C CA  . PHE A 1 93  ? -16.288 -15.037 -15.471 1.00 36.65 ? 140  PHE A CA  1 
ATOM   646  C C   . PHE A 1 93  ? -17.160 -14.973 -16.733 1.00 36.48 ? 140  PHE A C   1 
ATOM   647  O O   . PHE A 1 93  ? -16.612 -14.840 -17.831 1.00 34.23 ? 140  PHE A O   1 
ATOM   648  C CB  . PHE A 1 93  ? -16.084 -16.492 -15.043 1.00 37.38 ? 140  PHE A CB  1 
ATOM   649  C CG  . PHE A 1 93  ? -15.671 -17.381 -16.126 1.00 38.14 ? 140  PHE A CG  1 
ATOM   650  C CD1 . PHE A 1 93  ? -14.366 -17.385 -16.563 1.00 40.44 ? 140  PHE A CD1 1 
ATOM   651  C CD2 . PHE A 1 93  ? -16.585 -18.246 -16.721 1.00 39.14 ? 140  PHE A CD2 1 
ATOM   652  C CE1 . PHE A 1 93  ? -13.978 -18.228 -17.598 1.00 39.83 ? 140  PHE A CE1 1 
ATOM   653  C CE2 . PHE A 1 93  ? -16.209 -19.078 -17.749 1.00 39.89 ? 140  PHE A CE2 1 
ATOM   654  C CZ  . PHE A 1 93  ? -14.900 -19.081 -18.184 1.00 40.63 ? 140  PHE A CZ  1 
ATOM   655  N N   . ARG A 1 94  ? -18.487 -15.072 -16.574 1.00 36.19 ? 141  ARG A N   1 
ATOM   656  C CA  . ARG A 1 94  ? -19.404 -15.112 -17.731 1.00 36.93 ? 141  ARG A CA  1 
ATOM   657  C C   . ARG A 1 94  ? -19.516 -13.741 -18.370 1.00 36.39 ? 141  ARG A C   1 
ATOM   658  O O   . ARG A 1 94  ? -19.537 -13.630 -19.590 1.00 36.26 ? 141  ARG A O   1 
ATOM   659  C CB  . ARG A 1 94  ? -20.813 -15.668 -17.383 1.00 36.64 ? 141  ARG A CB  1 
ATOM   660  C CG  . ARG A 1 94  ? -20.828 -17.177 -17.281 1.00 38.26 ? 141  ARG A CG  1 
ATOM   661  C CD  . ARG A 1 94  ? -22.206 -17.739 -16.904 1.00 36.92 ? 141  ARG A CD  1 
ATOM   662  N NE  . ARG A 1 94  ? -22.122 -19.158 -16.562 1.00 38.22 ? 141  ARG A NE  1 
ATOM   663  C CZ  . ARG A 1 94  ? -23.040 -19.805 -15.837 1.00 36.00 ? 141  ARG A CZ  1 
ATOM   664  N NH1 . ARG A 1 94  ? -24.110 -19.160 -15.371 1.00 32.97 ? 141  ARG A NH1 1 
ATOM   665  N NH2 . ARG A 1 94  ? -22.854 -21.080 -15.544 1.00 35.35 ? 141  ARG A NH2 1 
ATOM   666  N N   . THR A 1 95  ? -19.574 -12.705 -17.557 1.00 36.72 ? 142  THR A N   1 
ATOM   667  C CA  . THR A 1 95  ? -19.560 -11.338 -18.075 1.00 37.16 ? 142  THR A CA  1 
ATOM   668  C C   . THR A 1 95  ? -18.238 -11.016 -18.813 1.00 37.60 ? 142  THR A C   1 
ATOM   669  O O   . THR A 1 95  ? -18.239 -10.421 -19.912 1.00 35.53 ? 142  THR A O   1 
ATOM   670  C CB  . THR A 1 95  ? -19.792 -10.363 -16.967 1.00 37.70 ? 142  THR A CB  1 
ATOM   671  O OG1 . THR A 1 95  ? -21.042 -10.672 -16.376 1.00 36.81 ? 142  THR A OG1 1 
ATOM   672  C CG2 . THR A 1 95  ? -19.800 -8.910  -17.479 1.00 37.85 ? 142  THR A CG2 1 
ATOM   673  N N   . ARG A 1 96  ? -17.132 -11.480 -18.228 1.00 38.18 ? 143  ARG A N   1 
ATOM   674  C CA  . ARG A 1 96  ? -15.815 -11.350 -18.855 1.00 39.11 ? 143  ARG A CA  1 
ATOM   675  C C   . ARG A 1 96  ? -15.763 -12.043 -20.212 1.00 39.13 ? 143  ARG A C   1 
ATOM   676  O O   . ARG A 1 96  ? -15.387 -11.419 -21.196 1.00 38.37 ? 143  ARG A O   1 
ATOM   677  C CB  . ARG A 1 96  ? -14.718 -11.874 -17.922 1.00 39.43 ? 143  ARG A CB  1 
ATOM   678  C CG  . ARG A 1 96  ? -13.313 -11.382 -18.252 1.00 41.27 ? 143  ARG A CG  1 
ATOM   679  C CD  . ARG A 1 96  ? -12.255 -11.885 -17.265 1.00 42.48 ? 143  ARG A CD  1 
ATOM   680  N NE  . ARG A 1 96  ? -12.703 -11.807 -15.862 1.00 47.17 ? 143  ARG A NE  1 
ATOM   681  C CZ  . ARG A 1 96  ? -12.994 -12.866 -15.083 1.00 49.73 ? 143  ARG A CZ  1 
ATOM   682  N NH1 . ARG A 1 96  ? -12.894 -14.127 -15.514 1.00 49.65 ? 143  ARG A NH1 1 
ATOM   683  N NH2 . ARG A 1 96  ? -13.385 -12.663 -13.836 1.00 51.38 ? 143  ARG A NH2 1 
ATOM   684  N N   . GLU A 1 97  ? -16.168 -13.322 -20.268 1.00 39.30 ? 144  GLU A N   1 
ATOM   685  C CA  . GLU A 1 97  ? -16.181 -14.081 -21.511 1.00 39.71 ? 144  GLU A CA  1 
ATOM   686  C C   . GLU A 1 97  ? -17.064 -13.444 -22.592 1.00 39.51 ? 144  GLU A C   1 
ATOM   687  O O   . GLU A 1 97  ? -16.658 -13.370 -23.778 1.00 38.92 ? 144  GLU A O   1 
ATOM   688  C CB  . GLU A 1 97  ? -16.625 -15.543 -21.269 1.00 40.42 ? 144  GLU A CB  1 
ATOM   689  C CG  . GLU A 1 97  ? -15.696 -16.335 -20.335 1.00 42.36 ? 144  GLU A CG  1 
ATOM   690  C CD  . GLU A 1 97  ? -14.757 -17.305 -21.052 1.00 47.31 ? 144  GLU A CD  1 
ATOM   691  O OE1 . GLU A 1 97  ? -15.215 -18.134 -21.892 1.00 46.70 ? 144  GLU A OE1 1 
ATOM   692  O OE2 . GLU A 1 97  ? -13.544 -17.258 -20.726 1.00 51.03 ? 144  GLU A OE2 1 
ATOM   693  N N   . SER A 1 98  ? -18.264 -13.004 -22.224 1.00 38.77 ? 145  SER A N   1 
ATOM   694  C CA  . SER A 1 98  ? -19.112 -12.328 -23.218 1.00 39.79 ? 145  SER A CA  1 
ATOM   695  C C   . SER A 1 98  ? -18.551 -10.963 -23.679 1.00 39.64 ? 145  SER A C   1 
ATOM   696  O O   . SER A 1 98  ? -18.673 -10.622 -24.861 1.00 39.34 ? 145  SER A O   1 
ATOM   697  C CB  . SER A 1 98  ? -20.571 -12.204 -22.776 1.00 40.04 ? 145  SER A CB  1 
ATOM   698  O OG  . SER A 1 98  ? -20.693 -11.414 -21.646 1.00 41.80 ? 145  SER A OG  1 
ATOM   699  N N   . THR A 1 99  ? -17.937 -10.208 -22.768 1.00 39.23 ? 146  THR A N   1 
ATOM   700  C CA  . THR A 1 99  ? -17.297 -8.935  -23.128 1.00 39.30 ? 146  THR A CA  1 
ATOM   701  C C   . THR A 1 99  ? -16.148 -9.189  -24.151 1.00 39.79 ? 146  THR A C   1 
ATOM   702  O O   . THR A 1 99  ? -16.041 -8.494  -25.170 1.00 38.95 ? 146  THR A O   1 
ATOM   703  C CB  . THR A 1 99  ? -16.791 -8.192  -21.885 1.00 38.72 ? 146  THR A CB  1 
ATOM   704  O OG1 . THR A 1 99  ? -17.889 -7.858  -21.019 1.00 37.18 ? 146  THR A OG1 1 
ATOM   705  C CG2 . THR A 1 99  ? -16.025 -6.857  -22.243 1.00 39.65 ? 146  THR A CG2 1 
ATOM   706  N N   . ALA A 1 100 ? -15.323 -10.200 -23.865 1.00 40.02 ? 147  ALA A N   1 
ATOM   707  C CA  . ALA A 1 100 ? -14.221 -10.581 -24.714 1.00 40.59 ? 147  ALA A CA  1 
ATOM   708  C C   . ALA A 1 100 ? -14.693 -10.877 -26.147 1.00 41.91 ? 147  ALA A C   1 
ATOM   709  O O   . ALA A 1 100 ? -14.025 -10.535 -27.115 1.00 41.02 ? 147  ALA A O   1 
ATOM   710  C CB  . ALA A 1 100 ? -13.526 -11.776 -24.133 1.00 40.69 ? 147  ALA A CB  1 
ATOM   711  N N   . LYS A 1 101 ? -15.845 -11.529 -26.261 1.00 42.66 ? 148  LYS A N   1 
ATOM   712  C CA  . LYS A 1 101 ? -16.449 -11.824 -27.537 1.00 44.15 ? 148  LYS A CA  1 
ATOM   713  C C   . LYS A 1 101 ? -16.927 -10.559 -28.251 1.00 45.28 ? 148  LYS A C   1 
ATOM   714  O O   . LYS A 1 101 ? -16.825 -10.474 -29.479 1.00 45.87 ? 148  LYS A O   1 
ATOM   715  C CB  . LYS A 1 101 ? -17.632 -12.782 -27.368 1.00 43.93 ? 148  LYS A CB  1 
ATOM   716  C CG  . LYS A 1 101 ? -17.237 -14.238 -27.278 1.00 45.90 ? 148  LYS A CG  1 
ATOM   717  N N   . LYS A 1 102 ? -17.468 -9.593  -27.505 1.00 46.14 ? 149  LYS A N   1 
ATOM   718  C CA  . LYS A 1 102 ? -17.917 -8.329  -28.107 1.00 47.26 ? 149  LYS A CA  1 
ATOM   719  C C   . LYS A 1 102 ? -16.741 -7.488  -28.663 1.00 47.85 ? 149  LYS A C   1 
ATOM   720  O O   . LYS A 1 102 ? -16.935 -6.660  -29.559 1.00 47.77 ? 149  LYS A O   1 
ATOM   721  C CB  . LYS A 1 102 ? -18.739 -7.533  -27.102 1.00 47.34 ? 149  LYS A CB  1 
ATOM   722  C CG  . LYS A 1 102 ? -20.053 -8.226  -26.753 1.00 47.75 ? 149  LYS A CG  1 
ATOM   723  C CD  . LYS A 1 102 ? -20.766 -7.624  -25.557 1.00 48.17 ? 149  LYS A CD  1 
ATOM   724  C CE  . LYS A 1 102 ? -22.254 -8.037  -25.587 1.00 49.38 ? 149  LYS A CE  1 
ATOM   725  N NZ  . LYS A 1 102 ? -23.091 -7.247  -24.650 1.00 51.91 ? 149  LYS A NZ  1 
ATOM   726  N N   . ILE A 1 103 ? -15.531 -7.733  -28.147 1.00 48.27 ? 150  ILE A N   1 
ATOM   727  C CA  . ILE A 1 103 ? -14.347 -6.918  -28.434 1.00 48.36 ? 150  ILE A CA  1 
ATOM   728  C C   . ILE A 1 103 ? -13.944 -7.035  -29.895 1.00 48.85 ? 150  ILE A C   1 
ATOM   729  O O   . ILE A 1 103 ? -13.422 -6.089  -30.472 1.00 48.56 ? 150  ILE A O   1 
ATOM   730  C CB  . ILE A 1 103 ? -13.116 -7.350  -27.542 1.00 47.98 ? 150  ILE A CB  1 
ATOM   731  C CG1 . ILE A 1 103 ? -13.381 -7.085  -26.064 1.00 47.82 ? 150  ILE A CG1 1 
ATOM   732  C CG2 . ILE A 1 103 ? -11.813 -6.639  -27.976 1.00 48.86 ? 150  ILE A CG2 1 
ATOM   733  C CD1 . ILE A 1 103 ? -14.021 -5.749  -25.744 1.00 45.35 ? 150  ILE A CD1 1 
ATOM   734  N N   . LYS A 1 104 ? -14.181 -8.206  -30.474 1.00 49.25 ? 151  LYS A N   1 
ATOM   735  C CA  . LYS A 1 104 ? -13.734 -8.509  -31.817 1.00 49.53 ? 151  LYS A CA  1 
ATOM   736  C C   . LYS A 1 104 ? -14.569 -7.801  -32.896 1.00 49.48 ? 151  LYS A C   1 
ATOM   737  O O   . LYS A 1 104 ? -14.128 -7.713  -34.036 1.00 50.13 ? 151  LYS A O   1 
ATOM   738  C CB  . LYS A 1 104 ? -13.795 -10.022 -32.057 1.00 50.18 ? 151  LYS A CB  1 
ATOM   739  C CG  . LYS A 1 104 ? -12.953 -10.893 -31.116 1.00 50.59 ? 151  LYS A CG  1 
ATOM   740  C CD  . LYS A 1 104 ? -13.506 -12.330 -31.086 1.00 50.43 ? 151  LYS A CD  1 
ATOM   741  C CE  . LYS A 1 104 ? -12.414 -13.387 -30.919 1.00 50.76 ? 151  LYS A CE  1 
ATOM   742  N NZ  . LYS A 1 104 ? -12.218 -14.162 -32.205 1.00 51.17 ? 151  LYS A NZ  1 
ATOM   743  N N   . ALA A 1 105 ? -15.785 -7.358  -32.561 1.00 48.84 ? 152  ALA A N   1 
ATOM   744  C CA  . ALA A 1 105 ? -16.589 -6.518  -33.467 1.00 48.14 ? 152  ALA A CA  1 
ATOM   745  C C   . ALA A 1 105 ? -17.491 -5.613  -32.653 1.00 47.28 ? 152  ALA A C   1 
ATOM   746  O O   . ALA A 1 105 ? -18.697 -5.819  -32.596 1.00 47.72 ? 152  ALA A O   1 
ATOM   747  C CB  . ALA A 1 105 ? -17.409 -7.377  -34.409 1.00 48.49 ? 152  ALA A CB  1 
ATOM   748  N N   . PRO A 1 106 ? -16.901 -4.608  -31.993 1.00 45.89 ? 153  PRO A N   1 
ATOM   749  C CA  . PRO A 1 106 ? -17.594 -3.851  -30.970 1.00 44.88 ? 153  PRO A CA  1 
ATOM   750  C C   . PRO A 1 106 ? -18.590 -2.790  -31.463 1.00 43.92 ? 153  PRO A C   1 
ATOM   751  O O   . PRO A 1 106 ? -18.388 -2.182  -32.511 1.00 43.59 ? 153  PRO A O   1 
ATOM   752  C CB  . PRO A 1 106 ? -16.438 -3.189  -30.212 1.00 45.10 ? 153  PRO A CB  1 
ATOM   753  C CG  . PRO A 1 106 ? -15.405 -3.013  -31.209 1.00 44.94 ? 153  PRO A CG  1 
ATOM   754  C CD  . PRO A 1 106 ? -15.517 -4.139  -32.167 1.00 45.97 ? 153  PRO A CD  1 
ATOM   755  N N   . THR A 1 107 ? -19.645 -2.593  -30.678 1.00 42.45 ? 154  THR A N   1 
ATOM   756  C CA  . THR A 1 107 ? -20.616 -1.536  -30.880 1.00 41.73 ? 154  THR A CA  1 
ATOM   757  C C   . THR A 1 107 ? -20.547 -0.630  -29.669 1.00 41.10 ? 154  THR A C   1 
ATOM   758  O O   . THR A 1 107 ? -19.865 -0.959  -28.686 1.00 40.83 ? 154  THR A O   1 
ATOM   759  C CB  . THR A 1 107 ? -22.061 -2.099  -30.987 1.00 41.86 ? 154  THR A CB  1 
ATOM   760  O OG1 . THR A 1 107 ? -22.485 -2.585  -29.708 1.00 41.85 ? 154  THR A OG1 1 
ATOM   761  C CG2 . THR A 1 107 ? -22.138 -3.231  -32.012 1.00 42.58 ? 154  THR A CG2 1 
ATOM   762  N N   . PRO A 1 108 ? -21.265 0.511   -29.714 1.00 40.90 ? 155  PRO A N   1 
ATOM   763  C CA  . PRO A 1 108 ? -21.297 1.409   -28.564 1.00 41.11 ? 155  PRO A CA  1 
ATOM   764  C C   . PRO A 1 108 ? -21.788 0.794   -27.224 1.00 40.77 ? 155  PRO A C   1 
ATOM   765  O O   . PRO A 1 108 ? -21.577 1.383   -26.195 1.00 39.87 ? 155  PRO A O   1 
ATOM   766  C CB  . PRO A 1 108 ? -22.241 2.539   -29.025 1.00 41.01 ? 155  PRO A CB  1 
ATOM   767  C CG  . PRO A 1 108 ? -22.238 2.470   -30.521 1.00 41.02 ? 155  PRO A CG  1 
ATOM   768  C CD  . PRO A 1 108 ? -22.054 1.041   -30.854 1.00 40.89 ? 155  PRO A CD  1 
ATOM   769  N N   . THR A 1 109 ? -22.432 -0.369  -27.256 1.00 41.46 ? 156  THR A N   1 
ATOM   770  C CA  . THR A 1 109 ? -22.962 -0.992  -26.041 1.00 41.82 ? 156  THR A CA  1 
ATOM   771  C C   . THR A 1 109 ? -22.088 -2.141  -25.538 1.00 41.75 ? 156  THR A C   1 
ATOM   772  O O   . THR A 1 109 ? -22.480 -2.879  -24.622 1.00 43.01 ? 156  THR A O   1 
ATOM   773  C CB  . THR A 1 109 ? -24.353 -1.575  -26.290 1.00 41.71 ? 156  THR A CB  1 
ATOM   774  O OG1 . THR A 1 109 ? -24.260 -2.613  -27.273 1.00 42.02 ? 156  THR A OG1 1 
ATOM   775  C CG2 . THR A 1 109 ? -25.321 -0.496  -26.729 1.00 41.90 ? 156  THR A CG2 1 
ATOM   776  N N   . CYS A 1 110 ? -20.922 -2.292  -26.141 1.00 40.97 ? 157  CYS A N   1 
ATOM   777  C CA  . CYS A 1 110 ? -20.018 -3.388  -25.836 1.00 40.34 ? 157  CYS A CA  1 
ATOM   778  C C   . CYS A 1 110 ? -19.793 -3.632  -24.308 1.00 39.31 ? 157  CYS A C   1 
ATOM   779  O O   . CYS A 1 110 ? -19.814 -4.785  -23.848 1.00 38.23 ? 157  CYS A O   1 
ATOM   780  C CB  . CYS A 1 110 ? -18.671 -3.126  -26.563 1.00 40.33 ? 157  CYS A CB  1 
ATOM   781  S SG  . CYS A 1 110 ? -17.302 -4.249  -26.198 1.00 43.47 ? 157  CYS A SG  1 
ATOM   782  N N   . PHE A 1 111 ? -19.528 -2.555  -23.564 1.00 38.37 ? 158  PHE A N   1 
ATOM   783  C CA  . PHE A 1 111 ? -19.115 -2.639  -22.167 1.00 38.51 ? 158  PHE A CA  1 
ATOM   784  C C   . PHE A 1 111 ? -20.245 -2.416  -21.150 1.00 38.40 ? 158  PHE A C   1 
ATOM   785  O O   . PHE A 1 111 ? -19.960 -2.373  -19.934 1.00 37.44 ? 158  PHE A O   1 
ATOM   786  C CB  . PHE A 1 111 ? -17.969 -1.630  -21.872 1.00 37.81 ? 158  PHE A CB  1 
ATOM   787  C CG  . PHE A 1 111 ? -16.727 -1.919  -22.621 1.00 36.94 ? 158  PHE A CG  1 
ATOM   788  C CD1 . PHE A 1 111 ? -15.937 -3.013  -22.264 1.00 36.82 ? 158  PHE A CD1 1 
ATOM   789  C CD2 . PHE A 1 111 ? -16.340 -1.124  -23.698 1.00 37.11 ? 158  PHE A CD2 1 
ATOM   790  C CE1 . PHE A 1 111 ? -14.784 -3.325  -22.971 1.00 37.57 ? 158  PHE A CE1 1 
ATOM   791  C CE2 . PHE A 1 111 ? -15.206 -1.427  -24.426 1.00 35.24 ? 158  PHE A CE2 1 
ATOM   792  C CZ  . PHE A 1 111 ? -14.413 -2.505  -24.067 1.00 36.55 ? 158  PHE A CZ  1 
ATOM   793  N N   . ASP A 1 112 ? -21.483 -2.272  -21.641 1.00 38.94 ? 159  ASP A N   1 
ATOM   794  C CA  . ASP A 1 112 ? -22.669 -2.012  -20.795 1.00 40.24 ? 159  ASP A CA  1 
ATOM   795  C C   . ASP A 1 112 ? -22.861 -3.047  -19.677 1.00 39.66 ? 159  ASP A C   1 
ATOM   796  O O   . ASP A 1 112 ? -23.195 -2.694  -18.554 1.00 40.07 ? 159  ASP A O   1 
ATOM   797  C CB  . ASP A 1 112 ? -23.927 -1.994  -21.647 1.00 41.38 ? 159  ASP A CB  1 
ATOM   798  C CG  . ASP A 1 112 ? -24.082 -0.698  -22.453 1.00 44.24 ? 159  ASP A CG  1 
ATOM   799  O OD1 . ASP A 1 112 ? -23.211 0.195   -22.373 1.00 45.97 ? 159  ASP A OD1 1 
ATOM   800  O OD2 . ASP A 1 112 ? -25.106 -0.591  -23.144 1.00 47.52 ? 159  ASP A OD2 1 
ATOM   801  N N   . GLU A 1 113 ? -22.636 -4.315  -19.977 1.00 40.36 ? 160  GLU A N   1 
ATOM   802  C CA  . GLU A 1 113 ? -22.827 -5.370  -18.978 1.00 41.79 ? 160  GLU A CA  1 
ATOM   803  C C   . GLU A 1 113 ? -21.753 -5.279  -17.894 1.00 39.03 ? 160  GLU A C   1 
ATOM   804  O O   . GLU A 1 113 ? -22.040 -5.280  -16.691 1.00 37.36 ? 160  GLU A O   1 
ATOM   805  C CB  . GLU A 1 113 ? -22.829 -6.761  -19.625 1.00 41.87 ? 160  GLU A CB  1 
ATOM   806  C CG  . GLU A 1 113 ? -24.181 -7.257  -20.116 1.00 45.93 ? 160  GLU A CG  1 
ATOM   807  C CD  . GLU A 1 113 ? -24.120 -8.692  -20.644 1.00 47.29 ? 160  GLU A CD  1 
ATOM   808  O OE1 . GLU A 1 113 ? -23.270 -9.497  -20.145 1.00 55.73 ? 160  GLU A OE1 1 
ATOM   809  O OE2 . GLU A 1 113 ? -24.924 -9.019  -21.560 1.00 53.88 ? 160  GLU A OE2 1 
ATOM   810  N N   . ALA A 1 114 ? -20.501 -5.190  -18.325 1.00 38.72 ? 161  ALA A N   1 
ATOM   811  C CA  . ALA A 1 114 ? -19.382 -5.080  -17.404 1.00 37.29 ? 161  ALA A CA  1 
ATOM   812  C C   . ALA A 1 114 ? -19.458 -3.791  -16.603 1.00 37.59 ? 161  ALA A C   1 
ATOM   813  O O   . ALA A 1 114 ? -19.159 -3.768  -15.397 1.00 38.39 ? 161  ALA A O   1 
ATOM   814  C CB  . ALA A 1 114 ? -18.053 -5.200  -18.133 1.00 37.37 ? 161  ALA A CB  1 
ATOM   815  N N   . GLN A 1 115 ? -19.951 -2.742  -17.234 1.00 37.74 ? 162  GLN A N   1 
ATOM   816  C CA  . GLN A 1 115 ? -20.011 -1.423  -16.594 1.00 37.73 ? 162  GLN A CA  1 
ATOM   817  C C   . GLN A 1 115 ? -21.065 -1.487  -15.458 1.00 37.15 ? 162  GLN A C   1 
ATOM   818  O O   . GLN A 1 115 ? -20.876 -0.960  -14.383 1.00 35.52 ? 162  GLN A O   1 
ATOM   819  C CB  . GLN A 1 115 ? -20.403 -0.362  -17.593 1.00 37.12 ? 162  GLN A CB  1 
ATOM   820  C CG  . GLN A 1 115 ? -20.347 1.041   -16.977 1.00 39.64 ? 162  GLN A CG  1 
ATOM   821  C CD  . GLN A 1 115 ? -20.659 2.170   -17.943 1.00 37.66 ? 162  GLN A CD  1 
ATOM   822  O OE1 . GLN A 1 115 ? -21.220 1.956   -19.009 1.00 41.72 ? 162  GLN A OE1 1 
ATOM   823  N NE2 . GLN A 1 115 ? -20.288 3.397   -17.557 1.00 40.56 ? 162  GLN A NE2 1 
ATOM   824  N N   . LYS A 1 116 ? -22.184 -2.129  -15.759 1.00 38.24 ? 163  LYS A N   1 
ATOM   825  C CA  . LYS A 1 116 ? -23.237 -2.294  -14.794 1.00 38.25 ? 163  LYS A CA  1 
ATOM   826  C C   . LYS A 1 116 ? -22.776 -3.068  -13.574 1.00 37.63 ? 163  LYS A C   1 
ATOM   827  O O   . LYS A 1 116 ? -23.035 -2.665  -12.474 1.00 38.58 ? 163  LYS A O   1 
ATOM   828  C CB  . LYS A 1 116 ? -24.440 -2.914  -15.444 1.00 38.65 ? 163  LYS A CB  1 
ATOM   829  C CG  . LYS A 1 116 ? -25.702 -2.766  -14.589 1.00 42.38 ? 163  LYS A CG  1 
ATOM   830  N N   . VAL A 1 117 ? -22.081 -4.177  -13.765 1.00 37.62 ? 164  VAL A N   1 
ATOM   831  C CA  . VAL A 1 117 ? -21.525 -4.932  -12.666 1.00 37.14 ? 164  VAL A CA  1 
ATOM   832  C C   . VAL A 1 117 ? -20.645 -4.019  -11.799 1.00 36.92 ? 164  VAL A C   1 
ATOM   833  O O   . VAL A 1 117 ? -20.752 -3.986  -10.547 1.00 36.06 ? 164  VAL A O   1 
ATOM   834  C CB  . VAL A 1 117 ? -20.709 -6.172  -13.164 1.00 36.34 ? 164  VAL A CB  1 
ATOM   835  C CG1 . VAL A 1 117 ? -19.974 -6.866  -12.000 1.00 36.36 ? 164  VAL A CG1 1 
ATOM   836  C CG2 . VAL A 1 117 ? -21.602 -7.158  -13.859 1.00 37.83 ? 164  VAL A CG2 1 
ATOM   837  N N   . ILE A 1 118 ? -19.731 -3.307  -12.439 1.00 37.15 ? 165  ILE A N   1 
ATOM   838  C CA  . ILE A 1 118 ? -18.782 -2.474  -11.698 1.00 37.53 ? 165  ILE A CA  1 
ATOM   839  C C   . ILE A 1 118 ? -19.509 -1.317  -11.008 1.00 37.22 ? 165  ILE A C   1 
ATOM   840  O O   . ILE A 1 118 ? -19.184 -0.989  -9.904  1.00 38.45 ? 165  ILE A O   1 
ATOM   841  C CB  . ILE A 1 118 ? -17.641 -1.901  -12.617 1.00 38.04 ? 165  ILE A CB  1 
ATOM   842  C CG1 . ILE A 1 118 ? -16.757 -3.020  -13.182 1.00 37.40 ? 165  ILE A CG1 1 
ATOM   843  C CG2 . ILE A 1 118 ? -16.849 -0.834  -11.896 1.00 37.32 ? 165  ILE A CG2 1 
ATOM   844  C CD1 . ILE A 1 118 ? -16.145 -3.994  -12.170 1.00 38.49 ? 165  ILE A CD1 1 
ATOM   845  N N   . TYR A 1 119 ? -20.499 -0.725  -11.638 1.00 37.87 ? 166  TYR A N   1 
ATOM   846  C CA  . TYR A 1 119 ? -21.285 0.311   -10.969 1.00 37.83 ? 166  TYR A CA  1 
ATOM   847  C C   . TYR A 1 119 ? -21.914 -0.215  -9.694  1.00 38.24 ? 166  TYR A C   1 
ATOM   848  O O   . TYR A 1 119 ? -21.866 0.414   -8.649  1.00 37.18 ? 166  TYR A O   1 
ATOM   849  C CB  . TYR A 1 119 ? -22.374 0.782   -11.896 1.00 39.05 ? 166  TYR A CB  1 
ATOM   850  C CG  . TYR A 1 119 ? -23.118 1.955   -11.359 1.00 41.14 ? 166  TYR A CG  1 
ATOM   851  C CD1 . TYR A 1 119 ? -22.646 3.229   -11.586 1.00 43.36 ? 166  TYR A CD1 1 
ATOM   852  C CD2 . TYR A 1 119 ? -24.296 1.799   -10.601 1.00 41.54 ? 166  TYR A CD2 1 
ATOM   853  C CE1 . TYR A 1 119 ? -23.312 4.318   -11.136 1.00 42.73 ? 166  TYR A CE1 1 
ATOM   854  C CE2 . TYR A 1 119 ? -24.984 2.921   -10.118 1.00 44.29 ? 166  TYR A CE2 1 
ATOM   855  C CZ  . TYR A 1 119 ? -24.451 4.181   -10.402 1.00 45.73 ? 166  TYR A CZ  1 
ATOM   856  O OH  . TYR A 1 119 ? -25.036 5.335   -9.994  1.00 46.23 ? 166  TYR A OH  1 
ATOM   857  N N   . THR A 1 120 ? -22.498 -1.418  -9.779  1.00 38.40 ? 167  THR A N   1 
ATOM   858  C CA  . THR A 1 120 ? -23.078 -2.045  -8.595  1.00 37.50 ? 167  THR A CA  1 
ATOM   859  C C   . THR A 1 120 ? -22.055 -2.321  -7.510  1.00 37.53 ? 167  THR A C   1 
ATOM   860  O O   . THR A 1 120 ? -22.319 -2.090  -6.294  1.00 36.00 ? 167  THR A O   1 
ATOM   861  C CB  . THR A 1 120 ? -23.807 -3.330  -9.012  1.00 37.62 ? 167  THR A CB  1 
ATOM   862  O OG1 . THR A 1 120 ? -24.746 -2.996  -10.036 1.00 36.54 ? 167  THR A OG1 1 
ATOM   863  C CG2 . THR A 1 120 ? -24.501 -4.052  -7.815  1.00 37.85 ? 167  THR A CG2 1 
ATOM   864  N N   . LEU A 1 121 ? -20.890 -2.825  -7.908  1.00 37.27 ? 168  LEU A N   1 
ATOM   865  C CA  . LEU A 1 121 ? -19.850 -3.100  -6.940  1.00 39.53 ? 168  LEU A CA  1 
ATOM   866  C C   . LEU A 1 121 ? -19.471 -1.838  -6.139  1.00 39.28 ? 168  LEU A C   1 
ATOM   867  O O   . LEU A 1 121 ? -19.237 -1.887  -4.904  1.00 39.05 ? 168  LEU A O   1 
ATOM   868  C CB  . LEU A 1 121 ? -18.592 -3.682  -7.589  1.00 40.46 ? 168  LEU A CB  1 
ATOM   869  C CG  . LEU A 1 121 ? -18.418 -5.153  -7.959  1.00 44.14 ? 168  LEU A CG  1 
ATOM   870  C CD1 . LEU A 1 121 ? -16.924 -5.376  -8.265  1.00 47.30 ? 168  LEU A CD1 1 
ATOM   871  C CD2 . LEU A 1 121 ? -18.900 -6.146  -6.898  1.00 45.44 ? 168  LEU A CD2 1 
ATOM   872  N N   . MET A 1 122 ? -19.359 -0.738  -6.856  1.00 39.53 ? 169  MET A N   1 
ATOM   873  C CA  . MET A 1 122 ? -19.113 0.577   -6.227  1.00 40.61 ? 169  MET A CA  1 
ATOM   874  C C   . MET A 1 122 ? -20.327 0.994   -5.351  1.00 39.69 ? 169  MET A C   1 
ATOM   875  O O   . MET A 1 122 ? -20.195 1.334   -4.208  1.00 40.38 ? 169  MET A O   1 
ATOM   876  C CB  . MET A 1 122 ? -18.839 1.621   -7.310  1.00 39.42 ? 169  MET A CB  1 
ATOM   877  C CG  . MET A 1 122 ? -17.471 1.469   -7.990  1.00 42.90 ? 169  MET A CG  1 
ATOM   878  S SD  . MET A 1 122 ? -16.926 2.886   -9.028  1.00 41.36 ? 169  MET A SD  1 
ATOM   879  C CE  . MET A 1 122 ? -18.177 2.982   -10.246 1.00 40.89 ? 169  MET A CE  1 
ATOM   880  N N   . GLU A 1 123 ? -21.513 0.929   -5.906  1.00 41.39 ? 170  GLU A N   1 
ATOM   881  C CA  . GLU A 1 123 ? -22.717 1.373   -5.187  1.00 42.43 ? 170  GLU A CA  1 
ATOM   882  C C   . GLU A 1 123 ? -22.891 0.683   -3.858  1.00 41.52 ? 170  GLU A C   1 
ATOM   883  O O   . GLU A 1 123 ? -23.241 1.317   -2.895  1.00 41.57 ? 170  GLU A O   1 
ATOM   884  C CB  . GLU A 1 123 ? -23.948 1.207   -6.042  1.00 42.33 ? 170  GLU A CB  1 
ATOM   885  C CG  . GLU A 1 123 ? -25.161 2.004   -5.603  1.00 44.30 ? 170  GLU A CG  1 
ATOM   886  C CD  . GLU A 1 123 ? -26.303 2.024   -6.651  1.00 45.86 ? 170  GLU A CD  1 
ATOM   887  O OE1 . GLU A 1 123 ? -26.402 1.105   -7.521  1.00 50.91 ? 170  GLU A OE1 1 
ATOM   888  O OE2 . GLU A 1 123 ? -27.098 3.002   -6.641  1.00 50.42 ? 170  GLU A OE2 1 
ATOM   889  N N   . LYS A 1 124 ? -22.586 -0.605  -3.807  1.00 42.00 ? 171  LYS A N   1 
ATOM   890  C CA  . LYS A 1 124 ? -22.883 -1.431  -2.675  1.00 42.31 ? 171  LYS A CA  1 
ATOM   891  C C   . LYS A 1 124 ? -21.721 -1.605  -1.721  1.00 41.70 ? 171  LYS A C   1 
ATOM   892  O O   . LYS A 1 124 ? -21.926 -1.894  -0.579  1.00 40.69 ? 171  LYS A O   1 
ATOM   893  C CB  . LYS A 1 124 ? -23.383 -2.790  -3.141  1.00 43.54 ? 171  LYS A CB  1 
ATOM   894  C CG  . LYS A 1 124 ? -24.677 -2.699  -3.934  1.00 45.56 ? 171  LYS A CG  1 
ATOM   895  C CD  . LYS A 1 124 ? -25.715 -1.726  -3.283  1.00 48.35 ? 171  LYS A CD  1 
ATOM   896  C CE  . LYS A 1 124 ? -27.140 -2.058  -3.740  1.00 51.10 ? 171  LYS A CE  1 
ATOM   897  N NZ  . LYS A 1 124 ? -27.862 -0.887  -4.332  1.00 53.69 ? 171  LYS A NZ  1 
ATOM   898  N N   . ASP A 1 125 ? -20.505 -1.346  -2.152  1.00 41.08 ? 172  ASP A N   1 
ATOM   899  C CA  . ASP A 1 125 ? -19.349 -1.579  -1.297  1.00 41.26 ? 172  ASP A CA  1 
ATOM   900  C C   . ASP A 1 125 ? -18.526 -0.300  -1.004  1.00 40.28 ? 172  ASP A C   1 
ATOM   901  O O   . ASP A 1 125 ? -18.514 0.214   0.102   1.00 39.89 ? 172  ASP A O   1 
ATOM   902  C CB  . ASP A 1 125 ? -18.502 -2.652  -2.003  1.00 42.34 ? 172  ASP A CB  1 
ATOM   903  C CG  . ASP A 1 125 ? -17.195 -2.956  -1.295  1.00 46.25 ? 172  ASP A CG  1 
ATOM   904  O OD1 . ASP A 1 125 ? -17.166 -2.988  -0.059  1.00 50.97 ? 172  ASP A OD1 1 
ATOM   905  O OD2 . ASP A 1 125 ? -16.170 -3.140  -1.998  1.00 52.76 ? 172  ASP A OD2 1 
ATOM   906  N N   . SER A 1 126 ? -17.846 0.236   -2.004  1.00 38.90 ? 173  SER A N   1 
ATOM   907  C CA  . SER A 1 126 ? -16.875 1.293   -1.731  1.00 38.22 ? 173  SER A CA  1 
ATOM   908  C C   . SER A 1 126 ? -17.542 2.684   -1.577  1.00 37.61 ? 173  SER A C   1 
ATOM   909  O O   . SER A 1 126 ? -17.031 3.505   -0.831  1.00 38.79 ? 173  SER A O   1 
ATOM   910  C CB  . SER A 1 126 ? -15.798 1.334   -2.811  1.00 37.57 ? 173  SER A CB  1 
ATOM   911  O OG  . SER A 1 126 ? -16.375 1.545   -4.058  1.00 38.45 ? 173  SER A OG  1 
ATOM   912  N N   . TYR A 1 127 ? -18.658 2.931   -2.266  1.00 37.16 ? 174  TYR A N   1 
ATOM   913  C CA  . TYR A 1 127 ? -19.398 4.165   -2.120  1.00 37.16 ? 174  TYR A CA  1 
ATOM   914  C C   . TYR A 1 127 ? -19.905 4.403   -0.662  1.00 37.49 ? 174  TYR A C   1 
ATOM   915  O O   . TYR A 1 127 ? -19.627 5.476   -0.102  1.00 37.18 ? 174  TYR A O   1 
ATOM   916  C CB  . TYR A 1 127 ? -20.515 4.246   -3.130  1.00 36.08 ? 174  TYR A CB  1 
ATOM   917  C CG  . TYR A 1 127 ? -21.505 5.350   -2.940  1.00 36.06 ? 174  TYR A CG  1 
ATOM   918  C CD1 . TYR A 1 127 ? -21.124 6.690   -3.074  1.00 34.90 ? 174  TYR A CD1 1 
ATOM   919  C CD2 . TYR A 1 127 ? -22.840 5.068   -2.662  1.00 35.91 ? 174  TYR A CD2 1 
ATOM   920  C CE1 . TYR A 1 127 ? -22.071 7.710   -2.908  1.00 35.65 ? 174  TYR A CE1 1 
ATOM   921  C CE2 . TYR A 1 127 ? -23.760 6.054   -2.489  1.00 35.83 ? 174  TYR A CE2 1 
ATOM   922  C CZ  . TYR A 1 127 ? -23.370 7.399   -2.623  1.00 36.00 ? 174  TYR A CZ  1 
ATOM   923  O OH  . TYR A 1 127 ? -24.317 8.367   -2.450  1.00 34.06 ? 174  TYR A OH  1 
ATOM   924  N N   . PRO A 1 128 ? -20.625 3.432   -0.056  1.00 38.04 ? 175  PRO A N   1 
ATOM   925  C CA  . PRO A 1 128 ? -20.951 3.598   1.365   1.00 38.19 ? 175  PRO A CA  1 
ATOM   926  C C   . PRO A 1 128 ? -19.747 3.842   2.283   1.00 38.47 ? 175  PRO A C   1 
ATOM   927  O O   . PRO A 1 128 ? -19.837 4.674   3.173   1.00 38.17 ? 175  PRO A O   1 
ATOM   928  C CB  . PRO A 1 128 ? -21.663 2.272   1.735   1.00 39.72 ? 175  PRO A CB  1 
ATOM   929  C CG  . PRO A 1 128 ? -22.208 1.772   0.421   1.00 38.73 ? 175  PRO A CG  1 
ATOM   930  C CD  . PRO A 1 128 ? -21.280 2.245   -0.641  1.00 37.73 ? 175  PRO A CD  1 
ATOM   931  N N   . ARG A 1 129 ? -18.649 3.125   2.080   1.00 38.41 ? 176  ARG A N   1 
ATOM   932  C CA  . ARG A 1 129 ? -17.446 3.299   2.891   1.00 39.65 ? 176  ARG A CA  1 
ATOM   933  C C   . ARG A 1 129 ? -16.864 4.700   2.745   1.00 37.43 ? 176  ARG A C   1 
ATOM   934  O O   . ARG A 1 129 ? -16.445 5.307   3.730   1.00 36.62 ? 176  ARG A O   1 
ATOM   935  C CB  . ARG A 1 129 ? -16.386 2.287   2.476   1.00 40.31 ? 176  ARG A CB  1 
ATOM   936  C CG  . ARG A 1 129 ? -15.264 2.062   3.473   1.00 44.61 ? 176  ARG A CG  1 
ATOM   937  C CD  . ARG A 1 129 ? -14.574 0.712   3.277   1.00 45.16 ? 176  ARG A CD  1 
ATOM   938  N NE  . ARG A 1 129 ? -14.297 0.383   1.868   1.00 45.29 ? 176  ARG A NE  1 
ATOM   939  C CZ  . ARG A 1 129 ? -14.928 -0.558  1.178   1.00 47.37 ? 176  ARG A CZ  1 
ATOM   940  N NH1 . ARG A 1 129 ? -15.929 -1.257  1.718   1.00 51.97 ? 176  ARG A NH1 1 
ATOM   941  N NH2 . ARG A 1 129 ? -14.577 -0.799  -0.072  1.00 46.78 ? 176  ARG A NH2 1 
ATOM   942  N N   . PHE A 1 130 ? -16.836 5.190   1.508   1.00 37.40 ? 177  PHE A N   1 
ATOM   943  C CA  . PHE A 1 130 ? -16.399 6.562   1.207   1.00 36.01 ? 177  PHE A CA  1 
ATOM   944  C C   . PHE A 1 130 ? -17.191 7.614   2.008   1.00 36.52 ? 177  PHE A C   1 
ATOM   945  O O   . PHE A 1 130 ? -16.614 8.616   2.536   1.00 36.16 ? 177  PHE A O   1 
ATOM   946  C CB  . PHE A 1 130 ? -16.600 6.817   -0.262  1.00 36.41 ? 177  PHE A CB  1 
ATOM   947  C CG  . PHE A 1 130 ? -16.457 8.243   -0.654  1.00 35.93 ? 177  PHE A CG  1 
ATOM   948  C CD1 . PHE A 1 130 ? -15.211 8.874   -0.593  1.00 38.10 ? 177  PHE A CD1 1 
ATOM   949  C CD2 . PHE A 1 130 ? -17.542 8.940   -1.132  1.00 35.68 ? 177  PHE A CD2 1 
ATOM   950  C CE1 . PHE A 1 130 ? -15.080 10.189  -0.976  1.00 36.95 ? 177  PHE A CE1 1 
ATOM   951  C CE2 . PHE A 1 130 ? -17.413 10.249  -1.504  1.00 39.06 ? 177  PHE A CE2 1 
ATOM   952  C CZ  . PHE A 1 130 ? -16.176 10.874  -1.435  1.00 36.18 ? 177  PHE A CZ  1 
ATOM   953  N N   . LEU A 1 131 ? -18.504 7.394   2.091   1.00 35.79 ? 178  LEU A N   1 
ATOM   954  C CA  . LEU A 1 131 ? -19.353 8.342   2.777   1.00 36.44 ? 178  LEU A CA  1 
ATOM   955  C C   . LEU A 1 131 ? -19.105 8.354   4.253   1.00 36.63 ? 178  LEU A C   1 
ATOM   956  O O   . LEU A 1 131 ? -19.525 9.276   4.931   1.00 35.80 ? 178  LEU A O   1 
ATOM   957  C CB  . LEU A 1 131 ? -20.834 8.095   2.473   1.00 37.05 ? 178  LEU A CB  1 
ATOM   958  C CG  . LEU A 1 131 ? -21.314 8.247   1.029   1.00 36.97 ? 178  LEU A CG  1 
ATOM   959  C CD1 . LEU A 1 131 ? -22.748 7.839   0.910   1.00 36.08 ? 178  LEU A CD1 1 
ATOM   960  C CD2 . LEU A 1 131 ? -21.126 9.694   0.557   1.00 37.30 ? 178  LEU A CD2 1 
ATOM   961  N N   . LYS A 1 132 ? -18.435 7.312   4.766   1.00 38.40 ? 179  LYS A N   1 
ATOM   962  C CA  . LYS A 1 132 ? -17.979 7.287   6.156   1.00 37.84 ? 179  LYS A CA  1 
ATOM   963  C C   . LYS A 1 132 ? -16.493 7.584   6.323   1.00 38.22 ? 179  LYS A C   1 
ATOM   964  O O   . LYS A 1 132 ? -15.974 7.469   7.432   1.00 37.18 ? 179  LYS A O   1 
ATOM   965  C CB  . LYS A 1 132 ? -18.320 5.947   6.832   1.00 38.89 ? 179  LYS A CB  1 
ATOM   966  C CG  . LYS A 1 132 ? -19.820 5.698   6.960   1.00 37.63 ? 179  LYS A CG  1 
ATOM   967  C CD  . LYS A 1 132 ? -20.133 4.270   7.396   1.00 38.89 ? 179  LYS A CD  1 
ATOM   968  N N   . SER A 1 133 ? -15.814 7.975   5.248   1.00 37.71 ? 180  SER A N   1 
ATOM   969  C CA  . SER A 1 133 ? -14.363 8.266   5.307   1.00 37.68 ? 180  SER A CA  1 
ATOM   970  C C   . SER A 1 133 ? -14.056 9.654   5.820   1.00 37.39 ? 180  SER A C   1 
ATOM   971  O O   . SER A 1 133 ? -14.875 10.545  5.751   1.00 36.77 ? 180  SER A O   1 
ATOM   972  C CB  . SER A 1 133 ? -13.707 8.088   3.930   1.00 38.03 ? 180  SER A CB  1 
ATOM   973  O OG  . SER A 1 133 ? -14.169 9.028   2.974   1.00 35.44 ? 180  SER A OG  1 
ATOM   974  N N   . ASP A 1 134 ? -12.833 9.830   6.271   1.00 37.61 ? 181  ASP A N   1 
ATOM   975  C CA  . ASP A 1 134 ? -12.335 11.136  6.654   1.00 39.32 ? 181  ASP A CA  1 
ATOM   976  C C   . ASP A 1 134 ? -12.325 12.088  5.487   1.00 39.20 ? 181  ASP A C   1 
ATOM   977  O O   . ASP A 1 134 ? -12.695 13.229  5.665   1.00 38.30 ? 181  ASP A O   1 
ATOM   978  C CB  . ASP A 1 134 ? -10.941 11.027  7.260   1.00 39.23 ? 181  ASP A CB  1 
ATOM   979  C CG  . ASP A 1 134 ? -10.982 10.581  8.711   1.00 43.53 ? 181  ASP A CG  1 
ATOM   980  O OD1 . ASP A 1 134 ? -12.102 10.496  9.296   1.00 46.74 ? 181  ASP A OD1 1 
ATOM   981  O OD2 . ASP A 1 134 ? -9.901  10.316  9.260   1.00 45.95 ? 181  ASP A OD2 1 
ATOM   982  N N   . ILE A 1 135 ? -11.959 11.578  4.303   1.00 39.89 ? 182  ILE A N   1 
ATOM   983  C CA  . ILE A 1 135 ? -11.902 12.356  3.092   1.00 40.83 ? 182  ILE A CA  1 
ATOM   984  C C   . ILE A 1 135 ? -13.220 13.075  2.916   1.00 40.00 ? 182  ILE A C   1 
ATOM   985  O O   . ILE A 1 135 ? -13.253 14.312  2.883   1.00 41.22 ? 182  ILE A O   1 
ATOM   986  C CB  . ILE A 1 135 ? -11.551 11.467  1.810   1.00 40.94 ? 182  ILE A CB  1 
ATOM   987  C CG1 . ILE A 1 135 ? -10.050 11.222  1.772   1.00 43.88 ? 182  ILE A CG1 1 
ATOM   988  C CG2 . ILE A 1 135 ? -11.907 12.227  0.521   1.00 43.35 ? 182  ILE A CG2 1 
ATOM   989  C CD1 . ILE A 1 135 ? -9.513  10.530  0.481   1.00 43.34 ? 182  ILE A CD1 1 
ATOM   990  N N   . TYR A 1 136 ? -14.301 12.293  2.818   1.00 38.58 ? 183  TYR A N   1 
ATOM   991  C CA  . TYR A 1 136 ? -15.634 12.833  2.641   1.00 37.53 ? 183  TYR A CA  1 
ATOM   992  C C   . TYR A 1 136 ? -16.104 13.713  3.813   1.00 36.48 ? 183  TYR A C   1 
ATOM   993  O O   . TYR A 1 136 ? -16.512 14.842  3.608   1.00 36.63 ? 183  TYR A O   1 
ATOM   994  C CB  . TYR A 1 136 ? -16.634 11.705  2.343   1.00 37.01 ? 183  TYR A CB  1 
ATOM   995  C CG  . TYR A 1 136 ? -18.028 12.224  2.102   1.00 36.69 ? 183  TYR A CG  1 
ATOM   996  C CD1 . TYR A 1 136 ? -18.356 12.876  0.916   1.00 35.42 ? 183  TYR A CD1 1 
ATOM   997  C CD2 . TYR A 1 136 ? -19.012 12.092  3.079   1.00 34.55 ? 183  TYR A CD2 1 
ATOM   998  C CE1 . TYR A 1 136 ? -19.627 13.395  0.729   1.00 36.55 ? 183  TYR A CE1 1 
ATOM   999  C CE2 . TYR A 1 136 ? -20.260 12.596  2.900   1.00 35.26 ? 183  TYR A CE2 1 
ATOM   1000 C CZ  . TYR A 1 136 ? -20.580 13.231  1.724   1.00 35.40 ? 183  TYR A CZ  1 
ATOM   1001 O OH  . TYR A 1 136 ? -21.822 13.740  1.532   1.00 34.71 ? 183  TYR A OH  1 
ATOM   1002 N N   . LEU A 1 137 ? -16.029 13.189  5.034   1.00 36.92 ? 184  LEU A N   1 
ATOM   1003 C CA  . LEU A 1 137 ? -16.623 13.860  6.190   1.00 37.02 ? 184  LEU A CA  1 
ATOM   1004 C C   . LEU A 1 137 ? -15.874 15.145  6.564   1.00 37.21 ? 184  LEU A C   1 
ATOM   1005 O O   . LEU A 1 137 ? -16.518 16.153  6.856   1.00 36.65 ? 184  LEU A O   1 
ATOM   1006 C CB  . LEU A 1 137 ? -16.738 12.877  7.361   1.00 36.81 ? 184  LEU A CB  1 
ATOM   1007 C CG  . LEU A 1 137 ? -17.737 11.723  7.120   1.00 37.09 ? 184  LEU A CG  1 
ATOM   1008 C CD1 . LEU A 1 137 ? -17.675 10.650  8.150   1.00 37.56 ? 184  LEU A CD1 1 
ATOM   1009 C CD2 . LEU A 1 137 ? -19.135 12.273  7.031   1.00 37.41 ? 184  LEU A CD2 1 
ATOM   1010 N N   . ASN A 1 138 ? -14.538 15.138  6.481   1.00 36.11 ? 185  ASN A N   1 
ATOM   1011 C CA  . ASN A 1 138 ? -13.741 16.392  6.612   1.00 36.69 ? 185  ASN A CA  1 
ATOM   1012 C C   . ASN A 1 138 ? -14.127 17.424  5.586   1.00 36.02 ? 185  ASN A C   1 
ATOM   1013 O O   . ASN A 1 138 ? -14.403 18.562  5.937   1.00 34.77 ? 185  ASN A O   1 
ATOM   1014 C CB  . ASN A 1 138 ? -12.204 16.129  6.584   1.00 36.73 ? 185  ASN A CB  1 
ATOM   1015 C CG  . ASN A 1 138 ? -11.693 15.383  7.859   1.00 38.90 ? 185  ASN A CG  1 
ATOM   1016 O OD1 . ASN A 1 138 ? -12.389 15.325  8.856   1.00 38.13 ? 185  ASN A OD1 1 
ATOM   1017 N ND2 . ASN A 1 138 ? -10.492 14.822  7.797   1.00 36.33 ? 185  ASN A ND2 1 
ATOM   1018 N N   . LEU A 1 139 ? -14.166 17.033  4.311   1.00 37.24 ? 186  LEU A N   1 
ATOM   1019 C CA  . LEU A 1 139 ? -14.527 17.966  3.241   1.00 37.54 ? 186  LEU A CA  1 
ATOM   1020 C C   . LEU A 1 139 ? -15.872 18.614  3.549   1.00 38.57 ? 186  LEU A C   1 
ATOM   1021 O O   . LEU A 1 139 ? -16.011 19.827  3.539   1.00 36.49 ? 186  LEU A O   1 
ATOM   1022 C CB  . LEU A 1 139 ? -14.587 17.263  1.885   1.00 36.94 ? 186  LEU A CB  1 
ATOM   1023 C CG  . LEU A 1 139 ? -14.827 18.133  0.657   1.00 37.70 ? 186  LEU A CG  1 
ATOM   1024 C CD1 . LEU A 1 139 ? -13.603 19.126  0.408   1.00 37.49 ? 186  LEU A CD1 1 
ATOM   1025 C CD2 . LEU A 1 139 ? -15.127 17.340  -0.594  1.00 37.97 ? 186  LEU A CD2 1 
ATOM   1026 N N   . LEU A 1 140 ? -16.851 17.767  3.855   1.00 40.12 ? 187  LEU A N   1 
ATOM   1027 C CA  . LEU A 1 140 ? -18.216 18.202  4.146   1.00 40.97 ? 187  LEU A CA  1 
ATOM   1028 C C   . LEU A 1 140 ? -18.283 19.194  5.306   1.00 40.97 ? 187  LEU A C   1 
ATOM   1029 O O   . LEU A 1 140 ? -18.842 20.282  5.161   1.00 40.80 ? 187  LEU A O   1 
ATOM   1030 C CB  . LEU A 1 140 ? -19.082 16.965  4.438   1.00 41.26 ? 187  LEU A CB  1 
ATOM   1031 C CG  . LEU A 1 140 ? -20.537 17.163  4.812   1.00 42.51 ? 187  LEU A CG  1 
ATOM   1032 C CD1 . LEU A 1 140 ? -21.282 18.076  3.813   1.00 43.11 ? 187  LEU A CD1 1 
ATOM   1033 C CD2 . LEU A 1 140 ? -21.237 15.811  4.966   1.00 42.15 ? 187  LEU A CD2 1 
ATOM   1034 N N   . ASN A 1 141 ? -17.688 18.824  6.436   1.00 41.85 ? 188  ASN A N   1 
ATOM   1035 C CA  . ASN A 1 141 ? -17.812 19.607  7.656   1.00 43.41 ? 188  ASN A CA  1 
ATOM   1036 C C   . ASN A 1 141 ? -17.026 20.908  7.620   1.00 43.16 ? 188  ASN A C   1 
ATOM   1037 O O   . ASN A 1 141 ? -17.526 21.953  8.027   1.00 42.56 ? 188  ASN A O   1 
ATOM   1038 C CB  . ASN A 1 141 ? -17.440 18.739  8.862   1.00 44.45 ? 188  ASN A CB  1 
ATOM   1039 C CG  . ASN A 1 141 ? -18.611 17.825  9.273   1.00 48.17 ? 188  ASN A CG  1 
ATOM   1040 O OD1 . ASN A 1 141 ? -19.491 18.247  10.039  1.00 51.49 ? 188  ASN A OD1 1 
ATOM   1041 N ND2 . ASN A 1 141 ? -18.660 16.617  8.717   1.00 46.76 ? 188  ASN A ND2 1 
ATOM   1042 N N   . ASP A 1 142 ? -15.815 20.848  7.083   1.00 42.24 ? 189  ASP A N   1 
ATOM   1043 C CA  . ASP A 1 142 ? -14.939 22.023  7.036   1.00 42.15 ? 189  ASP A CA  1 
ATOM   1044 C C   . ASP A 1 142 ? -15.435 23.088  6.043   1.00 41.66 ? 189  ASP A C   1 
ATOM   1045 O O   . ASP A 1 142 ? -15.012 24.247  6.110   1.00 41.23 ? 189  ASP A O   1 
ATOM   1046 C CB  . ASP A 1 142 ? -13.502 21.569  6.753   1.00 41.79 ? 189  ASP A CB  1 
ATOM   1047 C CG  . ASP A 1 142 ? -12.936 20.690  7.876   1.00 43.27 ? 189  ASP A CG  1 
ATOM   1048 O OD1 . ASP A 1 142 ? -13.596 20.598  8.935   1.00 43.91 ? 189  ASP A OD1 1 
ATOM   1049 O OD2 . ASP A 1 142 ? -11.842 20.086  7.734   1.00 42.21 ? 189  ASP A OD2 1 
ATOM   1050 N N   . LEU A 1 143 ? -16.324 22.704  5.125   1.00 42.06 ? 190  LEU A N   1 
ATOM   1051 C CA  . LEU A 1 143 ? -17.020 23.675  4.260   1.00 42.74 ? 190  LEU A CA  1 
ATOM   1052 C C   . LEU A 1 143 ? -18.077 24.496  5.024   1.00 43.21 ? 190  LEU A C   1 
ATOM   1053 O O   . LEU A 1 143 ? -18.502 25.535  4.559   1.00 42.63 ? 190  LEU A O   1 
ATOM   1054 C CB  . LEU A 1 143 ? -17.691 22.977  3.081   1.00 42.86 ? 190  LEU A CB  1 
ATOM   1055 C CG  . LEU A 1 143 ? -16.797 22.684  1.877   1.00 44.58 ? 190  LEU A CG  1 
ATOM   1056 C CD1 . LEU A 1 143 ? -17.469 21.653  0.977   1.00 46.40 ? 190  LEU A CD1 1 
ATOM   1057 C CD2 . LEU A 1 143 ? -16.490 23.960  1.087   1.00 46.68 ? 190  LEU A CD2 1 
ATOM   1058 N N   . GLN A 1 144 ? -18.495 23.982  6.177   1.00 44.54 ? 191  GLN A N   1 
ATOM   1059 C CA  . GLN A 1 144 ? -19.494 24.606  7.045   1.00 46.06 ? 191  GLN A CA  1 
ATOM   1060 C C   . GLN A 1 144 ? -18.844 25.116  8.297   1.00 45.95 ? 191  GLN A C   1 
ATOM   1061 O O   . GLN A 1 144 ? -18.173 26.116  8.219   1.00 48.67 ? 191  GLN A O   1 
ATOM   1062 C CB  . GLN A 1 144 ? -20.530 23.584  7.456   1.00 45.59 ? 191  GLN A CB  1 
ATOM   1063 C CG  . GLN A 1 144 ? -20.987 22.740  6.311   1.00 46.93 ? 191  GLN A CG  1 
ATOM   1064 C CD  . GLN A 1 144 ? -21.916 21.667  6.752   1.00 46.36 ? 191  GLN A CD  1 
ATOM   1065 O OE1 . GLN A 1 144 ? -22.932 21.946  7.401   1.00 50.70 ? 191  GLN A OE1 1 
ATOM   1066 N NE2 . GLN A 1 144 ? -21.595 20.437  6.418   1.00 46.25 ? 191  GLN A NE2 1 
ATOM   1067 N N   . ASP B 1 12  ? -21.551 28.511  3.221   1.00 35.37 ? 59   ASP B N   1 
ATOM   1068 C CA  . ASP B 1 12  ? -20.876 27.193  3.364   1.00 36.09 ? 59   ASP B CA  1 
ATOM   1069 C C   . ASP B 1 12  ? -20.312 26.827  1.985   1.00 36.23 ? 59   ASP B C   1 
ATOM   1070 O O   . ASP B 1 12  ? -20.746 25.838  1.370   1.00 35.69 ? 59   ASP B O   1 
ATOM   1071 C CB  . ASP B 1 12  ? -21.860 26.109  3.825   1.00 35.78 ? 59   ASP B CB  1 
ATOM   1072 C CG  . ASP B 1 12  ? -22.398 26.323  5.259   1.00 36.86 ? 59   ASP B CG  1 
ATOM   1073 O OD1 . ASP B 1 12  ? -21.699 26.906  6.135   1.00 33.95 ? 59   ASP B OD1 1 
ATOM   1074 O OD2 . ASP B 1 12  ? -23.533 25.844  5.499   1.00 35.06 ? 59   ASP B OD2 1 
ATOM   1075 N N   . VAL B 1 13  ? -19.364 27.637  1.496   1.00 35.71 ? 60   VAL B N   1 
ATOM   1076 C CA  . VAL B 1 13  ? -18.895 27.558  0.095   1.00 36.36 ? 60   VAL B CA  1 
ATOM   1077 C C   . VAL B 1 13  ? -17.399 27.797  -0.056  1.00 36.86 ? 60   VAL B C   1 
ATOM   1078 O O   . VAL B 1 13  ? -16.761 28.408  0.786   1.00 38.17 ? 60   VAL B O   1 
ATOM   1079 C CB  . VAL B 1 13  ? -19.629 28.553  -0.892  1.00 36.38 ? 60   VAL B CB  1 
ATOM   1080 C CG1 . VAL B 1 13  ? -21.110 28.208  -1.039  1.00 37.06 ? 60   VAL B CG1 1 
ATOM   1081 C CG2 . VAL B 1 13  ? -19.460 30.065  -0.475  1.00 37.07 ? 60   VAL B CG2 1 
ATOM   1082 N N   . LEU B 1 14  ? -16.869 27.303  -1.163  1.00 35.84 ? 61   LEU B N   1 
ATOM   1083 C CA  . LEU B 1 14  ? -15.524 27.564  -1.574  1.00 35.77 ? 61   LEU B CA  1 
ATOM   1084 C C   . LEU B 1 14  ? -15.607 28.410  -2.842  1.00 35.94 ? 61   LEU B C   1 
ATOM   1085 O O   . LEU B 1 14  ? -16.309 28.031  -3.784  1.00 35.11 ? 61   LEU B O   1 
ATOM   1086 C CB  . LEU B 1 14  ? -14.833 26.233  -1.850  1.00 35.18 ? 61   LEU B CB  1 
ATOM   1087 C CG  . LEU B 1 14  ? -13.380 26.289  -2.384  1.00 36.89 ? 61   LEU B CG  1 
ATOM   1088 C CD1 . LEU B 1 14  ? -12.401 26.928  -1.387  1.00 38.36 ? 61   LEU B CD1 1 
ATOM   1089 C CD2 . LEU B 1 14  ? -12.973 24.893  -2.735  1.00 35.78 ? 61   LEU B CD2 1 
ATOM   1090 N N   . SER B 1 15  ? -14.918 29.571  -2.832  1.00 35.83 ? 62   SER B N   1 
ATOM   1091 C CA  . SER B 1 15  ? -14.808 30.448  -3.989  1.00 35.14 ? 62   SER B CA  1 
ATOM   1092 C C   . SER B 1 15  ? -13.609 30.099  -4.902  1.00 35.15 ? 62   SER B C   1 
ATOM   1093 O O   . SER B 1 15  ? -12.584 29.542  -4.481  1.00 31.84 ? 62   SER B O   1 
ATOM   1094 C CB  . SER B 1 15  ? -14.656 31.922  -3.528  1.00 35.80 ? 62   SER B CB  1 
ATOM   1095 O OG  . SER B 1 15  ? -13.356 32.084  -2.998  1.00 35.03 ? 62   SER B OG  1 
ATOM   1096 N N   . ALA B 1 16  ? -13.763 30.454  -6.183  1.00 35.55 ? 63   ALA B N   1 
ATOM   1097 C CA  . ALA B 1 16  ? -12.704 30.269  -7.142  1.00 35.77 ? 63   ALA B CA  1 
ATOM   1098 C C   . ALA B 1 16  ? -11.473 31.060  -6.682  1.00 34.33 ? 63   ALA B C   1 
ATOM   1099 O O   . ALA B 1 16  ? -10.379 30.568  -6.737  1.00 32.32 ? 63   ALA B O   1 
ATOM   1100 C CB  . ALA B 1 16  ? -13.180 30.676  -8.561  1.00 36.40 ? 63   ALA B CB  1 
ATOM   1101 N N   . ALA B 1 17  ? -11.673 32.235  -6.101  1.00 35.75 ? 64   ALA B N   1 
ATOM   1102 C CA  . ALA B 1 17  ? -10.530 33.086  -5.710  1.00 35.93 ? 64   ALA B CA  1 
ATOM   1103 C C   . ALA B 1 17  ? -9.728  32.398  -4.592  1.00 36.86 ? 64   ALA B C   1 
ATOM   1104 O O   . ALA B 1 17  ? -8.484  32.396  -4.591  1.00 33.55 ? 64   ALA B O   1 
ATOM   1105 C CB  . ALA B 1 17  ? -10.997 34.483  -5.330  1.00 36.15 ? 64   ALA B CB  1 
ATOM   1106 N N   . GLU B 1 18  ? -10.422 31.711  -3.682  1.00 38.05 ? 65   GLU B N   1 
ATOM   1107 C CA  . GLU B 1 18  ? -9.698  31.009  -2.602  1.00 38.47 ? 65   GLU B CA  1 
ATOM   1108 C C   . GLU B 1 18  ? -8.815  29.883  -3.153  1.00 38.13 ? 65   GLU B C   1 
ATOM   1109 O O   . GLU B 1 18  ? -7.625  29.775  -2.799  1.00 38.64 ? 65   GLU B O   1 
ATOM   1110 C CB  . GLU B 1 18  ? -10.650 30.456  -1.528  1.00 38.87 ? 65   GLU B CB  1 
ATOM   1111 C CG  . GLU B 1 18  ? -9.907  29.650  -0.440  1.00 40.75 ? 65   GLU B CG  1 
ATOM   1112 C CD  . GLU B 1 18  ? -8.812  30.474  0.239   1.00 46.17 ? 65   GLU B CD  1 
ATOM   1113 O OE1 . GLU B 1 18  ? -9.119  31.647  0.517   1.00 51.06 ? 65   GLU B OE1 1 
ATOM   1114 O OE2 . GLU B 1 18  ? -7.673  29.980  0.476   1.00 47.17 ? 65   GLU B OE2 1 
ATOM   1115 N N   . VAL B 1 19  ? -9.406  29.044  -3.996  1.00 37.84 ? 66   VAL B N   1 
ATOM   1116 C CA  . VAL B 1 19  ? -8.683  27.989  -4.695  1.00 38.56 ? 66   VAL B CA  1 
ATOM   1117 C C   . VAL B 1 19  ? -7.509  28.579  -5.483  1.00 38.59 ? 66   VAL B C   1 
ATOM   1118 O O   . VAL B 1 19  ? -6.443  28.040  -5.400  1.00 37.54 ? 66   VAL B O   1 
ATOM   1119 C CB  . VAL B 1 19  ? -9.616  27.196  -5.652  1.00 38.04 ? 66   VAL B CB  1 
ATOM   1120 C CG1 . VAL B 1 19  ? -8.850  26.156  -6.468  1.00 37.23 ? 66   VAL B CG1 1 
ATOM   1121 C CG2 . VAL B 1 19  ? -10.710 26.507  -4.861  1.00 39.20 ? 66   VAL B CG2 1 
ATOM   1122 N N   . MET B 1 20  ? -7.723  29.674  -6.230  1.00 39.45 ? 67   MET B N   1 
ATOM   1123 C CA  . MET B 1 20  ? -6.592  30.387  -6.883  1.00 41.15 ? 67   MET B CA  1 
ATOM   1124 C C   . MET B 1 20  ? -5.459  30.700  -5.902  1.00 41.35 ? 67   MET B C   1 
ATOM   1125 O O   . MET B 1 20  ? -4.312  30.460  -6.237  1.00 42.74 ? 67   MET B O   1 
ATOM   1126 C CB  . MET B 1 20  ? -7.024  31.664  -7.604  1.00 41.00 ? 67   MET B CB  1 
ATOM   1127 C CG  . MET B 1 20  ? -7.951  31.497  -8.823  1.00 42.44 ? 67   MET B CG  1 
ATOM   1128 S SD  . MET B 1 20  ? -8.477  33.067  -9.602  1.00 45.93 ? 67   MET B SD  1 
ATOM   1129 C CE  . MET B 1 20  ? -7.235  34.214  -8.984  1.00 46.48 ? 67   MET B CE  1 
ATOM   1130 N N   . GLN B 1 21  ? -5.763  31.215  -4.700  1.00 41.09 ? 68   GLN B N   1 
ATOM   1131 C CA  . GLN B 1 21  ? -4.723  31.537  -3.687  1.00 41.09 ? 68   GLN B CA  1 
ATOM   1132 C C   . GLN B 1 21  ? -3.819  30.394  -3.218  1.00 41.21 ? 68   GLN B C   1 
ATOM   1133 O O   . GLN B 1 21  ? -2.695  30.613  -2.762  1.00 40.07 ? 68   GLN B O   1 
ATOM   1134 C CB  . GLN B 1 21  ? -5.379  32.183  -2.471  1.00 41.81 ? 68   GLN B CB  1 
ATOM   1135 C CG  . GLN B 1 21  ? -6.134  33.415  -2.920  1.00 44.60 ? 68   GLN B CG  1 
ATOM   1136 C CD  . GLN B 1 21  ? -6.120  34.527  -1.977  1.00 49.48 ? 68   GLN B CD  1 
ATOM   1137 O OE1 . GLN B 1 21  ? -5.067  34.897  -1.414  1.00 52.90 ? 68   GLN B OE1 1 
ATOM   1138 N NE2 . GLN B 1 21  ? -7.286  35.136  -1.814  1.00 51.22 ? 68   GLN B NE2 1 
ATOM   1139 N N   . TRP B 1 22  ? -4.316  29.163  -3.327  1.00 40.83 ? 69   TRP B N   1 
ATOM   1140 C CA  . TRP B 1 22  ? -3.549  27.983  -2.959  1.00 40.31 ? 69   TRP B CA  1 
ATOM   1141 C C   . TRP B 1 22  ? -2.314  27.816  -3.823  1.00 40.30 ? 69   TRP B C   1 
ATOM   1142 O O   . TRP B 1 22  ? -1.350  27.190  -3.377  1.00 41.65 ? 69   TRP B O   1 
ATOM   1143 C CB  . TRP B 1 22  ? -4.434  26.696  -3.060  1.00 40.55 ? 69   TRP B CB  1 
ATOM   1144 C CG  . TRP B 1 22  ? -5.657  26.695  -2.210  1.00 39.51 ? 69   TRP B CG  1 
ATOM   1145 C CD1 . TRP B 1 22  ? -5.954  27.548  -1.182  1.00 39.45 ? 69   TRP B CD1 1 
ATOM   1146 C CD2 . TRP B 1 22  ? -6.762  25.768  -2.283  1.00 38.96 ? 69   TRP B CD2 1 
ATOM   1147 N NE1 . TRP B 1 22  ? -7.176  27.228  -0.653  1.00 39.83 ? 69   TRP B NE1 1 
ATOM   1148 C CE2 . TRP B 1 22  ? -7.693  26.152  -1.311  1.00 39.10 ? 69   TRP B CE2 1 
ATOM   1149 C CE3 . TRP B 1 22  ? -7.048  24.660  -3.083  1.00 38.34 ? 69   TRP B CE3 1 
ATOM   1150 C CZ2 . TRP B 1 22  ? -8.919  25.463  -1.114  1.00 41.79 ? 69   TRP B CZ2 1 
ATOM   1151 C CZ3 . TRP B 1 22  ? -8.272  23.974  -2.880  1.00 39.05 ? 69   TRP B CZ3 1 
ATOM   1152 C CH2 . TRP B 1 22  ? -9.178  24.393  -1.925  1.00 38.83 ? 69   TRP B CH2 1 
ATOM   1153 N N   . SER B 1 23  ? -2.379  28.335  -5.059  1.00 41.01 ? 70   SER B N   1 
ATOM   1154 C CA  . SER B 1 23  ? -1.290  28.392  -6.032  1.00 42.07 ? 70   SER B CA  1 
ATOM   1155 C C   . SER B 1 23  ? -0.120  29.292  -5.611  1.00 42.27 ? 70   SER B C   1 
ATOM   1156 O O   . SER B 1 23  ? 0.962   29.184  -6.192  1.00 42.74 ? 70   SER B O   1 
ATOM   1157 C CB  . SER B 1 23  ? -1.784  28.917  -7.413  1.00 42.67 ? 70   SER B CB  1 
ATOM   1158 O OG  . SER B 1 23  ? -2.404  27.900  -8.258  1.00 46.36 ? 70   SER B OG  1 
ATOM   1159 N N   . GLN B 1 24  ? -0.325  30.149  -4.611  1.00 41.86 ? 71   GLN B N   1 
ATOM   1160 C CA  . GLN B 1 24  ? 0.640   31.198  -4.261  1.00 42.05 ? 71   GLN B CA  1 
ATOM   1161 C C   . GLN B 1 24  ? 1.724   30.733  -3.328  1.00 41.73 ? 71   GLN B C   1 
ATOM   1162 O O   . GLN B 1 24  ? 2.836   31.180  -3.415  1.00 40.66 ? 71   GLN B O   1 
ATOM   1163 C CB  . GLN B 1 24  ? -0.099  32.358  -3.622  1.00 42.17 ? 71   GLN B CB  1 
ATOM   1164 C CG  . GLN B 1 24  ? -0.944  33.115  -4.632  1.00 44.53 ? 71   GLN B CG  1 
ATOM   1165 C CD  . GLN B 1 24  ? -1.560  34.320  -4.011  1.00 47.10 ? 71   GLN B CD  1 
ATOM   1166 O OE1 . GLN B 1 24  ? -2.469  34.199  -3.194  1.00 51.36 ? 71   GLN B OE1 1 
ATOM   1167 N NE2 . GLN B 1 24  ? -1.058  35.492  -4.361  1.00 45.99 ? 71   GLN B NE2 1 
ATOM   1168 N N   . SER B 1 25  ? 1.366   29.871  -2.384  1.00 41.07 ? 72   SER B N   1 
ATOM   1169 C CA  . SER B 1 25  ? 2.338   29.171  -1.564  1.00 40.19 ? 72   SER B CA  1 
ATOM   1170 C C   . SER B 1 25  ? 1.630   27.993  -0.905  1.00 39.89 ? 72   SER B C   1 
ATOM   1171 O O   . SER B 1 25  ? 0.395   28.012  -0.752  1.00 38.72 ? 72   SER B O   1 
ATOM   1172 C CB  . SER B 1 25  ? 2.953   30.066  -0.503  1.00 40.59 ? 72   SER B CB  1 
ATOM   1173 O OG  . SER B 1 25  ? 1.981   30.474  0.445   1.00 40.97 ? 72   SER B OG  1 
ATOM   1174 N N   . LEU B 1 26  ? 2.422   26.990  -0.534  1.00 39.71 ? 73   LEU B N   1 
ATOM   1175 C CA  . LEU B 1 26  ? 1.960   25.877  0.302   1.00 39.68 ? 73   LEU B CA  1 
ATOM   1176 C C   . LEU B 1 26  ? 1.422   26.438  1.626   1.00 40.05 ? 73   LEU B C   1 
ATOM   1177 O O   . LEU B 1 26  ? 0.418   25.976  2.162   1.00 37.99 ? 73   LEU B O   1 
ATOM   1178 C CB  . LEU B 1 26  ? 3.086   24.892  0.572   1.00 38.69 ? 73   LEU B CB  1 
ATOM   1179 C CG  . LEU B 1 26  ? 2.715   23.691  1.481   1.00 39.76 ? 73   LEU B CG  1 
ATOM   1180 C CD1 . LEU B 1 26  ? 1.596   22.837  0.876   1.00 39.11 ? 73   LEU B CD1 1 
ATOM   1181 C CD2 . LEU B 1 26  ? 3.894   22.823  1.845   1.00 39.38 ? 73   LEU B CD2 1 
ATOM   1182 N N   . GLU B 1 27  ? 2.097   27.445  2.163   1.00 40.99 ? 74   GLU B N   1 
ATOM   1183 C CA  . GLU B 1 27  ? 1.591   28.115  3.328   1.00 42.96 ? 74   GLU B CA  1 
ATOM   1184 C C   . GLU B 1 27  ? 0.123   28.594  3.151   1.00 42.80 ? 74   GLU B C   1 
ATOM   1185 O O   . GLU B 1 27  ? -0.657  28.467  4.073   1.00 42.32 ? 74   GLU B O   1 
ATOM   1186 C CB  . GLU B 1 27  ? 2.485   29.315  3.697   1.00 43.94 ? 74   GLU B CB  1 
ATOM   1187 C CG  . GLU B 1 27  ? 2.144   29.857  5.077   1.00 45.81 ? 74   GLU B CG  1 
ATOM   1188 C CD  . GLU B 1 27  ? 2.658   31.257  5.313   1.00 46.70 ? 74   GLU B CD  1 
ATOM   1189 O OE1 . GLU B 1 27  ? 2.973   31.970  4.336   1.00 53.31 ? 74   GLU B OE1 1 
ATOM   1190 O OE2 . GLU B 1 27  ? 2.708   31.659  6.495   1.00 52.57 ? 74   GLU B OE2 1 
ATOM   1191 N N   . LYS B 1 28  ? -0.229  29.180  1.997   1.00 42.61 ? 75   LYS B N   1 
ATOM   1192 C CA  . LYS B 1 28  ? -1.614  29.630  1.788   1.00 42.79 ? 75   LYS B CA  1 
ATOM   1193 C C   . LYS B 1 28  ? -2.614  28.454  1.608   1.00 42.54 ? 75   LYS B C   1 
ATOM   1194 O O   . LYS B 1 28  ? -3.751  28.542  2.092   1.00 41.52 ? 75   LYS B O   1 
ATOM   1195 C CB  . LYS B 1 28  ? -1.716  30.618  0.631   1.00 43.59 ? 75   LYS B CB  1 
ATOM   1196 C CG  . LYS B 1 28  ? -1.491  32.024  1.077   1.00 44.88 ? 75   LYS B CG  1 
ATOM   1197 C CD  . LYS B 1 28  ? -1.227  32.980  -0.076  1.00 46.41 ? 75   LYS B CD  1 
ATOM   1198 N N   . LEU B 1 29  ? -2.191  27.373  0.942   1.00 41.08 ? 76   LEU B N   1 
ATOM   1199 C CA  . LEU B 1 29  ? -3.017  26.171  0.844   1.00 41.85 ? 76   LEU B CA  1 
ATOM   1200 C C   . LEU B 1 29  ? -3.335  25.632  2.241   1.00 42.02 ? 76   LEU B C   1 
ATOM   1201 O O   . LEU B 1 29  ? -4.468  25.278  2.521   1.00 42.73 ? 76   LEU B O   1 
ATOM   1202 C CB  . LEU B 1 29  ? -2.303  25.076  0.037   1.00 41.73 ? 76   LEU B CB  1 
ATOM   1203 C CG  . LEU B 1 29  ? -2.958  23.676  -0.151  1.00 41.47 ? 76   LEU B CG  1 
ATOM   1204 C CD1 . LEU B 1 29  ? -4.390  23.705  -0.700  1.00 42.53 ? 76   LEU B CD1 1 
ATOM   1205 C CD2 . LEU B 1 29  ? -2.083  22.846  -1.078  1.00 41.93 ? 76   LEU B CD2 1 
ATOM   1206 N N   . LEU B 1 30  ? -2.329  25.528  3.107   1.00 42.56 ? 77   LEU B N   1 
ATOM   1207 C CA  . LEU B 1 30  ? -2.545  24.904  4.406   1.00 43.54 ? 77   LEU B CA  1 
ATOM   1208 C C   . LEU B 1 30  ? -3.231  25.829  5.392   1.00 44.27 ? 77   LEU B C   1 
ATOM   1209 O O   . LEU B 1 30  ? -3.736  25.352  6.421   1.00 44.99 ? 77   LEU B O   1 
ATOM   1210 C CB  . LEU B 1 30  ? -1.251  24.333  4.992   1.00 43.43 ? 77   LEU B CB  1 
ATOM   1211 C CG  . LEU B 1 30  ? -0.499  23.301  4.174   1.00 42.22 ? 77   LEU B CG  1 
ATOM   1212 C CD1 . LEU B 1 30  ? 0.765   22.929  4.924   1.00 42.83 ? 77   LEU B CD1 1 
ATOM   1213 C CD2 . LEU B 1 30  ? -1.316  22.074  3.827   1.00 43.45 ? 77   LEU B CD2 1 
ATOM   1214 N N   . ALA B 1 31  ? -3.270  27.134  5.079   1.00 44.47 ? 78   ALA B N   1 
ATOM   1215 C CA  . ALA B 1 31  ? -4.030  28.106  5.876   1.00 44.99 ? 78   ALA B CA  1 
ATOM   1216 C C   . ALA B 1 31  ? -5.548  28.000  5.670   1.00 45.77 ? 78   ALA B C   1 
ATOM   1217 O O   . ALA B 1 31  ? -6.286  28.627  6.423   1.00 46.94 ? 78   ALA B O   1 
ATOM   1218 C CB  . ALA B 1 31  ? -3.562  29.552  5.573   1.00 45.90 ? 78   ALA B CB  1 
ATOM   1219 N N   . ASN B 1 32  ? -6.004  27.241  4.653   1.00 44.52 ? 79   ASN B N   1 
ATOM   1220 C CA  . ASN B 1 32  ? -7.423  27.040  4.384   1.00 43.36 ? 79   ASN B CA  1 
ATOM   1221 C C   . ASN B 1 32  ? -7.767  25.536  4.695   1.00 42.48 ? 79   ASN B C   1 
ATOM   1222 O O   . ASN B 1 32  ? -7.125  24.617  4.225   1.00 40.12 ? 79   ASN B O   1 
ATOM   1223 C CB  . ASN B 1 32  ? -7.753  27.491  2.936   1.00 42.83 ? 79   ASN B CB  1 
ATOM   1224 C CG  . ASN B 1 32  ? -9.246  27.373  2.587   1.00 43.94 ? 79   ASN B CG  1 
ATOM   1225 O OD1 . ASN B 1 32  ? -9.718  26.314  2.188   1.00 43.98 ? 79   ASN B OD1 1 
ATOM   1226 N ND2 . ASN B 1 32  ? -9.980  28.463  2.723   1.00 45.63 ? 79   ASN B ND2 1 
ATOM   1227 N N   . GLN B 1 33  ? -8.736  25.330  5.572   1.00 41.43 ? 80   GLN B N   1 
ATOM   1228 C CA  . GLN B 1 33  ? -9.171  23.996  5.977   1.00 41.80 ? 80   GLN B CA  1 
ATOM   1229 C C   . GLN B 1 33  ? -9.610  23.130  4.790   1.00 39.05 ? 80   GLN B C   1 
ATOM   1230 O O   . GLN B 1 33  ? -9.288  21.933  4.723   1.00 38.01 ? 80   GLN B O   1 
ATOM   1231 C CB  . GLN B 1 33  ? -10.317 24.158  7.002   1.00 42.86 ? 80   GLN B CB  1 
ATOM   1232 C CG  . GLN B 1 33  ? -10.379 23.096  8.028   1.00 45.91 ? 80   GLN B CG  1 
ATOM   1233 C CD  . GLN B 1 33  ? -10.992 23.557  9.336   1.00 45.98 ? 80   GLN B CD  1 
ATOM   1234 O OE1 . GLN B 1 33  ? -11.789 24.504  9.373   1.00 50.54 ? 80   GLN B OE1 1 
ATOM   1235 N NE2 . GLN B 1 33  ? -10.614 22.875  10.429  1.00 48.53 ? 80   GLN B NE2 1 
ATOM   1236 N N   . THR B 1 34  ? -10.365 23.719  3.867   1.00 37.41 ? 81   THR B N   1 
ATOM   1237 C CA  . THR B 1 34  ? -10.761 23.032  2.651   1.00 37.08 ? 81   THR B CA  1 
ATOM   1238 C C   . THR B 1 34  ? -9.562  22.715  1.743   1.00 37.12 ? 81   THR B C   1 
ATOM   1239 O O   . THR B 1 34  ? -9.485  21.641  1.147   1.00 36.74 ? 81   THR B O   1 
ATOM   1240 C CB  . THR B 1 34  ? -11.851 23.831  1.892   1.00 37.29 ? 81   THR B CB  1 
ATOM   1241 O OG1 . THR B 1 34  ? -13.016 23.863  2.699   1.00 36.59 ? 81   THR B OG1 1 
ATOM   1242 C CG2 . THR B 1 34  ? -12.220 23.200  0.541   1.00 37.68 ? 81   THR B CG2 1 
ATOM   1243 N N   . GLY B 1 35  ? -8.620  23.663  1.642   1.00 37.31 ? 82   GLY B N   1 
ATOM   1244 C CA  . GLY B 1 35  ? -7.345  23.429  1.007   1.00 37.06 ? 82   GLY B CA  1 
ATOM   1245 C C   . GLY B 1 35  ? -6.619  22.235  1.583   1.00 37.81 ? 82   GLY B C   1 
ATOM   1246 O O   . GLY B 1 35  ? -6.146  21.375  0.834   1.00 37.59 ? 82   GLY B O   1 
ATOM   1247 N N   . GLN B 1 36  ? -6.565  22.153  2.914   1.00 38.00 ? 83   GLN B N   1 
ATOM   1248 C CA  . GLN B 1 36  ? -5.995  21.002  3.569   1.00 38.19 ? 83   GLN B CA  1 
ATOM   1249 C C   . GLN B 1 36  ? -6.664  19.707  3.138   1.00 37.57 ? 83   GLN B C   1 
ATOM   1250 O O   . GLN B 1 36  ? -5.994  18.719  2.900   1.00 37.76 ? 83   GLN B O   1 
ATOM   1251 C CB  . GLN B 1 36  ? -6.105  21.103  5.102   1.00 37.72 ? 83   GLN B CB  1 
ATOM   1252 C CG  . GLN B 1 36  ? -5.151  22.093  5.782   1.00 39.40 ? 83   GLN B CG  1 
ATOM   1253 C CD  . GLN B 1 36  ? -5.490  22.232  7.254   1.00 39.79 ? 83   GLN B CD  1 
ATOM   1254 O OE1 . GLN B 1 36  ? -6.239  21.429  7.797   1.00 41.84 ? 83   GLN B OE1 1 
ATOM   1255 N NE2 . GLN B 1 36  ? -4.983  23.271  7.882   1.00 42.64 ? 83   GLN B NE2 1 
ATOM   1256 N N   . ASN B 1 37  ? -7.989  19.712  3.085   1.00 36.69 ? 84   ASN B N   1 
ATOM   1257 C CA  . ASN B 1 37  ? -8.772  18.537  2.737   1.00 36.46 ? 84   ASN B CA  1 
ATOM   1258 C C   . ASN B 1 37  ? -8.572  18.106  1.298   1.00 36.87 ? 84   ASN B C   1 
ATOM   1259 O O   . ASN B 1 37  ? -8.320  16.940  1.037   1.00 36.46 ? 84   ASN B O   1 
ATOM   1260 C CB  . ASN B 1 37  ? -10.263 18.804  3.049   1.00 35.96 ? 84   ASN B CB  1 
ATOM   1261 C CG  . ASN B 1 37  ? -10.539 18.843  4.533   1.00 36.71 ? 84   ASN B CG  1 
ATOM   1262 O OD1 . ASN B 1 37  ? -9.789  18.258  5.323   1.00 38.01 ? 84   ASN B OD1 1 
ATOM   1263 N ND2 . ASN B 1 37  ? -11.614 19.513  4.928   1.00 34.29 ? 84   ASN B ND2 1 
ATOM   1264 N N   . VAL B 1 38  ? -8.618  19.063  0.361   1.00 36.51 ? 85   VAL B N   1 
ATOM   1265 C CA  . VAL B 1 38  ? -8.412  18.774  -1.044  1.00 35.77 ? 85   VAL B CA  1 
ATOM   1266 C C   . VAL B 1 38  ? -6.955  18.292  -1.353  1.00 36.05 ? 85   VAL B C   1 
ATOM   1267 O O   . VAL B 1 38  ? -6.755  17.298  -2.019  1.00 36.16 ? 85   VAL B O   1 
ATOM   1268 C CB  . VAL B 1 38  ? -8.835  19.966  -1.913  1.00 35.57 ? 85   VAL B CB  1 
ATOM   1269 C CG1 . VAL B 1 38  ? -8.519  19.727  -3.400  1.00 37.96 ? 85   VAL B CG1 1 
ATOM   1270 C CG2 . VAL B 1 38  ? -10.363 20.220  -1.776  1.00 34.66 ? 85   VAL B CG2 1 
ATOM   1271 N N   . PHE B 1 39  ? -5.958  18.981  -0.816  1.00 36.37 ? 86   PHE B N   1 
ATOM   1272 C CA  . PHE B 1 39  ? -4.586  18.522  -0.928  1.00 36.95 ? 86   PHE B CA  1 
ATOM   1273 C C   . PHE B 1 39  ? -4.386  17.193  -0.222  1.00 36.55 ? 86   PHE B C   1 
ATOM   1274 O O   . PHE B 1 39  ? -3.708  16.339  -0.749  1.00 36.01 ? 86   PHE B O   1 
ATOM   1275 C CB  . PHE B 1 39  ? -3.659  19.550  -0.304  1.00 37.21 ? 86   PHE B CB  1 
ATOM   1276 C CG  . PHE B 1 39  ? -2.228  19.276  -0.458  1.00 37.55 ? 86   PHE B CG  1 
ATOM   1277 C CD1 . PHE B 1 39  ? -1.696  18.867  -1.667  1.00 36.78 ? 86   PHE B CD1 1 
ATOM   1278 C CD2 . PHE B 1 39  ? -1.376  19.484  0.625   1.00 38.91 ? 86   PHE B CD2 1 
ATOM   1279 C CE1 . PHE B 1 39  ? -0.332  18.699  -1.803  1.00 39.01 ? 86   PHE B CE1 1 
ATOM   1280 C CE2 . PHE B 1 39  ? -0.034  19.278  0.506   1.00 40.64 ? 86   PHE B CE2 1 
ATOM   1281 C CZ  . PHE B 1 39  ? 0.492   18.911  -0.732  1.00 39.22 ? 86   PHE B CZ  1 
ATOM   1282 N N   . GLY B 1 40  ? -4.928  17.040  0.984   1.00 36.90 ? 87   GLY B N   1 
ATOM   1283 C CA  . GLY B 1 40  ? -4.979  15.720  1.639   1.00 37.82 ? 87   GLY B CA  1 
ATOM   1284 C C   . GLY B 1 40  ? -5.505  14.586  0.787   1.00 38.00 ? 87   GLY B C   1 
ATOM   1285 O O   . GLY B 1 40  ? -4.973  13.461  0.791   1.00 36.99 ? 87   GLY B O   1 
ATOM   1286 N N   . SER B 1 41  ? -6.580  14.854  0.046   1.00 38.79 ? 88   SER B N   1 
ATOM   1287 C CA  . SER B 1 41  ? -7.143  13.864  -0.839  1.00 39.03 ? 88   SER B CA  1 
ATOM   1288 C C   . SER B 1 41  ? -6.179  13.493  -1.957  1.00 37.78 ? 88   SER B C   1 
ATOM   1289 O O   . SER B 1 41  ? -6.017  12.313  -2.293  1.00 36.03 ? 88   SER B O   1 
ATOM   1290 C CB  . SER B 1 41  ? -8.505  14.332  -1.385  1.00 40.23 ? 88   SER B CB  1 
ATOM   1291 O OG  . SER B 1 41  ? -9.377  14.626  -0.277  1.00 45.25 ? 88   SER B OG  1 
ATOM   1292 N N   . PHE B 1 42  ? -5.525  14.505  -2.511  1.00 37.24 ? 89   PHE B N   1 
ATOM   1293 C CA  . PHE B 1 42  ? -4.480  14.316  -3.511  1.00 37.59 ? 89   PHE B CA  1 
ATOM   1294 C C   . PHE B 1 42  ? -3.334  13.470  -2.948  1.00 37.49 ? 89   PHE B C   1 
ATOM   1295 O O   . PHE B 1 42  ? -2.882  12.551  -3.602  1.00 36.65 ? 89   PHE B O   1 
ATOM   1296 C CB  . PHE B 1 42  ? -3.925  15.665  -4.027  1.00 36.83 ? 89   PHE B CB  1 
ATOM   1297 C CG  . PHE B 1 42  ? -2.736  15.525  -4.955  1.00 38.41 ? 89   PHE B CG  1 
ATOM   1298 C CD1 . PHE B 1 42  ? -2.914  15.144  -6.297  1.00 38.42 ? 89   PHE B CD1 1 
ATOM   1299 C CD2 . PHE B 1 42  ? -1.433  15.790  -4.504  1.00 38.59 ? 89   PHE B CD2 1 
ATOM   1300 C CE1 . PHE B 1 42  ? -1.847  15.018  -7.144  1.00 36.21 ? 89   PHE B CE1 1 
ATOM   1301 C CE2 . PHE B 1 42  ? -0.359  15.663  -5.359  1.00 39.43 ? 89   PHE B CE2 1 
ATOM   1302 C CZ  . PHE B 1 42  ? -0.579  15.290  -6.702  1.00 38.35 ? 89   PHE B CZ  1 
ATOM   1303 N N   . LEU B 1 43  ? -2.897  13.780  -1.730  1.00 38.02 ? 90   LEU B N   1 
ATOM   1304 C CA  . LEU B 1 43  ? -1.787  13.029  -1.120  1.00 39.00 ? 90   LEU B CA  1 
ATOM   1305 C C   . LEU B 1 43  ? -2.185  11.562  -0.854  1.00 38.79 ? 90   LEU B C   1 
ATOM   1306 O O   . LEU B 1 43  ? -1.402  10.621  -1.116  1.00 38.07 ? 90   LEU B O   1 
ATOM   1307 C CB  . LEU B 1 43  ? -1.303  13.721  0.155   1.00 38.17 ? 90   LEU B CB  1 
ATOM   1308 C CG  . LEU B 1 43  ? -0.671  15.117  -0.067  1.00 37.18 ? 90   LEU B CG  1 
ATOM   1309 C CD1 . LEU B 1 43  ? -0.156  15.551  1.235   1.00 38.17 ? 90   LEU B CD1 1 
ATOM   1310 C CD2 . LEU B 1 43  ? 0.470   15.159  -1.117  1.00 40.00 ? 90   LEU B CD2 1 
ATOM   1311 N N   . LYS B 1 44  ? -3.404  11.380  -0.355  1.00 40.00 ? 91   LYS B N   1 
ATOM   1312 C CA  . LYS B 1 44  ? -4.021  10.026  -0.254  1.00 41.44 ? 91   LYS B CA  1 
ATOM   1313 C C   . LYS B 1 44  ? -3.954  9.258   -1.588  1.00 41.29 ? 91   LYS B C   1 
ATOM   1314 O O   . LYS B 1 44  ? -3.500  8.113   -1.627  1.00 40.47 ? 91   LYS B O   1 
ATOM   1315 C CB  . LYS B 1 44  ? -5.436  10.074  0.353   1.00 41.37 ? 91   LYS B CB  1 
ATOM   1316 C CG  . LYS B 1 44  ? -5.387  10.206  1.898   1.00 45.31 ? 91   LYS B CG  1 
ATOM   1317 C CD  . LYS B 1 44  ? -6.747  10.472  2.653   1.00 46.53 ? 91   LYS B CD  1 
ATOM   1318 C CE  . LYS B 1 44  ? -6.549  10.783  4.191   1.00 49.09 ? 91   LYS B CE  1 
ATOM   1319 N NZ  . LYS B 1 44  ? -7.842  10.793  5.054   1.00 49.11 ? 91   LYS B NZ  1 
ATOM   1320 N N   . SER B 1 45  ? -4.343  9.890   -2.683  1.00 41.72 ? 92   SER B N   1 
ATOM   1321 C CA  . SER B 1 45  ? -4.288  9.232   -3.946  1.00 43.29 ? 92   SER B CA  1 
ATOM   1322 C C   . SER B 1 45  ? -2.855  8.798   -4.375  1.00 44.04 ? 92   SER B C   1 
ATOM   1323 O O   . SER B 1 45  ? -2.728  7.941   -5.240  1.00 44.86 ? 92   SER B O   1 
ATOM   1324 C CB  . SER B 1 45  ? -4.965  10.050  -5.029  1.00 42.87 ? 92   SER B CB  1 
ATOM   1325 O OG  . SER B 1 45  ? -4.173  11.148  -5.401  1.00 45.89 ? 92   SER B OG  1 
ATOM   1326 N N   . GLU B 1 46  ? -1.818  9.408   -3.779  1.00 44.74 ? 93   GLU B N   1 
ATOM   1327 C CA  . GLU B 1 46  ? -0.419  9.054   -4.009  1.00 45.15 ? 93   GLU B CA  1 
ATOM   1328 C C   . GLU B 1 46  ? 0.258   8.340   -2.863  1.00 44.80 ? 93   GLU B C   1 
ATOM   1329 O O   . GLU B 1 46  ? 1.470   8.351   -2.829  1.00 44.93 ? 93   GLU B O   1 
ATOM   1330 C CB  . GLU B 1 46  ? 0.450   10.304  -4.103  1.00 46.10 ? 93   GLU B CB  1 
ATOM   1331 C CG  . GLU B 1 46  ? -0.011  11.411  -4.886  1.00 48.58 ? 93   GLU B CG  1 
ATOM   1332 C CD  . GLU B 1 46  ? 1.181   12.146  -5.401  1.00 48.29 ? 93   GLU B CD  1 
ATOM   1333 O OE1 . GLU B 1 46  ? 1.946   12.696  -4.592  1.00 50.85 ? 93   GLU B OE1 1 
ATOM   1334 O OE2 . GLU B 1 46  ? 1.350   12.120  -6.615  1.00 52.41 ? 93   GLU B OE2 1 
ATOM   1335 N N   . PHE B 1 47  ? -0.480  7.853   -1.869  1.00 44.56 ? 94   PHE B N   1 
ATOM   1336 C CA  . PHE B 1 47  ? 0.110   7.266   -0.677  1.00 43.95 ? 94   PHE B CA  1 
ATOM   1337 C C   . PHE B 1 47  ? 1.191   8.111   -0.008  1.00 43.18 ? 94   PHE B C   1 
ATOM   1338 O O   . PHE B 1 47  ? 2.249   7.600   0.309   1.00 42.74 ? 94   PHE B O   1 
ATOM   1339 C CB  . PHE B 1 47  ? 0.682   5.911   -1.077  1.00 45.01 ? 94   PHE B CB  1 
ATOM   1340 C CG  . PHE B 1 47  ? -0.226  5.145   -1.927  1.00 44.75 ? 94   PHE B CG  1 
ATOM   1341 C CD1 . PHE B 1 47  ? -0.075  5.162   -3.302  1.00 46.02 ? 94   PHE B CD1 1 
ATOM   1342 C CD2 . PHE B 1 47  ? -1.298  4.486   -1.366  1.00 44.21 ? 94   PHE B CD2 1 
ATOM   1343 C CE1 . PHE B 1 47  ? -0.958  4.485   -4.103  1.00 48.44 ? 94   PHE B CE1 1 
ATOM   1344 C CE2 . PHE B 1 47  ? -2.171  3.796   -2.143  1.00 47.10 ? 94   PHE B CE2 1 
ATOM   1345 C CZ  . PHE B 1 47  ? -2.021  3.791   -3.515  1.00 48.19 ? 94   PHE B CZ  1 
ATOM   1346 N N   . SER B 1 48  ? 0.934   9.406   0.165   1.00 42.57 ? 95   SER B N   1 
ATOM   1347 C CA  . SER B 1 48  ? 1.867   10.306  0.838   1.00 43.05 ? 95   SER B CA  1 
ATOM   1348 C C   . SER B 1 48  ? 1.155   11.223  1.839   1.00 42.11 ? 95   SER B C   1 
ATOM   1349 O O   . SER B 1 48  ? 1.687   12.254  2.268   1.00 40.93 ? 95   SER B O   1 
ATOM   1350 C CB  . SER B 1 48  ? 2.719   11.086  -0.193  1.00 43.48 ? 95   SER B CB  1 
ATOM   1351 O OG  . SER B 1 48  ? 1.965   12.112  -0.830  1.00 46.16 ? 95   SER B OG  1 
ATOM   1352 N N   . GLU B 1 49  ? -0.044  10.821  2.248   1.00 41.09 ? 96   GLU B N   1 
ATOM   1353 C CA  . GLU B 1 49  ? -0.837  11.653  3.146   1.00 42.24 ? 96   GLU B CA  1 
ATOM   1354 C C   . GLU B 1 49  ? -0.283  11.697  4.578   1.00 41.18 ? 96   GLU B C   1 
ATOM   1355 O O   . GLU B 1 49  ? -0.569  12.625  5.309   1.00 40.78 ? 96   GLU B O   1 
ATOM   1356 C CB  . GLU B 1 49  ? -2.313  11.240  3.132   1.00 43.18 ? 96   GLU B CB  1 
ATOM   1357 C CG  . GLU B 1 49  ? -2.651  10.008  3.973   1.00 45.51 ? 96   GLU B CG  1 
ATOM   1358 C CD  . GLU B 1 49  ? -2.195  8.661   3.422   1.00 48.32 ? 96   GLU B CD  1 
ATOM   1359 O OE1 . GLU B 1 49  ? -1.793  8.487   2.233   1.00 48.02 ? 96   GLU B OE1 1 
ATOM   1360 O OE2 . GLU B 1 49  ? -2.288  7.722   4.238   1.00 53.37 ? 96   GLU B OE2 1 
ATOM   1361 N N   . GLU B 1 50  ? 0.544   10.728  4.945   1.00 40.94 ? 97   GLU B N   1 
ATOM   1362 C CA  . GLU B 1 50  ? 1.294   10.781  6.198   1.00 41.73 ? 97   GLU B CA  1 
ATOM   1363 C C   . GLU B 1 50  ? 2.053   12.088  6.401   1.00 41.22 ? 97   GLU B C   1 
ATOM   1364 O O   . GLU B 1 50  ? 2.212   12.528  7.534   1.00 40.30 ? 97   GLU B O   1 
ATOM   1365 C CB  . GLU B 1 50  ? 2.235   9.587   6.359   1.00 42.06 ? 97   GLU B CB  1 
ATOM   1366 C CG  . GLU B 1 50  ? 3.530   9.608   5.551   1.00 45.12 ? 97   GLU B CG  1 
ATOM   1367 C CD  . GLU B 1 50  ? 3.396   8.999   4.154   1.00 49.81 ? 97   GLU B CD  1 
ATOM   1368 O OE1 . GLU B 1 50  ? 2.278   8.547   3.749   1.00 51.24 ? 97   GLU B OE1 1 
ATOM   1369 O OE2 . GLU B 1 50  ? 4.450   8.952   3.480   1.00 52.55 ? 97   GLU B OE2 1 
ATOM   1370 N N   . ASN B 1 51  ? 2.470   12.740  5.305   1.00 40.37 ? 98   ASN B N   1 
ATOM   1371 C CA  . ASN B 1 51  ? 3.144   14.024  5.415   1.00 39.34 ? 98   ASN B CA  1 
ATOM   1372 C C   . ASN B 1 51  ? 2.229   15.123  5.933   1.00 38.95 ? 98   ASN B C   1 
ATOM   1373 O O   . ASN B 1 51  ? 2.625   15.882  6.804   1.00 38.04 ? 98   ASN B O   1 
ATOM   1374 C CB  . ASN B 1 51  ? 3.804   14.466  4.069   1.00 40.00 ? 98   ASN B CB  1 
ATOM   1375 C CG  . ASN B 1 51  ? 5.016   13.583  3.671   1.00 40.23 ? 98   ASN B CG  1 
ATOM   1376 O OD1 . ASN B 1 51  ? 5.715   13.017  4.506   1.00 42.87 ? 98   ASN B OD1 1 
ATOM   1377 N ND2 . ASN B 1 51  ? 5.229   13.454  2.373   1.00 44.15 ? 98   ASN B ND2 1 
ATOM   1378 N N   . ILE B 1 52  ? 1.036   15.249  5.366   1.00 38.60 ? 99   ILE B N   1 
ATOM   1379 C CA  . ILE B 1 52  ? 0.111   16.249  5.825   1.00 39.11 ? 99   ILE B CA  1 
ATOM   1380 C C   . ILE B 1 52  ? -0.492  15.861  7.207   1.00 38.17 ? 99   ILE B C   1 
ATOM   1381 O O   . ILE B 1 52  ? -0.734  16.711  8.035   1.00 36.43 ? 99   ILE B O   1 
ATOM   1382 C CB  . ILE B 1 52  ? -0.997  16.626  4.761   1.00 38.28 ? 99   ILE B CB  1 
ATOM   1383 C CG1 . ILE B 1 52  ? -1.601  17.974  5.166   1.00 40.38 ? 99   ILE B CG1 1 
ATOM   1384 C CG2 . ILE B 1 52  ? -2.049  15.546  4.583   1.00 41.65 ? 99   ILE B CG2 1 
ATOM   1385 C CD1 . ILE B 1 52  ? -2.727  18.469  4.294   1.00 41.36 ? 99   ILE B CD1 1 
ATOM   1386 N N   . GLU B 1 53  ? -0.745  14.570  7.415   1.00 38.56 ? 100  GLU B N   1 
ATOM   1387 C CA  . GLU B 1 53  ? -1.201  14.094  8.713   1.00 39.30 ? 100  GLU B CA  1 
ATOM   1388 C C   . GLU B 1 53  ? -0.193  14.390  9.804   1.00 37.69 ? 100  GLU B C   1 
ATOM   1389 O O   . GLU B 1 53  ? -0.552  14.903  10.860  1.00 37.56 ? 100  GLU B O   1 
ATOM   1390 C CB  . GLU B 1 53  ? -1.533  12.584  8.670   1.00 39.17 ? 100  GLU B CB  1 
ATOM   1391 C CG  . GLU B 1 53  ? -2.747  12.284  7.879   1.00 42.39 ? 100  GLU B CG  1 
ATOM   1392 C CD  . GLU B 1 53  ? -3.059  10.773  7.773   1.00 44.18 ? 100  GLU B CD  1 
ATOM   1393 O OE1 . GLU B 1 53  ? -2.273  9.906   8.253   1.00 49.58 ? 100  GLU B OE1 1 
ATOM   1394 O OE2 . GLU B 1 53  ? -4.117  10.481  7.182   1.00 51.93 ? 100  GLU B OE2 1 
ATOM   1395 N N   . PHE B 1 54  ? 1.085   14.108  9.545   1.00 37.58 ? 101  PHE B N   1 
ATOM   1396 C CA  . PHE B 1 54  ? 2.156   14.483  10.468  1.00 36.77 ? 101  PHE B CA  1 
ATOM   1397 C C   . PHE B 1 54  ? 2.258   15.986  10.723  1.00 36.54 ? 101  PHE B C   1 
ATOM   1398 O O   . PHE B 1 54  ? 2.443   16.409  11.848  1.00 35.76 ? 101  PHE B O   1 
ATOM   1399 C CB  . PHE B 1 54  ? 3.537   13.958  9.980   1.00 37.20 ? 101  PHE B CB  1 
ATOM   1400 C CG  . PHE B 1 54  ? 4.680   14.457  10.807  1.00 37.12 ? 101  PHE B CG  1 
ATOM   1401 C CD1 . PHE B 1 54  ? 4.834   14.031  12.116  1.00 34.67 ? 101  PHE B CD1 1 
ATOM   1402 C CD2 . PHE B 1 54  ? 5.607   15.371  10.278  1.00 37.20 ? 101  PHE B CD2 1 
ATOM   1403 C CE1 . PHE B 1 54  ? 5.856   14.495  12.868  1.00 38.45 ? 101  PHE B CE1 1 
ATOM   1404 C CE2 . PHE B 1 54  ? 6.615   15.833  11.014  1.00 34.24 ? 101  PHE B CE2 1 
ATOM   1405 C CZ  . PHE B 1 54  ? 6.780   15.390  12.324  1.00 37.26 ? 101  PHE B CZ  1 
ATOM   1406 N N   . TRP B 1 55  ? 2.233   16.779  9.658   1.00 37.30 ? 102  TRP B N   1 
ATOM   1407 C CA  . TRP B 1 55  ? 2.316   18.250  9.768   1.00 37.82 ? 102  TRP B CA  1 
ATOM   1408 C C   . TRP B 1 55  ? 1.179   18.794  10.653  1.00 38.19 ? 102  TRP B C   1 
ATOM   1409 O O   . TRP B 1 55  ? 1.392   19.588  11.565  1.00 36.63 ? 102  TRP B O   1 
ATOM   1410 C CB  . TRP B 1 55  ? 2.236   18.892  8.358   1.00 39.31 ? 102  TRP B CB  1 
ATOM   1411 C CG  . TRP B 1 55  ? 2.536   20.367  8.345   1.00 39.52 ? 102  TRP B CG  1 
ATOM   1412 C CD1 . TRP B 1 55  ? 3.778   20.958  8.308   1.00 41.69 ? 102  TRP B CD1 1 
ATOM   1413 C CD2 . TRP B 1 55  ? 1.587   21.442  8.407   1.00 41.24 ? 102  TRP B CD2 1 
ATOM   1414 N NE1 . TRP B 1 55  ? 3.647   22.321  8.348   1.00 40.31 ? 102  TRP B NE1 1 
ATOM   1415 C CE2 . TRP B 1 55  ? 2.316   22.643  8.389   1.00 41.86 ? 102  TRP B CE2 1 
ATOM   1416 C CE3 . TRP B 1 55  ? 0.192   21.501  8.453   1.00 42.24 ? 102  TRP B CE3 1 
ATOM   1417 C CZ2 . TRP B 1 55  ? 1.699   23.887  8.436   1.00 42.42 ? 102  TRP B CZ2 1 
ATOM   1418 C CZ3 . TRP B 1 55  ? -0.417  22.728  8.479   1.00 41.29 ? 102  TRP B CZ3 1 
ATOM   1419 C CH2 . TRP B 1 55  ? 0.329   23.906  8.482   1.00 41.94 ? 102  TRP B CH2 1 
ATOM   1420 N N   . LEU B 1 56  ? -0.030  18.342  10.357  1.00 37.90 ? 103  LEU B N   1 
ATOM   1421 C CA  . LEU B 1 56  ? -1.217  18.782  11.090  1.00 38.30 ? 103  LEU B CA  1 
ATOM   1422 C C   . LEU B 1 56  ? -1.180  18.335  12.559  1.00 38.00 ? 103  LEU B C   1 
ATOM   1423 O O   . LEU B 1 56  ? -1.622  19.063  13.404  1.00 39.50 ? 103  LEU B O   1 
ATOM   1424 C CB  . LEU B 1 56  ? -2.480  18.319  10.363  1.00 38.02 ? 103  LEU B CB  1 
ATOM   1425 C CG  . LEU B 1 56  ? -2.774  19.049  9.041   1.00 39.54 ? 103  LEU B CG  1 
ATOM   1426 C CD1 . LEU B 1 56  ? -3.863  18.287  8.284   1.00 43.94 ? 103  LEU B CD1 1 
ATOM   1427 C CD2 . LEU B 1 56  ? -3.199  20.477  9.204   1.00 41.40 ? 103  LEU B CD2 1 
ATOM   1428 N N   . ALA B 1 57  ? -0.609  17.160  12.842  1.00 38.37 ? 104  ALA B N   1 
ATOM   1429 C CA  . ALA B 1 57  ? -0.390  16.663  14.231  1.00 37.77 ? 104  ALA B CA  1 
ATOM   1430 C C   . ALA B 1 57  ? 0.574   17.529  15.001  1.00 36.89 ? 104  ALA B C   1 
ATOM   1431 O O   . ALA B 1 57  ? 0.424   17.735  16.210  1.00 34.31 ? 104  ALA B O   1 
ATOM   1432 C CB  . ALA B 1 57  ? 0.142   15.213  14.219  1.00 38.03 ? 104  ALA B CB  1 
ATOM   1433 N N   . CYS B 1 58  ? 1.632   17.967  14.319  1.00 36.96 ? 105  CYS B N   1 
ATOM   1434 C CA  . CYS B 1 58  ? 2.608   18.871  14.919  1.00 38.01 ? 105  CYS B CA  1 
ATOM   1435 C C   . CYS B 1 58  ? 1.974   20.208  15.236  1.00 38.14 ? 105  CYS B C   1 
ATOM   1436 O O   . CYS B 1 58  ? 2.250   20.774  16.291  1.00 38.82 ? 105  CYS B O   1 
ATOM   1437 C CB  . CYS B 1 58  ? 3.819   19.096  13.992  1.00 38.25 ? 105  CYS B CB  1 
ATOM   1438 S SG  . CYS B 1 58  ? 4.781   17.623  13.785  1.00 40.09 ? 105  CYS B SG  1 
ATOM   1439 N N   . GLU B 1 59  ? 1.159   20.728  14.325  1.00 38.68 ? 106  GLU B N   1 
ATOM   1440 C CA  . GLU B 1 59  ? 0.428   21.968  14.588  1.00 38.75 ? 106  GLU B CA  1 
ATOM   1441 C C   . GLU B 1 59  ? -0.453  21.834  15.859  1.00 39.34 ? 106  GLU B C   1 
ATOM   1442 O O   . GLU B 1 59  ? -0.417  22.691  16.750  1.00 38.80 ? 106  GLU B O   1 
ATOM   1443 C CB  . GLU B 1 59  ? -0.417  22.363  13.382  1.00 39.23 ? 106  GLU B CB  1 
ATOM   1444 C CG  . GLU B 1 59  ? 0.400   22.789  12.144  1.00 41.70 ? 106  GLU B CG  1 
ATOM   1445 C CD  . GLU B 1 59  ? 1.198   24.060  12.409  1.00 42.78 ? 106  GLU B CD  1 
ATOM   1446 O OE1 . GLU B 1 59  ? 2.430   23.980  12.577  1.00 45.44 ? 106  GLU B OE1 1 
ATOM   1447 O OE2 . GLU B 1 59  ? 0.578   25.128  12.515  1.00 46.75 ? 106  GLU B OE2 1 
ATOM   1448 N N   . ASP B 1 60  ? -1.213  20.748  15.951  1.00 39.38 ? 107  ASP B N   1 
ATOM   1449 C CA  . ASP B 1 60  ? -1.971  20.451  17.188  1.00 39.46 ? 107  ASP B CA  1 
ATOM   1450 C C   . ASP B 1 60  ? -1.103  20.237  18.424  1.00 38.64 ? 107  ASP B C   1 
ATOM   1451 O O   . ASP B 1 60  ? -1.432  20.714  19.513  1.00 37.29 ? 107  ASP B O   1 
ATOM   1452 C CB  . ASP B 1 60  ? -2.815  19.190  17.000  1.00 40.09 ? 107  ASP B CB  1 
ATOM   1453 C CG  . ASP B 1 60  ? -3.963  19.388  16.043  1.00 43.65 ? 107  ASP B CG  1 
ATOM   1454 O OD1 . ASP B 1 60  ? -4.399  20.553  15.832  1.00 46.45 ? 107  ASP B OD1 1 
ATOM   1455 O OD2 . ASP B 1 60  ? -4.449  18.362  15.511  1.00 47.80 ? 107  ASP B OD2 1 
ATOM   1456 N N   . TYR B 1 61  ? -0.033  19.463  18.271  1.00 38.26 ? 108  TYR B N   1 
ATOM   1457 C CA  . TYR B 1 61  ? 0.886   19.163  19.365  1.00 37.99 ? 108  TYR B CA  1 
ATOM   1458 C C   . TYR B 1 61  ? 1.394   20.435  20.040  1.00 39.61 ? 108  TYR B C   1 
ATOM   1459 O O   . TYR B 1 61  ? 1.433   20.534  21.278  1.00 38.07 ? 108  TYR B O   1 
ATOM   1460 C CB  . TYR B 1 61  ? 2.056   18.306  18.879  1.00 37.10 ? 108  TYR B CB  1 
ATOM   1461 C CG  . TYR B 1 61  ? 3.140   18.128  19.905  1.00 36.68 ? 108  TYR B CG  1 
ATOM   1462 C CD1 . TYR B 1 61  ? 2.976   17.244  20.992  1.00 36.64 ? 108  TYR B CD1 1 
ATOM   1463 C CD2 . TYR B 1 61  ? 4.302   18.887  19.844  1.00 35.75 ? 108  TYR B CD2 1 
ATOM   1464 C CE1 . TYR B 1 61  ? 3.961   17.096  21.939  1.00 36.18 ? 108  TYR B CE1 1 
ATOM   1465 C CE2 . TYR B 1 61  ? 5.295   18.755  20.785  1.00 36.89 ? 108  TYR B CE2 1 
ATOM   1466 C CZ  . TYR B 1 61  ? 5.128   17.861  21.830  1.00 36.52 ? 108  TYR B CZ  1 
ATOM   1467 O OH  . TYR B 1 61  ? 6.122   17.741  22.748  1.00 36.63 ? 108  TYR B OH  1 
ATOM   1468 N N   . LYS B 1 62  ? 1.735   21.404  19.193  1.00 40.52 ? 109  LYS B N   1 
ATOM   1469 C CA  . LYS B 1 62  ? 2.254   22.706  19.599  1.00 42.81 ? 109  LYS B CA  1 
ATOM   1470 C C   . LYS B 1 62  ? 1.381   23.487  20.560  1.00 41.90 ? 109  LYS B C   1 
ATOM   1471 O O   . LYS B 1 62  ? 1.901   24.174  21.441  1.00 42.32 ? 109  LYS B O   1 
ATOM   1472 C CB  . LYS B 1 62  ? 2.417   23.587  18.347  1.00 42.92 ? 109  LYS B CB  1 
ATOM   1473 C CG  . LYS B 1 62  ? 3.794   24.023  18.085  1.00 46.46 ? 109  LYS B CG  1 
ATOM   1474 C CD  . LYS B 1 62  ? 3.793   25.071  16.939  1.00 46.28 ? 109  LYS B CD  1 
ATOM   1475 C CE  . LYS B 1 62  ? 3.593   24.430  15.589  1.00 48.27 ? 109  LYS B CE  1 
ATOM   1476 N NZ  . LYS B 1 62  ? 4.802   23.696  15.210  1.00 49.62 ? 109  LYS B NZ  1 
ATOM   1477 N N   . LYS B 1 63  ? 0.073   23.422  20.341  1.00 42.28 ? 110  LYS B N   1 
ATOM   1478 C CA  . LYS B 1 63  ? -0.923  24.136  21.156  1.00 42.56 ? 110  LYS B CA  1 
ATOM   1479 C C   . LYS B 1 63  ? -1.488  23.279  22.322  1.00 41.65 ? 110  LYS B C   1 
ATOM   1480 O O   . LYS B 1 63  ? -2.441  23.684  22.959  1.00 42.01 ? 110  LYS B O   1 
ATOM   1481 C CB  . LYS B 1 63  ? -2.099  24.552  20.263  1.00 43.00 ? 110  LYS B CB  1 
ATOM   1482 C CG  . LYS B 1 63  ? -1.757  25.487  19.136  1.00 44.49 ? 110  LYS B CG  1 
ATOM   1483 C CD  . LYS B 1 63  ? -2.859  25.471  18.067  1.00 45.29 ? 110  LYS B CD  1 
ATOM   1484 C CE  . LYS B 1 63  ? -2.438  26.185  16.749  1.00 47.79 ? 110  LYS B CE  1 
ATOM   1485 N NZ  . LYS B 1 63  ? -1.651  25.322  15.793  1.00 48.20 ? 110  LYS B NZ  1 
ATOM   1486 N N   . THR B 1 64  ? -0.917  22.096  22.572  1.00 41.34 ? 111  THR B N   1 
ATOM   1487 C CA  . THR B 1 64  ? -1.426  21.140  23.574  1.00 40.72 ? 111  THR B CA  1 
ATOM   1488 C C   . THR B 1 64  ? -0.902  21.412  24.990  1.00 40.09 ? 111  THR B C   1 
ATOM   1489 O O   . THR B 1 64  ? 0.295   21.684  25.179  1.00 39.64 ? 111  THR B O   1 
ATOM   1490 C CB  . THR B 1 64  ? -1.049  19.674  23.187  1.00 40.52 ? 111  THR B CB  1 
ATOM   1491 O OG1 . THR B 1 64  ? -1.607  19.359  21.923  1.00 38.73 ? 111  THR B OG1 1 
ATOM   1492 C CG2 . THR B 1 64  ? -1.568  18.641  24.209  1.00 41.06 ? 111  THR B CG2 1 
ATOM   1493 N N   . GLU B 1 65  ? -1.813  21.300  25.968  1.00 39.03 ? 112  GLU B N   1 
ATOM   1494 C CA  . GLU B 1 65  ? -1.509  21.348  27.407  1.00 39.02 ? 112  GLU B CA  1 
ATOM   1495 C C   . GLU B 1 65  ? -0.237  20.621  27.725  1.00 38.36 ? 112  GLU B C   1 
ATOM   1496 O O   . GLU B 1 65  ? -0.051  19.507  27.249  1.00 37.50 ? 112  GLU B O   1 
ATOM   1497 C CB  . GLU B 1 65  ? -2.626  20.651  28.219  1.00 38.56 ? 112  GLU B CB  1 
ATOM   1498 C CG  . GLU B 1 65  ? -3.905  21.390  28.242  1.00 39.12 ? 112  GLU B CG  1 
ATOM   1499 C CD  . GLU B 1 65  ? -5.130  20.474  28.338  1.00 41.45 ? 112  GLU B CD  1 
ATOM   1500 O OE1 . GLU B 1 65  ? -5.309  19.845  29.426  1.00 35.21 ? 112  GLU B OE1 1 
ATOM   1501 O OE2 . GLU B 1 65  ? -5.914  20.426  27.338  1.00 40.67 ? 112  GLU B OE2 1 
ATOM   1502 N N   . SER B 1 66  ? 0.612   21.217  28.562  1.00 38.28 ? 113  SER B N   1 
ATOM   1503 C CA  . SER B 1 66  ? 1.936   20.641  28.821  1.00 39.16 ? 113  SER B CA  1 
ATOM   1504 C C   . SER B 1 66  ? 1.900   19.267  29.500  1.00 39.00 ? 113  SER B C   1 
ATOM   1505 O O   . SER B 1 66  ? 2.789   18.445  29.264  1.00 39.43 ? 113  SER B O   1 
ATOM   1506 C CB  . SER B 1 66  ? 2.830   21.605  29.608  1.00 38.78 ? 113  SER B CB  1 
ATOM   1507 O OG  . SER B 1 66  ? 2.064   22.634  30.174  1.00 41.58 ? 113  SER B OG  1 
ATOM   1508 N N   . ASP B 1 67  ? 0.871   19.011  30.306  1.00 38.51 ? 114  ASP B N   1 
ATOM   1509 C CA  . ASP B 1 67  ? 0.684   17.697  30.922  1.00 38.82 ? 114  ASP B CA  1 
ATOM   1510 C C   . ASP B 1 67  ? 0.552   16.585  29.889  1.00 38.28 ? 114  ASP B C   1 
ATOM   1511 O O   . ASP B 1 67  ? 0.984   15.474  30.129  1.00 38.22 ? 114  ASP B O   1 
ATOM   1512 C CB  . ASP B 1 67  ? -0.554  17.686  31.835  1.00 38.89 ? 114  ASP B CB  1 
ATOM   1513 C CG  . ASP B 1 67  ? -0.341  18.448  33.137  1.00 40.93 ? 114  ASP B CG  1 
ATOM   1514 O OD1 . ASP B 1 67  ? 0.825   18.793  33.467  1.00 42.69 ? 114  ASP B OD1 1 
ATOM   1515 O OD2 . ASP B 1 67  ? -1.354  18.676  33.858  1.00 42.68 ? 114  ASP B OD2 1 
ATOM   1516 N N   . LEU B 1 68  ? -0.040  16.889  28.738  1.00 38.14 ? 115  LEU B N   1 
ATOM   1517 C CA  . LEU B 1 68  ? -0.292  15.883  27.708  1.00 37.91 ? 115  LEU B CA  1 
ATOM   1518 C C   . LEU B 1 68  ? 0.777   15.797  26.613  1.00 38.01 ? 115  LEU B C   1 
ATOM   1519 O O   . LEU B 1 68  ? 0.664   14.957  25.737  1.00 37.48 ? 115  LEU B O   1 
ATOM   1520 C CB  . LEU B 1 68  ? -1.659  16.124  27.080  1.00 37.56 ? 115  LEU B CB  1 
ATOM   1521 C CG  . LEU B 1 68  ? -2.801  16.224  28.096  1.00 36.85 ? 115  LEU B CG  1 
ATOM   1522 C CD1 . LEU B 1 68  ? -4.129  16.350  27.333  1.00 36.76 ? 115  LEU B CD1 1 
ATOM   1523 C CD2 . LEU B 1 68  ? -2.807  15.033  29.080  1.00 34.98 ? 115  LEU B CD2 1 
ATOM   1524 N N   . LEU B 1 69  ? 1.825   16.624  26.686  1.00 38.56 ? 116  LEU B N   1 
ATOM   1525 C CA  . LEU B 1 69  ? 2.903   16.576  25.695  1.00 39.09 ? 116  LEU B CA  1 
ATOM   1526 C C   . LEU B 1 69  ? 3.670   15.253  25.707  1.00 39.49 ? 116  LEU B C   1 
ATOM   1527 O O   . LEU B 1 69  ? 3.950   14.718  24.653  1.00 39.71 ? 116  LEU B O   1 
ATOM   1528 C CB  . LEU B 1 69  ? 3.886   17.750  25.841  1.00 39.31 ? 116  LEU B CB  1 
ATOM   1529 C CG  . LEU B 1 69  ? 3.296   19.146  25.672  1.00 39.41 ? 116  LEU B CG  1 
ATOM   1530 C CD1 . LEU B 1 69  ? 4.376   20.177  25.944  1.00 41.46 ? 116  LEU B CD1 1 
ATOM   1531 C CD2 . LEU B 1 69  ? 2.683   19.358  24.329  1.00 40.69 ? 116  LEU B CD2 1 
ATOM   1532 N N   . PRO B 1 70  ? 4.005   14.708  26.892  1.00 40.08 ? 117  PRO B N   1 
ATOM   1533 C CA  . PRO B 1 70  ? 4.723   13.425  26.806  1.00 40.27 ? 117  PRO B CA  1 
ATOM   1534 C C   . PRO B 1 70  ? 3.922   12.358  26.055  1.00 40.46 ? 117  PRO B C   1 
ATOM   1535 O O   . PRO B 1 70  ? 4.451   11.662  25.176  1.00 39.83 ? 117  PRO B O   1 
ATOM   1536 C CB  . PRO B 1 70  ? 4.949   13.047  28.264  1.00 40.25 ? 117  PRO B CB  1 
ATOM   1537 C CG  . PRO B 1 70  ? 4.871   14.358  29.006  1.00 40.67 ? 117  PRO B CG  1 
ATOM   1538 C CD  . PRO B 1 70  ? 3.837   15.155  28.280  1.00 39.96 ? 117  PRO B CD  1 
ATOM   1539 N N   . CYS B 1 71  ? 2.637   12.294  26.363  1.00 40.23 ? 118  CYS B N   1 
ATOM   1540 C CA  . CYS B 1 71  ? 1.739   11.362  25.715  1.00 39.98 ? 118  CYS B CA  1 
ATOM   1541 C C   . CYS B 1 71  ? 1.555   11.636  24.212  1.00 39.24 ? 118  CYS B C   1 
ATOM   1542 O O   . CYS B 1 71  ? 1.665   10.721  23.394  1.00 38.20 ? 118  CYS B O   1 
ATOM   1543 C CB  . CYS B 1 71  ? 0.380   11.410  26.416  1.00 40.31 ? 118  CYS B CB  1 
ATOM   1544 S SG  . CYS B 1 71  ? -0.687  10.032  26.010  1.00 42.90 ? 118  CYS B SG  1 
ATOM   1545 N N   . LYS B 1 72  ? 1.226   12.877  23.859  1.00 38.55 ? 119  LYS B N   1 
ATOM   1546 C CA  . LYS B 1 72  ? 1.098   13.231  22.461  1.00 39.31 ? 119  LYS B CA  1 
ATOM   1547 C C   . LYS B 1 72  ? 2.388   12.982  21.699  1.00 38.15 ? 119  LYS B C   1 
ATOM   1548 O O   . LYS B 1 72  ? 2.356   12.418  20.617  1.00 38.58 ? 119  LYS B O   1 
ATOM   1549 C CB  . LYS B 1 72  ? 0.611   14.668  22.259  1.00 39.91 ? 119  LYS B CB  1 
ATOM   1550 C CG  . LYS B 1 72  ? -0.877  14.735  22.054  1.00 43.29 ? 119  LYS B CG  1 
ATOM   1551 C CD  . LYS B 1 72  ? -1.289  14.078  20.705  1.00 46.30 ? 119  LYS B CD  1 
ATOM   1552 C CE  . LYS B 1 72  ? -2.749  13.612  20.767  1.00 47.61 ? 119  LYS B CE  1 
ATOM   1553 N NZ  . LYS B 1 72  ? -3.186  13.053  19.432  1.00 47.13 ? 119  LYS B NZ  1 
ATOM   1554 N N   . ALA B 1 73  ? 3.508   13.395  22.269  1.00 37.49 ? 120  ALA B N   1 
ATOM   1555 C CA  . ALA B 1 73  ? 4.809   13.170  21.652  1.00 37.94 ? 120  ALA B CA  1 
ATOM   1556 C C   . ALA B 1 73  ? 5.084   11.689  21.387  1.00 37.59 ? 120  ALA B C   1 
ATOM   1557 O O   . ALA B 1 73  ? 5.559   11.342  20.304  1.00 36.07 ? 120  ALA B O   1 
ATOM   1558 C CB  . ALA B 1 73  ? 5.921   13.783  22.479  1.00 37.76 ? 120  ALA B CB  1 
ATOM   1559 N N   . GLU B 1 74  ? 4.777   10.831  22.360  1.00 37.00 ? 121  GLU B N   1 
ATOM   1560 C CA  . GLU B 1 74  ? 4.943   9.393   22.191  1.00 38.46 ? 121  GLU B CA  1 
ATOM   1561 C C   . GLU B 1 74  ? 4.073   8.857   21.072  1.00 37.87 ? 121  GLU B C   1 
ATOM   1562 O O   . GLU B 1 74  ? 4.537   8.049   20.275  1.00 37.44 ? 121  GLU B O   1 
ATOM   1563 C CB  . GLU B 1 74  ? 4.684   8.613   23.498  1.00 38.56 ? 121  GLU B CB  1 
ATOM   1564 C CG  . GLU B 1 74  ? 5.912   8.615   24.380  1.00 41.19 ? 121  GLU B CG  1 
ATOM   1565 C CD  . GLU B 1 74  ? 5.685   8.077   25.772  1.00 42.46 ? 121  GLU B CD  1 
ATOM   1566 O OE1 . GLU B 1 74  ? 4.669   7.359   26.012  1.00 46.79 ? 121  GLU B OE1 1 
ATOM   1567 O OE2 . GLU B 1 74  ? 6.549   8.360   26.638  1.00 48.69 ? 121  GLU B OE2 1 
ATOM   1568 N N   . GLU B 1 75  ? 2.810   9.291   21.030  1.00 38.12 ? 122  GLU B N   1 
ATOM   1569 C CA  . GLU B 1 75  ? 1.885   8.920   19.976  1.00 38.63 ? 122  GLU B CA  1 
ATOM   1570 C C   . GLU B 1 75  ? 2.388   9.360   18.573  1.00 37.96 ? 122  GLU B C   1 
ATOM   1571 O O   . GLU B 1 75  ? 2.379   8.577   17.625  1.00 37.19 ? 122  GLU B O   1 
ATOM   1572 C CB  . GLU B 1 75  ? 0.537   9.588   20.230  1.00 38.43 ? 122  GLU B CB  1 
ATOM   1573 C CG  . GLU B 1 75  ? -0.519  9.250   19.203  1.00 40.19 ? 122  GLU B CG  1 
ATOM   1574 C CD  . GLU B 1 75  ? -1.852  9.927   19.467  1.00 42.58 ? 122  GLU B CD  1 
ATOM   1575 O OE1 . GLU B 1 75  ? -1.999  10.579  20.528  1.00 48.37 ? 122  GLU B OE1 1 
ATOM   1576 O OE2 . GLU B 1 75  ? -2.768  9.798   18.620  1.00 48.12 ? 122  GLU B OE2 1 
ATOM   1577 N N   . ILE B 1 76  ? 2.776   10.621  18.454  1.00 37.87 ? 123  ILE B N   1 
ATOM   1578 C CA  . ILE B 1 76  ? 3.269   11.150  17.168  1.00 38.16 ? 123  ILE B CA  1 
ATOM   1579 C C   . ILE B 1 76  ? 4.521   10.380  16.720  1.00 38.19 ? 123  ILE B C   1 
ATOM   1580 O O   . ILE B 1 76  ? 4.635   10.008  15.540  1.00 38.60 ? 123  ILE B O   1 
ATOM   1581 C CB  . ILE B 1 76  ? 3.512   12.687  17.214  1.00 37.33 ? 123  ILE B CB  1 
ATOM   1582 C CG1 . ILE B 1 76  ? 2.190   13.450  17.334  1.00 37.83 ? 123  ILE B CG1 1 
ATOM   1583 C CG2 . ILE B 1 76  ? 4.166   13.184  15.925  1.00 39.05 ? 123  ILE B CG2 1 
ATOM   1584 C CD1 . ILE B 1 76  ? 2.329   14.863  17.850  1.00 37.36 ? 123  ILE B CD1 1 
ATOM   1585 N N   . TYR B 1 77  ? 5.444   10.160  17.650  1.00 38.48 ? 124  TYR B N   1 
ATOM   1586 C CA  . TYR B 1 77  ? 6.696   9.510   17.338  1.00 39.14 ? 124  TYR B CA  1 
ATOM   1587 C C   . TYR B 1 77  ? 6.430   8.093   16.841  1.00 39.19 ? 124  TYR B C   1 
ATOM   1588 O O   . TYR B 1 77  ? 6.918   7.703   15.773  1.00 37.10 ? 124  TYR B O   1 
ATOM   1589 C CB  . TYR B 1 77  ? 7.626   9.480   18.559  1.00 40.78 ? 124  TYR B CB  1 
ATOM   1590 C CG  . TYR B 1 77  ? 8.918   8.711   18.329  1.00 42.01 ? 124  TYR B CG  1 
ATOM   1591 C CD1 . TYR B 1 77  ? 9.077   7.425   18.838  1.00 43.98 ? 124  TYR B CD1 1 
ATOM   1592 C CD2 . TYR B 1 77  ? 9.969   9.267   17.601  1.00 42.29 ? 124  TYR B CD2 1 
ATOM   1593 C CE1 . TYR B 1 77  ? 10.251  6.715   18.643  1.00 45.82 ? 124  TYR B CE1 1 
ATOM   1594 C CE2 . TYR B 1 77  ? 11.151  8.558   17.379  1.00 43.37 ? 124  TYR B CE2 1 
ATOM   1595 C CZ  . TYR B 1 77  ? 11.286  7.279   17.896  1.00 44.86 ? 124  TYR B CZ  1 
ATOM   1596 O OH  . TYR B 1 77  ? 12.455  6.553   17.703  1.00 45.17 ? 124  TYR B OH  1 
ATOM   1597 N N   . LYS B 1 78  ? 5.666   7.325   17.630  1.00 37.62 ? 125  LYS B N   1 
ATOM   1598 C CA  . LYS B 1 78  ? 5.314   5.947   17.263  1.00 37.51 ? 125  LYS B CA  1 
ATOM   1599 C C   . LYS B 1 78  ? 4.483   5.861   15.982  1.00 37.31 ? 125  LYS B C   1 
ATOM   1600 O O   . LYS B 1 78  ? 4.623   4.891   15.222  1.00 37.31 ? 125  LYS B O   1 
ATOM   1601 C CB  . LYS B 1 78  ? 4.575   5.233   18.433  1.00 36.98 ? 125  LYS B CB  1 
ATOM   1602 N N   . ALA B 1 79  ? 3.619   6.851   15.740  1.00 37.57 ? 126  ALA B N   1 
ATOM   1603 C CA  . ALA B 1 79  ? 2.755   6.856   14.559  1.00 38.76 ? 126  ALA B CA  1 
ATOM   1604 C C   . ALA B 1 79  ? 3.461   7.282   13.246  1.00 38.44 ? 126  ALA B C   1 
ATOM   1605 O O   . ALA B 1 79  ? 3.131   6.777   12.155  1.00 37.06 ? 126  ALA B O   1 
ATOM   1606 C CB  . ALA B 1 79  ? 1.538   7.736   14.778  1.00 38.89 ? 126  ALA B CB  1 
ATOM   1607 N N   . PHE B 1 80  ? 4.415   8.204   13.352  1.00 38.99 ? 127  PHE B N   1 
ATOM   1608 C CA  . PHE B 1 80  ? 5.026   8.809   12.148  1.00 39.60 ? 127  PHE B CA  1 
ATOM   1609 C C   . PHE B 1 80  ? 6.560   8.691   12.067  1.00 40.61 ? 127  PHE B C   1 
ATOM   1610 O O   . PHE B 1 80  ? 7.125   8.584   10.979  1.00 40.15 ? 127  PHE B O   1 
ATOM   1611 C CB  . PHE B 1 80  ? 4.674   10.300  12.060  1.00 39.79 ? 127  PHE B CB  1 
ATOM   1612 C CG  . PHE B 1 80  ? 3.219   10.566  11.940  1.00 40.28 ? 127  PHE B CG  1 
ATOM   1613 C CD1 . PHE B 1 80  ? 2.560   10.338  10.740  1.00 40.60 ? 127  PHE B CD1 1 
ATOM   1614 C CD2 . PHE B 1 80  ? 2.485   11.013  13.045  1.00 39.45 ? 127  PHE B CD2 1 
ATOM   1615 C CE1 . PHE B 1 80  ? 1.223   10.541  10.641  1.00 39.97 ? 127  PHE B CE1 1 
ATOM   1616 C CE2 . PHE B 1 80  ? 1.156   11.251  12.936  1.00 40.73 ? 127  PHE B CE2 1 
ATOM   1617 C CZ  . PHE B 1 80  ? 0.514   11.009  11.735  1.00 41.17 ? 127  PHE B CZ  1 
ATOM   1618 N N   . VAL B 1 81  ? 7.236   8.758   13.202  1.00 41.18 ? 128  VAL B N   1 
ATOM   1619 C CA  . VAL B 1 81  ? 8.654   9.067   13.193  1.00 42.10 ? 128  VAL B CA  1 
ATOM   1620 C C   . VAL B 1 81  ? 9.459   7.780   13.257  1.00 43.80 ? 128  VAL B C   1 
ATOM   1621 O O   . VAL B 1 81  ? 10.408  7.604   12.489  1.00 41.97 ? 128  VAL B O   1 
ATOM   1622 C CB  . VAL B 1 81  ? 9.019   10.031  14.317  1.00 41.30 ? 128  VAL B CB  1 
ATOM   1623 C CG1 . VAL B 1 81  ? 10.489  10.286  14.344  1.00 41.27 ? 128  VAL B CG1 1 
ATOM   1624 C CG2 . VAL B 1 81  ? 8.257   11.346  14.146  1.00 41.77 ? 128  VAL B CG2 1 
ATOM   1625 N N   . HIS B 1 82  ? 9.042   6.895   14.175  1.00 45.71 ? 129  HIS B N   1 
ATOM   1626 C CA  . HIS B 1 82  ? 9.720   5.640   14.470  1.00 47.81 ? 129  HIS B CA  1 
ATOM   1627 C C   . HIS B 1 82  ? 9.915   4.774   13.222  1.00 49.79 ? 129  HIS B C   1 
ATOM   1628 O O   . HIS B 1 82  ? 9.050   4.709   12.347  1.00 49.34 ? 129  HIS B O   1 
ATOM   1629 C CB  . HIS B 1 82  ? 8.927   4.859   15.539  1.00 47.64 ? 129  HIS B CB  1 
ATOM   1630 C CG  . HIS B 1 82  ? 9.709   3.765   16.176  1.00 47.71 ? 129  HIS B CG  1 
ATOM   1631 N ND1 . HIS B 1 82  ? 10.713  4.001   17.090  1.00 48.97 ? 129  HIS B ND1 1 
ATOM   1632 C CD2 . HIS B 1 82  ? 9.644   2.419   16.029  1.00 48.65 ? 129  HIS B CD2 1 
ATOM   1633 C CE1 . HIS B 1 82  ? 11.235  2.850   17.475  1.00 47.70 ? 129  HIS B CE1 1 
ATOM   1634 N NE2 . HIS B 1 82  ? 10.605  1.875   16.846  1.00 47.98 ? 129  HIS B NE2 1 
ATOM   1635 N N   . SER B 1 83  ? 11.061  4.097   13.163  1.00 52.39 ? 130  SER B N   1 
ATOM   1636 C CA  . SER B 1 83  ? 11.439  3.317   11.976  1.00 54.11 ? 130  SER B CA  1 
ATOM   1637 C C   . SER B 1 83  ? 10.482  2.166   11.646  1.00 54.80 ? 130  SER B C   1 
ATOM   1638 O O   . SER B 1 83  ? 10.514  1.642   10.530  1.00 56.11 ? 130  SER B O   1 
ATOM   1639 C CB  . SER B 1 83  ? 12.897  2.824   12.066  1.00 54.68 ? 130  SER B CB  1 
ATOM   1640 O OG  . SER B 1 83  ? 13.769  3.768   11.450  1.00 55.70 ? 130  SER B OG  1 
ATOM   1641 N N   . ASP B 1 84  ? 9.628   1.792   12.593  1.00 55.02 ? 131  ASP B N   1 
ATOM   1642 C CA  . ASP B 1 84  ? 8.637   0.763   12.368  1.00 55.06 ? 131  ASP B CA  1 
ATOM   1643 C C   . ASP B 1 84  ? 7.232   1.335   12.418  1.00 55.12 ? 131  ASP B C   1 
ATOM   1644 O O   . ASP B 1 84  ? 6.282   0.583   12.606  1.00 54.87 ? 131  ASP B O   1 
ATOM   1645 C CB  . ASP B 1 84  ? 8.788   -0.354  13.405  1.00 55.72 ? 131  ASP B CB  1 
ATOM   1646 N N   . ALA B 1 85  ? 7.101   2.660   12.238  1.00 54.96 ? 132  ALA B N   1 
ATOM   1647 C CA  . ALA B 1 85  ? 5.787   3.322   12.164  1.00 54.51 ? 132  ALA B CA  1 
ATOM   1648 C C   . ALA B 1 85  ? 5.120   2.934   10.856  1.00 54.22 ? 132  ALA B C   1 
ATOM   1649 O O   . ALA B 1 85  ? 5.801   2.801   9.839   1.00 54.10 ? 132  ALA B O   1 
ATOM   1650 C CB  . ALA B 1 85  ? 5.940   4.840   12.238  1.00 54.47 ? 132  ALA B CB  1 
ATOM   1651 N N   . ALA B 1 86  ? 3.797   2.764   10.875  1.00 53.80 ? 133  ALA B N   1 
ATOM   1652 C CA  . ALA B 1 86  ? 3.050   2.357   9.682   1.00 53.46 ? 133  ALA B CA  1 
ATOM   1653 C C   . ALA B 1 86  ? 3.023   3.509   8.713   1.00 53.15 ? 133  ALA B C   1 
ATOM   1654 O O   . ALA B 1 86  ? 2.965   3.320   7.497   1.00 54.20 ? 133  ALA B O   1 
ATOM   1655 C CB  . ALA B 1 86  ? 1.627   1.982   10.037  1.00 53.71 ? 133  ALA B CB  1 
ATOM   1656 N N   . LYS B 1 87  ? 3.064   4.709   9.281   1.00 51.91 ? 134  LYS B N   1 
ATOM   1657 C CA  . LYS B 1 87  ? 2.925   5.938   8.541   1.00 50.48 ? 134  LYS B CA  1 
ATOM   1658 C C   . LYS B 1 87  ? 4.282   6.686   8.532   1.00 49.05 ? 134  LYS B C   1 
ATOM   1659 O O   . LYS B 1 87  ? 4.299   7.884   8.701   1.00 49.02 ? 134  LYS B O   1 
ATOM   1660 C CB  . LYS B 1 87  ? 1.805   6.772   9.179   1.00 50.42 ? 134  LYS B CB  1 
ATOM   1661 C CG  . LYS B 1 87  ? 0.380   6.290   8.819   1.00 52.03 ? 134  LYS B CG  1 
ATOM   1662 N N   . GLN B 1 88  ? 5.401   5.971   8.348   1.00 47.48 ? 135  GLN B N   1 
ATOM   1663 C CA  . GLN B 1 88  ? 6.725   6.541   8.644   1.00 47.35 ? 135  GLN B CA  1 
ATOM   1664 C C   . GLN B 1 88  ? 7.014   7.775   7.748   1.00 44.70 ? 135  GLN B C   1 
ATOM   1665 O O   . GLN B 1 88  ? 6.848   7.719   6.550   1.00 44.23 ? 135  GLN B O   1 
ATOM   1666 C CB  . GLN B 1 88  ? 7.891   5.515   8.551   1.00 46.88 ? 135  GLN B CB  1 
ATOM   1667 C CG  . GLN B 1 88  ? 9.154   6.075   9.279   1.00 47.45 ? 135  GLN B CG  1 
ATOM   1668 C CD  . GLN B 1 88  ? 10.468  5.341   9.029   1.00 49.10 ? 135  GLN B CD  1 
ATOM   1669 O OE1 . GLN B 1 88  ? 10.693  4.709   7.991   1.00 50.77 ? 135  GLN B OE1 1 
ATOM   1670 N NE2 . GLN B 1 88  ? 11.362  5.462   9.982   1.00 52.12 ? 135  GLN B NE2 1 
ATOM   1671 N N   . ILE B 1 89  ? 7.391   8.889   8.345   1.00 42.47 ? 136  ILE B N   1 
ATOM   1672 C CA  . ILE B 1 89  ? 7.741   10.061  7.533   1.00 41.31 ? 136  ILE B CA  1 
ATOM   1673 C C   . ILE B 1 89  ? 9.198   9.970   7.016   1.00 40.36 ? 136  ILE B C   1 
ATOM   1674 O O   . ILE B 1 89  ? 10.072  9.393   7.676   1.00 39.15 ? 136  ILE B O   1 
ATOM   1675 C CB  . ILE B 1 89  ? 7.476   11.412  8.256   1.00 40.55 ? 136  ILE B CB  1 
ATOM   1676 C CG1 . ILE B 1 89  ? 8.260   11.486  9.551   1.00 39.47 ? 136  ILE B CG1 1 
ATOM   1677 C CG2 . ILE B 1 89  ? 5.962   11.646  8.386   1.00 40.20 ? 136  ILE B CG2 1 
ATOM   1678 C CD1 . ILE B 1 89  ? 8.152   12.754  10.226  1.00 39.22 ? 136  ILE B CD1 1 
ATOM   1679 N N   . ASN B 1 90  ? 9.427   10.546  5.837   1.00 41.26 ? 137  ASN B N   1 
ATOM   1680 C CA  . ASN B 1 90  ? 10.756  10.496  5.169   1.00 40.97 ? 137  ASN B CA  1 
ATOM   1681 C C   . ASN B 1 90  ? 11.589  11.695  5.648   1.00 40.45 ? 137  ASN B C   1 
ATOM   1682 O O   . ASN B 1 90  ? 11.629  12.744  5.033   1.00 41.48 ? 137  ASN B O   1 
ATOM   1683 C CB  . ASN B 1 90  ? 10.602  10.461  3.628   1.00 40.55 ? 137  ASN B CB  1 
ATOM   1684 C CG  . ASN B 1 90  ? 11.939  10.312  2.889   1.00 42.92 ? 137  ASN B CG  1 
ATOM   1685 O OD1 . ASN B 1 90  ? 12.900  9.721   3.419   1.00 43.97 ? 137  ASN B OD1 1 
ATOM   1686 N ND2 . ASN B 1 90  ? 12.005  10.854  1.651   1.00 44.98 ? 137  ASN B ND2 1 
ATOM   1687 N N   . ILE B 1 91  ? 12.156  11.566  6.835   1.00 40.17 ? 138  ILE B N   1 
ATOM   1688 C CA  . ILE B 1 91  ? 13.119  12.540  7.334   1.00 38.62 ? 138  ILE B CA  1 
ATOM   1689 C C   . ILE B 1 91  ? 14.420  11.826  7.352   1.00 37.41 ? 138  ILE B C   1 
ATOM   1690 O O   . ILE B 1 91  ? 14.473  10.592  7.330   1.00 36.98 ? 138  ILE B O   1 
ATOM   1691 C CB  . ILE B 1 91  ? 12.785  13.091  8.766   1.00 37.78 ? 138  ILE B CB  1 
ATOM   1692 C CG1 . ILE B 1 91  ? 12.751  11.972  9.808   1.00 38.22 ? 138  ILE B CG1 1 
ATOM   1693 C CG2 . ILE B 1 91  ? 11.496  13.892  8.726   1.00 39.81 ? 138  ILE B CG2 1 
ATOM   1694 C CD1 . ILE B 1 91  ? 12.478  12.475  11.305  1.00 39.28 ? 138  ILE B CD1 1 
ATOM   1695 N N   . ASP B 1 92  ? 15.490  12.603  7.395   1.00 36.88 ? 139  ASP B N   1 
ATOM   1696 C CA  . ASP B 1 92  ? 16.807  12.033  7.405   1.00 35.75 ? 139  ASP B CA  1 
ATOM   1697 C C   . ASP B 1 92  ? 17.144  11.427  8.776   1.00 35.51 ? 139  ASP B C   1 
ATOM   1698 O O   . ASP B 1 92  ? 16.520  11.733  9.800   1.00 34.90 ? 139  ASP B O   1 
ATOM   1699 C CB  . ASP B 1 92  ? 17.826  13.099  7.011   1.00 35.71 ? 139  ASP B CB  1 
ATOM   1700 C CG  . ASP B 1 92  ? 17.954  14.177  8.064   1.00 33.67 ? 139  ASP B CG  1 
ATOM   1701 O OD1 . ASP B 1 92  ? 17.057  15.065  8.136   1.00 34.32 ? 139  ASP B OD1 1 
ATOM   1702 O OD2 . ASP B 1 92  ? 18.920  14.090  8.827   1.00 31.49 ? 139  ASP B OD2 1 
ATOM   1703 N N   . PHE B 1 93  ? 18.139  10.558  8.760   1.00 35.77 ? 140  PHE B N   1 
ATOM   1704 C CA  . PHE B 1 93  ? 18.575  9.824   9.927   1.00 37.32 ? 140  PHE B CA  1 
ATOM   1705 C C   . PHE B 1 93  ? 18.977  10.682  11.147  1.00 37.42 ? 140  PHE B C   1 
ATOM   1706 O O   . PHE B 1 93  ? 18.705  10.282  12.298  1.00 35.84 ? 140  PHE B O   1 
ATOM   1707 C CB  . PHE B 1 93  ? 19.726  8.868   9.526   1.00 37.83 ? 140  PHE B CB  1 
ATOM   1708 C CG  . PHE B 1 93  ? 20.349  8.161   10.662  1.00 39.52 ? 140  PHE B CG  1 
ATOM   1709 C CD1 . PHE B 1 93  ? 19.858  6.935   11.084  1.00 41.82 ? 140  PHE B CD1 1 
ATOM   1710 C CD2 . PHE B 1 93  ? 21.463  8.702   11.313  1.00 40.59 ? 140  PHE B CD2 1 
ATOM   1711 C CE1 . PHE B 1 93  ? 20.458  6.261   12.147  1.00 41.48 ? 140  PHE B CE1 1 
ATOM   1712 C CE2 . PHE B 1 93  ? 22.054  8.053   12.375  1.00 41.76 ? 140  PHE B CE2 1 
ATOM   1713 C CZ  . PHE B 1 93  ? 21.558  6.819   12.799  1.00 41.71 ? 140  PHE B CZ  1 
ATOM   1714 N N   . ARG B 1 94  ? 19.661  11.814  10.917  1.00 36.97 ? 141  ARG B N   1 
ATOM   1715 C CA  . ARG B 1 94  ? 20.093  12.646  12.042  1.00 37.30 ? 141  ARG B CA  1 
ATOM   1716 C C   . ARG B 1 94  ? 18.909  13.352  12.648  1.00 37.03 ? 141  ARG B C   1 
ATOM   1717 O O   . ARG B 1 94  ? 18.800  13.439  13.856  1.00 36.71 ? 141  ARG B O   1 
ATOM   1718 C CB  . ARG B 1 94  ? 21.100  13.738  11.666  1.00 37.20 ? 141  ARG B CB  1 
ATOM   1719 C CG  . ARG B 1 94  ? 22.327  13.259  11.012  1.00 38.74 ? 141  ARG B CG  1 
ATOM   1720 C CD  . ARG B 1 94  ? 23.511  14.152  11.341  1.00 37.18 ? 141  ARG B CD  1 
ATOM   1721 N NE  . ARG B 1 94  ? 24.705  13.343  11.133  1.00 38.08 ? 141  ARG B NE  1 
ATOM   1722 C CZ  . ARG B 1 94  ? 25.720  13.649  10.327  1.00 35.99 ? 141  ARG B CZ  1 
ATOM   1723 N NH1 . ARG B 1 94  ? 25.725  14.790  9.669   1.00 35.11 ? 141  ARG B NH1 1 
ATOM   1724 N NH2 . ARG B 1 94  ? 26.743  12.805  10.211  1.00 36.13 ? 141  ARG B NH2 1 
ATOM   1725 N N   . THR B 1 95  ? 18.061  13.913  11.803  1.00 37.28 ? 142  THR B N   1 
ATOM   1726 C CA  . THR B 1 95  ? 16.821  14.517  12.281  1.00 38.02 ? 142  THR B CA  1 
ATOM   1727 C C   . THR B 1 95  ? 15.950  13.535  13.059  1.00 38.29 ? 142  THR B C   1 
ATOM   1728 O O   . THR B 1 95  ? 15.405  13.898  14.115  1.00 38.43 ? 142  THR B O   1 
ATOM   1729 C CB  . THR B 1 95  ? 16.051  15.165  11.149  1.00 37.82 ? 142  THR B CB  1 
ATOM   1730 O OG1 . THR B 1 95  ? 16.882  16.176  10.572  1.00 36.60 ? 142  THR B OG1 1 
ATOM   1731 C CG2 . THR B 1 95  ? 14.723  15.802  11.649  1.00 39.18 ? 142  THR B CG2 1 
ATOM   1732 N N   . ARG B 1 96  ? 15.854  12.295  12.580  1.00 38.73 ? 143  ARG B N   1 
ATOM   1733 C CA  . ARG B 1 96  ? 15.082  11.260  13.278  1.00 39.28 ? 143  ARG B CA  1 
ATOM   1734 C C   . ARG B 1 96  ? 15.665  10.926  14.664  1.00 39.63 ? 143  ARG B C   1 
ATOM   1735 O O   . ARG B 1 96  ? 14.937  10.873  15.653  1.00 38.74 ? 143  ARG B O   1 
ATOM   1736 C CB  . ARG B 1 96  ? 14.994  9.986   12.441  1.00 39.20 ? 143  ARG B CB  1 
ATOM   1737 C CG  . ARG B 1 96  ? 14.198  8.850   13.138  1.00 40.93 ? 143  ARG B CG  1 
ATOM   1738 C CD  . ARG B 1 96  ? 14.244  7.564   12.336  1.00 43.01 ? 143  ARG B CD  1 
ATOM   1739 N NE  . ARG B 1 96  ? 13.768  7.855   10.988  1.00 48.09 ? 143  ARG B NE  1 
ATOM   1740 C CZ  . ARG B 1 96  ? 14.450  7.682   9.855   1.00 49.56 ? 143  ARG B CZ  1 
ATOM   1741 N NH1 . ARG B 1 96  ? 15.688  7.173   9.828   1.00 50.09 ? 143  ARG B NH1 1 
ATOM   1742 N NH2 . ARG B 1 96  ? 13.849  8.022   8.717   1.00 52.32 ? 143  ARG B NH2 1 
ATOM   1743 N N   . GLU B 1 97  ? 16.976  10.689  14.699  1.00 39.45 ? 144  GLU B N   1 
ATOM   1744 C CA  . GLU B 1 97  ? 17.697  10.353  15.920  1.00 40.99 ? 144  GLU B CA  1 
ATOM   1745 C C   . GLU B 1 97  ? 17.627  11.498  16.961  1.00 40.98 ? 144  GLU B C   1 
ATOM   1746 O O   . GLU B 1 97  ? 17.502  11.246  18.180  1.00 41.55 ? 144  GLU B O   1 
ATOM   1747 C CB  . GLU B 1 97  ? 19.127  9.955   15.553  1.00 40.63 ? 144  GLU B CB  1 
ATOM   1748 C CG  . GLU B 1 97  ? 20.141  9.976   16.635  1.00 43.33 ? 144  GLU B CG  1 
ATOM   1749 C CD  . GLU B 1 97  ? 21.576  9.838   16.098  1.00 44.20 ? 144  GLU B CD  1 
ATOM   1750 O OE1 . GLU B 1 97  ? 21.897  10.435  15.030  1.00 49.49 ? 144  GLU B OE1 1 
ATOM   1751 O OE2 . GLU B 1 97  ? 22.382  9.131   16.746  1.00 48.35 ? 144  GLU B OE2 1 
ATOM   1752 N N   . SER B 1 98  ? 17.652  12.745  16.502  1.00 40.44 ? 145  SER B N   1 
ATOM   1753 C CA  . SER B 1 98  ? 17.567  13.859  17.436  1.00 40.95 ? 145  SER B CA  1 
ATOM   1754 C C   . SER B 1 98  ? 16.123  14.144  17.888  1.00 40.41 ? 145  SER B C   1 
ATOM   1755 O O   . SER B 1 98  ? 15.883  14.553  19.035  1.00 40.22 ? 145  SER B O   1 
ATOM   1756 C CB  . SER B 1 98  ? 18.314  15.092  16.899  1.00 41.02 ? 145  SER B CB  1 
ATOM   1757 O OG  . SER B 1 98  ? 17.479  15.940  16.208  1.00 42.83 ? 145  SER B OG  1 
ATOM   1758 N N   . THR B 1 99  ? 15.161  13.863  17.031  1.00 40.23 ? 146  THR B N   1 
ATOM   1759 C CA  . THR B 1 99  ? 13.754  13.877  17.446  1.00 40.62 ? 146  THR B CA  1 
ATOM   1760 C C   . THR B 1 99  ? 13.490  12.757  18.497  1.00 40.80 ? 146  THR B C   1 
ATOM   1761 O O   . THR B 1 99  ? 12.786  12.987  19.483  1.00 39.89 ? 146  THR B O   1 
ATOM   1762 C CB  . THR B 1 99  ? 12.784  13.746  16.224  1.00 40.45 ? 146  THR B CB  1 
ATOM   1763 O OG1 . THR B 1 99  ? 12.954  14.852  15.315  1.00 38.10 ? 146  THR B OG1 1 
ATOM   1764 C CG2 . THR B 1 99  ? 11.316  13.711  16.697  1.00 40.23 ? 146  THR B CG2 1 
ATOM   1765 N N   . ALA B 1 100 ? 14.073  11.566  18.282  1.00 40.90 ? 147  ALA B N   1 
ATOM   1766 C CA  . ALA B 1 100 ? 13.869  10.434  19.173  1.00 41.84 ? 147  ALA B CA  1 
ATOM   1767 C C   . ALA B 1 100 ? 14.330  10.769  20.596  1.00 42.75 ? 147  ALA B C   1 
ATOM   1768 O O   . ALA B 1 100 ? 13.713  10.332  21.571  1.00 42.56 ? 147  ALA B O   1 
ATOM   1769 C CB  . ALA B 1 100 ? 14.588  9.194   18.660  1.00 41.78 ? 147  ALA B CB  1 
ATOM   1770 N N   . LYS B 1 101 ? 15.396  11.564  20.682  1.00 43.53 ? 148  LYS B N   1 
ATOM   1771 C CA  . LYS B 1 101 ? 15.994  11.998  21.935  1.00 44.64 ? 148  LYS B CA  1 
ATOM   1772 C C   . LYS B 1 101 ? 15.095  12.969  22.713  1.00 45.27 ? 148  LYS B C   1 
ATOM   1773 O O   . LYS B 1 101 ? 15.081  12.944  23.933  1.00 45.01 ? 148  LYS B O   1 
ATOM   1774 C CB  . LYS B 1 101 ? 17.344  12.703  21.673  1.00 44.85 ? 148  LYS B CB  1 
ATOM   1775 C CG  . LYS B 1 101 ? 18.541  11.811  21.339  1.00 45.73 ? 148  LYS B CG  1 
ATOM   1776 C CD  . LYS B 1 101 ? 19.751  12.673  20.863  1.00 45.38 ? 148  LYS B CD  1 
ATOM   1777 C CE  . LYS B 1 101 ? 21.071  11.876  20.765  1.00 45.00 ? 148  LYS B CE  1 
ATOM   1778 N N   . LYS B 1 102 ? 14.386  13.842  22.007  1.00 46.24 ? 149  LYS B N   1 
ATOM   1779 C CA  . LYS B 1 102 ? 13.504  14.826  22.641  1.00 47.04 ? 149  LYS B CA  1 
ATOM   1780 C C   . LYS B 1 102 ? 12.188  14.232  23.189  1.00 47.32 ? 149  LYS B C   1 
ATOM   1781 O O   . LYS B 1 102 ? 11.496  14.879  23.993  1.00 47.07 ? 149  LYS B O   1 
ATOM   1782 C CB  . LYS B 1 102 ? 13.148  15.926  21.636  1.00 47.20 ? 149  LYS B CB  1 
ATOM   1783 C CG  . LYS B 1 102 ? 14.287  16.782  21.107  1.00 47.55 ? 149  LYS B CG  1 
ATOM   1784 C CD  . LYS B 1 102 ? 13.821  17.437  19.803  1.00 48.06 ? 149  LYS B CD  1 
ATOM   1785 C CE  . LYS B 1 102 ? 14.710  18.555  19.282  1.00 48.78 ? 149  LYS B CE  1 
ATOM   1786 N NZ  . LYS B 1 102 ? 14.189  18.954  17.911  1.00 50.47 ? 149  LYS B NZ  1 
ATOM   1787 N N   . ILE B 1 103 ? 11.832  13.021  22.748  1.00 47.77 ? 150  ILE B N   1 
ATOM   1788 C CA  . ILE B 1 103 ? 10.536  12.401  23.092  1.00 47.77 ? 150  ILE B CA  1 
ATOM   1789 C C   . ILE B 1 103 ? 10.422  12.085  24.585  1.00 48.32 ? 150  ILE B C   1 
ATOM   1790 O O   . ILE B 1 103 ? 9.314   12.076  25.142  1.00 47.49 ? 150  ILE B O   1 
ATOM   1791 C CB  . ILE B 1 103 ? 10.281  11.077  22.291  1.00 47.96 ? 150  ILE B CB  1 
ATOM   1792 C CG1 . ILE B 1 103 ? 10.182  11.351  20.793  1.00 46.31 ? 150  ILE B CG1 1 
ATOM   1793 C CG2 . ILE B 1 103 ? 8.977   10.380  22.742  1.00 48.27 ? 150  ILE B CG2 1 
ATOM   1794 C CD1 . ILE B 1 103 ? 9.187   12.441  20.413  1.00 45.81 ? 150  ILE B CD1 1 
ATOM   1795 N N   . LYS B 1 104 ? 11.573  11.834  25.213  1.00 48.49 ? 151  LYS B N   1 
ATOM   1796 C CA  . LYS B 1 104 ? 11.615  11.369  26.584  1.00 48.91 ? 151  LYS B CA  1 
ATOM   1797 C C   . LYS B 1 104 ? 11.473  12.527  27.580  1.00 48.84 ? 151  LYS B C   1 
ATOM   1798 O O   . LYS B 1 104 ? 11.382  12.289  28.779  1.00 49.66 ? 151  LYS B O   1 
ATOM   1799 C CB  . LYS B 1 104 ? 12.913  10.574  26.845  1.00 49.05 ? 151  LYS B CB  1 
ATOM   1800 N N   . ALA B 1 105 ? 11.484  13.768  27.090  1.00 48.22 ? 152  ALA B N   1 
ATOM   1801 C CA  . ALA B 1 105 ? 11.207  14.944  27.924  1.00 47.39 ? 152  ALA B CA  1 
ATOM   1802 C C   . ALA B 1 105 ? 10.837  16.091  26.992  1.00 46.59 ? 152  ALA B C   1 
ATOM   1803 O O   . ALA B 1 105 ? 11.591  17.052  26.838  1.00 46.83 ? 152  ALA B O   1 
ATOM   1804 C CB  . ALA B 1 105 ? 12.419  15.304  28.783  1.00 47.51 ? 152  ALA B CB  1 
ATOM   1805 N N   . PRO B 1 106 ? 9.664   15.985  26.354  1.00 45.32 ? 153  PRO B N   1 
ATOM   1806 C CA  . PRO B 1 106 ? 9.378   16.800  25.197  1.00 44.30 ? 153  PRO B CA  1 
ATOM   1807 C C   . PRO B 1 106 ? 8.800   18.170  25.524  1.00 43.26 ? 153  PRO B C   1 
ATOM   1808 O O   . PRO B 1 106 ? 8.054   18.302  26.482  1.00 41.96 ? 153  PRO B O   1 
ATOM   1809 C CB  . PRO B 1 106 ? 8.355   15.947  24.446  1.00 44.88 ? 153  PRO B CB  1 
ATOM   1810 C CG  . PRO B 1 106 ? 7.631   15.223  25.494  1.00 44.47 ? 153  PRO B CG  1 
ATOM   1811 C CD  . PRO B 1 106 ? 8.540   15.092  26.679  1.00 45.09 ? 153  PRO B CD  1 
ATOM   1812 N N   . THR B 1 107 ? 9.130   19.166  24.705  1.00 41.83 ? 154  THR B N   1 
ATOM   1813 C CA  . THR B 1 107 ? 8.585   20.512  24.843  1.00 41.24 ? 154  THR B CA  1 
ATOM   1814 C C   . THR B 1 107 ? 7.696   20.785  23.635  1.00 40.91 ? 154  THR B C   1 
ATOM   1815 O O   . THR B 1 107 ? 7.608   19.958  22.728  1.00 40.29 ? 154  THR B O   1 
ATOM   1816 C CB  . THR B 1 107 ? 9.715   21.576  24.899  1.00 41.43 ? 154  THR B CB  1 
ATOM   1817 O OG1 . THR B 1 107 ? 10.183  21.848  23.568  1.00 41.53 ? 154  THR B OG1 1 
ATOM   1818 C CG2 . THR B 1 107 ? 10.858  21.092  25.777  1.00 41.43 ? 154  THR B CG2 1 
ATOM   1819 N N   . PRO B 1 108 ? 7.006   21.936  23.619  1.00 40.67 ? 155  PRO B N   1 
ATOM   1820 C CA  . PRO B 1 108 ? 6.202   22.303  22.450  1.00 41.03 ? 155  PRO B CA  1 
ATOM   1821 C C   . PRO B 1 108 ? 6.940   22.359  21.082  1.00 40.84 ? 155  PRO B C   1 
ATOM   1822 O O   . PRO B 1 108 ? 6.289   22.270  20.058  1.00 40.85 ? 155  PRO B O   1 
ATOM   1823 C CB  . PRO B 1 108 ? 5.665   23.681  22.837  1.00 40.90 ? 155  PRO B CB  1 
ATOM   1824 C CG  . PRO B 1 108 ? 5.629   23.649  24.312  1.00 41.07 ? 155  PRO B CG  1 
ATOM   1825 C CD  . PRO B 1 108 ? 6.859   22.926  24.697  1.00 41.02 ? 155  PRO B CD  1 
ATOM   1826 N N   . THR B 1 109 ? 8.269   22.504  21.083  1.00 41.25 ? 156  THR B N   1 
ATOM   1827 C CA  . THR B 1 109 ? 9.057   22.598  19.841  1.00 40.98 ? 156  THR B CA  1 
ATOM   1828 C C   . THR B 1 109 ? 9.769   21.282  19.462  1.00 41.15 ? 156  THR B C   1 
ATOM   1829 O O   . THR B 1 109 ? 10.543  21.249  18.495  1.00 41.95 ? 156  THR B O   1 
ATOM   1830 C CB  . THR B 1 109 ? 10.137  23.712  19.941  1.00 41.48 ? 156  THR B CB  1 
ATOM   1831 O OG1 . THR B 1 109 ? 10.938  23.493  21.100  1.00 41.27 ? 156  THR B OG1 1 
ATOM   1832 C CG2 . THR B 1 109 ? 9.522   25.100  20.006  1.00 41.45 ? 156  THR B CG2 1 
ATOM   1833 N N   . CYS B 1 110 ? 9.480   20.208  20.206  1.00 40.72 ? 157  CYS B N   1 
ATOM   1834 C CA  . CYS B 1 110 ? 9.989   18.851  19.971  1.00 39.99 ? 157  CYS B CA  1 
ATOM   1835 C C   . CYS B 1 110 ? 10.074  18.431  18.473  1.00 39.62 ? 157  CYS B C   1 
ATOM   1836 O O   . CYS B 1 110 ? 11.088  17.861  18.028  1.00 38.19 ? 157  CYS B O   1 
ATOM   1837 C CB  . CYS B 1 110 ? 9.091   17.857  20.733  1.00 40.18 ? 157  CYS B CB  1 
ATOM   1838 S SG  . CYS B 1 110 ? 9.455   16.092  20.480  1.00 41.69 ? 157  CYS B SG  1 
ATOM   1839 N N   . PHE B 1 111 ? 9.000   18.708  17.729  1.00 39.23 ? 158  PHE B N   1 
ATOM   1840 C CA  . PHE B 1 111 ? 8.856   18.263  16.347  1.00 39.26 ? 158  PHE B CA  1 
ATOM   1841 C C   . PHE B 1 111 ? 9.190   19.318  15.262  1.00 39.19 ? 158  PHE B C   1 
ATOM   1842 O O   . PHE B 1 111 ? 9.077   19.037  14.061  1.00 38.41 ? 158  PHE B O   1 
ATOM   1843 C CB  . PHE B 1 111 ? 7.438   17.698  16.135  1.00 38.81 ? 158  PHE B CB  1 
ATOM   1844 C CG  . PHE B 1 111 ? 7.168   16.449  16.932  1.00 37.97 ? 158  PHE B CG  1 
ATOM   1845 C CD1 . PHE B 1 111 ? 7.813   15.261  16.604  1.00 37.79 ? 158  PHE B CD1 1 
ATOM   1846 C CD2 . PHE B 1 111 ? 6.303   16.467  18.030  1.00 37.02 ? 158  PHE B CD2 1 
ATOM   1847 C CE1 . PHE B 1 111 ? 7.584   14.105  17.334  1.00 38.13 ? 158  PHE B CE1 1 
ATOM   1848 C CE2 . PHE B 1 111 ? 6.066   15.329  18.743  1.00 36.75 ? 158  PHE B CE2 1 
ATOM   1849 C CZ  . PHE B 1 111 ? 6.715   14.142  18.410  1.00 36.58 ? 158  PHE B CZ  1 
ATOM   1850 N N   . ASP B 1 112 ? 9.649   20.498  15.680  1.00 39.92 ? 159  ASP B N   1 
ATOM   1851 C CA  . ASP B 1 112 ? 9.908   21.599  14.757  1.00 39.93 ? 159  ASP B CA  1 
ATOM   1852 C C   . ASP B 1 112 ? 10.877  21.215  13.618  1.00 39.92 ? 159  ASP B C   1 
ATOM   1853 O O   . ASP B 1 112 ? 10.639  21.565  12.468  1.00 38.45 ? 159  ASP B O   1 
ATOM   1854 C CB  . ASP B 1 112 ? 10.479  22.810  15.510  1.00 40.75 ? 159  ASP B CB  1 
ATOM   1855 C CG  . ASP B 1 112 ? 9.400   23.704  16.146  1.00 42.82 ? 159  ASP B CG  1 
ATOM   1856 O OD1 . ASP B 1 112 ? 8.191   23.384  16.086  1.00 45.45 ? 159  ASP B OD1 1 
ATOM   1857 O OD2 . ASP B 1 112 ? 9.796   24.759  16.699  1.00 46.53 ? 159  ASP B OD2 1 
ATOM   1858 N N   . GLU B 1 113 ? 11.964  20.519  13.953  1.00 40.21 ? 160  GLU B N   1 
ATOM   1859 C CA  . GLU B 1 113 ? 12.971  20.119  12.950  1.00 41.39 ? 160  GLU B CA  1 
ATOM   1860 C C   . GLU B 1 113 ? 12.383  19.130  11.962  1.00 39.19 ? 160  GLU B C   1 
ATOM   1861 O O   . GLU B 1 113 ? 12.531  19.280  10.756  1.00 40.41 ? 160  GLU B O   1 
ATOM   1862 C CB  . GLU B 1 113 ? 14.227  19.505  13.609  1.00 40.69 ? 160  GLU B CB  1 
ATOM   1863 C CG  . GLU B 1 113 ? 15.284  20.536  14.015  1.00 44.77 ? 160  GLU B CG  1 
ATOM   1864 C CD  . GLU B 1 113 ? 16.552  19.906  14.614  1.00 46.01 ? 160  GLU B CD  1 
ATOM   1865 O OE1 . GLU B 1 113 ? 16.692  18.651  14.592  1.00 51.81 ? 160  GLU B OE1 1 
ATOM   1866 O OE2 . GLU B 1 113 ? 17.416  20.680  15.103  1.00 52.63 ? 160  GLU B OE2 1 
ATOM   1867 N N   . ALA B 1 114 ? 11.726  18.099  12.478  1.00 38.80 ? 161  ALA B N   1 
ATOM   1868 C CA  . ALA B 1 114 ? 11.061  17.111  11.624  1.00 36.95 ? 161  ALA B CA  1 
ATOM   1869 C C   . ALA B 1 114 ? 9.991   17.741  10.772  1.00 37.19 ? 161  ALA B C   1 
ATOM   1870 O O   . ALA B 1 114 ? 9.861   17.402  9.579   1.00 35.03 ? 161  ALA B O   1 
ATOM   1871 C CB  . ALA B 1 114 ? 10.510  15.980  12.436  1.00 36.76 ? 161  ALA B CB  1 
ATOM   1872 N N   . GLN B 1 115 ? 9.237   18.684  11.364  1.00 37.81 ? 162  GLN B N   1 
ATOM   1873 C CA  . GLN B 1 115 ? 8.121   19.309  10.680  1.00 37.37 ? 162  GLN B CA  1 
ATOM   1874 C C   . GLN B 1 115 ? 8.622   20.212  9.526   1.00 37.07 ? 162  GLN B C   1 
ATOM   1875 O O   . GLN B 1 115 ? 7.998   20.292  8.489   1.00 34.78 ? 162  GLN B O   1 
ATOM   1876 C CB  . GLN B 1 115 ? 7.243   20.105  11.653  1.00 37.74 ? 162  GLN B CB  1 
ATOM   1877 C CG  . GLN B 1 115 ? 6.000   20.719  10.990  1.00 38.67 ? 162  GLN B CG  1 
ATOM   1878 C CD  . GLN B 1 115 ? 5.159   21.657  11.925  1.00 36.69 ? 162  GLN B CD  1 
ATOM   1879 O OE1 . GLN B 1 115 ? 5.674   22.280  12.828  1.00 39.24 ? 162  GLN B OE1 1 
ATOM   1880 N NE2 . GLN B 1 115 ? 3.871   21.734  11.665  1.00 38.96 ? 162  GLN B NE2 1 
ATOM   1881 N N   . LYS B 1 116 ? 9.732   20.905  9.724   1.00 38.67 ? 163  LYS B N   1 
ATOM   1882 C CA  . LYS B 1 116 ? 10.297  21.728  8.660   1.00 39.13 ? 163  LYS B CA  1 
ATOM   1883 C C   . LYS B 1 116 ? 10.782  20.882  7.483   1.00 37.56 ? 163  LYS B C   1 
ATOM   1884 O O   . LYS B 1 116 ? 10.566  21.237  6.349   1.00 38.39 ? 163  LYS B O   1 
ATOM   1885 C CB  . LYS B 1 116 ? 11.382  22.661  9.198   1.00 39.97 ? 163  LYS B CB  1 
ATOM   1886 C CG  . LYS B 1 116 ? 11.965  23.614  8.132   1.00 40.68 ? 163  LYS B CG  1 
ATOM   1887 C CD  . LYS B 1 116 ? 12.691  24.838  8.784   1.00 43.25 ? 163  LYS B CD  1 
ATOM   1888 C CE  . LYS B 1 116 ? 13.447  25.666  7.753   1.00 44.04 ? 163  LYS B CE  1 
ATOM   1889 N NZ  . LYS B 1 116 ? 14.626  26.308  8.399   1.00 48.06 ? 163  LYS B NZ  1 
ATOM   1890 N N   . VAL B 1 117 ? 11.403  19.745  7.748   1.00 36.93 ? 164  VAL B N   1 
ATOM   1891 C CA  . VAL B 1 117 ? 11.793  18.810  6.683   1.00 36.98 ? 164  VAL B CA  1 
ATOM   1892 C C   . VAL B 1 117 ? 10.570  18.402  5.830   1.00 36.93 ? 164  VAL B C   1 
ATOM   1893 O O   . VAL B 1 117 ? 10.575  18.463  4.584   1.00 35.08 ? 164  VAL B O   1 
ATOM   1894 C CB  . VAL B 1 117 ? 12.500  17.532  7.270   1.00 36.11 ? 164  VAL B CB  1 
ATOM   1895 C CG1 . VAL B 1 117 ? 12.764  16.513  6.215   1.00 36.60 ? 164  VAL B CG1 1 
ATOM   1896 C CG2 . VAL B 1 117 ? 13.798  17.902  7.935   1.00 37.43 ? 164  VAL B CG2 1 
ATOM   1897 N N   . ILE B 1 118 ? 9.514   17.971  6.524   1.00 36.68 ? 165  ILE B N   1 
ATOM   1898 C CA  . ILE B 1 118 ? 8.355   17.470  5.855   1.00 36.60 ? 165  ILE B CA  1 
ATOM   1899 C C   . ILE B 1 118 ? 7.635   18.604  5.139   1.00 36.02 ? 165  ILE B C   1 
ATOM   1900 O O   . ILE B 1 118 ? 7.093   18.394  4.097   1.00 35.93 ? 165  ILE B O   1 
ATOM   1901 C CB  . ILE B 1 118 ? 7.336   16.786  6.876   1.00 36.84 ? 165  ILE B CB  1 
ATOM   1902 C CG1 . ILE B 1 118 ? 7.925   15.513  7.521   1.00 38.25 ? 165  ILE B CG1 1 
ATOM   1903 C CG2 . ILE B 1 118 ? 5.992   16.477  6.184   1.00 37.94 ? 165  ILE B CG2 1 
ATOM   1904 C CD1 . ILE B 1 118 ? 8.469   14.422  6.511   1.00 39.77 ? 165  ILE B CD1 1 
ATOM   1905 N N   . TYR B 1 119 ? 7.601   19.804  5.706   1.00 37.08 ? 166  TYR B N   1 
ATOM   1906 C CA  . TYR B 1 119 ? 6.995   20.921  4.991   1.00 37.54 ? 166  TYR B CA  1 
ATOM   1907 C C   . TYR B 1 119 ? 7.766   21.169  3.655   1.00 36.95 ? 166  TYR B C   1 
ATOM   1908 O O   . TYR B 1 119 ? 7.180   21.250  2.600   1.00 35.54 ? 166  TYR B O   1 
ATOM   1909 C CB  . TYR B 1 119 ? 6.970   22.147  5.894   1.00 39.04 ? 166  TYR B CB  1 
ATOM   1910 C CG  . TYR B 1 119 ? 6.370   23.377  5.256   1.00 42.07 ? 166  TYR B CG  1 
ATOM   1911 C CD1 . TYR B 1 119 ? 5.011   23.627  5.343   1.00 43.23 ? 166  TYR B CD1 1 
ATOM   1912 C CD2 . TYR B 1 119 ? 7.157   24.284  4.563   1.00 42.11 ? 166  TYR B CD2 1 
ATOM   1913 C CE1 . TYR B 1 119 ? 4.446   24.742  4.748   1.00 44.34 ? 166  TYR B CE1 1 
ATOM   1914 C CE2 . TYR B 1 119 ? 6.598   25.403  3.963   1.00 44.60 ? 166  TYR B CE2 1 
ATOM   1915 C CZ  . TYR B 1 119 ? 5.230   25.625  4.079   1.00 45.05 ? 166  TYR B CZ  1 
ATOM   1916 O OH  . TYR B 1 119 ? 4.651   26.736  3.506   1.00 46.36 ? 166  TYR B OH  1 
ATOM   1917 N N   . THR B 1 120 ? 9.090   21.197  3.728   1.00 37.95 ? 167  THR B N   1 
ATOM   1918 C CA  . THR B 1 120 ? 9.974   21.413  2.548   1.00 38.07 ? 167  THR B CA  1 
ATOM   1919 C C   . THR B 1 120 ? 9.803   20.337  1.483   1.00 38.63 ? 167  THR B C   1 
ATOM   1920 O O   . THR B 1 120 ? 9.727   20.618  0.273   1.00 38.46 ? 167  THR B O   1 
ATOM   1921 C CB  . THR B 1 120 ? 11.434  21.474  3.024   1.00 37.69 ? 167  THR B CB  1 
ATOM   1922 O OG1 . THR B 1 120 ? 11.538  22.494  3.986   1.00 37.45 ? 167  THR B OG1 1 
ATOM   1923 C CG2 . THR B 1 120 ? 12.435  21.751  1.898   1.00 37.77 ? 167  THR B CG2 1 
ATOM   1924 N N   . LEU B 1 121 ? 9.687   19.104  1.943   1.00 39.56 ? 168  LEU B N   1 
ATOM   1925 C CA  . LEU B 1 121 ? 9.377   17.975  1.076   1.00 40.05 ? 168  LEU B CA  1 
ATOM   1926 C C   . LEU B 1 121 ? 8.093   18.110  0.313   1.00 38.89 ? 168  LEU B C   1 
ATOM   1927 O O   . LEU B 1 121 ? 8.025   17.823  -0.848  1.00 38.31 ? 168  LEU B O   1 
ATOM   1928 C CB  . LEU B 1 121 ? 9.250   16.696  1.881   1.00 41.08 ? 168  LEU B CB  1 
ATOM   1929 C CG  . LEU B 1 121 ? 10.514  15.918  2.195   1.00 44.02 ? 168  LEU B CG  1 
ATOM   1930 C CD1 . LEU B 1 121 ? 10.026  14.497  2.573   1.00 46.05 ? 168  LEU B CD1 1 
ATOM   1931 C CD2 . LEU B 1 121 ? 11.499  15.907  1.076   1.00 46.41 ? 168  LEU B CD2 1 
ATOM   1932 N N   . MET B 1 122 ? 7.051   18.487  1.001   1.00 39.23 ? 169  MET B N   1 
ATOM   1933 C CA  . MET B 1 122 ? 5.787   18.778  0.317   1.00 40.06 ? 169  MET B CA  1 
ATOM   1934 C C   . MET B 1 122 ? 5.888   20.010  -0.615  1.00 39.33 ? 169  MET B C   1 
ATOM   1935 O O   . MET B 1 122 ? 5.384   20.023  -1.746  1.00 40.17 ? 169  MET B O   1 
ATOM   1936 C CB  . MET B 1 122 ? 4.679   18.983  1.365   1.00 38.41 ? 169  MET B CB  1 
ATOM   1937 C CG  . MET B 1 122 ? 4.276   17.720  2.196   1.00 41.38 ? 169  MET B CG  1 
ATOM   1938 S SD  . MET B 1 122 ? 2.765   18.119  3.160   1.00 42.13 ? 169  MET B SD  1 
ATOM   1939 C CE  . MET B 1 122 ? 3.366   19.233  4.371   1.00 40.17 ? 169  MET B CE  1 
ATOM   1940 N N   . GLU B 1 123 ? 6.559   21.032  -0.139  1.00 39.84 ? 170  GLU B N   1 
ATOM   1941 C CA  . GLU B 1 123 ? 6.708   22.265  -0.887  1.00 41.30 ? 170  GLU B CA  1 
ATOM   1942 C C   . GLU B 1 123 ? 7.385   22.085  -2.229  1.00 40.95 ? 170  GLU B C   1 
ATOM   1943 O O   . GLU B 1 123 ? 6.938   22.654  -3.188  1.00 40.71 ? 170  GLU B O   1 
ATOM   1944 C CB  . GLU B 1 123 ? 7.437   23.315  -0.065  1.00 40.78 ? 170  GLU B CB  1 
ATOM   1945 C CG  . GLU B 1 123 ? 7.069   24.676  -0.502  1.00 44.13 ? 170  GLU B CG  1 
ATOM   1946 C CD  . GLU B 1 123 ? 7.869   25.765  0.191   1.00 45.37 ? 170  GLU B CD  1 
ATOM   1947 O OE1 . GLU B 1 123 ? 9.007   25.474  0.654   1.00 49.63 ? 170  GLU B OE1 1 
ATOM   1948 O OE2 . GLU B 1 123 ? 7.329   26.897  0.258   1.00 50.03 ? 170  GLU B OE2 1 
ATOM   1949 N N   . LYS B 1 124 ? 8.402   21.228  -2.272  1.00 41.57 ? 171  LYS B N   1 
ATOM   1950 C CA  . LYS B 1 124 ? 9.210   20.933  -3.466  1.00 41.48 ? 171  LYS B CA  1 
ATOM   1951 C C   . LYS B 1 124 ? 8.692   19.815  -4.337  1.00 41.13 ? 171  LYS B C   1 
ATOM   1952 O O   . LYS B 1 124 ? 8.992   19.778  -5.514  1.00 40.41 ? 171  LYS B O   1 
ATOM   1953 C CB  . LYS B 1 124 ? 10.645  20.620  -3.045  1.00 41.80 ? 171  LYS B CB  1 
ATOM   1954 C CG  . LYS B 1 124 ? 11.332  21.745  -2.294  1.00 44.12 ? 171  LYS B CG  1 
ATOM   1955 C CD  . LYS B 1 124 ? 10.741  23.133  -2.629  1.00 48.90 ? 171  LYS B CD  1 
ATOM   1956 C CE  . LYS B 1 124 ? 11.742  24.286  -2.535  1.00 49.72 ? 171  LYS B CE  1 
ATOM   1957 N NZ  . LYS B 1 124 ? 11.202  25.348  -3.424  1.00 53.96 ? 171  LYS B NZ  1 
ATOM   1958 N N   . ASP B 1 125 ? 7.851   18.931  -3.800  1.00 40.66 ? 172  ASP B N   1 
ATOM   1959 C CA  . ASP B 1 125 ? 7.515   17.694  -4.520  1.00 40.47 ? 172  ASP B CA  1 
ATOM   1960 C C   . ASP B 1 125 ? 5.995   17.583  -4.775  1.00 39.28 ? 172  ASP B C   1 
ATOM   1961 O O   . ASP B 1 125 ? 5.518   17.805  -5.891  1.00 38.57 ? 172  ASP B O   1 
ATOM   1962 C CB  . ASP B 1 125 ? 8.060   16.480  -3.713  1.00 41.27 ? 172  ASP B CB  1 
ATOM   1963 C CG  . ASP B 1 125 ? 7.703   15.146  -4.337  1.00 43.75 ? 172  ASP B CG  1 
ATOM   1964 O OD1 . ASP B 1 125 ? 7.594   15.084  -5.569  1.00 48.08 ? 172  ASP B OD1 1 
ATOM   1965 O OD2 . ASP B 1 125 ? 7.534   14.161  -3.602  1.00 48.56 ? 172  ASP B OD2 1 
ATOM   1966 N N   . SER B 1 126 ? 5.246   17.252  -3.731  1.00 37.37 ? 173  SER B N   1 
ATOM   1967 C CA  . SER B 1 126 ? 3.833   16.984  -3.903  1.00 37.98 ? 173  SER B CA  1 
ATOM   1968 C C   . SER B 1 126 ? 3.006   18.227  -4.190  1.00 37.16 ? 173  SER B C   1 
ATOM   1969 O O   . SER B 1 126 ? 2.050   18.154  -4.970  1.00 36.37 ? 173  SER B O   1 
ATOM   1970 C CB  . SER B 1 126 ? 3.270   16.261  -2.685  1.00 37.13 ? 173  SER B CB  1 
ATOM   1971 O OG  . SER B 1 126 ? 3.637   16.936  -1.514  1.00 37.72 ? 173  SER B OG  1 
ATOM   1972 N N   . TYR B 1 127 ? 3.368   19.358  -3.579  1.00 37.09 ? 174  TYR B N   1 
ATOM   1973 C CA  . TYR B 1 127 ? 2.584   20.573  -3.769  1.00 37.55 ? 174  TYR B CA  1 
ATOM   1974 C C   . TYR B 1 127 ? 2.572   21.078  -5.271  1.00 37.96 ? 174  TYR B C   1 
ATOM   1975 O O   . TYR B 1 127 ? 1.509   21.297  -5.840  1.00 37.66 ? 174  TYR B O   1 
ATOM   1976 C CB  . TYR B 1 127 ? 3.030   21.634  -2.759  1.00 38.42 ? 174  TYR B CB  1 
ATOM   1977 C CG  . TYR B 1 127 ? 2.511   23.022  -3.040  1.00 36.88 ? 174  TYR B CG  1 
ATOM   1978 C CD1 . TYR B 1 127 ? 1.158   23.321  -2.931  1.00 34.71 ? 174  TYR B CD1 1 
ATOM   1979 C CD2 . TYR B 1 127 ? 3.388   24.039  -3.367  1.00 38.44 ? 174  TYR B CD2 1 
ATOM   1980 C CE1 . TYR B 1 127 ? 0.683   24.568  -3.177  1.00 35.16 ? 174  TYR B CE1 1 
ATOM   1981 C CE2 . TYR B 1 127 ? 2.934   25.303  -3.650  1.00 34.87 ? 174  TYR B CE2 1 
ATOM   1982 C CZ  . TYR B 1 127 ? 1.619   25.577  -3.564  1.00 37.50 ? 174  TYR B CZ  1 
ATOM   1983 O OH  . TYR B 1 127 ? 1.249   26.847  -3.817  1.00 38.43 ? 174  TYR B OH  1 
ATOM   1984 N N   . PRO B 1 128 ? 3.741   21.215  -5.919  1.00 37.96 ? 175  PRO B N   1 
ATOM   1985 C CA  . PRO B 1 128 ? 3.734   21.551  -7.346  1.00 38.47 ? 175  PRO B CA  1 
ATOM   1986 C C   . PRO B 1 128 ? 2.953   20.551  -8.211  1.00 38.57 ? 175  PRO B C   1 
ATOM   1987 O O   . PRO B 1 128 ? 2.232   20.932  -9.121  1.00 38.25 ? 175  PRO B O   1 
ATOM   1988 C CB  . PRO B 1 128 ? 5.217   21.526  -7.713  1.00 38.89 ? 175  PRO B CB  1 
ATOM   1989 C CG  . PRO B 1 128 ? 5.919   21.722  -6.501  1.00 39.14 ? 175  PRO B CG  1 
ATOM   1990 C CD  . PRO B 1 128 ? 5.113   21.128  -5.410  1.00 37.20 ? 175  PRO B CD  1 
ATOM   1991 N N   . ARG B 1 129 ? 3.042   19.281  -7.893  1.00 38.73 ? 176  ARG B N   1 
ATOM   1992 C CA  . ARG B 1 129 ? 2.281   18.298  -8.649  1.00 39.11 ? 176  ARG B CA  1 
ATOM   1993 C C   . ARG B 1 129 ? 0.792   18.419  -8.374  1.00 37.57 ? 176  ARG B C   1 
ATOM   1994 O O   . ARG B 1 129 ? -0.010  18.283  -9.280  1.00 36.15 ? 176  ARG B O   1 
ATOM   1995 C CB  A ARG B 1 129 ? 2.868   16.914  -8.445  0.50 39.12 ? 176  ARG B CB  1 
ATOM   1996 C CB  B ARG B 1 129 ? 2.717   16.889  -8.265  0.50 39.41 ? 176  ARG B CB  1 
ATOM   1997 C CG  A ARG B 1 129 ? 4.304   16.890  -8.999  0.50 38.65 ? 176  ARG B CG  1 
ATOM   1998 C CG  B ARG B 1 129 ? 2.609   15.854  -9.373  0.50 41.13 ? 176  ARG B CG  1 
ATOM   1999 C CD  A ARG B 1 129 ? 4.964   15.543  -8.911  0.50 39.32 ? 176  ARG B CD  1 
ATOM   2000 C CD  B ARG B 1 129 ? 2.356   14.449  -8.829  0.50 41.32 ? 176  ARG B CD  1 
ATOM   2001 N NE  A ARG B 1 129 ? 5.100   15.065  -7.533  0.50 39.42 ? 176  ARG B NE  1 
ATOM   2002 N NE  B ARG B 1 129 ? 2.818   14.284  -7.443  0.50 42.54 ? 176  ARG B NE  1 
ATOM   2003 C CZ  A ARG B 1 129 ? 4.282   14.203  -6.939  0.50 40.02 ? 176  ARG B CZ  1 
ATOM   2004 C CZ  B ARG B 1 129 ? 4.091   14.209  -7.070  0.50 42.64 ? 176  ARG B CZ  1 
ATOM   2005 N NH1 A ARG B 1 129 ? 4.507   13.822  -5.676  0.50 39.20 ? 176  ARG B NH1 1 
ATOM   2006 N NH1 B ARG B 1 129 ? 4.399   14.039  -5.782  0.50 42.52 ? 176  ARG B NH1 1 
ATOM   2007 N NH2 A ARG B 1 129 ? 3.244   13.713  -7.598  0.50 39.63 ? 176  ARG B NH2 1 
ATOM   2008 N NH2 B ARG B 1 129 ? 5.059   14.306  -7.969  0.50 42.82 ? 176  ARG B NH2 1 
ATOM   2009 N N   . PHE B 1 130 ? 0.423   18.769  -7.144  1.00 36.84 ? 177  PHE B N   1 
ATOM   2010 C CA  . PHE B 1 130 ? -0.979  19.031  -6.825  1.00 35.65 ? 177  PHE B CA  1 
ATOM   2011 C C   . PHE B 1 130 ? -1.612  20.136  -7.708  1.00 35.98 ? 177  PHE B C   1 
ATOM   2012 O O   . PHE B 1 130 ? -2.741  20.003  -8.206  1.00 35.29 ? 177  PHE B O   1 
ATOM   2013 C CB  . PHE B 1 130 ? -1.099  19.333  -5.356  1.00 35.13 ? 177  PHE B CB  1 
ATOM   2014 C CG  . PHE B 1 130 ? -2.430  19.885  -4.939  1.00 35.46 ? 177  PHE B CG  1 
ATOM   2015 C CD1 . PHE B 1 130 ? -3.567  19.081  -4.939  1.00 36.09 ? 177  PHE B CD1 1 
ATOM   2016 C CD2 . PHE B 1 130 ? -2.536  21.179  -4.500  1.00 36.56 ? 177  PHE B CD2 1 
ATOM   2017 C CE1 . PHE B 1 130 ? -4.774  19.572  -4.519  1.00 36.18 ? 177  PHE B CE1 1 
ATOM   2018 C CE2 . PHE B 1 130 ? -3.773  21.701  -4.050  1.00 36.38 ? 177  PHE B CE2 1 
ATOM   2019 C CZ  . PHE B 1 130 ? -4.883  20.897  -4.081  1.00 35.97 ? 177  PHE B CZ  1 
ATOM   2020 N N   . LEU B 1 131 ? -0.851  21.193  -7.928  1.00 36.31 ? 178  LEU B N   1 
ATOM   2021 C CA  . LEU B 1 131 ? -1.283  22.348  -8.685  1.00 36.34 ? 178  LEU B CA  1 
ATOM   2022 C C   . LEU B 1 131 ? -1.519  22.016  -10.124 1.00 36.63 ? 178  LEU B C   1 
ATOM   2023 O O   . LEU B 1 131 ? -2.288  22.688  -10.768 1.00 35.62 ? 178  LEU B O   1 
ATOM   2024 C CB  . LEU B 1 131 ? -0.237  23.494  -8.561  1.00 37.24 ? 178  LEU B CB  1 
ATOM   2025 C CG  . LEU B 1 131 ? -0.012  24.113  -7.177  1.00 36.36 ? 178  LEU B CG  1 
ATOM   2026 C CD1 . LEU B 1 131 ? 0.979   25.301  -7.238  1.00 37.75 ? 178  LEU B CD1 1 
ATOM   2027 C CD2 . LEU B 1 131 ? -1.374  24.556  -6.563  1.00 37.89 ? 178  LEU B CD2 1 
ATOM   2028 N N   . LYS B 1 132 ? -0.904  20.944  -10.624 1.00 37.40 ? 179  LYS B N   1 
ATOM   2029 C CA  . LYS B 1 132 ? -1.150  20.472  -11.974 1.00 38.29 ? 179  LYS B CA  1 
ATOM   2030 C C   . LYS B 1 132 ? -2.173  19.322  -12.031 1.00 37.78 ? 179  LYS B C   1 
ATOM   2031 O O   . LYS B 1 132 ? -2.441  18.744  -13.095 1.00 38.19 ? 179  LYS B O   1 
ATOM   2032 C CB  . LYS B 1 132 ? 0.171   20.012  -12.607 1.00 38.63 ? 179  LYS B CB  1 
ATOM   2033 C CG  . LYS B 1 132 ? 1.207   21.112  -12.643 1.00 39.28 ? 179  LYS B CG  1 
ATOM   2034 C CD  . LYS B 1 132 ? 2.360   20.843  -13.601 1.00 40.52 ? 179  LYS B CD  1 
ATOM   2035 N N   . SER B 1 133 ? -2.718  18.959  -10.888 1.00 37.83 ? 180  SER B N   1 
ATOM   2036 C CA  . SER B 1 133 ? -3.623  17.804  -10.836 1.00 37.25 ? 180  SER B CA  1 
ATOM   2037 C C   . SER B 1 133 ? -5.035  18.116  -11.324 1.00 36.20 ? 180  SER B C   1 
ATOM   2038 O O   . SER B 1 133 ? -5.472  19.235  -11.274 1.00 36.65 ? 180  SER B O   1 
ATOM   2039 C CB  . SER B 1 133 ? -3.658  17.250  -9.409  1.00 37.58 ? 180  SER B CB  1 
ATOM   2040 O OG  . SER B 1 133 ? -4.331  18.124  -8.564  1.00 36.83 ? 180  SER B OG  1 
ATOM   2041 N N   . ASP B 1 134 ? -5.758  17.097  -11.766 1.00 36.16 ? 181  ASP B N   1 
ATOM   2042 C CA  . ASP B 1 134 ? -7.191  17.197  -12.038 1.00 37.25 ? 181  ASP B CA  1 
ATOM   2043 C C   . ASP B 1 134 ? -7.997  17.691  -10.863 1.00 36.91 ? 181  ASP B C   1 
ATOM   2044 O O   . ASP B 1 134 ? -8.848  18.528  -11.011 1.00 36.56 ? 181  ASP B O   1 
ATOM   2045 C CB  . ASP B 1 134 ? -7.738  15.826  -12.424 1.00 38.21 ? 181  ASP B CB  1 
ATOM   2046 C CG  . ASP B 1 134 ? -7.400  15.473  -13.835 1.00 42.28 ? 181  ASP B CG  1 
ATOM   2047 O OD1 . ASP B 1 134 ? -6.705  16.306  -14.470 1.00 46.77 ? 181  ASP B OD1 1 
ATOM   2048 O OD2 . ASP B 1 134 ? -7.831  14.400  -14.300 1.00 46.58 ? 181  ASP B OD2 1 
ATOM   2049 N N   . ILE B 1 135 ? -7.727  17.155  -9.676  1.00 37.23 ? 182  ILE B N   1 
ATOM   2050 C CA  . ILE B 1 135 ? -8.548  17.514  -8.521  1.00 37.60 ? 182  ILE B CA  1 
ATOM   2051 C C   . ILE B 1 135 ? -8.445  19.043  -8.200  1.00 36.63 ? 182  ILE B C   1 
ATOM   2052 O O   . ILE B 1 135 ? -9.449  19.705  -7.906  1.00 36.86 ? 182  ILE B O   1 
ATOM   2053 C CB  . ILE B 1 135 ? -8.264  16.553  -7.342  1.00 37.75 ? 182  ILE B CB  1 
ATOM   2054 C CG1 . ILE B 1 135 ? -9.334  16.709  -6.252  1.00 39.17 ? 182  ILE B CG1 1 
ATOM   2055 C CG2 . ILE B 1 135 ? -6.909  16.774  -6.818  1.00 38.84 ? 182  ILE B CG2 1 
ATOM   2056 C CD1 . ILE B 1 135 ? -9.139  15.793  -5.059  1.00 40.91 ? 182  ILE B CD1 1 
ATOM   2057 N N   . TYR B 1 136 ? -7.241  19.606  -8.293  1.00 35.88 ? 183  TYR B N   1 
ATOM   2058 C CA  . TYR B 1 136 ? -7.069  21.039  -8.115  1.00 35.91 ? 183  TYR B CA  1 
ATOM   2059 C C   . TYR B 1 136 ? -7.677  21.854  -9.273  1.00 34.66 ? 183  TYR B C   1 
ATOM   2060 O O   . TYR B 1 136 ? -8.579  22.702  -9.048  1.00 34.47 ? 183  TYR B O   1 
ATOM   2061 C CB  . TYR B 1 136 ? -5.594  21.392  -7.918  1.00 35.79 ? 183  TYR B CB  1 
ATOM   2062 C CG  . TYR B 1 136 ? -5.378  22.893  -7.785  1.00 35.19 ? 183  TYR B CG  1 
ATOM   2063 C CD1 . TYR B 1 136 ? -5.865  23.567  -6.687  1.00 34.17 ? 183  TYR B CD1 1 
ATOM   2064 C CD2 . TYR B 1 136 ? -4.768  23.633  -8.809  1.00 33.96 ? 183  TYR B CD2 1 
ATOM   2065 C CE1 . TYR B 1 136 ? -5.704  24.982  -6.546  1.00 37.71 ? 183  TYR B CE1 1 
ATOM   2066 C CE2 . TYR B 1 136 ? -4.631  25.075  -8.702  1.00 36.59 ? 183  TYR B CE2 1 
ATOM   2067 C CZ  . TYR B 1 136 ? -5.110  25.711  -7.546  1.00 35.96 ? 183  TYR B CZ  1 
ATOM   2068 O OH  . TYR B 1 136 ? -4.977  27.055  -7.327  1.00 37.96 ? 183  TYR B OH  1 
ATOM   2069 N N   . LEU B 1 137 ? -7.220  21.553  -10.481 1.00 35.19 ? 184  LEU B N   1 
ATOM   2070 C CA  . LEU B 1 137 ? -7.566  22.328  -11.693 1.00 37.19 ? 184  LEU B CA  1 
ATOM   2071 C C   . LEU B 1 137 ? -9.041  22.252  -12.053 1.00 37.61 ? 184  LEU B C   1 
ATOM   2072 O O   . LEU B 1 137 ? -9.627  23.276  -12.451 1.00 37.86 ? 184  LEU B O   1 
ATOM   2073 C CB  . LEU B 1 137 ? -6.695  21.910  -12.886 1.00 36.77 ? 184  LEU B CB  1 
ATOM   2074 C CG  . LEU B 1 137 ? -5.183  22.154  -12.729 1.00 37.79 ? 184  LEU B CG  1 
ATOM   2075 C CD1 . LEU B 1 137 ? -4.407  21.532  -13.863 1.00 38.37 ? 184  LEU B CD1 1 
ATOM   2076 C CD2 . LEU B 1 137 ? -4.902  23.673  -12.662 1.00 39.30 ? 184  LEU B CD2 1 
ATOM   2077 N N   . ASN B 1 138 ? -9.656  21.077  -11.851 1.00 37.27 ? 185  ASN B N   1 
ATOM   2078 C CA  . ASN B 1 138 ? -11.112 20.910  -12.111 1.00 38.45 ? 185  ASN B CA  1 
ATOM   2079 C C   . ASN B 1 138 ? -11.931 21.775  -11.171 1.00 38.85 ? 185  ASN B C   1 
ATOM   2080 O O   . ASN B 1 138 ? -13.012 22.254  -11.495 1.00 37.81 ? 185  ASN B O   1 
ATOM   2081 C CB  . ASN B 1 138 ? -11.562 19.429  -11.943 1.00 36.57 ? 185  ASN B CB  1 
ATOM   2082 C CG  . ASN B 1 138 ? -11.106 18.546  -13.052 1.00 40.37 ? 185  ASN B CG  1 
ATOM   2083 O OD1 . ASN B 1 138 ? -10.661 19.037  -14.111 1.00 42.79 ? 185  ASN B OD1 1 
ATOM   2084 N ND2 . ASN B 1 138 ? -11.218 17.217  -12.860 1.00 34.46 ? 185  ASN B ND2 1 
ATOM   2085 N N   . LEU B 1 139 ? -11.424 21.921  -9.961  1.00 41.45 ? 186  LEU B N   1 
ATOM   2086 C CA  . LEU B 1 139 ? -12.127 22.672  -8.924  1.00 42.76 ? 186  LEU B CA  1 
ATOM   2087 C C   . LEU B 1 139 ? -12.133 24.153  -9.254  1.00 44.56 ? 186  LEU B C   1 
ATOM   2088 O O   . LEU B 1 139 ? -13.094 24.883  -8.980  1.00 45.77 ? 186  LEU B O   1 
ATOM   2089 C CB  . LEU B 1 139 ? -11.409 22.407  -7.596  1.00 42.91 ? 186  LEU B CB  1 
ATOM   2090 C CG  . LEU B 1 139 ? -11.965 22.808  -6.260  1.00 42.18 ? 186  LEU B CG  1 
ATOM   2091 C CD1 . LEU B 1 139 ? -13.349 22.256  -6.010  1.00 40.35 ? 186  LEU B CD1 1 
ATOM   2092 C CD2 . LEU B 1 139 ? -10.978 22.426  -5.200  1.00 41.91 ? 186  LEU B CD2 1 
ATOM   2093 N N   . LEU B 1 140 ? -11.040 24.591  -9.869  1.00 46.21 ? 187  LEU B N   1 
ATOM   2094 C CA  . LEU B 1 140 ? -10.823 25.961  -10.242 1.00 46.62 ? 187  LEU B CA  1 
ATOM   2095 C C   . LEU B 1 140 ? -11.696 26.222  -11.441 1.00 48.35 ? 187  LEU B C   1 
ATOM   2096 O O   . LEU B 1 140 ? -12.455 27.187  -11.476 1.00 50.13 ? 187  LEU B O   1 
ATOM   2097 C CB  . LEU B 1 140 ? -9.327  26.122  -10.611 1.00 46.99 ? 187  LEU B CB  1 
ATOM   2098 C CG  . LEU B 1 140 ? -8.664  27.443  -10.760 1.00 45.25 ? 187  LEU B CG  1 
ATOM   2099 C CD1 . LEU B 1 140 ? -8.916  28.277  -9.511  1.00 45.65 ? 187  LEU B CD1 1 
ATOM   2100 C CD2 . LEU B 1 140 ? -7.142  27.224  -11.027 1.00 45.21 ? 187  LEU B CD2 1 
ATOM   2101 N N   . ASN B 1 141 ? -11.637 25.327  -12.413 1.00 50.19 ? 188  ASN B N   1 
ATOM   2102 C CA  . ASN B 1 141 ? -12.375 25.505  -13.673 1.00 50.75 ? 188  ASN B CA  1 
ATOM   2103 C C   . ASN B 1 141 ? -13.875 25.448  -13.487 1.00 51.24 ? 188  ASN B C   1 
ATOM   2104 O O   . ASN B 1 141 ? -14.622 25.553  -14.460 1.00 52.12 ? 188  ASN B O   1 
ATOM   2105 C CB  . ASN B 1 141 ? -11.950 24.439  -14.688 1.00 50.85 ? 188  ASN B CB  1 
ATOM   2106 C CG  . ASN B 1 141 ? -10.668 24.826  -15.450 1.00 53.15 ? 188  ASN B CG  1 
ATOM   2107 O OD1 . ASN B 1 141 ? -10.730 25.117  -16.660 1.00 57.18 ? 188  ASN B OD1 1 
ATOM   2108 N ND2 . ASN B 1 141 ? -9.517  24.832  -14.758 1.00 50.50 ? 188  ASN B ND2 1 
HETATM 2109 O O   . HOH C 2 .   ? -21.118 22.890  -5.735  1.00 49.39 ? 2001 HOH A O   1 
HETATM 2110 O O   . HOH C 2 .   ? -24.184 24.949  0.952   1.00 38.23 ? 2002 HOH A O   1 
HETATM 2111 O O   . HOH C 2 .   ? -27.598 18.984  -0.022  1.00 47.59 ? 2003 HOH A O   1 
HETATM 2112 O O   . HOH C 2 .   ? -26.579 6.743   -0.453  1.00 45.62 ? 2004 HOH A O   1 
HETATM 2113 O O   . HOH C 2 .   ? -28.773 5.796   -3.237  1.00 52.25 ? 2005 HOH A O   1 
HETATM 2114 O O   . HOH C 2 .   ? -32.017 9.435   -2.509  1.00 49.74 ? 2006 HOH A O   1 
HETATM 2115 O O   . HOH C 2 .   ? -23.731 10.286  -12.877 1.00 38.05 ? 2007 HOH A O   1 
HETATM 2116 O O   . HOH C 2 .   ? -22.199 11.084  -14.668 1.00 52.44 ? 2008 HOH A O   1 
HETATM 2117 O O   . HOH C 2 .   ? -23.208 15.979  -14.935 1.00 52.00 ? 2009 HOH A O   1 
HETATM 2118 O O   . HOH C 2 .   ? -11.967 18.555  -8.624  1.00 25.62 ? 2010 HOH A O   1 
HETATM 2119 O O   . HOH C 2 .   ? -12.890 12.306  -13.188 1.00 43.45 ? 2011 HOH A O   1 
HETATM 2120 O O   . HOH C 2 .   ? -11.013 9.716   -10.402 1.00 40.64 ? 2012 HOH A O   1 
HETATM 2121 O O   . HOH C 2 .   ? -23.911 7.491   -13.224 1.00 51.15 ? 2013 HOH A O   1 
HETATM 2122 O O   . HOH C 2 .   ? -9.192  11.322  -8.566  1.00 45.32 ? 2014 HOH A O   1 
HETATM 2123 O O   . HOH C 2 .   ? -8.525  13.034  -10.108 1.00 51.99 ? 2015 HOH A O   1 
HETATM 2124 O O   . HOH C 2 .   ? -7.357  10.023  -8.056  1.00 49.87 ? 2016 HOH A O   1 
HETATM 2125 O O   . HOH C 2 .   ? -6.509  13.020  -6.322  1.00 52.51 ? 2017 HOH A O   1 
HETATM 2126 O O   . HOH C 2 .   ? -9.090  4.537   1.710   1.00 80.14 ? 2018 HOH A O   1 
HETATM 2127 O O   . HOH C 2 .   ? -10.994 2.302   2.902   1.00 57.56 ? 2019 HOH A O   1 
HETATM 2128 O O   . HOH C 2 .   ? -9.757  8.276   -15.239 1.00 53.22 ? 2020 HOH A O   1 
HETATM 2129 O O   . HOH C 2 .   ? -25.685 0.900   -14.003 1.00 41.32 ? 2021 HOH A O   1 
HETATM 2130 O O   . HOH C 2 .   ? -4.341  2.339   -5.684  1.00 39.84 ? 2022 HOH A O   1 
HETATM 2131 O O   . HOH C 2 .   ? -9.661  -3.607  -5.875  1.00 47.75 ? 2023 HOH A O   1 
HETATM 2132 O O   . HOH C 2 .   ? -12.717 -4.371  -9.572  1.00 31.67 ? 2024 HOH A O   1 
HETATM 2133 O O   . HOH C 2 .   ? -14.578 0.228   -5.844  1.00 45.81 ? 2025 HOH A O   1 
HETATM 2134 O O   . HOH C 2 .   ? -10.448 6.044   -16.833 1.00 42.98 ? 2026 HOH A O   1 
HETATM 2135 O O   . HOH C 2 .   ? -6.880  4.398   -15.878 1.00 50.77 ? 2027 HOH A O   1 
HETATM 2136 O O   . HOH C 2 .   ? -6.457  1.828   -12.396 1.00 68.07 ? 2028 HOH A O   1 
HETATM 2137 O O   . HOH C 2 .   ? -23.350 2.360   -15.154 1.00 48.63 ? 2029 HOH A O   1 
HETATM 2138 O O   . HOH C 2 .   ? -23.314 5.298   -17.281 1.00 66.85 ? 2030 HOH A O   1 
HETATM 2139 O O   . HOH C 2 .   ? -24.331 7.446   -16.686 1.00 53.10 ? 2031 HOH A O   1 
HETATM 2140 O O   . HOH C 2 .   ? -20.796 8.690   -22.093 1.00 52.83 ? 2032 HOH A O   1 
HETATM 2141 O O   . HOH C 2 .   ? -13.691 -14.641 -27.359 1.00 52.37 ? 2033 HOH A O   1 
HETATM 2142 O O   . HOH C 2 .   ? -8.585  -3.217  -33.202 1.00 74.07 ? 2034 HOH A O   1 
HETATM 2143 O O   . HOH C 2 .   ? -16.577 0.220   -35.668 1.00 55.14 ? 2035 HOH A O   1 
HETATM 2144 O O   . HOH C 2 .   ? -16.050 7.315   -37.144 1.00 62.13 ? 2036 HOH A O   1 
HETATM 2145 O O   . HOH C 2 .   ? -10.271 1.418   -34.453 1.00 40.55 ? 2037 HOH A O   1 
HETATM 2146 O O   . HOH C 2 .   ? -24.599 4.930   2.650   1.00 57.07 ? 2038 HOH A O   1 
HETATM 2147 O O   . HOH C 2 .   ? -23.057 7.157   6.186   1.00 45.72 ? 2039 HOH A O   1 
HETATM 2148 O O   . HOH C 2 .   ? -23.500 10.508  4.058   1.00 46.24 ? 2040 HOH A O   1 
HETATM 2149 O O   . HOH C 2 .   ? -8.663  3.193   -21.128 1.00 53.53 ? 2041 HOH A O   1 
HETATM 2150 O O   . HOH C 2 .   ? -4.638  -0.861  -22.717 1.00 44.83 ? 2042 HOH A O   1 
HETATM 2151 O O   . HOH C 2 .   ? -8.155  5.289   -25.245 1.00 62.32 ? 2043 HOH A O   1 
HETATM 2152 O O   . HOH C 2 .   ? -10.591 -11.871 -20.838 1.00 48.43 ? 2044 HOH A O   1 
HETATM 2153 O O   . HOH C 2 .   ? -6.092  -3.774  -10.320 1.00 56.20 ? 2045 HOH A O   1 
HETATM 2154 O O   . HOH C 2 .   ? -12.069 -8.852  -15.471 1.00 35.15 ? 2046 HOH A O   1 
HETATM 2155 O O   . HOH C 2 .   ? -13.605 -4.684  -6.973  1.00 44.62 ? 2047 HOH A O   1 
HETATM 2156 O O   . HOH C 2 .   ? -19.621 -9.910  -9.906  1.00 45.51 ? 2048 HOH A O   1 
HETATM 2157 O O   . HOH C 2 .   ? -23.019 -13.396 -15.036 1.00 39.57 ? 2049 HOH A O   1 
HETATM 2158 O O   . HOH C 2 .   ? -20.357 -15.632 -21.303 1.00 46.42 ? 2050 HOH A O   1 
HETATM 2159 O O   . HOH C 2 .   ? -19.768 -19.999 -17.972 1.00 64.23 ? 2051 HOH A O   1 
HETATM 2160 O O   . HOH C 2 .   ? -10.952 -15.400 -16.865 1.00 53.30 ? 2052 HOH A O   1 
HETATM 2161 O O   . HOH C 2 .   ? -13.626 -15.392 -11.957 1.00 48.37 ? 2053 HOH A O   1 
HETATM 2162 O O   . HOH C 2 .   ? -15.183 -15.180 -24.886 1.00 54.54 ? 2054 HOH A O   1 
HETATM 2163 O O   . HOH C 2 .   ? -20.958 -8.811  -22.075 1.00 55.87 ? 2055 HOH A O   1 
HETATM 2164 O O   . HOH C 2 .   ? -19.706 -5.936  -21.226 1.00 32.17 ? 2056 HOH A O   1 
HETATM 2165 O O   . HOH C 2 .   ? -22.722 -5.492  -22.788 1.00 41.96 ? 2057 HOH A O   1 
HETATM 2166 O O   . HOH C 2 .   ? -11.381 -4.459  -31.245 1.00 62.32 ? 2058 HOH A O   1 
HETATM 2167 O O   . HOH C 2 .   ? -20.684 -4.629  -28.713 1.00 41.28 ? 2059 HOH A O   1 
HETATM 2168 O O   . HOH C 2 .   ? -19.952 0.200   -24.007 1.00 38.50 ? 2060 HOH A O   1 
HETATM 2169 O O   . HOH C 2 .   ? -24.229 -0.559  -18.162 1.00 46.32 ? 2061 HOH A O   1 
HETATM 2170 O O   . HOH C 2 .   ? -20.897 0.863   -21.602 1.00 49.97 ? 2062 HOH A O   1 
HETATM 2171 O O   . HOH C 2 .   ? -24.536 -11.025 -23.283 1.00 63.13 ? 2063 HOH A O   1 
HETATM 2172 O O   . HOH C 2 .   ? -24.212 -6.730  -16.071 1.00 37.16 ? 2064 HOH A O   1 
HETATM 2173 O O   . HOH C 2 .   ? -26.621 5.426   -8.296  1.00 36.20 ? 2065 HOH A O   1 
HETATM 2174 O O   . HOH C 2 .   ? -25.753 -5.061  -11.320 1.00 45.00 ? 2066 HOH A O   1 
HETATM 2175 O O   . HOH C 2 .   ? -26.307 4.878   -4.873  1.00 33.06 ? 2067 HOH A O   1 
HETATM 2176 O O   . HOH C 2 .   ? -26.744 -1.143  -8.390  1.00 43.45 ? 2068 HOH A O   1 
HETATM 2177 O O   . HOH C 2 .   ? -25.539 2.711   -2.482  1.00 51.74 ? 2069 HOH A O   1 
HETATM 2178 O O   . HOH C 2 .   ? -24.172 -2.130  0.758   1.00 55.72 ? 2070 HOH A O   1 
HETATM 2179 O O   . HOH C 2 .   ? -19.664 -1.058  2.227   1.00 40.03 ? 2071 HOH A O   1 
HETATM 2180 O O   . HOH C 2 .   ? -16.396 -1.574  -3.944  1.00 56.20 ? 2072 HOH A O   1 
HETATM 2181 O O   . HOH C 2 .   ? -22.265 5.000   4.249   1.00 37.93 ? 2073 HOH A O   1 
HETATM 2182 O O   . HOH C 2 .   ? -14.540 4.527   5.477   1.00 37.89 ? 2074 HOH A O   1 
HETATM 2183 O O   . HOH C 2 .   ? -21.956 9.726   6.108   1.00 33.44 ? 2075 HOH A O   1 
HETATM 2184 O O   . HOH C 2 .   ? -9.569  13.194  10.317  1.00 48.79 ? 2076 HOH A O   1 
HETATM 2185 O O   . HOH C 2 .   ? -11.240 7.343   6.557   1.00 44.84 ? 2077 HOH A O   1 
HETATM 2186 O O   . HOH C 2 .   ? -8.232  8.334   7.417   1.00 69.23 ? 2078 HOH A O   1 
HETATM 2187 O O   . HOH C 2 .   ? -11.138 15.661  2.601   1.00 44.01 ? 2079 HOH A O   1 
HETATM 2188 O O   . HOH C 2 .   ? -13.595 21.177  3.412   1.00 30.24 ? 2080 HOH A O   1 
HETATM 2189 O O   . HOH C 2 .   ? -19.212 21.878  10.669  1.00 51.62 ? 2081 HOH A O   1 
HETATM 2190 O O   . HOH C 2 .   ? -9.240  20.531  7.456   1.00 68.27 ? 2082 HOH A O   1 
HETATM 2191 O O   . HOH C 2 .   ? -25.604 21.710  7.273   1.00 41.61 ? 2083 HOH A O   1 
HETATM 2192 O O   . HOH C 2 .   ? -23.093 18.306  7.253   1.00 40.72 ? 2084 HOH A O   1 
HETATM 2193 O O   . HOH D 2 .   ? -13.230 34.820  -2.309  1.00 46.58 ? 2001 HOH B O   1 
HETATM 2194 O O   . HOH D 2 .   ? -13.528 30.202  -0.005  1.00 42.91 ? 2002 HOH B O   1 
HETATM 2195 O O   . HOH D 2 .   ? -13.909 33.884  -6.480  1.00 49.71 ? 2003 HOH B O   1 
HETATM 2196 O O   . HOH D 2 .   ? -5.664  30.464  1.813   1.00 52.39 ? 2004 HOH B O   1 
HETATM 2197 O O   . HOH D 2 .   ? 3.326   27.922  -5.764  1.00 49.87 ? 2005 HOH B O   1 
HETATM 2198 O O   . HOH D 2 .   ? 5.694   30.000  -2.472  1.00 48.90 ? 2006 HOH B O   1 
HETATM 2199 O O   . HOH D 2 .   ? 2.433   32.653  1.571   1.00 56.36 ? 2007 HOH B O   1 
HETATM 2200 O O   . HOH D 2 .   ? 5.013   27.262  -1.742  1.00 41.17 ? 2008 HOH B O   1 
HETATM 2201 O O   . HOH D 2 .   ? -0.305  27.673  6.612   1.00 46.95 ? 2009 HOH B O   1 
HETATM 2202 O O   . HOH D 2 .   ? -2.366  26.477  8.676   1.00 50.73 ? 2010 HOH B O   1 
HETATM 2203 O O   . HOH D 2 .   ? -13.147 25.670  7.679   1.00 61.62 ? 2011 HOH B O   1 
HETATM 2204 O O   . HOH D 2 .   ? -12.126 26.112  5.008   1.00 53.33 ? 2012 HOH B O   1 
HETATM 2205 O O   . HOH D 2 .   ? -6.168  16.388  5.100   1.00 48.80 ? 2013 HOH B O   1 
HETATM 2206 O O   . HOH D 2 .   ? 2.844   27.224  7.318   1.00 59.32 ? 2014 HOH B O   1 
HETATM 2207 O O   . HOH D 2 .   ? -7.686  18.812  7.174   1.00 49.92 ? 2015 HOH B O   1 
HETATM 2208 O O   . HOH D 2 .   ? -9.131  15.602  5.048   1.00 48.86 ? 2016 HOH B O   1 
HETATM 2209 O O   . HOH D 2 .   ? -10.042 8.552   4.089   1.00 32.74 ? 2017 HOH B O   1 
HETATM 2210 O O   . HOH D 2 .   ? -3.003  6.724   0.385   1.00 40.69 ? 2018 HOH B O   1 
HETATM 2211 O O   . HOH D 2 .   ? 0.854   27.350  17.923  1.00 49.35 ? 2019 HOH B O   1 
HETATM 2212 O O   . HOH D 2 .   ? 0.769   6.592   2.801   1.00 60.27 ? 2020 HOH B O   1 
HETATM 2213 O O   . HOH D 2 .   ? 7.308   11.376  3.970   1.00 31.58 ? 2021 HOH B O   1 
HETATM 2214 O O   . HOH D 2 .   ? 7.476   11.970  1.270   1.00 44.67 ? 2022 HOH B O   1 
HETATM 2215 O O   . HOH D 2 .   ? -2.922  14.790  12.100  1.00 44.40 ? 2023 HOH B O   1 
HETATM 2216 O O   . HOH D 2 .   ? 6.068   24.043  9.068   1.00 39.80 ? 2024 HOH B O   1 
HETATM 2217 O O   . HOH D 2 .   ? -3.398  20.671  12.924  1.00 51.86 ? 2025 HOH B O   1 
HETATM 2218 O O   . HOH D 2 .   ? -1.221  16.242  17.814  1.00 38.76 ? 2026 HOH B O   1 
HETATM 2219 O O   . HOH D 2 .   ? 4.325   25.261  10.908  1.00 49.09 ? 2027 HOH B O   1 
HETATM 2220 O O   . HOH D 2 .   ? 16.062  15.003  3.932   1.00 32.66 ? 2028 HOH B O   1 
HETATM 2221 O O   . HOH D 2 .   ? -4.150  21.148  20.258  1.00 46.35 ? 2029 HOH B O   1 
HETATM 2222 O O   . HOH D 2 .   ? 0.587   25.132  16.507  1.00 59.35 ? 2030 HOH B O   1 
HETATM 2223 O O   . HOH D 2 .   ? -2.414  17.453  20.103  1.00 43.19 ? 2031 HOH B O   1 
HETATM 2224 O O   . HOH D 2 .   ? -4.593  21.604  25.246  1.00 48.65 ? 2032 HOH B O   1 
HETATM 2225 O O   . HOH D 2 .   ? 5.204   19.421  29.398  1.00 65.74 ? 2033 HOH B O   1 
HETATM 2226 O O   . HOH D 2 .   ? -1.475  20.777  31.393  1.00 49.93 ? 2034 HOH B O   1 
HETATM 2227 O O   . HOH D 2 .   ? 0.991   8.002   23.624  1.00 43.00 ? 2035 HOH B O   1 
HETATM 2228 O O   . HOH D 2 .   ? -1.659  14.298  -10.822 1.00 55.77 ? 2036 HOH B O   1 
HETATM 2229 O O   . HOH D 2 .   ? -2.558  14.664  16.850  1.00 49.73 ? 2037 HOH B O   1 
HETATM 2230 O O   . HOH D 2 .   ? 7.121   10.855  26.189  1.00 68.27 ? 2038 HOH B O   1 
HETATM 2231 O O   . HOH D 2 .   ? -1.230  11.784  15.959  1.00 49.11 ? 2039 HOH B O   1 
HETATM 2232 O O   . HOH D 2 .   ? 1.127   6.211   17.763  1.00 48.25 ? 2040 HOH B O   1 
HETATM 2233 O O   . HOH D 2 .   ? 6.362   2.659   15.678  1.00 57.76 ? 2041 HOH B O   1 
HETATM 2234 O O   . HOH D 2 .   ? 11.132  8.563   10.295  1.00 33.04 ? 2042 HOH B O   1 
HETATM 2235 O O   . HOH D 2 .   ? 3.390   5.610   5.701   1.00 79.24 ? 2043 HOH B O   1 
HETATM 2236 O O   . HOH D 2 .   ? 16.230  16.558  6.013   1.00 52.77 ? 2044 HOH B O   1 
HETATM 2237 O O   . HOH D 2 .   ? 20.968  13.179  15.510  1.00 45.01 ? 2045 HOH B O   1 
HETATM 2238 O O   . HOH D 2 .   ? 24.849  9.690   11.416  1.00 60.10 ? 2046 HOH B O   1 
HETATM 2239 O O   . HOH D 2 .   ? 18.132  8.962   19.016  1.00 55.21 ? 2047 HOH B O   1 
HETATM 2240 O O   . HOH D 2 .   ? 17.690  15.929  20.355  1.00 46.88 ? 2048 HOH B O   1 
HETATM 2241 O O   . HOH D 2 .   ? 11.976  17.349  15.468  1.00 38.05 ? 2049 HOH B O   1 
HETATM 2242 O O   . HOH D 2 .   ? 14.133  13.230  26.280  1.00 57.03 ? 2050 HOH B O   1 
HETATM 2243 O O   . HOH D 2 .   ? 15.188  17.380  16.212  1.00 55.53 ? 2051 HOH B O   1 
HETATM 2244 O O   . HOH D 2 .   ? 12.807  20.579  16.729  1.00 55.69 ? 2052 HOH B O   1 
HETATM 2245 O O   . HOH D 2 .   ? 11.685  18.905  22.917  1.00 42.30 ? 2053 HOH B O   1 
HETATM 2246 O O   . HOH D 2 .   ? 6.614   20.496  18.073  1.00 41.96 ? 2054 HOH B O   1 
HETATM 2247 O O   . HOH D 2 .   ? 6.647   25.200  18.457  1.00 79.82 ? 2055 HOH B O   1 
HETATM 2248 O O   . HOH D 2 .   ? 9.130   23.601  12.082  1.00 46.96 ? 2056 HOH B O   1 
HETATM 2249 O O   . HOH D 2 .   ? 6.584   21.506  15.624  1.00 59.28 ? 2057 HOH B O   1 
HETATM 2250 O O   . HOH D 2 .   ? 12.360  25.009  17.336  1.00 60.39 ? 2058 HOH B O   1 
HETATM 2251 O O   . HOH D 2 .   ? 14.478  20.901  9.791   1.00 39.87 ? 2059 HOH B O   1 
HETATM 2252 O O   . HOH D 2 .   ? 4.950   27.837  1.850   1.00 44.88 ? 2060 HOH B O   1 
HETATM 2253 O O   . HOH D 2 .   ? 10.348  25.318  2.541   1.00 55.00 ? 2061 HOH B O   1 
HETATM 2254 O O   . HOH D 2 .   ? 10.741  23.689  0.173   1.00 65.95 ? 2062 HOH B O   1 
HETATM 2255 O O   . HOH D 2 .   ? 7.061   24.634  -4.591  1.00 40.84 ? 2063 HOH B O   1 
HETATM 2256 O O   . HOH D 2 .   ? 3.931   14.801  0.041   1.00 39.88 ? 2064 HOH B O   1 
HETATM 2257 O O   . HOH D 2 .   ? 2.982   23.221  -10.392 1.00 37.18 ? 2065 HOH B O   1 
HETATM 2258 O O   . HOH D 2 .   ? -0.179  16.282  -11.188 1.00 37.95 ? 2066 HOH B O   1 
HETATM 2259 O O   . HOH D 2 .   ? -1.320  24.861  -11.850 1.00 40.92 ? 2067 HOH B O   1 
HETATM 2260 O O   . HOH D 2 .   ? -4.255  14.379  -12.005 1.00 40.51 ? 2068 HOH B O   1 
HETATM 2261 O O   . HOH D 2 .   ? -8.218  12.339  -12.411 1.00 50.48 ? 2069 HOH B O   1 
HETATM 2262 O O   . HOH D 2 .   ? -6.364  14.516  -9.431  1.00 31.69 ? 2070 HOH B O   1 
HETATM 2263 O O   . HOH D 2 .   ? -11.275 14.662  -14.057 1.00 43.73 ? 2071 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   48  ?   ?   ?   A . n 
A 1 2   MET 2   49  ?   ?   ?   A . n 
A 1 3   SER 3   50  ?   ?   ?   A . n 
A 1 4   GLY 4   51  ?   ?   ?   A . n 
A 1 5   MET 5   52  ?   ?   ?   A . n 
A 1 6   LYS 6   53  ?   ?   ?   A . n 
A 1 7   SER 7   54  ?   ?   ?   A . n 
A 1 8   SER 8   55  ?   ?   ?   A . n 
A 1 9   LYS 9   56  ?   ?   ?   A . n 
A 1 10  SER 10  57  ?   ?   ?   A . n 
A 1 11  LYS 11  58  58  LYS LYS A . n 
A 1 12  ASP 12  59  59  ASP ASP A . n 
A 1 13  VAL 13  60  60  VAL VAL A . n 
A 1 14  LEU 14  61  61  LEU LEU A . n 
A 1 15  SER 15  62  62  SER SER A . n 
A 1 16  ALA 16  63  63  ALA ALA A . n 
A 1 17  ALA 17  64  64  ALA ALA A . n 
A 1 18  GLU 18  65  65  GLU GLU A . n 
A 1 19  VAL 19  66  66  VAL VAL A . n 
A 1 20  MET 20  67  67  MET MET A . n 
A 1 21  GLN 21  68  68  GLN GLN A . n 
A 1 22  TRP 22  69  69  TRP TRP A . n 
A 1 23  SER 23  70  70  SER SER A . n 
A 1 24  GLN 24  71  71  GLN GLN A . n 
A 1 25  SER 25  72  72  SER SER A . n 
A 1 26  LEU 26  73  73  LEU LEU A . n 
A 1 27  GLU 27  74  74  GLU GLU A . n 
A 1 28  LYS 28  75  75  LYS LYS A . n 
A 1 29  LEU 29  76  76  LEU LEU A . n 
A 1 30  LEU 30  77  77  LEU LEU A . n 
A 1 31  ALA 31  78  78  ALA ALA A . n 
A 1 32  ASN 32  79  79  ASN ASN A . n 
A 1 33  GLN 33  80  80  GLN GLN A . n 
A 1 34  THR 34  81  81  THR THR A . n 
A 1 35  GLY 35  82  82  GLY GLY A . n 
A 1 36  GLN 36  83  83  GLN GLN A . n 
A 1 37  ASN 37  84  84  ASN ASN A . n 
A 1 38  VAL 38  85  85  VAL VAL A . n 
A 1 39  PHE 39  86  86  PHE PHE A . n 
A 1 40  GLY 40  87  87  GLY GLY A . n 
A 1 41  SER 41  88  88  SER SER A . n 
A 1 42  PHE 42  89  89  PHE PHE A . n 
A 1 43  LEU 43  90  90  LEU LEU A . n 
A 1 44  LYS 44  91  91  LYS LYS A . n 
A 1 45  SER 45  92  92  SER SER A . n 
A 1 46  GLU 46  93  93  GLU GLU A . n 
A 1 47  PHE 47  94  94  PHE PHE A . n 
A 1 48  SER 48  95  95  SER SER A . n 
A 1 49  GLU 49  96  96  GLU GLU A . n 
A 1 50  GLU 50  97  97  GLU GLU A . n 
A 1 51  ASN 51  98  98  ASN ASN A . n 
A 1 52  ILE 52  99  99  ILE ILE A . n 
A 1 53  GLU 53  100 100 GLU GLU A . n 
A 1 54  PHE 54  101 101 PHE PHE A . n 
A 1 55  TRP 55  102 102 TRP TRP A . n 
A 1 56  LEU 56  103 103 LEU LEU A . n 
A 1 57  ALA 57  104 104 ALA ALA A . n 
A 1 58  CYS 58  105 105 CYS CYS A . n 
A 1 59  GLU 59  106 106 GLU GLU A . n 
A 1 60  ASP 60  107 107 ASP ASP A . n 
A 1 61  TYR 61  108 108 TYR TYR A . n 
A 1 62  LYS 62  109 109 LYS LYS A . n 
A 1 63  LYS 63  110 110 LYS LYS A . n 
A 1 64  THR 64  111 111 THR THR A . n 
A 1 65  GLU 65  112 112 GLU GLU A . n 
A 1 66  SER 66  113 113 SER SER A . n 
A 1 67  ASP 67  114 114 ASP ASP A . n 
A 1 68  LEU 68  115 115 LEU LEU A . n 
A 1 69  LEU 69  116 116 LEU LEU A . n 
A 1 70  PRO 70  117 117 PRO PRO A . n 
A 1 71  CYS 71  118 118 CYS CYS A . n 
A 1 72  LYS 72  119 119 LYS LYS A . n 
A 1 73  ALA 73  120 120 ALA ALA A . n 
A 1 74  GLU 74  121 121 GLU GLU A . n 
A 1 75  GLU 75  122 122 GLU GLU A . n 
A 1 76  ILE 76  123 123 ILE ILE A . n 
A 1 77  TYR 77  124 124 TYR TYR A . n 
A 1 78  LYS 78  125 125 LYS LYS A . n 
A 1 79  ALA 79  126 126 ALA ALA A . n 
A 1 80  PHE 80  127 127 PHE PHE A . n 
A 1 81  VAL 81  128 128 VAL VAL A . n 
A 1 82  HIS 82  129 129 HIS HIS A . n 
A 1 83  SER 83  130 130 SER SER A . n 
A 1 84  ASP 84  131 131 ASP ASP A . n 
A 1 85  ALA 85  132 132 ALA ALA A . n 
A 1 86  ALA 86  133 133 ALA ALA A . n 
A 1 87  LYS 87  134 134 LYS LYS A . n 
A 1 88  GLN 88  135 135 GLN GLN A . n 
A 1 89  ILE 89  136 136 ILE ILE A . n 
A 1 90  ASN 90  137 137 ASN ASN A . n 
A 1 91  ILE 91  138 138 ILE ILE A . n 
A 1 92  ASP 92  139 139 ASP ASP A . n 
A 1 93  PHE 93  140 140 PHE PHE A . n 
A 1 94  ARG 94  141 141 ARG ARG A . n 
A 1 95  THR 95  142 142 THR THR A . n 
A 1 96  ARG 96  143 143 ARG ARG A . n 
A 1 97  GLU 97  144 144 GLU GLU A . n 
A 1 98  SER 98  145 145 SER SER A . n 
A 1 99  THR 99  146 146 THR THR A . n 
A 1 100 ALA 100 147 147 ALA ALA A . n 
A 1 101 LYS 101 148 148 LYS LYS A . n 
A 1 102 LYS 102 149 149 LYS LYS A . n 
A 1 103 ILE 103 150 150 ILE ILE A . n 
A 1 104 LYS 104 151 151 LYS LYS A . n 
A 1 105 ALA 105 152 152 ALA ALA A . n 
A 1 106 PRO 106 153 153 PRO PRO A . n 
A 1 107 THR 107 154 154 THR THR A . n 
A 1 108 PRO 108 155 155 PRO PRO A . n 
A 1 109 THR 109 156 156 THR THR A . n 
A 1 110 CYS 110 157 157 CYS CYS A . n 
A 1 111 PHE 111 158 158 PHE PHE A . n 
A 1 112 ASP 112 159 159 ASP ASP A . n 
A 1 113 GLU 113 160 160 GLU GLU A . n 
A 1 114 ALA 114 161 161 ALA ALA A . n 
A 1 115 GLN 115 162 162 GLN GLN A . n 
A 1 116 LYS 116 163 163 LYS LYS A . n 
A 1 117 VAL 117 164 164 VAL VAL A . n 
A 1 118 ILE 118 165 165 ILE ILE A . n 
A 1 119 TYR 119 166 166 TYR TYR A . n 
A 1 120 THR 120 167 167 THR THR A . n 
A 1 121 LEU 121 168 168 LEU LEU A . n 
A 1 122 MET 122 169 169 MET MET A . n 
A 1 123 GLU 123 170 170 GLU GLU A . n 
A 1 124 LYS 124 171 171 LYS LYS A . n 
A 1 125 ASP 125 172 172 ASP ASP A . n 
A 1 126 SER 126 173 173 SER SER A . n 
A 1 127 TYR 127 174 174 TYR TYR A . n 
A 1 128 PRO 128 175 175 PRO PRO A . n 
A 1 129 ARG 129 176 176 ARG ARG A . n 
A 1 130 PHE 130 177 177 PHE PHE A . n 
A 1 131 LEU 131 178 178 LEU LEU A . n 
A 1 132 LYS 132 179 179 LYS LYS A . n 
A 1 133 SER 133 180 180 SER SER A . n 
A 1 134 ASP 134 181 181 ASP ASP A . n 
A 1 135 ILE 135 182 182 ILE ILE A . n 
A 1 136 TYR 136 183 183 TYR TYR A . n 
A 1 137 LEU 137 184 184 LEU LEU A . n 
A 1 138 ASN 138 185 185 ASN ASN A . n 
A 1 139 LEU 139 186 186 LEU LEU A . n 
A 1 140 LEU 140 187 187 LEU LEU A . n 
A 1 141 ASN 141 188 188 ASN ASN A . n 
A 1 142 ASP 142 189 189 ASP ASP A . n 
A 1 143 LEU 143 190 190 LEU LEU A . n 
A 1 144 GLN 144 191 191 GLN GLN A . n 
A 1 145 ALA 145 192 ?   ?   ?   A . n 
B 1 1   SER 1   48  ?   ?   ?   B . n 
B 1 2   MET 2   49  ?   ?   ?   B . n 
B 1 3   SER 3   50  ?   ?   ?   B . n 
B 1 4   GLY 4   51  ?   ?   ?   B . n 
B 1 5   MET 5   52  ?   ?   ?   B . n 
B 1 6   LYS 6   53  ?   ?   ?   B . n 
B 1 7   SER 7   54  ?   ?   ?   B . n 
B 1 8   SER 8   55  ?   ?   ?   B . n 
B 1 9   LYS 9   56  ?   ?   ?   B . n 
B 1 10  SER 10  57  ?   ?   ?   B . n 
B 1 11  LYS 11  58  ?   ?   ?   B . n 
B 1 12  ASP 12  59  59  ASP ASP B . n 
B 1 13  VAL 13  60  60  VAL VAL B . n 
B 1 14  LEU 14  61  61  LEU LEU B . n 
B 1 15  SER 15  62  62  SER SER B . n 
B 1 16  ALA 16  63  63  ALA ALA B . n 
B 1 17  ALA 17  64  64  ALA ALA B . n 
B 1 18  GLU 18  65  65  GLU GLU B . n 
B 1 19  VAL 19  66  66  VAL VAL B . n 
B 1 20  MET 20  67  67  MET MET B . n 
B 1 21  GLN 21  68  68  GLN GLN B . n 
B 1 22  TRP 22  69  69  TRP TRP B . n 
B 1 23  SER 23  70  70  SER SER B . n 
B 1 24  GLN 24  71  71  GLN GLN B . n 
B 1 25  SER 25  72  72  SER SER B . n 
B 1 26  LEU 26  73  73  LEU LEU B . n 
B 1 27  GLU 27  74  74  GLU GLU B . n 
B 1 28  LYS 28  75  75  LYS LYS B . n 
B 1 29  LEU 29  76  76  LEU LEU B . n 
B 1 30  LEU 30  77  77  LEU LEU B . n 
B 1 31  ALA 31  78  78  ALA ALA B . n 
B 1 32  ASN 32  79  79  ASN ASN B . n 
B 1 33  GLN 33  80  80  GLN GLN B . n 
B 1 34  THR 34  81  81  THR THR B . n 
B 1 35  GLY 35  82  82  GLY GLY B . n 
B 1 36  GLN 36  83  83  GLN GLN B . n 
B 1 37  ASN 37  84  84  ASN ASN B . n 
B 1 38  VAL 38  85  85  VAL VAL B . n 
B 1 39  PHE 39  86  86  PHE PHE B . n 
B 1 40  GLY 40  87  87  GLY GLY B . n 
B 1 41  SER 41  88  88  SER SER B . n 
B 1 42  PHE 42  89  89  PHE PHE B . n 
B 1 43  LEU 43  90  90  LEU LEU B . n 
B 1 44  LYS 44  91  91  LYS LYS B . n 
B 1 45  SER 45  92  92  SER SER B . n 
B 1 46  GLU 46  93  93  GLU GLU B . n 
B 1 47  PHE 47  94  94  PHE PHE B . n 
B 1 48  SER 48  95  95  SER SER B . n 
B 1 49  GLU 49  96  96  GLU GLU B . n 
B 1 50  GLU 50  97  97  GLU GLU B . n 
B 1 51  ASN 51  98  98  ASN ASN B . n 
B 1 52  ILE 52  99  99  ILE ILE B . n 
B 1 53  GLU 53  100 100 GLU GLU B . n 
B 1 54  PHE 54  101 101 PHE PHE B . n 
B 1 55  TRP 55  102 102 TRP TRP B . n 
B 1 56  LEU 56  103 103 LEU LEU B . n 
B 1 57  ALA 57  104 104 ALA ALA B . n 
B 1 58  CYS 58  105 105 CYS CYS B . n 
B 1 59  GLU 59  106 106 GLU GLU B . n 
B 1 60  ASP 60  107 107 ASP ASP B . n 
B 1 61  TYR 61  108 108 TYR TYR B . n 
B 1 62  LYS 62  109 109 LYS LYS B . n 
B 1 63  LYS 63  110 110 LYS LYS B . n 
B 1 64  THR 64  111 111 THR THR B . n 
B 1 65  GLU 65  112 112 GLU GLU B . n 
B 1 66  SER 66  113 113 SER SER B . n 
B 1 67  ASP 67  114 114 ASP ASP B . n 
B 1 68  LEU 68  115 115 LEU LEU B . n 
B 1 69  LEU 69  116 116 LEU LEU B . n 
B 1 70  PRO 70  117 117 PRO PRO B . n 
B 1 71  CYS 71  118 118 CYS CYS B . n 
B 1 72  LYS 72  119 119 LYS LYS B . n 
B 1 73  ALA 73  120 120 ALA ALA B . n 
B 1 74  GLU 74  121 121 GLU GLU B . n 
B 1 75  GLU 75  122 122 GLU GLU B . n 
B 1 76  ILE 76  123 123 ILE ILE B . n 
B 1 77  TYR 77  124 124 TYR TYR B . n 
B 1 78  LYS 78  125 125 LYS LYS B . n 
B 1 79  ALA 79  126 126 ALA ALA B . n 
B 1 80  PHE 80  127 127 PHE PHE B . n 
B 1 81  VAL 81  128 128 VAL VAL B . n 
B 1 82  HIS 82  129 129 HIS HIS B . n 
B 1 83  SER 83  130 130 SER SER B . n 
B 1 84  ASP 84  131 131 ASP ASP B . n 
B 1 85  ALA 85  132 132 ALA ALA B . n 
B 1 86  ALA 86  133 133 ALA ALA B . n 
B 1 87  LYS 87  134 134 LYS LYS B . n 
B 1 88  GLN 88  135 135 GLN GLN B . n 
B 1 89  ILE 89  136 136 ILE ILE B . n 
B 1 90  ASN 90  137 137 ASN ASN B . n 
B 1 91  ILE 91  138 138 ILE ILE B . n 
B 1 92  ASP 92  139 139 ASP ASP B . n 
B 1 93  PHE 93  140 140 PHE PHE B . n 
B 1 94  ARG 94  141 141 ARG ARG B . n 
B 1 95  THR 95  142 142 THR THR B . n 
B 1 96  ARG 96  143 143 ARG ARG B . n 
B 1 97  GLU 97  144 144 GLU GLU B . n 
B 1 98  SER 98  145 145 SER SER B . n 
B 1 99  THR 99  146 146 THR THR B . n 
B 1 100 ALA 100 147 147 ALA ALA B . n 
B 1 101 LYS 101 148 148 LYS LYS B . n 
B 1 102 LYS 102 149 149 LYS LYS B . n 
B 1 103 ILE 103 150 150 ILE ILE B . n 
B 1 104 LYS 104 151 151 LYS LYS B . n 
B 1 105 ALA 105 152 152 ALA ALA B . n 
B 1 106 PRO 106 153 153 PRO PRO B . n 
B 1 107 THR 107 154 154 THR THR B . n 
B 1 108 PRO 108 155 155 PRO PRO B . n 
B 1 109 THR 109 156 156 THR THR B . n 
B 1 110 CYS 110 157 157 CYS CYS B . n 
B 1 111 PHE 111 158 158 PHE PHE B . n 
B 1 112 ASP 112 159 159 ASP ASP B . n 
B 1 113 GLU 113 160 160 GLU GLU B . n 
B 1 114 ALA 114 161 161 ALA ALA B . n 
B 1 115 GLN 115 162 162 GLN GLN B . n 
B 1 116 LYS 116 163 163 LYS LYS B . n 
B 1 117 VAL 117 164 164 VAL VAL B . n 
B 1 118 ILE 118 165 165 ILE ILE B . n 
B 1 119 TYR 119 166 166 TYR TYR B . n 
B 1 120 THR 120 167 167 THR THR B . n 
B 1 121 LEU 121 168 168 LEU LEU B . n 
B 1 122 MET 122 169 169 MET MET B . n 
B 1 123 GLU 123 170 170 GLU GLU B . n 
B 1 124 LYS 124 171 171 LYS LYS B . n 
B 1 125 ASP 125 172 172 ASP ASP B . n 
B 1 126 SER 126 173 173 SER SER B . n 
B 1 127 TYR 127 174 174 TYR TYR B . n 
B 1 128 PRO 128 175 175 PRO PRO B . n 
B 1 129 ARG 129 176 176 ARG ARG B . n 
B 1 130 PHE 130 177 177 PHE PHE B . n 
B 1 131 LEU 131 178 178 LEU LEU B . n 
B 1 132 LYS 132 179 179 LYS LYS B . n 
B 1 133 SER 133 180 180 SER SER B . n 
B 1 134 ASP 134 181 181 ASP ASP B . n 
B 1 135 ILE 135 182 182 ILE ILE B . n 
B 1 136 TYR 136 183 183 TYR TYR B . n 
B 1 137 LEU 137 184 184 LEU LEU B . n 
B 1 138 ASN 138 185 185 ASN ASN B . n 
B 1 139 LEU 139 186 186 LEU LEU B . n 
B 1 140 LEU 140 187 187 LEU LEU B . n 
B 1 141 ASN 141 188 188 ASN ASN B . n 
B 1 142 ASP 142 189 ?   ?   ?   B . n 
B 1 143 LEU 143 190 ?   ?   ?   B . n 
B 1 144 GLN 144 191 ?   ?   ?   B . n 
B 1 145 ALA 145 192 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 HOH 1  2001 2001 HOH HOH A . 
C 2 HOH 2  2002 2002 HOH HOH A . 
C 2 HOH 3  2003 2003 HOH HOH A . 
C 2 HOH 4  2004 2004 HOH HOH A . 
C 2 HOH 5  2005 2005 HOH HOH A . 
C 2 HOH 6  2006 2006 HOH HOH A . 
C 2 HOH 7  2007 2007 HOH HOH A . 
C 2 HOH 8  2008 2008 HOH HOH A . 
C 2 HOH 9  2009 2009 HOH HOH A . 
C 2 HOH 10 2010 2010 HOH HOH A . 
C 2 HOH 11 2011 2011 HOH HOH A . 
C 2 HOH 12 2012 2012 HOH HOH A . 
C 2 HOH 13 2013 2013 HOH HOH A . 
C 2 HOH 14 2014 2014 HOH HOH A . 
C 2 HOH 15 2015 2015 HOH HOH A . 
C 2 HOH 16 2016 2016 HOH HOH A . 
C 2 HOH 17 2017 2017 HOH HOH A . 
C 2 HOH 18 2018 2018 HOH HOH A . 
C 2 HOH 19 2019 2019 HOH HOH A . 
C 2 HOH 20 2020 2020 HOH HOH A . 
C 2 HOH 21 2021 2021 HOH HOH A . 
C 2 HOH 22 2022 2022 HOH HOH A . 
C 2 HOH 23 2023 2023 HOH HOH A . 
C 2 HOH 24 2024 2024 HOH HOH A . 
C 2 HOH 25 2025 2025 HOH HOH A . 
C 2 HOH 26 2026 2026 HOH HOH A . 
C 2 HOH 27 2027 2027 HOH HOH A . 
C 2 HOH 28 2028 2028 HOH HOH A . 
C 2 HOH 29 2029 2029 HOH HOH A . 
C 2 HOH 30 2030 2030 HOH HOH A . 
C 2 HOH 31 2031 2031 HOH HOH A . 
C 2 HOH 32 2032 2032 HOH HOH A . 
C 2 HOH 33 2033 2033 HOH HOH A . 
C 2 HOH 34 2034 2034 HOH HOH A . 
C 2 HOH 35 2035 2035 HOH HOH A . 
C 2 HOH 36 2036 2036 HOH HOH A . 
C 2 HOH 37 2037 2037 HOH HOH A . 
C 2 HOH 38 2038 2038 HOH HOH A . 
C 2 HOH 39 2039 2039 HOH HOH A . 
C 2 HOH 40 2040 2040 HOH HOH A . 
C 2 HOH 41 2041 2041 HOH HOH A . 
C 2 HOH 42 2042 2042 HOH HOH A . 
C 2 HOH 43 2043 2043 HOH HOH A . 
C 2 HOH 44 2044 2044 HOH HOH A . 
C 2 HOH 45 2045 2045 HOH HOH A . 
C 2 HOH 46 2046 2046 HOH HOH A . 
C 2 HOH 47 2047 2047 HOH HOH A . 
C 2 HOH 48 2048 2048 HOH HOH A . 
C 2 HOH 49 2049 2049 HOH HOH A . 
C 2 HOH 50 2050 2050 HOH HOH A . 
C 2 HOH 51 2051 2051 HOH HOH A . 
C 2 HOH 52 2052 2052 HOH HOH A . 
C 2 HOH 53 2053 2053 HOH HOH A . 
C 2 HOH 54 2054 2054 HOH HOH A . 
C 2 HOH 55 2055 2055 HOH HOH A . 
C 2 HOH 56 2056 2056 HOH HOH A . 
C 2 HOH 57 2057 2057 HOH HOH A . 
C 2 HOH 58 2058 2058 HOH HOH A . 
C 2 HOH 59 2059 2059 HOH HOH A . 
C 2 HOH 60 2060 2060 HOH HOH A . 
C 2 HOH 61 2061 2061 HOH HOH A . 
C 2 HOH 62 2062 2062 HOH HOH A . 
C 2 HOH 63 2063 2063 HOH HOH A . 
C 2 HOH 64 2064 2064 HOH HOH A . 
C 2 HOH 65 2065 2065 HOH HOH A . 
C 2 HOH 66 2066 2066 HOH HOH A . 
C 2 HOH 67 2067 2067 HOH HOH A . 
C 2 HOH 68 2068 2068 HOH HOH A . 
C 2 HOH 69 2069 2069 HOH HOH A . 
C 2 HOH 70 2070 2070 HOH HOH A . 
C 2 HOH 71 2071 2071 HOH HOH A . 
C 2 HOH 72 2072 2072 HOH HOH A . 
C 2 HOH 73 2073 2073 HOH HOH A . 
C 2 HOH 74 2074 2074 HOH HOH A . 
C 2 HOH 75 2075 2075 HOH HOH A . 
C 2 HOH 76 2076 2076 HOH HOH A . 
C 2 HOH 77 2077 2077 HOH HOH A . 
C 2 HOH 78 2078 2078 HOH HOH A . 
C 2 HOH 79 2079 2079 HOH HOH A . 
C 2 HOH 80 2080 2080 HOH HOH A . 
C 2 HOH 81 2081 2081 HOH HOH A . 
C 2 HOH 82 2082 2082 HOH HOH A . 
C 2 HOH 83 2083 2083 HOH HOH A . 
C 2 HOH 84 2084 2084 HOH HOH A . 
D 2 HOH 1  2001 2001 HOH HOH B . 
D 2 HOH 2  2002 2002 HOH HOH B . 
D 2 HOH 3  2003 2003 HOH HOH B . 
D 2 HOH 4  2004 2004 HOH HOH B . 
D 2 HOH 5  2005 2005 HOH HOH B . 
D 2 HOH 6  2006 2006 HOH HOH B . 
D 2 HOH 7  2007 2007 HOH HOH B . 
D 2 HOH 8  2008 2008 HOH HOH B . 
D 2 HOH 9  2009 2009 HOH HOH B . 
D 2 HOH 10 2010 2010 HOH HOH B . 
D 2 HOH 11 2011 2011 HOH HOH B . 
D 2 HOH 12 2012 2012 HOH HOH B . 
D 2 HOH 13 2013 2013 HOH HOH B . 
D 2 HOH 14 2014 2014 HOH HOH B . 
D 2 HOH 15 2015 2015 HOH HOH B . 
D 2 HOH 16 2016 2016 HOH HOH B . 
D 2 HOH 17 2017 2017 HOH HOH B . 
D 2 HOH 18 2018 2018 HOH HOH B . 
D 2 HOH 19 2019 2019 HOH HOH B . 
D 2 HOH 20 2020 2020 HOH HOH B . 
D 2 HOH 21 2021 2021 HOH HOH B . 
D 2 HOH 22 2022 2022 HOH HOH B . 
D 2 HOH 23 2023 2023 HOH HOH B . 
D 2 HOH 24 2024 2024 HOH HOH B . 
D 2 HOH 25 2025 2025 HOH HOH B . 
D 2 HOH 26 2026 2026 HOH HOH B . 
D 2 HOH 27 2027 2027 HOH HOH B . 
D 2 HOH 28 2028 2028 HOH HOH B . 
D 2 HOH 29 2029 2029 HOH HOH B . 
D 2 HOH 30 2030 2030 HOH HOH B . 
D 2 HOH 31 2031 2031 HOH HOH B . 
D 2 HOH 32 2032 2032 HOH HOH B . 
D 2 HOH 33 2033 2033 HOH HOH B . 
D 2 HOH 34 2034 2034 HOH HOH B . 
D 2 HOH 35 2035 2035 HOH HOH B . 
D 2 HOH 36 2036 2036 HOH HOH B . 
D 2 HOH 37 2037 2037 HOH HOH B . 
D 2 HOH 38 2038 2038 HOH HOH B . 
D 2 HOH 39 2039 2039 HOH HOH B . 
D 2 HOH 40 2040 2040 HOH HOH B . 
D 2 HOH 41 2041 2041 HOH HOH B . 
D 2 HOH 42 2042 2042 HOH HOH B . 
D 2 HOH 43 2043 2043 HOH HOH B . 
D 2 HOH 44 2044 2044 HOH HOH B . 
D 2 HOH 45 2045 2045 HOH HOH B . 
D 2 HOH 46 2046 2046 HOH HOH B . 
D 2 HOH 47 2047 2047 HOH HOH B . 
D 2 HOH 48 2048 2048 HOH HOH B . 
D 2 HOH 49 2049 2049 HOH HOH B . 
D 2 HOH 50 2050 2050 HOH HOH B . 
D 2 HOH 51 2051 2051 HOH HOH B . 
D 2 HOH 52 2052 2052 HOH HOH B . 
D 2 HOH 53 2053 2053 HOH HOH B . 
D 2 HOH 54 2054 2054 HOH HOH B . 
D 2 HOH 55 2055 2055 HOH HOH B . 
D 2 HOH 56 2056 2056 HOH HOH B . 
D 2 HOH 57 2057 2057 HOH HOH B . 
D 2 HOH 58 2058 2058 HOH HOH B . 
D 2 HOH 59 2059 2059 HOH HOH B . 
D 2 HOH 60 2060 2060 HOH HOH B . 
D 2 HOH 61 2061 2061 HOH HOH B . 
D 2 HOH 62 2062 2062 HOH HOH B . 
D 2 HOH 63 2063 2063 HOH HOH B . 
D 2 HOH 64 2064 2064 HOH HOH B . 
D 2 HOH 65 2065 2065 HOH HOH B . 
D 2 HOH 66 2066 2066 HOH HOH B . 
D 2 HOH 67 2067 2067 HOH HOH B . 
D 2 HOH 68 2068 2068 HOH HOH B . 
D 2 HOH 69 2069 2069 HOH HOH B . 
D 2 HOH 70 2070 2070 HOH HOH B . 
D 2 HOH 71 2071 2071 HOH HOH B . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PQS monomeric 1 
2 author_and_software_defined_assembly PQS monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C 
2 1 B,D 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2005-06-27 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2018-02-28 
4 'Structure model' 1 3 2018-04-04 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                    
2 2 'Structure model' 'Version format compliance' 
3 3 'Structure model' 'Database references'       
4 3 'Structure model' 'Source and taxonomy'       
5 4 'Structure model' 'Data collection'           
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' citation       
2 3 'Structure model' entity_src_gen 
3 4 'Structure model' diffrn_source  
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  3 'Structure model' '_citation.journal_abbrev'                       
2  3 'Structure model' '_citation.journal_id_ISSN'                      
3  3 'Structure model' '_citation.page_last'                            
4  3 'Structure model' '_citation.pdbx_database_id_DOI'                 
5  3 'Structure model' '_citation.title'                                
6  3 'Structure model' '_entity_src_gen.pdbx_host_org_cell_line'        
7  3 'Structure model' '_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id' 
8  3 'Structure model' '_entity_src_gen.pdbx_host_org_scientific_name'  
9  3 'Structure model' '_entity_src_gen.pdbx_host_org_strain'           
10 4 'Structure model' '_diffrn_source.type'                            
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined -16.2608 3.7553  -12.2985 -0.1439 -0.1171 -0.1203 -0.0330 0.0194 0.0478  1.6118 3.5909 4.2275 
0.0949  -0.2318 2.6551  0.0096 0.1658  -0.0364 -0.2503 0.1164  -0.1369 0.0288  0.0522 -0.1260 
'X-RAY DIFFRACTION' 2 ? refined 2.0948   18.0323 7.0573   -0.1065 -0.1087 -0.0768 -0.0277 0.0558 -0.0068 3.1173 1.3197 3.0430 
-0.3976 1.4021  -0.3766 0.0036 -0.2742 -0.0211 0.1862  -0.0013 0.0751  -0.0147 0.1675 -0.0024 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 A 59 ? ? A 191 ? ? ? ? 
'X-RAY DIFFRACTION' 2 2 B 59 ? ? B 188 ? ? ? ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC refinement       5.2.0005 ? 1 
MOSFLM 'data reduction' .        ? 2 
SCALA  'data scaling'   .        ? 3 
PHASER phasing          .        ? 4 
# 
_pdbx_entry_details.entry_id             2BV1 
_pdbx_entry_details.compound_details     'INHIBITS SIGNAL TRANSDUCTION' 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     'RESIDUES 48-49 OF CHAINS A, B ARE CLONING ARTEFACT' 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   OH 
_pdbx_validate_close_contact.auth_asym_id_1   B 
_pdbx_validate_close_contact.auth_comp_id_1   TYR 
_pdbx_validate_close_contact.auth_seq_id_1    166 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   B 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    2060 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.01 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 PHE A 127 ? ? -135.15 -39.88 
2 1 ALA A 152 ? ? -150.70 71.53  
3 1 GLU B 112 ? ? -39.45  135.74 
4 1 ALA B 152 ? ? -160.98 69.24  
5 1 ASP B 172 ? ? -121.27 -75.51 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 58  ? CG  ? A LYS 11  CG  
2  1 Y 1 A LYS 58  ? CD  ? A LYS 11  CD  
3  1 Y 1 A LYS 58  ? CE  ? A LYS 11  CE  
4  1 Y 1 A LYS 58  ? NZ  ? A LYS 11  NZ  
5  1 Y 1 A LYS 119 ? NZ  ? A LYS 72  NZ  
6  1 Y 1 A GLU 121 ? CG  ? A GLU 74  CG  
7  1 Y 1 A GLU 121 ? CD  ? A GLU 74  CD  
8  1 Y 1 A GLU 121 ? OE1 ? A GLU 74  OE1 
9  1 Y 1 A GLU 121 ? OE2 ? A GLU 74  OE2 
10 1 Y 1 A LYS 125 ? CG  ? A LYS 78  CG  
11 1 Y 1 A LYS 125 ? CD  ? A LYS 78  CD  
12 1 Y 1 A LYS 125 ? CE  ? A LYS 78  CE  
13 1 Y 1 A LYS 125 ? NZ  ? A LYS 78  NZ  
14 1 Y 1 A ASP 131 ? CG  ? A ASP 84  CG  
15 1 Y 1 A ASP 131 ? OD1 ? A ASP 84  OD1 
16 1 Y 1 A ASP 131 ? OD2 ? A ASP 84  OD2 
17 1 Y 1 A LYS 134 ? CD  ? A LYS 87  CD  
18 1 Y 1 A LYS 134 ? CE  ? A LYS 87  CE  
19 1 Y 1 A LYS 134 ? NZ  ? A LYS 87  NZ  
20 1 Y 1 A LYS 148 ? CD  ? A LYS 101 CD  
21 1 Y 1 A LYS 148 ? CE  ? A LYS 101 CE  
22 1 Y 1 A LYS 148 ? NZ  ? A LYS 101 NZ  
23 1 Y 1 A LYS 163 ? CD  ? A LYS 116 CD  
24 1 Y 1 A LYS 163 ? CE  ? A LYS 116 CE  
25 1 Y 1 A LYS 163 ? NZ  ? A LYS 116 NZ  
26 1 Y 1 A LYS 179 ? CE  ? A LYS 132 CE  
27 1 Y 1 A LYS 179 ? NZ  ? A LYS 132 NZ  
28 1 Y 1 B LYS 75  ? CE  ? B LYS 28  CE  
29 1 Y 1 B LYS 75  ? NZ  ? B LYS 28  NZ  
30 1 Y 1 B LYS 125 ? CG  ? B LYS 78  CG  
31 1 Y 1 B LYS 125 ? CD  ? B LYS 78  CD  
32 1 Y 1 B LYS 125 ? CE  ? B LYS 78  CE  
33 1 Y 1 B LYS 125 ? NZ  ? B LYS 78  NZ  
34 1 Y 1 B ASP 131 ? CG  ? B ASP 84  CG  
35 1 Y 1 B ASP 131 ? OD1 ? B ASP 84  OD1 
36 1 Y 1 B ASP 131 ? OD2 ? B ASP 84  OD2 
37 1 Y 1 B LYS 134 ? CD  ? B LYS 87  CD  
38 1 Y 1 B LYS 134 ? CE  ? B LYS 87  CE  
39 1 Y 1 B LYS 134 ? NZ  ? B LYS 87  NZ  
40 1 Y 1 B LYS 148 ? NZ  ? B LYS 101 NZ  
41 1 Y 1 B LYS 151 ? CG  ? B LYS 104 CG  
42 1 Y 1 B LYS 151 ? CD  ? B LYS 104 CD  
43 1 Y 1 B LYS 151 ? CE  ? B LYS 104 CE  
44 1 Y 1 B LYS 151 ? NZ  ? B LYS 104 NZ  
45 1 Y 1 B LYS 179 ? CE  ? B LYS 132 CE  
46 1 Y 1 B LYS 179 ? NZ  ? B LYS 132 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A SER 48  ? A SER 1   
2  1 Y 1 A MET 49  ? A MET 2   
3  1 Y 1 A SER 50  ? A SER 3   
4  1 Y 1 A GLY 51  ? A GLY 4   
5  1 Y 1 A MET 52  ? A MET 5   
6  1 Y 1 A LYS 53  ? A LYS 6   
7  1 Y 1 A SER 54  ? A SER 7   
8  1 Y 1 A SER 55  ? A SER 8   
9  1 Y 1 A LYS 56  ? A LYS 9   
10 1 Y 1 A SER 57  ? A SER 10  
11 1 Y 1 A ALA 192 ? A ALA 145 
12 1 Y 1 B SER 48  ? B SER 1   
13 1 Y 1 B MET 49  ? B MET 2   
14 1 Y 1 B SER 50  ? B SER 3   
15 1 Y 1 B GLY 51  ? B GLY 4   
16 1 Y 1 B MET 52  ? B MET 5   
17 1 Y 1 B LYS 53  ? B LYS 6   
18 1 Y 1 B SER 54  ? B SER 7   
19 1 Y 1 B SER 55  ? B SER 8   
20 1 Y 1 B LYS 56  ? B LYS 9   
21 1 Y 1 B SER 57  ? B SER 10  
22 1 Y 1 B LYS 58  ? B LYS 11  
23 1 Y 1 B ASP 189 ? B ASP 142 
24 1 Y 1 B LEU 190 ? B LEU 143 
25 1 Y 1 B GLN 191 ? B GLN 144 
26 1 Y 1 B ALA 192 ? B ALA 145 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#